data_3OEH
# 
_entry.id   3OEH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OEH         
RCSB  RCSB061013   
WWPDB D_1000061013 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HLD 'YEAST MITOCHONDRIAL F1-ATPASE'                       unspecified 
PDB 3FKS 'YEAST F1 ATPASE IN THE ABSENCE OF BOUND NUCLEOTIDES' unspecified 
PDB 1W0J 'BERYLLIUM FLUORIDE INHIBITED BOVINE F1-ATPASE'       unspecified 
PDB 3OE7 'YEAST F1 ATPASE MUTANT GAMMA-I270T'                  unspecified 
PDB 3OEE 'YEAST F1 ATPASE MUTANT ALPHA-F405S'                  unspecified 
PDB 3OFN 'YEAST F1 ATPASE MUTANT ALPHA-N67I'                   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OEH 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arsenieva, D.' 1 
'Symersky, J.'  2 
'Wang, Y.'      3 
'Pagadala, V.'  4 
'Mueller, D.M.' 5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of mutant forms of the yeast f1 ATPase reveal two modes of uncoupling.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                36561 
_citation.page_last                 36569 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20843806 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.174383 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arsenieva, D.' 1 
primary 'Symersky, J.'  2 
primary 'Wang, Y.'      3 
primary 'Pagadala, V.'  4 
primary 'Mueller, D.M.' 5 
# 
_cell.entry_id           3OEH 
_cell.length_a           110.931 
_cell.length_b           291.896 
_cell.length_c           188.765 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.91 
_cell.angle_gamma        90.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OEH 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP synthase subunit alpha'                  55007.402 9  3.6.3.14 ?     'UNP RESIDUES 36-545' ? 
2 polymer     man 'ATP synthase subunit beta'                   52058.008 9  3.6.3.14 V279F 'UNP RESIDUES 34-511' ? 
3 polymer     man 'ATP synthase subunit gamma'                  30657.160 3  3.6.3.14 ?     'UNP RESIDUES 34-311' ? 
4 polymer     man 'ATP synthase subunit delta'                  14565.385 3  3.6.3.14 ?     'UNP RESIDUES 23-160' ? 
5 polymer     man 'ATP synthase subunit epsilon'                6618.359  3  3.6.3.14 ?     'UNP RESIDUES 2-62'   ? 
6 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   15 ?        ?     ?                     ? 
7 non-polymer syn 'MAGNESIUM ION'                               24.305    15 ?        ?     ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'F-ATPase gamma subunit' 
4 'F-ATPase delta subunit' 
5 'ATPase subunit epsilon' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
A,B,C,J,K,L,S,T,U ? 
2 'polypeptide(L)' no no 
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAFGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAFGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
D,E,F,M,N,O,V,W,X ? 
3 'polypeptide(L)' no no 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
G,P,Y             ? 
4 'polypeptide(L)' no no 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
H,Q,Z             ? 
5 'polypeptide(L)' no no SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK I,R,1             ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   THR n 
1 4   LYS n 
1 5   ALA n 
1 6   GLN n 
1 7   PRO n 
1 8   THR n 
1 9   GLU n 
1 10  VAL n 
1 11  SER n 
1 12  SER n 
1 13  ILE n 
1 14  LEU n 
1 15  GLU n 
1 16  GLU n 
1 17  ARG n 
1 18  ILE n 
1 19  LYS n 
1 20  GLY n 
1 21  VAL n 
1 22  SER n 
1 23  ASP n 
1 24  GLU n 
1 25  ALA n 
1 26  ASN n 
1 27  LEU n 
1 28  ASN n 
1 29  GLU n 
1 30  THR n 
1 31  GLY n 
1 32  ARG n 
1 33  VAL n 
1 34  LEU n 
1 35  ALA n 
1 36  VAL n 
1 37  GLY n 
1 38  ASP n 
1 39  GLY n 
1 40  ILE n 
1 41  ALA n 
1 42  ARG n 
1 43  VAL n 
1 44  PHE n 
1 45  GLY n 
1 46  LEU n 
1 47  ASN n 
1 48  ASN n 
1 49  ILE n 
1 50  GLN n 
1 51  ALA n 
1 52  GLU n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  GLU n 
1 57  PHE n 
1 58  SER n 
1 59  SER n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  GLY n 
1 64  MET n 
1 65  ALA n 
1 66  LEU n 
1 67  ASN n 
1 68  LEU n 
1 69  GLU n 
1 70  PRO n 
1 71  GLY n 
1 72  GLN n 
1 73  VAL n 
1 74  GLY n 
1 75  ILE n 
1 76  VAL n 
1 77  LEU n 
1 78  PHE n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  ARG n 
1 83  LEU n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  GLY n 
1 88  GLU n 
1 89  LEU n 
1 90  VAL n 
1 91  LYS n 
1 92  ARG n 
1 93  THR n 
1 94  GLY n 
1 95  ASN n 
1 96  ILE n 
1 97  VAL n 
1 98  ASP n 
1 99  VAL n 
1 100 PRO n 
1 101 VAL n 
1 102 GLY n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 ARG n 
1 109 VAL n 
1 110 VAL n 
1 111 ASP n 
1 112 ALA n 
1 113 LEU n 
1 114 GLY n 
1 115 ASN n 
1 116 PRO n 
1 117 ILE n 
1 118 ASP n 
1 119 GLY n 
1 120 LYS n 
1 121 GLY n 
1 122 PRO n 
1 123 ILE n 
1 124 ASP n 
1 125 ALA n 
1 126 ALA n 
1 127 GLY n 
1 128 ARG n 
1 129 SER n 
1 130 ARG n 
1 131 ALA n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 ALA n 
1 136 PRO n 
1 137 GLY n 
1 138 ILE n 
1 139 LEU n 
1 140 PRO n 
1 141 ARG n 
1 142 ARG n 
1 143 SER n 
1 144 VAL n 
1 145 HIS n 
1 146 GLU n 
1 147 PRO n 
1 148 VAL n 
1 149 GLN n 
1 150 THR n 
1 151 GLY n 
1 152 LEU n 
1 153 LYS n 
1 154 ALA n 
1 155 VAL n 
1 156 ASP n 
1 157 ALA n 
1 158 LEU n 
1 159 VAL n 
1 160 PRO n 
1 161 ILE n 
1 162 GLY n 
1 163 ARG n 
1 164 GLY n 
1 165 GLN n 
1 166 ARG n 
1 167 GLU n 
1 168 LEU n 
1 169 ILE n 
1 170 ILE n 
1 171 GLY n 
1 172 ASP n 
1 173 ARG n 
1 174 GLN n 
1 175 THR n 
1 176 GLY n 
1 177 LYS n 
1 178 THR n 
1 179 ALA n 
1 180 VAL n 
1 181 ALA n 
1 182 LEU n 
1 183 ASP n 
1 184 THR n 
1 185 ILE n 
1 186 LEU n 
1 187 ASN n 
1 188 GLN n 
1 189 LYS n 
1 190 ARG n 
1 191 TRP n 
1 192 ASN n 
1 193 ASN n 
1 194 GLY n 
1 195 SER n 
1 196 ASP n 
1 197 GLU n 
1 198 SER n 
1 199 LYS n 
1 200 LYS n 
1 201 LEU n 
1 202 TYR n 
1 203 CYS n 
1 204 VAL n 
1 205 TYR n 
1 206 VAL n 
1 207 ALA n 
1 208 VAL n 
1 209 GLY n 
1 210 GLN n 
1 211 LYS n 
1 212 ARG n 
1 213 SER n 
1 214 THR n 
1 215 VAL n 
1 216 ALA n 
1 217 GLN n 
1 218 LEU n 
1 219 VAL n 
1 220 GLN n 
1 221 THR n 
1 222 LEU n 
1 223 GLU n 
1 224 GLN n 
1 225 HIS n 
1 226 ASP n 
1 227 ALA n 
1 228 MET n 
1 229 LYS n 
1 230 TYR n 
1 231 SER n 
1 232 ILE n 
1 233 ILE n 
1 234 VAL n 
1 235 ALA n 
1 236 ALA n 
1 237 THR n 
1 238 ALA n 
1 239 SER n 
1 240 GLU n 
1 241 ALA n 
1 242 ALA n 
1 243 PRO n 
1 244 LEU n 
1 245 GLN n 
1 246 TYR n 
1 247 LEU n 
1 248 ALA n 
1 249 PRO n 
1 250 PHE n 
1 251 THR n 
1 252 ALA n 
1 253 ALA n 
1 254 SER n 
1 255 ILE n 
1 256 GLY n 
1 257 GLU n 
1 258 TRP n 
1 259 PHE n 
1 260 ARG n 
1 261 ASP n 
1 262 ASN n 
1 263 GLY n 
1 264 LYS n 
1 265 HIS n 
1 266 ALA n 
1 267 LEU n 
1 268 ILE n 
1 269 VAL n 
1 270 TYR n 
1 271 ASP n 
1 272 ASP n 
1 273 LEU n 
1 274 SER n 
1 275 LYS n 
1 276 GLN n 
1 277 ALA n 
1 278 VAL n 
1 279 ALA n 
1 280 TYR n 
1 281 ARG n 
1 282 GLN n 
1 283 LEU n 
1 284 SER n 
1 285 LEU n 
1 286 LEU n 
1 287 LEU n 
1 288 ARG n 
1 289 ARG n 
1 290 PRO n 
1 291 PRO n 
1 292 GLY n 
1 293 ARG n 
1 294 GLU n 
1 295 ALA n 
1 296 TYR n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 VAL n 
1 301 PHE n 
1 302 TYR n 
1 303 LEU n 
1 304 HIS n 
1 305 SER n 
1 306 ARG n 
1 307 LEU n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 ALA n 
1 312 ALA n 
1 313 LYS n 
1 314 LEU n 
1 315 SER n 
1 316 GLU n 
1 317 LYS n 
1 318 GLU n 
1 319 GLY n 
1 320 SER n 
1 321 GLY n 
1 322 SER n 
1 323 LEU n 
1 324 THR n 
1 325 ALA n 
1 326 LEU n 
1 327 PRO n 
1 328 VAL n 
1 329 ILE n 
1 330 GLU n 
1 331 THR n 
1 332 GLN n 
1 333 GLY n 
1 334 GLY n 
1 335 ASP n 
1 336 VAL n 
1 337 SER n 
1 338 ALA n 
1 339 TYR n 
1 340 ILE n 
1 341 PRO n 
1 342 THR n 
1 343 ASN n 
1 344 VAL n 
1 345 ILE n 
1 346 SER n 
1 347 ILE n 
1 348 THR n 
1 349 ASP n 
1 350 GLY n 
1 351 GLN n 
1 352 ILE n 
1 353 PHE n 
1 354 LEU n 
1 355 GLU n 
1 356 ALA n 
1 357 GLU n 
1 358 LEU n 
1 359 PHE n 
1 360 TYR n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ARG n 
1 365 PRO n 
1 366 ALA n 
1 367 ILE n 
1 368 ASN n 
1 369 VAL n 
1 370 GLY n 
1 371 LEU n 
1 372 SER n 
1 373 VAL n 
1 374 SER n 
1 375 ARG n 
1 376 VAL n 
1 377 GLY n 
1 378 SER n 
1 379 ALA n 
1 380 ALA n 
1 381 GLN n 
1 382 VAL n 
1 383 LYS n 
1 384 ALA n 
1 385 LEU n 
1 386 LYS n 
1 387 GLN n 
1 388 VAL n 
1 389 ALA n 
1 390 GLY n 
1 391 SER n 
1 392 LEU n 
1 393 LYS n 
1 394 LEU n 
1 395 PHE n 
1 396 LEU n 
1 397 ALA n 
1 398 GLN n 
1 399 TYR n 
1 400 ARG n 
1 401 GLU n 
1 402 VAL n 
1 403 ALA n 
1 404 ALA n 
1 405 PHE n 
1 406 ALA n 
1 407 GLN n 
1 408 PHE n 
1 409 GLY n 
1 410 SER n 
1 411 ASP n 
1 412 LEU n 
1 413 ASP n 
1 414 ALA n 
1 415 SER n 
1 416 THR n 
1 417 LYS n 
1 418 GLN n 
1 419 THR n 
1 420 LEU n 
1 421 VAL n 
1 422 ARG n 
1 423 GLY n 
1 424 GLU n 
1 425 ARG n 
1 426 LEU n 
1 427 THR n 
1 428 GLN n 
1 429 LEU n 
1 430 LEU n 
1 431 LYS n 
1 432 GLN n 
1 433 ASN n 
1 434 GLN n 
1 435 TYR n 
1 436 SER n 
1 437 PRO n 
1 438 LEU n 
1 439 ALA n 
1 440 THR n 
1 441 GLU n 
1 442 GLU n 
1 443 GLN n 
1 444 VAL n 
1 445 PRO n 
1 446 LEU n 
1 447 ILE n 
1 448 TYR n 
1 449 ALA n 
1 450 GLY n 
1 451 VAL n 
1 452 ASN n 
1 453 GLY n 
1 454 HIS n 
1 455 LEU n 
1 456 ASP n 
1 457 GLY n 
1 458 ILE n 
1 459 GLU n 
1 460 LEU n 
1 461 SER n 
1 462 ARG n 
1 463 ILE n 
1 464 GLY n 
1 465 GLU n 
1 466 PHE n 
1 467 GLU n 
1 468 SER n 
1 469 SER n 
1 470 PHE n 
1 471 LEU n 
1 472 SER n 
1 473 TYR n 
1 474 LEU n 
1 475 LYS n 
1 476 SER n 
1 477 ASN n 
1 478 HIS n 
1 479 ASN n 
1 480 GLU n 
1 481 LEU n 
1 482 LEU n 
1 483 THR n 
1 484 GLU n 
1 485 ILE n 
1 486 ARG n 
1 487 GLU n 
1 488 LYS n 
1 489 GLY n 
1 490 GLU n 
1 491 LEU n 
1 492 SER n 
1 493 LYS n 
1 494 GLU n 
1 495 LEU n 
1 496 LEU n 
1 497 ALA n 
1 498 SER n 
1 499 LEU n 
1 500 LYS n 
1 501 SER n 
1 502 ALA n 
1 503 THR n 
1 504 GLU n 
1 505 SER n 
1 506 PHE n 
1 507 VAL n 
1 508 ALA n 
1 509 THR n 
1 510 PHE n 
2 1   ALA n 
2 2   SER n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   ALA n 
2 10  ALA n 
2 11  GLN n 
2 12  SER n 
2 13  THR n 
2 14  PRO n 
2 15  ILE n 
2 16  THR n 
2 17  GLY n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  ALA n 
2 22  VAL n 
2 23  ILE n 
2 24  GLY n 
2 25  ALA n 
2 26  ILE n 
2 27  VAL n 
2 28  ASP n 
2 29  VAL n 
2 30  HIS n 
2 31  PHE n 
2 32  GLU n 
2 33  GLN n 
2 34  SER n 
2 35  GLU n 
2 36  LEU n 
2 37  PRO n 
2 38  ALA n 
2 39  ILE n 
2 40  LEU n 
2 41  ASN n 
2 42  ALA n 
2 43  LEU n 
2 44  GLU n 
2 45  ILE n 
2 46  LYS n 
2 47  THR n 
2 48  PRO n 
2 49  GLN n 
2 50  GLY n 
2 51  LYS n 
2 52  LEU n 
2 53  VAL n 
2 54  LEU n 
2 55  GLU n 
2 56  VAL n 
2 57  ALA n 
2 58  GLN n 
2 59  HIS n 
2 60  LEU n 
2 61  GLY n 
2 62  GLU n 
2 63  ASN n 
2 64  THR n 
2 65  VAL n 
2 66  ARG n 
2 67  THR n 
2 68  ILE n 
2 69  ALA n 
2 70  MET n 
2 71  ASP n 
2 72  GLY n 
2 73  THR n 
2 74  GLU n 
2 75  GLY n 
2 76  LEU n 
2 77  VAL n 
2 78  ARG n 
2 79  GLY n 
2 80  GLU n 
2 81  LYS n 
2 82  VAL n 
2 83  LEU n 
2 84  ASP n 
2 85  THR n 
2 86  GLY n 
2 87  GLY n 
2 88  PRO n 
2 89  ILE n 
2 90  SER n 
2 91  VAL n 
2 92  PRO n 
2 93  VAL n 
2 94  GLY n 
2 95  ARG n 
2 96  GLU n 
2 97  THR n 
2 98  LEU n 
2 99  GLY n 
2 100 ARG n 
2 101 ILE n 
2 102 ILE n 
2 103 ASN n 
2 104 VAL n 
2 105 ILE n 
2 106 GLY n 
2 107 GLU n 
2 108 PRO n 
2 109 ILE n 
2 110 ASP n 
2 111 GLU n 
2 112 ARG n 
2 113 GLY n 
2 114 PRO n 
2 115 ILE n 
2 116 LYS n 
2 117 SER n 
2 118 LYS n 
2 119 LEU n 
2 120 ARG n 
2 121 LYS n 
2 122 PRO n 
2 123 ILE n 
2 124 HIS n 
2 125 ALA n 
2 126 ASP n 
2 127 PRO n 
2 128 PRO n 
2 129 SER n 
2 130 PHE n 
2 131 ALA n 
2 132 GLU n 
2 133 GLN n 
2 134 SER n 
2 135 THR n 
2 136 SER n 
2 137 ALA n 
2 138 GLU n 
2 139 ILE n 
2 140 LEU n 
2 141 GLU n 
2 142 THR n 
2 143 GLY n 
2 144 ILE n 
2 145 LYS n 
2 146 VAL n 
2 147 VAL n 
2 148 ASP n 
2 149 LEU n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 TYR n 
2 154 ALA n 
2 155 ARG n 
2 156 GLY n 
2 157 GLY n 
2 158 LYS n 
2 159 ILE n 
2 160 GLY n 
2 161 LEU n 
2 162 PHE n 
2 163 GLY n 
2 164 GLY n 
2 165 ALA n 
2 166 GLY n 
2 167 VAL n 
2 168 GLY n 
2 169 LYS n 
2 170 THR n 
2 171 VAL n 
2 172 PHE n 
2 173 ILE n 
2 174 GLN n 
2 175 GLU n 
2 176 LEU n 
2 177 ILE n 
2 178 ASN n 
2 179 ASN n 
2 180 ILE n 
2 181 ALA n 
2 182 LYS n 
2 183 ALA n 
2 184 HIS n 
2 185 GLY n 
2 186 GLY n 
2 187 PHE n 
2 188 SER n 
2 189 VAL n 
2 190 PHE n 
2 191 THR n 
2 192 GLY n 
2 193 VAL n 
2 194 GLY n 
2 195 GLU n 
2 196 ARG n 
2 197 THR n 
2 198 ARG n 
2 199 GLU n 
2 200 GLY n 
2 201 ASN n 
2 202 ASP n 
2 203 LEU n 
2 204 TYR n 
2 205 ARG n 
2 206 GLU n 
2 207 MET n 
2 208 LYS n 
2 209 GLU n 
2 210 THR n 
2 211 GLY n 
2 212 VAL n 
2 213 ILE n 
2 214 ASN n 
2 215 LEU n 
2 216 GLU n 
2 217 GLY n 
2 218 GLU n 
2 219 SER n 
2 220 LYS n 
2 221 VAL n 
2 222 ALA n 
2 223 LEU n 
2 224 VAL n 
2 225 PHE n 
2 226 GLY n 
2 227 GLN n 
2 228 MET n 
2 229 ASN n 
2 230 GLU n 
2 231 PRO n 
2 232 PRO n 
2 233 GLY n 
2 234 ALA n 
2 235 ARG n 
2 236 ALA n 
2 237 ARG n 
2 238 VAL n 
2 239 ALA n 
2 240 LEU n 
2 241 THR n 
2 242 GLY n 
2 243 LEU n 
2 244 THR n 
2 245 ILE n 
2 246 ALA n 
2 247 GLU n 
2 248 TYR n 
2 249 PHE n 
2 250 ARG n 
2 251 ASP n 
2 252 GLU n 
2 253 GLU n 
2 254 GLY n 
2 255 GLN n 
2 256 ASP n 
2 257 VAL n 
2 258 LEU n 
2 259 LEU n 
2 260 PHE n 
2 261 ILE n 
2 262 ASP n 
2 263 ASN n 
2 264 ILE n 
2 265 PHE n 
2 266 ARG n 
2 267 PHE n 
2 268 THR n 
2 269 GLN n 
2 270 ALA n 
2 271 GLY n 
2 272 SER n 
2 273 GLU n 
2 274 VAL n 
2 275 SER n 
2 276 ALA n 
2 277 LEU n 
2 278 LEU n 
2 279 GLY n 
2 280 ARG n 
2 281 ILE n 
2 282 PRO n 
2 283 SER n 
2 284 ALA n 
2 285 PHE n 
2 286 GLY n 
2 287 TYR n 
2 288 GLN n 
2 289 PRO n 
2 290 THR n 
2 291 LEU n 
2 292 ALA n 
2 293 THR n 
2 294 ASP n 
2 295 MET n 
2 296 GLY n 
2 297 LEU n 
2 298 LEU n 
2 299 GLN n 
2 300 GLU n 
2 301 ARG n 
2 302 ILE n 
2 303 THR n 
2 304 THR n 
2 305 THR n 
2 306 LYS n 
2 307 LYS n 
2 308 GLY n 
2 309 SER n 
2 310 VAL n 
2 311 THR n 
2 312 SER n 
2 313 VAL n 
2 314 GLN n 
2 315 ALA n 
2 316 VAL n 
2 317 TYR n 
2 318 VAL n 
2 319 PRO n 
2 320 ALA n 
2 321 ASP n 
2 322 ASP n 
2 323 LEU n 
2 324 THR n 
2 325 ASP n 
2 326 PRO n 
2 327 ALA n 
2 328 PRO n 
2 329 ALA n 
2 330 THR n 
2 331 THR n 
2 332 PHE n 
2 333 ALA n 
2 334 HIS n 
2 335 LEU n 
2 336 ASP n 
2 337 ALA n 
2 338 THR n 
2 339 THR n 
2 340 VAL n 
2 341 LEU n 
2 342 SER n 
2 343 ARG n 
2 344 GLY n 
2 345 ILE n 
2 346 SER n 
2 347 GLU n 
2 348 LEU n 
2 349 GLY n 
2 350 ILE n 
2 351 TYR n 
2 352 PRO n 
2 353 ALA n 
2 354 VAL n 
2 355 ASP n 
2 356 PRO n 
2 357 LEU n 
2 358 ASP n 
2 359 SER n 
2 360 LYS n 
2 361 SER n 
2 362 ARG n 
2 363 LEU n 
2 364 LEU n 
2 365 ASP n 
2 366 ALA n 
2 367 ALA n 
2 368 VAL n 
2 369 VAL n 
2 370 GLY n 
2 371 GLN n 
2 372 GLU n 
2 373 HIS n 
2 374 TYR n 
2 375 ASP n 
2 376 VAL n 
2 377 ALA n 
2 378 SER n 
2 379 LYS n 
2 380 VAL n 
2 381 GLN n 
2 382 GLU n 
2 383 THR n 
2 384 LEU n 
2 385 GLN n 
2 386 THR n 
2 387 TYR n 
2 388 LYS n 
2 389 SER n 
2 390 LEU n 
2 391 GLN n 
2 392 ASP n 
2 393 ILE n 
2 394 ILE n 
2 395 ALA n 
2 396 ILE n 
2 397 LEU n 
2 398 GLY n 
2 399 MET n 
2 400 ASP n 
2 401 GLU n 
2 402 LEU n 
2 403 SER n 
2 404 GLU n 
2 405 GLN n 
2 406 ASP n 
2 407 LYS n 
2 408 LEU n 
2 409 THR n 
2 410 VAL n 
2 411 GLU n 
2 412 ARG n 
2 413 ALA n 
2 414 ARG n 
2 415 LYS n 
2 416 ILE n 
2 417 GLN n 
2 418 ARG n 
2 419 PHE n 
2 420 LEU n 
2 421 SER n 
2 422 GLN n 
2 423 PRO n 
2 424 PHE n 
2 425 ALA n 
2 426 VAL n 
2 427 ALA n 
2 428 GLU n 
2 429 VAL n 
2 430 PHE n 
2 431 THR n 
2 432 GLY n 
2 433 ILE n 
2 434 PRO n 
2 435 GLY n 
2 436 LYS n 
2 437 LEU n 
2 438 VAL n 
2 439 ARG n 
2 440 LEU n 
2 441 LYS n 
2 442 ASP n 
2 443 THR n 
2 444 VAL n 
2 445 ALA n 
2 446 SER n 
2 447 PHE n 
2 448 LYS n 
2 449 ALA n 
2 450 VAL n 
2 451 LEU n 
2 452 GLU n 
2 453 GLY n 
2 454 LYS n 
2 455 TYR n 
2 456 ASP n 
2 457 ASN n 
2 458 ILE n 
2 459 PRO n 
2 460 GLU n 
2 461 HIS n 
2 462 ALA n 
2 463 PHE n 
2 464 TYR n 
2 465 MET n 
2 466 VAL n 
2 467 GLY n 
2 468 GLY n 
2 469 ILE n 
2 470 GLU n 
2 471 ASP n 
2 472 VAL n 
2 473 VAL n 
2 474 ALA n 
2 475 LYS n 
2 476 ALA n 
2 477 GLU n 
2 478 LYS n 
2 479 LEU n 
2 480 ALA n 
2 481 ALA n 
2 482 GLU n 
2 483 ALA n 
2 484 ASN n 
3 1   ALA n 
3 2   THR n 
3 3   LEU n 
3 4   LYS n 
3 5   GLU n 
3 6   VAL n 
3 7   GLU n 
3 8   MET n 
3 9   ARG n 
3 10  LEU n 
3 11  LYS n 
3 12  SER n 
3 13  ILE n 
3 14  LYS n 
3 15  ASN n 
3 16  ILE n 
3 17  GLU n 
3 18  LYS n 
3 19  ILE n 
3 20  THR n 
3 21  LYS n 
3 22  THR n 
3 23  MET n 
3 24  LYS n 
3 25  ILE n 
3 26  VAL n 
3 27  ALA n 
3 28  SER n 
3 29  THR n 
3 30  ARG n 
3 31  LEU n 
3 32  SER n 
3 33  LYS n 
3 34  ALA n 
3 35  GLU n 
3 36  LYS n 
3 37  ALA n 
3 38  LYS n 
3 39  ILE n 
3 40  SER n 
3 41  ALA n 
3 42  LYS n 
3 43  LYS n 
3 44  MET n 
3 45  ASP n 
3 46  GLU n 
3 47  ALA n 
3 48  GLU n 
3 49  GLN n 
3 50  LEU n 
3 51  PHE n 
3 52  TYR n 
3 53  LYS n 
3 54  ASN n 
3 55  ALA n 
3 56  GLU n 
3 57  THR n 
3 58  LYS n 
3 59  ASN n 
3 60  LEU n 
3 61  ASP n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  THR n 
3 66  GLU n 
3 67  THR n 
3 68  GLY n 
3 69  ALA n 
3 70  PRO n 
3 71  LYS n 
3 72  GLU n 
3 73  LEU n 
3 74  ILE n 
3 75  VAL n 
3 76  ALA n 
3 77  ILE n 
3 78  THR n 
3 79  SER n 
3 80  ASP n 
3 81  LYS n 
3 82  GLY n 
3 83  LEU n 
3 84  CYS n 
3 85  GLY n 
3 86  SER n 
3 87  ILE n 
3 88  HIS n 
3 89  SER n 
3 90  GLN n 
3 91  LEU n 
3 92  ALA n 
3 93  LYS n 
3 94  ALA n 
3 95  VAL n 
3 96  ARG n 
3 97  ARG n 
3 98  HIS n 
3 99  LEU n 
3 100 ASN n 
3 101 ASP n 
3 102 GLN n 
3 103 PRO n 
3 104 ASN n 
3 105 ALA n 
3 106 ASP n 
3 107 ILE n 
3 108 VAL n 
3 109 THR n 
3 110 ILE n 
3 111 GLY n 
3 112 ASP n 
3 113 LYS n 
3 114 ILE n 
3 115 LYS n 
3 116 MET n 
3 117 GLN n 
3 118 LEU n 
3 119 LEU n 
3 120 ARG n 
3 121 THR n 
3 122 HIS n 
3 123 PRO n 
3 124 ASN n 
3 125 ASN n 
3 126 ILE n 
3 127 LYS n 
3 128 LEU n 
3 129 SER n 
3 130 ILE n 
3 131 ASN n 
3 132 GLY n 
3 133 ILE n 
3 134 GLY n 
3 135 LYS n 
3 136 ASP n 
3 137 ALA n 
3 138 PRO n 
3 139 THR n 
3 140 PHE n 
3 141 GLN n 
3 142 GLU n 
3 143 SER n 
3 144 ALA n 
3 145 LEU n 
3 146 ILE n 
3 147 ALA n 
3 148 ASP n 
3 149 LYS n 
3 150 LEU n 
3 151 LEU n 
3 152 SER n 
3 153 VAL n 
3 154 MET n 
3 155 LYS n 
3 156 ALA n 
3 157 GLY n 
3 158 THR n 
3 159 TYR n 
3 160 PRO n 
3 161 LYS n 
3 162 ILE n 
3 163 SER n 
3 164 ILE n 
3 165 PHE n 
3 166 TYR n 
3 167 ASN n 
3 168 ASP n 
3 169 PRO n 
3 170 VAL n 
3 171 SER n 
3 172 SER n 
3 173 LEU n 
3 174 SER n 
3 175 PHE n 
3 176 GLU n 
3 177 PRO n 
3 178 SER n 
3 179 GLU n 
3 180 LYS n 
3 181 PRO n 
3 182 ILE n 
3 183 PHE n 
3 184 ASN n 
3 185 ALA n 
3 186 LYS n 
3 187 THR n 
3 188 ILE n 
3 189 GLU n 
3 190 GLN n 
3 191 SER n 
3 192 PRO n 
3 193 SER n 
3 194 PHE n 
3 195 GLY n 
3 196 LYS n 
3 197 PHE n 
3 198 GLU n 
3 199 ILE n 
3 200 ASP n 
3 201 THR n 
3 202 ASP n 
3 203 ALA n 
3 204 ASN n 
3 205 VAL n 
3 206 PRO n 
3 207 ARG n 
3 208 ASP n 
3 209 LEU n 
3 210 PHE n 
3 211 GLU n 
3 212 TYR n 
3 213 THR n 
3 214 LEU n 
3 215 ALA n 
3 216 ASN n 
3 217 GLN n 
3 218 MET n 
3 219 LEU n 
3 220 THR n 
3 221 ALA n 
3 222 MET n 
3 223 ALA n 
3 224 GLN n 
3 225 GLY n 
3 226 TYR n 
3 227 ALA n 
3 228 ALA n 
3 229 GLU n 
3 230 ILE n 
3 231 SER n 
3 232 ALA n 
3 233 ARG n 
3 234 ARG n 
3 235 ASN n 
3 236 ALA n 
3 237 MET n 
3 238 ASP n 
3 239 ASN n 
3 240 ALA n 
3 241 SER n 
3 242 LYS n 
3 243 ASN n 
3 244 ALA n 
3 245 GLY n 
3 246 ASP n 
3 247 MET n 
3 248 ILE n 
3 249 ASN n 
3 250 ARG n 
3 251 TYR n 
3 252 SER n 
3 253 ILE n 
3 254 LEU n 
3 255 TYR n 
3 256 ASN n 
3 257 ARG n 
3 258 THR n 
3 259 ARG n 
3 260 GLN n 
3 261 ALA n 
3 262 VAL n 
3 263 ILE n 
3 264 THR n 
3 265 ASN n 
3 266 GLU n 
3 267 LEU n 
3 268 VAL n 
3 269 ASP n 
3 270 ILE n 
3 271 ILE n 
3 272 THR n 
3 273 GLY n 
3 274 ALA n 
3 275 SER n 
3 276 SER n 
3 277 LEU n 
3 278 GLY n 
4 1   ALA n 
4 2   GLU n 
4 3   ALA n 
4 4   ALA n 
4 5   ALA n 
4 6   ALA n 
4 7   SER n 
4 8   SER n 
4 9   GLY n 
4 10  LEU n 
4 11  LYS n 
4 12  LEU n 
4 13  GLN n 
4 14  PHE n 
4 15  ALA n 
4 16  LEU n 
4 17  PRO n 
4 18  HIS n 
4 19  GLU n 
4 20  THR n 
4 21  LEU n 
4 22  TYR n 
4 23  SER n 
4 24  GLY n 
4 25  SER n 
4 26  GLU n 
4 27  VAL n 
4 28  THR n 
4 29  GLN n 
4 30  VAL n 
4 31  ASN n 
4 32  LEU n 
4 33  PRO n 
4 34  ALA n 
4 35  LYS n 
4 36  SER n 
4 37  GLY n 
4 38  ARG n 
4 39  ILE n 
4 40  GLY n 
4 41  VAL n 
4 42  LEU n 
4 43  ALA n 
4 44  ASN n 
4 45  HIS n 
4 46  VAL n 
4 47  PRO n 
4 48  THR n 
4 49  VAL n 
4 50  GLU n 
4 51  GLN n 
4 52  LEU n 
4 53  LEU n 
4 54  PRO n 
4 55  GLY n 
4 56  VAL n 
4 57  VAL n 
4 58  GLU n 
4 59  VAL n 
4 60  MET n 
4 61  GLU n 
4 62  GLY n 
4 63  SER n 
4 64  ASN n 
4 65  SER n 
4 66  LYS n 
4 67  LYS n 
4 68  PHE n 
4 69  PHE n 
4 70  ILE n 
4 71  SER n 
4 72  GLY n 
4 73  GLY n 
4 74  PHE n 
4 75  ALA n 
4 76  THR n 
4 77  VAL n 
4 78  GLN n 
4 79  PRO n 
4 80  ASP n 
4 81  SER n 
4 82  GLN n 
4 83  LEU n 
4 84  CYS n 
4 85  VAL n 
4 86  THR n 
4 87  ALA n 
4 88  ILE n 
4 89  GLU n 
4 90  ALA n 
4 91  PHE n 
4 92  PRO n 
4 93  LEU n 
4 94  GLU n 
4 95  SER n 
4 96  PHE n 
4 97  SER n 
4 98  GLN n 
4 99  GLU n 
4 100 ASN n 
4 101 ILE n 
4 102 LYS n 
4 103 ASN n 
4 104 LEU n 
4 105 LEU n 
4 106 ALA n 
4 107 GLU n 
4 108 ALA n 
4 109 LYS n 
4 110 LYS n 
4 111 ASN n 
4 112 VAL n 
4 113 SER n 
4 114 SER n 
4 115 SER n 
4 116 ASP n 
4 117 ALA n 
4 118 ARG n 
4 119 GLU n 
4 120 ALA n 
4 121 ALA n 
4 122 GLU n 
4 123 ALA n 
4 124 ALA n 
4 125 ILE n 
4 126 GLN n 
4 127 VAL n 
4 128 GLU n 
4 129 VAL n 
4 130 LEU n 
4 131 GLU n 
4 132 ASN n 
4 133 LEU n 
4 134 GLN n 
4 135 SER n 
4 136 VAL n 
4 137 LEU n 
4 138 LYS n 
5 1   SER n 
5 2   ALA n 
5 3   TRP n 
5 4   ARG n 
5 5   LYS n 
5 6   ALA n 
5 7   GLY n 
5 8   ILE n 
5 9   SER n 
5 10  TYR n 
5 11  ALA n 
5 12  ALA n 
5 13  TYR n 
5 14  LEU n 
5 15  ASN n 
5 16  VAL n 
5 17  ALA n 
5 18  ALA n 
5 19  GLN n 
5 20  ALA n 
5 21  ILE n 
5 22  ARG n 
5 23  SER n 
5 24  SER n 
5 25  LEU n 
5 26  LYS n 
5 27  THR n 
5 28  GLU n 
5 29  LEU n 
5 30  GLN n 
5 31  THR n 
5 32  ALA n 
5 33  SER n 
5 34  VAL n 
5 35  LEU n 
5 36  ASN n 
5 37  ARG n 
5 38  SER n 
5 39  GLN n 
5 40  THR n 
5 41  ASP n 
5 42  ALA n 
5 43  PHE n 
5 44  TYR n 
5 45  THR n 
5 46  GLN n 
5 47  TYR n 
5 48  LYS n 
5 49  ASN n 
5 50  GLY n 
5 51  THR n 
5 52  ALA n 
5 53  ALA n 
5 54  SER n 
5 55  GLU n 
5 56  PRO n 
5 57  THR n 
5 58  PRO n 
5 59  ILE n 
5 60  THR n 
5 61  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP1, YBL099W, YBL0827'               ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP2, YJR121W, J2041'                 ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP3, ATP3a, ATP3b, YBR039W, YBR0408' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP16, YDL004W, YD8119.03, D2935'     ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP15, YPL271W, P0345'                ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATPA_YEAST  P07251 1 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
36 ? 
2 UNP ATPB_YEAST  P00830 2 
;AAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGP
ISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVG
KTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEY
FRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAP
ATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKL
TVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN
;
36 ? 
3 UNP ATPG_YEAST  P38077 3 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
34 ? 
4 UNP ATPD_YEAST  Q12165 4 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
23 ? 
5 UNP ATP5E_YEAST P21306 5 SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 2  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3OEH A 1 ? 510 ? P07251 36 ? 545 ? 1 510 
2  1 3OEH B 1 ? 510 ? P07251 36 ? 545 ? 1 510 
3  1 3OEH C 1 ? 510 ? P07251 36 ? 545 ? 1 510 
4  2 3OEH D 9 ? 484 ? P00830 36 ? 511 ? 3 478 
5  2 3OEH E 9 ? 484 ? P00830 36 ? 511 ? 3 478 
6  2 3OEH F 9 ? 484 ? P00830 36 ? 511 ? 3 478 
7  3 3OEH G 1 ? 278 ? P38077 34 ? 311 ? 1 278 
8  4 3OEH H 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
9  5 3OEH I 1 ? 61  ? P21306 2  ? 62  ? 1 61  
10 1 3OEH J 1 ? 510 ? P07251 36 ? 545 ? 1 510 
11 1 3OEH K 1 ? 510 ? P07251 36 ? 545 ? 1 510 
12 1 3OEH L 1 ? 510 ? P07251 36 ? 545 ? 1 510 
13 2 3OEH M 9 ? 484 ? P00830 36 ? 511 ? 3 478 
14 2 3OEH N 9 ? 484 ? P00830 36 ? 511 ? 3 478 
15 2 3OEH O 9 ? 484 ? P00830 36 ? 511 ? 3 478 
16 3 3OEH P 1 ? 278 ? P38077 34 ? 311 ? 1 278 
17 4 3OEH Q 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
18 5 3OEH R 1 ? 61  ? P21306 2  ? 62  ? 1 61  
19 1 3OEH S 1 ? 510 ? P07251 36 ? 545 ? 1 510 
20 1 3OEH T 1 ? 510 ? P07251 36 ? 545 ? 1 510 
21 1 3OEH U 1 ? 510 ? P07251 36 ? 545 ? 1 510 
22 2 3OEH V 9 ? 484 ? P00830 36 ? 511 ? 3 478 
23 2 3OEH W 9 ? 484 ? P00830 36 ? 511 ? 3 478 
24 2 3OEH X 9 ? 484 ? P00830 36 ? 511 ? 3 478 
25 3 3OEH Y 1 ? 278 ? P38077 34 ? 311 ? 1 278 
26 4 3OEH Z 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
27 5 3OEH 1 1 ? 61  ? P21306 2  ? 62  ? 1 61  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4  3OEH ALA D 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  1  
4  3OEH SER D 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  2  
4  3OEH HIS D 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  3  
4  3OEH HIS D 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  4  
4  3OEH HIS D 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  5  
4  3OEH HIS D 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   6  
4  3OEH HIS D 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   7  
4  3OEH HIS D 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   8  
4  3OEH PHE D 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 9  
5  3OEH ALA E 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  10 
5  3OEH SER E 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  11 
5  3OEH HIS E 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  12 
5  3OEH HIS E 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  13 
5  3OEH HIS E 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  14 
5  3OEH HIS E 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   15 
5  3OEH HIS E 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   16 
5  3OEH HIS E 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   17 
5  3OEH PHE E 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 18 
6  3OEH ALA F 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  19 
6  3OEH SER F 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  20 
6  3OEH HIS F 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  21 
6  3OEH HIS F 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  22 
6  3OEH HIS F 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  23 
6  3OEH HIS F 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   24 
6  3OEH HIS F 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   25 
6  3OEH HIS F 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   26 
6  3OEH PHE F 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 27 
13 3OEH ALA M 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  28 
13 3OEH SER M 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  29 
13 3OEH HIS M 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  30 
13 3OEH HIS M 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  31 
13 3OEH HIS M 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  32 
13 3OEH HIS M 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   33 
13 3OEH HIS M 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   34 
13 3OEH HIS M 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   35 
13 3OEH PHE M 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 36 
14 3OEH ALA N 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  37 
14 3OEH SER N 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  38 
14 3OEH HIS N 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  39 
14 3OEH HIS N 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  40 
14 3OEH HIS N 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  41 
14 3OEH HIS N 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   42 
14 3OEH HIS N 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   43 
14 3OEH HIS N 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   44 
14 3OEH PHE N 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 45 
15 3OEH ALA O 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  46 
15 3OEH SER O 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  47 
15 3OEH HIS O 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  48 
15 3OEH HIS O 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  49 
15 3OEH HIS O 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  50 
15 3OEH HIS O 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   51 
15 3OEH HIS O 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   52 
15 3OEH HIS O 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   53 
15 3OEH PHE O 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 54 
22 3OEH ALA V 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  55 
22 3OEH SER V 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  56 
22 3OEH HIS V 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  57 
22 3OEH HIS V 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  58 
22 3OEH HIS V 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  59 
22 3OEH HIS V 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   60 
22 3OEH HIS V 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   61 
22 3OEH HIS V 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   62 
22 3OEH PHE V 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 63 
23 3OEH ALA W 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  64 
23 3OEH SER W 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  65 
23 3OEH HIS W 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  66 
23 3OEH HIS W 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  67 
23 3OEH HIS W 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  68 
23 3OEH HIS W 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   69 
23 3OEH HIS W 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   70 
23 3OEH HIS W 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   71 
23 3OEH PHE W 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 72 
24 3OEH ALA X 1   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5  73 
24 3OEH SER X 2   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4  74 
24 3OEH HIS X 3   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3  75 
24 3OEH HIS X 4   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2  76 
24 3OEH HIS X 5   ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1  77 
24 3OEH HIS X 6   ? UNP P00830 ?   ?   'EXPRESSION TAG'      0   78 
24 3OEH HIS X 7   ? UNP P00830 ?   ?   'EXPRESSION TAG'      1   79 
24 3OEH HIS X 8   ? UNP P00830 ?   ?   'EXPRESSION TAG'      2   80 
24 3OEH PHE X 285 ? UNP P00830 VAL 312 'ENGINEERED MUTATION' 279 81 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OEH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-02-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             1.033 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3OEH 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   203379 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05000 
_reflns.pdbx_netI_over_sigmaI        14.1000 
_reflns.B_iso_Wilson_estimate        88.60 
_reflns.pdbx_redundancy              1.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   85.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.39100 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3OEH 
_refine.ls_number_reflns_obs                     203286 
_refine.ls_number_reflns_all                     203286 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    88.81 
_refine.ls_R_factor_obs                          0.210 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  4157 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.B_iso_mean                               109.40 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2HLD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.508 
_refine.overall_SU_ML                            0.406 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3OEH 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.508 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        72227 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         480 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               72707 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.160 ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.07 
_refine_ls_shell.number_reflns_R_work             13427 
_refine_ls_shell.R_factor_R_work                  0.2840 
_refine_ls_shell.percent_reflns_obs               81.04 
_refine_ls_shell.R_factor_R_free                  0.3670 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             289 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3OEH 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3OEH 
_struct.title                     'Structure of four mutant forms of yeast F1 ATPase: beta-V279F' 
_struct.pdbx_descriptor           
;ATP synthase subunit alpha (E.C.3.6.3.14), ATP synthase subunit beta (E.C.3.6.3.14), ATP synthase subunit gamma (E.C.3.6.3.14), ATP synthase subunit delta (E.C.3.6.3.14), ATP synthase subunit epsilon (E.C.3.6.3.14)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OEH 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ATP SYNTHASE, ATP PHOSPHATASE, F1F0 ATPASE, ATP SYNTHESIS, HYDROLASE, ADP, PO4, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 6 ? 
CA N N 7 ? 
DA N N 6 ? 
EA N N 7 ? 
FA N N 6 ? 
GA N N 7 ? 
HA N N 6 ? 
IA N N 7 ? 
JA N N 6 ? 
KA N N 7 ? 
LA N N 6 ? 
MA N N 7 ? 
NA N N 6 ? 
OA N N 7 ? 
PA N N 6 ? 
QA N N 7 ? 
RA N N 6 ? 
SA N N 7 ? 
TA N N 6 ? 
UA N N 7 ? 
VA N N 6 ? 
WA N N 7 ? 
XA N N 6 ? 
YA N N 7 ? 
ZA N N 6 ? 
AB N N 7 ? 
BB N N 6 ? 
CB N N 7 ? 
DB N N 6 ? 
EB N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A  102 ? LEU A  106 ? GLY A 102 LEU A 106 5 ? 5  
HELX_P HELX_P2   2   LEU A  152 ? VAL A  159 ? LEU A 152 VAL A 159 1 ? 8  
HELX_P HELX_P3   3   GLY A  176 ? GLN A  188 ? GLY A 176 GLN A 188 1 ? 13 
HELX_P HELX_P4   4   GLN A  188 ? ASN A  193 ? GLN A 188 ASN A 193 1 ? 6  
HELX_P HELX_P5   5   LYS A  211 ? HIS A  225 ? LYS A 211 HIS A 225 1 ? 15 
HELX_P HELX_P6   6   ALA A  227 ? LYS A  229 ? ALA A 227 LYS A 229 5 ? 3  
HELX_P HELX_P7   7   ALA A  241 ? ASN A  262 ? ALA A 241 ASN A 262 1 ? 22 
HELX_P HELX_P8   8   ASP A  272 ? LEU A  287 ? ASP A 272 LEU A 287 1 ? 16 
HELX_P HELX_P9   9   GLY A  292 ? TYR A  296 ? GLY A 292 TYR A 296 5 ? 5  
HELX_P HELX_P10  10  ASP A  299 ? GLU A  309 ? ASP A 299 GLU A 309 1 ? 11 
HELX_P HELX_P11  11  SER A  315 ? GLY A  319 ? SER A 315 GLY A 319 5 ? 5  
HELX_P HELX_P12  12  ALA A  338 ? THR A  348 ? ALA A 338 THR A 348 1 ? 11 
HELX_P HELX_P13  13  GLU A  355 ? GLY A  362 ? GLU A 355 GLY A 362 1 ? 8  
HELX_P HELX_P14  14  ASN A  368 ? SER A  372 ? ASN A 368 SER A 372 5 ? 5  
HELX_P HELX_P15  15  VAL A  376 ? GLN A  381 ? VAL A 376 GLN A 381 5 ? 6  
HELX_P HELX_P16  16  VAL A  382 ? ALA A  389 ? VAL A 382 ALA A 389 1 ? 8  
HELX_P HELX_P17  17  ALA A  389 ? ALA A  403 ? ALA A 389 ALA A 403 1 ? 15 
HELX_P HELX_P18  18  ALA A  404 ? GLN A  407 ? ALA A 404 GLN A 407 5 ? 4  
HELX_P HELX_P19  19  ASP A  413 ? LEU A  430 ? ASP A 413 LEU A 430 1 ? 18 
HELX_P HELX_P20  20  ALA A  439 ? ASN A  452 ? ALA A 439 ASN A 452 1 ? 14 
HELX_P HELX_P21  21  ARG A  462 ? HIS A  478 ? ARG A 462 HIS A 478 1 ? 17 
HELX_P HELX_P22  22  HIS A  478 ? GLY A  489 ? HIS A 478 GLY A 489 1 ? 12 
HELX_P HELX_P23  23  SER A  492 ? ALA A  508 ? SER A 492 ALA A 508 1 ? 17 
HELX_P HELX_P24  24  SER B  80  ? VAL B  84  ? SER B 80  VAL B 84  5 ? 5  
HELX_P HELX_P25  25  GLY B  102 ? LEU B  106 ? GLY B 102 LEU B 106 5 ? 5  
HELX_P HELX_P26  26  LEU B  152 ? VAL B  159 ? LEU B 152 VAL B 159 1 ? 8  
HELX_P HELX_P27  27  GLY B  176 ? LEU B  186 ? GLY B 176 LEU B 186 1 ? 11 
HELX_P HELX_P28  28  ASN B  187 ? TRP B  191 ? ASN B 187 TRP B 191 5 ? 5  
HELX_P HELX_P29  29  LYS B  211 ? HIS B  225 ? LYS B 211 HIS B 225 1 ? 15 
HELX_P HELX_P30  30  ALA B  227 ? LYS B  229 ? ALA B 227 LYS B 229 5 ? 3  
HELX_P HELX_P31  31  ALA B  241 ? ASN B  262 ? ALA B 241 ASN B 262 1 ? 22 
HELX_P HELX_P32  32  ASP B  272 ? LEU B  287 ? ASP B 272 LEU B 287 1 ? 16 
HELX_P HELX_P33  33  GLY B  292 ? TYR B  296 ? GLY B 292 TYR B 296 5 ? 5  
HELX_P HELX_P34  34  ASP B  299 ? GLU B  309 ? ASP B 299 GLU B 309 1 ? 11 
HELX_P HELX_P35  35  SER B  315 ? GLY B  319 ? SER B 315 GLY B 319 5 ? 5  
HELX_P HELX_P36  36  ALA B  338 ? SER B  346 ? ALA B 338 SER B 346 1 ? 9  
HELX_P HELX_P37  37  GLU B  355 ? GLY B  362 ? GLU B 355 GLY B 362 1 ? 8  
HELX_P HELX_P38  38  VAL B  382 ? ALA B  389 ? VAL B 382 ALA B 389 1 ? 8  
HELX_P HELX_P39  39  SER B  391 ? ALA B  403 ? SER B 391 ALA B 403 1 ? 13 
HELX_P HELX_P40  40  ALA B  414 ? LYS B  417 ? ALA B 414 LYS B 417 5 ? 4  
HELX_P HELX_P41  41  GLN B  418 ? LEU B  430 ? GLN B 418 LEU B 430 1 ? 13 
HELX_P HELX_P42  42  ALA B  439 ? ASN B  452 ? ALA B 439 ASN B 452 1 ? 14 
HELX_P HELX_P43  43  GLU B  459 ? SER B  461 ? GLU B 459 SER B 461 5 ? 3  
HELX_P HELX_P44  44  ARG B  462 ? ASN B  477 ? ARG B 462 ASN B 477 1 ? 16 
HELX_P HELX_P45  45  HIS B  478 ? GLY B  489 ? HIS B 478 GLY B 489 1 ? 12 
HELX_P HELX_P46  46  SER B  492 ? ALA B  508 ? SER B 492 ALA B 508 1 ? 17 
HELX_P HELX_P47  47  GLY C  102 ? LEU C  106 ? GLY C 102 LEU C 106 5 ? 5  
HELX_P HELX_P48  48  LEU C  152 ? VAL C  159 ? LEU C 152 VAL C 159 1 ? 8  
HELX_P HELX_P49  49  GLY C  176 ? GLN C  188 ? GLY C 176 GLN C 188 1 ? 13 
HELX_P HELX_P50  50  GLN C  188 ? ASN C  193 ? GLN C 188 ASN C 193 1 ? 6  
HELX_P HELX_P51  51  LYS C  211 ? HIS C  225 ? LYS C 211 HIS C 225 1 ? 15 
HELX_P HELX_P52  52  ALA C  227 ? LYS C  229 ? ALA C 227 LYS C 229 5 ? 3  
HELX_P HELX_P53  53  ALA C  241 ? ASP C  261 ? ALA C 241 ASP C 261 1 ? 21 
HELX_P HELX_P54  54  ASP C  272 ? LEU C  287 ? ASP C 272 LEU C 287 1 ? 16 
HELX_P HELX_P55  55  GLY C  292 ? TYR C  296 ? GLY C 292 TYR C 296 5 ? 5  
HELX_P HELX_P56  56  ASP C  299 ? ARG C  310 ? ASP C 299 ARG C 310 1 ? 12 
HELX_P HELX_P57  57  SER C  315 ? GLY C  319 ? SER C 315 GLY C 319 5 ? 5  
HELX_P HELX_P58  58  ALA C  338 ? THR C  348 ? ALA C 338 THR C 348 1 ? 11 
HELX_P HELX_P59  59  GLU C  355 ? LYS C  361 ? GLU C 355 LYS C 361 1 ? 7  
HELX_P HELX_P60  60  VAL C  376 ? GLN C  381 ? VAL C 376 GLN C 381 5 ? 6  
HELX_P HELX_P61  61  VAL C  382 ? ALA C  389 ? VAL C 382 ALA C 389 1 ? 8  
HELX_P HELX_P62  62  SER C  391 ? ALA C  406 ? SER C 391 ALA C 406 1 ? 16 
HELX_P HELX_P63  63  ASP C  413 ? LEU C  430 ? ASP C 413 LEU C 430 1 ? 18 
HELX_P HELX_P64  64  ALA C  439 ? ASN C  452 ? ALA C 439 ASN C 452 1 ? 14 
HELX_P HELX_P65  65  GLU C  459 ? SER C  461 ? GLU C 459 SER C 461 5 ? 3  
HELX_P HELX_P66  66  ARG C  462 ? ASN C  477 ? ARG C 462 ASN C 477 1 ? 16 
HELX_P HELX_P67  67  HIS C  478 ? GLY C  489 ? HIS C 478 GLY C 489 1 ? 12 
HELX_P HELX_P68  68  SER C  492 ? ALA C  508 ? SER C 492 ALA C 508 1 ? 17 
HELX_P HELX_P69  69  GLY D  94  ? LEU D  98  ? GLY D 88  LEU D 92  5 ? 5  
HELX_P HELX_P70  70  SER D  129 ? GLN D  133 ? SER D 123 GLN D 127 5 ? 5  
HELX_P HELX_P71  71  ILE D  144 ? ALA D  151 ? ILE D 138 ALA D 145 1 ? 8  
HELX_P HELX_P72  72  GLY D  168 ? ALA D  181 ? GLY D 162 ALA D 175 1 ? 14 
HELX_P HELX_P73  73  ARG D  196 ? THR D  210 ? ARG D 190 THR D 204 1 ? 15 
HELX_P HELX_P74  74  PRO D  231 ? GLU D  253 ? PRO D 225 GLU D 247 1 ? 23 
HELX_P HELX_P75  75  ILE D  264 ? ALA D  276 ? ILE D 258 ALA D 270 1 ? 13 
HELX_P HELX_P76  76  LEU D  277 ? GLY D  279 ? LEU D 271 GLY D 273 5 ? 3  
HELX_P HELX_P77  77  SER D  283 ? TYR D  287 ? SER D 277 TYR D 281 5 ? 5  
HELX_P HELX_P78  78  THR D  290 ? GLU D  300 ? THR D 284 GLU D 294 1 ? 11 
HELX_P HELX_P79  79  PRO D  319 ? ASP D  322 ? PRO D 313 ASP D 316 5 ? 4  
HELX_P HELX_P80  80  ASP D  325 ? PHE D  332 ? ASP D 319 PHE D 326 1 ? 8  
HELX_P HELX_P81  81  ALA D  333 ? LEU D  335 ? ALA D 327 LEU D 329 5 ? 3  
HELX_P HELX_P82  82  SER D  342 ? GLU D  347 ? SER D 336 GLU D 341 1 ? 6  
HELX_P HELX_P83  83  ASP D  365 ? GLY D  370 ? ASP D 359 GLY D 364 1 ? 6  
HELX_P HELX_P84  84  GLY D  370 ? LEU D  397 ? GLY D 364 LEU D 391 1 ? 28 
HELX_P HELX_P85  85  GLY D  398 ? LEU D  402 ? GLY D 392 LEU D 396 5 ? 5  
HELX_P HELX_P86  86  SER D  403 ? LEU D  420 ? SER D 397 LEU D 414 1 ? 18 
HELX_P HELX_P87  87  ALA D  427 ? GLY D  432 ? ALA D 421 GLY D 426 1 ? 6  
HELX_P HELX_P88  88  ARG D  439 ? GLY D  453 ? ARG D 433 GLY D 447 1 ? 15 
HELX_P HELX_P89  89  PRO D  459 ? PHE D  463 ? PRO D 453 PHE D 457 5 ? 5  
HELX_P HELX_P90  90  GLY D  468 ? ALA D  480 ? GLY D 462 ALA D 474 1 ? 13 
HELX_P HELX_P91  91  GLY E  94  ? LEU E  98  ? GLY E 88  LEU E 92  5 ? 5  
HELX_P HELX_P92  92  ILE E  144 ? ALA E  151 ? ILE E 138 ALA E 145 1 ? 8  
HELX_P HELX_P93  93  GLY E  168 ? HIS E  184 ? GLY E 162 HIS E 178 1 ? 17 
HELX_P HELX_P94  94  ARG E  196 ? GLY E  211 ? ARG E 190 GLY E 205 1 ? 16 
HELX_P HELX_P95  95  PRO E  231 ? GLY E  254 ? PRO E 225 GLY E 248 1 ? 24 
HELX_P HELX_P96  96  ASN E  263 ? LEU E  278 ? ASN E 257 LEU E 272 1 ? 16 
HELX_P HELX_P97  97  SER E  283 ? TYR E  287 ? SER E 277 TYR E 281 5 ? 5  
HELX_P HELX_P98  98  THR E  290 ? GLU E  300 ? THR E 284 GLU E 294 1 ? 11 
HELX_P HELX_P99  99  VAL E  318 ? ASP E  322 ? VAL E 312 ASP E 316 5 ? 5  
HELX_P HELX_P100 100 ASP E  325 ? ALA E  333 ? ASP E 319 ALA E 327 1 ? 9  
HELX_P HELX_P101 101 SER E  342 ? GLU E  347 ? SER E 336 GLU E 341 1 ? 6  
HELX_P HELX_P102 102 ASP E  365 ? GLY E  370 ? ASP E 359 GLY E 364 1 ? 6  
HELX_P HELX_P103 103 GLY E  370 ? SER E  389 ? GLY E 364 SER E 383 1 ? 20 
HELX_P HELX_P104 104 ASP E  392 ? LEU E  397 ? ASP E 386 LEU E 391 1 ? 6  
HELX_P HELX_P105 105 SER E  403 ? LEU E  420 ? SER E 397 LEU E 414 1 ? 18 
HELX_P HELX_P106 106 PHE E  424 ? VAL E  426 ? PHE E 418 VAL E 420 5 ? 3  
HELX_P HELX_P107 107 ALA E  427 ? GLY E  432 ? ALA E 421 GLY E 426 1 ? 6  
HELX_P HELX_P108 108 ARG E  439 ? GLY E  453 ? ARG E 433 GLY E 447 1 ? 15 
HELX_P HELX_P109 109 PRO E  459 ? PHE E  463 ? PRO E 453 PHE E 457 5 ? 5  
HELX_P HELX_P110 110 ILE E  469 ? GLU E  477 ? ILE E 463 GLU E 471 1 ? 9  
HELX_P HELX_P111 111 GLY F  94  ? LEU F  98  ? GLY F 88  LEU F 92  5 ? 5  
HELX_P HELX_P112 112 ILE F  144 ? ALA F  151 ? ILE F 138 ALA F 145 1 ? 8  
HELX_P HELX_P113 113 GLY F  168 ? ALA F  181 ? GLY F 162 ALA F 175 1 ? 14 
HELX_P HELX_P114 114 ARG F  196 ? GLU F  209 ? ARG F 190 GLU F 203 1 ? 14 
HELX_P HELX_P115 115 PRO F  231 ? GLU F  253 ? PRO F 225 GLU F 247 1 ? 23 
HELX_P HELX_P116 116 ILE F  264 ? SER F  275 ? ILE F 258 SER F 269 1 ? 12 
HELX_P HELX_P117 117 SER F  283 ? TYR F  287 ? SER F 277 TYR F 281 5 ? 5  
HELX_P HELX_P118 118 THR F  290 ? GLU F  300 ? THR F 284 GLU F 294 1 ? 11 
HELX_P HELX_P119 119 PRO F  319 ? ASP F  322 ? PRO F 313 ASP F 316 5 ? 4  
HELX_P HELX_P120 120 ASP F  325 ? PHE F  332 ? ASP F 319 PHE F 326 1 ? 8  
HELX_P HELX_P121 121 ALA F  333 ? LEU F  335 ? ALA F 327 LEU F 329 5 ? 3  
HELX_P HELX_P122 122 SER F  342 ? GLU F  347 ? SER F 336 GLU F 341 1 ? 6  
HELX_P HELX_P123 123 ASP F  365 ? GLY F  370 ? ASP F 359 GLY F 364 1 ? 6  
HELX_P HELX_P124 124 GLY F  370 ? SER F  389 ? GLY F 364 SER F 383 1 ? 20 
HELX_P HELX_P125 125 LEU F  390 ? LEU F  397 ? LEU F 384 LEU F 391 1 ? 8  
HELX_P HELX_P126 126 GLY F  398 ? LEU F  402 ? GLY F 392 LEU F 396 5 ? 5  
HELX_P HELX_P127 127 SER F  403 ? LEU F  420 ? SER F 397 LEU F 414 1 ? 18 
HELX_P HELX_P128 128 ALA F  427 ? GLY F  432 ? ALA F 421 GLY F 426 1 ? 6  
HELX_P HELX_P129 129 ARG F  439 ? GLY F  453 ? ARG F 433 GLY F 447 1 ? 15 
HELX_P HELX_P130 130 PRO F  459 ? TYR F  464 ? PRO F 453 TYR F 458 5 ? 6  
HELX_P HELX_P131 131 GLY F  468 ? ALA F  481 ? GLY F 462 ALA F 475 1 ? 14 
HELX_P HELX_P132 132 THR G  2   ? GLU G  56  ? THR G 2   GLU G 56  1 ? 55 
HELX_P HELX_P133 133 SER G  86  ? ASN G  100 ? SER G 86  ASN G 100 1 ? 15 
HELX_P HELX_P134 134 GLY G  111 ? ARG G  120 ? GLY G 111 ARG G 120 1 ? 10 
HELX_P HELX_P135 135 HIS G  122 ? ASN G  124 ? HIS G 122 ASN G 124 5 ? 3  
HELX_P HELX_P136 136 THR G  139 ? MET G  154 ? THR G 139 MET G 154 1 ? 16 
HELX_P HELX_P137 137 LYS G  155 ? TYR G  159 ? LYS G 155 TYR G 159 5 ? 5  
HELX_P HELX_P138 138 ASN G  184 ? GLN G  190 ? ASN G 184 GLN G 190 1 ? 7  
HELX_P HELX_P139 139 SER G  193 ? PHE G  197 ? SER G 193 PHE G 197 5 ? 5  
HELX_P HELX_P140 140 ASN G  204 ? ALA G  274 ? ASN G 204 ALA G 274 1 ? 71 
HELX_P HELX_P141 141 ALA H  106 ? ASN H  111 ? ALA H 106 ASN H 111 1 ? 6  
HELX_P HELX_P142 142 GLU H  119 ? ALA H  124 ? GLU H 119 ALA H 124 1 ? 6  
HELX_P HELX_P143 143 GLN H  126 ? GLN H  134 ? GLN H 126 GLN H 134 1 ? 9  
HELX_P HELX_P144 144 SER I  9   ? ALA I  18  ? SER I 9   ALA I 18  1 ? 10 
HELX_P HELX_P145 145 SER I  33  ? SER I  38  ? SER I 33  SER I 38  1 ? 6  
HELX_P HELX_P146 146 SER J  80  ? VAL J  84  ? SER J 80  VAL J 84  5 ? 5  
HELX_P HELX_P147 147 GLY J  102 ? LEU J  106 ? GLY J 102 LEU J 106 5 ? 5  
HELX_P HELX_P148 148 LEU J  152 ? VAL J  159 ? LEU J 152 VAL J 159 1 ? 8  
HELX_P HELX_P149 149 GLY J  176 ? ASN J  187 ? GLY J 176 ASN J 187 1 ? 12 
HELX_P HELX_P150 150 GLN J  188 ? TRP J  191 ? GLN J 188 TRP J 191 5 ? 4  
HELX_P HELX_P151 151 LYS J  211 ? HIS J  225 ? LYS J 211 HIS J 225 1 ? 15 
HELX_P HELX_P152 152 ALA J  227 ? LYS J  229 ? ALA J 227 LYS J 229 5 ? 3  
HELX_P HELX_P153 153 ALA J  241 ? ASN J  262 ? ALA J 241 ASN J 262 1 ? 22 
HELX_P HELX_P154 154 ASP J  272 ? LEU J  287 ? ASP J 272 LEU J 287 1 ? 16 
HELX_P HELX_P155 155 GLY J  292 ? TYR J  296 ? GLY J 292 TYR J 296 5 ? 5  
HELX_P HELX_P156 156 ASP J  299 ? GLU J  309 ? ASP J 299 GLU J 309 1 ? 11 
HELX_P HELX_P157 157 ALA J  338 ? THR J  348 ? ALA J 338 THR J 348 1 ? 11 
HELX_P HELX_P158 158 GLU J  355 ? GLY J  362 ? GLU J 355 GLY J 362 1 ? 8  
HELX_P HELX_P159 159 ASN J  368 ? SER J  372 ? ASN J 368 SER J 372 5 ? 5  
HELX_P HELX_P160 160 VAL J  376 ? GLN J  381 ? VAL J 376 GLN J 381 5 ? 6  
HELX_P HELX_P161 161 VAL J  382 ? GLY J  390 ? VAL J 382 GLY J 390 1 ? 9  
HELX_P HELX_P162 162 SER J  391 ? ALA J  403 ? SER J 391 ALA J 403 1 ? 13 
HELX_P HELX_P163 163 ASP J  413 ? LEU J  430 ? ASP J 413 LEU J 430 1 ? 18 
HELX_P HELX_P164 164 ALA J  439 ? ASN J  452 ? ALA J 439 ASN J 452 1 ? 14 
HELX_P HELX_P165 165 GLU J  459 ? SER J  461 ? GLU J 459 SER J 461 5 ? 3  
HELX_P HELX_P166 166 ARG J  462 ? ASN J  477 ? ARG J 462 ASN J 477 1 ? 16 
HELX_P HELX_P167 167 HIS J  478 ? GLY J  489 ? HIS J 478 GLY J 489 1 ? 12 
HELX_P HELX_P168 168 SER J  492 ? ALA J  508 ? SER J 492 ALA J 508 1 ? 17 
HELX_P HELX_P169 169 ASP K  23  ? LEU K  27  ? ASP K 23  LEU K 27  5 ? 5  
HELX_P HELX_P170 170 GLY K  102 ? LEU K  106 ? GLY K 102 LEU K 106 5 ? 5  
HELX_P HELX_P171 171 LEU K  152 ? VAL K  159 ? LEU K 152 VAL K 159 1 ? 8  
HELX_P HELX_P172 172 GLY K  176 ? ASN K  187 ? GLY K 176 ASN K 187 1 ? 12 
HELX_P HELX_P173 173 GLN K  188 ? TRP K  191 ? GLN K 188 TRP K 191 5 ? 4  
HELX_P HELX_P174 174 LYS K  211 ? HIS K  225 ? LYS K 211 HIS K 225 1 ? 15 
HELX_P HELX_P175 175 ALA K  227 ? LYS K  229 ? ALA K 227 LYS K 229 5 ? 3  
HELX_P HELX_P176 176 ALA K  241 ? ASN K  262 ? ALA K 241 ASN K 262 1 ? 22 
HELX_P HELX_P177 177 ASP K  272 ? LEU K  287 ? ASP K 272 LEU K 287 1 ? 16 
HELX_P HELX_P178 178 GLY K  292 ? TYR K  296 ? GLY K 292 TYR K 296 5 ? 5  
HELX_P HELX_P179 179 ASP K  299 ? ARG K  310 ? ASP K 299 ARG K 310 1 ? 12 
HELX_P HELX_P180 180 SER K  315 ? GLY K  319 ? SER K 315 GLY K 319 5 ? 5  
HELX_P HELX_P181 181 ALA K  338 ? SER K  346 ? ALA K 338 SER K 346 1 ? 9  
HELX_P HELX_P182 182 GLU K  355 ? GLY K  362 ? GLU K 355 GLY K 362 1 ? 8  
HELX_P HELX_P183 183 VAL K  376 ? GLN K  381 ? VAL K 376 GLN K 381 5 ? 6  
HELX_P HELX_P184 184 VAL K  382 ? ALA K  389 ? VAL K 382 ALA K 389 1 ? 8  
HELX_P HELX_P185 185 SER K  391 ? ALA K  406 ? SER K 391 ALA K 406 1 ? 16 
HELX_P HELX_P186 186 LYS K  417 ? LYS K  431 ? LYS K 417 LYS K 431 1 ? 15 
HELX_P HELX_P187 187 ALA K  439 ? ASN K  452 ? ALA K 439 ASN K 452 1 ? 14 
HELX_P HELX_P188 188 ARG K  462 ? HIS K  478 ? ARG K 462 HIS K 478 1 ? 17 
HELX_P HELX_P189 189 HIS K  478 ? LYS K  488 ? HIS K 478 LYS K 488 1 ? 11 
HELX_P HELX_P190 190 SER K  492 ? ALA K  508 ? SER K 492 ALA K 508 1 ? 17 
HELX_P HELX_P191 191 GLY L  102 ? LEU L  106 ? GLY L 102 LEU L 106 5 ? 5  
HELX_P HELX_P192 192 LEU L  152 ? VAL L  159 ? LEU L 152 VAL L 159 1 ? 8  
HELX_P HELX_P193 193 GLY L  176 ? GLN L  188 ? GLY L 176 GLN L 188 1 ? 13 
HELX_P HELX_P194 194 GLN L  188 ? ASN L  193 ? GLN L 188 ASN L 193 1 ? 6  
HELX_P HELX_P195 195 LYS L  211 ? HIS L  225 ? LYS L 211 HIS L 225 1 ? 15 
HELX_P HELX_P196 196 ALA L  227 ? LYS L  229 ? ALA L 227 LYS L 229 5 ? 3  
HELX_P HELX_P197 197 ALA L  241 ? ASP L  261 ? ALA L 241 ASP L 261 1 ? 21 
HELX_P HELX_P198 198 ASP L  272 ? LEU L  287 ? ASP L 272 LEU L 287 1 ? 16 
HELX_P HELX_P199 199 GLY L  292 ? TYR L  296 ? GLY L 292 TYR L 296 5 ? 5  
HELX_P HELX_P200 200 ASP L  299 ? GLU L  309 ? ASP L 299 GLU L 309 1 ? 11 
HELX_P HELX_P201 201 ALA L  338 ? SER L  346 ? ALA L 338 SER L 346 1 ? 9  
HELX_P HELX_P202 202 GLU L  355 ? LYS L  361 ? GLU L 355 LYS L 361 1 ? 7  
HELX_P HELX_P203 203 VAL L  376 ? GLN L  381 ? VAL L 376 GLN L 381 5 ? 6  
HELX_P HELX_P204 204 VAL L  382 ? ALA L  389 ? VAL L 382 ALA L 389 1 ? 8  
HELX_P HELX_P205 205 SER L  391 ? ALA L  404 ? SER L 391 ALA L 404 1 ? 14 
HELX_P HELX_P206 206 ASP L  413 ? LEU L  430 ? ASP L 413 LEU L 430 1 ? 18 
HELX_P HELX_P207 207 ALA L  439 ? ASN L  452 ? ALA L 439 ASN L 452 1 ? 14 
HELX_P HELX_P208 208 GLU L  459 ? SER L  461 ? GLU L 459 SER L 461 5 ? 3  
HELX_P HELX_P209 209 ARG L  462 ? ASN L  477 ? ARG L 462 ASN L 477 1 ? 16 
HELX_P HELX_P210 210 HIS L  478 ? GLY L  489 ? HIS L 478 GLY L 489 1 ? 12 
HELX_P HELX_P211 211 SER L  492 ? ALA L  508 ? SER L 492 ALA L 508 1 ? 17 
HELX_P HELX_P212 212 SER M  129 ? GLN M  133 ? SER M 123 GLN M 127 5 ? 5  
HELX_P HELX_P213 213 ILE M  144 ? ALA M  151 ? ILE M 138 ALA M 145 1 ? 8  
HELX_P HELX_P214 214 GLY M  168 ? HIS M  184 ? GLY M 162 HIS M 178 1 ? 17 
HELX_P HELX_P215 215 ARG M  196 ? GLY M  211 ? ARG M 190 GLY M 205 1 ? 16 
HELX_P HELX_P216 216 PRO M  231 ? GLU M  252 ? PRO M 225 GLU M 246 1 ? 22 
HELX_P HELX_P217 217 ILE M  264 ? VAL M  274 ? ILE M 258 VAL M 268 1 ? 11 
HELX_P HELX_P218 218 VAL M  274 ? GLY M  279 ? VAL M 268 GLY M 273 1 ? 6  
HELX_P HELX_P219 219 SER M  283 ? TYR M  287 ? SER M 277 TYR M 281 5 ? 5  
HELX_P HELX_P220 220 THR M  290 ? GLU M  300 ? THR M 284 GLU M 294 1 ? 11 
HELX_P HELX_P221 221 PRO M  319 ? ASP M  322 ? PRO M 313 ASP M 316 5 ? 4  
HELX_P HELX_P222 222 ASP M  325 ? PHE M  332 ? ASP M 319 PHE M 326 1 ? 8  
HELX_P HELX_P223 223 ALA M  333 ? LEU M  335 ? ALA M 327 LEU M 329 5 ? 3  
HELX_P HELX_P224 224 SER M  342 ? GLY M  349 ? SER M 336 GLY M 343 1 ? 8  
HELX_P HELX_P225 225 ASP M  365 ? GLY M  370 ? ASP M 359 GLY M 364 1 ? 6  
HELX_P HELX_P226 226 GLY M  370 ? GLN M  391 ? GLY M 364 GLN M 385 1 ? 22 
HELX_P HELX_P227 227 GLY M  398 ? LEU M  402 ? GLY M 392 LEU M 396 5 ? 5  
HELX_P HELX_P228 228 SER M  403 ? SER M  421 ? SER M 397 SER M 415 1 ? 19 
HELX_P HELX_P229 229 ALA M  427 ? GLY M  432 ? ALA M 421 GLY M 426 1 ? 6  
HELX_P HELX_P230 230 ARG M  439 ? GLU M  452 ? ARG M 433 GLU M 446 1 ? 14 
HELX_P HELX_P231 231 GLU M  460 ? TYR M  464 ? GLU M 454 TYR M 458 5 ? 5  
HELX_P HELX_P232 232 GLY M  468 ? GLU M  477 ? GLY M 462 GLU M 471 1 ? 10 
HELX_P HELX_P233 233 GLY N  94  ? LEU N  98  ? GLY N 88  LEU N 92  5 ? 5  
HELX_P HELX_P234 234 ILE N  144 ? ALA N  151 ? ILE N 138 ALA N 145 1 ? 8  
HELX_P HELX_P235 235 GLY N  168 ? ALA N  183 ? GLY N 162 ALA N 177 1 ? 16 
HELX_P HELX_P236 236 ARG N  196 ? GLY N  211 ? ARG N 190 GLY N 205 1 ? 16 
HELX_P HELX_P237 237 PRO N  231 ? GLU N  252 ? PRO N 225 GLU N 246 1 ? 22 
HELX_P HELX_P238 238 ILE N  264 ? GLY N  279 ? ILE N 258 GLY N 273 1 ? 16 
HELX_P HELX_P239 239 SER N  283 ? TYR N  287 ? SER N 277 TYR N 281 5 ? 5  
HELX_P HELX_P240 240 THR N  290 ? GLU N  300 ? THR N 284 GLU N 294 1 ? 11 
HELX_P HELX_P241 241 VAL N  318 ? ASP N  322 ? VAL N 312 ASP N 316 5 ? 5  
HELX_P HELX_P242 242 ASP N  325 ? LEU N  335 ? ASP N 319 LEU N 329 1 ? 11 
HELX_P HELX_P243 243 SER N  342 ? GLU N  347 ? SER N 336 GLU N 341 1 ? 6  
HELX_P HELX_P244 244 ASP N  365 ? GLY N  370 ? ASP N 359 GLY N 364 1 ? 6  
HELX_P HELX_P245 245 GLY N  370 ? LEU N  397 ? GLY N 364 LEU N 391 1 ? 28 
HELX_P HELX_P246 246 SER N  403 ? LEU N  420 ? SER N 397 LEU N 414 1 ? 18 
HELX_P HELX_P247 247 PHE N  424 ? GLU N  428 ? PHE N 418 GLU N 422 5 ? 5  
HELX_P HELX_P248 248 ARG N  439 ? GLY N  453 ? ARG N 433 GLY N 447 1 ? 15 
HELX_P HELX_P249 249 PRO N  459 ? PHE N  463 ? PRO N 453 PHE N 457 5 ? 5  
HELX_P HELX_P250 250 GLY N  468 ? LEU N  479 ? GLY N 462 LEU N 473 1 ? 12 
HELX_P HELX_P251 251 ILE O  144 ? ALA O  151 ? ILE O 138 ALA O 145 1 ? 8  
HELX_P HELX_P252 252 GLY O  168 ? LYS O  182 ? GLY O 162 LYS O 176 1 ? 15 
HELX_P HELX_P253 253 ARG O  196 ? THR O  210 ? ARG O 190 THR O 204 1 ? 15 
HELX_P HELX_P254 254 PRO O  231 ? GLU O  252 ? PRO O 225 GLU O 246 1 ? 22 
HELX_P HELX_P255 255 ILE O  264 ? ALA O  276 ? ILE O 258 ALA O 270 1 ? 13 
HELX_P HELX_P256 256 LEU O  277 ? GLY O  279 ? LEU O 271 GLY O 273 5 ? 3  
HELX_P HELX_P257 257 SER O  283 ? TYR O  287 ? SER O 277 TYR O 281 5 ? 5  
HELX_P HELX_P258 258 THR O  290 ? GLU O  300 ? THR O 284 GLU O 294 1 ? 11 
HELX_P HELX_P259 259 PRO O  319 ? ASP O  322 ? PRO O 313 ASP O 316 5 ? 4  
HELX_P HELX_P260 260 ASP O  325 ? THR O  330 ? ASP O 319 THR O 324 1 ? 6  
HELX_P HELX_P261 261 THR O  331 ? LEU O  335 ? THR O 325 LEU O 329 5 ? 5  
HELX_P HELX_P262 262 SER O  342 ? GLU O  347 ? SER O 336 GLU O 341 1 ? 6  
HELX_P HELX_P263 263 ASP O  365 ? GLY O  370 ? ASP O 359 GLY O 364 1 ? 6  
HELX_P HELX_P264 264 GLY O  370 ? LEU O  397 ? GLY O 364 LEU O 391 1 ? 28 
HELX_P HELX_P265 265 GLY O  398 ? LEU O  402 ? GLY O 392 LEU O 396 5 ? 5  
HELX_P HELX_P266 266 SER O  403 ? LEU O  420 ? SER O 397 LEU O 414 1 ? 18 
HELX_P HELX_P267 267 ALA O  427 ? GLY O  432 ? ALA O 421 GLY O 426 1 ? 6  
HELX_P HELX_P268 268 ARG O  439 ? LEU O  451 ? ARG O 433 LEU O 445 1 ? 13 
HELX_P HELX_P269 269 GLU O  460 ? TYR O  464 ? GLU O 454 TYR O 458 5 ? 5  
HELX_P HELX_P270 270 GLY O  468 ? ALA O  480 ? GLY O 462 ALA O 474 1 ? 13 
HELX_P HELX_P271 271 THR P  2   ? ALA P  27  ? THR P 2   ALA P 27  1 ? 26 
HELX_P HELX_P272 272 LYS P  36  ? MET P  44  ? LYS P 36  MET P 44  1 ? 9  
HELX_P HELX_P273 273 ALA P  47  ? ALA P  55  ? ALA P 47  ALA P 55  1 ? 9  
HELX_P HELX_P274 274 SER P  86  ? LYS P  93  ? SER P 86  LYS P 93  1 ? 8  
HELX_P HELX_P275 275 LYS P  93  ? HIS P  98  ? LYS P 93  HIS P 98  1 ? 6  
HELX_P HELX_P276 276 GLY P  111 ? MET P  116 ? GLY P 111 MET P 116 1 ? 6  
HELX_P HELX_P277 277 THR P  139 ? VAL P  153 ? THR P 139 VAL P 153 1 ? 15 
HELX_P HELX_P278 278 LYS P  155 ? TYR P  159 ? LYS P 155 TYR P 159 5 ? 5  
HELX_P HELX_P279 279 VAL P  205 ? LYS P  242 ? VAL P 205 LYS P 242 1 ? 38 
HELX_P HELX_P280 280 LYS P  242 ? TYR P  251 ? LYS P 242 TYR P 251 1 ? 10 
HELX_P HELX_P281 281 TYR P  251 ? ALA P  274 ? TYR P 251 ALA P 274 1 ? 24 
HELX_P HELX_P282 282 GLU Q  128 ? LEU Q  133 ? GLU Q 128 LEU Q 133 1 ? 6  
HELX_P HELX_P283 283 TYR R  10  ? ALA R  17  ? TYR R 10  ALA R 17  1 ? 8  
HELX_P HELX_P284 284 ALA R  17  ? ARG R  22  ? ALA R 17  ARG R 22  1 ? 6  
HELX_P HELX_P285 285 GLY S  102 ? LEU S  106 ? GLY S 102 LEU S 106 5 ? 5  
HELX_P HELX_P286 286 LEU S  152 ? VAL S  159 ? LEU S 152 VAL S 159 1 ? 8  
HELX_P HELX_P287 287 GLY S  176 ? GLN S  188 ? GLY S 176 GLN S 188 1 ? 13 
HELX_P HELX_P288 288 LYS S  189 ? TRP S  191 ? LYS S 189 TRP S 191 5 ? 3  
HELX_P HELX_P289 289 LYS S  211 ? HIS S  225 ? LYS S 211 HIS S 225 1 ? 15 
HELX_P HELX_P290 290 ALA S  227 ? LYS S  229 ? ALA S 227 LYS S 229 5 ? 3  
HELX_P HELX_P291 291 ALA S  241 ? ASN S  262 ? ALA S 241 ASN S 262 1 ? 22 
HELX_P HELX_P292 292 ASP S  272 ? LEU S  287 ? ASP S 272 LEU S 287 1 ? 16 
HELX_P HELX_P293 293 GLY S  292 ? TYR S  296 ? GLY S 292 TYR S 296 5 ? 5  
HELX_P HELX_P294 294 ASP S  299 ? GLU S  309 ? ASP S 299 GLU S 309 1 ? 11 
HELX_P HELX_P295 295 SER S  315 ? GLY S  319 ? SER S 315 GLY S 319 5 ? 5  
HELX_P HELX_P296 296 ALA S  338 ? THR S  348 ? ALA S 338 THR S 348 1 ? 11 
HELX_P HELX_P297 297 GLU S  355 ? LYS S  361 ? GLU S 355 LYS S 361 1 ? 7  
HELX_P HELX_P298 298 VAL S  376 ? ALA S  380 ? VAL S 376 ALA S 380 5 ? 5  
HELX_P HELX_P299 299 VAL S  382 ? GLY S  390 ? VAL S 382 GLY S 390 1 ? 9  
HELX_P HELX_P300 300 SER S  391 ? GLU S  401 ? SER S 391 GLU S 401 1 ? 11 
HELX_P HELX_P301 301 VAL S  402 ? GLN S  407 ? VAL S 402 GLN S 407 5 ? 6  
HELX_P HELX_P302 302 ALA S  414 ? LEU S  430 ? ALA S 414 LEU S 430 1 ? 17 
HELX_P HELX_P303 303 ALA S  439 ? ASN S  452 ? ALA S 439 ASN S 452 1 ? 14 
HELX_P HELX_P304 304 SER S  461 ? ASN S  477 ? SER S 461 ASN S 477 1 ? 17 
HELX_P HELX_P305 305 HIS S  478 ? GLY S  489 ? HIS S 478 GLY S 489 1 ? 12 
HELX_P HELX_P306 306 SER S  492 ? ALA S  508 ? SER S 492 ALA S 508 1 ? 17 
HELX_P HELX_P307 307 SER T  80  ? VAL T  84  ? SER T 80  VAL T 84  5 ? 5  
HELX_P HELX_P308 308 GLY T  102 ? LEU T  106 ? GLY T 102 LEU T 106 5 ? 5  
HELX_P HELX_P309 309 LEU T  152 ? VAL T  159 ? LEU T 152 VAL T 159 1 ? 8  
HELX_P HELX_P310 310 GLY T  176 ? GLN T  188 ? GLY T 176 GLN T 188 1 ? 13 
HELX_P HELX_P311 311 LYS T  189 ? TRP T  191 ? LYS T 189 TRP T 191 5 ? 3  
HELX_P HELX_P312 312 LYS T  211 ? HIS T  225 ? LYS T 211 HIS T 225 1 ? 15 
HELX_P HELX_P313 313 ALA T  227 ? LYS T  229 ? ALA T 227 LYS T 229 5 ? 3  
HELX_P HELX_P314 314 ALA T  241 ? ASN T  262 ? ALA T 241 ASN T 262 1 ? 22 
HELX_P HELX_P315 315 ASP T  272 ? LEU T  287 ? ASP T 272 LEU T 287 1 ? 16 
HELX_P HELX_P316 316 GLY T  292 ? TYR T  296 ? GLY T 292 TYR T 296 5 ? 5  
HELX_P HELX_P317 317 ASP T  299 ? ARG T  310 ? ASP T 299 ARG T 310 1 ? 12 
HELX_P HELX_P318 318 SER T  315 ? GLY T  319 ? SER T 315 GLY T 319 5 ? 5  
HELX_P HELX_P319 319 ALA T  338 ? SER T  346 ? ALA T 338 SER T 346 1 ? 9  
HELX_P HELX_P320 320 GLU T  355 ? GLY T  362 ? GLU T 355 GLY T 362 1 ? 8  
HELX_P HELX_P321 321 ASN T  368 ? SER T  372 ? ASN T 368 SER T 372 5 ? 5  
HELX_P HELX_P322 322 VAL T  376 ? GLN T  381 ? VAL T 376 GLN T 381 5 ? 6  
HELX_P HELX_P323 323 VAL T  382 ? GLY T  390 ? VAL T 382 GLY T 390 1 ? 9  
HELX_P HELX_P324 324 SER T  391 ? ALA T  403 ? SER T 391 ALA T 403 1 ? 13 
HELX_P HELX_P325 325 ALA T  414 ? LEU T  430 ? ALA T 414 LEU T 430 1 ? 17 
HELX_P HELX_P326 326 ALA T  439 ? ASN T  452 ? ALA T 439 ASN T 452 1 ? 14 
HELX_P HELX_P327 327 ARG T  462 ? ASN T  477 ? ARG T 462 ASN T 477 1 ? 16 
HELX_P HELX_P328 328 HIS T  478 ? GLY T  489 ? HIS T 478 GLY T 489 1 ? 12 
HELX_P HELX_P329 329 SER T  492 ? ALA T  508 ? SER T 492 ALA T 508 1 ? 17 
HELX_P HELX_P330 330 LEU U  152 ? VAL U  159 ? LEU U 152 VAL U 159 1 ? 8  
HELX_P HELX_P331 331 LYS U  177 ? LEU U  186 ? LYS U 177 LEU U 186 1 ? 10 
HELX_P HELX_P332 332 ASN U  187 ? TRP U  191 ? ASN U 187 TRP U 191 5 ? 5  
HELX_P HELX_P333 333 LYS U  211 ? HIS U  225 ? LYS U 211 HIS U 225 1 ? 15 
HELX_P HELX_P334 334 ALA U  227 ? LYS U  229 ? ALA U 227 LYS U 229 5 ? 3  
HELX_P HELX_P335 335 ALA U  241 ? ASP U  261 ? ALA U 241 ASP U 261 1 ? 21 
HELX_P HELX_P336 336 ASP U  272 ? LEU U  287 ? ASP U 272 LEU U 287 1 ? 16 
HELX_P HELX_P337 337 GLY U  292 ? TYR U  296 ? GLY U 292 TYR U 296 5 ? 5  
HELX_P HELX_P338 338 ASP U  299 ? HIS U  304 ? ASP U 299 HIS U 304 1 ? 6  
HELX_P HELX_P339 339 HIS U  304 ? GLU U  309 ? HIS U 304 GLU U 309 1 ? 6  
HELX_P HELX_P340 340 SER U  315 ? GLY U  319 ? SER U 315 GLY U 319 5 ? 5  
HELX_P HELX_P341 341 ALA U  338 ? SER U  346 ? ALA U 338 SER U 346 1 ? 9  
HELX_P HELX_P342 342 GLU U  355 ? LYS U  361 ? GLU U 355 LYS U 361 1 ? 7  
HELX_P HELX_P343 343 ALA U  384 ? ALA U  389 ? ALA U 384 ALA U 389 1 ? 6  
HELX_P HELX_P344 344 SER U  391 ? ALA U  404 ? SER U 391 ALA U 404 1 ? 14 
HELX_P HELX_P345 345 SER U  415 ? LEU U  429 ? SER U 415 LEU U 429 1 ? 15 
HELX_P HELX_P346 346 ALA U  439 ? ASN U  452 ? ALA U 439 ASN U 452 1 ? 14 
HELX_P HELX_P347 347 GLU U  459 ? SER U  461 ? GLU U 459 SER U 461 5 ? 3  
HELX_P HELX_P348 348 ARG U  462 ? LYS U  475 ? ARG U 462 LYS U 475 1 ? 14 
HELX_P HELX_P349 349 HIS U  478 ? GLY U  489 ? HIS U 478 GLY U 489 1 ? 12 
HELX_P HELX_P350 350 SER U  492 ? SER U  505 ? SER U 492 SER U 505 1 ? 14 
HELX_P HELX_P351 351 ILE V  144 ? ALA V  151 ? ILE V 138 ALA V 145 1 ? 8  
HELX_P HELX_P352 352 GLY V  168 ? HIS V  184 ? GLY V 162 HIS V 178 1 ? 17 
HELX_P HELX_P353 353 ARG V  196 ? GLU V  209 ? ARG V 190 GLU V 203 1 ? 14 
HELX_P HELX_P354 354 PRO V  231 ? GLU V  252 ? PRO V 225 GLU V 246 1 ? 22 
HELX_P HELX_P355 355 ILE V  264 ? LEU V  278 ? ILE V 258 LEU V 272 1 ? 15 
HELX_P HELX_P356 356 SER V  283 ? TYR V  287 ? SER V 277 TYR V 281 5 ? 5  
HELX_P HELX_P357 357 GLN V  288 ? PRO V  289 ? GLN V 282 PRO V 283 5 ? 2  
HELX_P HELX_P358 358 THR V  290 ? GLU V  300 ? THR V 284 GLU V 294 1 ? 11 
HELX_P HELX_P359 359 PRO V  319 ? ASP V  322 ? PRO V 313 ASP V 316 5 ? 4  
HELX_P HELX_P360 360 ASP V  325 ? THR V  330 ? ASP V 319 THR V 324 1 ? 6  
HELX_P HELX_P361 361 THR V  331 ? LEU V  335 ? THR V 325 LEU V 329 5 ? 5  
HELX_P HELX_P362 362 SER V  342 ? GLU V  347 ? SER V 336 GLU V 341 1 ? 6  
HELX_P HELX_P363 363 ASP V  365 ? GLY V  370 ? ASP V 359 GLY V 364 1 ? 6  
HELX_P HELX_P364 364 GLY V  370 ? SER V  389 ? GLY V 364 SER V 383 1 ? 20 
HELX_P HELX_P365 365 SER V  403 ? LEU V  420 ? SER V 397 LEU V 414 1 ? 18 
HELX_P HELX_P366 366 ALA V  425 ? VAL V  429 ? ALA V 419 VAL V 423 5 ? 5  
HELX_P HELX_P367 367 ARG V  439 ? GLU V  452 ? ARG V 433 GLU V 446 1 ? 14 
HELX_P HELX_P368 368 PRO V  459 ? PHE V  463 ? PRO V 453 PHE V 457 5 ? 5  
HELX_P HELX_P369 369 GLY V  468 ? ASP V  471 ? GLY V 462 ASP V 465 5 ? 4  
HELX_P HELX_P370 370 VAL V  472 ? ALA V  481 ? VAL V 466 ALA V 475 1 ? 10 
HELX_P HELX_P371 371 GLY W  94  ? LEU W  98  ? GLY W 88  LEU W 92  5 ? 5  
HELX_P HELX_P372 372 SER W  129 ? GLN W  133 ? SER W 123 GLN W 127 5 ? 5  
HELX_P HELX_P373 373 ILE W  144 ? ALA W  151 ? ILE W 138 ALA W 145 1 ? 8  
HELX_P HELX_P374 374 GLY W  168 ? ALA W  183 ? GLY W 162 ALA W 177 1 ? 16 
HELX_P HELX_P375 375 ARG W  196 ? THR W  210 ? ARG W 190 THR W 204 1 ? 15 
HELX_P HELX_P376 376 PRO W  231 ? GLY W  254 ? PRO W 225 GLY W 248 1 ? 24 
HELX_P HELX_P377 377 ILE W  264 ? LEU W  278 ? ILE W 258 LEU W 272 1 ? 15 
HELX_P HELX_P378 378 SER W  283 ? TYR W  287 ? SER W 277 TYR W 281 5 ? 5  
HELX_P HELX_P379 379 THR W  290 ? GLU W  300 ? THR W 284 GLU W 294 1 ? 11 
HELX_P HELX_P380 380 VAL W  318 ? ASP W  322 ? VAL W 312 ASP W 316 5 ? 5  
HELX_P HELX_P381 381 ASP W  325 ? ALA W  333 ? ASP W 319 ALA W 327 1 ? 9  
HELX_P HELX_P382 382 SER W  342 ? LEU W  348 ? SER W 336 LEU W 342 1 ? 7  
HELX_P HELX_P383 383 ASP W  365 ? GLY W  370 ? ASP W 359 GLY W 364 1 ? 6  
HELX_P HELX_P384 384 GLY W  370 ? GLY W  398 ? GLY W 364 GLY W 392 1 ? 29 
HELX_P HELX_P385 385 MET W  399 ? LEU W  402 ? MET W 393 LEU W 396 5 ? 4  
HELX_P HELX_P386 386 LYS W  407 ? LEU W  420 ? LYS W 401 LEU W 414 1 ? 14 
HELX_P HELX_P387 387 PHE W  424 ? VAL W  426 ? PHE W 418 VAL W 420 5 ? 3  
HELX_P HELX_P388 388 ALA W  427 ? GLY W  432 ? ALA W 421 GLY W 426 1 ? 6  
HELX_P HELX_P389 389 ARG W  439 ? GLU W  452 ? ARG W 433 GLU W 446 1 ? 14 
HELX_P HELX_P390 390 PRO W  459 ? TYR W  464 ? PRO W 453 TYR W 458 5 ? 6  
HELX_P HELX_P391 391 GLY W  468 ? ALA W  476 ? GLY W 462 ALA W 470 1 ? 9  
HELX_P HELX_P392 392 GLY X  94  ? LEU X  98  ? GLY X 88  LEU X 92  5 ? 5  
HELX_P HELX_P393 393 ILE X  144 ? ALA X  151 ? ILE X 138 ALA X 145 1 ? 8  
HELX_P HELX_P394 394 GLY X  168 ? GLY X  185 ? GLY X 162 GLY X 179 1 ? 18 
HELX_P HELX_P395 395 ARG X  196 ? THR X  210 ? ARG X 190 THR X 204 1 ? 15 
HELX_P HELX_P396 396 PRO X  231 ? GLU X  252 ? PRO X 225 GLU X 246 1 ? 22 
HELX_P HELX_P397 397 ILE X  264 ? SER X  272 ? ILE X 258 SER X 266 1 ? 9  
HELX_P HELX_P398 398 SER X  283 ? TYR X  287 ? SER X 277 TYR X 281 5 ? 5  
HELX_P HELX_P399 399 LEU X  291 ? GLU X  300 ? LEU X 285 GLU X 294 1 ? 10 
HELX_P HELX_P400 400 PRO X  319 ? ASP X  322 ? PRO X 313 ASP X 316 5 ? 4  
HELX_P HELX_P401 401 ASP X  325 ? PHE X  332 ? ASP X 319 PHE X 326 1 ? 8  
HELX_P HELX_P402 402 ALA X  333 ? LEU X  335 ? ALA X 327 LEU X 329 5 ? 3  
HELX_P HELX_P403 403 SER X  342 ? GLU X  347 ? SER X 336 GLU X 341 1 ? 6  
HELX_P HELX_P404 404 ASP X  365 ? GLY X  370 ? ASP X 359 GLY X 364 1 ? 6  
HELX_P HELX_P405 405 GLY X  370 ? GLY X  398 ? GLY X 364 GLY X 392 1 ? 29 
HELX_P HELX_P406 406 MET X  399 ? LEU X  402 ? MET X 393 LEU X 396 5 ? 4  
HELX_P HELX_P407 407 SER X  403 ? LEU X  420 ? SER X 397 LEU X 414 1 ? 18 
HELX_P HELX_P408 408 PHE X  424 ? VAL X  426 ? PHE X 418 VAL X 420 5 ? 3  
HELX_P HELX_P409 409 ALA X  427 ? GLY X  432 ? ALA X 421 GLY X 426 1 ? 6  
HELX_P HELX_P410 410 ARG X  439 ? GLU X  452 ? ARG X 433 GLU X 446 1 ? 14 
HELX_P HELX_P411 411 GLU X  460 ? TYR X  464 ? GLU X 454 TYR X 458 5 ? 5  
HELX_P HELX_P412 412 GLY X  468 ? ALA X  480 ? GLY X 462 ALA X 474 1 ? 13 
HELX_P HELX_P413 413 THR Y  2   ? ARG Y  30  ? THR Y 2   ARG Y 30  1 ? 29 
HELX_P HELX_P414 414 ARG Y  30  ? MET Y  44  ? ARG Y 30  MET Y 44  1 ? 15 
HELX_P HELX_P415 415 HIS Y  88  ? LEU Y  99  ? HIS Y 88  LEU Y 99  1 ? 12 
HELX_P HELX_P416 416 GLY Y  111 ? ARG Y  120 ? GLY Y 111 ARG Y 120 1 ? 10 
HELX_P HELX_P417 417 THR Y  139 ? VAL Y  153 ? THR Y 139 VAL Y 153 1 ? 15 
HELX_P HELX_P418 418 GLU Y  211 ? GLU Y  266 ? GLU Y 211 GLU Y 266 1 ? 56 
HELX_P HELX_P419 419 LEU Y  267 ? SER Y  275 ? LEU Y 267 SER Y 275 1 ? 9  
HELX_P HELX_P420 420 GLU Z  122 ? GLN Z  126 ? GLU Z 122 GLN Z 126 5 ? 5  
HELX_P HELX_P421 421 TYR AA 10  ? ALA AA 17  ? TYR 1 10  ALA 1 17  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? BA ANP .   O2G ? ? ? 1_555 CA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc2  metalc ? ? PA ANP .   O2G ? ? ? 1_555 QA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc3  metalc ? ? DA ANP .   O2B ? ? ? 1_555 EA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc4  metalc ? ? JA ANP .   O2G ? ? ? 1_555 KA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc5  metalc ? ? BB ANP .   O2G ? ? ? 1_555 CB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc6  metalc ? ? B  THR 178 OG1 ? ? ? 1_555 EA MG . MG ? ? B THR 178 B MG 700 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc7  metalc ? ? ZA ANP .   O2B ? ? ? 1_555 AB MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc8  metalc ? ? A  THR 178 OG1 ? ? ? 1_555 CA MG . MG ? ? A THR 178 A MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc9  metalc ? ? RA ANP .   O2G ? ? ? 1_555 SA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc10 metalc ? ? TA ANP .   O2G ? ? ? 1_555 UA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc11 metalc ? ? M  THR 170 OG1 ? ? ? 1_555 SA MG . MG ? ? M THR 164 M MG 700 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc12 metalc ? ? J  THR 178 OG1 ? ? ? 1_555 MA MG . MG ? ? J THR 178 J MG 700 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc13 metalc ? ? ZA ANP .   O2G ? ? ? 1_555 AB MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc14 metalc ? ? L  THR 178 OG1 ? ? ? 1_555 QA MG . MG ? ? L THR 178 L MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc15 metalc ? ? S  THR 178 OG1 ? ? ? 1_555 WA MG . MG ? ? S THR 178 S MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc16 metalc ? ? HA ANP .   O2B ? ? ? 1_555 IA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc17 metalc ? ? C  THR 178 OG1 ? ? ? 1_555 GA MG . MG ? ? C THR 178 C MG 700 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc18 metalc ? ? K  THR 178 OG1 ? ? ? 1_555 OA MG . MG ? ? K THR 178 K MG 700 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc19 metalc ? ? U  THR 178 OG1 ? ? ? 1_555 AB MG . MG ? ? U THR 178 U MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc20 metalc ? ? DA ANP .   O2G ? ? ? 1_555 EA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc21 metalc ? ? O  THR 170 OG1 ? ? ? 1_555 UA MG . MG ? ? O THR 164 O MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc22 metalc ? ? T  THR 178 OG1 ? ? ? 1_555 YA MG . MG ? ? T THR 178 T MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc23 metalc ? ? NA ANP .   O2G ? ? ? 1_555 OA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc24 metalc ? ? DB ANP .   O2B ? ? ? 1_555 EB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc25 metalc ? ? VA ANP .   O2B ? ? ? 1_555 WA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc26 metalc ? ? D  THR 170 OG1 ? ? ? 1_555 IA MG . MG ? ? D THR 164 D MG 700 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc27 metalc ? ? XA ANP .   O2G ? ? ? 1_555 YA MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc28 metalc ? ? BA ANP .   O2B ? ? ? 1_555 CA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc29 metalc ? ? FA ANP .   O2G ? ? ? 1_555 GA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc30 metalc ? ? X  THR 170 OG1 ? ? ? 1_555 EB MG . MG ? ? X THR 164 X MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc31 metalc ? ? VA ANP .   O2G ? ? ? 1_555 WA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc32 metalc ? ? HA ANP .   O2G ? ? ? 1_555 IA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc33 metalc ? ? V  THR 170 OG1 ? ? ? 1_555 CB MG . MG ? ? V THR 164 V MG 700 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc34 metalc ? ? F  THR 170 OG1 ? ? ? 1_555 KA MG . MG ? ? F THR 164 F MG 700 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc35 metalc ? ? PA ANP .   O2B ? ? ? 1_555 QA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc36 metalc ? ? RA ANP .   O2B ? ? ? 1_555 SA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc37 metalc ? ? LA ANP .   O2B ? ? ? 1_555 MA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc38 metalc ? ? TA ANP .   O2B ? ? ? 1_555 UA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc39 metalc ? ? FA ANP .   O2B ? ? ? 1_555 GA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc40 metalc ? ? JA ANP .   O2B ? ? ? 1_555 KA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc41 metalc ? ? DB ANP .   O2G ? ? ? 1_555 EB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc42 metalc ? ? NA ANP .   O2B ? ? ? 1_555 OA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc43 metalc ? ? LA ANP .   O2G ? ? ? 1_555 MA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc44 metalc ? ? X  GLU 195 OE1 ? ? ? 1_555 EB MG . MG ? ? X GLU 189 X MG 700 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc45 metalc ? ? XA ANP .   O2B ? ? ? 1_555 YA MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc46 metalc ? ? BB ANP .   O2B ? ? ? 1_555 CB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc47 metalc ? ? DB ANP .   O3G ? ? ? 1_555 EB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.918 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 271 A . ? ASP 271 A ASP 272 A ? ASP 272 A 1 11.61  
2  ARG 364 A . ? ARG 364 A PRO 365 A ? PRO 365 A 1 -7.24  
3  ASP 271 B . ? ASP 271 B ASP 272 B ? ASP 272 B 1 -0.44  
4  ARG 364 B . ? ARG 364 B PRO 365 B ? PRO 365 B 1 0.77   
5  ASP 271 C . ? ASP 271 C ASP 272 C ? ASP 272 C 1 4.45   
6  ARG 364 C . ? ARG 364 C PRO 365 C ? PRO 365 C 1 -5.46  
7  ASP 262 D . ? ASP 256 D ASN 263 D ? ASN 257 D 1 18.08  
8  TYR 351 D . ? TYR 345 D PRO 352 D ? PRO 346 D 1 -1.45  
9  ASP 262 E . ? ASP 256 E ASN 263 E ? ASN 257 E 1 11.39  
10 TYR 351 E . ? TYR 345 E PRO 352 E ? PRO 346 E 1 -1.17  
11 ASP 262 F . ? ASP 256 F ASN 263 F ? ASN 257 F 1 11.70  
12 TYR 351 F . ? TYR 345 F PRO 352 F ? PRO 346 F 1 -1.84  
13 SER 113 H . ? SER 113 H SER 114 H ? SER 114 H 1 -4.33  
14 ASP 271 J . ? ASP 271 J ASP 272 J ? ASP 272 J 1 -3.64  
15 ARG 364 J . ? ARG 364 J PRO 365 J ? PRO 365 J 1 -1.74  
16 ASP 271 K . ? ASP 271 K ASP 272 K ? ASP 272 K 1 -5.72  
17 ARG 364 K . ? ARG 364 K PRO 365 K ? PRO 365 K 1 -2.83  
18 ASP 271 L . ? ASP 271 L ASP 272 L ? ASP 272 L 1 6.29   
19 ARG 364 L . ? ARG 364 L PRO 365 L ? PRO 365 L 1 -1.81  
20 ASP 262 M . ? ASP 256 M ASN 263 M ? ASN 257 M 1 4.23   
21 TYR 351 M . ? TYR 345 M PRO 352 M ? PRO 346 M 1 -2.39  
22 ASP 262 N . ? ASP 256 N ASN 263 N ? ASN 257 N 1 1.23   
23 TYR 351 N . ? TYR 345 N PRO 352 N ? PRO 346 N 1 8.64   
24 ASP 262 O . ? ASP 256 O ASN 263 O ? ASN 257 O 1 3.69   
25 TYR 351 O . ? TYR 345 O PRO 352 O ? PRO 346 O 1 -2.77  
26 ASP 271 S . ? ASP 271 S ASP 272 S ? ASP 272 S 1 -11.48 
27 ARG 364 S . ? ARG 364 S PRO 365 S ? PRO 365 S 1 4.54   
28 ASP 271 T . ? ASP 271 T ASP 272 T ? ASP 272 T 1 -0.25  
29 ARG 364 T . ? ARG 364 T PRO 365 T ? PRO 365 T 1 1.80   
30 ASP 271 U . ? ASP 271 U ASP 272 U ? ASP 272 U 1 -4.52  
31 ARG 364 U . ? ARG 364 U PRO 365 U ? PRO 365 U 1 -5.48  
32 ASP 262 V . ? ASP 256 V ASN 263 V ? ASN 257 V 1 8.63   
33 TYR 351 V . ? TYR 345 V PRO 352 V ? PRO 346 V 1 15.29  
34 ASP 262 W . ? ASP 256 W ASN 263 W ? ASN 257 W 1 -4.66  
35 TYR 351 W . ? TYR 345 W PRO 352 W ? PRO 346 W 1 0.64   
36 ASP 262 X . ? ASP 256 X ASN 263 X ? ASN 257 X 1 3.18   
37 TYR 351 X . ? TYR 345 X PRO 352 X ? PRO 346 X 1 -3.65  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 14 ? 
B  ? 2  ? 
C  ? 6  ? 
D  ? 7  ? 
E  ? 2  ? 
F  ? 20 ? 
G  ? 20 ? 
H  ? 2  ? 
I  ? 6  ? 
J  ? 8  ? 
K  ? 2  ? 
L  ? 2  ? 
M  ? 8  ? 
N  ? 2  ? 
O  ? 8  ? 
P  ? 2  ? 
Q  ? 2  ? 
R  ? 7  ? 
S  ? 2  ? 
T  ? 2  ? 
U  ? 8  ? 
V  ? 2  ? 
W  ? 7  ? 
X  ? 4  ? 
Y  ? 4  ? 
Z  ? 2  ? 
AA ? 20 ? 
AB ? 20 ? 
AC ? 2  ? 
AD ? 8  ? 
AE ? 2  ? 
AF ? 7  ? 
AG ? 2  ? 
AH ? 5  ? 
AI ? 2  ? 
AJ ? 4  ? 
AK ? 2  ? 
AL ? 6  ? 
AM ? 8  ? 
AN ? 2  ? 
AO ? 2  ? 
AP ? 8  ? 
AQ ? 2  ? 
AR ? 2  ? 
AS ? 8  ? 
AT ? 2  ? 
AU ? 7  ? 
AV ? 2  ? 
AW ? 8  ? 
AX ? 2  ? 
AY ? 5  ? 
AZ ? 4  ? 
BA ? 2  ? 
BB ? 16 ? 
BC ? 12 ? 
BD ? 2  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 4  ? 
BH ? 7  ? 
BI ? 12 ? 
BJ ? 2  ? 
BK ? 8  ? 
BL ? 7  ? 
BM ? 2  ? 
BN ? 8  ? 
BO ? 2  ? 
BP ? 8  ? 
BQ ? 2  ? 
BR ? 2  ? 
BS ? 7  ? 
BT ? 2  ? 
BU ? 2  ? 
BV ? 8  ? 
BW ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? anti-parallel 
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
A  7  8  ? anti-parallel 
A  8  9  ? anti-parallel 
A  9  10 ? anti-parallel 
A  10 11 ? anti-parallel 
A  11 12 ? anti-parallel 
A  12 13 ? anti-parallel 
A  13 14 ? anti-parallel 
B  1  2  ? anti-parallel 
C  1  2  ? parallel      
C  2  3  ? parallel      
C  3  4  ? parallel      
C  4  5  ? parallel      
C  5  6  ? anti-parallel 
D  1  2  ? parallel      
D  2  3  ? parallel      
D  3  4  ? parallel      
D  4  5  ? parallel      
D  5  6  ? parallel      
D  6  7  ? parallel      
E  1  2  ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
F  4  5  ? anti-parallel 
F  5  6  ? anti-parallel 
F  6  7  ? anti-parallel 
F  7  8  ? anti-parallel 
F  8  9  ? anti-parallel 
F  9  10 ? anti-parallel 
F  10 11 ? anti-parallel 
F  11 12 ? anti-parallel 
F  12 13 ? anti-parallel 
F  13 14 ? anti-parallel 
F  14 15 ? anti-parallel 
F  15 16 ? anti-parallel 
F  16 17 ? anti-parallel 
F  17 18 ? anti-parallel 
F  18 19 ? anti-parallel 
F  19 20 ? anti-parallel 
G  1  2  ? anti-parallel 
G  2  3  ? anti-parallel 
G  3  4  ? anti-parallel 
G  4  5  ? anti-parallel 
G  5  6  ? anti-parallel 
G  6  7  ? anti-parallel 
G  7  8  ? anti-parallel 
G  8  9  ? anti-parallel 
G  9  10 ? anti-parallel 
G  10 11 ? anti-parallel 
G  11 12 ? anti-parallel 
G  12 13 ? anti-parallel 
G  13 14 ? anti-parallel 
G  14 15 ? anti-parallel 
G  15 16 ? anti-parallel 
G  16 17 ? anti-parallel 
G  17 18 ? anti-parallel 
G  18 19 ? anti-parallel 
G  19 20 ? anti-parallel 
H  1  2  ? anti-parallel 
I  1  2  ? parallel      
I  2  3  ? parallel      
I  3  4  ? parallel      
I  4  5  ? parallel      
I  5  6  ? anti-parallel 
J  1  2  ? parallel      
J  2  3  ? parallel      
J  3  4  ? parallel      
J  4  5  ? parallel      
J  5  6  ? parallel      
J  6  7  ? parallel      
J  7  8  ? anti-parallel 
K  1  2  ? anti-parallel 
L  1  2  ? anti-parallel 
M  1  2  ? parallel      
M  2  3  ? parallel      
M  3  4  ? parallel      
M  4  5  ? parallel      
M  5  6  ? parallel      
M  6  7  ? parallel      
M  7  8  ? anti-parallel 
N  1  2  ? anti-parallel 
O  1  2  ? parallel      
O  2  3  ? parallel      
O  3  4  ? parallel      
O  4  5  ? parallel      
O  5  6  ? parallel      
O  6  7  ? parallel      
O  7  8  ? anti-parallel 
P  1  2  ? anti-parallel 
Q  1  2  ? anti-parallel 
R  1  2  ? parallel      
R  2  3  ? parallel      
R  3  4  ? parallel      
R  4  5  ? parallel      
R  5  6  ? parallel      
R  6  7  ? parallel      
S  1  2  ? anti-parallel 
T  1  2  ? anti-parallel 
U  1  2  ? parallel      
U  2  3  ? parallel      
U  3  4  ? parallel      
U  4  5  ? parallel      
U  5  6  ? parallel      
U  6  7  ? parallel      
U  7  8  ? anti-parallel 
V  1  2  ? anti-parallel 
W  1  2  ? anti-parallel 
W  2  3  ? parallel      
W  3  4  ? parallel      
W  4  5  ? parallel      
W  5  6  ? anti-parallel 
W  6  7  ? anti-parallel 
X  1  2  ? parallel      
X  2  3  ? anti-parallel 
X  3  4  ? anti-parallel 
Y  1  2  ? anti-parallel 
Y  2  3  ? anti-parallel 
Y  3  4  ? anti-parallel 
Z  1  2  ? anti-parallel 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AA 6  7  ? anti-parallel 
AA 7  8  ? anti-parallel 
AA 8  9  ? anti-parallel 
AA 9  10 ? anti-parallel 
AA 10 11 ? anti-parallel 
AA 11 12 ? anti-parallel 
AA 12 13 ? anti-parallel 
AA 13 14 ? anti-parallel 
AA 14 15 ? anti-parallel 
AA 15 16 ? anti-parallel 
AA 16 17 ? anti-parallel 
AA 17 18 ? anti-parallel 
AA 18 19 ? anti-parallel 
AA 19 20 ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? anti-parallel 
AB 5  6  ? anti-parallel 
AB 6  7  ? anti-parallel 
AB 7  8  ? anti-parallel 
AB 8  9  ? anti-parallel 
AB 9  10 ? anti-parallel 
AB 10 11 ? anti-parallel 
AB 11 12 ? anti-parallel 
AB 12 13 ? anti-parallel 
AB 13 14 ? anti-parallel 
AB 14 15 ? anti-parallel 
AB 15 16 ? anti-parallel 
AB 16 17 ? anti-parallel 
AB 17 18 ? anti-parallel 
AB 18 19 ? anti-parallel 
AB 19 20 ? anti-parallel 
AC 1  2  ? anti-parallel 
AD 1  2  ? parallel      
AD 2  3  ? parallel      
AD 3  4  ? parallel      
AD 4  5  ? parallel      
AD 5  6  ? parallel      
AD 6  7  ? parallel      
AD 7  8  ? anti-parallel 
AE 1  2  ? anti-parallel 
AF 1  2  ? anti-parallel 
AF 2  3  ? anti-parallel 
AF 3  4  ? anti-parallel 
AF 4  5  ? anti-parallel 
AF 5  6  ? anti-parallel 
AF 6  7  ? anti-parallel 
AG 1  2  ? anti-parallel 
AH 1  2  ? parallel      
AH 2  3  ? parallel      
AH 3  4  ? parallel      
AH 4  5  ? parallel      
AI 1  2  ? anti-parallel 
AJ 1  2  ? parallel      
AJ 2  3  ? parallel      
AJ 3  4  ? anti-parallel 
AK 1  2  ? anti-parallel 
AL 1  2  ? parallel      
AL 2  3  ? parallel      
AL 3  4  ? parallel      
AL 4  5  ? parallel      
AL 5  6  ? anti-parallel 
AM 1  2  ? parallel      
AM 2  3  ? parallel      
AM 3  4  ? parallel      
AM 4  5  ? parallel      
AM 5  6  ? parallel      
AM 6  7  ? parallel      
AM 7  8  ? anti-parallel 
AN 1  2  ? anti-parallel 
AO 1  2  ? anti-parallel 
AP 1  2  ? parallel      
AP 2  3  ? parallel      
AP 3  4  ? parallel      
AP 4  5  ? parallel      
AP 5  6  ? parallel      
AP 6  7  ? parallel      
AP 7  8  ? anti-parallel 
AQ 1  2  ? anti-parallel 
AR 1  2  ? anti-parallel 
AS 1  2  ? parallel      
AS 2  3  ? parallel      
AS 3  4  ? parallel      
AS 4  5  ? parallel      
AS 5  6  ? parallel      
AS 6  7  ? parallel      
AS 7  8  ? anti-parallel 
AT 1  2  ? anti-parallel 
AU 1  2  ? anti-parallel 
AU 2  3  ? anti-parallel 
AU 3  4  ? anti-parallel 
AU 4  5  ? anti-parallel 
AU 5  6  ? anti-parallel 
AU 6  7  ? anti-parallel 
AV 1  2  ? anti-parallel 
AW 1  2  ? parallel      
AW 2  3  ? parallel      
AW 3  4  ? parallel      
AW 4  5  ? parallel      
AW 5  6  ? parallel      
AW 6  7  ? parallel      
AW 7  8  ? anti-parallel 
AX 1  2  ? anti-parallel 
AY 1  2  ? parallel      
AY 2  3  ? parallel      
AY 3  4  ? parallel      
AY 4  5  ? anti-parallel 
AZ 1  2  ? parallel      
AZ 2  3  ? anti-parallel 
AZ 3  4  ? anti-parallel 
BA 1  2  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? anti-parallel 
BB 6  7  ? anti-parallel 
BB 7  8  ? anti-parallel 
BB 8  9  ? anti-parallel 
BB 9  10 ? anti-parallel 
BB 10 11 ? anti-parallel 
BB 11 12 ? anti-parallel 
BB 12 13 ? anti-parallel 
BB 13 14 ? anti-parallel 
BB 14 15 ? anti-parallel 
BB 15 16 ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BC 4  5  ? anti-parallel 
BC 5  6  ? anti-parallel 
BC 6  7  ? anti-parallel 
BC 7  8  ? anti-parallel 
BC 8  9  ? anti-parallel 
BC 9  10 ? anti-parallel 
BC 10 11 ? anti-parallel 
BC 11 12 ? anti-parallel 
BD 1  2  ? anti-parallel 
BE 1  2  ? parallel      
BE 2  3  ? parallel      
BE 3  4  ? parallel      
BE 4  5  ? parallel      
BF 1  2  ? anti-parallel 
BG 1  2  ? parallel      
BG 2  3  ? parallel      
BG 3  4  ? anti-parallel 
BH 1  2  ? anti-parallel 
BH 2  3  ? anti-parallel 
BH 3  4  ? anti-parallel 
BH 4  5  ? anti-parallel 
BH 6  7  ? anti-parallel 
BI 1  2  ? anti-parallel 
BI 2  3  ? anti-parallel 
BI 3  4  ? anti-parallel 
BI 5  6  ? anti-parallel 
BI 6  7  ? anti-parallel 
BI 7  8  ? anti-parallel 
BI 8  9  ? anti-parallel 
BI 9  10 ? anti-parallel 
BI 11 12 ? anti-parallel 
BJ 1  2  ? anti-parallel 
BK 1  2  ? parallel      
BK 2  3  ? parallel      
BK 3  4  ? parallel      
BK 4  5  ? parallel      
BK 5  6  ? parallel      
BK 6  7  ? parallel      
BK 7  8  ? anti-parallel 
BL 1  2  ? anti-parallel 
BL 2  3  ? anti-parallel 
BL 3  4  ? anti-parallel 
BL 4  5  ? anti-parallel 
BL 5  6  ? anti-parallel 
BL 6  7  ? anti-parallel 
BM 1  2  ? anti-parallel 
BN 1  2  ? parallel      
BN 2  3  ? parallel      
BN 3  4  ? parallel      
BN 4  5  ? parallel      
BN 5  6  ? parallel      
BN 6  7  ? parallel      
BN 7  8  ? anti-parallel 
BO 1  2  ? anti-parallel 
BP 1  2  ? parallel      
BP 2  3  ? parallel      
BP 3  4  ? parallel      
BP 4  5  ? parallel      
BP 5  6  ? parallel      
BP 6  7  ? parallel      
BP 7  8  ? anti-parallel 
BQ 1  2  ? anti-parallel 
BR 1  2  ? anti-parallel 
BS 1  2  ? parallel      
BS 2  3  ? parallel      
BS 3  4  ? parallel      
BS 4  5  ? parallel      
BS 5  6  ? parallel      
BS 6  7  ? parallel      
BT 1  2  ? anti-parallel 
BU 1  2  ? anti-parallel 
BV 1  2  ? parallel      
BV 2  3  ? parallel      
BV 3  4  ? parallel      
BV 4  5  ? parallel      
BV 5  6  ? parallel      
BV 6  7  ? parallel      
BV 7  8  ? anti-parallel 
BW 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  2  GLU A 53  ? PHE A 57  ? GLU A 53  PHE A 57  
A  3  LEU A 89  ? ILE A 96  ? LEU A 89  ILE A 96  
A  4  THR A 30  ? GLY A 37  ? THR A 30  GLY A 37  
A  5  ILE A 40  ? GLY A 45  ? ILE A 40  GLY A 45  
A  6  VAL A 73  ? LEU A 77  ? VAL A 73  LEU A 77  
A  7  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  8  THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
A  9  LYS E 81  ? ASP E 84  ? LYS E 75  ASP E 78  
A  10 ALA E 42  ? LYS E 46  ? ALA E 36  LYS E 40  
A  11 LYS E 51  ? GLY E 61  ? LYS E 45  GLY E 55  
A  12 THR E 64  ? ALA E 69  ? THR E 58  ALA E 63  
A  13 ILE E 26  ? HIS E 30  ? ILE E 20  HIS E 24  
A  14 THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
B  1  ASP A 98  ? VAL A 101 ? ASP A 98  VAL A 101 
B  2  GLY A 127 ? ARG A 130 ? GLY A 127 ARG A 130 
C  1  VAL A 109 ? VAL A 110 ? VAL A 109 VAL A 110 
C  2  SER A 231 ? ALA A 236 ? SER A 231 ALA A 236 
C  3  TYR A 202 ? VAL A 208 ? TYR A 202 VAL A 208 
C  4  HIS A 265 ? ASP A 271 ? HIS A 265 ASP A 271 
C  5  SER A 322 ? THR A 331 ? SER A 322 THR A 331 
C  6  ALA A 312 ? LYS A 313 ? ALA A 312 LYS A 313 
D  1  VAL A 109 ? VAL A 110 ? VAL A 109 VAL A 110 
D  2  SER A 231 ? ALA A 236 ? SER A 231 ALA A 236 
D  3  TYR A 202 ? VAL A 208 ? TYR A 202 VAL A 208 
D  4  HIS A 265 ? ASP A 271 ? HIS A 265 ASP A 271 
D  5  SER A 322 ? THR A 331 ? SER A 322 THR A 331 
D  6  LEU A 168 ? ASP A 172 ? LEU A 168 ASP A 172 
D  7  GLN A 351 ? LEU A 354 ? GLN A 351 LEU A 354 
E  1  PRO A 147 ? VAL A 148 ? PRO A 147 VAL A 148 
E  2  ILE A 161 ? GLY A 162 ? ILE A 161 GLY A 162 
F  1  GLN B 72  ? LEU B 77  ? GLN B 72  LEU B 77  
F  2  ILE B 40  ? GLY B 45  ? ILE B 40  GLY B 45  
F  3  THR B 30  ? GLY B 37  ? THR B 30  GLY B 37  
F  4  LEU B 89  ? ILE B 96  ? LEU B 89  ILE B 96  
F  5  GLU B 53  ? PHE B 57  ? GLU B 53  PHE B 57  
F  6  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
F  7  GLY F 17  ? ILE F 23  ? GLY F 11  ILE F 17  
F  8  ILE F 26  ? HIS F 30  ? ILE F 20  HIS F 24  
F  9  THR F 64  ? ALA F 69  ? THR F 58  ALA F 63  
F  10 LYS F 51  ? GLY F 61  ? LYS F 45  GLY F 55  
F  11 THR C 30  ? GLY C 37  ? THR C 30  GLY C 37  
F  12 LEU C 89  ? ILE C 96  ? LEU C 89  ILE C 96  
F  13 GLU C 53  ? PHE C 57  ? GLU C 53  PHE C 57  
F  14 LYS C 62  ? LEU C 68  ? LYS C 62  LEU C 68  
F  15 THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
F  16 LYS D 81  ? ASP D 84  ? LYS D 75  ASP D 78  
F  17 ALA D 42  ? LYS D 46  ? ALA D 36  LYS D 40  
F  18 LYS D 51  ? GLY D 61  ? LYS D 45  GLY D 55  
F  19 THR D 64  ? ALA D 69  ? THR D 58  ALA D 63  
F  20 ILE D 26  ? HIS D 30  ? ILE D 20  HIS D 24  
G  1  GLU B 53  ? PHE B 57  ? GLU B 53  PHE B 57  
G  2  LEU B 89  ? ILE B 96  ? LEU B 89  ILE B 96  
G  3  THR B 30  ? GLY B 37  ? THR B 30  GLY B 37  
G  4  ILE B 40  ? GLY B 45  ? ILE B 40  GLY B 45  
G  5  GLN B 72  ? LEU B 77  ? GLN B 72  LEU B 77  
G  6  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
G  7  GLY F 17  ? ILE F 23  ? GLY F 11  ILE F 17  
G  8  LYS F 81  ? PRO F 88  ? LYS F 75  PRO F 82  
G  9  ASN F 41  ? LYS F 46  ? ASN F 35  LYS F 40  
G  10 LYS F 51  ? GLY F 61  ? LYS F 45  GLY F 55  
G  11 THR C 30  ? GLY C 37  ? THR C 30  GLY C 37  
G  12 ILE C 40  ? GLY C 45  ? ILE C 40  GLY C 45  
G  13 VAL C 73  ? LEU C 77  ? VAL C 73  LEU C 77  
G  14 LYS C 62  ? LEU C 68  ? LYS C 62  LEU C 68  
G  15 THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
G  16 ILE D 26  ? HIS D 30  ? ILE D 20  HIS D 24  
G  17 THR D 64  ? ALA D 69  ? THR D 58  ALA D 63  
G  18 LYS D 51  ? GLY D 61  ? LYS D 45  GLY D 55  
G  19 ALA D 42  ? LYS D 46  ? ALA D 36  LYS D 40  
G  20 LYS D 81  ? ASP D 84  ? LYS D 75  ASP D 78  
H  1  ASP B 98  ? VAL B 101 ? ASP B 98  VAL B 101 
H  2  GLY B 127 ? ARG B 130 ? GLY B 127 ARG B 130 
I  1  ARG B 108 ? ASP B 111 ? ARG B 108 ASP B 111 
I  2  SER B 231 ? ALA B 236 ? SER B 231 ALA B 236 
I  3  LEU B 201 ? VAL B 208 ? LEU B 201 VAL B 208 
I  4  HIS B 265 ? ASP B 271 ? HIS B 265 ASP B 271 
I  5  SER B 322 ? GLU B 330 ? SER B 322 GLU B 330 
I  6  ALA B 312 ? LYS B 313 ? ALA B 312 LYS B 313 
J  1  ARG B 108 ? ASP B 111 ? ARG B 108 ASP B 111 
J  2  SER B 231 ? ALA B 236 ? SER B 231 ALA B 236 
J  3  LEU B 201 ? VAL B 208 ? LEU B 201 VAL B 208 
J  4  HIS B 265 ? ASP B 271 ? HIS B 265 ASP B 271 
J  5  SER B 322 ? GLU B 330 ? SER B 322 GLU B 330 
J  6  LEU B 168 ? GLY B 171 ? LEU B 168 GLY B 171 
J  7  GLY B 350 ? LEU B 354 ? GLY B 350 LEU B 354 
J  8  VAL B 373 ? SER B 374 ? VAL B 373 SER B 374 
K  1  PRO B 147 ? VAL B 148 ? PRO B 147 VAL B 148 
K  2  ILE B 161 ? GLY B 162 ? ILE B 161 GLY B 162 
L  1  ASP C 98  ? VAL C 101 ? ASP C 98  VAL C 101 
L  2  GLY C 127 ? ARG C 130 ? GLY C 127 ARG C 130 
M  1  ARG C 108 ? VAL C 110 ? ARG C 108 VAL C 110 
M  2  SER C 231 ? ALA C 236 ? SER C 231 ALA C 236 
M  3  TYR C 202 ? VAL C 208 ? TYR C 202 VAL C 208 
M  4  HIS C 265 ? ASP C 271 ? HIS C 265 ASP C 271 
M  5  SER C 322 ? GLU C 330 ? SER C 322 GLU C 330 
M  6  LEU C 168 ? GLY C 171 ? LEU C 168 GLY C 171 
M  7  GLY C 350 ? LEU C 354 ? GLY C 350 LEU C 354 
M  8  VAL C 373 ? SER C 374 ? VAL C 373 SER C 374 
N  1  SER D 90  ? PRO D 92  ? SER D 84  PRO D 86  
N  2  ARG D 120 ? PRO D 122 ? ARG D 114 PRO D 116 
O  1  ILE D 101 ? ILE D 102 ? ILE D 95  ILE D 96  
O  2  VAL D 221 ? GLY D 226 ? VAL D 215 GLY D 220 
O  3  PHE D 187 ? VAL D 193 ? PHE D 181 VAL D 187 
O  4  ASP D 256 ? ASP D 262 ? ASP D 250 ASP D 256 
O  5  SER D 309 ? TYR D 317 ? SER D 303 TYR D 311 
O  6  LYS D 158 ? GLY D 163 ? LYS D 152 GLY D 157 
O  7  ALA D 337 ? VAL D 340 ? ALA D 331 VAL D 334 
O  8  LYS D 360 ? SER D 361 ? LYS D 354 SER D 355 
P  1  ILE D 139 ? LEU D 140 ? ILE D 133 LEU D 134 
P  2  TYR D 153 ? ALA D 154 ? TYR D 147 ALA D 148 
Q  1  SER E 90  ? PRO E 92  ? SER E 84  PRO E 86  
Q  2  ARG E 120 ? PRO E 122 ? ARG E 114 PRO E 116 
R  1  ILE E 101 ? ILE E 102 ? ILE E 95  ILE E 96  
R  2  VAL E 221 ? GLY E 226 ? VAL E 215 GLY E 220 
R  3  SER E 188 ? VAL E 193 ? SER E 182 VAL E 187 
R  4  ASP E 256 ? ASP E 262 ? ASP E 250 ASP E 256 
R  5  SER E 309 ? ALA E 315 ? SER E 303 ALA E 309 
R  6  LYS E 158 ? PHE E 162 ? LYS E 152 PHE E 156 
R  7  ALA E 337 ? VAL E 340 ? ALA E 331 VAL E 334 
S  1  ILE E 139 ? LEU E 140 ? ILE E 133 LEU E 134 
S  2  TYR E 153 ? ALA E 154 ? TYR E 147 ALA E 148 
T  1  SER F 90  ? VAL F 93  ? SER F 84  VAL F 87  
T  2  LEU F 119 ? PRO F 122 ? LEU F 113 PRO F 116 
U  1  ILE F 101 ? ILE F 102 ? ILE F 95  ILE F 96  
U  2  VAL F 221 ? GLY F 226 ? VAL F 215 GLY F 220 
U  3  PHE F 187 ? VAL F 193 ? PHE F 181 VAL F 187 
U  4  ASP F 256 ? ASP F 262 ? ASP F 250 ASP F 256 
U  5  SER F 309 ? TYR F 317 ? SER F 303 TYR F 311 
U  6  LYS F 158 ? GLY F 163 ? LYS F 152 GLY F 157 
U  7  ALA F 337 ? VAL F 340 ? ALA F 331 VAL F 334 
U  8  LYS F 360 ? SER F 361 ? LYS F 354 SER F 355 
V  1  ILE F 139 ? LEU F 140 ? ILE F 133 LEU F 134 
V  2  TYR F 153 ? ALA F 154 ? TYR F 147 ALA F 148 
W  1  GLU G 176 ? ILE G 182 ? GLU G 176 ILE G 182 
W  2  LYS G 161 ? ASP G 168 ? LYS G 161 ASP G 168 
W  3  GLU G 72  ? ILE G 77  ? GLU G 72  ILE G 77  
W  4  ASP G 106 ? ILE G 110 ? ASP G 106 ILE G 110 
W  5  ILE G 126 ? ASN G 131 ? ILE G 126 ASN G 131 
W  6  PHE I 43  ? GLN I 46  ? PHE I 43  GLN I 46  
W  7  ILE I 59  ? THR I 60  ? ILE I 59  THR I 60  
X  1  LEU H 12  ? ALA H 15  ? LEU H 12  ALA H 15  
X  2  LEU H 83  ? ALA H 87  ? LEU H 83  ALA H 87  
X  3  GLY H 73  ? VAL H 77  ? GLY H 73  VAL H 77  
X  4  THR H 48  ? LEU H 52  ? THR H 48  LEU H 52  
Y  1  ARG H 38  ? VAL H 41  ? ARG H 38  VAL H 41  
Y  2  GLN H 29  ? PRO H 33  ? GLN H 29  PRO H 33  
Y  3  GLU H 58  ? MET H 60  ? GLU H 58  MET H 60  
Y  4  SER H 65  ? LYS H 66  ? SER H 65  LYS H 66  
Z  1  GLY H 55  ? VAL H 56  ? GLY H 55  VAL H 56  
Z  2  PHE H 69  ? ILE H 70  ? PHE H 69  ILE H 70  
AA 1  LYS N 81  ? PRO N 88  ? LYS N 75  PRO N 82  
AA 2  ASN N 41  ? LYS N 46  ? ASN N 35  LYS N 40  
AA 3  LYS N 51  ? GLY N 61  ? LYS N 45  GLY N 55  
AA 4  THR N 64  ? ALA N 69  ? THR N 58  ALA N 63  
AA 5  ILE N 26  ? HIS N 30  ? ILE N 20  HIS N 24  
AA 6  THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
AA 7  LYS J 62  ? GLU J 69  ? LYS J 62  GLU J 69  
AA 8  GLU J 53  ? PHE J 57  ? GLU J 53  PHE J 57  
AA 9  LEU J 89  ? ILE J 96  ? LEU J 89  ILE J 96  
AA 10 THR J 30  ? GLY J 37  ? THR J 30  GLY J 37  
AA 11 LEU M 52  ? GLY M 61  ? LEU M 46  GLY M 55  
AA 12 THR M 64  ? ALA M 69  ? THR M 58  ALA M 63  
AA 13 ILE M 26  ? HIS M 30  ? ILE M 20  HIS M 24  
AA 14 THR M 16  ? ILE M 23  ? THR M 10  ILE M 17  
AA 15 LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AA 16 VAL L 73  ? LEU L 77  ? VAL L 73  LEU L 77  
AA 17 ILE L 40  ? GLY L 45  ? ILE L 40  GLY L 45  
AA 18 THR L 30  ? GLY L 37  ? THR L 30  GLY L 37  
AA 19 LEU L 89  ? LYS L 91  ? LEU L 89  LYS L 91  
AA 20 LEU L 54  ? PHE L 57  ? LEU L 54  PHE L 57  
AB 1  ILE N 26  ? HIS N 30  ? ILE N 20  HIS N 24  
AB 2  THR N 64  ? ALA N 69  ? THR N 58  ALA N 63  
AB 3  LYS N 51  ? GLY N 61  ? LYS N 45  GLY N 55  
AB 4  ASN N 41  ? LYS N 46  ? ASN N 35  LYS N 40  
AB 5  LYS N 81  ? PRO N 88  ? LYS N 75  PRO N 82  
AB 6  THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
AB 7  LYS J 62  ? GLU J 69  ? LYS J 62  GLU J 69  
AB 8  GLN J 72  ? LEU J 77  ? GLN J 72  LEU J 77  
AB 9  ILE J 40  ? GLY J 45  ? ILE J 40  GLY J 45  
AB 10 THR J 30  ? GLY J 37  ? THR J 30  GLY J 37  
AB 11 LEU M 52  ? GLY M 61  ? LEU M 46  GLY M 55  
AB 12 ALA M 42  ? ILE M 45  ? ALA M 36  ILE M 39  
AB 13 LYS M 81  ? ASP M 84  ? LYS M 75  ASP M 78  
AB 14 THR M 16  ? ILE M 23  ? THR M 10  ILE M 17  
AB 15 LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AB 16 LEU L 54  ? PHE L 57  ? LEU L 54  PHE L 57  
AB 17 LEU L 89  ? LYS L 91  ? LEU L 89  LYS L 91  
AB 18 THR L 30  ? GLY L 37  ? THR L 30  GLY L 37  
AB 19 ILE L 40  ? GLY L 45  ? ILE L 40  GLY L 45  
AB 20 VAL L 73  ? LEU L 77  ? VAL L 73  LEU L 77  
AC 1  ASP J 98  ? PRO J 100 ? ASP J 98  PRO J 100 
AC 2  ARG J 128 ? ARG J 130 ? ARG J 128 ARG J 130 
AD 1  ARG J 108 ? VAL J 110 ? ARG J 108 VAL J 110 
AD 2  SER J 231 ? ALA J 236 ? SER J 231 ALA J 236 
AD 3  LEU J 201 ? VAL J 208 ? LEU J 201 VAL J 208 
AD 4  HIS J 265 ? ASP J 271 ? HIS J 265 ASP J 271 
AD 5  SER J 322 ? GLU J 330 ? SER J 322 GLU J 330 
AD 6  GLU J 167 ? GLY J 171 ? GLU J 167 GLY J 171 
AD 7  GLY J 350 ? LEU J 354 ? GLY J 350 LEU J 354 
AD 8  VAL J 373 ? SER J 374 ? VAL J 373 SER J 374 
AE 1  PRO J 147 ? VAL J 148 ? PRO J 147 VAL J 148 
AE 2  ILE J 161 ? GLY J 162 ? ILE J 161 GLY J 162 
AF 1  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AF 2  ILE K 40  ? GLY K 45  ? ILE K 40  GLY K 45  
AF 3  GLN K 72  ? LEU K 77  ? GLN K 72  LEU K 77  
AF 4  LYS K 62  ? GLU K 69  ? LYS K 62  GLU K 69  
AF 5  GLU K 53  ? PHE K 57  ? GLU K 53  PHE K 57  
AF 6  LEU K 89  ? ILE K 96  ? LEU K 89  ILE K 96  
AF 7  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AG 1  ASP K 98  ? VAL K 101 ? ASP K 98  VAL K 101 
AG 2  GLY K 127 ? ARG K 130 ? GLY K 127 ARG K 130 
AH 1  VAL K 109 ? VAL K 110 ? VAL K 109 VAL K 110 
AH 2  SER K 231 ? ALA K 236 ? SER K 231 ALA K 236 
AH 3  LEU K 201 ? VAL K 208 ? LEU K 201 VAL K 208 
AH 4  HIS K 265 ? ASP K 271 ? HIS K 265 ASP K 271 
AH 5  SER K 322 ? ALA K 325 ? SER K 322 ALA K 325 
AI 1  PRO K 147 ? VAL K 148 ? PRO K 147 VAL K 148 
AI 2  ILE K 161 ? GLY K 162 ? ILE K 161 GLY K 162 
AJ 1  VAL K 328 ? GLU K 330 ? VAL K 328 GLU K 330 
AJ 2  LEU K 168 ? GLY K 171 ? LEU K 168 GLY K 171 
AJ 3  GLY K 350 ? LEU K 354 ? GLY K 350 LEU K 354 
AJ 4  VAL K 373 ? SER K 374 ? VAL K 373 SER K 374 
AK 1  ASP L 98  ? VAL L 101 ? ASP L 98  VAL L 101 
AK 2  GLY L 127 ? ARG L 130 ? GLY L 127 ARG L 130 
AL 1  VAL L 109 ? VAL L 110 ? VAL L 109 VAL L 110 
AL 2  SER L 231 ? ALA L 236 ? SER L 231 ALA L 236 
AL 3  TYR L 202 ? VAL L 208 ? TYR L 202 VAL L 208 
AL 4  HIS L 265 ? ASP L 271 ? HIS L 265 ASP L 271 
AL 5  SER L 322 ? GLU L 330 ? SER L 322 GLU L 330 
AL 6  ALA L 312 ? LYS L 313 ? ALA L 312 LYS L 313 
AM 1  VAL L 109 ? VAL L 110 ? VAL L 109 VAL L 110 
AM 2  SER L 231 ? ALA L 236 ? SER L 231 ALA L 236 
AM 3  TYR L 202 ? VAL L 208 ? TYR L 202 VAL L 208 
AM 4  HIS L 265 ? ASP L 271 ? HIS L 265 ASP L 271 
AM 5  SER L 322 ? GLU L 330 ? SER L 322 GLU L 330 
AM 6  LEU L 168 ? GLY L 171 ? LEU L 168 GLY L 171 
AM 7  GLY L 350 ? LEU L 354 ? GLY L 350 LEU L 354 
AM 8  VAL L 373 ? SER L 374 ? VAL L 373 SER L 374 
AN 1  PRO L 147 ? VAL L 148 ? PRO L 147 VAL L 148 
AN 2  ILE L 161 ? GLY L 162 ? ILE L 161 GLY L 162 
AO 1  SER M 90  ? PRO M 92  ? SER M 84  PRO M 86  
AO 2  ARG M 120 ? PRO M 122 ? ARG M 114 PRO M 116 
AP 1  ILE M 101 ? ILE M 102 ? ILE M 95  ILE M 96  
AP 2  VAL M 221 ? GLY M 226 ? VAL M 215 GLY M 220 
AP 3  PHE M 187 ? VAL M 193 ? PHE M 181 VAL M 187 
AP 4  VAL M 257 ? ASP M 262 ? VAL M 251 ASP M 256 
AP 5  VAL M 310 ? TYR M 317 ? VAL M 304 TYR M 311 
AP 6  LYS M 158 ? GLY M 163 ? LYS M 152 GLY M 157 
AP 7  ALA M 337 ? VAL M 340 ? ALA M 331 VAL M 334 
AP 8  LYS M 360 ? SER M 361 ? LYS M 354 SER M 355 
AQ 1  ILE M 139 ? LEU M 140 ? ILE M 133 LEU M 134 
AQ 2  TYR M 153 ? ALA M 154 ? TYR M 147 ALA M 148 
AR 1  SER N 90  ? PRO N 92  ? SER N 84  PRO N 86  
AR 2  ARG N 120 ? PRO N 122 ? ARG N 114 PRO N 116 
AS 1  ILE N 101 ? ILE N 102 ? ILE N 95  ILE N 96  
AS 2  VAL N 221 ? GLY N 226 ? VAL N 215 GLY N 220 
AS 3  SER N 188 ? VAL N 193 ? SER N 182 VAL N 187 
AS 4  VAL N 257 ? ASP N 262 ? VAL N 251 ASP N 256 
AS 5  VAL N 310 ? ALA N 315 ? VAL N 304 ALA N 309 
AS 6  LYS N 158 ? PHE N 162 ? LYS N 152 PHE N 156 
AS 7  ALA N 337 ? VAL N 340 ? ALA N 331 VAL N 334 
AS 8  LYS N 360 ? SER N 361 ? LYS N 354 SER N 355 
AT 1  ILE N 139 ? LEU N 140 ? ILE N 133 LEU N 134 
AT 2  TYR N 153 ? ALA N 154 ? TYR N 147 ALA N 148 
AU 1  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AU 2  ILE O 26  ? HIS O 30  ? ILE O 20  HIS O 24  
AU 3  THR O 64  ? ALA O 69  ? THR O 58  ALA O 63  
AU 4  LYS O 51  ? GLY O 61  ? LYS O 45  GLY O 55  
AU 5  ALA O 42  ? LYS O 46  ? ALA O 36  LYS O 40  
AU 6  LYS O 81  ? ASP O 84  ? LYS O 75  ASP O 78  
AU 7  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AV 1  SER O 90  ? VAL O 93  ? SER O 84  VAL O 87  
AV 2  LEU O 119 ? PRO O 122 ? LEU O 113 PRO O 116 
AW 1  ILE O 101 ? ILE O 102 ? ILE O 95  ILE O 96  
AW 2  VAL O 221 ? GLY O 226 ? VAL O 215 GLY O 220 
AW 3  SER O 188 ? VAL O 193 ? SER O 182 VAL O 187 
AW 4  ASP O 256 ? ASP O 262 ? ASP O 250 ASP O 256 
AW 5  SER O 309 ? TYR O 317 ? SER O 303 TYR O 311 
AW 6  LYS O 158 ? GLY O 163 ? LYS O 152 GLY O 157 
AW 7  ALA O 337 ? VAL O 340 ? ALA O 331 VAL O 334 
AW 8  LYS O 360 ? SER O 361 ? LYS O 354 SER O 355 
AX 1  ILE O 139 ? LEU O 140 ? ILE O 133 LEU O 134 
AX 2  TYR O 153 ? ALA O 154 ? TYR O 147 ALA O 148 
AY 1  LEU P 128 ? ILE P 130 ? LEU P 128 ILE P 130 
AY 2  ASP P 106 ? ILE P 110 ? ASP P 106 ILE P 110 
AY 3  LEU P 73  ? ILE P 77  ? LEU P 73  ILE P 77  
AY 4  ILE P 162 ? ASP P 168 ? ILE P 162 ASP P 168 
AY 5  GLU P 176 ? ILE P 182 ? GLU P 176 ILE P 182 
AZ 1  PHE Q 14  ? ALA Q 15  ? PHE Q 14  ALA Q 15  
AZ 2  GLN Q 82  ? ALA Q 87  ? GLN Q 82  ALA Q 87  
AZ 3  GLY Q 73  ? GLN Q 78  ? GLY Q 73  GLN Q 78  
AZ 4  THR Q 48  ? LEU Q 52  ? THR Q 48  LEU Q 52  
BA 1  VAL Q 30  ? ASN Q 31  ? VAL Q 30  ASN Q 31  
BA 2  GLY Q 40  ? VAL Q 41  ? GLY Q 40  VAL Q 41  
BB 1  LEU W 83  ? PRO W 88  ? LEU W 77  PRO W 82  
BB 2  ASN W 41  ? LYS W 46  ? ASN W 35  LYS W 40  
BB 3  LYS W 51  ? GLN W 58  ? LYS W 45  GLN W 52  
BB 4  THR W 64  ? ALA W 69  ? THR W 58  ALA W 63  
BB 5  ILE W 26  ? HIS W 30  ? ILE W 20  HIS W 24  
BB 6  LYS W 18  ? ILE W 23  ? LYS W 12  ILE W 17  
BB 7  LYS S 62  ? LEU S 68  ? LYS S 62  LEU S 68  
BB 8  GLU S 53  ? GLU S 56  ? GLU S 53  GLU S 56  
BB 9  LEU S 89  ? ILE S 96  ? LEU S 89  ILE S 96  
BB 10 THR S 30  ? GLY S 37  ? THR S 30  GLY S 37  
BB 11 LYS V 51  ? GLY V 61  ? LYS V 45  GLY V 55  
BB 12 ALA V 42  ? LYS V 46  ? ALA V 36  LYS V 40  
BB 13 LYS V 81  ? ASP V 84  ? LYS V 75  ASP V 78  
BB 14 THR V 16  ? ILE V 23  ? THR V 10  ILE V 17  
BB 15 ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
BB 16 THR V 64  ? ILE V 68  ? THR V 58  ILE V 62  
BC 1  LEU S 89  ? ILE S 96  ? LEU S 89  ILE S 96  
BC 2  GLU S 53  ? GLU S 56  ? GLU S 53  GLU S 56  
BC 3  LYS S 62  ? LEU S 68  ? LYS S 62  LEU S 68  
BC 4  GLN S 72  ? LEU S 77  ? GLN S 72  LEU S 77  
BC 5  ILE S 40  ? GLY S 45  ? ILE S 40  GLY S 45  
BC 6  THR S 30  ? GLY S 37  ? THR S 30  GLY S 37  
BC 7  LYS V 51  ? GLY V 61  ? LYS V 45  GLY V 55  
BC 8  THR V 64  ? ILE V 68  ? THR V 58  ILE V 62  
BC 9  ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
BC 10 THR V 16  ? ILE V 23  ? THR V 10  ILE V 17  
BC 11 LYS V 81  ? ASP V 84  ? LYS V 75  ASP V 78  
BC 12 ALA V 42  ? LYS V 46  ? ALA V 36  LYS V 40  
BD 1  ASP S 98  ? PRO S 100 ? ASP S 98  PRO S 100 
BD 2  ARG S 128 ? ARG S 130 ? ARG S 128 ARG S 130 
BE 1  ARG S 108 ? ASP S 111 ? ARG S 108 ASP S 111 
BE 2  SER S 231 ? ALA S 236 ? SER S 231 ALA S 236 
BE 3  LEU S 201 ? VAL S 208 ? LEU S 201 VAL S 208 
BE 4  HIS S 265 ? ASP S 271 ? HIS S 265 ASP S 271 
BE 5  SER S 322 ? ALA S 325 ? SER S 322 ALA S 325 
BF 1  PRO S 147 ? VAL S 148 ? PRO S 147 VAL S 148 
BF 2  ILE S 161 ? GLY S 162 ? ILE S 161 GLY S 162 
BG 1  VAL S 328 ? GLU S 330 ? VAL S 328 GLU S 330 
BG 2  LEU S 168 ? GLY S 171 ? LEU S 168 GLY S 171 
BG 3  GLY S 350 ? LEU S 354 ? GLY S 350 LEU S 354 
BG 4  VAL S 373 ? SER S 374 ? VAL S 373 SER S 374 
BH 1  GLY T 31  ? GLY T 37  ? GLY T 31  GLY T 37  
BH 2  ILE T 40  ? GLY T 45  ? ILE T 40  GLY T 45  
BH 3  GLN T 72  ? PHE T 78  ? GLN T 72  PHE T 78  
BH 4  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
BH 5  THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
BH 6  GLU T 53  ? GLU T 56  ? GLU T 53  GLU T 56  
BH 7  LYS T 91  ? ILE T 96  ? LYS T 91  ILE T 96  
BI 1  GLY T 31  ? GLY T 37  ? GLY T 31  GLY T 37  
BI 2  ILE T 40  ? GLY T 45  ? ILE T 40  GLY T 45  
BI 3  GLN T 72  ? PHE T 78  ? GLN T 72  PHE T 78  
BI 4  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
BI 5  VAL X 82  ? PRO X 88  ? VAL X 76  PRO X 82  
BI 6  ASN X 41  ? GLU X 44  ? ASN X 35  GLU X 38  
BI 7  VAL X 53  ? GLY X 61  ? VAL X 47  GLY X 55  
BI 8  THR X 64  ? ALA X 69  ? THR X 58  ALA X 63  
BI 9  ILE X 26  ? PHE X 31  ? ILE X 20  PHE X 25  
BI 10 THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
BI 11 GLU T 53  ? GLU T 56  ? GLU T 53  GLU T 56  
BI 12 LYS T 91  ? ILE T 96  ? LYS T 91  ILE T 96  
BJ 1  ASP T 98  ? PRO T 100 ? ASP T 98  PRO T 100 
BJ 2  ARG T 128 ? ARG T 130 ? ARG T 128 ARG T 130 
BK 1  VAL T 109 ? VAL T 110 ? VAL T 109 VAL T 110 
BK 2  SER T 231 ? ALA T 236 ? SER T 231 ALA T 236 
BK 3  LEU T 201 ? VAL T 208 ? LEU T 201 VAL T 208 
BK 4  HIS T 265 ? ASP T 271 ? HIS T 265 ASP T 271 
BK 5  SER T 322 ? GLU T 330 ? SER T 322 GLU T 330 
BK 6  LEU T 168 ? GLY T 171 ? LEU T 168 GLY T 171 
BK 7  GLY T 350 ? LEU T 354 ? GLY T 350 LEU T 354 
BK 8  VAL T 373 ? SER T 374 ? VAL T 373 SER T 374 
BL 1  GLY U 31  ? VAL U 36  ? GLY U 31  VAL U 36  
BL 2  ILE U 40  ? GLY U 45  ? ILE U 40  GLY U 45  
BL 3  VAL U 73  ? LEU U 77  ? VAL U 73  LEU U 77  
BL 4  LYS U 62  ? LEU U 68  ? LYS U 62  LEU U 68  
BL 5  GLU U 53  ? PHE U 57  ? GLU U 53  PHE U 57  
BL 6  LEU U 89  ? ILE U 96  ? LEU U 89  ILE U 96  
BL 7  GLY U 31  ? VAL U 36  ? GLY U 31  VAL U 36  
BM 1  ASP U 98  ? VAL U 101 ? ASP U 98  VAL U 101 
BM 2  GLY U 127 ? ARG U 130 ? GLY U 127 ARG U 130 
BN 1  ARG U 108 ? VAL U 110 ? ARG U 108 VAL U 110 
BN 2  SER U 231 ? ALA U 236 ? SER U 231 ALA U 236 
BN 3  LEU U 201 ? VAL U 208 ? LEU U 201 VAL U 208 
BN 4  HIS U 265 ? ASP U 271 ? HIS U 265 ASP U 271 
BN 5  SER U 322 ? GLU U 330 ? SER U 322 GLU U 330 
BN 6  LEU U 168 ? GLY U 171 ? LEU U 168 GLY U 171 
BN 7  GLY U 350 ? LEU U 354 ? GLY U 350 LEU U 354 
BN 8  VAL U 373 ? SER U 374 ? VAL U 373 SER U 374 
BO 1  SER V 90  ? PRO V 92  ? SER V 84  PRO V 86  
BO 2  ARG V 120 ? PRO V 122 ? ARG V 114 PRO V 116 
BP 1  ILE V 101 ? ILE V 102 ? ILE V 95  ILE V 96  
BP 2  VAL V 221 ? GLY V 226 ? VAL V 215 GLY V 220 
BP 3  SER V 188 ? VAL V 193 ? SER V 182 VAL V 187 
BP 4  ASP V 256 ? ASP V 262 ? ASP V 250 ASP V 256 
BP 5  SER V 309 ? TYR V 317 ? SER V 303 TYR V 311 
BP 6  LYS V 158 ? GLY V 163 ? LYS V 152 GLY V 157 
BP 7  ALA V 337 ? LEU V 341 ? ALA V 331 LEU V 335 
BP 8  LYS V 360 ? SER V 361 ? LYS V 354 SER V 355 
BQ 1  ILE V 139 ? LEU V 140 ? ILE V 133 LEU V 134 
BQ 2  TYR V 153 ? ALA V 154 ? TYR V 147 ALA V 148 
BR 1  SER W 90  ? PRO W 92  ? SER W 84  PRO W 86  
BR 2  ARG W 120 ? PRO W 122 ? ARG W 114 PRO W 116 
BS 1  ILE W 101 ? ILE W 102 ? ILE W 95  ILE W 96  
BS 2  VAL W 221 ? GLN W 227 ? VAL W 215 GLN W 221 
BS 3  SER W 188 ? GLU W 195 ? SER W 182 GLU W 189 
BS 4  ASP W 256 ? ASP W 262 ? ASP W 250 ASP W 256 
BS 5  SER W 309 ? ALA W 315 ? SER W 303 ALA W 309 
BS 6  LYS W 158 ? PHE W 162 ? LYS W 152 PHE W 156 
BS 7  ALA W 337 ? VAL W 340 ? ALA W 331 VAL W 334 
BT 1  ILE W 139 ? LEU W 140 ? ILE W 133 LEU W 134 
BT 2  TYR W 153 ? ALA W 154 ? TYR W 147 ALA W 148 
BU 1  SER X 90  ? VAL X 93  ? SER X 84  VAL X 87  
BU 2  LEU X 119 ? PRO X 122 ? LEU X 113 PRO X 116 
BV 1  ILE X 101 ? ILE X 102 ? ILE X 95  ILE X 96  
BV 2  VAL X 221 ? GLY X 226 ? VAL X 215 GLY X 220 
BV 3  PHE X 187 ? VAL X 193 ? PHE X 181 VAL X 187 
BV 4  ASP X 256 ? ASP X 262 ? ASP X 250 ASP X 256 
BV 5  SER X 309 ? TYR X 317 ? SER X 303 TYR X 311 
BV 6  LYS X 158 ? GLY X 163 ? LYS X 152 GLY X 157 
BV 7  ALA X 337 ? VAL X 340 ? ALA X 331 VAL X 334 
BV 8  LYS X 360 ? SER X 361 ? LYS X 354 SER X 355 
BW 1  TYR Y 166 ? ASP Y 168 ? TYR Y 166 ASP Y 168 
BW 2  GLU Y 176 ? SER Y 178 ? GLU Y 176 SER Y 178 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O GLY A 63  ? O GLY A 63  N VAL A 55  ? N VAL A 55  
A  2  3  N GLU A 56  ? N GLU A 56  O LYS A 91  ? O LYS A 91  
A  3  4  O VAL A 90  ? O VAL A 90  N GLY A 31  ? N GLY A 31  
A  4  5  N ARG A 32  ? N ARG A 32  O PHE A 44  ? O PHE A 44  
A  5  6  N VAL A 43  ? N VAL A 43  O VAL A 73  ? O VAL A 73  
A  6  7  O GLY A 74  ? O GLY A 74  N ASN A 67  ? N ASN A 67  
A  7  8  N LEU A 68  ? N LEU A 68  O VAL E 22  ? O VAL E 16  
A  8  9  N GLY E 17  ? N GLY E 11  O VAL E 82  ? O VAL E 76  
A  9  10 O LEU E 83  ? O LEU E 77  N GLU E 44  ? N GLU E 38  
A  10 11 N ILE E 45  ? N ILE E 39  O LEU E 52  ? O LEU E 46  
A  11 12 N ALA E 57  ? N ALA E 51  O ARG E 66  ? O ARG E 60  
A  12 13 O THR E 67  ? O THR E 61  N VAL E 27  ? N VAL E 21  
A  13 14 O HIS E 30  ? O HIS E 24  N LYS E 18  ? N LYS E 12  
B  1  2  N VAL A 99  ? N VAL A 99  O SER A 129 ? O SER A 129 
C  1  2  N VAL A 110 ? N VAL A 110 O ILE A 233 ? O ILE A 233 
C  2  3  O ILE A 232 ? O ILE A 232 N TYR A 205 ? N TYR A 205 
C  3  4  N VAL A 206 ? N VAL A 206 O VAL A 269 ? O VAL A 269 
C  4  5  N ILE A 268 ? N ILE A 268 O THR A 324 ? O THR A 324 
C  5  6  O LEU A 323 ? O LEU A 323 N ALA A 312 ? N ALA A 312 
D  1  2  N VAL A 110 ? N VAL A 110 O ILE A 233 ? O ILE A 233 
D  2  3  O ILE A 232 ? O ILE A 232 N TYR A 205 ? N TYR A 205 
D  3  4  N VAL A 206 ? N VAL A 206 O VAL A 269 ? O VAL A 269 
D  4  5  N ILE A 268 ? N ILE A 268 O THR A 324 ? O THR A 324 
D  5  6  O PRO A 327 ? O PRO A 327 N ILE A 169 ? N ILE A 169 
D  6  7  N ILE A 170 ? N ILE A 170 O ILE A 352 ? O ILE A 352 
E  1  2  N VAL A 148 ? N VAL A 148 O ILE A 161 ? O ILE A 161 
F  1  2  O ILE B 75  ? O ILE B 75  N ALA B 41  ? N ALA B 41  
F  2  3  O PHE B 44  ? O PHE B 44  N ARG B 32  ? N ARG B 32  
F  3  4  N GLY B 31  ? N GLY B 31  O VAL B 90  ? O VAL B 90  
F  4  5  O ASN B 95  ? O ASN B 95  N LEU B 54  ? N LEU B 54  
F  5  6  N GLU B 53  ? N GLU B 53  O ALA B 65  ? O ALA B 65  
F  6  7  N LEU B 68  ? N LEU B 68  O VAL F 22  ? O VAL F 16  
F  7  8  N LYS F 18  ? N LYS F 12  O HIS F 30  ? O HIS F 24  
F  8  9  N VAL F 29  ? N VAL F 23  O VAL F 65  ? O VAL F 59  
F  9  10 O ILE F 68  ? O ILE F 62  N GLU F 55  ? N GLU F 49  
F  10 11 O HIS F 59  ? O HIS F 53  N VAL C 36  ? N VAL C 36  
F  11 12 N GLY C 31  ? N GLY C 31  O VAL C 90  ? O VAL C 90  
F  12 13 O ASN C 95  ? O ASN C 95  N LEU C 54  ? N LEU C 54  
F  13 14 N VAL C 55  ? N VAL C 55  O GLY C 63  ? O GLY C 63  
F  14 15 N LEU C 68  ? N LEU C 68  O VAL D 22  ? O VAL D 16  
F  15 16 N GLY D 17  ? N GLY D 11  O VAL D 82  ? O VAL D 76  
F  16 17 O LEU D 83  ? O LEU D 77  N GLU D 44  ? N GLU D 38  
F  17 18 N LEU D 43  ? N LEU D 37  O LEU D 54  ? O LEU D 48  
F  18 19 N ALA D 57  ? N ALA D 51  O ARG D 66  ? O ARG D 60  
F  19 20 O THR D 67  ? O THR D 61  N VAL D 27  ? N VAL D 21  
G  1  2  N LEU B 54  ? N LEU B 54  O ASN B 95  ? O ASN B 95  
G  2  3  O VAL B 90  ? O VAL B 90  N GLY B 31  ? N GLY B 31  
G  3  4  N ARG B 32  ? N ARG B 32  O PHE B 44  ? O PHE B 44  
G  4  5  N ALA B 41  ? N ALA B 41  O ILE B 75  ? O ILE B 75  
G  5  6  O GLY B 74  ? O GLY B 74  N ASN B 67  ? N ASN B 67  
G  6  7  N LEU B 68  ? N LEU B 68  O VAL F 22  ? O VAL F 16  
G  7  8  N GLY F 17  ? N GLY F 11  O VAL F 82  ? O VAL F 76  
G  8  9  O GLY F 87  ? O GLY F 81  N ALA F 42  ? N ALA F 36  
G  9  10 N LEU F 43  ? N LEU F 37  O LEU F 54  ? O LEU F 48  
G  10 11 O HIS F 59  ? O HIS F 53  N VAL C 36  ? N VAL C 36  
G  11 12 N LEU C 34  ? N LEU C 34  O ARG C 42  ? O ARG C 42  
G  12 13 N ALA C 41  ? N ALA C 41  O ILE C 75  ? O ILE C 75  
G  13 14 O VAL C 76  ? O VAL C 76  N MET C 64  ? N MET C 64  
G  14 15 N LEU C 68  ? N LEU C 68  O VAL D 22  ? O VAL D 16  
G  15 16 N THR D 20  ? N THR D 14  O ASP D 28  ? O ASP D 22  
G  16 17 N VAL D 27  ? N VAL D 21  O THR D 67  ? O THR D 61  
G  17 18 O ARG D 66  ? O ARG D 60  N ALA D 57  ? N ALA D 51  
G  18 19 O LEU D 54  ? O LEU D 48  N LEU D 43  ? N LEU D 37  
G  19 20 N GLU D 44  ? N GLU D 38  O LEU D 83  ? O LEU D 77  
H  1  2  N VAL B 99  ? N VAL B 99  O SER B 129 ? O SER B 129 
I  1  2  N VAL B 110 ? N VAL B 110 O ALA B 235 ? O ALA B 235 
I  2  3  O ILE B 232 ? O ILE B 232 N TYR B 205 ? N TYR B 205 
I  3  4  N VAL B 206 ? N VAL B 206 O VAL B 269 ? O VAL B 269 
I  4  5  N ILE B 268 ? N ILE B 268 O THR B 324 ? O THR B 324 
I  5  6  O LEU B 323 ? O LEU B 323 N ALA B 312 ? N ALA B 312 
J  1  2  N VAL B 110 ? N VAL B 110 O ALA B 235 ? O ALA B 235 
J  2  3  O ILE B 232 ? O ILE B 232 N TYR B 205 ? N TYR B 205 
J  3  4  N VAL B 206 ? N VAL B 206 O VAL B 269 ? O VAL B 269 
J  4  5  N ILE B 268 ? N ILE B 268 O THR B 324 ? O THR B 324 
J  5  6  O PRO B 327 ? O PRO B 327 N ILE B 169 ? N ILE B 169 
J  6  7  N LEU B 168 ? N LEU B 168 O ILE B 352 ? O ILE B 352 
J  7  8  N GLN B 351 ? N GLN B 351 O VAL B 373 ? O VAL B 373 
K  1  2  N VAL B 148 ? N VAL B 148 O ILE B 161 ? O ILE B 161 
L  1  2  N VAL C 99  ? N VAL C 99  O SER C 129 ? O SER C 129 
M  1  2  N VAL C 110 ? N VAL C 110 O ILE C 233 ? O ILE C 233 
M  2  3  O ALA C 236 ? O ALA C 236 N ALA C 207 ? N ALA C 207 
M  3  4  N TYR C 202 ? N TYR C 202 O LEU C 267 ? O LEU C 267 
M  4  5  N ILE C 268 ? N ILE C 268 O THR C 324 ? O THR C 324 
M  5  6  O PRO C 327 ? O PRO C 327 N ILE C 169 ? N ILE C 169 
M  6  7  N LEU C 168 ? N LEU C 168 O ILE C 352 ? O ILE C 352 
M  7  8  N GLN C 351 ? N GLN C 351 O VAL C 373 ? O VAL C 373 
N  1  2  N VAL D 91  ? N VAL D 85  O LYS D 121 ? O LYS D 115 
O  1  2  N ILE D 102 ? N ILE D 96  O PHE D 225 ? O PHE D 219 
O  2  3  O ALA D 222 ? O ALA D 216 N PHE D 190 ? N PHE D 184 
O  3  4  N THR D 191 ? N THR D 185 O PHE D 260 ? O PHE D 254 
O  4  5  N ILE D 261 ? N ILE D 255 O VAL D 313 ? O VAL D 307 
O  5  6  O VAL D 316 ? O VAL D 310 N LEU D 161 ? N LEU D 155 
O  6  7  N GLY D 160 ? N GLY D 154 O ALA D 337 ? O ALA D 331 
O  7  8  N THR D 338 ? N THR D 332 O LYS D 360 ? O LYS D 354 
P  1  2  N LEU D 140 ? N LEU D 134 O TYR D 153 ? O TYR D 147 
Q  1  2  N VAL E 91  ? N VAL E 85  O LYS E 121 ? O LYS E 115 
R  1  2  N ILE E 102 ? N ILE E 96  O PHE E 225 ? O PHE E 219 
R  2  3  O ALA E 222 ? O ALA E 216 N PHE E 190 ? N PHE E 184 
R  3  4  N THR E 191 ? N THR E 185 O PHE E 260 ? O PHE E 254 
R  4  5  N VAL E 257 ? N VAL E 251 O THR E 311 ? O THR E 305 
R  5  6  O GLN E 314 ? O GLN E 308 N ILE E 159 ? N ILE E 153 
R  6  7  N PHE E 162 ? N PHE E 156 O THR E 339 ? O THR E 333 
S  1  2  N LEU E 140 ? N LEU E 134 O TYR E 153 ? O TYR E 147 
T  1  2  N VAL F 91  ? N VAL F 85  O LYS F 121 ? O LYS F 115 
U  1  2  N ILE F 102 ? N ILE F 96  O PHE F 225 ? O PHE F 219 
U  2  3  O VAL F 224 ? O VAL F 218 N PHE F 190 ? N PHE F 184 
U  3  4  N VAL F 189 ? N VAL F 183 O PHE F 260 ? O PHE F 254 
U  4  5  N VAL F 257 ? N VAL F 251 O SER F 309 ? O SER F 303 
U  5  6  O VAL F 316 ? O VAL F 310 N LEU F 161 ? N LEU F 155 
U  6  7  N GLY F 160 ? N GLY F 154 O THR F 339 ? O THR F 333 
U  7  8  N THR F 338 ? N THR F 332 O LYS F 360 ? O LYS F 354 
V  1  2  N LEU F 140 ? N LEU F 134 O TYR F 153 ? O TYR F 147 
W  1  2  O GLU G 176 ? O GLU G 176 N ASP G 168 ? N ASP G 168 
W  2  3  O PHE G 165 ? O PHE G 165 N VAL G 75  ? N VAL G 75  
W  3  4  N ILE G 74  ? N ILE G 74  O VAL G 108 ? O VAL G 108 
W  4  5  N THR G 109 ? N THR G 109 O LEU G 128 ? O LEU G 128 
W  5  6  N SER G 129 ? N SER G 129 O THR I 45  ? O THR I 45  
W  6  7  N TYR I 44  ? N TYR I 44  O ILE I 59  ? O ILE I 59  
X  1  2  N GLN H 13  ? N GLN H 13  O VAL H 85  ? O VAL H 85  
X  2  3  O CYS H 84  ? O CYS H 84  N THR H 76  ? N THR H 76  
X  3  4  O ALA H 75  ? O ALA H 75  N GLU H 50  ? N GLU H 50  
Y  1  2  O ILE H 39  ? O ILE H 39  N LEU H 32  ? N LEU H 32  
Y  2  3  N GLN H 29  ? N GLN H 29  O MET H 60  ? O MET H 60  
Y  3  4  N VAL H 59  ? N VAL H 59  O LYS H 66  ? O LYS H 66  
Z  1  2  N GLY H 55  ? N GLY H 55  O ILE H 70  ? O ILE H 70  
AA 1  2  O LEU N 83  ? O LEU N 77  N GLU N 44  ? N GLU N 38  
AA 2  3  N LEU N 43  ? N LEU N 37  O LEU N 54  ? O LEU N 48  
AA 3  4  N ALA N 57  ? N ALA N 51  O ARG N 66  ? O ARG N 60  
AA 4  5  O VAL N 65  ? O VAL N 59  N VAL N 29  ? N VAL N 23  
AA 5  6  O ASP N 28  ? O ASP N 22  N THR N 20  ? N THR N 14  
AA 6  7  O VAL N 22  ? O VAL N 16  N LEU J 68  ? N LEU J 68  
AA 7  8  O ALA J 65  ? O ALA J 65  N GLU J 53  ? N GLU J 53  
AA 8  9  N LEU J 54  ? N LEU J 54  O ASN J 95  ? O ASN J 95  
AA 9  10 O VAL J 90  ? O VAL J 90  N GLY J 31  ? N GLY J 31  
AA 10 11 N VAL J 36  ? N VAL J 36  O HIS M 59  ? O HIS M 53  
AA 11 12 N GLU M 55  ? N GLU M 49  O ILE M 68  ? O ILE M 62  
AA 12 13 O VAL M 65  ? O VAL M 59  N VAL M 29  ? N VAL M 23  
AA 13 14 O ASP M 28  ? O ASP M 22  N THR M 20  ? N THR M 14  
AA 14 15 O VAL M 22  ? O VAL M 16  N LEU L 68  ? N LEU L 68  
AA 15 16 N MET L 64  ? N MET L 64  O VAL L 76  ? O VAL L 76  
AA 16 17 O ILE L 75  ? O ILE L 75  N ALA L 41  ? N ALA L 41  
AA 17 18 O PHE L 44  ? O PHE L 44  N ARG L 32  ? N ARG L 32  
AA 18 19 N GLY L 31  ? N GLY L 31  O VAL L 90  ? O VAL L 90  
AA 19 20 O LYS L 91  ? O LYS L 91  N GLU L 56  ? N GLU L 56  
AB 1  2  N VAL N 29  ? N VAL N 23  O VAL N 65  ? O VAL N 59  
AB 2  3  O ARG N 66  ? O ARG N 60  N ALA N 57  ? N ALA N 51  
AB 3  4  O LEU N 54  ? O LEU N 48  N LEU N 43  ? N LEU N 37  
AB 4  5  N GLU N 44  ? N GLU N 38  O LEU N 83  ? O LEU N 77  
AB 5  6  O VAL N 82  ? O VAL N 76  N GLY N 17  ? N GLY N 11  
AB 6  7  O VAL N 22  ? O VAL N 16  N LEU J 68  ? N LEU J 68  
AB 7  8  N ASN J 67  ? N ASN J 67  O GLY J 74  ? O GLY J 74  
AB 8  9  O VAL J 73  ? O VAL J 73  N VAL J 43  ? N VAL J 43  
AB 9  10 O ARG J 42  ? O ARG J 42  N ALA J 35  ? N ALA J 35  
AB 10 11 N VAL J 36  ? N VAL J 36  O HIS M 59  ? O HIS M 53  
AB 11 12 O LEU M 52  ? O LEU M 46  N ILE M 45  ? N ILE M 39  
AB 12 13 N GLU M 44  ? N GLU M 38  O LEU M 83  ? O LEU M 77  
AB 13 14 O VAL M 82  ? O VAL M 76  N GLY M 17  ? N GLY M 11  
AB 14 15 O VAL M 22  ? O VAL M 16  N LEU L 68  ? N LEU L 68  
AB 15 16 O GLY L 63  ? O GLY L 63  N VAL L 55  ? N VAL L 55  
AB 16 17 N GLU L 56  ? N GLU L 56  O LYS L 91  ? O LYS L 91  
AB 17 18 O VAL L 90  ? O VAL L 90  N GLY L 31  ? N GLY L 31  
AB 18 19 N ARG L 32  ? N ARG L 32  O PHE L 44  ? O PHE L 44  
AB 19 20 N ALA L 41  ? N ALA L 41  O ILE L 75  ? O ILE L 75  
AC 1  2  N VAL J 99  ? N VAL J 99  O SER J 129 ? O SER J 129 
AD 1  2  N VAL J 110 ? N VAL J 110 O ALA J 235 ? O ALA J 235 
AD 2  3  O ALA J 236 ? O ALA J 236 N ALA J 207 ? N ALA J 207 
AD 3  4  N VAL J 206 ? N VAL J 206 O VAL J 269 ? O VAL J 269 
AD 4  5  N ILE J 268 ? N ILE J 268 O LEU J 326 ? O LEU J 326 
AD 5  6  O PRO J 327 ? O PRO J 327 N ILE J 169 ? N ILE J 169 
AD 6  7  N LEU J 168 ? N LEU J 168 O ILE J 352 ? O ILE J 352 
AD 7  8  N GLN J 351 ? N GLN J 351 O VAL J 373 ? O VAL J 373 
AE 1  2  N VAL J 148 ? N VAL J 148 O ILE J 161 ? O ILE J 161 
AF 1  2  N GLY K 37  ? N GLY K 37  O ILE K 40  ? O ILE K 40  
AF 2  3  N ALA K 41  ? N ALA K 41  O ILE K 75  ? O ILE K 75  
AF 3  4  O GLN K 72  ? O GLN K 72  N GLU K 69  ? N GLU K 69  
AF 4  5  O ALA K 65  ? O ALA K 65  N GLU K 53  ? N GLU K 53  
AF 5  6  N GLU K 56  ? N GLU K 56  O LYS K 91  ? O LYS K 91  
AF 6  7  O VAL K 90  ? O VAL K 90  N GLY K 31  ? N GLY K 31  
AG 1  2  N VAL K 99  ? N VAL K 99  O SER K 129 ? O SER K 129 
AH 1  2  N VAL K 110 ? N VAL K 110 O ILE K 233 ? O ILE K 233 
AH 2  3  O VAL K 234 ? O VAL K 234 N ALA K 207 ? N ALA K 207 
AH 3  4  N VAL K 204 ? N VAL K 204 O LEU K 267 ? O LEU K 267 
AH 4  5  N ALA K 266 ? N ALA K 266 O SER K 322 ? O SER K 322 
AI 1  2  N VAL K 148 ? N VAL K 148 O ILE K 161 ? O ILE K 161 
AJ 1  2  O ILE K 329 ? O ILE K 329 N ILE K 169 ? N ILE K 169 
AJ 2  3  N LEU K 168 ? N LEU K 168 O ILE K 352 ? O ILE K 352 
AJ 3  4  N GLN K 351 ? N GLN K 351 O VAL K 373 ? O VAL K 373 
AK 1  2  N VAL L 99  ? N VAL L 99  O SER L 129 ? O SER L 129 
AL 1  2  N VAL L 110 ? N VAL L 110 O ALA L 235 ? O ALA L 235 
AL 2  3  O ILE L 232 ? O ILE L 232 N CYS L 203 ? N CYS L 203 
AL 3  4  N VAL L 206 ? N VAL L 206 O VAL L 269 ? O VAL L 269 
AL 4  5  N ILE L 268 ? N ILE L 268 O LEU L 326 ? O LEU L 326 
AL 5  6  O LEU L 323 ? O LEU L 323 N ALA L 312 ? N ALA L 312 
AM 1  2  N VAL L 110 ? N VAL L 110 O ALA L 235 ? O ALA L 235 
AM 2  3  O ILE L 232 ? O ILE L 232 N CYS L 203 ? N CYS L 203 
AM 3  4  N VAL L 206 ? N VAL L 206 O VAL L 269 ? O VAL L 269 
AM 4  5  N ILE L 268 ? N ILE L 268 O LEU L 326 ? O LEU L 326 
AM 5  6  O PRO L 327 ? O PRO L 327 N ILE L 169 ? N ILE L 169 
AM 6  7  N ILE L 170 ? N ILE L 170 O LEU L 354 ? O LEU L 354 
AM 7  8  N GLN L 351 ? N GLN L 351 O VAL L 373 ? O VAL L 373 
AN 1  2  N VAL L 148 ? N VAL L 148 O ILE L 161 ? O ILE L 161 
AO 1  2  N VAL M 91  ? N VAL M 85  O LYS M 121 ? O LYS M 115 
AP 1  2  N ILE M 102 ? N ILE M 96  O LEU M 223 ? O LEU M 217 
AP 2  3  O VAL M 224 ? O VAL M 218 N GLY M 192 ? N GLY M 186 
AP 3  4  N THR M 191 ? N THR M 185 O PHE M 260 ? O PHE M 254 
AP 4  5  N ILE M 261 ? N ILE M 255 O VAL M 313 ? O VAL M 307 
AP 5  6  O VAL M 316 ? O VAL M 310 N LEU M 161 ? N LEU M 155 
AP 6  7  N GLY M 160 ? N GLY M 154 O ALA M 337 ? O ALA M 331 
AP 7  8  N THR M 338 ? N THR M 332 O LYS M 360 ? O LYS M 354 
AQ 1  2  N LEU M 140 ? N LEU M 134 O TYR M 153 ? O TYR M 147 
AR 1  2  N VAL N 91  ? N VAL N 85  O LYS N 121 ? O LYS N 115 
AS 1  2  N ILE N 102 ? N ILE N 96  O LEU N 223 ? O LEU N 217 
AS 2  3  O GLY N 226 ? O GLY N 220 N GLY N 192 ? N GLY N 186 
AS 3  4  N VAL N 189 ? N VAL N 183 O PHE N 260 ? O PHE N 254 
AS 4  5  N VAL N 257 ? N VAL N 251 O THR N 311 ? O THR N 305 
AS 5  6  O GLN N 314 ? O GLN N 308 N LEU N 161 ? N LEU N 155 
AS 6  7  N PHE N 162 ? N PHE N 156 O THR N 339 ? O THR N 333 
AS 7  8  N THR N 338 ? N THR N 332 O LYS N 360 ? O LYS N 354 
AT 1  2  N LEU N 140 ? N LEU N 134 O TYR N 153 ? O TYR N 147 
AU 1  2  N THR O 20  ? N THR O 14  O ASP O 28  ? O ASP O 22  
AU 2  3  N VAL O 29  ? N VAL O 23  O VAL O 65  ? O VAL O 59  
AU 3  4  O ARG O 66  ? O ARG O 60  N ALA O 57  ? N ALA O 51  
AU 4  5  O LEU O 54  ? O LEU O 48  N LEU O 43  ? N LEU O 37  
AU 5  6  N GLU O 44  ? N GLU O 38  O LEU O 83  ? O LEU O 77  
AU 6  7  O VAL O 82  ? O VAL O 76  N GLY O 17  ? N GLY O 11  
AV 1  2  N VAL O 91  ? N VAL O 85  O LYS O 121 ? O LYS O 115 
AW 1  2  N ILE O 102 ? N ILE O 96  O LEU O 223 ? O LEU O 217 
AW 2  3  O GLY O 226 ? O GLY O 220 N GLY O 192 ? N GLY O 186 
AW 3  4  N THR O 191 ? N THR O 185 O PHE O 260 ? O PHE O 254 
AW 4  5  N ILE O 261 ? N ILE O 255 O ALA O 315 ? O ALA O 309 
AW 5  6  O VAL O 316 ? O VAL O 310 N LEU O 161 ? N LEU O 155 
AW 6  7  N GLY O 160 ? N GLY O 154 O ALA O 337 ? O ALA O 331 
AW 7  8  N THR O 338 ? N THR O 332 O LYS O 360 ? O LYS O 354 
AX 1  2  N LEU O 140 ? N LEU O 134 O TYR O 153 ? O TYR O 147 
AY 1  2  O LEU P 128 ? O LEU P 128 N THR P 109 ? N THR P 109 
AY 2  3  O ASP P 106 ? O ASP P 106 N ILE P 74  ? N ILE P 74  
AY 3  4  N LEU P 73  ? N LEU P 73  O SER P 163 ? O SER P 163 
AY 4  5  N ASP P 168 ? N ASP P 168 O GLU P 176 ? O GLU P 176 
AZ 1  2  N ALA Q 15  ? N ALA Q 15  O ALA Q 87  ? O ALA Q 87  
AZ 2  3  O THR Q 86  ? O THR Q 86  N PHE Q 74  ? N PHE Q 74  
AZ 3  4  O VAL Q 77  ? O VAL Q 77  N THR Q 48  ? N THR Q 48  
BA 1  2  N VAL Q 30  ? N VAL Q 30  O VAL Q 41  ? O VAL Q 41  
BB 1  2  O GLY W 87  ? O GLY W 81  N ALA W 42  ? N ALA W 36  
BB 2  3  N ILE W 45  ? N ILE W 39  O LEU W 52  ? O LEU W 46  
BB 3  4  N ALA W 57  ? N ALA W 51  O ARG W 66  ? O ARG W 60  
BB 4  5  O VAL W 65  ? O VAL W 59  N VAL W 29  ? N VAL W 23  
BB 5  6  O ASP W 28  ? O ASP W 22  N THR W 20  ? N THR W 14  
BB 6  7  O VAL W 22  ? O VAL W 16  N LEU S 68  ? N LEU S 68  
BB 7  8  O GLY S 63  ? O GLY S 63  N VAL S 55  ? N VAL S 55  
BB 8  9  N GLU S 56  ? N GLU S 56  O LYS S 91  ? O LYS S 91  
BB 9  10 O VAL S 90  ? O VAL S 90  N GLY S 31  ? N GLY S 31  
BB 10 11 N VAL S 36  ? N VAL S 36  O HIS V 59  ? O HIS V 53  
BB 11 12 O LEU V 52  ? O LEU V 46  N ILE V 45  ? N ILE V 39  
BB 12 13 N GLU V 44  ? N GLU V 38  O LEU V 83  ? O LEU V 77  
BB 13 14 O VAL V 82  ? O VAL V 76  N GLY V 17  ? N GLY V 11  
BB 14 15 N THR V 20  ? N THR V 14  O ASP V 28  ? O ASP V 22  
BB 15 16 N VAL V 27  ? N VAL V 21  O THR V 67  ? O THR V 61  
BC 1  2  O LYS S 91  ? O LYS S 91  N GLU S 56  ? N GLU S 56  
BC 2  3  N VAL S 55  ? N VAL S 55  O GLY S 63  ? O GLY S 63  
BC 3  4  N ASN S 67  ? N ASN S 67  O GLY S 74  ? O GLY S 74  
BC 4  5  O ILE S 75  ? O ILE S 75  N ALA S 41  ? N ALA S 41  
BC 5  6  O PHE S 44  ? O PHE S 44  N ARG S 32  ? N ARG S 32  
BC 6  7  N VAL S 36  ? N VAL S 36  O HIS V 59  ? O HIS V 53  
BC 7  8  N GLN V 58  ? N GLN V 52  O ARG V 66  ? O ARG V 60  
BC 8  9  O THR V 67  ? O THR V 61  N VAL V 27  ? N VAL V 21  
BC 9  10 O ASP V 28  ? O ASP V 22  N THR V 20  ? N THR V 14  
BC 10 11 N GLY V 17  ? N GLY V 11  O VAL V 82  ? O VAL V 76  
BC 11 12 O LEU V 83  ? O LEU V 77  N GLU V 44  ? N GLU V 38  
BD 1  2  N VAL S 99  ? N VAL S 99  O SER S 129 ? O SER S 129 
BE 1  2  N VAL S 110 ? N VAL S 110 O ILE S 233 ? O ILE S 233 
BE 2  3  O ALA S 236 ? O ALA S 236 N ALA S 207 ? N ALA S 207 
BE 3  4  N VAL S 208 ? N VAL S 208 O ASP S 271 ? O ASP S 271 
BE 4  5  N ILE S 268 ? N ILE S 268 O THR S 324 ? O THR S 324 
BF 1  2  N VAL S 148 ? N VAL S 148 O ILE S 161 ? O ILE S 161 
BG 1  2  O ILE S 329 ? O ILE S 329 N ILE S 169 ? N ILE S 169 
BG 2  3  N LEU S 168 ? N LEU S 168 O ILE S 352 ? O ILE S 352 
BG 3  4  N GLN S 351 ? N GLN S 351 O VAL S 373 ? O VAL S 373 
BH 1  2  N ARG T 32  ? N ARG T 32  O PHE T 44  ? O PHE T 44  
BH 2  3  N ALA T 41  ? N ALA T 41  O ILE T 75  ? O ILE T 75  
BH 3  4  O GLY T 74  ? O GLY T 74  N ASN T 67  ? N ASN T 67  
BH 4  5  N LEU T 68  ? N LEU T 68  O VAL X 22  ? O VAL X 16  
BH 6  7  N GLU T 56  ? N GLU T 56  O LYS T 91  ? O LYS T 91  
BI 1  2  N ARG T 32  ? N ARG T 32  O PHE T 44  ? O PHE T 44  
BI 2  3  N ALA T 41  ? N ALA T 41  O ILE T 75  ? O ILE T 75  
BI 3  4  O GLY T 74  ? O GLY T 74  N ASN T 67  ? N ASN T 67  
BI 5  6  O LEU X 83  ? O LEU X 77  N GLU X 44  ? N GLU X 38  
BI 6  7  N LEU X 43  ? N LEU X 37  O LEU X 54  ? O LEU X 48  
BI 7  8  N ALA X 57  ? N ALA X 51  O ARG X 66  ? O ARG X 60  
BI 8  9  O VAL X 65  ? O VAL X 59  N VAL X 29  ? N VAL X 23  
BI 9  10 O ILE X 26  ? O ILE X 20  N ILE X 23  ? N ILE X 17  
BI 11 12 N GLU T 56  ? N GLU T 56  O LYS T 91  ? O LYS T 91  
BJ 1  2  N VAL T 99  ? N VAL T 99  O SER T 129 ? O SER T 129 
BK 1  2  N VAL T 110 ? N VAL T 110 O ILE T 233 ? O ILE T 233 
BK 2  3  O ILE T 232 ? O ILE T 232 N CYS T 203 ? N CYS T 203 
BK 3  4  N VAL T 204 ? N VAL T 204 O LEU T 267 ? O LEU T 267 
BK 4  5  N TYR T 270 ? N TYR T 270 O VAL T 328 ? O VAL T 328 
BK 5  6  O PRO T 327 ? O PRO T 327 N ILE T 169 ? N ILE T 169 
BK 6  7  N LEU T 168 ? N LEU T 168 O ILE T 352 ? O ILE T 352 
BK 7  8  N GLN T 351 ? N GLN T 351 O VAL T 373 ? O VAL T 373 
BL 1  2  N LEU U 34  ? N LEU U 34  O ARG U 42  ? O ARG U 42  
BL 2  3  N VAL U 43  ? N VAL U 43  O VAL U 73  ? O VAL U 73  
BL 3  4  O GLY U 74  ? O GLY U 74  N ASN U 67  ? N ASN U 67  
BL 4  5  O GLY U 63  ? O GLY U 63  N VAL U 55  ? N VAL U 55  
BL 5  6  N GLU U 56  ? N GLU U 56  O LYS U 91  ? O LYS U 91  
BL 6  7  O VAL U 90  ? O VAL U 90  N GLY U 31  ? N GLY U 31  
BM 1  2  N VAL U 101 ? N VAL U 101 O GLY U 127 ? O GLY U 127 
BN 1  2  N VAL U 110 ? N VAL U 110 O ILE U 233 ? O ILE U 233 
BN 2  3  O ILE U 232 ? O ILE U 232 N TYR U 205 ? N TYR U 205 
BN 3  4  N VAL U 204 ? N VAL U 204 O LEU U 267 ? O LEU U 267 
BN 4  5  N ILE U 268 ? N ILE U 268 O THR U 324 ? O THR U 324 
BN 5  6  O PRO U 327 ? O PRO U 327 N ILE U 169 ? N ILE U 169 
BN 6  7  N LEU U 168 ? N LEU U 168 O GLY U 350 ? O GLY U 350 
BN 7  8  N GLN U 351 ? N GLN U 351 O VAL U 373 ? O VAL U 373 
BO 1  2  N VAL V 91  ? N VAL V 85  O LYS V 121 ? O LYS V 115 
BP 1  2  N ILE V 102 ? N ILE V 96  O LEU V 223 ? O LEU V 217 
BP 2  3  O VAL V 224 ? O VAL V 218 N GLY V 192 ? N GLY V 186 
BP 3  4  N THR V 191 ? N THR V 185 O PHE V 260 ? O PHE V 254 
BP 4  5  N ILE V 261 ? N ILE V 255 O ALA V 315 ? O ALA V 309 
BP 5  6  O GLN V 314 ? O GLN V 308 N LEU V 161 ? N LEU V 155 
BP 6  7  N PHE V 162 ? N PHE V 156 O LEU V 341 ? O LEU V 335 
BP 7  8  N THR V 338 ? N THR V 332 O LYS V 360 ? O LYS V 354 
BQ 1  2  N LEU V 140 ? N LEU V 134 O TYR V 153 ? O TYR V 147 
BR 1  2  N VAL W 91  ? N VAL W 85  O LYS W 121 ? O LYS W 115 
BS 1  2  N ILE W 102 ? N ILE W 96  O PHE W 225 ? O PHE W 219 
BS 2  3  O GLY W 226 ? O GLY W 220 N GLY W 192 ? N GLY W 186 
BS 3  4  N THR W 191 ? N THR W 185 O PHE W 260 ? O PHE W 254 
BS 4  5  N VAL W 257 ? N VAL W 251 O SER W 309 ? O SER W 303 
BS 5  6  O GLN W 314 ? O GLN W 308 N ILE W 159 ? N ILE W 153 
BS 6  7  N GLY W 160 ? N GLY W 154 O THR W 339 ? O THR W 333 
BT 1  2  N LEU W 140 ? N LEU W 134 O TYR W 153 ? O TYR W 147 
BU 1  2  N VAL X 91  ? N VAL X 85  O LYS X 121 ? O LYS X 115 
BV 1  2  N ILE X 102 ? N ILE X 96  O LEU X 223 ? O LEU X 217 
BV 2  3  O GLY X 226 ? O GLY X 220 N GLY X 192 ? N GLY X 186 
BV 3  4  N VAL X 189 ? N VAL X 183 O PHE X 260 ? O PHE X 254 
BV 4  5  N ILE X 261 ? N ILE X 255 O ALA X 315 ? O ALA X 309 
BV 5  6  O SER X 312 ? O SER X 306 N ILE X 159 ? N ILE X 153 
BV 6  7  N GLY X 160 ? N GLY X 154 O ALA X 337 ? O ALA X 331 
BV 7  8  N THR X 338 ? N THR X 332 O LYS X 360 ? O LYS X 354 
BW 1  2  N ASP Y 168 ? N ASP Y 168 O GLU Y 176 ? O GLU Y 176 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP A 600' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 700'  
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP B 600' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 700'  
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP C 600' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 700'  
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP D 600' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG D 700'  
AC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP F 600' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG F 700'  
BC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP J 600' 
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG J 700'  
BC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP K 600' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG K 700'  
BC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP L 600' 
BC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG L 700'  
BC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP M 600' 
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG M 700'  
CC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ANP O 600' 
CC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG O 700'  
CC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP S 600' 
CC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG S 700'  
CC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP T 600' 
CC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG T 700'  
CC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANP U 600' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG U 700'  
CC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ANP V 600' 
DC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG V 700'  
DC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ANP X 600' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG X 700'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 ARG A  173 ? ARG A 173 . ? 1_555 ? 
2   AC1 12 GLN A  174 ? GLN A 174 . ? 1_555 ? 
3   AC1 12 THR A  175 ? THR A 175 . ? 1_555 ? 
4   AC1 12 GLY A  176 ? GLY A 176 . ? 1_555 ? 
5   AC1 12 LYS A  177 ? LYS A 177 . ? 1_555 ? 
6   AC1 12 THR A  178 ? THR A 178 . ? 1_555 ? 
7   AC1 12 ALA A  179 ? ALA A 179 . ? 1_555 ? 
8   AC1 12 PHE A  359 ? PHE A 359 . ? 1_555 ? 
9   AC1 12 ARG A  364 ? ARG A 364 . ? 1_555 ? 
10  AC1 12 GLN A  432 ? GLN A 432 . ? 1_555 ? 
11  AC1 12 GLN A  434 ? GLN A 434 . ? 1_555 ? 
12  AC1 12 MG  CA .   ? MG  A 700 . ? 1_555 ? 
13  AC2 2  THR A  178 ? THR A 178 . ? 1_555 ? 
14  AC2 2  ANP BA .   ? ANP A 600 . ? 1_555 ? 
15  AC3 11 GLN B  174 ? GLN B 174 . ? 1_555 ? 
16  AC3 11 THR B  175 ? THR B 175 . ? 1_555 ? 
17  AC3 11 GLY B  176 ? GLY B 176 . ? 1_555 ? 
18  AC3 11 LYS B  177 ? LYS B 177 . ? 1_555 ? 
19  AC3 11 THR B  178 ? THR B 178 . ? 1_555 ? 
20  AC3 11 ALA B  179 ? ALA B 179 . ? 1_555 ? 
21  AC3 11 PHE B  359 ? PHE B 359 . ? 1_555 ? 
22  AC3 11 ARG B  364 ? ARG B 364 . ? 1_555 ? 
23  AC3 11 GLN B  432 ? GLN B 432 . ? 1_555 ? 
24  AC3 11 GLN B  434 ? GLN B 434 . ? 1_555 ? 
25  AC3 11 MG  EA .   ? MG  B 700 . ? 1_555 ? 
26  AC4 2  THR B  178 ? THR B 178 . ? 1_555 ? 
27  AC4 2  ANP DA .   ? ANP B 600 . ? 1_555 ? 
28  AC5 13 ARG C  173 ? ARG C 173 . ? 1_555 ? 
29  AC5 13 GLN C  174 ? GLN C 174 . ? 1_555 ? 
30  AC5 13 THR C  175 ? THR C 175 . ? 1_555 ? 
31  AC5 13 GLY C  176 ? GLY C 176 . ? 1_555 ? 
32  AC5 13 LYS C  177 ? LYS C 177 . ? 1_555 ? 
33  AC5 13 THR C  178 ? THR C 178 . ? 1_555 ? 
34  AC5 13 ALA C  179 ? ALA C 179 . ? 1_555 ? 
35  AC5 13 PHE C  359 ? PHE C 359 . ? 1_555 ? 
36  AC5 13 ARG C  364 ? ARG C 364 . ? 1_555 ? 
37  AC5 13 GLN C  432 ? GLN C 432 . ? 1_555 ? 
38  AC5 13 GLN C  434 ? GLN C 434 . ? 1_555 ? 
39  AC5 13 MG  GA .   ? MG  C 700 . ? 1_555 ? 
40  AC5 13 TYR F  374 ? TYR F 368 . ? 1_555 ? 
41  AC6 2  THR C  178 ? THR C 178 . ? 1_555 ? 
42  AC6 2  ANP FA .   ? ANP C 600 . ? 1_555 ? 
43  AC7 13 ARG C  375 ? ARG C 375 . ? 1_555 ? 
44  AC7 13 ALA D  165 ? ALA D 159 . ? 1_555 ? 
45  AC7 13 GLY D  166 ? GLY D 160 . ? 1_555 ? 
46  AC7 13 VAL D  167 ? VAL D 161 . ? 1_555 ? 
47  AC7 13 GLY D  168 ? GLY D 162 . ? 1_555 ? 
48  AC7 13 LYS D  169 ? LYS D 163 . ? 1_555 ? 
49  AC7 13 THR D  170 ? THR D 164 . ? 1_555 ? 
50  AC7 13 VAL D  171 ? VAL D 165 . ? 1_555 ? 
51  AC7 13 ARG D  196 ? ARG D 190 . ? 1_555 ? 
52  AC7 13 TYR D  351 ? TYR D 345 . ? 1_555 ? 
53  AC7 13 PHE D  424 ? PHE D 418 . ? 1_555 ? 
54  AC7 13 ALA D  427 ? ALA D 421 . ? 1_555 ? 
55  AC7 13 MG  IA .   ? MG  D 700 . ? 1_555 ? 
56  AC8 4  THR D  170 ? THR D 164 . ? 1_555 ? 
57  AC8 4  ARG D  196 ? ARG D 190 . ? 1_555 ? 
58  AC8 4  GLU D  199 ? GLU D 193 . ? 1_555 ? 
59  AC8 4  ANP HA .   ? ANP D 600 . ? 1_555 ? 
60  AC9 18 ILE B  345 ? ILE B 345 . ? 1_555 ? 
61  AC9 18 SER B  346 ? SER B 346 . ? 1_555 ? 
62  AC9 18 ARG B  375 ? ARG B 375 . ? 1_555 ? 
63  AC9 18 GLY F  164 ? GLY F 158 . ? 1_555 ? 
64  AC9 18 ALA F  165 ? ALA F 159 . ? 1_555 ? 
65  AC9 18 GLY F  166 ? GLY F 160 . ? 1_555 ? 
66  AC9 18 VAL F  167 ? VAL F 161 . ? 1_555 ? 
67  AC9 18 GLY F  168 ? GLY F 162 . ? 1_555 ? 
68  AC9 18 LYS F  169 ? LYS F 163 . ? 1_555 ? 
69  AC9 18 THR F  170 ? THR F 164 . ? 1_555 ? 
70  AC9 18 VAL F  171 ? VAL F 165 . ? 1_555 ? 
71  AC9 18 GLU F  195 ? GLU F 189 . ? 1_555 ? 
72  AC9 18 ARG F  196 ? ARG F 190 . ? 1_555 ? 
73  AC9 18 TYR F  351 ? TYR F 345 . ? 1_555 ? 
74  AC9 18 PHE F  424 ? PHE F 418 . ? 1_555 ? 
75  AC9 18 ALA F  427 ? ALA F 421 . ? 1_555 ? 
76  AC9 18 PHE F  430 ? PHE F 424 . ? 1_555 ? 
77  AC9 18 MG  KA .   ? MG  F 700 . ? 1_555 ? 
78  BC1 4  THR F  170 ? THR F 164 . ? 1_555 ? 
79  BC1 4  ARG F  196 ? ARG F 190 . ? 1_555 ? 
80  BC1 4  GLU F  199 ? GLU F 193 . ? 1_555 ? 
81  BC1 4  ANP JA .   ? ANP F 600 . ? 1_555 ? 
82  BC2 13 ARG J  173 ? ARG J 173 . ? 1_555 ? 
83  BC2 13 GLN J  174 ? GLN J 174 . ? 1_555 ? 
84  BC2 13 THR J  175 ? THR J 175 . ? 1_555 ? 
85  BC2 13 GLY J  176 ? GLY J 176 . ? 1_555 ? 
86  BC2 13 LYS J  177 ? LYS J 177 . ? 1_555 ? 
87  BC2 13 THR J  178 ? THR J 178 . ? 1_555 ? 
88  BC2 13 ALA J  179 ? ALA J 179 . ? 1_555 ? 
89  BC2 13 PHE J  359 ? PHE J 359 . ? 1_555 ? 
90  BC2 13 ARG J  364 ? ARG J 364 . ? 1_555 ? 
91  BC2 13 PRO J  365 ? PRO J 365 . ? 1_555 ? 
92  BC2 13 GLN J  432 ? GLN J 432 . ? 1_555 ? 
93  BC2 13 GLN J  434 ? GLN J 434 . ? 1_555 ? 
94  BC2 13 MG  MA .   ? MG  J 700 . ? 1_555 ? 
95  BC3 3  THR J  178 ? THR J 178 . ? 1_555 ? 
96  BC3 3  ASP J  271 ? ASP J 271 . ? 1_555 ? 
97  BC3 3  ANP LA .   ? ANP J 600 . ? 1_555 ? 
98  BC4 12 GLN K  174 ? GLN K 174 . ? 1_555 ? 
99  BC4 12 THR K  175 ? THR K 175 . ? 1_555 ? 
100 BC4 12 GLY K  176 ? GLY K 176 . ? 1_555 ? 
101 BC4 12 LYS K  177 ? LYS K 177 . ? 1_555 ? 
102 BC4 12 THR K  178 ? THR K 178 . ? 1_555 ? 
103 BC4 12 ALA K  179 ? ALA K 179 . ? 1_555 ? 
104 BC4 12 PHE K  359 ? PHE K 359 . ? 1_555 ? 
105 BC4 12 ARG K  364 ? ARG K 364 . ? 1_555 ? 
106 BC4 12 PRO K  365 ? PRO K 365 . ? 1_555 ? 
107 BC4 12 GLN K  432 ? GLN K 432 . ? 1_555 ? 
108 BC4 12 GLN K  434 ? GLN K 434 . ? 1_555 ? 
109 BC4 12 MG  OA .   ? MG  K 700 . ? 1_555 ? 
110 BC5 3  THR K  178 ? THR K 178 . ? 1_555 ? 
111 BC5 3  ASP K  271 ? ASP K 271 . ? 1_555 ? 
112 BC5 3  ANP NA .   ? ANP K 600 . ? 1_555 ? 
113 BC6 13 ASP L  172 ? ASP L 172 . ? 1_555 ? 
114 BC6 13 ARG L  173 ? ARG L 173 . ? 1_555 ? 
115 BC6 13 GLN L  174 ? GLN L 174 . ? 1_555 ? 
116 BC6 13 THR L  175 ? THR L 175 . ? 1_555 ? 
117 BC6 13 GLY L  176 ? GLY L 176 . ? 1_555 ? 
118 BC6 13 LYS L  177 ? LYS L 177 . ? 1_555 ? 
119 BC6 13 THR L  178 ? THR L 178 . ? 1_555 ? 
120 BC6 13 ALA L  179 ? ALA L 179 . ? 1_555 ? 
121 BC6 13 PHE L  359 ? PHE L 359 . ? 1_555 ? 
122 BC6 13 GLN L  432 ? GLN L 432 . ? 1_555 ? 
123 BC6 13 GLN L  434 ? GLN L 434 . ? 1_555 ? 
124 BC6 13 MG  QA .   ? MG  L 700 . ? 1_555 ? 
125 BC6 13 TYR O  374 ? TYR O 368 . ? 1_555 ? 
126 BC7 2  THR L  178 ? THR L 178 . ? 1_555 ? 
127 BC7 2  ANP PA .   ? ANP L 600 . ? 1_555 ? 
128 BC8 18 SER L  374 ? SER L 374 . ? 1_555 ? 
129 BC8 18 ARG L  375 ? ARG L 375 . ? 1_555 ? 
130 BC8 18 ALA M  165 ? ALA M 159 . ? 1_555 ? 
131 BC8 18 GLY M  166 ? GLY M 160 . ? 1_555 ? 
132 BC8 18 VAL M  167 ? VAL M 161 . ? 1_555 ? 
133 BC8 18 GLY M  168 ? GLY M 162 . ? 1_555 ? 
134 BC8 18 LYS M  169 ? LYS M 163 . ? 1_555 ? 
135 BC8 18 THR M  170 ? THR M 164 . ? 1_555 ? 
136 BC8 18 VAL M  171 ? VAL M 165 . ? 1_555 ? 
137 BC8 18 GLU M  195 ? GLU M 189 . ? 1_555 ? 
138 BC8 18 ARG M  196 ? ARG M 190 . ? 1_555 ? 
139 BC8 18 TYR M  317 ? TYR M 311 . ? 1_555 ? 
140 BC8 18 TYR M  351 ? TYR M 345 . ? 1_555 ? 
141 BC8 18 PHE M  424 ? PHE M 418 . ? 1_555 ? 
142 BC8 18 ALA M  427 ? ALA M 421 . ? 1_555 ? 
143 BC8 18 PHE M  430 ? PHE M 424 . ? 1_555 ? 
144 BC8 18 THR M  431 ? THR M 425 . ? 1_555 ? 
145 BC8 18 MG  SA .   ? MG  M 700 . ? 1_555 ? 
146 BC9 4  THR M  170 ? THR M 164 . ? 1_555 ? 
147 BC9 4  GLU M  195 ? GLU M 189 . ? 1_555 ? 
148 BC9 4  ASP M  262 ? ASP M 256 . ? 1_555 ? 
149 BC9 4  ANP RA .   ? ANP M 600 . ? 1_555 ? 
150 CC1 16 ILE K  345 ? ILE K 345 . ? 1_555 ? 
151 CC1 16 SER K  346 ? SER K 346 . ? 1_555 ? 
152 CC1 16 VAL K  373 ? VAL K 373 . ? 1_555 ? 
153 CC1 16 ARG K  375 ? ARG K 375 . ? 1_555 ? 
154 CC1 16 ALA O  165 ? ALA O 159 . ? 1_555 ? 
155 CC1 16 GLY O  166 ? GLY O 160 . ? 1_555 ? 
156 CC1 16 GLY O  168 ? GLY O 162 . ? 1_555 ? 
157 CC1 16 LYS O  169 ? LYS O 163 . ? 1_555 ? 
158 CC1 16 THR O  170 ? THR O 164 . ? 1_555 ? 
159 CC1 16 VAL O  171 ? VAL O 165 . ? 1_555 ? 
160 CC1 16 ARG O  196 ? ARG O 190 . ? 1_555 ? 
161 CC1 16 TYR O  351 ? TYR O 345 . ? 1_555 ? 
162 CC1 16 PHE O  424 ? PHE O 418 . ? 1_555 ? 
163 CC1 16 ALA O  427 ? ALA O 421 . ? 1_555 ? 
164 CC1 16 PHE O  430 ? PHE O 424 . ? 1_555 ? 
165 CC1 16 MG  UA .   ? MG  O 700 . ? 1_555 ? 
166 CC2 3  THR O  170 ? THR O 164 . ? 1_555 ? 
167 CC2 3  GLU O  195 ? GLU O 189 . ? 1_555 ? 
168 CC2 3  ANP TA .   ? ANP O 600 . ? 1_555 ? 
169 CC3 13 ARG S  173 ? ARG S 173 . ? 1_555 ? 
170 CC3 13 GLN S  174 ? GLN S 174 . ? 1_555 ? 
171 CC3 13 GLY S  176 ? GLY S 176 . ? 1_555 ? 
172 CC3 13 LYS S  177 ? LYS S 177 . ? 1_555 ? 
173 CC3 13 THR S  178 ? THR S 178 . ? 1_555 ? 
174 CC3 13 ALA S  179 ? ALA S 179 . ? 1_555 ? 
175 CC3 13 PHE S  359 ? PHE S 359 . ? 1_555 ? 
176 CC3 13 ARG S  364 ? ARG S 364 . ? 1_555 ? 
177 CC3 13 PRO S  365 ? PRO S 365 . ? 1_555 ? 
178 CC3 13 GLN S  432 ? GLN S 432 . ? 1_555 ? 
179 CC3 13 GLN S  434 ? GLN S 434 . ? 1_555 ? 
180 CC3 13 MG  WA .   ? MG  S 700 . ? 1_555 ? 
181 CC3 13 TYR V  374 ? TYR V 368 . ? 1_555 ? 
182 CC4 2  THR S  178 ? THR S 178 . ? 1_555 ? 
183 CC4 2  ANP VA .   ? ANP S 600 . ? 1_555 ? 
184 CC5 13 GLN T  174 ? GLN T 174 . ? 1_555 ? 
185 CC5 13 THR T  175 ? THR T 175 . ? 1_555 ? 
186 CC5 13 GLY T  176 ? GLY T 176 . ? 1_555 ? 
187 CC5 13 LYS T  177 ? LYS T 177 . ? 1_555 ? 
188 CC5 13 THR T  178 ? THR T 178 . ? 1_555 ? 
189 CC5 13 ALA T  179 ? ALA T 179 . ? 1_555 ? 
190 CC5 13 GLU T  330 ? GLU T 330 . ? 1_555 ? 
191 CC5 13 PHE T  359 ? PHE T 359 . ? 1_555 ? 
192 CC5 13 ARG T  364 ? ARG T 364 . ? 1_555 ? 
193 CC5 13 GLN T  432 ? GLN T 432 . ? 1_555 ? 
194 CC5 13 GLN T  434 ? GLN T 434 . ? 1_555 ? 
195 CC5 13 MG  YA .   ? MG  T 700 . ? 1_555 ? 
196 CC5 13 ASP W  365 ? ASP W 359 . ? 1_555 ? 
197 CC6 3  THR T  178 ? THR T 178 . ? 1_555 ? 
198 CC6 3  ASP T  271 ? ASP T 271 . ? 1_555 ? 
199 CC6 3  ANP XA .   ? ANP T 600 . ? 1_555 ? 
200 CC7 14 ARG U  173 ? ARG U 173 . ? 1_555 ? 
201 CC7 14 GLN U  174 ? GLN U 174 . ? 1_555 ? 
202 CC7 14 THR U  175 ? THR U 175 . ? 1_555 ? 
203 CC7 14 GLY U  176 ? GLY U 176 . ? 1_555 ? 
204 CC7 14 LYS U  177 ? LYS U 177 . ? 1_555 ? 
205 CC7 14 THR U  178 ? THR U 178 . ? 1_555 ? 
206 CC7 14 ALA U  179 ? ALA U 179 . ? 1_555 ? 
207 CC7 14 PHE U  359 ? PHE U 359 . ? 1_555 ? 
208 CC7 14 ARG U  364 ? ARG U 364 . ? 1_555 ? 
209 CC7 14 PRO U  365 ? PRO U 365 . ? 1_555 ? 
210 CC7 14 GLN U  432 ? GLN U 432 . ? 1_555 ? 
211 CC7 14 GLN U  434 ? GLN U 434 . ? 1_555 ? 
212 CC7 14 MG  AB .   ? MG  U 700 . ? 1_555 ? 
213 CC7 14 TYR X  374 ? TYR X 368 . ? 1_555 ? 
214 CC8 3  THR U  178 ? THR U 178 . ? 1_555 ? 
215 CC8 3  ASP U  271 ? ASP U 271 . ? 1_555 ? 
216 CC8 3  ANP ZA .   ? ANP U 600 . ? 1_555 ? 
217 CC9 10 ARG U  375 ? ARG U 375 . ? 1_555 ? 
218 CC9 10 GLY V  166 ? GLY V 160 . ? 1_555 ? 
219 CC9 10 GLY V  168 ? GLY V 162 . ? 1_555 ? 
220 CC9 10 LYS V  169 ? LYS V 163 . ? 1_555 ? 
221 CC9 10 THR V  170 ? THR V 164 . ? 1_555 ? 
222 CC9 10 VAL V  171 ? VAL V 165 . ? 1_555 ? 
223 CC9 10 ARG V  196 ? ARG V 190 . ? 1_555 ? 
224 CC9 10 TYR V  351 ? TYR V 345 . ? 1_555 ? 
225 CC9 10 ALA V  427 ? ALA V 421 . ? 1_555 ? 
226 CC9 10 MG  CB .   ? MG  V 700 . ? 1_555 ? 
227 DC1 3  THR V  170 ? THR V 164 . ? 1_555 ? 
228 DC1 3  ASP V  262 ? ASP V 256 . ? 1_555 ? 
229 DC1 3  ANP BB .   ? ANP V 600 . ? 1_555 ? 
230 DC2 17 ILE T  345 ? ILE T 345 . ? 1_555 ? 
231 DC2 17 SER T  346 ? SER T 346 . ? 1_555 ? 
232 DC2 17 VAL T  373 ? VAL T 373 . ? 1_555 ? 
233 DC2 17 ARG T  375 ? ARG T 375 . ? 1_555 ? 
234 DC2 17 GLY X  166 ? GLY X 160 . ? 1_555 ? 
235 DC2 17 VAL X  167 ? VAL X 161 . ? 1_555 ? 
236 DC2 17 GLY X  168 ? GLY X 162 . ? 1_555 ? 
237 DC2 17 LYS X  169 ? LYS X 163 . ? 1_555 ? 
238 DC2 17 THR X  170 ? THR X 164 . ? 1_555 ? 
239 DC2 17 VAL X  171 ? VAL X 165 . ? 1_555 ? 
240 DC2 17 GLU X  195 ? GLU X 189 . ? 1_555 ? 
241 DC2 17 ARG X  196 ? ARG X 190 . ? 1_555 ? 
242 DC2 17 TYR X  351 ? TYR X 345 . ? 1_555 ? 
243 DC2 17 PHE X  424 ? PHE X 418 . ? 1_555 ? 
244 DC2 17 ALA X  427 ? ALA X 421 . ? 1_555 ? 
245 DC2 17 PHE X  430 ? PHE X 424 . ? 1_555 ? 
246 DC2 17 MG  EB .   ? MG  X 700 . ? 1_555 ? 
247 DC3 3  THR X  170 ? THR X 164 . ? 1_555 ? 
248 DC3 3  GLU X  195 ? GLU X 189 . ? 1_555 ? 
249 DC3 3  ANP DB .   ? ANP X 600 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OEH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OEH 
_atom_sites.fract_transf_matrix[1][1]   0.009015 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001901 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003426 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005414 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1 26  ? 29.048  -3.647   94.582  1.00 108.85 ? 26  ASN A N     1 
ATOM   2     C  CA    . ASN A  1 26  ? 27.666  -4.210   94.562  1.00 106.87 ? 26  ASN A CA    1 
ATOM   3     C  C     . ASN A  1 26  ? 27.409  -5.071   93.309  1.00 101.68 ? 26  ASN A C     1 
ATOM   4     O  O     . ASN A  1 26  ? 27.457  -6.305   93.382  1.00 102.75 ? 26  ASN A O     1 
ATOM   5     C  CB    . ASN A  1 26  ? 26.637  -3.082   94.692  1.00 106.01 ? 26  ASN A CB    1 
ATOM   6     C  CG    . ASN A  1 26  ? 25.236  -3.595   94.985  1.00 106.55 ? 26  ASN A CG    1 
ATOM   7     O  OD1   . ASN A  1 26  ? 24.703  -4.433   94.256  1.00 104.04 ? 26  ASN A OD1   1 
ATOM   8     N  ND2   . ASN A  1 26  ? 24.629  -3.086   96.057  1.00 111.03 ? 26  ASN A ND2   1 
ATOM   9     N  N     . LEU A  1 27  ? 27.116  -4.407   92.187  1.00 96.34  ? 27  LEU A N     1 
ATOM   10    C  CA    . LEU A  1 27  ? 27.107  -4.995   90.831  1.00 91.32  ? 27  LEU A CA    1 
ATOM   11    C  C     . LEU A  1 27  ? 25.912  -5.829   90.392  1.00 88.59  ? 27  LEU A C     1 
ATOM   12    O  O     . LEU A  1 27  ? 25.654  -5.943   89.193  1.00 84.88  ? 27  LEU A O     1 
ATOM   13    C  CB    . LEU A  1 27  ? 28.425  -5.699   90.483  1.00 92.27  ? 27  LEU A CB    1 
ATOM   14    C  CG    . LEU A  1 27  ? 29.582  -4.794   90.038  1.00 92.43  ? 27  LEU A CG    1 
ATOM   15    C  CD1   . LEU A  1 27  ? 30.565  -5.575   89.164  1.00 92.37  ? 27  LEU A CD1   1 
ATOM   16    C  CD2   . LEU A  1 27  ? 29.109  -3.534   89.307  1.00 88.29  ? 27  LEU A CD2   1 
ATOM   17    N  N     . ASN A  1 28  ? 25.200  -6.440   91.329  1.00 90.75  ? 28  ASN A N     1 
ATOM   18    C  CA    . ASN A  1 28  ? 23.998  -7.180   90.962  1.00 88.51  ? 28  ASN A CA    1 
ATOM   19    C  C     . ASN A  1 28  ? 22.827  -6.243   90.773  1.00 86.36  ? 28  ASN A C     1 
ATOM   20    O  O     . ASN A  1 28  ? 22.023  -6.405   89.864  1.00 83.16  ? 28  ASN A O     1 
ATOM   21    C  CB    . ASN A  1 28  ? 23.655  -8.228   92.011  1.00 92.30  ? 28  ASN A CB    1 
ATOM   22    C  CG    . ASN A  1 28  ? 24.478  -9.481   91.866  1.00 93.64  ? 28  ASN A CG    1 
ATOM   23    O  OD1   . ASN A  1 28  ? 25.012  -9.768   90.795  1.00 91.47  ? 28  ASN A OD1   1 
ATOM   24    N  ND2   . ASN A  1 28  ? 24.583  -10.244  92.946  1.00 97.90  ? 28  ASN A ND2   1 
ATOM   25    N  N     . GLU A  1 29  ? 22.752  -5.250   91.643  1.00 88.67  ? 29  GLU A N     1 
ATOM   26    C  CA    . GLU A  1 29  ? 21.658  -4.311   91.639  1.00 87.63  ? 29  GLU A CA    1 
ATOM   27    C  C     . GLU A  1 29  ? 22.124  -2.992   91.043  1.00 85.51  ? 29  GLU A C     1 
ATOM   28    O  O     . GLU A  1 29  ? 21.314  -2.116   90.748  1.00 84.40  ? 29  GLU A O     1 
ATOM   29    C  CB    . GLU A  1 29  ? 21.143  -4.111   93.064  1.00 92.47  ? 29  GLU A CB    1 
ATOM   30    C  CG    . GLU A  1 29  ? 20.893  -5.413   93.832  1.00 95.90  ? 29  GLU A CG    1 
ATOM   31    C  CD    . GLU A  1 29  ? 19.779  -6.252   93.234  1.00 94.46  ? 29  GLU A CD    1 
ATOM   32    O  OE1   . GLU A  1 29  ? 18.685  -5.695   92.989  1.00 94.64  ? 29  GLU A OE1   1 
ATOM   33    O  OE2   . GLU A  1 29  ? 19.992  -7.467   93.018  1.00 93.83  ? 29  GLU A OE2   1 
ATOM   34    N  N     . THR A  1 30  ? 23.432  -2.856   90.856  1.00 85.40  ? 30  THR A N     1 
ATOM   35    C  CA    . THR A  1 30  ? 23.994  -1.631   90.304  1.00 83.58  ? 30  THR A CA    1 
ATOM   36    C  C     . THR A  1 30  ? 24.878  -1.915   89.123  1.00 80.33  ? 30  THR A C     1 
ATOM   37    O  O     . THR A  1 30  ? 25.281  -3.049   88.904  1.00 80.50  ? 30  THR A O     1 
ATOM   38    C  CB    . THR A  1 30  ? 24.842  -0.880   91.326  1.00 87.80  ? 30  THR A CB    1 
ATOM   39    O  OG1   . THR A  1 30  ? 25.651  -1.819   92.048  1.00 91.83  ? 30  THR A OG1   1 
ATOM   40    C  CG2   . THR A  1 30  ? 23.948  -0.106   92.286  1.00 90.56  ? 30  THR A CG2   1 
ATOM   41    N  N     . GLY A  1 31  ? 25.165  -0.867   88.360  1.00 77.84  ? 31  GLY A N     1 
ATOM   42    C  CA    . GLY A  1 31  ? 26.131  -0.934   87.281  1.00 75.14  ? 31  GLY A CA    1 
ATOM   43    C  C     . GLY A  1 31  ? 26.860  0.380    87.105  1.00 75.04  ? 31  GLY A C     1 
ATOM   44    O  O     . GLY A  1 31  ? 26.429  1.416    87.618  1.00 75.92  ? 31  GLY A O     1 
ATOM   45    N  N     . ARG A  1 32  ? 27.976  0.329    86.386  1.00 74.21  ? 32  ARG A N     1 
ATOM   46    C  CA    . ARG A  1 32  ? 28.676  1.536    85.971  1.00 73.92  ? 32  ARG A CA    1 
ATOM   47    C  C     . ARG A  1 32  ? 28.522  1.736    84.457  1.00 69.80  ? 32  ARG A C     1 
ATOM   48    O  O     . ARG A  1 32  ? 28.418  0.766    83.708  1.00 68.00  ? 32  ARG A O     1 
ATOM   49    C  CB    . ARG A  1 32  ? 30.150  1.458    86.366  1.00 77.59  ? 32  ARG A CB    1 
ATOM   50    C  CG    . ARG A  1 32  ? 30.403  1.285    87.856  1.00 82.80  ? 32  ARG A CG    1 
ATOM   51    C  CD    . ARG A  1 32  ? 30.004  2.520    88.667  1.00 86.18  ? 32  ARG A CD    1 
ATOM   52    N  NE    . ARG A  1 32  ? 30.623  2.505    89.994  1.00 92.71  ? 32  ARG A NE    1 
ATOM   53    C  CZ    . ARG A  1 32  ? 30.473  3.451    90.917  1.00 96.05  ? 32  ARG A CZ    1 
ATOM   54    N  NH1   . ARG A  1 32  ? 29.717  4.516    90.676  1.00 93.71  ? 32  ARG A NH1   1 
ATOM   55    N  NH2   . ARG A  1 32  ? 31.088  3.332    92.089  1.00 101.54 ? 32  ARG A NH2   1 
ATOM   56    N  N     . VAL A  1 33  ? 28.501  2.990    84.013  1.00 68.43  ? 33  VAL A N     1 
ATOM   57    C  CA    . VAL A  1 33  ? 28.339  3.299    82.588  1.00 65.05  ? 33  VAL A CA    1 
ATOM   58    C  C     . VAL A  1 33  ? 29.654  3.102    81.836  1.00 65.58  ? 33  VAL A C     1 
ATOM   59    O  O     . VAL A  1 33  ? 30.671  3.714    82.172  1.00 67.66  ? 33  VAL A O     1 
ATOM   60    C  CB    . VAL A  1 33  ? 27.806  4.736    82.364  1.00 64.18  ? 33  VAL A CB    1 
ATOM   61    C  CG1   . VAL A  1 33  ? 27.790  5.091    80.889  1.00 62.12  ? 33  VAL A CG1   1 
ATOM   62    C  CG2   . VAL A  1 33  ? 26.421  4.868    82.921  1.00 63.51  ? 33  VAL A CG2   1 
ATOM   63    N  N     . LEU A  1 34  ? 29.621  2.245    80.818  1.00 63.67  ? 34  LEU A N     1 
ATOM   64    C  CA    . LEU A  1 34  ? 30.803  1.975    80.009  1.00 64.86  ? 34  LEU A CA    1 
ATOM   65    C  C     . LEU A  1 34  ? 31.000  3.056    78.963  1.00 64.51  ? 34  LEU A C     1 
ATOM   66    O  O     . LEU A  1 34  ? 32.071  3.665    78.883  1.00 66.65  ? 34  LEU A O     1 
ATOM   67    C  CB    . LEU A  1 34  ? 30.715  0.597    79.350  1.00 63.91  ? 34  LEU A CB    1 
ATOM   68    C  CG    . LEU A  1 34  ? 31.043  -0.611   80.232  1.00 65.03  ? 34  LEU A CG    1 
ATOM   69    C  CD1   . LEU A  1 34  ? 30.347  -1.871   79.702  1.00 62.25  ? 34  LEU A CD1   1 
ATOM   70    C  CD2   . LEU A  1 34  ? 32.540  -0.799   80.340  1.00 66.39  ? 34  LEU A CD2   1 
ATOM   71    N  N     . ALA A  1 35  ? 29.958  3.282    78.163  1.00 62.13  ? 35  ALA A N     1 
ATOM   72    C  CA    . ALA A  1 35  ? 29.950  4.309    77.130  1.00 61.65  ? 35  ALA A CA    1 
ATOM   73    C  C     . ALA A  1 35  ? 28.531  4.809    76.991  1.00 59.51  ? 35  ALA A C     1 
ATOM   74    O  O     . ALA A  1 35  ? 27.590  4.088    77.311  1.00 58.14  ? 35  ALA A O     1 
ATOM   75    C  CB    . ALA A  1 35  ? 30.446  3.744    75.823  1.00 61.63  ? 35  ALA A CB    1 
ATOM   76    N  N     . VAL A  1 36  ? 28.377  6.048    76.540  1.00 59.97  ? 36  VAL A N     1 
ATOM   77    C  CA    . VAL A  1 36  ? 27.050  6.620    76.316  1.00 58.88  ? 36  VAL A CA    1 
ATOM   78    C  C     . VAL A  1 36  ? 27.031  7.504    75.071  1.00 59.61  ? 36  VAL A C     1 
ATOM   79    O  O     . VAL A  1 36  ? 28.007  8.185    74.765  1.00 61.58  ? 36  VAL A O     1 
ATOM   80    C  CB    . VAL A  1 36  ? 26.479  7.357    77.586  1.00 59.00  ? 36  VAL A CB    1 
ATOM   81    C  CG1   . VAL A  1 36  ? 27.463  8.323    78.180  1.00 60.87  ? 36  VAL A CG1   1 
ATOM   82    C  CG2   . VAL A  1 36  ? 25.187  8.085    77.270  1.00 57.96  ? 36  VAL A CG2   1 
ATOM   83    N  N     . GLY A  1 37  ? 25.923  7.468    74.341  1.00 58.88  ? 37  GLY A N     1 
ATOM   84    C  CA    . GLY A  1 37  ? 25.742  8.340    73.185  1.00 59.93  ? 37  GLY A CA    1 
ATOM   85    C  C     . GLY A  1 37  ? 24.559  7.908    72.348  1.00 59.27  ? 37  GLY A C     1 
ATOM   86    O  O     . GLY A  1 37  ? 24.252  6.706    72.272  1.00 58.77  ? 37  GLY A O     1 
ATOM   87    N  N     . ASP A  1 38  ? 23.898  8.885    71.721  1.00 59.51  ? 38  ASP A N     1 
ATOM   88    C  CA    . ASP A  1 38  ? 22.742  8.620    70.862  1.00 59.23  ? 38  ASP A CA    1 
ATOM   89    C  C     . ASP A  1 38  ? 21.606  7.910    71.612  1.00 57.78  ? 38  ASP A C     1 
ATOM   90    O  O     . ASP A  1 38  ? 20.925  7.050    71.062  1.00 57.63  ? 38  ASP A O     1 
ATOM   91    C  CB    . ASP A  1 38  ? 23.156  7.803    69.642  1.00 60.25  ? 38  ASP A CB    1 
ATOM   92    C  CG    . ASP A  1 38  ? 24.227  8.485    68.816  1.00 64.20  ? 38  ASP A CG    1 
ATOM   93    O  OD1   . ASP A  1 38  ? 24.230  9.740    68.748  1.00 66.08  ? 38  ASP A OD1   1 
ATOM   94    O  OD2   . ASP A  1 38  ? 25.062  7.758    68.221  1.00 67.89  ? 38  ASP A OD2   1 
ATOM   95    N  N     . GLY A  1 39  ? 21.408  8.270    72.874  1.00 57.21  ? 39  GLY A N     1 
ATOM   96    C  CA    . GLY A  1 39  ? 20.337  7.695    73.661  1.00 56.11  ? 39  GLY A CA    1 
ATOM   97    C  C     . GLY A  1 39  ? 20.566  6.256    74.073  1.00 55.18  ? 39  GLY A C     1 
ATOM   98    O  O     . GLY A  1 39  ? 19.678  5.634    74.646  1.00 55.44  ? 39  GLY A O     1 
ATOM   99    N  N     . ILE A  1 40  ? 21.736  5.711    73.777  1.00 54.80  ? 40  ILE A N     1 
ATOM   100   C  CA    . ILE A  1 40  ? 22.091  4.414    74.326  1.00 54.25  ? 40  ILE A CA    1 
ATOM   101   C  C     . ILE A  1 40  ? 23.161  4.591    75.401  1.00 55.31  ? 40  ILE A C     1 
ATOM   102   O  O     . ILE A  1 40  ? 24.123  5.348    75.211  1.00 56.55  ? 40  ILE A O     1 
ATOM   103   C  CB    . ILE A  1 40  ? 22.610  3.434    73.242  1.00 54.37  ? 40  ILE A CB    1 
ATOM   104   C  CG1   . ILE A  1 40  ? 21.646  3.338    72.064  1.00 53.19  ? 40  ILE A CG1   1 
ATOM   105   C  CG2   . ILE A  1 40  ? 22.887  2.050    73.842  1.00 54.09  ? 40  ILE A CG2   1 
ATOM   106   C  CD1   . ILE A  1 40  ? 20.310  2.779    72.409  1.00 52.99  ? 40  ILE A CD1   1 
ATOM   107   N  N     . ALA A  1 41  ? 22.986  3.905    76.526  1.00 55.26  ? 41  ALA A N     1 
ATOM   108   C  CA    . ALA A  1 41  ? 24.047  3.762    77.520  1.00 56.69  ? 41  ALA A CA    1 
ATOM   109   C  C     . ALA A  1 41  ? 24.418  2.274    77.644  1.00 57.17  ? 41  ALA A C     1 
ATOM   110   O  O     . ALA A  1 41  ? 23.550  1.429    77.906  1.00 56.90  ? 41  ALA A O     1 
ATOM   111   C  CB    . ALA A  1 41  ? 23.607  4.330    78.855  1.00 57.15  ? 41  ALA A CB    1 
ATOM   112   N  N     . ARG A  1 42  ? 25.687  1.945    77.410  1.00 58.14  ? 42  ARG A N     1 
ATOM   113   C  CA    . ARG A  1 42  ? 26.156  0.578    77.601  1.00 58.93  ? 42  ARG A CA    1 
ATOM   114   C  C     . ARG A  1 42  ? 26.694  0.504    79.016  1.00 61.07  ? 42  ARG A C     1 
ATOM   115   O  O     . ARG A  1 42  ? 27.529  1.315    79.413  1.00 62.93  ? 42  ARG A O     1 
ATOM   116   C  CB    . ARG A  1 42  ? 27.220  0.202    76.576  1.00 59.60  ? 42  ARG A CB    1 
ATOM   117   C  CG    . ARG A  1 42  ? 26.671  -0.049   75.162  1.00 59.14  ? 42  ARG A CG    1 
ATOM   118   C  CD    . ARG A  1 42  ? 27.762  -0.149   74.099  1.00 59.69  ? 42  ARG A CD    1 
ATOM   119   N  NE    . ARG A  1 42  ? 28.933  -0.833   74.633  1.00 62.64  ? 42  ARG A NE    1 
ATOM   120   C  CZ    . ARG A  1 42  ? 30.158  -0.317   74.706  1.00 64.61  ? 42  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A  1 42  ? 30.417  0.896    74.237  1.00 65.30  ? 42  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A  1 42  ? 31.139  -1.036   75.227  1.00 66.95  ? 42  ARG A NH2   1 
ATOM   123   N  N     . VAL A  1 43  ? 26.196  -0.447   79.795  1.00 61.49  ? 43  VAL A N     1 
ATOM   124   C  CA    . VAL A  1 43  ? 26.465  -0.436   81.224  1.00 63.57  ? 43  VAL A CA    1 
ATOM   125   C  C     . VAL A  1 43  ? 27.103  -1.720   81.712  1.00 65.49  ? 43  VAL A C     1 
ATOM   126   O  O     . VAL A  1 43  ? 26.748  -2.806   81.269  1.00 65.14  ? 43  VAL A O     1 
ATOM   127   C  CB    . VAL A  1 43  ? 25.176  -0.128   82.012  1.00 63.09  ? 43  VAL A CB    1 
ATOM   128   C  CG1   . VAL A  1 43  ? 25.369  -0.310   83.519  1.00 65.20  ? 43  VAL A CG1   1 
ATOM   129   C  CG2   . VAL A  1 43  ? 24.727  1.275    81.701  1.00 62.33  ? 43  VAL A CG2   1 
ATOM   130   N  N     . PHE A  1 44  ? 28.050  -1.575   82.627  1.00 68.27  ? 44  PHE A N     1 
ATOM   131   C  CA    . PHE A  1 44  ? 28.709  -2.710   83.258  1.00 70.97  ? 44  PHE A CA    1 
ATOM   132   C  C     . PHE A  1 44  ? 27.993  -3.094   84.555  1.00 72.33  ? 44  PHE A C     1 
ATOM   133   O  O     . PHE A  1 44  ? 27.591  -2.224   85.333  1.00 73.14  ? 44  PHE A O     1 
ATOM   134   C  CB    . PHE A  1 44  ? 30.187  -2.381   83.530  1.00 73.98  ? 44  PHE A CB    1 
ATOM   135   C  CG    . PHE A  1 44  ? 30.995  -3.559   83.979  1.00 76.74  ? 44  PHE A CG    1 
ATOM   136   C  CD1   . PHE A  1 44  ? 31.336  -4.568   83.079  1.00 76.47  ? 44  PHE A CD1   1 
ATOM   137   C  CD2   . PHE A  1 44  ? 31.413  -3.669   85.303  1.00 80.23  ? 44  PHE A CD2   1 
ATOM   138   C  CE1   . PHE A  1 44  ? 32.084  -5.675   83.498  1.00 79.44  ? 44  PHE A CE1   1 
ATOM   139   C  CE2   . PHE A  1 44  ? 32.158  -4.770   85.728  1.00 82.80  ? 44  PHE A CE2   1 
ATOM   140   C  CZ    . PHE A  1 44  ? 32.497  -5.771   84.821  1.00 82.17  ? 44  PHE A CZ    1 
ATOM   141   N  N     . GLY A  1 45  ? 27.847  -4.396   84.789  1.00 72.89  ? 45  GLY A N     1 
ATOM   142   C  CA    . GLY A  1 45  ? 27.133  -4.885   85.964  1.00 74.11  ? 45  GLY A CA    1 
ATOM   143   C  C     . GLY A  1 45  ? 25.658  -5.074   85.669  1.00 71.52  ? 45  GLY A C     1 
ATOM   144   O  O     . GLY A  1 45  ? 25.293  -5.539   84.578  1.00 69.33  ? 45  GLY A O     1 
ATOM   145   N  N     . LEU A  1 46  ? 24.815  -4.694   86.633  1.00 72.12  ? 46  LEU A N     1 
ATOM   146   C  CA    . LEU A  1 46  ? 23.376  -4.991   86.617  1.00 70.67  ? 46  LEU A CA    1 
ATOM   147   C  C     . LEU A  1 46  ? 23.128  -6.480   86.393  1.00 70.86  ? 46  LEU A C     1 
ATOM   148   O  O     . LEU A  1 46  ? 22.244  -6.866   85.631  1.00 69.02  ? 46  LEU A O     1 
ATOM   149   C  CB    . LEU A  1 46  ? 22.638  -4.170   85.559  1.00 67.04  ? 46  LEU A CB    1 
ATOM   150   C  CG    . LEU A  1 46  ? 22.818  -2.659   85.537  1.00 66.66  ? 46  LEU A CG    1 
ATOM   151   C  CD1   . LEU A  1 46  ? 22.161  -2.089   84.310  1.00 63.46  ? 46  LEU A CD1   1 
ATOM   152   C  CD2   . LEU A  1 46  ? 22.246  -2.009   86.781  1.00 69.94  ? 46  LEU A CD2   1 
ATOM   153   N  N     . ASN A  1 47  ? 23.919  -7.309   87.067  1.00 73.63  ? 47  ASN A N     1 
ATOM   154   C  CA    . ASN A  1 47  ? 23.909  -8.754   86.852  1.00 74.24  ? 47  ASN A CA    1 
ATOM   155   C  C     . ASN A  1 47  ? 22.563  -9.443   87.127  1.00 74.65  ? 47  ASN A C     1 
ATOM   156   O  O     . ASN A  1 47  ? 22.329  -10.551  86.649  1.00 74.98  ? 47  ASN A O     1 
ATOM   157   C  CB    . ASN A  1 47  ? 25.027  -9.426   87.665  1.00 77.69  ? 47  ASN A CB    1 
ATOM   158   C  CG    . ASN A  1 47  ? 26.426  -9.130   87.125  1.00 77.69  ? 47  ASN A CG    1 
ATOM   159   O  OD1   . ASN A  1 47  ? 26.601  -8.644   86.008  1.00 75.53  ? 47  ASN A OD1   1 
ATOM   160   N  ND2   . ASN A  1 47  ? 27.432  -9.446   87.922  1.00 81.56  ? 47  ASN A ND2   1 
ATOM   161   N  N     . ASN A  1 48  ? 21.681  -8.802   87.889  1.00 75.29  ? 48  ASN A N     1 
ATOM   162   C  CA    . ASN A  1 48  ? 20.398  -9.412   88.215  1.00 76.07  ? 48  ASN A CA    1 
ATOM   163   C  C     . ASN A  1 48  ? 19.212  -8.726   87.551  1.00 73.81  ? 48  ASN A C     1 
ATOM   164   O  O     . ASN A  1 48  ? 18.059  -8.993   87.909  1.00 74.79  ? 48  ASN A O     1 
ATOM   165   C  CB    . ASN A  1 48  ? 20.191  -9.465   89.731  1.00 80.46  ? 48  ASN A CB    1 
ATOM   166   C  CG    . ASN A  1 48  ? 20.747  -10.725  90.360  1.00 83.41  ? 48  ASN A CG    1 
ATOM   167   O  OD1   . ASN A  1 48  ? 20.659  -11.815  89.793  1.00 83.06  ? 48  ASN A OD1   1 
ATOM   168   N  ND2   . ASN A  1 48  ? 21.307  -10.584  91.550  1.00 87.00  ? 48  ASN A ND2   1 
ATOM   169   N  N     . ILE A  1 49  ? 19.495  -7.863   86.572  1.00 71.14  ? 49  ILE A N     1 
ATOM   170   C  CA    . ILE A  1 49  ? 18.447  -7.092   85.891  1.00 69.00  ? 49  ILE A CA    1 
ATOM   171   C  C     . ILE A  1 49  ? 17.625  -7.936   84.925  1.00 67.77  ? 49  ILE A C     1 
ATOM   172   O  O     . ILE A  1 49  ? 18.148  -8.854   84.291  1.00 67.32  ? 49  ILE A O     1 
ATOM   173   C  CB    . ILE A  1 49  ? 19.008  -5.855   85.162  1.00 66.60  ? 49  ILE A CB    1 
ATOM   174   C  CG1   . ILE A  1 49  ? 17.882  -4.851   84.906  1.00 65.49  ? 49  ILE A CG1   1 
ATOM   175   C  CG2   . ILE A  1 49  ? 19.702  -6.250   83.869  1.00 64.29  ? 49  ILE A CG2   1 
ATOM   176   C  CD1   . ILE A  1 49  ? 18.338  -3.528   84.403  1.00 64.17  ? 49  ILE A CD1   1 
ATOM   177   N  N     . GLN A  1 50  ? 16.338  -7.606   84.829  1.00 67.90  ? 50  GLN A N     1 
ATOM   178   C  CA    . GLN A  1 50  ? 15.407  -8.296   83.937  1.00 67.17  ? 50  GLN A CA    1 
ATOM   179   C  C     . GLN A  1 50  ? 15.344  -7.640   82.577  1.00 64.52  ? 50  GLN A C     1 
ATOM   180   O  O     . GLN A  1 50  ? 15.414  -6.417   82.459  1.00 63.60  ? 50  GLN A O     1 
ATOM   181   C  CB    . GLN A  1 50  ? 14.006  -8.295   84.523  1.00 68.94  ? 50  GLN A CB    1 
ATOM   182   C  CG    . GLN A  1 50  ? 13.874  -9.036   85.808  1.00 72.64  ? 50  GLN A CG    1 
ATOM   183   C  CD    . GLN A  1 50  ? 12.478  -8.948   86.356  1.00 75.88  ? 50  GLN A CD    1 
ATOM   184   O  OE1   . GLN A  1 50  ? 11.979  -7.861   86.662  1.00 76.48  ? 50  GLN A OE1   1 
ATOM   185   N  NE2   . GLN A  1 50  ? 11.829  -10.098  86.489  1.00 78.85  ? 50  GLN A NE2   1 
ATOM   186   N  N     . ALA A  1 51  ? 15.192  -8.457   81.546  1.00 64.01  ? 51  ALA A N     1 
ATOM   187   C  CA    . ALA A  1 51  ? 14.980  -7.940   80.209  1.00 62.32  ? 51  ALA A CA    1 
ATOM   188   C  C     . ALA A  1 51  ? 13.805  -6.984   80.246  1.00 62.54  ? 51  ALA A C     1 
ATOM   189   O  O     . ALA A  1 51  ? 12.708  -7.362   80.636  1.00 63.68  ? 51  ALA A O     1 
ATOM   190   C  CB    . ALA A  1 51  ? 14.734  -9.065   79.242  1.00 62.44  ? 51  ALA A CB    1 
ATOM   191   N  N     . GLU A  1 52  ? 14.082  -5.733   79.883  1.00 62.08  ? 52  GLU A N     1 
ATOM   192   C  CA    . GLU A  1 52  ? 13.096  -4.641   79.821  1.00 63.30  ? 52  GLU A CA    1 
ATOM   193   C  C     . GLU A  1 52  ? 12.718  -4.057   81.195  1.00 65.04  ? 52  GLU A C     1 
ATOM   194   O  O     . GLU A  1 52  ? 11.636  -3.476   81.375  1.00 66.20  ? 52  GLU A O     1 
ATOM   195   C  CB    . GLU A  1 52  ? 11.854  -5.063   79.031  1.00 64.43  ? 52  GLU A CB    1 
ATOM   196   C  CG    . GLU A  1 52  ? 12.117  -5.323   77.566  1.00 65.94  ? 52  GLU A CG    1 
ATOM   197   C  CD    . GLU A  1 52  ? 10.894  -5.866   76.857  1.00 72.37  ? 52  GLU A CD    1 
ATOM   198   O  OE1   . GLU A  1 52  ? 9.955   -5.073   76.557  1.00 75.46  ? 52  GLU A OE1   1 
ATOM   199   O  OE2   . GLU A  1 52  ? 10.874  -7.094   76.599  1.00 74.85  ? 52  GLU A OE2   1 
ATOM   200   N  N     . GLU A  1 53  ? 13.619  -4.227   82.158  1.00 65.67  ? 53  GLU A N     1 
ATOM   201   C  CA    . GLU A  1 53  ? 13.489  -3.608   83.464  1.00 67.59  ? 53  GLU A CA    1 
ATOM   202   C  C     . GLU A  1 53  ? 13.771  -2.121   83.307  1.00 66.50  ? 53  GLU A C     1 
ATOM   203   O  O     . GLU A  1 53  ? 14.656  -1.719   82.544  1.00 64.41  ? 53  GLU A O     1 
ATOM   204   C  CB    . GLU A  1 53  ? 14.480  -4.245   84.442  1.00 69.04  ? 53  GLU A CB    1 
ATOM   205   C  CG    . GLU A  1 53  ? 14.406  -3.755   85.886  1.00 73.35  ? 53  GLU A CG    1 
ATOM   206   C  CD    . GLU A  1 53  ? 15.117  -4.691   86.881  1.00 77.75  ? 53  GLU A CD    1 
ATOM   207   O  OE1   . GLU A  1 53  ? 15.127  -5.928   86.657  1.00 78.20  ? 53  GLU A OE1   1 
ATOM   208   O  OE2   . GLU A  1 53  ? 15.662  -4.187   87.895  1.00 79.64  ? 53  GLU A OE2   1 
ATOM   209   N  N     . LEU A  1 54  ? 12.996  -1.306   84.010  1.00 68.17  ? 54  LEU A N     1 
ATOM   210   C  CA    . LEU A  1 54  ? 13.291  0.108    84.136  1.00 67.91  ? 54  LEU A CA    1 
ATOM   211   C  C     . LEU A  1 54  ? 14.586  0.238    84.932  1.00 68.60  ? 54  LEU A C     1 
ATOM   212   O  O     . LEU A  1 54  ? 14.766  -0.485   85.920  1.00 70.89  ? 54  LEU A O     1 
ATOM   213   C  CB    . LEU A  1 54  ? 12.162  0.778    84.899  1.00 70.41  ? 54  LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 54  ? 11.777  2.191    84.497  1.00 70.74  ? 54  LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 54  ? 10.941  2.156    83.233  1.00 69.00  ? 54  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 54  ? 11.007  2.867    85.626  1.00 74.88  ? 54  LEU A CD2   1 
ATOM   217   N  N     . VAL A  1 55  ? 15.501  1.113    84.498  1.00 66.88  ? 55  VAL A N     1 
ATOM   218   C  CA    . VAL A  1 55  ? 16.633  1.520    85.358  1.00 67.96  ? 55  VAL A CA    1 
ATOM   219   C  C     . VAL A  1 55  ? 16.695  3.022    85.634  1.00 69.04  ? 55  VAL A C     1 
ATOM   220   O  O     . VAL A  1 55  ? 15.957  3.813    85.044  1.00 68.19  ? 55  VAL A O     1 
ATOM   221   C  CB    . VAL A  1 55  ? 18.009  1.056    84.850  1.00 66.22  ? 55  VAL A CB    1 
ATOM   222   C  CG1   . VAL A  1 55  ? 18.023  -0.430   84.645  1.00 65.47  ? 55  VAL A CG1   1 
ATOM   223   C  CG2   . VAL A  1 55  ? 18.414  1.814    83.593  1.00 63.65  ? 55  VAL A CG2   1 
ATOM   224   N  N     . GLU A  1 56  ? 17.607  3.395    86.523  1.00 71.17  ? 56  GLU A N     1 
ATOM   225   C  CA    . GLU A  1 56  ? 17.730  4.760    86.997  1.00 73.24  ? 56  GLU A CA    1 
ATOM   226   C  C     . GLU A  1 56  ? 19.207  5.160    87.085  1.00 73.33  ? 56  GLU A C     1 
ATOM   227   O  O     . GLU A  1 56  ? 20.015  4.463    87.707  1.00 74.57  ? 56  GLU A O     1 
ATOM   228   C  CB    . GLU A  1 56  ? 17.039  4.866    88.355  1.00 77.55  ? 56  GLU A CB    1 
ATOM   229   C  CG    . GLU A  1 56  ? 17.260  6.156    89.128  1.00 82.63  ? 56  GLU A CG    1 
ATOM   230   C  CD    . GLU A  1 56  ? 16.472  6.190    90.435  1.00 89.76  ? 56  GLU A CD    1 
ATOM   231   O  OE1   . GLU A  1 56  ? 15.384  5.564    90.502  1.00 91.13  ? 56  GLU A OE1   1 
ATOM   232   O  OE2   . GLU A  1 56  ? 16.939  6.846    91.396  1.00 94.08  ? 56  GLU A OE2   1 
ATOM   233   N  N     . PHE A  1 57  ? 19.547  6.275    86.438  1.00 72.10  ? 57  PHE A N     1 
ATOM   234   C  CA    . PHE A  1 57  ? 20.917  6.792    86.403  1.00 72.34  ? 57  PHE A CA    1 
ATOM   235   C  C     . PHE A  1 57  ? 21.148  7.825    87.506  1.00 76.37  ? 57  PHE A C     1 
ATOM   236   O  O     . PHE A  1 57  ? 20.194  8.322    88.108  1.00 78.48  ? 57  PHE A O     1 
ATOM   237   C  CB    . PHE A  1 57  ? 21.226  7.406    85.034  1.00 69.22  ? 57  PHE A CB    1 
ATOM   238   C  CG    . PHE A  1 57  ? 21.328  6.397    83.909  1.00 65.23  ? 57  PHE A CG    1 
ATOM   239   C  CD1   . PHE A  1 57  ? 20.185  6.001    83.199  1.00 62.32  ? 57  PHE A CD1   1 
ATOM   240   C  CD2   . PHE A  1 57  ? 22.569  5.864    83.542  1.00 63.06  ? 57  PHE A CD2   1 
ATOM   241   C  CE1   . PHE A  1 57  ? 20.273  5.078    82.156  1.00 59.11  ? 57  PHE A CE1   1 
ATOM   242   C  CE2   . PHE A  1 57  ? 22.674  4.946    82.504  1.00 60.60  ? 57  PHE A CE2   1 
ATOM   243   C  CZ    . PHE A  1 57  ? 21.517  4.550    81.803  1.00 59.45  ? 57  PHE A CZ    1 
ATOM   244   N  N     . SER A  1 58  ? 22.415  8.150    87.764  1.00 78.03  ? 58  SER A N     1 
ATOM   245   C  CA    . SER A  1 58  ? 22.776  9.084    88.834  1.00 82.05  ? 58  SER A CA    1 
ATOM   246   C  C     . SER A  1 58  ? 22.151  10.458   88.684  1.00 82.32  ? 58  SER A C     1 
ATOM   247   O  O     . SER A  1 58  ? 21.783  11.065   89.675  1.00 86.15  ? 58  SER A O     1 
ATOM   248   C  CB    . SER A  1 58  ? 24.287  9.247    88.920  1.00 83.59  ? 58  SER A CB    1 
ATOM   249   O  OG    . SER A  1 58  ? 24.912  8.008    89.191  1.00 85.27  ? 58  SER A OG    1 
ATOM   250   N  N     . SER A  1 59  ? 22.039  10.950   87.453  1.00 78.87  ? 59  SER A N     1 
ATOM   251   C  CA    . SER A  1 59  ? 21.575  12.316   87.214  1.00 79.25  ? 59  SER A CA    1 
ATOM   252   C  C     . SER A  1 59  ? 20.069  12.447   87.329  1.00 79.28  ? 59  SER A C     1 
ATOM   253   O  O     . SER A  1 59  ? 19.537  13.561   87.372  1.00 80.85  ? 59  SER A O     1 
ATOM   254   C  CB    . SER A  1 59  ? 22.019  12.797   85.843  1.00 76.23  ? 59  SER A CB    1 
ATOM   255   O  OG    . SER A  1 59  ? 21.609  11.881   84.853  1.00 72.94  ? 59  SER A OG    1 
ATOM   256   N  N     . GLY A  1 60  ? 19.381  11.311   87.366  1.00 77.92  ? 60  GLY A N     1 
ATOM   257   C  CA    . GLY A  1 60  ? 17.924  11.310   87.501  1.00 78.28  ? 60  GLY A CA    1 
ATOM   258   C  C     . GLY A  1 60  ? 17.153  10.839   86.283  1.00 74.17  ? 60  GLY A C     1 
ATOM   259   O  O     . GLY A  1 60  ? 15.939  10.661   86.346  1.00 74.74  ? 60  GLY A O     1 
ATOM   260   N  N     . VAL A  1 61  ? 17.848  10.642   85.171  1.00 70.55  ? 61  VAL A N     1 
ATOM   261   C  CA    . VAL A  1 61  ? 17.207  10.113   83.986  1.00 67.28  ? 61  VAL A CA    1 
ATOM   262   C  C     . VAL A  1 61  ? 16.977  8.602    84.129  1.00 66.17  ? 61  VAL A C     1 
ATOM   263   O  O     . VAL A  1 61  ? 17.832  7.877    84.645  1.00 66.50  ? 61  VAL A O     1 
ATOM   264   C  CB    . VAL A  1 61  ? 18.005  10.465   82.704  1.00 64.90  ? 61  VAL A CB    1 
ATOM   265   C  CG1   . VAL A  1 61  ? 19.365  9.766    82.682  1.00 64.26  ? 61  VAL A CG1   1 
ATOM   266   C  CG2   . VAL A  1 61  ? 17.201  10.121   81.463  1.00 62.39  ? 61  VAL A CG2   1 
ATOM   267   N  N     . LYS A  1 62  ? 15.814  8.138    83.685  1.00 65.09  ? 62  LYS A N     1 
ATOM   268   C  CA    . LYS A  1 62  ? 15.520  6.709    83.675  1.00 64.21  ? 62  LYS A CA    1 
ATOM   269   C  C     . LYS A  1 62  ? 15.773  6.119    82.285  1.00 61.15  ? 62  LYS A C     1 
ATOM   270   O  O     . LYS A  1 62  ? 16.096  6.849    81.341  1.00 59.86  ? 62  LYS A O     1 
ATOM   271   C  CB    . LYS A  1 62  ? 14.084  6.452    84.143  1.00 66.04  ? 62  LYS A CB    1 
ATOM   272   C  CG    . LYS A  1 62  ? 13.793  7.034    85.516  1.00 69.98  ? 62  LYS A CG    1 
ATOM   273   C  CD    . LYS A  1 62  ? 12.365  6.827    85.980  1.00 71.87  ? 62  LYS A CD    1 
ATOM   274   C  CE    . LYS A  1 62  ? 12.298  7.126    87.476  1.00 76.44  ? 62  LYS A CE    1 
ATOM   275   N  NZ    . LYS A  1 62  ? 10.928  7.410    87.986  1.00 79.85  ? 62  LYS A NZ    1 
ATOM   276   N  N     . GLY A  1 63  ? 15.640  4.804    82.164  1.00 60.39  ? 63  GLY A N     1 
ATOM   277   C  CA    . GLY A  1 63  ? 15.856  4.121    80.888  1.00 58.49  ? 63  GLY A CA    1 
ATOM   278   C  C     . GLY A  1 63  ? 15.568  2.642    81.017  1.00 58.71  ? 63  GLY A C     1 
ATOM   279   O  O     . GLY A  1 63  ? 15.432  2.135    82.132  1.00 60.71  ? 63  GLY A O     1 
ATOM   280   N  N     . MET A  1 64  ? 15.470  1.932    79.899  1.00 57.29  ? 64  MET A N     1 
ATOM   281   C  CA    . MET A  1 64  ? 15.107  0.521    79.993  1.00 57.81  ? 64  MET A CA    1 
ATOM   282   C  C     . MET A  1 64  ? 16.054  -0.454   79.301  1.00 56.65  ? 64  MET A C     1 
ATOM   283   O  O     . MET A  1 64  ? 16.452  -0.247   78.153  1.00 55.63  ? 64  MET A O     1 
ATOM   284   C  CB    . MET A  1 64  ? 13.644  0.290    79.590  1.00 58.44  ? 64  MET A CB    1 
ATOM   285   C  CG    . MET A  1 64  ? 13.359  0.298    78.118  1.00 58.02  ? 64  MET A CG    1 
ATOM   286   S  SD    . MET A  1 64  ? 11.645  -0.159   77.804  1.00 62.63  ? 64  MET A SD    1 
ATOM   287   C  CE    . MET A  1 64  ? 11.581  -1.820   78.429  1.00 62.52  ? 64  MET A CE    1 
ATOM   288   N  N     . ALA A  1 65  ? 16.392  -1.515   80.033  1.00 57.29  ? 65  ALA A N     1 
ATOM   289   C  CA    . ALA A  1 65  ? 17.289  -2.577   79.586  1.00 56.80  ? 65  ALA A CA    1 
ATOM   290   C  C     . ALA A  1 65  ? 16.716  -3.403   78.427  1.00 56.43  ? 65  ALA A C     1 
ATOM   291   O  O     . ALA A  1 65  ? 15.964  -4.355   78.635  1.00 57.52  ? 65  ALA A O     1 
ATOM   292   C  CB    . ALA A  1 65  ? 17.623  -3.479   80.753  1.00 58.16  ? 65  ALA A CB    1 
ATOM   293   N  N     . LEU A  1 66  ? 17.086  -3.045   77.205  1.00 55.39  ? 66  LEU A N     1 
ATOM   294   C  CA    . LEU A  1 66  ? 16.636  -3.783   76.042  1.00 55.32  ? 66  LEU A CA    1 
ATOM   295   C  C     . LEU A  1 66  ? 17.611  -4.882   75.620  1.00 55.81  ? 66  LEU A C     1 
ATOM   296   O  O     . LEU A  1 66  ? 17.186  -5.913   75.071  1.00 56.87  ? 66  LEU A O     1 
ATOM   297   C  CB    . LEU A  1 66  ? 16.398  -2.842   74.863  1.00 55.12  ? 66  LEU A CB    1 
ATOM   298   C  CG    . LEU A  1 66  ? 15.144  -1.977   74.823  1.00 54.59  ? 66  LEU A CG    1 
ATOM   299   C  CD1   . LEU A  1 66  ? 14.707  -1.835   73.367  1.00 54.50  ? 66  LEU A CD1   1 
ATOM   300   C  CD2   . LEU A  1 66  ? 14.045  -2.589   75.658  1.00 55.53  ? 66  LEU A CD2   1 
ATOM   301   N  N     . ASN A  1 67  ? 18.907  -4.663   75.849  1.00 55.19  ? 67  ASN A N     1 
ATOM   302   C  CA    . ASN A  1 67  ? 19.915  -5.657   75.476  1.00 55.58  ? 67  ASN A CA    1 
ATOM   303   C  C     . ASN A  1 67  ? 20.690  -6.192   76.651  1.00 56.42  ? 67  ASN A C     1 
ATOM   304   O  O     . ASN A  1 67  ? 21.566  -5.516   77.190  1.00 57.14  ? 67  ASN A O     1 
ATOM   305   C  CB    . ASN A  1 67  ? 20.880  -5.105   74.430  1.00 55.33  ? 67  ASN A CB    1 
ATOM   306   C  CG    . ASN A  1 67  ? 20.290  -5.104   73.040  1.00 55.94  ? 67  ASN A CG    1 
ATOM   307   O  OD1   . ASN A  1 67  ? 19.142  -5.513   72.834  1.00 57.56  ? 67  ASN A OD1   1 
ATOM   308   N  ND2   . ASN A  1 67  ? 21.064  -4.642   72.075  1.00 55.43  ? 67  ASN A ND2   1 
ATOM   309   N  N     . LEU A  1 68  ? 20.357  -7.408   77.058  1.00 57.17  ? 68  LEU A N     1 
ATOM   310   C  CA    . LEU A  1 68  ? 21.181  -8.140   77.997  1.00 58.19  ? 68  LEU A CA    1 
ATOM   311   C  C     . LEU A  1 68  ? 22.186  -8.933   77.181  1.00 59.16  ? 68  LEU A C     1 
ATOM   312   O  O     . LEU A  1 68  ? 21.838  -9.916   76.537  1.00 59.79  ? 68  LEU A O     1 
ATOM   313   C  CB    . LEU A  1 68  ? 20.330  -9.054   78.879  1.00 59.15  ? 68  LEU A CB    1 
ATOM   314   C  CG    . LEU A  1 68  ? 19.155  -8.417   79.634  1.00 59.20  ? 68  LEU A CG    1 
ATOM   315   C  CD1   . LEU A  1 68  ? 18.539  -9.398   80.637  1.00 60.74  ? 68  LEU A CD1   1 
ATOM   316   C  CD2   . LEU A  1 68  ? 19.560  -7.134   80.340  1.00 58.34  ? 68  LEU A CD2   1 
ATOM   317   N  N     . GLU A  1 69  ? 23.428  -8.461   77.174  1.00 59.69  ? 69  GLU A N     1 
ATOM   318   C  CA    . GLU A  1 69  ? 24.517  -9.116   76.459  1.00 61.04  ? 69  GLU A CA    1 
ATOM   319   C  C     . GLU A  1 69  ? 25.475  -9.695   77.496  1.00 62.84  ? 69  GLU A C     1 
ATOM   320   O  O     . GLU A  1 69  ? 25.350  -9.377   78.685  1.00 62.70  ? 69  GLU A O     1 
ATOM   321   C  CB    . GLU A  1 69  ? 25.238  -8.106   75.562  1.00 60.87  ? 69  GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 69  ? 24.441  -7.639   74.339  1.00 60.66  ? 69  GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 69  ? 24.979  -6.345   73.708  1.00 62.40  ? 69  GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 69  ? 26.212  -6.128   73.688  1.00 66.10  ? 69  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 69  ? 24.170  -5.536   73.212  1.00 62.09  ? 69  GLU A OE2   1 
ATOM   326   N  N     . PRO A  1 70  ? 26.417  -10.564  77.063  1.00 64.85  ? 70  PRO A N     1 
ATOM   327   C  CA    . PRO A  1 70  ? 27.434  -11.162  77.923  1.00 67.17  ? 70  PRO A CA    1 
ATOM   328   C  C     . PRO A  1 70  ? 28.120  -10.217  78.912  1.00 67.82  ? 70  PRO A C     1 
ATOM   329   O  O     . PRO A  1 70  ? 27.856  -10.295  80.113  1.00 68.54  ? 70  PRO A O     1 
ATOM   330   C  CB    . PRO A  1 70  ? 28.418  -11.716  76.915  1.00 68.83  ? 70  PRO A CB    1 
ATOM   331   C  CG    . PRO A  1 70  ? 27.520  -12.235  75.864  1.00 68.02  ? 70  PRO A CG    1 
ATOM   332   C  CD    . PRO A  1 70  ? 26.432  -11.212  75.737  1.00 65.51  ? 70  PRO A CD    1 
ATOM   333   N  N     . GLY A  1 71  ? 28.974  -9.325   78.434  1.00 68.14  ? 71  GLY A N     1 
ATOM   334   C  CA    . GLY A  1 71  ? 29.714  -8.470   79.356  1.00 69.76  ? 71  GLY A CA    1 
ATOM   335   C  C     . GLY A  1 71  ? 28.977  -7.272   79.927  1.00 68.29  ? 71  GLY A C     1 
ATOM   336   O  O     . GLY A  1 71  ? 29.447  -6.665   80.887  1.00 69.50  ? 71  GLY A O     1 
ATOM   337   N  N     . GLN A  1 72  ? 27.820  -6.941   79.344  1.00 66.16  ? 72  GLN A N     1 
ATOM   338   C  CA    . GLN A  1 72  ? 27.224  -5.612   79.485  1.00 64.83  ? 72  GLN A CA    1 
ATOM   339   C  C     . GLN A  1 72  ? 25.733  -5.574   79.171  1.00 62.90  ? 72  GLN A C     1 
ATOM   340   O  O     . GLN A  1 72  ? 25.205  -6.460   78.488  1.00 62.79  ? 72  GLN A O     1 
ATOM   341   C  CB    . GLN A  1 72  ? 27.930  -4.643   78.539  1.00 64.46  ? 72  GLN A CB    1 
ATOM   342   C  CG    . GLN A  1 72  ? 27.983  -5.146   77.107  1.00 65.33  ? 72  GLN A CG    1 
ATOM   343   C  CD    . GLN A  1 72  ? 28.615  -4.164   76.134  1.00 67.41  ? 72  GLN A CD    1 
ATOM   344   O  OE1   . GLN A  1 72  ? 28.537  -2.951   76.315  1.00 68.30  ? 72  GLN A OE1   1 
ATOM   345   N  NE2   . GLN A  1 72  ? 29.225  -4.688   75.081  1.00 68.92  ? 72  GLN A NE2   1 
ATOM   346   N  N     . VAL A  1 73  ? 25.066  -4.527   79.656  1.00 61.81  ? 73  VAL A N     1 
ATOM   347   C  CA    . VAL A  1 73  ? 23.658  -4.292   79.359  1.00 59.95  ? 73  VAL A CA    1 
ATOM   348   C  C     . VAL A  1 73  ? 23.568  -3.056   78.462  1.00 58.75  ? 73  VAL A C     1 
ATOM   349   O  O     . VAL A  1 73  ? 24.313  -2.085   78.667  1.00 59.46  ? 73  VAL A O     1 
ATOM   350   C  CB    . VAL A  1 73  ? 22.841  -4.022   80.644  1.00 60.41  ? 73  VAL A CB    1 
ATOM   351   C  CG1   . VAL A  1 73  ? 21.361  -3.911   80.333  1.00 59.39  ? 73  VAL A CG1   1 
ATOM   352   C  CG2   . VAL A  1 73  ? 23.059  -5.096   81.655  1.00 62.22  ? 73  VAL A CG2   1 
ATOM   353   N  N     . GLY A  1 74  ? 22.673  -3.098   77.474  1.00 57.03  ? 74  GLY A N     1 
ATOM   354   C  CA    . GLY A  1 74  ? 22.396  -1.946   76.631  1.00 56.11  ? 74  GLY A CA    1 
ATOM   355   C  C     . GLY A  1 74  ? 21.084  -1.294   77.036  1.00 55.58  ? 74  GLY A C     1 
ATOM   356   O  O     . GLY A  1 74  ? 20.021  -1.919   76.977  1.00 55.65  ? 74  GLY A O     1 
ATOM   357   N  N     . ILE A  1 75  ? 21.155  -0.032   77.439  1.00 55.33  ? 75  ILE A N     1 
ATOM   358   C  CA    . ILE A  1 75  ? 20.008  0.659    77.989  1.00 55.14  ? 75  ILE A CA    1 
ATOM   359   C  C     . ILE A  1 75  ? 19.636  1.883    77.150  1.00 54.88  ? 75  ILE A C     1 
ATOM   360   O  O     . ILE A  1 75  ? 20.471  2.745    76.878  1.00 55.37  ? 75  ILE A O     1 
ATOM   361   C  CB    . ILE A  1 75  ? 20.291  1.067    79.437  1.00 56.33  ? 75  ILE A CB    1 
ATOM   362   C  CG1   . ILE A  1 75  ? 20.493  -0.183   80.287  1.00 57.14  ? 75  ILE A CG1   1 
ATOM   363   C  CG2   . ILE A  1 75  ? 19.156  1.916    79.999  1.00 57.24  ? 75  ILE A CG2   1 
ATOM   364   C  CD1   . ILE A  1 75  ? 21.074  0.088    81.629  1.00 59.25  ? 75  ILE A CD1   1 
ATOM   365   N  N     . VAL A  1 76  ? 18.374  1.953    76.740  1.00 54.76  ? 76  VAL A N     1 
ATOM   366   C  CA    . VAL A  1 76  ? 17.856  3.102    76.003  1.00 54.56  ? 76  VAL A CA    1 
ATOM   367   C  C     . VAL A  1 76  ? 17.364  4.167    76.974  1.00 55.25  ? 76  VAL A C     1 
ATOM   368   O  O     . VAL A  1 76  ? 16.641  3.863    77.919  1.00 56.33  ? 76  VAL A O     1 
ATOM   369   C  CB    . VAL A  1 76  ? 16.729  2.687    75.040  1.00 54.67  ? 76  VAL A CB    1 
ATOM   370   C  CG1   . VAL A  1 76  ? 17.252  1.637    74.043  1.00 54.90  ? 76  VAL A CG1   1 
ATOM   371   C  CG2   . VAL A  1 76  ? 15.538  2.141    75.800  1.00 54.88  ? 76  VAL A CG2   1 
ATOM   372   N  N     . LEU A  1 77  ? 17.763  5.412    76.743  1.00 55.22  ? 77  LEU A N     1 
ATOM   373   C  CA    . LEU A  1 77  ? 17.457  6.505    77.667  1.00 56.06  ? 77  LEU A CA    1 
ATOM   374   C  C     . LEU A  1 77  ? 16.058  7.094    77.471  1.00 56.69  ? 77  LEU A C     1 
ATOM   375   O  O     . LEU A  1 77  ? 15.614  7.263    76.340  1.00 56.49  ? 77  LEU A O     1 
ATOM   376   C  CB    . LEU A  1 77  ? 18.487  7.617    77.501  1.00 56.13  ? 77  LEU A CB    1 
ATOM   377   C  CG    . LEU A  1 77  ? 19.938  7.291    77.797  1.00 55.82  ? 77  LEU A CG    1 
ATOM   378   C  CD1   . LEU A  1 77  ? 20.691  8.568    77.861  1.00 56.49  ? 77  LEU A CD1   1 
ATOM   379   C  CD2   . LEU A  1 77  ? 20.054  6.580    79.120  1.00 57.57  ? 77  LEU A CD2   1 
ATOM   380   N  N     . PHE A  1 78  ? 15.375  7.424    78.565  1.00 57.94  ? 78  PHE A N     1 
ATOM   381   C  CA    . PHE A  1 78  ? 14.096  8.130    78.470  1.00 58.99  ? 78  PHE A CA    1 
ATOM   382   C  C     . PHE A  1 78  ? 14.290  9.643    78.489  1.00 59.97  ? 78  PHE A C     1 
ATOM   383   O  O     . PHE A  1 78  ? 13.319  10.394   78.539  1.00 61.39  ? 78  PHE A O     1 
ATOM   384   C  CB    . PHE A  1 78  ? 13.135  7.739    79.600  1.00 60.68  ? 78  PHE A CB    1 
ATOM   385   C  CG    . PHE A  1 78  ? 12.629  6.332    79.531  1.00 60.06  ? 78  PHE A CG    1 
ATOM   386   C  CD1   . PHE A  1 78  ? 12.834  5.537    78.415  1.00 59.54  ? 78  PHE A CD1   1 
ATOM   387   C  CD2   . PHE A  1 78  ? 11.912  5.806    80.586  1.00 62.12  ? 78  PHE A CD2   1 
ATOM   388   C  CE1   . PHE A  1 78  ? 12.337  4.219    78.365  1.00 59.46  ? 78  PHE A CE1   1 
ATOM   389   C  CE2   . PHE A  1 78  ? 11.416  4.503    80.538  1.00 62.84  ? 78  PHE A CE2   1 
ATOM   390   C  CZ    . PHE A  1 78  ? 11.630  3.712    79.425  1.00 60.45  ? 78  PHE A CZ    1 
ATOM   391   N  N     . GLY A  1 79  ? 15.538  10.089   78.453  1.00 59.57  ? 79  GLY A N     1 
ATOM   392   C  CA    . GLY A  1 79  ? 15.836  11.514   78.531  1.00 61.53  ? 79  GLY A CA    1 
ATOM   393   C  C     . GLY A  1 79  ? 17.161  11.869   77.889  1.00 61.29  ? 79  GLY A C     1 
ATOM   394   O  O     . GLY A  1 79  ? 17.931  10.983   77.500  1.00 60.03  ? 79  GLY A O     1 
ATOM   395   N  N     . SER A  1 80  ? 17.433  13.170   77.790  1.00 62.97  ? 80  SER A N     1 
ATOM   396   C  CA    . SER A  1 80  ? 18.601  13.672   77.058  1.00 63.04  ? 80  SER A CA    1 
ATOM   397   C  C     . SER A  1 80  ? 19.872  13.036   77.581  1.00 62.86  ? 80  SER A C     1 
ATOM   398   O  O     . SER A  1 80  ? 20.099  13.021   78.789  1.00 64.33  ? 80  SER A O     1 
ATOM   399   C  CB    . SER A  1 80  ? 18.681  15.197   77.157  1.00 64.92  ? 80  SER A CB    1 
ATOM   400   O  OG    . SER A  1 80  ? 19.980  15.657   76.823  1.00 66.36  ? 80  SER A OG    1 
ATOM   401   N  N     . ASP A  1 81  ? 20.705  12.508   76.693  1.00 61.79  ? 81  ASP A N     1 
ATOM   402   C  CA    . ASP A  1 81  ? 21.878  11.797   77.186  1.00 62.39  ? 81  ASP A CA    1 
ATOM   403   C  C     . ASP A  1 81  ? 23.101  12.672   77.500  1.00 64.01  ? 81  ASP A C     1 
ATOM   404   O  O     . ASP A  1 81  ? 24.210  12.167   77.668  1.00 64.39  ? 81  ASP A O     1 
ATOM   405   C  CB    . ASP A  1 81  ? 22.219  10.582   76.323  1.00 61.29  ? 81  ASP A CB    1 
ATOM   406   C  CG    . ASP A  1 81  ? 22.682  10.951   74.951  1.00 63.00  ? 81  ASP A CG    1 
ATOM   407   O  OD1   . ASP A  1 81  ? 23.773  11.544   74.841  1.00 67.05  ? 81  ASP A OD1   1 
ATOM   408   O  OD2   . ASP A  1 81  ? 21.972  10.626   73.976  1.00 64.54  ? 81  ASP A OD2   1 
ATOM   409   N  N     . ARG A  1 82  ? 22.879  13.983   77.598  1.00 65.26  ? 82  ARG A N     1 
ATOM   410   C  CA    . ARG A  1 82  ? 23.824  14.883   78.243  1.00 67.31  ? 82  ARG A CA    1 
ATOM   411   C  C     . ARG A  1 82  ? 23.755  14.652   79.744  1.00 68.95  ? 82  ARG A C     1 
ATOM   412   O  O     . ARG A  1 82  ? 24.590  15.141   80.504  1.00 71.27  ? 82  ARG A O     1 
ATOM   413   C  CB    . ARG A  1 82  ? 23.483  16.336   77.943  1.00 68.54  ? 82  ARG A CB    1 
ATOM   414   C  CG    . ARG A  1 82  ? 24.345  17.308   78.713  1.00 71.19  ? 82  ARG A CG    1 
ATOM   415   C  CD    . ARG A  1 82  ? 23.925  18.746   78.526  1.00 73.37  ? 82  ARG A CD    1 
ATOM   416   N  NE    . ARG A  1 82  ? 24.700  19.635   79.390  1.00 77.41  ? 82  ARG A NE    1 
ATOM   417   C  CZ    . ARG A  1 82  ? 25.951  20.025   79.150  1.00 79.25  ? 82  ARG A CZ    1 
ATOM   418   N  NH1   . ARG A  1 82  ? 26.597  19.608   78.064  1.00 78.63  ? 82  ARG A NH1   1 
ATOM   419   N  NH2   . ARG A  1 82  ? 26.561  20.835   80.002  1.00 82.05  ? 82  ARG A NH2   1 
ATOM   420   N  N     . LEU A  1 83  ? 22.742  13.912   80.177  1.00 68.23  ? 83  LEU A N     1 
ATOM   421   C  CA    . LEU A  1 83  ? 22.550  13.673   81.605  1.00 70.18  ? 83  LEU A CA    1 
ATOM   422   C  C     . LEU A  1 83  ? 23.434  12.534   82.119  1.00 70.23  ? 83  LEU A C     1 
ATOM   423   O  O     . LEU A  1 83  ? 23.773  12.496   83.308  1.00 73.07  ? 83  LEU A O     1 
ATOM   424   C  CB    . LEU A  1 83  ? 21.058  13.477   81.938  1.00 69.93  ? 83  LEU A CB    1 
ATOM   425   C  CG    . LEU A  1 83  ? 20.216  14.763   81.787  1.00 70.87  ? 83  LEU A CG    1 
ATOM   426   C  CD1   . LEU A  1 83  ? 18.718  14.485   81.596  1.00 69.51  ? 83  LEU A CD1   1 
ATOM   427   C  CD2   . LEU A  1 83  ? 20.470  15.738   82.948  1.00 73.40  ? 83  LEU A CD2   1 
ATOM   428   N  N     . VAL A  1 84  ? 23.840  11.644   81.214  1.00 67.51  ? 84  VAL A N     1 
ATOM   429   C  CA    . VAL A  1 84  ? 24.675  10.498   81.569  1.00 67.22  ? 84  VAL A CA    1 
ATOM   430   C  C     . VAL A  1 84  ? 26.142  10.728   81.189  1.00 68.17  ? 84  VAL A C     1 
ATOM   431   O  O     . VAL A  1 84  ? 26.424  11.420   80.203  1.00 67.84  ? 84  VAL A O     1 
ATOM   432   C  CB    . VAL A  1 84  ? 24.135  9.211    80.911  1.00 64.68  ? 84  VAL A CB    1 
ATOM   433   C  CG1   . VAL A  1 84  ? 24.966  7.995    81.306  1.00 64.91  ? 84  VAL A CG1   1 
ATOM   434   C  CG2   . VAL A  1 84  ? 22.679  9.001    81.295  1.00 63.69  ? 84  VAL A CG2   1 
ATOM   435   N  N     . LYS A  1 85  ? 27.055  10.156   81.989  1.00 69.70  ? 85  LYS A N     1 
ATOM   436   C  CA    . LYS A  1 85  ? 28.514  10.172   81.740  1.00 70.82  ? 85  LYS A CA    1 
ATOM   437   C  C     . LYS A  1 85  ? 29.165  8.801    81.952  1.00 71.30  ? 85  LYS A C     1 
ATOM   438   O  O     . LYS A  1 85  ? 28.696  8.000    82.756  1.00 71.09  ? 85  LYS A O     1 
ATOM   439   C  CB    . LYS A  1 85  ? 29.200  11.178   82.657  1.00 74.04  ? 85  LYS A CB    1 
ATOM   440   C  CG    . LYS A  1 85  ? 29.072  12.611   82.223  1.00 73.70  ? 85  LYS A CG    1 
ATOM   441   C  CD    . LYS A  1 85  ? 29.520  13.548   83.313  1.00 76.84  ? 85  LYS A CD    1 
ATOM   442   C  CE    . LYS A  1 85  ? 29.580  14.972   82.820  1.00 77.57  ? 85  LYS A CE    1 
ATOM   443   N  NZ    . LYS A  1 85  ? 30.419  15.811   83.712  1.00 82.03  ? 85  LYS A NZ    1 
ATOM   444   N  N     . GLU A  1 86  ? 30.256  8.533    81.238  1.00 72.44  ? 86  GLU A N     1 
ATOM   445   C  CA    . GLU A  1 86  ? 31.017  7.302    81.460  1.00 74.10  ? 86  GLU A CA    1 
ATOM   446   C  C     . GLU A  1 86  ? 31.377  7.204    82.933  1.00 77.67  ? 86  GLU A C     1 
ATOM   447   O  O     . GLU A  1 86  ? 31.883  8.165    83.519  1.00 80.45  ? 86  GLU A O     1 
ATOM   448   C  CB    . GLU A  1 86  ? 32.306  7.249    80.628  1.00 75.38  ? 86  GLU A CB    1 
ATOM   449   C  CG    . GLU A  1 86  ? 33.088  5.939    80.827  1.00 76.86  ? 86  GLU A CG    1 
ATOM   450   C  CD    . GLU A  1 86  ? 34.601  6.052    80.620  1.00 80.95  ? 86  GLU A CD    1 
ATOM   451   O  OE1   . GLU A  1 86  ? 35.153  7.170    80.711  1.00 83.65  ? 86  GLU A OE1   1 
ATOM   452   O  OE2   . GLU A  1 86  ? 35.250  5.003    80.385  1.00 81.31  ? 86  GLU A OE2   1 
ATOM   453   N  N     . GLY A  1 87  ? 31.097  6.047    83.525  1.00 78.13  ? 87  GLY A N     1 
ATOM   454   C  CA    . GLY A  1 87  ? 31.499  5.764    84.903  1.00 82.08  ? 87  GLY A CA    1 
ATOM   455   C  C     . GLY A  1 87  ? 30.393  5.957    85.915  1.00 82.55  ? 87  GLY A C     1 
ATOM   456   O  O     . GLY A  1 87  ? 30.512  5.527    87.057  1.00 85.51  ? 87  GLY A O     1 
ATOM   457   N  N     . GLU A  1 88  ? 29.311  6.596    85.486  1.00 80.48  ? 88  GLU A N     1 
ATOM   458   C  CA    . GLU A  1 88  ? 28.203  6.940    86.372  1.00 81.46  ? 88  GLU A CA    1 
ATOM   459   C  C     . GLU A  1 88  ? 27.496  5.686    86.869  1.00 80.65  ? 88  GLU A C     1 
ATOM   460   O  O     . GLU A  1 88  ? 27.492  4.662    86.188  1.00 78.43  ? 88  GLU A O     1 
ATOM   461   C  CB    . GLU A  1 88  ? 27.226  7.880    85.662  1.00 79.19  ? 88  GLU A CB    1 
ATOM   462   C  CG    . GLU A  1 88  ? 27.009  9.167    86.435  1.00 83.87  ? 88  GLU A CG    1 
ATOM   463   C  CD    . GLU A  1 88  ? 26.498  10.317   85.573  1.00 84.73  ? 88  GLU A CD    1 
ATOM   464   O  OE1   . GLU A  1 88  ? 27.233  11.332   85.478  1.00 86.56  ? 88  GLU A OE1   1 
ATOM   465   O  OE2   . GLU A  1 88  ? 25.370  10.209   85.012  1.00 82.40  ? 88  GLU A OE2   1 
ATOM   466   N  N     . LEU A  1 89  ? 26.922  5.777    88.066  1.00 82.91  ? 89  LEU A N     1 
ATOM   467   C  CA    . LEU A  1 89  ? 26.241  4.655    88.712  1.00 83.06  ? 89  LEU A CA    1 
ATOM   468   C  C     . LEU A  1 89  ? 24.827  4.482    88.172  1.00 79.64  ? 89  LEU A C     1 
ATOM   469   O  O     . LEU A  1 89  ? 24.127  5.463    87.900  1.00 78.55  ? 89  LEU A O     1 
ATOM   470   C  CB    . LEU A  1 89  ? 26.205  4.879    90.228  1.00 88.10  ? 89  LEU A CB    1 
ATOM   471   C  CG    . LEU A  1 89  ? 25.778  3.796    91.232  1.00 90.72  ? 89  LEU A CG    1 
ATOM   472   C  CD1   . LEU A  1 89  ? 26.793  2.664    91.334  1.00 92.00  ? 89  LEU A CD1   1 
ATOM   473   C  CD2   . LEU A  1 89  ? 25.564  4.437    92.605  1.00 95.50  ? 89  LEU A CD2   1 
ATOM   474   N  N     . VAL A  1 90  ? 24.419  3.227    88.007  1.00 78.10  ? 90  VAL A N     1 
ATOM   475   C  CA    . VAL A  1 90  ? 23.078  2.903    87.512  1.00 75.37  ? 90  VAL A CA    1 
ATOM   476   C  C     . VAL A  1 90  ? 22.407  1.932    88.473  1.00 76.99  ? 90  VAL A C     1 
ATOM   477   O  O     . VAL A  1 90  ? 23.045  1.003    88.964  1.00 78.75  ? 90  VAL A O     1 
ATOM   478   C  CB    . VAL A  1 90  ? 23.104  2.283    86.093  1.00 71.74  ? 90  VAL A CB    1 
ATOM   479   C  CG1   . VAL A  1 90  ? 21.724  2.362    85.442  1.00 69.60  ? 90  VAL A CG1   1 
ATOM   480   C  CG2   . VAL A  1 90  ? 24.123  2.984    85.215  1.00 70.73  ? 90  VAL A CG2   1 
ATOM   481   N  N     . LYS A  1 91  ? 21.122  2.153    88.735  1.00 76.68  ? 91  LYS A N     1 
ATOM   482   C  CA    . LYS A  1 91  ? 20.384  1.365    89.716  1.00 78.73  ? 91  LYS A CA    1 
ATOM   483   C  C     . LYS A  1 91  ? 19.250  0.584    89.068  1.00 75.95  ? 91  LYS A C     1 
ATOM   484   O  O     . LYS A  1 91  ? 18.485  1.136    88.278  1.00 73.54  ? 91  LYS A O     1 
ATOM   485   C  CB    . LYS A  1 91  ? 19.833  2.274    90.824  1.00 82.58  ? 91  LYS A CB    1 
ATOM   486   C  CG    . LYS A  1 91  ? 20.914  2.956    91.655  1.00 86.74  ? 91  LYS A CG    1 
ATOM   487   C  CD    . LYS A  1 91  ? 20.397  4.160    92.428  1.00 91.09  ? 91  LYS A CD    1 
ATOM   488   C  CE    . LYS A  1 91  ? 21.459  4.662    93.412  1.00 96.19  ? 91  LYS A CE    1 
ATOM   489   N  NZ    . LYS A  1 91  ? 20.888  5.497    94.522  1.00 101.36 ? 91  LYS A NZ    1 
ATOM   490   N  N     . ARG A  1 92  ? 19.160  -0.705   89.391  1.00 76.44  ? 92  ARG A N     1 
ATOM   491   C  CA    . ARG A  1 92  ? 17.971  -1.484   89.096  1.00 75.62  ? 92  ARG A CA    1 
ATOM   492   C  C     . ARG A  1 92  ? 16.810  -0.792   89.777  1.00 77.97  ? 92  ARG A C     1 
ATOM   493   O  O     . ARG A  1 92  ? 17.011  -0.040   90.731  1.00 81.25  ? 92  ARG A O     1 
ATOM   494   C  CB    . ARG A  1 92  ? 18.084  -2.887   89.672  1.00 77.48  ? 92  ARG A CB    1 
ATOM   495   C  CG    . ARG A  1 92  ? 18.849  -3.881   88.836  1.00 76.02  ? 92  ARG A CG    1 
ATOM   496   C  CD    . ARG A  1 92  ? 18.669  -5.288   89.413  1.00 79.60  ? 92  ARG A CD    1 
ATOM   497   N  NE    . ARG A  1 92  ? 17.426  -5.910   88.951  1.00 80.10  ? 92  ARG A NE    1 
ATOM   498   C  CZ    . ARG A  1 92  ? 16.768  -6.878   89.590  1.00 83.19  ? 92  ARG A CZ    1 
ATOM   499   N  NH1   . ARG A  1 92  ? 17.213  -7.356   90.745  1.00 86.70  ? 92  ARG A NH1   1 
ATOM   500   N  NH2   . ARG A  1 92  ? 15.649  -7.368   89.070  1.00 82.46  ? 92  ARG A NH2   1 
ATOM   501   N  N     . THR A  1 93  ? 15.597  -1.026   89.291  1.00 76.96  ? 93  THR A N     1 
ATOM   502   C  CA    . THR A  1 93  ? 14.408  -0.549   89.988  1.00 79.88  ? 93  THR A CA    1 
ATOM   503   C  C     . THR A  1 93  ? 13.571  -1.746   90.382  1.00 81.66  ? 93  THR A C     1 
ATOM   504   O  O     . THR A  1 93  ? 12.752  -1.666   91.297  1.00 85.58  ? 93  THR A O     1 
ATOM   505   C  CB    . THR A  1 93  ? 13.566  0.405    89.137  1.00 78.01  ? 93  THR A CB    1 
ATOM   506   O  OG1   . THR A  1 93  ? 12.982  -0.321   88.052  1.00 75.91  ? 93  THR A OG1   1 
ATOM   507   C  CG2   . THR A  1 93  ? 14.417  1.547    88.595  1.00 75.98  ? 93  THR A CG2   1 
ATOM   508   N  N     . GLY A  1 94  ? 13.788  -2.850   89.674  1.00 79.33  ? 94  GLY A N     1 
ATOM   509   C  CA    . GLY A  1 94  ? 13.167  -4.123   89.997  1.00 81.30  ? 94  GLY A CA    1 
ATOM   510   C  C     . GLY A  1 94  ? 11.895  -4.436   89.241  1.00 80.59  ? 94  GLY A C     1 
ATOM   511   O  O     . GLY A  1 94  ? 11.416  -5.565   89.290  1.00 81.74  ? 94  GLY A O     1 
ATOM   512   N  N     . ASN A  1 95  ? 11.337  -3.444   88.551  1.00 79.35  ? 95  ASN A N     1 
ATOM   513   C  CA    . ASN A  1 95  ? 10.068  -3.634   87.840  1.00 79.32  ? 95  ASN A CA    1 
ATOM   514   C  C     . ASN A  1 95  ? 10.226  -3.450   86.348  1.00 75.25  ? 95  ASN A C     1 
ATOM   515   O  O     . ASN A  1 95  ? 10.861  -2.494   85.904  1.00 73.05  ? 95  ASN A O     1 
ATOM   516   C  CB    . ASN A  1 95  ? 8.975   -2.649   88.307  1.00 82.23  ? 95  ASN A CB    1 
ATOM   517   C  CG    . ASN A  1 95  ? 9.138   -2.202   89.742  1.00 85.75  ? 95  ASN A CG    1 
ATOM   518   O  OD1   . ASN A  1 95  ? 8.789   -2.923   90.676  1.00 88.69  ? 95  ASN A OD1   1 
ATOM   519   N  ND2   . ASN A  1 95  ? 9.644   -0.985   89.922  1.00 84.97  ? 95  ASN A ND2   1 
ATOM   520   N  N     . ILE A  1 96  ? 9.616   -4.352   85.583  1.00 74.79  ? 96  ILE A N     1 
ATOM   521   C  CA    . ILE A  1 96  ? 9.428   -4.147   84.149  1.00 72.49  ? 96  ILE A CA    1 
ATOM   522   C  C     . ILE A  1 96  ? 8.623   -2.859   84.000  1.00 73.38  ? 96  ILE A C     1 
ATOM   523   O  O     . ILE A  1 96  ? 7.845   -2.523   84.898  1.00 76.57  ? 96  ILE A O     1 
ATOM   524   C  CB    . ILE A  1 96  ? 8.655   -5.328   83.507  1.00 72.83  ? 96  ILE A CB    1 
ATOM   525   C  CG1   . ILE A  1 96  ? 9.188   -6.672   84.007  1.00 73.63  ? 96  ILE A CG1   1 
ATOM   526   C  CG2   . ILE A  1 96  ? 8.731   -5.274   81.996  1.00 70.71  ? 96  ILE A CG2   1 
ATOM   527   C  CD1   . ILE A  1 96  ? 10.587  -6.999   83.534  1.00 71.26  ? 96  ILE A CD1   1 
ATOM   528   N  N     . VAL A  1 97  ? 8.814   -2.129   82.899  1.00 71.30  ? 97  VAL A N     1 
ATOM   529   C  CA    . VAL A  1 97  ? 8.065   -0.892   82.690  1.00 72.58  ? 97  VAL A CA    1 
ATOM   530   C  C     . VAL A  1 97  ? 6.591   -1.178   82.841  1.00 76.12  ? 97  VAL A C     1 
ATOM   531   O  O     . VAL A  1 97  ? 6.069   -2.155   82.281  1.00 76.59  ? 97  VAL A O     1 
ATOM   532   C  CB    . VAL A  1 97  ? 8.246   -0.286   81.302  1.00 69.98  ? 97  VAL A CB    1 
ATOM   533   C  CG1   . VAL A  1 97  ? 7.636   1.104    81.274  1.00 70.70  ? 97  VAL A CG1   1 
ATOM   534   C  CG2   . VAL A  1 97  ? 9.701   -0.214   80.934  1.00 68.50  ? 97  VAL A CG2   1 
ATOM   535   N  N     . ASP A  1 98  ? 5.924   -0.331   83.612  1.00 65.48  ? 98  ASP A N     1 
ATOM   536   C  CA    . ASP A  1 98  ? 4.501   -0.443   83.763  1.00 65.77  ? 98  ASP A CA    1 
ATOM   537   C  C     . ASP A  1 98  ? 3.883   0.953    83.819  1.00 64.76  ? 98  ASP A C     1 
ATOM   538   O  O     . ASP A  1 98  ? 4.592   1.954    83.695  1.00 64.77  ? 98  ASP A O     1 
ATOM   539   C  CB    . ASP A  1 98  ? 4.157   -1.303   84.985  1.00 68.43  ? 98  ASP A CB    1 
ATOM   540   C  CG    . ASP A  1 98  ? 4.362   -0.578   86.314  1.00 71.56  ? 98  ASP A CG    1 
ATOM   541   O  OD1   . ASP A  1 98  ? 4.438   0.675    86.324  1.00 70.95  ? 98  ASP A OD1   1 
ATOM   542   O  OD2   . ASP A  1 98  ? 4.425   -1.281   87.360  1.00 75.66  ? 98  ASP A OD2   1 
ATOM   543   N  N     . VAL A  1 99  ? 2.567   1.015    84.005  1.00 64.15  ? 99  VAL A N     1 
ATOM   544   C  CA    . VAL A  1 99  ? 1.845   2.272    83.997  1.00 62.50  ? 99  VAL A CA    1 
ATOM   545   C  C     . VAL A  1 99  ? 0.622   2.164    84.909  1.00 63.17  ? 99  VAL A C     1 
ATOM   546   O  O     . VAL A  1 99  ? 0.028   1.085    85.002  1.00 63.63  ? 99  VAL A O     1 
ATOM   547   C  CB    . VAL A  1 99  ? 1.430   2.634    82.567  1.00 60.45  ? 99  VAL A CB    1 
ATOM   548   C  CG1   . VAL A  1 99  ? 0.661   1.474    81.922  1.00 60.61  ? 99  VAL A CG1   1 
ATOM   549   C  CG2   . VAL A  1 99  ? 0.629   3.943    82.524  1.00 59.70  ? 99  VAL A CG2   1 
ATOM   550   N  N     . PRO A  1 100 ? 0.276   3.270    85.613  1.00 63.05  ? 100 PRO A N     1 
ATOM   551   C  CA    . PRO A  1 100 ? -0.958  3.413    86.373  1.00 63.72  ? 100 PRO A CA    1 
ATOM   552   C  C     . PRO A  1 100 ? -2.167  3.202    85.482  1.00 62.26  ? 100 PRO A C     1 
ATOM   553   O  O     . PRO A  1 100 ? -2.196  3.708    84.365  1.00 60.60  ? 100 PRO A O     1 
ATOM   554   C  CB    . PRO A  1 100 ? -0.918  4.878    86.822  1.00 63.83  ? 100 PRO A CB    1 
ATOM   555   C  CG    . PRO A  1 100 ? 0.137   5.519    85.980  1.00 62.50  ? 100 PRO A CG    1 
ATOM   556   C  CD    . PRO A  1 100 ? 1.126   4.458    85.788  1.00 62.77  ? 100 PRO A CD    1 
ATOM   557   N  N     . VAL A  1 101 ? -3.142  2.439    85.957  1.00 62.95  ? 101 VAL A N     1 
ATOM   558   C  CA    . VAL A  1 101 ? -4.369  2.250    85.202  1.00 61.90  ? 101 VAL A CA    1 
ATOM   559   C  C     . VAL A  1 101 ? -5.586  2.499    86.090  1.00 63.45  ? 101 VAL A C     1 
ATOM   560   O  O     . VAL A  1 101 ? -5.495  2.405    87.321  1.00 65.32  ? 101 VAL A O     1 
ATOM   561   C  CB    . VAL A  1 101 ? -4.453  0.858    84.533  1.00 61.67  ? 101 VAL A CB    1 
ATOM   562   C  CG1   . VAL A  1 101 ? -3.232  0.591    83.670  1.00 59.92  ? 101 VAL A CG1   1 
ATOM   563   C  CG2   . VAL A  1 101 ? -4.655  -0.242   85.568  1.00 64.06  ? 101 VAL A CG2   1 
ATOM   564   N  N     . GLY A  1 102 ? -6.716  2.824    85.462  1.00 62.60  ? 102 GLY A N     1 
ATOM   565   C  CA    . GLY A  1 102 ? -7.971  3.018    86.190  1.00 63.79  ? 102 GLY A CA    1 
ATOM   566   C  C     . GLY A  1 102 ? -8.646  4.330    85.848  1.00 62.88  ? 102 GLY A C     1 
ATOM   567   O  O     . GLY A  1 102 ? -8.048  5.187    85.183  1.00 62.02  ? 102 GLY A O     1 
ATOM   568   N  N     . PRO A  1 103 ? -9.894  4.504    86.308  1.00 63.42  ? 103 PRO A N     1 
ATOM   569   C  CA    . PRO A  1 103 ? -10.721 5.665    85.983  1.00 62.71  ? 103 PRO A CA    1 
ATOM   570   C  C     . PRO A  1 103 ? -10.164 6.995    86.492  1.00 62.70  ? 103 PRO A C     1 
ATOM   571   O  O     . PRO A  1 103 ? -10.639 8.060    86.087  1.00 62.14  ? 103 PRO A O     1 
ATOM   572   C  CB    . PRO A  1 103 ? -12.054 5.345    86.666  1.00 64.22  ? 103 PRO A CB    1 
ATOM   573   C  CG    . PRO A  1 103 ? -11.726 4.355    87.707  1.00 65.69  ? 103 PRO A CG    1 
ATOM   574   C  CD    . PRO A  1 103 ? -10.609 3.546    87.163  1.00 65.14  ? 103 PRO A CD    1 
ATOM   575   N  N     . GLY A  1 104 ? -9.172  6.939    87.372  1.00 63.46  ? 104 GLY A N     1 
ATOM   576   C  CA    . GLY A  1 104 ? -8.527  8.154    87.858  1.00 64.30  ? 104 GLY A CA    1 
ATOM   577   C  C     . GLY A  1 104 ? -7.836  8.936    86.747  1.00 62.74  ? 104 GLY A C     1 
ATOM   578   O  O     . GLY A  1 104 ? -7.375  10.067   86.954  1.00 63.17  ? 104 GLY A O     1 
ATOM   579   N  N     . LEU A  1 105 ? -7.782  8.326    85.566  1.00 61.08  ? 105 LEU A N     1 
ATOM   580   C  CA    . LEU A  1 105 ? -7.072  8.860    84.420  1.00 59.50  ? 105 LEU A CA    1 
ATOM   581   C  C     . LEU A  1 105 ? -8.010  9.566    83.452  1.00 58.68  ? 105 LEU A C     1 
ATOM   582   O  O     . LEU A  1 105 ? -7.558  10.233   82.515  1.00 57.98  ? 105 LEU A O     1 
ATOM   583   C  CB    . LEU A  1 105 ? -6.373  7.716    83.683  1.00 58.65  ? 105 LEU A CB    1 
ATOM   584   C  CG    . LEU A  1 105 ? -5.071  7.171    84.257  1.00 59.45  ? 105 LEU A CG    1 
ATOM   585   C  CD1   . LEU A  1 105 ? -4.793  5.793    83.706  1.00 59.44  ? 105 LEU A CD1   1 
ATOM   586   C  CD2   . LEU A  1 105 ? -3.948  8.109    83.883  1.00 59.10  ? 105 LEU A CD2   1 
ATOM   587   N  N     . LEU A  1 106 ? -9.315  9.391    83.660  1.00 59.09  ? 106 LEU A N     1 
ATOM   588   C  CA    . LEU A  1 106 ? -10.317 10.011   82.815  1.00 57.91  ? 106 LEU A CA    1 
ATOM   589   C  C     . LEU A  1 106 ? -10.214 11.527   82.927  1.00 58.48  ? 106 LEU A C     1 
ATOM   590   O  O     . LEU A  1 106 ? -10.249 12.088   84.025  1.00 59.95  ? 106 LEU A O     1 
ATOM   591   C  CB    . LEU A  1 106 ? -11.721 9.494    83.154  1.00 58.42  ? 106 LEU A CB    1 
ATOM   592   C  CG    . LEU A  1 106 ? -11.972 8.019    82.795  1.00 57.17  ? 106 LEU A CG    1 
ATOM   593   C  CD1   . LEU A  1 106 ? -13.211 7.470    83.453  1.00 56.89  ? 106 LEU A CD1   1 
ATOM   594   C  CD2   . LEU A  1 106 ? -12.029 7.762    81.295  1.00 54.66  ? 106 LEU A CD2   1 
ATOM   595   N  N     . GLY A  1 107 ? -10.040 12.166   81.770  1.00 57.49  ? 107 GLY A N     1 
ATOM   596   C  CA    . GLY A  1 107 ? -9.940  13.610   81.654  1.00 57.79  ? 107 GLY A CA    1 
ATOM   597   C  C     . GLY A  1 107 ? -8.508  14.070   81.746  1.00 57.76  ? 107 GLY A C     1 
ATOM   598   O  O     . GLY A  1 107 ? -8.223  15.268   81.640  1.00 58.79  ? 107 GLY A O     1 
ATOM   599   N  N     . ARG A  1 108 ? -7.595  13.122   81.941  1.00 56.95  ? 108 ARG A N     1 
ATOM   600   C  CA    . ARG A  1 108 ? -6.196  13.460   82.139  1.00 56.30  ? 108 ARG A CA    1 
ATOM   601   C  C     . ARG A  1 108 ? -5.364  13.295   80.884  1.00 54.99  ? 108 ARG A C     1 
ATOM   602   O  O     . ARG A  1 108 ? -5.685  12.477   80.021  1.00 53.47  ? 108 ARG A O     1 
ATOM   603   C  CB    . ARG A  1 108 ? -5.591  12.627   83.271  1.00 57.11  ? 108 ARG A CB    1 
ATOM   604   C  CG    . ARG A  1 108 ? -6.339  12.697   84.591  1.00 56.80  ? 108 ARG A CG    1 
ATOM   605   C  CD    . ARG A  1 108 ? -6.522  14.121   85.053  1.00 54.42  ? 108 ARG A CD    1 
ATOM   606   N  NE    . ARG A  1 108 ? -5.269  14.806   85.319  1.00 51.72  ? 108 ARG A NE    1 
ATOM   607   C  CZ    . ARG A  1 108 ? -4.659  14.808   86.497  1.00 53.53  ? 108 ARG A CZ    1 
ATOM   608   N  NH1   . ARG A  1 108 ? -5.171  14.138   87.514  1.00 55.41  ? 108 ARG A NH1   1 
ATOM   609   N  NH2   . ARG A  1 108 ? -3.521  15.466   86.659  1.00 53.93  ? 108 ARG A NH2   1 
ATOM   610   N  N     . VAL A  1 109 ? -4.298  14.095   80.803  1.00 55.53  ? 109 VAL A N     1 
ATOM   611   C  CA    . VAL A  1 109 ? -3.279  13.965   79.772  1.00 54.81  ? 109 VAL A CA    1 
ATOM   612   C  C     . VAL A  1 109 ? -2.007  13.548   80.464  1.00 55.61  ? 109 VAL A C     1 
ATOM   613   O  O     . VAL A  1 109 ? -1.504  14.266   81.319  1.00 57.48  ? 109 VAL A O     1 
ATOM   614   C  CB    . VAL A  1 109 ? -2.995  15.288   79.035  1.00 54.60  ? 109 VAL A CB    1 
ATOM   615   C  CG1   . VAL A  1 109 ? -2.054  15.038   77.851  1.00 53.65  ? 109 VAL A CG1   1 
ATOM   616   C  CG2   . VAL A  1 109 ? -4.267  15.912   78.546  1.00 54.95  ? 109 VAL A CG2   1 
ATOM   617   N  N     . VAL A  1 110 ? -1.487  12.385   80.095  1.00 55.28  ? 110 VAL A N     1 
ATOM   618   C  CA    . VAL A  1 110 ? -0.289  11.828   80.727  1.00 55.74  ? 110 VAL A CA    1 
ATOM   619   C  C     . VAL A  1 110 ? 0.813   11.674   79.698  1.00 54.86  ? 110 VAL A C     1 
ATOM   620   O  O     . VAL A  1 110 ? 0.527   11.642   78.488  1.00 53.90  ? 110 VAL A O     1 
ATOM   621   C  CB    . VAL A  1 110 ? -0.568  10.435   81.360  1.00 55.99  ? 110 VAL A CB    1 
ATOM   622   C  CG1   . VAL A  1 110 ? -1.355  10.584   82.618  1.00 57.25  ? 110 VAL A CG1   1 
ATOM   623   C  CG2   . VAL A  1 110 ? -1.297  9.504    80.374  1.00 54.74  ? 110 VAL A CG2   1 
ATOM   624   N  N     . ASP A  1 111 ? 2.055   11.567   80.175  1.00 55.31  ? 111 ASP A N     1 
ATOM   625   C  CA    . ASP A  1 111 ? 3.168   11.133   79.333  1.00 54.82  ? 111 ASP A CA    1 
ATOM   626   C  C     . ASP A  1 111 ? 3.148   9.605    79.169  1.00 54.15  ? 111 ASP A C     1 
ATOM   627   O  O     . ASP A  1 111 ? 2.240   8.943    79.680  1.00 54.67  ? 111 ASP A O     1 
ATOM   628   C  CB    . ASP A  1 111 ? 4.509   11.660   79.853  1.00 56.14  ? 111 ASP A CB    1 
ATOM   629   C  CG    . ASP A  1 111 ? 5.005   10.938   81.104  1.00 59.70  ? 111 ASP A CG    1 
ATOM   630   O  OD1   . ASP A  1 111 ? 4.544   9.819    81.423  1.00 62.62  ? 111 ASP A OD1   1 
ATOM   631   O  OD2   . ASP A  1 111 ? 5.898   11.499   81.774  1.00 63.00  ? 111 ASP A OD2   1 
ATOM   632   N  N     . ALA A  1 112 ? 4.125   9.041    78.457  1.00 53.20  ? 112 ALA A N     1 
ATOM   633   C  CA    . ALA A  1 112 ? 4.080   7.607    78.126  1.00 52.51  ? 112 ALA A CA    1 
ATOM   634   C  C     . ALA A  1 112 ? 4.145   6.719    79.359  1.00 53.71  ? 112 ALA A C     1 
ATOM   635   O  O     . ALA A  1 112 ? 3.647   5.605    79.349  1.00 53.91  ? 112 ALA A O     1 
ATOM   636   C  CB    . ALA A  1 112 ? 5.165   7.235    77.128  1.00 51.49  ? 112 ALA A CB    1 
ATOM   637   N  N     . LEU A  1 113 ? 4.745   7.224    80.427  1.00 54.91  ? 113 LEU A N     1 
ATOM   638   C  CA    . LEU A  1 113 ? 4.888   6.450    81.648  1.00 56.40  ? 113 LEU A CA    1 
ATOM   639   C  C     . LEU A  1 113 ? 3.759   6.726    82.619  1.00 57.58  ? 113 LEU A C     1 
ATOM   640   O  O     . LEU A  1 113 ? 3.808   6.263    83.752  1.00 59.89  ? 113 LEU A O     1 
ATOM   641   C  CB    . LEU A  1 113 ? 6.237   6.732    82.314  1.00 57.18  ? 113 LEU A CB    1 
ATOM   642   C  CG    . LEU A  1 113 ? 7.453   6.308    81.496  1.00 56.37  ? 113 LEU A CG    1 
ATOM   643   C  CD1   . LEU A  1 113 ? 8.719   6.958    82.017  1.00 56.44  ? 113 LEU A CD1   1 
ATOM   644   C  CD2   . LEU A  1 113 ? 7.570   4.795    81.462  1.00 56.67  ? 113 LEU A CD2   1 
ATOM   645   N  N     . GLY A  1 114 ? 2.748   7.477    82.187  1.00 56.74  ? 114 GLY A N     1 
ATOM   646   C  CA    . GLY A  1 114 ? 1.584   7.753    83.029  1.00 57.43  ? 114 GLY A CA    1 
ATOM   647   C  C     . GLY A  1 114 ? 1.754   8.934    83.965  1.00 58.63  ? 114 GLY A C     1 
ATOM   648   O  O     . GLY A  1 114 ? 0.915   9.169    84.835  1.00 59.87  ? 114 GLY A O     1 
ATOM   649   N  N     . ASN A  1 115 ? 2.839   9.680    83.798  1.00 58.54  ? 115 ASN A N     1 
ATOM   650   C  CA    . ASN A  1 115 ? 3.010   10.934   84.518  1.00 59.93  ? 115 ASN A CA    1 
ATOM   651   C  C     . ASN A  1 115 ? 2.075   12.000   83.967  1.00 59.34  ? 115 ASN A C     1 
ATOM   652   O  O     . ASN A  1 115 ? 2.007   12.191   82.753  1.00 58.28  ? 115 ASN A O     1 
ATOM   653   C  CB    . ASN A  1 115 ? 4.444   11.419   84.406  1.00 60.35  ? 115 ASN A CB    1 
ATOM   654   C  CG    . ASN A  1 115 ? 5.417   10.510   85.111  1.00 62.17  ? 115 ASN A CG    1 
ATOM   655   O  OD1   . ASN A  1 115 ? 5.190   10.113   86.260  1.00 64.03  ? 115 ASN A OD1   1 
ATOM   656   N  ND2   . ASN A  1 115 ? 6.517   10.174   84.431  1.00 61.68  ? 115 ASN A ND2   1 
ATOM   657   N  N     . PRO A  1 116 ? 1.341   12.697   84.847  1.00 60.37  ? 116 PRO A N     1 
ATOM   658   C  CA    . PRO A  1 116 ? 0.411   13.661   84.290  1.00 59.65  ? 116 PRO A CA    1 
ATOM   659   C  C     . PRO A  1 116 ? 1.158   14.887   83.773  1.00 59.45  ? 116 PRO A C     1 
ATOM   660   O  O     . PRO A  1 116 ? 2.127   15.331   84.397  1.00 60.55  ? 116 PRO A O     1 
ATOM   661   C  CB    . PRO A  1 116 ? -0.469  14.020   85.490  1.00 61.33  ? 116 PRO A CB    1 
ATOM   662   C  CG    . PRO A  1 116 ? 0.424   13.857   86.661  1.00 62.70  ? 116 PRO A CG    1 
ATOM   663   C  CD    . PRO A  1 116 ? 1.358   12.728   86.321  1.00 62.34  ? 116 PRO A CD    1 
ATOM   664   N  N     . ILE A  1 117 ? 0.719   15.420   82.638  1.00 58.04  ? 117 ILE A N     1 
ATOM   665   C  CA    . ILE A  1 117 ? 1.302   16.659   82.113  1.00 58.12  ? 117 ILE A CA    1 
ATOM   666   C  C     . ILE A  1 117 ? 0.318   17.843   82.018  1.00 58.82  ? 117 ILE A C     1 
ATOM   667   O  O     . ILE A  1 117 ? 0.725   18.980   81.800  1.00 59.71  ? 117 ILE A O     1 
ATOM   668   C  CB    . ILE A  1 117 ? 2.057   16.426   80.786  1.00 56.32  ? 117 ILE A CB    1 
ATOM   669   C  CG1   . ILE A  1 117 ? 1.168   15.691   79.779  1.00 55.22  ? 117 ILE A CG1   1 
ATOM   670   C  CG2   . ILE A  1 117 ? 3.334   15.645   81.064  1.00 55.88  ? 117 ILE A CG2   1 
ATOM   671   C  CD1   . ILE A  1 117 ? 1.667   15.722   78.350  1.00 53.93  ? 117 ILE A CD1   1 
ATOM   672   N  N     . ASP A  1 118 ? -0.964  17.572   82.231  1.00 58.89  ? 118 ASP A N     1 
ATOM   673   C  CA    . ASP A  1 118 ? -2.021  18.584   82.136  1.00 59.57  ? 118 ASP A CA    1 
ATOM   674   C  C     . ASP A  1 118 ? -2.029  19.686   83.206  1.00 61.31  ? 118 ASP A C     1 
ATOM   675   O  O     . ASP A  1 118 ? -2.836  20.597   83.142  1.00 62.43  ? 118 ASP A O     1 
ATOM   676   C  CB    . ASP A  1 118 ? -3.392  17.900   82.086  1.00 59.41  ? 118 ASP A CB    1 
ATOM   677   C  CG    . ASP A  1 118 ? -3.551  16.799   83.127  1.00 60.39  ? 118 ASP A CG    1 
ATOM   678   O  OD1   . ASP A  1 118 ? -2.683  16.663   84.014  1.00 60.75  ? 118 ASP A OD1   1 
ATOM   679   O  OD2   . ASP A  1 118 ? -4.564  16.063   83.049  1.00 61.65  ? 118 ASP A OD2   1 
ATOM   680   N  N     . GLY A  1 119 ? -1.134  19.607   84.178  1.00 62.04  ? 119 GLY A N     1 
ATOM   681   C  CA    . GLY A  1 119 ? -1.096  20.577   85.264  1.00 63.55  ? 119 GLY A CA    1 
ATOM   682   C  C     . GLY A  1 119 ? -2.137  20.318   86.338  1.00 64.67  ? 119 GLY A C     1 
ATOM   683   O  O     . GLY A  1 119 ? -2.328  21.158   87.217  1.00 67.02  ? 119 GLY A O     1 
ATOM   684   N  N     . LYS A  1 120 ? -2.798  19.157   86.291  1.00 63.32  ? 120 LYS A N     1 
ATOM   685   C  CA    . LYS A  1 120 ? -3.916  18.852   87.206  1.00 64.23  ? 120 LYS A CA    1 
ATOM   686   C  C     . LYS A  1 120 ? -3.605  17.978   88.431  1.00 65.03  ? 120 LYS A C     1 
ATOM   687   O  O     . LYS A  1 120 ? -4.513  17.443   89.058  1.00 65.44  ? 120 LYS A O     1 
ATOM   688   C  CB    . LYS A  1 120 ? -5.076  18.223   86.438  1.00 63.17  ? 120 LYS A CB    1 
ATOM   689   C  CG    . LYS A  1 120 ? -5.937  19.191   85.665  1.00 63.62  ? 120 LYS A CG    1 
ATOM   690   C  CD    . LYS A  1 120 ? -6.835  18.432   84.745  1.00 62.40  ? 120 LYS A CD    1 
ATOM   691   C  CE    . LYS A  1 120 ? -7.794  19.348   84.076  1.00 64.96  ? 120 LYS A CE    1 
ATOM   692   N  NZ    . LYS A  1 120 ? -8.891  18.534   83.458  1.00 68.08  ? 120 LYS A NZ    1 
ATOM   693   N  N     . GLY A  1 121 ? -2.333  17.830   88.778  1.00 65.22  ? 121 GLY A N     1 
ATOM   694   C  CA    . GLY A  1 121 ? -1.974  17.101   89.990  1.00 66.19  ? 121 GLY A CA    1 
ATOM   695   C  C     . GLY A  1 121 ? -1.915  15.597   89.812  1.00 64.77  ? 121 GLY A C     1 
ATOM   696   O  O     . GLY A  1 121 ? -2.137  15.091   88.715  1.00 62.80  ? 121 GLY A O     1 
ATOM   697   N  N     . PRO A  1 122 ? -1.614  14.869   90.901  1.00 66.08  ? 122 PRO A N     1 
ATOM   698   C  CA    . PRO A  1 122 ? -1.412  13.422   90.892  1.00 65.79  ? 122 PRO A CA    1 
ATOM   699   C  C     . PRO A  1 122 ? -2.521  12.644   90.190  1.00 64.85  ? 122 PRO A C     1 
ATOM   700   O  O     . PRO A  1 122 ? -3.677  13.086   90.190  1.00 65.43  ? 122 PRO A O     1 
ATOM   701   C  CB    . PRO A  1 122 ? -1.406  13.073   92.383  1.00 68.08  ? 122 PRO A CB    1 
ATOM   702   C  CG    . PRO A  1 122 ? -0.874  14.284   93.036  1.00 69.23  ? 122 PRO A CG    1 
ATOM   703   C  CD    . PRO A  1 122 ? -1.416  15.434   92.248  1.00 68.53  ? 122 PRO A CD    1 
ATOM   704   N  N     . ILE A  1 123 ? -2.159  11.498   89.609  1.00 63.93  ? 123 ILE A N     1 
ATOM   705   C  CA    . ILE A  1 123 ? -3.121  10.547   89.042  1.00 63.40  ? 123 ILE A CA    1 
ATOM   706   C  C     . ILE A  1 123 ? -3.407  9.388    90.006  1.00 65.41  ? 123 ILE A C     1 
ATOM   707   O  O     . ILE A  1 123 ? -2.557  8.523    90.209  1.00 65.88  ? 123 ILE A O     1 
ATOM   708   C  CB    . ILE A  1 123 ? -2.613  9.937    87.715  1.00 61.20  ? 123 ILE A CB    1 
ATOM   709   C  CG1   . ILE A  1 123 ? -2.305  11.025   86.676  1.00 60.05  ? 123 ILE A CG1   1 
ATOM   710   C  CG2   . ILE A  1 123 ? -3.594  8.890    87.186  1.00 60.39  ? 123 ILE A CG2   1 
ATOM   711   C  CD1   . ILE A  1 123 ? -3.514  11.717   86.092  1.00 59.31  ? 123 ILE A CD1   1 
ATOM   712   N  N     . ASP A  1 124 ? -4.605  9.369    90.585  1.00 67.19  ? 124 ASP A N     1 
ATOM   713   C  CA    . ASP A  1 124 ? -5.048  8.250    91.411  1.00 69.35  ? 124 ASP A CA    1 
ATOM   714   C  C     . ASP A  1 124 ? -5.197  6.981    90.576  1.00 68.01  ? 124 ASP A C     1 
ATOM   715   O  O     . ASP A  1 124 ? -6.022  6.931    89.664  1.00 66.86  ? 124 ASP A O     1 
ATOM   716   C  CB    . ASP A  1 124 ? -6.373  8.588    92.101  1.00 71.28  ? 124 ASP A CB    1 
ATOM   717   C  CG    . ASP A  1 124 ? -6.190  9.471    93.329  1.00 75.62  ? 124 ASP A CG    1 
ATOM   718   O  OD1   . ASP A  1 124 ? -5.062  9.982    93.516  1.00 78.50  ? 124 ASP A OD1   1 
ATOM   719   O  OD2   . ASP A  1 124 ? -7.164  9.651    94.112  1.00 79.14  ? 124 ASP A OD2   1 
ATOM   720   N  N     . ALA A  1 125 ? -4.391  5.967    90.881  1.00 68.55  ? 125 ALA A N     1 
ATOM   721   C  CA    . ALA A  1 125 ? -4.439  4.691    90.161  1.00 67.62  ? 125 ALA A CA    1 
ATOM   722   C  C     . ALA A  1 125 ? -5.216  3.637    90.936  1.00 69.50  ? 125 ALA A C     1 
ATOM   723   O  O     . ALA A  1 125 ? -5.153  3.590    92.154  1.00 71.68  ? 125 ALA A O     1 
ATOM   724   C  CB    . ALA A  1 125 ? -3.035  4.195    89.876  1.00 67.07  ? 125 ALA A CB    1 
ATOM   725   N  N     . ALA A  1 126 ? -5.953  2.792    90.226  1.00 69.11  ? 126 ALA A N     1 
ATOM   726   C  CA    . ALA A  1 126 ? -6.581  1.633    90.851  1.00 71.47  ? 126 ALA A CA    1 
ATOM   727   C  C     . ALA A  1 126 ? -5.511  0.576    91.108  1.00 72.86  ? 126 ALA A C     1 
ATOM   728   O  O     . ALA A  1 126 ? -5.578  -0.175   92.081  1.00 75.62  ? 126 ALA A O     1 
ATOM   729   C  CB    . ALA A  1 126 ? -7.694  1.074    89.972  1.00 70.46  ? 126 ALA A CB    1 
ATOM   730   N  N     . GLY A  1 127 ? -4.521  0.542    90.225  1.00 71.43  ? 127 GLY A N     1 
ATOM   731   C  CA    . GLY A  1 127 ? -3.389  -0.357   90.329  1.00 72.70  ? 127 GLY A CA    1 
ATOM   732   C  C     . GLY A  1 127 ? -2.451  -0.067   89.175  1.00 71.04  ? 127 GLY A C     1 
ATOM   733   O  O     . GLY A  1 127 ? -2.710  0.821    88.356  1.00 69.19  ? 127 GLY A O     1 
ATOM   734   N  N     . ARG A  1 128 ? -1.359  -0.811   89.097  1.00 71.83  ? 128 ARG A N     1 
ATOM   735   C  CA    . ARG A  1 128 ? -0.398  -0.593   88.031  1.00 70.33  ? 128 ARG A CA    1 
ATOM   736   C  C     . ARG A  1 128 ? -0.393  -1.783   87.060  1.00 70.37  ? 128 ARG A C     1 
ATOM   737   O  O     . ARG A  1 128 ? -0.772  -2.901   87.438  1.00 72.09  ? 128 ARG A O     1 
ATOM   738   C  CB    . ARG A  1 128 ? 0.990   -0.313   88.620  1.00 71.07  ? 128 ARG A CB    1 
ATOM   739   C  CG    . ARG A  1 128 ? 1.054   0.964    89.458  1.00 70.80  ? 128 ARG A CG    1 
ATOM   740   C  CD    . ARG A  1 128 ? 2.481   1.338    89.830  1.00 71.13  ? 128 ARG A CD    1 
ATOM   741   N  NE    . ARG A  1 128 ? 3.276   1.712    88.659  1.00 69.70  ? 128 ARG A NE    1 
ATOM   742   C  CZ    . ARG A  1 128 ? 3.376   2.950    88.172  1.00 69.22  ? 128 ARG A CZ    1 
ATOM   743   N  NH1   . ARG A  1 128 ? 2.731   3.961    88.748  1.00 70.13  ? 128 ARG A NH1   1 
ATOM   744   N  NH2   . ARG A  1 128 ? 4.110   3.181    87.089  1.00 66.98  ? 128 ARG A NH2   1 
ATOM   745   N  N     . SER A  1 129 ? 0.009   -1.541   85.809  1.00 68.51  ? 129 SER A N     1 
ATOM   746   C  CA    . SER A  1 129 ? 0.012   -2.600   84.806  1.00 68.33  ? 129 SER A CA    1 
ATOM   747   C  C     . SER A  1 129 ? 1.161   -2.478   83.846  1.00 67.06  ? 129 SER A C     1 
ATOM   748   O  O     . SER A  1 129 ? 1.482   -1.379   83.411  1.00 65.69  ? 129 SER A O     1 
ATOM   749   C  CB    . SER A  1 129 ? -1.295  -2.607   84.024  1.00 67.23  ? 129 SER A CB    1 
ATOM   750   O  OG    . SER A  1 129 ? -2.372  -2.940   84.874  1.00 69.89  ? 129 SER A OG    1 
ATOM   751   N  N     . ARG A  1 130 ? 1.755   -3.623   83.512  1.00 68.11  ? 130 ARG A N     1 
ATOM   752   C  CA    . ARG A  1 130 ? 2.877   -3.720   82.571  1.00 67.48  ? 130 ARG A CA    1 
ATOM   753   C  C     . ARG A  1 130 ? 2.551   -3.192   81.188  1.00 65.02  ? 130 ARG A C     1 
ATOM   754   O  O     . ARG A  1 130 ? 1.432   -3.381   80.698  1.00 64.33  ? 130 ARG A O     1 
ATOM   755   C  CB    . ARG A  1 130 ? 3.312   -5.170   82.427  1.00 68.95  ? 130 ARG A CB    1 
ATOM   756   C  CG    . ARG A  1 130 ? 4.124   -5.655   83.578  1.00 72.79  ? 130 ARG A CG    1 
ATOM   757   C  CD    . ARG A  1 130 ? 4.477   -7.091   83.387  1.00 76.65  ? 130 ARG A CD    1 
ATOM   758   N  NE    . ARG A  1 130 ? 5.525   -7.490   84.310  1.00 80.92  ? 130 ARG A NE    1 
ATOM   759   C  CZ    . ARG A  1 130 ? 5.881   -8.750   84.512  1.00 84.92  ? 130 ARG A CZ    1 
ATOM   760   N  NH1   . ARG A  1 130 ? 5.253   -9.718   83.854  1.00 86.00  ? 130 ARG A NH1   1 
ATOM   761   N  NH2   . ARG A  1 130 ? 6.862   -9.044   85.362  1.00 87.61  ? 130 ARG A NH2   1 
ATOM   762   N  N     . ALA A  1 131 ? 3.531   -2.545   80.559  1.00 63.65  ? 131 ALA A N     1 
ATOM   763   C  CA    . ALA A  1 131 ? 3.367   -2.092   79.190  1.00 61.65  ? 131 ALA A CA    1 
ATOM   764   C  C     . ALA A  1 131 ? 3.062   -3.285   78.286  1.00 61.89  ? 131 ALA A C     1 
ATOM   765   O  O     . ALA A  1 131 ? 1.989   -3.318   77.685  1.00 61.68  ? 131 ALA A O     1 
ATOM   766   C  CB    . ALA A  1 131 ? 4.573   -1.333   78.717  1.00 60.77  ? 131 ALA A CB    1 
ATOM   767   N  N     . GLN A  1 132 ? 3.964   -4.272   78.224  1.00 62.82  ? 132 GLN A N     1 
ATOM   768   C  CA    . GLN A  1 132 ? 3.727   -5.507   77.457  1.00 63.19  ? 132 GLN A CA    1 
ATOM   769   C  C     . GLN A  1 132 ? 2.855   -6.495   78.218  1.00 64.11  ? 132 GLN A C     1 
ATOM   770   O  O     . GLN A  1 132 ? 3.216   -6.925   79.318  1.00 65.55  ? 132 GLN A O     1 
ATOM   771   C  CB    . GLN A  1 132 ? 5.036   -6.214   77.076  1.00 64.39  ? 132 GLN A CB    1 
ATOM   772   C  CG    . GLN A  1 132 ? 6.184   -5.325   76.606  1.00 66.95  ? 132 GLN A CG    1 
ATOM   773   C  CD    . GLN A  1 132 ? 5.838   -4.433   75.410  1.00 69.66  ? 132 GLN A CD    1 
ATOM   774   O  OE1   . GLN A  1 132 ? 4.929   -4.734   74.613  1.00 70.51  ? 132 GLN A OE1   1 
ATOM   775   N  NE2   . GLN A  1 132 ? 6.579   -3.323   75.276  1.00 69.96  ? 132 GLN A NE2   1 
ATOM   776   N  N     . VAL A  1 133 ? 1.721   -6.856   77.609  1.00 63.21  ? 133 VAL A N     1 
ATOM   777   C  CA    . VAL A  1 133 ? 0.773   -7.850   78.150  1.00 64.54  ? 133 VAL A CA    1 
ATOM   778   C  C     . VAL A  1 133 ? 0.211   -8.734   77.035  1.00 64.08  ? 133 VAL A C     1 
ATOM   779   O  O     . VAL A  1 133 ? -0.194  -8.217   75.987  1.00 62.27  ? 133 VAL A O     1 
ATOM   780   C  CB    . VAL A  1 133 ? -0.456  -7.200   78.869  1.00 64.46  ? 133 VAL A CB    1 
ATOM   781   C  CG1   . VAL A  1 133 ? -1.166  -8.233   79.741  1.00 66.99  ? 133 VAL A CG1   1 
ATOM   782   C  CG2   . VAL A  1 133 ? -0.050  -6.016   79.718  1.00 64.02  ? 133 VAL A CG2   1 
ATOM   783   N  N     . LYS A  1 134 ? 0.155   -10.048  77.286  1.00 65.61  ? 134 LYS A N     1 
ATOM   784   C  CA    . LYS A  1 134 ? -0.428  -11.024  76.355  1.00 65.95  ? 134 LYS A CA    1 
ATOM   785   C  C     . LYS A  1 134 ? -1.869  -10.682  75.980  1.00 64.84  ? 134 LYS A C     1 
ATOM   786   O  O     . LYS A  1 134 ? -2.701  -10.461  76.863  1.00 65.64  ? 134 LYS A O     1 
ATOM   787   C  CB    . LYS A  1 134 ? -0.427  -12.420  76.972  1.00 68.91  ? 134 LYS A CB    1 
ATOM   788   C  CG    . LYS A  1 134 ? 0.920   -12.974  77.314  1.00 71.74  ? 134 LYS A CG    1 
ATOM   789   C  CD    . LYS A  1 134 ? 1.376   -13.969  76.272  1.00 75.33  ? 134 LYS A CD    1 
ATOM   790   C  CE    . LYS A  1 134 ? 2.902   -13.933  76.112  1.00 77.01  ? 134 LYS A CE    1 
ATOM   791   N  NZ    . LYS A  1 134 ? 3.661   -14.461  77.284  1.00 79.51  ? 134 LYS A NZ    1 
ATOM   792   N  N     . ALA A  1 135 ? -2.164  -10.647  74.678  1.00 63.19  ? 135 ALA A N     1 
ATOM   793   C  CA    . ALA A  1 135 ? -3.540  -10.476  74.192  1.00 62.19  ? 135 ALA A CA    1 
ATOM   794   C  C     . ALA A  1 135 ? -4.421  -11.656  74.608  1.00 64.17  ? 135 ALA A C     1 
ATOM   795   O  O     . ALA A  1 135 ? -3.940  -12.793  74.685  1.00 65.90  ? 135 ALA A O     1 
ATOM   796   C  CB    . ALA A  1 135 ? -3.556  -10.335  72.690  1.00 60.73  ? 135 ALA A CB    1 
ATOM   797   N  N     . PRO A  1 136 ? -5.711  -11.390  74.889  1.00 63.96  ? 136 PRO A N     1 
ATOM   798   C  CA    . PRO A  1 136 ? -6.661  -12.468  75.123  1.00 65.77  ? 136 PRO A CA    1 
ATOM   799   C  C     . PRO A  1 136 ? -6.492  -13.556  74.061  1.00 66.54  ? 136 PRO A C     1 
ATOM   800   O  O     . PRO A  1 136 ? -6.392  -13.251  72.866  1.00 65.17  ? 136 PRO A O     1 
ATOM   801   C  CB    . PRO A  1 136 ? -8.005  -11.768  74.953  1.00 65.15  ? 136 PRO A CB    1 
ATOM   802   C  CG    . PRO A  1 136 ? -7.748  -10.359  75.394  1.00 63.02  ? 136 PRO A CG    1 
ATOM   803   C  CD    . PRO A  1 136 ? -6.322  -10.058  75.080  1.00 62.23  ? 136 PRO A CD    1 
ATOM   804   N  N     . GLY A  1 137 ? -6.443  -14.812  74.492  1.00 68.88  ? 137 GLY A N     1 
ATOM   805   C  CA    . GLY A  1 137 ? -6.197  -15.928  73.578  1.00 69.82  ? 137 GLY A CA    1 
ATOM   806   C  C     . GLY A  1 137 ? -7.373  -16.284  72.691  1.00 70.02  ? 137 GLY A C     1 
ATOM   807   O  O     . GLY A  1 137 ? -8.317  -15.521  72.562  1.00 68.75  ? 137 GLY A O     1 
ATOM   808   N  N     . ILE A  1 138 ? -7.306  -17.454  72.069  1.00 71.94  ? 138 ILE A N     1 
ATOM   809   C  CA    . ILE A  1 138 ? -8.391  -17.961  71.237  1.00 72.96  ? 138 ILE A CA    1 
ATOM   810   C  C     . ILE A  1 138 ? -9.709  -17.973  71.998  1.00 73.99  ? 138 ILE A C     1 
ATOM   811   O  O     . ILE A  1 138 ? -10.730 -17.503  71.510  1.00 73.35  ? 138 ILE A O     1 
ATOM   812   C  CB    . ILE A  1 138 ? -8.088  -19.399  70.762  1.00 75.53  ? 138 ILE A CB    1 
ATOM   813   C  CG1   . ILE A  1 138 ? -7.163  -19.384  69.545  1.00 75.23  ? 138 ILE A CG1   1 
ATOM   814   C  CG2   . ILE A  1 138 ? -9.368  -20.151  70.437  1.00 77.83  ? 138 ILE A CG2   1 
ATOM   815   C  CD1   . ILE A  1 138 ? -7.678  -18.563  68.375  1.00 74.31  ? 138 ILE A CD1   1 
ATOM   816   N  N     . LEU A  1 139 ? -9.658  -18.489  73.215  1.00 75.76  ? 139 LEU A N     1 
ATOM   817   C  CA    . LEU A  1 139 ? -10.849 -18.830  73.963  1.00 77.32  ? 139 LEU A CA    1 
ATOM   818   C  C     . LEU A  1 139 ? -11.668 -17.666  74.553  1.00 75.69  ? 139 LEU A C     1 
ATOM   819   O  O     . LEU A  1 139 ? -12.879 -17.614  74.319  1.00 76.37  ? 139 LEU A O     1 
ATOM   820   C  CB    . LEU A  1 139 ? -10.491 -19.835  75.046  1.00 80.03  ? 139 LEU A CB    1 
ATOM   821   C  CG    . LEU A  1 139 ? -11.601 -20.807  75.362  1.00 83.37  ? 139 LEU A CG    1 
ATOM   822   C  CD1   . LEU A  1 139 ? -11.726 -21.831  74.246  1.00 85.33  ? 139 LEU A CD1   1 
ATOM   823   C  CD2   . LEU A  1 139 ? -11.255 -21.460  76.672  1.00 87.75  ? 139 LEU A CD2   1 
ATOM   824   N  N     . PRO A  1 140 ? -11.038 -16.738  75.318  1.00 73.74  ? 140 PRO A N     1 
ATOM   825   C  CA    . PRO A  1 140 ? -11.885 -15.767  76.021  1.00 72.72  ? 140 PRO A CA    1 
ATOM   826   C  C     . PRO A  1 140 ? -12.418 -14.631  75.140  1.00 70.07  ? 140 PRO A C     1 
ATOM   827   O  O     . PRO A  1 140 ? -12.570 -13.508  75.611  1.00 68.87  ? 140 PRO A O     1 
ATOM   828   C  CB    . PRO A  1 140 ? -10.957 -15.219  77.105  1.00 71.97  ? 140 PRO A CB    1 
ATOM   829   C  CG    . PRO A  1 140 ? -9.626  -15.288  76.509  1.00 71.12  ? 140 PRO A CG    1 
ATOM   830   C  CD    . PRO A  1 140 ? -9.610  -16.479  75.574  1.00 72.73  ? 140 PRO A CD    1 
ATOM   831   N  N     . ARG A  1 141 ? -12.714 -14.931  73.880  1.00 69.49  ? 141 ARG A N     1 
ATOM   832   C  CA    . ARG A  1 141 ? -13.278 -13.947  72.975  1.00 67.31  ? 141 ARG A CA    1 
ATOM   833   C  C     . ARG A  1 141 ? -14.642 -14.365  72.462  1.00 68.69  ? 141 ARG A C     1 
ATOM   834   O  O     . ARG A  1 141 ? -14.904 -15.538  72.234  1.00 70.98  ? 141 ARG A O     1 
ATOM   835   C  CB    . ARG A  1 141 ? -12.359 -13.727  71.789  1.00 65.61  ? 141 ARG A CB    1 
ATOM   836   C  CG    . ARG A  1 141 ? -10.985 -13.241  72.143  1.00 64.10  ? 141 ARG A CG    1 
ATOM   837   C  CD    . ARG A  1 141 ? -10.040 -13.531  71.003  1.00 63.16  ? 141 ARG A CD    1 
ATOM   838   N  NE    . ARG A  1 141 ? -8.751  -12.874  71.199  1.00 62.36  ? 141 ARG A NE    1 
ATOM   839   C  CZ    . ARG A  1 141 ? -8.412  -11.704  70.671  1.00 59.06  ? 141 ARG A CZ    1 
ATOM   840   N  NH1   . ARG A  1 141 ? -9.260  -11.035  69.904  1.00 58.23  ? 141 ARG A NH1   1 
ATOM   841   N  NH2   . ARG A  1 141 ? -7.217  -11.207  70.917  1.00 58.59  ? 141 ARG A NH2   1 
ATOM   842   N  N     . ARG A  1 142 ? -15.501 -13.376  72.269  1.00 67.61  ? 142 ARG A N     1 
ATOM   843   C  CA    . ARG A  1 142 ? -16.820 -13.555  71.688  1.00 68.35  ? 142 ARG A CA    1 
ATOM   844   C  C     . ARG A  1 142 ? -16.836 -12.781  70.363  1.00 66.49  ? 142 ARG A C     1 
ATOM   845   O  O     . ARG A  1 142 ? -16.214 -11.715  70.263  1.00 64.71  ? 142 ARG A O     1 
ATOM   846   C  CB    . ARG A  1 142 ? -17.840 -12.973  72.664  1.00 68.92  ? 142 ARG A CB    1 
ATOM   847   C  CG    . ARG A  1 142 ? -19.273 -13.237  72.331  1.00 70.64  ? 142 ARG A CG    1 
ATOM   848   C  CD    . ARG A  1 142 ? -19.922 -12.064  71.664  1.00 68.80  ? 142 ARG A CD    1 
ATOM   849   N  NE    . ARG A  1 142 ? -21.288 -12.394  71.304  1.00 71.85  ? 142 ARG A NE    1 
ATOM   850   C  CZ    . ARG A  1 142 ? -22.244 -12.653  72.193  1.00 75.51  ? 142 ARG A CZ    1 
ATOM   851   N  NH1   . ARG A  1 142 ? -21.982 -12.628  73.498  1.00 75.95  ? 142 ARG A NH1   1 
ATOM   852   N  NH2   . ARG A  1 142 ? -23.467 -12.950  71.777  1.00 78.56  ? 142 ARG A NH2   1 
ATOM   853   N  N     . SER A  1 143 ? -17.520 -13.307  69.349  1.00 67.14  ? 143 SER A N     1 
ATOM   854   C  CA    . SER A  1 143 ? -17.638 -12.616  68.065  1.00 65.91  ? 143 SER A CA    1 
ATOM   855   C  C     . SER A  1 143 ? -18.118 -11.184  68.233  1.00 64.67  ? 143 SER A C     1 
ATOM   856   O  O     . SER A  1 143 ? -19.042 -10.922  68.997  1.00 65.89  ? 143 SER A O     1 
ATOM   857   C  CB    . SER A  1 143 ? -18.589 -13.349  67.129  1.00 67.60  ? 143 SER A CB    1 
ATOM   858   O  OG    . SER A  1 143 ? -17.921 -14.377  66.428  1.00 69.15  ? 143 SER A OG    1 
ATOM   859   N  N     . VAL A  1 144 ? -17.485 -10.265  67.509  1.00 62.99  ? 144 VAL A N     1 
ATOM   860   C  CA    . VAL A  1 144 ? -17.832 -8.853   67.535  1.00 61.79  ? 144 VAL A CA    1 
ATOM   861   C  C     . VAL A  1 144 ? -19.292 -8.720   67.105  1.00 63.56  ? 144 VAL A C     1 
ATOM   862   O  O     . VAL A  1 144 ? -19.700 -9.310   66.097  1.00 65.19  ? 144 VAL A O     1 
ATOM   863   C  CB    . VAL A  1 144 ? -16.859 -8.049   66.631  1.00 59.63  ? 144 VAL A CB    1 
ATOM   864   C  CG1   . VAL A  1 144 ? -17.356 -6.657   66.363  1.00 58.45  ? 144 VAL A CG1   1 
ATOM   865   C  CG2   . VAL A  1 144 ? -15.493 -7.952   67.300  1.00 58.46  ? 144 VAL A CG2   1 
ATOM   866   N  N     . HIS A  1 145 ? -20.095 -8.000   67.888  1.00 63.80  ? 145 HIS A N     1 
ATOM   867   C  CA    . HIS A  1 145 ? -21.534 -7.902   67.585  1.00 64.98  ? 145 HIS A CA    1 
ATOM   868   C  C     . HIS A  1 145 ? -22.183 -6.548   67.893  1.00 64.41  ? 145 HIS A C     1 
ATOM   869   O  O     . HIS A  1 145 ? -23.317 -6.291   67.483  1.00 65.59  ? 145 HIS A O     1 
ATOM   870   C  CB    . HIS A  1 145 ? -22.321 -9.048   68.234  1.00 67.09  ? 145 HIS A CB    1 
ATOM   871   C  CG    . HIS A  1 145 ? -22.430 -8.969   69.729  1.00 67.18  ? 145 HIS A CG    1 
ATOM   872   N  ND1   . HIS A  1 145 ? -21.349 -9.130   70.569  1.00 66.82  ? 145 HIS A ND1   1 
ATOM   873   C  CD2   . HIS A  1 145 ? -23.505 -8.809   70.536  1.00 67.99  ? 145 HIS A CD2   1 
ATOM   874   C  CE1   . HIS A  1 145 ? -21.748 -9.049   71.826  1.00 66.94  ? 145 HIS A CE1   1 
ATOM   875   N  NE2   . HIS A  1 145 ? -23.053 -8.860   71.833  1.00 68.15  ? 145 HIS A NE2   1 
ATOM   876   N  N     . GLU A  1 146 ? -21.448 -5.687   68.586  1.00 62.58  ? 146 GLU A N     1 
ATOM   877   C  CA    . GLU A  1 146 ? -21.977 -4.430   69.045  1.00 61.89  ? 146 GLU A CA    1 
ATOM   878   C  C     . GLU A  1 146 ? -21.348 -3.292   68.277  1.00 60.37  ? 146 GLU A C     1 
ATOM   879   O  O     . GLU A  1 146 ? -20.125 -3.223   68.161  1.00 59.42  ? 146 GLU A O     1 
ATOM   880   C  CB    . GLU A  1 146 ? -21.663 -4.248   70.520  1.00 61.83  ? 146 GLU A CB    1 
ATOM   881   C  CG    . GLU A  1 146 ? -22.157 -5.356   71.412  1.00 63.53  ? 146 GLU A CG    1 
ATOM   882   C  CD    . GLU A  1 146 ? -21.421 -5.376   72.715  1.00 63.47  ? 146 GLU A CD    1 
ATOM   883   O  OE1   . GLU A  1 146 ? -20.202 -5.639   72.697  1.00 62.92  ? 146 GLU A OE1   1 
ATOM   884   O  OE2   . GLU A  1 146 ? -22.055 -5.128   73.759  1.00 65.34  ? 146 GLU A OE2   1 
ATOM   885   N  N     . PRO A  1 147 ? -22.181 -2.390   67.745  1.00 60.54  ? 147 PRO A N     1 
ATOM   886   C  CA    . PRO A  1 147 ? -21.760 -1.140   67.126  1.00 59.04  ? 147 PRO A CA    1 
ATOM   887   C  C     . PRO A  1 147 ? -20.835 -0.269   67.971  1.00 57.60  ? 147 PRO A C     1 
ATOM   888   O  O     . PRO A  1 147 ? -21.043 -0.109   69.174  1.00 58.30  ? 147 PRO A O     1 
ATOM   889   C  CB    . PRO A  1 147 ? -23.081 -0.418   66.923  1.00 60.01  ? 147 PRO A CB    1 
ATOM   890   C  CG    . PRO A  1 147 ? -24.005 -1.514   66.590  1.00 61.97  ? 147 PRO A CG    1 
ATOM   891   C  CD    . PRO A  1 147 ? -23.592 -2.681   67.444  1.00 62.30  ? 147 PRO A CD    1 
ATOM   892   N  N     . VAL A  1 148 ? -19.800 0.248    67.320  1.00 55.87  ? 148 VAL A N     1 
ATOM   893   C  CA    . VAL A  1 148 ? -19.078 1.431    67.749  1.00 54.24  ? 148 VAL A CA    1 
ATOM   894   C  C     . VAL A  1 148 ? -19.604 2.486    66.791  1.00 54.15  ? 148 VAL A C     1 
ATOM   895   O  O     . VAL A  1 148 ? -19.280 2.485    65.599  1.00 53.81  ? 148 VAL A O     1 
ATOM   896   C  CB    . VAL A  1 148 ? -17.536 1.263    67.594  1.00 52.81  ? 148 VAL A CB    1 
ATOM   897   C  CG1   . VAL A  1 148 ? -16.837 2.615    67.472  1.00 51.99  ? 148 VAL A CG1   1 
ATOM   898   C  CG2   . VAL A  1 148 ? -16.953 0.472    68.749  1.00 52.35  ? 148 VAL A CG2   1 
ATOM   899   N  N     . GLN A  1 149 ? -20.468 3.355    67.294  1.00 54.94  ? 149 GLN A N     1 
ATOM   900   C  CA    . GLN A  1 149 ? -21.093 4.365    66.442  1.00 55.11  ? 149 GLN A CA    1 
ATOM   901   C  C     . GLN A  1 149 ? -20.199 5.583    66.275  1.00 53.68  ? 149 GLN A C     1 
ATOM   902   O  O     . GLN A  1 149 ? -20.017 6.369    67.194  1.00 53.31  ? 149 GLN A O     1 
ATOM   903   C  CB    . GLN A  1 149 ? -22.483 4.732    66.959  1.00 56.42  ? 149 GLN A CB    1 
ATOM   904   C  CG    . GLN A  1 149 ? -23.534 3.726    66.543  1.00 58.85  ? 149 GLN A CG    1 
ATOM   905   C  CD    . GLN A  1 149 ? -24.793 3.798    67.381  1.00 63.09  ? 149 GLN A CD    1 
ATOM   906   O  OE1   . GLN A  1 149 ? -25.778 4.416    66.981  1.00 65.96  ? 149 GLN A OE1   1 
ATOM   907   N  NE2   . GLN A  1 149 ? -24.769 3.169    68.555  1.00 63.86  ? 149 GLN A NE2   1 
ATOM   908   N  N     . THR A  1 150 ? -19.621 5.712    65.091  1.00 53.21  ? 150 THR A N     1 
ATOM   909   C  CA    . THR A  1 150 ? -18.776 6.848    64.782  1.00 52.70  ? 150 THR A CA    1 
ATOM   910   C  C     . THR A  1 150 ? -19.641 8.094    64.603  1.00 54.22  ? 150 THR A C     1 
ATOM   911   O  O     . THR A  1 150 ? -19.198 9.208    64.876  1.00 54.45  ? 150 THR A O     1 
ATOM   912   C  CB    . THR A  1 150 ? -17.966 6.628    63.492  1.00 51.89  ? 150 THR A CB    1 
ATOM   913   O  OG1   . THR A  1 150 ? -18.862 6.504    62.380  1.00 53.36  ? 150 THR A OG1   1 
ATOM   914   C  CG2   . THR A  1 150 ? -17.090 5.381    63.598  1.00 50.71  ? 150 THR A CG2   1 
ATOM   915   N  N     . GLY A  1 151 ? -20.875 7.911    64.144  1.00 55.48  ? 151 GLY A N     1 
ATOM   916   C  CA    . GLY A  1 151 ? -21.729 9.044    63.845  1.00 56.85  ? 151 GLY A CA    1 
ATOM   917   C  C     . GLY A  1 151 ? -21.439 9.678    62.491  1.00 57.17  ? 151 GLY A C     1 
ATOM   918   O  O     . GLY A  1 151 ? -21.929 10.766   62.186  1.00 58.09  ? 151 GLY A O     1 
ATOM   919   N  N     . LEU A  1 152 ? -20.646 8.993    61.676  1.00 56.33  ? 152 LEU A N     1 
ATOM   920   C  CA    . LEU A  1 152 ? -20.288 9.486    60.364  1.00 56.66  ? 152 LEU A CA    1 
ATOM   921   C  C     . LEU A  1 152 ? -21.015 8.630    59.353  1.00 58.01  ? 152 LEU A C     1 
ATOM   922   O  O     . LEU A  1 152 ? -20.730 7.434    59.254  1.00 57.98  ? 152 LEU A O     1 
ATOM   923   C  CB    . LEU A  1 152 ? -18.783 9.341    60.143  1.00 55.08  ? 152 LEU A CB    1 
ATOM   924   C  CG    . LEU A  1 152 ? -17.793 10.189   60.930  1.00 53.67  ? 152 LEU A CG    1 
ATOM   925   C  CD1   . LEU A  1 152 ? -16.409 9.597    60.805  1.00 52.35  ? 152 LEU A CD1   1 
ATOM   926   C  CD2   . LEU A  1 152 ? -17.807 11.584   60.407  1.00 54.22  ? 152 LEU A CD2   1 
ATOM   927   N  N     . LYS A  1 153 ? -21.934 9.236    58.598  1.00 59.69  ? 153 LYS A N     1 
ATOM   928   C  CA    . LYS A  1 153 ? -22.731 8.517    57.605  1.00 61.10  ? 153 LYS A CA    1 
ATOM   929   C  C     . LYS A  1 153 ? -21.871 7.597    56.756  1.00 60.78  ? 153 LYS A C     1 
ATOM   930   O  O     . LYS A  1 153 ? -22.150 6.401    56.655  1.00 61.32  ? 153 LYS A O     1 
ATOM   931   C  CB    . LYS A  1 153 ? -23.465 9.476    56.681  1.00 62.87  ? 153 LYS A CB    1 
ATOM   932   C  CG    . LYS A  1 153 ? -24.463 10.384   57.353  1.00 63.80  ? 153 LYS A CG    1 
ATOM   933   C  CD    . LYS A  1 153 ? -24.875 11.496   56.408  1.00 64.38  ? 153 LYS A CD    1 
ATOM   934   C  CE    . LYS A  1 153 ? -23.810 12.578   56.332  1.00 62.78  ? 153 LYS A CE    1 
ATOM   935   N  NZ    . LYS A  1 153 ? -24.389 13.865   55.841  1.00 64.73  ? 153 LYS A NZ    1 
ATOM   936   N  N     . ALA A  1 154 ? -20.815 8.147    56.163  1.00 60.15  ? 154 ALA A N     1 
ATOM   937   C  CA    . ALA A  1 154 ? -20.024 7.382    55.210  1.00 60.19  ? 154 ALA A CA    1 
ATOM   938   C  C     . ALA A  1 154 ? -19.505 6.090    55.829  1.00 59.47  ? 154 ALA A C     1 
ATOM   939   O  O     . ALA A  1 154 ? -19.471 5.061    55.163  1.00 60.13  ? 154 ALA A O     1 
ATOM   940   C  CB    . ALA A  1 154 ? -18.887 8.215    54.670  1.00 59.32  ? 154 ALA A CB    1 
ATOM   941   N  N     . VAL A  1 155 ? -19.144 6.154    57.112  1.00 58.62  ? 155 VAL A N     1 
ATOM   942   C  CA    . VAL A  1 155 ? -18.490 5.057    57.817  1.00 57.97  ? 155 VAL A CA    1 
ATOM   943   C  C     . VAL A  1 155 ? -19.528 4.091    58.319  1.00 59.29  ? 155 VAL A C     1 
ATOM   944   O  O     . VAL A  1 155 ? -19.526 2.918    57.956  1.00 59.73  ? 155 VAL A O     1 
ATOM   945   C  CB    . VAL A  1 155 ? -17.702 5.567    59.043  1.00 56.67  ? 155 VAL A CB    1 
ATOM   946   C  CG1   . VAL A  1 155 ? -16.926 4.421    59.726  1.00 55.76  ? 155 VAL A CG1   1 
ATOM   947   C  CG2   . VAL A  1 155 ? -16.759 6.683    58.643  1.00 56.36  ? 155 VAL A CG2   1 
ATOM   948   N  N     . ASP A  1 156 ? -20.412 4.606    59.166  1.00 60.27  ? 156 ASP A N     1 
ATOM   949   C  CA    . ASP A  1 156 ? -21.475 3.833    59.781  1.00 61.72  ? 156 ASP A CA    1 
ATOM   950   C  C     . ASP A  1 156 ? -22.336 3.102    58.763  1.00 63.34  ? 156 ASP A C     1 
ATOM   951   O  O     . ASP A  1 156 ? -22.808 2.000    59.027  1.00 64.34  ? 156 ASP A O     1 
ATOM   952   C  CB    . ASP A  1 156 ? -22.354 4.750    60.627  1.00 62.64  ? 156 ASP A CB    1 
ATOM   953   C  CG    . ASP A  1 156 ? -21.888 4.855    62.094  1.00 63.21  ? 156 ASP A CG    1 
ATOM   954   O  OD1   . ASP A  1 156 ? -20.687 4.593    62.427  1.00 60.09  ? 156 ASP A OD1   1 
ATOM   955   O  OD2   . ASP A  1 156 ? -22.773 5.208    62.917  1.00 66.14  ? 156 ASP A OD2   1 
ATOM   956   N  N     . ALA A  1 157 ? -22.539 3.702    57.597  1.00 64.06  ? 157 ALA A N     1 
ATOM   957   C  CA    . ALA A  1 157 ? -23.306 3.034    56.554  1.00 65.75  ? 157 ALA A CA    1 
ATOM   958   C  C     . ALA A  1 157 ? -22.498 1.997    55.775  1.00 65.55  ? 157 ALA A C     1 
ATOM   959   O  O     . ALA A  1 157 ? -23.039 0.957    55.418  1.00 66.98  ? 157 ALA A O     1 
ATOM   960   C  CB    . ALA A  1 157 ? -23.927 4.042    55.607  1.00 67.15  ? 157 ALA A CB    1 
ATOM   961   N  N     . LEU A  1 158 ? -21.213 2.268    55.530  1.00 64.09  ? 158 LEU A N     1 
ATOM   962   C  CA    . LEU A  1 158 ? -20.428 1.489    54.563  1.00 64.00  ? 158 LEU A CA    1 
ATOM   963   C  C     . LEU A  1 158 ? -19.253 0.692    55.114  1.00 62.70  ? 158 LEU A C     1 
ATOM   964   O  O     . LEU A  1 158 ? -18.770 -0.234   54.456  1.00 63.26  ? 158 LEU A O     1 
ATOM   965   C  CB    . LEU A  1 158 ? -19.866 2.407    53.485  1.00 63.91  ? 158 LEU A CB    1 
ATOM   966   C  CG    . LEU A  1 158 ? -20.788 3.260    52.633  1.00 65.28  ? 158 LEU A CG    1 
ATOM   967   C  CD1   . LEU A  1 158 ? -19.906 4.248    51.885  1.00 63.37  ? 158 LEU A CD1   1 
ATOM   968   C  CD2   . LEU A  1 158 ? -21.626 2.395    51.689  1.00 66.22  ? 158 LEU A CD2   1 
ATOM   969   N  N     . VAL A  1 159 ? -18.753 1.078    56.284  1.00 61.26  ? 159 VAL A N     1 
ATOM   970   C  CA    . VAL A  1 159 ? -17.574 0.433    56.877  1.00 59.64  ? 159 VAL A CA    1 
ATOM   971   C  C     . VAL A  1 159 ? -17.797 0.357    58.388  1.00 58.86  ? 159 VAL A C     1 
ATOM   972   O  O     . VAL A  1 159 ? -17.136 1.056    59.151  1.00 57.19  ? 159 VAL A O     1 
ATOM   973   C  CB    . VAL A  1 159 ? -16.274 1.231    56.566  1.00 58.40  ? 159 VAL A CB    1 
ATOM   974   C  CG1   . VAL A  1 159 ? -15.044 0.410    56.894  1.00 57.91  ? 159 VAL A CG1   1 
ATOM   975   C  CG2   . VAL A  1 159 ? -16.227 1.682    55.103  1.00 58.88  ? 159 VAL A CG2   1 
ATOM   976   N  N     . PRO A  1 160 ? -18.754 -0.480   58.827  1.00 60.10  ? 160 PRO A N     1 
ATOM   977   C  CA    . PRO A  1 160 ? -19.146 -0.430   60.232  1.00 60.05  ? 160 PRO A CA    1 
ATOM   978   C  C     . PRO A  1 160 ? -18.129 -1.077   61.158  1.00 59.23  ? 160 PRO A C     1 
ATOM   979   O  O     . PRO A  1 160 ? -17.654 -2.181   60.889  1.00 59.93  ? 160 PRO A O     1 
ATOM   980   C  CB    . PRO A  1 160 ? -20.468 -1.206   60.266  1.00 61.82  ? 160 PRO A CB    1 
ATOM   981   C  CG    . PRO A  1 160 ? -20.620 -1.853   58.931  1.00 62.58  ? 160 PRO A CG    1 
ATOM   982   C  CD    . PRO A  1 160 ? -19.413 -1.585   58.108  1.00 61.69  ? 160 PRO A CD    1 
ATOM   983   N  N     . ILE A  1 161 ? -17.803 -0.381   62.242  1.00 58.27  ? 161 ILE A N     1 
ATOM   984   C  CA    . ILE A  1 161 ? -16.881 -0.881   63.248  1.00 57.54  ? 161 ILE A CA    1 
ATOM   985   C  C     . ILE A  1 161 ? -17.653 -1.455   64.429  1.00 58.29  ? 161 ILE A C     1 
ATOM   986   O  O     . ILE A  1 161 ? -18.570 -0.830   64.914  1.00 59.07  ? 161 ILE A O     1 
ATOM   987   C  CB    . ILE A  1 161 ? -15.983 0.238    63.767  1.00 56.13  ? 161 ILE A CB    1 
ATOM   988   C  CG1   . ILE A  1 161 ? -15.294 0.954    62.605  1.00 55.68  ? 161 ILE A CG1   1 
ATOM   989   C  CG2   . ILE A  1 161 ? -14.938 -0.325   64.728  1.00 56.49  ? 161 ILE A CG2   1 
ATOM   990   C  CD1   . ILE A  1 161 ? -14.849 2.367    62.944  1.00 55.20  ? 161 ILE A CD1   1 
ATOM   991   N  N     . GLY A  1 162 ? -17.282 -2.647   64.886  1.00 58.71  ? 162 GLY A N     1 
ATOM   992   C  CA    . GLY A  1 162 ? -17.879 -3.228   66.086  1.00 59.69  ? 162 GLY A CA    1 
ATOM   993   C  C     . GLY A  1 162 ? -16.969 -3.171   67.298  1.00 59.03  ? 162 GLY A C     1 
ATOM   994   O  O     . GLY A  1 162 ? -15.743 -3.106   67.156  1.00 58.30  ? 162 GLY A O     1 
ATOM   995   N  N     . ARG A  1 163 ? -17.553 -3.185   68.493  1.00 59.35  ? 163 ARG A N     1 
ATOM   996   C  CA    . ARG A  1 163 ? -16.753 -3.190   69.713  1.00 58.92  ? 163 ARG A CA    1 
ATOM   997   C  C     . ARG A  1 163 ? -15.877 -4.442   69.722  1.00 59.32  ? 163 ARG A C     1 
ATOM   998   O  O     . ARG A  1 163 ? -16.390 -5.554   69.699  1.00 61.00  ? 163 ARG A O     1 
ATOM   999   C  CB    . ARG A  1 163 ? -17.638 -3.112   70.964  1.00 59.84  ? 163 ARG A CB    1 
ATOM   1000  C  CG    . ARG A  1 163 ? -18.813 -2.173   70.800  1.00 60.31  ? 163 ARG A CG    1 
ATOM   1001  C  CD    . ARG A  1 163 ? -19.203 -1.412   72.055  1.00 61.01  ? 163 ARG A CD    1 
ATOM   1002  N  NE    . ARG A  1 163 ? -19.700 -0.082   71.679  1.00 60.24  ? 163 ARG A NE    1 
ATOM   1003  C  CZ    . ARG A  1 163 ? -20.165 0.845    72.515  1.00 60.02  ? 163 ARG A CZ    1 
ATOM   1004  N  NH1   . ARG A  1 163 ? -20.230 0.619    73.822  1.00 61.34  ? 163 ARG A NH1   1 
ATOM   1005  N  NH2   . ARG A  1 163 ? -20.574 2.011    72.031  1.00 59.47  ? 163 ARG A NH2   1 
ATOM   1006  N  N     . GLY A  1 164 ? -14.558 -4.247   69.713  1.00 58.25  ? 164 GLY A N     1 
ATOM   1007  C  CA    . GLY A  1 164 ? -13.583 -5.356   69.715  1.00 58.66  ? 164 GLY A CA    1 
ATOM   1008  C  C     . GLY A  1 164 ? -12.704 -5.382   68.474  1.00 57.57  ? 164 GLY A C     1 
ATOM   1009  O  O     . GLY A  1 164 ? -11.673 -6.061   68.421  1.00 57.44  ? 164 GLY A O     1 
ATOM   1010  N  N     . GLN A  1 165 ? -13.134 -4.616   67.484  1.00 56.80  ? 165 GLN A N     1 
ATOM   1011  C  CA    . GLN A  1 165 ? -12.591 -4.629   66.147  1.00 56.27  ? 165 GLN A CA    1 
ATOM   1012  C  C     . GLN A  1 165 ? -11.316 -3.786   66.093  1.00 54.85  ? 165 GLN A C     1 
ATOM   1013  O  O     . GLN A  1 165 ? -11.136 -2.875   66.904  1.00 54.16  ? 165 GLN A O     1 
ATOM   1014  C  CB    . GLN A  1 165 ? -13.677 -4.057   65.222  1.00 56.39  ? 165 GLN A CB    1 
ATOM   1015  C  CG    . GLN A  1 165 ? -13.328 -3.822   63.766  1.00 56.36  ? 165 GLN A CG    1 
ATOM   1016  C  CD    . GLN A  1 165 ? -14.544 -3.930   62.870  1.00 58.05  ? 165 GLN A CD    1 
ATOM   1017  O  OE1   . GLN A  1 165 ? -15.675 -4.010   63.340  1.00 58.69  ? 165 GLN A OE1   1 
ATOM   1018  N  NE2   . GLN A  1 165 ? -14.313 -3.957   61.571  1.00 59.77  ? 165 GLN A NE2   1 
ATOM   1019  N  N     . ARG A  1 166 ? -10.427 -4.106   65.156  1.00 54.48  ? 166 ARG A N     1 
ATOM   1020  C  CA    . ARG A  1 166 ? -9.344  -3.203   64.814  1.00 53.62  ? 166 ARG A CA    1 
ATOM   1021  C  C     . ARG A  1 166 ? -9.640  -2.691   63.425  1.00 53.56  ? 166 ARG A C     1 
ATOM   1022  O  O     . ARG A  1 166 ? -9.528  -3.454   62.469  1.00 54.86  ? 166 ARG A O     1 
ATOM   1023  C  CB    . ARG A  1 166 ? -7.985  -3.919   64.801  1.00 53.64  ? 166 ARG A CB    1 
ATOM   1024  C  CG    . ARG A  1 166 ? -7.392  -4.252   66.170  1.00 53.83  ? 166 ARG A CG    1 
ATOM   1025  C  CD    . ARG A  1 166 ? -7.857  -5.606   66.636  1.00 55.85  ? 166 ARG A CD    1 
ATOM   1026  N  NE    . ARG A  1 166 ? -7.985  -6.516   65.511  1.00 57.49  ? 166 ARG A NE    1 
ATOM   1027  C  CZ    . ARG A  1 166 ? -7.029  -7.329   65.092  1.00 59.09  ? 166 ARG A CZ    1 
ATOM   1028  N  NH1   . ARG A  1 166 ? -5.866  -7.360   65.723  1.00 59.98  ? 166 ARG A NH1   1 
ATOM   1029  N  NH2   . ARG A  1 166 ? -7.243  -8.117   64.042  1.00 60.88  ? 166 ARG A NH2   1 
ATOM   1030  N  N     . GLU A  1 167 ? -10.034 -1.424   63.305  1.00 52.58  ? 167 GLU A N     1 
ATOM   1031  C  CA    . GLU A  1 167 ? -10.265 -0.824   61.995  1.00 51.98  ? 167 GLU A CA    1 
ATOM   1032  C  C     . GLU A  1 167 ? -9.215  0.227    61.749  1.00 50.48  ? 167 GLU A C     1 
ATOM   1033  O  O     . GLU A  1 167 ? -9.115  1.197    62.504  1.00 50.28  ? 167 GLU A O     1 
ATOM   1034  C  CB    . GLU A  1 167 ? -11.644 -0.187   61.920  1.00 52.95  ? 167 GLU A CB    1 
ATOM   1035  C  CG    . GLU A  1 167 ? -11.995 0.397    60.551  1.00 54.45  ? 167 GLU A CG    1 
ATOM   1036  C  CD    . GLU A  1 167 ? -12.226 -0.668   59.472  1.00 57.51  ? 167 GLU A CD    1 
ATOM   1037  O  OE1   . GLU A  1 167 ? -12.342 -1.873   59.802  1.00 59.40  ? 167 GLU A OE1   1 
ATOM   1038  O  OE2   . GLU A  1 167 ? -12.288 -0.294   58.285  1.00 57.41  ? 167 GLU A OE2   1 
ATOM   1039  N  N     . LEU A  1 168 ? -8.422  0.026    60.702  1.00 49.56  ? 168 LEU A N     1 
ATOM   1040  C  CA    . LEU A  1 168 ? -7.319  0.917    60.388  1.00 47.62  ? 168 LEU A CA    1 
ATOM   1041  C  C     . LEU A  1 168 ? -7.854  2.208    59.771  1.00 47.63  ? 168 LEU A C     1 
ATOM   1042  O  O     . LEU A  1 168 ? -8.786  2.181    58.961  1.00 48.49  ? 168 LEU A O     1 
ATOM   1043  C  CB    . LEU A  1 168 ? -6.337  0.221    59.438  1.00 47.04  ? 168 LEU A CB    1 
ATOM   1044  C  CG    . LEU A  1 168 ? -5.220  1.032    58.765  1.00 45.81  ? 168 LEU A CG    1 
ATOM   1045  C  CD1   . LEU A  1 168 ? -4.264  1.639    59.768  1.00 44.25  ? 168 LEU A CD1   1 
ATOM   1046  C  CD2   . LEU A  1 168 ? -4.446  0.194    57.764  1.00 46.20  ? 168 LEU A CD2   1 
ATOM   1047  N  N     . ILE A  1 169 ? -7.281  3.337    60.172  1.00 46.63  ? 169 ILE A N     1 
ATOM   1048  C  CA    . ILE A  1 169 ? -7.448  4.572    59.427  1.00 46.57  ? 169 ILE A CA    1 
ATOM   1049  C  C     . ILE A  1 169 ? -6.121  4.862    58.718  1.00 46.17  ? 169 ILE A C     1 
ATOM   1050  O  O     . ILE A  1 169 ? -5.098  5.087    59.368  1.00 45.52  ? 169 ILE A O     1 
ATOM   1051  C  CB    . ILE A  1 169 ? -7.845  5.742    60.338  1.00 46.47  ? 169 ILE A CB    1 
ATOM   1052  C  CG1   . ILE A  1 169 ? -9.084  5.385    61.156  1.00 47.09  ? 169 ILE A CG1   1 
ATOM   1053  C  CG2   . ILE A  1 169 ? -8.096  6.995    59.511  1.00 47.06  ? 169 ILE A CG2   1 
ATOM   1054  C  CD1   . ILE A  1 169 ? -9.441  6.423    62.190  1.00 48.40  ? 169 ILE A CD1   1 
ATOM   1055  N  N     . ILE A  1 170 ? -6.146  4.843    57.385  1.00 46.49  ? 170 ILE A N     1 
ATOM   1056  C  CA    . ILE A  1 170 ? -4.927  4.909    56.558  1.00 45.71  ? 170 ILE A CA    1 
ATOM   1057  C  C     . ILE A  1 170 ? -5.113  5.955    55.451  1.00 46.42  ? 170 ILE A C     1 
ATOM   1058  O  O     . ILE A  1 170 ? -6.223  6.138    54.937  1.00 47.58  ? 170 ILE A O     1 
ATOM   1059  C  CB    . ILE A  1 170 ? -4.569  3.490    55.962  1.00 45.89  ? 170 ILE A CB    1 
ATOM   1060  C  CG1   . ILE A  1 170 ? -3.267  3.514    55.172  1.00 45.80  ? 170 ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A  1 170 ? -5.663  2.953    55.063  1.00 45.84  ? 170 ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A  1 170 ? -2.657  2.150    54.946  1.00 44.69  ? 170 ILE A CD1   1 
ATOM   1063  N  N     . GLY A  1 171 ? -4.033  6.641    55.094  1.00 45.77  ? 171 GLY A N     1 
ATOM   1064  C  CA    . GLY A  1 171 ? -4.067  7.660    54.055  1.00 46.24  ? 171 GLY A CA    1 
ATOM   1065  C  C     . GLY A  1 171 ? -2.785  8.475    54.083  1.00 46.10  ? 171 GLY A C     1 
ATOM   1066  O  O     . GLY A  1 171 ? -1.960  8.333    54.992  1.00 44.88  ? 171 GLY A O     1 
ATOM   1067  N  N     . ASP A  1 172 ? -2.615  9.326    53.073  1.00 46.80  ? 172 ASP A N     1 
ATOM   1068  C  CA    . ASP A  1 172 ? -1.490  10.239   53.000  1.00 46.21  ? 172 ASP A CA    1 
ATOM   1069  C  C     . ASP A  1 172 ? -1.678  11.358   54.012  1.00 45.92  ? 172 ASP A C     1 
ATOM   1070  O  O     . ASP A  1 172 ? -2.759  11.527   54.568  1.00 45.66  ? 172 ASP A O     1 
ATOM   1071  C  CB    . ASP A  1 172 ? -1.404  10.848   51.593  1.00 47.59  ? 172 ASP A CB    1 
ATOM   1072  C  CG    . ASP A  1 172 ? -0.811  9.892    50.544  1.00 48.15  ? 172 ASP A CG    1 
ATOM   1073  O  OD1   . ASP A  1 172 ? -0.295  8.796    50.884  1.00 47.26  ? 172 ASP A OD1   1 
ATOM   1074  O  OD2   . ASP A  1 172 ? -0.857  10.262   49.349  1.00 50.14  ? 172 ASP A OD2   1 
ATOM   1075  N  N     . ARG A  1 173 ? -0.620  12.132   54.231  1.00 46.27  ? 173 ARG A N     1 
ATOM   1076  C  CA    . ARG A  1 173 ? -0.681  13.369   55.021  1.00 46.96  ? 173 ARG A CA    1 
ATOM   1077  C  C     . ARG A  1 173 ? -1.881  14.245   54.670  1.00 48.37  ? 173 ARG A C     1 
ATOM   1078  O  O     . ARG A  1 173 ? -2.331  14.268   53.523  1.00 49.66  ? 173 ARG A O     1 
ATOM   1079  C  CB    . ARG A  1 173 ? 0.592   14.186   54.814  1.00 47.04  ? 173 ARG A CB    1 
ATOM   1080  C  CG    . ARG A  1 173 ? 0.812   14.601   53.391  1.00 49.06  ? 173 ARG A CG    1 
ATOM   1081  C  CD    . ARG A  1 173 ? 2.045   15.456   53.208  1.00 52.40  ? 173 ARG A CD    1 
ATOM   1082  N  NE    . ARG A  1 173 ? 1.742   16.560   52.298  1.00 57.33  ? 173 ARG A NE    1 
ATOM   1083  C  CZ    . ARG A  1 173 ? 1.886   16.537   50.974  1.00 58.68  ? 173 ARG A CZ    1 
ATOM   1084  N  NH1   . ARG A  1 173 ? 2.357   15.466   50.348  1.00 59.95  ? 173 ARG A NH1   1 
ATOM   1085  N  NH2   . ARG A  1 173 ? 1.572   17.611   50.276  1.00 59.73  ? 173 ARG A NH2   1 
ATOM   1086  N  N     . GLN A  1 174 ? -2.393  14.954   55.672  1.00 48.74  ? 174 GLN A N     1 
ATOM   1087  C  CA    . GLN A  1 174 ? -3.426  15.981   55.491  1.00 50.58  ? 174 GLN A CA    1 
ATOM   1088  C  C     . GLN A  1 174 ? -4.631  15.506   54.660  1.00 51.18  ? 174 GLN A C     1 
ATOM   1089  O  O     . GLN A  1 174 ? -4.988  16.132   53.666  1.00 52.65  ? 174 GLN A O     1 
ATOM   1090  C  CB    . GLN A  1 174 ? -2.807  17.276   54.922  1.00 51.49  ? 174 GLN A CB    1 
ATOM   1091  C  CG    . GLN A  1 174 ? -1.875  17.993   55.889  1.00 52.37  ? 174 GLN A CG    1 
ATOM   1092  C  CD    . GLN A  1 174 ? -0.567  18.492   55.233  1.00 56.36  ? 174 GLN A CD    1 
ATOM   1093  O  OE1   . GLN A  1 174 ? -0.338  18.306   54.031  1.00 59.72  ? 174 GLN A OE1   1 
ATOM   1094  N  NE2   . GLN A  1 174 ? 0.288   19.136   56.029  1.00 56.39  ? 174 GLN A NE2   1 
ATOM   1095  N  N     . THR A  1 175 ? -5.250  14.400   55.073  1.00 50.52  ? 175 THR A N     1 
ATOM   1096  C  CA    . THR A  1 175 ? -6.389  13.820   54.327  1.00 51.09  ? 175 THR A CA    1 
ATOM   1097  C  C     . THR A  1 175 ? -7.665  13.648   55.170  1.00 51.24  ? 175 THR A C     1 
ATOM   1098  O  O     . THR A  1 175 ? -8.776  13.562   54.635  1.00 52.78  ? 175 THR A O     1 
ATOM   1099  C  CB    . THR A  1 175 ? -6.002  12.503   53.575  1.00 50.38  ? 175 THR A CB    1 
ATOM   1100  O  OG1   . THR A  1 175 ? -5.325  11.610   54.458  1.00 48.83  ? 175 THR A OG1   1 
ATOM   1101  C  CG2   . THR A  1 175 ? -5.071  12.809   52.424  1.00 50.65  ? 175 THR A CG2   1 
ATOM   1102  N  N     . GLY A  1 176 ? -7.502  13.619   56.486  1.00 50.33  ? 176 GLY A N     1 
ATOM   1103  C  CA    . GLY A  1 176 ? -8.620  13.609   57.404  1.00 50.79  ? 176 GLY A CA    1 
ATOM   1104  C  C     . GLY A  1 176 ? -8.582  12.468   58.394  1.00 50.13  ? 176 GLY A C     1 
ATOM   1105  O  O     . GLY A  1 176 ? -9.568  12.220   59.090  1.00 50.92  ? 176 GLY A O     1 
ATOM   1106  N  N     . LYS A  1 177 ? -7.450  11.771   58.459  1.00 49.42  ? 177 LYS A N     1 
ATOM   1107  C  CA    . LYS A  1 177 ? -7.282  10.614   59.342  1.00 48.58  ? 177 LYS A CA    1 
ATOM   1108  C  C     . LYS A  1 177 ? -7.647  10.877   60.793  1.00 48.51  ? 177 LYS A C     1 
ATOM   1109  O  O     . LYS A  1 177 ? -8.343  10.070   61.377  1.00 48.61  ? 177 LYS A O     1 
ATOM   1110  C  CB    . LYS A  1 177 ? -5.862  10.030   59.267  1.00 47.78  ? 177 LYS A CB    1 
ATOM   1111  C  CG    . LYS A  1 177 ? -5.374  9.689    57.864  1.00 48.17  ? 177 LYS A CG    1 
ATOM   1112  C  CD    . LYS A  1 177 ? -4.028  8.979    57.869  1.00 46.98  ? 177 LYS A CD    1 
ATOM   1113  C  CE    . LYS A  1 177 ? -2.880  9.868    58.260  1.00 45.85  ? 177 LYS A CE    1 
ATOM   1114  N  NZ    . LYS A  1 177 ? -2.607  10.892   57.236  1.00 48.19  ? 177 LYS A NZ    1 
ATOM   1115  N  N     . THR A  1 178 ? -7.185  11.987   61.375  1.00 48.95  ? 178 THR A N     1 
ATOM   1116  C  CA    . THR A  1 178 ? -7.394  12.238   62.807  1.00 49.95  ? 178 THR A CA    1 
ATOM   1117  C  C     . THR A  1 178 ? -8.829  12.615   63.034  1.00 50.50  ? 178 THR A C     1 
ATOM   1118  O  O     . THR A  1 178 ? -9.439  12.223   64.027  1.00 50.68  ? 178 THR A O     1 
ATOM   1119  C  CB    . THR A  1 178 ? -6.524  13.385   63.358  1.00 50.12  ? 178 THR A CB    1 
ATOM   1120  O  OG1   . THR A  1 178 ? -5.153  12.995   63.389  1.00 55.35  ? 178 THR A OG1   1 
ATOM   1121  C  CG2   . THR A  1 178 ? -6.941  13.741   64.776  1.00 51.01  ? 178 THR A CG2   1 
ATOM   1122  N  N     . ALA A  1 179 ? -9.352  13.401   62.103  1.00 51.54  ? 179 ALA A N     1 
ATOM   1123  C  CA    . ALA A  1 179 ? -10.718 13.862   62.148  1.00 52.74  ? 179 ALA A CA    1 
ATOM   1124  C  C     . ALA A  1 179 ? -11.664 12.675   62.281  1.00 53.03  ? 179 ALA A C     1 
ATOM   1125  O  O     . ALA A  1 179 ? -12.598 12.711   63.089  1.00 54.05  ? 179 ALA A O     1 
ATOM   1126  C  CB    . ALA A  1 179 ? -11.028 14.661   60.913  1.00 53.47  ? 179 ALA A CB    1 
ATOM   1127  N  N     . VAL A  1 180 ? -11.406 11.624   61.507  1.00 52.31  ? 180 VAL A N     1 
ATOM   1128  C  CA    . VAL A  1 180 ? -12.242 10.447   61.527  1.00 52.74  ? 180 VAL A CA    1 
ATOM   1129  C  C     . VAL A  1 180 ? -12.237 9.810    62.913  1.00 52.50  ? 180 VAL A C     1 
ATOM   1130  O  O     . VAL A  1 180 ? -13.253 9.314    63.365  1.00 53.74  ? 180 VAL A O     1 
ATOM   1131  C  CB    . VAL A  1 180 ? -11.849 9.450    60.408  1.00 52.76  ? 180 VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1 180 ? -12.289 8.018    60.737  1.00 53.24  ? 180 VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1 180 ? -12.440 9.892    59.067  1.00 53.10  ? 180 VAL A CG2   1 
ATOM   1134  N  N     . ALA A  1 181 ? -11.113 9.847    63.604  1.00 51.86  ? 181 ALA A N     1 
ATOM   1135  C  CA    . ALA A  1 181 ? -11.060 9.315    64.956  1.00 51.98  ? 181 ALA A CA    1 
ATOM   1136  C  C     . ALA A  1 181 ? -11.722 10.292   65.900  1.00 53.06  ? 181 ALA A C     1 
ATOM   1137  O  O     . ALA A  1 181 ? -12.494 9.899    66.776  1.00 53.98  ? 181 ALA A O     1 
ATOM   1138  C  CB    . ALA A  1 181 ? -9.628  9.077    65.380  1.00 50.98  ? 181 ALA A CB    1 
ATOM   1139  N  N     . LEU A  1 182 ? -11.419 11.571   65.723  1.00 53.52  ? 182 LEU A N     1 
ATOM   1140  C  CA    . LEU A  1 182 ? -11.885 12.586   66.647  1.00 54.71  ? 182 LEU A CA    1 
ATOM   1141  C  C     . LEU A  1 182 ? -13.422 12.728   66.634  1.00 56.31  ? 182 LEU A C     1 
ATOM   1142  O  O     . LEU A  1 182 ? -14.049 12.902   67.681  1.00 57.20  ? 182 LEU A O     1 
ATOM   1143  C  CB    . LEU A  1 182 ? -11.209 13.921   66.345  1.00 54.82  ? 182 LEU A CB    1 
ATOM   1144  C  CG    . LEU A  1 182 ? -11.473 15.025   67.366  1.00 55.99  ? 182 LEU A CG    1 
ATOM   1145  C  CD1   . LEU A  1 182 ? -10.452 14.892   68.448  1.00 55.70  ? 182 LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A  1 182 ? -11.447 16.430   66.746  1.00 56.56  ? 182 LEU A CD2   1 
ATOM   1147  N  N     . ASP A  1 183 ? -14.029 12.651   65.453  1.00 56.90  ? 183 ASP A N     1 
ATOM   1148  C  CA    . ASP A  1 183 ? -15.474 12.768   65.358  1.00 58.18  ? 183 ASP A CA    1 
ATOM   1149  C  C     . ASP A  1 183 ? -16.130 11.508   65.904  1.00 57.35  ? 183 ASP A C     1 
ATOM   1150  O  O     . ASP A  1 183 ? -17.204 11.568   66.480  1.00 58.49  ? 183 ASP A O     1 
ATOM   1151  C  CB    . ASP A  1 183 ? -15.906 13.105   63.930  1.00 59.65  ? 183 ASP A CB    1 
ATOM   1152  C  CG    . ASP A  1 183 ? -15.661 14.600   63.574  1.00 64.37  ? 183 ASP A CG    1 
ATOM   1153  O  OD1   . ASP A  1 183 ? -15.277 15.381   64.486  1.00 66.78  ? 183 ASP A OD1   1 
ATOM   1154  O  OD2   . ASP A  1 183 ? -15.857 15.008   62.390  1.00 69.34  ? 183 ASP A OD2   1 
ATOM   1155  N  N     . THR A  1 184 ? -15.465 10.372   65.754  1.00 55.35  ? 184 THR A N     1 
ATOM   1156  C  CA    . THR A  1 184 ? -15.884 9.157    66.430  1.00 54.69  ? 184 THR A CA    1 
ATOM   1157  C  C     . THR A  1 184 ? -15.830 9.346    67.947  1.00 54.68  ? 184 THR A C     1 
ATOM   1158  O  O     . THR A  1 184 ? -16.799 9.025    68.649  1.00 55.31  ? 184 THR A O     1 
ATOM   1159  C  CB    . THR A  1 184 ? -15.007 7.970    66.003  1.00 53.77  ? 184 THR A CB    1 
ATOM   1160  O  OG1   . THR A  1 184 ? -15.309 7.656    64.644  1.00 54.28  ? 184 THR A OG1   1 
ATOM   1161  C  CG2   . THR A  1 184 ? -15.222 6.729    66.892  1.00 52.79  ? 184 THR A CG2   1 
ATOM   1162  N  N     . ILE A  1 185 ? -14.702 9.859    68.450  1.00 53.41  ? 185 ILE A N     1 
ATOM   1163  C  CA    . ILE A  1 185 ? -14.564 10.137   69.880  1.00 53.15  ? 185 ILE A CA    1 
ATOM   1164  C  C     . ILE A  1 185 ? -15.680 11.089   70.341  1.00 54.35  ? 185 ILE A C     1 
ATOM   1165  O  O     . ILE A  1 185 ? -16.364 10.804   71.322  1.00 55.28  ? 185 ILE A O     1 
ATOM   1166  C  CB    . ILE A  1 185 ? -13.166 10.681   70.237  1.00 52.25  ? 185 ILE A CB    1 
ATOM   1167  C  CG1   . ILE A  1 185 ? -12.117 9.562    70.140  1.00 51.32  ? 185 ILE A CG1   1 
ATOM   1168  C  CG2   . ILE A  1 185 ? -13.157 11.299   71.634  1.00 52.26  ? 185 ILE A CG2   1 
ATOM   1169  C  CD1   . ILE A  1 185 ? -10.653 10.020   70.392  1.00 48.42  ? 185 ILE A CD1   1 
ATOM   1170  N  N     . LEU A  1 186 ? -15.880 12.187   69.609  1.00 54.27  ? 186 LEU A N     1 
ATOM   1171  C  CA    . LEU A  1 186 ? -16.934 13.153   69.910  1.00 55.39  ? 186 LEU A CA    1 
ATOM   1172  C  C     . LEU A  1 186 ? -18.333 12.536   69.981  1.00 56.28  ? 186 LEU A C     1 
ATOM   1173  O  O     . LEU A  1 186 ? -19.173 12.976   70.755  1.00 57.43  ? 186 LEU A O     1 
ATOM   1174  C  CB    . LEU A  1 186 ? -16.928 14.306   68.897  1.00 55.74  ? 186 LEU A CB    1 
ATOM   1175  C  CG    . LEU A  1 186 ? -15.770 15.306   68.954  1.00 55.51  ? 186 LEU A CG    1 
ATOM   1176  C  CD1   . LEU A  1 186 ? -16.175 16.682   68.430  1.00 55.25  ? 186 LEU A CD1   1 
ATOM   1177  C  CD2   . LEU A  1 186 ? -15.268 15.424   70.370  1.00 55.25  ? 186 LEU A CD2   1 
ATOM   1178  N  N     . ASN A  1 187 ? -18.574 11.512   69.177  1.00 55.96  ? 187 ASN A N     1 
ATOM   1179  C  CA    . ASN A  1 187 ? -19.893 10.895   69.088  1.00 57.13  ? 187 ASN A CA    1 
ATOM   1180  C  C     . ASN A  1 187 ? -20.324 10.143   70.344  1.00 57.84  ? 187 ASN A C     1 
ATOM   1181  O  O     . ASN A  1 187 ? -21.518 10.030   70.610  1.00 59.37  ? 187 ASN A O     1 
ATOM   1182  C  CB    . ASN A  1 187 ? -19.961 9.962    67.883  1.00 56.69  ? 187 ASN A CB    1 
ATOM   1183  C  CG    . ASN A  1 187 ? -21.367 9.598    67.508  1.00 58.00  ? 187 ASN A CG    1 
ATOM   1184  O  OD1   . ASN A  1 187 ? -22.167 10.458   67.160  1.00 60.23  ? 187 ASN A OD1   1 
ATOM   1185  N  ND2   . ASN A  1 187 ? -21.682 8.314    67.573  1.00 58.85  ? 187 ASN A ND2   1 
ATOM   1186  N  N     . GLN A  1 188 ? -19.361 9.651    71.121  1.00 57.11  ? 188 GLN A N     1 
ATOM   1187  C  CA    . GLN A  1 188 ? -19.668 8.848    72.302  1.00 57.89  ? 188 GLN A CA    1 
ATOM   1188  C  C     . GLN A  1 188 ? -20.438 9.612    73.379  1.00 59.58  ? 188 GLN A C     1 
ATOM   1189  O  O     . GLN A  1 188 ? -20.977 9.003    74.313  1.00 60.44  ? 188 GLN A O     1 
ATOM   1190  C  CB    . GLN A  1 188 ? -18.408 8.203    72.889  1.00 56.77  ? 188 GLN A CB    1 
ATOM   1191  C  CG    . GLN A  1 188 ? -17.628 7.311    71.927  1.00 55.92  ? 188 GLN A CG    1 
ATOM   1192  C  CD    . GLN A  1 188 ? -18.504 6.564    70.933  1.00 57.50  ? 188 GLN A CD    1 
ATOM   1193  O  OE1   . GLN A  1 188 ? -19.238 5.632    71.288  1.00 58.67  ? 188 GLN A OE1   1 
ATOM   1194  N  NE2   . GLN A  1 188 ? -18.413 6.962    69.668  1.00 57.08  ? 188 GLN A NE2   1 
ATOM   1195  N  N     . LYS A  1 189 ? -20.507 10.938   73.238  1.00 60.23  ? 189 LYS A N     1 
ATOM   1196  C  CA    . LYS A  1 189 ? -21.354 11.778   74.097  1.00 61.98  ? 189 LYS A CA    1 
ATOM   1197  C  C     . LYS A  1 189 ? -22.736 11.179   74.374  1.00 63.38  ? 189 LYS A C     1 
ATOM   1198  O  O     . LYS A  1 189 ? -23.196 11.200   75.510  1.00 64.71  ? 189 LYS A O     1 
ATOM   1199  C  CB    . LYS A  1 189 ? -21.501 13.186   73.521  1.00 62.48  ? 189 LYS A CB    1 
ATOM   1200  C  CG    . LYS A  1 189 ? -20.503 14.185   74.089  1.00 63.76  ? 189 LYS A CG    1 
ATOM   1201  C  CD    . LYS A  1 189 ? -20.871 15.636   73.774  1.00 66.50  ? 189 LYS A CD    1 
ATOM   1202  C  CE    . LYS A  1 189 ? -20.263 16.114   72.462  1.00 66.69  ? 189 LYS A CE    1 
ATOM   1203  N  NZ    . LYS A  1 189 ? -20.485 17.584   72.281  1.00 69.48  ? 189 LYS A NZ    1 
ATOM   1204  N  N     . ARG A  1 190 ? -23.374 10.619   73.349  1.00 63.45  ? 190 ARG A N     1 
ATOM   1205  C  CA    . ARG A  1 190 ? -24.730 10.080   73.476  1.00 65.28  ? 190 ARG A CA    1 
ATOM   1206  C  C     . ARG A  1 190 ? -24.897 9.110    74.628  1.00 65.77  ? 190 ARG A C     1 
ATOM   1207  O  O     . ARG A  1 190 ? -25.886 9.165    75.340  1.00 68.19  ? 190 ARG A O     1 
ATOM   1208  C  CB    . ARG A  1 190 ? -25.188 9.380    72.194  1.00 65.24  ? 190 ARG A CB    1 
ATOM   1209  C  CG    . ARG A  1 190 ? -24.716 10.035   70.934  1.00 65.42  ? 190 ARG A CG    1 
ATOM   1210  C  CD    . ARG A  1 190 ? -25.639 9.766    69.784  1.00 67.97  ? 190 ARG A CD    1 
ATOM   1211  N  NE    . ARG A  1 190 ? -25.153 10.459   68.600  1.00 69.03  ? 190 ARG A NE    1 
ATOM   1212  C  CZ    . ARG A  1 190 ? -25.471 11.706   68.278  1.00 70.35  ? 190 ARG A CZ    1 
ATOM   1213  N  NH1   . ARG A  1 190 ? -26.288 12.406   69.043  1.00 72.10  ? 190 ARG A NH1   1 
ATOM   1214  N  NH2   . ARG A  1 190 ? -24.965 12.251   67.187  1.00 71.54  ? 190 ARG A NH2   1 
ATOM   1215  N  N     . TRP A  1 191 ? -23.939 8.225    74.816  1.00 64.44  ? 191 TRP A N     1 
ATOM   1216  C  CA    . TRP A  1 191 ? -24.112 7.159    75.772  1.00 65.36  ? 191 TRP A CA    1 
ATOM   1217  C  C     . TRP A  1 191 ? -23.325 7.415    77.035  1.00 65.60  ? 191 TRP A C     1 
ATOM   1218  O  O     . TRP A  1 191 ? -23.727 6.980    78.120  1.00 66.60  ? 191 TRP A O     1 
ATOM   1219  C  CB    . TRP A  1 191 ? -23.736 5.826    75.130  1.00 64.80  ? 191 TRP A CB    1 
ATOM   1220  C  CG    . TRP A  1 191 ? -24.474 5.660    73.852  1.00 65.46  ? 191 TRP A CG    1 
ATOM   1221  C  CD1   . TRP A  1 191 ? -25.739 5.168    73.695  1.00 66.73  ? 191 TRP A CD1   1 
ATOM   1222  C  CD2   . TRP A  1 191 ? -24.024 6.042    72.548  1.00 64.17  ? 191 TRP A CD2   1 
ATOM   1223  N  NE1   . TRP A  1 191 ? -26.094 5.199    72.373  1.00 66.97  ? 191 TRP A NE1   1 
ATOM   1224  C  CE2   . TRP A  1 191 ? -25.064 5.734    71.644  1.00 64.69  ? 191 TRP A CE2   1 
ATOM   1225  C  CE3   . TRP A  1 191 ? -22.843 6.610    72.058  1.00 62.10  ? 191 TRP A CE3   1 
ATOM   1226  C  CZ2   . TRP A  1 191 ? -24.964 5.975    70.276  1.00 62.99  ? 191 TRP A CZ2   1 
ATOM   1227  C  CZ3   . TRP A  1 191 ? -22.742 6.844    70.699  1.00 62.52  ? 191 TRP A CZ3   1 
ATOM   1228  C  CH2   . TRP A  1 191 ? -23.807 6.530    69.822  1.00 62.71  ? 191 TRP A CH2   1 
ATOM   1229  N  N     . ASN A  1 192 ? -22.213 8.140    76.885  1.00 64.77  ? 192 ASN A N     1 
ATOM   1230  C  CA    . ASN A  1 192 ? -21.369 8.523    78.011  1.00 65.01  ? 192 ASN A CA    1 
ATOM   1231  C  C     . ASN A  1 192 ? -22.055 9.570    78.895  1.00 66.64  ? 192 ASN A C     1 
ATOM   1232  O  O     . ASN A  1 192 ? -21.604 9.848    79.999  1.00 67.58  ? 192 ASN A O     1 
ATOM   1233  C  CB    . ASN A  1 192 ? -19.976 8.983    77.537  1.00 63.23  ? 192 ASN A CB    1 
ATOM   1234  C  CG    . ASN A  1 192 ? -19.127 7.830    76.956  1.00 62.73  ? 192 ASN A CG    1 
ATOM   1235  O  OD1   . ASN A  1 192 ? -19.529 6.671    76.973  1.00 64.16  ? 192 ASN A OD1   1 
ATOM   1236  N  ND2   . ASN A  1 192 ? -17.954 8.157    76.441  1.00 60.93  ? 192 ASN A ND2   1 
ATOM   1237  N  N     . ASN A  1 193 ? -23.158 10.136   78.426  1.00 67.59  ? 193 ASN A N     1 
ATOM   1238  C  CA    . ASN A  1 193 ? -23.963 10.996   79.285  1.00 69.66  ? 193 ASN A CA    1 
ATOM   1239  C  C     . ASN A  1 193 ? -25.129 10.261   79.961  1.00 71.74  ? 193 ASN A C     1 
ATOM   1240  O  O     . ASN A  1 193 ? -25.941 10.860   80.662  1.00 73.10  ? 193 ASN A O     1 
ATOM   1241  C  CB    . ASN A  1 193 ? -24.412 12.255   78.539  1.00 69.90  ? 193 ASN A CB    1 
ATOM   1242  C  CG    . ASN A  1 193 ? -23.274 13.221   78.319  1.00 68.31  ? 193 ASN A CG    1 
ATOM   1243  O  OD1   . ASN A  1 193 ? -22.252 13.132   78.978  1.00 66.56  ? 193 ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A  1 193 ? -23.439 14.141   77.383  1.00 68.93  ? 193 ASN A ND2   1 
ATOM   1245  N  N     . GLY A  1 194 ? -25.174 8.949    79.772  1.00 72.09  ? 194 GLY A N     1 
ATOM   1246  C  CA    . GLY A  1 194 ? -26.154 8.108    80.438  1.00 74.85  ? 194 GLY A CA    1 
ATOM   1247  C  C     . GLY A  1 194 ? -25.620 7.374    81.656  1.00 76.03  ? 194 GLY A C     1 
ATOM   1248  O  O     . GLY A  1 194 ? -24.561 7.704    82.189  1.00 75.17  ? 194 GLY A O     1 
ATOM   1249  N  N     . SER A  1 195 ? -26.376 6.371    82.092  1.00 78.44  ? 195 SER A N     1 
ATOM   1250  C  CA    . SER A  1 195 ? -26.024 5.571    83.260  1.00 80.11  ? 195 SER A CA    1 
ATOM   1251  C  C     . SER A  1 195 ? -25.725 4.118    82.877  1.00 80.15  ? 195 SER A C     1 
ATOM   1252  O  O     . SER A  1 195 ? -24.918 3.456    83.541  1.00 80.59  ? 195 SER A O     1 
ATOM   1253  C  CB    . SER A  1 195 ? -27.130 5.646    84.311  1.00 82.63  ? 195 SER A CB    1 
ATOM   1254  O  OG    . SER A  1 195 ? -27.517 6.993    84.540  1.00 83.71  ? 195 SER A OG    1 
ATOM   1255  N  N     . ASP A  1 196 ? -26.353 3.627    81.807  1.00 80.18  ? 196 ASP A N     1 
ATOM   1256  C  CA    . ASP A  1 196 ? -26.047 2.292    81.315  1.00 80.29  ? 196 ASP A CA    1 
ATOM   1257  C  C     . ASP A  1 196 ? -24.597 2.290    80.889  1.00 78.44  ? 196 ASP A C     1 
ATOM   1258  O  O     . ASP A  1 196 ? -24.248 2.930    79.886  1.00 77.37  ? 196 ASP A O     1 
ATOM   1259  C  CB    . ASP A  1 196 ? -26.937 1.907    80.131  1.00 80.76  ? 196 ASP A CB    1 
ATOM   1260  C  CG    . ASP A  1 196 ? -26.918 0.397    79.832  1.00 82.11  ? 196 ASP A CG    1 
ATOM   1261  O  OD1   . ASP A  1 196 ? -26.007 -0.321   80.301  1.00 82.82  ? 196 ASP A OD1   1 
ATOM   1262  O  OD2   . ASP A  1 196 ? -27.829 -0.079   79.119  1.00 84.15  ? 196 ASP A OD2   1 
ATOM   1263  N  N     . GLU A  1 197 ? -23.759 1.588    81.663  1.00 78.43  ? 197 GLU A N     1 
ATOM   1264  C  CA    . GLU A  1 197 ? -22.317 1.493    81.387  1.00 76.27  ? 197 GLU A CA    1 
ATOM   1265  C  C     . GLU A  1 197 ? -21.991 0.509    80.278  1.00 74.83  ? 197 GLU A C     1 
ATOM   1266  O  O     . GLU A  1 197 ? -20.870 0.497    79.789  1.00 73.63  ? 197 GLU A O     1 
ATOM   1267  C  CB    . GLU A  1 197 ? -21.533 1.097    82.640  1.00 77.16  ? 197 GLU A CB    1 
ATOM   1268  C  CG    . GLU A  1 197 ? -21.370 2.200    83.683  1.00 79.14  ? 197 GLU A CG    1 
ATOM   1269  C  CD    . GLU A  1 197 ? -20.074 2.992    83.540  1.00 78.53  ? 197 GLU A CD    1 
ATOM   1270  O  OE1   . GLU A  1 197 ? -19.133 2.519    82.871  1.00 77.40  ? 197 GLU A OE1   1 
ATOM   1271  O  OE2   . GLU A  1 197 ? -19.993 4.098    84.116  1.00 80.02  ? 197 GLU A OE2   1 
ATOM   1272  N  N     . SER A  1 198 ? -22.946 -0.329   79.890  1.00 75.35  ? 198 SER A N     1 
ATOM   1273  C  CA    . SER A  1 198 ? -22.702 -1.282   78.808  1.00 74.23  ? 198 SER A CA    1 
ATOM   1274  C  C     . SER A  1 198 ? -22.655 -0.576   77.452  1.00 72.26  ? 198 SER A C     1 
ATOM   1275  O  O     . SER A  1 198 ? -22.037 -1.064   76.504  1.00 71.11  ? 198 SER A O     1 
ATOM   1276  C  CB    . SER A  1 198 ? -23.742 -2.409   78.812  1.00 76.20  ? 198 SER A CB    1 
ATOM   1277  O  OG    . SER A  1 198 ? -24.927 -2.043   78.125  1.00 76.62  ? 198 SER A OG    1 
ATOM   1278  N  N     . LYS A  1 199 ? -23.307 0.579    77.378  1.00 72.01  ? 199 LYS A N     1 
ATOM   1279  C  CA    . LYS A  1 199 ? -23.378 1.364    76.149  1.00 70.65  ? 199 LYS A CA    1 
ATOM   1280  C  C     . LYS A  1 199 ? -22.215 2.355    76.042  1.00 68.55  ? 199 LYS A C     1 
ATOM   1281  O  O     . LYS A  1 199 ? -21.835 2.753    74.934  1.00 67.34  ? 199 LYS A O     1 
ATOM   1282  C  CB    . LYS A  1 199 ? -24.707 2.110    76.074  1.00 71.75  ? 199 LYS A CB    1 
ATOM   1283  C  CG    . LYS A  1 199 ? -25.927 1.205    75.987  1.00 74.87  ? 199 LYS A CG    1 
ATOM   1284  C  CD    . LYS A  1 199 ? -27.192 2.035    75.780  1.00 78.35  ? 199 LYS A CD    1 
ATOM   1285  C  CE    . LYS A  1 199 ? -28.446 1.181    75.642  1.00 80.62  ? 199 LYS A CE    1 
ATOM   1286  N  NZ    . LYS A  1 199 ? -29.647 2.039    75.359  1.00 82.10  ? 199 LYS A NZ    1 
ATOM   1287  N  N     . LYS A  1 200 ? -21.658 2.741    77.195  1.00 67.94  ? 200 LYS A N     1 
ATOM   1288  C  CA    . LYS A  1 200 ? -20.615 3.768    77.265  1.00 65.76  ? 200 LYS A CA    1 
ATOM   1289  C  C     . LYS A  1 200 ? -19.348 3.313    76.575  1.00 63.67  ? 200 LYS A C     1 
ATOM   1290  O  O     . LYS A  1 200 ? -19.022 2.137    76.609  1.00 63.98  ? 200 LYS A O     1 
ATOM   1291  C  CB    . LYS A  1 200 ? -20.311 4.149    78.718  1.00 66.56  ? 200 LYS A CB    1 
ATOM   1292  C  CG    . LYS A  1 200 ? -21.436 4.886    79.422  1.00 68.05  ? 200 LYS A CG    1 
ATOM   1293  C  CD    . LYS A  1 200 ? -20.958 5.697    80.613  1.00 69.34  ? 200 LYS A CD    1 
ATOM   1294  C  CE    . LYS A  1 200 ? -22.067 5.763    81.653  1.00 73.65  ? 200 LYS A CE    1 
ATOM   1295  N  NZ    . LYS A  1 200 ? -22.019 6.968    82.538  1.00 76.03  ? 200 LYS A NZ    1 
ATOM   1296  N  N     . LEU A  1 201 ? -18.645 4.244    75.938  1.00 61.93  ? 201 LEU A N     1 
ATOM   1297  C  CA    . LEU A  1 201 ? -17.377 3.931    75.290  1.00 60.24  ? 201 LEU A CA    1 
ATOM   1298  C  C     . LEU A  1 201 ? -16.309 4.905    75.765  1.00 59.51  ? 201 LEU A C     1 
ATOM   1299  O  O     . LEU A  1 201 ? -16.329 6.082    75.421  1.00 59.49  ? 201 LEU A O     1 
ATOM   1300  C  CB    . LEU A  1 201 ? -17.522 3.956    73.761  1.00 59.42  ? 201 LEU A CB    1 
ATOM   1301  C  CG    . LEU A  1 201 ? -16.365 3.430    72.896  1.00 57.80  ? 201 LEU A CG    1 
ATOM   1302  C  CD1   . LEU A  1 201 ? -15.998 2.004    73.247  1.00 59.12  ? 201 LEU A CD1   1 
ATOM   1303  C  CD2   . LEU A  1 201 ? -16.692 3.521    71.421  1.00 56.34  ? 201 LEU A CD2   1 
ATOM   1304  N  N     . TYR A  1 202 ? -15.393 4.426    76.591  1.00 59.45  ? 202 TYR A N     1 
ATOM   1305  C  CA    . TYR A  1 202 ? -14.373 5.305    77.125  1.00 59.22  ? 202 TYR A CA    1 
ATOM   1306  C  C     . TYR A  1 202 ? -13.324 5.497    76.051  1.00 57.88  ? 202 TYR A C     1 
ATOM   1307  O  O     . TYR A  1 202 ? -13.267 4.716    75.110  1.00 57.81  ? 202 TYR A O     1 
ATOM   1308  C  CB    . TYR A  1 202 ? -13.824 4.763    78.444  1.00 60.02  ? 202 TYR A CB    1 
ATOM   1309  C  CG    . TYR A  1 202 ? -14.864 4.807    79.551  1.00 62.20  ? 202 TYR A CG    1 
ATOM   1310  C  CD1   . TYR A  1 202 ? -15.181 6.008    80.199  1.00 63.04  ? 202 TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A  1 202 ? -15.556 3.664    79.929  1.00 63.81  ? 202 TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A  1 202 ? -16.139 6.059    81.202  1.00 63.86  ? 202 TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A  1 202 ? -16.523 3.707    80.942  1.00 65.75  ? 202 TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A  1 202 ? -16.802 4.906    81.570  1.00 66.10  ? 202 TYR A CZ    1 
ATOM   1315  O  OH    . TYR A  1 202 ? -17.756 4.945    82.564  1.00 69.78  ? 202 TYR A OH    1 
ATOM   1316  N  N     . CYS A  1 203 ? -12.530 6.557    76.141  1.00 57.40  ? 203 CYS A N     1 
ATOM   1317  C  CA    . CYS A  1 203 ? -11.697 6.933    74.994  1.00 56.07  ? 203 CYS A CA    1 
ATOM   1318  C  C     . CYS A  1 203 ? -10.247 7.192    75.328  1.00 55.23  ? 203 CYS A C     1 
ATOM   1319  O  O     . CYS A  1 203 ? -9.942  7.983    76.224  1.00 56.29  ? 203 CYS A O     1 
ATOM   1320  C  CB    . CYS A  1 203 ? -12.297 8.120    74.250  1.00 55.86  ? 203 CYS A CB    1 
ATOM   1321  S  SG    . CYS A  1 203 ? -13.708 7.627    73.242  1.00 57.75  ? 203 CYS A SG    1 
ATOM   1322  N  N     . VAL A  1 204 ? -9.358  6.512    74.604  1.00 53.39  ? 204 VAL A N     1 
ATOM   1323  C  CA    . VAL A  1 204 ? -7.932  6.669    74.794  1.00 51.77  ? 204 VAL A CA    1 
ATOM   1324  C  C     . VAL A  1 204 ? -7.346  7.114    73.465  1.00 50.50  ? 204 VAL A C     1 
ATOM   1325  O  O     . VAL A  1 204 ? -7.455  6.401    72.465  1.00 50.19  ? 204 VAL A O     1 
ATOM   1326  C  CB    . VAL A  1 204 ? -7.279  5.355    75.259  1.00 51.96  ? 204 VAL A CB    1 
ATOM   1327  C  CG1   . VAL A  1 204 ? -5.853  5.599    75.678  1.00 51.07  ? 204 VAL A CG1   1 
ATOM   1328  C  CG2   . VAL A  1 204 ? -8.063  4.731    76.410  1.00 52.35  ? 204 VAL A CG2   1 
ATOM   1329  N  N     . TYR A  1 205 ? -6.759  8.306    73.446  1.00 49.67  ? 205 TYR A N     1 
ATOM   1330  C  CA    . TYR A  1 205 ? -6.128  8.830    72.238  1.00 48.46  ? 205 TYR A CA    1 
ATOM   1331  C  C     . TYR A  1 205 ? -4.612  8.923    72.454  1.00 48.24  ? 205 TYR A C     1 
ATOM   1332  O  O     . TYR A  1 205 ? -4.137  9.605    73.365  1.00 48.89  ? 205 TYR A O     1 
ATOM   1333  C  CB    . TYR A  1 205 ? -6.730  10.185   71.845  1.00 48.34  ? 205 TYR A CB    1 
ATOM   1334  C  CG    . TYR A  1 205 ? -6.067  10.815   70.638  1.00 47.83  ? 205 TYR A CG    1 
ATOM   1335  C  CD1   . TYR A  1 205 ? -6.618  10.674   69.357  1.00 45.80  ? 205 TYR A CD1   1 
ATOM   1336  C  CD2   . TYR A  1 205 ? -4.871  11.555   70.775  1.00 47.88  ? 205 TYR A CD2   1 
ATOM   1337  C  CE1   . TYR A  1 205 ? -6.002  11.249   68.237  1.00 44.93  ? 205 TYR A CE1   1 
ATOM   1338  C  CE2   . TYR A  1 205 ? -4.233  12.121   69.662  1.00 46.31  ? 205 TYR A CE2   1 
ATOM   1339  C  CZ    . TYR A  1 205 ? -4.806  11.970   68.394  1.00 45.59  ? 205 TYR A CZ    1 
ATOM   1340  O  OH    . TYR A  1 205 ? -4.172  12.524   67.298  1.00 43.29  ? 205 TYR A OH    1 
ATOM   1341  N  N     . VAL A  1 206 ? -3.860  8.231    71.606  1.00 47.56  ? 206 VAL A N     1 
ATOM   1342  C  CA    . VAL A  1 206 ? -2.414  8.087    71.760  1.00 47.11  ? 206 VAL A CA    1 
ATOM   1343  C  C     . VAL A  1 206 ? -1.707  9.006    70.769  1.00 46.89  ? 206 VAL A C     1 
ATOM   1344  O  O     . VAL A  1 206 ? -1.718  8.762    69.553  1.00 46.48  ? 206 VAL A O     1 
ATOM   1345  C  CB    . VAL A  1 206 ? -1.969  6.619    71.546  1.00 46.59  ? 206 VAL A CB    1 
ATOM   1346  C  CG1   . VAL A  1 206 ? -0.546  6.423    71.999  1.00 46.87  ? 206 VAL A CG1   1 
ATOM   1347  C  CG2   . VAL A  1 206 ? -2.863  5.693    72.309  1.00 46.61  ? 206 VAL A CG2   1 
ATOM   1348  N  N     . ALA A  1 207 ? -1.114  10.072   71.296  1.00 47.25  ? 207 ALA A N     1 
ATOM   1349  C  CA    . ALA A  1 207 ? -0.424  11.050   70.469  1.00 47.19  ? 207 ALA A CA    1 
ATOM   1350  C  C     . ALA A  1 207 ? 1.059   10.679   70.393  1.00 47.52  ? 207 ALA A C     1 
ATOM   1351  O  O     . ALA A  1 207 ? 1.817   10.822   71.372  1.00 48.07  ? 207 ALA A O     1 
ATOM   1352  C  CB    . ALA A  1 207 ? -0.622  12.439   71.002  1.00 47.14  ? 207 ALA A CB    1 
ATOM   1353  N  N     . VAL A  1 208 ? 1.464   10.164   69.231  1.00 47.22  ? 208 VAL A N     1 
ATOM   1354  C  CA    . VAL A  1 208 ? 2.823   9.671    69.065  1.00 47.01  ? 208 VAL A CA    1 
ATOM   1355  C  C     . VAL A  1 208 ? 3.539   10.420   67.962  1.00 46.83  ? 208 VAL A C     1 
ATOM   1356  O  O     . VAL A  1 208 ? 3.207   10.280   66.785  1.00 46.36  ? 208 VAL A O     1 
ATOM   1357  C  CB    . VAL A  1 208 ? 2.870   8.162    68.736  1.00 46.70  ? 208 VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1 208 ? 4.289   7.648    68.887  1.00 46.37  ? 208 VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1 208 ? 1.927   7.381    69.615  1.00 46.78  ? 208 VAL A CG2   1 
ATOM   1360  N  N     . GLY A  1 209 ? 4.535   11.201   68.352  1.00 46.99  ? 209 GLY A N     1 
ATOM   1361  C  CA    . GLY A  1 209 ? 5.374   11.872   67.385  1.00 46.86  ? 209 GLY A CA    1 
ATOM   1362  C  C     . GLY A  1 209 ? 4.766   13.136   66.816  1.00 47.08  ? 209 GLY A C     1 
ATOM   1363  O  O     . GLY A  1 209 ? 5.302   13.711   65.875  1.00 47.76  ? 209 GLY A O     1 
ATOM   1364  N  N     . GLN A  1 210 ? 3.645   13.573   67.375  1.00 47.10  ? 210 GLN A N     1 
ATOM   1365  C  CA    . GLN A  1 210 ? 3.051   14.848   66.994  1.00 47.45  ? 210 GLN A CA    1 
ATOM   1366  C  C     . GLN A  1 210 ? 3.740   15.915   67.803  1.00 48.25  ? 210 GLN A C     1 
ATOM   1367  O  O     . GLN A  1 210 ? 4.300   15.622   68.855  1.00 48.50  ? 210 GLN A O     1 
ATOM   1368  C  CB    . GLN A  1 210 ? 1.566   14.872   67.308  1.00 47.21  ? 210 GLN A CB    1 
ATOM   1369  C  CG    . GLN A  1 210 ? 0.869   13.604   66.932  1.00 47.78  ? 210 GLN A CG    1 
ATOM   1370  C  CD    . GLN A  1 210 ? -0.579  13.628   67.289  1.00 49.74  ? 210 GLN A CD    1 
ATOM   1371  O  OE1   . GLN A  1 210 ? -1.209  14.687   67.294  1.00 51.82  ? 210 GLN A OE1   1 
ATOM   1372  N  NE2   . GLN A  1 210 ? -1.134  12.459   67.585  1.00 50.07  ? 210 GLN A NE2   1 
ATOM   1373  N  N     . LYS A  1 211 ? 3.704   17.148   67.318  1.00 49.05  ? 211 LYS A N     1 
ATOM   1374  C  CA    . LYS A  1 211 ? 4.232   18.250   68.084  1.00 50.54  ? 211 LYS A CA    1 
ATOM   1375  C  C     . LYS A  1 211 ? 3.267   18.565   69.218  1.00 51.28  ? 211 LYS A C     1 
ATOM   1376  O  O     . LYS A  1 211 ? 2.094   18.190   69.153  1.00 50.99  ? 211 LYS A O     1 
ATOM   1377  C  CB    . LYS A  1 211 ? 4.479   19.458   67.191  1.00 51.83  ? 211 LYS A CB    1 
ATOM   1378  C  CG    . LYS A  1 211 ? 3.321   19.878   66.314  1.00 53.08  ? 211 LYS A CG    1 
ATOM   1379  C  CD    . LYS A  1 211 ? 3.650   21.207   65.653  1.00 55.97  ? 211 LYS A CD    1 
ATOM   1380  C  CE    . LYS A  1 211 ? 2.377   21.971   65.331  1.00 58.75  ? 211 LYS A CE    1 
ATOM   1381  N  NZ    . LYS A  1 211 ? 2.671   23.181   64.513  1.00 61.78  ? 211 LYS A NZ    1 
ATOM   1382  N  N     . ARG A  1 212 ? 3.753   19.237   70.261  1.00 52.44  ? 212 ARG A N     1 
ATOM   1383  C  CA    . ARG A  1 212 ? 2.945   19.454   71.475  1.00 52.84  ? 212 ARG A CA    1 
ATOM   1384  C  C     . ARG A  1 212 ? 1.717   20.344   71.284  1.00 53.39  ? 212 ARG A C     1 
ATOM   1385  O  O     . ARG A  1 212 ? 0.631   20.003   71.752  1.00 53.49  ? 212 ARG A O     1 
ATOM   1386  C  CB    . ARG A  1 212 ? 3.800   19.986   72.613  1.00 53.85  ? 212 ARG A CB    1 
ATOM   1387  C  CG    . ARG A  1 212 ? 4.779   18.989   73.102  1.00 53.66  ? 212 ARG A CG    1 
ATOM   1388  C  CD    . ARG A  1 212 ? 5.330   19.388   74.435  1.00 55.57  ? 212 ARG A CD    1 
ATOM   1389  N  NE    . ARG A  1 212 ? 5.928   18.221   75.071  1.00 54.99  ? 212 ARG A NE    1 
ATOM   1390  C  CZ    . ARG A  1 212 ? 7.167   18.164   75.528  1.00 53.36  ? 212 ARG A CZ    1 
ATOM   1391  N  NH1   . ARG A  1 212 ? 7.966   19.218   75.452  1.00 54.40  ? 212 ARG A NH1   1 
ATOM   1392  N  NH2   . ARG A  1 212 ? 7.592   17.044   76.081  1.00 52.81  ? 212 ARG A NH2   1 
ATOM   1393  N  N     . SER A  1 213 ? 1.880   21.471   70.597  1.00 53.88  ? 213 SER A N     1 
ATOM   1394  C  CA    . SER A  1 213 ? 0.740   22.346   70.328  1.00 54.55  ? 213 SER A CA    1 
ATOM   1395  C  C     . SER A  1 213 ? -0.384  21.634   69.563  1.00 52.89  ? 213 SER A C     1 
ATOM   1396  O  O     . SER A  1 213 ? -1.553  21.943   69.763  1.00 53.49  ? 213 SER A O     1 
ATOM   1397  C  CB    . SER A  1 213 ? 1.161   23.630   69.614  1.00 55.95  ? 213 SER A CB    1 
ATOM   1398  O  OG    . SER A  1 213 ? 1.455   23.373   68.255  1.00 56.72  ? 213 SER A OG    1 
ATOM   1399  N  N     . THR A  1 214 ? -0.042  20.679   68.707  1.00 50.89  ? 214 THR A N     1 
ATOM   1400  C  CA    . THR A  1 214 ? -1.076  19.871   68.067  1.00 49.63  ? 214 THR A CA    1 
ATOM   1401  C  C     . THR A  1 214 ? -1.871  19.112   69.118  1.00 49.22  ? 214 THR A C     1 
ATOM   1402  O  O     . THR A  1 214 ? -3.095  19.198   69.144  1.00 49.76  ? 214 THR A O     1 
ATOM   1403  C  CB    . THR A  1 214 ? -0.522  18.972   66.940  1.00 48.23  ? 214 THR A CB    1 
ATOM   1404  O  OG1   . THR A  1 214 ? -0.318  19.783   65.786  1.00 49.53  ? 214 THR A OG1   1 
ATOM   1405  C  CG2   . THR A  1 214 ? -1.483  17.876   66.559  1.00 46.11  ? 214 THR A CG2   1 
ATOM   1406  N  N     . VAL A  1 215 ? -1.185  18.412   70.009  1.00 48.69  ? 215 VAL A N     1 
ATOM   1407  C  CA    . VAL A  1 215 ? -1.872  17.704   71.082  1.00 48.71  ? 215 VAL A CA    1 
ATOM   1408  C  C     . VAL A  1 215 ? -2.623  18.692   71.978  1.00 50.15  ? 215 VAL A C     1 
ATOM   1409  O  O     . VAL A  1 215 ? -3.723  18.392   72.425  1.00 50.56  ? 215 VAL A O     1 
ATOM   1410  C  CB    . VAL A  1 215 ? -0.916  16.772   71.884  1.00 48.09  ? 215 VAL A CB    1 
ATOM   1411  C  CG1   . VAL A  1 215 ? -1.641  16.082   73.015  1.00 47.94  ? 215 VAL A CG1   1 
ATOM   1412  C  CG2   . VAL A  1 215 ? -0.356  15.724   70.971  1.00 47.05  ? 215 VAL A CG2   1 
ATOM   1413  N  N     . ALA A  1 216 ? -2.058  19.877   72.199  1.00 51.43  ? 216 ALA A N     1 
ATOM   1414  C  CA    . ALA A  1 216 ? -2.718  20.898   73.016  1.00 53.47  ? 216 ALA A CA    1 
ATOM   1415  C  C     . ALA A  1 216 ? -3.967  21.453   72.329  1.00 54.78  ? 216 ALA A C     1 
ATOM   1416  O  O     . ALA A  1 216 ? -4.986  21.710   72.977  1.00 56.13  ? 216 ALA A O     1 
ATOM   1417  C  CB    . ALA A  1 216 ? -1.767  22.009   73.343  1.00 54.38  ? 216 ALA A CB    1 
ATOM   1418  N  N     . GLN A  1 217 ? -3.883  21.624   71.012  1.00 54.73  ? 217 GLN A N     1 
ATOM   1419  C  CA    . GLN A  1 217 ? -4.998  22.106   70.222  1.00 55.63  ? 217 GLN A CA    1 
ATOM   1420  C  C     . GLN A  1 217 ? -6.091  21.048   70.113  1.00 54.81  ? 217 GLN A C     1 
ATOM   1421  O  O     . GLN A  1 217 ? -7.263  21.378   69.906  1.00 55.64  ? 217 GLN A O     1 
ATOM   1422  C  CB    . GLN A  1 217 ? -4.510  22.541   68.837  1.00 55.85  ? 217 GLN A CB    1 
ATOM   1423  C  CG    . GLN A  1 217 ? -5.573  23.211   67.948  1.00 59.14  ? 217 GLN A CG    1 
ATOM   1424  C  CD    . GLN A  1 217 ? -6.210  24.477   68.568  1.00 62.80  ? 217 GLN A CD    1 
ATOM   1425  O  OE1   . GLN A  1 217 ? -5.501  25.362   69.081  1.00 64.57  ? 217 GLN A OE1   1 
ATOM   1426  N  NE2   . GLN A  1 217 ? -7.550  24.563   68.510  1.00 60.44  ? 217 GLN A NE2   1 
ATOM   1427  N  N     . LEU A  1 218 ? -5.702  19.779   70.248  1.00 53.70  ? 218 LEU A N     1 
ATOM   1428  C  CA    . LEU A  1 218 ? -6.648  18.663   70.211  1.00 53.14  ? 218 LEU A CA    1 
ATOM   1429  C  C     . LEU A  1 218 ? -7.431  18.620   71.501  1.00 54.04  ? 218 LEU A C     1 
ATOM   1430  O  O     . LEU A  1 218 ? -8.670  18.488   71.489  1.00 54.35  ? 218 LEU A O     1 
ATOM   1431  C  CB    . LEU A  1 218 ? -5.937  17.329   70.034  1.00 51.73  ? 218 LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1 218 ? -6.878  16.131   69.888  1.00 51.97  ? 218 LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1 218 ? -7.620  16.236   68.592  1.00 53.27  ? 218 LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1 218 ? -6.122  14.828   69.911  1.00 52.31  ? 218 LEU A CD2   1 
ATOM   1435  N  N     . VAL A  1 219 ? -6.699  18.731   72.613  1.00 54.19  ? 219 VAL A N     1 
ATOM   1436  C  CA    . VAL A  1 219 ? -7.315  18.729   73.937  1.00 55.02  ? 219 VAL A CA    1 
ATOM   1437  C  C     . VAL A  1 219 ? -8.241  19.933   74.103  1.00 56.92  ? 219 VAL A C     1 
ATOM   1438  O  O     . VAL A  1 219 ? -9.379  19.795   74.570  1.00 57.89  ? 219 VAL A O     1 
ATOM   1439  C  CB    . VAL A  1 219 ? -6.276  18.598   75.065  1.00 54.94  ? 219 VAL A CB    1 
ATOM   1440  C  CG1   . VAL A  1 219 ? -6.879  18.981   76.429  1.00 56.15  ? 219 VAL A CG1   1 
ATOM   1441  C  CG2   . VAL A  1 219 ? -5.721  17.174   75.088  1.00 52.48  ? 219 VAL A CG2   1 
ATOM   1442  N  N     . GLN A  1 220 ? -7.788  21.099   73.669  1.00 57.63  ? 220 GLN A N     1 
ATOM   1443  C  CA    . GLN A  1 220 ? -8.668  22.250   73.673  1.00 59.61  ? 220 GLN A CA    1 
ATOM   1444  C  C     . GLN A  1 220 ? -9.987  21.965   72.919  1.00 59.27  ? 220 GLN A C     1 
ATOM   1445  O  O     . GLN A  1 220 ? -11.054 22.437   73.323  1.00 60.62  ? 220 GLN A O     1 
ATOM   1446  C  CB    . GLN A  1 220 ? -7.957  23.488   73.129  1.00 60.74  ? 220 GLN A CB    1 
ATOM   1447  C  CG    . GLN A  1 220 ? -8.808  24.741   73.255  1.00 65.36  ? 220 GLN A CG    1 
ATOM   1448  C  CD    . GLN A  1 220 ? -8.260  25.917   72.481  1.00 69.32  ? 220 GLN A CD    1 
ATOM   1449  O  OE1   . GLN A  1 220 ? -8.886  26.399   71.521  1.00 70.49  ? 220 GLN A OE1   1 
ATOM   1450  N  NE2   . GLN A  1 220 ? -7.089  26.398   72.896  1.00 70.63  ? 220 GLN A NE2   1 
ATOM   1451  N  N     . THR A  1 221 ? -9.917  21.182   71.845  1.00 57.64  ? 221 THR A N     1 
ATOM   1452  C  CA    . THR A  1 221 ? -11.124 20.821   71.082  1.00 57.52  ? 221 THR A CA    1 
ATOM   1453  C  C     . THR A  1 221 ? -12.047 19.861   71.838  1.00 57.14  ? 221 THR A C     1 
ATOM   1454  O  O     . THR A  1 221 ? -13.255 20.037   71.830  1.00 57.73  ? 221 THR A O     1 
ATOM   1455  C  CB    . THR A  1 221 ? -10.787 20.256   69.666  1.00 56.37  ? 221 THR A CB    1 
ATOM   1456  O  OG1   . THR A  1 221 ? -10.530 21.340   68.775  1.00 57.45  ? 221 THR A OG1   1 
ATOM   1457  C  CG2   . THR A  1 221 ? -11.932 19.436   69.088  1.00 55.42  ? 221 THR A CG2   1 
ATOM   1458  N  N     . LEU A  1 222 ? -11.475 18.842   72.472  1.00 55.92  ? 222 LEU A N     1 
ATOM   1459  C  CA    . LEU A  1 222 ? -12.283 17.866   73.186  1.00 55.63  ? 222 LEU A CA    1 
ATOM   1460  C  C     . LEU A  1 222 ? -12.915 18.532   74.396  1.00 57.18  ? 222 LEU A C     1 
ATOM   1461  O  O     . LEU A  1 222 ? -14.066 18.287   74.702  1.00 57.48  ? 222 LEU A O     1 
ATOM   1462  C  CB    . LEU A  1 222 ? -11.448 16.635   73.581  1.00 54.27  ? 222 LEU A CB    1 
ATOM   1463  C  CG    . LEU A  1 222 ? -10.989 15.687   72.466  1.00 52.29  ? 222 LEU A CG    1 
ATOM   1464  C  CD1   . LEU A  1 222 ? -9.936  14.704   72.935  1.00 50.80  ? 222 LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A  1 222 ? -12.144 14.941   71.885  1.00 51.53  ? 222 LEU A CD2   1 
ATOM   1466  N  N     . GLU A  1 223 ? -12.150 19.390   75.065  1.00 58.53  ? 223 GLU A N     1 
ATOM   1467  C  CA    . GLU A  1 223 ? -12.670 20.221   76.153  1.00 61.38  ? 223 GLU A CA    1 
ATOM   1468  C  C     . GLU A  1 223 ? -13.880 21.055   75.685  1.00 62.11  ? 223 GLU A C     1 
ATOM   1469  O  O     . GLU A  1 223 ? -14.897 21.061   76.350  1.00 62.79  ? 223 GLU A O     1 
ATOM   1470  C  CB    . GLU A  1 223 ? -11.559 21.106   76.769  1.00 62.56  ? 223 GLU A CB    1 
ATOM   1471  C  CG    . GLU A  1 223 ? -10.873 20.524   78.019  1.00 66.30  ? 223 GLU A CG    1 
ATOM   1472  C  CD    . GLU A  1 223 ? -9.440  21.081   78.287  1.00 73.20  ? 223 GLU A CD    1 
ATOM   1473  O  OE1   . GLU A  1 223 ? -8.787  21.620   77.347  1.00 75.61  ? 223 GLU A OE1   1 
ATOM   1474  O  OE2   . GLU A  1 223 ? -8.948  20.960   79.447  1.00 74.84  ? 223 GLU A OE2   1 
ATOM   1475  N  N     . GLN A  1 224 ? -13.768 21.717   74.531  1.00 62.11  ? 224 GLN A N     1 
ATOM   1476  C  CA    . GLN A  1 224 ? -14.878 22.479   73.931  1.00 63.86  ? 224 GLN A CA    1 
ATOM   1477  C  C     . GLN A  1 224 ? -16.115 21.678   73.573  1.00 63.10  ? 224 GLN A C     1 
ATOM   1478  O  O     . GLN A  1 224 ? -17.214 22.205   73.591  1.00 64.93  ? 224 GLN A O     1 
ATOM   1479  C  CB    . GLN A  1 224 ? -14.421 23.262   72.702  1.00 64.34  ? 224 GLN A CB    1 
ATOM   1480  C  CG    . GLN A  1 224 ? -14.289 24.755   72.971  1.00 69.69  ? 224 GLN A CG    1 
ATOM   1481  C  CD    . GLN A  1 224 ? -13.206 25.405   72.126  1.00 73.97  ? 224 GLN A CD    1 
ATOM   1482  O  OE1   . GLN A  1 224 ? -13.391 25.619   70.922  1.00 76.06  ? 224 GLN A OE1   1 
ATOM   1483  N  NE2   . GLN A  1 224 ? -12.062 25.724   72.754  1.00 74.35  ? 224 GLN A NE2   1 
ATOM   1484  N  N     . HIS A  1 225 ? -15.934 20.411   73.241  1.00 61.25  ? 225 HIS A N     1 
ATOM   1485  C  CA    . HIS A  1 225 ? -17.048 19.533   72.903  1.00 60.77  ? 225 HIS A CA    1 
ATOM   1486  C  C     . HIS A  1 225 ? -17.410 18.610   74.069  1.00 60.77  ? 225 HIS A C     1 
ATOM   1487  O  O     . HIS A  1 225 ? -18.142 17.634   73.898  1.00 60.72  ? 225 HIS A O     1 
ATOM   1488  C  CB    . HIS A  1 225 ? -16.748 18.759   71.611  1.00 59.06  ? 225 HIS A CB    1 
ATOM   1489  C  CG    . HIS A  1 225 ? -16.837 19.607   70.376  1.00 59.11  ? 225 HIS A CG    1 
ATOM   1490  N  ND1   . HIS A  1 225 ? -15.845 20.491   70.006  1.00 58.35  ? 225 HIS A ND1   1 
ATOM   1491  C  CD2   . HIS A  1 225 ? -17.811 19.727   69.445  1.00 59.05  ? 225 HIS A CD2   1 
ATOM   1492  C  CE1   . HIS A  1 225 ? -16.195 21.105   68.891  1.00 58.12  ? 225 HIS A CE1   1 
ATOM   1493  N  NE2   . HIS A  1 225 ? -17.384 20.658   68.529  1.00 59.26  ? 225 HIS A NE2   1 
ATOM   1494  N  N     . ASP A  1 226 ? -16.910 18.948   75.258  1.00 61.18  ? 226 ASP A N     1 
ATOM   1495  C  CA    . ASP A  1 226 ? -17.196 18.210   76.487  1.00 61.54  ? 226 ASP A CA    1 
ATOM   1496  C  C     . ASP A  1 226 ? -17.015 16.704   76.266  1.00 60.03  ? 226 ASP A C     1 
ATOM   1497  O  O     . ASP A  1 226 ? -17.893 15.904   76.621  1.00 60.94  ? 226 ASP A O     1 
ATOM   1498  C  CB    . ASP A  1 226 ? -18.611 18.548   76.979  1.00 63.65  ? 226 ASP A CB    1 
ATOM   1499  C  CG    . ASP A  1 226 ? -18.882 18.086   78.411  1.00 65.50  ? 226 ASP A CG    1 
ATOM   1500  O  OD1   . ASP A  1 226 ? -17.984 18.201   79.275  1.00 67.52  ? 226 ASP A OD1   1 
ATOM   1501  O  OD2   . ASP A  1 226 ? -20.015 17.627   78.678  1.00 66.46  ? 226 ASP A OD2   1 
ATOM   1502  N  N     . ALA A  1 227 ? -15.888 16.338   75.645  1.00 57.91  ? 227 ALA A N     1 
ATOM   1503  C  CA    . ALA A  1 227 ? -15.534 14.945   75.379  1.00 56.03  ? 227 ALA A CA    1 
ATOM   1504  C  C     . ALA A  1 227 ? -14.235 14.557   76.062  1.00 55.59  ? 227 ALA A C     1 
ATOM   1505  O  O     . ALA A  1 227 ? -13.900 13.379   76.089  1.00 55.42  ? 227 ALA A O     1 
ATOM   1506  C  CB    . ALA A  1 227 ? -15.442 14.681   73.902  1.00 54.33  ? 227 ALA A CB    1 
ATOM   1507  N  N     . MET A  1 228 ? -13.493 15.527   76.603  1.00 56.07  ? 228 MET A N     1 
ATOM   1508  C  CA    . MET A  1 228 ? -12.387 15.218   77.515  1.00 55.71  ? 228 MET A CA    1 
ATOM   1509  C  C     . MET A  1 228 ? -12.859 14.346   78.684  1.00 56.29  ? 228 MET A C     1 
ATOM   1510  O  O     . MET A  1 228 ? -12.181 13.398   79.059  1.00 56.18  ? 228 MET A O     1 
ATOM   1511  C  CB    . MET A  1 228 ? -11.732 16.486   78.072  1.00 56.56  ? 228 MET A CB    1 
ATOM   1512  C  CG    . MET A  1 228 ? -10.474 16.907   77.363  1.00 57.80  ? 228 MET A CG    1 
ATOM   1513  S  SD    . MET A  1 228 ? -9.307  15.549   77.066  1.00 60.63  ? 228 MET A SD    1 
ATOM   1514  C  CE    . MET A  1 228 ? -8.080  15.857   78.335  1.00 60.31  ? 228 MET A CE    1 
ATOM   1515  N  N     . LYS A  1 229 ? -14.025 14.661   79.249  1.00 57.15  ? 229 LYS A N     1 
ATOM   1516  C  CA    . LYS A  1 229 ? -14.479 14.025   80.474  1.00 57.51  ? 229 LYS A CA    1 
ATOM   1517  C  C     . LYS A  1 229 ? -14.491 12.513   80.420  1.00 56.59  ? 229 LYS A C     1 
ATOM   1518  O  O     . LYS A  1 229 ? -14.422 11.867   81.460  1.00 57.71  ? 229 LYS A O     1 
ATOM   1519  C  CB    . LYS A  1 229 ? -15.851 14.554   80.884  1.00 59.32  ? 229 LYS A CB    1 
ATOM   1520  C  CG    . LYS A  1 229 ? -17.041 13.909   80.210  1.00 59.02  ? 229 LYS A CG    1 
ATOM   1521  C  CD    . LYS A  1 229 ? -18.167 14.913   80.124  1.00 60.35  ? 229 LYS A CD    1 
ATOM   1522  C  CE    . LYS A  1 229 ? -19.512 14.262   80.240  1.00 61.61  ? 229 LYS A CE    1 
ATOM   1523  N  NZ    . LYS A  1 229 ? -20.494 15.222   80.841  1.00 63.50  ? 229 LYS A NZ    1 
ATOM   1524  N  N     . TYR A  1 230 ? -14.577 11.942   79.223  1.00 54.82  ? 230 TYR A N     1 
ATOM   1525  C  CA    . TYR A  1 230 ? -14.483 10.483   79.089  1.00 53.62  ? 230 TYR A CA    1 
ATOM   1526  C  C     . TYR A  1 230 ? -13.257 9.971    78.332  1.00 52.17  ? 230 TYR A C     1 
ATOM   1527  O  O     . TYR A  1 230 ? -13.254 8.839    77.852  1.00 51.82  ? 230 TYR A O     1 
ATOM   1528  C  CB    . TYR A  1 230 ? -15.754 9.903    78.489  1.00 53.47  ? 230 TYR A CB    1 
ATOM   1529  C  CG    . TYR A  1 230 ? -16.229 10.500   77.186  1.00 51.47  ? 230 TYR A CG    1 
ATOM   1530  C  CD1   . TYR A  1 230 ? -15.599 10.197   75.984  1.00 49.59  ? 230 TYR A CD1   1 
ATOM   1531  C  CD2   . TYR A  1 230 ? -17.358 11.307   77.147  1.00 51.71  ? 230 TYR A CD2   1 
ATOM   1532  C  CE1   . TYR A  1 230 ? -16.060 10.720   74.782  1.00 49.02  ? 230 TYR A CE1   1 
ATOM   1533  C  CE2   . TYR A  1 230 ? -17.827 11.837   75.952  1.00 51.18  ? 230 TYR A CE2   1 
ATOM   1534  C  CZ    . TYR A  1 230 ? -17.176 11.538   74.776  1.00 49.87  ? 230 TYR A CZ    1 
ATOM   1535  O  OH    . TYR A  1 230 ? -17.638 12.048   73.593  1.00 49.56  ? 230 TYR A OH    1 
ATOM   1536  N  N     . SER A  1 231 ? -12.217 10.796   78.262  1.00 51.48  ? 231 SER A N     1 
ATOM   1537  C  CA    . SER A  1 231 ? -11.065 10.538   77.418  1.00 50.19  ? 231 SER A CA    1 
ATOM   1538  C  C     . SER A  1 231 ? -9.751  10.542   78.192  1.00 50.46  ? 231 SER A C     1 
ATOM   1539  O  O     . SER A  1 231 ? -9.619  11.177   79.236  1.00 51.44  ? 231 SER A O     1 
ATOM   1540  C  CB    . SER A  1 231 ? -10.982 11.586   76.310  1.00 49.71  ? 231 SER A CB    1 
ATOM   1541  O  OG    . SER A  1 231 ? -12.049 11.469   75.387  1.00 49.99  ? 231 SER A OG    1 
ATOM   1542  N  N     . ILE A  1 232 ? -8.777  9.820    77.659  1.00 49.66  ? 232 ILE A N     1 
ATOM   1543  C  CA    . ILE A  1 232 ? -7.439  9.820    78.189  1.00 49.79  ? 232 ILE A CA    1 
ATOM   1544  C  C     . ILE A  1 232 ? -6.531  10.146   77.025  1.00 48.74  ? 232 ILE A C     1 
ATOM   1545  O  O     . ILE A  1 232 ? -6.682  9.569    75.946  1.00 48.10  ? 232 ILE A O     1 
ATOM   1546  C  CB    . ILE A  1 232 ? -7.081  8.450    78.785  1.00 50.13  ? 232 ILE A CB    1 
ATOM   1547  C  CG1   . ILE A  1 232 ? -8.041  8.121    79.933  1.00 52.50  ? 232 ILE A CG1   1 
ATOM   1548  C  CG2   . ILE A  1 232 ? -5.639  8.442    79.276  1.00 49.19  ? 232 ILE A CG2   1 
ATOM   1549  C  CD1   . ILE A  1 232 ? -8.223  6.635    80.220  1.00 54.08  ? 232 ILE A CD1   1 
ATOM   1550  N  N     . ILE A  1 233 ? -5.615  11.086   77.229  1.00 48.83  ? 233 ILE A N     1 
ATOM   1551  C  CA    . ILE A  1 233 ? -4.614  11.383   76.224  1.00 48.09  ? 233 ILE A CA    1 
ATOM   1552  C  C     . ILE A  1 233 ? -3.270  10.890   76.723  1.00 48.82  ? 233 ILE A C     1 
ATOM   1553  O  O     . ILE A  1 233 ? -2.770  11.360   77.757  1.00 50.20  ? 233 ILE A O     1 
ATOM   1554  C  CB    . ILE A  1 233 ? -4.524  12.889   75.910  1.00 48.20  ? 233 ILE A CB    1 
ATOM   1555  C  CG1   . ILE A  1 233 ? -5.892  13.450   75.524  1.00 48.19  ? 233 ILE A CG1   1 
ATOM   1556  C  CG2   . ILE A  1 233 ? -3.490  13.158   74.810  1.00 46.56  ? 233 ILE A CG2   1 
ATOM   1557  C  CD1   . ILE A  1 233 ? -6.295  13.158   74.106  1.00 47.69  ? 233 ILE A CD1   1 
ATOM   1558  N  N     . VAL A  1 234 ? -2.699  9.926    76.004  1.00 48.14  ? 234 VAL A N     1 
ATOM   1559  C  CA    . VAL A  1 234 ? -1.324  9.504    76.246  1.00 48.16  ? 234 VAL A CA    1 
ATOM   1560  C  C     . VAL A  1 234 ? -0.478  10.186   75.162  1.00 47.76  ? 234 VAL A C     1 
ATOM   1561  O  O     . VAL A  1 234 ? -0.646  9.889    73.971  1.00 47.02  ? 234 VAL A O     1 
ATOM   1562  C  CB    . VAL A  1 234 ? -1.178  7.959    76.192  1.00 47.76  ? 234 VAL A CB    1 
ATOM   1563  C  CG1   . VAL A  1 234 ? 0.291   7.558    76.246  1.00 48.09  ? 234 VAL A CG1   1 
ATOM   1564  C  CG2   . VAL A  1 234 ? -1.929  7.306    77.325  1.00 47.80  ? 234 VAL A CG2   1 
ATOM   1565  N  N     . ALA A  1 235 ? 0.412   11.099   75.560  1.00 48.27  ? 235 ALA A N     1 
ATOM   1566  C  CA    . ALA A  1 235 ? 1.150   11.904   74.579  1.00 48.14  ? 235 ALA A CA    1 
ATOM   1567  C  C     . ALA A  1 235 ? 2.671   11.792   74.651  1.00 48.74  ? 235 ALA A C     1 
ATOM   1568  O  O     . ALA A  1 235 ? 3.310   12.415   75.522  1.00 50.08  ? 235 ALA A O     1 
ATOM   1569  C  CB    . ALA A  1 235 ? 0.732   13.353   74.662  1.00 48.58  ? 235 ALA A CB    1 
ATOM   1570  N  N     . ALA A  1 236 ? 3.252   11.013   73.731  1.00 48.17  ? 236 ALA A N     1 
ATOM   1571  C  CA    . ALA A  1 236 ? 4.718   10.939   73.586  1.00 48.38  ? 236 ALA A CA    1 
ATOM   1572  C  C     . ALA A  1 236 ? 5.094   11.674   72.308  1.00 48.09  ? 236 ALA A C     1 
ATOM   1573  O  O     . ALA A  1 236 ? 4.944   11.139   71.195  1.00 47.89  ? 236 ALA A O     1 
ATOM   1574  C  CB    . ALA A  1 236 ? 5.199   9.500    73.563  1.00 47.88  ? 236 ALA A CB    1 
ATOM   1575  N  N     . THR A  1 237 ? 5.559   12.912   72.461  1.00 48.44  ? 237 THR A N     1 
ATOM   1576  C  CA    . THR A  1 237 ? 5.553   13.846   71.337  1.00 48.19  ? 237 THR A CA    1 
ATOM   1577  C  C     . THR A  1 237 ? 6.857   13.922   70.569  1.00 47.85  ? 237 THR A C     1 
ATOM   1578  O  O     . THR A  1 237 ? 7.826   13.259   70.914  1.00 48.02  ? 237 THR A O     1 
ATOM   1579  C  CB    . THR A  1 237 ? 5.094   15.233   71.778  1.00 49.17  ? 237 THR A CB    1 
ATOM   1580  O  OG1   . THR A  1 237 ? 5.935   15.700   72.837  1.00 51.36  ? 237 THR A OG1   1 
ATOM   1581  C  CG2   . THR A  1 237 ? 3.669   15.160   72.274  1.00 49.49  ? 237 THR A CG2   1 
ATOM   1582  N  N     . ALA A  1 238 ? 6.852   14.747   69.521  1.00 47.90  ? 238 ALA A N     1 
ATOM   1583  C  CA    . ALA A  1 238 ? 7.957   14.913   68.565  1.00 47.62  ? 238 ALA A CA    1 
ATOM   1584  C  C     . ALA A  1 238 ? 9.367   14.976   69.170  1.00 48.75  ? 238 ALA A C     1 
ATOM   1585  O  O     . ALA A  1 238 ? 10.286  14.305   68.682  1.00 48.59  ? 238 ALA A O     1 
ATOM   1586  C  CB    . ALA A  1 238 ? 7.707   16.123   67.700  1.00 47.43  ? 238 ALA A CB    1 
ATOM   1587  N  N     . SER A  1 239 ? 9.542   15.771   70.223  1.00 49.96  ? 239 SER A N     1 
ATOM   1588  C  CA    . SER A  1 239 ? 10.863  15.934   70.809  1.00 51.05  ? 239 SER A CA    1 
ATOM   1589  C  C     . SER A  1 239 ? 11.049  15.090   72.048  1.00 51.58  ? 239 SER A C     1 
ATOM   1590  O  O     . SER A  1 239 ? 11.621  15.571   73.035  1.00 53.61  ? 239 SER A O     1 
ATOM   1591  C  CB    . SER A  1 239 ? 11.120  17.389   71.181  1.00 52.42  ? 239 SER A CB    1 
ATOM   1592  O  OG    . SER A  1 239 ? 10.409  17.736   72.363  1.00 53.23  ? 239 SER A OG    1 
ATOM   1593  N  N     . GLU A  1 240 ? 10.572  13.849   72.027  1.00 50.43  ? 240 GLU A N     1 
ATOM   1594  C  CA    . GLU A  1 240 ? 10.791  12.964   73.167  1.00 50.69  ? 240 GLU A CA    1 
ATOM   1595  C  C     . GLU A  1 240 ? 11.603  11.764   72.749  1.00 50.24  ? 240 GLU A C     1 
ATOM   1596  O  O     . GLU A  1 240 ? 11.547  11.345   71.587  1.00 49.95  ? 240 GLU A O     1 
ATOM   1597  C  CB    . GLU A  1 240 ? 9.477   12.537   73.811  1.00 50.40  ? 240 GLU A CB    1 
ATOM   1598  C  CG    . GLU A  1 240 ? 8.639   13.709   74.355  1.00 52.49  ? 240 GLU A CG    1 
ATOM   1599  C  CD    . GLU A  1 240 ? 7.718   13.301   75.502  1.00 56.17  ? 240 GLU A CD    1 
ATOM   1600  O  OE1   . GLU A  1 240 ? 6.477   13.196   75.285  1.00 57.25  ? 240 GLU A OE1   1 
ATOM   1601  O  OE2   . GLU A  1 240 ? 8.243   13.077   76.624  1.00 58.24  ? 240 GLU A OE2   1 
ATOM   1602  N  N     . ALA A  1 241 ? 12.368  11.225   73.693  1.00 50.45  ? 241 ALA A N     1 
ATOM   1603  C  CA    . ALA A  1 241 ? 13.198  10.052   73.464  1.00 49.69  ? 241 ALA A CA    1 
ATOM   1604  C  C     . ALA A  1 241 ? 12.415  8.944    72.775  1.00 48.51  ? 241 ALA A C     1 
ATOM   1605  O  O     . ALA A  1 241 ? 11.284  8.665    73.132  1.00 47.94  ? 241 ALA A O     1 
ATOM   1606  C  CB    . ALA A  1 241 ? 13.753  9.567    74.771  1.00 50.81  ? 241 ALA A CB    1 
ATOM   1607  N  N     . ALA A  1 242 ? 13.027  8.315    71.780  1.00 48.54  ? 242 ALA A N     1 
ATOM   1608  C  CA    . ALA A  1 242 ? 12.360  7.275    70.991  1.00 47.93  ? 242 ALA A CA    1 
ATOM   1609  C  C     . ALA A  1 242 ? 11.656  6.198    71.829  1.00 48.42  ? 242 ALA A C     1 
ATOM   1610  O  O     . ALA A  1 242 ? 10.513  5.853    71.532  1.00 48.05  ? 242 ALA A O     1 
ATOM   1611  C  CB    . ALA A  1 242 ? 13.319  6.651    69.990  1.00 47.60  ? 242 ALA A CB    1 
ATOM   1612  N  N     . PRO A  1 243 ? 12.311  5.684    72.892  1.00 49.63  ? 243 PRO A N     1 
ATOM   1613  C  CA    . PRO A  1 243 ? 11.684  4.664    73.740  1.00 50.03  ? 243 PRO A CA    1 
ATOM   1614  C  C     . PRO A  1 243 ? 10.325  5.081    74.284  1.00 49.82  ? 243 PRO A C     1 
ATOM   1615  O  O     . PRO A  1 243 ? 9.434   4.251    74.395  1.00 50.03  ? 243 PRO A O     1 
ATOM   1616  C  CB    . PRO A  1 243 ? 12.653  4.546    74.901  1.00 51.54  ? 243 PRO A CB    1 
ATOM   1617  C  CG    . PRO A  1 243 ? 13.933  5.020    74.369  1.00 51.92  ? 243 PRO A CG    1 
ATOM   1618  C  CD    . PRO A  1 243 ? 13.614  6.100    73.434  1.00 50.30  ? 243 PRO A CD    1 
ATOM   1619  N  N     . LEU A  1 244 ? 10.174  6.360    74.622  1.00 49.92  ? 244 LEU A N     1 
ATOM   1620  C  CA    . LEU A  1 244 ? 8.889   6.906    75.056  1.00 49.70  ? 244 LEU A CA    1 
ATOM   1621  C  C     . LEU A  1 244 ? 7.829   6.873    73.948  1.00 48.79  ? 244 LEU A C     1 
ATOM   1622  O  O     . LEU A  1 244 ? 6.690   6.491    74.186  1.00 48.74  ? 244 LEU A O     1 
ATOM   1623  C  CB    . LEU A  1 244 ? 9.070   8.318    75.608  1.00 49.90  ? 244 LEU A CB    1 
ATOM   1624  C  CG    . LEU A  1 244 ? 9.852   8.397    76.923  1.00 51.81  ? 244 LEU A CG    1 
ATOM   1625  C  CD1   . LEU A  1 244 ? 10.108  9.843    77.303  1.00 53.44  ? 244 LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A  1 244 ? 9.131   7.672    78.056  1.00 53.49  ? 244 LEU A CD2   1 
ATOM   1627  N  N     . GLN A  1 245 ? 8.215   7.266    72.739  1.00 48.64  ? 245 GLN A N     1 
ATOM   1628  C  CA    . GLN A  1 245 ? 7.361   7.133    71.558  1.00 47.94  ? 245 GLN A CA    1 
ATOM   1629  C  C     . GLN A  1 245 ? 7.075   5.678    71.231  1.00 48.16  ? 245 GLN A C     1 
ATOM   1630  O  O     . GLN A  1 245 ? 5.962   5.350    70.829  1.00 47.72  ? 245 GLN A O     1 
ATOM   1631  C  CB    . GLN A  1 245 ? 7.994   7.826    70.351  1.00 47.34  ? 245 GLN A CB    1 
ATOM   1632  C  CG    . GLN A  1 245 ? 8.075   9.336    70.515  1.00 48.14  ? 245 GLN A CG    1 
ATOM   1633  C  CD    . GLN A  1 245 ? 8.520   10.050   69.261  1.00 48.69  ? 245 GLN A CD    1 
ATOM   1634  O  OE1   . GLN A  1 245 ? 8.126   9.691    68.152  1.00 48.89  ? 245 GLN A OE1   1 
ATOM   1635  N  NE2   . GLN A  1 245 ? 9.341   11.078   69.431  1.00 49.63  ? 245 GLN A NE2   1 
ATOM   1636  N  N     . TYR A  1 246 ? 8.076   4.813    71.414  1.00 49.25  ? 246 TYR A N     1 
ATOM   1637  C  CA    . TYR A  1 246 ? 7.927   3.370    71.200  1.00 50.04  ? 246 TYR A CA    1 
ATOM   1638  C  C     . TYR A  1 246 ? 6.964   2.770    72.203  1.00 50.84  ? 246 TYR A C     1 
ATOM   1639  O  O     . TYR A  1 246 ? 6.155   1.908    71.847  1.00 50.94  ? 246 TYR A O     1 
ATOM   1640  C  CB    . TYR A  1 246 ? 9.282   2.672    71.300  1.00 51.19  ? 246 TYR A CB    1 
ATOM   1641  C  CG    . TYR A  1 246 ? 9.270   1.277    71.919  1.00 53.39  ? 246 TYR A CG    1 
ATOM   1642  C  CD1   . TYR A  1 246 ? 8.678   0.191    71.259  1.00 54.71  ? 246 TYR A CD1   1 
ATOM   1643  C  CD2   . TYR A  1 246 ? 9.892   1.039    73.136  1.00 55.23  ? 246 TYR A CD2   1 
ATOM   1644  C  CE1   . TYR A  1 246 ? 8.680   -1.081   71.816  1.00 56.22  ? 246 TYR A CE1   1 
ATOM   1645  C  CE2   . TYR A  1 246 ? 9.906   -0.231   73.696  1.00 58.23  ? 246 TYR A CE2   1 
ATOM   1646  C  CZ    . TYR A  1 246 ? 9.295   -1.289   73.033  1.00 58.41  ? 246 TYR A CZ    1 
ATOM   1647  O  OH    . TYR A  1 246 ? 9.305   -2.552   73.592  1.00 60.63  ? 246 TYR A OH    1 
ATOM   1648  N  N     . LEU A  1 247 ? 7.061   3.243    73.446  1.00 51.64  ? 247 LEU A N     1 
ATOM   1649  C  CA    . LEU A  1 247 ? 6.260   2.749    74.563  1.00 52.73  ? 247 LEU A CA    1 
ATOM   1650  C  C     . LEU A  1 247 ? 4.818   3.240    74.607  1.00 52.16  ? 247 LEU A C     1 
ATOM   1651  O  O     . LEU A  1 247 ? 3.937   2.494    75.029  1.00 53.22  ? 247 LEU A O     1 
ATOM   1652  C  CB    . LEU A  1 247 ? 6.907   3.126    75.889  1.00 53.97  ? 247 LEU A CB    1 
ATOM   1653  C  CG    . LEU A  1 247 ? 7.847   2.171    76.604  1.00 56.34  ? 247 LEU A CG    1 
ATOM   1654  C  CD1   . LEU A  1 247 ? 8.047   2.740    77.989  1.00 58.88  ? 247 LEU A CD1   1 
ATOM   1655  C  CD2   . LEU A  1 247 ? 7.285   0.759    76.682  1.00 57.65  ? 247 LEU A CD2   1 
ATOM   1656  N  N     . ALA A  1 248 ? 4.580   4.489    74.206  1.00 51.08  ? 248 ALA A N     1 
ATOM   1657  C  CA    . ALA A  1 248 ? 3.266   5.123    74.367  1.00 50.54  ? 248 ALA A CA    1 
ATOM   1658  C  C     . ALA A  1 248 ? 2.109   4.218    73.946  1.00 50.20  ? 248 ALA A C     1 
ATOM   1659  O  O     . ALA A  1 248 ? 1.195   3.995    74.729  1.00 50.85  ? 248 ALA A O     1 
ATOM   1660  C  CB    . ALA A  1 248 ? 3.202   6.473    73.649  1.00 49.58  ? 248 ALA A CB    1 
ATOM   1661  N  N     . PRO A  1 249 ? 2.163   3.654    72.732  1.00 49.47  ? 249 PRO A N     1 
ATOM   1662  C  CA    . PRO A  1 249 ? 1.065   2.765    72.384  1.00 49.54  ? 249 PRO A CA    1 
ATOM   1663  C  C     . PRO A  1 249 ? 0.795   1.610    73.376  1.00 50.56  ? 249 PRO A C     1 
ATOM   1664  O  O     . PRO A  1 249 ? -0.352  1.430    73.759  1.00 51.25  ? 249 PRO A O     1 
ATOM   1665  C  CB    . PRO A  1 249 ? 1.465   2.260    70.997  1.00 49.00  ? 249 PRO A CB    1 
ATOM   1666  C  CG    . PRO A  1 249 ? 2.245   3.417    70.432  1.00 48.45  ? 249 PRO A CG    1 
ATOM   1667  C  CD    . PRO A  1 249 ? 3.087   3.828    71.597  1.00 48.77  ? 249 PRO A CD    1 
ATOM   1668  N  N     . PHE A  1 250 ? 1.805   0.851    73.802  1.00 51.05  ? 250 PHE A N     1 
ATOM   1669  C  CA    . PHE A  1 250 ? 1.566   -0.298   74.706  1.00 52.38  ? 250 PHE A CA    1 
ATOM   1670  C  C     . PHE A  1 250 ? 1.051   0.147    76.066  1.00 53.09  ? 250 PHE A C     1 
ATOM   1671  O  O     . PHE A  1 250 ? 0.132   -0.454   76.635  1.00 54.10  ? 250 PHE A O     1 
ATOM   1672  C  CB    . PHE A  1 250 ? 2.826   -1.142   74.900  1.00 53.17  ? 250 PHE A CB    1 
ATOM   1673  C  CG    . PHE A  1 250 ? 3.465   -1.552   73.622  1.00 53.12  ? 250 PHE A CG    1 
ATOM   1674  C  CD1   . PHE A  1 250 ? 2.997   -2.659   72.923  1.00 53.51  ? 250 PHE A CD1   1 
ATOM   1675  C  CD2   . PHE A  1 250 ? 4.527   -0.814   73.097  1.00 52.67  ? 250 PHE A CD2   1 
ATOM   1676  C  CE1   . PHE A  1 250 ? 3.573   -3.027   71.720  1.00 53.20  ? 250 PHE A CE1   1 
ATOM   1677  C  CE2   . PHE A  1 250 ? 5.117   -1.176   71.897  1.00 52.39  ? 250 PHE A CE2   1 
ATOM   1678  C  CZ    . PHE A  1 250 ? 4.637   -2.283   71.200  1.00 52.90  ? 250 PHE A CZ    1 
ATOM   1679  N  N     . THR A  1 251 ? 1.666   1.210    76.570  1.00 52.46  ? 251 THR A N     1 
ATOM   1680  C  CA    . THR A  1 251 ? 1.281   1.849    77.815  1.00 52.59  ? 251 THR A CA    1 
ATOM   1681  C  C     . THR A  1 251 ? -0.203  2.229    77.849  1.00 52.37  ? 251 THR A C     1 
ATOM   1682  O  O     . THR A  1 251 ? -0.908  1.935    78.811  1.00 53.58  ? 251 THR A O     1 
ATOM   1683  C  CB    . THR A  1 251 ? 2.200   3.059    78.061  1.00 52.00  ? 251 THR A CB    1 
ATOM   1684  O  OG1   . THR A  1 251 ? 2.898   2.856    79.283  1.00 53.50  ? 251 THR A OG1   1 
ATOM   1685  C  CG2   . THR A  1 251 ? 1.443   4.360    78.147  1.00 51.21  ? 251 THR A CG2   1 
ATOM   1686  N  N     . ALA A  1 252 ? -0.671  2.868    76.783  1.00 50.82  ? 252 ALA A N     1 
ATOM   1687  C  CA    . ALA A  1 252 ? -2.033  3.335    76.715  1.00 50.21  ? 252 ALA A CA    1 
ATOM   1688  C  C     . ALA A  1 252 ? -2.944  2.119    76.575  1.00 50.79  ? 252 ALA A C     1 
ATOM   1689  O  O     . ALA A  1 252 ? -4.007  2.059    77.189  1.00 51.69  ? 252 ALA A O     1 
ATOM   1690  C  CB    . ALA A  1 252 ? -2.193  4.288    75.554  1.00 48.53  ? 252 ALA A CB    1 
ATOM   1691  N  N     . ALA A  1 253 ? -2.499  1.133    75.798  1.00 50.51  ? 253 ALA A N     1 
ATOM   1692  C  CA    . ALA A  1 253 ? -3.242  -0.112   75.609  1.00 51.15  ? 253 ALA A CA    1 
ATOM   1693  C  C     . ALA A  1 253 ? -3.562  -0.822   76.937  1.00 52.88  ? 253 ALA A C     1 
ATOM   1694  O  O     . ALA A  1 253 ? -4.608  -1.450   77.065  1.00 53.67  ? 253 ALA A O     1 
ATOM   1695  C  CB    . ALA A  1 253 ? -2.486  -1.038   74.684  1.00 50.91  ? 253 ALA A CB    1 
ATOM   1696  N  N     . SER A  1 254 ? -2.656  -0.730   77.910  1.00 53.31  ? 254 SER A N     1 
ATOM   1697  C  CA    . SER A  1 254 ? -2.926  -1.191   79.263  1.00 54.88  ? 254 SER A CA    1 
ATOM   1698  C  C     . SER A  1 254 ? -3.948  -0.302   79.948  1.00 55.13  ? 254 SER A C     1 
ATOM   1699  O  O     . SER A  1 254 ? -4.858  -0.804   80.608  1.00 56.47  ? 254 SER A O     1 
ATOM   1700  C  CB    . SER A  1 254 ? -1.653  -1.186   80.079  1.00 55.58  ? 254 SER A CB    1 
ATOM   1701  O  OG    . SER A  1 254 ? -0.681  -1.957   79.419  1.00 56.86  ? 254 SER A OG    1 
ATOM   1702  N  N     . ILE A  1 255 ? -3.796  1.016    79.795  1.00 53.88  ? 255 ILE A N     1 
ATOM   1703  C  CA    . ILE A  1 255 ? -4.761  1.961    80.339  1.00 53.92  ? 255 ILE A CA    1 
ATOM   1704  C  C     . ILE A  1 255 ? -6.143  1.616    79.785  1.00 54.01  ? 255 ILE A C     1 
ATOM   1705  O  O     . ILE A  1 255 ? -7.115  1.519    80.541  1.00 55.10  ? 255 ILE A O     1 
ATOM   1706  C  CB    . ILE A  1 255 ? -4.359  3.424    80.045  1.00 52.69  ? 255 ILE A CB    1 
ATOM   1707  C  CG1   . ILE A  1 255 ? -3.174  3.817    80.919  1.00 53.71  ? 255 ILE A CG1   1 
ATOM   1708  C  CG2   . ILE A  1 255 ? -5.505  4.385    80.318  1.00 52.39  ? 255 ILE A CG2   1 
ATOM   1709  C  CD1   . ILE A  1 255 ? -2.509  5.112    80.512  1.00 54.26  ? 255 ILE A CD1   1 
ATOM   1710  N  N     . GLY A  1 256 ? -6.203  1.395    78.471  1.00 52.86  ? 256 GLY A N     1 
ATOM   1711  C  CA    . GLY A  1 256 ? -7.433  1.038    77.788  1.00 52.90  ? 256 GLY A CA    1 
ATOM   1712  C  C     . GLY A  1 256 ? -7.913  -0.330   78.228  1.00 54.77  ? 256 GLY A C     1 
ATOM   1713  O  O     . GLY A  1 256 ? -9.118  -0.590   78.245  1.00 56.26  ? 256 GLY A O     1 
ATOM   1714  N  N     . GLU A  1 257 ? -6.983  -1.207   78.603  1.00 55.06  ? 257 GLU A N     1 
ATOM   1715  C  CA    . GLU A  1 257 ? -7.340  -2.569   78.967  1.00 56.31  ? 257 GLU A CA    1 
ATOM   1716  C  C     . GLU A  1 257 ? -8.018  -2.695   80.311  1.00 57.91  ? 257 GLU A C     1 
ATOM   1717  O  O     . GLU A  1 257 ? -8.690  -3.694   80.558  1.00 59.51  ? 257 GLU A O     1 
ATOM   1718  C  CB    . GLU A  1 257 ? -6.123  -3.468   78.954  1.00 56.87  ? 257 GLU A CB    1 
ATOM   1719  C  CG    . GLU A  1 257 ? -6.007  -4.242   77.683  1.00 57.49  ? 257 GLU A CG    1 
ATOM   1720  C  CD    . GLU A  1 257 ? -4.645  -4.869   77.464  1.00 58.13  ? 257 GLU A CD    1 
ATOM   1721  O  OE1   . GLU A  1 257 ? -3.811  -4.930   78.405  1.00 59.52  ? 257 GLU A OE1   1 
ATOM   1722  O  OE2   . GLU A  1 257 ? -4.425  -5.311   76.324  1.00 57.78  ? 257 GLU A OE2   1 
ATOM   1723  N  N     . TRP A  1 258 ? -7.826  -1.709   81.190  1.00 57.53  ? 258 TRP A N     1 
ATOM   1724  C  CA    . TRP A  1 258 ? -8.478  -1.732   82.497  1.00 58.68  ? 258 TRP A CA    1 
ATOM   1725  C  C     . TRP A  1 258 ? -9.979  -1.754   82.260  1.00 59.30  ? 258 TRP A C     1 
ATOM   1726  O  O     . TRP A  1 258 ? -10.729 -2.521   82.888  1.00 60.82  ? 258 TRP A O     1 
ATOM   1727  C  CB    . TRP A  1 258 ? -8.103  -0.516   83.343  1.00 58.33  ? 258 TRP A CB    1 
ATOM   1728  C  CG    . TRP A  1 258 ? -8.878  -0.486   84.615  1.00 59.06  ? 258 TRP A CG    1 
ATOM   1729  C  CD1   . TRP A  1 258 ? -8.492  -0.999   85.812  1.00 60.73  ? 258 TRP A CD1   1 
ATOM   1730  C  CD2   . TRP A  1 258 ? -10.194 0.048    84.811  1.00 58.33  ? 258 TRP A CD2   1 
ATOM   1731  N  NE1   . TRP A  1 258 ? -9.476  -0.813   86.747  1.00 61.95  ? 258 TRP A NE1   1 
ATOM   1732  C  CE2   . TRP A  1 258 ? -10.535 -0.174   86.159  1.00 60.36  ? 258 TRP A CE2   1 
ATOM   1733  C  CE3   . TRP A  1 258 ? -11.114 0.697    83.978  1.00 56.85  ? 258 TRP A CE3   1 
ATOM   1734  C  CZ2   . TRP A  1 258 ? -11.763 0.220    86.699  1.00 60.89  ? 258 TRP A CZ2   1 
ATOM   1735  C  CZ3   . TRP A  1 258 ? -12.331 1.092    84.513  1.00 58.27  ? 258 TRP A CZ3   1 
ATOM   1736  C  CH2   . TRP A  1 258 ? -12.643 0.854    85.866  1.00 60.24  ? 258 TRP A CH2   1 
ATOM   1737  N  N     . PHE A  1 259 ? -10.399 -0.906   81.329  1.00 57.78  ? 259 PHE A N     1 
ATOM   1738  C  CA    . PHE A  1 259 ? -11.778 -0.831   80.928  1.00 58.15  ? 259 PHE A CA    1 
ATOM   1739  C  C     . PHE A  1 259 ? -12.242 -2.173   80.386  1.00 58.99  ? 259 PHE A C     1 
ATOM   1740  O  O     . PHE A  1 259 ? -13.189 -2.755   80.909  1.00 60.40  ? 259 PHE A O     1 
ATOM   1741  C  CB    . PHE A  1 259 ? -11.958 0.299    79.920  1.00 56.45  ? 259 PHE A CB    1 
ATOM   1742  C  CG    . PHE A  1 259 ? -11.746 1.655    80.513  1.00 55.74  ? 259 PHE A CG    1 
ATOM   1743  C  CD1   . PHE A  1 259 ? -12.732 2.247    81.286  1.00 56.78  ? 259 PHE A CD1   1 
ATOM   1744  C  CD2   . PHE A  1 259 ? -10.562 2.331    80.322  1.00 54.15  ? 259 PHE A CD2   1 
ATOM   1745  C  CE1   . PHE A  1 259 ? -12.544 3.497    81.849  1.00 55.94  ? 259 PHE A CE1   1 
ATOM   1746  C  CE2   . PHE A  1 259 ? -10.370 3.579    80.891  1.00 54.72  ? 259 PHE A CE2   1 
ATOM   1747  C  CZ    . PHE A  1 259 ? -11.371 4.160    81.656  1.00 54.57  ? 259 PHE A CZ    1 
ATOM   1748  N  N     . ARG A  1 260 ? -11.545 -2.679   79.372  1.00 58.18  ? 260 ARG A N     1 
ATOM   1749  C  CA    . ARG A  1 260 ? -11.882 -3.971   78.781  1.00 59.35  ? 260 ARG A CA    1 
ATOM   1750  C  C     . ARG A  1 260 ? -11.999 -5.052   79.862  1.00 62.04  ? 260 ARG A C     1 
ATOM   1751  O  O     . ARG A  1 260 ? -12.997 -5.773   79.932  1.00 63.52  ? 260 ARG A O     1 
ATOM   1752  C  CB    . ARG A  1 260 ? -10.818 -4.358   77.755  1.00 58.04  ? 260 ARG A CB    1 
ATOM   1753  C  CG    . ARG A  1 260 ? -11.139 -5.589   76.948  1.00 58.70  ? 260 ARG A CG    1 
ATOM   1754  C  CD    . ARG A  1 260 ? -9.880  -6.221   76.398  1.00 57.97  ? 260 ARG A CD    1 
ATOM   1755  N  NE    . ARG A  1 260 ? -9.063  -6.760   77.469  1.00 59.74  ? 260 ARG A NE    1 
ATOM   1756  C  CZ    . ARG A  1 260 ? -7.774  -7.046   77.359  1.00 61.28  ? 260 ARG A CZ    1 
ATOM   1757  N  NH1   . ARG A  1 260 ? -7.134  -6.844   76.215  1.00 61.00  ? 260 ARG A NH1   1 
ATOM   1758  N  NH2   . ARG A  1 260 ? -7.114  -7.525   78.402  1.00 63.77  ? 260 ARG A NH2   1 
ATOM   1759  N  N     . ASP A  1 261 ? -10.984 -5.119   80.722  1.00 62.90  ? 261 ASP A N     1 
ATOM   1760  C  CA    . ASP A  1 261 ? -10.861 -6.145   81.738  1.00 65.51  ? 261 ASP A CA    1 
ATOM   1761  C  C     . ASP A  1 261 ? -11.852 -6.041   82.894  1.00 67.26  ? 261 ASP A C     1 
ATOM   1762  O  O     . ASP A  1 261 ? -11.917 -6.943   83.732  1.00 69.50  ? 261 ASP A O     1 
ATOM   1763  C  CB    . ASP A  1 261 ? -9.436  -6.161   82.275  1.00 65.95  ? 261 ASP A CB    1 
ATOM   1764  C  CG    . ASP A  1 261 ? -8.478  -6.918   81.366  1.00 67.35  ? 261 ASP A CG    1 
ATOM   1765  O  OD1   . ASP A  1 261 ? -8.951  -7.530   80.370  1.00 68.13  ? 261 ASP A OD1   1 
ATOM   1766  O  OD2   . ASP A  1 261 ? -7.252  -6.909   81.654  1.00 68.88  ? 261 ASP A OD2   1 
ATOM   1767  N  N     . ASN A  1 262 ? -12.621 -4.956   82.939  1.00 66.35  ? 262 ASN A N     1 
ATOM   1768  C  CA    . ASN A  1 262 ? -13.608 -4.756   84.007  1.00 67.71  ? 262 ASN A CA    1 
ATOM   1769  C  C     . ASN A  1 262 ? -15.036 -4.614   83.492  1.00 67.33  ? 262 ASN A C     1 
ATOM   1770  O  O     . ASN A  1 262 ? -15.824 -3.827   84.021  1.00 67.74  ? 262 ASN A O     1 
ATOM   1771  C  CB    . ASN A  1 262 ? -13.221 -3.555   84.882  1.00 67.56  ? 262 ASN A CB    1 
ATOM   1772  C  CG    . ASN A  1 262 ? -12.040 -3.854   85.780  1.00 68.98  ? 262 ASN A CG    1 
ATOM   1773  O  OD1   . ASN A  1 262 ? -12.190 -4.520   86.805  1.00 72.80  ? 262 ASN A OD1   1 
ATOM   1774  N  ND2   . ASN A  1 262 ? -10.854 -3.382   85.395  1.00 66.41  ? 262 ASN A ND2   1 
ATOM   1775  N  N     . GLY A  1 263 ? -15.357 -5.379   82.452  1.00 66.61  ? 263 GLY A N     1 
ATOM   1776  C  CA    . GLY A  1 263 ? -16.709 -5.405   81.892  1.00 66.48  ? 263 GLY A CA    1 
ATOM   1777  C  C     . GLY A  1 263 ? -17.193 -4.131   81.225  1.00 64.46  ? 263 GLY A C     1 
ATOM   1778  O  O     . GLY A  1 263 ? -18.388 -3.951   81.051  1.00 65.18  ? 263 GLY A O     1 
ATOM   1779  N  N     . LYS A  1 264 ? -16.265 -3.255   80.849  1.00 62.47  ? 264 LYS A N     1 
ATOM   1780  C  CA    . LYS A  1 264 ? -16.577 -1.999   80.172  1.00 60.79  ? 264 LYS A CA    1 
ATOM   1781  C  C     . LYS A  1 264 ? -15.983 -1.981   78.763  1.00 59.26  ? 264 LYS A C     1 
ATOM   1782  O  O     . LYS A  1 264 ? -15.452 -2.986   78.297  1.00 59.50  ? 264 LYS A O     1 
ATOM   1783  C  CB    . LYS A  1 264 ? -16.063 -0.817   80.991  1.00 60.29  ? 264 LYS A CB    1 
ATOM   1784  C  CG    . LYS A  1 264 ? -16.750 -0.654   82.337  1.00 61.76  ? 264 LYS A CG    1 
ATOM   1785  C  CD    . LYS A  1 264 ? -16.022 0.343    83.206  1.00 62.09  ? 264 LYS A CD    1 
ATOM   1786  C  CE    . LYS A  1 264 ? -16.408 0.191    84.660  1.00 64.53  ? 264 LYS A CE    1 
ATOM   1787  N  NZ    . LYS A  1 264 ? -17.721 0.836    84.938  1.00 67.10  ? 264 LYS A NZ    1 
ATOM   1788  N  N     . HIS A  1 265 ? -16.073 -0.836   78.085  1.00 58.15  ? 265 HIS A N     1 
ATOM   1789  C  CA    . HIS A  1 265 ? -15.689 -0.726   76.673  1.00 56.27  ? 265 HIS A CA    1 
ATOM   1790  C  C     . HIS A  1 265 ? -14.959 0.558    76.424  1.00 54.65  ? 265 HIS A C     1 
ATOM   1791  O  O     . HIS A  1 265 ? -15.395 1.622    76.856  1.00 54.50  ? 265 HIS A O     1 
ATOM   1792  C  CB    . HIS A  1 265 ? -16.924 -0.783   75.784  1.00 56.73  ? 265 HIS A CB    1 
ATOM   1793  C  CG    . HIS A  1 265 ? -17.867 -1.874   76.164  1.00 58.70  ? 265 HIS A CG    1 
ATOM   1794  N  ND1   . HIS A  1 265 ? -17.627 -3.196   75.865  1.00 59.37  ? 265 HIS A ND1   1 
ATOM   1795  C  CD2   . HIS A  1 265 ? -19.019 -1.848   76.869  1.00 60.61  ? 265 HIS A CD2   1 
ATOM   1796  C  CE1   . HIS A  1 265 ? -18.608 -3.937   76.342  1.00 61.69  ? 265 HIS A CE1   1 
ATOM   1797  N  NE2   . HIS A  1 265 ? -19.467 -3.143   76.955  1.00 63.29  ? 265 HIS A NE2   1 
ATOM   1798  N  N     . ALA A  1 266 ? -13.836 0.442    75.724  1.00 53.70  ? 266 ALA A N     1 
ATOM   1799  C  CA    . ALA A  1 266 ? -12.968 1.573    75.454  1.00 52.42  ? 266 ALA A CA    1 
ATOM   1800  C  C     . ALA A  1 266 ? -12.433 1.531    74.043  1.00 51.61  ? 266 ALA A C     1 
ATOM   1801  O  O     . ALA A  1 266 ? -12.079 0.491    73.509  1.00 51.79  ? 266 ALA A O     1 
ATOM   1802  C  CB    . ALA A  1 266 ? -11.844 1.632    76.444  1.00 52.03  ? 266 ALA A CB    1 
ATOM   1803  N  N     . LEU A  1 267 ? -12.397 2.701    73.443  1.00 51.67  ? 267 LEU A N     1 
ATOM   1804  C  CA    . LEU A  1 267 ? -11.869 2.899    72.118  1.00 51.07  ? 267 LEU A CA    1 
ATOM   1805  C  C     . LEU A  1 267 ? -10.467 3.472    72.287  1.00 50.37  ? 267 LEU A C     1 
ATOM   1806  O  O     . LEU A  1 267 ? -10.254 4.385    73.102  1.00 50.90  ? 267 LEU A O     1 
ATOM   1807  C  CB    . LEU A  1 267 ? -12.762 3.906    71.404  1.00 50.94  ? 267 LEU A CB    1 
ATOM   1808  C  CG    . LEU A  1 267 ? -12.370 4.417    70.027  1.00 50.98  ? 267 LEU A CG    1 
ATOM   1809  C  CD1   . LEU A  1 267 ? -12.471 3.308    68.991  1.00 51.71  ? 267 LEU A CD1   1 
ATOM   1810  C  CD2   . LEU A  1 267 ? -13.286 5.569    69.673  1.00 52.55  ? 267 LEU A CD2   1 
ATOM   1811  N  N     . ILE A  1 268 ? -9.507  2.927    71.542  1.00 49.58  ? 268 ILE A N     1 
ATOM   1812  C  CA    . ILE A  1 268 ? -8.149  3.470    71.539  1.00 48.60  ? 268 ILE A CA    1 
ATOM   1813  C  C     . ILE A  1 268 ? -7.709  3.866    70.136  1.00 47.72  ? 268 ILE A C     1 
ATOM   1814  O  O     . ILE A  1 268 ? -7.848  3.098    69.189  1.00 47.46  ? 268 ILE A O     1 
ATOM   1815  C  CB    . ILE A  1 268 ? -7.122  2.534    72.215  1.00 48.82  ? 268 ILE A CB    1 
ATOM   1816  C  CG1   . ILE A  1 268 ? -5.764  3.234    72.288  1.00 48.55  ? 268 ILE A CG1   1 
ATOM   1817  C  CG2   . ILE A  1 268 ? -7.039  1.180    71.500  1.00 48.45  ? 268 ILE A CG2   1 
ATOM   1818  C  CD1   . ILE A  1 268 ? -4.831  2.699    73.364  1.00 51.18  ? 268 ILE A CD1   1 
ATOM   1819  N  N     . VAL A  1 269 ? -7.201  5.084    70.015  1.00 47.39  ? 269 VAL A N     1 
ATOM   1820  C  CA    . VAL A  1 269 ? -6.763  5.596    68.739  1.00 47.43  ? 269 VAL A CA    1 
ATOM   1821  C  C     . VAL A  1 269 ? -5.265  5.760    68.809  1.00 47.73  ? 269 VAL A C     1 
ATOM   1822  O  O     . VAL A  1 269 ? -4.789  6.501    69.656  1.00 48.67  ? 269 VAL A O     1 
ATOM   1823  C  CB    . VAL A  1 269 ? -7.340  6.990    68.473  1.00 47.46  ? 269 VAL A CB    1 
ATOM   1824  C  CG1   . VAL A  1 269 ? -6.954  7.440    67.078  1.00 46.44  ? 269 VAL A CG1   1 
ATOM   1825  C  CG2   . VAL A  1 269 ? -8.867  7.025    68.696  1.00 47.84  ? 269 VAL A CG2   1 
ATOM   1826  N  N     . TYR A  1 270 ? -4.512  5.076    67.948  1.00 47.99  ? 270 TYR A N     1 
ATOM   1827  C  CA    . TYR A  1 270 ? -3.051  5.202    67.955  1.00 48.00  ? 270 TYR A CA    1 
ATOM   1828  C  C     . TYR A  1 270 ? -2.648  6.089    66.789  1.00 48.08  ? 270 TYR A C     1 
ATOM   1829  O  O     . TYR A  1 270 ? -2.679  5.651    65.637  1.00 48.02  ? 270 TYR A O     1 
ATOM   1830  C  CB    . TYR A  1 270 ? -2.379  3.851    67.781  1.00 48.02  ? 270 TYR A CB    1 
ATOM   1831  C  CG    . TYR A  1 270 ? -2.723  2.765    68.773  1.00 48.76  ? 270 TYR A CG    1 
ATOM   1832  C  CD1   . TYR A  1 270 ? -2.331  2.849    70.109  1.00 49.41  ? 270 TYR A CD1   1 
ATOM   1833  C  CD2   . TYR A  1 270 ? -3.375  1.610    68.350  1.00 49.38  ? 270 TYR A CD2   1 
ATOM   1834  C  CE1   . TYR A  1 270 ? -2.615  1.820    71.006  1.00 50.70  ? 270 TYR A CE1   1 
ATOM   1835  C  CE2   . TYR A  1 270 ? -3.663  0.579    69.229  1.00 50.67  ? 270 TYR A CE2   1 
ATOM   1836  C  CZ    . TYR A  1 270 ? -3.288  0.687    70.554  1.00 51.63  ? 270 TYR A CZ    1 
ATOM   1837  O  OH    . TYR A  1 270 ? -3.600  -0.346   71.410  1.00 52.43  ? 270 TYR A OH    1 
ATOM   1838  N  N     . ASP A  1 271 ? -2.274  7.331    67.080  1.00 48.57  ? 271 ASP A N     1 
ATOM   1839  C  CA    . ASP A  1 271 ? -2.136  8.344    66.040  1.00 48.77  ? 271 ASP A CA    1 
ATOM   1840  C  C     . ASP A  1 271 ? -0.729  8.935    66.033  1.00 49.04  ? 271 ASP A C     1 
ATOM   1841  O  O     . ASP A  1 271 ? -0.533  10.037   66.546  1.00 49.74  ? 271 ASP A O     1 
ATOM   1842  C  CB    . ASP A  1 271 ? -3.170  9.440    66.283  1.00 49.30  ? 271 ASP A CB    1 
ATOM   1843  C  CG    . ASP A  1 271 ? -3.433  10.297   65.057  1.00 50.20  ? 271 ASP A CG    1 
ATOM   1844  O  OD1   . ASP A  1 271 ? -2.640  10.235   64.091  1.00 51.60  ? 271 ASP A OD1   1 
ATOM   1845  O  OD2   . ASP A  1 271 ? -4.441  11.043   65.065  1.00 49.29  ? 271 ASP A OD2   1 
ATOM   1846  N  N     . ASP A  1 272 ? 0.248   8.246    65.420  1.00 48.92  ? 272 ASP A N     1 
ATOM   1847  C  CA    . ASP A  1 272 ? 0.010   7.082    64.545  1.00 48.54  ? 272 ASP A CA    1 
ATOM   1848  C  C     . ASP A  1 272 ? 1.124   6.055    64.589  1.00 47.11  ? 272 ASP A C     1 
ATOM   1849  O  O     . ASP A  1 272 ? 2.199   6.351    65.058  1.00 46.77  ? 272 ASP A O     1 
ATOM   1850  C  CB    . ASP A  1 272 ? -0.166  7.545    63.104  1.00 49.20  ? 272 ASP A CB    1 
ATOM   1851  C  CG    . ASP A  1 272 ? 0.986   8.374    62.638  1.00 51.61  ? 272 ASP A CG    1 
ATOM   1852  O  OD1   . ASP A  1 272 ? 2.076   7.795    62.406  1.00 53.41  ? 272 ASP A OD1   1 
ATOM   1853  O  OD2   . ASP A  1 272 ? 0.796   9.612    62.536  1.00 56.03  ? 272 ASP A OD2   1 
ATOM   1854  N  N     . LEU A  1 273 ? 0.858   4.873    64.042  1.00 46.13  ? 273 LEU A N     1 
ATOM   1855  C  CA    . LEU A  1 273 ? 1.759   3.745    64.137  1.00 46.02  ? 273 LEU A CA    1 
ATOM   1856  C  C     . LEU A  1 273 ? 2.993   3.814    63.216  1.00 46.33  ? 273 LEU A C     1 
ATOM   1857  O  O     . LEU A  1 273 ? 4.007   3.128    63.446  1.00 45.91  ? 273 LEU A O     1 
ATOM   1858  C  CB    . LEU A  1 273 ? 0.982   2.460    63.925  1.00 46.12  ? 273 LEU A CB    1 
ATOM   1859  C  CG    . LEU A  1 273 ? 0.053   2.134    65.087  1.00 46.24  ? 273 LEU A CG    1 
ATOM   1860  C  CD1   . LEU A  1 273 ? -0.070  0.643    65.255  1.00 46.80  ? 273 LEU A CD1   1 
ATOM   1861  C  CD2   . LEU A  1 273 ? 0.593   2.726    66.355  1.00 46.92  ? 273 LEU A CD2   1 
ATOM   1862  N  N     . SER A  1 274 ? 2.893   4.644    62.179  1.00 46.34  ? 274 SER A N     1 
ATOM   1863  C  CA    . SER A  1 274 ? 4.033   5.009    61.368  1.00 46.57  ? 274 SER A CA    1 
ATOM   1864  C  C     . SER A  1 274 ? 5.109   5.595    62.275  1.00 46.72  ? 274 SER A C     1 
ATOM   1865  O  O     . SER A  1 274 ? 6.233   5.085    62.341  1.00 48.08  ? 274 SER A O     1 
ATOM   1866  C  CB    . SER A  1 274 ? 3.632   6.057    60.342  1.00 46.73  ? 274 SER A CB    1 
ATOM   1867  O  OG    . SER A  1 274 ? 2.467   5.674    59.635  1.00 47.66  ? 274 SER A OG    1 
ATOM   1868  N  N     . LYS A  1 275 ? 4.767   6.650    63.000  1.00 45.80  ? 275 LYS A N     1 
ATOM   1869  C  CA    . LYS A  1 275 ? 5.742   7.302    63.858  1.00 45.17  ? 275 LYS A CA    1 
ATOM   1870  C  C     . LYS A  1 275 ? 6.293   6.411    64.952  1.00 45.00  ? 275 LYS A C     1 
ATOM   1871  O  O     . LYS A  1 275 ? 7.477   6.527    65.281  1.00 45.41  ? 275 LYS A O     1 
ATOM   1872  C  CB    . LYS A  1 275 ? 5.181   8.590    64.448  1.00 45.39  ? 275 LYS A CB    1 
ATOM   1873  C  CG    . LYS A  1 275 ? 4.915   9.598    63.397  1.00 45.14  ? 275 LYS A CG    1 
ATOM   1874  C  CD    . LYS A  1 275 ? 4.567   10.903   63.982  1.00 47.99  ? 275 LYS A CD    1 
ATOM   1875  C  CE    . LYS A  1 275 ? 4.190   11.860   62.893  1.00 50.32  ? 275 LYS A CE    1 
ATOM   1876  N  NZ    . LYS A  1 275 ? 3.182   11.211   61.980  1.00 53.12  ? 275 LYS A NZ    1 
ATOM   1877  N  N     . GLN A  1 276 ? 5.457   5.534    65.516  1.00 44.38  ? 276 GLN A N     1 
ATOM   1878  C  CA    . GLN A  1 276 ? 5.964   4.536    66.477  1.00 44.64  ? 276 GLN A CA    1 
ATOM   1879  C  C     . GLN A  1 276 ? 7.010   3.625    65.815  1.00 44.36  ? 276 GLN A C     1 
ATOM   1880  O  O     . GLN A  1 276 ? 8.120   3.480    66.327  1.00 44.53  ? 276 GLN A O     1 
ATOM   1881  C  CB    . GLN A  1 276 ? 4.853   3.679    67.108  1.00 45.00  ? 276 GLN A CB    1 
ATOM   1882  C  CG    . GLN A  1 276 ? 5.421   2.682    68.145  1.00 46.35  ? 276 GLN A CG    1 
ATOM   1883  C  CD    . GLN A  1 276 ? 4.518   1.495    68.441  1.00 46.99  ? 276 GLN A CD    1 
ATOM   1884  O  OE1   . GLN A  1 276 ? 3.768   1.045    67.580  1.00 46.80  ? 276 GLN A OE1   1 
ATOM   1885  N  NE2   . GLN A  1 276 ? 4.602   0.974    69.668  1.00 46.89  ? 276 GLN A NE2   1 
ATOM   1886  N  N     . ALA A  1 277 ? 6.646   3.036    64.672  1.00 43.48  ? 277 ALA A N     1 
ATOM   1887  C  CA    . ALA A  1 277 ? 7.553   2.215    63.887  1.00 43.07  ? 277 ALA A CA    1 
ATOM   1888  C  C     . ALA A  1 277 ? 8.888   2.919    63.721  1.00 42.93  ? 277 ALA A C     1 
ATOM   1889  O  O     . ALA A  1 277 ? 9.952   2.302    63.850  1.00 43.76  ? 277 ALA A O     1 
ATOM   1890  C  CB    . ALA A  1 277 ? 6.959   1.933    62.548  1.00 43.09  ? 277 ALA A CB    1 
ATOM   1891  N  N     . VAL A  1 278 ? 8.827   4.220    63.449  1.00 41.86  ? 278 VAL A N     1 
ATOM   1892  C  CA    . VAL A  1 278 ? 10.038  5.020    63.282  1.00 41.00  ? 278 VAL A CA    1 
ATOM   1893  C  C     . VAL A  1 278 ? 10.908  5.087    64.551  1.00 41.53  ? 278 VAL A C     1 
ATOM   1894  O  O     . VAL A  1 278 ? 12.116  4.905    64.453  1.00 42.20  ? 278 VAL A O     1 
ATOM   1895  C  CB    . VAL A  1 278 ? 9.740   6.400    62.626  1.00 40.12  ? 278 VAL A CB    1 
ATOM   1896  C  CG1   . VAL A  1 278 ? 10.782  7.448    62.986  1.00 38.52  ? 278 VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A  1 278 ? 9.675   6.225    61.139  1.00 39.25  ? 278 VAL A CG2   1 
ATOM   1898  N  N     . ALA A  1 279 ? 10.311  5.301    65.723  1.00 41.53  ? 279 ALA A N     1 
ATOM   1899  C  CA    . ALA A  1 279 ? 11.095  5.321    66.961  1.00 42.73  ? 279 ALA A CA    1 
ATOM   1900  C  C     . ALA A  1 279 ? 11.660  3.931    67.306  1.00 43.98  ? 279 ALA A C     1 
ATOM   1901  O  O     . ALA A  1 279 ? 12.841  3.792    67.628  1.00 44.81  ? 279 ALA A O     1 
ATOM   1902  C  CB    . ALA A  1 279 ? 10.287  5.862    68.091  1.00 42.80  ? 279 ALA A CB    1 
ATOM   1903  N  N     . TYR A  1 280 ? 10.835  2.894    67.196  1.00 44.21  ? 280 TYR A N     1 
ATOM   1904  C  CA    . TYR A  1 280 ? 11.336  1.542    67.313  1.00 45.14  ? 280 TYR A CA    1 
ATOM   1905  C  C     . TYR A  1 280 ? 12.541  1.318    66.421  1.00 45.75  ? 280 TYR A C     1 
ATOM   1906  O  O     . TYR A  1 280 ? 13.544  0.727    66.847  1.00 47.61  ? 280 TYR A O     1 
ATOM   1907  C  CB    . TYR A  1 280 ? 10.288  0.520    66.943  1.00 45.15  ? 280 TYR A CB    1 
ATOM   1908  C  CG    . TYR A  1 280 ? 10.692  -0.819   67.447  1.00 47.74  ? 280 TYR A CG    1 
ATOM   1909  C  CD1   . TYR A  1 280 ? 11.056  -0.973   68.776  1.00 50.49  ? 280 TYR A CD1   1 
ATOM   1910  C  CD2   . TYR A  1 280 ? 10.740  -1.934   66.606  1.00 49.45  ? 280 TYR A CD2   1 
ATOM   1911  C  CE1   . TYR A  1 280 ? 11.464  -2.203   69.276  1.00 54.22  ? 280 TYR A CE1   1 
ATOM   1912  C  CE2   . TYR A  1 280 ? 11.135  -3.187   67.097  1.00 52.09  ? 280 TYR A CE2   1 
ATOM   1913  C  CZ    . TYR A  1 280 ? 11.502  -3.307   68.440  1.00 54.54  ? 280 TYR A CZ    1 
ATOM   1914  O  OH    . TYR A  1 280 ? 11.901  -4.509   68.983  1.00 56.79  ? 280 TYR A OH    1 
ATOM   1915  N  N     . ARG A  1 281 ? 12.452  1.767    65.174  1.00 44.79  ? 281 ARG A N     1 
ATOM   1916  C  CA    . ARG A  1 281 ? 13.567  1.580    64.271  1.00 44.77  ? 281 ARG A CA    1 
ATOM   1917  C  C     . ARG A  1 281 ? 14.784  2.345    64.772  1.00 45.64  ? 281 ARG A C     1 
ATOM   1918  O  O     . ARG A  1 281 ? 15.922  1.901    64.607  1.00 46.52  ? 281 ARG A O     1 
ATOM   1919  C  CB    . ARG A  1 281 ? 13.226  1.992    62.850  1.00 43.69  ? 281 ARG A CB    1 
ATOM   1920  C  CG    . ARG A  1 281 ? 14.366  1.708    61.906  1.00 43.46  ? 281 ARG A CG    1 
ATOM   1921  C  CD    . ARG A  1 281 ? 14.108  2.135    60.502  1.00 41.75  ? 281 ARG A CD    1 
ATOM   1922  N  NE    . ARG A  1 281 ? 13.834  3.557    60.419  1.00 42.21  ? 281 ARG A NE    1 
ATOM   1923  C  CZ    . ARG A  1 281 ? 13.205  4.103    59.394  1.00 43.39  ? 281 ARG A CZ    1 
ATOM   1924  N  NH1   . ARG A  1 281 ? 12.807  3.334    58.401  1.00 45.03  ? 281 ARG A NH1   1 
ATOM   1925  N  NH2   . ARG A  1 281 ? 12.959  5.401    59.359  1.00 44.56  ? 281 ARG A NH2   1 
ATOM   1926  N  N     . GLN A  1 282 ? 14.552  3.490    65.397  1.00 45.52  ? 282 GLN A N     1 
ATOM   1927  C  CA    . GLN A  1 282 ? 15.673  4.305    65.785  1.00 46.51  ? 282 GLN A CA    1 
ATOM   1928  C  C     . GLN A  1 282 ? 16.399  3.603    66.901  1.00 48.03  ? 282 GLN A C     1 
ATOM   1929  O  O     . GLN A  1 282 ? 17.617  3.524    66.870  1.00 49.49  ? 282 GLN A O     1 
ATOM   1930  C  CB    . GLN A  1 282 ? 15.244  5.696    66.208  1.00 46.06  ? 282 GLN A CB    1 
ATOM   1931  C  CG    . GLN A  1 282 ? 16.424  6.587    66.473  1.00 47.28  ? 282 GLN A CG    1 
ATOM   1932  C  CD    . GLN A  1 282 ? 16.099  7.699    67.415  1.00 47.59  ? 282 GLN A CD    1 
ATOM   1933  O  OE1   . GLN A  1 282 ? 15.340  8.600    67.095  1.00 47.71  ? 282 GLN A OE1   1 
ATOM   1934  N  NE2   . GLN A  1 282 ? 16.680  7.647    68.595  1.00 50.61  ? 282 GLN A NE2   1 
ATOM   1935  N  N     . LEU A  1 283 ? 15.649  3.071    67.865  1.00 48.39  ? 283 LEU A N     1 
ATOM   1936  C  CA    . LEU A  1 283 ? 16.214  2.275    68.952  1.00 49.91  ? 283 LEU A CA    1 
ATOM   1937  C  C     . LEU A  1 283 ? 17.040  1.134    68.438  1.00 50.88  ? 283 LEU A C     1 
ATOM   1938  O  O     . LEU A  1 283 ? 18.173  0.943    68.885  1.00 51.96  ? 283 LEU A O     1 
ATOM   1939  C  CB    . LEU A  1 283 ? 15.120  1.670    69.810  1.00 49.90  ? 283 LEU A CB    1 
ATOM   1940  C  CG    . LEU A  1 283 ? 14.325  2.723    70.543  1.00 51.82  ? 283 LEU A CG    1 
ATOM   1941  C  CD1   . LEU A  1 283 ? 13.439  2.051    71.579  1.00 54.51  ? 283 LEU A CD1   1 
ATOM   1942  C  CD2   . LEU A  1 283 ? 15.286  3.757    71.172  1.00 54.45  ? 283 LEU A CD2   1 
ATOM   1943  N  N     . SER A  1 284 ? 16.454  0.371    67.513  1.00 50.44  ? 284 SER A N     1 
ATOM   1944  C  CA    . SER A  1 284 ? 17.053  -0.862   67.037  1.00 51.78  ? 284 SER A CA    1 
ATOM   1945  C  C     . SER A  1 284 ? 18.377  -0.657   66.330  1.00 51.87  ? 284 SER A C     1 
ATOM   1946  O  O     . SER A  1 284 ? 19.342  -1.371   66.604  1.00 53.70  ? 284 SER A O     1 
ATOM   1947  C  CB    . SER A  1 284 ? 16.090  -1.596   66.129  1.00 51.68  ? 284 SER A CB    1 
ATOM   1948  O  OG    . SER A  1 284 ? 15.558  -2.702   66.827  1.00 55.48  ? 284 SER A OG    1 
ATOM   1949  N  N     . LEU A  1 285 ? 18.428  0.318    65.429  1.00 50.15  ? 285 LEU A N     1 
ATOM   1950  C  CA    . LEU A  1 285 ? 19.655  0.615    64.727  1.00 49.87  ? 285 LEU A CA    1 
ATOM   1951  C  C     . LEU A  1 285 ? 20.706  1.105    65.718  1.00 50.66  ? 285 LEU A C     1 
ATOM   1952  O  O     . LEU A  1 285 ? 21.864  0.672    65.668  1.00 52.24  ? 285 LEU A O     1 
ATOM   1953  C  CB    . LEU A  1 285 ? 19.412  1.620    63.600  1.00 48.83  ? 285 LEU A CB    1 
ATOM   1954  C  CG    . LEU A  1 285 ? 18.383  1.182    62.545  1.00 48.71  ? 285 LEU A CG    1 
ATOM   1955  C  CD1   . LEU A  1 285 ? 18.082  2.301    61.574  1.00 48.43  ? 285 LEU A CD1   1 
ATOM   1956  C  CD2   . LEU A  1 285 ? 18.783  -0.089   61.794  1.00 48.82  ? 285 LEU A CD2   1 
ATOM   1957  N  N     . LEU A  1 286 ? 20.318  1.981    66.639  1.00 49.43  ? 286 LEU A N     1 
ATOM   1958  C  CA    . LEU A  1 286 ? 21.290  2.479    67.614  1.00 49.95  ? 286 LEU A CA    1 
ATOM   1959  C  C     . LEU A  1 286 ? 21.880  1.388    68.521  1.00 51.09  ? 286 LEU A C     1 
ATOM   1960  O  O     . LEU A  1 286 ? 23.082  1.412    68.810  1.00 52.26  ? 286 LEU A O     1 
ATOM   1961  C  CB    . LEU A  1 286 ? 20.736  3.662    68.408  1.00 49.08  ? 286 LEU A CB    1 
ATOM   1962  C  CG    . LEU A  1 286 ? 20.384  4.849    67.514  1.00 48.12  ? 286 LEU A CG    1 
ATOM   1963  C  CD1   . LEU A  1 286 ? 19.778  5.964    68.338  1.00 48.92  ? 286 LEU A CD1   1 
ATOM   1964  C  CD2   . LEU A  1 286 ? 21.571  5.353    66.724  1.00 48.56  ? 286 LEU A CD2   1 
ATOM   1965  N  N     . LEU A  1 287 ? 21.036  0.437    68.937  1.00 50.60  ? 287 LEU A N     1 
ATOM   1966  C  CA    . LEU A  1 287 ? 21.460  -0.777   69.647  1.00 51.86  ? 287 LEU A CA    1 
ATOM   1967  C  C     . LEU A  1 287 ? 22.093  -1.801   68.711  1.00 52.71  ? 287 LEU A C     1 
ATOM   1968  O  O     . LEU A  1 287 ? 22.473  -2.885   69.139  1.00 54.15  ? 287 LEU A O     1 
ATOM   1969  C  CB    . LEU A  1 287 ? 20.287  -1.441   70.369  1.00 51.44  ? 287 LEU A CB    1 
ATOM   1970  C  CG    . LEU A  1 287 ? 19.735  -0.775   71.622  1.00 51.12  ? 287 LEU A CG    1 
ATOM   1971  C  CD1   . LEU A  1 287 ? 18.321  -1.306   71.971  1.00 48.24  ? 287 LEU A CD1   1 
ATOM   1972  C  CD2   . LEU A  1 287 ? 20.723  -0.924   72.788  1.00 51.15  ? 287 LEU A CD2   1 
ATOM   1973  N  N     . ARG A  1 288 ? 22.182  -1.462   67.431  1.00 51.99  ? 288 ARG A N     1 
ATOM   1974  C  CA    . ARG A  1 288 ? 22.980  -2.236   66.481  1.00 53.32  ? 288 ARG A CA    1 
ATOM   1975  C  C     . ARG A  1 288 ? 22.373  -3.579   66.119  1.00 53.27  ? 288 ARG A C     1 
ATOM   1976  O  O     . ARG A  1 288 ? 23.090  -4.496   65.723  1.00 55.12  ? 288 ARG A O     1 
ATOM   1977  C  CB    . ARG A  1 288 ? 24.393  -2.454   67.012  1.00 55.41  ? 288 ARG A CB    1 
ATOM   1978  C  CG    . ARG A  1 288 ? 25.327  -1.314   66.794  1.00 58.13  ? 288 ARG A CG    1 
ATOM   1979  C  CD    . ARG A  1 288 ? 26.602  -1.860   66.164  1.00 67.35  ? 288 ARG A CD    1 
ATOM   1980  N  NE    . ARG A  1 288 ? 27.767  -1.000   66.345  1.00 72.29  ? 288 ARG A NE    1 
ATOM   1981  C  CZ    . ARG A  1 288 ? 27.831  0.276    65.965  1.00 73.81  ? 288 ARG A CZ    1 
ATOM   1982  N  NH1   . ARG A  1 288 ? 26.780  0.864    65.393  1.00 70.50  ? 288 ARG A NH1   1 
ATOM   1983  N  NH2   . ARG A  1 288 ? 28.955  0.970    66.170  1.00 76.40  ? 288 ARG A NH2   1 
ATOM   1984  N  N     . ARG A  1 289 ? 21.063  -3.703   66.257  1.00 51.55  ? 289 ARG A N     1 
ATOM   1985  C  CA    . ARG A  1 289 ? 20.380  -4.932   65.887  1.00 51.74  ? 289 ARG A CA    1 
ATOM   1986  C  C     . ARG A  1 289 ? 20.253  -5.035   64.370  1.00 51.05  ? 289 ARG A C     1 
ATOM   1987  O  O     . ARG A  1 289 ? 20.188  -4.002   63.699  1.00 50.33  ? 289 ARG A O     1 
ATOM   1988  C  CB    . ARG A  1 289 ? 19.018  -4.981   66.550  1.00 51.05  ? 289 ARG A CB    1 
ATOM   1989  C  CG    . ARG A  1 289 ? 19.091  -4.912   68.062  1.00 52.00  ? 289 ARG A CG    1 
ATOM   1990  C  CD    . ARG A  1 289 ? 17.839  -5.488   68.611  1.00 53.23  ? 289 ARG A CD    1 
ATOM   1991  N  NE    . ARG A  1 289 ? 17.761  -5.392   70.058  1.00 54.17  ? 289 ARG A NE    1 
ATOM   1992  C  CZ    . ARG A  1 289 ? 16.617  -5.258   70.721  1.00 53.35  ? 289 ARG A CZ    1 
ATOM   1993  N  NH1   . ARG A  1 289 ? 15.460  -5.191   70.061  1.00 50.56  ? 289 ARG A NH1   1 
ATOM   1994  N  NH2   . ARG A  1 289 ? 16.634  -5.175   72.043  1.00 54.63  ? 289 ARG A NH2   1 
ATOM   1995  N  N     . PRO A  1 290 ? 20.230  -6.273   63.815  1.00 51.56  ? 290 PRO A N     1 
ATOM   1996  C  CA    . PRO A  1 290 ? 20.275  -6.419   62.354  1.00 51.48  ? 290 PRO A CA    1 
ATOM   1997  C  C     . PRO A  1 290 ? 19.115  -5.715   61.630  1.00 50.12  ? 290 PRO A C     1 
ATOM   1998  O  O     . PRO A  1 290 ? 17.950  -5.962   61.955  1.00 49.59  ? 290 PRO A O     1 
ATOM   1999  C  CB    . PRO A  1 290 ? 20.197  -7.932   62.136  1.00 52.77  ? 290 PRO A CB    1 
ATOM   2000  C  CG    . PRO A  1 290 ? 20.360  -8.540   63.445  1.00 53.31  ? 290 PRO A CG    1 
ATOM   2001  C  CD    . PRO A  1 290 ? 20.053  -7.565   64.492  1.00 52.49  ? 290 PRO A CD    1 
ATOM   2002  N  N     . PRO A  1 291 ? 19.431  -4.827   60.670  1.00 49.86  ? 291 PRO A N     1 
ATOM   2003  C  CA    . PRO A  1 291 ? 18.360  -4.169   59.913  1.00 48.97  ? 291 PRO A CA    1 
ATOM   2004  C  C     . PRO A  1 291 ? 17.856  -5.014   58.738  1.00 50.11  ? 291 PRO A C     1 
ATOM   2005  O  O     . PRO A  1 291 ? 18.549  -5.898   58.250  1.00 51.97  ? 291 PRO A O     1 
ATOM   2006  C  CB    . PRO A  1 291 ? 19.029  -2.893   59.399  1.00 48.10  ? 291 PRO A CB    1 
ATOM   2007  C  CG    . PRO A  1 291 ? 20.478  -3.243   59.304  1.00 49.23  ? 291 PRO A CG    1 
ATOM   2008  C  CD    . PRO A  1 291 ? 20.761  -4.276   60.349  1.00 50.14  ? 291 PRO A CD    1 
ATOM   2009  N  N     . GLY A  1 292 ? 16.653  -4.733   58.280  1.00 49.79  ? 292 GLY A N     1 
ATOM   2010  C  CA    . GLY A  1 292 ? 16.160  -5.360   57.067  1.00 51.02  ? 292 GLY A CA    1 
ATOM   2011  C  C     . GLY A  1 292 ? 15.403  -4.365   56.207  1.00 50.34  ? 292 GLY A C     1 
ATOM   2012  O  O     . GLY A  1 292 ? 15.747  -3.184   56.143  1.00 50.08  ? 292 GLY A O     1 
ATOM   2013  N  N     . ARG A  1 293 ? 14.364  -4.833   55.541  1.00 50.45  ? 293 ARG A N     1 
ATOM   2014  C  CA    . ARG A  1 293 ? 13.749  -4.022   54.535  1.00 50.07  ? 293 ARG A CA    1 
ATOM   2015  C  C     . ARG A  1 293 ? 13.403  -2.691   55.158  1.00 48.62  ? 293 ARG A C     1 
ATOM   2016  O  O     . ARG A  1 293 ? 12.784  -2.651   56.219  1.00 48.03  ? 293 ARG A O     1 
ATOM   2017  C  CB    . ARG A  1 293 ? 12.516  -4.714   53.985  1.00 50.57  ? 293 ARG A CB    1 
ATOM   2018  C  CG    . ARG A  1 293 ? 11.570  -3.767   53.307  1.00 51.51  ? 293 ARG A CG    1 
ATOM   2019  C  CD    . ARG A  1 293 ? 10.635  -4.538   52.479  1.00 54.04  ? 293 ARG A CD    1 
ATOM   2020  N  NE    . ARG A  1 293 ? 9.836   -3.682   51.629  1.00 54.68  ? 293 ARG A NE    1 
ATOM   2021  C  CZ    . ARG A  1 293 ? 8.548   -3.895   51.445  1.00 57.07  ? 293 ARG A CZ    1 
ATOM   2022  N  NH1   . ARG A  1 293 ? 7.972   -4.895   52.104  1.00 58.23  ? 293 ARG A NH1   1 
ATOM   2023  N  NH2   . ARG A  1 293 ? 7.834   -3.109   50.644  1.00 58.32  ? 293 ARG A NH2   1 
ATOM   2024  N  N     . GLU A  1 294 ? 13.850  -1.619   54.502  1.00 48.33  ? 294 GLU A N     1 
ATOM   2025  C  CA    . GLU A  1 294 ? 13.635  -0.232   54.930  1.00 47.26  ? 294 GLU A CA    1 
ATOM   2026  C  C     . GLU A  1 294 ? 14.334  0.102    56.238  1.00 46.49  ? 294 GLU A C     1 
ATOM   2027  O  O     . GLU A  1 294 ? 14.061  1.132    56.846  1.00 45.42  ? 294 GLU A O     1 
ATOM   2028  C  CB    . GLU A  1 294 ? 12.140  0.110    54.989  1.00 46.80  ? 294 GLU A CB    1 
ATOM   2029  C  CG    . GLU A  1 294 ? 11.577  0.619    53.671  1.00 49.51  ? 294 GLU A CG    1 
ATOM   2030  C  CD    . GLU A  1 294 ? 10.065  0.432    53.540  1.00 52.07  ? 294 GLU A CD    1 
ATOM   2031  O  OE1   . GLU A  1 294 ? 9.332   0.947    54.400  1.00 51.49  ? 294 GLU A OE1   1 
ATOM   2032  O  OE2   . GLU A  1 294 ? 9.609   -0.230   52.568  1.00 55.49  ? 294 GLU A OE2   1 
ATOM   2033  N  N     . ALA A  1 295 ? 15.256  -0.774   56.636  1.00 47.24  ? 295 ALA A N     1 
ATOM   2034  C  CA    . ALA A  1 295 ? 16.019  -0.688   57.895  1.00 47.46  ? 295 ALA A CA    1 
ATOM   2035  C  C     . ALA A  1 295 ? 15.211  -0.944   59.173  1.00 47.13  ? 295 ALA A C     1 
ATOM   2036  O  O     . ALA A  1 295 ? 15.734  -0.783   60.267  1.00 48.02  ? 295 ALA A O     1 
ATOM   2037  C  CB    . ALA A  1 295 ? 16.850  0.631    58.001  1.00 47.05  ? 295 ALA A CB    1 
ATOM   2038  N  N     . TYR A  1 296 ? 13.962  -1.365   59.058  1.00 46.63  ? 296 TYR A N     1 
ATOM   2039  C  CA    . TYR A  1 296 ? 13.278  -1.895   60.229  1.00 46.82  ? 296 TYR A CA    1 
ATOM   2040  C  C     . TYR A  1 296 ? 13.885  -3.207   60.701  1.00 48.72  ? 296 TYR A C     1 
ATOM   2041  O  O     . TYR A  1 296 ? 14.309  -4.048   59.882  1.00 49.62  ? 296 TYR A O     1 
ATOM   2042  C  CB    . TYR A  1 296 ? 11.794  -2.086   59.974  1.00 46.04  ? 296 TYR A CB    1 
ATOM   2043  C  CG    . TYR A  1 296 ? 11.124  -0.777   59.739  1.00 45.19  ? 296 TYR A CG    1 
ATOM   2044  C  CD1   . TYR A  1 296 ? 10.727  0.025    60.809  1.00 43.59  ? 296 TYR A CD1   1 
ATOM   2045  C  CD2   . TYR A  1 296 ? 10.918  -0.314   58.444  1.00 44.84  ? 296 TYR A CD2   1 
ATOM   2046  C  CE1   . TYR A  1 296 ? 10.141  1.241    60.593  1.00 43.05  ? 296 TYR A CE1   1 
ATOM   2047  C  CE2   . TYR A  1 296 ? 10.329  0.893    58.218  1.00 44.38  ? 296 TYR A CE2   1 
ATOM   2048  C  CZ    . TYR A  1 296 ? 9.943   1.668    59.293  1.00 44.51  ? 296 TYR A CZ    1 
ATOM   2049  O  OH    . TYR A  1 296 ? 9.337   2.876    59.048  1.00 47.84  ? 296 TYR A OH    1 
ATOM   2050  N  N     . PRO A  1 297 ? 13.922  -3.391   62.034  1.00 49.37  ? 297 PRO A N     1 
ATOM   2051  C  CA    . PRO A  1 297 ? 14.354  -4.651   62.609  1.00 50.66  ? 297 PRO A CA    1 
ATOM   2052  C  C     . PRO A  1 297 ? 13.369  -5.703   62.175  1.00 51.09  ? 297 PRO A C     1 
ATOM   2053  O  O     . PRO A  1 297 ? 12.229  -5.382   61.868  1.00 50.19  ? 297 PRO A O     1 
ATOM   2054  C  CB    . PRO A  1 297 ? 14.253  -4.410   64.119  1.00 50.78  ? 297 PRO A CB    1 
ATOM   2055  C  CG    . PRO A  1 297 ? 13.338  -3.259   64.283  1.00 49.33  ? 297 PRO A CG    1 
ATOM   2056  C  CD    . PRO A  1 297 ? 13.502  -2.421   63.066  1.00 48.70  ? 297 PRO A CD    1 
ATOM   2057  N  N     . GLY A  1 298 ? 13.815  -6.943   62.137  1.00 53.00  ? 298 GLY A N     1 
ATOM   2058  C  CA    . GLY A  1 298 ? 13.000  -8.036   61.667  1.00 54.33  ? 298 GLY A CA    1 
ATOM   2059  C  C     . GLY A  1 298 ? 11.985  -8.506   62.678  1.00 55.20  ? 298 GLY A C     1 
ATOM   2060  O  O     . GLY A  1 298 ? 11.479  -9.614   62.561  1.00 56.86  ? 298 GLY A O     1 
ATOM   2061  N  N     . ASP A  1 299 ? 11.682  -7.677   63.673  1.00 55.00  ? 299 ASP A N     1 
ATOM   2062  C  CA    . ASP A  1 299 ? 10.573  -7.956   64.601  1.00 55.79  ? 299 ASP A CA    1 
ATOM   2063  C  C     . ASP A  1 299 ? 9.602   -6.791   64.741  1.00 54.19  ? 299 ASP A C     1 
ATOM   2064  O  O     . ASP A  1 299 ? 8.977   -6.651   65.794  1.00 54.43  ? 299 ASP A O     1 
ATOM   2065  C  CB    . ASP A  1 299 ? 11.106  -8.318   65.985  1.00 57.16  ? 299 ASP A CB    1 
ATOM   2066  C  CG    . ASP A  1 299 ? 11.661  -7.114   66.739  1.00 57.69  ? 299 ASP A CG    1 
ATOM   2067  O  OD1   . ASP A  1 299 ? 12.008  -6.098   66.086  1.00 56.84  ? 299 ASP A OD1   1 
ATOM   2068  O  OD2   . ASP A  1 299 ? 11.754  -7.193   67.993  1.00 60.19  ? 299 ASP A OD2   1 
ATOM   2069  N  N     . VAL A  1 300 ? 9.486   -5.963   63.696  1.00 53.01  ? 300 VAL A N     1 
ATOM   2070  C  CA    . VAL A  1 300 ? 8.690   -4.739   63.739  1.00 51.46  ? 300 VAL A CA    1 
ATOM   2071  C  C     . VAL A  1 300 ? 7.223   -5.105   63.595  1.00 52.09  ? 300 VAL A C     1 
ATOM   2072  O  O     . VAL A  1 300 ? 6.332   -4.404   64.089  1.00 51.85  ? 300 VAL A O     1 
ATOM   2073  C  CB    . VAL A  1 300 ? 9.126   -3.732   62.639  1.00 50.27  ? 300 VAL A CB    1 
ATOM   2074  C  CG1   . VAL A  1 300 ? 8.809   -4.243   61.255  1.00 50.85  ? 300 VAL A CG1   1 
ATOM   2075  C  CG2   . VAL A  1 300 ? 8.490   -2.379   62.837  1.00 48.57  ? 300 VAL A CG2   1 
ATOM   2076  N  N     . PHE A  1 301 ? 6.987   -6.218   62.906  1.00 53.42  ? 301 PHE A N     1 
ATOM   2077  C  CA    . PHE A  1 301 ? 5.656   -6.726   62.661  1.00 53.42  ? 301 PHE A CA    1 
ATOM   2078  C  C     . PHE A  1 301 ? 5.139   -7.255   63.976  1.00 54.65  ? 301 PHE A C     1 
ATOM   2079  O  O     . PHE A  1 301 ? 3.974   -7.069   64.316  1.00 54.91  ? 301 PHE A O     1 
ATOM   2080  C  CB    . PHE A  1 301 ? 5.706   -7.824   61.609  1.00 54.00  ? 301 PHE A CB    1 
ATOM   2081  C  CG    . PHE A  1 301 ? 4.435   -8.574   61.466  1.00 53.88  ? 301 PHE A CG    1 
ATOM   2082  C  CD1   . PHE A  1 301 ? 3.413   -8.077   60.681  1.00 52.00  ? 301 PHE A CD1   1 
ATOM   2083  C  CD2   . PHE A  1 301 ? 4.254   -9.782   62.121  1.00 55.02  ? 301 PHE A CD2   1 
ATOM   2084  C  CE1   . PHE A  1 301 ? 2.228   -8.768   60.549  1.00 52.59  ? 301 PHE A CE1   1 
ATOM   2085  C  CE2   . PHE A  1 301 ? 3.068   -10.482  61.995  1.00 55.45  ? 301 PHE A CE2   1 
ATOM   2086  C  CZ    . PHE A  1 301 ? 2.051   -9.971   61.205  1.00 54.27  ? 301 PHE A CZ    1 
ATOM   2087  N  N     . TYR A  1 302 ? 6.024   -7.894   64.726  1.00 56.21  ? 302 TYR A N     1 
ATOM   2088  C  CA    . TYR A  1 302 ? 5.694   -8.400   66.043  1.00 57.96  ? 302 TYR A CA    1 
ATOM   2089  C  C     . TYR A  1 302 ? 5.385   -7.218   66.951  1.00 57.08  ? 302 TYR A C     1 
ATOM   2090  O  O     . TYR A  1 302 ? 4.543   -7.317   67.841  1.00 57.52  ? 302 TYR A O     1 
ATOM   2091  C  CB    . TYR A  1 302 ? 6.856   -9.235   66.565  1.00 59.68  ? 302 TYR A CB    1 
ATOM   2092  C  CG    . TYR A  1 302 ? 6.704   -9.889   67.921  1.00 62.18  ? 302 TYR A CG    1 
ATOM   2093  C  CD1   . TYR A  1 302 ? 5.520   -10.507  68.308  1.00 63.56  ? 302 TYR A CD1   1 
ATOM   2094  C  CD2   . TYR A  1 302 ? 7.797   -9.941   68.798  1.00 64.47  ? 302 TYR A CD2   1 
ATOM   2095  C  CE1   . TYR A  1 302 ? 5.420   -11.127  69.553  1.00 66.78  ? 302 TYR A CE1   1 
ATOM   2096  C  CE2   . TYR A  1 302 ? 7.712   -10.555  70.032  1.00 66.89  ? 302 TYR A CE2   1 
ATOM   2097  C  CZ    . TYR A  1 302 ? 6.527   -11.149  70.408  1.00 68.76  ? 302 TYR A CZ    1 
ATOM   2098  O  OH    . TYR A  1 302 ? 6.458   -11.759  71.646  1.00 72.36  ? 302 TYR A OH    1 
ATOM   2099  N  N     . LEU A  1 303 ? 6.030   -6.083   66.696  1.00 56.11  ? 303 LEU A N     1 
ATOM   2100  C  CA    . LEU A  1 303 ? 5.752   -4.873   67.474  1.00 55.40  ? 303 LEU A CA    1 
ATOM   2101  C  C     . LEU A  1 303 ? 4.281   -4.462   67.377  1.00 54.36  ? 303 LEU A C     1 
ATOM   2102  O  O     . LEU A  1 303 ? 3.662   -4.100   68.373  1.00 54.39  ? 303 LEU A O     1 
ATOM   2103  C  CB    . LEU A  1 303 ? 6.636   -3.711   67.027  1.00 54.45  ? 303 LEU A CB    1 
ATOM   2104  C  CG    . LEU A  1 303 ? 6.613   -2.530   67.994  1.00 55.39  ? 303 LEU A CG    1 
ATOM   2105  C  CD1   . LEU A  1 303 ? 7.744   -2.668   69.012  1.00 57.38  ? 303 LEU A CD1   1 
ATOM   2106  C  CD2   . LEU A  1 303 ? 6.721   -1.205   67.233  1.00 55.66  ? 303 LEU A CD2   1 
ATOM   2107  N  N     . HIS A  1 304 ? 3.724   -4.522   66.176  1.00 53.46  ? 304 HIS A N     1 
ATOM   2108  C  CA    . HIS A  1 304 ? 2.394   -4.014   65.979  1.00 52.41  ? 304 HIS A CA    1 
ATOM   2109  C  C     . HIS A  1 304 ? 1.328   -5.038   66.245  1.00 53.58  ? 304 HIS A C     1 
ATOM   2110  O  O     . HIS A  1 304 ? 0.237   -4.672   66.670  1.00 53.91  ? 304 HIS A O     1 
ATOM   2111  C  CB    . HIS A  1 304 ? 2.241   -3.362   64.613  1.00 51.22  ? 304 HIS A CB    1 
ATOM   2112  C  CG    . HIS A  1 304 ? 2.832   -1.987   64.555  1.00 50.17  ? 304 HIS A CG    1 
ATOM   2113  N  ND1   . HIS A  1 304 ? 3.016   -1.294   63.378  1.00 49.45  ? 304 HIS A ND1   1 
ATOM   2114  C  CD2   . HIS A  1 304 ? 3.301   -1.184   65.540  1.00 48.84  ? 304 HIS A CD2   1 
ATOM   2115  C  CE1   . HIS A  1 304 ? 3.562   -0.121   63.641  1.00 48.04  ? 304 HIS A CE1   1 
ATOM   2116  N  NE2   . HIS A  1 304 ? 3.739   -0.028   64.946  1.00 48.15  ? 304 HIS A NE2   1 
ATOM   2117  N  N     . SER A  1 305 ? 1.638   -6.316   66.035  1.00 54.49  ? 305 SER A N     1 
ATOM   2118  C  CA    . SER A  1 305 ? 0.644   -7.360   66.261  1.00 55.24  ? 305 SER A CA    1 
ATOM   2119  C  C     . SER A  1 305 ? 0.535   -7.715   67.741  1.00 56.09  ? 305 SER A C     1 
ATOM   2120  O  O     . SER A  1 305 ? -0.529  -8.077   68.204  1.00 57.05  ? 305 SER A O     1 
ATOM   2121  C  CB    . SER A  1 305 ? 0.895   -8.590   65.380  1.00 56.35  ? 305 SER A CB    1 
ATOM   2122  O  OG    . SER A  1 305 ? 2.161   -9.166   65.629  1.00 57.19  ? 305 SER A OG    1 
ATOM   2123  N  N     . ARG A  1 306 ? 1.636   -7.598   68.479  1.00 56.28  ? 306 ARG A N     1 
ATOM   2124  C  CA    . ARG A  1 306 ? 1.606   -7.657   69.939  1.00 57.06  ? 306 ARG A CA    1 
ATOM   2125  C  C     . ARG A  1 306 ? 0.564   -6.663   70.409  1.00 55.59  ? 306 ARG A C     1 
ATOM   2126  O  O     . ARG A  1 306 ? -0.235  -6.950   71.284  1.00 56.73  ? 306 ARG A O     1 
ATOM   2127  C  CB    . ARG A  1 306 ? 2.972   -7.250   70.545  1.00 57.51  ? 306 ARG A CB    1 
ATOM   2128  C  CG    . ARG A  1 306 ? 3.910   -8.400   70.925  1.00 61.51  ? 306 ARG A CG    1 
ATOM   2129  C  CD    . ARG A  1 306 ? 4.923   -8.023   72.041  1.00 66.87  ? 306 ARG A CD    1 
ATOM   2130  N  NE    . ARG A  1 306 ? 6.278   -7.733   71.549  1.00 69.65  ? 306 ARG A NE    1 
ATOM   2131  C  CZ    . ARG A  1 306 ? 6.884   -6.545   71.634  1.00 70.00  ? 306 ARG A CZ    1 
ATOM   2132  N  NH1   . ARG A  1 306 ? 6.281   -5.511   72.209  1.00 69.47  ? 306 ARG A NH1   1 
ATOM   2133  N  NH2   . ARG A  1 306 ? 8.106   -6.386   71.149  1.00 70.83  ? 306 ARG A NH2   1 
ATOM   2134  N  N     . LEU A  1 307 ? 0.580   -5.491   69.792  1.00 53.49  ? 307 LEU A N     1 
ATOM   2135  C  CA    . LEU A  1 307 ? -0.195  -4.345   70.239  1.00 52.05  ? 307 LEU A CA    1 
ATOM   2136  C  C     . LEU A  1 307 ? -1.644  -4.404   69.808  1.00 51.76  ? 307 LEU A C     1 
ATOM   2137  O  O     . LEU A  1 307 ? -2.526  -4.076   70.591  1.00 52.35  ? 307 LEU A O     1 
ATOM   2138  C  CB    . LEU A  1 307 ? 0.442   -3.056   69.703  1.00 50.59  ? 307 LEU A CB    1 
ATOM   2139  C  CG    . LEU A  1 307 ? -0.337  -1.747   69.784  1.00 48.82  ? 307 LEU A CG    1 
ATOM   2140  C  CD1   . LEU A  1 307 ? -0.481  -1.337   71.228  1.00 47.73  ? 307 LEU A CD1   1 
ATOM   2141  C  CD2   . LEU A  1 307 ? 0.365   -0.664   68.950  1.00 47.02  ? 307 LEU A CD2   1 
ATOM   2142  N  N     . LEU A  1 308 ? -1.891  -4.795   68.561  1.00 51.19  ? 308 LEU A N     1 
ATOM   2143  C  CA    . LEU A  1 308 ? -3.238  -4.712   68.008  1.00 50.74  ? 308 LEU A CA    1 
ATOM   2144  C  C     . LEU A  1 308 ? -4.090  -5.932   68.332  1.00 52.33  ? 308 LEU A C     1 
ATOM   2145  O  O     . LEU A  1 308 ? -5.309  -5.828   68.362  1.00 52.57  ? 308 LEU A O     1 
ATOM   2146  C  CB    . LEU A  1 308 ? -3.210  -4.428   66.507  1.00 49.69  ? 308 LEU A CB    1 
ATOM   2147  C  CG    . LEU A  1 308 ? -2.636  -3.058   66.147  1.00 48.10  ? 308 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A  1 308 ? -2.203  -3.037   64.697  1.00 48.28  ? 308 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A  1 308 ? -3.601  -1.923   66.440  1.00 46.87  ? 308 LEU A CD2   1 
ATOM   2150  N  N     . GLU A  1 309 ? -3.464  -7.077   68.601  1.00 53.40  ? 309 GLU A N     1 
ATOM   2151  C  CA    . GLU A  1 309 ? -4.233  -8.251   69.035  1.00 55.15  ? 309 GLU A CA    1 
ATOM   2152  C  C     . GLU A  1 309 ? -4.781  -8.120   70.463  1.00 55.56  ? 309 GLU A C     1 
ATOM   2153  O  O     . GLU A  1 309 ? -5.592  -8.940   70.909  1.00 57.53  ? 309 GLU A O     1 
ATOM   2154  C  CB    . GLU A  1 309 ? -3.444  -9.541   68.851  1.00 56.34  ? 309 GLU A CB    1 
ATOM   2155  C  CG    . GLU A  1 309 ? -3.286  -9.918   67.380  1.00 57.50  ? 309 GLU A CG    1 
ATOM   2156  C  CD    . GLU A  1 309 ? -4.300  -10.952  66.910  1.00 60.07  ? 309 GLU A CD    1 
ATOM   2157  O  OE1   . GLU A  1 309 ? -4.034  -12.166  67.085  1.00 60.81  ? 309 GLU A OE1   1 
ATOM   2158  O  OE2   . GLU A  1 309 ? -5.347  -10.550  66.345  1.00 61.40  ? 309 GLU A OE2   1 
ATOM   2159  N  N     . ARG A  1 310 ? -4.354  -7.072   71.162  1.00 53.70  ? 310 ARG A N     1 
ATOM   2160  C  CA    . ARG A  1 310 ? -4.834  -6.801   72.504  1.00 53.15  ? 310 ARG A CA    1 
ATOM   2161  C  C     . ARG A  1 310 ? -6.219  -6.181   72.482  1.00 52.55  ? 310 ARG A C     1 
ATOM   2162  O  O     . ARG A  1 310 ? -6.928  -6.222   73.482  1.00 53.43  ? 310 ARG A O     1 
ATOM   2163  C  CB    . ARG A  1 310 ? -3.859  -5.896   73.240  1.00 52.23  ? 310 ARG A CB    1 
ATOM   2164  C  CG    . ARG A  1 310 ? -2.598  -6.579   73.670  1.00 52.09  ? 310 ARG A CG    1 
ATOM   2165  C  CD    . ARG A  1 310 ? -1.584  -5.566   74.137  1.00 51.28  ? 310 ARG A CD    1 
ATOM   2166  N  NE    . ARG A  1 310 ? -1.915  -5.014   75.444  1.00 51.99  ? 310 ARG A NE    1 
ATOM   2167  C  CZ    . ARG A  1 310 ? -1.089  -4.290   76.192  1.00 51.97  ? 310 ARG A CZ    1 
ATOM   2168  N  NH1   . ARG A  1 310 ? 0.140   -4.017   75.771  1.00 51.62  ? 310 ARG A NH1   1 
ATOM   2169  N  NH2   . ARG A  1 310 ? -1.495  -3.835   77.367  1.00 52.85  ? 310 ARG A NH2   1 
ATOM   2170  N  N     . ALA A  1 311 ? -6.596  -5.571   71.360  1.00 51.10  ? 311 ALA A N     1 
ATOM   2171  C  CA    . ALA A  1 311 ? -7.981  -5.138   71.174  1.00 50.57  ? 311 ALA A CA    1 
ATOM   2172  C  C     . ALA A  1 311 ? -8.735  -6.428   71.009  1.00 52.23  ? 311 ALA A C     1 
ATOM   2173  O  O     . ALA A  1 311 ? -8.268  -7.349   70.305  1.00 52.61  ? 311 ALA A O     1 
ATOM   2174  C  CB    . ALA A  1 311 ? -8.148  -4.258   69.946  1.00 48.59  ? 311 ALA A CB    1 
ATOM   2175  N  N     . ALA A  1 312 ? -9.872  -6.517   71.691  1.00 53.11  ? 312 ALA A N     1 
ATOM   2176  C  CA    . ALA A  1 312 ? -10.649 -7.737   71.681  1.00 54.87  ? 312 ALA A CA    1 
ATOM   2177  C  C     . ALA A  1 312 ? -12.001 -7.539   72.311  1.00 55.62  ? 312 ALA A C     1 
ATOM   2178  O  O     . ALA A  1 312 ? -12.181 -6.651   73.126  1.00 55.23  ? 312 ALA A O     1 
ATOM   2179  C  CB    . ALA A  1 312 ? -9.889  -8.837   72.417  1.00 56.51  ? 312 ALA A CB    1 
ATOM   2180  N  N     . LYS A  1 313 ? -12.946 -8.375   71.907  1.00 57.08  ? 313 LYS A N     1 
ATOM   2181  C  CA    . LYS A  1 313 ? -14.199 -8.569   72.619  1.00 58.44  ? 313 LYS A CA    1 
ATOM   2182  C  C     . LYS A  1 313 ? -14.073 -9.834   73.473  1.00 60.99  ? 313 LYS A C     1 
ATOM   2183  O  O     . LYS A  1 313 ? -13.877 -10.936  72.955  1.00 61.76  ? 313 LYS A O     1 
ATOM   2184  C  CB    . LYS A  1 313 ? -15.347 -8.725   71.626  1.00 58.44  ? 313 LYS A CB    1 
ATOM   2185  C  CG    . LYS A  1 313 ? -16.631 -9.229   72.231  1.00 59.24  ? 313 LYS A CG    1 
ATOM   2186  C  CD    . LYS A  1 313 ? -17.323 -8.138   73.018  1.00 57.71  ? 313 LYS A CD    1 
ATOM   2187  C  CE    . LYS A  1 313 ? -18.716 -8.541   73.421  1.00 58.02  ? 313 LYS A CE    1 
ATOM   2188  N  NZ    . LYS A  1 313 ? -19.321 -7.494   74.269  1.00 57.07  ? 313 LYS A NZ    1 
ATOM   2189  N  N     . LEU A  1 314 ? -14.183 -9.660   74.784  1.00 62.45  ? 314 LEU A N     1 
ATOM   2190  C  CA    . LEU A  1 314 ? -14.065 -10.767  75.722  1.00 65.23  ? 314 LEU A CA    1 
ATOM   2191  C  C     . LEU A  1 314 ? -15.359 -11.568  75.829  1.00 68.16  ? 314 LEU A C     1 
ATOM   2192  O  O     . LEU A  1 314 ? -16.455 -11.046  75.580  1.00 68.23  ? 314 LEU A O     1 
ATOM   2193  C  CB    . LEU A  1 314 ? -13.613 -10.257  77.092  1.00 65.10  ? 314 LEU A CB    1 
ATOM   2194  C  CG    . LEU A  1 314 ? -12.200 -9.664   77.129  1.00 63.30  ? 314 LEU A CG    1 
ATOM   2195  C  CD1   . LEU A  1 314 ? -11.970 -8.833   78.379  1.00 62.50  ? 314 LEU A CD1   1 
ATOM   2196  C  CD2   . LEU A  1 314 ? -11.142 -10.767  77.005  1.00 64.18  ? 314 LEU A CD2   1 
ATOM   2197  N  N     . SER A  1 315 ? -15.230 -12.842  76.191  1.00 71.20  ? 315 SER A N     1 
ATOM   2198  C  CA    . SER A  1 315 ? -16.393 -13.711  76.379  1.00 74.71  ? 315 SER A CA    1 
ATOM   2199  C  C     . SER A  1 315 ? -17.225 -13.351  77.626  1.00 76.38  ? 315 SER A C     1 
ATOM   2200  O  O     . SER A  1 315 ? -16.735 -12.679  78.540  1.00 75.58  ? 315 SER A O     1 
ATOM   2201  C  CB    . SER A  1 315 ? -15.943 -15.173  76.436  1.00 76.97  ? 315 SER A CB    1 
ATOM   2202  O  OG    . SER A  1 315 ? -15.120 -15.411  77.566  1.00 78.60  ? 315 SER A OG    1 
ATOM   2203  N  N     . GLU A  1 316 ? -18.481 -13.800  77.661  1.00 79.19  ? 316 GLU A N     1 
ATOM   2204  C  CA    . GLU A  1 316 ? -19.340 -13.601  78.840  1.00 81.77  ? 316 GLU A CA    1 
ATOM   2205  C  C     . GLU A  1 316 ? -18.648 -14.041  80.132  1.00 83.67  ? 316 GLU A C     1 
ATOM   2206  O  O     . GLU A  1 316 ? -18.726 -13.342  81.145  1.00 84.03  ? 316 GLU A O     1 
ATOM   2207  C  CB    . GLU A  1 316 ? -20.684 -14.313  78.700  1.00 83.90  ? 316 GLU A CB    1 
ATOM   2208  C  CG    . GLU A  1 316 ? -21.742 -13.504  77.996  1.00 84.79  ? 316 GLU A CG    1 
ATOM   2209  C  CD    . GLU A  1 316 ? -23.145 -13.758  78.554  1.00 90.76  ? 316 GLU A CD    1 
ATOM   2210  O  OE1   . GLU A  1 316 ? -23.448 -14.920  78.937  1.00 94.17  ? 316 GLU A OE1   1 
ATOM   2211  O  OE2   . GLU A  1 316 ? -23.948 -12.787  78.611  1.00 91.23  ? 316 GLU A OE2   1 
ATOM   2212  N  N     . LYS A  1 317 ? -17.954 -15.180  80.078  1.00 85.34  ? 317 LYS A N     1 
ATOM   2213  C  CA    . LYS A  1 317 ? -17.230 -15.719  81.228  1.00 87.26  ? 317 LYS A CA    1 
ATOM   2214  C  C     . LYS A  1 317 ? -16.194 -14.742  81.788  1.00 85.80  ? 317 LYS A C     1 
ATOM   2215  O  O     . LYS A  1 317 ? -15.834 -14.824  82.965  1.00 87.29  ? 317 LYS A O     1 
ATOM   2216  C  CB    . LYS A  1 317 ? -16.544 -17.035  80.855  1.00 88.77  ? 317 LYS A CB    1 
ATOM   2217  C  CG    . LYS A  1 317 ? -16.162 -17.886  82.055  1.00 91.40  ? 317 LYS A CG    1 
ATOM   2218  C  CD    . LYS A  1 317 ? -15.019 -18.830  81.743  1.00 91.94  ? 317 LYS A CD    1 
ATOM   2219  C  CE    . LYS A  1 317 ? -14.628 -19.613  82.982  1.00 94.88  ? 317 LYS A CE    1 
ATOM   2220  N  NZ    . LYS A  1 317 ? -13.408 -20.424  82.767  1.00 95.89  ? 317 LYS A NZ    1 
ATOM   2221  N  N     . GLU A  1 318 ? -15.728 -13.816  80.951  1.00 83.14  ? 318 GLU A N     1 
ATOM   2222  C  CA    . GLU A  1 318 ? -14.641 -12.930  81.335  1.00 81.78  ? 318 GLU A CA    1 
ATOM   2223  C  C     . GLU A  1 318 ? -15.041 -11.453  81.376  1.00 79.48  ? 318 GLU A C     1 
ATOM   2224  O  O     . GLU A  1 318 ? -14.185 -10.561  81.253  1.00 77.55  ? 318 GLU A O     1 
ATOM   2225  C  CB    . GLU A  1 318 ? -13.448 -13.136  80.404  1.00 80.60  ? 318 GLU A CB    1 
ATOM   2226  C  CG    . GLU A  1 318 ? -12.105 -13.012  81.102  1.00 82.86  ? 318 GLU A CG    1 
ATOM   2227  C  CD    . GLU A  1 318 ? -11.633 -14.333  81.686  1.00 88.85  ? 318 GLU A CD    1 
ATOM   2228  O  OE1   . GLU A  1 318 ? -11.368 -15.268  80.896  1.00 90.51  ? 318 GLU A OE1   1 
ATOM   2229  O  OE2   . GLU A  1 318 ? -11.523 -14.438  82.931  1.00 92.36  ? 318 GLU A OE2   1 
ATOM   2230  N  N     . GLY A  1 319 ? -16.337 -11.197  81.546  1.00 79.72  ? 319 GLY A N     1 
ATOM   2231  C  CA    . GLY A  1 319 ? -16.822 -9.832   81.753  1.00 77.89  ? 319 GLY A CA    1 
ATOM   2232  C  C     . GLY A  1 319 ? -17.556 -9.210   80.582  1.00 75.94  ? 319 GLY A C     1 
ATOM   2233  O  O     . GLY A  1 319 ? -18.319 -8.244   80.761  1.00 75.41  ? 319 GLY A O     1 
ATOM   2234  N  N     . SER A  1 320 ? -17.329 -9.765   79.388  1.00 74.69  ? 320 SER A N     1 
ATOM   2235  C  CA    . SER A  1 320 ? -17.903 -9.252   78.135  1.00 72.79  ? 320 SER A CA    1 
ATOM   2236  C  C     . SER A  1 320 ? -17.392 -7.857   77.779  1.00 70.06  ? 320 SER A C     1 
ATOM   2237  O  O     . SER A  1 320 ? -17.950 -7.186   76.909  1.00 69.14  ? 320 SER A O     1 
ATOM   2238  C  CB    . SER A  1 320 ? -19.434 -9.258   78.165  1.00 73.98  ? 320 SER A CB    1 
ATOM   2239  O  OG    . SER A  1 320 ? -19.944 -10.544  77.882  1.00 76.15  ? 320 SER A OG    1 
ATOM   2240  N  N     . GLY A  1 321 ? -16.329 -7.420   78.446  1.00 68.85  ? 321 GLY A N     1 
ATOM   2241  C  CA    . GLY A  1 321 ? -15.735 -6.133   78.141  1.00 65.92  ? 321 GLY A CA    1 
ATOM   2242  C  C     . GLY A  1 321 ? -15.046 -6.167   76.795  1.00 63.93  ? 321 GLY A C     1 
ATOM   2243  O  O     . GLY A  1 321 ? -14.850 -7.234   76.212  1.00 64.33  ? 321 GLY A O     1 
ATOM   2244  N  N     . SER A  1 322 ? -14.674 -4.996   76.298  1.00 61.86  ? 322 SER A N     1 
ATOM   2245  C  CA    . SER A  1 322 ? -14.021 -4.913   75.006  1.00 60.05  ? 322 SER A CA    1 
ATOM   2246  C  C     . SER A  1 322 ? -13.089 -3.716   74.888  1.00 58.19  ? 322 SER A C     1 
ATOM   2247  O  O     . SER A  1 322 ? -13.314 -2.673   75.510  1.00 57.85  ? 322 SER A O     1 
ATOM   2248  C  CB    . SER A  1 322 ? -15.058 -4.887   73.882  1.00 59.84  ? 322 SER A CB    1 
ATOM   2249  O  OG    . SER A  1 322 ? -15.817 -3.696   73.937  1.00 59.41  ? 322 SER A OG    1 
ATOM   2250  N  N     . LEU A  1 323 ? -12.031 -3.903   74.103  1.00 56.97  ? 323 LEU A N     1 
ATOM   2251  C  CA    . LEU A  1 323 ? -11.207 -2.821   73.606  1.00 55.34  ? 323 LEU A CA    1 
ATOM   2252  C  C     . LEU A  1 323 ? -11.304 -2.817   72.084  1.00 54.68  ? 323 LEU A C     1 
ATOM   2253  O  O     . LEU A  1 323 ? -11.411 -3.868   71.457  1.00 55.31  ? 323 LEU A O     1 
ATOM   2254  C  CB    . LEU A  1 323 ? -9.772  -3.028   74.037  1.00 55.23  ? 323 LEU A CB    1 
ATOM   2255  C  CG    . LEU A  1 323 ? -8.723  -1.985   73.674  1.00 53.95  ? 323 LEU A CG    1 
ATOM   2256  C  CD1   . LEU A  1 323 ? -8.867  -0.744   74.545  1.00 54.65  ? 323 LEU A CD1   1 
ATOM   2257  C  CD2   . LEU A  1 323 ? -7.350  -2.613   73.844  1.00 53.54  ? 323 LEU A CD2   1 
ATOM   2258  N  N     . THR A  1 324 ? -11.270 -1.624   71.504  1.00 53.71  ? 324 THR A N     1 
ATOM   2259  C  CA    . THR A  1 324 ? -11.516 -1.395   70.081  1.00 53.08  ? 324 THR A CA    1 
ATOM   2260  C  C     . THR A  1 324 ? -10.412 -0.440   69.662  1.00 51.98  ? 324 THR A C     1 
ATOM   2261  O  O     . THR A  1 324 ? -10.168 0.559    70.338  1.00 52.13  ? 324 THR A O     1 
ATOM   2262  C  CB    . THR A  1 324 ? -12.871 -0.665   69.862  1.00 53.48  ? 324 THR A CB    1 
ATOM   2263  O  OG1   . THR A  1 324 ? -13.965 -1.457   70.368  1.00 54.78  ? 324 THR A OG1   1 
ATOM   2264  C  CG2   . THR A  1 324 ? -13.091 -0.336   68.397  1.00 52.40  ? 324 THR A CG2   1 
ATOM   2265  N  N     . ALA A  1 325 ? -9.737  -0.745   68.561  1.00 51.32  ? 325 ALA A N     1 
ATOM   2266  C  CA    . ALA A  1 325 ? -8.585  0.035    68.152  1.00 49.73  ? 325 ALA A CA    1 
ATOM   2267  C  C     . ALA A  1 325 ? -8.755  0.650    66.767  1.00 49.27  ? 325 ALA A C     1 
ATOM   2268  O  O     . ALA A  1 325 ? -9.111  -0.036   65.804  1.00 49.38  ? 325 ALA A O     1 
ATOM   2269  C  CB    . ALA A  1 325 ? -7.359  -0.810   68.209  1.00 49.59  ? 325 ALA A CB    1 
ATOM   2270  N  N     . LEU A  1 326 ? -8.528  1.961    66.700  1.00 48.80  ? 326 LEU A N     1 
ATOM   2271  C  CA    . LEU A  1 326 ? -8.416  2.681    65.441  1.00 48.86  ? 326 LEU A CA    1 
ATOM   2272  C  C     . LEU A  1 326 ? -6.956  3.110    65.257  1.00 48.16  ? 326 LEU A C     1 
ATOM   2273  O  O     . LEU A  1 326 ? -6.603  4.244    65.592  1.00 48.14  ? 326 LEU A O     1 
ATOM   2274  C  CB    . LEU A  1 326 ? -9.309  3.931    65.419  1.00 48.87  ? 326 LEU A CB    1 
ATOM   2275  C  CG    . LEU A  1 326 ? -10.822 3.873    65.635  1.00 50.61  ? 326 LEU A CG    1 
ATOM   2276  C  CD1   . LEU A  1 326 ? -11.405 5.277    65.670  1.00 51.38  ? 326 LEU A CD1   1 
ATOM   2277  C  CD2   . LEU A  1 326 ? -11.520 3.060    64.562  1.00 52.72  ? 326 LEU A CD2   1 
ATOM   2278  N  N     . PRO A  1 327 ? -6.094  2.213    64.728  1.00 48.04  ? 327 PRO A N     1 
ATOM   2279  C  CA    . PRO A  1 327 ? -4.727  2.690    64.537  1.00 47.32  ? 327 PRO A CA    1 
ATOM   2280  C  C     . PRO A  1 327 ? -4.666  3.629    63.336  1.00 46.90  ? 327 PRO A C     1 
ATOM   2281  O  O     . PRO A  1 327 ? -5.486  3.518    62.418  1.00 47.48  ? 327 PRO A O     1 
ATOM   2282  C  CB    . PRO A  1 327 ? -3.933  1.402    64.277  1.00 47.62  ? 327 PRO A CB    1 
ATOM   2283  C  CG    . PRO A  1 327 ? -4.933  0.414    63.733  1.00 47.71  ? 327 PRO A CG    1 
ATOM   2284  C  CD    . PRO A  1 327 ? -6.300  0.853    64.183  1.00 48.63  ? 327 PRO A CD    1 
ATOM   2285  N  N     . VAL A  1 328 ? -3.726  4.565    63.354  1.00 46.08  ? 328 VAL A N     1 
ATOM   2286  C  CA    . VAL A  1 328 ? -3.525  5.436    62.198  1.00 45.41  ? 328 VAL A CA    1 
ATOM   2287  C  C     . VAL A  1 328 ? -2.191  5.135    61.523  1.00 44.79  ? 328 VAL A C     1 
ATOM   2288  O  O     . VAL A  1 328 ? -1.197  4.872    62.187  1.00 44.88  ? 328 VAL A O     1 
ATOM   2289  C  CB    . VAL A  1 328 ? -3.642  6.925    62.550  1.00 45.15  ? 328 VAL A CB    1 
ATOM   2290  C  CG1   . VAL A  1 328 ? -3.474  7.763    61.296  1.00 44.99  ? 328 VAL A CG1   1 
ATOM   2291  C  CG2   . VAL A  1 328 ? -4.987  7.203    63.179  1.00 44.90  ? 328 VAL A CG2   1 
ATOM   2292  N  N     . ILE A  1 329 ? -2.196  5.157    60.198  1.00 44.48  ? 329 ILE A N     1 
ATOM   2293  C  CA    . ILE A  1 329 ? -1.010  4.912    59.397  1.00 43.69  ? 329 ILE A CA    1 
ATOM   2294  C  C     . ILE A  1 329 ? -0.943  5.991    58.324  1.00 43.98  ? 329 ILE A C     1 
ATOM   2295  O  O     . ILE A  1 329 ? -1.907  6.237    57.593  1.00 44.24  ? 329 ILE A O     1 
ATOM   2296  C  CB    . ILE A  1 329 ? -1.040  3.494    58.763  1.00 43.70  ? 329 ILE A CB    1 
ATOM   2297  C  CG1   . ILE A  1 329 ? -0.814  2.417    59.816  1.00 43.54  ? 329 ILE A CG1   1 
ATOM   2298  C  CG2   . ILE A  1 329 ? -0.015  3.347    57.659  1.00 43.79  ? 329 ILE A CG2   1 
ATOM   2299  C  CD1   . ILE A  1 329 ? 0.642   2.210    60.224  1.00 43.45  ? 329 ILE A CD1   1 
ATOM   2300  N  N     . GLU A  1 330 ? 0.196   6.656    58.248  1.00 43.97  ? 330 GLU A N     1 
ATOM   2301  C  CA    . GLU A  1 330 ? 0.441   7.572    57.151  1.00 44.88  ? 330 GLU A CA    1 
ATOM   2302  C  C     . GLU A  1 330 ? 1.136   6.840    56.007  1.00 44.88  ? 330 GLU A C     1 
ATOM   2303  O  O     . GLU A  1 330 ? 2.120   6.157    56.218  1.00 45.28  ? 330 GLU A O     1 
ATOM   2304  C  CB    . GLU A  1 330 ? 1.294   8.735    57.614  1.00 44.81  ? 330 GLU A CB    1 
ATOM   2305  C  CG    . GLU A  1 330 ? 1.270   9.910    56.698  1.00 46.97  ? 330 GLU A CG    1 
ATOM   2306  C  CD    . GLU A  1 330 ? 2.225   10.981   57.167  1.00 52.64  ? 330 GLU A CD    1 
ATOM   2307  O  OE1   . GLU A  1 330 ? 3.409   10.657   57.449  1.00 54.96  ? 330 GLU A OE1   1 
ATOM   2308  O  OE2   . GLU A  1 330 ? 1.799   12.153   57.260  1.00 55.87  ? 330 GLU A OE2   1 
ATOM   2309  N  N     . THR A  1 331 ? 0.599   6.985    54.807  1.00 45.20  ? 331 THR A N     1 
ATOM   2310  C  CA    . THR A  1 331 ? 1.172   6.432    53.612  1.00 45.22  ? 331 THR A CA    1 
ATOM   2311  C  C     . THR A  1 331 ? 1.917   7.535    52.888  1.00 45.90  ? 331 THR A C     1 
ATOM   2312  O  O     . THR A  1 331 ? 1.752   8.715    53.178  1.00 45.47  ? 331 THR A O     1 
ATOM   2313  C  CB    . THR A  1 331 ? 0.072   5.898    52.673  1.00 46.36  ? 331 THR A CB    1 
ATOM   2314  O  OG1   . THR A  1 331 ? -0.948  6.891    52.519  1.00 45.65  ? 331 THR A OG1   1 
ATOM   2315  C  CG2   . THR A  1 331 ? -0.549  4.617    53.221  1.00 45.32  ? 331 THR A CG2   1 
ATOM   2316  N  N     . GLN A  1 332 ? 2.756   7.143    51.943  1.00 47.24  ? 332 GLN A N     1 
ATOM   2317  C  CA    . GLN A  1 332 ? 3.467   8.108    51.114  1.00 48.69  ? 332 GLN A CA    1 
ATOM   2318  C  C     . GLN A  1 332 ? 3.064   7.881    49.661  1.00 50.85  ? 332 GLN A C     1 
ATOM   2319  O  O     . GLN A  1 332 ? 3.391   6.838    49.064  1.00 51.65  ? 332 GLN A O     1 
ATOM   2320  C  CB    . GLN A  1 332 ? 4.972   7.969    51.292  1.00 47.75  ? 332 GLN A CB    1 
ATOM   2321  C  CG    . GLN A  1 332 ? 5.406   7.874    52.754  1.00 46.60  ? 332 GLN A CG    1 
ATOM   2322  C  CD    . GLN A  1 332 ? 5.263   9.187    53.528  1.00 46.08  ? 332 GLN A CD    1 
ATOM   2323  O  OE1   . GLN A  1 332 ? 5.446   10.288   52.970  1.00 46.48  ? 332 GLN A OE1   1 
ATOM   2324  N  NE2   . GLN A  1 332 ? 4.943   9.074    54.831  1.00 42.52  ? 332 GLN A NE2   1 
ATOM   2325  N  N     . GLY A  1 333 ? 2.329   8.841    49.104  1.00 52.01  ? 333 GLY A N     1 
ATOM   2326  C  CA    . GLY A  1 333 ? 1.864   8.714    47.747  1.00 54.46  ? 333 GLY A CA    1 
ATOM   2327  C  C     . GLY A  1 333 ? 0.999   7.478    47.599  1.00 55.63  ? 333 GLY A C     1 
ATOM   2328  O  O     . GLY A  1 333 ? 1.066   6.788    46.579  1.00 57.01  ? 333 GLY A O     1 
ATOM   2329  N  N     . GLY A  1 334 ? 0.191   7.193    48.623  1.00 55.30  ? 334 GLY A N     1 
ATOM   2330  C  CA    . GLY A  1 334 ? -0.760  6.076    48.584  1.00 56.04  ? 334 GLY A CA    1 
ATOM   2331  C  C     . GLY A  1 334 ? -0.119  4.711    48.362  1.00 56.47  ? 334 GLY A C     1 
ATOM   2332  O  O     . GLY A  1 334 ? -0.721  3.824    47.754  1.00 57.72  ? 334 GLY A O     1 
ATOM   2333  N  N     . ASP A  1 335 ? 1.097   4.535    48.867  1.00 55.72  ? 335 ASP A N     1 
ATOM   2334  C  CA    . ASP A  1 335 ? 1.829   3.291    48.684  1.00 55.99  ? 335 ASP A CA    1 
ATOM   2335  C  C     . ASP A  1 335 ? 1.586   2.257    49.803  1.00 55.19  ? 335 ASP A C     1 
ATOM   2336  O  O     . ASP A  1 335 ? 2.459   2.050    50.659  1.00 54.60  ? 335 ASP A O     1 
ATOM   2337  C  CB    . ASP A  1 335 ? 3.317   3.612    48.575  1.00 55.94  ? 335 ASP A CB    1 
ATOM   2338  C  CG    . ASP A  1 335 ? 4.160   2.397    48.256  1.00 57.08  ? 335 ASP A CG    1 
ATOM   2339  O  OD1   . ASP A  1 335 ? 3.582   1.342    47.897  1.00 56.46  ? 335 ASP A OD1   1 
ATOM   2340  O  OD2   . ASP A  1 335 ? 5.411   2.513    48.359  1.00 58.96  ? 335 ASP A OD2   1 
ATOM   2341  N  N     . VAL A  1 336 ? 0.431   1.588    49.780  1.00 55.07  ? 336 VAL A N     1 
ATOM   2342  C  CA    . VAL A  1 336 ? 0.120   0.551    50.786  1.00 54.37  ? 336 VAL A CA    1 
ATOM   2343  C  C     . VAL A  1 336 ? 1.111   -0.634   50.832  1.00 54.99  ? 336 VAL A C     1 
ATOM   2344  O  O     . VAL A  1 336 ? 1.099   -1.447   51.768  1.00 54.97  ? 336 VAL A O     1 
ATOM   2345  C  CB    . VAL A  1 336 ? -1.265  -0.032   50.574  1.00 54.59  ? 336 VAL A CB    1 
ATOM   2346  C  CG1   . VAL A  1 336 ? -2.320  0.990    50.919  1.00 53.88  ? 336 VAL A CG1   1 
ATOM   2347  C  CG2   . VAL A  1 336 ? -1.402  -0.515   49.155  1.00 55.77  ? 336 VAL A CG2   1 
ATOM   2348  N  N     . SER A  1 337 ? 1.959   -0.727   49.816  1.00 55.63  ? 337 SER A N     1 
ATOM   2349  C  CA    . SER A  1 337 ? 2.884   -1.821   49.664  1.00 56.04  ? 337 SER A CA    1 
ATOM   2350  C  C     . SER A  1 337 ? 4.120   -1.600   50.506  1.00 54.75  ? 337 SER A C     1 
ATOM   2351  O  O     . SER A  1 337 ? 4.972   -2.495   50.615  1.00 55.48  ? 337 SER A O     1 
ATOM   2352  C  CB    . SER A  1 337 ? 3.305   -1.890   48.211  1.00 57.82  ? 337 SER A CB    1 
ATOM   2353  O  OG    . SER A  1 337 ? 3.699   -3.202   47.862  1.00 62.04  ? 337 SER A OG    1 
ATOM   2354  N  N     . ALA A  1 338 ? 4.241   -0.403   51.081  1.00 52.95  ? 338 ALA A N     1 
ATOM   2355  C  CA    . ALA A  1 338 ? 5.393   -0.064   51.909  1.00 51.28  ? 338 ALA A CA    1 
ATOM   2356  C  C     . ALA A  1 338 ? 5.395   -0.957   53.138  1.00 50.60  ? 338 ALA A C     1 
ATOM   2357  O  O     . ALA A  1 338 ? 4.332   -1.437   53.572  1.00 49.75  ? 338 ALA A O     1 
ATOM   2358  C  CB    . ALA A  1 338 ? 5.358   1.397    52.306  1.00 50.57  ? 338 ALA A CB    1 
ATOM   2359  N  N     . TYR A  1 339 ? 6.584   -1.175   53.700  1.00 50.20  ? 339 TYR A N     1 
ATOM   2360  C  CA    . TYR A  1 339 ? 6.717   -2.122   54.801  1.00 50.20  ? 339 TYR A CA    1 
ATOM   2361  C  C     . TYR A  1 339 ? 5.679   -2.001   55.955  1.00 49.69  ? 339 TYR A C     1 
ATOM   2362  O  O     . TYR A  1 339 ? 4.866   -2.906   56.157  1.00 50.53  ? 339 TYR A O     1 
ATOM   2363  C  CB    . TYR A  1 339 ? 8.146   -2.209   55.317  1.00 49.85  ? 339 TYR A CB    1 
ATOM   2364  C  CG    . TYR A  1 339 ? 8.365   -3.496   56.073  1.00 51.17  ? 339 TYR A CG    1 
ATOM   2365  C  CD1   . TYR A  1 339 ? 7.702   -4.659   55.686  1.00 51.83  ? 339 TYR A CD1   1 
ATOM   2366  C  CD2   . TYR A  1 339 ? 9.230   -3.567   57.173  1.00 51.15  ? 339 TYR A CD2   1 
ATOM   2367  C  CE1   . TYR A  1 339 ? 7.879   -5.847   56.367  1.00 52.65  ? 339 TYR A CE1   1 
ATOM   2368  C  CE2   . TYR A  1 339 ? 9.415   -4.774   57.862  1.00 50.55  ? 339 TYR A CE2   1 
ATOM   2369  C  CZ    . TYR A  1 339 ? 8.732   -5.902   57.447  1.00 51.36  ? 339 TYR A CZ    1 
ATOM   2370  O  OH    . TYR A  1 339 ? 8.860   -7.100   58.106  1.00 52.69  ? 339 TYR A OH    1 
ATOM   2371  N  N     . ILE A  1 340 ? 5.679   -0.893   56.687  1.00 48.56  ? 340 ILE A N     1 
ATOM   2372  C  CA    . ILE A  1 340 ? 4.755   -0.772   57.810  1.00 47.81  ? 340 ILE A CA    1 
ATOM   2373  C  C     . ILE A  1 340 ? 3.280   -0.795   57.376  1.00 48.14  ? 340 ILE A C     1 
ATOM   2374  O  O     . ILE A  1 340 ? 2.480   -1.499   57.996  1.00 48.60  ? 340 ILE A O     1 
ATOM   2375  C  CB    . ILE A  1 340 ? 5.071   0.444    58.734  1.00 46.83  ? 340 ILE A CB    1 
ATOM   2376  C  CG1   . ILE A  1 340 ? 6.541   0.445    59.149  1.00 46.56  ? 340 ILE A CG1   1 
ATOM   2377  C  CG2   . ILE A  1 340 ? 4.214   0.421    59.993  1.00 46.17  ? 340 ILE A CG2   1 
ATOM   2378  C  CD1   . ILE A  1 340 ? 6.947   -0.753   59.955  1.00 47.05  ? 340 ILE A CD1   1 
ATOM   2379  N  N     . PRO A  1 341 ? 2.907   -0.045   56.314  1.00 48.06  ? 341 PRO A N     1 
ATOM   2380  C  CA    . PRO A  1 341 ? 1.506   -0.095   55.924  1.00 47.99  ? 341 PRO A CA    1 
ATOM   2381  C  C     . PRO A  1 341 ? 1.068   -1.516   55.660  1.00 49.04  ? 341 PRO A C     1 
ATOM   2382  O  O     . PRO A  1 341 ? -0.004  -1.915   56.078  1.00 48.97  ? 341 PRO A O     1 
ATOM   2383  C  CB    . PRO A  1 341 ? 1.487   0.734    54.648  1.00 47.94  ? 341 PRO A CB    1 
ATOM   2384  C  CG    . PRO A  1 341 ? 2.490   1.779    54.906  1.00 47.11  ? 341 PRO A CG    1 
ATOM   2385  C  CD    . PRO A  1 341 ? 3.610   1.037    55.597  1.00 48.11  ? 341 PRO A CD    1 
ATOM   2386  N  N     . THR A  1 342 ? 1.931   -2.285   55.013  1.00 50.40  ? 342 THR A N     1 
ATOM   2387  C  CA    . THR A  1 342 ? 1.673   -3.693   54.752  1.00 52.19  ? 342 THR A CA    1 
ATOM   2388  C  C     . THR A  1 342 ? 1.468   -4.512   56.023  1.00 51.88  ? 342 THR A C     1 
ATOM   2389  O  O     . THR A  1 342 ? 0.502   -5.258   56.125  1.00 52.84  ? 342 THR A O     1 
ATOM   2390  C  CB    . THR A  1 342 ? 2.780   -4.274   53.881  1.00 53.23  ? 342 THR A CB    1 
ATOM   2391  O  OG1   . THR A  1 342 ? 2.532   -3.860   52.532  1.00 55.94  ? 342 THR A OG1   1 
ATOM   2392  C  CG2   . THR A  1 342 ? 2.814   -5.808   53.947  1.00 55.55  ? 342 THR A CG2   1 
ATOM   2393  N  N     . ASN A  1 343 ? 2.366   -4.366   56.987  1.00 50.99  ? 343 ASN A N     1 
ATOM   2394  C  CA    . ASN A  1 343 ? 2.226   -5.047   58.257  1.00 51.00  ? 343 ASN A CA    1 
ATOM   2395  C  C     . ASN A  1 343 ? 0.874   -4.787   58.915  1.00 50.66  ? 343 ASN A C     1 
ATOM   2396  O  O     . ASN A  1 343 ? 0.137   -5.713   59.248  1.00 51.39  ? 343 ASN A O     1 
ATOM   2397  C  CB    . ASN A  1 343 ? 3.360   -4.628   59.176  1.00 50.42  ? 343 ASN A CB    1 
ATOM   2398  C  CG    . ASN A  1 343 ? 4.663   -5.326   58.838  1.00 52.64  ? 343 ASN A CG    1 
ATOM   2399  O  OD1   . ASN A  1 343 ? 4.703   -6.260   58.026  1.00 53.78  ? 343 ASN A OD1   1 
ATOM   2400  N  ND2   . ASN A  1 343 ? 5.742   -4.885   59.471  1.00 54.05  ? 343 ASN A ND2   1 
ATOM   2401  N  N     . VAL A  1 344 ? 0.545   -3.511   59.062  1.00 49.59  ? 344 VAL A N     1 
ATOM   2402  C  CA    . VAL A  1 344 ? -0.651  -3.087   59.769  1.00 48.89  ? 344 VAL A CA    1 
ATOM   2403  C  C     . VAL A  1 344 ? -1.914  -3.488   59.001  1.00 49.95  ? 344 VAL A C     1 
ATOM   2404  O  O     . VAL A  1 344 ? -2.878  -3.990   59.601  1.00 50.62  ? 344 VAL A O     1 
ATOM   2405  C  CB    . VAL A  1 344 ? -0.596  -1.571   60.055  1.00 47.57  ? 344 VAL A CB    1 
ATOM   2406  C  CG1   . VAL A  1 344 ? -1.755  -1.122   60.924  1.00 46.24  ? 344 VAL A CG1   1 
ATOM   2407  C  CG2   . VAL A  1 344 ? 0.723   -1.236   60.734  1.00 46.96  ? 344 VAL A CG2   1 
ATOM   2408  N  N     . ILE A  1 345 ? -1.905  -3.300   57.681  1.00 50.07  ? 345 ILE A N     1 
ATOM   2409  C  CA    . ILE A  1 345 ? -3.076  -3.646   56.873  1.00 50.80  ? 345 ILE A CA    1 
ATOM   2410  C  C     . ILE A  1 345 ? -3.368  -5.131   56.990  1.00 52.15  ? 345 ILE A C     1 
ATOM   2411  O  O     . ILE A  1 345 ? -4.524  -5.542   56.896  1.00 53.55  ? 345 ILE A O     1 
ATOM   2412  C  CB    . ILE A  1 345 ? -2.936  -3.245   55.384  1.00 50.97  ? 345 ILE A CB    1 
ATOM   2413  C  CG1   . ILE A  1 345 ? -2.993  -1.728   55.223  1.00 49.36  ? 345 ILE A CG1   1 
ATOM   2414  C  CG2   . ILE A  1 345 ? -4.041  -3.870   54.540  1.00 51.68  ? 345 ILE A CG2   1 
ATOM   2415  C  CD1   . ILE A  1 345 ? -2.415  -1.262   53.908  1.00 48.57  ? 345 ILE A CD1   1 
ATOM   2416  N  N     . SER A  1 346 ? -2.331  -5.930   57.211  1.00 52.38  ? 346 SER A N     1 
ATOM   2417  C  CA    . SER A  1 346 ? -2.513  -7.364   57.341  1.00 53.97  ? 346 SER A CA    1 
ATOM   2418  C  C     . SER A  1 346 ? -2.896  -7.751   58.756  1.00 54.20  ? 346 SER A C     1 
ATOM   2419  O  O     . SER A  1 346 ? -3.537  -8.766   58.960  1.00 55.69  ? 346 SER A O     1 
ATOM   2420  C  CB    . SER A  1 346 ? -1.270  -8.128   56.888  1.00 54.84  ? 346 SER A CB    1 
ATOM   2421  O  OG    . SER A  1 346 ? -0.213  -8.037   57.837  1.00 55.32  ? 346 SER A OG    1 
ATOM   2422  N  N     . ILE A  1 347 ? -2.513  -6.942   59.734  1.00 53.46  ? 347 ILE A N     1 
ATOM   2423  C  CA    . ILE A  1 347 ? -2.857  -7.227   61.127  1.00 53.87  ? 347 ILE A CA    1 
ATOM   2424  C  C     . ILE A  1 347 ? -4.310  -6.893   61.483  1.00 54.13  ? 347 ILE A C     1 
ATOM   2425  O  O     . ILE A  1 347 ? -4.935  -7.646   62.228  1.00 55.82  ? 347 ILE A O     1 
ATOM   2426  C  CB    . ILE A  1 347 ? -1.921  -6.504   62.118  1.00 52.89  ? 347 ILE A CB    1 
ATOM   2427  C  CG1   . ILE A  1 347 ? -0.487  -7.004   61.963  1.00 53.14  ? 347 ILE A CG1   1 
ATOM   2428  C  CG2   . ILE A  1 347 ? -2.396  -6.713   63.549  1.00 53.20  ? 347 ILE A CG2   1 
ATOM   2429  C  CD1   . ILE A  1 347 ? 0.579   -5.967   62.313  1.00 51.69  ? 347 ILE A CD1   1 
ATOM   2430  N  N     . THR A  1 348 ? -4.848  -5.781   60.980  1.00 53.19  ? 348 THR A N     1 
ATOM   2431  C  CA    . THR A  1 348 ? -6.182  -5.319   61.415  1.00 53.29  ? 348 THR A CA    1 
ATOM   2432  C  C     . THR A  1 348 ? -7.347  -6.065   60.760  1.00 54.22  ? 348 THR A C     1 
ATOM   2433  O  O     . THR A  1 348 ? -7.154  -7.107   60.121  1.00 55.41  ? 348 THR A O     1 
ATOM   2434  C  CB    . THR A  1 348 ? -6.398  -3.813   61.168  1.00 52.17  ? 348 THR A CB    1 
ATOM   2435  O  OG1   . THR A  1 348 ? -6.361  -3.568   59.759  1.00 53.79  ? 348 THR A OG1   1 
ATOM   2436  C  CG2   . THR A  1 348 ? -5.347  -2.972   61.867  1.00 50.81  ? 348 THR A CG2   1 
ATOM   2437  N  N     . ASP A  1 349 ? -8.548  -5.502   60.922  1.00 53.76  ? 349 ASP A N     1 
ATOM   2438  C  CA    . ASP A  1 349 ? -9.796  -6.078   60.416  1.00 54.68  ? 349 ASP A CA    1 
ATOM   2439  C  C     . ASP A  1 349 ? -10.409 -5.190   59.342  1.00 54.33  ? 349 ASP A C     1 
ATOM   2440  O  O     . ASP A  1 349 ? -11.606 -5.227   59.105  1.00 55.32  ? 349 ASP A O     1 
ATOM   2441  C  CB    . ASP A  1 349 ? -10.821 -6.273   61.557  1.00 55.12  ? 349 ASP A CB    1 
ATOM   2442  C  CG    . ASP A  1 349 ? -10.330 -7.208   62.654  1.00 55.54  ? 349 ASP A CG    1 
ATOM   2443  O  OD1   . ASP A  1 349 ? -9.802  -8.302   62.360  1.00 56.20  ? 349 ASP A OD1   1 
ATOM   2444  O  OD2   . ASP A  1 349 ? -10.478 -6.846   63.832  1.00 55.40  ? 349 ASP A OD2   1 
ATOM   2445  N  N     . GLY A  1 350 ? -9.605  -4.360   58.702  1.00 53.45  ? 350 GLY A N     1 
ATOM   2446  C  CA    . GLY A  1 350 ? -10.159 -3.489   57.668  1.00 53.53  ? 350 GLY A CA    1 
ATOM   2447  C  C     . GLY A  1 350 ? -9.579  -2.098   57.679  1.00 52.04  ? 350 GLY A C     1 
ATOM   2448  O  O     . GLY A  1 350 ? -8.971  -1.686   58.665  1.00 51.32  ? 350 GLY A O     1 
ATOM   2449  N  N     . GLN A  1 351 ? -9.753  -1.389   56.568  1.00 51.99  ? 351 GLN A N     1 
ATOM   2450  C  CA    . GLN A  1 351 ? -9.205  -0.048   56.411  1.00 51.08  ? 351 GLN A CA    1 
ATOM   2451  C  C     . GLN A  1 351 ? -10.338 0.875    56.074  1.00 51.58  ? 351 GLN A C     1 
ATOM   2452  O  O     . GLN A  1 351 ? -11.278 0.488    55.364  1.00 52.88  ? 351 GLN A O     1 
ATOM   2453  C  CB    . GLN A  1 351 ? -8.194  0.064    55.254  1.00 50.93  ? 351 GLN A CB    1 
ATOM   2454  C  CG    . GLN A  1 351 ? -7.129  -0.974   55.179  1.00 51.40  ? 351 GLN A CG    1 
ATOM   2455  C  CD    . GLN A  1 351 ? -7.701  -2.330   54.878  1.00 54.28  ? 351 GLN A CD    1 
ATOM   2456  O  OE1   . GLN A  1 351 ? -8.567  -2.455   54.010  1.00 55.09  ? 351 GLN A OE1   1 
ATOM   2457  N  NE2   . GLN A  1 351 ? -7.245  -3.362   55.614  1.00 54.72  ? 351 GLN A NE2   1 
ATOM   2458  N  N     . ILE A  1 352 ? -10.239 2.088    56.605  1.00 50.60  ? 352 ILE A N     1 
ATOM   2459  C  CA    . ILE A  1 352 ? -10.941 3.238    56.083  1.00 50.75  ? 352 ILE A CA    1 
ATOM   2460  C  C     . ILE A  1 352 ? -9.814  3.971    55.382  1.00 50.81  ? 352 ILE A C     1 
ATOM   2461  O  O     . ILE A  1 352 ? -8.826  4.368    56.019  1.00 50.20  ? 352 ILE A O     1 
ATOM   2462  C  CB    . ILE A  1 352 ? -11.520 4.098    57.208  1.00 49.96  ? 352 ILE A CB    1 
ATOM   2463  C  CG1   . ILE A  1 352 ? -12.692 3.391    57.871  1.00 49.49  ? 352 ILE A CG1   1 
ATOM   2464  C  CG2   . ILE A  1 352 ? -11.959 5.446    56.686  1.00 50.35  ? 352 ILE A CG2   1 
ATOM   2465  C  CD1   . ILE A  1 352 ? -12.888 3.837    59.294  1.00 49.00  ? 352 ILE A CD1   1 
ATOM   2466  N  N     . PHE A  1 353 ? -9.932  4.108    54.070  1.00 52.01  ? 353 PHE A N     1 
ATOM   2467  C  CA    . PHE A  1 353 ? -8.842  4.628    53.262  1.00 52.38  ? 353 PHE A CA    1 
ATOM   2468  C  C     . PHE A  1 353 ? -9.196  6.010    52.729  1.00 53.02  ? 353 PHE A C     1 
ATOM   2469  O  O     . PHE A  1 353 ? -10.195 6.150    52.037  1.00 54.47  ? 353 PHE A O     1 
ATOM   2470  C  CB    . PHE A  1 353 ? -8.562  3.664    52.109  1.00 53.38  ? 353 PHE A CB    1 
ATOM   2471  C  CG    . PHE A  1 353 ? -7.237  3.881    51.467  1.00 54.87  ? 353 PHE A CG    1 
ATOM   2472  C  CD1   . PHE A  1 353 ? -6.981  5.050    50.738  1.00 56.46  ? 353 PHE A CD1   1 
ATOM   2473  C  CD2   . PHE A  1 353 ? -6.237  2.932    51.589  1.00 55.31  ? 353 PHE A CD2   1 
ATOM   2474  C  CE1   . PHE A  1 353 ? -5.743  5.271    50.152  1.00 56.25  ? 353 PHE A CE1   1 
ATOM   2475  C  CE2   . PHE A  1 353 ? -4.995  3.144    51.009  1.00 55.86  ? 353 PHE A CE2   1 
ATOM   2476  C  CZ    . PHE A  1 353 ? -4.746  4.320    50.288  1.00 56.36  ? 353 PHE A CZ    1 
ATOM   2477  N  N     . LEU A  1 354 ? -8.388  7.023    53.047  1.00 52.55  ? 354 LEU A N     1 
ATOM   2478  C  CA    . LEU A  1 354 ? -8.735  8.427    52.742  1.00 53.83  ? 354 LEU A CA    1 
ATOM   2479  C  C     . LEU A  1 354 ? -7.840  8.998    51.661  1.00 55.02  ? 354 LEU A C     1 
ATOM   2480  O  O     . LEU A  1 354 ? -6.667  8.653    51.610  1.00 55.26  ? 354 LEU A O     1 
ATOM   2481  C  CB    . LEU A  1 354 ? -8.659  9.299    53.996  1.00 52.70  ? 354 LEU A CB    1 
ATOM   2482  C  CG    . LEU A  1 354 ? -9.625  9.016    55.152  1.00 52.07  ? 354 LEU A CG    1 
ATOM   2483  C  CD1   . LEU A  1 354 ? -9.182  7.818    55.926  1.00 53.17  ? 354 LEU A CD1   1 
ATOM   2484  C  CD2   . LEU A  1 354 ? -9.670  10.156   56.101  1.00 52.01  ? 354 LEU A CD2   1 
ATOM   2485  N  N     . GLU A  1 355 ? -8.367  9.870    50.803  1.00 57.02  ? 355 GLU A N     1 
ATOM   2486  C  CA    . GLU A  1 355 ? -7.606  10.326   49.624  1.00 58.67  ? 355 GLU A CA    1 
ATOM   2487  C  C     . GLU A  1 355 ? -7.635  11.829   49.363  1.00 59.76  ? 355 GLU A C     1 
ATOM   2488  O  O     . GLU A  1 355 ? -8.698  12.439   49.309  1.00 61.19  ? 355 GLU A O     1 
ATOM   2489  C  CB    . GLU A  1 355 ? -8.106  9.640    48.357  1.00 60.25  ? 355 GLU A CB    1 
ATOM   2490  C  CG    . GLU A  1 355 ? -7.820  8.160    48.234  1.00 62.46  ? 355 GLU A CG    1 
ATOM   2491  C  CD    . GLU A  1 355 ? -8.189  7.616    46.838  1.00 68.67  ? 355 GLU A CD    1 
ATOM   2492  O  OE1   . GLU A  1 355 ? -9.120  8.174    46.185  1.00 70.84  ? 355 GLU A OE1   1 
ATOM   2493  O  OE2   . GLU A  1 355 ? -7.539  6.632    46.390  1.00 70.26  ? 355 GLU A OE2   1 
ATOM   2494  N  N     . ALA A  1 356 ? -6.465  12.413   49.145  1.00 59.77  ? 356 ALA A N     1 
ATOM   2495  C  CA    . ALA A  1 356 ? -6.367  13.824   48.776  1.00 61.12  ? 356 ALA A CA    1 
ATOM   2496  C  C     . ALA A  1 356 ? -7.373  14.244   47.700  1.00 63.19  ? 356 ALA A C     1 
ATOM   2497  O  O     . ALA A  1 356 ? -8.071  15.228   47.875  1.00 64.36  ? 356 ALA A O     1 
ATOM   2498  C  CB    . ALA A  1 356 ? -4.957  14.149   48.327  1.00 61.36  ? 356 ALA A CB    1 
ATOM   2499  N  N     . GLU A  1 357 ? -7.451  13.488   46.605  1.00 64.05  ? 357 GLU A N     1 
ATOM   2500  C  CA    . GLU A  1 357 ? -8.282  13.852   45.453  1.00 66.55  ? 357 GLU A CA    1 
ATOM   2501  C  C     . GLU A  1 357 ? -9.757  13.947   45.807  1.00 66.49  ? 357 GLU A C     1 
ATOM   2502  O  O     . GLU A  1 357 ? -10.439 14.886   45.412  1.00 68.41  ? 357 GLU A O     1 
ATOM   2503  C  CB    . GLU A  1 357 ? -8.106  12.859   44.300  1.00 67.74  ? 357 GLU A CB    1 
ATOM   2504  C  CG    . GLU A  1 357 ? -7.072  13.260   43.250  1.00 72.78  ? 357 GLU A CG    1 
ATOM   2505  C  CD    . GLU A  1 357 ? -7.524  12.925   41.809  1.00 81.46  ? 357 GLU A CD    1 
ATOM   2506  O  OE1   . GLU A  1 357 ? -8.410  12.042   41.625  1.00 83.36  ? 357 GLU A OE1   1 
ATOM   2507  O  OE2   . GLU A  1 357 ? -6.999  13.559   40.852  1.00 85.24  ? 357 GLU A OE2   1 
ATOM   2508  N  N     . LEU A  1 358 ? -10.256 12.970   46.551  1.00 64.51  ? 358 LEU A N     1 
ATOM   2509  C  CA    . LEU A  1 358 ? -11.654 12.979   46.936  1.00 64.20  ? 358 LEU A CA    1 
ATOM   2510  C  C     . LEU A  1 358 ? -11.896 14.230   47.738  1.00 64.34  ? 358 LEU A C     1 
ATOM   2511  O  O     . LEU A  1 358 ? -12.892 14.917   47.534  1.00 66.07  ? 358 LEU A O     1 
ATOM   2512  C  CB    . LEU A  1 358 ? -12.004 11.739   47.756  1.00 62.36  ? 358 LEU A CB    1 
ATOM   2513  C  CG    . LEU A  1 358 ? -11.853 10.398   47.040  1.00 60.89  ? 358 LEU A CG    1 
ATOM   2514  C  CD1   . LEU A  1 358 ? -12.103 9.276    48.018  1.00 58.70  ? 358 LEU A CD1   1 
ATOM   2515  C  CD2   . LEU A  1 358 ? -12.759 10.301   45.835  1.00 60.31  ? 358 LEU A CD2   1 
ATOM   2516  N  N     . PHE A  1 359 ? -10.953 14.529   48.629  1.00 62.90  ? 359 PHE A N     1 
ATOM   2517  C  CA    . PHE A  1 359 ? -10.990 15.716   49.463  1.00 63.14  ? 359 PHE A CA    1 
ATOM   2518  C  C     . PHE A  1 359 ? -11.171 16.989   48.655  1.00 65.59  ? 359 PHE A C     1 
ATOM   2519  O  O     . PHE A  1 359 ? -12.144 17.717   48.860  1.00 67.34  ? 359 PHE A O     1 
ATOM   2520  C  CB    . PHE A  1 359 ? -9.729  15.808   50.290  1.00 61.26  ? 359 PHE A CB    1 
ATOM   2521  C  CG    . PHE A  1 359 ? -9.821  16.778   51.426  1.00 62.18  ? 359 PHE A CG    1 
ATOM   2522  C  CD1   . PHE A  1 359 ? -9.684  18.150   51.205  1.00 63.87  ? 359 PHE A CD1   1 
ATOM   2523  C  CD2   . PHE A  1 359 ? -10.018 16.317   52.728  1.00 61.62  ? 359 PHE A CD2   1 
ATOM   2524  C  CE1   . PHE A  1 359 ? -9.751  19.045   52.253  1.00 64.17  ? 359 PHE A CE1   1 
ATOM   2525  C  CE2   . PHE A  1 359 ? -10.091 17.203   53.790  1.00 61.90  ? 359 PHE A CE2   1 
ATOM   2526  C  CZ    . PHE A  1 359 ? -9.957  18.573   53.549  1.00 64.07  ? 359 PHE A CZ    1 
ATOM   2527  N  N     . TYR A  1 360 ? -10.262 17.270   47.730  1.00 66.39  ? 360 TYR A N     1 
ATOM   2528  C  CA    . TYR A  1 360 ? -10.384 18.510   46.970  1.00 69.13  ? 360 TYR A CA    1 
ATOM   2529  C  C     . TYR A  1 360 ? -11.700 18.584   46.202  1.00 71.13  ? 360 TYR A C     1 
ATOM   2530  O  O     . TYR A  1 360 ? -12.310 19.652   46.142  1.00 73.29  ? 360 TYR A O     1 
ATOM   2531  C  CB    . TYR A  1 360 ? -9.185  18.761   46.061  1.00 69.90  ? 360 TYR A CB    1 
ATOM   2532  C  CG    . TYR A  1 360 ? -7.853  18.517   46.724  1.00 69.49  ? 360 TYR A CG    1 
ATOM   2533  C  CD1   . TYR A  1 360 ? -7.479  19.200   47.889  1.00 69.65  ? 360 TYR A CD1   1 
ATOM   2534  C  CD2   . TYR A  1 360 ? -6.958  17.600   46.179  1.00 70.63  ? 360 TYR A CD2   1 
ATOM   2535  C  CE1   . TYR A  1 360 ? -6.242  18.955   48.498  1.00 69.55  ? 360 TYR A CE1   1 
ATOM   2536  C  CE2   . TYR A  1 360 ? -5.730  17.350   46.769  1.00 70.84  ? 360 TYR A CE2   1 
ATOM   2537  C  CZ    . TYR A  1 360 ? -5.370  18.025   47.925  1.00 70.83  ? 360 TYR A CZ    1 
ATOM   2538  O  OH    . TYR A  1 360 ? -4.124  17.744   48.486  1.00 72.83  ? 360 TYR A OH    1 
ATOM   2539  N  N     . LYS A  1 361 ? -12.139 17.448   45.650  1.00 70.96  ? 361 LYS A N     1 
ATOM   2540  C  CA    . LYS A  1 361 ? -13.468 17.308   45.014  1.00 72.64  ? 361 LYS A CA    1 
ATOM   2541  C  C     . LYS A  1 361 ? -14.584 17.737   45.941  1.00 72.28  ? 361 LYS A C     1 
ATOM   2542  O  O     . LYS A  1 361 ? -15.653 18.113   45.495  1.00 74.32  ? 361 LYS A O     1 
ATOM   2543  C  CB    . LYS A  1 361 ? -13.743 15.859   44.611  1.00 72.32  ? 361 LYS A CB    1 
ATOM   2544  C  CG    . LYS A  1 361 ? -13.017 15.367   43.379  1.00 74.39  ? 361 LYS A CG    1 
ATOM   2545  C  CD    . LYS A  1 361 ? -13.502 13.961   43.015  1.00 76.97  ? 361 LYS A CD    1 
ATOM   2546  C  CE    . LYS A  1 361 ? -13.433 13.694   41.511  1.00 79.99  ? 361 LYS A CE    1 
ATOM   2547  N  NZ    . LYS A  1 361 ? -12.023 13.703   41.013  1.00 80.62  ? 361 LYS A NZ    1 
ATOM   2548  N  N     . GLY A  1 362 ? -14.334 17.664   47.238  1.00 69.92  ? 362 GLY A N     1 
ATOM   2549  C  CA    . GLY A  1 362 ? -15.309 18.110   48.216  1.00 70.00  ? 362 GLY A CA    1 
ATOM   2550  C  C     . GLY A  1 362 ? -15.900 16.948   48.977  1.00 68.24  ? 362 GLY A C     1 
ATOM   2551  O  O     . GLY A  1 362 ? -16.735 17.135   49.861  1.00 68.71  ? 362 GLY A O     1 
ATOM   2552  N  N     . ILE A  1 363 ? -15.459 15.743   48.636  1.00 66.27  ? 363 ILE A N     1 
ATOM   2553  C  CA    . ILE A  1 363 ? -15.970 14.549   49.265  1.00 64.32  ? 363 ILE A CA    1 
ATOM   2554  C  C     . ILE A  1 363 ? -15.276 14.383   50.608  1.00 62.16  ? 363 ILE A C     1 
ATOM   2555  O  O     . ILE A  1 363 ? -14.248 13.727   50.697  1.00 60.90  ? 363 ILE A O     1 
ATOM   2556  C  CB    . ILE A  1 363 ? -15.764 13.344   48.337  1.00 63.89  ? 363 ILE A CB    1 
ATOM   2557  C  CG1   . ILE A  1 363 ? -16.618 13.525   47.087  1.00 66.15  ? 363 ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A  1 363 ? -16.118 12.046   49.032  1.00 62.51  ? 363 ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A  1 363 ? -16.191 12.702   45.917  1.00 67.29  ? 363 ILE A CD1   1 
ATOM   2560  N  N     . ARG A  1 364 ? -15.817 15.004   51.652  1.00 62.14  ? 364 ARG A N     1 
ATOM   2561  C  CA    . ARG A  1 364 ? -15.233 14.875   52.993  1.00 60.55  ? 364 ARG A CA    1 
ATOM   2562  C  C     . ARG A  1 364 ? -16.234 14.267   53.962  1.00 60.05  ? 364 ARG A C     1 
ATOM   2563  O  O     . ARG A  1 364 ? -17.388 14.699   54.001  1.00 62.14  ? 364 ARG A O     1 
ATOM   2564  C  CB    . ARG A  1 364 ? -14.794 16.235   53.509  1.00 61.28  ? 364 ARG A CB    1 
ATOM   2565  C  CG    . ARG A  1 364 ? -13.844 16.969   52.574  1.00 63.97  ? 364 ARG A CG    1 
ATOM   2566  C  CD    . ARG A  1 364 ? -14.029 18.470   52.661  1.00 68.15  ? 364 ARG A CD    1 
ATOM   2567  N  NE    . ARG A  1 364 ? -12.901 19.181   52.064  1.00 70.15  ? 364 ARG A NE    1 
ATOM   2568  C  CZ    . ARG A  1 364 ? -12.971 20.404   51.545  1.00 73.30  ? 364 ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A  1 364 ? -14.118 21.072   51.536  1.00 75.80  ? 364 ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A  1 364 ? -11.893 20.962   51.024  1.00 74.46  ? 364 ARG A NH2   1 
ATOM   2571  N  N     . PRO A  1 365 ? -15.835 13.245   54.729  1.00 57.84  ? 365 PRO A N     1 
ATOM   2572  C  CA    . PRO A  1 365 ? -14.623 12.454   54.759  1.00 56.39  ? 365 PRO A CA    1 
ATOM   2573  C  C     . PRO A  1 365 ? -14.203 11.923   53.390  1.00 57.09  ? 365 PRO A C     1 
ATOM   2574  O  O     . PRO A  1 365 ? -15.020 11.385   52.658  1.00 58.65  ? 365 PRO A O     1 
ATOM   2575  C  CB    . PRO A  1 365 ? -15.010 11.292   55.664  1.00 55.24  ? 365 PRO A CB    1 
ATOM   2576  C  CG    . PRO A  1 365 ? -15.949 11.880   56.610  1.00 55.48  ? 365 PRO A CG    1 
ATOM   2577  C  CD    . PRO A  1 365 ? -16.728 12.889   55.843  1.00 57.64  ? 365 PRO A CD    1 
ATOM   2578  N  N     . ALA A  1 366 ? -12.929 12.079   53.052  1.00 56.59  ? 366 ALA A N     1 
ATOM   2579  C  CA    . ALA A  1 366 ? -12.434 11.644   51.757  1.00 57.07  ? 366 ALA A CA    1 
ATOM   2580  C  C     . ALA A  1 366 ? -12.229 10.129   51.753  1.00 56.15  ? 366 ALA A C     1 
ATOM   2581  O  O     . ALA A  1 366 ? -11.144 9.628    51.437  1.00 55.06  ? 366 ALA A O     1 
ATOM   2582  C  CB    . ALA A  1 366 ? -11.151 12.387   51.411  1.00 56.92  ? 366 ALA A CB    1 
ATOM   2583  N  N     . ILE A  1 367 ? -13.289 9.415    52.123  1.00 56.14  ? 367 ILE A N     1 
ATOM   2584  C  CA    . ILE A  1 367 ? -13.272 7.963    52.156  1.00 55.73  ? 367 ILE A CA    1 
ATOM   2585  C  C     . ILE A  1 367 ? -13.401 7.421    50.745  1.00 56.93  ? 367 ILE A C     1 
ATOM   2586  O  O     . ILE A  1 367 ? -14.338 7.773    50.021  1.00 58.81  ? 367 ILE A O     1 
ATOM   2587  C  CB    . ILE A  1 367 ? -14.412 7.408    53.035  1.00 55.83  ? 367 ILE A CB    1 
ATOM   2588  C  CG1   . ILE A  1 367 ? -14.243 7.890    54.473  1.00 55.53  ? 367 ILE A CG1   1 
ATOM   2589  C  CG2   . ILE A  1 367 ? -14.427 5.886    53.015  1.00 55.58  ? 367 ILE A CG2   1 
ATOM   2590  C  CD1   . ILE A  1 367 ? -15.448 7.632    55.370  1.00 57.75  ? 367 ILE A CD1   1 
ATOM   2591  N  N     . ASN A  1 368 ? -12.445 6.585    50.358  1.00 56.12  ? 368 ASN A N     1 
ATOM   2592  C  CA    . ASN A  1 368 ? -12.526 5.819    49.125  1.00 57.67  ? 368 ASN A CA    1 
ATOM   2593  C  C     . ASN A  1 368 ? -13.174 4.461    49.425  1.00 58.39  ? 368 ASN A C     1 
ATOM   2594  O  O     . ASN A  1 368 ? -12.526 3.549    49.937  1.00 57.51  ? 368 ASN A O     1 
ATOM   2595  C  CB    . ASN A  1 368 ? -11.132 5.699    48.495  1.00 57.15  ? 368 ASN A CB    1 
ATOM   2596  C  CG    . ASN A  1 368 ? -11.056 4.669    47.385  1.00 58.11  ? 368 ASN A CG    1 
ATOM   2597  O  OD1   . ASN A  1 368 ? -11.768 3.674    47.390  1.00 59.32  ? 368 ASN A OD1   1 
ATOM   2598  N  ND2   . ASN A  1 368 ? -10.165 4.903    46.428  1.00 58.38  ? 368 ASN A ND2   1 
ATOM   2599  N  N     . VAL A  1 369 ? -14.466 4.360    49.112  1.00 60.64  ? 369 VAL A N     1 
ATOM   2600  C  CA    . VAL A  1 369 ? -15.306 3.219    49.465  1.00 62.06  ? 369 VAL A CA    1 
ATOM   2601  C  C     . VAL A  1 369 ? -14.793 1.926    48.855  1.00 63.26  ? 369 VAL A C     1 
ATOM   2602  O  O     . VAL A  1 369 ? -14.744 0.894    49.520  1.00 63.43  ? 369 VAL A O     1 
ATOM   2603  C  CB    . VAL A  1 369 ? -16.759 3.400    48.982  1.00 64.03  ? 369 VAL A CB    1 
ATOM   2604  C  CG1   . VAL A  1 369 ? -17.657 2.327    49.586  1.00 64.49  ? 369 VAL A CG1   1 
ATOM   2605  C  CG2   . VAL A  1 369 ? -17.276 4.780    49.322  1.00 64.44  ? 369 VAL A CG2   1 
ATOM   2606  N  N     . GLY A  1 370 ? -14.420 1.976    47.584  1.00 64.87  ? 370 GLY A N     1 
ATOM   2607  C  CA    . GLY A  1 370 ? -13.931 0.788    46.899  1.00 66.35  ? 370 GLY A CA    1 
ATOM   2608  C  C     . GLY A  1 370 ? -12.645 0.232    47.490  1.00 65.14  ? 370 GLY A C     1 
ATOM   2609  O  O     . GLY A  1 370 ? -12.196 -0.849   47.120  1.00 66.04  ? 370 GLY A O     1 
ATOM   2610  N  N     . LEU A  1 371 ? -12.037 0.964    48.407  1.00 63.70  ? 371 LEU A N     1 
ATOM   2611  C  CA    . LEU A  1 371 ? -10.771 0.509    48.955  1.00 62.94  ? 371 LEU A CA    1 
ATOM   2612  C  C     . LEU A  1 371 ? -10.861 0.267    50.451  1.00 62.07  ? 371 LEU A C     1 
ATOM   2613  O  O     . LEU A  1 371 ? -9.935  -0.300   51.057  1.00 61.27  ? 371 LEU A O     1 
ATOM   2614  C  CB    . LEU A  1 371 ? -9.634  1.486    48.624  1.00 62.02  ? 371 LEU A CB    1 
ATOM   2615  C  CG    . LEU A  1 371 ? -9.000  1.379    47.240  1.00 62.25  ? 371 LEU A CG    1 
ATOM   2616  C  CD1   . LEU A  1 371 ? -7.598  1.949    47.316  1.00 60.50  ? 371 LEU A CD1   1 
ATOM   2617  C  CD2   . LEU A  1 371 ? -8.963  -0.063   46.757  1.00 62.98  ? 371 LEU A CD2   1 
ATOM   2618  N  N     . SER A  1 372 ? -11.977 0.695    51.032  1.00 62.16  ? 372 SER A N     1 
ATOM   2619  C  CA    . SER A  1 372 ? -12.182 0.554    52.454  1.00 61.36  ? 372 SER A CA    1 
ATOM   2620  C  C     . SER A  1 372 ? -12.943 -0.727   52.736  1.00 62.59  ? 372 SER A C     1 
ATOM   2621  O  O     . SER A  1 372 ? -13.714 -1.199   51.900  1.00 64.18  ? 372 SER A O     1 
ATOM   2622  C  CB    . SER A  1 372 ? -12.927 1.765    53.000  1.00 61.16  ? 372 SER A CB    1 
ATOM   2623  O  OG    . SER A  1 372 ? -12.147 2.932    52.835  1.00 59.99  ? 372 SER A OG    1 
ATOM   2624  N  N     . VAL A  1 373 ? -12.697 -1.306   53.906  1.00 61.92  ? 373 VAL A N     1 
ATOM   2625  C  CA    . VAL A  1 373 ? -13.418 -2.499   54.343  1.00 62.83  ? 373 VAL A CA    1 
ATOM   2626  C  C     . VAL A  1 373 ? -13.529 -2.532   55.844  1.00 62.27  ? 373 VAL A C     1 
ATOM   2627  O  O     . VAL A  1 373 ? -12.680 -1.973   56.550  1.00 61.15  ? 373 VAL A O     1 
ATOM   2628  C  CB    . VAL A  1 373 ? -12.735 -3.840   53.922  1.00 63.22  ? 373 VAL A CB    1 
ATOM   2629  C  CG1   . VAL A  1 373 ? -13.630 -4.634   52.998  1.00 64.94  ? 373 VAL A CG1   1 
ATOM   2630  C  CG2   . VAL A  1 373 ? -11.357 -3.619   53.329  1.00 62.18  ? 373 VAL A CG2   1 
ATOM   2631  N  N     . SER A  1 374 ? -14.600 -3.177   56.308  1.00 63.20  ? 374 SER A N     1 
ATOM   2632  C  CA    . SER A  1 374 ? -14.703 -3.696   57.659  1.00 62.61  ? 374 SER A CA    1 
ATOM   2633  C  C     . SER A  1 374 ? -14.874 -5.195   57.491  1.00 64.08  ? 374 SER A C     1 
ATOM   2634  O  O     . SER A  1 374 ? -15.869 -5.646   56.928  1.00 65.40  ? 374 SER A O     1 
ATOM   2635  C  CB    . SER A  1 374 ? -15.909 -3.095   58.376  1.00 62.95  ? 374 SER A CB    1 
ATOM   2636  O  OG    . SER A  1 374 ? -16.221 -3.806   59.565  1.00 62.84  ? 374 SER A OG    1 
ATOM   2637  N  N     . ARG A  1 375 ? -13.888 -5.963   57.944  1.00 64.13  ? 375 ARG A N     1 
ATOM   2638  C  CA    . ARG A  1 375 ? -13.940 -7.424   57.845  1.00 66.14  ? 375 ARG A CA    1 
ATOM   2639  C  C     . ARG A  1 375 ? -14.979 -8.012   58.792  1.00 67.37  ? 375 ARG A C     1 
ATOM   2640  O  O     . ARG A  1 375 ? -15.437 -9.134   58.579  1.00 69.63  ? 375 ARG A O     1 
ATOM   2641  C  CB    . ARG A  1 375 ? -12.582 -8.065   58.109  1.00 65.67  ? 375 ARG A CB    1 
ATOM   2642  C  CG    . ARG A  1 375 ? -11.540 -7.814   57.028  1.00 67.43  ? 375 ARG A CG    1 
ATOM   2643  C  CD    . ARG A  1 375 ? -10.170 -8.345   57.444  1.00 69.99  ? 375 ARG A CD    1 
ATOM   2644  N  NE    . ARG A  1 375 ? -10.216 -9.793   57.638  1.00 74.47  ? 375 ARG A NE    1 
ATOM   2645  C  CZ    . ARG A  1 375 ? -9.650  -10.686  56.829  1.00 77.49  ? 375 ARG A CZ    1 
ATOM   2646  N  NH1   . ARG A  1 375 ? -8.942  -10.296  55.767  1.00 77.40  ? 375 ARG A NH1   1 
ATOM   2647  N  NH2   . ARG A  1 375 ? -9.771  -11.981  57.099  1.00 79.84  ? 375 ARG A NH2   1 
ATOM   2648  N  N     . VAL A  1 376 ? -15.348 -7.273   59.836  1.00 66.37  ? 376 VAL A N     1 
ATOM   2649  C  CA    . VAL A  1 376 ? -16.466 -7.692   60.668  1.00 67.44  ? 376 VAL A CA    1 
ATOM   2650  C  C     . VAL A  1 376 ? -17.744 -7.341   59.924  1.00 68.50  ? 376 VAL A C     1 
ATOM   2651  O  O     . VAL A  1 376 ? -18.590 -8.197   59.725  1.00 70.53  ? 376 VAL A O     1 
ATOM   2652  C  CB    . VAL A  1 376 ? -16.466 -7.036   62.064  1.00 66.67  ? 376 VAL A CB    1 
ATOM   2653  C  CG1   . VAL A  1 376 ? -17.730 -7.445   62.843  1.00 67.88  ? 376 VAL A CG1   1 
ATOM   2654  C  CG2   . VAL A  1 376 ? -15.201 -7.396   62.839  1.00 65.01  ? 376 VAL A CG2   1 
ATOM   2655  N  N     . GLY A  1 377 ? -17.865 -6.075   59.529  1.00 67.63  ? 377 GLY A N     1 
ATOM   2656  C  CA    . GLY A  1 377 ? -18.958 -5.588   58.686  1.00 68.61  ? 377 GLY A CA    1 
ATOM   2657  C  C     . GLY A  1 377 ? -20.324 -5.471   59.343  1.00 69.81  ? 377 GLY A C     1 
ATOM   2658  O  O     . GLY A  1 377 ? -20.462 -4.867   60.414  1.00 69.27  ? 377 GLY A O     1 
ATOM   2659  N  N     . SER A  1 378 ? -21.326 -6.064   58.690  1.00 71.35  ? 378 SER A N     1 
ATOM   2660  C  CA    . SER A  1 378 ? -22.735 -5.934   59.075  1.00 72.63  ? 378 SER A CA    1 
ATOM   2661  C  C     . SER A  1 378 ? -23.089 -6.396   60.478  1.00 72.44  ? 378 SER A C     1 
ATOM   2662  O  O     . SER A  1 378 ? -24.120 -5.993   61.001  1.00 73.54  ? 378 SER A O     1 
ATOM   2663  C  CB    . SER A  1 378 ? -23.642 -6.683   58.087  1.00 75.28  ? 378 SER A CB    1 
ATOM   2664  O  OG    . SER A  1 378 ? -24.335 -5.788   57.235  1.00 77.07  ? 378 SER A OG    1 
ATOM   2665  N  N     . ALA A  1 379 ? -22.279 -7.272   61.068  1.00 71.41  ? 379 ALA A N     1 
ATOM   2666  C  CA    . ALA A  1 379 ? -22.561 -7.761   62.420  1.00 71.22  ? 379 ALA A CA    1 
ATOM   2667  C  C     . ALA A  1 379 ? -22.195 -6.688   63.454  1.00 69.11  ? 379 ALA A C     1 
ATOM   2668  O  O     . ALA A  1 379 ? -22.508 -6.800   64.636  1.00 69.73  ? 379 ALA A O     1 
ATOM   2669  C  CB    . ALA A  1 379 ? -21.831 -9.081   62.687  1.00 71.44  ? 379 ALA A CB    1 
ATOM   2670  N  N     . ALA A  1 380 ? -21.554 -5.633   62.976  1.00 66.73  ? 380 ALA A N     1 
ATOM   2671  C  CA    . ALA A  1 380 ? -21.083 -4.561   63.823  1.00 64.72  ? 380 ALA A CA    1 
ATOM   2672  C  C     . ALA A  1 380 ? -21.961 -3.323   63.617  1.00 64.42  ? 380 ALA A C     1 
ATOM   2673  O  O     . ALA A  1 380 ? -21.604 -2.203   64.029  1.00 63.58  ? 380 ALA A O     1 
ATOM   2674  C  CB    . ALA A  1 380 ? -19.641 -4.254   63.468  1.00 62.98  ? 380 ALA A CB    1 
ATOM   2675  N  N     . GLN A  1 381 ? -23.110 -3.536   62.985  1.00 64.79  ? 381 GLN A N     1 
ATOM   2676  C  CA    . GLN A  1 381 ? -23.909 -2.451   62.469  1.00 64.26  ? 381 GLN A CA    1 
ATOM   2677  C  C     . GLN A  1 381 ? -25.319 -2.546   63.025  1.00 65.80  ? 381 GLN A C     1 
ATOM   2678  O  O     . GLN A  1 381 ? -25.907 -3.637   63.040  1.00 67.19  ? 381 GLN A O     1 
ATOM   2679  C  CB    . GLN A  1 381 ? -23.911 -2.533   60.943  1.00 64.55  ? 381 GLN A CB    1 
ATOM   2680  C  CG    . GLN A  1 381 ? -24.599 -1.396   60.216  1.00 65.11  ? 381 GLN A CG    1 
ATOM   2681  C  CD    . GLN A  1 381 ? -24.417 -1.473   58.705  1.00 66.44  ? 381 GLN A CD    1 
ATOM   2682  O  OE1   . GLN A  1 381 ? -24.732 -2.489   58.065  1.00 67.07  ? 381 GLN A OE1   1 
ATOM   2683  N  NE2   . GLN A  1 381 ? -23.899 -0.390   58.124  1.00 65.83  ? 381 GLN A NE2   1 
ATOM   2684  N  N     . VAL A  1 382 ? -25.838 -1.402   63.493  1.00 65.26  ? 382 VAL A N     1 
ATOM   2685  C  CA    . VAL A  1 382 ? -27.234 -1.247   63.924  1.00 66.57  ? 382 VAL A CA    1 
ATOM   2686  C  C     . VAL A  1 382 ? -28.131 -1.847   62.853  1.00 68.44  ? 382 VAL A C     1 
ATOM   2687  O  O     . VAL A  1 382 ? -28.007 -1.503   61.676  1.00 68.32  ? 382 VAL A O     1 
ATOM   2688  C  CB    . VAL A  1 382 ? -27.623 0.248    64.117  1.00 66.20  ? 382 VAL A CB    1 
ATOM   2689  C  CG1   . VAL A  1 382 ? -29.093 0.387    64.484  1.00 68.20  ? 382 VAL A CG1   1 
ATOM   2690  C  CG2   . VAL A  1 382 ? -26.765 0.907    65.183  1.00 64.41  ? 382 VAL A CG2   1 
ATOM   2691  N  N     . LYS A  1 383 ? -29.030 -2.744   63.247  1.00 75.39  ? 383 LYS A N     1 
ATOM   2692  C  CA    . LYS A  1 383 ? -29.850 -3.435   62.261  1.00 76.88  ? 383 LYS A CA    1 
ATOM   2693  C  C     . LYS A  1 383 ? -30.578 -2.458   61.326  1.00 75.06  ? 383 LYS A C     1 
ATOM   2694  O  O     . LYS A  1 383 ? -30.661 -2.705   60.123  1.00 75.43  ? 383 LYS A O     1 
ATOM   2695  C  CB    . LYS A  1 383 ? -30.823 -4.406   62.921  1.00 80.11  ? 383 LYS A CB    1 
ATOM   2696  C  CG    . LYS A  1 383 ? -31.024 -5.667   62.105  1.00 83.73  ? 383 LYS A CG    1 
ATOM   2697  C  CD    . LYS A  1 383 ? -32.434 -6.212   62.242  1.00 88.05  ? 383 LYS A CD    1 
ATOM   2698  C  CE    . LYS A  1 383 ? -32.617 -7.484   61.426  1.00 92.16  ? 383 LYS A CE    1 
ATOM   2699  N  NZ    . LYS A  1 383 ? -34.061 -7.795   61.193  1.00 95.04  ? 383 LYS A NZ    1 
ATOM   2700  N  N     . ALA A  1 384 ? -31.062 -1.342   61.881  1.00 73.62  ? 384 ALA A N     1 
ATOM   2701  C  CA    . ALA A  1 384 ? -31.757 -0.278   61.130  1.00 72.13  ? 384 ALA A CA    1 
ATOM   2702  C  C     . ALA A  1 384 ? -30.958 0.270    59.952  1.00 70.16  ? 384 ALA A C     1 
ATOM   2703  O  O     . ALA A  1 384 ? -31.510 0.577    58.889  1.00 69.93  ? 384 ALA A O     1 
ATOM   2704  C  CB    . ALA A  1 384 ? -32.111 0.861    62.061  1.00 71.37  ? 384 ALA A CB    1 
ATOM   2705  N  N     . LEU A  1 385 ? -29.656 0.413    60.163  1.00 68.91  ? 385 LEU A N     1 
ATOM   2706  C  CA    . LEU A  1 385 ? -28.780 0.950    59.148  1.00 67.37  ? 385 LEU A CA    1 
ATOM   2707  C  C     . LEU A  1 385 ? -28.440 -0.129   58.120  1.00 68.92  ? 385 LEU A C     1 
ATOM   2708  O  O     . LEU A  1 385 ? -28.400 0.151    56.920  1.00 68.95  ? 385 LEU A O     1 
ATOM   2709  C  CB    . LEU A  1 385 ? -27.530 1.545    59.791  1.00 65.88  ? 385 LEU A CB    1 
ATOM   2710  C  CG    . LEU A  1 385 ? -26.854 2.702    59.061  1.00 63.75  ? 385 LEU A CG    1 
ATOM   2711  C  CD1   . LEU A  1 385 ? -27.852 3.801    58.731  1.00 63.36  ? 385 LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A  1 385 ? -25.751 3.235    59.931  1.00 62.45  ? 385 LEU A CD2   1 
ATOM   2713  N  N     . LYS A  1 386 ? -28.227 -1.362   58.586  1.00 70.71  ? 386 LYS A N     1 
ATOM   2714  C  CA    . LYS A  1 386 ? -28.034 -2.511   57.697  1.00 72.67  ? 386 LYS A CA    1 
ATOM   2715  C  C     . LYS A  1 386 ? -29.188 -2.663   56.716  1.00 74.24  ? 386 LYS A C     1 
ATOM   2716  O  O     . LYS A  1 386 ? -28.977 -3.065   55.578  1.00 75.33  ? 386 LYS A O     1 
ATOM   2717  C  CB    . LYS A  1 386 ? -27.879 -3.807   58.501  1.00 75.23  ? 386 LYS A CB    1 
ATOM   2718  C  CG    . LYS A  1 386 ? -27.624 -5.040   57.651  1.00 76.95  ? 386 LYS A CG    1 
ATOM   2719  C  CD    . LYS A  1 386 ? -27.818 -6.321   58.420  1.00 78.91  ? 386 LYS A CD    1 
ATOM   2720  C  CE    . LYS A  1 386 ? -27.535 -7.508   57.509  1.00 82.90  ? 386 LYS A CE    1 
ATOM   2721  N  NZ    . LYS A  1 386 ? -28.085 -8.808   58.015  1.00 87.27  ? 386 LYS A NZ    1 
ATOM   2722  N  N     . GLN A  1 387 ? -30.399 -2.332   57.168  1.00 74.98  ? 387 GLN A N     1 
ATOM   2723  C  CA    . GLN A  1 387 ? -31.622 -2.495   56.375  1.00 77.20  ? 387 GLN A CA    1 
ATOM   2724  C  C     . GLN A  1 387 ? -31.711 -1.539   55.200  1.00 76.66  ? 387 GLN A C     1 
ATOM   2725  O  O     . GLN A  1 387 ? -31.911 -1.977   54.077  1.00 78.45  ? 387 GLN A O     1 
ATOM   2726  C  CB    . GLN A  1 387 ? -32.860 -2.344   57.249  1.00 77.77  ? 387 GLN A CB    1 
ATOM   2727  C  CG    . GLN A  1 387 ? -32.972 -3.383   58.337  1.00 79.67  ? 387 GLN A CG    1 
ATOM   2728  C  CD    . GLN A  1 387 ? -34.374 -3.488   58.894  1.00 81.69  ? 387 GLN A CD    1 
ATOM   2729  O  OE1   . GLN A  1 387 ? -34.678 -2.930   59.947  1.00 80.51  ? 387 GLN A OE1   1 
ATOM   2730  N  NE2   . GLN A  1 387 ? -35.243 -4.204   58.182  1.00 84.27  ? 387 GLN A NE2   1 
ATOM   2731  N  N     . VAL A  1 388 ? -31.558 -0.241   55.458  1.00 75.23  ? 388 VAL A N     1 
ATOM   2732  C  CA    . VAL A  1 388 ? -31.633 0.776    54.397  1.00 75.68  ? 388 VAL A CA    1 
ATOM   2733  C  C     . VAL A  1 388 ? -30.350 0.893    53.577  1.00 75.74  ? 388 VAL A C     1 
ATOM   2734  O  O     . VAL A  1 388 ? -30.388 1.357    52.442  1.00 76.87  ? 388 VAL A O     1 
ATOM   2735  C  CB    . VAL A  1 388 ? -32.017 2.194    54.921  1.00 73.81  ? 388 VAL A CB    1 
ATOM   2736  C  CG1   . VAL A  1 388 ? -33.426 2.200    55.509  1.00 75.67  ? 388 VAL A CG1   1 
ATOM   2737  C  CG2   . VAL A  1 388 ? -31.002 2.708    55.937  1.00 71.71  ? 388 VAL A CG2   1 
ATOM   2738  N  N     . ALA A  1 389 ? -29.220 0.481    54.141  1.00 75.63  ? 389 ALA A N     1 
ATOM   2739  C  CA    . ALA A  1 389 ? -27.937 0.707    53.490  1.00 75.59  ? 389 ALA A CA    1 
ATOM   2740  C  C     . ALA A  1 389 ? -27.306 -0.573   52.955  1.00 78.38  ? 389 ALA A C     1 
ATOM   2741  O  O     . ALA A  1 389 ? -26.118 -0.584   52.575  1.00 78.57  ? 389 ALA A O     1 
ATOM   2742  C  CB    . ALA A  1 389 ? -26.980 1.409    54.447  1.00 73.48  ? 389 ALA A CB    1 
ATOM   2743  N  N     . GLY A  1 390 ? -28.085 -1.655   52.936  1.00 81.04  ? 390 GLY A N     1 
ATOM   2744  C  CA    . GLY A  1 390 ? -27.602 -2.924   52.395  1.00 83.94  ? 390 GLY A CA    1 
ATOM   2745  C  C     . GLY A  1 390 ? -27.397 -2.727   50.912  1.00 85.22  ? 390 GLY A C     1 
ATOM   2746  O  O     . GLY A  1 390 ? -26.392 -3.142   50.347  1.00 86.35  ? 390 GLY A O     1 
ATOM   2747  N  N     . SER A  1 391 ? -28.361 -2.057   50.295  1.00 85.53  ? 391 SER A N     1 
ATOM   2748  C  CA    . SER A  1 391 ? -28.272 -1.693   48.895  1.00 87.19  ? 391 SER A CA    1 
ATOM   2749  C  C     . SER A  1 391 ? -27.179 -0.653   48.659  1.00 84.84  ? 391 SER A C     1 
ATOM   2750  O  O     . SER A  1 391 ? -26.412 -0.790   47.711  1.00 86.33  ? 391 SER A O     1 
ATOM   2751  C  CB    . SER A  1 391 ? -29.619 -1.169   48.394  1.00 88.31  ? 391 SER A CB    1 
ATOM   2752  O  OG    . SER A  1 391 ? -29.968 0.020    49.075  1.00 86.11  ? 391 SER A OG    1 
ATOM   2753  N  N     . LEU A  1 392 ? -27.100 0.370    49.521  1.00 81.68  ? 392 LEU A N     1 
ATOM   2754  C  CA    . LEU A  1 392 ? -26.094 1.443    49.381  1.00 79.32  ? 392 LEU A CA    1 
ATOM   2755  C  C     . LEU A  1 392 ? -24.710 0.913    49.040  1.00 80.39  ? 392 LEU A C     1 
ATOM   2756  O  O     . LEU A  1 392 ? -24.042 1.448    48.159  1.00 80.60  ? 392 LEU A O     1 
ATOM   2757  C  CB    . LEU A  1 392 ? -26.018 2.319    50.628  1.00 75.99  ? 392 LEU A CB    1 
ATOM   2758  C  CG    . LEU A  1 392 ? -25.084 3.514    50.448  1.00 73.40  ? 392 LEU A CG    1 
ATOM   2759  C  CD1   . LEU A  1 392 ? -25.451 4.298    49.205  1.00 72.94  ? 392 LEU A CD1   1 
ATOM   2760  C  CD2   . LEU A  1 392 ? -25.085 4.411    51.668  1.00 70.85  ? 392 LEU A CD2   1 
ATOM   2761  N  N     . LYS A  1 393 ? -24.301 -0.136   49.750  1.00 81.69  ? 393 LYS A N     1 
ATOM   2762  C  CA    . LYS A  1 393 ? -23.101 -0.926   49.429  1.00 84.27  ? 393 LYS A CA    1 
ATOM   2763  C  C     . LYS A  1 393 ? -23.004 -1.223   47.916  1.00 87.20  ? 393 LYS A C     1 
ATOM   2764  O  O     . LYS A  1 393 ? -21.948 -0.992   47.290  1.00 87.64  ? 393 LYS A O     1 
ATOM   2765  C  CB    . LYS A  1 393 ? -23.141 -2.234   50.241  1.00 86.00  ? 393 LYS A CB    1 
ATOM   2766  C  CG    . LYS A  1 393 ? -21.919 -3.149   50.142  1.00 89.29  ? 393 LYS A CG    1 
ATOM   2767  C  CD    . LYS A  1 393 ? -22.111 -4.389   51.035  1.00 92.74  ? 393 LYS A CD    1 
ATOM   2768  C  CE    . LYS A  1 393 ? -20.779 -5.072   51.380  1.00 95.32  ? 393 LYS A CE    1 
ATOM   2769  N  NZ    . LYS A  1 393 ? -19.984 -4.316   52.404  1.00 92.91  ? 393 LYS A NZ    1 
ATOM   2770  N  N     . LEU A  1 394 ? -24.126 -1.713   47.362  1.00 89.22  ? 394 LEU A N     1 
ATOM   2771  C  CA    . LEU A  1 394 ? -24.285 -2.078   45.940  1.00 92.67  ? 394 LEU A CA    1 
ATOM   2772  C  C     . LEU A  1 394 ? -24.105 -0.905   44.995  1.00 92.04  ? 394 LEU A C     1 
ATOM   2773  O  O     . LEU A  1 394 ? -23.256 -0.944   44.097  1.00 94.11  ? 394 LEU A O     1 
ATOM   2774  C  CB    . LEU A  1 394 ? -25.680 -2.676   45.676  1.00 94.91  ? 394 LEU A CB    1 
ATOM   2775  C  CG    . LEU A  1 394 ? -25.936 -4.155   45.371  1.00 99.23  ? 394 LEU A CG    1 
ATOM   2776  C  CD1   . LEU A  1 394 ? -27.418 -4.458   45.577  1.00 100.25 ? 394 LEU A CD1   1 
ATOM   2777  C  CD2   . LEU A  1 394 ? -25.503 -4.529   43.951  1.00 102.68 ? 394 LEU A CD2   1 
ATOM   2778  N  N     . PHE A  1 395 ? -24.914 0.131    45.187  1.00 89.50  ? 395 PHE A N     1 
ATOM   2779  C  CA    . PHE A  1 395 ? -24.983 1.169    44.184  1.00 89.64  ? 395 PHE A CA    1 
ATOM   2780  C  C     . PHE A  1 395 ? -23.684 1.911    43.978  1.00 88.09  ? 395 PHE A C     1 
ATOM   2781  O  O     . PHE A  1 395 ? -23.214 2.003    42.849  1.00 90.96  ? 395 PHE A O     1 
ATOM   2782  C  CB    . PHE A  1 395 ? -26.132 2.134    44.392  1.00 88.49  ? 395 PHE A CB    1 
ATOM   2783  C  CG    . PHE A  1 395 ? -26.532 2.805    43.136  1.00 91.93  ? 395 PHE A CG    1 
ATOM   2784  C  CD1   . PHE A  1 395 ? -27.369 2.153    42.234  1.00 97.32  ? 395 PHE A CD1   1 
ATOM   2785  C  CD2   . PHE A  1 395 ? -26.025 4.055    42.808  1.00 91.54  ? 395 PHE A CD2   1 
ATOM   2786  C  CE1   . PHE A  1 395 ? -27.729 2.754    41.037  1.00 100.68 ? 395 PHE A CE1   1 
ATOM   2787  C  CE2   . PHE A  1 395 ? -26.380 4.661    41.624  1.00 94.76  ? 395 PHE A CE2   1 
ATOM   2788  C  CZ    . PHE A  1 395 ? -27.238 4.011    40.738  1.00 99.34  ? 395 PHE A CZ    1 
ATOM   2789  N  N     . LEU A  1 396 ? -23.094 2.438    45.045  1.00 84.02  ? 396 LEU A N     1 
ATOM   2790  C  CA    . LEU A  1 396 ? -21.847 3.183    44.890  1.00 82.35  ? 396 LEU A CA    1 
ATOM   2791  C  C     . LEU A  1 396 ? -20.821 2.330    44.137  1.00 85.11  ? 396 LEU A C     1 
ATOM   2792  O  O     . LEU A  1 396 ? -20.002 2.857    43.380  1.00 86.03  ? 396 LEU A O     1 
ATOM   2793  C  CB    . LEU A  1 396 ? -21.323 3.684    46.238  1.00 78.69  ? 396 LEU A CB    1 
ATOM   2794  C  CG    . LEU A  1 396 ? -22.220 4.694    46.955  1.00 74.37  ? 396 LEU A CG    1 
ATOM   2795  C  CD1   . LEU A  1 396 ? -21.717 4.944    48.345  1.00 70.84  ? 396 LEU A CD1   1 
ATOM   2796  C  CD2   . LEU A  1 396 ? -22.329 5.996    46.193  1.00 73.50  ? 396 LEU A CD2   1 
ATOM   2797  N  N     . ALA A  1 397 ? -20.917 1.010    44.317  1.00 86.63  ? 397 ALA A N     1 
ATOM   2798  C  CA    . ALA A  1 397 ? -20.089 0.055    43.579  1.00 90.20  ? 397 ALA A CA    1 
ATOM   2799  C  C     . ALA A  1 397 ? -20.381 0.135    42.083  1.00 93.59  ? 397 ALA A C     1 
ATOM   2800  O  O     . ALA A  1 397 ? -19.449 0.195    41.268  1.00 95.75  ? 397 ALA A O     1 
ATOM   2801  C  CB    . ALA A  1 397 ? -20.303 -1.371   44.101  1.00 91.59  ? 397 ALA A CB    1 
ATOM   2802  N  N     . GLN A  1 398 ? -21.676 0.147    41.745  1.00 94.15  ? 398 GLN A N     1 
ATOM   2803  C  CA    . GLN A  1 398 ? -22.151 0.284    40.363  1.00 97.47  ? 398 GLN A CA    1 
ATOM   2804  C  C     . GLN A  1 398 ? -21.857 1.676    39.816  1.00 96.82  ? 398 GLN A C     1 
ATOM   2805  O  O     . GLN A  1 398 ? -21.435 1.818    38.669  1.00 100.04 ? 398 GLN A O     1 
ATOM   2806  C  CB    . GLN A  1 398 ? -23.648 -0.003   40.264  1.00 98.36  ? 398 GLN A CB    1 
ATOM   2807  C  CG    . GLN A  1 398 ? -24.050 -1.434   40.590  1.00 100.18 ? 398 GLN A CG    1 
ATOM   2808  C  CD    . GLN A  1 398 ? -25.564 -1.643   40.572  1.00 101.03 ? 398 GLN A CD    1 
ATOM   2809  O  OE1   . GLN A  1 398 ? -26.343 -0.704   40.769  1.00 98.47  ? 398 GLN A OE1   1 
ATOM   2810  N  NE2   . GLN A  1 398 ? -25.984 -2.882   40.338  1.00 104.35 ? 398 GLN A NE2   1 
ATOM   2811  N  N     . TYR A  1 399 ? -22.081 2.696    40.643  1.00 93.13  ? 399 TYR A N     1 
ATOM   2812  C  CA    . TYR A  1 399 ? -21.736 4.068    40.299  1.00 92.70  ? 399 TYR A CA    1 
ATOM   2813  C  C     . TYR A  1 399 ? -20.309 4.124    39.778  1.00 94.76  ? 399 TYR A C     1 
ATOM   2814  O  O     . TYR A  1 399 ? -20.073 4.576    38.660  1.00 97.73  ? 399 TYR A O     1 
ATOM   2815  C  CB    . TYR A  1 399 ? -21.895 4.986    41.511  1.00 88.32  ? 399 TYR A CB    1 
ATOM   2816  C  CG    . TYR A  1 399 ? -21.600 6.446    41.242  1.00 87.57  ? 399 TYR A CG    1 
ATOM   2817  C  CD1   . TYR A  1 399 ? -22.107 7.083    40.117  1.00 90.35  ? 399 TYR A CD1   1 
ATOM   2818  C  CD2   . TYR A  1 399 ? -20.844 7.199    42.134  1.00 84.69  ? 399 TYR A CD2   1 
ATOM   2819  C  CE1   . TYR A  1 399 ? -21.848 8.426    39.871  1.00 90.98  ? 399 TYR A CE1   1 
ATOM   2820  C  CE2   . TYR A  1 399 ? -20.583 8.546    41.901  1.00 84.91  ? 399 TYR A CE2   1 
ATOM   2821  C  CZ    . TYR A  1 399 ? -21.086 9.152    40.766  1.00 88.36  ? 399 TYR A CZ    1 
ATOM   2822  O  OH    . TYR A  1 399 ? -20.835 10.486   40.514  1.00 89.47  ? 399 TYR A OH    1 
ATOM   2823  N  N     . ARG A  1 400 ? -19.376 3.618    40.582  1.00 93.87  ? 400 ARG A N     1 
ATOM   2824  C  CA    . ARG A  1 400 ? -17.949 3.649    40.267  1.00 95.91  ? 400 ARG A CA    1 
ATOM   2825  C  C     . ARG A  1 400 ? -17.534 2.972    38.946  1.00 101.03 ? 400 ARG A C     1 
ATOM   2826  O  O     . ARG A  1 400 ? -16.606 3.438    38.287  1.00 103.08 ? 400 ARG A O     1 
ATOM   2827  C  CB    . ARG A  1 400 ? -17.145 3.099    41.449  1.00 94.06  ? 400 ARG A CB    1 
ATOM   2828  C  CG    . ARG A  1 400 ? -16.811 4.150    42.523  1.00 91.03  ? 400 ARG A CG    1 
ATOM   2829  C  CD    . ARG A  1 400 ? -17.079 3.643    43.947  1.00 88.53  ? 400 ARG A CD    1 
ATOM   2830  N  NE    . ARG A  1 400 ? -16.782 2.216    44.093  1.00 90.74  ? 400 ARG A NE    1 
ATOM   2831  C  CZ    . ARG A  1 400 ? -17.223 1.444    45.084  1.00 89.09  ? 400 ARG A CZ    1 
ATOM   2832  N  NH1   . ARG A  1 400 ? -17.997 1.948    46.045  1.00 85.30  ? 400 ARG A NH1   1 
ATOM   2833  N  NH2   . ARG A  1 400 ? -16.888 0.160    45.108  1.00 90.81  ? 400 ARG A NH2   1 
ATOM   2834  N  N     . GLU A  1 401 ? -18.210 1.888    38.560  1.00 103.85 ? 401 GLU A N     1 
ATOM   2835  C  CA    . GLU A  1 401 ? -17.915 1.199    37.283  1.00 109.49 ? 401 GLU A CA    1 
ATOM   2836  C  C     . GLU A  1 401 ? -18.282 2.084    36.096  1.00 111.78 ? 401 GLU A C     1 
ATOM   2837  O  O     . GLU A  1 401 ? -17.494 2.263    35.165  1.00 115.18 ? 401 GLU A O     1 
ATOM   2838  C  CB    . GLU A  1 401 ? -18.694 -0.117   37.153  1.00 111.95 ? 401 GLU A CB    1 
ATOM   2839  C  CG    . GLU A  1 401 ? -18.775 -0.972   38.410  1.00 110.91 ? 401 GLU A CG    1 
ATOM   2840  C  CD    . GLU A  1 401 ? -20.041 -1.827   38.466  1.00 113.81 ? 401 GLU A CD    1 
ATOM   2841  O  OE1   . GLU A  1 401 ? -20.774 -1.903   37.448  1.00 117.53 ? 401 GLU A OE1   1 
ATOM   2842  O  OE2   . GLU A  1 401 ? -20.304 -2.420   39.540  1.00 112.38 ? 401 GLU A OE2   1 
ATOM   2843  N  N     . VAL A  1 402 ? -19.493 2.629    36.164  1.00 110.27 ? 402 VAL A N     1 
ATOM   2844  C  CA    . VAL A  1 402 ? -20.093 3.458    35.129  1.00 112.66 ? 402 VAL A CA    1 
ATOM   2845  C  C     . VAL A  1 402 ? -19.627 4.919    35.271  1.00 110.69 ? 402 VAL A C     1 
ATOM   2846  O  O     . VAL A  1 402 ? -20.015 5.784    34.479  1.00 112.64 ? 402 VAL A O     1 
ATOM   2847  C  CB    . VAL A  1 402 ? -21.651 3.378    35.227  1.00 112.41 ? 402 VAL A CB    1 
ATOM   2848  C  CG1   . VAL A  1 402 ? -22.327 4.019    34.026  1.00 116.43 ? 402 VAL A CG1   1 
ATOM   2849  C  CG2   . VAL A  1 402 ? -22.119 1.927    35.372  1.00 113.68 ? 402 VAL A CG2   1 
ATOM   2850  N  N     . ALA A  1 403 ? -18.777 5.173    36.267  1.00 107.25 ? 403 ALA A N     1 
ATOM   2851  C  CA    . ALA A  1 403 ? -18.370 6.530    36.664  1.00 105.14 ? 403 ALA A CA    1 
ATOM   2852  C  C     . ALA A  1 403 ? -17.917 7.435    35.521  1.00 108.83 ? 403 ALA A C     1 
ATOM   2853  O  O     . ALA A  1 403 ? -18.434 8.548    35.363  1.00 108.85 ? 403 ALA A O     1 
ATOM   2854  C  CB    . ALA A  1 403 ? -17.299 6.470    37.743  1.00 102.19 ? 403 ALA A CB    1 
ATOM   2855  N  N     . ALA A  1 404 ? -16.965 6.944    34.727  1.00 112.36 ? 404 ALA A N     1 
ATOM   2856  C  CA    . ALA A  1 404 ? -16.332 7.725    33.663  1.00 116.19 ? 404 ALA A CA    1 
ATOM   2857  C  C     . ALA A  1 404 ? -17.284 8.158    32.543  1.00 119.86 ? 404 ALA A C     1 
ATOM   2858  O  O     . ALA A  1 404 ? -16.873 8.834    31.598  1.00 123.69 ? 404 ALA A O     1 
ATOM   2859  C  CB    . ALA A  1 404 ? -15.150 6.961    33.093  1.00 119.59 ? 404 ALA A CB    1 
ATOM   2860  N  N     . PHE A  1 405 ? -18.553 7.772    32.654  1.00 119.25 ? 405 PHE A N     1 
ATOM   2861  C  CA    . PHE A  1 405 ? -19.560 8.140    31.658  1.00 123.08 ? 405 PHE A CA    1 
ATOM   2862  C  C     . PHE A  1 405 ? -20.207 9.501    31.937  1.00 121.77 ? 405 PHE A C     1 
ATOM   2863  O  O     . PHE A  1 405 ? -20.974 10.006   31.111  1.00 125.24 ? 405 PHE A O     1 
ATOM   2864  C  CB    . PHE A  1 405 ? -20.636 7.053    31.538  1.00 123.92 ? 405 PHE A CB    1 
ATOM   2865  C  CG    . PHE A  1 405 ? -20.199 5.837    30.761  1.00 127.71 ? 405 PHE A CG    1 
ATOM   2866  C  CD1   . PHE A  1 405 ? -20.146 4.589    31.372  1.00 126.00 ? 405 PHE A CD1   1 
ATOM   2867  C  CD2   . PHE A  1 405 ? -19.848 5.936    29.420  1.00 133.31 ? 405 PHE A CD2   1 
ATOM   2868  C  CE1   . PHE A  1 405 ? -19.752 3.459    30.660  1.00 130.13 ? 405 PHE A CE1   1 
ATOM   2869  C  CE2   . PHE A  1 405 ? -19.450 4.811    28.700  1.00 137.57 ? 405 PHE A CE2   1 
ATOM   2870  C  CZ    . PHE A  1 405 ? -19.402 3.571    29.323  1.00 135.90 ? 405 PHE A CZ    1 
ATOM   2871  N  N     . ALA A  1 406 ? -19.880 10.086   33.092  1.00 117.39 ? 406 ALA A N     1 
ATOM   2872  C  CA    . ALA A  1 406 ? -20.406 11.393   33.528  1.00 115.98 ? 406 ALA A CA    1 
ATOM   2873  C  C     . ALA A  1 406 ? -20.236 12.528   32.501  1.00 120.45 ? 406 ALA A C     1 
ATOM   2874  O  O     . ALA A  1 406 ? -21.044 13.466   32.471  1.00 121.18 ? 406 ALA A O     1 
ATOM   2875  C  CB    . ALA A  1 406 ? -19.784 11.793   34.874  1.00 111.11 ? 406 ALA A CB    1 
ATOM   2876  N  N     . GLN A  1 407 ? -19.190 12.426   31.674  1.00 123.68 ? 407 GLN A N     1 
ATOM   2877  C  CA    . GLN A  1 407 ? -18.867 13.409   30.638  1.00 128.44 ? 407 GLN A CA    1 
ATOM   2878  C  C     . GLN A  1 407 ? -19.922 13.454   29.535  1.00 133.13 ? 407 GLN A C     1 
ATOM   2879  O  O     . GLN A  1 407 ? -20.423 12.420   29.093  1.00 134.58 ? 407 GLN A O     1 
ATOM   2880  C  CB    . GLN A  1 407 ? -17.491 13.105   30.031  1.00 131.24 ? 407 GLN A CB    1 
ATOM   2881  C  CG    . GLN A  1 407 ? -16.287 13.578   30.865  1.00 128.92 ? 407 GLN A CG    1 
ATOM   2882  C  CD    . GLN A  1 407 ? -15.979 12.700   32.090  1.00 124.19 ? 407 GLN A CD    1 
ATOM   2883  O  OE1   . GLN A  1 407 ? -16.770 11.836   32.479  1.00 122.36 ? 407 GLN A OE1   1 
ATOM   2884  N  NE2   . GLN A  1 407 ? -14.823 12.933   32.702  1.00 122.20 ? 407 GLN A NE2   1 
ATOM   2885  N  N     . SER A  1 410 ? -23.220 12.212   28.153  1.00 132.49 ? 410 SER A N     1 
ATOM   2886  C  CA    . SER A  1 410 ? -24.068 12.729   27.079  1.00 138.41 ? 410 SER A CA    1 
ATOM   2887  C  C     . SER A  1 410 ? -25.073 11.678   26.587  1.00 141.11 ? 410 SER A C     1 
ATOM   2888  O  O     . SER A  1 410 ? -26.078 11.421   27.259  1.00 138.44 ? 410 SER A O     1 
ATOM   2889  C  CB    . SER A  1 410 ? -23.212 13.262   25.920  1.00 143.91 ? 410 SER A CB    1 
ATOM   2890  N  N     . ASP A  1 411 ? -24.791 11.085   25.422  1.00 146.67 ? 411 ASP A N     1 
ATOM   2891  C  CA    . ASP A  1 411 ? -25.639 10.052   24.814  1.00 150.41 ? 411 ASP A CA    1 
ATOM   2892  C  C     . ASP A  1 411 ? -25.544 8.733    25.586  1.00 146.40 ? 411 ASP A C     1 
ATOM   2893  O  O     . ASP A  1 411 ? -24.741 7.854    25.245  1.00 147.74 ? 411 ASP A O     1 
ATOM   2894  C  CB    . ASP A  1 411 ? -25.252 9.831    23.343  1.00 158.10 ? 411 ASP A CB    1 
ATOM   2895  C  CG    . ASP A  1 411 ? -25.536 11.044   22.462  1.00 163.49 ? 411 ASP A CG    1 
ATOM   2896  O  OD1   . ASP A  1 411 ? -25.347 12.191   22.924  1.00 161.42 ? 411 ASP A OD1   1 
ATOM   2897  O  OD2   . ASP A  1 411 ? -25.935 10.848   21.292  1.00 170.25 ? 411 ASP A OD2   1 
ATOM   2898  N  N     . LEU A  1 412 ? -26.375 8.609    26.623  1.00 141.81 ? 412 LEU A N     1 
ATOM   2899  C  CA    . LEU A  1 412 ? -26.332 7.470    27.545  1.00 137.45 ? 412 LEU A CA    1 
ATOM   2900  C  C     . LEU A  1 412 ? -27.686 6.788    27.692  1.00 138.31 ? 412 LEU A C     1 
ATOM   2901  O  O     . LEU A  1 412 ? -28.727 7.402    27.465  1.00 140.31 ? 412 LEU A O     1 
ATOM   2902  C  CB    . LEU A  1 412 ? -25.873 7.921    28.936  1.00 130.28 ? 412 LEU A CB    1 
ATOM   2903  C  CG    . LEU A  1 412 ? -24.814 9.008    29.124  1.00 128.25 ? 412 LEU A CG    1 
ATOM   2904  C  CD1   . LEU A  1 412 ? -24.801 9.448    30.577  1.00 121.63 ? 412 LEU A CD1   1 
ATOM   2905  C  CD2   . LEU A  1 412 ? -23.436 8.535    28.682  1.00 129.65 ? 412 LEU A CD2   1 
ATOM   2906  N  N     . ASP A  1 413 ? -27.650 5.521    28.098  1.00 137.12 ? 413 ASP A N     1 
ATOM   2907  C  CA    . ASP A  1 413 ? -28.845 4.744    28.435  1.00 137.57 ? 413 ASP A CA    1 
ATOM   2908  C  C     . ASP A  1 413 ? -29.712 5.391    29.515  1.00 133.05 ? 413 ASP A C     1 
ATOM   2909  O  O     . ASP A  1 413 ? -29.250 6.260    30.264  1.00 128.45 ? 413 ASP A O     1 
ATOM   2910  C  CB    . ASP A  1 413 ? -28.431 3.357    28.932  1.00 136.22 ? 413 ASP A CB    1 
ATOM   2911  C  CG    . ASP A  1 413 ? -28.421 2.320    27.840  1.00 142.82 ? 413 ASP A CG    1 
ATOM   2912  O  OD1   . ASP A  1 413 ? -27.935 2.614    26.729  1.00 147.75 ? 413 ASP A OD1   1 
ATOM   2913  O  OD2   . ASP A  1 413 ? -28.895 1.197    28.104  1.00 144.00 ? 413 ASP A OD2   1 
ATOM   2914  N  N     . ALA A  1 414 ? -30.967 4.946    29.594  1.00 134.71 ? 414 ALA A N     1 
ATOM   2915  C  CA    . ALA A  1 414 ? -31.835 5.258    30.727  1.00 130.67 ? 414 ALA A CA    1 
ATOM   2916  C  C     . ALA A  1 414 ? -31.384 4.443    31.939  1.00 125.45 ? 414 ALA A C     1 
ATOM   2917  O  O     . ALA A  1 414 ? -31.697 4.780    33.087  1.00 120.91 ? 414 ALA A O     1 
ATOM   2918  C  CB    . ALA A  1 414 ? -33.285 4.959    30.393  1.00 134.84 ? 414 ALA A CB    1 
ATOM   2919  N  N     . SER A  1 415 ? -30.648 3.368    31.665  1.00 126.63 ? 415 SER A N     1 
ATOM   2920  C  CA    . SER A  1 415 ? -30.044 2.532    32.695  1.00 122.36 ? 415 SER A CA    1 
ATOM   2921  C  C     . SER A  1 415 ? -28.828 3.214    33.334  1.00 117.39 ? 415 SER A C     1 
ATOM   2922  O  O     . SER A  1 415 ? -28.756 3.354    34.558  1.00 112.25 ? 415 SER A O     1 
ATOM   2923  C  CB    . SER A  1 415 ? -29.650 1.175    32.099  1.00 126.28 ? 415 SER A CB    1 
ATOM   2924  O  OG    . SER A  1 415 ? -28.881 0.412    33.010  1.00 122.88 ? 415 SER A OG    1 
ATOM   2925  N  N     . THR A  1 416 ? -27.889 3.648    32.497  1.00 119.25 ? 416 THR A N     1 
ATOM   2926  C  CA    . THR A  1 416 ? -26.600 4.164    32.969  1.00 115.61 ? 416 THR A CA    1 
ATOM   2927  C  C     . THR A  1 416 ? -26.641 5.610    33.487  1.00 112.20 ? 416 THR A C     1 
ATOM   2928  O  O     . THR A  1 416 ? -25.701 6.061    34.147  1.00 108.65 ? 416 THR A O     1 
ATOM   2929  C  CB    . THR A  1 416 ? -25.508 4.042    31.881  1.00 119.37 ? 416 THR A CB    1 
ATOM   2930  O  OG1   . THR A  1 416 ? -25.935 4.728    30.700  1.00 124.25 ? 416 THR A OG1   1 
ATOM   2931  C  CG2   . THR A  1 416 ? -25.224 2.576    31.551  1.00 122.27 ? 416 THR A CG2   1 
ATOM   2932  N  N     . LYS A  1 417 ? -27.718 6.330    33.184  1.00 113.64 ? 417 LYS A N     1 
ATOM   2933  C  CA    . LYS A  1 417 ? -27.879 7.705    33.649  1.00 110.97 ? 417 LYS A CA    1 
ATOM   2934  C  C     . LYS A  1 417 ? -28.579 7.717    34.996  1.00 106.22 ? 417 LYS A C     1 
ATOM   2935  O  O     . LYS A  1 417 ? -28.318 8.580    35.829  1.00 102.63 ? 417 LYS A O     1 
ATOM   2936  C  CB    . LYS A  1 417 ? -28.689 8.508    32.644  1.00 115.86 ? 417 LYS A CB    1 
ATOM   2937  C  CG    . LYS A  1 417 ? -28.429 10.005   32.673  1.00 115.72 ? 417 LYS A CG    1 
ATOM   2938  C  CD    . LYS A  1 417 ? -29.321 10.724   31.659  1.00 121.73 ? 417 LYS A CD    1 
ATOM   2939  C  CE    . LYS A  1 417 ? -29.061 10.251   30.227  1.00 127.63 ? 417 LYS A CE    1 
ATOM   2940  N  NZ    . LYS A  1 417 ? -29.988 10.886   29.244  1.00 134.28 ? 417 LYS A NZ    1 
ATOM   2941  N  N     . GLN A  1 418 ? -29.484 6.762    35.189  1.00 106.57 ? 418 GLN A N     1 
ATOM   2942  C  CA    . GLN A  1 418 ? -30.154 6.558    36.468  1.00 102.45 ? 418 GLN A CA    1 
ATOM   2943  C  C     . GLN A  1 418 ? -29.136 6.166    37.532  1.00 97.44  ? 418 GLN A C     1 
ATOM   2944  O  O     . GLN A  1 418 ? -29.149 6.702    38.643  1.00 93.58  ? 418 GLN A O     1 
ATOM   2945  C  CB    . GLN A  1 418 ? -31.233 5.483    36.329  1.00 105.17 ? 418 GLN A CB    1 
ATOM   2946  C  CG    . GLN A  1 418 ? -31.739 4.898    37.644  1.00 102.13 ? 418 GLN A CG    1 
ATOM   2947  C  CD    . GLN A  1 418 ? -32.339 5.937    38.574  1.00 99.33  ? 418 GLN A CD    1 
ATOM   2948  O  OE1   . GLN A  1 418 ? -32.985 6.895    38.136  1.00 101.27 ? 418 GLN A OE1   1 
ATOM   2949  N  NE2   . GLN A  1 418 ? -32.126 5.748    39.870  1.00 94.95  ? 418 GLN A NE2   1 
ATOM   2950  N  N     . THR A  1 419 ? -28.260 5.228    37.177  1.00 97.81  ? 419 THR A N     1 
ATOM   2951  C  CA    . THR A  1 419 ? -27.085 4.911    37.975  1.00 93.54  ? 419 THR A CA    1 
ATOM   2952  C  C     . THR A  1 419 ? -26.351 6.204    38.320  1.00 90.49  ? 419 THR A C     1 
ATOM   2953  O  O     . THR A  1 419 ? -26.081 6.472    39.482  1.00 86.53  ? 419 THR A O     1 
ATOM   2954  C  CB    . THR A  1 419 ? -26.152 3.919    37.242  1.00 96.21  ? 419 THR A CB    1 
ATOM   2955  O  OG1   . THR A  1 419 ? -26.777 2.634    37.175  1.00 98.27  ? 419 THR A OG1   1 
ATOM   2956  C  CG2   . THR A  1 419 ? -24.828 3.770    37.968  1.00 93.43  ? 419 THR A CG2   1 
ATOM   2957  N  N     . LEU A  1 420 ? -26.070 7.022    37.311  1.00 92.67  ? 420 LEU A N     1 
ATOM   2958  C  CA    . LEU A  1 420 ? -25.361 8.283    37.523  1.00 90.66  ? 420 LEU A CA    1 
ATOM   2959  C  C     . LEU A  1 420 ? -26.079 9.250    38.466  1.00 87.87  ? 420 LEU A C     1 
ATOM   2960  O  O     . LEU A  1 420 ? -25.463 9.775    39.391  1.00 84.71  ? 420 LEU A O     1 
ATOM   2961  C  CB    . LEU A  1 420 ? -25.040 8.959    36.189  1.00 94.69  ? 420 LEU A CB    1 
ATOM   2962  C  CG    . LEU A  1 420 ? -23.678 8.586    35.610  1.00 95.51  ? 420 LEU A CG    1 
ATOM   2963  C  CD1   . LEU A  1 420 ? -23.677 8.700    34.105  1.00 100.93 ? 420 LEU A CD1   1 
ATOM   2964  C  CD2   . LEU A  1 420 ? -22.601 9.466    36.216  1.00 93.15  ? 420 LEU A CD2   1 
ATOM   2965  N  N     . VAL A  1 421 ? -27.374 9.462    38.239  1.00 89.48  ? 421 VAL A N     1 
ATOM   2966  C  CA    . VAL A  1 421 ? -28.179 10.398   39.032  1.00 87.70  ? 421 VAL A CA    1 
ATOM   2967  C  C     . VAL A  1 421 ? -28.213 10.019   40.517  1.00 83.39  ? 421 VAL A C     1 
ATOM   2968  O  O     . VAL A  1 421 ? -27.970 10.860   41.386  1.00 80.76  ? 421 VAL A O     1 
ATOM   2969  C  CB    . VAL A  1 421 ? -29.623 10.536   38.458  1.00 90.94  ? 421 VAL A CB    1 
ATOM   2970  C  CG1   . VAL A  1 421 ? -30.540 11.269   39.427  1.00 88.90  ? 421 VAL A CG1   1 
ATOM   2971  C  CG2   . VAL A  1 421 ? -29.592 11.262   37.128  1.00 95.36  ? 421 VAL A CG2   1 
ATOM   2972  N  N     . ARG A  1 422 ? -28.501 8.750    40.787  1.00 83.14  ? 422 ARG A N     1 
ATOM   2973  C  CA    . ARG A  1 422 ? -28.594 8.228    42.148  1.00 80.07  ? 422 ARG A CA    1 
ATOM   2974  C  C     . ARG A  1 422 ? -27.253 8.299    42.899  1.00 77.43  ? 422 ARG A C     1 
ATOM   2975  O  O     . ARG A  1 422 ? -27.182 8.839    44.009  1.00 74.77  ? 422 ARG A O     1 
ATOM   2976  C  CB    . ARG A  1 422 ? -29.123 6.791    42.110  1.00 81.06  ? 422 ARG A CB    1 
ATOM   2977  C  CG    . ARG A  1 422 ? -29.317 6.140    43.462  1.00 78.05  ? 422 ARG A CG    1 
ATOM   2978  C  CD    . ARG A  1 422 ? -30.527 6.716    44.192  1.00 77.68  ? 422 ARG A CD    1 
ATOM   2979  N  NE    . ARG A  1 422 ? -31.734 6.708    43.365  1.00 80.60  ? 422 ARG A NE    1 
ATOM   2980  C  CZ    . ARG A  1 422 ? -32.466 5.629    43.100  1.00 82.46  ? 422 ARG A CZ    1 
ATOM   2981  N  NH1   . ARG A  1 422 ? -32.132 4.444    43.586  1.00 81.23  ? 422 ARG A NH1   1 
ATOM   2982  N  NH2   . ARG A  1 422 ? -33.543 5.737    42.343  1.00 86.89  ? 422 ARG A NH2   1 
ATOM   2983  N  N     . GLY A  1 423 ? -26.205 7.753    42.282  1.00 78.69  ? 423 GLY A N     1 
ATOM   2984  C  CA    . GLY A  1 423 ? -24.854 7.798    42.822  1.00 77.23  ? 423 GLY A CA    1 
ATOM   2985  C  C     . GLY A  1 423 ? -24.407 9.197    43.205  1.00 76.45  ? 423 GLY A C     1 
ATOM   2986  O  O     . GLY A  1 423 ? -24.074 9.450    44.364  1.00 73.98  ? 423 GLY A O     1 
ATOM   2987  N  N     . GLU A  1 424 ? -24.414 10.111   42.238  1.00 79.16  ? 424 GLU A N     1 
ATOM   2988  C  CA    . GLU A  1 424 ? -24.083 11.509   42.499  1.00 79.24  ? 424 GLU A CA    1 
ATOM   2989  C  C     . GLU A  1 424 ? -24.708 12.004   43.796  1.00 76.71  ? 424 GLU A C     1 
ATOM   2990  O  O     . GLU A  1 424 ? -24.065 12.685   44.575  1.00 75.30  ? 424 GLU A O     1 
ATOM   2991  C  CB    . GLU A  1 424 ? -24.505 12.399   41.330  1.00 82.82  ? 424 GLU A CB    1 
ATOM   2992  C  CG    . GLU A  1 424 ? -23.575 12.320   40.124  1.00 87.08  ? 424 GLU A CG    1 
ATOM   2993  C  CD    . GLU A  1 424 ? -24.034 13.177   38.944  1.00 94.02  ? 424 GLU A CD    1 
ATOM   2994  O  OE1   . GLU A  1 424 ? -25.264 13.241   38.656  1.00 96.26  ? 424 GLU A OE1   1 
ATOM   2995  O  OE2   . GLU A  1 424 ? -23.149 13.781   38.289  1.00 96.86  ? 424 GLU A OE2   1 
ATOM   2996  N  N     . ARG A  1 425 ? -25.953 11.624   44.041  1.00 77.17  ? 425 ARG A N     1 
ATOM   2997  C  CA    . ARG A  1 425 ? -26.680 12.088   45.223  1.00 75.74  ? 425 ARG A CA    1 
ATOM   2998  C  C     . ARG A  1 425 ? -26.275 11.411   46.533  1.00 72.81  ? 425 ARG A C     1 
ATOM   2999  O  O     . ARG A  1 425 ? -26.065 12.085   47.539  1.00 71.29  ? 425 ARG A O     1 
ATOM   3000  C  CB    . ARG A  1 425 ? -28.186 12.009   44.982  1.00 77.28  ? 425 ARG A CB    1 
ATOM   3001  C  CG    . ARG A  1 425 ? -28.705 13.237   44.263  1.00 80.18  ? 425 ARG A CG    1 
ATOM   3002  C  CD    . ARG A  1 425 ? -29.789 12.915   43.279  1.00 83.42  ? 425 ARG A CD    1 
ATOM   3003  N  NE    . ARG A  1 425 ? -30.110 14.085   42.475  1.00 87.64  ? 425 ARG A NE    1 
ATOM   3004  C  CZ    . ARG A  1 425 ? -29.470 14.435   41.362  1.00 90.71  ? 425 ARG A CZ    1 
ATOM   3005  N  NH1   . ARG A  1 425 ? -28.464 13.700   40.907  1.00 90.67  ? 425 ARG A NH1   1 
ATOM   3006  N  NH2   . ARG A  1 425 ? -29.842 15.523   40.698  1.00 94.09  ? 425 ARG A NH2   1 
ATOM   3007  N  N     . LEU A  1 426 ? -26.167 10.087   46.517  1.00 72.54  ? 426 LEU A N     1 
ATOM   3008  C  CA    . LEU A  1 426 ? -25.680 9.352    47.672  1.00 70.42  ? 426 LEU A CA    1 
ATOM   3009  C  C     . LEU A  1 426 ? -24.264 9.818    48.041  1.00 69.91  ? 426 LEU A C     1 
ATOM   3010  O  O     . LEU A  1 426 ? -23.955 10.024   49.214  1.00 68.54  ? 426 LEU A O     1 
ATOM   3011  C  CB    . LEU A  1 426 ? -25.690 7.854    47.389  1.00 70.88  ? 426 LEU A CB    1 
ATOM   3012  C  CG    . LEU A  1 426 ? -27.041 7.185    47.154  1.00 71.84  ? 426 LEU A CG    1 
ATOM   3013  C  CD1   . LEU A  1 426 ? -26.847 5.880    46.409  1.00 72.77  ? 426 LEU A CD1   1 
ATOM   3014  C  CD2   . LEU A  1 426 ? -27.786 6.966    48.462  1.00 69.41  ? 426 LEU A CD2   1 
ATOM   3015  N  N     . THR A  1 427 ? -23.405 10.001   47.041  1.00 71.56  ? 427 THR A N     1 
ATOM   3016  C  CA    . THR A  1 427 ? -22.077 10.558   47.285  1.00 71.33  ? 427 THR A CA    1 
ATOM   3017  C  C     . THR A  1 427 ? -22.179 11.897   48.021  1.00 70.79  ? 427 THR A C     1 
ATOM   3018  O  O     . THR A  1 427 ? -21.376 12.181   48.916  1.00 69.97  ? 427 THR A O     1 
ATOM   3019  C  CB    . THR A  1 427 ? -21.277 10.722   45.973  1.00 73.76  ? 427 THR A CB    1 
ATOM   3020  O  OG1   . THR A  1 427 ? -21.131 9.442    45.347  1.00 75.07  ? 427 THR A OG1   1 
ATOM   3021  C  CG2   . THR A  1 427 ? -19.891 11.325   46.231  1.00 73.43  ? 427 THR A CG2   1 
ATOM   3022  N  N     . GLN A  1 428 ? -23.181 12.698   47.653  1.00 71.76  ? 428 GLN A N     1 
ATOM   3023  C  CA    . GLN A  1 428 ? -23.371 14.025   48.230  1.00 71.68  ? 428 GLN A CA    1 
ATOM   3024  C  C     . GLN A  1 428 ? -23.962 13.924   49.638  1.00 69.58  ? 428 GLN A C     1 
ATOM   3025  O  O     . GLN A  1 428 ? -23.492 14.603   50.546  1.00 69.31  ? 428 GLN A O     1 
ATOM   3026  C  CB    . GLN A  1 428 ? -24.220 14.899   47.297  1.00 74.19  ? 428 GLN A CB    1 
ATOM   3027  C  CG    . GLN A  1 428 ? -24.443 16.337   47.750  1.00 75.90  ? 428 GLN A CG    1 
ATOM   3028  C  CD    . GLN A  1 428 ? -23.232 17.231   47.579  1.00 78.99  ? 428 GLN A CD    1 
ATOM   3029  O  OE1   . GLN A  1 428 ? -22.350 16.967   46.755  1.00 80.01  ? 428 GLN A OE1   1 
ATOM   3030  N  NE2   . GLN A  1 428 ? -23.186 18.309   48.360  1.00 80.03  ? 428 GLN A NE2   1 
ATOM   3031  N  N     . LEU A  1 429 ? -24.973 13.068   49.810  1.00 68.72  ? 429 LEU A N     1 
ATOM   3032  C  CA    . LEU A  1 429 ? -25.535 12.718   51.124  1.00 66.91  ? 429 LEU A CA    1 
ATOM   3033  C  C     . LEU A  1 429 ? -24.464 12.406   52.151  1.00 65.15  ? 429 LEU A C     1 
ATOM   3034  O  O     . LEU A  1 429 ? -24.587 12.778   53.320  1.00 64.92  ? 429 LEU A O     1 
ATOM   3035  C  CB    . LEU A  1 429 ? -26.354 11.446   51.008  1.00 66.81  ? 429 LEU A CB    1 
ATOM   3036  C  CG    . LEU A  1 429 ? -27.851 11.384   51.207  1.00 69.12  ? 429 LEU A CG    1 
ATOM   3037  C  CD1   . LEU A  1 429 ? -28.223 9.915    51.204  1.00 69.57  ? 429 LEU A CD1   1 
ATOM   3038  C  CD2   . LEU A  1 429 ? -28.289 12.061   52.511  1.00 70.62  ? 429 LEU A CD2   1 
ATOM   3039  N  N     . LEU A  1 430 ? -23.426 11.693   51.704  1.00 64.15  ? 430 LEU A N     1 
ATOM   3040  C  CA    . LEU A  1 430 ? -22.427 11.121   52.589  1.00 61.90  ? 430 LEU A CA    1 
ATOM   3041  C  C     . LEU A  1 430 ? -21.352 12.108   52.996  1.00 61.90  ? 430 LEU A C     1 
ATOM   3042  O  O     . LEU A  1 430 ? -20.500 11.779   53.834  1.00 61.09  ? 430 LEU A O     1 
ATOM   3043  C  CB    . LEU A  1 430 ? -21.803 9.891    51.948  1.00 61.87  ? 430 LEU A CB    1 
ATOM   3044  C  CG    . LEU A  1 430 ? -22.750 8.715    51.725  1.00 61.54  ? 430 LEU A CG    1 
ATOM   3045  C  CD1   . LEU A  1 430 ? -21.960 7.498    51.247  1.00 61.12  ? 430 LEU A CD1   1 
ATOM   3046  C  CD2   . LEU A  1 430 ? -23.592 8.402    52.981  1.00 59.17  ? 430 LEU A CD2   1 
ATOM   3047  N  N     . LYS A  1 431 ? -21.397 13.313   52.410  1.00 62.82  ? 431 LYS A N     1 
ATOM   3048  C  CA    . LYS A  1 431 ? -20.530 14.419   52.837  1.00 63.54  ? 431 LYS A CA    1 
ATOM   3049  C  C     . LYS A  1 431 ? -20.977 14.804   54.218  1.00 62.64  ? 431 LYS A C     1 
ATOM   3050  O  O     . LYS A  1 431 ? -22.125 14.552   54.580  1.00 62.24  ? 431 LYS A O     1 
ATOM   3051  C  CB    . LYS A  1 431 ? -20.645 15.641   51.927  1.00 65.65  ? 431 LYS A CB    1 
ATOM   3052  C  CG    . LYS A  1 431 ? -20.098 15.480   50.530  1.00 67.86  ? 431 LYS A CG    1 
ATOM   3053  C  CD    . LYS A  1 431 ? -20.120 16.801   49.793  1.00 72.31  ? 431 LYS A CD    1 
ATOM   3054  C  CE    . LYS A  1 431 ? -19.647 16.633   48.355  1.00 76.07  ? 431 LYS A CE    1 
ATOM   3055  N  NZ    . LYS A  1 431 ? -19.495 17.942   47.637  1.00 80.91  ? 431 LYS A NZ    1 
ATOM   3056  N  N     . GLN A  1 432 ? -20.084 15.415   54.982  1.00 62.81  ? 432 GLN A N     1 
ATOM   3057  C  CA    . GLN A  1 432 ? -20.369 15.770   56.361  1.00 62.73  ? 432 GLN A CA    1 
ATOM   3058  C  C     . GLN A  1 432 ? -19.396 16.861   56.812  1.00 64.63  ? 432 GLN A C     1 
ATOM   3059  O  O     . GLN A  1 432 ? -18.262 16.962   56.313  1.00 65.44  ? 432 GLN A O     1 
ATOM   3060  C  CB    . GLN A  1 432 ? -20.228 14.525   57.232  1.00 61.39  ? 432 GLN A CB    1 
ATOM   3061  C  CG    . GLN A  1 432 ? -20.903 14.578   58.585  1.00 62.41  ? 432 GLN A CG    1 
ATOM   3062  C  CD    . GLN A  1 432 ? -21.291 13.188   59.101  1.00 62.62  ? 432 GLN A CD    1 
ATOM   3063  O  OE1   . GLN A  1 432 ? -21.025 12.172   58.452  1.00 62.89  ? 432 GLN A OE1   1 
ATOM   3064  N  NE2   . GLN A  1 432 ? -21.930 13.144   60.271  1.00 62.68  ? 432 GLN A NE2   1 
ATOM   3065  N  N     . ASN A  1 433 ? -19.830 17.691   57.748  1.00 65.39  ? 433 ASN A N     1 
ATOM   3066  C  CA    . ASN A  1 433 ? -18.924 18.672   58.302  1.00 67.38  ? 433 ASN A CA    1 
ATOM   3067  C  C     . ASN A  1 433 ? -18.147 18.071   59.439  1.00 67.13  ? 433 ASN A C     1 
ATOM   3068  O  O     . ASN A  1 433 ? -18.579 17.107   60.046  1.00 66.16  ? 433 ASN A O     1 
ATOM   3069  C  CB    . ASN A  1 433 ? -19.684 19.895   58.778  1.00 69.56  ? 433 ASN A CB    1 
ATOM   3070  C  CG    . ASN A  1 433 ? -20.377 20.611   57.654  1.00 70.07  ? 433 ASN A CG    1 
ATOM   3071  O  OD1   . ASN A  1 433 ? -19.833 20.762   56.561  1.00 70.11  ? 433 ASN A OD1   1 
ATOM   3072  N  ND2   . ASN A  1 433 ? -21.593 21.046   57.911  1.00 71.64  ? 433 ASN A ND2   1 
ATOM   3073  N  N     . GLN A  1 434 ? -16.987 18.635   59.728  1.00 69.18  ? 434 GLN A N     1 
ATOM   3074  C  CA    . GLN A  1 434 ? -16.210 18.165   60.861  1.00 69.69  ? 434 GLN A CA    1 
ATOM   3075  C  C     . GLN A  1 434 ? -16.959 18.451   62.172  1.00 70.10  ? 434 GLN A C     1 
ATOM   3076  O  O     . GLN A  1 434 ? -17.829 19.327   62.220  1.00 70.56  ? 434 GLN A O     1 
ATOM   3077  C  CB    . GLN A  1 434 ? -14.806 18.776   60.871  1.00 72.00  ? 434 GLN A CB    1 
ATOM   3078  C  CG    . GLN A  1 434 ? -13.854 17.920   61.648  1.00 73.74  ? 434 GLN A CG    1 
ATOM   3079  C  CD    . GLN A  1 434 ? -12.423 18.414   61.649  1.00 78.50  ? 434 GLN A CD    1 
ATOM   3080  O  OE1   . GLN A  1 434 ? -12.012 19.219   60.809  1.00 80.58  ? 434 GLN A OE1   1 
ATOM   3081  N  NE2   . GLN A  1 434 ? -11.646 17.918   62.604  1.00 79.87  ? 434 GLN A NE2   1 
ATOM   3082  N  N     . TYR A  1 435 ? -16.624 17.681   63.208  1.00 69.68  ? 435 TYR A N     1 
ATOM   3083  C  CA    . TYR A  1 435 ? -17.149 17.854   64.572  1.00 70.60  ? 435 TYR A CA    1 
ATOM   3084  C  C     . TYR A  1 435 ? -18.669 17.773   64.700  1.00 69.01  ? 435 TYR A C     1 
ATOM   3085  O  O     . TYR A  1 435 ? -19.239 18.300   65.657  1.00 70.72  ? 435 TYR A O     1 
ATOM   3086  C  CB    . TYR A  1 435 ? -16.663 19.162   65.217  1.00 74.07  ? 435 TYR A CB    1 
ATOM   3087  C  CG    . TYR A  1 435 ? -15.238 19.546   64.928  1.00 75.14  ? 435 TYR A CG    1 
ATOM   3088  C  CD1   . TYR A  1 435 ? -14.176 18.873   65.517  1.00 76.28  ? 435 TYR A CD1   1 
ATOM   3089  C  CD2   . TYR A  1 435 ? -14.956 20.612   64.088  1.00 76.19  ? 435 TYR A CD2   1 
ATOM   3090  C  CE1   . TYR A  1 435 ? -12.855 19.248   65.251  1.00 78.21  ? 435 TYR A CE1   1 
ATOM   3091  C  CE2   . TYR A  1 435 ? -13.665 20.994   63.823  1.00 78.34  ? 435 TYR A CE2   1 
ATOM   3092  C  CZ    . TYR A  1 435 ? -12.616 20.315   64.403  1.00 79.13  ? 435 TYR A CZ    1 
ATOM   3093  O  OH    . TYR A  1 435 ? -11.335 20.711   64.110  1.00 81.22  ? 435 TYR A OH    1 
ATOM   3094  N  N     . SER A  1 436 ? -19.317 17.105   63.755  1.00 66.20  ? 436 SER A N     1 
ATOM   3095  C  CA    . SER A  1 436 ? -20.779 17.008   63.771  1.00 65.15  ? 436 SER A CA    1 
ATOM   3096  C  C     . SER A  1 436 ? -21.291 15.605   63.416  1.00 62.80  ? 436 SER A C     1 
ATOM   3097  O  O     . SER A  1 436 ? -21.938 15.407   62.380  1.00 60.96  ? 436 SER A O     1 
ATOM   3098  C  CB    . SER A  1 436 ? -21.403 18.103   62.895  1.00 65.65  ? 436 SER A CB    1 
ATOM   3099  O  OG    . SER A  1 436 ? -20.522 18.513   61.862  1.00 64.74  ? 436 SER A OG    1 
ATOM   3100  N  N     . PRO A  1 437 ? -20.990 14.619   64.281  1.00 63.08  ? 437 PRO A N     1 
ATOM   3101  C  CA    . PRO A  1 437 ? -21.443 13.266   64.000  1.00 61.75  ? 437 PRO A CA    1 
ATOM   3102  C  C     . PRO A  1 437 ? -22.932 13.131   64.291  1.00 62.06  ? 437 PRO A C     1 
ATOM   3103  O  O     . PRO A  1 437 ? -23.429 13.733   65.240  1.00 63.68  ? 437 PRO A O     1 
ATOM   3104  C  CB    . PRO A  1 437 ? -20.602 12.404   64.947  1.00 62.35  ? 437 PRO A CB    1 
ATOM   3105  C  CG    . PRO A  1 437 ? -20.246 13.294   66.061  1.00 64.56  ? 437 PRO A CG    1 
ATOM   3106  C  CD    . PRO A  1 437 ? -20.257 14.706   65.558  1.00 65.03  ? 437 PRO A CD    1 
ATOM   3107  N  N     . LEU A  1 438 ? -23.620 12.349   63.463  1.00 61.08  ? 438 LEU A N     1 
ATOM   3108  C  CA    . LEU A  1 438 ? -25.060 12.213   63.516  1.00 61.59  ? 438 LEU A CA    1 
ATOM   3109  C  C     . LEU A  1 438 ? -25.489 10.970   64.259  1.00 62.02  ? 438 LEU A C     1 
ATOM   3110  O  O     . LEU A  1 438 ? -24.840 9.944    64.201  1.00 60.92  ? 438 LEU A O     1 
ATOM   3111  C  CB    . LEU A  1 438 ? -25.625 12.151   62.097  1.00 60.78  ? 438 LEU A CB    1 
ATOM   3112  C  CG    . LEU A  1 438 ? -25.515 13.390   61.202  1.00 61.82  ? 438 LEU A CG    1 
ATOM   3113  C  CD1   . LEU A  1 438 ? -25.459 12.959   59.763  1.00 61.99  ? 438 LEU A CD1   1 
ATOM   3114  C  CD2   . LEU A  1 438 ? -26.656 14.365   61.408  1.00 63.43  ? 438 LEU A CD2   1 
ATOM   3115  N  N     . ALA A  1 439 ? -26.620 11.073   64.942  1.00 64.41  ? 439 ALA A N     1 
ATOM   3116  C  CA    . ALA A  1 439 ? -27.274 9.910    65.535  1.00 66.08  ? 439 ALA A CA    1 
ATOM   3117  C  C     . ALA A  1 439 ? -27.810 8.919    64.484  1.00 65.70  ? 439 ALA A C     1 
ATOM   3118  O  O     . ALA A  1 439 ? -28.142 9.278    63.349  1.00 64.81  ? 439 ALA A O     1 
ATOM   3119  C  CB    . ALA A  1 439 ? -28.386 10.352   66.459  1.00 67.84  ? 439 ALA A CB    1 
ATOM   3120  N  N     . THR A  1 440 ? -27.884 7.661    64.890  1.00 67.14  ? 440 THR A N     1 
ATOM   3121  C  CA    . THR A  1 440 ? -28.375 6.582    64.044  1.00 67.77  ? 440 THR A CA    1 
ATOM   3122  C  C     . THR A  1 440 ? -29.789 6.833    63.516  1.00 68.61  ? 440 THR A C     1 
ATOM   3123  O  O     . THR A  1 440 ? -30.100 6.482    62.383  1.00 68.12  ? 440 THR A O     1 
ATOM   3124  C  CB    . THR A  1 440 ? -28.346 5.270    64.827  1.00 69.10  ? 440 THR A CB    1 
ATOM   3125  O  OG1   . THR A  1 440 ? -27.139 5.224    65.599  1.00 69.68  ? 440 THR A OG1   1 
ATOM   3126  C  CG2   . THR A  1 440 ? -28.376 4.095    63.885  1.00 69.61  ? 440 THR A CG2   1 
ATOM   3127  N  N     . GLU A  1 441 ? -30.635 7.448    64.337  1.00 70.55  ? 441 GLU A N     1 
ATOM   3128  C  CA    . GLU A  1 441 ? -32.000 7.757    63.934  1.00 72.30  ? 441 GLU A CA    1 
ATOM   3129  C  C     . GLU A  1 441 ? -32.064 8.975    63.007  1.00 71.94  ? 441 GLU A C     1 
ATOM   3130  O  O     . GLU A  1 441 ? -33.102 9.257    62.411  1.00 72.96  ? 441 GLU A O     1 
ATOM   3131  C  CB    . GLU A  1 441 ? -32.900 7.947    65.159  1.00 74.73  ? 441 GLU A CB    1 
ATOM   3132  C  CG    . GLU A  1 441 ? -32.625 9.210    65.980  1.00 76.65  ? 441 GLU A CG    1 
ATOM   3133  C  CD    . GLU A  1 441 ? -31.508 9.038    67.006  1.00 78.20  ? 441 GLU A CD    1 
ATOM   3134  O  OE1   . GLU A  1 441 ? -30.769 8.025    66.957  1.00 76.33  ? 441 GLU A OE1   1 
ATOM   3135  O  OE2   . GLU A  1 441 ? -31.378 9.936    67.871  1.00 80.78  ? 441 GLU A OE2   1 
ATOM   3136  N  N     . GLU A  1 442 ? -30.955 9.698    62.905  1.00 71.00  ? 442 GLU A N     1 
ATOM   3137  C  CA    . GLU A  1 442 ? -30.824 10.774   61.939  1.00 70.75  ? 442 GLU A CA    1 
ATOM   3138  C  C     . GLU A  1 442 ? -30.191 10.259   60.651  1.00 69.06  ? 442 GLU A C     1 
ATOM   3139  O  O     . GLU A  1 442 ? -30.403 10.819   59.587  1.00 69.21  ? 442 GLU A O     1 
ATOM   3140  C  CB    . GLU A  1 442 ? -29.985 11.908   62.522  1.00 71.32  ? 442 GLU A CB    1 
ATOM   3141  C  CG    . GLU A  1 442 ? -30.750 12.812   63.478  1.00 74.95  ? 442 GLU A CG    1 
ATOM   3142  C  CD    . GLU A  1 442 ? -29.839 13.651   64.375  1.00 77.86  ? 442 GLU A CD    1 
ATOM   3143  O  OE1   . GLU A  1 442 ? -28.613 13.376   64.444  1.00 76.81  ? 442 GLU A OE1   1 
ATOM   3144  O  OE2   . GLU A  1 442 ? -30.366 14.582   65.029  1.00 80.87  ? 442 GLU A OE2   1 
ATOM   3145  N  N     . GLN A  1 443 ? -29.410 9.191    60.745  1.00 67.96  ? 443 GLN A N     1 
ATOM   3146  C  CA    . GLN A  1 443 ? -28.773 8.625    59.560  1.00 66.68  ? 443 GLN A CA    1 
ATOM   3147  C  C     . GLN A  1 443 ? -29.746 7.804    58.714  1.00 67.11  ? 443 GLN A C     1 
ATOM   3148  O  O     . GLN A  1 443 ? -29.814 8.011    57.497  1.00 67.35  ? 443 GLN A O     1 
ATOM   3149  C  CB    . GLN A  1 443 ? -27.537 7.793    59.917  1.00 65.98  ? 443 GLN A CB    1 
ATOM   3150  C  CG    . GLN A  1 443 ? -26.400 8.576    60.534  1.00 65.76  ? 443 GLN A CG    1 
ATOM   3151  C  CD    . GLN A  1 443 ? -25.236 7.686    60.926  1.00 66.34  ? 443 GLN A CD    1 
ATOM   3152  O  OE1   . GLN A  1 443 ? -24.945 6.703    60.251  1.00 66.99  ? 443 GLN A OE1   1 
ATOM   3153  N  NE2   . GLN A  1 443 ? -24.562 8.030    62.014  1.00 66.32  ? 443 GLN A NE2   1 
ATOM   3154  N  N     . VAL A  1 444 ? -30.501 6.889    59.337  1.00 67.53  ? 444 VAL A N     1 
ATOM   3155  C  CA    . VAL A  1 444 ? -31.323 5.961    58.538  1.00 68.20  ? 444 VAL A CA    1 
ATOM   3156  C  C     . VAL A  1 444 ? -32.320 6.690    57.655  1.00 68.83  ? 444 VAL A C     1 
ATOM   3157  O  O     . VAL A  1 444 ? -32.457 6.315    56.492  1.00 69.19  ? 444 VAL A O     1 
ATOM   3158  C  CB    . VAL A  1 444 ? -31.992 4.775    59.309  1.00 69.53  ? 444 VAL A CB    1 
ATOM   3159  C  CG1   . VAL A  1 444 ? -31.063 4.200    60.370  1.00 69.33  ? 444 VAL A CG1   1 
ATOM   3160  C  CG2   . VAL A  1 444 ? -33.320 5.159    59.906  1.00 70.91  ? 444 VAL A CG2   1 
ATOM   3161  N  N     . PRO A  1 445 ? -32.978 7.754    58.178  1.00 69.31  ? 445 PRO A N     1 
ATOM   3162  C  CA    . PRO A  1 445 ? -33.922 8.429    57.283  1.00 70.72  ? 445 PRO A CA    1 
ATOM   3163  C  C     . PRO A  1 445 ? -33.226 9.184    56.140  1.00 69.88  ? 445 PRO A C     1 
ATOM   3164  O  O     . PRO A  1 445 ? -33.768 9.237    55.031  1.00 71.49  ? 445 PRO A O     1 
ATOM   3165  C  CB    . PRO A  1 445 ? -34.724 9.356    58.207  1.00 71.60  ? 445 PRO A CB    1 
ATOM   3166  C  CG    . PRO A  1 445 ? -33.909 9.523    59.404  1.00 70.54  ? 445 PRO A CG    1 
ATOM   3167  C  CD    . PRO A  1 445 ? -32.916 8.403    59.501  1.00 69.22  ? 445 PRO A CD    1 
ATOM   3168  N  N     . LEU A  1 446 ? -32.035 9.722    56.378  1.00 67.70  ? 446 LEU A N     1 
ATOM   3169  C  CA    . LEU A  1 446 ? -31.285 10.320   55.273  1.00 67.45  ? 446 LEU A CA    1 
ATOM   3170  C  C     . LEU A  1 446 ? -30.909 9.281    54.228  1.00 67.12  ? 446 LEU A C     1 
ATOM   3171  O  O     . LEU A  1 446 ? -30.910 9.578    53.030  1.00 68.05  ? 446 LEU A O     1 
ATOM   3172  C  CB    . LEU A  1 446 ? -30.022 11.043   55.746  1.00 66.17  ? 446 LEU A CB    1 
ATOM   3173  C  CG    . LEU A  1 446 ? -30.204 12.203   56.722  1.00 67.28  ? 446 LEU A CG    1 
ATOM   3174  C  CD1   . LEU A  1 446 ? -28.838 12.654   57.257  1.00 65.89  ? 446 LEU A CD1   1 
ATOM   3175  C  CD2   . LEU A  1 446 ? -31.026 13.350   56.109  1.00 68.44  ? 446 LEU A CD2   1 
ATOM   3176  N  N     . ILE A  1 447 ? -30.593 8.069    54.686  1.00 66.06  ? 447 ILE A N     1 
ATOM   3177  C  CA    . ILE A  1 447 ? -30.104 7.014    53.796  1.00 65.74  ? 447 ILE A CA    1 
ATOM   3178  C  C     . ILE A  1 447 ? -31.249 6.231    53.190  1.00 67.40  ? 447 ILE A C     1 
ATOM   3179  O  O     . ILE A  1 447 ? -31.119 5.692    52.096  1.00 68.25  ? 447 ILE A O     1 
ATOM   3180  C  CB    . ILE A  1 447 ? -29.036 6.123    54.488  1.00 64.79  ? 447 ILE A CB    1 
ATOM   3181  C  CG1   . ILE A  1 447 ? -27.737 6.923    54.603  1.00 63.24  ? 447 ILE A CG1   1 
ATOM   3182  C  CG2   . ILE A  1 447 ? -28.791 4.817    53.714  1.00 65.18  ? 447 ILE A CG2   1 
ATOM   3183  C  CD1   . ILE A  1 447 ? -26.684 6.281    55.444  1.00 64.24  ? 447 ILE A CD1   1 
ATOM   3184  N  N     . TYR A  1 448 ? -32.380 6.189    53.888  1.00 68.13  ? 448 TYR A N     1 
ATOM   3185  C  CA    . TYR A  1 448 ? -33.592 5.641    53.295  1.00 70.54  ? 448 TYR A CA    1 
ATOM   3186  C  C     . TYR A  1 448 ? -33.995 6.534    52.139  1.00 71.87  ? 448 TYR A C     1 
ATOM   3187  O  O     . TYR A  1 448 ? -34.373 6.046    51.077  1.00 73.89  ? 448 TYR A O     1 
ATOM   3188  C  CB    . TYR A  1 448 ? -34.739 5.545    54.305  1.00 71.49  ? 448 TYR A CB    1 
ATOM   3189  C  CG    . TYR A  1 448 ? -36.040 5.100    53.672  1.00 74.62  ? 448 TYR A CG    1 
ATOM   3190  C  CD1   . TYR A  1 448 ? -36.330 3.751    53.524  1.00 76.21  ? 448 TYR A CD1   1 
ATOM   3191  C  CD2   . TYR A  1 448 ? -36.975 6.033    53.207  1.00 75.85  ? 448 TYR A CD2   1 
ATOM   3192  C  CE1   . TYR A  1 448 ? -37.514 3.335    52.939  1.00 79.42  ? 448 TYR A CE1   1 
ATOM   3193  C  CE2   . TYR A  1 448 ? -38.155 5.630    52.618  1.00 78.88  ? 448 TYR A CE2   1 
ATOM   3194  C  CZ    . TYR A  1 448 ? -38.418 4.274    52.484  1.00 80.93  ? 448 TYR A CZ    1 
ATOM   3195  O  OH    . TYR A  1 448 ? -39.584 3.843    51.887  1.00 84.79  ? 448 TYR A OH    1 
ATOM   3196  N  N     . ALA A  1 449 ? -33.909 7.845    52.363  1.00 71.24  ? 449 ALA A N     1 
ATOM   3197  C  CA    . ALA A  1 449 ? -34.268 8.840    51.360  1.00 73.05  ? 449 ALA A CA    1 
ATOM   3198  C  C     . ALA A  1 449 ? -33.435 8.670    50.099  1.00 73.39  ? 449 ALA A C     1 
ATOM   3199  O  O     . ALA A  1 449 ? -33.981 8.542    49.005  1.00 75.91  ? 449 ALA A O     1 
ATOM   3200  C  CB    . ALA A  1 449 ? -34.114 10.245   51.923  1.00 72.43  ? 449 ALA A CB    1 
ATOM   3201  N  N     . GLY A  1 450 ? -32.115 8.655    50.266  1.00 71.54  ? 450 GLY A N     1 
ATOM   3202  C  CA    . GLY A  1 450 ? -31.176 8.467    49.163  1.00 72.06  ? 450 GLY A CA    1 
ATOM   3203  C  C     . GLY A  1 450 ? -31.424 7.167    48.426  1.00 74.08  ? 450 GLY A C     1 
ATOM   3204  O  O     . GLY A  1 450 ? -31.883 7.172    47.275  1.00 76.83  ? 450 GLY A O     1 
ATOM   3205  N  N     . VAL A  1 451 ? -31.149 6.057    49.112  1.00 73.20  ? 451 VAL A N     1 
ATOM   3206  C  CA    . VAL A  1 451 ? -31.218 4.709    48.541  1.00 74.88  ? 451 VAL A CA    1 
ATOM   3207  C  C     . VAL A  1 451 ? -32.492 4.458    47.737  1.00 78.26  ? 451 VAL A C     1 
ATOM   3208  O  O     . VAL A  1 451 ? -32.424 3.955    46.613  1.00 80.78  ? 451 VAL A O     1 
ATOM   3209  C  CB    . VAL A  1 451 ? -31.023 3.631    49.635  1.00 73.68  ? 451 VAL A CB    1 
ATOM   3210  C  CG1   . VAL A  1 451 ? -31.815 2.370    49.334  1.00 76.56  ? 451 VAL A CG1   1 
ATOM   3211  C  CG2   . VAL A  1 451 ? -29.558 3.316    49.792  1.00 71.80  ? 451 VAL A CG2   1 
ATOM   3212  N  N     . ASN A  1 452 ? -33.634 4.835    48.310  1.00 78.70  ? 452 ASN A N     1 
ATOM   3213  C  CA    . ASN A  1 452 ? -34.937 4.588    47.706  1.00 82.20  ? 452 ASN A CA    1 
ATOM   3214  C  C     . ASN A  1 452 ? -35.493 5.750    46.859  1.00 84.11  ? 452 ASN A C     1 
ATOM   3215  O  O     . ASN A  1 452 ? -36.698 6.025    46.874  1.00 86.37  ? 452 ASN A O     1 
ATOM   3216  C  CB    . ASN A  1 452 ? -35.934 4.151    48.782  1.00 82.58  ? 452 ASN A CB    1 
ATOM   3217  C  CG    . ASN A  1 452 ? -35.653 2.751    49.303  1.00 83.10  ? 452 ASN A CG    1 
ATOM   3218  O  OD1   . ASN A  1 452 ? -35.509 1.804    48.528  1.00 86.85  ? 452 ASN A OD1   1 
ATOM   3219  N  ND2   . ASN A  1 452 ? -35.579 2.613    50.620  1.00 80.80  ? 452 ASN A ND2   1 
ATOM   3220  N  N     . GLY A  1 453 ? -34.598 6.434    46.144  1.00 83.55  ? 453 GLY A N     1 
ATOM   3221  C  CA    . GLY A  1 453 ? -34.960 7.319    45.033  1.00 86.03  ? 453 GLY A CA    1 
ATOM   3222  C  C     . GLY A  1 453 ? -35.563 8.686    45.300  1.00 86.31  ? 453 GLY A C     1 
ATOM   3223  O  O     . GLY A  1 453 ? -35.747 9.464    44.367  1.00 88.78  ? 453 GLY A O     1 
ATOM   3224  N  N     . HIS A  1 454 ? -35.865 8.992    46.560  1.00 84.25  ? 454 HIS A N     1 
ATOM   3225  C  CA    . HIS A  1 454 ? -36.543 10.244   46.910  1.00 85.07  ? 454 HIS A CA    1 
ATOM   3226  C  C     . HIS A  1 454 ? -35.652 11.504   46.820  1.00 83.84  ? 454 HIS A C     1 
ATOM   3227  O  O     . HIS A  1 454 ? -36.030 12.572   47.306  1.00 84.42  ? 454 HIS A O     1 
ATOM   3228  C  CB    . HIS A  1 454 ? -37.185 10.141   48.305  1.00 83.91  ? 454 HIS A CB    1 
ATOM   3229  C  CG    . HIS A  1 454 ? -38.214 9.057    48.430  1.00 86.21  ? 454 HIS A CG    1 
ATOM   3230  N  ND1   . HIS A  1 454 ? -38.178 8.111    49.432  1.00 85.25  ? 454 HIS A ND1   1 
ATOM   3231  C  CD2   . HIS A  1 454 ? -39.306 8.770    47.684  1.00 90.69  ? 454 HIS A CD2   1 
ATOM   3232  C  CE1   . HIS A  1 454 ? -39.201 7.285    49.298  1.00 87.30  ? 454 HIS A CE1   1 
ATOM   3233  N  NE2   . HIS A  1 454 ? -39.900 7.662    48.243  1.00 91.46  ? 454 HIS A NE2   1 
ATOM   3234  N  N     . LEU A  1 455 ? -34.484 11.386   46.193  1.00 82.70  ? 455 LEU A N     1 
ATOM   3235  C  CA    . LEU A  1 455 ? -33.569 12.528   46.045  1.00 82.07  ? 455 LEU A CA    1 
ATOM   3236  C  C     . LEU A  1 455 ? -33.290 12.911   44.588  1.00 84.87  ? 455 LEU A C     1 
ATOM   3237  O  O     . LEU A  1 455 ? -32.775 13.994   44.307  1.00 85.47  ? 455 LEU A O     1 
ATOM   3238  C  CB    . LEU A  1 455 ? -32.242 12.254   46.758  1.00 78.26  ? 455 LEU A CB    1 
ATOM   3239  C  CG    . LEU A  1 455 ? -32.265 11.948   48.257  1.00 75.43  ? 455 LEU A CG    1 
ATOM   3240  C  CD1   . LEU A  1 455 ? -30.856 12.098   48.802  1.00 73.18  ? 455 LEU A CD1   1 
ATOM   3241  C  CD2   . LEU A  1 455 ? -33.221 12.835   49.039  1.00 75.10  ? 455 LEU A CD2   1 
ATOM   3242  N  N     . ASP A  1 456 ? -33.655 12.018   43.673  1.00 86.86  ? 456 ASP A N     1 
ATOM   3243  C  CA    . ASP A  1 456 ? -33.303 12.128   42.262  1.00 89.61  ? 456 ASP A CA    1 
ATOM   3244  C  C     . ASP A  1 456 ? -33.904 13.361   41.596  1.00 93.22  ? 456 ASP A C     1 
ATOM   3245  O  O     . ASP A  1 456 ? -33.467 13.771   40.520  1.00 95.72  ? 456 ASP A O     1 
ATOM   3246  C  CB    . ASP A  1 456 ? -33.706 10.845   41.529  1.00 91.46  ? 456 ASP A CB    1 
ATOM   3247  C  CG    . ASP A  1 456 ? -33.263 9.576    42.271  1.00 88.53  ? 456 ASP A CG    1 
ATOM   3248  O  OD1   . ASP A  1 456 ? -32.326 9.630    43.119  1.00 83.44  ? 456 ASP A OD1   1 
ATOM   3249  O  OD2   . ASP A  1 456 ? -33.868 8.517    42.000  1.00 89.96  ? 456 ASP A OD2   1 
ATOM   3250  N  N     . GLY A  1 457 ? -34.898 13.951   42.253  1.00 93.96  ? 457 GLY A N     1 
ATOM   3251  C  CA    . GLY A  1 457 ? -35.552 15.161   41.766  1.00 97.76  ? 457 GLY A CA    1 
ATOM   3252  C  C     . GLY A  1 457 ? -34.843 16.424   42.216  1.00 96.72  ? 457 GLY A C     1 
ATOM   3253  O  O     . GLY A  1 457 ? -34.772 17.397   41.463  1.00 100.13 ? 457 GLY A O     1 
ATOM   3254  N  N     . ILE A  1 458 ? -34.322 16.407   43.444  1.00 92.47  ? 458 ILE A N     1 
ATOM   3255  C  CA    . ILE A  1 458 ? -33.627 17.562   44.016  1.00 91.55  ? 458 ILE A CA    1 
ATOM   3256  C  C     . ILE A  1 458 ? -32.268 17.777   43.343  1.00 91.44  ? 458 ILE A C     1 
ATOM   3257  O  O     . ILE A  1 458 ? -31.515 16.827   43.128  1.00 89.39  ? 458 ILE A O     1 
ATOM   3258  C  CB    . ILE A  1 458 ? -33.489 17.444   45.571  1.00 87.72  ? 458 ILE A CB    1 
ATOM   3259  C  CG1   . ILE A  1 458 ? -34.834 17.759   46.254  1.00 88.88  ? 458 ILE A CG1   1 
ATOM   3260  C  CG2   . ILE A  1 458 ? -32.345 18.317   46.102  1.00 85.82  ? 458 ILE A CG2   1 
ATOM   3261  C  CD1   . ILE A  1 458 ? -34.773 18.643   47.526  1.00 86.92  ? 458 ILE A CD1   1 
ATOM   3262  N  N     . GLU A  1 459 ? -31.968 19.025   42.995  1.00 94.30  ? 459 GLU A N     1 
ATOM   3263  C  CA    . GLU A  1 459 ? -30.675 19.357   42.385  1.00 94.87  ? 459 GLU A CA    1 
ATOM   3264  C  C     . GLU A  1 459 ? -29.511 19.202   43.373  1.00 90.51  ? 459 GLU A C     1 
ATOM   3265  O  O     . GLU A  1 459 ? -29.646 19.478   44.567  1.00 88.52  ? 459 GLU A O     1 
ATOM   3266  C  CB    . GLU A  1 459 ? -30.694 20.755   41.742  1.00 99.44  ? 459 GLU A CB    1 
ATOM   3267  C  CG    . GLU A  1 459 ? -30.904 21.900   42.716  1.00 100.74 ? 459 GLU A CG    1 
ATOM   3268  C  CD    . GLU A  1 459 ? -31.246 23.195   42.021  1.00 107.23 ? 459 GLU A CD    1 
ATOM   3269  O  OE1   . GLU A  1 459 ? -30.336 23.790   41.403  1.00 109.37 ? 459 GLU A OE1   1 
ATOM   3270  O  OE2   . GLU A  1 459 ? -32.425 23.615   42.100  1.00 110.35 ? 459 GLU A OE2   1 
ATOM   3271  N  N     . LEU A  1 460 ? -28.369 18.770   42.850  1.00 89.66  ? 460 LEU A N     1 
ATOM   3272  C  CA    . LEU A  1 460 ? -27.202 18.386   43.661  1.00 86.00  ? 460 LEU A CA    1 
ATOM   3273  C  C     . LEU A  1 460 ? -26.705 19.462   44.637  1.00 85.47  ? 460 LEU A C     1 
ATOM   3274  O  O     . LEU A  1 460 ? -26.142 19.143   45.686  1.00 82.57  ? 460 LEU A O     1 
ATOM   3275  C  CB    . LEU A  1 460 ? -26.065 17.944   42.733  1.00 86.35  ? 460 LEU A CB    1 
ATOM   3276  C  CG    . LEU A  1 460 ? -25.316 16.629   42.940  1.00 82.73  ? 460 LEU A CG    1 
ATOM   3277  C  CD1   . LEU A  1 460 ? -26.133 15.569   43.639  1.00 79.91  ? 460 LEU A CD1   1 
ATOM   3278  C  CD2   . LEU A  1 460 ? -24.894 16.133   41.584  1.00 85.30  ? 460 LEU A CD2   1 
ATOM   3279  N  N     . SER A  1 461 ? -26.917 20.729   44.284  1.00 88.97  ? 461 SER A N     1 
ATOM   3280  C  CA    . SER A  1 461 ? -26.555 21.861   45.134  1.00 89.32  ? 461 SER A CA    1 
ATOM   3281  C  C     . SER A  1 461 ? -27.353 21.912   46.439  1.00 87.80  ? 461 SER A C     1 
ATOM   3282  O  O     . SER A  1 461 ? -26.889 22.498   47.419  1.00 87.22  ? 461 SER A O     1 
ATOM   3283  C  CB    . SER A  1 461 ? -26.713 23.183   44.367  1.00 94.28  ? 461 SER A CB    1 
ATOM   3284  O  OG    . SER A  1 461 ? -27.966 23.267   43.704  1.00 96.47  ? 461 SER A OG    1 
ATOM   3285  N  N     . ARG A  1 462 ? -28.532 21.285   46.457  1.00 87.40  ? 462 ARG A N     1 
ATOM   3286  C  CA    . ARG A  1 462 ? -29.442 21.398   47.600  1.00 86.84  ? 462 ARG A CA    1 
ATOM   3287  C  C     . ARG A  1 462 ? -29.517 20.181   48.530  1.00 82.87  ? 462 ARG A C     1 
ATOM   3288  O  O     . ARG A  1 462 ? -30.117 20.263   49.604  1.00 82.05  ? 462 ARG A O     1 
ATOM   3289  C  CB    . ARG A  1 462 ? -30.840 21.833   47.148  1.00 90.31  ? 462 ARG A CB    1 
ATOM   3290  C  CG    . ARG A  1 462 ? -30.834 23.130   46.360  1.00 95.84  ? 462 ARG A CG    1 
ATOM   3291  C  CD    . ARG A  1 462 ? -32.095 23.965   46.551  1.00 100.85 ? 462 ARG A CD    1 
ATOM   3292  N  NE    . ARG A  1 462 ? -33.310 23.249   46.169  1.00 103.16 ? 462 ARG A NE    1 
ATOM   3293  C  CZ    . ARG A  1 462 ? -34.393 23.121   46.936  1.00 103.47 ? 462 ARG A CZ    1 
ATOM   3294  N  NH1   . ARG A  1 462 ? -34.444 23.671   48.146  1.00 102.63 ? 462 ARG A NH1   1 
ATOM   3295  N  NH2   . ARG A  1 462 ? -35.438 22.447   46.481  1.00 104.70 ? 462 ARG A NH2   1 
ATOM   3296  N  N     . ILE A  1 463 ? -28.898 19.067   48.137  1.00 80.86  ? 463 ILE A N     1 
ATOM   3297  C  CA    . ILE A  1 463 ? -28.827 17.868   48.995  1.00 77.68  ? 463 ILE A CA    1 
ATOM   3298  C  C     . ILE A  1 463 ? -28.208 18.200   50.367  1.00 76.34  ? 463 ILE A C     1 
ATOM   3299  O  O     . ILE A  1 463 ? -28.436 17.492   51.349  1.00 74.44  ? 463 ILE A O     1 
ATOM   3300  C  CB    . ILE A  1 463 ? -28.056 16.694   48.313  1.00 76.00  ? 463 ILE A CB    1 
ATOM   3301  C  CG1   . ILE A  1 463 ? -28.492 16.499   46.856  1.00 78.55  ? 463 ILE A CG1   1 
ATOM   3302  C  CG2   . ILE A  1 463 ? -28.211 15.389   49.091  1.00 72.85  ? 463 ILE A CG2   1 
ATOM   3303  C  CD1   . ILE A  1 463 ? -29.835 15.800   46.670  1.00 80.36  ? 463 ILE A CD1   1 
ATOM   3304  N  N     . GLY A  1 464 ? -27.430 19.280   50.423  1.00 78.01  ? 464 GLY A N     1 
ATOM   3305  C  CA    . GLY A  1 464 ? -26.966 19.840   51.689  1.00 77.98  ? 464 GLY A CA    1 
ATOM   3306  C  C     . GLY A  1 464 ? -28.128 20.417   52.476  1.00 80.05  ? 464 GLY A C     1 
ATOM   3307  O  O     . GLY A  1 464 ? -28.594 19.810   53.441  1.00 78.67  ? 464 GLY A O     1 
ATOM   3308  N  N     . GLU A  1 465 ? -28.624 21.578   52.050  1.00 83.85  ? 465 GLU A N     1 
ATOM   3309  C  CA    . GLU A  1 465 ? -29.745 22.223   52.742  1.00 86.40  ? 465 GLU A CA    1 
ATOM   3310  C  C     . GLU A  1 465 ? -30.946 21.291   52.964  1.00 85.13  ? 465 GLU A C     1 
ATOM   3311  O  O     . GLU A  1 465 ? -31.771 21.547   53.844  1.00 86.02  ? 465 GLU A O     1 
ATOM   3312  C  CB    . GLU A  1 465 ? -30.181 23.519   52.035  1.00 91.03  ? 465 GLU A CB    1 
ATOM   3313  C  CG    . GLU A  1 465 ? -30.855 23.316   50.683  1.00 94.14  ? 465 GLU A CG    1 
ATOM   3314  C  CD    . GLU A  1 465 ? -31.675 24.521   50.239  1.00 100.88 ? 465 GLU A CD    1 
ATOM   3315  O  OE1   . GLU A  1 465 ? -32.836 24.662   50.690  1.00 102.82 ? 465 GLU A OE1   1 
ATOM   3316  O  OE2   . GLU A  1 465 ? -31.161 25.321   49.424  1.00 104.31 ? 465 GLU A OE2   1 
ATOM   3317  N  N     . PHE A  1 466 ? -31.024 20.218   52.171  1.00 83.38  ? 466 PHE A N     1 
ATOM   3318  C  CA    . PHE A  1 466 ? -32.131 19.261   52.241  1.00 82.79  ? 466 PHE A CA    1 
ATOM   3319  C  C     . PHE A  1 466 ? -32.031 18.411   53.486  1.00 80.13  ? 466 PHE A C     1 
ATOM   3320  O  O     . PHE A  1 466 ? -33.017 18.245   54.208  1.00 80.58  ? 466 PHE A O     1 
ATOM   3321  C  CB    . PHE A  1 466 ? -32.165 18.341   51.012  1.00 82.40  ? 466 PHE A CB    1 
ATOM   3322  C  CG    . PHE A  1 466 ? -33.044 17.122   51.184  1.00 81.11  ? 466 PHE A CG    1 
ATOM   3323  C  CD1   . PHE A  1 466 ? -32.543 15.953   51.758  1.00 78.12  ? 466 PHE A CD1   1 
ATOM   3324  C  CD2   . PHE A  1 466 ? -34.367 17.138   50.771  1.00 83.13  ? 466 PHE A CD2   1 
ATOM   3325  C  CE1   . PHE A  1 466 ? -33.357 14.829   51.928  1.00 77.34  ? 466 PHE A CE1   1 
ATOM   3326  C  CE2   . PHE A  1 466 ? -35.179 16.019   50.932  1.00 82.72  ? 466 PHE A CE2   1 
ATOM   3327  C  CZ    . PHE A  1 466 ? -34.671 14.864   51.514  1.00 79.71  ? 466 PHE A CZ    1 
ATOM   3328  N  N     . GLU A  1 467 ? -30.841 17.850   53.705  1.00 77.46  ? 467 GLU A N     1 
ATOM   3329  C  CA    . GLU A  1 467 ? -30.572 17.015   54.865  1.00 75.22  ? 467 GLU A CA    1 
ATOM   3330  C  C     . GLU A  1 467 ? -30.849 17.801   56.143  1.00 76.04  ? 467 GLU A C     1 
ATOM   3331  O  O     . GLU A  1 467 ? -31.470 17.292   57.080  1.00 75.90  ? 467 GLU A O     1 
ATOM   3332  C  CB    . GLU A  1 467 ? -29.121 16.534   54.859  1.00 73.16  ? 467 GLU A CB    1 
ATOM   3333  C  CG    . GLU A  1 467 ? -28.786 15.719   56.081  1.00 72.62  ? 467 GLU A CG    1 
ATOM   3334  C  CD    . GLU A  1 467 ? -27.333 15.778   56.473  1.00 74.17  ? 467 GLU A CD    1 
ATOM   3335  O  OE1   . GLU A  1 467 ? -26.506 15.045   55.876  1.00 72.46  ? 467 GLU A OE1   1 
ATOM   3336  O  OE2   . GLU A  1 467 ? -27.033 16.550   57.414  1.00 76.88  ? 467 GLU A OE2   1 
ATOM   3337  N  N     . SER A  1 468 ? -30.387 19.045   56.155  1.00 77.26  ? 468 SER A N     1 
ATOM   3338  C  CA    . SER A  1 468 ? -30.593 19.959   57.256  1.00 79.04  ? 468 SER A CA    1 
ATOM   3339  C  C     . SER A  1 468 ? -32.093 20.167   57.535  1.00 81.52  ? 468 SER A C     1 
ATOM   3340  O  O     . SER A  1 468 ? -32.559 20.013   58.670  1.00 81.81  ? 468 SER A O     1 
ATOM   3341  C  CB    . SER A  1 468 ? -29.916 21.275   56.893  1.00 81.31  ? 468 SER A CB    1 
ATOM   3342  O  OG    . SER A  1 468 ? -30.014 22.229   57.928  1.00 84.76  ? 468 SER A OG    1 
ATOM   3343  N  N     . SER A  1 469 ? -32.841 20.497   56.484  1.00 83.37  ? 469 SER A N     1 
ATOM   3344  C  CA    . SER A  1 469 ? -34.251 20.799   56.608  1.00 86.19  ? 469 SER A CA    1 
ATOM   3345  C  C     . SER A  1 469 ? -35.114 19.578   56.895  1.00 85.05  ? 469 SER A C     1 
ATOM   3346  O  O     . SER A  1 469 ? -36.166 19.708   57.529  1.00 87.58  ? 469 SER A O     1 
ATOM   3347  C  CB    . SER A  1 469 ? -34.765 21.519   55.360  1.00 89.14  ? 469 SER A CB    1 
ATOM   3348  O  OG    . SER A  1 469 ? -34.487 22.903   55.430  1.00 91.99  ? 469 SER A OG    1 
ATOM   3349  N  N     . PHE A  1 470 ? -34.689 18.406   56.423  1.00 81.97  ? 470 PHE A N     1 
ATOM   3350  C  CA    . PHE A  1 470 ? -35.498 17.176   56.531  1.00 80.85  ? 470 PHE A CA    1 
ATOM   3351  C  C     . PHE A  1 470 ? -35.468 16.636   57.951  1.00 79.70  ? 470 PHE A C     1 
ATOM   3352  O  O     . PHE A  1 470 ? -36.498 16.219   58.486  1.00 80.63  ? 470 PHE A O     1 
ATOM   3353  C  CB    . PHE A  1 470 ? -35.004 16.128   55.528  1.00 78.69  ? 470 PHE A CB    1 
ATOM   3354  C  CG    . PHE A  1 470 ? -35.701 14.796   55.610  1.00 77.21  ? 470 PHE A CG    1 
ATOM   3355  C  CD1   . PHE A  1 470 ? -37.082 14.704   55.617  1.00 79.81  ? 470 PHE A CD1   1 
ATOM   3356  C  CD2   . PHE A  1 470 ? -34.962 13.623   55.615  1.00 74.34  ? 470 PHE A CD2   1 
ATOM   3357  C  CE1   . PHE A  1 470 ? -37.715 13.462   55.669  1.00 79.40  ? 470 PHE A CE1   1 
ATOM   3358  C  CE2   . PHE A  1 470 ? -35.586 12.380   55.665  1.00 73.99  ? 470 PHE A CE2   1 
ATOM   3359  C  CZ    . PHE A  1 470 ? -36.959 12.299   55.688  1.00 76.45  ? 470 PHE A CZ    1 
ATOM   3360  N  N     . LEU A  1 471 ? -34.281 16.676   58.557  1.00 77.82  ? 471 LEU A N     1 
ATOM   3361  C  CA    . LEU A  1 471 ? -34.089 16.230   59.933  1.00 77.09  ? 471 LEU A CA    1 
ATOM   3362  C  C     . LEU A  1 471 ? -34.863 17.091   60.935  1.00 80.07  ? 471 LEU A C     1 
ATOM   3363  O  O     . LEU A  1 471 ? -35.608 16.561   61.764  1.00 81.00  ? 471 LEU A O     1 
ATOM   3364  C  CB    . LEU A  1 471 ? -32.599 16.143   60.281  1.00 74.83  ? 471 LEU A CB    1 
ATOM   3365  C  CG    . LEU A  1 471 ? -31.782 15.087   59.517  1.00 72.14  ? 471 LEU A CG    1 
ATOM   3366  C  CD1   . LEU A  1 471 ? -30.329 15.155   59.930  1.00 70.99  ? 471 LEU A CD1   1 
ATOM   3367  C  CD2   . LEU A  1 471 ? -32.319 13.664   59.698  1.00 70.91  ? 471 LEU A CD2   1 
ATOM   3368  N  N     . SER A  1 472 ? -34.713 18.413   60.832  1.00 82.09  ? 472 SER A N     1 
ATOM   3369  C  CA    . SER A  1 472 ? -35.455 19.363   61.678  1.00 85.52  ? 472 SER A CA    1 
ATOM   3370  C  C     . SER A  1 472 ? -36.962 19.165   61.592  1.00 87.62  ? 472 SER A C     1 
ATOM   3371  O  O     . SER A  1 472 ? -37.644 19.127   62.621  1.00 89.44  ? 472 SER A O     1 
ATOM   3372  C  CB    . SER A  1 472 ? -35.101 20.793   61.307  1.00 87.84  ? 472 SER A CB    1 
ATOM   3373  O  OG    . SER A  1 472 ? -34.768 20.855   59.934  1.00 87.98  ? 472 SER A OG    1 
ATOM   3374  N  N     . TYR A  1 473 ? -37.462 19.039   60.360  1.00 87.74  ? 473 TYR A N     1 
ATOM   3375  C  CA    . TYR A  1 473 ? -38.864 18.726   60.082  1.00 89.65  ? 473 TYR A CA    1 
ATOM   3376  C  C     . TYR A  1 473 ? -39.243 17.412   60.758  1.00 87.98  ? 473 TYR A C     1 
ATOM   3377  O  O     . TYR A  1 473 ? -40.245 17.346   61.467  1.00 90.16  ? 473 TYR A O     1 
ATOM   3378  C  CB    . TYR A  1 473 ? -39.105 18.661   58.567  1.00 89.94  ? 473 TYR A CB    1 
ATOM   3379  C  CG    . TYR A  1 473 ? -40.386 17.960   58.145  1.00 92.47  ? 473 TYR A CG    1 
ATOM   3380  C  CD1   . TYR A  1 473 ? -41.586 18.674   57.985  1.00 97.83  ? 473 TYR A CD1   1 
ATOM   3381  C  CD2   . TYR A  1 473 ? -40.401 16.586   57.897  1.00 90.41  ? 473 TYR A CD2   1 
ATOM   3382  C  CE1   . TYR A  1 473 ? -42.766 18.030   57.599  1.00 99.26  ? 473 TYR A CE1   1 
ATOM   3383  C  CE2   . TYR A  1 473 ? -41.570 15.934   57.516  1.00 92.79  ? 473 TYR A CE2   1 
ATOM   3384  C  CZ    . TYR A  1 473 ? -42.745 16.657   57.367  1.00 97.17  ? 473 TYR A CZ    1 
ATOM   3385  O  OH    . TYR A  1 473 ? -43.886 15.995   56.978  1.00 99.45  ? 473 TYR A OH    1 
ATOM   3386  N  N     . LEU A  1 474 ? -38.427 16.377   60.552  1.00 84.33  ? 474 LEU A N     1 
ATOM   3387  C  CA    . LEU A  1 474 ? -38.671 15.076   61.177  1.00 83.01  ? 474 LEU A CA    1 
ATOM   3388  C  C     . LEU A  1 474 ? -38.701 15.183   62.695  1.00 83.91  ? 474 LEU A C     1 
ATOM   3389  O  O     . LEU A  1 474 ? -39.488 14.503   63.354  1.00 84.98  ? 474 LEU A O     1 
ATOM   3390  C  CB    . LEU A  1 474 ? -37.634 14.044   60.741  1.00 79.35  ? 474 LEU A CB    1 
ATOM   3391  C  CG    . LEU A  1 474 ? -37.811 13.340   59.396  1.00 78.40  ? 474 LEU A CG    1 
ATOM   3392  C  CD1   . LEU A  1 474 ? -36.720 12.297   59.233  1.00 75.78  ? 474 LEU A CD1   1 
ATOM   3393  C  CD2   . LEU A  1 474 ? -39.159 12.687   59.286  1.00 79.75  ? 474 LEU A CD2   1 
ATOM   3394  N  N     . LYS A  1 475 ? -37.849 16.051   63.236  1.00 83.75  ? 475 LYS A N     1 
ATOM   3395  C  CA    . LYS A  1 475 ? -37.864 16.365   64.662  1.00 85.64  ? 475 LYS A CA    1 
ATOM   3396  C  C     . LYS A  1 475 ? -39.164 17.048   65.119  1.00 90.11  ? 475 LYS A C     1 
ATOM   3397  O  O     . LYS A  1 475 ? -39.685 16.718   66.186  1.00 91.99  ? 475 LYS A O     1 
ATOM   3398  C  CB    . LYS A  1 475 ? -36.662 17.225   65.047  1.00 84.89  ? 475 LYS A CB    1 
ATOM   3399  C  CG    . LYS A  1 475 ? -35.344 16.492   65.020  1.00 81.62  ? 475 LYS A CG    1 
ATOM   3400  C  CD    . LYS A  1 475 ? -34.251 17.296   65.690  1.00 82.37  ? 475 LYS A CD    1 
ATOM   3401  C  CE    . LYS A  1 475 ? -32.898 16.707   65.384  1.00 79.62  ? 475 LYS A CE    1 
ATOM   3402  N  NZ    . LYS A  1 475 ? -31.923 17.014   66.467  1.00 81.57  ? 475 LYS A NZ    1 
ATOM   3403  N  N     . SER A  1 476 ? -39.677 17.990   64.322  1.00 92.17  ? 476 SER A N     1 
ATOM   3404  C  CA    . SER A  1 476 ? -40.873 18.756   64.695  1.00 96.85  ? 476 SER A CA    1 
ATOM   3405  C  C     . SER A  1 476 ? -42.122 17.876   64.680  1.00 98.27  ? 476 SER A C     1 
ATOM   3406  O  O     . SER A  1 476 ? -42.957 17.946   65.585  1.00 101.52 ? 476 SER A O     1 
ATOM   3407  C  CB    . SER A  1 476 ? -41.104 19.960   63.758  1.00 99.27  ? 476 SER A CB    1 
ATOM   3408  O  OG    . SER A  1 476 ? -39.903 20.585   63.333  1.00 97.65  ? 476 SER A OG    1 
ATOM   3409  N  N     . ASN A  1 477 ? -42.227 17.042   63.649  1.00 96.07  ? 477 ASN A N     1 
ATOM   3410  C  CA    . ASN A  1 477 ? -43.468 16.359   63.322  1.00 97.74  ? 477 ASN A CA    1 
ATOM   3411  C  C     . ASN A  1 477 ? -43.441 14.858   63.595  1.00 95.66  ? 477 ASN A C     1 
ATOM   3412  O  O     . ASN A  1 477 ? -44.402 14.308   64.114  1.00 98.39  ? 477 ASN A O     1 
ATOM   3413  C  CB    . ASN A  1 477 ? -43.840 16.637   61.864  1.00 98.31  ? 477 ASN A CB    1 
ATOM   3414  C  CG    . ASN A  1 477 ? -43.937 18.128   61.558  1.00 101.21 ? 477 ASN A CG    1 
ATOM   3415  O  OD1   . ASN A  1 477 ? -44.889 18.798   61.959  1.00 106.60 ? 477 ASN A OD1   1 
ATOM   3416  N  ND2   . ASN A  1 477 ? -42.956 18.649   60.835  1.00 98.65  ? 477 ASN A ND2   1 
ATOM   3417  N  N     . HIS A  1 478 ? -42.343 14.196   63.266  1.00 91.63  ? 478 HIS A N     1 
ATOM   3418  C  CA    . HIS A  1 478 ? -42.288 12.746   63.394  1.00 90.10  ? 478 HIS A CA    1 
ATOM   3419  C  C     . HIS A  1 478 ? -41.263 12.271   64.429  1.00 88.05  ? 478 HIS A C     1 
ATOM   3420  O  O     . HIS A  1 478 ? -40.490 11.331   64.185  1.00 85.14  ? 478 HIS A O     1 
ATOM   3421  C  CB    . HIS A  1 478 ? -42.002 12.117   62.034  1.00 88.10  ? 478 HIS A CB    1 
ATOM   3422  C  CG    . HIS A  1 478 ? -42.849 12.661   60.934  1.00 89.77  ? 478 HIS A CG    1 
ATOM   3423  N  ND1   . HIS A  1 478 ? -44.181 12.343   60.797  1.00 92.43  ? 478 HIS A ND1   1 
ATOM   3424  C  CD2   . HIS A  1 478 ? -42.554 13.503   59.917  1.00 89.58  ? 478 HIS A CD2   1 
ATOM   3425  C  CE1   . HIS A  1 478 ? -44.671 12.969   59.742  1.00 94.76  ? 478 HIS A CE1   1 
ATOM   3426  N  NE2   . HIS A  1 478 ? -43.704 13.680   59.191  1.00 92.57  ? 478 HIS A NE2   1 
ATOM   3427  N  N     . ASN A  1 479 ? -41.274 12.917   65.590  1.00 89.75  ? 479 ASN A N     1 
ATOM   3428  C  CA    . ASN A  1 479 ? -40.405 12.532   66.689  1.00 88.64  ? 479 ASN A CA    1 
ATOM   3429  C  C     . ASN A  1 479 ? -40.675 11.094   67.122  1.00 88.75  ? 479 ASN A C     1 
ATOM   3430  O  O     . ASN A  1 479 ? -39.821 10.448   67.716  1.00 87.46  ? 479 ASN A O     1 
ATOM   3431  C  CB    . ASN A  1 479 ? -40.593 13.489   67.860  1.00 91.68  ? 479 ASN A CB    1 
ATOM   3432  C  CG    . ASN A  1 479 ? -39.401 13.517   68.791  1.00 90.60  ? 479 ASN A CG    1 
ATOM   3433  O  OD1   . ASN A  1 479 ? -38.299 13.904   68.406  1.00 87.46  ? 479 ASN A OD1   1 
ATOM   3434  N  ND2   . ASN A  1 479 ? -39.626 13.124   70.036  1.00 94.29  ? 479 ASN A ND2   1 
ATOM   3435  N  N     . GLU A  1 480 ? -41.865 10.602   66.794  1.00 91.05  ? 480 GLU A N     1 
ATOM   3436  C  CA    . GLU A  1 480 ? -42.300 9.232    67.086  1.00 92.07  ? 480 GLU A CA    1 
ATOM   3437  C  C     . GLU A  1 480 ? -41.357 8.153    66.528  1.00 88.72  ? 480 GLU A C     1 
ATOM   3438  O  O     . GLU A  1 480 ? -40.907 7.278    67.270  1.00 88.57  ? 480 GLU A O     1 
ATOM   3439  C  CB    . GLU A  1 480 ? -43.693 9.022    66.507  1.00 94.94  ? 480 GLU A CB    1 
ATOM   3440  C  CG    . GLU A  1 480 ? -44.461 10.325   66.351  1.00 98.91  ? 480 GLU A CG    1 
ATOM   3441  C  CD    . GLU A  1 480 ? -45.193 10.448   65.020  1.00 101.44 ? 480 GLU A CD    1 
ATOM   3442  O  OE1   . GLU A  1 480 ? -44.670 9.958    63.986  1.00 98.43  ? 480 GLU A OE1   1 
ATOM   3443  O  OE2   . GLU A  1 480 ? -46.292 11.058   65.018  1.00 105.82 ? 480 GLU A OE2   1 
ATOM   3444  N  N     . LEU A  1 481 ? -41.067 8.214    65.227  1.00 86.36  ? 481 LEU A N     1 
ATOM   3445  C  CA    . LEU A  1 481 ? -40.266 7.178    64.569  1.00 83.62  ? 481 LEU A CA    1 
ATOM   3446  C  C     . LEU A  1 481 ? -38.773 7.343    64.832  1.00 80.56  ? 481 LEU A C     1 
ATOM   3447  O  O     . LEU A  1 481 ? -38.031 6.352    64.915  1.00 79.37  ? 481 LEU A O     1 
ATOM   3448  C  CB    . LEU A  1 481 ? -40.537 7.114    63.066  1.00 83.08  ? 481 LEU A CB    1 
ATOM   3449  C  CG    . LEU A  1 481 ? -40.862 8.398    62.313  1.00 83.88  ? 481 LEU A CG    1 
ATOM   3450  C  CD1   . LEU A  1 481 ? -40.170 8.375    60.978  1.00 82.54  ? 481 LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A  1 481 ? -42.374 8.533    62.133  1.00 89.01  ? 481 LEU A CD2   1 
ATOM   3452  N  N     . LEU A  1 482 ? -38.328 8.590    64.954  1.00 79.29  ? 482 LEU A N     1 
ATOM   3453  C  CA    . LEU A  1 482 ? -36.968 8.834    65.379  1.00 76.48  ? 482 LEU A CA    1 
ATOM   3454  C  C     . LEU A  1 482 ? -36.763 8.023    66.650  1.00 77.67  ? 482 LEU A C     1 
ATOM   3455  O  O     . LEU A  1 482 ? -35.906 7.142    66.688  1.00 76.57  ? 482 LEU A O     1 
ATOM   3456  C  CB    . LEU A  1 482 ? -36.713 10.323   65.602  1.00 76.17  ? 482 LEU A CB    1 
ATOM   3457  C  CG    . LEU A  1 482 ? -36.812 11.206   64.355  1.00 74.01  ? 482 LEU A CG    1 
ATOM   3458  C  CD1   . LEU A  1 482 ? -36.203 12.557   64.647  1.00 72.49  ? 482 LEU A CD1   1 
ATOM   3459  C  CD2   . LEU A  1 482 ? -36.162 10.567   63.128  1.00 69.51  ? 482 LEU A CD2   1 
ATOM   3460  N  N     . THR A  1 483 ? -37.597 8.270    67.658  1.00 80.52  ? 483 THR A N     1 
ATOM   3461  C  CA    . THR A  1 483 ? -37.526 7.528    68.912  1.00 82.26  ? 483 THR A CA    1 
ATOM   3462  C  C     . THR A  1 483 ? -37.513 6.010    68.728  1.00 82.58  ? 483 THR A C     1 
ATOM   3463  O  O     . THR A  1 483 ? -36.622 5.347    69.255  1.00 82.12  ? 483 THR A O     1 
ATOM   3464  C  CB    . THR A  1 483 ? -38.618 7.970    69.891  1.00 85.70  ? 483 THR A CB    1 
ATOM   3465  O  OG1   . THR A  1 483 ? -38.345 9.313    70.306  1.00 85.74  ? 483 THR A OG1   1 
ATOM   3466  C  CG2   . THR A  1 483 ? -38.651 7.070    71.118  1.00 87.92  ? 483 THR A CG2   1 
ATOM   3467  N  N     . GLU A  1 484 ? -38.465 5.464    67.970  1.00 83.93  ? 484 GLU A N     1 
ATOM   3468  C  CA    . GLU A  1 484 ? -38.507 4.013    67.745  1.00 85.22  ? 484 GLU A CA    1 
ATOM   3469  C  C     . GLU A  1 484 ? -37.239 3.460    67.072  1.00 82.73  ? 484 GLU A C     1 
ATOM   3470  O  O     . GLU A  1 484 ? -36.772 2.370    67.421  1.00 83.51  ? 484 GLU A O     1 
ATOM   3471  C  CB    . GLU A  1 484 ? -39.749 3.570    66.963  1.00 87.01  ? 484 GLU A CB    1 
ATOM   3472  C  CG    . GLU A  1 484 ? -39.888 2.047    66.967  1.00 90.22  ? 484 GLU A CG    1 
ATOM   3473  C  CD    . GLU A  1 484 ? -41.033 1.500    66.131  1.00 94.89  ? 484 GLU A CD    1 
ATOM   3474  O  OE1   . GLU A  1 484 ? -42.129 2.108    66.117  1.00 98.16  ? 484 GLU A OE1   1 
ATOM   3475  O  OE2   . GLU A  1 484 ? -40.836 0.428    65.505  1.00 95.57  ? 484 GLU A OE2   1 
ATOM   3476  N  N     . ILE A  1 485 ? -36.696 4.197    66.105  1.00 80.38  ? 485 ILE A N     1 
ATOM   3477  C  CA    . ILE A  1 485 ? -35.442 3.805    65.471  1.00 78.18  ? 485 ILE A CA    1 
ATOM   3478  C  C     . ILE A  1 485 ? -34.360 3.743    66.552  1.00 78.23  ? 485 ILE A C     1 
ATOM   3479  O  O     . ILE A  1 485 ? -33.727 2.702    66.745  1.00 78.83  ? 485 ILE A O     1 
ATOM   3480  C  CB    . ILE A  1 485 ? -35.041 4.774    64.330  1.00 75.84  ? 485 ILE A CB    1 
ATOM   3481  C  CG1   . ILE A  1 485 ? -36.038 4.681    63.167  1.00 76.39  ? 485 ILE A CG1   1 
ATOM   3482  C  CG2   . ILE A  1 485 ? -33.644 4.466    63.839  1.00 73.64  ? 485 ILE A CG2   1 
ATOM   3483  C  CD1   . ILE A  1 485 ? -35.975 5.833    62.182  1.00 73.99  ? 485 ILE A CD1   1 
ATOM   3484  N  N     . ARG A  1 486 ? -34.184 4.849    67.275  1.00 78.29  ? 486 ARG A N     1 
ATOM   3485  C  CA    . ARG A  1 486 ? -33.246 4.924    68.400  1.00 78.72  ? 486 ARG A CA    1 
ATOM   3486  C  C     . ARG A  1 486 ? -33.470 3.806    69.433  1.00 81.56  ? 486 ARG A C     1 
ATOM   3487  O  O     . ARG A  1 486 ? -32.520 3.191    69.889  1.00 81.81  ? 486 ARG A O     1 
ATOM   3488  C  CB    . ARG A  1 486 ? -33.318 6.315    69.065  1.00 79.20  ? 486 ARG A CB    1 
ATOM   3489  C  CG    . ARG A  1 486 ? -32.270 6.588    70.145  1.00 79.07  ? 486 ARG A CG    1 
ATOM   3490  C  CD    . ARG A  1 486 ? -32.487 7.941    70.831  1.00 79.84  ? 486 ARG A CD    1 
ATOM   3491  N  NE    . ARG A  1 486 ? -33.398 7.840    71.965  1.00 84.30  ? 486 ARG A NE    1 
ATOM   3492  C  CZ    . ARG A  1 486 ? -34.620 8.376    72.010  1.00 87.40  ? 486 ARG A CZ    1 
ATOM   3493  N  NH1   . ARG A  1 486 ? -35.082 9.086    70.983  1.00 86.08  ? 486 ARG A NH1   1 
ATOM   3494  N  NH2   . ARG A  1 486 ? -35.382 8.215    73.091  1.00 90.05  ? 486 ARG A NH2   1 
ATOM   3495  N  N     . GLU A  1 487 ? -34.721 3.533    69.788  1.00 84.33  ? 487 GLU A N     1 
ATOM   3496  C  CA    . GLU A  1 487 ? -35.003 2.592    70.880  1.00 87.97  ? 487 GLU A CA    1 
ATOM   3497  C  C     . GLU A  1 487 ? -35.012 1.109    70.483  1.00 88.84  ? 487 GLU A C     1 
ATOM   3498  O  O     . GLU A  1 487 ? -34.379 0.288    71.148  1.00 90.25  ? 487 GLU A O     1 
ATOM   3499  C  CB    . GLU A  1 487 ? -36.274 2.990    71.648  1.00 91.03  ? 487 GLU A CB    1 
ATOM   3500  C  CG    . GLU A  1 487 ? -36.068 4.176    72.608  1.00 92.81  ? 487 GLU A CG    1 
ATOM   3501  C  CD    . GLU A  1 487 ? -37.214 4.352    73.617  1.00 98.92  ? 487 GLU A CD    1 
ATOM   3502  O  OE1   . GLU A  1 487 ? -38.407 4.318    73.213  1.00 100.28 ? 487 GLU A OE1   1 
ATOM   3503  O  OE2   . GLU A  1 487 ? -36.915 4.540    74.823  1.00 101.75 ? 487 GLU A OE2   1 
ATOM   3504  N  N     . LYS A  1 488 ? -35.722 0.760    69.416  1.00 88.49  ? 488 LYS A N     1 
ATOM   3505  C  CA    . LYS A  1 488 ? -35.703 -0.619   68.935  1.00 89.81  ? 488 LYS A CA    1 
ATOM   3506  C  C     . LYS A  1 488 ? -34.438 -0.931   68.120  1.00 87.53  ? 488 LYS A C     1 
ATOM   3507  O  O     . LYS A  1 488 ? -33.952 -2.069   68.127  1.00 89.31  ? 488 LYS A O     1 
ATOM   3508  C  CB    . LYS A  1 488 ? -36.967 -0.947   68.145  1.00 90.92  ? 488 LYS A CB    1 
ATOM   3509  C  CG    . LYS A  1 488 ? -38.234 -0.582   68.899  1.00 94.55  ? 488 LYS A CG    1 
ATOM   3510  C  CD    . LYS A  1 488 ? -39.309 -1.652   68.822  1.00 98.10  ? 488 LYS A CD    1 
ATOM   3511  C  CE    . LYS A  1 488 ? -40.393 -1.342   69.817  1.00 101.86 ? 488 LYS A CE    1 
ATOM   3512  N  NZ    . LYS A  1 488 ? -41.592 -2.212   69.628  1.00 107.97 ? 488 LYS A NZ    1 
ATOM   3513  N  N     . GLY A  1 489 ? -33.903 0.076    67.430  1.00 84.03  ? 489 GLY A N     1 
ATOM   3514  C  CA    . GLY A  1 489 ? -32.726 -0.117   66.589  1.00 81.64  ? 489 GLY A CA    1 
ATOM   3515  C  C     . GLY A  1 489 ? -33.013 -0.866   65.303  1.00 81.64  ? 489 GLY A C     1 
ATOM   3516  O  O     . GLY A  1 489 ? -32.138 -0.993   64.455  1.00 80.24  ? 489 GLY A O     1 
ATOM   3517  N  N     . GLU A  1 490 ? -34.240 -1.366   65.172  1.00 83.81  ? 490 GLU A N     1 
ATOM   3518  C  CA    . GLU A  1 490 ? -34.697 -2.114   64.002  1.00 84.74  ? 490 GLU A CA    1 
ATOM   3519  C  C     . GLU A  1 490 ? -35.697 -1.289   63.202  1.00 84.03  ? 490 GLU A C     1 
ATOM   3520  O  O     . GLU A  1 490 ? -36.153 -0.235   63.651  1.00 83.61  ? 490 GLU A O     1 
ATOM   3521  C  CB    . GLU A  1 490 ? -35.397 -3.403   64.438  1.00 88.68  ? 490 GLU A CB    1 
ATOM   3522  C  CG    . GLU A  1 490 ? -34.503 -4.534   64.911  1.00 91.51  ? 490 GLU A CG    1 
ATOM   3523  C  CD    . GLU A  1 490 ? -35.270 -5.846   65.063  1.00 97.78  ? 490 GLU A CD    1 
ATOM   3524  O  OE1   . GLU A  1 490 ? -36.249 -5.897   65.842  1.00 101.41 ? 490 GLU A OE1   1 
ATOM   3525  O  OE2   . GLU A  1 490 ? -34.898 -6.834   64.400  1.00 100.07 ? 490 GLU A OE2   1 
ATOM   3526  N  N     . LEU A  1 491 ? -36.052 -1.775   62.019  1.00 84.46  ? 491 LEU A N     1 
ATOM   3527  C  CA    . LEU A  1 491 ? -37.168 -1.209   61.292  1.00 84.73  ? 491 LEU A CA    1 
ATOM   3528  C  C     . LEU A  1 491 ? -38.162 -2.299   60.939  1.00 88.08  ? 491 LEU A C     1 
ATOM   3529  O  O     . LEU A  1 491 ? -37.908 -3.134   60.071  1.00 89.07  ? 491 LEU A O     1 
ATOM   3530  C  CB    . LEU A  1 491 ? -36.708 -0.473   60.033  1.00 82.71  ? 491 LEU A CB    1 
ATOM   3531  C  CG    . LEU A  1 491 ? -35.866 0.790    60.182  1.00 80.04  ? 491 LEU A CG    1 
ATOM   3532  C  CD1   . LEU A  1 491 ? -35.579 1.366    58.809  1.00 79.78  ? 491 LEU A CD1   1 
ATOM   3533  C  CD2   . LEU A  1 491 ? -36.572 1.810    61.041  1.00 80.67  ? 491 LEU A CD2   1 
ATOM   3534  N  N     . SER A  1 492 ? -39.290 -2.287   61.644  1.00 90.09  ? 492 SER A N     1 
ATOM   3535  C  CA    . SER A  1 492 ? -40.443 -3.104   61.305  1.00 93.52  ? 492 SER A CA    1 
ATOM   3536  C  C     . SER A  1 492 ? -41.008 -2.655   59.959  1.00 93.47  ? 492 SER A C     1 
ATOM   3537  O  O     . SER A  1 492 ? -40.530 -1.679   59.363  1.00 90.38  ? 492 SER A O     1 
ATOM   3538  C  CB    . SER A  1 492 ? -41.505 -2.969   62.387  1.00 95.99  ? 492 SER A CB    1 
ATOM   3539  O  OG    . SER A  1 492 ? -41.826 -1.603   62.574  1.00 94.49  ? 492 SER A OG    1 
ATOM   3540  N  N     . LYS A  1 493 ? -42.029 -3.369   59.491  1.00 96.98  ? 493 LYS A N     1 
ATOM   3541  C  CA    . LYS A  1 493 ? -42.617 -3.124   58.180  1.00 97.77  ? 493 LYS A CA    1 
ATOM   3542  C  C     . LYS A  1 493 ? -43.443 -1.847   58.202  1.00 97.23  ? 493 LYS A C     1 
ATOM   3543  O  O     . LYS A  1 493 ? -43.472 -1.100   57.218  1.00 96.13  ? 493 LYS A O     1 
ATOM   3544  C  CB    . LYS A  1 493 ? -43.464 -4.322   57.758  1.00 102.87 ? 493 LYS A CB    1 
ATOM   3545  C  CG    . LYS A  1 493 ? -42.907 -5.649   58.252  1.00 104.67 ? 493 LYS A CG    1 
ATOM   3546  C  CD    . LYS A  1 493 ? -43.050 -6.752   57.219  1.00 109.24 ? 493 LYS A CD    1 
ATOM   3547  C  CE    . LYS A  1 493 ? -42.119 -7.914   57.545  1.00 110.06 ? 493 LYS A CE    1 
ATOM   3548  N  NZ    . LYS A  1 493 ? -42.039 -8.894   56.430  1.00 113.73 ? 493 LYS A NZ    1 
ATOM   3549  N  N     . GLU A  1 494 ? -44.093 -1.606   59.344  1.00 98.11  ? 494 GLU A N     1 
ATOM   3550  C  CA    . GLU A  1 494 ? -44.880 -0.396   59.593  1.00 98.34  ? 494 GLU A CA    1 
ATOM   3551  C  C     . GLU A  1 494 ? -43.984 0.826    59.593  1.00 93.85  ? 494 GLU A C     1 
ATOM   3552  O  O     . GLU A  1 494 ? -44.381 1.903    59.151  1.00 93.79  ? 494 GLU A O     1 
ATOM   3553  C  CB    . GLU A  1 494 ? -45.591 -0.481   60.946  1.00 100.65 ? 494 GLU A CB    1 
ATOM   3554  C  CG    . GLU A  1 494 ? -46.726 -1.507   61.023  1.00 106.75 ? 494 GLU A CG    1 
ATOM   3555  C  CD    . GLU A  1 494 ? -46.241 -2.956   61.113  1.00 108.87 ? 494 GLU A CD    1 
ATOM   3556  O  OE1   . GLU A  1 494 ? -45.047 -3.191   61.439  1.00 105.86 ? 494 GLU A OE1   1 
ATOM   3557  O  OE2   . GLU A  1 494 ? -47.071 -3.860   60.854  1.00 113.28 ? 494 GLU A OE2   1 
ATOM   3558  N  N     . LEU A  1 495 ? -42.770 0.645    60.099  1.00 90.48  ? 495 LEU A N     1 
ATOM   3559  C  CA    . LEU A  1 495 ? -41.809 1.722    60.188  1.00 86.29  ? 495 LEU A CA    1 
ATOM   3560  C  C     . LEU A  1 495 ? -41.279 2.194    58.836  1.00 84.15  ? 495 LEU A C     1 
ATOM   3561  O  O     . LEU A  1 495 ? -41.188 3.402    58.612  1.00 82.74  ? 495 LEU A O     1 
ATOM   3562  C  CB    . LEU A  1 495 ? -40.663 1.342    61.115  1.00 84.31  ? 495 LEU A CB    1 
ATOM   3563  C  CG    . LEU A  1 495 ? -40.651 2.002    62.491  1.00 84.47  ? 495 LEU A CG    1 
ATOM   3564  C  CD1   . LEU A  1 495 ? -39.322 1.705    63.176  1.00 83.35  ? 495 LEU A CD1   1 
ATOM   3565  C  CD2   . LEU A  1 495 ? -40.849 3.512    62.370  1.00 83.85  ? 495 LEU A CD2   1 
ATOM   3566  N  N     . LEU A  1 496 ? -40.928 1.265    57.944  1.00 83.95  ? 496 LEU A N     1 
ATOM   3567  C  CA    . LEU A  1 496 ? -40.496 1.652    56.599  1.00 82.74  ? 496 LEU A CA    1 
ATOM   3568  C  C     . LEU A  1 496 ? -41.628 2.404    55.907  1.00 85.19  ? 496 LEU A C     1 
ATOM   3569  O  O     . LEU A  1 496 ? -41.403 3.414    55.242  1.00 84.09  ? 496 LEU A O     1 
ATOM   3570  C  CB    . LEU A  1 496 ? -40.090 0.444    55.748  1.00 83.65  ? 496 LEU A CB    1 
ATOM   3571  C  CG    . LEU A  1 496 ? -39.042 -0.576   56.197  1.00 82.57  ? 496 LEU A CG    1 
ATOM   3572  C  CD1   . LEU A  1 496 ? -38.968 -1.717   55.198  1.00 84.43  ? 496 LEU A CD1   1 
ATOM   3573  C  CD2   . LEU A  1 496 ? -37.669 0.058    56.373  1.00 79.51  ? 496 LEU A CD2   1 
ATOM   3574  N  N     . ALA A  1 497 ? -42.850 1.903    56.086  1.00 88.95  ? 497 ALA A N     1 
ATOM   3575  C  CA    . ALA A  1 497 ? -44.046 2.513    55.532  1.00 91.89  ? 497 ALA A CA    1 
ATOM   3576  C  C     . ALA A  1 497 ? -44.300 3.902    56.116  1.00 91.14  ? 497 ALA A C     1 
ATOM   3577  O  O     . ALA A  1 497 ? -44.800 4.785    55.415  1.00 92.58  ? 497 ALA A O     1 
ATOM   3578  C  CB    . ALA A  1 497 ? -45.222 1.624    55.774  1.00 96.24  ? 497 ALA A CB    1 
ATOM   3579  N  N     . SER A  1 498 ? -43.959 4.084    57.393  1.00 89.49  ? 498 SER A N     1 
ATOM   3580  C  CA    . SER A  1 498 ? -44.071 5.384    58.058  1.00 89.06  ? 498 SER A CA    1 
ATOM   3581  C  C     . SER A  1 498 ? -42.974 6.307    57.566  1.00 86.17  ? 498 SER A C     1 
ATOM   3582  O  O     . SER A  1 498 ? -43.220 7.468    57.252  1.00 86.93  ? 498 SER A O     1 
ATOM   3583  C  CB    . SER A  1 498 ? -43.984 5.239    59.580  1.00 88.46  ? 498 SER A CB    1 
ATOM   3584  O  OG    . SER A  1 498 ? -45.217 4.819    60.139  1.00 92.28  ? 498 SER A OG    1 
ATOM   3585  N  N     . LEU A  1 499 ? -41.759 5.774    57.503  1.00 83.61  ? 499 LEU A N     1 
ATOM   3586  C  CA    . LEU A  1 499 ? -40.615 6.494    56.976  1.00 80.98  ? 499 LEU A CA    1 
ATOM   3587  C  C     . LEU A  1 499 ? -40.913 6.954    55.552  1.00 82.52  ? 499 LEU A C     1 
ATOM   3588  O  O     . LEU A  1 499 ? -40.716 8.122    55.217  1.00 82.51  ? 499 LEU A O     1 
ATOM   3589  C  CB    . LEU A  1 499 ? -39.385 5.590    57.009  1.00 78.39  ? 499 LEU A CB    1 
ATOM   3590  C  CG    . LEU A  1 499 ? -38.008 6.191    57.278  1.00 75.50  ? 499 LEU A CG    1 
ATOM   3591  C  CD1   . LEU A  1 499 ? -38.098 7.516    58.025  1.00 75.46  ? 499 LEU A CD1   1 
ATOM   3592  C  CD2   . LEU A  1 499 ? -37.149 5.176    58.046  1.00 73.73  ? 499 LEU A CD2   1 
ATOM   3593  N  N     . LYS A  1 500 ? -41.425 6.039    54.732  1.00 84.54  ? 500 LYS A N     1 
ATOM   3594  C  CA    . LYS A  1 500 ? -41.775 6.340    53.353  1.00 86.60  ? 500 LYS A CA    1 
ATOM   3595  C  C     . LYS A  1 500 ? -42.768 7.492    53.307  1.00 89.16  ? 500 LYS A C     1 
ATOM   3596  O  O     . LYS A  1 500 ? -42.666 8.372    52.461  1.00 89.57  ? 500 LYS A O     1 
ATOM   3597  C  CB    . LYS A  1 500 ? -42.358 5.101    52.674  1.00 89.41  ? 500 LYS A CB    1 
ATOM   3598  C  CG    . LYS A  1 500 ? -42.545 5.232    51.171  1.00 92.44  ? 500 LYS A CG    1 
ATOM   3599  C  CD    . LYS A  1 500 ? -43.145 3.961    50.567  1.00 96.66  ? 500 LYS A CD    1 
ATOM   3600  C  CE    . LYS A  1 500 ? -43.104 3.987    49.042  1.00 99.44  ? 500 LYS A CE    1 
ATOM   3601  N  NZ    . LYS A  1 500 ? -44.043 5.004    48.473  1.00 103.58 ? 500 LYS A NZ    1 
ATOM   3602  N  N     . SER A  1 501 ? -43.721 7.485    54.234  1.00 91.39  ? 501 SER A N     1 
ATOM   3603  C  CA    . SER A  1 501 ? -44.749 8.522    54.296  1.00 94.71  ? 501 SER A CA    1 
ATOM   3604  C  C     . SER A  1 501 ? -44.161 9.884    54.676  1.00 93.04  ? 501 SER A C     1 
ATOM   3605  O  O     . SER A  1 501 ? -44.516 10.912   54.088  1.00 94.91  ? 501 SER A O     1 
ATOM   3606  C  CB    . SER A  1 501 ? -45.853 8.125    55.280  1.00 97.20  ? 501 SER A CB    1 
ATOM   3607  O  OG    . SER A  1 501 ? -46.829 9.146    55.390  1.00 100.61 ? 501 SER A OG    1 
ATOM   3608  N  N     . ALA A  1 502 ? -43.259 9.877    55.654  1.00 89.81  ? 502 ALA A N     1 
ATOM   3609  C  CA    . ALA A  1 502 ? -42.694 11.109   56.167  1.00 88.79  ? 502 ALA A CA    1 
ATOM   3610  C  C     . ALA A  1 502 ? -41.750 11.720   55.139  1.00 87.63  ? 502 ALA A C     1 
ATOM   3611  O  O     . ALA A  1 502 ? -41.656 12.943   55.017  1.00 88.39  ? 502 ALA A O     1 
ATOM   3612  C  CB    . ALA A  1 502 ? -41.992 10.858   57.477  1.00 86.00  ? 502 ALA A CB    1 
ATOM   3613  N  N     . THR A  1 503 ? -41.079 10.854   54.383  1.00 86.46  ? 503 THR A N     1 
ATOM   3614  C  CA    . THR A  1 503 ? -40.139 11.279   53.355  1.00 85.76  ? 503 THR A CA    1 
ATOM   3615  C  C     . THR A  1 503 ? -40.872 11.911   52.173  1.00 89.44  ? 503 THR A C     1 
ATOM   3616  O  O     . THR A  1 503 ? -40.623 13.070   51.822  1.00 90.18  ? 503 THR A O     1 
ATOM   3617  C  CB    . THR A  1 503 ? -39.258 10.107   52.897  1.00 83.60  ? 503 THR A CB    1 
ATOM   3618  O  OG1   . THR A  1 503 ? -38.581 9.558    54.036  1.00 81.13  ? 503 THR A OG1   1 
ATOM   3619  C  CG2   . THR A  1 503 ? -38.223 10.578   51.882  1.00 83.34  ? 503 THR A CG2   1 
ATOM   3620  N  N     . GLU A  1 504 ? -41.799 11.152   51.591  1.00 92.50  ? 504 GLU A N     1 
ATOM   3621  C  CA    . GLU A  1 504 ? -42.573 11.603   50.433  1.00 96.39  ? 504 GLU A CA    1 
ATOM   3622  C  C     . GLU A  1 504 ? -43.307 12.901   50.725  1.00 99.19  ? 504 GLU A C     1 
ATOM   3623  O  O     . GLU A  1 504 ? -43.460 13.738   49.835  1.00 101.81 ? 504 GLU A O     1 
ATOM   3624  C  CB    . GLU A  1 504 ? -43.543 10.517   49.950  1.00 99.13  ? 504 GLU A CB    1 
ATOM   3625  C  CG    . GLU A  1 504 ? -42.869 9.178    49.653  1.00 97.12  ? 504 GLU A CG    1 
ATOM   3626  C  CD    . GLU A  1 504 ? -43.441 8.432    48.456  1.00 101.24 ? 504 GLU A CD    1 
ATOM   3627  O  OE1   . GLU A  1 504 ? -44.493 8.846    47.911  1.00 106.58 ? 504 GLU A OE1   1 
ATOM   3628  O  OE2   . GLU A  1 504 ? -42.822 7.420    48.057  1.00 99.48  ? 504 GLU A OE2   1 
ATOM   3629  N  N     . SER A  1 505 ? -43.736 13.071   51.974  1.00 99.30  ? 505 SER A N     1 
ATOM   3630  C  CA    . SER A  1 505 ? -44.417 14.296   52.395  1.00 102.59 ? 505 SER A CA    1 
ATOM   3631  C  C     . SER A  1 505 ? -43.469 15.484   52.485  1.00 101.38 ? 505 SER A C     1 
ATOM   3632  O  O     . SER A  1 505 ? -43.871 16.621   52.239  1.00 104.43 ? 505 SER A O     1 
ATOM   3633  C  CB    . SER A  1 505 ? -45.160 14.096   53.717  1.00 103.23 ? 505 SER A CB    1 
ATOM   3634  O  OG    . SER A  1 505 ? -46.413 13.477   53.488  1.00 106.98 ? 505 SER A OG    1 
ATOM   3635  N  N     . PHE A  1 506 ? -42.210 15.224   52.823  1.00 97.54  ? 506 PHE A N     1 
ATOM   3636  C  CA    . PHE A  1 506 ? -41.241 16.305   52.891  1.00 96.80  ? 506 PHE A CA    1 
ATOM   3637  C  C     . PHE A  1 506 ? -40.743 16.736   51.512  1.00 98.15  ? 506 PHE A C     1 
ATOM   3638  O  O     . PHE A  1 506 ? -40.586 17.936   51.260  1.00 100.08 ? 506 PHE A O     1 
ATOM   3639  C  CB    . PHE A  1 506 ? -40.068 15.966   53.802  1.00 92.23  ? 506 PHE A CB    1 
ATOM   3640  C  CG    . PHE A  1 506 ? -39.073 17.082   53.921  1.00 91.69  ? 506 PHE A CG    1 
ATOM   3641  C  CD1   . PHE A  1 506 ? -39.316 18.160   54.769  1.00 93.76  ? 506 PHE A CD1   1 
ATOM   3642  C  CD2   . PHE A  1 506 ? -37.902 17.076   53.161  1.00 89.09  ? 506 PHE A CD2   1 
ATOM   3643  C  CE1   . PHE A  1 506 ? -38.396 19.206   54.866  1.00 93.56  ? 506 PHE A CE1   1 
ATOM   3644  C  CE2   . PHE A  1 506 ? -36.984 18.114   53.253  1.00 88.13  ? 506 PHE A CE2   1 
ATOM   3645  C  CZ    . PHE A  1 506 ? -37.228 19.178   54.103  1.00 90.25  ? 506 PHE A CZ    1 
ATOM   3646  N  N     . VAL A  1 507 ? -40.500 15.763   50.631  1.00 97.83  ? 507 VAL A N     1 
ATOM   3647  C  CA    . VAL A  1 507 ? -39.995 16.041   49.278  1.00 99.59  ? 507 VAL A CA    1 
ATOM   3648  C  C     . VAL A  1 507 ? -40.941 16.978   48.504  1.00 105.31 ? 507 VAL A C     1 
ATOM   3649  O  O     . VAL A  1 507 ? -40.523 18.046   48.044  1.00 107.02 ? 507 VAL A O     1 
ATOM   3650  C  CB    . VAL A  1 507 ? -39.710 14.738   48.472  1.00 98.36  ? 507 VAL A CB    1 
ATOM   3651  C  CG1   . VAL A  1 507 ? -39.135 15.061   47.102  1.00 99.85  ? 507 VAL A CG1   1 
ATOM   3652  C  CG2   . VAL A  1 507 ? -38.740 13.846   49.219  1.00 94.28  ? 507 VAL A CG2   1 
ATOM   3653  N  N     . ALA A  1 508 ? -42.210 16.581   48.398  1.00 108.92 ? 508 ALA A N     1 
ATOM   3654  C  CA    . ALA A  1 508 ? -43.236 17.346   47.692  1.00 114.94 ? 508 ALA A CA    1 
ATOM   3655  C  C     . ALA A  1 508 ? -43.343 18.794   48.175  1.00 117.45 ? 508 ALA A C     1 
ATOM   3656  O  O     . ALA A  1 508 ? -43.768 19.679   47.428  1.00 121.99 ? 508 ALA A O     1 
ATOM   3657  C  CB    . ALA A  1 508 ? -44.574 16.650   47.819  1.00 117.75 ? 508 ALA A CB    1 
ATOM   3658  N  N     . THR A  1 509 ? -42.968 19.020   49.431  1.00 115.19 ? 509 THR A N     1 
ATOM   3659  C  CA    . THR A  1 509 ? -42.879 20.365   49.990  1.00 117.31 ? 509 THR A CA    1 
ATOM   3660  C  C     . THR A  1 509 ? -41.416 20.821   49.998  1.00 114.30 ? 509 THR A C     1 
ATOM   3661  O  O     . THR A  1 509 ? -41.127 22.010   49.889  1.00 116.81 ? 509 THR A O     1 
ATOM   3662  C  CB    . THR A  1 509 ? -43.485 20.428   51.419  1.00 117.38 ? 509 THR A CB    1 
ATOM   3663  O  OG1   . THR A  1 509 ? -44.215 21.646   51.583  1.00 122.32 ? 509 THR A OG1   1 
ATOM   3664  C  CG2   . THR A  1 509 ? -42.406 20.313   52.514  1.00 112.95 ? 509 THR A CG2   1 
ATOM   3665  N  N     . ALA B  1 25  ? 44.730  -38.654  68.509  1.00 130.91 ? 25  ALA B N     1 
ATOM   3666  C  CA    . ALA B  1 25  ? 44.113  -37.825  67.431  1.00 123.33 ? 25  ALA B CA    1 
ATOM   3667  C  C     . ALA B  1 25  ? 45.083  -36.770  66.897  1.00 121.51 ? 25  ALA B C     1 
ATOM   3668  O  O     . ALA B  1 25  ? 45.516  -35.872  67.630  1.00 123.42 ? 25  ALA B O     1 
ATOM   3669  C  CB    . ALA B  1 25  ? 42.801  -37.170  67.916  1.00 119.81 ? 25  ALA B CB    1 
ATOM   3670  N  N     . ASN B  1 26  ? 45.420  -36.897  65.615  1.00 118.32 ? 26  ASN B N     1 
ATOM   3671  C  CA    . ASN B  1 26  ? 46.274  -35.939  64.922  1.00 116.18 ? 26  ASN B CA    1 
ATOM   3672  C  C     . ASN B  1 26  ? 45.560  -34.603  64.797  1.00 110.73 ? 26  ASN B C     1 
ATOM   3673  O  O     . ASN B  1 26  ? 44.352  -34.574  64.587  1.00 107.17 ? 26  ASN B O     1 
ATOM   3674  C  CB    . ASN B  1 26  ? 46.620  -36.444  63.514  1.00 114.44 ? 26  ASN B CB    1 
ATOM   3675  C  CG    . ASN B  1 26  ? 46.764  -37.959  63.441  1.00 118.59 ? 26  ASN B CG    1 
ATOM   3676  O  OD1   . ASN B  1 26  ? 47.881  -38.492  63.440  1.00 123.49 ? 26  ASN B OD1   1 
ATOM   3677  N  ND2   . ASN B  1 26  ? 45.632  -38.660  63.371  1.00 117.02 ? 26  ASN B ND2   1 
ATOM   3678  N  N     . LEU B  1 27  ? 46.280  -33.493  64.924  1.00 110.47 ? 27  LEU B N     1 
ATOM   3679  C  CA    . LEU B  1 27  ? 45.675  -32.214  64.557  1.00 105.03 ? 27  LEU B CA    1 
ATOM   3680  C  C     . LEU B  1 27  ? 45.793  -31.979  63.056  1.00 100.86 ? 27  LEU B C     1 
ATOM   3681  O  O     . LEU B  1 27  ? 45.093  -31.138  62.499  1.00 96.90  ? 27  LEU B O     1 
ATOM   3682  C  CB    . LEU B  1 27  ? 46.245  -31.041  65.361  1.00 107.30 ? 27  LEU B CB    1 
ATOM   3683  C  CG    . LEU B  1 27  ? 45.473  -30.681  66.639  1.00 107.92 ? 27  LEU B CG    1 
ATOM   3684  C  CD1   . LEU B  1 27  ? 46.101  -29.462  67.325  1.00 110.13 ? 27  LEU B CD1   1 
ATOM   3685  C  CD2   . LEU B  1 27  ? 43.971  -30.470  66.377  1.00 100.87 ? 27  LEU B CD2   1 
ATOM   3686  N  N     . ASN B  1 28  ? 46.666  -32.751  62.415  1.00 102.19 ? 28  ASN B N     1 
ATOM   3687  C  CA    . ASN B  1 28  ? 46.889  -32.693  60.975  1.00 99.04  ? 28  ASN B CA    1 
ATOM   3688  C  C     . ASN B  1 28  ? 45.817  -33.415  60.160  1.00 95.33  ? 28  ASN B C     1 
ATOM   3689  O  O     . ASN B  1 28  ? 45.475  -32.989  59.056  1.00 91.70  ? 28  ASN B O     1 
ATOM   3690  C  CB    . ASN B  1 28  ? 48.248  -33.317  60.662  1.00 103.39 ? 28  ASN B CB    1 
ATOM   3691  C  CG    . ASN B  1 28  ? 49.358  -32.734  61.500  1.00 107.84 ? 28  ASN B CG    1 
ATOM   3692  O  OD1   . ASN B  1 28  ? 49.489  -31.513  61.613  1.00 107.85 ? 28  ASN B OD1   1 
ATOM   3693  N  ND2   . ASN B  1 28  ? 50.161  -33.601  62.104  1.00 112.66 ? 28  ASN B ND2   1 
ATOM   3694  N  N     . GLU B  1 29  ? 45.312  -34.515  60.718  1.00 96.49  ? 29  GLU B N     1 
ATOM   3695  C  CA    . GLU B  1 29  ? 44.369  -35.418  60.050  1.00 94.29  ? 29  GLU B CA    1 
ATOM   3696  C  C     . GLU B  1 29  ? 42.957  -35.295  60.605  1.00 91.54  ? 29  GLU B C     1 
ATOM   3697  O  O     . GLU B  1 29  ? 41.980  -35.682  59.967  1.00 89.36  ? 29  GLU B O     1 
ATOM   3698  C  CB    . GLU B  1 29  ? 44.826  -36.869  60.236  1.00 98.56  ? 29  GLU B CB    1 
ATOM   3699  C  CG    . GLU B  1 29  ? 46.106  -37.229  59.531  1.00 100.75 ? 29  GLU B CG    1 
ATOM   3700  C  CD    . GLU B  1 29  ? 46.038  -36.967  58.044  1.00 97.90  ? 29  GLU B CD    1 
ATOM   3701  O  OE1   . GLU B  1 29  ? 45.103  -37.474  57.378  1.00 95.58  ? 29  GLU B OE1   1 
ATOM   3702  O  OE2   . GLU B  1 29  ? 46.930  -36.248  57.545  1.00 98.47  ? 29  GLU B OE2   1 
ATOM   3703  N  N     . THR B  1 30  ? 42.873  -34.759  61.810  1.00 92.12  ? 30  THR B N     1 
ATOM   3704  C  CA    . THR B  1 30  ? 41.654  -34.742  62.579  1.00 90.84  ? 30  THR B CA    1 
ATOM   3705  C  C     . THR B  1 30  ? 41.347  -33.287  62.936  1.00 88.20  ? 30  THR B C     1 
ATOM   3706  O  O     . THR B  1 30  ? 42.221  -32.419  62.838  1.00 88.62  ? 30  THR B O     1 
ATOM   3707  C  CB    . THR B  1 30  ? 41.824  -35.675  63.818  1.00 95.80  ? 30  THR B CB    1 
ATOM   3708  O  OG1   . THR B  1 30  ? 41.281  -36.970  63.530  1.00 96.68  ? 30  THR B OG1   1 
ATOM   3709  C  CG2   . THR B  1 30  ? 41.186  -35.110  65.083  1.00 96.86  ? 30  THR B CG2   1 
ATOM   3710  N  N     . GLY B  1 31  ? 40.101  -33.009  63.305  1.00 85.64  ? 31  GLY B N     1 
ATOM   3711  C  CA    . GLY B  1 31  ? 39.737  -31.678  63.755  1.00 83.58  ? 31  GLY B CA    1 
ATOM   3712  C  C     . GLY B  1 31  ? 38.690  -31.703  64.841  1.00 83.97  ? 31  GLY B C     1 
ATOM   3713  O  O     . GLY B  1 31  ? 37.996  -32.701  65.009  1.00 84.94  ? 31  GLY B O     1 
ATOM   3714  N  N     . ARG B  1 32  ? 38.589  -30.606  65.587  1.00 83.88  ? 32  ARG B N     1 
ATOM   3715  C  CA    . ARG B  1 32  ? 37.497  -30.407  66.539  1.00 83.96  ? 32  ARG B CA    1 
ATOM   3716  C  C     . ARG B  1 32  ? 36.672  -29.212  66.071  1.00 79.59  ? 32  ARG B C     1 
ATOM   3717  O  O     . ARG B  1 32  ? 37.231  -28.211  65.614  1.00 78.75  ? 32  ARG B O     1 
ATOM   3718  C  CB    . ARG B  1 32  ? 38.030  -30.169  67.957  1.00 88.78  ? 32  ARG B CB    1 
ATOM   3719  C  CG    . ARG B  1 32  ? 38.703  -31.382  68.625  1.00 95.35  ? 32  ARG B CG    1 
ATOM   3720  C  CD    . ARG B  1 32  ? 37.708  -32.224  69.436  1.00 99.91  ? 32  ARG B CD    1 
ATOM   3721  N  NE    . ARG B  1 32  ? 38.356  -32.949  70.534  1.00 108.43 ? 32  ARG B NE    1 
ATOM   3722  C  CZ    . ARG B  1 32  ? 38.505  -34.273  70.600  1.00 112.82 ? 32  ARG B CZ    1 
ATOM   3723  N  NH1   . ARG B  1 32  ? 38.040  -35.055  69.630  1.00 110.67 ? 32  ARG B NH1   1 
ATOM   3724  N  NH2   . ARG B  1 32  ? 39.115  -34.820  71.649  1.00 119.28 ? 32  ARG B NH2   1 
ATOM   3725  N  N     . VAL B  1 33  ? 35.347  -29.318  66.168  1.00 77.18  ? 33  VAL B N     1 
ATOM   3726  C  CA    . VAL B  1 33  ? 34.462  -28.240  65.739  1.00 72.81  ? 33  VAL B CA    1 
ATOM   3727  C  C     . VAL B  1 33  ? 34.481  -27.103  66.751  1.00 73.75  ? 33  VAL B C     1 
ATOM   3728  O  O     . VAL B  1 33  ? 34.248  -27.313  67.938  1.00 76.07  ? 33  VAL B O     1 
ATOM   3729  C  CB    . VAL B  1 33  ? 33.013  -28.719  65.511  1.00 70.85  ? 33  VAL B CB    1 
ATOM   3730  C  CG1   . VAL B  1 33  ? 32.145  -27.566  65.038  1.00 68.18  ? 33  VAL B CG1   1 
ATOM   3731  C  CG2   . VAL B  1 33  ? 32.966  -29.818  64.483  1.00 69.70  ? 33  VAL B CG2   1 
ATOM   3732  N  N     . LEU B  1 34  ? 34.787  -25.904  66.259  1.00 72.22  ? 34  LEU B N     1 
ATOM   3733  C  CA    . LEU B  1 34  ? 34.734  -24.672  67.049  1.00 73.21  ? 34  LEU B CA    1 
ATOM   3734  C  C     . LEU B  1 34  ? 33.318  -24.111  67.170  1.00 71.26  ? 34  LEU B C     1 
ATOM   3735  O  O     . LEU B  1 34  ? 32.920  -23.660  68.247  1.00 73.06  ? 34  LEU B O     1 
ATOM   3736  C  CB    . LEU B  1 34  ? 35.657  -23.596  66.454  1.00 72.88  ? 34  LEU B CB    1 
ATOM   3737  C  CG    . LEU B  1 34  ? 37.176  -23.744  66.574  1.00 75.49  ? 34  LEU B CG    1 
ATOM   3738  C  CD1   . LEU B  1 34  ? 37.822  -22.388  66.401  1.00 77.00  ? 34  LEU B CD1   1 
ATOM   3739  C  CD2   . LEU B  1 34  ? 37.591  -24.330  67.906  1.00 79.33  ? 34  LEU B CD2   1 
ATOM   3740  N  N     . ALA B  1 35  ? 32.577  -24.142  66.058  1.00 67.98  ? 35  ALA B N     1 
ATOM   3741  C  CA    . ALA B  1 35  ? 31.249  -23.542  65.948  1.00 66.07  ? 35  ALA B CA    1 
ATOM   3742  C  C     . ALA B  1 35  ? 30.518  -24.067  64.712  1.00 63.80  ? 35  ALA B C     1 
ATOM   3743  O  O     . ALA B  1 35  ? 31.145  -24.499  63.753  1.00 63.62  ? 35  ALA B O     1 
ATOM   3744  C  CB    . ALA B  1 35  ? 31.372  -22.055  65.881  1.00 65.60  ? 35  ALA B CB    1 
ATOM   3745  N  N     . VAL B  1 36  ? 29.190  -24.036  64.740  1.00 63.23  ? 36  VAL B N     1 
ATOM   3746  C  CA    . VAL B  1 36  ? 28.362  -24.489  63.612  1.00 61.56  ? 36  VAL B CA    1 
ATOM   3747  C  C     . VAL B  1 36  ? 27.034  -23.728  63.567  1.00 60.90  ? 36  VAL B C     1 
ATOM   3748  O  O     . VAL B  1 36  ? 26.244  -23.787  64.499  1.00 61.74  ? 36  VAL B O     1 
ATOM   3749  C  CB    . VAL B  1 36  ? 28.094  -26.024  63.658  1.00 62.29  ? 36  VAL B CB    1 
ATOM   3750  C  CG1   . VAL B  1 36  ? 27.513  -26.438  65.005  1.00 64.03  ? 36  VAL B CG1   1 
ATOM   3751  C  CG2   . VAL B  1 36  ? 27.163  -26.457  62.525  1.00 61.05  ? 36  VAL B CG2   1 
ATOM   3752  N  N     . GLY B  1 37  ? 26.807  -23.010  62.479  1.00 59.94  ? 37  GLY B N     1 
ATOM   3753  C  CA    . GLY B  1 37  ? 25.546  -22.331  62.245  1.00 60.29  ? 37  GLY B CA    1 
ATOM   3754  C  C     . GLY B  1 37  ? 25.509  -21.808  60.824  1.00 60.42  ? 37  GLY B C     1 
ATOM   3755  O  O     . GLY B  1 37  ? 26.564  -21.623  60.203  1.00 60.43  ? 37  GLY B O     1 
ATOM   3756  N  N     . ASP B  1 38  ? 24.301  -21.590  60.300  1.00 60.95  ? 38  ASP B N     1 
ATOM   3757  C  CA    . ASP B  1 38  ? 24.128  -20.996  58.979  1.00 61.82  ? 38  ASP B CA    1 
ATOM   3758  C  C     . ASP B  1 38  ? 24.813  -21.816  57.863  1.00 62.09  ? 38  ASP B C     1 
ATOM   3759  O  O     . ASP B  1 38  ? 25.298  -21.259  56.865  1.00 62.86  ? 38  ASP B O     1 
ATOM   3760  C  CB    . ASP B  1 38  ? 24.602  -19.528  59.004  1.00 62.28  ? 38  ASP B CB    1 
ATOM   3761  C  CG    . ASP B  1 38  ? 23.760  -18.644  59.953  1.00 64.31  ? 38  ASP B CG    1 
ATOM   3762  O  OD1   . ASP B  1 38  ? 22.798  -19.150  60.568  1.00 64.78  ? 38  ASP B OD1   1 
ATOM   3763  O  OD2   . ASP B  1 38  ? 24.039  -17.428  60.080  1.00 66.56  ? 38  ASP B OD2   1 
ATOM   3764  N  N     . GLY B  1 39  ? 24.854  -23.139  58.046  1.00 61.87  ? 39  GLY B N     1 
ATOM   3765  C  CA    . GLY B  1 39  ? 25.411  -24.059  57.053  1.00 62.67  ? 39  GLY B CA    1 
ATOM   3766  C  C     . GLY B  1 39  ? 26.920  -24.245  57.105  1.00 62.81  ? 39  GLY B C     1 
ATOM   3767  O  O     . GLY B  1 39  ? 27.458  -25.181  56.498  1.00 64.07  ? 39  GLY B O     1 
ATOM   3768  N  N     . ILE B  1 40  ? 27.608  -23.359  57.824  1.00 62.04  ? 40  ILE B N     1 
ATOM   3769  C  CA    . ILE B  1 40  ? 29.061  -23.402  57.943  1.00 61.53  ? 40  ILE B CA    1 
ATOM   3770  C  C     . ILE B  1 40  ? 29.412  -24.148  59.216  1.00 61.44  ? 40  ILE B C     1 
ATOM   3771  O  O     . ILE B  1 40  ? 28.675  -24.107  60.185  1.00 61.80  ? 40  ILE B O     1 
ATOM   3772  C  CB    . ILE B  1 40  ? 29.671  -21.975  58.068  1.00 62.04  ? 40  ILE B CB    1 
ATOM   3773  C  CG1   . ILE B  1 40  ? 28.872  -20.921  57.268  1.00 62.63  ? 40  ILE B CG1   1 
ATOM   3774  C  CG2   . ILE B  1 40  ? 31.180  -21.978  57.769  1.00 61.51  ? 40  ILE B CG2   1 
ATOM   3775  C  CD1   . ILE B  1 40  ? 28.844  -21.143  55.768  1.00 64.63  ? 40  ILE B CD1   1 
ATOM   3776  N  N     . ALA B  1 41  ? 30.543  -24.829  59.215  1.00 61.72  ? 41  ALA B N     1 
ATOM   3777  C  CA    . ALA B  1 41  ? 31.086  -25.400  60.427  1.00 62.38  ? 41  ALA B CA    1 
ATOM   3778  C  C     . ALA B  1 41  ? 32.518  -24.913  60.504  1.00 63.29  ? 41  ALA B C     1 
ATOM   3779  O  O     . ALA B  1 41  ? 33.235  -24.908  59.495  1.00 63.51  ? 41  ALA B O     1 
ATOM   3780  C  CB    . ALA B  1 41  ? 31.033  -26.918  60.379  1.00 63.03  ? 41  ALA B CB    1 
ATOM   3781  N  N     . ARG B  1 42  ? 32.927  -24.471  61.686  1.00 64.23  ? 42  ARG B N     1 
ATOM   3782  C  CA    . ARG B  1 42  ? 34.292  -24.042  61.893  1.00 65.66  ? 42  ARG B CA    1 
ATOM   3783  C  C     . ARG B  1 42  ? 35.027  -25.134  62.655  1.00 67.83  ? 42  ARG B C     1 
ATOM   3784  O  O     . ARG B  1 42  ? 34.574  -25.579  63.707  1.00 69.21  ? 42  ARG B O     1 
ATOM   3785  C  CB    . ARG B  1 42  ? 34.336  -22.710  62.631  1.00 66.33  ? 42  ARG B CB    1 
ATOM   3786  C  CG    . ARG B  1 42  ? 34.244  -21.502  61.720  1.00 65.79  ? 42  ARG B CG    1 
ATOM   3787  C  CD    . ARG B  1 42  ? 33.747  -20.252  62.472  1.00 67.82  ? 42  ARG B CD    1 
ATOM   3788  N  NE    . ARG B  1 42  ? 34.572  -19.937  63.640  1.00 70.27  ? 42  ARG B NE    1 
ATOM   3789  C  CZ    . ARG B  1 42  ? 34.100  -19.510  64.807  1.00 71.28  ? 42  ARG B CZ    1 
ATOM   3790  N  NH1   . ARG B  1 42  ? 32.808  -19.332  64.991  1.00 69.44  ? 42  ARG B NH1   1 
ATOM   3791  N  NH2   . ARG B  1 42  ? 34.927  -19.273  65.806  1.00 76.25  ? 42  ARG B NH2   1 
ATOM   3792  N  N     . VAL B  1 43  ? 36.148  -25.579  62.106  1.00 68.52  ? 43  VAL B N     1 
ATOM   3793  C  CA    . VAL B  1 43  ? 36.890  -26.667  62.694  1.00 70.90  ? 43  VAL B CA    1 
ATOM   3794  C  C     . VAL B  1 43  ? 38.298  -26.183  62.993  1.00 73.31  ? 43  VAL B C     1 
ATOM   3795  O  O     . VAL B  1 43  ? 38.894  -25.460  62.195  1.00 72.97  ? 43  VAL B O     1 
ATOM   3796  C  CB    . VAL B  1 43  ? 36.912  -27.904  61.747  1.00 70.79  ? 43  VAL B CB    1 
ATOM   3797  C  CG1   . VAL B  1 43  ? 37.783  -29.033  62.308  1.00 73.49  ? 43  VAL B CG1   1 
ATOM   3798  C  CG2   . VAL B  1 43  ? 35.494  -28.410  61.490  1.00 68.92  ? 43  VAL B CG2   1 
ATOM   3799  N  N     . PHE B  1 44  ? 38.803  -26.572  64.160  1.00 76.17  ? 44  PHE B N     1 
ATOM   3800  C  CA    . PHE B  1 44  ? 40.167  -26.291  64.585  1.00 79.28  ? 44  PHE B CA    1 
ATOM   3801  C  C     . PHE B  1 44  ? 41.039  -27.471  64.157  1.00 80.67  ? 44  PHE B C     1 
ATOM   3802  O  O     . PHE B  1 44  ? 40.595  -28.615  64.207  1.00 80.89  ? 44  PHE B O     1 
ATOM   3803  C  CB    . PHE B  1 44  ? 40.192  -26.111  66.108  1.00 82.71  ? 44  PHE B CB    1 
ATOM   3804  C  CG    . PHE B  1 44  ? 41.538  -25.737  66.670  1.00 87.45  ? 44  PHE B CG    1 
ATOM   3805  C  CD1   . PHE B  1 44  ? 42.000  -24.422  66.594  1.00 88.35  ? 44  PHE B CD1   1 
ATOM   3806  C  CD2   . PHE B  1 44  ? 42.334  -26.694  67.308  1.00 91.41  ? 44  PHE B CD2   1 
ATOM   3807  C  CE1   . PHE B  1 44  ? 43.246  -24.068  67.124  1.00 93.18  ? 44  PHE B CE1   1 
ATOM   3808  C  CE2   . PHE B  1 44  ? 43.573  -26.353  67.844  1.00 95.90  ? 44  PHE B CE2   1 
ATOM   3809  C  CZ    . PHE B  1 44  ? 44.034  -25.038  67.751  1.00 96.99  ? 44  PHE B CZ    1 
ATOM   3810  N  N     . GLY B  1 45  ? 42.266  -27.200  63.728  1.00 81.84  ? 45  GLY B N     1 
ATOM   3811  C  CA    . GLY B  1 45  ? 43.139  -28.258  63.250  1.00 83.19  ? 45  GLY B CA    1 
ATOM   3812  C  C     . GLY B  1 45  ? 42.917  -28.597  61.789  1.00 79.94  ? 45  GLY B C     1 
ATOM   3813  O  O     . GLY B  1 45  ? 42.823  -27.696  60.947  1.00 77.64  ? 45  GLY B O     1 
ATOM   3814  N  N     . LEU B  1 46  ? 42.816  -29.897  61.498  1.00 80.12  ? 46  LEU B N     1 
ATOM   3815  C  CA    . LEU B  1 46  ? 42.870  -30.419  60.128  1.00 78.76  ? 46  LEU B CA    1 
ATOM   3816  C  C     . LEU B  1 46  ? 44.021  -29.783  59.334  1.00 79.68  ? 46  LEU B C     1 
ATOM   3817  O  O     . LEU B  1 46  ? 43.853  -29.344  58.196  1.00 77.49  ? 46  LEU B O     1 
ATOM   3818  C  CB    . LEU B  1 46  ? 41.531  -30.252  59.403  1.00 75.04  ? 46  LEU B CB    1 
ATOM   3819  C  CG    . LEU B  1 46  ? 40.338  -31.104  59.846  1.00 74.89  ? 46  LEU B CG    1 
ATOM   3820  C  CD1   . LEU B  1 46  ? 39.044  -30.632  59.176  1.00 71.28  ? 46  LEU B CD1   1 
ATOM   3821  C  CD2   . LEU B  1 46  ? 40.574  -32.593  59.580  1.00 77.70  ? 46  LEU B CD2   1 
ATOM   3822  N  N     . ASN B  1 47  ? 45.199  -29.760  59.954  1.00 83.57  ? 47  ASN B N     1 
ATOM   3823  C  CA    . ASN B  1 47  ? 46.369  -29.058  59.426  1.00 85.33  ? 47  ASN B CA    1 
ATOM   3824  C  C     . ASN B  1 47  ? 46.951  -29.585  58.118  1.00 85.67  ? 47  ASN B C     1 
ATOM   3825  O  O     . ASN B  1 47  ? 47.767  -28.916  57.487  1.00 86.70  ? 47  ASN B O     1 
ATOM   3826  C  CB    . ASN B  1 47  ? 47.451  -28.982  60.499  1.00 89.89  ? 47  ASN B CB    1 
ATOM   3827  C  CG    . ASN B  1 47  ? 47.130  -27.961  61.559  1.00 90.50  ? 47  ASN B CG    1 
ATOM   3828  O  OD1   . ASN B  1 47  ? 46.706  -26.845  61.251  1.00 87.94  ? 47  ASN B OD1   1 
ATOM   3829  N  ND2   . ASN B  1 47  ? 47.329  -28.331  62.821  1.00 94.69  ? 47  ASN B ND2   1 
ATOM   3830  N  N     . ASN B  1 48  ? 46.542  -30.783  57.717  1.00 85.42  ? 48  ASN B N     1 
ATOM   3831  C  CA    . ASN B  1 48  ? 46.951  -31.320  56.427  1.00 85.80  ? 48  ASN B CA    1 
ATOM   3832  C  C     . ASN B  1 48  ? 45.795  -31.424  55.430  1.00 82.76  ? 48  ASN B C     1 
ATOM   3833  O  O     . ASN B  1 48  ? 45.884  -32.163  54.449  1.00 83.59  ? 48  ASN B O     1 
ATOM   3834  C  CB    . ASN B  1 48  ? 47.670  -32.662  56.598  1.00 89.16  ? 48  ASN B CB    1 
ATOM   3835  C  CG    . ASN B  1 48  ? 49.053  -32.516  57.240  1.00 93.00  ? 48  ASN B CG    1 
ATOM   3836  O  OD1   . ASN B  1 48  ? 49.570  -31.408  57.412  1.00 92.45  ? 48  ASN B OD1   1 
ATOM   3837  N  ND2   . ASN B  1 48  ? 49.652  -33.645  57.599  1.00 96.05  ? 48  ASN B ND2   1 
ATOM   3838  N  N     . ILE B  1 49  ? 44.718  -30.676  55.674  1.00 79.76  ? 49  ILE B N     1 
ATOM   3839  C  CA    . ILE B  1 49  ? 43.587  -30.676  54.751  1.00 77.24  ? 49  ILE B CA    1 
ATOM   3840  C  C     . ILE B  1 49  ? 43.926  -29.886  53.495  1.00 77.49  ? 49  ILE B C     1 
ATOM   3841  O  O     . ILE B  1 49  ? 44.715  -28.928  53.535  1.00 78.38  ? 49  ILE B O     1 
ATOM   3842  C  CB    . ILE B  1 49  ? 42.269  -30.141  55.392  1.00 74.45  ? 49  ILE B CB    1 
ATOM   3843  C  CG1   . ILE B  1 49  ? 41.054  -30.653  54.615  1.00 72.53  ? 49  ILE B CG1   1 
ATOM   3844  C  CG2   . ILE B  1 49  ? 42.252  -28.615  55.457  1.00 72.39  ? 49  ILE B CG2   1 
ATOM   3845  C  CD1   . ILE B  1 49  ? 39.791  -30.732  55.413  1.00 70.58  ? 49  ILE B CD1   1 
ATOM   3846  N  N     . GLN B  1 50  ? 43.326  -30.308  52.386  1.00 77.27  ? 50  GLN B N     1 
ATOM   3847  C  CA    . GLN B  1 50  ? 43.425  -29.598  51.120  1.00 77.56  ? 50  GLN B CA    1 
ATOM   3848  C  C     . GLN B  1 50  ? 42.260  -28.629  50.949  1.00 75.60  ? 50  GLN B C     1 
ATOM   3849  O  O     . GLN B  1 50  ? 41.154  -28.861  51.447  1.00 73.83  ? 50  GLN B O     1 
ATOM   3850  C  CB    . GLN B  1 50  ? 43.424  -30.589  49.963  1.00 79.13  ? 50  GLN B CB    1 
ATOM   3851  C  CG    . GLN B  1 50  ? 44.654  -31.453  49.888  1.00 81.13  ? 50  GLN B CG    1 
ATOM   3852  C  CD    . GLN B  1 50  ? 44.453  -32.648  48.992  1.00 82.16  ? 50  GLN B CD    1 
ATOM   3853  O  OE1   . GLN B  1 50  ? 43.560  -33.469  49.222  1.00 80.40  ? 50  GLN B OE1   1 
ATOM   3854  N  NE2   . GLN B  1 50  ? 45.291  -32.764  47.966  1.00 84.65  ? 50  GLN B NE2   1 
ATOM   3855  N  N     . ALA B  1 51  ? 42.520  -27.537  50.238  1.00 76.38  ? 51  ALA B N     1 
ATOM   3856  C  CA    . ALA B  1 51  ? 41.467  -26.644  49.806  1.00 75.27  ? 51  ALA B CA    1 
ATOM   3857  C  C     . ALA B  1 51  ? 40.511  -27.458  48.946  1.00 75.61  ? 51  ALA B C     1 
ATOM   3858  O  O     . ALA B  1 51  ? 40.920  -28.033  47.934  1.00 77.60  ? 51  ALA B O     1 
ATOM   3859  C  CB    . ALA B  1 51  ? 42.053  -25.475  49.019  1.00 76.86  ? 51  ALA B CB    1 
ATOM   3860  N  N     . GLU B  1 52  ? 39.256  -27.517  49.385  1.00 74.01  ? 52  GLU B N     1 
ATOM   3861  C  CA    . GLU B  1 52  ? 38.160  -28.200  48.682  1.00 75.23  ? 52  GLU B CA    1 
ATOM   3862  C  C     . GLU B  1 52  ? 38.124  -29.702  48.931  1.00 76.10  ? 52  GLU B C     1 
ATOM   3863  O  O     . GLU B  1 52  ? 37.696  -30.477  48.071  1.00 78.26  ? 52  GLU B O     1 
ATOM   3864  C  CB    . GLU B  1 52  ? 38.153  -27.890  47.182  1.00 77.88  ? 52  GLU B CB    1 
ATOM   3865  C  CG    . GLU B  1 52  ? 37.578  -26.531  46.853  1.00 78.70  ? 52  GLU B CG    1 
ATOM   3866  C  CD    . GLU B  1 52  ? 37.857  -26.104  45.425  1.00 83.56  ? 52  GLU B CD    1 
ATOM   3867  O  OE1   . GLU B  1 52  ? 37.566  -26.878  44.480  1.00 86.45  ? 52  GLU B OE1   1 
ATOM   3868  O  OE2   . GLU B  1 52  ? 38.368  -24.980  45.252  1.00 85.30  ? 52  GLU B OE2   1 
ATOM   3869  N  N     . GLU B  1 53  ? 38.555  -30.103  50.122  1.00 75.31  ? 53  GLU B N     1 
ATOM   3870  C  CA    . GLU B  1 53  ? 38.596  -31.505  50.492  1.00 76.39  ? 53  GLU B CA    1 
ATOM   3871  C  C     . GLU B  1 53  ? 37.317  -31.867  51.229  1.00 75.11  ? 53  GLU B C     1 
ATOM   3872  O  O     . GLU B  1 53  ? 36.827  -31.104  52.063  1.00 73.17  ? 53  GLU B O     1 
ATOM   3873  C  CB    . GLU B  1 53  ? 39.822  -31.766  51.369  1.00 77.07  ? 53  GLU B CB    1 
ATOM   3874  C  CG    . GLU B  1 53  ? 40.111  -33.222  51.689  1.00 79.38  ? 53  GLU B CG    1 
ATOM   3875  C  CD    . GLU B  1 53  ? 41.378  -33.396  52.514  1.00 81.80  ? 53  GLU B CD    1 
ATOM   3876  O  OE1   . GLU B  1 53  ? 42.488  -33.068  52.030  1.00 83.40  ? 53  GLU B OE1   1 
ATOM   3877  O  OE2   . GLU B  1 53  ? 41.261  -33.873  53.659  1.00 82.88  ? 53  GLU B OE2   1 
ATOM   3878  N  N     . LEU B  1 54  ? 36.772  -33.031  50.902  1.00 76.80  ? 54  LEU B N     1 
ATOM   3879  C  CA    . LEU B  1 54  ? 35.644  -33.591  51.637  1.00 76.33  ? 54  LEU B CA    1 
ATOM   3880  C  C     . LEU B  1 54  ? 36.100  -33.957  53.050  1.00 75.92  ? 54  LEU B C     1 
ATOM   3881  O  O     . LEU B  1 54  ? 37.265  -34.292  53.257  1.00 77.25  ? 54  LEU B O     1 
ATOM   3882  C  CB    . LEU B  1 54  ? 35.111  -34.829  50.909  1.00 78.92  ? 54  LEU B CB    1 
ATOM   3883  C  CG    . LEU B  1 54  ? 33.607  -35.107  50.923  1.00 79.51  ? 54  LEU B CG    1 
ATOM   3884  C  CD1   . LEU B  1 54  ? 32.839  -34.013  50.177  1.00 79.36  ? 54  LEU B CD1   1 
ATOM   3885  C  CD2   . LEU B  1 54  ? 33.303  -36.474  50.315  1.00 83.18  ? 54  LEU B CD2   1 
ATOM   3886  N  N     . VAL B  1 55  ? 35.200  -33.846  54.023  1.00 74.65  ? 55  VAL B N     1 
ATOM   3887  C  CA    . VAL B  1 55  ? 35.464  -34.321  55.385  1.00 75.27  ? 55  VAL B CA    1 
ATOM   3888  C  C     . VAL B  1 55  ? 34.286  -35.168  55.821  1.00 76.20  ? 55  VAL B C     1 
ATOM   3889  O  O     . VAL B  1 55  ? 33.204  -35.065  55.244  1.00 75.96  ? 55  VAL B O     1 
ATOM   3890  C  CB    . VAL B  1 55  ? 35.651  -33.175  56.424  1.00 73.27  ? 55  VAL B CB    1 
ATOM   3891  C  CG1   . VAL B  1 55  ? 36.710  -32.183  55.987  1.00 72.86  ? 55  VAL B CG1   1 
ATOM   3892  C  CG2   . VAL B  1 55  ? 34.352  -32.458  56.669  1.00 71.77  ? 55  VAL B CG2   1 
ATOM   3893  N  N     . GLU B  1 56  ? 34.493  -35.999  56.837  1.00 78.06  ? 56  GLU B N     1 
ATOM   3894  C  CA    . GLU B  1 56  ? 33.391  -36.710  57.467  1.00 79.07  ? 56  GLU B CA    1 
ATOM   3895  C  C     . GLU B  1 56  ? 33.270  -36.268  58.927  1.00 78.45  ? 56  GLU B C     1 
ATOM   3896  O  O     . GLU B  1 56  ? 34.275  -36.221  59.650  1.00 79.65  ? 56  GLU B O     1 
ATOM   3897  C  CB    . GLU B  1 56  ? 33.574  -38.226  57.357  1.00 82.68  ? 56  GLU B CB    1 
ATOM   3898  C  CG    . GLU B  1 56  ? 32.377  -39.019  57.882  1.00 85.72  ? 56  GLU B CG    1 
ATOM   3899  C  CD    . GLU B  1 56  ? 32.406  -40.509  57.530  1.00 91.67  ? 56  GLU B CD    1 
ATOM   3900  O  OE1   . GLU B  1 56  ? 33.477  -41.043  57.140  1.00 93.78  ? 56  GLU B OE1   1 
ATOM   3901  O  OE2   . GLU B  1 56  ? 31.335  -41.151  57.655  1.00 93.50  ? 56  GLU B OE2   1 
ATOM   3902  N  N     . PHE B  1 57  ? 32.044  -35.929  59.336  1.00 76.81  ? 57  PHE B N     1 
ATOM   3903  C  CA    . PHE B  1 57  ? 31.728  -35.587  60.726  1.00 76.67  ? 57  PHE B CA    1 
ATOM   3904  C  C     . PHE B  1 57  ? 31.301  -36.816  61.535  1.00 80.20  ? 57  PHE B C     1 
ATOM   3905  O  O     . PHE B  1 57  ? 31.000  -37.870  60.962  1.00 82.04  ? 57  PHE B O     1 
ATOM   3906  C  CB    . PHE B  1 57  ? 30.623  -34.530  60.769  1.00 74.07  ? 57  PHE B CB    1 
ATOM   3907  C  CG    . PHE B  1 57  ? 31.065  -33.178  60.301  1.00 70.82  ? 57  PHE B CG    1 
ATOM   3908  C  CD1   . PHE B  1 57  ? 31.592  -32.260  61.200  1.00 69.49  ? 57  PHE B CD1   1 
ATOM   3909  C  CD2   . PHE B  1 57  ? 30.970  -32.828  58.961  1.00 69.92  ? 57  PHE B CD2   1 
ATOM   3910  C  CE1   . PHE B  1 57  ? 32.012  -31.023  60.780  1.00 67.99  ? 57  PHE B CE1   1 
ATOM   3911  C  CE2   . PHE B  1 57  ? 31.387  -31.580  58.519  1.00 68.02  ? 57  PHE B CE2   1 
ATOM   3912  C  CZ    . PHE B  1 57  ? 31.912  -30.676  59.429  1.00 67.85  ? 57  PHE B CZ    1 
ATOM   3913  N  N     . SER B  1 58  ? 31.272  -36.669  62.864  1.00 81.60  ? 58  SER B N     1 
ATOM   3914  C  CA    . SER B  1 58  ? 30.875  -37.742  63.802  1.00 85.46  ? 58  SER B CA    1 
ATOM   3915  C  C     . SER B  1 58  ? 29.611  -38.485  63.392  1.00 86.31  ? 58  SER B C     1 
ATOM   3916  O  O     . SER B  1 58  ? 29.533  -39.710  63.545  1.00 90.16  ? 58  SER B O     1 
ATOM   3917  C  CB    . SER B  1 58  ? 30.649  -37.181  65.211  1.00 86.30  ? 58  SER B CB    1 
ATOM   3918  O  OG    . SER B  1 58  ? 31.864  -37.015  65.907  1.00 88.46  ? 58  SER B OG    1 
ATOM   3919  N  N     . SER B  1 59  ? 28.627  -37.736  62.886  1.00 83.16  ? 59  SER B N     1 
ATOM   3920  C  CA    . SER B  1 59  ? 27.304  -38.281  62.591  1.00 84.03  ? 59  SER B CA    1 
ATOM   3921  C  C     . SER B  1 59  ? 27.172  -38.896  61.192  1.00 84.25  ? 59  SER B C     1 
ATOM   3922  O  O     . SER B  1 59  ? 26.158  -39.518  60.876  1.00 86.15  ? 59  SER B O     1 
ATOM   3923  C  CB    . SER B  1 59  ? 26.233  -37.216  62.811  1.00 81.54  ? 59  SER B CB    1 
ATOM   3924  O  OG    . SER B  1 59  ? 26.366  -36.181  61.860  1.00 78.38  ? 59  SER B OG    1 
ATOM   3925  N  N     . GLY B  1 60  ? 28.192  -38.731  60.359  1.00 82.85  ? 60  GLY B N     1 
ATOM   3926  C  CA    . GLY B  1 60  ? 28.171  -39.311  59.019  1.00 83.59  ? 60  GLY B CA    1 
ATOM   3927  C  C     . GLY B  1 60  ? 27.994  -38.279  57.926  1.00 80.47  ? 60  GLY B C     1 
ATOM   3928  O  O     . GLY B  1 60  ? 28.350  -38.527  56.774  1.00 81.02  ? 60  GLY B O     1 
ATOM   3929  N  N     . VAL B  1 61  ? 27.437  -37.123  58.292  1.00 77.69  ? 61  VAL B N     1 
ATOM   3930  C  CA    . VAL B  1 61  ? 27.289  -35.993  57.378  1.00 75.09  ? 61  VAL B CA    1 
ATOM   3931  C  C     . VAL B  1 61  ? 28.650  -35.535  56.884  1.00 73.95  ? 61  VAL B C     1 
ATOM   3932  O  O     . VAL B  1 61  ? 29.614  -35.471  57.652  1.00 73.71  ? 61  VAL B O     1 
ATOM   3933  C  CB    . VAL B  1 61  ? 26.539  -34.808  58.032  1.00 72.78  ? 61  VAL B CB    1 
ATOM   3934  C  CG1   . VAL B  1 61  ? 27.344  -34.212  59.183  1.00 71.42  ? 61  VAL B CG1   1 
ATOM   3935  C  CG2   . VAL B  1 61  ? 26.199  -33.741  56.996  1.00 70.81  ? 61  VAL B CG2   1 
ATOM   3936  N  N     . LYS B  1 62  ? 28.730  -35.225  55.597  1.00 73.93  ? 62  LYS B N     1 
ATOM   3937  C  CA    . LYS B  1 62  ? 29.990  -34.780  55.023  1.00 73.39  ? 62  LYS B CA    1 
ATOM   3938  C  C     . LYS B  1 62  ? 29.989  -33.279  54.713  1.00 70.98  ? 62  LYS B C     1 
ATOM   3939  O  O     . LYS B  1 62  ? 28.931  -32.627  54.700  1.00 69.85  ? 62  LYS B O     1 
ATOM   3940  C  CB    . LYS B  1 62  ? 30.350  -35.635  53.806  1.00 75.97  ? 62  LYS B CB    1 
ATOM   3941  C  CG    . LYS B  1 62  ? 30.374  -37.118  54.150  1.00 79.45  ? 62  LYS B CG    1 
ATOM   3942  C  CD    . LYS B  1 62  ? 30.923  -37.983  53.036  1.00 83.57  ? 62  LYS B CD    1 
ATOM   3943  C  CE    . LYS B  1 62  ? 30.609  -39.449  53.302  1.00 87.93  ? 62  LYS B CE    1 
ATOM   3944  N  NZ    . LYS B  1 62  ? 29.126  -39.690  53.349  1.00 89.69  ? 62  LYS B NZ    1 
ATOM   3945  N  N     . GLY B  1 63  ? 31.184  -32.734  54.503  1.00 70.24  ? 63  GLY B N     1 
ATOM   3946  C  CA    . GLY B  1 63  ? 31.338  -31.318  54.192  1.00 68.46  ? 63  GLY B CA    1 
ATOM   3947  C  C     . GLY B  1 63  ? 32.493  -31.060  53.256  1.00 69.07  ? 63  GLY B C     1 
ATOM   3948  O  O     . GLY B  1 63  ? 33.205  -31.983  52.866  1.00 70.88  ? 63  GLY B O     1 
ATOM   3949  N  N     . MET B  1 64  ? 32.681  -29.798  52.895  1.00 68.05  ? 64  MET B N     1 
ATOM   3950  C  CA    . MET B  1 64  ? 33.778  -29.412  52.017  1.00 68.90  ? 64  MET B CA    1 
ATOM   3951  C  C     . MET B  1 64  ? 34.586  -28.319  52.686  1.00 67.28  ? 64  MET B C     1 
ATOM   3952  O  O     . MET B  1 64  ? 34.024  -27.441  53.321  1.00 66.03  ? 64  MET B O     1 
ATOM   3953  C  CB    . MET B  1 64  ? 33.228  -28.918  50.685  1.00 70.37  ? 64  MET B CB    1 
ATOM   3954  C  CG    . MET B  1 64  ? 34.286  -28.662  49.645  1.00 73.25  ? 64  MET B CG    1 
ATOM   3955  S  SD    . MET B  1 64  ? 33.675  -27.593  48.336  1.00 77.82  ? 64  MET B SD    1 
ATOM   3956  C  CE    . MET B  1 64  ? 33.658  -26.005  49.164  1.00 75.22  ? 64  MET B CE    1 
ATOM   3957  N  N     . ALA B  1 65  ? 35.904  -28.376  52.562  1.00 67.90  ? 65  ALA B N     1 
ATOM   3958  C  CA    . ALA B  1 65  ? 36.738  -27.344  53.147  1.00 67.41  ? 65  ALA B CA    1 
ATOM   3959  C  C     . ALA B  1 65  ? 36.753  -26.170  52.189  1.00 67.98  ? 65  ALA B C     1 
ATOM   3960  O  O     . ALA B  1 65  ? 37.408  -26.204  51.152  1.00 69.76  ? 65  ALA B O     1 
ATOM   3961  C  CB    . ALA B  1 65  ? 38.141  -27.858  53.410  1.00 68.60  ? 65  ALA B CB    1 
ATOM   3962  N  N     . LEU B  1 66  ? 36.000  -25.133  52.522  1.00 66.97  ? 66  LEU B N     1 
ATOM   3963  C  CA    . LEU B  1 66  ? 35.892  -24.013  51.612  1.00 68.07  ? 66  LEU B CA    1 
ATOM   3964  C  C     . LEU B  1 66  ? 36.995  -23.004  51.873  1.00 68.95  ? 66  LEU B C     1 
ATOM   3965  O  O     . LEU B  1 66  ? 37.802  -22.711  50.986  1.00 71.11  ? 66  LEU B O     1 
ATOM   3966  C  CB    . LEU B  1 66  ? 34.512  -23.364  51.690  1.00 67.11  ? 66  LEU B CB    1 
ATOM   3967  C  CG    . LEU B  1 66  ? 34.323  -22.143  50.797  1.00 68.95  ? 66  LEU B CG    1 
ATOM   3968  C  CD1   . LEU B  1 66  ? 34.487  -22.494  49.317  1.00 71.76  ? 66  LEU B CD1   1 
ATOM   3969  C  CD2   . LEU B  1 66  ? 32.968  -21.512  51.061  1.00 69.30  ? 66  LEU B CD2   1 
ATOM   3970  N  N     . ASN B  1 67  ? 37.026  -22.473  53.089  1.00 67.85  ? 67  ASN B N     1 
ATOM   3971  C  CA    . ASN B  1 67  ? 37.976  -21.435  53.421  1.00 68.96  ? 67  ASN B CA    1 
ATOM   3972  C  C     . ASN B  1 67  ? 38.968  -21.884  54.502  1.00 69.13  ? 67  ASN B C     1 
ATOM   3973  O  O     . ASN B  1 67  ? 38.568  -22.321  55.594  1.00 67.90  ? 67  ASN B O     1 
ATOM   3974  C  CB    . ASN B  1 67  ? 37.254  -20.104  53.711  1.00 69.05  ? 67  ASN B CB    1 
ATOM   3975  C  CG    . ASN B  1 67  ? 36.652  -20.033  55.098  1.00 68.62  ? 67  ASN B CG    1 
ATOM   3976  O  OD1   . ASN B  1 67  ? 37.367  -19.797  56.077  1.00 70.55  ? 67  ASN B OD1   1 
ATOM   3977  N  ND2   . ASN B  1 67  ? 35.323  -20.194  55.192  1.00 67.73  ? 67  ASN B ND2   1 
ATOM   3978  N  N     . LEU B  1 68  ? 40.260  -21.806  54.147  1.00 70.79  ? 68  LEU B N     1 
ATOM   3979  C  CA    . LEU B  1 68  ? 41.375  -22.319  54.946  1.00 71.47  ? 68  LEU B CA    1 
ATOM   3980  C  C     . LEU B  1 68  ? 42.159  -21.201  55.588  1.00 73.32  ? 68  LEU B C     1 
ATOM   3981  O  O     . LEU B  1 68  ? 42.788  -20.423  54.896  1.00 75.09  ? 68  LEU B O     1 
ATOM   3982  C  CB    . LEU B  1 68  ? 42.334  -23.113  54.061  1.00 72.98  ? 68  LEU B CB    1 
ATOM   3983  C  CG    . LEU B  1 68  ? 41.873  -24.409  53.407  1.00 71.83  ? 68  LEU B CG    1 
ATOM   3984  C  CD1   . LEU B  1 68  ? 43.055  -25.084  52.782  1.00 73.70  ? 68  LEU B CD1   1 
ATOM   3985  C  CD2   . LEU B  1 68  ? 41.244  -25.309  54.418  1.00 70.07  ? 68  LEU B CD2   1 
ATOM   3986  N  N     . GLU B  1 69  ? 42.159  -21.149  56.913  1.00 73.83  ? 69  GLU B N     1 
ATOM   3987  C  CA    . GLU B  1 69  ? 42.779  -20.046  57.637  1.00 76.79  ? 69  GLU B CA    1 
ATOM   3988  C  C     . GLU B  1 69  ? 43.823  -20.494  58.653  1.00 79.22  ? 69  GLU B C     1 
ATOM   3989  O  O     . GLU B  1 69  ? 43.868  -21.676  59.017  1.00 78.68  ? 69  GLU B O     1 
ATOM   3990  C  CB    . GLU B  1 69  ? 41.702  -19.238  58.365  1.00 75.94  ? 69  GLU B CB    1 
ATOM   3991  C  CG    . GLU B  1 69  ? 40.832  -18.400  57.449  1.00 77.15  ? 69  GLU B CG    1 
ATOM   3992  C  CD    . GLU B  1 69  ? 39.505  -18.015  58.086  1.00 78.52  ? 69  GLU B CD    1 
ATOM   3993  O  OE1   . GLU B  1 69  ? 39.378  -18.096  59.331  1.00 79.95  ? 69  GLU B OE1   1 
ATOM   3994  O  OE2   . GLU B  1 69  ? 38.587  -17.620  57.336  1.00 78.83  ? 69  GLU B OE2   1 
ATOM   3995  N  N     . PRO B  1 70  ? 44.671  -19.544  59.112  1.00 82.41  ? 70  PRO B N     1 
ATOM   3996  C  CA    . PRO B  1 70  ? 45.442  -19.722  60.334  1.00 85.72  ? 70  PRO B CA    1 
ATOM   3997  C  C     . PRO B  1 70  ? 44.500  -19.981  61.489  1.00 85.06  ? 70  PRO B C     1 
ATOM   3998  O  O     . PRO B  1 70  ? 43.607  -19.167  61.752  1.00 84.74  ? 70  PRO B O     1 
ATOM   3999  C  CB    . PRO B  1 70  ? 46.122  -18.359  60.528  1.00 88.87  ? 70  PRO B CB    1 
ATOM   4000  C  CG    . PRO B  1 70  ? 45.483  -17.447  59.562  1.00 86.87  ? 70  PRO B CG    1 
ATOM   4001  C  CD    . PRO B  1 70  ? 45.047  -18.295  58.433  1.00 83.81  ? 70  PRO B CD    1 
ATOM   4002  N  N     . GLY B  1 71  ? 44.657  -21.126  62.137  1.00 85.81  ? 71  GLY B N     1 
ATOM   4003  C  CA    . GLY B  1 71  ? 43.902  -21.427  63.343  1.00 86.33  ? 71  GLY B CA    1 
ATOM   4004  C  C     . GLY B  1 71  ? 42.496  -21.986  63.201  1.00 82.57  ? 71  GLY B C     1 
ATOM   4005  O  O     . GLY B  1 71  ? 41.866  -22.287  64.220  1.00 83.26  ? 71  GLY B O     1 
ATOM   4006  N  N     . GLN B  1 72  ? 41.992  -22.114  61.968  1.00 79.30  ? 72  GLN B N     1 
ATOM   4007  C  CA    . GLN B  1 72  ? 40.671  -22.747  61.720  1.00 75.87  ? 72  GLN B CA    1 
ATOM   4008  C  C     . GLN B  1 72  ? 40.304  -22.970  60.253  1.00 72.95  ? 72  GLN B C     1 
ATOM   4009  O  O     . GLN B  1 72  ? 40.749  -22.242  59.373  1.00 73.27  ? 72  GLN B O     1 
ATOM   4010  C  CB    . GLN B  1 72  ? 39.539  -21.971  62.394  1.00 74.87  ? 72  GLN B CB    1 
ATOM   4011  C  CG    . GLN B  1 72  ? 39.394  -20.542  61.900  1.00 75.65  ? 72  GLN B CG    1 
ATOM   4012  C  CD    . GLN B  1 72  ? 38.117  -19.906  62.372  1.00 74.81  ? 72  GLN B CD    1 
ATOM   4013  O  OE1   . GLN B  1 72  ? 37.971  -19.568  63.546  1.00 77.04  ? 72  GLN B OE1   1 
ATOM   4014  N  NE2   . GLN B  1 72  ? 37.176  -19.738  61.457  1.00 73.37  ? 72  GLN B NE2   1 
ATOM   4015  N  N     . VAL B  1 73  ? 39.461  -23.972  60.020  1.00 70.79  ? 73  VAL B N     1 
ATOM   4016  C  CA    . VAL B  1 73  ? 38.941  -24.298  58.691  1.00 68.66  ? 73  VAL B CA    1 
ATOM   4017  C  C     . VAL B  1 73  ? 37.434  -24.017  58.599  1.00 66.02  ? 73  VAL B C     1 
ATOM   4018  O  O     . VAL B  1 73  ? 36.664  -24.425  59.470  1.00 65.57  ? 73  VAL B O     1 
ATOM   4019  C  CB    . VAL B  1 73  ? 39.140  -25.795  58.375  1.00 69.01  ? 73  VAL B CB    1 
ATOM   4020  C  CG1   . VAL B  1 73  ? 38.766  -26.099  56.926  1.00 68.19  ? 73  VAL B CG1   1 
ATOM   4021  C  CG2   . VAL B  1 73  ? 40.557  -26.228  58.672  1.00 71.78  ? 73  VAL B CG2   1 
ATOM   4022  N  N     . GLY B  1 74  ? 37.015  -23.335  57.541  1.00 64.56  ? 74  GLY B N     1 
ATOM   4023  C  CA    . GLY B  1 74  ? 35.592  -23.142  57.290  1.00 62.68  ? 74  GLY B CA    1 
ATOM   4024  C  C     . GLY B  1 74  ? 35.050  -24.260  56.419  1.00 62.07  ? 74  GLY B C     1 
ATOM   4025  O  O     . GLY B  1 74  ? 35.513  -24.455  55.279  1.00 62.79  ? 74  GLY B O     1 
ATOM   4026  N  N     . ILE B  1 75  ? 34.075  -25.003  56.949  1.00 60.84  ? 75  ILE B N     1 
ATOM   4027  C  CA    . ILE B  1 75  ? 33.501  -26.153  56.228  1.00 60.42  ? 75  ILE B CA    1 
ATOM   4028  C  C     . ILE B  1 75  ? 32.013  -25.990  55.947  1.00 59.45  ? 75  ILE B C     1 
ATOM   4029  O  O     . ILE B  1 75  ? 31.232  -25.739  56.846  1.00 58.80  ? 75  ILE B O     1 
ATOM   4030  C  CB    . ILE B  1 75  ? 33.815  -27.503  56.936  1.00 60.97  ? 75  ILE B CB    1 
ATOM   4031  C  CG1   . ILE B  1 75  ? 35.268  -27.874  56.702  1.00 61.45  ? 75  ILE B CG1   1 
ATOM   4032  C  CG2   . ILE B  1 75  ? 32.934  -28.637  56.421  1.00 61.19  ? 75  ILE B CG2   1 
ATOM   4033  C  CD1   . ILE B  1 75  ? 35.908  -28.448  57.906  1.00 63.01  ? 75  ILE B CD1   1 
ATOM   4034  N  N     . VAL B  1 76  ? 31.644  -26.135  54.682  1.00 60.10  ? 76  VAL B N     1 
ATOM   4035  C  CA    . VAL B  1 76  ? 30.262  -26.047  54.249  1.00 60.33  ? 76  VAL B CA    1 
ATOM   4036  C  C     . VAL B  1 76  ? 29.631  -27.438  54.351  1.00 61.08  ? 76  VAL B C     1 
ATOM   4037  O  O     . VAL B  1 76  ? 30.131  -28.398  53.762  1.00 62.58  ? 76  VAL B O     1 
ATOM   4038  C  CB    . VAL B  1 76  ? 30.177  -25.530  52.794  1.00 61.74  ? 76  VAL B CB    1 
ATOM   4039  C  CG1   . VAL B  1 76  ? 28.750  -25.283  52.399  1.00 62.55  ? 76  VAL B CG1   1 
ATOM   4040  C  CG2   . VAL B  1 76  ? 30.966  -24.246  52.633  1.00 62.14  ? 76  VAL B CG2   1 
ATOM   4041  N  N     . LEU B  1 77  ? 28.534  -27.544  55.096  1.00 60.57  ? 77  LEU B N     1 
ATOM   4042  C  CA    . LEU B  1 77  ? 27.849  -28.822  55.297  1.00 61.59  ? 77  LEU B CA    1 
ATOM   4043  C  C     . LEU B  1 77  ? 27.009  -29.323  54.116  1.00 63.64  ? 77  LEU B C     1 
ATOM   4044  O  O     . LEU B  1 77  ? 26.267  -28.563  53.501  1.00 64.19  ? 77  LEU B O     1 
ATOM   4045  C  CB    . LEU B  1 77  ? 26.957  -28.736  56.529  1.00 60.71  ? 77  LEU B CB    1 
ATOM   4046  C  CG    . LEU B  1 77  ? 27.592  -28.267  57.829  1.00 59.82  ? 77  LEU B CG    1 
ATOM   4047  C  CD1   . LEU B  1 77  ? 26.620  -28.591  58.923  1.00 61.88  ? 77  LEU B CD1   1 
ATOM   4048  C  CD2   . LEU B  1 77  ? 28.906  -28.973  58.113  1.00 61.53  ? 77  LEU B CD2   1 
ATOM   4049  N  N     . PHE B  1 78  ? 27.116  -30.614  53.824  1.00 65.62  ? 78  PHE B N     1 
ATOM   4050  C  CA    . PHE B  1 78  ? 26.209  -31.272  52.878  1.00 68.66  ? 78  PHE B CA    1 
ATOM   4051  C  C     . PHE B  1 78  ? 25.001  -31.905  53.597  1.00 69.82  ? 78  PHE B C     1 
ATOM   4052  O  O     . PHE B  1 78  ? 24.667  -33.081  53.397  1.00 71.78  ? 78  PHE B O     1 
ATOM   4053  C  CB    . PHE B  1 78  ? 26.950  -32.302  52.007  1.00 70.78  ? 78  PHE B CB    1 
ATOM   4054  C  CG    . PHE B  1 78  ? 27.895  -31.689  51.004  1.00 70.83  ? 78  PHE B CG    1 
ATOM   4055  C  CD1   . PHE B  1 78  ? 27.421  -30.864  49.991  1.00 72.08  ? 78  PHE B CD1   1 
ATOM   4056  C  CD2   . PHE B  1 78  ? 29.259  -31.946  51.069  1.00 70.24  ? 78  PHE B CD2   1 
ATOM   4057  C  CE1   . PHE B  1 78  ? 28.292  -30.297  49.070  1.00 72.54  ? 78  PHE B CE1   1 
ATOM   4058  C  CE2   . PHE B  1 78  ? 30.132  -31.386  50.150  1.00 70.32  ? 78  PHE B CE2   1 
ATOM   4059  C  CZ    . PHE B  1 78  ? 29.647  -30.560  49.151  1.00 71.60  ? 78  PHE B CZ    1 
ATOM   4060  N  N     . GLY B  1 79  ? 24.352  -31.104  54.435  1.00 68.73  ? 79  GLY B N     1 
ATOM   4061  C  CA    . GLY B  1 79  ? 23.164  -31.536  55.156  1.00 70.64  ? 79  GLY B CA    1 
ATOM   4062  C  C     . GLY B  1 79  ? 22.833  -30.584  56.280  1.00 69.25  ? 79  GLY B C     1 
ATOM   4063  O  O     . GLY B  1 79  ? 23.520  -29.587  56.470  1.00 67.99  ? 79  GLY B O     1 
ATOM   4064  N  N     . SER B  1 80  ? 21.788  -30.905  57.034  1.00 70.63  ? 80  SER B N     1 
ATOM   4065  C  CA    . SER B  1 80  ? 21.309  -30.072  58.144  1.00 69.90  ? 80  SER B CA    1 
ATOM   4066  C  C     . SER B  1 80  ? 22.402  -29.778  59.181  1.00 68.39  ? 80  SER B C     1 
ATOM   4067  O  O     . SER B  1 80  ? 23.213  -30.651  59.492  1.00 69.10  ? 80  SER B O     1 
ATOM   4068  C  CB    . SER B  1 80  ? 20.113  -30.764  58.816  1.00 71.86  ? 80  SER B CB    1 
ATOM   4069  O  OG    . SER B  1 80  ? 19.635  -30.037  59.928  1.00 70.97  ? 80  SER B OG    1 
ATOM   4070  N  N     . ASP B  1 81  ? 22.405  -28.551  59.707  1.00 67.10  ? 81  ASP B N     1 
ATOM   4071  C  CA    . ASP B  1 81  ? 23.344  -28.125  60.749  1.00 66.30  ? 81  ASP B CA    1 
ATOM   4072  C  C     . ASP B  1 81  ? 23.102  -28.882  62.047  1.00 67.13  ? 81  ASP B C     1 
ATOM   4073  O  O     . ASP B  1 81  ? 24.021  -29.057  62.850  1.00 67.49  ? 81  ASP B O     1 
ATOM   4074  C  CB    . ASP B  1 81  ? 23.226  -26.624  61.034  1.00 65.73  ? 81  ASP B CB    1 
ATOM   4075  C  CG    . ASP B  1 81  ? 23.126  -25.775  59.771  1.00 68.28  ? 81  ASP B CG    1 
ATOM   4076  O  OD1   . ASP B  1 81  ? 23.475  -26.258  58.662  1.00 71.71  ? 81  ASP B OD1   1 
ATOM   4077  O  OD2   . ASP B  1 81  ? 22.678  -24.606  59.890  1.00 71.47  ? 81  ASP B OD2   1 
ATOM   4078  N  N     . ARG B  1 82  ? 21.863  -29.319  62.256  1.00 67.93  ? 82  ARG B N     1 
ATOM   4079  C  CA    . ARG B  1 82  ? 21.525  -30.165  63.394  1.00 69.48  ? 82  ARG B CA    1 
ATOM   4080  C  C     . ARG B  1 82  ? 22.518  -31.315  63.501  1.00 70.70  ? 82  ARG B C     1 
ATOM   4081  O  O     . ARG B  1 82  ? 22.837  -31.788  64.598  1.00 72.43  ? 82  ARG B O     1 
ATOM   4082  C  CB    . ARG B  1 82  ? 20.107  -30.712  63.252  1.00 71.02  ? 82  ARG B CB    1 
ATOM   4083  C  CG    . ARG B  1 82  ? 19.750  -31.737  64.296  1.00 73.05  ? 82  ARG B CG    1 
ATOM   4084  C  CD    . ARG B  1 82  ? 18.269  -31.973  64.367  1.00 75.47  ? 82  ARG B CD    1 
ATOM   4085  N  NE    . ARG B  1 82  ? 17.984  -33.127  65.214  1.00 79.12  ? 82  ARG B NE    1 
ATOM   4086  C  CZ    . ARG B  1 82  ? 17.763  -33.074  66.525  1.00 80.18  ? 82  ARG B CZ    1 
ATOM   4087  N  NH1   . ARG B  1 82  ? 17.780  -31.911  67.169  1.00 77.43  ? 82  ARG B NH1   1 
ATOM   4088  N  NH2   . ARG B  1 82  ? 17.527  -34.200  67.190  1.00 83.91  ? 82  ARG B NH2   1 
ATOM   4089  N  N     . LEU B  1 83  ? 23.022  -31.736  62.347  1.00 70.04  ? 83  LEU B N     1 
ATOM   4090  C  CA    . LEU B  1 83  ? 23.907  -32.880  62.270  1.00 71.54  ? 83  LEU B CA    1 
ATOM   4091  C  C     . LEU B  1 83  ? 25.380  -32.651  62.684  1.00 70.95  ? 83  LEU B C     1 
ATOM   4092  O  O     . LEU B  1 83  ? 26.176  -33.587  62.598  1.00 72.68  ? 83  LEU B O     1 
ATOM   4093  C  CB    . LEU B  1 83  ? 23.804  -33.517  60.874  1.00 72.08  ? 83  LEU B CB    1 
ATOM   4094  C  CG    . LEU B  1 83  ? 22.514  -34.285  60.538  1.00 73.87  ? 83  LEU B CG    1 
ATOM   4095  C  CD1   . LEU B  1 83  ? 22.525  -34.743  59.090  1.00 74.55  ? 83  LEU B CD1   1 
ATOM   4096  C  CD2   . LEU B  1 83  ? 22.303  -35.483  61.458  1.00 76.05  ? 83  LEU B CD2   1 
ATOM   4097  N  N     . VAL B  1 84  ? 25.738  -31.444  63.144  1.00 69.11  ? 84  VAL B N     1 
ATOM   4098  C  CA    . VAL B  1 84  ? 27.121  -31.137  63.598  1.00 69.08  ? 84  VAL B CA    1 
ATOM   4099  C  C     . VAL B  1 84  ? 27.158  -30.308  64.892  1.00 69.76  ? 84  VAL B C     1 
ATOM   4100  O  O     . VAL B  1 84  ? 26.646  -29.198  64.919  1.00 68.84  ? 84  VAL B O     1 
ATOM   4101  C  CB    . VAL B  1 84  ? 27.921  -30.364  62.522  1.00 66.80  ? 84  VAL B CB    1 
ATOM   4102  C  CG1   . VAL B  1 84  ? 29.280  -29.942  63.058  1.00 67.03  ? 84  VAL B CG1   1 
ATOM   4103  C  CG2   . VAL B  1 84  ? 28.084  -31.183  61.257  1.00 67.16  ? 84  VAL B CG2   1 
ATOM   4104  N  N     . LYS B  1 85  ? 27.774  -30.826  65.953  1.00 72.45  ? 85  LYS B N     1 
ATOM   4105  C  CA    . LYS B  1 85  ? 27.845  -30.101  67.239  1.00 73.75  ? 85  LYS B CA    1 
ATOM   4106  C  C     . LYS B  1 85  ? 29.223  -29.494  67.501  1.00 74.40  ? 85  LYS B C     1 
ATOM   4107  O  O     . LYS B  1 85  ? 30.216  -29.968  66.969  1.00 74.62  ? 85  LYS B O     1 
ATOM   4108  C  CB    . LYS B  1 85  ? 27.508  -31.023  68.422  1.00 77.42  ? 85  LYS B CB    1 
ATOM   4109  C  CG    . LYS B  1 85  ? 26.134  -31.659  68.410  1.00 76.69  ? 85  LYS B CG    1 
ATOM   4110  C  CD    . LYS B  1 85  ? 25.745  -32.103  69.803  1.00 78.46  ? 85  LYS B CD    1 
ATOM   4111  C  CE    . LYS B  1 85  ? 24.559  -33.031  69.748  1.00 79.84  ? 85  LYS B CE    1 
ATOM   4112  N  NZ    . LYS B  1 85  ? 23.731  -32.948  70.987  1.00 83.59  ? 85  LYS B NZ    1 
ATOM   4113  N  N     . GLU B  1 86  ? 29.286  -28.467  68.347  1.00 75.26  ? 86  GLU B N     1 
ATOM   4114  C  CA    . GLU B  1 86  ? 30.571  -27.971  68.823  1.00 77.18  ? 86  GLU B CA    1 
ATOM   4115  C  C     . GLU B  1 86  ? 31.236  -29.062  69.635  1.00 81.65  ? 86  GLU B C     1 
ATOM   4116  O  O     . GLU B  1 86  ? 30.576  -29.753  70.405  1.00 84.17  ? 86  GLU B O     1 
ATOM   4117  C  CB    . GLU B  1 86  ? 30.425  -26.726  69.697  1.00 78.08  ? 86  GLU B CB    1 
ATOM   4118  C  CG    . GLU B  1 86  ? 31.740  -25.961  69.860  1.00 79.34  ? 86  GLU B CG    1 
ATOM   4119  C  CD    . GLU B  1 86  ? 31.963  -25.350  71.242  1.00 83.07  ? 86  GLU B CD    1 
ATOM   4120  O  OE1   . GLU B  1 86  ? 31.115  -25.513  72.140  1.00 84.10  ? 86  GLU B OE1   1 
ATOM   4121  O  OE2   . GLU B  1 86  ? 33.014  -24.700  71.430  1.00 85.58  ? 86  GLU B OE2   1 
ATOM   4122  N  N     . GLY B  1 87  ? 32.546  -29.206  69.450  1.00 83.34  ? 87  GLY B N     1 
ATOM   4123  C  CA    . GLY B  1 87  ? 33.342  -30.182  70.179  1.00 88.19  ? 87  GLY B CA    1 
ATOM   4124  C  C     . GLY B  1 87  ? 33.457  -31.510  69.461  1.00 88.51  ? 87  GLY B C     1 
ATOM   4125  O  O     . GLY B  1 87  ? 34.011  -32.463  70.003  1.00 92.84  ? 87  GLY B O     1 
ATOM   4126  N  N     . GLU B  1 88  ? 32.945  -31.583  68.239  1.00 84.70  ? 88  GLU B N     1 
ATOM   4127  C  CA    . GLU B  1 88  ? 32.889  -32.856  67.544  1.00 85.46  ? 88  GLU B CA    1 
ATOM   4128  C  C     . GLU B  1 88  ? 34.136  -33.172  66.746  1.00 85.70  ? 88  GLU B C     1 
ATOM   4129  O  O     . GLU B  1 88  ? 34.812  -32.277  66.226  1.00 83.75  ? 88  GLU B O     1 
ATOM   4130  C  CB    . GLU B  1 88  ? 31.653  -32.957  66.655  1.00 82.43  ? 88  GLU B CB    1 
ATOM   4131  C  CG    . GLU B  1 88  ? 30.478  -33.648  67.339  1.00 85.87  ? 88  GLU B CG    1 
ATOM   4132  C  CD    . GLU B  1 88  ? 29.216  -33.670  66.487  1.00 85.49  ? 88  GLU B CD    1 
ATOM   4133  O  OE1   . GLU B  1 88  ? 29.315  -33.549  65.237  1.00 83.59  ? 88  GLU B OE1   1 
ATOM   4134  O  OE2   . GLU B  1 88  ? 28.120  -33.815  67.074  1.00 86.83  ? 88  GLU B OE2   1 
ATOM   4135  N  N     . LEU B  1 89  ? 34.425  -34.468  66.671  1.00 88.37  ? 89  LEU B N     1 
ATOM   4136  C  CA    . LEU B  1 89  ? 35.483  -35.001  65.843  1.00 88.92  ? 89  LEU B CA    1 
ATOM   4137  C  C     . LEU B  1 89  ? 35.159  -34.831  64.355  1.00 85.08  ? 89  LEU B C     1 
ATOM   4138  O  O     . LEU B  1 89  ? 34.024  -35.058  63.933  1.00 83.87  ? 89  LEU B O     1 
ATOM   4139  C  CB    . LEU B  1 89  ? 35.657  -36.479  66.172  1.00 93.29  ? 89  LEU B CB    1 
ATOM   4140  C  CG    . LEU B  1 89  ? 36.724  -37.294  65.447  1.00 95.02  ? 89  LEU B CG    1 
ATOM   4141  C  CD1   . LEU B  1 89  ? 38.100  -36.712  65.696  1.00 95.50  ? 89  LEU B CD1   1 
ATOM   4142  C  CD2   . LEU B  1 89  ? 36.645  -38.743  65.910  1.00 100.10 ? 89  LEU B CD2   1 
ATOM   4143  N  N     . VAL B  1 90  ? 36.152  -34.410  63.571  1.00 83.92  ? 90  VAL B N     1 
ATOM   4144  C  CA    . VAL B  1 90  ? 36.039  -34.378  62.116  1.00 81.09  ? 90  VAL B CA    1 
ATOM   4145  C  C     . VAL B  1 90  ? 37.276  -34.994  61.485  1.00 83.14  ? 90  VAL B C     1 
ATOM   4146  O  O     . VAL B  1 90  ? 38.400  -34.550  61.752  1.00 84.57  ? 90  VAL B O     1 
ATOM   4147  C  CB    . VAL B  1 90  ? 35.936  -32.963  61.585  1.00 77.63  ? 90  VAL B CB    1 
ATOM   4148  C  CG1   . VAL B  1 90  ? 35.324  -32.983  60.197  1.00 75.73  ? 90  VAL B CG1   1 
ATOM   4149  C  CG2   . VAL B  1 90  ? 35.124  -32.103  62.519  1.00 76.75  ? 90  VAL B CG2   1 
ATOM   4150  N  N     . LYS B  1 91  ? 37.066  -36.005  60.642  1.00 83.76  ? 91  LYS B N     1 
ATOM   4151  C  CA    . LYS B  1 91  ? 38.164  -36.730  59.987  1.00 85.64  ? 91  LYS B CA    1 
ATOM   4152  C  C     . LYS B  1 91  ? 38.350  -36.238  58.556  1.00 83.19  ? 91  LYS B C     1 
ATOM   4153  O  O     . LYS B  1 91  ? 37.376  -36.012  57.835  1.00 80.89  ? 91  LYS B O     1 
ATOM   4154  C  CB    . LYS B  1 91  ? 37.894  -38.245  59.974  1.00 88.87  ? 91  LYS B CB    1 
ATOM   4155  C  CG    . LYS B  1 91  ? 37.810  -38.920  61.351  1.00 92.49  ? 91  LYS B CG    1 
ATOM   4156  C  CD    . LYS B  1 91  ? 36.470  -39.639  61.540  1.00 94.16  ? 91  LYS B CD    1 
ATOM   4157  C  CE    . LYS B  1 91  ? 35.302  -38.608  61.646  1.00 90.65  ? 91  LYS B CE    1 
ATOM   4158  N  NZ    . LYS B  1 91  ? 33.926  -39.176  61.791  1.00 90.88  ? 91  LYS B NZ    1 
ATOM   4159  N  N     . ARG B  1 92  ? 39.607  -36.070  58.155  1.00 84.24  ? 92  ARG B N     1 
ATOM   4160  C  CA    . ARG B  1 92  ? 39.956  -35.836  56.753  1.00 83.27  ? 92  ARG B CA    1 
ATOM   4161  C  C     . ARG B  1 92  ? 39.480  -36.987  55.868  1.00 84.71  ? 92  ARG B C     1 
ATOM   4162  O  O     . ARG B  1 92  ? 39.153  -38.076  56.356  1.00 87.26  ? 92  ARG B O     1 
ATOM   4163  C  CB    . ARG B  1 92  ? 41.472  -35.671  56.584  1.00 84.99  ? 92  ARG B CB    1 
ATOM   4164  C  CG    . ARG B  1 92  ? 41.980  -34.249  56.728  1.00 83.06  ? 92  ARG B CG    1 
ATOM   4165  C  CD    . ARG B  1 92  ? 43.429  -34.149  56.302  1.00 85.08  ? 92  ARG B CD    1 
ATOM   4166  N  NE    . ARG B  1 92  ? 43.601  -34.332  54.860  1.00 85.08  ? 92  ARG B NE    1 
ATOM   4167  C  CZ    . ARG B  1 92  ? 44.718  -34.771  54.284  1.00 87.33  ? 92  ARG B CZ    1 
ATOM   4168  N  NH1   . ARG B  1 92  ? 45.776  -35.080  55.020  1.00 89.68  ? 92  ARG B NH1   1 
ATOM   4169  N  NH2   . ARG B  1 92  ? 44.780  -34.897  52.966  1.00 87.37  ? 92  ARG B NH2   1 
ATOM   4170  N  N     . THR B  1 93  ? 39.450  -36.737  54.565  1.00 83.79  ? 93  THR B N     1 
ATOM   4171  C  CA    . THR B  1 93  ? 39.096  -37.751  53.584  1.00 85.48  ? 93  THR B CA    1 
ATOM   4172  C  C     . THR B  1 93  ? 40.302  -38.013  52.697  1.00 87.57  ? 93  THR B C     1 
ATOM   4173  O  O     . THR B  1 93  ? 40.531  -39.146  52.268  1.00 90.97  ? 93  THR B O     1 
ATOM   4174  C  CB    . THR B  1 93  ? 37.882  -37.302  52.744  1.00 83.53  ? 93  THR B CB    1 
ATOM   4175  O  OG1   . THR B  1 93  ? 36.788  -37.036  53.624  1.00 81.84  ? 93  THR B OG1   1 
ATOM   4176  C  CG2   . THR B  1 93  ? 37.454  -38.365  51.749  1.00 86.26  ? 93  THR B CG2   1 
ATOM   4177  N  N     . GLY B  1 94  ? 41.086  -36.966  52.453  1.00 85.97  ? 94  GLY B N     1 
ATOM   4178  C  CA    . GLY B  1 94  ? 42.154  -37.023  51.469  1.00 87.80  ? 94  GLY B CA    1 
ATOM   4179  C  C     . GLY B  1 94  ? 41.632  -36.596  50.109  1.00 87.18  ? 94  GLY B C     1 
ATOM   4180  O  O     . GLY B  1 94  ? 42.352  -35.981  49.318  1.00 87.85  ? 94  GLY B O     1 
ATOM   4181  N  N     . ASN B  1 95  ? 40.363  -36.902  49.854  1.00 86.42  ? 95  ASN B N     1 
ATOM   4182  C  CA    . ASN B  1 95  ? 39.742  -36.650  48.559  1.00 86.65  ? 95  ASN B CA    1 
ATOM   4183  C  C     . ASN B  1 95  ? 39.114  -35.283  48.415  1.00 83.56  ? 95  ASN B C     1 
ATOM   4184  O  O     . ASN B  1 95  ? 38.391  -34.835  49.301  1.00 81.17  ? 95  ASN B O     1 
ATOM   4185  C  CB    . ASN B  1 95  ? 38.677  -37.708  48.269  1.00 88.49  ? 95  ASN B CB    1 
ATOM   4186  C  CG    . ASN B  1 95  ? 39.269  -39.013  47.795  1.00 92.09  ? 95  ASN B CG    1 
ATOM   4187  O  OD1   . ASN B  1 95  ? 40.459  -39.099  47.475  1.00 93.04  ? 95  ASN B OD1   1 
ATOM   4188  N  ND2   . ASN B  1 95  ? 38.435  -40.041  47.732  1.00 94.36  ? 95  ASN B ND2   1 
ATOM   4189  N  N     . ILE B  1 96  ? 39.394  -34.632  47.288  1.00 84.20  ? 96  ILE B N     1 
ATOM   4190  C  CA    . ILE B  1 96  ? 38.639  -33.453  46.863  1.00 82.50  ? 96  ILE B CA    1 
ATOM   4191  C  C     . ILE B  1 96  ? 37.227  -33.929  46.501  1.00 83.23  ? 96  ILE B C     1 
ATOM   4192  O  O     . ILE B  1 96  ? 37.045  -35.085  46.096  1.00 85.83  ? 96  ILE B O     1 
ATOM   4193  C  CB    . ILE B  1 96  ? 39.306  -32.744  45.644  1.00 84.31  ? 96  ILE B CB    1 
ATOM   4194  C  CG1   . ILE B  1 96  ? 40.766  -32.351  45.936  1.00 83.81  ? 96  ILE B CG1   1 
ATOM   4195  C  CG2   . ILE B  1 96  ? 38.490  -31.547  45.185  1.00 83.72  ? 96  ILE B CG2   1 
ATOM   4196  C  CD1   . ILE B  1 96  ? 41.005  -31.537  47.213  1.00 78.83  ? 96  ILE B CD1   1 
ATOM   4197  N  N     . VAL B  1 97  ? 36.234  -33.057  46.666  1.00 81.17  ? 97  VAL B N     1 
ATOM   4198  C  CA    . VAL B  1 97  ? 34.850  -33.410  46.375  1.00 82.13  ? 97  VAL B CA    1 
ATOM   4199  C  C     . VAL B  1 97  ? 34.780  -34.096  45.021  1.00 86.72  ? 97  VAL B C     1 
ATOM   4200  O  O     . VAL B  1 97  ? 35.301  -33.581  44.031  1.00 88.56  ? 97  VAL B O     1 
ATOM   4201  C  CB    . VAL B  1 97  ? 33.927  -32.178  46.385  1.00 80.57  ? 97  VAL B CB    1 
ATOM   4202  C  CG1   . VAL B  1 97  ? 32.464  -32.587  46.214  1.00 81.30  ? 97  VAL B CG1   1 
ATOM   4203  C  CG2   . VAL B  1 97  ? 34.105  -31.408  47.668  1.00 76.80  ? 97  VAL B CG2   1 
ATOM   4204  N  N     . ASP B  1 98  ? 34.152  -35.269  44.996  1.00 71.03  ? 98  ASP B N     1 
ATOM   4205  C  CA    . ASP B  1 98  ? 34.064  -36.071  43.779  1.00 72.55  ? 98  ASP B CA    1 
ATOM   4206  C  C     . ASP B  1 98  ? 32.866  -37.025  43.735  1.00 72.32  ? 98  ASP B C     1 
ATOM   4207  O  O     . ASP B  1 98  ? 32.100  -37.142  44.696  1.00 71.42  ? 98  ASP B O     1 
ATOM   4208  C  CB    . ASP B  1 98  ? 35.351  -36.868  43.597  1.00 75.69  ? 98  ASP B CB    1 
ATOM   4209  C  CG    . ASP B  1 98  ? 35.542  -37.914  44.664  1.00 78.36  ? 98  ASP B CG    1 
ATOM   4210  O  OD1   . ASP B  1 98  ? 34.822  -37.871  45.687  1.00 77.72  ? 98  ASP B OD1   1 
ATOM   4211  O  OD2   . ASP B  1 98  ? 36.428  -38.779  44.478  1.00 83.28  ? 98  ASP B OD2   1 
ATOM   4212  N  N     . VAL B  1 99  ? 32.725  -37.700  42.600  1.00 73.23  ? 99  VAL B N     1 
ATOM   4213  C  CA    . VAL B  1 99  ? 31.705  -38.715  42.416  1.00 73.71  ? 99  VAL B CA    1 
ATOM   4214  C  C     . VAL B  1 99  ? 32.244  -39.967  41.740  1.00 76.51  ? 99  VAL B C     1 
ATOM   4215  O  O     . VAL B  1 99  ? 33.303  -39.944  41.109  1.00 77.97  ? 99  VAL B O     1 
ATOM   4216  C  CB    . VAL B  1 99  ? 30.507  -38.216  41.569  1.00 72.06  ? 99  VAL B CB    1 
ATOM   4217  C  CG1   . VAL B  1 99  ? 29.525  -37.464  42.434  1.00 70.68  ? 99  VAL B CG1   1 
ATOM   4218  C  CG2   . VAL B  1 99  ? 30.962  -37.414  40.360  1.00 71.39  ? 99  VAL B CG2   1 
ATOM   4219  N  N     . PRO B  1 100 ? 31.501  -41.069  41.863  1.00 77.39  ? 100 PRO B N     1 
ATOM   4220  C  CA    . PRO B  1 100 ? 31.753  -42.213  41.027  1.00 79.81  ? 100 PRO B CA    1 
ATOM   4221  C  C     . PRO B  1 100 ? 31.191  -41.957  39.638  1.00 79.47  ? 100 PRO B C     1 
ATOM   4222  O  O     . PRO B  1 100 ? 30.115  -41.366  39.502  1.00 77.58  ? 100 PRO B O     1 
ATOM   4223  C  CB    . PRO B  1 100 ? 30.955  -43.314  41.715  1.00 80.88  ? 100 PRO B CB    1 
ATOM   4224  C  CG    . PRO B  1 100 ? 29.825  -42.608  42.332  1.00 78.80  ? 100 PRO B CG    1 
ATOM   4225  C  CD    . PRO B  1 100 ? 30.409  -41.314  42.819  1.00 76.62  ? 100 PRO B CD    1 
ATOM   4226  N  N     . VAL B  1 101 ? 31.933  -42.384  38.621  1.00 81.47  ? 101 VAL B N     1 
ATOM   4227  C  CA    . VAL B  1 101 ? 31.467  -42.342  37.235  1.00 81.72  ? 101 VAL B CA    1 
ATOM   4228  C  C     . VAL B  1 101 ? 31.550  -43.741  36.636  1.00 84.70  ? 101 VAL B C     1 
ATOM   4229  O  O     . VAL B  1 101 ? 31.793  -44.712  37.349  1.00 86.05  ? 101 VAL B O     1 
ATOM   4230  C  CB    . VAL B  1 101 ? 32.282  -41.347  36.371  1.00 81.48  ? 101 VAL B CB    1 
ATOM   4231  C  CG1   . VAL B  1 101 ? 32.143  -39.936  36.915  1.00 78.68  ? 101 VAL B CG1   1 
ATOM   4232  C  CG2   . VAL B  1 101 ? 33.760  -41.761  36.287  1.00 83.65  ? 101 VAL B CG2   1 
ATOM   4233  N  N     . GLY B  1 102 ? 31.351  -43.832  35.327  1.00 85.86  ? 102 GLY B N     1 
ATOM   4234  C  CA    . GLY B  1 102 ? 31.447  -45.096  34.620  1.00 88.95  ? 102 GLY B CA    1 
ATOM   4235  C  C     . GLY B  1 102 ? 30.123  -45.466  33.988  1.00 89.24  ? 102 GLY B C     1 
ATOM   4236  O  O     . GLY B  1 102 ? 29.123  -44.776  34.198  1.00 86.98  ? 102 GLY B O     1 
ATOM   4237  N  N     . PRO B  1 103 ? 30.104  -46.565  33.215  1.00 92.19  ? 103 PRO B N     1 
ATOM   4238  C  CA    . PRO B  1 103 ? 28.882  -46.996  32.558  1.00 92.89  ? 103 PRO B CA    1 
ATOM   4239  C  C     . PRO B  1 103 ? 27.922  -47.666  33.535  1.00 92.42  ? 103 PRO B C     1 
ATOM   4240  O  O     . PRO B  1 103 ? 26.730  -47.749  33.252  1.00 92.35  ? 103 PRO B O     1 
ATOM   4241  C  CB    . PRO B  1 103 ? 29.384  -47.999  31.527  1.00 96.68  ? 103 PRO B CB    1 
ATOM   4242  C  CG    . PRO B  1 103 ? 30.594  -48.593  32.157  1.00 98.19  ? 103 PRO B CG    1 
ATOM   4243  C  CD    . PRO B  1 103 ? 31.215  -47.506  32.988  1.00 95.32  ? 103 PRO B CD    1 
ATOM   4244  N  N     . GLY B  1 104 ? 28.430  -48.117  34.680  1.00 92.21  ? 104 GLY B N     1 
ATOM   4245  C  CA    . GLY B  1 104 ? 27.595  -48.770  35.687  1.00 92.25  ? 104 GLY B CA    1 
ATOM   4246  C  C     . GLY B  1 104 ? 26.539  -47.890  36.344  1.00 89.41  ? 104 GLY B C     1 
ATOM   4247  O  O     . GLY B  1 104 ? 25.826  -48.327  37.250  1.00 89.15  ? 104 GLY B O     1 
ATOM   4248  N  N     . LEU B  1 105 ? 26.428  -46.649  35.887  1.00 87.46  ? 105 LEU B N     1 
ATOM   4249  C  CA    . LEU B  1 105 ? 25.499  -45.711  36.493  1.00 84.94  ? 105 LEU B CA    1 
ATOM   4250  C  C     . LEU B  1 105 ? 24.225  -45.525  35.695  1.00 85.09  ? 105 LEU B C     1 
ATOM   4251  O  O     . LEU B  1 105 ? 23.332  -44.783  36.121  1.00 83.15  ? 105 LEU B O     1 
ATOM   4252  C  CB    . LEU B  1 105 ? 26.169  -44.359  36.757  1.00 82.40  ? 105 LEU B CB    1 
ATOM   4253  C  CG    . LEU B  1 105 ? 26.936  -44.301  38.077  1.00 81.77  ? 105 LEU B CG    1 
ATOM   4254  C  CD1   . LEU B  1 105 ? 28.394  -44.705  37.869  1.00 84.00  ? 105 LEU B CD1   1 
ATOM   4255  C  CD2   . LEU B  1 105 ? 26.835  -42.921  38.693  1.00 78.72  ? 105 LEU B CD2   1 
ATOM   4256  N  N     . LEU B  1 106 ? 24.134  -46.192  34.545  1.00 87.50  ? 106 LEU B N     1 
ATOM   4257  C  CA    . LEU B  1 106 ? 22.903  -46.153  33.771  1.00 88.41  ? 106 LEU B CA    1 
ATOM   4258  C  C     . LEU B  1 106 ? 21.793  -46.819  34.579  1.00 88.99  ? 106 LEU B C     1 
ATOM   4259  O  O     . LEU B  1 106 ? 22.053  -47.730  35.362  1.00 89.97  ? 106 LEU B O     1 
ATOM   4260  C  CB    . LEU B  1 106 ? 23.062  -46.823  32.404  1.00 91.46  ? 106 LEU B CB    1 
ATOM   4261  C  CG    . LEU B  1 106 ? 23.690  -46.120  31.188  1.00 92.12  ? 106 LEU B CG    1 
ATOM   4262  C  CD1   . LEU B  1 106 ? 23.542  -44.593  31.214  1.00 89.91  ? 106 LEU B CD1   1 
ATOM   4263  C  CD2   . LEU B  1 106 ? 25.158  -46.520  31.004  1.00 93.41  ? 106 LEU B CD2   1 
ATOM   4264  N  N     . GLY B  1 107 ? 20.565  -46.332  34.413  1.00 88.62  ? 107 GLY B N     1 
ATOM   4265  C  CA    . GLY B  1 107 ? 19.410  -46.851  35.140  1.00 89.23  ? 107 GLY B CA    1 
ATOM   4266  C  C     . GLY B  1 107 ? 19.475  -46.664  36.644  1.00 87.49  ? 107 GLY B C     1 
ATOM   4267  O  O     . GLY B  1 107 ? 18.773  -47.352  37.386  1.00 88.71  ? 107 GLY B O     1 
ATOM   4268  N  N     . ARG B  1 108 ? 20.321  -45.740  37.096  1.00 85.07  ? 108 ARG B N     1 
ATOM   4269  C  CA    . ARG B  1 108 ? 20.469  -45.455  38.524  1.00 83.27  ? 108 ARG B CA    1 
ATOM   4270  C  C     . ARG B  1 108 ? 19.959  -44.068  38.868  1.00 80.70  ? 108 ARG B C     1 
ATOM   4271  O  O     . ARG B  1 108 ? 19.857  -43.198  37.999  1.00 80.13  ? 108 ARG B O     1 
ATOM   4272  C  CB    . ARG B  1 108 ? 21.934  -45.588  38.970  1.00 82.76  ? 108 ARG B CB    1 
ATOM   4273  C  CG    . ARG B  1 108 ? 22.544  -47.001  38.864  1.00 84.85  ? 108 ARG B CG    1 
ATOM   4274  C  CD    . ARG B  1 108 ? 21.706  -48.097  39.522  1.00 84.64  ? 108 ARG B CD    1 
ATOM   4275  N  NE    . ARG B  1 108 ? 21.459  -47.867  40.945  1.00 82.95  ? 108 ARG B NE    1 
ATOM   4276  C  CZ    . ARG B  1 108 ? 22.068  -48.504  41.944  1.00 84.16  ? 108 ARG B CZ    1 
ATOM   4277  N  NH1   . ARG B  1 108 ? 22.990  -49.427  41.710  1.00 86.07  ? 108 ARG B NH1   1 
ATOM   4278  N  NH2   . ARG B  1 108 ? 21.749  -48.216  43.197  1.00 83.73  ? 108 ARG B NH2   1 
ATOM   4279  N  N     . VAL B  1 109 ? 19.633  -43.864  40.139  1.00 79.70  ? 109 VAL B N     1 
ATOM   4280  C  CA    . VAL B  1 109 ? 19.314  -42.526  40.641  1.00 77.16  ? 109 VAL B CA    1 
ATOM   4281  C  C     . VAL B  1 109 ? 20.164  -42.231  41.872  1.00 75.98  ? 109 VAL B C     1 
ATOM   4282  O  O     . VAL B  1 109 ? 19.925  -42.777  42.951  1.00 76.90  ? 109 VAL B O     1 
ATOM   4283  C  CB    . VAL B  1 109 ? 17.820  -42.363  40.993  1.00 77.17  ? 109 VAL B CB    1 
ATOM   4284  C  CG1   . VAL B  1 109 ? 17.567  -40.996  41.587  1.00 74.74  ? 109 VAL B CG1   1 
ATOM   4285  C  CG2   . VAL B  1 109 ? 16.944  -42.567  39.770  1.00 78.68  ? 109 VAL B CG2   1 
ATOM   4286  N  N     . VAL B  1 110 ? 21.166  -41.379  41.703  1.00 74.45  ? 110 VAL B N     1 
ATOM   4287  C  CA    . VAL B  1 110 ? 22.020  -41.001  42.813  1.00 73.42  ? 110 VAL B CA    1 
ATOM   4288  C  C     . VAL B  1 110 ? 21.640  -39.611  43.322  1.00 71.41  ? 110 VAL B C     1 
ATOM   4289  O  O     . VAL B  1 110 ? 20.840  -38.897  42.692  1.00 70.65  ? 110 VAL B O     1 
ATOM   4290  C  CB    . VAL B  1 110 ? 23.508  -41.023  42.414  1.00 73.79  ? 110 VAL B CB    1 
ATOM   4291  C  CG1   . VAL B  1 110 ? 23.928  -42.416  41.942  1.00 76.12  ? 110 VAL B CG1   1 
ATOM   4292  C  CG2   . VAL B  1 110 ? 23.799  -39.981  41.336  1.00 72.65  ? 110 VAL B CG2   1 
ATOM   4293  N  N     . ASP B  1 111 ? 22.193  -39.240  44.475  1.00 70.75  ? 111 ASP B N     1 
ATOM   4294  C  CA    . ASP B  1 111 ? 22.146  -37.857  44.937  1.00 68.42  ? 111 ASP B CA    1 
ATOM   4295  C  C     . ASP B  1 111 ? 23.445  -37.161  44.509  1.00 67.62  ? 111 ASP B C     1 
ATOM   4296  O  O     . ASP B  1 111 ? 24.299  -37.795  43.870  1.00 69.12  ? 111 ASP B O     1 
ATOM   4297  C  CB    . ASP B  1 111 ? 21.905  -37.777  46.452  1.00 68.16  ? 111 ASP B CB    1 
ATOM   4298  C  CG    . ASP B  1 111 ? 23.079  -38.289  47.278  1.00 69.09  ? 111 ASP B CG    1 
ATOM   4299  O  OD1   . ASP B  1 111 ? 24.245  -38.163  46.852  1.00 69.32  ? 111 ASP B OD1   1 
ATOM   4300  O  OD2   . ASP B  1 111 ? 22.827  -38.812  48.382  1.00 70.66  ? 111 ASP B OD2   1 
ATOM   4301  N  N     . ALA B  1 112 ? 23.597  -35.887  44.880  1.00 65.43  ? 112 ALA B N     1 
ATOM   4302  C  CA    . ALA B  1 112 ? 24.702  -35.039  44.414  1.00 64.15  ? 112 ALA B CA    1 
ATOM   4303  C  C     . ALA B  1 112 ? 26.102  -35.556  44.732  1.00 65.19  ? 112 ALA B C     1 
ATOM   4304  O  O     . ALA B  1 112 ? 27.031  -35.327  43.962  1.00 65.43  ? 112 ALA B O     1 
ATOM   4305  C  CB    . ALA B  1 112 ? 24.534  -33.629  44.933  1.00 62.35  ? 112 ALA B CB    1 
ATOM   4306  N  N     . LEU B  1 113 ? 26.258  -36.245  45.861  1.00 66.07  ? 113 LEU B N     1 
ATOM   4307  C  CA    . LEU B  1 113 ? 27.544  -36.866  46.198  1.00 67.52  ? 113 LEU B CA    1 
ATOM   4308  C  C     . LEU B  1 113 ? 27.647  -38.274  45.630  1.00 69.99  ? 113 LEU B C     1 
ATOM   4309  O  O     . LEU B  1 113 ? 28.436  -39.087  46.119  1.00 72.20  ? 113 LEU B O     1 
ATOM   4310  C  CB    . LEU B  1 113 ? 27.773  -36.880  47.712  1.00 67.45  ? 113 LEU B CB    1 
ATOM   4311  C  CG    . LEU B  1 113 ? 28.172  -35.558  48.373  1.00 65.37  ? 113 LEU B CG    1 
ATOM   4312  C  CD1   . LEU B  1 113 ? 27.853  -35.561  49.855  1.00 64.42  ? 113 LEU B CD1   1 
ATOM   4313  C  CD2   . LEU B  1 113 ? 29.650  -35.226  48.136  1.00 65.44  ? 113 LEU B CD2   1 
ATOM   4314  N  N     . GLY B  1 114 ? 26.841  -38.561  44.607  1.00 70.24  ? 114 GLY B N     1 
ATOM   4315  C  CA    . GLY B  1 114 ? 26.833  -39.869  43.948  1.00 72.77  ? 114 GLY B CA    1 
ATOM   4316  C  C     . GLY B  1 114 ? 26.325  -41.030  44.801  1.00 74.58  ? 114 GLY B C     1 
ATOM   4317  O  O     . GLY B  1 114 ? 26.522  -42.211  44.450  1.00 76.69  ? 114 GLY B O     1 
ATOM   4318  N  N     . ASN B  1 115 ? 25.677  -40.702  45.918  1.00 73.54  ? 115 ASN B N     1 
ATOM   4319  C  CA    . ASN B  1 115 ? 25.121  -41.712  46.798  1.00 75.17  ? 115 ASN B CA    1 
ATOM   4320  C  C     . ASN B  1 115 ? 23.816  -42.265  46.235  1.00 75.81  ? 115 ASN B C     1 
ATOM   4321  O  O     . ASN B  1 115 ? 22.921  -41.499  45.881  1.00 74.42  ? 115 ASN B O     1 
ATOM   4322  C  CB    . ASN B  1 115 ? 24.922  -41.151  48.204  1.00 74.40  ? 115 ASN B CB    1 
ATOM   4323  C  CG    . ASN B  1 115 ? 26.227  -40.994  48.958  1.00 75.36  ? 115 ASN B CG    1 
ATOM   4324  O  OD1   . ASN B  1 115 ? 26.858  -41.981  49.347  1.00 78.58  ? 115 ASN B OD1   1 
ATOM   4325  N  ND2   . ASN B  1 115 ? 26.636  -39.752  49.178  1.00 73.95  ? 115 ASN B ND2   1 
ATOM   4326  N  N     . PRO B  1 116 ? 23.704  -43.602  46.148  1.00 78.23  ? 116 PRO B N     1 
ATOM   4327  C  CA    . PRO B  1 116 ? 22.547  -44.222  45.507  1.00 79.29  ? 116 PRO B CA    1 
ATOM   4328  C  C     . PRO B  1 116 ? 21.288  -44.063  46.349  1.00 78.99  ? 116 PRO B C     1 
ATOM   4329  O  O     . PRO B  1 116 ? 21.290  -44.383  47.540  1.00 79.82  ? 116 PRO B O     1 
ATOM   4330  C  CB    . PRO B  1 116 ? 22.951  -45.692  45.413  1.00 82.11  ? 116 PRO B CB    1 
ATOM   4331  C  CG    . PRO B  1 116 ? 23.849  -45.900  46.581  1.00 82.81  ? 116 PRO B CG    1 
ATOM   4332  C  CD    . PRO B  1 116 ? 24.593  -44.604  46.766  1.00 80.33  ? 116 PRO B CD    1 
ATOM   4333  N  N     . ILE B  1 117 ? 20.222  -43.561  45.739  1.00 78.22  ? 117 ILE B N     1 
ATOM   4334  C  CA    . ILE B  1 117 ? 18.988  -43.317  46.486  1.00 78.08  ? 117 ILE B CA    1 
ATOM   4335  C  C     . ILE B  1 117 ? 17.766  -44.057  45.936  1.00 80.08  ? 117 ILE B C     1 
ATOM   4336  O  O     . ILE B  1 117 ? 16.664  -43.917  46.472  1.00 80.31  ? 117 ILE B O     1 
ATOM   4337  C  CB    . ILE B  1 117 ? 18.684  -41.803  46.639  1.00 75.25  ? 117 ILE B CB    1 
ATOM   4338  C  CG1   . ILE B  1 117 ? 18.431  -41.157  45.275  1.00 74.01  ? 117 ILE B CG1   1 
ATOM   4339  C  CG2   . ILE B  1 117 ? 19.825  -41.104  47.371  1.00 73.77  ? 117 ILE B CG2   1 
ATOM   4340  C  CD1   . ILE B  1 117 ? 17.406  -40.060  45.295  1.00 72.15  ? 117 ILE B CD1   1 
ATOM   4341  N  N     . ASP B  1 118 ? 17.961  -44.848  44.883  1.00 81.86  ? 118 ASP B N     1 
ATOM   4342  C  CA    . ASP B  1 118 ? 16.862  -45.647  44.326  1.00 84.53  ? 118 ASP B CA    1 
ATOM   4343  C  C     . ASP B  1 118 ? 16.642  -46.978  45.054  1.00 87.44  ? 118 ASP B C     1 
ATOM   4344  O  O     . ASP B  1 118 ? 15.761  -47.746  44.688  1.00 89.66  ? 118 ASP B O     1 
ATOM   4345  C  CB    . ASP B  1 118 ? 17.013  -45.858  42.808  1.00 85.23  ? 118 ASP B CB    1 
ATOM   4346  C  CG    . ASP B  1 118 ? 18.362  -46.449  42.411  1.00 86.32  ? 118 ASP B CG    1 
ATOM   4347  O  OD1   . ASP B  1 118 ? 19.071  -47.020  43.274  1.00 86.98  ? 118 ASP B OD1   1 
ATOM   4348  O  OD2   . ASP B  1 118 ? 18.705  -46.340  41.212  1.00 86.46  ? 118 ASP B OD2   1 
ATOM   4349  N  N     . GLY B  1 119 ? 17.438  -47.237  46.090  1.00 87.79  ? 119 GLY B N     1 
ATOM   4350  C  CA    . GLY B  1 119 ? 17.332  -48.474  46.858  1.00 90.69  ? 119 GLY B CA    1 
ATOM   4351  C  C     . GLY B  1 119 ? 17.870  -49.683  46.115  1.00 93.23  ? 119 GLY B C     1 
ATOM   4352  O  O     . GLY B  1 119 ? 17.689  -50.824  46.555  1.00 95.74  ? 119 GLY B O     1 
ATOM   4353  N  N     . LYS B  1 120 ? 18.538  -49.437  44.992  1.00 92.69  ? 120 LYS B N     1 
ATOM   4354  C  CA    . LYS B  1 120 ? 19.035  -50.526  44.155  1.00 95.54  ? 120 LYS B CA    1 
ATOM   4355  C  C     . LYS B  1 120 ? 20.474  -50.936  44.498  1.00 96.24  ? 120 LYS B C     1 
ATOM   4356  O  O     . LYS B  1 120 ? 21.117  -51.694  43.763  1.00 98.02  ? 120 LYS B O     1 
ATOM   4357  C  CB    . LYS B  1 120 ? 18.851  -50.209  42.667  1.00 95.19  ? 120 LYS B CB    1 
ATOM   4358  C  CG    . LYS B  1 120 ? 17.403  -49.939  42.306  1.00 95.87  ? 120 LYS B CG    1 
ATOM   4359  C  CD    . LYS B  1 120 ? 17.065  -50.358  40.890  1.00 99.12  ? 120 LYS B CD    1 
ATOM   4360  C  CE    . LYS B  1 120 ? 15.574  -50.151  40.609  1.00 100.70 ? 120 LYS B CE    1 
ATOM   4361  N  NZ    . LYS B  1 120 ? 15.048  -51.085  39.561  1.00 104.77 ? 120 LYS B NZ    1 
ATOM   4362  N  N     . GLY B  1 121 ? 20.958  -50.435  45.632  1.00 95.21  ? 121 GLY B N     1 
ATOM   4363  C  CA    . GLY B  1 121 ? 22.226  -50.875  46.208  1.00 96.26  ? 121 GLY B CA    1 
ATOM   4364  C  C     . GLY B  1 121 ? 23.445  -50.105  45.745  1.00 94.70  ? 121 GLY B C     1 
ATOM   4365  O  O     . GLY B  1 121 ? 23.309  -49.050  45.119  1.00 92.15  ? 121 GLY B O     1 
ATOM   4366  N  N     . PRO B  1 122 ? 24.648  -50.647  46.033  1.00 96.27  ? 122 PRO B N     1 
ATOM   4367  C  CA    . PRO B  1 122 ? 25.926  -49.998  45.743  1.00 95.28  ? 122 PRO B CA    1 
ATOM   4368  C  C     . PRO B  1 122 ? 26.017  -49.539  44.295  1.00 94.42  ? 122 PRO B C     1 
ATOM   4369  O  O     . PRO B  1 122 ? 25.508  -50.214  43.400  1.00 95.85  ? 122 PRO B O     1 
ATOM   4370  C  CB    . PRO B  1 122 ? 26.946  -51.114  45.993  1.00 98.08  ? 122 PRO B CB    1 
ATOM   4371  C  CG    . PRO B  1 122 ? 26.288  -52.008  46.953  1.00 100.05 ? 122 PRO B CG    1 
ATOM   4372  C  CD    . PRO B  1 122 ? 24.849  -52.014  46.544  1.00 99.53  ? 122 PRO B CD    1 
ATOM   4373  N  N     . ILE B  1 123 ? 26.646  -48.391  44.069  1.00 92.34  ? 123 ILE B N     1 
ATOM   4374  C  CA    . ILE B  1 123 ? 26.899  -47.951  42.708  1.00 91.87  ? 123 ILE B CA    1 
ATOM   4375  C  C     . ILE B  1 123 ? 28.101  -48.702  42.175  1.00 94.62  ? 123 ILE B C     1 
ATOM   4376  O  O     . ILE B  1 123 ? 29.155  -48.715  42.809  1.00 95.21  ? 123 ILE B O     1 
ATOM   4377  C  CB    . ILE B  1 123 ? 27.146  -46.439  42.626  1.00 88.73  ? 123 ILE B CB    1 
ATOM   4378  C  CG1   . ILE B  1 123 ? 25.855  -45.662  42.938  1.00 85.94  ? 123 ILE B CG1   1 
ATOM   4379  C  CG2   . ILE B  1 123 ? 27.738  -46.070  41.262  1.00 88.68  ? 123 ILE B CG2   1 
ATOM   4380  C  CD1   . ILE B  1 123 ? 24.671  -45.996  42.042  1.00 85.09  ? 123 ILE B CD1   1 
ATOM   4381  N  N     . ASP B  1 124 ? 27.932  -49.352  41.027  1.00 96.84  ? 124 ASP B N     1 
ATOM   4382  C  CA    . ASP B  1 124 ? 29.048  -50.022  40.366  1.00 99.84  ? 124 ASP B CA    1 
ATOM   4383  C  C     . ASP B  1 124 ? 29.782  -49.016  39.484  1.00 98.82  ? 124 ASP B C     1 
ATOM   4384  O  O     . ASP B  1 124 ? 29.292  -48.632  38.418  1.00 98.58  ? 124 ASP B O     1 
ATOM   4385  C  CB    . ASP B  1 124 ? 28.567  -51.211  39.543  1.00 102.68 ? 124 ASP B CB    1 
ATOM   4386  C  CG    . ASP B  1 124 ? 29.710  -52.068  39.056  1.00 106.63 ? 124 ASP B CG    1 
ATOM   4387  O  OD1   . ASP B  1 124 ? 30.105  -53.014  39.782  1.00 109.54 ? 124 ASP B OD1   1 
ATOM   4388  O  OD2   . ASP B  1 124 ? 30.214  -51.791  37.946  1.00 107.57 ? 124 ASP B OD2   1 
ATOM   4389  N  N     . ALA B  1 125 ? 30.954  -48.583  39.935  1.00 98.63  ? 125 ALA B N     1 
ATOM   4390  C  CA    . ALA B  1 125 ? 31.618  -47.457  39.298  1.00 97.36  ? 125 ALA B CA    1 
ATOM   4391  C  C     . ALA B  1 125 ? 32.980  -47.808  38.735  1.00 99.96  ? 125 ALA B C     1 
ATOM   4392  O  O     . ALA B  1 125 ? 33.755  -48.533  39.359  1.00 102.06 ? 125 ALA B O     1 
ATOM   4393  C  CB    . ALA B  1 125 ? 31.734  -46.303  40.268  1.00 94.55  ? 125 ALA B CB    1 
ATOM   4394  N  N     . ALA B  1 126 ? 33.268  -47.270  37.554  1.00 100.21 ? 126 ALA B N     1 
ATOM   4395  C  CA    . ALA B  1 126 ? 34.583  -47.407  36.935  1.00 102.72 ? 126 ALA B CA    1 
ATOM   4396  C  C     . ALA B  1 126 ? 35.652  -46.569  37.651  1.00 102.06 ? 126 ALA B C     1 
ATOM   4397  O  O     . ALA B  1 126 ? 36.850  -46.733  37.401  1.00 104.25 ? 126 ALA B O     1 
ATOM   4398  C  CB    . ALA B  1 126 ? 34.511  -47.041  35.462  1.00 103.18 ? 126 ALA B CB    1 
ATOM   4399  N  N     . GLY B  1 127 ? 35.217  -45.676  38.539  1.00 99.33  ? 127 GLY B N     1 
ATOM   4400  C  CA    . GLY B  1 127 ? 36.144  -44.824  39.278  1.00 98.79  ? 127 GLY B CA    1 
ATOM   4401  C  C     . GLY B  1 127 ? 35.545  -43.514  39.748  1.00 95.31  ? 127 GLY B C     1 
ATOM   4402  O  O     . GLY B  1 127 ? 34.324  -43.369  39.813  1.00 93.42  ? 127 GLY B O     1 
ATOM   4403  N  N     . ARG B  1 128 ? 36.416  -42.559  40.070  1.00 94.72  ? 128 ARG B N     1 
ATOM   4404  C  CA    . ARG B  1 128 ? 35.994  -41.320  40.724  1.00 91.81  ? 128 ARG B CA    1 
ATOM   4405  C  C     . ARG B  1 128 ? 36.556  -40.051  40.070  1.00 90.98  ? 128 ARG B C     1 
ATOM   4406  O  O     . ARG B  1 128 ? 37.718  -39.698  40.277  1.00 92.31  ? 128 ARG B O     1 
ATOM   4407  C  CB    . ARG B  1 128 ? 36.380  -41.335  42.212  1.00 91.73  ? 128 ARG B CB    1 
ATOM   4408  C  CG    . ARG B  1 128 ? 35.840  -42.497  43.025  1.00 92.48  ? 128 ARG B CG    1 
ATOM   4409  C  CD    . ARG B  1 128 ? 35.879  -42.176  44.517  1.00 92.12  ? 128 ARG B CD    1 
ATOM   4410  N  NE    . ARG B  1 128 ? 34.863  -41.184  44.869  1.00 89.74  ? 128 ARG B NE    1 
ATOM   4411  C  CZ    . ARG B  1 128 ? 33.604  -41.472  45.196  1.00 88.60  ? 128 ARG B CZ    1 
ATOM   4412  N  NH1   . ARG B  1 128 ? 33.190  -42.735  45.238  1.00 90.62  ? 128 ARG B NH1   1 
ATOM   4413  N  NH2   . ARG B  1 128 ? 32.756  -40.494  45.481  1.00 85.65  ? 128 ARG B NH2   1 
ATOM   4414  N  N     . SER B  1 129 ? 35.731  -39.359  39.292  1.00 89.09  ? 129 SER B N     1 
ATOM   4415  C  CA    . SER B  1 129 ? 36.114  -38.050  38.773  1.00 88.08  ? 129 SER B CA    1 
ATOM   4416  C  C     . SER B  1 129 ? 35.836  -37.012  39.840  1.00 85.50  ? 129 SER B C     1 
ATOM   4417  O  O     . SER B  1 129 ? 35.004  -37.233  40.715  1.00 84.37  ? 129 SER B O     1 
ATOM   4418  C  CB    . SER B  1 129 ? 35.332  -37.706  37.501  1.00 87.40  ? 129 SER B CB    1 
ATOM   4419  O  OG    . SER B  1 129 ? 35.469  -38.727  36.527  1.00 90.27  ? 129 SER B OG    1 
ATOM   4420  N  N     . ARG B  1 130 ? 36.526  -35.881  39.765  1.00 84.99  ? 130 ARG B N     1 
ATOM   4421  C  CA    . ARG B  1 130 ? 36.256  -34.753  40.665  1.00 82.59  ? 130 ARG B CA    1 
ATOM   4422  C  C     . ARG B  1 130 ? 34.949  -34.020  40.320  1.00 79.85  ? 130 ARG B C     1 
ATOM   4423  O  O     . ARG B  1 130 ? 34.408  -34.182  39.229  1.00 79.84  ? 130 ARG B O     1 
ATOM   4424  C  CB    . ARG B  1 130 ? 37.423  -33.767  40.639  1.00 83.13  ? 130 ARG B CB    1 
ATOM   4425  C  CG    . ARG B  1 130 ? 38.725  -34.316  41.181  1.00 86.03  ? 130 ARG B CG    1 
ATOM   4426  C  CD    . ARG B  1 130 ? 39.783  -33.235  41.154  1.00 87.71  ? 130 ARG B CD    1 
ATOM   4427  N  NE    . ARG B  1 130 ? 41.073  -33.698  41.650  1.00 91.30  ? 130 ARG B NE    1 
ATOM   4428  C  CZ    . ARG B  1 130 ? 42.065  -32.892  42.017  1.00 93.14  ? 130 ARG B CZ    1 
ATOM   4429  N  NH1   . ARG B  1 130 ? 41.922  -31.571  41.948  1.00 92.22  ? 130 ARG B NH1   1 
ATOM   4430  N  NH2   . ARG B  1 130 ? 43.201  -33.410  42.457  1.00 96.35  ? 130 ARG B NH2   1 
ATOM   4431  N  N     . ALA B  1 131 ? 34.456  -33.211  41.257  1.00 77.76  ? 131 ALA B N     1 
ATOM   4432  C  CA    . ALA B  1 131 ? 33.265  -32.387  41.039  1.00 75.14  ? 131 ALA B CA    1 
ATOM   4433  C  C     . ALA B  1 131 ? 33.593  -31.183  40.167  1.00 74.64  ? 131 ALA B C     1 
ATOM   4434  O  O     . ALA B  1 131 ? 32.853  -30.863  39.227  1.00 74.14  ? 131 ALA B O     1 
ATOM   4435  C  CB    . ALA B  1 131 ? 32.676  -31.937  42.364  1.00 73.28  ? 131 ALA B CB    1 
ATOM   4436  N  N     . GLN B  1 132 ? 34.696  -30.511  40.492  1.00 75.02  ? 132 GLN B N     1 
ATOM   4437  C  CA    . GLN B  1 132 ? 35.171  -29.394  39.690  1.00 74.69  ? 132 GLN B CA    1 
ATOM   4438  C  C     . GLN B  1 132 ? 36.296  -29.886  38.790  1.00 77.19  ? 132 GLN B C     1 
ATOM   4439  O  O     . GLN B  1 132 ? 37.399  -30.169  39.257  1.00 79.00  ? 132 GLN B O     1 
ATOM   4440  C  CB    . GLN B  1 132 ? 35.644  -28.237  40.577  1.00 73.90  ? 132 GLN B CB    1 
ATOM   4441  C  CG    . GLN B  1 132 ? 34.577  -27.659  41.487  1.00 71.64  ? 132 GLN B CG    1 
ATOM   4442  C  CD    . GLN B  1 132 ? 33.457  -26.992  40.722  1.00 71.32  ? 132 GLN B CD    1 
ATOM   4443  O  OE1   . GLN B  1 132 ? 33.607  -25.890  40.199  1.00 72.18  ? 132 GLN B OE1   1 
ATOM   4444  N  NE2   . GLN B  1 132 ? 32.319  -27.649  40.669  1.00 71.26  ? 132 GLN B NE2   1 
ATOM   4445  N  N     . VAL B  1 133 ? 35.987  -30.017  37.503  1.00 77.57  ? 133 VAL B N     1 
ATOM   4446  C  CA    . VAL B  1 133 ? 36.953  -30.434  36.483  1.00 80.10  ? 133 VAL B CA    1 
ATOM   4447  C  C     . VAL B  1 133 ? 37.099  -29.300  35.489  1.00 80.08  ? 133 VAL B C     1 
ATOM   4448  O  O     . VAL B  1 133 ? 36.135  -28.580  35.237  1.00 78.38  ? 133 VAL B O     1 
ATOM   4449  C  CB    . VAL B  1 133 ? 36.477  -31.723  35.758  1.00 81.15  ? 133 VAL B CB    1 
ATOM   4450  C  CG1   . VAL B  1 133 ? 37.015  -31.815  34.336  1.00 82.65  ? 133 VAL B CG1   1 
ATOM   4451  C  CG2   . VAL B  1 133 ? 36.876  -32.930  36.554  1.00 82.66  ? 133 VAL B CG2   1 
ATOM   4452  N  N     . LYS B  1 134 ? 38.288  -29.129  34.927  1.00 82.35  ? 134 LYS B N     1 
ATOM   4453  C  CA    . LYS B  1 134 ? 38.450  -28.115  33.897  1.00 83.00  ? 134 LYS B CA    1 
ATOM   4454  C  C     . LYS B  1 134 ? 37.927  -28.575  32.537  1.00 83.90  ? 134 LYS B C     1 
ATOM   4455  O  O     . LYS B  1 134 ? 38.031  -29.751  32.172  1.00 85.88  ? 134 LYS B O     1 
ATOM   4456  C  CB    . LYS B  1 134 ? 39.892  -27.599  33.806  1.00 85.40  ? 134 LYS B CB    1 
ATOM   4457  C  CG    . LYS B  1 134 ? 39.933  -26.066  33.720  1.00 84.95  ? 134 LYS B CG    1 
ATOM   4458  C  CD    . LYS B  1 134 ? 41.330  -25.502  33.910  1.00 87.55  ? 134 LYS B CD    1 
ATOM   4459  C  CE    . LYS B  1 134 ? 41.243  -24.105  34.501  1.00 85.60  ? 134 LYS B CE    1 
ATOM   4460  N  NZ    . LYS B  1 134 ? 42.491  -23.328  34.300  1.00 87.52  ? 134 LYS B NZ    1 
ATOM   4461  N  N     . ALA B  1 135 ? 37.343  -27.631  31.810  1.00 82.82  ? 135 ALA B N     1 
ATOM   4462  C  CA    . ALA B  1 135 ? 36.809  -27.874  30.481  1.00 83.87  ? 135 ALA B CA    1 
ATOM   4463  C  C     . ALA B  1 135 ? 37.935  -27.986  29.446  1.00 87.23  ? 135 ALA B C     1 
ATOM   4464  O  O     . ALA B  1 135 ? 38.917  -27.230  29.499  1.00 88.08  ? 135 ALA B O     1 
ATOM   4465  C  CB    . ALA B  1 135 ? 35.830  -26.767  30.095  1.00 82.10  ? 135 ALA B CB    1 
ATOM   4466  N  N     . PRO B  1 136 ? 37.797  -28.936  28.502  1.00 89.14  ? 136 PRO B N     1 
ATOM   4467  C  CA    . PRO B  1 136 ? 38.738  -29.074  27.405  1.00 92.72  ? 136 PRO B CA    1 
ATOM   4468  C  C     . PRO B  1 136 ? 38.926  -27.734  26.690  1.00 93.15  ? 136 PRO B C     1 
ATOM   4469  O  O     . PRO B  1 136 ? 37.941  -27.045  26.395  1.00 91.73  ? 136 PRO B O     1 
ATOM   4470  C  CB    . PRO B  1 136 ? 38.052  -30.092  26.487  1.00 94.32  ? 136 PRO B CB    1 
ATOM   4471  C  CG    . PRO B  1 136 ? 36.627  -30.136  26.939  1.00 91.20  ? 136 PRO B CG    1 
ATOM   4472  C  CD    . PRO B  1 136 ? 36.703  -29.913  28.395  1.00 88.58  ? 136 PRO B CD    1 
ATOM   4473  N  N     . GLY B  1 137 ? 40.184  -27.374  26.435  1.00 95.26  ? 137 GLY B N     1 
ATOM   4474  C  CA    . GLY B  1 137 ? 40.540  -26.067  25.886  1.00 95.29  ? 137 GLY B CA    1 
ATOM   4475  C  C     . GLY B  1 137 ? 40.237  -25.896  24.411  1.00 97.26  ? 137 GLY B C     1 
ATOM   4476  O  O     . GLY B  1 137 ? 39.446  -26.650  23.834  1.00 97.35  ? 137 GLY B O     1 
ATOM   4477  N  N     . ILE B  1 138 ? 40.872  -24.892  23.808  1.00 98.88  ? 138 ILE B N     1 
ATOM   4478  C  CA    . ILE B  1 138 ? 40.653  -24.535  22.404  1.00 101.30 ? 138 ILE B CA    1 
ATOM   4479  C  C     . ILE B  1 138 ? 41.009  -25.706  21.493  1.00 104.75 ? 138 ILE B C     1 
ATOM   4480  O  O     . ILE B  1 138 ? 40.293  -26.007  20.535  1.00 106.07 ? 138 ILE B O     1 
ATOM   4481  C  CB    . ILE B  1 138 ? 41.466  -23.272  21.988  1.00 103.13 ? 138 ILE B CB    1 
ATOM   4482  C  CG1   . ILE B  1 138 ? 40.990  -22.024  22.742  1.00 100.87 ? 138 ILE B CG1   1 
ATOM   4483  C  CG2   . ILE B  1 138 ? 41.336  -22.994  20.502  1.00 105.99 ? 138 ILE B CG2   1 
ATOM   4484  C  CD1   . ILE B  1 138 ? 41.589  -21.838  24.129  1.00 100.06 ? 138 ILE B CD1   1 
ATOM   4485  N  N     . LEU B  1 139 ? 42.103  -26.384  21.811  1.00 106.29 ? 139 LEU B N     1 
ATOM   4486  C  CA    . LEU B  1 139 ? 42.592  -27.434  20.941  1.00 109.86 ? 139 LEU B CA    1 
ATOM   4487  C  C     . LEU B  1 139 ? 41.686  -28.664  20.841  1.00 109.22 ? 139 LEU B C     1 
ATOM   4488  O  O     . LEU B  1 139 ? 41.227  -28.984  19.748  1.00 111.46 ? 139 LEU B O     1 
ATOM   4489  C  CB    . LEU B  1 139 ? 44.028  -27.812  21.293  1.00 112.26 ? 139 LEU B CB    1 
ATOM   4490  C  CG    . LEU B  1 139 ? 44.876  -28.191  20.083  1.00 116.95 ? 139 LEU B CG    1 
ATOM   4491  C  CD1   . LEU B  1 139 ? 44.559  -27.345  18.851  1.00 118.26 ? 139 LEU B CD1   1 
ATOM   4492  C  CD2   . LEU B  1 139 ? 46.327  -28.063  20.457  1.00 119.37 ? 139 LEU B CD2   1 
ATOM   4493  N  N     . PRO B  1 140 ? 41.406  -29.345  21.972  1.00 106.51 ? 140 PRO B N     1 
ATOM   4494  C  CA    . PRO B  1 140 ? 40.765  -30.665  21.880  1.00 106.61 ? 140 PRO B CA    1 
ATOM   4495  C  C     . PRO B  1 140 ? 39.305  -30.720  21.394  1.00 105.03 ? 140 PRO B C     1 
ATOM   4496  O  O     . PRO B  1 140 ? 38.633  -31.710  21.653  1.00 104.57 ? 140 PRO B O     1 
ATOM   4497  C  CB    . PRO B  1 140 ? 40.865  -31.197  23.317  1.00 104.04 ? 140 PRO B CB    1 
ATOM   4498  C  CG    . PRO B  1 140 ? 40.919  -29.979  24.163  1.00 101.37 ? 140 PRO B CG    1 
ATOM   4499  C  CD    . PRO B  1 140 ? 41.723  -28.995  23.371  1.00 103.79 ? 140 PRO B CD    1 
ATOM   4500  N  N     . ARG B  1 141 ? 38.823  -29.704  20.683  1.00 104.69 ? 141 ARG B N     1 
ATOM   4501  C  CA    . ARG B  1 141 ? 37.432  -29.710  20.204  1.00 103.43 ? 141 ARG B CA    1 
ATOM   4502  C  C     . ARG B  1 141 ? 37.295  -29.739  18.675  1.00 106.98 ? 141 ARG B C     1 
ATOM   4503  O  O     . ARG B  1 141 ? 38.216  -29.361  17.946  1.00 110.05 ? 141 ARG B O     1 
ATOM   4504  C  CB    . ARG B  1 141 ? 36.662  -28.501  20.742  1.00 99.96  ? 141 ARG B CB    1 
ATOM   4505  C  CG    . ARG B  1 141 ? 36.591  -28.359  22.249  1.00 96.65  ? 141 ARG B CG    1 
ATOM   4506  C  CD    . ARG B  1 141 ? 35.949  -27.027  22.599  1.00 94.47  ? 141 ARG B CD    1 
ATOM   4507  N  NE    . ARG B  1 141 ? 35.913  -26.775  24.035  1.00 92.26  ? 141 ARG B NE    1 
ATOM   4508  C  CZ    . ARG B  1 141 ? 34.805  -26.564  24.742  1.00 90.65  ? 141 ARG B CZ    1 
ATOM   4509  N  NH1   . ARG B  1 141 ? 33.612  -26.571  24.153  1.00 91.51  ? 141 ARG B NH1   1 
ATOM   4510  N  NH2   . ARG B  1 141 ? 34.886  -26.331  26.048  1.00 88.18  ? 141 ARG B NH2   1 
ATOM   4511  N  N     . ARG B  1 142 ? 36.131  -30.191  18.208  1.00 106.67 ? 142 ARG B N     1 
ATOM   4512  C  CA    . ARG B  1 142 ? 35.708  -30.044  16.814  1.00 109.57 ? 142 ARG B CA    1 
ATOM   4513  C  C     . ARG B  1 142 ? 34.317  -29.404  16.808  1.00 107.10 ? 142 ARG B C     1 
ATOM   4514  O  O     . ARG B  1 142 ? 33.615  -29.440  17.820  1.00 103.72 ? 142 ARG B O     1 
ATOM   4515  C  CB    . ARG B  1 142 ? 35.655  -31.404  16.117  1.00 112.74 ? 142 ARG B CB    1 
ATOM   4516  C  CG    . ARG B  1 142 ? 35.526  -31.325  14.608  1.00 117.38 ? 142 ARG B CG    1 
ATOM   4517  C  CD    . ARG B  1 142 ? 34.420  -32.236  14.103  1.00 119.73 ? 142 ARG B CD    1 
ATOM   4518  N  NE    . ARG B  1 142 ? 34.518  -32.477  12.662  1.00 125.76 ? 142 ARG B NE    1 
ATOM   4519  C  CZ    . ARG B  1 142 ? 33.811  -31.837  11.730  1.00 127.88 ? 142 ARG B CZ    1 
ATOM   4520  N  NH1   . ARG B  1 142 ? 32.928  -30.905  12.075  1.00 124.29 ? 142 ARG B NH1   1 
ATOM   4521  N  NH2   . ARG B  1 142 ? 33.988  -32.136  10.442  1.00 133.02 ? 142 ARG B NH2   1 
ATOM   4522  N  N     . SER B  1 143 ? 33.923  -28.809  15.684  1.00 109.04 ? 143 SER B N     1 
ATOM   4523  C  CA    . SER B  1 143 ? 32.581  -28.234  15.545  1.00 107.24 ? 143 SER B CA    1 
ATOM   4524  C  C     . SER B  1 143 ? 31.486  -29.308  15.546  1.00 106.99 ? 143 SER B C     1 
ATOM   4525  O  O     . SER B  1 143 ? 31.742  -30.478  15.227  1.00 109.25 ? 143 SER B O     1 
ATOM   4526  C  CB    . SER B  1 143 ? 32.489  -27.358  14.290  1.00 110.27 ? 143 SER B CB    1 
ATOM   4527  O  OG    . SER B  1 143 ? 33.062  -27.998  13.159  1.00 115.03 ? 143 SER B OG    1 
ATOM   4528  N  N     . VAL B  1 144 ? 30.274  -28.911  15.921  1.00 104.41 ? 144 VAL B N     1 
ATOM   4529  C  CA    . VAL B  1 144 ? 29.146  -29.839  15.954  1.00 104.40 ? 144 VAL B CA    1 
ATOM   4530  C  C     . VAL B  1 144 ? 28.614  -30.088  14.544  1.00 108.96 ? 144 VAL B C     1 
ATOM   4531  O  O     . VAL B  1 144 ? 28.619  -29.181  13.702  1.00 111.04 ? 144 VAL B O     1 
ATOM   4532  C  CB    . VAL B  1 144 ? 27.994  -29.361  16.879  1.00 100.43 ? 144 VAL B CB    1 
ATOM   4533  C  CG1   . VAL B  1 144 ? 28.458  -29.276  18.331  1.00 95.66  ? 144 VAL B CG1   1 
ATOM   4534  C  CG2   . VAL B  1 144 ? 27.423  -28.043  16.395  1.00 100.31 ? 144 VAL B CG2   1 
ATOM   4535  N  N     . HIS B  1 145 ? 28.157  -31.316  14.295  1.00 110.73 ? 145 HIS B N     1 
ATOM   4536  C  CA    . HIS B  1 145 ? 27.653  -31.703  12.979  1.00 115.08 ? 145 HIS B CA    1 
ATOM   4537  C  C     . HIS B  1 145 ? 26.615  -32.825  13.059  1.00 115.76 ? 145 HIS B C     1 
ATOM   4538  O  O     . HIS B  1 145 ? 25.845  -33.033  12.123  1.00 118.95 ? 145 HIS B O     1 
ATOM   4539  C  CB    . HIS B  1 145 ? 28.818  -32.112  12.068  1.00 119.12 ? 145 HIS B CB    1 
ATOM   4540  C  CG    . HIS B  1 145 ? 29.563  -33.323  12.542  1.00 119.38 ? 145 HIS B CG    1 
ATOM   4541  N  ND1   . HIS B  1 145 ? 30.204  -33.375  13.762  1.00 116.32 ? 145 HIS B ND1   1 
ATOM   4542  C  CD2   . HIS B  1 145 ? 29.776  -34.523  11.955  1.00 122.60 ? 145 HIS B CD2   1 
ATOM   4543  C  CE1   . HIS B  1 145 ? 30.771  -34.559  13.910  1.00 117.13 ? 145 HIS B CE1   1 
ATOM   4544  N  NE2   . HIS B  1 145 ? 30.528  -35.273  12.827  1.00 121.46 ? 145 HIS B NE2   1 
ATOM   4545  N  N     . GLU B  1 146 ? 26.598  -33.545  14.178  1.00 113.09 ? 146 GLU B N     1 
ATOM   4546  C  CA    . GLU B  1 146 ? 25.685  -34.674  14.358  1.00 113.47 ? 146 GLU B CA    1 
ATOM   4547  C  C     . GLU B  1 146 ? 24.405  -34.224  15.057  1.00 110.82 ? 146 GLU B C     1 
ATOM   4548  O  O     . GLU B  1 146 ? 24.458  -33.416  15.991  1.00 106.88 ? 146 GLU B O     1 
ATOM   4549  C  CB    . GLU B  1 146 ? 26.348  -35.782  15.172  1.00 112.32 ? 146 GLU B CB    1 
ATOM   4550  C  CG    . GLU B  1 146 ? 27.713  -36.193  14.676  1.00 114.35 ? 146 GLU B CG    1 
ATOM   4551  C  CD    . GLU B  1 146 ? 28.626  -36.585  15.811  1.00 112.13 ? 146 GLU B CD    1 
ATOM   4552  O  OE1   . GLU B  1 146 ? 28.962  -35.705  16.626  1.00 109.58 ? 146 GLU B OE1   1 
ATOM   4553  O  OE2   . GLU B  1 146 ? 29.011  -37.769  15.898  1.00 114.00 ? 146 GLU B OE2   1 
ATOM   4554  N  N     . PRO B  1 147 ? 23.249  -34.739  14.599  1.00 113.04 ? 147 PRO B N     1 
ATOM   4555  C  CA    . PRO B  1 147 ? 21.948  -34.429  15.196  1.00 111.19 ? 147 PRO B CA    1 
ATOM   4556  C  C     . PRO B  1 147 ? 21.694  -35.085  16.549  1.00 108.12 ? 147 PRO B C     1 
ATOM   4557  O  O     . PRO B  1 147 ? 21.854  -36.297  16.692  1.00 109.49 ? 147 PRO B O     1 
ATOM   4558  C  CB    . PRO B  1 147 ? 20.941  -34.988  14.174  1.00 115.17 ? 147 PRO B CB    1 
ATOM   4559  C  CG    . PRO B  1 147 ? 21.703  -35.158  12.917  1.00 119.26 ? 147 PRO B CG    1 
ATOM   4560  C  CD    . PRO B  1 147 ? 23.102  -35.472  13.330  1.00 118.05 ? 147 PRO B CD    1 
ATOM   4561  N  N     . VAL B  1 148 ? 21.309  -34.277  17.529  1.00 104.47 ? 148 VAL B N     1 
ATOM   4562  C  CA    . VAL B  1 148 ? 20.564  -34.774  18.671  1.00 102.28 ? 148 VAL B CA    1 
ATOM   4563  C  C     . VAL B  1 148 ? 19.101  -34.678  18.243  1.00 104.01 ? 148 VAL B C     1 
ATOM   4564  O  O     . VAL B  1 148 ? 18.554  -33.580  18.094  1.00 103.34 ? 148 VAL B O     1 
ATOM   4565  C  CB    . VAL B  1 148 ? 20.836  -33.959  19.958  1.00 97.88  ? 148 VAL B CB    1 
ATOM   4566  C  CG1   . VAL B  1 148 ? 19.788  -34.253  21.022  1.00 95.97  ? 148 VAL B CG1   1 
ATOM   4567  C  CG2   . VAL B  1 148 ? 22.232  -34.254  20.502  1.00 96.77  ? 148 VAL B CG2   1 
ATOM   4568  N  N     . GLN B  1 149 ? 18.490  -35.837  18.010  1.00 106.72 ? 149 GLN B N     1 
ATOM   4569  C  CA    . GLN B  1 149 ? 17.131  -35.927  17.476  1.00 109.36 ? 149 GLN B CA    1 
ATOM   4570  C  C     . GLN B  1 149 ? 16.113  -35.853  18.606  1.00 106.74 ? 149 GLN B C     1 
ATOM   4571  O  O     . GLN B  1 149 ? 16.046  -36.752  19.447  1.00 105.93 ? 149 GLN B O     1 
ATOM   4572  C  CB    . GLN B  1 149 ? 16.942  -37.247  16.728  1.00 113.62 ? 149 GLN B CB    1 
ATOM   4573  C  CG    . GLN B  1 149 ? 18.025  -37.592  15.705  1.00 117.20 ? 149 GLN B CG    1 
ATOM   4574  C  CD    . GLN B  1 149 ? 17.547  -37.447  14.274  1.00 122.61 ? 149 GLN B CD    1 
ATOM   4575  O  OE1   . GLN B  1 149 ? 17.341  -38.444  13.566  1.00 124.85 ? 149 GLN B OE1   1 
ATOM   4576  N  NE2   . GLN B  1 149 ? 17.357  -36.198  13.838  1.00 123.37 ? 149 GLN B NE2   1 
ATOM   4577  N  N     . THR B  1 150 ? 15.313  -34.791  18.617  1.00 105.70 ? 150 THR B N     1 
ATOM   4578  C  CA    . THR B  1 150 ? 14.346  -34.582  19.690  1.00 103.17 ? 150 THR B CA    1 
ATOM   4579  C  C     . THR B  1 150 ? 12.987  -35.210  19.403  1.00 106.10 ? 150 THR B C     1 
ATOM   4580  O  O     . THR B  1 150 ? 12.232  -35.508  20.330  1.00 104.97 ? 150 THR B O     1 
ATOM   4581  C  CB    . THR B  1 150 ? 14.150  -33.093  19.992  1.00 100.71 ? 150 THR B CB    1 
ATOM   4582  O  OG1   . THR B  1 150 ? 13.460  -32.466  18.903  1.00 103.37 ? 150 THR B OG1   1 
ATOM   4583  C  CG2   . THR B  1 150 ? 15.491  -32.417  20.213  1.00 98.30  ? 150 THR B CG2   1 
ATOM   4584  N  N     . GLY B  1 151 ? 12.678  -35.408  18.123  1.00 110.03 ? 151 GLY B N     1 
ATOM   4585  C  CA    . GLY B  1 151 ? 11.386  -35.949  17.714  1.00 113.31 ? 151 GLY B CA    1 
ATOM   4586  C  C     . GLY B  1 151 ? 10.256  -34.947  17.830  1.00 113.23 ? 151 GLY B C     1 
ATOM   4587  O  O     . GLY B  1 151 ? 9.084   -35.314  17.776  1.00 115.35 ? 151 GLY B O     1 
ATOM   4588  N  N     . LEU B  1 152 ? 10.622  -33.675  17.986  1.00 111.03 ? 152 LEU B N     1 
ATOM   4589  C  CA    . LEU B  1 152 ? 9.669   -32.578  18.158  1.00 110.69 ? 152 LEU B CA    1 
ATOM   4590  C  C     . LEU B  1 152 ? 9.670   -31.685  16.927  1.00 113.40 ? 152 LEU B C     1 
ATOM   4591  O  O     . LEU B  1 152 ? 10.620  -30.931  16.690  1.00 111.97 ? 152 LEU B O     1 
ATOM   4592  C  CB    . LEU B  1 152 ? 10.013  -31.767  19.404  1.00 105.68 ? 152 LEU B CB    1 
ATOM   4593  C  CG    . LEU B  1 152 ? 10.296  -32.581  20.669  1.00 103.19 ? 152 LEU B CG    1 
ATOM   4594  C  CD1   . LEU B  1 152 ? 11.007  -31.734  21.718  1.00 98.67  ? 152 LEU B CD1   1 
ATOM   4595  C  CD2   . LEU B  1 152 ? 9.015   -33.196  21.231  1.00 104.31 ? 152 LEU B CD2   1 
ATOM   4596  N  N     . LYS B  1 153 ? 8.595   -31.780  16.152  1.00 117.66 ? 153 LYS B N     1 
ATOM   4597  C  CA    . LYS B  1 153 ? 8.473   -31.097  14.866  1.00 121.36 ? 153 LYS B CA    1 
ATOM   4598  C  C     . LYS B  1 153 ? 8.963   -29.653  14.878  1.00 119.20 ? 153 LYS B C     1 
ATOM   4599  O  O     . LYS B  1 153 ? 9.477   -29.163  13.873  1.00 121.22 ? 153 LYS B O     1 
ATOM   4600  C  CB    . LYS B  1 153 ? 7.025   -31.137  14.379  1.00 125.46 ? 153 LYS B CB    1 
ATOM   4601  C  CG    . LYS B  1 153 ? 6.559   -32.498  13.907  1.00 129.31 ? 153 LYS B CG    1 
ATOM   4602  C  CD    . LYS B  1 153 ? 5.102   -32.458  13.487  1.00 133.82 ? 153 LYS B CD    1 
ATOM   4603  C  CE    . LYS B  1 153 ? 4.163   -32.527  14.684  1.00 132.32 ? 153 LYS B CE    1 
ATOM   4604  N  NZ    . LYS B  1 153 ? 2.751   -32.748  14.258  1.00 137.46 ? 153 LYS B NZ    1 
ATOM   4605  N  N     . ALA B  1 154 ? 8.797   -28.974  16.006  1.00 115.41 ? 154 ALA B N     1 
ATOM   4606  C  CA    . ALA B  1 154 ? 9.214   -27.582  16.101  1.00 113.61 ? 154 ALA B CA    1 
ATOM   4607  C  C     . ALA B  1 154 ? 10.719  -27.432  16.334  1.00 110.76 ? 154 ALA B C     1 
ATOM   4608  O  O     . ALA B  1 154 ? 11.370  -26.616  15.671  1.00 111.34 ? 154 ALA B O     1 
ATOM   4609  C  CB    . ALA B  1 154 ? 8.413   -26.843  17.174  1.00 111.06 ? 154 ALA B CB    1 
ATOM   4610  N  N     . VAL B  1 155 ? 11.265  -28.219  17.260  1.00 108.00 ? 155 VAL B N     1 
ATOM   4611  C  CA    . VAL B  1 155 ? 12.684  -28.127  17.610  1.00 105.21 ? 155 VAL B CA    1 
ATOM   4612  C  C     . VAL B  1 155 ? 13.568  -28.485  16.419  1.00 108.18 ? 155 VAL B C     1 
ATOM   4613  O  O     . VAL B  1 155 ? 14.431  -27.701  16.033  1.00 107.79 ? 155 VAL B O     1 
ATOM   4614  C  CB    . VAL B  1 155 ? 13.067  -29.026  18.822  1.00 102.21 ? 155 VAL B CB    1 
ATOM   4615  C  CG1   . VAL B  1 155 ? 14.534  -28.849  19.181  1.00 99.25  ? 155 VAL B CG1   1 
ATOM   4616  C  CG2   . VAL B  1 155 ? 12.211  -28.708  20.026  1.00 99.84  ? 155 VAL B CG2   1 
ATOM   4617  N  N     . ASP B  1 156 ? 13.325  -29.657  15.832  1.00 111.35 ? 156 ASP B N     1 
ATOM   4618  C  CA    . ASP B  1 156 ? 14.235  -30.241  14.848  1.00 114.04 ? 156 ASP B CA    1 
ATOM   4619  C  C     . ASP B  1 156 ? 14.229  -29.535  13.503  1.00 117.64 ? 156 ASP B C     1 
ATOM   4620  O  O     . ASP B  1 156 ? 15.217  -29.588  12.768  1.00 119.19 ? 156 ASP B O     1 
ATOM   4621  C  CB    . ASP B  1 156 ? 13.938  -31.725  14.675  1.00 116.60 ? 156 ASP B CB    1 
ATOM   4622  C  CG    . ASP B  1 156 ? 14.266  -32.530  15.915  1.00 113.79 ? 156 ASP B CG    1 
ATOM   4623  O  OD1   . ASP B  1 156 ? 15.111  -32.079  16.727  1.00 109.86 ? 156 ASP B OD1   1 
ATOM   4624  O  OD2   . ASP B  1 156 ? 13.676  -33.621  16.074  1.00 116.03 ? 156 ASP B OD2   1 
ATOM   4625  N  N     . ALA B  1 157 ? 13.117  -28.880  13.188  1.00 119.25 ? 157 ALA B N     1 
ATOM   4626  C  CA    . ALA B  1 157 ? 13.013  -28.075  11.975  1.00 122.66 ? 157 ALA B CA    1 
ATOM   4627  C  C     . ALA B  1 157 ? 13.535  -26.651  12.184  1.00 120.12 ? 157 ALA B C     1 
ATOM   4628  O  O     . ALA B  1 157 ? 14.204  -26.103  11.307  1.00 122.15 ? 157 ALA B O     1 
ATOM   4629  C  CB    . ALA B  1 157 ? 11.574  -28.049  11.468  1.00 126.04 ? 157 ALA B CB    1 
ATOM   4630  N  N     . LEU B  1 158 ? 13.245  -26.063  13.343  1.00 115.86 ? 158 LEU B N     1 
ATOM   4631  C  CA    . LEU B  1 158 ? 13.455  -24.627  13.535  1.00 114.00 ? 158 LEU B CA    1 
ATOM   4632  C  C     . LEU B  1 158 ? 14.609  -24.261  14.472  1.00 109.71 ? 158 LEU B C     1 
ATOM   4633  O  O     . LEU B  1 158 ? 15.187  -23.178  14.357  1.00 108.87 ? 158 LEU B O     1 
ATOM   4634  C  CB    . LEU B  1 158 ? 12.158  -23.951  13.994  1.00 113.43 ? 158 LEU B CB    1 
ATOM   4635  C  CG    . LEU B  1 158 ? 10.895  -24.245  13.176  1.00 117.51 ? 158 LEU B CG    1 
ATOM   4636  C  CD1   . LEU B  1 158 ? 9.651   -24.009  14.005  1.00 116.36 ? 158 LEU B CD1   1 
ATOM   4637  C  CD2   . LEU B  1 158 ? 10.849  -23.429  11.899  1.00 120.66 ? 158 LEU B CD2   1 
ATOM   4638  N  N     . VAL B  1 159 ? 14.937  -25.159  15.397  1.00 107.20 ? 159 VAL B N     1 
ATOM   4639  C  CA    . VAL B  1 159 ? 16.075  -24.960  16.303  1.00 103.30 ? 159 VAL B CA    1 
ATOM   4640  C  C     . VAL B  1 159 ? 16.888  -26.246  16.482  1.00 103.12 ? 159 VAL B C     1 
ATOM   4641  O  O     . VAL B  1 159 ? 16.871  -26.853  17.552  1.00 100.46 ? 159 VAL B O     1 
ATOM   4642  C  CB    . VAL B  1 159 ? 15.643  -24.372  17.675  1.00 99.13  ? 159 VAL B CB    1 
ATOM   4643  C  CG1   . VAL B  1 159 ? 15.841  -22.880  17.685  1.00 98.19  ? 159 VAL B CG1   1 
ATOM   4644  C  CG2   . VAL B  1 159 ? 14.195  -24.710  17.994  1.00 99.80  ? 159 VAL B CG2   1 
ATOM   4645  N  N     . PRO B  1 160 ? 17.597  -26.671  15.420  1.00 106.37 ? 160 PRO B N     1 
ATOM   4646  C  CA    . PRO B  1 160 ? 18.331  -27.940  15.448  1.00 107.04 ? 160 PRO B CA    1 
ATOM   4647  C  C     . PRO B  1 160 ? 19.467  -27.951  16.460  1.00 103.42 ? 160 PRO B C     1 
ATOM   4648  O  O     . PRO B  1 160 ? 20.258  -27.011  16.510  1.00 102.25 ? 160 PRO B O     1 
ATOM   4649  C  CB    . PRO B  1 160 ? 18.886  -28.065  14.022  1.00 111.53 ? 160 PRO B CB    1 
ATOM   4650  C  CG    . PRO B  1 160 ? 18.844  -26.675  13.455  1.00 112.19 ? 160 PRO B CG    1 
ATOM   4651  C  CD    . PRO B  1 160 ? 17.664  -26.025  14.095  1.00 110.10 ? 160 PRO B CD    1 
ATOM   4652  N  N     . ILE B  1 161 ? 19.528  -29.018  17.254  1.00 101.99 ? 161 ILE B N     1 
ATOM   4653  C  CA    . ILE B  1 161 ? 20.524  -29.169  18.312  1.00 98.70  ? 161 ILE B CA    1 
ATOM   4654  C  C     . ILE B  1 161 ? 21.597  -30.173  17.900  1.00 100.58 ? 161 ILE B C     1 
ATOM   4655  O  O     . ILE B  1 161 ? 21.287  -31.317  17.527  1.00 102.84 ? 161 ILE B O     1 
ATOM   4656  C  CB    . ILE B  1 161 ? 19.881  -29.650  19.635  1.00 95.89  ? 161 ILE B CB    1 
ATOM   4657  C  CG1   . ILE B  1 161 ? 18.655  -28.805  19.991  1.00 94.63  ? 161 ILE B CG1   1 
ATOM   4658  C  CG2   . ILE B  1 161 ? 20.910  -29.658  20.775  1.00 92.63  ? 161 ILE B CG2   1 
ATOM   4659  C  CD1   . ILE B  1 161 ? 17.674  -29.523  20.910  1.00 93.61  ? 161 ILE B CD1   1 
ATOM   4660  N  N     . GLY B  1 162 ? 22.856  -29.740  17.979  1.00 99.62  ? 162 GLY B N     1 
ATOM   4661  C  CA    . GLY B  1 162 ? 24.005  -30.573  17.617  1.00 101.35 ? 162 GLY B CA    1 
ATOM   4662  C  C     . GLY B  1 162 ? 24.504  -31.410  18.772  1.00 98.90  ? 162 GLY B C     1 
ATOM   4663  O  O     . GLY B  1 162 ? 24.087  -31.204  19.902  1.00 95.87  ? 162 GLY B O     1 
ATOM   4664  N  N     . ARG B  1 163 ? 25.391  -32.361  18.491  1.00 100.92 ? 163 ARG B N     1 
ATOM   4665  C  CA    . ARG B  1 163 ? 25.966  -33.207  19.540  1.00 99.15  ? 163 ARG B CA    1 
ATOM   4666  C  C     . ARG B  1 163 ? 27.251  -32.592  20.062  1.00 97.49  ? 163 ARG B C     1 
ATOM   4667  O  O     . ARG B  1 163 ? 28.320  -32.780  19.481  1.00 99.71  ? 163 ARG B O     1 
ATOM   4668  C  CB    . ARG B  1 163 ? 26.236  -34.629  19.038  1.00 102.39 ? 163 ARG B CB    1 
ATOM   4669  C  CG    . ARG B  1 163 ? 25.000  -35.421  18.688  1.00 103.72 ? 163 ARG B CG    1 
ATOM   4670  C  CD    . ARG B  1 163 ? 25.195  -36.878  19.003  1.00 104.49 ? 163 ARG B CD    1 
ATOM   4671  N  NE    . ARG B  1 163 ? 24.097  -37.667  18.458  1.00 107.31 ? 163 ARG B NE    1 
ATOM   4672  C  CZ    . ARG B  1 163 ? 23.798  -38.913  18.815  1.00 107.68 ? 163 ARG B CZ    1 
ATOM   4673  N  NH1   . ARG B  1 163 ? 24.503  -39.552  19.743  1.00 105.81 ? 163 ARG B NH1   1 
ATOM   4674  N  NH2   . ARG B  1 163 ? 22.773  -39.514  18.238  1.00 110.42 ? 163 ARG B NH2   1 
ATOM   4675  N  N     . GLY B  1 164 ? 27.137  -31.869  21.171  1.00 93.90  ? 164 GLY B N     1 
ATOM   4676  C  CA    . GLY B  1 164 ? 28.245  -31.096  21.722  1.00 92.44  ? 164 GLY B CA    1 
ATOM   4677  C  C     . GLY B  1 164 ? 27.794  -29.675  22.000  1.00 90.23  ? 164 GLY B C     1 
ATOM   4678  O  O     . GLY B  1 164 ? 28.471  -28.916  22.700  1.00 88.42  ? 164 GLY B O     1 
ATOM   4679  N  N     . GLN B  1 165 ? 26.638  -29.329  21.442  1.00 90.68  ? 165 GLN B N     1 
ATOM   4680  C  CA    . GLN B  1 165 ? 26.027  -28.024  21.615  1.00 88.79  ? 165 GLN B CA    1 
ATOM   4681  C  C     . GLN B  1 165 ? 25.574  -27.820  23.066  1.00 85.37  ? 165 GLN B C     1 
ATOM   4682  O  O     . GLN B  1 165 ? 25.576  -28.754  23.884  1.00 84.49  ? 165 GLN B O     1 
ATOM   4683  C  CB    . GLN B  1 165 ? 24.840  -27.883  20.656  1.00 90.48  ? 165 GLN B CB    1 
ATOM   4684  C  CG    . GLN B  1 165 ? 24.287  -26.474  20.535  1.00 89.74  ? 165 GLN B CG    1 
ATOM   4685  C  CD    . GLN B  1 165 ? 23.168  -26.342  19.512  1.00 92.61  ? 165 GLN B CD    1 
ATOM   4686  O  OE1   . GLN B  1 165 ? 22.879  -27.275  18.756  1.00 94.87  ? 165 GLN B OE1   1 
ATOM   4687  N  NE2   . GLN B  1 165 ? 22.536  -25.165  19.479  1.00 91.20  ? 165 GLN B NE2   1 
ATOM   4688  N  N     . ARG B  1 166 ? 25.223  -26.580  23.382  1.00 83.45  ? 166 ARG B N     1 
ATOM   4689  C  CA    . ARG B  1 166 ? 24.564  -26.262  24.622  1.00 80.32  ? 166 ARG B CA    1 
ATOM   4690  C  C     . ARG B  1 166 ? 23.376  -25.401  24.252  1.00 80.16  ? 166 ARG B C     1 
ATOM   4691  O  O     . ARG B  1 166 ? 23.534  -24.252  23.865  1.00 80.41  ? 166 ARG B O     1 
ATOM   4692  C  CB    . ARG B  1 166 ? 25.520  -25.515  25.540  1.00 78.39  ? 166 ARG B CB    1 
ATOM   4693  C  CG    . ARG B  1 166 ? 26.869  -26.202  25.689  1.00 80.20  ? 166 ARG B CG    1 
ATOM   4694  C  CD    . ARG B  1 166 ? 27.933  -25.251  26.187  1.00 79.91  ? 166 ARG B CD    1 
ATOM   4695  N  NE    . ARG B  1 166 ? 28.491  -24.457  25.108  1.00 81.91  ? 166 ARG B NE    1 
ATOM   4696  C  CZ    . ARG B  1 166 ? 29.199  -23.349  25.284  1.00 82.74  ? 166 ARG B CZ    1 
ATOM   4697  N  NH1   . ARG B  1 166 ? 29.453  -22.876  26.506  1.00 80.39  ? 166 ARG B NH1   1 
ATOM   4698  N  NH2   . ARG B  1 166 ? 29.656  -22.707  24.223  1.00 85.69  ? 166 ARG B NH2   1 
ATOM   4699  N  N     . GLU B  1 167 ? 22.182  -25.969  24.323  1.00 80.31  ? 167 GLU B N     1 
ATOM   4700  C  CA    . GLU B  1 167 ? 20.983  -25.224  23.974  1.00 80.49  ? 167 GLU B CA    1 
ATOM   4701  C  C     . GLU B  1 167 ? 20.141  -25.049  25.222  1.00 77.69  ? 167 GLU B C     1 
ATOM   4702  O  O     . GLU B  1 167 ? 19.769  -26.034  25.870  1.00 77.22  ? 167 GLU B O     1 
ATOM   4703  C  CB    . GLU B  1 167 ? 20.195  -25.947  22.876  1.00 83.77  ? 167 GLU B CB    1 
ATOM   4704  C  CG    . GLU B  1 167 ? 18.914  -25.238  22.439  1.00 85.00  ? 167 GLU B CG    1 
ATOM   4705  C  CD    . GLU B  1 167 ? 19.159  -24.073  21.488  1.00 86.97  ? 167 GLU B CD    1 
ATOM   4706  O  OE1   . GLU B  1 167 ? 20.320  -23.846  21.085  1.00 87.52  ? 167 GLU B OE1   1 
ATOM   4707  O  OE2   . GLU B  1 167 ? 18.178  -23.388  21.134  1.00 87.85  ? 167 GLU B OE2   1 
ATOM   4708  N  N     . LEU B  1 168 ? 19.859  -23.796  25.561  1.00 75.94  ? 168 LEU B N     1 
ATOM   4709  C  CA    . LEU B  1 168 ? 19.061  -23.481  26.739  1.00 73.48  ? 168 LEU B CA    1 
ATOM   4710  C  C     . LEU B  1 168 ? 17.565  -23.580  26.451  1.00 74.83  ? 168 LEU B C     1 
ATOM   4711  O  O     . LEU B  1 168 ? 17.068  -23.013  25.475  1.00 76.79  ? 168 LEU B O     1 
ATOM   4712  C  CB    . LEU B  1 168 ? 19.404  -22.083  27.255  1.00 71.53  ? 168 LEU B CB    1 
ATOM   4713  C  CG    . LEU B  1 168 ? 18.429  -21.392  28.214  1.00 69.59  ? 168 LEU B CG    1 
ATOM   4714  C  CD1   . LEU B  1 168 ? 18.522  -21.989  29.608  1.00 67.30  ? 168 LEU B CD1   1 
ATOM   4715  C  CD2   . LEU B  1 168 ? 18.705  -19.908  28.251  1.00 67.55  ? 168 LEU B CD2   1 
ATOM   4716  N  N     . ILE B  1 169 ? 16.858  -24.324  27.296  1.00 73.91  ? 169 ILE B N     1 
ATOM   4717  C  CA    . ILE B  1 169 ? 15.408  -24.268  27.328  1.00 74.61  ? 169 ILE B CA    1 
ATOM   4718  C  C     . ILE B  1 169 ? 15.075  -23.195  28.361  1.00 72.31  ? 169 ILE B C     1 
ATOM   4719  O  O     . ILE B  1 169 ? 15.540  -23.258  29.502  1.00 70.11  ? 169 ILE B O     1 
ATOM   4720  C  CB    . ILE B  1 169 ? 14.781  -25.629  27.706  1.00 75.37  ? 169 ILE B CB    1 
ATOM   4721  C  CG1   . ILE B  1 169 ? 15.205  -26.717  26.707  1.00 77.45  ? 169 ILE B CG1   1 
ATOM   4722  C  CG2   . ILE B  1 169 ? 13.257  -25.518  27.780  1.00 76.55  ? 169 ILE B CG2   1 
ATOM   4723  C  CD1   . ILE B  1 169 ? 14.923  -28.140  27.165  1.00 76.51  ? 169 ILE B CD1   1 
ATOM   4724  N  N     . ILE B  1 170 ? 14.297  -22.202  27.944  1.00 73.04  ? 170 ILE B N     1 
ATOM   4725  C  CA    . ILE B  1 170 ? 13.955  -21.058  28.784  1.00 70.95  ? 170 ILE B CA    1 
ATOM   4726  C  C     . ILE B  1 170 ? 12.487  -20.665  28.598  1.00 72.91  ? 170 ILE B C     1 
ATOM   4727  O  O     . ILE B  1 170 ? 11.976  -20.598  27.471  1.00 75.68  ? 170 ILE B O     1 
ATOM   4728  C  CB    . ILE B  1 170 ? 14.877  -19.844  28.492  1.00 69.99  ? 170 ILE B CB    1 
ATOM   4729  C  CG1   . ILE B  1 170 ? 14.369  -18.584  29.196  1.00 67.97  ? 170 ILE B CG1   1 
ATOM   4730  C  CG2   . ILE B  1 170 ? 15.001  -19.593  26.987  1.00 72.49  ? 170 ILE B CG2   1 
ATOM   4731  C  CD1   . ILE B  1 170 ? 15.390  -17.490  29.271  1.00 66.66  ? 170 ILE B CD1   1 
ATOM   4732  N  N     . GLY B  1 171 ? 11.814  -20.409  29.711  1.00 71.57  ? 171 GLY B N     1 
ATOM   4733  C  CA    . GLY B  1 171 ? 10.432  -19.980  29.676  1.00 73.37  ? 171 GLY B CA    1 
ATOM   4734  C  C     . GLY B  1 171 ? 9.899   -19.852  31.075  1.00 72.12  ? 171 GLY B C     1 
ATOM   4735  O  O     . GLY B  1 171 ? 10.576  -20.213  32.039  1.00 69.64  ? 171 GLY B O     1 
ATOM   4736  N  N     . ASP B  1 172 ? 8.678   -19.332  31.179  1.00 74.19  ? 172 ASP B N     1 
ATOM   4737  C  CA    . ASP B  1 172 ? 7.998   -19.169  32.459  1.00 73.95  ? 172 ASP B CA    1 
ATOM   4738  C  C     . ASP B  1 172 ? 7.725   -20.503  33.141  1.00 74.41  ? 172 ASP B C     1 
ATOM   4739  O  O     . ASP B  1 172 ? 8.026   -21.575  32.605  1.00 75.40  ? 172 ASP B O     1 
ATOM   4740  C  CB    . ASP B  1 172 ? 6.680   -18.407  32.272  1.00 76.10  ? 172 ASP B CB    1 
ATOM   4741  C  CG    . ASP B  1 172 ? 6.881   -16.900  32.143  1.00 76.66  ? 172 ASP B CG    1 
ATOM   4742  O  OD1   . ASP B  1 172 ? 7.875   -16.375  32.698  1.00 74.28  ? 172 ASP B OD1   1 
ATOM   4743  O  OD2   . ASP B  1 172 ? 6.033   -16.236  31.491  1.00 80.20  ? 172 ASP B OD2   1 
ATOM   4744  N  N     . ARG B  1 173 ? 7.160   -20.410  34.339  1.00 74.19  ? 173 ARG B N     1 
ATOM   4745  C  CA    . ARG B  1 173 ? 6.632   -21.545  35.087  1.00 75.25  ? 173 ARG B CA    1 
ATOM   4746  C  C     . ARG B  1 173 ? 5.579   -22.313  34.283  1.00 78.53  ? 173 ARG B C     1 
ATOM   4747  O  O     . ARG B  1 173 ? 4.669   -21.708  33.718  1.00 80.56  ? 173 ARG B O     1 
ATOM   4748  C  CB    . ARG B  1 173 ? 5.992   -21.006  36.366  1.00 74.72  ? 173 ARG B CB    1 
ATOM   4749  C  CG    . ARG B  1 173 ? 5.495   -22.053  37.315  1.00 77.08  ? 173 ARG B CG    1 
ATOM   4750  C  CD    . ARG B  1 173 ? 4.853   -21.424  38.536  1.00 80.01  ? 173 ARG B CD    1 
ATOM   4751  N  NE    . ARG B  1 173 ? 4.037   -22.412  39.233  1.00 83.47  ? 173 ARG B NE    1 
ATOM   4752  C  CZ    . ARG B  1 173 ? 2.712   -22.457  39.165  1.00 87.62  ? 173 ARG B CZ    1 
ATOM   4753  N  NH1   . ARG B  1 173 ? 2.048   -21.541  38.456  1.00 88.91  ? 173 ARG B NH1   1 
ATOM   4754  N  NH2   . ARG B  1 173 ? 2.050   -23.407  39.820  1.00 89.56  ? 173 ARG B NH2   1 
ATOM   4755  N  N     . GLN B  1 174 ? 5.706   -23.640  34.249  1.00 79.51  ? 174 GLN B N     1 
ATOM   4756  C  CA    . GLN B  1 174 ? 4.706   -24.534  33.635  1.00 82.86  ? 174 GLN B CA    1 
ATOM   4757  C  C     . GLN B  1 174 ? 4.458   -24.210  32.158  1.00 85.49  ? 174 GLN B C     1 
ATOM   4758  O  O     . GLN B  1 174 ? 3.323   -23.899  31.756  1.00 88.26  ? 174 GLN B O     1 
ATOM   4759  C  CB    . GLN B  1 174 ? 3.383   -24.539  34.437  1.00 84.14  ? 174 GLN B CB    1 
ATOM   4760  C  CG    . GLN B  1 174 ? 3.425   -25.266  35.783  1.00 82.82  ? 174 GLN B CG    1 
ATOM   4761  C  CD    . GLN B  1 174 ? 2.991   -26.732  35.704  1.00 85.96  ? 174 GLN B CD    1 
ATOM   4762  O  OE1   . GLN B  1 174 ? 2.008   -27.072  35.041  1.00 90.35  ? 174 GLN B OE1   1 
ATOM   4763  N  NE2   . GLN B  1 174 ? 3.711   -27.601  36.403  1.00 84.06  ? 174 GLN B NE2   1 
ATOM   4764  N  N     . THR B  1 175 ? 5.518   -24.274  31.355  1.00 84.98  ? 175 THR B N     1 
ATOM   4765  C  CA    . THR B  1 175 ? 5.406   -24.007  29.911  1.00 87.81  ? 175 THR B CA    1 
ATOM   4766  C  C     . THR B  1 175 ? 5.965   -25.141  29.041  1.00 89.48  ? 175 THR B C     1 
ATOM   4767  O  O     . THR B  1 175 ? 6.318   -24.932  27.877  1.00 91.00  ? 175 THR B O     1 
ATOM   4768  C  CB    . THR B  1 175 ? 6.086   -22.683  29.513  1.00 86.34  ? 175 THR B CB    1 
ATOM   4769  O  OG1   . THR B  1 175 ? 7.450   -22.699  29.949  1.00 83.39  ? 175 THR B OG1   1 
ATOM   4770  C  CG2   . THR B  1 175 ? 5.364   -21.490  30.129  1.00 86.02  ? 175 THR B CG2   1 
ATOM   4771  N  N     . GLY B  1 176 ? 6.035   -26.338  29.613  1.00 89.63  ? 176 GLY B N     1 
ATOM   4772  C  CA    . GLY B  1 176 ? 6.529   -27.503  28.898  1.00 91.46  ? 176 GLY B CA    1 
ATOM   4773  C  C     . GLY B  1 176 ? 8.030   -27.488  28.716  1.00 89.67  ? 176 GLY B C     1 
ATOM   4774  O  O     . GLY B  1 176 ? 8.530   -28.006  27.713  1.00 91.60  ? 176 GLY B O     1 
ATOM   4775  N  N     . LYS B  1 177 ? 8.750   -26.898  29.675  1.00 86.48  ? 177 LYS B N     1 
ATOM   4776  C  CA    . LYS B  1 177 ? 10.212  -26.813  29.600  1.00 84.68  ? 177 LYS B CA    1 
ATOM   4777  C  C     . LYS B  1 177 ? 10.805  -28.195  29.770  1.00 85.27  ? 177 LYS B C     1 
ATOM   4778  O  O     . LYS B  1 177 ? 11.520  -28.685  28.903  1.00 86.23  ? 177 LYS B O     1 
ATOM   4779  C  CB    . LYS B  1 177 ? 10.793  -25.865  30.657  1.00 81.24  ? 177 LYS B CB    1 
ATOM   4780  C  CG    . LYS B  1 177 ? 10.322  -24.423  30.582  1.00 79.88  ? 177 LYS B CG    1 
ATOM   4781  C  CD    . LYS B  1 177 ? 11.147  -23.525  31.491  1.00 76.33  ? 177 LYS B CD    1 
ATOM   4782  C  CE    . LYS B  1 177 ? 11.082  -23.924  32.963  1.00 73.72  ? 177 LYS B CE    1 
ATOM   4783  N  NZ    . LYS B  1 177 ? 9.892   -23.386  33.652  1.00 73.32  ? 177 LYS B NZ    1 
ATOM   4784  N  N     . THR B  1 178 ? 10.484  -28.815  30.899  1.00 85.04  ? 178 THR B N     1 
ATOM   4785  C  CA    . THR B  1 178 ? 10.901  -30.171  31.193  1.00 86.78  ? 178 THR B CA    1 
ATOM   4786  C  C     . THR B  1 178 ? 10.466  -31.119  30.067  1.00 89.21  ? 178 THR B C     1 
ATOM   4787  O  O     . THR B  1 178 ? 11.251  -31.948  29.612  1.00 89.70  ? 178 THR B O     1 
ATOM   4788  C  CB    . THR B  1 178 ? 10.362  -30.607  32.584  1.00 86.22  ? 178 THR B CB    1 
ATOM   4789  O  OG1   . THR B  1 178 ? 11.130  -29.960  33.607  1.00 90.02  ? 178 THR B OG1   1 
ATOM   4790  C  CG2   . THR B  1 178 ? 10.436  -32.135  32.778  1.00 88.31  ? 178 THR B CG2   1 
ATOM   4791  N  N     . ALA B  1 179 ? 9.227   -30.949  29.607  1.00 91.00  ? 179 ALA B N     1 
ATOM   4792  C  CA    . ALA B  1 179 ? 8.643   -31.752  28.531  1.00 94.15  ? 179 ALA B CA    1 
ATOM   4793  C  C     . ALA B  1 179 ? 9.525   -31.877  27.284  1.00 95.00  ? 179 ALA B C     1 
ATOM   4794  O  O     . ALA B  1 179 ? 9.586   -32.950  26.672  1.00 97.53  ? 179 ALA B O     1 
ATOM   4795  C  CB    . ALA B  1 179 ? 7.274   -31.217  28.156  1.00 96.37  ? 179 ALA B CB    1 
ATOM   4796  N  N     . VAL B  1 180 ? 10.196  -30.789  26.911  1.00 92.87  ? 180 VAL B N     1 
ATOM   4797  C  CA    . VAL B  1 180 ? 11.117  -30.810  25.774  1.00 93.47  ? 180 VAL B CA    1 
ATOM   4798  C  C     . VAL B  1 180 ? 12.322  -31.711  26.069  1.00 92.23  ? 180 VAL B C     1 
ATOM   4799  O  O     . VAL B  1 180 ? 12.630  -32.610  25.288  1.00 94.67  ? 180 VAL B O     1 
ATOM   4800  C  CB    . VAL B  1 180 ? 11.549  -29.387  25.342  1.00 92.29  ? 180 VAL B CB    1 
ATOM   4801  C  CG1   . VAL B  1 180 ? 12.675  -29.443  24.318  1.00 93.04  ? 180 VAL B CG1   1 
ATOM   4802  C  CG2   . VAL B  1 180 ? 10.356  -28.623  24.775  1.00 93.95  ? 180 VAL B CG2   1 
ATOM   4803  N  N     . ALA B  1 181 ? 12.971  -31.481  27.208  1.00 88.72  ? 181 ALA B N     1 
ATOM   4804  C  CA    . ALA B  1 181 ? 14.080  -32.316  27.671  1.00 87.51  ? 181 ALA B CA    1 
ATOM   4805  C  C     . ALA B  1 181 ? 13.693  -33.796  27.761  1.00 89.56  ? 181 ALA B C     1 
ATOM   4806  O  O     . ALA B  1 181 ? 14.440  -34.671  27.317  1.00 90.86  ? 181 ALA B O     1 
ATOM   4807  C  CB    . ALA B  1 181 ? 14.577  -31.821  29.019  1.00 83.70  ? 181 ALA B CB    1 
ATOM   4808  N  N     . LEU B  1 182 ? 12.516  -34.057  28.328  1.00 90.10  ? 182 LEU B N     1 
ATOM   4809  C  CA    . LEU B  1 182 ? 12.044  -35.410  28.588  1.00 91.92  ? 182 LEU B CA    1 
ATOM   4810  C  C     . LEU B  1 182 ? 11.741  -36.157  27.295  1.00 95.81  ? 182 LEU B C     1 
ATOM   4811  O  O     . LEU B  1 182 ? 12.199  -37.294  27.106  1.00 97.35  ? 182 LEU B O     1 
ATOM   4812  C  CB    . LEU B  1 182 ? 10.803  -35.378  29.486  1.00 91.82  ? 182 LEU B CB    1 
ATOM   4813  C  CG    . LEU B  1 182 ? 10.153  -36.704  29.903  1.00 94.12  ? 182 LEU B CG    1 
ATOM   4814  C  CD1   . LEU B  1 182 ? 11.009  -37.440  30.920  1.00 92.84  ? 182 LEU B CD1   1 
ATOM   4815  C  CD2   . LEU B  1 182 ? 8.753   -36.476  30.460  1.00 94.90  ? 182 LEU B CD2   1 
ATOM   4816  N  N     . ASP B  1 183 ? 10.975  -35.520  26.409  1.00 97.50  ? 183 ASP B N     1 
ATOM   4817  C  CA    . ASP B  1 183 ? 10.624  -36.125  25.118  1.00 101.28 ? 183 ASP B CA    1 
ATOM   4818  C  C     . ASP B  1 183 ? 11.845  -36.312  24.225  1.00 101.56 ? 183 ASP B C     1 
ATOM   4819  O  O     . ASP B  1 183 ? 11.838  -37.158  23.338  1.00 104.47 ? 183 ASP B O     1 
ATOM   4820  C  CB    . ASP B  1 183 ? 9.559   -35.299  24.393  1.00 103.46 ? 183 ASP B CB    1 
ATOM   4821  C  CG    . ASP B  1 183 ? 8.153   -35.601  24.881  1.00 105.58 ? 183 ASP B CG    1 
ATOM   4822  O  OD1   . ASP B  1 183 ? 7.801   -35.205  26.017  1.00 104.29 ? 183 ASP B OD1   1 
ATOM   4823  O  OD2   . ASP B  1 183 ? 7.395   -36.229  24.114  1.00 109.81 ? 183 ASP B OD2   1 
ATOM   4824  N  N     . THR B  1 184 ? 12.881  -35.505  24.464  1.00 98.43  ? 184 THR B N     1 
ATOM   4825  C  CA    . THR B  1 184 ? 14.171  -35.662  23.797  1.00 98.48  ? 184 THR B CA    1 
ATOM   4826  C  C     . THR B  1 184 ? 14.836  -36.959  24.250  1.00 98.42  ? 184 THR B C     1 
ATOM   4827  O  O     . THR B  1 184 ? 15.388  -37.702  23.434  1.00 100.79 ? 184 THR B O     1 
ATOM   4828  C  CB    . THR B  1 184 ? 15.094  -34.454  24.066  1.00 95.40  ? 184 THR B CB    1 
ATOM   4829  O  OG1   . THR B  1 184 ? 14.602  -33.317  23.348  1.00 96.11  ? 184 THR B OG1   1 
ATOM   4830  C  CG2   . THR B  1 184 ? 16.523  -34.733  23.620  1.00 95.74  ? 184 THR B CG2   1 
ATOM   4831  N  N     . ILE B  1 185 ? 14.762  -37.227  25.552  1.00 95.75  ? 185 ILE B N     1 
ATOM   4832  C  CA    . ILE B  1 185 ? 15.320  -38.446  26.122  1.00 95.58  ? 185 ILE B CA    1 
ATOM   4833  C  C     . ILE B  1 185 ? 14.534  -39.683  25.672  1.00 99.06  ? 185 ILE B C     1 
ATOM   4834  O  O     . ILE B  1 185 ? 15.131  -40.682  25.280  1.00 101.06 ? 185 ILE B O     1 
ATOM   4835  C  CB    . ILE B  1 185 ? 15.445  -38.352  27.663  1.00 92.12  ? 185 ILE B CB    1 
ATOM   4836  C  CG1   . ILE B  1 185 ? 16.556  -37.365  28.027  1.00 88.99  ? 185 ILE B CG1   1 
ATOM   4837  C  CG2   . ILE B  1 185 ? 15.751  -39.715  28.271  1.00 93.25  ? 185 ILE B CG2   1 
ATOM   4838  C  CD1   . ILE B  1 185 ? 16.634  -37.013  29.492  1.00 86.01  ? 185 ILE B CD1   1 
ATOM   4839  N  N     . LEU B  1 186 ? 13.204  -39.605  25.699  1.00 100.11 ? 186 LEU B N     1 
ATOM   4840  C  CA    . LEU B  1 186 ? 12.353  -40.722  25.259  1.00 103.60 ? 186 LEU B CA    1 
ATOM   4841  C  C     . LEU B  1 186 ? 12.447  -40.969  23.758  1.00 107.21 ? 186 LEU B C     1 
ATOM   4842  O  O     . LEU B  1 186 ? 11.923  -41.959  23.259  1.00 110.97 ? 186 LEU B O     1 
ATOM   4843  C  CB    . LEU B  1 186 ? 10.882  -40.486  25.617  1.00 104.11 ? 186 LEU B CB    1 
ATOM   4844  C  CG    . LEU B  1 186 ? 10.455  -40.294  27.068  1.00 101.55 ? 186 LEU B CG    1 
ATOM   4845  C  CD1   . LEU B  1 186 ? 9.003   -39.844  27.129  1.00 102.87 ? 186 LEU B CD1   1 
ATOM   4846  C  CD2   . LEU B  1 186 ? 10.662  -41.567  27.854  1.00 101.67 ? 186 LEU B CD2   1 
ATOM   4847  N  N     . ASN B  1 187 ? 13.095  -40.058  23.039  1.00 106.63 ? 187 ASN B N     1 
ATOM   4848  C  CA    . ASN B  1 187 ? 13.253  -40.191  21.599  1.00 109.99 ? 187 ASN B CA    1 
ATOM   4849  C  C     . ASN B  1 187 ? 14.525  -40.950  21.284  1.00 110.64 ? 187 ASN B C     1 
ATOM   4850  O  O     . ASN B  1 187 ? 14.676  -41.483  20.184  1.00 114.27 ? 187 ASN B O     1 
ATOM   4851  C  CB    . ASN B  1 187 ? 13.280  -38.813  20.930  1.00 109.61 ? 187 ASN B CB    1 
ATOM   4852  C  CG    . ASN B  1 187 ? 13.012  -38.879  19.436  1.00 113.93 ? 187 ASN B CG    1 
ATOM   4853  O  OD1   . ASN B  1 187 ? 12.036  -39.487  18.993  1.00 117.13 ? 187 ASN B OD1   1 
ATOM   4854  N  ND2   . ASN B  1 187 ? 13.879  -38.245  18.651  1.00 114.00 ? 187 ASN B ND2   1 
ATOM   4855  N  N     . GLN B  1 188 ? 15.429  -41.003  22.261  1.00 107.46 ? 188 GLN B N     1 
ATOM   4856  C  CA    . GLN B  1 188 ? 16.711  -41.691  22.108  1.00 108.02 ? 188 GLN B CA    1 
ATOM   4857  C  C     . GLN B  1 188 ? 16.574  -43.209  22.059  1.00 111.04 ? 188 GLN B C     1 
ATOM   4858  O  O     . GLN B  1 188 ? 17.437  -43.889  21.495  1.00 113.00 ? 188 GLN B O     1 
ATOM   4859  C  CB    . GLN B  1 188 ? 17.697  -41.283  23.208  1.00 104.12 ? 188 GLN B CB    1 
ATOM   4860  C  CG    . GLN B  1 188 ? 18.037  -39.804  23.239  1.00 100.85 ? 188 GLN B CG    1 
ATOM   4861  C  CD    . GLN B  1 188 ? 18.236  -39.224  21.859  1.00 102.57 ? 188 GLN B CD    1 
ATOM   4862  O  OE1   . GLN B  1 188 ? 19.195  -39.556  21.165  1.00 104.07 ? 188 GLN B OE1   1 
ATOM   4863  N  NE2   . GLN B  1 188 ? 17.326  -38.348  21.451  1.00 102.90 ? 188 GLN B NE2   1 
ATOM   4864  N  N     . LYS B  1 189 ? 15.488  -43.728  22.635  1.00 111.67 ? 189 LYS B N     1 
ATOM   4865  C  CA    . LYS B  1 189 ? 15.166  -45.155  22.566  1.00 114.94 ? 189 LYS B CA    1 
ATOM   4866  C  C     . LYS B  1 189 ? 15.394  -45.690  21.157  1.00 119.41 ? 189 LYS B C     1 
ATOM   4867  O  O     . LYS B  1 189 ? 15.798  -46.845  20.981  1.00 122.02 ? 189 LYS B O     1 
ATOM   4868  C  CB    . LYS B  1 189 ? 13.723  -45.425  23.022  1.00 115.67 ? 189 LYS B CB    1 
ATOM   4869  C  CG    . LYS B  1 189 ? 13.411  -46.922  23.223  1.00 118.59 ? 189 LYS B CG    1 
ATOM   4870  C  CD    . LYS B  1 189 ? 12.186  -47.194  24.103  1.00 118.16 ? 189 LYS B CD    1 
ATOM   4871  C  CE    . LYS B  1 189 ? 10.859  -46.908  23.395  1.00 120.84 ? 189 LYS B CE    1 
ATOM   4872  N  NZ    . LYS B  1 189 ? 10.577  -47.837  22.262  1.00 125.61 ? 189 LYS B NZ    1 
ATOM   4873  N  N     . ARG B  1 190 ? 15.164  -44.833  20.165  1.00 120.70 ? 190 ARG B N     1 
ATOM   4874  C  CA    . ARG B  1 190 ? 15.315  -45.196  18.754  1.00 125.31 ? 190 ARG B CA    1 
ATOM   4875  C  C     . ARG B  1 190 ? 16.651  -45.867  18.398  1.00 126.70 ? 190 ARG B C     1 
ATOM   4876  O  O     . ARG B  1 190 ? 16.663  -46.924  17.771  1.00 130.61 ? 190 ARG B O     1 
ATOM   4877  C  CB    . ARG B  1 190 ? 15.034  -43.990  17.851  1.00 125.71 ? 190 ARG B CB    1 
ATOM   4878  C  CG    . ARG B  1 190 ? 13.557  -43.656  17.757  1.00 126.61 ? 190 ARG B CG    1 
ATOM   4879  C  CD    . ARG B  1 190 ? 13.259  -42.673  16.640  1.00 127.97 ? 190 ARG B CD    1 
ATOM   4880  N  NE    . ARG B  1 190 ? 11.887  -42.817  16.153  1.00 130.92 ? 190 ARG B NE    1 
ATOM   4881  C  CZ    . ARG B  1 190 ? 10.809  -42.316  16.754  1.00 129.38 ? 190 ARG B CZ    1 
ATOM   4882  N  NH1   . ARG B  1 190 ? 10.923  -41.628  17.881  1.00 124.95 ? 190 ARG B NH1   1 
ATOM   4883  N  NH2   . ARG B  1 190 ? 9.608   -42.505  16.225  1.00 132.66 ? 190 ARG B NH2   1 
ATOM   4884  N  N     . TRP B  1 191 ? 17.760  -45.261  18.817  1.00 124.04 ? 191 TRP B N     1 
ATOM   4885  C  CA    . TRP B  1 191 ? 19.098  -45.773  18.500  1.00 125.50 ? 191 TRP B CA    1 
ATOM   4886  C  C     . TRP B  1 191 ? 19.769  -46.455  19.696  1.00 123.58 ? 191 TRP B C     1 
ATOM   4887  O  O     . TRP B  1 191 ? 20.733  -47.206  19.527  1.00 125.13 ? 191 TRP B O     1 
ATOM   4888  C  CB    . TRP B  1 191 ? 19.999  -44.651  17.968  1.00 124.51 ? 191 TRP B CB    1 
ATOM   4889  C  CG    . TRP B  1 191 ? 19.367  -43.816  16.895  1.00 126.73 ? 191 TRP B CG    1 
ATOM   4890  C  CD1   . TRP B  1 191 ? 19.519  -43.959  15.544  1.00 131.33 ? 191 TRP B CD1   1 
ATOM   4891  C  CD2   . TRP B  1 191 ? 18.477  -42.709  17.083  1.00 124.63 ? 191 TRP B CD2   1 
ATOM   4892  N  NE1   . TRP B  1 191 ? 18.776  -43.011  14.879  1.00 132.12 ? 191 TRP B NE1   1 
ATOM   4893  C  CE2   . TRP B  1 191 ? 18.127  -42.231  15.800  1.00 127.97 ? 191 TRP B CE2   1 
ATOM   4894  C  CE3   . TRP B  1 191 ? 17.936  -42.081  18.209  1.00 120.12 ? 191 TRP B CE3   1 
ATOM   4895  C  CZ2   . TRP B  1 191 ? 17.263  -41.153  15.615  1.00 127.04 ? 191 TRP B CZ2   1 
ATOM   4896  C  CZ3   . TRP B  1 191 ? 17.077  -41.012  18.022  1.00 119.67 ? 191 TRP B CZ3   1 
ATOM   4897  C  CH2   . TRP B  1 191 ? 16.745  -40.562  16.735  1.00 122.95 ? 191 TRP B CH2   1 
ATOM   4898  N  N     . ASN B  1 192 ? 19.258  -46.196  20.897  1.00 120.60 ? 192 ASN B N     1 
ATOM   4899  C  CA    . ASN B  1 192 ? 19.828  -46.761  22.119  1.00 118.97 ? 192 ASN B CA    1 
ATOM   4900  C  C     . ASN B  1 192 ? 19.460  -48.226  22.357  1.00 121.92 ? 192 ASN B C     1 
ATOM   4901  O  O     . ASN B  1 192 ? 19.645  -48.746  23.461  1.00 120.55 ? 192 ASN B O     1 
ATOM   4902  C  CB    . ASN B  1 192 ? 19.453  -45.905  23.330  1.00 114.69 ? 192 ASN B CB    1 
ATOM   4903  C  CG    . ASN B  1 192 ? 20.222  -44.586  23.384  1.00 112.09 ? 192 ASN B CG    1 
ATOM   4904  O  OD1   . ASN B  1 192 ? 21.208  -44.392  22.673  1.00 113.57 ? 192 ASN B OD1   1 
ATOM   4905  N  ND2   . ASN B  1 192 ? 19.772  -43.677  24.241  1.00 108.35 ? 192 ASN B ND2   1 
ATOM   4906  N  N     . ASN B  1 193 ? 18.931  -48.872  21.317  1.00 126.36 ? 193 ASN B N     1 
ATOM   4907  C  CA    . ASN B  1 193 ? 18.697  -50.319  21.290  1.00 130.00 ? 193 ASN B CA    1 
ATOM   4908  C  C     . ASN B  1 193 ? 19.587  -50.970  20.237  1.00 133.68 ? 193 ASN B C     1 
ATOM   4909  O  O     . ASN B  1 193 ? 19.706  -52.201  20.170  1.00 136.54 ? 193 ASN B O     1 
ATOM   4910  C  CB    . ASN B  1 193 ? 17.237  -50.630  20.945  1.00 132.59 ? 193 ASN B CB    1 
ATOM   4911  C  CG    . ASN B  1 193 ? 16.258  -50.098  21.971  1.00 130.22 ? 193 ASN B CG    1 
ATOM   4912  O  OD1   . ASN B  1 193 ? 16.469  -50.220  23.181  1.00 128.40 ? 193 ASN B OD1   1 
ATOM   4913  N  ND2   . ASN B  1 193 ? 15.164  -49.512  21.489  1.00 131.20 ? 193 ASN B ND2   1 
ATOM   4914  N  N     . GLY B  1 194 ? 20.201  -50.125  19.414  1.00 133.75 ? 194 GLY B N     1 
ATOM   4915  C  CA    . GLY B  1 194 ? 20.935  -50.565  18.240  1.00 137.65 ? 194 GLY B CA    1 
ATOM   4916  C  C     . GLY B  1 194 ? 22.334  -51.093  18.483  1.00 137.91 ? 194 GLY B C     1 
ATOM   4917  O  O     . GLY B  1 194 ? 22.852  -51.052  19.605  1.00 134.67 ? 194 GLY B O     1 
ATOM   4918  N  N     . SER B  1 195 ? 22.927  -51.593  17.400  1.00 142.08 ? 195 SER B N     1 
ATOM   4919  C  CA    . SER B  1 195 ? 24.284  -52.131  17.380  1.00 143.35 ? 195 SER B CA    1 
ATOM   4920  C  C     . SER B  1 195 ? 25.314  -51.018  17.170  1.00 141.70 ? 195 SER B C     1 
ATOM   4921  O  O     . SER B  1 195 ? 26.337  -50.981  17.862  1.00 140.12 ? 195 SER B O     1 
ATOM   4922  C  CB    . SER B  1 195 ? 24.405  -53.178  16.275  1.00 148.78 ? 195 SER B CB    1 
ATOM   4923  O  OG    . SER B  1 195 ? 23.221  -53.951  16.195  1.00 150.72 ? 195 SER B OG    1 
ATOM   4924  N  N     . ASP B  1 196 ? 25.035  -50.121  16.217  1.00 142.40 ? 196 ASP B N     1 
ATOM   4925  C  CA    . ASP B  1 196 ? 25.878  -48.954  15.950  1.00 140.67 ? 196 ASP B CA    1 
ATOM   4926  C  C     . ASP B  1 196 ? 26.167  -48.249  17.266  1.00 135.42 ? 196 ASP B C     1 
ATOM   4927  O  O     . ASP B  1 196 ? 25.251  -47.771  17.941  1.00 132.54 ? 196 ASP B O     1 
ATOM   4928  C  CB    . ASP B  1 196 ? 25.203  -48.005  14.942  1.00 141.70 ? 196 ASP B CB    1 
ATOM   4929  C  CG    . ASP B  1 196 ? 25.954  -46.673  14.768  1.00 139.97 ? 196 ASP B CG    1 
ATOM   4930  O  OD1   . ASP B  1 196 ? 25.930  -45.833  15.699  1.00 135.29 ? 196 ASP B OD1   1 
ATOM   4931  O  OD2   . ASP B  1 196 ? 26.542  -46.454  13.684  1.00 143.18 ? 196 ASP B OD2   1 
ATOM   4932  N  N     . GLU B  1 197 ? 27.445  -48.210  17.628  1.00 134.47 ? 197 GLU B N     1 
ATOM   4933  C  CA    . GLU B  1 197 ? 27.881  -47.616  18.891  1.00 129.86 ? 197 GLU B CA    1 
ATOM   4934  C  C     . GLU B  1 197 ? 27.859  -46.074  18.919  1.00 126.31 ? 197 GLU B C     1 
ATOM   4935  O  O     . GLU B  1 197 ? 27.842  -45.474  19.992  1.00 122.04 ? 197 GLU B O     1 
ATOM   4936  C  CB    . GLU B  1 197 ? 29.273  -48.157  19.264  1.00 130.74 ? 197 GLU B CB    1 
ATOM   4937  C  CG    . GLU B  1 197 ? 29.266  -49.251  20.335  1.00 130.47 ? 197 GLU B CG    1 
ATOM   4938  C  CD    . GLU B  1 197 ? 29.305  -48.698  21.771  1.00 126.70 ? 197 GLU B CD    1 
ATOM   4939  O  OE1   . GLU B  1 197 ? 28.789  -47.578  22.029  1.00 122.80 ? 197 GLU B OE1   1 
ATOM   4940  O  OE2   . GLU B  1 197 ? 29.857  -49.399  22.651  1.00 126.57 ? 197 GLU B OE2   1 
ATOM   4941  N  N     . SER B  1 198 ? 27.832  -45.451  17.741  1.00 127.99 ? 198 SER B N     1 
ATOM   4942  C  CA    . SER B  1 198 ? 28.099  -44.013  17.604  1.00 125.66 ? 198 SER B CA    1 
ATOM   4943  C  C     . SER B  1 198 ? 26.874  -43.106  17.646  1.00 123.15 ? 198 SER B C     1 
ATOM   4944  O  O     . SER B  1 198 ? 26.999  -41.921  17.955  1.00 120.32 ? 198 SER B O     1 
ATOM   4945  C  CB    . SER B  1 198 ? 28.863  -43.732  16.306  1.00 129.33 ? 198 SER B CB    1 
ATOM   4946  O  OG    . SER B  1 198 ? 27.972  -43.588  15.209  1.00 132.03 ? 198 SER B OG    1 
ATOM   4947  N  N     . LYS B  1 199 ? 25.708  -43.647  17.299  1.00 124.34 ? 199 LYS B N     1 
ATOM   4948  C  CA    . LYS B  1 199 ? 24.468  -42.859  17.273  1.00 122.30 ? 199 LYS B CA    1 
ATOM   4949  C  C     . LYS B  1 199 ? 23.681  -43.029  18.573  1.00 118.46 ? 199 LYS B C     1 
ATOM   4950  O  O     . LYS B  1 199 ? 22.490  -42.710  18.645  1.00 117.47 ? 199 LYS B O     1 
ATOM   4951  C  CB    . LYS B  1 199 ? 23.609  -43.223  16.051  1.00 126.62 ? 199 LYS B CB    1 
ATOM   4952  C  CG    . LYS B  1 199 ? 24.198  -42.801  14.699  1.00 129.86 ? 199 LYS B CG    1 
ATOM   4953  C  CD    . LYS B  1 199 ? 23.281  -43.202  13.554  1.00 134.12 ? 199 LYS B CD    1 
ATOM   4954  C  CE    . LYS B  1 199 ? 23.987  -43.102  12.216  1.00 138.24 ? 199 LYS B CE    1 
ATOM   4955  N  NZ    . LYS B  1 199 ? 23.374  -44.031  11.225  1.00 142.87 ? 199 LYS B NZ    1 
ATOM   4956  N  N     . LYS B  1 200 ? 24.372  -43.534  19.592  1.00 116.23 ? 200 LYS B N     1 
ATOM   4957  C  CA    . LYS B  1 200 ? 23.800  -43.762  20.911  1.00 112.97 ? 200 LYS B CA    1 
ATOM   4958  C  C     . LYS B  1 200 ? 23.976  -42.533  21.790  1.00 108.22 ? 200 LYS B C     1 
ATOM   4959  O  O     . LYS B  1 200 ? 25.092  -42.035  21.947  1.00 106.98 ? 200 LYS B O     1 
ATOM   4960  C  CB    . LYS B  1 200 ? 24.472  -44.963  21.580  1.00 113.70 ? 200 LYS B CB    1 
ATOM   4961  C  CG    . LYS B  1 200 ? 23.872  -46.305  21.244  1.00 117.19 ? 200 LYS B CG    1 
ATOM   4962  C  CD    . LYS B  1 200 ? 24.629  -47.398  21.972  1.00 118.72 ? 200 LYS B CD    1 
ATOM   4963  C  CE    . LYS B  1 200 ? 23.741  -48.600  22.236  1.00 121.14 ? 200 LYS B CE    1 
ATOM   4964  N  NZ    . LYS B  1 200 ? 24.533  -49.798  22.639  1.00 123.41 ? 200 LYS B NZ    1 
ATOM   4965  N  N     . LEU B  1 201 ? 22.875  -42.061  22.369  1.00 105.57 ? 201 LEU B N     1 
ATOM   4966  C  CA    . LEU B  1 201 ? 22.916  -40.896  23.247  1.00 101.38 ? 201 LEU B CA    1 
ATOM   4967  C  C     . LEU B  1 201 ? 22.516  -41.219  24.688  1.00 98.80  ? 201 LEU B C     1 
ATOM   4968  O  O     . LEU B  1 201 ? 21.328  -41.279  25.020  1.00 98.35  ? 201 LEU B O     1 
ATOM   4969  C  CB    . LEU B  1 201 ? 22.055  -39.757  22.686  1.00 100.73 ? 201 LEU B CB    1 
ATOM   4970  C  CG    . LEU B  1 201 ? 22.260  -38.369  23.296  1.00 96.18  ? 201 LEU B CG    1 
ATOM   4971  C  CD1   . LEU B  1 201 ? 23.676  -37.880  23.070  1.00 95.26  ? 201 LEU B CD1   1 
ATOM   4972  C  CD2   . LEU B  1 201 ? 21.274  -37.388  22.715  1.00 95.31  ? 201 LEU B CD2   1 
ATOM   4973  N  N     . TYR B  1 202 ? 23.517  -41.427  25.538  1.00 97.31  ? 202 TYR B N     1 
ATOM   4974  C  CA    . TYR B  1 202 ? 23.270  -41.720  26.941  1.00 95.15  ? 202 TYR B CA    1 
ATOM   4975  C  C     . TYR B  1 202 ? 22.875  -40.429  27.625  1.00 91.79  ? 202 TYR B C     1 
ATOM   4976  O  O     . TYR B  1 202 ? 23.350  -39.360  27.258  1.00 90.94  ? 202 TYR B O     1 
ATOM   4977  C  CB    . TYR B  1 202 ? 24.498  -42.354  27.598  1.00 95.15  ? 202 TYR B CB    1 
ATOM   4978  C  CG    . TYR B  1 202 ? 24.866  -43.699  27.006  1.00 98.83  ? 202 TYR B CG    1 
ATOM   4979  C  CD1   . TYR B  1 202 ? 25.709  -43.787  25.901  1.00 101.73 ? 202 TYR B CD1   1 
ATOM   4980  C  CD2   . TYR B  1 202 ? 24.364  -44.881  27.540  1.00 100.12 ? 202 TYR B CD2   1 
ATOM   4981  C  CE1   . TYR B  1 202 ? 26.049  -45.018  25.343  1.00 105.55 ? 202 TYR B CE1   1 
ATOM   4982  C  CE2   . TYR B  1 202 ? 24.704  -46.121  26.992  1.00 104.32 ? 202 TYR B CE2   1 
ATOM   4983  C  CZ    . TYR B  1 202 ? 25.548  -46.181  25.891  1.00 106.63 ? 202 TYR B CZ    1 
ATOM   4984  O  OH    . TYR B  1 202 ? 25.889  -47.397  25.334  1.00 110.31 ? 202 TYR B OH    1 
ATOM   4985  N  N     . CYS B  1 203 ? 21.990  -40.525  28.605  1.00 90.22  ? 203 CYS B N     1 
ATOM   4986  C  CA    . CYS B  1 203 ? 21.391  -39.335  29.168  1.00 87.42  ? 203 CYS B CA    1 
ATOM   4987  C  C     . CYS B  1 203 ? 21.721  -39.103  30.631  1.00 84.72  ? 203 CYS B C     1 
ATOM   4988  O  O     . CYS B  1 203 ? 21.958  -40.036  31.396  1.00 85.44  ? 203 CYS B O     1 
ATOM   4989  C  CB    . CYS B  1 203 ? 19.881  -39.384  28.984  1.00 88.19  ? 203 CYS B CB    1 
ATOM   4990  S  SG    . CYS B  1 203 ? 19.387  -39.493  27.273  1.00 92.20  ? 203 CYS B SG    1 
ATOM   4991  N  N     . VAL B  1 204 ? 21.740  -37.834  31.009  1.00 82.10  ? 204 VAL B N     1 
ATOM   4992  C  CA    . VAL B  1 204 ? 21.810  -37.457  32.400  1.00 79.34  ? 204 VAL B CA    1 
ATOM   4993  C  C     . VAL B  1 204 ? 20.769  -36.366  32.655  1.00 77.49  ? 204 VAL B C     1 
ATOM   4994  O  O     . VAL B  1 204 ? 20.811  -35.275  32.061  1.00 76.55  ? 204 VAL B O     1 
ATOM   4995  C  CB    . VAL B  1 204 ? 23.213  -36.973  32.809  1.00 78.17  ? 204 VAL B CB    1 
ATOM   4996  C  CG1   . VAL B  1 204 ? 23.687  -37.773  33.998  1.00 78.34  ? 204 VAL B CG1   1 
ATOM   4997  C  CG2   . VAL B  1 204 ? 24.209  -37.114  31.664  1.00 80.06  ? 204 VAL B CG2   1 
ATOM   4998  N  N     . TYR B  1 205 ? 19.811  -36.685  33.518  1.00 76.81  ? 205 TYR B N     1 
ATOM   4999  C  CA    . TYR B  1 205 ? 18.807  -35.721  33.926  1.00 75.07  ? 205 TYR B CA    1 
ATOM   5000  C  C     . TYR B  1 205 ? 19.115  -35.267  35.340  1.00 72.48  ? 205 TYR B C     1 
ATOM   5001  O  O     . TYR B  1 205 ? 19.124  -36.074  36.263  1.00 72.62  ? 205 TYR B O     1 
ATOM   5002  C  CB    . TYR B  1 205 ? 17.406  -36.328  33.839  1.00 76.67  ? 205 TYR B CB    1 
ATOM   5003  C  CG    . TYR B  1 205 ? 16.300  -35.377  34.223  1.00 75.64  ? 205 TYR B CG    1 
ATOM   5004  C  CD1   . TYR B  1 205 ? 15.765  -34.477  33.296  1.00 75.66  ? 205 TYR B CD1   1 
ATOM   5005  C  CD2   . TYR B  1 205 ? 15.790  -35.369  35.516  1.00 75.09  ? 205 TYR B CD2   1 
ATOM   5006  C  CE1   . TYR B  1 205 ? 14.747  -33.594  33.651  1.00 74.64  ? 205 TYR B CE1   1 
ATOM   5007  C  CE2   . TYR B  1 205 ? 14.777  -34.485  35.881  1.00 74.74  ? 205 TYR B CE2   1 
ATOM   5008  C  CZ    . TYR B  1 205 ? 14.259  -33.611  34.944  1.00 74.04  ? 205 TYR B CZ    1 
ATOM   5009  O  OH    . TYR B  1 205 ? 13.256  -32.764  35.323  1.00 73.38  ? 205 TYR B OH    1 
ATOM   5010  N  N     . VAL B  1 206 ? 19.370  -33.971  35.497  1.00 70.41  ? 206 VAL B N     1 
ATOM   5011  C  CA    . VAL B  1 206 ? 19.725  -33.395  36.796  1.00 67.92  ? 206 VAL B CA    1 
ATOM   5012  C  C     . VAL B  1 206 ? 18.555  -32.640  37.417  1.00 66.55  ? 206 VAL B C     1 
ATOM   5013  O  O     . VAL B  1 206 ? 18.098  -31.648  36.864  1.00 66.22  ? 206 VAL B O     1 
ATOM   5014  C  CB    . VAL B  1 206 ? 20.905  -32.425  36.677  1.00 66.46  ? 206 VAL B CB    1 
ATOM   5015  C  CG1   . VAL B  1 206 ? 21.461  -32.118  38.059  1.00 64.41  ? 206 VAL B CG1   1 
ATOM   5016  C  CG2   . VAL B  1 206 ? 21.972  -33.009  35.773  1.00 67.80  ? 206 VAL B CG2   1 
ATOM   5017  N  N     . ALA B  1 207 ? 18.086  -33.111  38.568  1.00 65.85  ? 207 ALA B N     1 
ATOM   5018  C  CA    . ALA B  1 207 ? 16.987  -32.468  39.268  1.00 64.67  ? 207 ALA B CA    1 
ATOM   5019  C  C     . ALA B  1 207 ? 17.512  -31.549  40.367  1.00 62.43  ? 207 ALA B C     1 
ATOM   5020  O  O     . ALA B  1 207 ? 18.043  -32.027  41.369  1.00 62.42  ? 207 ALA B O     1 
ATOM   5021  C  CB    . ALA B  1 207 ? 16.060  -33.523  39.846  1.00 65.89  ? 207 ALA B CB    1 
ATOM   5022  N  N     . VAL B  1 208 ? 17.374  -30.236  40.188  1.00 60.91  ? 208 VAL B N     1 
ATOM   5023  C  CA    . VAL B  1 208 ? 17.828  -29.277  41.211  1.00 59.05  ? 208 VAL B CA    1 
ATOM   5024  C  C     . VAL B  1 208 ? 16.664  -28.514  41.860  1.00 58.60  ? 208 VAL B C     1 
ATOM   5025  O  O     . VAL B  1 208 ? 16.029  -27.672  41.228  1.00 58.31  ? 208 VAL B O     1 
ATOM   5026  C  CB    . VAL B  1 208 ? 18.873  -28.251  40.672  1.00 57.90  ? 208 VAL B CB    1 
ATOM   5027  C  CG1   . VAL B  1 208 ? 19.342  -27.325  41.791  1.00 56.14  ? 208 VAL B CG1   1 
ATOM   5028  C  CG2   . VAL B  1 208 ? 20.070  -28.947  40.059  1.00 58.59  ? 208 VAL B CG2   1 
ATOM   5029  N  N     . GLY B  1 209 ? 16.394  -28.815  43.127  1.00 58.58  ? 209 GLY B N     1 
ATOM   5030  C  CA    . GLY B  1 209 ? 15.361  -28.111  43.882  1.00 58.32  ? 209 GLY B CA    1 
ATOM   5031  C  C     . GLY B  1 209 ? 13.949  -28.521  43.538  1.00 59.94  ? 209 GLY B C     1 
ATOM   5032  O  O     . GLY B  1 209 ? 12.995  -27.905  43.995  1.00 60.32  ? 209 GLY B O     1 
ATOM   5033  N  N     . GLN B  1 210 ? 13.813  -29.560  42.728  1.00 61.43  ? 210 GLN B N     1 
ATOM   5034  C  CA    . GLN B  1 210 ? 12.505  -30.090  42.390  1.00 63.54  ? 210 GLN B CA    1 
ATOM   5035  C  C     . GLN B  1 210 ? 11.894  -30.777  43.604  1.00 64.61  ? 210 GLN B C     1 
ATOM   5036  O  O     . GLN B  1 210 ? 12.576  -31.036  44.596  1.00 64.05  ? 210 GLN B O     1 
ATOM   5037  C  CB    . GLN B  1 210 ? 12.604  -31.074  41.225  1.00 65.00  ? 210 GLN B CB    1 
ATOM   5038  C  CG    . GLN B  1 210 ? 12.894  -30.424  39.891  1.00 64.88  ? 210 GLN B CG    1 
ATOM   5039  C  CD    . GLN B  1 210 ? 12.888  -31.412  38.741  1.00 67.53  ? 210 GLN B CD    1 
ATOM   5040  O  OE1   . GLN B  1 210 ? 12.140  -32.388  38.745  1.00 69.94  ? 210 GLN B OE1   1 
ATOM   5041  N  NE2   . GLN B  1 210 ? 13.724  -31.158  37.743  1.00 68.02  ? 210 GLN B NE2   1 
ATOM   5042  N  N     . LYS B  1 211 ? 10.596  -31.049  43.529  1.00 66.46  ? 211 LYS B N     1 
ATOM   5043  C  CA    . LYS B  1 211 ? 9.937   -31.855  44.541  1.00 67.93  ? 211 LYS B CA    1 
ATOM   5044  C  C     . LYS B  1 211 ? 10.394  -33.319  44.414  1.00 69.35  ? 211 LYS B C     1 
ATOM   5045  O  O     . LYS B  1 211 ? 10.590  -33.841  43.304  1.00 69.93  ? 211 LYS B O     1 
ATOM   5046  C  CB    . LYS B  1 211 ? 8.406   -31.728  44.417  1.00 69.92  ? 211 LYS B CB    1 
ATOM   5047  C  CG    . LYS B  1 211 ? 7.768   -30.645  45.298  1.00 68.99  ? 211 LYS B CG    1 
ATOM   5048  C  CD    . LYS B  1 211 ? 6.471   -30.113  44.712  1.00 70.39  ? 211 LYS B CD    1 
ATOM   5049  C  CE    . LYS B  1 211 ? 5.400   -31.194  44.612  1.00 74.88  ? 211 LYS B CE    1 
ATOM   5050  N  NZ    . LYS B  1 211 ? 4.146   -30.714  43.943  1.00 76.91  ? 211 LYS B NZ    1 
ATOM   5051  N  N     . ARG B  1 212 ? 10.567  -33.971  45.559  1.00 69.83  ? 212 ARG B N     1 
ATOM   5052  C  CA    . ARG B  1 212 ? 10.943  -35.379  45.608  1.00 71.33  ? 212 ARG B CA    1 
ATOM   5053  C  C     . ARG B  1 212 ? 9.957   -36.258  44.823  1.00 74.25  ? 212 ARG B C     1 
ATOM   5054  O  O     . ARG B  1 212 ? 10.363  -37.219  44.156  1.00 75.52  ? 212 ARG B O     1 
ATOM   5055  C  CB    . ARG B  1 212 ? 11.042  -35.837  47.062  1.00 71.47  ? 212 ARG B CB    1 
ATOM   5056  C  CG    . ARG B  1 212 ? 12.148  -36.817  47.321  1.00 71.53  ? 212 ARG B CG    1 
ATOM   5057  C  CD    . ARG B  1 212 ? 12.466  -36.924  48.801  1.00 71.98  ? 212 ARG B CD    1 
ATOM   5058  N  NE    . ARG B  1 212 ? 13.739  -36.288  49.145  1.00 71.09  ? 212 ARG B NE    1 
ATOM   5059  C  CZ    . ARG B  1 212 ? 14.444  -36.552  50.245  1.00 71.54  ? 212 ARG B CZ    1 
ATOM   5060  N  NH1   . ARG B  1 212 ? 14.013  -37.451  51.121  1.00 74.58  ? 212 ARG B NH1   1 
ATOM   5061  N  NH2   . ARG B  1 212 ? 15.589  -35.919  50.473  1.00 69.35  ? 212 ARG B NH2   1 
ATOM   5062  N  N     . SER B  1 213 ? 8.669   -35.920  44.886  1.00 75.68  ? 213 SER B N     1 
ATOM   5063  C  CA    . SER B  1 213 ? 7.649   -36.701  44.181  1.00 78.83  ? 213 SER B CA    1 
ATOM   5064  C  C     . SER B  1 213 ? 7.744   -36.537  42.660  1.00 79.06  ? 213 SER B C     1 
ATOM   5065  O  O     . SER B  1 213 ? 7.696   -37.519  41.929  1.00 81.01  ? 213 SER B O     1 
ATOM   5066  C  CB    . SER B  1 213 ? 6.234   -36.394  44.699  1.00 80.37  ? 213 SER B CB    1 
ATOM   5067  O  OG    . SER B  1 213 ? 5.670   -35.246  44.088  1.00 80.35  ? 213 SER B OG    1 
ATOM   5068  N  N     . THR B  1 214 ? 7.901   -35.300  42.198  1.00 77.38  ? 214 THR B N     1 
ATOM   5069  C  CA    . THR B  1 214 ? 8.033   -35.005  40.773  1.00 77.72  ? 214 THR B CA    1 
ATOM   5070  C  C     . THR B  1 214 ? 9.123   -35.871  40.151  1.00 77.98  ? 214 THR B C     1 
ATOM   5071  O  O     . THR B  1 214 ? 8.885   -36.515  39.129  1.00 80.05  ? 214 THR B O     1 
ATOM   5072  C  CB    . THR B  1 214 ? 8.333   -33.501  40.530  1.00 75.48  ? 214 THR B CB    1 
ATOM   5073  O  OG1   . THR B  1 214 ? 7.345   -32.706  41.199  1.00 75.49  ? 214 THR B OG1   1 
ATOM   5074  C  CG2   . THR B  1 214 ? 8.343   -33.156  39.030  1.00 75.62  ? 214 THR B CG2   1 
ATOM   5075  N  N     . VAL B  1 215 ? 10.298  -35.895  40.789  1.00 76.26  ? 215 VAL B N     1 
ATOM   5076  C  CA    . VAL B  1 215 ? 11.447  -36.721  40.360  1.00 76.50  ? 215 VAL B CA    1 
ATOM   5077  C  C     . VAL B  1 215 ? 11.173  -38.234  40.416  1.00 79.18  ? 215 VAL B C     1 
ATOM   5078  O  O     . VAL B  1 215 ? 11.658  -38.983  39.566  1.00 80.40  ? 215 VAL B O     1 
ATOM   5079  C  CB    . VAL B  1 215 ? 12.726  -36.392  41.169  1.00 74.00  ? 215 VAL B CB    1 
ATOM   5080  C  CG1   . VAL B  1 215 ? 13.925  -37.118  40.605  1.00 74.27  ? 215 VAL B CG1   1 
ATOM   5081  C  CG2   . VAL B  1 215 ? 12.986  -34.905  41.144  1.00 72.23  ? 215 VAL B CG2   1 
ATOM   5082  N  N     . ALA B  1 216 ? 10.403  -38.677  41.409  1.00 80.27  ? 216 ALA B N     1 
ATOM   5083  C  CA    . ALA B  1 216 ? 10.003  -40.080  41.491  1.00 83.21  ? 216 ALA B CA    1 
ATOM   5084  C  C     . ALA B  1 216 ? 8.994   -40.443  40.406  1.00 85.97  ? 216 ALA B C     1 
ATOM   5085  O  O     . ALA B  1 216 ? 9.045   -41.540  39.847  1.00 88.32  ? 216 ALA B O     1 
ATOM   5086  C  CB    . ALA B  1 216 ? 9.444   -40.396  42.860  1.00 83.95  ? 216 ALA B CB    1 
ATOM   5087  N  N     . GLN B  1 217 ? 8.080   -39.513  40.121  1.00 86.06  ? 217 GLN B N     1 
ATOM   5088  C  CA    . GLN B  1 217 ? 7.049   -39.692  39.093  1.00 88.74  ? 217 GLN B CA    1 
ATOM   5089  C  C     . GLN B  1 217 ? 7.655   -39.544  37.703  1.00 88.98  ? 217 GLN B C     1 
ATOM   5090  O  O     . GLN B  1 217 ? 7.128   -40.084  36.729  1.00 91.96  ? 217 GLN B O     1 
ATOM   5091  C  CB    . GLN B  1 217 ? 5.895   -38.696  39.284  1.00 88.64  ? 217 GLN B CB    1 
ATOM   5092  C  CG    . GLN B  1 217 ? 5.229   -38.774  40.658  1.00 88.66  ? 217 GLN B CG    1 
ATOM   5093  C  CD    . GLN B  1 217 ? 3.902   -38.032  40.762  1.00 89.37  ? 217 GLN B CD    1 
ATOM   5094  O  OE1   . GLN B  1 217 ? 3.533   -37.244  39.892  1.00 89.33  ? 217 GLN B OE1   1 
ATOM   5095  N  NE2   . GLN B  1 217 ? 3.180   -38.284  41.848  1.00 90.35  ? 217 GLN B NE2   1 
ATOM   5096  N  N     . LEU B  1 218 ? 8.767   -38.817  37.623  1.00 86.31  ? 218 LEU B N     1 
ATOM   5097  C  CA    . LEU B  1 218 ? 9.503   -38.658  36.375  1.00 86.42  ? 218 LEU B CA    1 
ATOM   5098  C  C     . LEU B  1 218 ? 10.304  -39.907  36.004  1.00 87.94  ? 218 LEU B C     1 
ATOM   5099  O  O     . LEU B  1 218 ? 10.327  -40.318  34.838  1.00 90.12  ? 218 LEU B O     1 
ATOM   5100  C  CB    . LEU B  1 218 ? 10.452  -37.473  36.453  1.00 83.09  ? 218 LEU B CB    1 
ATOM   5101  C  CG    . LEU B  1 218 ? 11.036  -37.217  35.074  1.00 83.54  ? 218 LEU B CG    1 
ATOM   5102  C  CD1   . LEU B  1 218 ? 10.116  -36.276  34.315  1.00 84.64  ? 218 LEU B CD1   1 
ATOM   5103  C  CD2   . LEU B  1 218 ? 12.432  -36.673  35.186  1.00 81.28  ? 218 LEU B CD2   1 
ATOM   5104  N  N     . VAL B  1 219 ? 10.988  -40.481  36.991  1.00 86.98  ? 219 VAL B N     1 
ATOM   5105  C  CA    . VAL B  1 219 ? 11.661  -41.751  36.804  1.00 88.38  ? 219 VAL B CA    1 
ATOM   5106  C  C     . VAL B  1 219 ? 10.635  -42.736  36.261  1.00 92.17  ? 219 VAL B C     1 
ATOM   5107  O  O     . VAL B  1 219 ? 10.841  -43.323  35.202  1.00 94.22  ? 219 VAL B O     1 
ATOM   5108  C  CB    . VAL B  1 219 ? 12.295  -42.249  38.115  1.00 87.20  ? 219 VAL B CB    1 
ATOM   5109  C  CG1   . VAL B  1 219 ? 12.578  -43.741  38.058  1.00 89.56  ? 219 VAL B CG1   1 
ATOM   5110  C  CG2   . VAL B  1 219 ? 13.571  -41.479  38.392  1.00 84.10  ? 219 VAL B CG2   1 
ATOM   5111  N  N     . GLN B  1 220 ? 9.507   -42.864  36.956  1.00 93.49  ? 220 GLN B N     1 
ATOM   5112  C  CA    . GLN B  1 220 ? 8.454   -43.803  36.562  1.00 97.44  ? 220 GLN B CA    1 
ATOM   5113  C  C     . GLN B  1 220 ? 8.029   -43.627  35.110  1.00 99.33  ? 220 GLN B C     1 
ATOM   5114  O  O     . GLN B  1 220 ? 7.577   -44.577  34.479  1.00 102.49 ? 220 GLN B O     1 
ATOM   5115  C  CB    . GLN B  1 220 ? 7.236   -43.690  37.490  1.00 98.35  ? 220 GLN B CB    1 
ATOM   5116  C  CG    . GLN B  1 220 ? 6.216   -44.831  37.350  1.00 102.90 ? 220 GLN B CG    1 
ATOM   5117  C  CD    . GLN B  1 220 ? 6.809   -46.209  37.636  1.00 105.67 ? 220 GLN B CD    1 
ATOM   5118  O  OE1   . GLN B  1 220 ? 7.861   -46.330  38.272  1.00 104.17 ? 220 GLN B OE1   1 
ATOM   5119  N  NE2   . GLN B  1 220 ? 6.129   -47.258  37.167  1.00 109.67 ? 220 GLN B NE2   1 
ATOM   5120  N  N     . THR B  1 221 ? 8.180   -42.412  34.587  1.00 97.61  ? 221 THR B N     1 
ATOM   5121  C  CA    . THR B  1 221 ? 7.870   -42.142  33.186  1.00 99.47  ? 221 THR B CA    1 
ATOM   5122  C  C     . THR B  1 221 ? 8.999   -42.600  32.258  1.00 100.11 ? 221 THR B C     1 
ATOM   5123  O  O     . THR B  1 221 ? 8.738   -43.015  31.127  1.00 103.08 ? 221 THR B O     1 
ATOM   5124  C  CB    . THR B  1 221 ? 7.458   -40.679  32.959  1.00 97.72  ? 221 THR B CB    1 
ATOM   5125  O  OG1   . THR B  1 221 ? 6.183   -40.468  33.572  1.00 98.60  ? 221 THR B OG1   1 
ATOM   5126  C  CG2   . THR B  1 221 ? 7.337   -40.359  31.477  1.00 99.40  ? 221 THR B CG2   1 
ATOM   5127  N  N     . LEU B  1 222 ? 10.240  -42.540  32.735  1.00 97.79  ? 222 LEU B N     1 
ATOM   5128  C  CA    . LEU B  1 222 ? 11.356  -43.114  31.983  1.00 98.88  ? 222 LEU B CA    1 
ATOM   5129  C  C     . LEU B  1 222 ? 11.301  -44.644  32.036  1.00 102.09 ? 222 LEU B C     1 
ATOM   5130  O  O     . LEU B  1 222 ? 11.657  -45.328  31.070  1.00 104.45 ? 222 LEU B O     1 
ATOM   5131  C  CB    . LEU B  1 222 ? 12.703  -42.583  32.483  1.00 95.49  ? 222 LEU B CB    1 
ATOM   5132  C  CG    . LEU B  1 222 ? 13.009  -41.106  32.199  1.00 93.32  ? 222 LEU B CG    1 
ATOM   5133  C  CD1   . LEU B  1 222 ? 14.397  -40.731  32.710  1.00 90.91  ? 222 LEU B CD1   1 
ATOM   5134  C  CD2   . LEU B  1 222 ? 12.884  -40.766  30.716  1.00 94.60  ? 222 LEU B CD2   1 
ATOM   5135  N  N     . GLU B  1 223 ? 10.824  -45.169  33.160  1.00 102.49 ? 223 GLU B N     1 
ATOM   5136  C  CA    . GLU B  1 223 ? 10.660  -46.603  33.331  1.00 105.76 ? 223 GLU B CA    1 
ATOM   5137  C  C     . GLU B  1 223 ? 9.637   -47.183  32.352  1.00 109.79 ? 223 GLU B C     1 
ATOM   5138  O  O     . GLU B  1 223 ? 9.941   -48.136  31.638  1.00 112.51 ? 223 GLU B O     1 
ATOM   5139  C  CB    . GLU B  1 223 ? 10.257  -46.924  34.773  1.00 105.32 ? 223 GLU B CB    1 
ATOM   5140  C  CG    . GLU B  1 223 ? 10.460  -48.381  35.156  1.00 108.30 ? 223 GLU B CG    1 
ATOM   5141  C  CD    . GLU B  1 223 ? 11.929  -48.769  35.176  1.00 108.54 ? 223 GLU B CD    1 
ATOM   5142  O  OE1   . GLU B  1 223 ? 12.728  -48.051  35.835  1.00 105.06 ? 223 GLU B OE1   1 
ATOM   5143  O  OE2   . GLU B  1 223 ? 12.278  -49.791  34.531  1.00 111.06 ? 223 GLU B OE2   1 
ATOM   5144  N  N     . GLN B  1 224 ? 8.438   -46.597  32.320  1.00 110.62 ? 224 GLN B N     1 
ATOM   5145  C  CA    . GLN B  1 224 ? 7.329   -47.089  31.490  1.00 114.82 ? 224 GLN B CA    1 
ATOM   5146  C  C     . GLN B  1 224 ? 7.681   -47.082  30.011  1.00 116.45 ? 224 GLN B C     1 
ATOM   5147  O  O     . GLN B  1 224 ? 7.326   -48.010  29.277  1.00 120.37 ? 224 GLN B O     1 
ATOM   5148  C  CB    . GLN B  1 224 ? 6.069   -46.244  31.690  1.00 115.16 ? 224 GLN B CB    1 
ATOM   5149  C  CG    . GLN B  1 224 ? 5.283   -46.491  32.969  1.00 116.17 ? 224 GLN B CG    1 
ATOM   5150  C  CD    . GLN B  1 224 ? 4.092   -45.545  33.084  1.00 117.86 ? 224 GLN B CD    1 
ATOM   5151  O  OE1   . GLN B  1 224 ? 3.115   -45.673  32.343  1.00 122.13 ? 224 GLN B OE1   1 
ATOM   5152  N  NE2   . GLN B  1 224 ? 4.172   -44.587  34.010  1.00 114.20 ? 224 GLN B NE2   1 
ATOM   5153  N  N     . HIS B  1 225 ? 8.369   -46.027  29.580  1.00 113.71 ? 225 HIS B N     1 
ATOM   5154  C  CA    . HIS B  1 225 ? 8.771   -45.886  28.185  1.00 115.09 ? 225 HIS B CA    1 
ATOM   5155  C  C     . HIS B  1 225 ? 10.081  -46.619  27.886  1.00 115.11 ? 225 HIS B C     1 
ATOM   5156  O  O     . HIS B  1 225 ? 10.603  -46.525  26.772  1.00 116.41 ? 225 HIS B O     1 
ATOM   5157  C  CB    . HIS B  1 225 ? 8.862   -44.408  27.795  1.00 112.72 ? 225 HIS B CB    1 
ATOM   5158  C  CG    . HIS B  1 225 ? 7.533   -43.725  27.700  1.00 113.57 ? 225 HIS B CG    1 
ATOM   5159  N  ND1   . HIS B  1 225 ? 6.782   -43.397  28.809  1.00 111.88 ? 225 HIS B ND1   1 
ATOM   5160  C  CD2   . HIS B  1 225 ? 6.820   -43.308  26.627  1.00 116.12 ? 225 HIS B CD2   1 
ATOM   5161  C  CE1   . HIS B  1 225 ? 5.662   -42.810  28.424  1.00 113.49 ? 225 HIS B CE1   1 
ATOM   5162  N  NE2   . HIS B  1 225 ? 5.661   -42.743  27.105  1.00 116.29 ? 225 HIS B NE2   1 
ATOM   5163  N  N     . ASP B  1 226 ? 10.597  -47.343  28.886  1.00 113.86 ? 226 ASP B N     1 
ATOM   5164  C  CA    . ASP B  1 226 ? 11.791  -48.188  28.751  1.00 114.01 ? 226 ASP B CA    1 
ATOM   5165  C  C     . ASP B  1 226 ? 13.048  -47.362  28.459  1.00 111.17 ? 226 ASP B C     1 
ATOM   5166  O  O     . ASP B  1 226 ? 14.000  -47.848  27.849  1.00 112.25 ? 226 ASP B O     1 
ATOM   5167  C  CB    . ASP B  1 226 ? 11.558  -49.270  27.681  1.00 118.63 ? 226 ASP B CB    1 
ATOM   5168  C  CG    . ASP B  1 226 ? 12.586  -50.389  27.728  1.00 119.76 ? 226 ASP B CG    1 
ATOM   5169  O  OD1   . ASP B  1 226 ? 12.940  -50.845  28.838  1.00 118.16 ? 226 ASP B OD1   1 
ATOM   5170  O  OD2   . ASP B  1 226 ? 13.032  -50.818  26.642  1.00 122.20 ? 226 ASP B OD2   1 
ATOM   5171  N  N     . ALA B  1 227 ? 13.038  -46.109  28.915  1.00 107.72 ? 227 ALA B N     1 
ATOM   5172  C  CA    . ALA B  1 227 ? 14.119  -45.149  28.659  1.00 104.94 ? 227 ALA B CA    1 
ATOM   5173  C  C     . ALA B  1 227 ? 15.117  -45.074  29.809  1.00 101.76 ? 227 ALA B C     1 
ATOM   5174  O  O     . ALA B  1 227 ? 16.279  -44.717  29.615  1.00 100.36 ? 227 ALA B O     1 
ATOM   5175  C  CB    . ALA B  1 227 ? 13.539  -43.770  28.384  1.00 103.46 ? 227 ALA B CB    1 
ATOM   5176  N  N     . MET B  1 228 ? 14.642  -45.412  31.005  1.00 100.87 ? 228 MET B N     1 
ATOM   5177  C  CA    . MET B  1 228 ? 15.436  -45.398  32.229  1.00 98.26  ? 228 MET B CA    1 
ATOM   5178  C  C     . MET B  1 228 ? 16.762  -46.159  32.101  1.00 98.79  ? 228 MET B C     1 
ATOM   5179  O  O     . MET B  1 228 ? 17.756  -45.779  32.722  1.00 96.73  ? 228 MET B O     1 
ATOM   5180  C  CB    . MET B  1 228 ? 14.597  -45.956  33.384  1.00 98.61  ? 228 MET B CB    1 
ATOM   5181  C  CG    . MET B  1 228 ? 15.230  -45.832  34.752  1.00 96.69  ? 228 MET B CG    1 
ATOM   5182  S  SD    . MET B  1 228 ? 15.585  -44.129  35.199  1.00 94.10  ? 228 MET B SD    1 
ATOM   5183  C  CE    . MET B  1 228 ? 16.592  -44.414  36.653  1.00 92.75  ? 228 MET B CE    1 
ATOM   5184  N  N     . LYS B  1 229 ? 16.767  -47.212  31.282  1.00 101.72 ? 229 LYS B N     1 
ATOM   5185  C  CA    . LYS B  1 229 ? 17.944  -48.064  31.067  1.00 102.69 ? 229 LYS B CA    1 
ATOM   5186  C  C     . LYS B  1 229 ? 19.177  -47.379  30.437  1.00 101.31 ? 229 LYS B C     1 
ATOM   5187  O  O     . LYS B  1 229 ? 20.294  -47.875  30.578  1.00 101.71 ? 229 LYS B O     1 
ATOM   5188  C  CB    . LYS B  1 229 ? 17.558  -49.308  30.256  1.00 106.83 ? 229 LYS B CB    1 
ATOM   5189  C  CG    . LYS B  1 229 ? 17.013  -49.017  28.867  1.00 108.73 ? 229 LYS B CG    1 
ATOM   5190  C  CD    . LYS B  1 229 ? 16.887  -50.289  28.043  1.00 113.41 ? 229 LYS B CD    1 
ATOM   5191  C  CE    . LYS B  1 229 ? 16.588  -49.971  26.583  1.00 115.58 ? 229 LYS B CE    1 
ATOM   5192  N  NZ    . LYS B  1 229 ? 16.521  -51.200  25.754  1.00 119.86 ? 229 LYS B NZ    1 
ATOM   5193  N  N     . TYR B  1 230 ? 18.975  -46.263  29.739  1.00 99.93  ? 230 TYR B N     1 
ATOM   5194  C  CA    . TYR B  1 230 ? 20.087  -45.517  29.131  1.00 98.63  ? 230 TYR B CA    1 
ATOM   5195  C  C     . TYR B  1 230 ? 20.254  -44.112  29.711  1.00 94.87  ? 230 TYR B C     1 
ATOM   5196  O  O     . TYR B  1 230 ? 20.903  -43.243  29.118  1.00 94.02  ? 230 TYR B O     1 
ATOM   5197  C  CB    . TYR B  1 230 ? 19.947  -45.453  27.605  1.00 101.09 ? 230 TYR B CB    1 
ATOM   5198  C  CG    . TYR B  1 230 ? 18.660  -44.845  27.080  1.00 101.16 ? 230 TYR B CG    1 
ATOM   5199  C  CD1   . TYR B  1 230 ? 18.436  -43.469  27.129  1.00 98.76  ? 230 TYR B CD1   1 
ATOM   5200  C  CD2   . TYR B  1 230 ? 17.680  -45.647  26.498  1.00 104.44 ? 230 TYR B CD2   1 
ATOM   5201  C  CE1   . TYR B  1 230 ? 17.261  -42.912  26.630  1.00 99.55  ? 230 TYR B CE1   1 
ATOM   5202  C  CE2   . TYR B  1 230 ? 16.505  -45.102  25.993  1.00 105.15 ? 230 TYR B CE2   1 
ATOM   5203  C  CZ    . TYR B  1 230 ? 16.302  -43.735  26.061  1.00 102.71 ? 230 TYR B CZ    1 
ATOM   5204  O  OH    . TYR B  1 230 ? 15.139  -43.196  25.565  1.00 103.44 ? 230 TYR B OH    1 
ATOM   5205  N  N     . SER B  1 231 ? 19.673  -43.896  30.882  1.00 92.58  ? 231 SER B N     1 
ATOM   5206  C  CA    . SER B  1 231 ? 19.717  -42.590  31.495  1.00 89.04  ? 231 SER B CA    1 
ATOM   5207  C  C     . SER B  1 231 ? 20.170  -42.669  32.945  1.00 86.87  ? 231 SER B C     1 
ATOM   5208  O  O     . SER B  1 231 ? 20.158  -43.733  33.566  1.00 87.82  ? 231 SER B O     1 
ATOM   5209  C  CB    . SER B  1 231 ? 18.353  -41.912  31.380  1.00 88.58  ? 231 SER B CB    1 
ATOM   5210  O  OG    . SER B  1 231 ? 17.354  -42.705  31.984  1.00 89.72  ? 231 SER B OG    1 
ATOM   5211  N  N     . ILE B  1 232 ? 20.592  -41.524  33.463  1.00 83.92  ? 232 ILE B N     1 
ATOM   5212  C  CA    . ILE B  1 232 ? 21.029  -41.399  34.835  1.00 81.86  ? 232 ILE B CA    1 
ATOM   5213  C  C     . ILE B  1 232 ? 20.341  -40.179  35.433  1.00 79.29  ? 232 ILE B C     1 
ATOM   5214  O  O     . ILE B  1 232 ? 20.363  -39.089  34.848  1.00 78.33  ? 232 ILE B O     1 
ATOM   5215  C  CB    . ILE B  1 232 ? 22.562  -41.242  34.911  1.00 81.37  ? 232 ILE B CB    1 
ATOM   5216  C  CG1   . ILE B  1 232 ? 23.239  -42.436  34.232  1.00 84.19  ? 232 ILE B CG1   1 
ATOM   5217  C  CG2   . ILE B  1 232 ? 23.026  -41.074  36.365  1.00 79.53  ? 232 ILE B CG2   1 
ATOM   5218  C  CD1   . ILE B  1 232 ? 24.722  -42.286  33.986  1.00 84.82  ? 232 ILE B CD1   1 
ATOM   5219  N  N     . ILE B  1 233 ? 19.716  -40.376  36.587  1.00 78.32  ? 233 ILE B N     1 
ATOM   5220  C  CA    . ILE B  1 233 ? 19.111  -39.284  37.331  1.00 75.69  ? 233 ILE B CA    1 
ATOM   5221  C  C     . ILE B  1 233 ? 20.027  -38.932  38.500  1.00 73.89  ? 233 ILE B C     1 
ATOM   5222  O  O     . ILE B  1 233 ? 20.396  -39.799  39.294  1.00 74.95  ? 233 ILE B O     1 
ATOM   5223  C  CB    . ILE B  1 233 ? 17.699  -39.668  37.857  1.00 76.47  ? 233 ILE B CB    1 
ATOM   5224  C  CG1   . ILE B  1 233 ? 16.829  -40.291  36.753  1.00 78.70  ? 233 ILE B CG1   1 
ATOM   5225  C  CG2   . ILE B  1 233 ? 17.001  -38.486  38.532  1.00 74.45  ? 233 ILE B CG2   1 
ATOM   5226  C  CD1   . ILE B  1 233 ? 16.637  -39.440  35.527  1.00 78.50  ? 233 ILE B CD1   1 
ATOM   5227  N  N     . VAL B  1 234 ? 20.424  -37.666  38.569  1.00 71.66  ? 234 VAL B N     1 
ATOM   5228  C  CA    . VAL B  1 234 ? 21.097  -37.099  39.737  1.00 69.67  ? 234 VAL B CA    1 
ATOM   5229  C  C     . VAL B  1 234 ? 20.133  -36.091  40.376  1.00 68.14  ? 234 VAL B C     1 
ATOM   5230  O  O     . VAL B  1 234 ? 19.699  -35.136  39.717  1.00 67.32  ? 234 VAL B O     1 
ATOM   5231  C  CB    . VAL B  1 234 ? 22.406  -36.384  39.344  1.00 68.64  ? 234 VAL B CB    1 
ATOM   5232  C  CG1   . VAL B  1 234 ? 23.047  -35.715  40.551  1.00 66.77  ? 234 VAL B CG1   1 
ATOM   5233  C  CG2   . VAL B  1 234 ? 23.369  -37.357  38.710  1.00 70.40  ? 234 VAL B CG2   1 
ATOM   5234  N  N     . ALA B  1 235 ? 19.793  -36.304  41.647  1.00 67.77  ? 235 ALA B N     1 
ATOM   5235  C  CA    . ALA B  1 235 ? 18.804  -35.453  42.322  1.00 66.35  ? 235 ALA B CA    1 
ATOM   5236  C  C     . ALA B  1 235 ? 19.251  -34.777  43.638  1.00 64.55  ? 235 ALA B C     1 
ATOM   5237  O  O     . ALA B  1 235 ? 19.662  -35.439  44.596  1.00 65.17  ? 235 ALA B O     1 
ATOM   5238  C  CB    . ALA B  1 235 ? 17.507  -36.238  42.529  1.00 67.89  ? 235 ALA B CB    1 
ATOM   5239  N  N     . ALA B  1 236 ? 19.159  -33.451  43.674  1.00 62.60  ? 236 ALA B N     1 
ATOM   5240  C  CA    . ALA B  1 236 ? 19.233  -32.699  44.935  1.00 61.30  ? 236 ALA B CA    1 
ATOM   5241  C  C     . ALA B  1 236 ? 17.947  -31.897  45.084  1.00 60.62  ? 236 ALA B C     1 
ATOM   5242  O  O     . ALA B  1 236 ? 17.812  -30.840  44.477  1.00 60.03  ? 236 ALA B O     1 
ATOM   5243  C  CB    . ALA B  1 236 ? 20.446  -31.783  44.950  1.00 59.62  ? 236 ALA B CB    1 
ATOM   5244  N  N     . THR B  1 237 ? 16.998  -32.396  45.869  1.00 61.25  ? 237 THR B N     1 
ATOM   5245  C  CA    . THR B  1 237 ? 15.640  -31.851  45.830  1.00 61.75  ? 237 THR B CA    1 
ATOM   5246  C  C     . THR B  1 237 ? 15.349  -30.645  46.741  1.00 60.61  ? 237 THR B C     1 
ATOM   5247  O  O     . THR B  1 237 ? 16.232  -30.123  47.426  1.00 59.45  ? 237 THR B O     1 
ATOM   5248  C  CB    . THR B  1 237 ? 14.579  -32.918  46.104  1.00 63.70  ? 237 THR B CB    1 
ATOM   5249  O  OG1   . THR B  1 237 ? 14.779  -33.457  47.416  1.00 65.21  ? 237 THR B OG1   1 
ATOM   5250  C  CG2   . THR B  1 237 ? 14.636  -34.011  45.059  1.00 65.38  ? 237 THR B CG2   1 
ATOM   5251  N  N     . ALA B  1 238 ? 14.084  -30.235  46.734  1.00 61.09  ? 238 ALA B N     1 
ATOM   5252  C  CA    . ALA B  1 238 ? 13.624  -29.015  47.372  1.00 60.59  ? 238 ALA B CA    1 
ATOM   5253  C  C     . ALA B  1 238 ? 14.111  -28.835  48.806  1.00 60.52  ? 238 ALA B C     1 
ATOM   5254  O  O     . ALA B  1 238 ? 14.448  -27.712  49.220  1.00 59.57  ? 238 ALA B O     1 
ATOM   5255  C  CB    . ALA B  1 238 ? 12.088  -28.937  47.314  1.00 61.65  ? 238 ALA B CB    1 
ATOM   5256  N  N     . SER B  1 239 ? 14.148  -29.942  49.544  1.00 62.08  ? 239 SER B N     1 
ATOM   5257  C  CA    . SER B  1 239 ? 14.380  -29.934  50.987  1.00 62.80  ? 239 SER B CA    1 
ATOM   5258  C  C     . SER B  1 239 ? 15.860  -30.038  51.375  1.00 62.64  ? 239 SER B C     1 
ATOM   5259  O  O     . SER B  1 239 ? 16.241  -29.683  52.492  1.00 62.93  ? 239 SER B O     1 
ATOM   5260  C  CB    . SER B  1 239 ? 13.616  -31.090  51.629  1.00 64.84  ? 239 SER B CB    1 
ATOM   5261  O  OG    . SER B  1 239 ? 13.960  -32.325  51.011  1.00 65.29  ? 239 SER B OG    1 
ATOM   5262  N  N     . GLU B  1 240 ? 16.685  -30.529  50.456  1.00 62.72  ? 240 GLU B N     1 
ATOM   5263  C  CA    . GLU B  1 240 ? 18.089  -30.818  50.741  1.00 62.91  ? 240 GLU B CA    1 
ATOM   5264  C  C     . GLU B  1 240 ? 18.913  -29.548  50.924  1.00 60.92  ? 240 GLU B C     1 
ATOM   5265  O  O     . GLU B  1 240 ? 18.561  -28.494  50.381  1.00 59.68  ? 240 GLU B O     1 
ATOM   5266  C  CB    . GLU B  1 240 ? 18.679  -31.677  49.627  1.00 63.66  ? 240 GLU B CB    1 
ATOM   5267  C  CG    . GLU B  1 240 ? 17.857  -32.918  49.339  1.00 67.44  ? 240 GLU B CG    1 
ATOM   5268  C  CD    . GLU B  1 240 ? 18.672  -33.993  48.668  1.00 72.22  ? 240 GLU B CD    1 
ATOM   5269  O  OE1   . GLU B  1 240 ? 19.792  -34.273  49.153  1.00 73.33  ? 240 GLU B OE1   1 
ATOM   5270  O  OE2   . GLU B  1 240 ? 18.195  -34.563  47.657  1.00 75.20  ? 240 GLU B OE2   1 
ATOM   5271  N  N     . ALA B  1 241 ? 19.998  -29.651  51.693  1.00 60.56  ? 241 ALA B N     1 
ATOM   5272  C  CA    . ALA B  1 241 ? 20.823  -28.494  52.011  1.00 59.13  ? 241 ALA B CA    1 
ATOM   5273  C  C     . ALA B  1 241 ? 21.330  -27.841  50.733  1.00 57.77  ? 241 ALA B C     1 
ATOM   5274  O  O     . ALA B  1 241 ? 21.594  -28.519  49.746  1.00 58.13  ? 241 ALA B O     1 
ATOM   5275  C  CB    . ALA B  1 241 ? 21.968  -28.893  52.908  1.00 60.08  ? 241 ALA B CB    1 
ATOM   5276  N  N     . ALA B  1 242 ? 21.448  -26.518  50.749  1.00 56.63  ? 242 ALA B N     1 
ATOM   5277  C  CA    . ALA B  1 242 ? 21.789  -25.763  49.542  1.00 55.52  ? 242 ALA B CA    1 
ATOM   5278  C  C     . ALA B  1 242 ? 23.041  -26.277  48.827  1.00 55.89  ? 242 ALA B C     1 
ATOM   5279  O  O     . ALA B  1 242 ? 23.008  -26.432  47.608  1.00 55.83  ? 242 ALA B O     1 
ATOM   5280  C  CB    . ALA B  1 242 ? 21.900  -24.263  49.832  1.00 54.29  ? 242 ALA B CB    1 
ATOM   5281  N  N     . PRO B  1 243 ? 24.136  -26.553  49.572  1.00 56.50  ? 243 PRO B N     1 
ATOM   5282  C  CA    . PRO B  1 243 ? 25.366  -26.937  48.874  1.00 57.17  ? 243 PRO B CA    1 
ATOM   5283  C  C     . PRO B  1 243 ? 25.225  -28.223  48.079  1.00 58.18  ? 243 PRO B C     1 
ATOM   5284  O  O     . PRO B  1 243 ? 25.911  -28.399  47.084  1.00 58.67  ? 243 PRO B O     1 
ATOM   5285  C  CB    . PRO B  1 243 ? 26.379  -27.110  50.005  1.00 57.98  ? 243 PRO B CB    1 
ATOM   5286  C  CG    . PRO B  1 243 ? 25.818  -26.317  51.117  1.00 57.56  ? 243 PRO B CG    1 
ATOM   5287  C  CD    . PRO B  1 243 ? 24.350  -26.502  51.027  1.00 56.88  ? 243 PRO B CD    1 
ATOM   5288  N  N     . LEU B  1 244 ? 24.331  -29.105  48.504  1.00 59.01  ? 244 LEU B N     1 
ATOM   5289  C  CA    . LEU B  1 244 ? 24.001  -30.280  47.712  1.00 60.16  ? 244 LEU B CA    1 
ATOM   5290  C  C     . LEU B  1 244 ? 23.360  -29.886  46.384  1.00 59.84  ? 244 LEU B C     1 
ATOM   5291  O  O     . LEU B  1 244 ? 23.688  -30.448  45.339  1.00 60.77  ? 244 LEU B O     1 
ATOM   5292  C  CB    . LEU B  1 244 ? 23.082  -31.210  48.492  1.00 60.97  ? 244 LEU B CB    1 
ATOM   5293  C  CG    . LEU B  1 244 ? 23.785  -32.127  49.472  1.00 61.60  ? 244 LEU B CG    1 
ATOM   5294  C  CD1   . LEU B  1 244 ? 22.823  -32.570  50.526  1.00 62.29  ? 244 LEU B CD1   1 
ATOM   5295  C  CD2   . LEU B  1 244 ? 24.320  -33.309  48.719  1.00 63.51  ? 244 LEU B CD2   1 
ATOM   5296  N  N     . GLN B  1 245 ? 22.454  -28.916  46.425  1.00 59.06  ? 245 GLN B N     1 
ATOM   5297  C  CA    . GLN B  1 245 ? 21.819  -28.426  45.197  1.00 59.12  ? 245 GLN B CA    1 
ATOM   5298  C  C     . GLN B  1 245 ? 22.809  -27.678  44.325  1.00 58.83  ? 245 GLN B C     1 
ATOM   5299  O  O     . GLN B  1 245 ? 22.923  -27.979  43.144  1.00 59.92  ? 245 GLN B O     1 
ATOM   5300  C  CB    . GLN B  1 245 ? 20.595  -27.573  45.495  1.00 58.38  ? 245 GLN B CB    1 
ATOM   5301  C  CG    . GLN B  1 245 ? 19.475  -28.347  46.175  1.00 59.22  ? 245 GLN B CG    1 
ATOM   5302  C  CD    . GLN B  1 245 ? 18.205  -27.565  46.217  1.00 58.34  ? 245 GLN B CD    1 
ATOM   5303  O  OE1   . GLN B  1 245 ? 17.743  -27.074  45.195  1.00 59.56  ? 245 GLN B OE1   1 
ATOM   5304  N  NE2   . GLN B  1 245 ? 17.633  -27.426  47.396  1.00 59.01  ? 245 GLN B NE2   1 
ATOM   5305  N  N     . TYR B  1 246 ? 23.523  -26.715  44.912  1.00 58.07  ? 246 TYR B N     1 
ATOM   5306  C  CA    . TYR B  1 246 ? 24.712  -26.115  44.292  1.00 57.63  ? 246 TYR B CA    1 
ATOM   5307  C  C     . TYR B  1 246 ? 25.618  -27.157  43.614  1.00 58.52  ? 246 TYR B C     1 
ATOM   5308  O  O     . TYR B  1 246 ? 26.072  -26.939  42.484  1.00 58.75  ? 246 TYR B O     1 
ATOM   5309  C  CB    . TYR B  1 246 ? 25.508  -25.296  45.327  1.00 57.29  ? 246 TYR B CB    1 
ATOM   5310  C  CG    . TYR B  1 246 ? 26.986  -25.174  45.020  1.00 59.44  ? 246 TYR B CG    1 
ATOM   5311  C  CD1   . TYR B  1 246 ? 27.451  -24.314  44.020  1.00 60.18  ? 246 TYR B CD1   1 
ATOM   5312  C  CD2   . TYR B  1 246 ? 27.924  -25.930  45.720  1.00 62.20  ? 246 TYR B CD2   1 
ATOM   5313  C  CE1   . TYR B  1 246 ? 28.815  -24.216  43.727  1.00 61.44  ? 246 TYR B CE1   1 
ATOM   5314  C  CE2   . TYR B  1 246 ? 29.293  -25.839  45.434  1.00 64.03  ? 246 TYR B CE2   1 
ATOM   5315  C  CZ    . TYR B  1 246 ? 29.728  -24.979  44.438  1.00 63.61  ? 246 TYR B CZ    1 
ATOM   5316  O  OH    . TYR B  1 246 ? 31.075  -24.887  44.164  1.00 65.47  ? 246 TYR B OH    1 
ATOM   5317  N  N     . LEU B  1 247 ? 25.862  -28.283  44.295  1.00 58.88  ? 247 LEU B N     1 
ATOM   5318  C  CA    . LEU B  1 247 ? 26.836  -29.292  43.824  1.00 60.01  ? 247 LEU B CA    1 
ATOM   5319  C  C     . LEU B  1 247 ? 26.316  -30.187  42.701  1.00 60.62  ? 247 LEU B C     1 
ATOM   5320  O  O     . LEU B  1 247 ? 27.038  -30.477  41.745  1.00 61.61  ? 247 LEU B O     1 
ATOM   5321  C  CB    . LEU B  1 247 ? 27.347  -30.157  44.983  1.00 60.86  ? 247 LEU B CB    1 
ATOM   5322  C  CG    . LEU B  1 247 ? 28.311  -31.294  44.632  1.00 62.82  ? 247 LEU B CG    1 
ATOM   5323  C  CD1   . LEU B  1 247 ? 29.709  -30.756  44.393  1.00 63.59  ? 247 LEU B CD1   1 
ATOM   5324  C  CD2   . LEU B  1 247 ? 28.328  -32.386  45.707  1.00 63.84  ? 247 LEU B CD2   1 
ATOM   5325  N  N     . ALA B  1 248 ? 25.058  -30.607  42.828  1.00 60.15  ? 248 ALA B N     1 
ATOM   5326  C  CA    . ALA B  1 248 ? 24.407  -31.520  41.879  1.00 60.72  ? 248 ALA B CA    1 
ATOM   5327  C  C     . ALA B  1 248 ? 24.717  -31.370  40.373  1.00 61.01  ? 248 ALA B C     1 
ATOM   5328  O  O     . ALA B  1 248 ? 24.960  -32.373  39.727  1.00 63.02  ? 248 ALA B O     1 
ATOM   5329  C  CB    . ALA B  1 248 ? 22.914  -31.558  42.115  1.00 60.15  ? 248 ALA B CB    1 
ATOM   5330  N  N     . PRO B  1 249 ? 24.718  -30.142  39.808  1.00 59.50  ? 249 PRO B N     1 
ATOM   5331  C  CA    . PRO B  1 249 ? 24.936  -30.121  38.369  1.00 60.34  ? 249 PRO B CA    1 
ATOM   5332  C  C     . PRO B  1 249 ? 26.366  -30.469  37.993  1.00 61.72  ? 249 PRO B C     1 
ATOM   5333  O  O     . PRO B  1 249 ? 26.603  -31.015  36.908  1.00 63.39  ? 249 PRO B O     1 
ATOM   5334  C  CB    . PRO B  1 249 ? 24.633  -28.666  37.984  1.00 58.79  ? 249 PRO B CB    1 
ATOM   5335  C  CG    . PRO B  1 249 ? 23.805  -28.162  39.064  1.00 57.40  ? 249 PRO B CG    1 
ATOM   5336  C  CD    . PRO B  1 249 ? 24.372  -28.798  40.292  1.00 57.86  ? 249 PRO B CD    1 
ATOM   5337  N  N     . PHE B  1 250 ? 27.307  -30.156  38.879  1.00 61.22  ? 250 PHE B N     1 
ATOM   5338  C  CA    . PHE B  1 250 ? 28.711  -30.416  38.611  1.00 62.77  ? 250 PHE B CA    1 
ATOM   5339  C  C     . PHE B  1 250 ? 29.023  -31.908  38.659  1.00 64.83  ? 250 PHE B C     1 
ATOM   5340  O  O     . PHE B  1 250 ? 29.651  -32.454  37.747  1.00 66.67  ? 250 PHE B O     1 
ATOM   5341  C  CB    . PHE B  1 250 ? 29.583  -29.665  39.597  1.00 61.69  ? 250 PHE B CB    1 
ATOM   5342  C  CG    . PHE B  1 250 ? 29.419  -28.186  39.533  1.00 61.22  ? 250 PHE B CG    1 
ATOM   5343  C  CD1   . PHE B  1 250 ? 30.001  -27.450  38.503  1.00 62.49  ? 250 PHE B CD1   1 
ATOM   5344  C  CD2   . PHE B  1 250 ? 28.698  -27.509  40.511  1.00 60.42  ? 250 PHE B CD2   1 
ATOM   5345  C  CE1   . PHE B  1 250 ? 29.867  -26.063  38.452  1.00 60.80  ? 250 PHE B CE1   1 
ATOM   5346  C  CE2   . PHE B  1 250 ? 28.561  -26.123  40.459  1.00 58.76  ? 250 PHE B CE2   1 
ATOM   5347  C  CZ    . PHE B  1 250 ? 29.143  -25.404  39.425  1.00 58.46  ? 250 PHE B CZ    1 
ATOM   5348  N  N     . THR B  1 251 ? 28.576  -32.576  39.715  1.00 64.66  ? 251 THR B N     1 
ATOM   5349  C  CA    . THR B  1 251 ? 28.837  -33.996  39.835  1.00 66.86  ? 251 THR B CA    1 
ATOM   5350  C  C     . THR B  1 251 ? 28.074  -34.763  38.750  1.00 68.14  ? 251 THR B C     1 
ATOM   5351  O  O     . THR B  1 251 ? 28.449  -35.886  38.394  1.00 70.25  ? 251 THR B O     1 
ATOM   5352  C  CB    . THR B  1 251 ? 28.518  -34.531  41.241  1.00 66.59  ? 251 THR B CB    1 
ATOM   5353  O  OG1   . THR B  1 251 ? 27.215  -34.093  41.636  1.00 66.20  ? 251 THR B OG1   1 
ATOM   5354  C  CG2   . THR B  1 251 ? 29.539  -34.028  42.246  1.00 65.58  ? 251 THR B CG2   1 
ATOM   5355  N  N     . ALA B  1 252 ? 27.021  -34.142  38.219  1.00 66.92  ? 252 ALA B N     1 
ATOM   5356  C  CA    . ALA B  1 252 ? 26.333  -34.673  37.053  1.00 68.23  ? 252 ALA B CA    1 
ATOM   5357  C  C     . ALA B  1 252 ? 27.196  -34.502  35.808  1.00 69.77  ? 252 ALA B C     1 
ATOM   5358  O  O     . ALA B  1 252 ? 27.251  -35.389  34.962  1.00 72.14  ? 252 ALA B O     1 
ATOM   5359  C  CB    . ALA B  1 252 ? 24.998  -34.016  36.868  1.00 66.65  ? 252 ALA B CB    1 
ATOM   5360  N  N     . ALA B  1 253 ? 27.880  -33.369  35.699  1.00 69.02  ? 253 ALA B N     1 
ATOM   5361  C  CA    . ALA B  1 253 ? 28.748  -33.128  34.544  1.00 70.61  ? 253 ALA B CA    1 
ATOM   5362  C  C     . ALA B  1 253 ? 29.850  -34.190  34.429  1.00 72.82  ? 253 ALA B C     1 
ATOM   5363  O  O     . ALA B  1 253 ? 30.098  -34.701  33.345  1.00 74.73  ? 253 ALA B O     1 
ATOM   5364  C  CB    . ALA B  1 253 ? 29.345  -31.705  34.579  1.00 69.08  ? 253 ALA B CB    1 
ATOM   5365  N  N     . SER B  1 254 ? 30.486  -34.526  35.550  1.00 72.73  ? 254 SER B N     1 
ATOM   5366  C  CA    . SER B  1 254 ? 31.570  -35.507  35.565  1.00 75.39  ? 254 SER B CA    1 
ATOM   5367  C  C     . SER B  1 254 ? 31.080  -36.886  35.140  1.00 77.52  ? 254 SER B C     1 
ATOM   5368  O  O     . SER B  1 254 ? 31.747  -37.597  34.376  1.00 79.72  ? 254 SER B O     1 
ATOM   5369  C  CB    . SER B  1 254 ? 32.178  -35.596  36.957  1.00 74.71  ? 254 SER B CB    1 
ATOM   5370  O  OG    . SER B  1 254 ? 32.721  -34.353  37.324  1.00 73.67  ? 254 SER B OG    1 
ATOM   5371  N  N     . ILE B  1 255 ? 29.907  -37.241  35.659  1.00 76.87  ? 255 ILE B N     1 
ATOM   5372  C  CA    . ILE B  1 255 ? 29.215  -38.464  35.311  1.00 78.81  ? 255 ILE B CA    1 
ATOM   5373  C  C     . ILE B  1 255 ? 28.980  -38.502  33.804  1.00 80.50  ? 255 ILE B C     1 
ATOM   5374  O  O     . ILE B  1 255 ? 29.235  -39.524  33.156  1.00 83.43  ? 255 ILE B O     1 
ATOM   5375  C  CB    . ILE B  1 255 ? 27.898  -38.593  36.114  1.00 77.40  ? 255 ILE B CB    1 
ATOM   5376  C  CG1   . ILE B  1 255 ? 28.224  -38.858  37.593  1.00 76.87  ? 255 ILE B CG1   1 
ATOM   5377  C  CG2   . ILE B  1 255 ? 27.009  -39.703  35.537  1.00 79.71  ? 255 ILE B CG2   1 
ATOM   5378  C  CD1   . ILE B  1 255 ? 27.029  -38.856  38.531  1.00 75.95  ? 255 ILE B CD1   1 
ATOM   5379  N  N     . GLY B  1 256 ? 28.523  -37.376  33.258  1.00 79.14  ? 256 GLY B N     1 
ATOM   5380  C  CA    . GLY B  1 256 ? 28.321  -37.221  31.824  1.00 80.56  ? 256 GLY B CA    1 
ATOM   5381  C  C     . GLY B  1 256 ? 29.620  -37.258  31.051  1.00 82.66  ? 256 GLY B C     1 
ATOM   5382  O  O     . GLY B  1 256 ? 29.718  -37.947  30.039  1.00 85.38  ? 256 GLY B O     1 
ATOM   5383  N  N     . GLU B  1 257 ? 30.621  -36.528  31.544  1.00 81.95  ? 257 GLU B N     1 
ATOM   5384  C  CA    . GLU B  1 257 ? 31.928  -36.395  30.881  1.00 83.95  ? 257 GLU B CA    1 
ATOM   5385  C  C     . GLU B  1 257 ? 32.567  -37.724  30.525  1.00 86.62  ? 257 GLU B C     1 
ATOM   5386  O  O     . GLU B  1 257 ? 33.252  -37.820  29.511  1.00 88.92  ? 257 GLU B O     1 
ATOM   5387  C  CB    . GLU B  1 257 ? 32.904  -35.566  31.728  1.00 82.84  ? 257 GLU B CB    1 
ATOM   5388  C  CG    . GLU B  1 257 ? 32.672  -34.060  31.635  1.00 82.30  ? 257 GLU B CG    1 
ATOM   5389  C  CD    . GLU B  1 257 ? 33.594  -33.241  32.536  1.00 83.22  ? 257 GLU B CD    1 
ATOM   5390  O  OE1   . GLU B  1 257 ? 34.011  -33.751  33.604  1.00 83.89  ? 257 GLU B OE1   1 
ATOM   5391  O  OE2   . GLU B  1 257 ? 33.895  -32.077  32.172  1.00 82.68  ? 257 GLU B OE2   1 
ATOM   5392  N  N     . TRP B  1 258 ? 32.342  -38.740  31.356  1.00 86.39  ? 258 TRP B N     1 
ATOM   5393  C  CA    . TRP B  1 258 ? 32.900  -40.068  31.125  1.00 89.07  ? 258 TRP B CA    1 
ATOM   5394  C  C     . TRP B  1 258 ? 32.647  -40.535  29.691  1.00 91.70  ? 258 TRP B C     1 
ATOM   5395  O  O     . TRP B  1 258 ? 33.565  -40.965  28.993  1.00 94.35  ? 258 TRP B O     1 
ATOM   5396  C  CB    . TRP B  1 258 ? 32.329  -41.077  32.125  1.00 88.64  ? 258 TRP B CB    1 
ATOM   5397  C  CG    . TRP B  1 258 ? 33.028  -42.391  32.059  1.00 91.14  ? 258 TRP B CG    1 
ATOM   5398  C  CD1   . TRP B  1 258 ? 34.170  -42.739  32.713  1.00 91.69  ? 258 TRP B CD1   1 
ATOM   5399  C  CD2   . TRP B  1 258 ? 32.651  -43.527  31.274  1.00 93.36  ? 258 TRP B CD2   1 
ATOM   5400  N  NE1   . TRP B  1 258 ? 34.524  -44.023  32.398  1.00 94.58  ? 258 TRP B NE1   1 
ATOM   5401  C  CE2   . TRP B  1 258 ? 33.610  -44.534  31.516  1.00 95.90  ? 258 TRP B CE2   1 
ATOM   5402  C  CE3   . TRP B  1 258 ? 31.590  -43.798  30.397  1.00 94.26  ? 258 TRP B CE3   1 
ATOM   5403  C  CZ2   . TRP B  1 258 ? 33.546  -45.798  30.906  1.00 98.81  ? 258 TRP B CZ2   1 
ATOM   5404  C  CZ3   . TRP B  1 258 ? 31.527  -45.060  29.790  1.00 97.37  ? 258 TRP B CZ3   1 
ATOM   5405  C  CH2   . TRP B  1 258 ? 32.502  -46.038  30.048  1.00 99.14  ? 258 TRP B CH2   1 
ATOM   5406  N  N     . PHE B  1 259 ? 31.392  -40.428  29.264  1.00 91.14  ? 259 PHE B N     1 
ATOM   5407  C  CA    . PHE B  1 259 ? 30.976  -40.788  27.915  1.00 93.72  ? 259 PHE B CA    1 
ATOM   5408  C  C     . PHE B  1 259 ? 31.689  -39.932  26.878  1.00 95.03  ? 259 PHE B C     1 
ATOM   5409  O  O     . PHE B  1 259 ? 32.218  -40.453  25.899  1.00 98.24  ? 259 PHE B O     1 
ATOM   5410  C  CB    . PHE B  1 259 ? 29.455  -40.653  27.781  1.00 92.54  ? 259 PHE B CB    1 
ATOM   5411  C  CG    . PHE B  1 259 ? 28.682  -41.543  28.725  1.00 91.73  ? 259 PHE B CG    1 
ATOM   5412  C  CD1   . PHE B  1 259 ? 28.332  -42.841  28.350  1.00 93.41  ? 259 PHE B CD1   1 
ATOM   5413  C  CD2   . PHE B  1 259 ? 28.317  -41.090  29.992  1.00 88.16  ? 259 PHE B CD2   1 
ATOM   5414  C  CE1   . PHE B  1 259 ? 27.628  -43.666  29.213  1.00 92.77  ? 259 PHE B CE1   1 
ATOM   5415  C  CE2   . PHE B  1 259 ? 27.615  -41.914  30.868  1.00 87.86  ? 259 PHE B CE2   1 
ATOM   5416  C  CZ    . PHE B  1 259 ? 27.266  -43.204  30.475  1.00 90.33  ? 259 PHE B CZ    1 
ATOM   5417  N  N     . ARG B  1 260 ? 31.713  -38.621  27.110  1.00 92.91  ? 260 ARG B N     1 
ATOM   5418  C  CA    . ARG B  1 260 ? 32.437  -37.680  26.256  1.00 93.93  ? 260 ARG B CA    1 
ATOM   5419  C  C     . ARG B  1 260 ? 33.912  -38.078  26.154  1.00 96.45  ? 260 ARG B C     1 
ATOM   5420  O  O     . ARG B  1 260 ? 34.489  -38.039  25.073  1.00 99.39  ? 260 ARG B O     1 
ATOM   5421  C  CB    . ARG B  1 260 ? 32.287  -36.258  26.812  1.00 90.76  ? 260 ARG B CB    1 
ATOM   5422  C  CG    . ARG B  1 260 ? 32.973  -35.136  26.028  1.00 91.26  ? 260 ARG B CG    1 
ATOM   5423  C  CD    . ARG B  1 260 ? 33.251  -33.920  26.936  1.00 87.62  ? 260 ARG B CD    1 
ATOM   5424  N  NE    . ARG B  1 260 ? 34.470  -34.104  27.728  1.00 87.53  ? 260 ARG B NE    1 
ATOM   5425  C  CZ    . ARG B  1 260 ? 34.859  -33.332  28.742  1.00 85.05  ? 260 ARG B CZ    1 
ATOM   5426  N  NH1   . ARG B  1 260 ? 34.135  -32.292  29.130  1.00 81.91  ? 260 ARG B NH1   1 
ATOM   5427  N  NH2   . ARG B  1 260 ? 35.987  -33.609  29.377  1.00 86.19  ? 260 ARG B NH2   1 
ATOM   5428  N  N     . ASP B  1 261 ? 34.502  -38.493  27.277  1.00 95.81  ? 261 ASP B N     1 
ATOM   5429  C  CA    . ASP B  1 261 ? 35.930  -38.832  27.343  1.00 98.01  ? 261 ASP B CA    1 
ATOM   5430  C  C     . ASP B  1 261 ? 36.262  -40.180  26.735  1.00 101.31 ? 261 ASP B C     1 
ATOM   5431  O  O     . ASP B  1 261 ? 37.403  -40.421  26.351  1.00 104.12 ? 261 ASP B O     1 
ATOM   5432  C  CB    . ASP B  1 261 ? 36.430  -38.822  28.788  1.00 96.49  ? 261 ASP B CB    1 
ATOM   5433  C  CG    . ASP B  1 261 ? 36.405  -37.436  29.416  1.00 94.51  ? 261 ASP B CG    1 
ATOM   5434  O  OD1   . ASP B  1 261 ? 36.502  -36.408  28.695  1.00 95.11  ? 261 ASP B OD1   1 
ATOM   5435  O  OD2   . ASP B  1 261 ? 36.295  -37.387  30.656  1.00 93.92  ? 261 ASP B OD2   1 
ATOM   5436  N  N     . ASN B  1 262 ? 35.270  -41.061  26.666  1.00 101.25 ? 262 ASN B N     1 
ATOM   5437  C  CA    . ASN B  1 262 ? 35.484  -42.418  26.171  1.00 104.24 ? 262 ASN B CA    1 
ATOM   5438  C  C     . ASN B  1 262 ? 34.803  -42.697  24.822  1.00 106.41 ? 262 ASN B C     1 
ATOM   5439  O  O     . ASN B  1 262 ? 34.281  -43.787  24.580  1.00 108.14 ? 262 ASN B O     1 
ATOM   5440  C  CB    . ASN B  1 262 ? 35.087  -43.433  27.248  1.00 103.36 ? 262 ASN B CB    1 
ATOM   5441  C  CG    . ASN B  1 262 ? 36.006  -43.385  28.460  1.00 101.76 ? 262 ASN B CG    1 
ATOM   5442  O  OD1   . ASN B  1 262 ? 37.079  -43.990  28.465  1.00 103.42 ? 262 ASN B OD1   1 
ATOM   5443  N  ND2   . ASN B  1 262 ? 35.584  -42.670  29.497  1.00 97.70  ? 262 ASN B ND2   1 
ATOM   5444  N  N     . GLY B  1 263 ? 34.826  -41.694  23.948  1.00 106.44 ? 263 GLY B N     1 
ATOM   5445  C  CA    . GLY B  1 263 ? 34.305  -41.814  22.592  1.00 108.86 ? 263 GLY B CA    1 
ATOM   5446  C  C     . GLY B  1 263 ? 32.818  -42.079  22.439  1.00 108.05 ? 263 GLY B C     1 
ATOM   5447  O  O     . GLY B  1 263 ? 32.392  -42.595  21.411  1.00 111.11 ? 263 GLY B O     1 
ATOM   5448  N  N     . LYS B  1 264 ? 32.027  -41.732  23.449  1.00 104.38 ? 264 LYS B N     1 
ATOM   5449  C  CA    . LYS B  1 264 ? 30.571  -41.896  23.383  1.00 103.51 ? 264 LYS B CA    1 
ATOM   5450  C  C     . LYS B  1 264 ? 29.873  -40.533  23.466  1.00 100.57 ? 264 LYS B C     1 
ATOM   5451  O  O     . LYS B  1 264 ? 30.537  -39.499  23.493  1.00 99.40  ? 264 LYS B O     1 
ATOM   5452  C  CB    . LYS B  1 264 ? 30.073  -42.844  24.482  1.00 102.30 ? 264 LYS B CB    1 
ATOM   5453  C  CG    . LYS B  1 264 ? 30.877  -44.122  24.598  1.00 105.17 ? 264 LYS B CG    1 
ATOM   5454  C  CD    . LYS B  1 264 ? 30.038  -45.287  25.080  1.00 105.94 ? 264 LYS B CD    1 
ATOM   5455  C  CE    . LYS B  1 264 ? 30.646  -46.601  24.625  1.00 109.81 ? 264 LYS B CE    1 
ATOM   5456  N  NZ    . LYS B  1 264 ? 29.660  -47.705  24.717  1.00 111.72 ? 264 LYS B NZ    1 
ATOM   5457  N  N     . HIS B  1 265 ? 28.540  -40.535  23.501  1.00 99.64  ? 265 HIS B N     1 
ATOM   5458  C  CA    . HIS B  1 265 ? 27.755  -39.300  23.492  1.00 97.12  ? 265 HIS B CA    1 
ATOM   5459  C  C     . HIS B  1 265 ? 26.705  -39.230  24.612  1.00 94.13  ? 265 HIS B C     1 
ATOM   5460  O  O     . HIS B  1 265 ? 25.696  -39.939  24.590  1.00 94.76  ? 265 HIS B O     1 
ATOM   5461  C  CB    . HIS B  1 265 ? 27.086  -39.093  22.124  1.00 99.66  ? 265 HIS B CB    1 
ATOM   5462  C  CG    . HIS B  1 265 ? 28.006  -39.273  20.952  1.00 103.32 ? 265 HIS B CG    1 
ATOM   5463  N  ND1   . HIS B  1 265 ? 29.322  -38.863  20.958  1.00 103.99 ? 265 HIS B ND1   1 
ATOM   5464  C  CD2   . HIS B  1 265 ? 27.783  -39.790  19.721  1.00 107.52 ? 265 HIS B CD2   1 
ATOM   5465  C  CE1   . HIS B  1 265 ? 29.875  -39.137  19.790  1.00 107.51 ? 265 HIS B CE1   1 
ATOM   5466  N  NE2   . HIS B  1 265 ? 28.962  -39.700  19.020  1.00 109.90 ? 265 HIS B NE2   1 
ATOM   5467  N  N     . ALA B  1 266 ? 26.951  -38.361  25.587  1.00 91.06  ? 266 ALA B N     1 
ATOM   5468  C  CA    . ALA B  1 266 ? 26.003  -38.136  26.678  1.00 88.20  ? 266 ALA B CA    1 
ATOM   5469  C  C     . ALA B  1 266 ? 25.241  -36.828  26.504  1.00 86.48  ? 266 ALA B C     1 
ATOM   5470  O  O     . ALA B  1 266 ? 25.795  -35.835  26.026  1.00 86.27  ? 266 ALA B O     1 
ATOM   5471  C  CB    . ALA B  1 266 ? 26.710  -38.163  28.013  1.00 85.94  ? 266 ALA B CB    1 
ATOM   5472  N  N     . LEU B  1 267 ? 23.965  -36.850  26.877  1.00 85.65  ? 267 LEU B N     1 
ATOM   5473  C  CA    . LEU B  1 267 ? 23.127  -35.658  26.894  1.00 84.13  ? 267 LEU B CA    1 
ATOM   5474  C  C     . LEU B  1 267 ? 22.819  -35.290  28.337  1.00 81.09  ? 267 LEU B C     1 
ATOM   5475  O  O     . LEU B  1 267 ? 22.293  -36.100  29.091  1.00 80.86  ? 267 LEU B O     1 
ATOM   5476  C  CB    . LEU B  1 267 ? 21.822  -35.906  26.137  1.00 86.07  ? 267 LEU B CB    1 
ATOM   5477  C  CG    . LEU B  1 267 ? 20.683  -34.891  26.308  1.00 84.75  ? 267 LEU B CG    1 
ATOM   5478  C  CD1   . LEU B  1 267 ? 20.938  -33.648  25.481  1.00 84.43  ? 267 LEU B CD1   1 
ATOM   5479  C  CD2   . LEU B  1 267 ? 19.345  -35.519  25.932  1.00 87.12  ? 267 LEU B CD2   1 
ATOM   5480  N  N     . ILE B  1 268 ? 23.145  -34.067  28.726  1.00 78.99  ? 268 ILE B N     1 
ATOM   5481  C  CA    . ILE B  1 268 ? 22.900  -33.655  30.095  1.00 76.48  ? 268 ILE B CA    1 
ATOM   5482  C  C     . ILE B  1 268 ? 21.794  -32.601  30.187  1.00 75.11  ? 268 ILE B C     1 
ATOM   5483  O  O     . ILE B  1 268 ? 21.788  -31.628  29.432  1.00 75.06  ? 268 ILE B O     1 
ATOM   5484  C  CB    . ILE B  1 268 ? 24.217  -33.257  30.823  1.00 75.11  ? 268 ILE B CB    1 
ATOM   5485  C  CG1   . ILE B  1 268 ? 23.963  -32.992  32.306  1.00 73.08  ? 268 ILE B CG1   1 
ATOM   5486  C  CG2   . ILE B  1 268 ? 24.916  -32.084  30.147  1.00 74.94  ? 268 ILE B CG2   1 
ATOM   5487  C  CD1   . ILE B  1 268 ? 25.121  -33.395  33.188  1.00 73.97  ? 268 ILE B CD1   1 
ATOM   5488  N  N     . VAL B  1 269 ? 20.839  -32.830  31.089  1.00 74.20  ? 269 VAL B N     1 
ATOM   5489  C  CA    . VAL B  1 269 ? 19.745  -31.882  31.306  1.00 73.26  ? 269 VAL B CA    1 
ATOM   5490  C  C     . VAL B  1 269 ? 19.755  -31.288  32.728  1.00 70.75  ? 269 VAL B C     1 
ATOM   5491  O  O     . VAL B  1 269 ? 19.538  -31.998  33.720  1.00 70.31  ? 269 VAL B O     1 
ATOM   5492  C  CB    . VAL B  1 269 ? 18.377  -32.504  30.968  1.00 74.90  ? 269 VAL B CB    1 
ATOM   5493  C  CG1   . VAL B  1 269 ? 17.253  -31.594  31.409  1.00 73.89  ? 269 VAL B CG1   1 
ATOM   5494  C  CG2   . VAL B  1 269 ? 18.271  -32.745  29.480  1.00 78.06  ? 269 VAL B CG2   1 
ATOM   5495  N  N     . TYR B  1 270 ? 20.021  -29.985  32.813  1.00 69.09  ? 270 TYR B N     1 
ATOM   5496  C  CA    . TYR B  1 270 ? 20.069  -29.303  34.095  1.00 66.89  ? 270 TYR B CA    1 
ATOM   5497  C  C     . TYR B  1 270 ? 18.722  -28.680  34.398  1.00 66.24  ? 270 TYR B C     1 
ATOM   5498  O  O     . TYR B  1 270 ? 18.343  -27.683  33.789  1.00 66.27  ? 270 TYR B O     1 
ATOM   5499  C  CB    . TYR B  1 270 ? 21.167  -28.245  34.096  1.00 65.83  ? 270 TYR B CB    1 
ATOM   5500  C  CG    . TYR B  1 270 ? 22.557  -28.792  33.855  1.00 67.16  ? 270 TYR B CG    1 
ATOM   5501  C  CD1   . TYR B  1 270 ? 23.137  -29.686  34.749  1.00 67.36  ? 270 TYR B CD1   1 
ATOM   5502  C  CD2   . TYR B  1 270 ? 23.297  -28.401  32.742  1.00 69.33  ? 270 TYR B CD2   1 
ATOM   5503  C  CE1   . TYR B  1 270 ? 24.410  -30.182  34.540  1.00 68.98  ? 270 TYR B CE1   1 
ATOM   5504  C  CE2   . TYR B  1 270 ? 24.577  -28.891  32.523  1.00 70.82  ? 270 TYR B CE2   1 
ATOM   5505  C  CZ    . TYR B  1 270 ? 25.123  -29.784  33.428  1.00 70.76  ? 270 TYR B CZ    1 
ATOM   5506  O  OH    . TYR B  1 270 ? 26.384  -30.281  33.221  1.00 73.16  ? 270 TYR B OH    1 
ATOM   5507  N  N     . ASP B  1 271 ? 18.000  -29.279  35.340  1.00 66.10  ? 271 ASP B N     1 
ATOM   5508  C  CA    . ASP B  1 271 ? 16.597  -28.933  35.582  1.00 66.42  ? 271 ASP B CA    1 
ATOM   5509  C  C     . ASP B  1 271 ? 16.336  -28.632  37.066  1.00 64.81  ? 271 ASP B C     1 
ATOM   5510  O  O     . ASP B  1 271 ? 15.948  -29.531  37.830  1.00 65.22  ? 271 ASP B O     1 
ATOM   5511  C  CB    . ASP B  1 271 ? 15.675  -30.058  35.073  1.00 68.79  ? 271 ASP B CB    1 
ATOM   5512  C  CG    . ASP B  1 271 ? 14.296  -29.557  34.656  1.00 70.75  ? 271 ASP B CG    1 
ATOM   5513  O  OD1   . ASP B  1 271 ? 14.111  -28.325  34.538  1.00 71.78  ? 271 ASP B OD1   1 
ATOM   5514  O  OD2   . ASP B  1 271 ? 13.389  -30.391  34.441  1.00 72.41  ? 271 ASP B OD2   1 
ATOM   5515  N  N     . ASP B  1 272 ? 16.558  -27.380  37.482  1.00 62.99  ? 272 ASP B N     1 
ATOM   5516  C  CA    . ASP B  1 272 ? 17.038  -26.320  36.592  1.00 62.74  ? 272 ASP B CA    1 
ATOM   5517  C  C     . ASP B  1 272 ? 18.143  -25.466  37.213  1.00 60.34  ? 272 ASP B C     1 
ATOM   5518  O  O     . ASP B  1 272 ? 18.375  -25.517  38.416  1.00 59.47  ? 272 ASP B O     1 
ATOM   5519  C  CB    . ASP B  1 272 ? 15.871  -25.458  36.075  1.00 63.78  ? 272 ASP B CB    1 
ATOM   5520  C  CG    . ASP B  1 272 ? 15.147  -24.686  37.181  1.00 64.55  ? 272 ASP B CG    1 
ATOM   5521  O  OD1   . ASP B  1 272 ? 15.750  -24.441  38.254  1.00 65.33  ? 272 ASP B OD1   1 
ATOM   5522  O  OD2   . ASP B  1 272 ? 13.967  -24.301  36.960  1.00 66.61  ? 272 ASP B OD2   1 
ATOM   5523  N  N     . LEU B  1 273 ? 18.819  -24.685  36.382  1.00 59.57  ? 273 LEU B N     1 
ATOM   5524  C  CA    . LEU B  1 273 ? 19.894  -23.814  36.836  1.00 57.68  ? 273 LEU B CA    1 
ATOM   5525  C  C     . LEU B  1 273 ? 19.399  -22.573  37.590  1.00 55.74  ? 273 LEU B C     1 
ATOM   5526  O  O     . LEU B  1 273 ? 20.164  -21.932  38.311  1.00 53.81  ? 273 LEU B O     1 
ATOM   5527  C  CB    . LEU B  1 273 ? 20.748  -23.384  35.643  1.00 58.86  ? 273 LEU B CB    1 
ATOM   5528  C  CG    . LEU B  1 273 ? 21.504  -24.478  34.879  1.00 60.67  ? 273 LEU B CG    1 
ATOM   5529  C  CD1   . LEU B  1 273 ? 22.318  -23.841  33.752  1.00 61.70  ? 273 LEU B CD1   1 
ATOM   5530  C  CD2   . LEU B  1 273 ? 22.396  -25.296  35.807  1.00 58.93  ? 273 LEU B CD2   1 
ATOM   5531  N  N     . SER B  1 274 ? 18.129  -22.228  37.407  1.00 55.79  ? 274 SER B N     1 
ATOM   5532  C  CA    . SER B  1 274 ? 17.512  -21.179  38.193  1.00 54.88  ? 274 SER B CA    1 
ATOM   5533  C  C     . SER B  1 274 ? 17.660  -21.545  39.655  1.00 54.12  ? 274 SER B C     1 
ATOM   5534  O  O     . SER B  1 274 ? 18.220  -20.776  40.458  1.00 53.09  ? 274 SER B O     1 
ATOM   5535  C  CB    . SER B  1 274 ? 16.031  -21.074  37.881  1.00 55.72  ? 274 SER B CB    1 
ATOM   5536  O  OG    . SER B  1 274 ? 15.818  -20.981  36.498  1.00 58.26  ? 274 SER B OG    1 
ATOM   5537  N  N     . LYS B  1 275 ? 17.164  -22.735  39.990  1.00 54.66  ? 275 LYS B N     1 
ATOM   5538  C  CA    . LYS B  1 275 ? 17.122  -23.174  41.369  1.00 53.97  ? 275 LYS B CA    1 
ATOM   5539  C  C     . LYS B  1 275 ? 18.530  -23.398  41.913  1.00 53.25  ? 275 LYS B C     1 
ATOM   5540  O  O     . LYS B  1 275 ? 18.814  -23.069  43.063  1.00 52.60  ? 275 LYS B O     1 
ATOM   5541  C  CB    . LYS B  1 275 ? 16.232  -24.405  41.516  1.00 55.33  ? 275 LYS B CB    1 
ATOM   5542  C  CG    . LYS B  1 275 ? 14.743  -24.101  41.372  1.00 55.93  ? 275 LYS B CG    1 
ATOM   5543  C  CD    . LYS B  1 275 ? 13.887  -25.363  41.447  1.00 57.81  ? 275 LYS B CD    1 
ATOM   5544  C  CE    . LYS B  1 275 ? 12.400  -25.053  41.313  1.00 58.82  ? 275 LYS B CE    1 
ATOM   5545  N  NZ    . LYS B  1 275 ? 12.124  -24.204  40.123  1.00 59.50  ? 275 LYS B NZ    1 
ATOM   5546  N  N     . GLN B  1 276 ? 19.422  -23.923  41.081  1.00 53.73  ? 276 GLN B N     1 
ATOM   5547  C  CA    . GLN B  1 276 ? 20.827  -23.989  41.473  1.00 53.01  ? 276 GLN B CA    1 
ATOM   5548  C  C     . GLN B  1 276 ? 21.345  -22.596  41.845  1.00 51.90  ? 276 GLN B C     1 
ATOM   5549  O  O     . GLN B  1 276 ? 21.941  -22.436  42.903  1.00 51.40  ? 276 GLN B O     1 
ATOM   5550  C  CB    . GLN B  1 276 ? 21.701  -24.618  40.391  1.00 53.67  ? 276 GLN B CB    1 
ATOM   5551  C  CG    . GLN B  1 276 ? 23.053  -25.024  40.925  1.00 52.62  ? 276 GLN B CG    1 
ATOM   5552  C  CD    . GLN B  1 276 ? 24.167  -24.873  39.913  1.00 52.73  ? 276 GLN B CD    1 
ATOM   5553  O  OE1   . GLN B  1 276 ? 23.971  -24.343  38.815  1.00 52.24  ? 276 GLN B OE1   1 
ATOM   5554  N  NE2   . GLN B  1 276 ? 25.354  -25.346  40.279  1.00 53.15  ? 276 GLN B NE2   1 
ATOM   5555  N  N     . ALA B  1 277 ? 21.103  -21.595  40.994  1.00 51.77  ? 277 ALA B N     1 
ATOM   5556  C  CA    . ALA B  1 277 ? 21.559  -20.225  41.289  1.00 50.80  ? 277 ALA B CA    1 
ATOM   5557  C  C     . ALA B  1 277 ? 20.960  -19.705  42.587  1.00 49.73  ? 277 ALA B C     1 
ATOM   5558  O  O     . ALA B  1 277 ? 21.645  -19.015  43.346  1.00 49.03  ? 277 ALA B O     1 
ATOM   5559  C  CB    . ALA B  1 277 ? 21.265  -19.270  40.144  1.00 51.09  ? 277 ALA B CB    1 
ATOM   5560  N  N     . VAL B  1 278 ? 19.696  -20.059  42.845  1.00 49.71  ? 278 VAL B N     1 
ATOM   5561  C  CA    . VAL B  1 278 ? 19.042  -19.721  44.116  1.00 48.94  ? 278 VAL B CA    1 
ATOM   5562  C  C     . VAL B  1 278 ? 19.746  -20.413  45.279  1.00 49.05  ? 278 VAL B C     1 
ATOM   5563  O  O     . VAL B  1 278 ? 20.037  -19.768  46.278  1.00 49.05  ? 278 VAL B O     1 
ATOM   5564  C  CB    . VAL B  1 278 ? 17.509  -20.009  44.122  1.00 49.25  ? 278 VAL B CB    1 
ATOM   5565  C  CG1   . VAL B  1 278 ? 16.958  -20.022  45.536  1.00 48.60  ? 278 VAL B CG1   1 
ATOM   5566  C  CG2   . VAL B  1 278 ? 16.777  -18.976  43.311  1.00 48.94  ? 278 VAL B CG2   1 
ATOM   5567  N  N     . ALA B  1 279 ? 20.046  -21.706  45.139  1.00 49.82  ? 279 ALA B N     1 
ATOM   5568  C  CA    . ALA B  1 279 ? 20.765  -22.436  46.181  1.00 50.12  ? 279 ALA B CA    1 
ATOM   5569  C  C     . ALA B  1 279 ? 22.090  -21.750  46.439  1.00 50.04  ? 279 ALA B C     1 
ATOM   5570  O  O     . ALA B  1 279 ? 22.470  -21.528  47.581  1.00 50.26  ? 279 ALA B O     1 
ATOM   5571  C  CB    . ALA B  1 279 ? 20.986  -23.889  45.790  1.00 50.99  ? 279 ALA B CB    1 
ATOM   5572  N  N     . TYR B  1 280 ? 22.775  -21.389  45.360  1.00 50.40  ? 280 TYR B N     1 
ATOM   5573  C  CA    . TYR B  1 280 ? 24.078  -20.760  45.453  1.00 50.63  ? 280 TYR B CA    1 
ATOM   5574  C  C     . TYR B  1 280 ? 24.033  -19.383  46.118  1.00 49.96  ? 280 TYR B C     1 
ATOM   5575  O  O     . TYR B  1 280 ? 24.968  -19.024  46.848  1.00 50.61  ? 280 TYR B O     1 
ATOM   5576  C  CB    . TYR B  1 280 ? 24.737  -20.666  44.079  1.00 51.33  ? 280 TYR B CB    1 
ATOM   5577  C  CG    . TYR B  1 280 ? 26.169  -20.193  44.150  1.00 51.92  ? 280 TYR B CG    1 
ATOM   5578  C  CD1   . TYR B  1 280 ? 27.113  -20.880  44.912  1.00 52.61  ? 280 TYR B CD1   1 
ATOM   5579  C  CD2   . TYR B  1 280 ? 26.579  -19.062  43.458  1.00 52.38  ? 280 TYR B CD2   1 
ATOM   5580  C  CE1   . TYR B  1 280 ? 28.426  -20.450  44.985  1.00 54.09  ? 280 TYR B CE1   1 
ATOM   5581  C  CE2   . TYR B  1 280 ? 27.897  -18.622  43.526  1.00 54.10  ? 280 TYR B CE2   1 
ATOM   5582  C  CZ    . TYR B  1 280 ? 28.813  -19.320  44.291  1.00 54.13  ? 280 TYR B CZ    1 
ATOM   5583  O  OH    . TYR B  1 280 ? 30.113  -18.886  44.355  1.00 54.57  ? 280 TYR B OH    1 
ATOM   5584  N  N     . ARG B  1 281 ? 22.961  -18.624  45.878  1.00 48.70  ? 281 ARG B N     1 
ATOM   5585  C  CA    . ARG B  1 281 ? 22.763  -17.357  46.576  1.00 47.60  ? 281 ARG B CA    1 
ATOM   5586  C  C     . ARG B  1 281 ? 22.626  -17.542  48.098  1.00 47.45  ? 281 ARG B C     1 
ATOM   5587  O  O     . ARG B  1 281 ? 23.117  -16.723  48.876  1.00 46.98  ? 281 ARG B O     1 
ATOM   5588  C  CB    . ARG B  1 281 ? 21.556  -16.603  46.015  1.00 47.36  ? 281 ARG B CB    1 
ATOM   5589  C  CG    . ARG B  1 281 ? 21.312  -15.271  46.713  1.00 47.08  ? 281 ARG B CG    1 
ATOM   5590  C  CD    . ARG B  1 281 ? 20.167  -14.489  46.118  1.00 47.59  ? 281 ARG B CD    1 
ATOM   5591  N  NE    . ARG B  1 281 ? 18.895  -15.205  46.168  1.00 48.46  ? 281 ARG B NE    1 
ATOM   5592  C  CZ    . ARG B  1 281 ? 17.796  -14.812  45.527  1.00 48.84  ? 281 ARG B CZ    1 
ATOM   5593  N  NH1   . ARG B  1 281 ? 17.795  -13.709  44.792  1.00 47.90  ? 281 ARG B NH1   1 
ATOM   5594  N  NH2   . ARG B  1 281 ? 16.690  -15.526  45.621  1.00 51.40  ? 281 ARG B NH2   1 
ATOM   5595  N  N     . GLN B  1 282 ? 21.962  -18.623  48.509  1.00 47.72  ? 282 GLN B N     1 
ATOM   5596  C  CA    . GLN B  1 282 ? 21.764  -18.933  49.925  1.00 48.15  ? 282 GLN B CA    1 
ATOM   5597  C  C     . GLN B  1 282 ? 23.115  -19.137  50.618  1.00 48.93  ? 282 GLN B C     1 
ATOM   5598  O  O     . GLN B  1 282 ? 23.458  -18.485  51.614  1.00 48.55  ? 282 GLN B O     1 
ATOM   5599  C  CB    . GLN B  1 282 ? 20.896  -20.183  50.056  1.00 48.36  ? 282 GLN B CB    1 
ATOM   5600  C  CG    . GLN B  1 282 ? 20.960  -20.837  51.428  1.00 49.88  ? 282 GLN B CG    1 
ATOM   5601  C  CD    . GLN B  1 282 ? 19.865  -21.850  51.659  1.00 51.60  ? 282 GLN B CD    1 
ATOM   5602  O  OE1   . GLN B  1 282 ? 18.729  -21.668  51.225  1.00 52.98  ? 282 GLN B OE1   1 
ATOM   5603  N  NE2   . GLN B  1 282 ? 20.196  -22.923  52.360  1.00 53.11  ? 282 GLN B NE2   1 
ATOM   5604  N  N     . LEU B  1 283 ? 23.863  -20.066  50.040  1.00 50.09  ? 283 LEU B N     1 
ATOM   5605  C  CA    . LEU B  1 283 ? 25.218  -20.393  50.394  1.00 51.47  ? 283 LEU B CA    1 
ATOM   5606  C  C     . LEU B  1 283 ? 26.053  -19.104  50.502  1.00 51.64  ? 283 LEU B C     1 
ATOM   5607  O  O     . LEU B  1 283 ? 26.719  -18.867  51.517  1.00 52.36  ? 283 LEU B O     1 
ATOM   5608  C  CB    . LEU B  1 283 ? 25.741  -21.292  49.285  1.00 51.90  ? 283 LEU B CB    1 
ATOM   5609  C  CG    . LEU B  1 283 ? 26.616  -22.504  49.554  1.00 54.35  ? 283 LEU B CG    1 
ATOM   5610  C  CD1   . LEU B  1 283 ? 26.562  -23.444  48.344  1.00 55.92  ? 283 LEU B CD1   1 
ATOM   5611  C  CD2   . LEU B  1 283 ? 28.040  -22.068  49.806  1.00 55.54  ? 283 LEU B CD2   1 
ATOM   5612  N  N     . SER B  1 284 ? 25.977  -18.264  49.465  1.00 50.94  ? 284 SER B N     1 
ATOM   5613  C  CA    . SER B  1 284 ? 26.724  -17.006  49.391  1.00 50.80  ? 284 SER B CA    1 
ATOM   5614  C  C     . SER B  1 284 ? 26.349  -15.997  50.469  1.00 50.41  ? 284 SER B C     1 
ATOM   5615  O  O     . SER B  1 284 ? 27.219  -15.404  51.104  1.00 51.04  ? 284 SER B O     1 
ATOM   5616  C  CB    . SER B  1 284 ? 26.533  -16.372  48.021  1.00 50.34  ? 284 SER B CB    1 
ATOM   5617  O  OG    . SER B  1 284 ? 26.981  -17.256  47.008  1.00 52.41  ? 284 SER B OG    1 
ATOM   5618  N  N     . LEU B  1 285 ? 25.052  -15.798  50.676  1.00 49.73  ? 285 LEU B N     1 
ATOM   5619  C  CA    . LEU B  1 285 ? 24.597  -14.847  51.686  1.00 49.44  ? 285 LEU B CA    1 
ATOM   5620  C  C     . LEU B  1 285 ? 24.888  -15.345  53.102  1.00 50.31  ? 285 LEU B C     1 
ATOM   5621  O  O     . LEU B  1 285 ? 25.206  -14.550  54.004  1.00 51.19  ? 285 LEU B O     1 
ATOM   5622  C  CB    . LEU B  1 285 ? 23.117  -14.495  51.497  1.00 48.44  ? 285 LEU B CB    1 
ATOM   5623  C  CG    . LEU B  1 285 ? 22.844  -13.762  50.181  1.00 48.07  ? 285 LEU B CG    1 
ATOM   5624  C  CD1   . LEU B  1 285 ? 21.394  -13.846  49.826  1.00 49.58  ? 285 LEU B CD1   1 
ATOM   5625  C  CD2   . LEU B  1 285 ? 23.295  -12.316  50.189  1.00 47.74  ? 285 LEU B CD2   1 
ATOM   5626  N  N     . LEU B  1 286 ? 24.810  -16.658  53.305  1.00 50.16  ? 286 LEU B N     1 
ATOM   5627  C  CA    . LEU B  1 286 ? 25.094  -17.179  54.626  1.00 50.88  ? 286 LEU B CA    1 
ATOM   5628  C  C     . LEU B  1 286 ? 26.578  -17.039  54.903  1.00 52.17  ? 286 LEU B C     1 
ATOM   5629  O  O     . LEU B  1 286 ? 27.001  -16.929  56.040  1.00 53.65  ? 286 LEU B O     1 
ATOM   5630  C  CB    . LEU B  1 286 ? 24.597  -18.607  54.767  1.00 50.90  ? 286 LEU B CB    1 
ATOM   5631  C  CG    . LEU B  1 286 ? 23.070  -18.751  54.672  1.00 47.98  ? 286 LEU B CG    1 
ATOM   5632  C  CD1   . LEU B  1 286 ? 22.680  -20.216  54.627  1.00 48.23  ? 286 LEU B CD1   1 
ATOM   5633  C  CD2   . LEU B  1 286 ? 22.382  -18.068  55.816  1.00 44.91  ? 286 LEU B CD2   1 
ATOM   5634  N  N     . LEU B  1 287 ? 27.350  -16.973  53.829  1.00 52.32  ? 287 LEU B N     1 
ATOM   5635  C  CA    . LEU B  1 287 ? 28.792  -16.814  53.899  1.00 53.47  ? 287 LEU B CA    1 
ATOM   5636  C  C     . LEU B  1 287 ? 29.190  -15.364  53.868  1.00 53.52  ? 287 LEU B C     1 
ATOM   5637  O  O     . LEU B  1 287 ? 30.373  -15.059  53.893  1.00 55.20  ? 287 LEU B O     1 
ATOM   5638  C  CB    . LEU B  1 287 ? 29.448  -17.515  52.716  1.00 53.50  ? 287 LEU B CB    1 
ATOM   5639  C  CG    . LEU B  1 287 ? 29.689  -19.014  52.822  1.00 54.11  ? 287 LEU B CG    1 
ATOM   5640  C  CD1   . LEU B  1 287 ? 29.861  -19.575  51.432  1.00 54.24  ? 287 LEU B CD1   1 
ATOM   5641  C  CD2   . LEU B  1 287 ? 30.925  -19.258  53.660  1.00 56.65  ? 287 LEU B CD2   1 
ATOM   5642  N  N     . ARG B  1 288 ? 28.204  -14.476  53.793  1.00 52.52  ? 288 ARG B N     1 
ATOM   5643  C  CA    . ARG B  1 288 ? 28.417  -13.015  53.780  1.00 52.27  ? 288 ARG B CA    1 
ATOM   5644  C  C     . ARG B  1 288 ? 29.246  -12.437  52.639  1.00 52.19  ? 288 ARG B C     1 
ATOM   5645  O  O     . ARG B  1 288 ? 30.019  -11.527  52.865  1.00 52.82  ? 288 ARG B O     1 
ATOM   5646  C  CB    . ARG B  1 288 ? 29.006  -12.556  55.097  1.00 53.39  ? 288 ARG B CB    1 
ATOM   5647  C  CG    . ARG B  1 288 ? 28.363  -13.217  56.240  1.00 54.30  ? 288 ARG B CG    1 
ATOM   5648  C  CD    . ARG B  1 288 ? 28.740  -12.569  57.522  1.00 57.68  ? 288 ARG B CD    1 
ATOM   5649  N  NE    . ARG B  1 288 ? 27.588  -12.657  58.392  1.00 59.24  ? 288 ARG B NE    1 
ATOM   5650  C  CZ    . ARG B  1 288 ? 26.824  -11.629  58.709  1.00 60.64  ? 288 ARG B CZ    1 
ATOM   5651  N  NH1   . ARG B  1 288 ? 27.126  -10.404  58.266  1.00 61.04  ? 288 ARG B NH1   1 
ATOM   5652  N  NH2   . ARG B  1 288 ? 25.773  -11.833  59.488  1.00 61.85  ? 288 ARG B NH2   1 
ATOM   5653  N  N     . ARG B  1 289 ? 29.081  -12.959  51.428  1.00 51.85  ? 289 ARG B N     1 
ATOM   5654  C  CA    . ARG B  1 289 ? 29.691  -12.380  50.235  1.00 52.64  ? 289 ARG B CA    1 
ATOM   5655  C  C     . ARG B  1 289 ? 28.842  -11.193  49.801  1.00 51.99  ? 289 ARG B C     1 
ATOM   5656  O  O     . ARG B  1 289 ? 27.616  -11.263  49.888  1.00 51.46  ? 289 ARG B O     1 
ATOM   5657  C  CB    . ARG B  1 289 ? 29.709  -13.411  49.110  1.00 52.71  ? 289 ARG B CB    1 
ATOM   5658  C  CG    . ARG B  1 289 ? 30.330  -14.765  49.473  1.00 56.21  ? 289 ARG B CG    1 
ATOM   5659  C  CD    . ARG B  1 289 ? 31.722  -14.918  48.854  1.00 63.49  ? 289 ARG B CD    1 
ATOM   5660  N  NE    . ARG B  1 289 ? 32.712  -15.427  49.807  1.00 69.05  ? 289 ARG B NE    1 
ATOM   5661  C  CZ    . ARG B  1 289 ? 32.992  -16.719  50.002  1.00 71.70  ? 289 ARG B CZ    1 
ATOM   5662  N  NH1   . ARG B  1 289 ? 32.351  -17.667  49.304  1.00 71.17  ? 289 ARG B NH1   1 
ATOM   5663  N  NH2   . ARG B  1 289 ? 33.917  -17.060  50.901  1.00 72.89  ? 289 ARG B NH2   1 
ATOM   5664  N  N     . PRO B  1 290 ? 29.473  -10.092  49.340  1.00 52.51  ? 290 PRO B N     1 
ATOM   5665  C  CA    . PRO B  1 290 ? 28.746  -8.962   48.764  1.00 51.88  ? 290 PRO B CA    1 
ATOM   5666  C  C     . PRO B  1 290 ? 27.651  -9.381   47.780  1.00 51.12  ? 290 PRO B C     1 
ATOM   5667  O  O     . PRO B  1 290 ? 27.949  -9.979   46.737  1.00 51.67  ? 290 PRO B O     1 
ATOM   5668  C  CB    . PRO B  1 290 ? 29.841  -8.205   48.016  1.00 52.27  ? 290 PRO B CB    1 
ATOM   5669  C  CG    . PRO B  1 290 ? 30.985  -8.375   48.857  1.00 53.69  ? 290 PRO B CG    1 
ATOM   5670  C  CD    . PRO B  1 290 ? 30.904  -9.779   49.434  1.00 53.96  ? 290 PRO B CD    1 
ATOM   5671  N  N     . PRO B  1 291 ? 26.387  -9.077   48.110  1.00 50.42  ? 291 PRO B N     1 
ATOM   5672  C  CA    . PRO B  1 291 ? 25.304  -9.345   47.171  1.00 49.52  ? 291 PRO B CA    1 
ATOM   5673  C  C     . PRO B  1 291 ? 25.244  -8.282   46.071  1.00 49.48  ? 291 PRO B C     1 
ATOM   5674  O  O     . PRO B  1 291 ? 25.259  -7.084   46.363  1.00 49.73  ? 291 PRO B O     1 
ATOM   5675  C  CB    . PRO B  1 291 ? 24.050  -9.289   48.056  1.00 49.48  ? 291 PRO B CB    1 
ATOM   5676  C  CG    . PRO B  1 291 ? 24.421  -8.424   49.243  1.00 49.74  ? 291 PRO B CG    1 
ATOM   5677  C  CD    . PRO B  1 291 ? 25.920  -8.458   49.372  1.00 50.65  ? 291 PRO B CD    1 
ATOM   5678  N  N     . GLY B  1 292 ? 25.179  -8.716   44.817  1.00 49.29  ? 292 GLY B N     1 
ATOM   5679  C  CA    . GLY B  1 292 ? 25.021  -7.784   43.698  1.00 49.33  ? 292 GLY B CA    1 
ATOM   5680  C  C     . GLY B  1 292 ? 23.608  -7.721   43.137  1.00 48.93  ? 292 GLY B C     1 
ATOM   5681  O  O     . GLY B  1 292 ? 22.622  -7.691   43.881  1.00 48.59  ? 292 GLY B O     1 
ATOM   5682  N  N     . ARG B  1 293 ? 23.516  -7.668   41.814  1.00 49.44  ? 293 ARG B N     1 
ATOM   5683  C  CA    . ARG B  1 293 ? 22.249  -7.686   41.095  1.00 49.63  ? 293 ARG B CA    1 
ATOM   5684  C  C     . ARG B  1 293 ? 21.353  -8.770   41.697  1.00 49.71  ? 293 ARG B C     1 
ATOM   5685  O  O     . ARG B  1 293 ? 21.812  -9.905   41.929  1.00 50.19  ? 293 ARG B O     1 
ATOM   5686  C  CB    . ARG B  1 293 ? 22.521  -7.965   39.620  1.00 49.97  ? 293 ARG B CB    1 
ATOM   5687  C  CG    . ARG B  1 293 ? 21.512  -7.403   38.673  1.00 49.75  ? 293 ARG B CG    1 
ATOM   5688  C  CD    . ARG B  1 293 ? 22.096  -7.248   37.287  1.00 48.02  ? 293 ARG B CD    1 
ATOM   5689  N  NE    . ARG B  1 293 ? 22.858  -6.008   37.156  1.00 48.52  ? 293 ARG B NE    1 
ATOM   5690  C  CZ    . ARG B  1 293 ? 22.375  -4.856   36.687  1.00 48.42  ? 293 ARG B CZ    1 
ATOM   5691  N  NH1   . ARG B  1 293 ? 21.113  -4.746   36.295  1.00 48.36  ? 293 ARG B NH1   1 
ATOM   5692  N  NH2   . ARG B  1 293 ? 23.167  -3.803   36.595  1.00 49.33  ? 293 ARG B NH2   1 
ATOM   5693  N  N     . GLU B  1 294 ? 20.108  -8.400   41.997  1.00 49.75  ? 294 GLU B N     1 
ATOM   5694  C  CA    . GLU B  1 294 ? 19.112  -9.289   42.613  1.00 50.00  ? 294 GLU B CA    1 
ATOM   5695  C  C     . GLU B  1 294 ? 19.660  -10.169  43.740  1.00 49.66  ? 294 GLU B C     1 
ATOM   5696  O  O     . GLU B  1 294 ? 19.285  -11.333  43.895  1.00 49.61  ? 294 GLU B O     1 
ATOM   5697  C  CB    . GLU B  1 294 ? 18.411  -10.113  41.540  1.00 50.92  ? 294 GLU B CB    1 
ATOM   5698  C  CG    . GLU B  1 294 ? 17.949  -9.256   40.387  1.00 53.16  ? 294 GLU B CG    1 
ATOM   5699  C  CD    . GLU B  1 294 ? 17.392  -10.038  39.226  1.00 56.06  ? 294 GLU B CD    1 
ATOM   5700  O  OE1   . GLU B  1 294 ? 16.559  -10.952  39.480  1.00 56.94  ? 294 GLU B OE1   1 
ATOM   5701  O  OE2   . GLU B  1 294 ? 17.772  -9.704   38.065  1.00 56.79  ? 294 GLU B OE2   1 
ATOM   5702  N  N     . ALA B  1 295 ? 20.555  -9.576   44.524  1.00 50.01  ? 295 ALA B N     1 
ATOM   5703  C  CA    . ALA B  1 295 ? 21.241  -10.231  45.645  1.00 49.97  ? 295 ALA B CA    1 
ATOM   5704  C  C     . ALA B  1 295 ? 21.983  -11.525  45.303  1.00 50.33  ? 295 ALA B C     1 
ATOM   5705  O  O     . ALA B  1 295 ? 22.336  -12.299  46.195  1.00 50.65  ? 295 ALA B O     1 
ATOM   5706  C  CB    . ALA B  1 295 ? 20.300  -10.423  46.824  1.00 49.87  ? 295 ALA B CB    1 
ATOM   5707  N  N     . TYR B  1 296 ? 22.243  -11.760  44.021  1.00 50.93  ? 296 TYR B N     1 
ATOM   5708  C  CA    . TYR B  1 296 ? 23.173  -12.823  43.657  1.00 51.47  ? 296 TYR B CA    1 
ATOM   5709  C  C     . TYR B  1 296 ? 24.612  -12.344  43.861  1.00 52.21  ? 296 TYR B C     1 
ATOM   5710  O  O     . TYR B  1 296 ? 24.884  -11.139  43.739  1.00 52.62  ? 296 TYR B O     1 
ATOM   5711  C  CB    . TYR B  1 296 ? 22.963  -13.262  42.225  1.00 51.75  ? 296 TYR B CB    1 
ATOM   5712  C  CG    . TYR B  1 296 ? 21.675  -13.997  42.019  1.00 51.71  ? 296 TYR B CG    1 
ATOM   5713  C  CD1   . TYR B  1 296 ? 21.513  -15.308  42.493  1.00 50.64  ? 296 TYR B CD1   1 
ATOM   5714  C  CD2   . TYR B  1 296 ? 20.604  -13.387  41.354  1.00 50.43  ? 296 TYR B CD2   1 
ATOM   5715  C  CE1   . TYR B  1 296 ? 20.318  -15.997  42.296  1.00 50.10  ? 296 TYR B CE1   1 
ATOM   5716  C  CE2   . TYR B  1 296 ? 19.410  -14.064  41.159  1.00 50.46  ? 296 TYR B CE2   1 
ATOM   5717  C  CZ    . TYR B  1 296 ? 19.280  -15.370  41.622  1.00 50.70  ? 296 TYR B CZ    1 
ATOM   5718  O  OH    . TYR B  1 296 ? 18.100  -16.037  41.428  1.00 52.34  ? 296 TYR B OH    1 
ATOM   5719  N  N     . PRO B  1 297 ? 25.536  -13.274  44.193  1.00 52.63  ? 297 PRO B N     1 
ATOM   5720  C  CA    . PRO B  1 297 ? 26.913  -12.863  44.399  1.00 53.10  ? 297 PRO B CA    1 
ATOM   5721  C  C     . PRO B  1 297 ? 27.587  -12.509  43.084  1.00 53.96  ? 297 PRO B C     1 
ATOM   5722  O  O     . PRO B  1 297 ? 27.058  -12.804  42.006  1.00 53.64  ? 297 PRO B O     1 
ATOM   5723  C  CB    . PRO B  1 297 ? 27.549  -14.105  45.018  1.00 53.60  ? 297 PRO B CB    1 
ATOM   5724  C  CG    . PRO B  1 297 ? 26.736  -15.237  44.465  1.00 53.25  ? 297 PRO B CG    1 
ATOM   5725  C  CD    . PRO B  1 297 ? 25.352  -14.705  44.509  1.00 52.84  ? 297 PRO B CD    1 
ATOM   5726  N  N     . GLY B  1 298 ? 28.755  -11.881  43.194  1.00 55.02  ? 298 GLY B N     1 
ATOM   5727  C  CA    . GLY B  1 298 ? 29.506  -11.414  42.042  1.00 56.16  ? 298 GLY B CA    1 
ATOM   5728  C  C     . GLY B  1 298 ? 29.784  -12.512  41.049  1.00 56.97  ? 298 GLY B C     1 
ATOM   5729  O  O     . GLY B  1 298 ? 29.830  -12.252  39.858  1.00 58.08  ? 298 GLY B O     1 
ATOM   5730  N  N     . ASP B  1 299 ? 29.919  -13.741  41.545  1.00 56.89  ? 299 ASP B N     1 
ATOM   5731  C  CA    . ASP B  1 299 ? 30.427  -14.859  40.764  1.00 57.92  ? 299 ASP B CA    1 
ATOM   5732  C  C     . ASP B  1 299 ? 29.378  -15.864  40.274  1.00 57.53  ? 299 ASP B C     1 
ATOM   5733  O  O     . ASP B  1 299 ? 29.692  -17.041  40.060  1.00 58.69  ? 299 ASP B O     1 
ATOM   5734  C  CB    . ASP B  1 299 ? 31.484  -15.588  41.591  1.00 58.81  ? 299 ASP B CB    1 
ATOM   5735  C  CG    . ASP B  1 299 ? 30.900  -16.317  42.799  1.00 59.01  ? 299 ASP B CG    1 
ATOM   5736  O  OD1   . ASP B  1 299 ? 29.932  -15.816  43.404  1.00 58.50  ? 299 ASP B OD1   1 
ATOM   5737  O  OD2   . ASP B  1 299 ? 31.427  -17.399  43.156  1.00 61.55  ? 299 ASP B OD2   1 
ATOM   5738  N  N     . VAL B  1 300 ? 28.141  -15.422  40.085  1.00 56.49  ? 300 VAL B N     1 
ATOM   5739  C  CA    . VAL B  1 300 ? 27.070  -16.346  39.681  1.00 55.92  ? 300 VAL B CA    1 
ATOM   5740  C  C     . VAL B  1 300 ? 27.120  -16.645  38.185  1.00 57.04  ? 300 VAL B C     1 
ATOM   5741  O  O     . VAL B  1 300 ? 26.667  -17.692  37.740  1.00 58.08  ? 300 VAL B O     1 
ATOM   5742  C  CB    . VAL B  1 300 ? 25.658  -15.846  40.124  1.00 54.94  ? 300 VAL B CB    1 
ATOM   5743  C  CG1   . VAL B  1 300 ? 25.237  -14.580  39.350  1.00 54.83  ? 300 VAL B CG1   1 
ATOM   5744  C  CG2   . VAL B  1 300 ? 24.617  -16.960  40.019  1.00 54.18  ? 300 VAL B CG2   1 
ATOM   5745  N  N     . PHE B  1 301 ? 27.665  -15.718  37.409  1.00 57.50  ? 301 PHE B N     1 
ATOM   5746  C  CA    . PHE B  1 301 ? 27.907  -15.971  36.003  1.00 58.33  ? 301 PHE B CA    1 
ATOM   5747  C  C     . PHE B  1 301 ? 28.877  -17.119  35.923  1.00 59.11  ? 301 PHE B C     1 
ATOM   5748  O  O     . PHE B  1 301 ? 28.652  -18.069  35.189  1.00 59.93  ? 301 PHE B O     1 
ATOM   5749  C  CB    . PHE B  1 301 ? 28.502  -14.744  35.298  1.00 59.12  ? 301 PHE B CB    1 
ATOM   5750  C  CG    . PHE B  1 301 ? 29.046  -15.046  33.927  1.00 60.52  ? 301 PHE B CG    1 
ATOM   5751  C  CD1   . PHE B  1 301 ? 28.183  -15.327  32.863  1.00 60.76  ? 301 PHE B CD1   1 
ATOM   5752  C  CD2   . PHE B  1 301 ? 30.410  -15.069  33.699  1.00 61.20  ? 301 PHE B CD2   1 
ATOM   5753  C  CE1   . PHE B  1 301 ? 28.672  -15.615  31.596  1.00 61.85  ? 301 PHE B CE1   1 
ATOM   5754  C  CE2   . PHE B  1 301 ? 30.904  -15.357  32.434  1.00 63.57  ? 301 PHE B CE2   1 
ATOM   5755  C  CZ    . PHE B  1 301 ? 30.030  -15.631  31.381  1.00 63.48  ? 301 PHE B CZ    1 
ATOM   5756  N  N     . TYR B  1 302 ? 29.944  -17.013  36.711  1.00 59.26  ? 302 TYR B N     1 
ATOM   5757  C  CA    . TYR B  1 302 ? 31.047  -17.969  36.715  1.00 60.59  ? 302 TYR B CA    1 
ATOM   5758  C  C     . TYR B  1 302 ? 30.587  -19.361  37.118  1.00 60.02  ? 302 TYR B C     1 
ATOM   5759  O  O     . TYR B  1 302 ? 30.991  -20.339  36.492  1.00 61.17  ? 302 TYR B O     1 
ATOM   5760  C  CB    . TYR B  1 302 ? 32.174  -17.471  37.618  1.00 60.89  ? 302 TYR B CB    1 
ATOM   5761  C  CG    . TYR B  1 302 ? 33.325  -18.429  37.791  1.00 64.26  ? 302 TYR B CG    1 
ATOM   5762  C  CD1   . TYR B  1 302 ? 33.869  -19.119  36.704  1.00 66.75  ? 302 TYR B CD1   1 
ATOM   5763  C  CD2   . TYR B  1 302 ? 33.895  -18.631  39.046  1.00 66.17  ? 302 TYR B CD2   1 
ATOM   5764  C  CE1   . TYR B  1 302 ? 34.926  -19.990  36.870  1.00 68.52  ? 302 TYR B CE1   1 
ATOM   5765  C  CE2   . TYR B  1 302 ? 34.955  -19.511  39.215  1.00 67.63  ? 302 TYR B CE2   1 
ATOM   5766  C  CZ    . TYR B  1 302 ? 35.462  -20.179  38.127  1.00 68.95  ? 302 TYR B CZ    1 
ATOM   5767  O  OH    . TYR B  1 302 ? 36.523  -21.035  38.305  1.00 73.32  ? 302 TYR B OH    1 
ATOM   5768  N  N     . LEU B  1 303 ? 29.727  -19.433  38.142  1.00 58.37  ? 303 LEU B N     1 
ATOM   5769  C  CA    . LEU B  1 303 ? 29.084  -20.685  38.559  1.00 57.63  ? 303 LEU B CA    1 
ATOM   5770  C  C     . LEU B  1 303 ? 28.588  -21.468  37.355  1.00 58.62  ? 303 LEU B C     1 
ATOM   5771  O  O     . LEU B  1 303 ? 28.985  -22.624  37.156  1.00 59.94  ? 303 LEU B O     1 
ATOM   5772  C  CB    . LEU B  1 303 ? 27.933  -20.423  39.537  1.00 55.85  ? 303 LEU B CB    1 
ATOM   5773  C  CG    . LEU B  1 303 ? 26.983  -21.585  39.874  1.00 55.40  ? 303 LEU B CG    1 
ATOM   5774  C  CD1   . LEU B  1 303 ? 27.556  -22.505  40.922  1.00 53.10  ? 303 LEU B CD1   1 
ATOM   5775  C  CD2   . LEU B  1 303 ? 25.607  -21.063  40.313  1.00 54.68  ? 303 LEU B CD2   1 
ATOM   5776  N  N     . HIS B  1 304 ? 27.740  -20.837  36.543  1.00 58.19  ? 304 HIS B N     1 
ATOM   5777  C  CA    . HIS B  1 304 ? 27.225  -21.498  35.346  1.00 59.50  ? 304 HIS B CA    1 
ATOM   5778  C  C     . HIS B  1 304 ? 28.251  -21.665  34.238  1.00 61.41  ? 304 HIS B C     1 
ATOM   5779  O  O     . HIS B  1 304 ? 28.382  -22.750  33.682  1.00 63.27  ? 304 HIS B O     1 
ATOM   5780  C  CB    . HIS B  1 304 ? 25.953  -20.838  34.833  1.00 58.99  ? 304 HIS B CB    1 
ATOM   5781  C  CG    . HIS B  1 304 ? 24.792  -20.992  35.766  1.00 58.14  ? 304 HIS B CG    1 
ATOM   5782  N  ND1   . HIS B  1 304 ? 23.969  -19.944  36.111  1.00 57.23  ? 304 HIS B ND1   1 
ATOM   5783  C  CD2   . HIS B  1 304 ? 24.339  -22.068  36.451  1.00 57.35  ? 304 HIS B CD2   1 
ATOM   5784  C  CE1   . HIS B  1 304 ? 23.048  -20.372  36.953  1.00 55.76  ? 304 HIS B CE1   1 
ATOM   5785  N  NE2   . HIS B  1 304 ? 23.252  -21.655  37.176  1.00 55.96  ? 304 HIS B NE2   1 
ATOM   5786  N  N     . SER B  1 305 ? 28.994  -20.605  33.939  1.00 61.58  ? 305 SER B N     1 
ATOM   5787  C  CA    . SER B  1 305 ? 29.960  -20.643  32.848  1.00 63.51  ? 305 SER B CA    1 
ATOM   5788  C  C     . SER B  1 305 ? 30.872  -21.862  32.955  1.00 64.53  ? 305 SER B C     1 
ATOM   5789  O  O     . SER B  1 305 ? 30.981  -22.638  32.006  1.00 66.38  ? 305 SER B O     1 
ATOM   5790  C  CB    . SER B  1 305 ? 30.767  -19.353  32.780  1.00 63.63  ? 305 SER B CB    1 
ATOM   5791  O  OG    . SER B  1 305 ? 31.720  -19.311  33.819  1.00 64.07  ? 305 SER B OG    1 
ATOM   5792  N  N     . ARG B  1 306 ? 31.497  -22.065  34.110  1.00 63.46  ? 306 ARG B N     1 
ATOM   5793  C  CA    . ARG B  1 306 ? 32.384  -23.212  34.229  1.00 64.55  ? 306 ARG B CA    1 
ATOM   5794  C  C     . ARG B  1 306 ? 31.633  -24.523  34.050  1.00 64.91  ? 306 ARG B C     1 
ATOM   5795  O  O     . ARG B  1 306 ? 32.195  -25.487  33.517  1.00 66.96  ? 306 ARG B O     1 
ATOM   5796  C  CB    . ARG B  1 306 ? 33.223  -23.181  35.503  1.00 63.77  ? 306 ARG B CB    1 
ATOM   5797  C  CG    . ARG B  1 306 ? 32.563  -23.606  36.776  1.00 61.73  ? 306 ARG B CG    1 
ATOM   5798  C  CD    . ARG B  1 306 ? 33.542  -23.274  37.883  1.00 63.04  ? 306 ARG B CD    1 
ATOM   5799  N  NE    . ARG B  1 306 ? 33.065  -23.568  39.228  1.00 62.50  ? 306 ARG B NE    1 
ATOM   5800  C  CZ    . ARG B  1 306 ? 32.372  -22.721  39.974  1.00 61.18  ? 306 ARG B CZ    1 
ATOM   5801  N  NH1   . ARG B  1 306 ? 32.059  -21.529  39.491  1.00 60.78  ? 306 ARG B NH1   1 
ATOM   5802  N  NH2   . ARG B  1 306 ? 31.985  -23.068  41.199  1.00 60.80  ? 306 ARG B NH2   1 
ATOM   5803  N  N     . LEU B  1 307 ? 30.359  -24.542  34.450  1.00 63.18  ? 307 LEU B N     1 
ATOM   5804  C  CA    . LEU B  1 307 ? 29.514  -25.724  34.241  1.00 63.18  ? 307 LEU B CA    1 
ATOM   5805  C  C     . LEU B  1 307 ? 29.340  -26.002  32.755  1.00 64.93  ? 307 LEU B C     1 
ATOM   5806  O  O     . LEU B  1 307 ? 29.910  -26.961  32.228  1.00 66.64  ? 307 LEU B O     1 
ATOM   5807  C  CB    . LEU B  1 307 ? 28.138  -25.582  34.913  1.00 60.97  ? 307 LEU B CB    1 
ATOM   5808  C  CG    . LEU B  1 307 ? 27.275  -26.838  34.730  1.00 61.39  ? 307 LEU B CG    1 
ATOM   5809  C  CD1   . LEU B  1 307 ? 27.829  -28.024  35.510  1.00 61.13  ? 307 LEU B CD1   1 
ATOM   5810  C  CD2   . LEU B  1 307 ? 25.844  -26.582  35.112  1.00 60.62  ? 307 LEU B CD2   1 
ATOM   5811  N  N     . LEU B  1 308 ? 28.569  -25.135  32.097  1.00 64.43  ? 308 LEU B N     1 
ATOM   5812  C  CA    . LEU B  1 308 ? 28.155  -25.315  30.706  1.00 66.30  ? 308 LEU B CA    1 
ATOM   5813  C  C     . LEU B  1 308 ? 29.308  -25.331  29.681  1.00 68.92  ? 308 LEU B C     1 
ATOM   5814  O  O     . LEU B  1 308 ? 29.116  -25.681  28.521  1.00 71.04  ? 308 LEU B O     1 
ATOM   5815  C  CB    . LEU B  1 308 ? 27.111  -24.256  30.342  1.00 65.32  ? 308 LEU B CB    1 
ATOM   5816  C  CG    . LEU B  1 308 ? 25.802  -24.304  31.126  1.00 63.12  ? 308 LEU B CG    1 
ATOM   5817  C  CD1   . LEU B  1 308 ? 24.923  -23.127  30.814  1.00 61.64  ? 308 LEU B CD1   1 
ATOM   5818  C  CD2   . LEU B  1 308 ? 25.064  -25.587  30.811  1.00 65.39  ? 308 LEU B CD2   1 
ATOM   5819  N  N     . GLU B  1 309 ? 30.505  -24.953  30.112  1.00 69.02  ? 309 GLU B N     1 
ATOM   5820  C  CA    . GLU B  1 309 ? 31.671  -24.998  29.247  1.00 71.56  ? 309 GLU B CA    1 
ATOM   5821  C  C     . GLU B  1 309 ? 32.237  -26.411  29.105  1.00 73.42  ? 309 GLU B C     1 
ATOM   5822  O  O     . GLU B  1 309 ? 33.045  -26.668  28.214  1.00 75.97  ? 309 GLU B O     1 
ATOM   5823  C  CB    . GLU B  1 309 ? 32.730  -24.018  29.741  1.00 71.17  ? 309 GLU B CB    1 
ATOM   5824  C  CG    . GLU B  1 309 ? 32.679  -22.686  29.023  1.00 72.03  ? 309 GLU B CG    1 
ATOM   5825  C  CD    . GLU B  1 309 ? 33.817  -22.524  28.034  1.00 76.33  ? 309 GLU B CD    1 
ATOM   5826  O  OE1   . GLU B  1 309 ? 34.983  -22.496  28.484  1.00 77.01  ? 309 GLU B OE1   1 
ATOM   5827  O  OE2   . GLU B  1 309 ? 33.557  -22.414  26.813  1.00 79.00  ? 309 GLU B OE2   1 
ATOM   5828  N  N     . ARG B  1 310 ? 31.787  -27.319  29.971  1.00 72.50  ? 310 ARG B N     1 
ATOM   5829  C  CA    . ARG B  1 310 ? 32.215  -28.723  29.953  1.00 74.47  ? 310 ARG B CA    1 
ATOM   5830  C  C     . ARG B  1 310 ? 31.438  -29.553  28.939  1.00 76.32  ? 310 ARG B C     1 
ATOM   5831  O  O     . ARG B  1 310 ? 31.686  -30.744  28.782  1.00 78.10  ? 310 ARG B O     1 
ATOM   5832  C  CB    . ARG B  1 310 ? 32.114  -29.344  31.351  1.00 72.70  ? 310 ARG B CB    1 
ATOM   5833  C  CG    . ARG B  1 310 ? 33.187  -28.841  32.301  1.00 72.40  ? 310 ARG B CG    1 
ATOM   5834  C  CD    . ARG B  1 310 ? 32.816  -29.009  33.761  1.00 70.88  ? 310 ARG B CD    1 
ATOM   5835  N  NE    . ARG B  1 310 ? 32.910  -30.398  34.194  1.00 73.01  ? 310 ARG B NE    1 
ATOM   5836  C  CZ    . ARG B  1 310 ? 32.764  -30.817  35.451  1.00 72.92  ? 310 ARG B CZ    1 
ATOM   5837  N  NH1   . ARG B  1 310 ? 32.515  -29.958  36.438  1.00 70.02  ? 310 ARG B NH1   1 
ATOM   5838  N  NH2   . ARG B  1 310 ? 32.876  -32.113  35.722  1.00 74.95  ? 310 ARG B NH2   1 
ATOM   5839  N  N     . ALA B  1 311 ? 30.487  -28.920  28.263  1.00 76.44  ? 311 ALA B N     1 
ATOM   5840  C  CA    . ALA B  1 311 ? 29.860  -29.516  27.097  1.00 78.90  ? 311 ALA B CA    1 
ATOM   5841  C  C     . ALA B  1 311 ? 30.697  -29.156  25.876  1.00 81.79  ? 311 ALA B C     1 
ATOM   5842  O  O     . ALA B  1 311 ? 31.056  -27.985  25.670  1.00 81.66  ? 311 ALA B O     1 
ATOM   5843  C  CB    . ALA B  1 311 ? 28.441  -29.028  26.938  1.00 77.77  ? 311 ALA B CB    1 
ATOM   5844  N  N     . ALA B  1 312 ? 31.013  -30.176  25.083  1.00 84.62  ? 312 ALA B N     1 
ATOM   5845  C  CA    . ALA B  1 312 ? 31.873  -30.032  23.923  1.00 87.89  ? 312 ALA B CA    1 
ATOM   5846  C  C     . ALA B  1 312 ? 31.710  -31.221  22.988  1.00 91.18  ? 312 ALA B C     1 
ATOM   5847  O  O     . ALA B  1 312 ? 31.247  -32.285  23.398  1.00 91.21  ? 312 ALA B O     1 
ATOM   5848  C  CB    . ALA B  1 312 ? 33.323  -29.916  24.366  1.00 88.15  ? 312 ALA B CB    1 
ATOM   5849  N  N     . LYS B  1 313 ? 32.070  -31.022  21.726  1.00 94.39  ? 313 LYS B N     1 
ATOM   5850  C  CA    . LYS B  1 313 ? 32.364  -32.126  20.827  1.00 98.32  ? 313 LYS B CA    1 
ATOM   5851  C  C     . LYS B  1 313 ? 33.879  -32.205  20.781  1.00 100.29 ? 313 LYS B C     1 
ATOM   5852  O  O     . LYS B  1 313 ? 34.544  -31.192  20.564  1.00 100.70 ? 313 LYS B O     1 
ATOM   5853  C  CB    . LYS B  1 313 ? 31.797  -31.859  19.429  1.00 101.06 ? 313 LYS B CB    1 
ATOM   5854  C  CG    . LYS B  1 313 ? 32.284  -32.811  18.329  1.00 105.08 ? 313 LYS B CG    1 
ATOM   5855  C  CD    . LYS B  1 313 ? 31.450  -34.071  18.260  1.00 105.50 ? 313 LYS B CD    1 
ATOM   5856  C  CE    . LYS B  1 313 ? 32.083  -35.080  17.329  1.00 109.98 ? 313 LYS B CE    1 
ATOM   5857  N  NZ    . LYS B  1 313 ? 31.419  -36.401  17.448  1.00 110.90 ? 313 LYS B NZ    1 
ATOM   5858  N  N     . LEU B  1 314 ? 34.430  -33.393  21.003  1.00 101.89 ? 314 LEU B N     1 
ATOM   5859  C  CA    . LEU B  1 314 ? 35.882  -33.541  21.025  1.00 103.94 ? 314 LEU B CA    1 
ATOM   5860  C  C     . LEU B  1 314 ? 36.423  -33.864  19.642  1.00 108.58 ? 314 LEU B C     1 
ATOM   5861  O  O     . LEU B  1 314 ? 35.713  -34.432  18.816  1.00 110.43 ? 314 LEU B O     1 
ATOM   5862  C  CB    . LEU B  1 314 ? 36.322  -34.580  22.065  1.00 103.24 ? 314 LEU B CB    1 
ATOM   5863  C  CG    . LEU B  1 314 ? 36.069  -34.225  23.540  1.00 98.95  ? 314 LEU B CG    1 
ATOM   5864  C  CD1   . LEU B  1 314 ? 36.264  -35.440  24.420  1.00 98.58  ? 314 LEU B CD1   1 
ATOM   5865  C  CD2   . LEU B  1 314 ? 36.953  -33.077  24.029  1.00 97.72  ? 314 LEU B CD2   1 
ATOM   5866  N  N     . SER B  1 315 ? 37.668  -33.466  19.390  1.00 110.89 ? 315 SER B N     1 
ATOM   5867  C  CA    . SER B  1 315 ? 38.341  -33.759  18.126  1.00 116.11 ? 315 SER B CA    1 
ATOM   5868  C  C     . SER B  1 315 ? 38.712  -35.238  18.062  1.00 118.88 ? 315 SER B C     1 
ATOM   5869  O  O     . SER B  1 315 ? 38.940  -35.866  19.096  1.00 117.42 ? 315 SER B O     1 
ATOM   5870  C  CB    . SER B  1 315 ? 39.591  -32.891  17.970  1.00 117.65 ? 315 SER B CB    1 
ATOM   5871  O  OG    . SER B  1 315 ? 40.508  -33.106  19.031  1.00 117.01 ? 315 SER B OG    1 
ATOM   5872  N  N     . GLU B  1 316 ? 38.774  -35.794  16.854  1.00 123.29 ? 316 GLU B N     1 
ATOM   5873  C  CA    . GLU B  1 316 ? 39.124  -37.210  16.693  1.00 126.55 ? 316 GLU B CA    1 
ATOM   5874  C  C     . GLU B  1 316 ? 40.449  -37.574  17.373  1.00 127.55 ? 316 GLU B C     1 
ATOM   5875  O  O     . GLU B  1 316 ? 40.689  -38.740  17.684  1.00 128.85 ? 316 GLU B O     1 
ATOM   5876  C  CB    . GLU B  1 316 ? 39.125  -37.630  15.214  1.00 131.35 ? 316 GLU B CB    1 
ATOM   5877  C  CG    . GLU B  1 316 ? 37.846  -38.353  14.773  1.00 132.28 ? 316 GLU B CG    1 
ATOM   5878  C  CD    . GLU B  1 316 ? 37.912  -38.899  13.352  1.00 138.56 ? 316 GLU B CD    1 
ATOM   5879  O  OE1   . GLU B  1 316 ? 38.131  -38.099  12.414  1.00 141.39 ? 316 GLU B OE1   1 
ATOM   5880  O  OE2   . GLU B  1 316 ? 37.733  -40.127  13.171  1.00 140.74 ? 316 GLU B OE2   1 
ATOM   5881  N  N     . LYS B  1 317 ? 41.288  -36.568  17.623  1.00 127.26 ? 317 LYS B N     1 
ATOM   5882  C  CA    . LYS B  1 317 ? 42.570  -36.763  18.303  1.00 128.30 ? 317 LYS B CA    1 
ATOM   5883  C  C     . LYS B  1 317 ? 42.369  -37.014  19.796  1.00 124.49 ? 317 LYS B C     1 
ATOM   5884  O  O     . LYS B  1 317 ? 43.313  -37.370  20.507  1.00 125.21 ? 317 LYS B O     1 
ATOM   5885  C  CB    . LYS B  1 317 ? 43.479  -35.544  18.103  1.00 129.18 ? 317 LYS B CB    1 
ATOM   5886  C  CG    . LYS B  1 317 ? 44.969  -35.883  18.085  1.00 133.12 ? 317 LYS B CG    1 
ATOM   5887  C  CD    . LYS B  1 317 ? 45.838  -34.753  18.639  1.00 132.46 ? 317 LYS B CD    1 
ATOM   5888  C  CE    . LYS B  1 317 ? 46.094  -34.927  20.136  1.00 129.36 ? 317 LYS B CE    1 
ATOM   5889  N  NZ    . LYS B  1 317 ? 47.366  -34.275  20.563  1.00 130.35 ? 317 LYS B NZ    1 
ATOM   5890  N  N     . GLU B  1 318 ? 41.136  -36.821  20.259  1.00 120.74 ? 318 GLU B N     1 
ATOM   5891  C  CA    . GLU B  1 318 ? 40.792  -36.964  21.668  1.00 117.03 ? 318 GLU B CA    1 
ATOM   5892  C  C     . GLU B  1 318 ? 39.673  -37.985  21.872  1.00 115.91 ? 318 GLU B C     1 
ATOM   5893  O  O     . GLU B  1 318 ? 39.192  -38.168  22.996  1.00 112.95 ? 318 GLU B O     1 
ATOM   5894  C  CB    . GLU B  1 318 ? 40.372  -35.610  22.252  1.00 113.31 ? 318 GLU B CB    1 
ATOM   5895  C  CG    . GLU B  1 318 ? 41.324  -34.452  21.962  1.00 114.98 ? 318 GLU B CG    1 
ATOM   5896  C  CD    . GLU B  1 318 ? 42.632  -34.523  22.742  1.00 117.13 ? 318 GLU B CD    1 
ATOM   5897  O  OE1   . GLU B  1 318 ? 42.671  -35.185  23.809  1.00 115.85 ? 318 GLU B OE1   1 
ATOM   5898  O  OE2   . GLU B  1 318 ? 43.623  -33.902  22.283  1.00 119.75 ? 318 GLU B OE2   1 
ATOM   5899  N  N     . GLY B  1 319 ? 39.248  -38.628  20.784  1.00 118.51 ? 319 GLY B N     1 
ATOM   5900  C  CA    . GLY B  1 319 ? 38.253  -39.701  20.849  1.00 118.29 ? 319 GLY B CA    1 
ATOM   5901  C  C     . GLY B  1 319 ? 36.839  -39.341  20.421  1.00 116.62 ? 319 GLY B C     1 
ATOM   5902  O  O     . GLY B  1 319 ? 35.923  -40.152  20.563  1.00 116.28 ? 319 GLY B O     1 
ATOM   5903  N  N     . SER B  1 320 ? 36.659  -38.122  19.912  1.00 115.74 ? 320 SER B N     1 
ATOM   5904  C  CA    . SER B  1 320 ? 35.383  -37.661  19.331  1.00 114.81 ? 320 SER B CA    1 
ATOM   5905  C  C     . SER B  1 320 ? 34.146  -37.683  20.237  1.00 111.04 ? 320 SER B C     1 
ATOM   5906  O  O     . SER B  1 320 ? 33.051  -37.327  19.794  1.00 110.49 ? 320 SER B O     1 
ATOM   5907  C  CB    . SER B  1 320 ? 35.079  -38.394  18.020  1.00 118.92 ? 320 SER B CB    1 
ATOM   5908  O  OG    . SER B  1 320 ? 35.722  -37.759  16.935  1.00 122.06 ? 320 SER B OG    1 
ATOM   5909  N  N     . GLY B  1 321 ? 34.315  -38.090  21.493  1.00 108.71 ? 321 GLY B N     1 
ATOM   5910  C  CA    . GLY B  1 321 ? 33.201  -38.124  22.444  1.00 105.29 ? 321 GLY B CA    1 
ATOM   5911  C  C     . GLY B  1 321 ? 32.560  -36.760  22.635  1.00 102.21 ? 321 GLY B C     1 
ATOM   5912  O  O     . GLY B  1 321 ? 33.234  -35.733  22.519  1.00 102.03 ? 321 GLY B O     1 
ATOM   5913  N  N     . SER B  1 322 ? 31.260  -36.739  22.925  1.00 100.06 ? 322 SER B N     1 
ATOM   5914  C  CA    . SER B  1 322 ? 30.534  -35.476  22.992  1.00 97.32  ? 322 SER B CA    1 
ATOM   5915  C  C     . SER B  1 322 ? 29.587  -35.372  24.173  1.00 93.99  ? 322 SER B C     1 
ATOM   5916  O  O     . SER B  1 322 ? 28.739  -36.244  24.383  1.00 94.15  ? 322 SER B O     1 
ATOM   5917  C  CB    . SER B  1 322 ? 29.767  -35.220  21.689  1.00 99.33  ? 322 SER B CB    1 
ATOM   5918  O  OG    . SER B  1 322 ? 28.570  -35.979  21.631  1.00 99.16  ? 322 SER B OG    1 
ATOM   5919  N  N     . LEU B  1 323 ? 29.739  -34.291  24.933  1.00 91.04  ? 323 LEU B N     1 
ATOM   5920  C  CA    . LEU B  1 323 ? 28.761  -33.916  25.943  1.00 87.76  ? 323 LEU B CA    1 
ATOM   5921  C  C     . LEU B  1 323 ? 27.870  -32.829  25.368  1.00 87.03  ? 323 LEU B C     1 
ATOM   5922  O  O     . LEU B  1 323 ? 28.346  -31.941  24.669  1.00 87.90  ? 323 LEU B O     1 
ATOM   5923  C  CB    . LEU B  1 323 ? 29.447  -33.412  27.212  1.00 85.20  ? 323 LEU B CB    1 
ATOM   5924  C  CG    . LEU B  1 323 ? 28.573  -33.417  28.467  1.00 82.15  ? 323 LEU B CG    1 
ATOM   5925  C  CD1   . LEU B  1 323 ? 28.184  -34.833  28.814  1.00 82.61  ? 323 LEU B CD1   1 
ATOM   5926  C  CD2   . LEU B  1 323 ? 29.303  -32.778  29.628  1.00 79.88  ? 323 LEU B CD2   1 
ATOM   5927  N  N     . THR B  1 324 ? 26.578  -32.908  25.661  1.00 85.81  ? 324 THR B N     1 
ATOM   5928  C  CA    . THR B  1 324 ? 25.610  -31.940  25.164  1.00 85.16  ? 324 THR B CA    1 
ATOM   5929  C  C     . THR B  1 324 ? 24.738  -31.516  26.327  1.00 81.93  ? 324 THR B C     1 
ATOM   5930  O  O     . THR B  1 324 ? 24.166  -32.361  27.021  1.00 81.52  ? 324 THR B O     1 
ATOM   5931  C  CB    . THR B  1 324 ? 24.727  -32.539  24.043  1.00 88.11  ? 324 THR B CB    1 
ATOM   5932  O  OG1   . THR B  1 324 ? 25.557  -33.055  22.996  1.00 91.39  ? 324 THR B OG1   1 
ATOM   5933  C  CG2   . THR B  1 324 ? 23.795  -31.494  23.464  1.00 88.02  ? 324 THR B CG2   1 
ATOM   5934  N  N     . ALA B  1 325 ? 24.644  -30.209  26.540  1.00 79.70  ? 325 ALA B N     1 
ATOM   5935  C  CA    . ALA B  1 325 ? 23.878  -29.680  27.652  1.00 76.55  ? 325 ALA B CA    1 
ATOM   5936  C  C     . ALA B  1 325 ? 22.586  -29.002  27.208  1.00 76.58  ? 325 ALA B C     1 
ATOM   5937  O  O     . ALA B  1 325 ? 22.567  -28.189  26.286  1.00 77.62  ? 325 ALA B O     1 
ATOM   5938  C  CB    . ALA B  1 325 ? 24.728  -28.738  28.471  1.00 74.19  ? 325 ALA B CB    1 
ATOM   5939  N  N     . LEU B  1 326 ? 21.496  -29.371  27.864  1.00 75.73  ? 326 LEU B N     1 
ATOM   5940  C  CA    . LEU B  1 326 ? 20.247  -28.653  27.726  1.00 75.43  ? 326 LEU B CA    1 
ATOM   5941  C  C     . LEU B  1 326 ? 19.872  -28.103  29.101  1.00 72.76  ? 326 LEU B C     1 
ATOM   5942  O  O     . LEU B  1 326 ? 19.092  -28.722  29.823  1.00 72.64  ? 326 LEU B O     1 
ATOM   5943  C  CB    . LEU B  1 326 ? 19.133  -29.564  27.182  1.00 77.57  ? 326 LEU B CB    1 
ATOM   5944  C  CG    . LEU B  1 326 ? 19.275  -30.373  25.882  1.00 80.23  ? 326 LEU B CG    1 
ATOM   5945  C  CD1   . LEU B  1 326 ? 17.929  -30.958  25.496  1.00 81.38  ? 326 LEU B CD1   1 
ATOM   5946  C  CD2   . LEU B  1 326 ? 19.836  -29.569  24.721  1.00 80.99  ? 326 LEU B CD2   1 
ATOM   5947  N  N     . PRO B  1 327 ? 20.450  -26.951  29.490  1.00 70.97  ? 327 PRO B N     1 
ATOM   5948  C  CA    . PRO B  1 327 ? 20.062  -26.359  30.765  1.00 68.56  ? 327 PRO B CA    1 
ATOM   5949  C  C     . PRO B  1 327 ? 18.671  -25.740  30.704  1.00 68.91  ? 327 PRO B C     1 
ATOM   5950  O  O     . PRO B  1 327 ? 18.248  -25.267  29.647  1.00 70.82  ? 327 PRO B O     1 
ATOM   5951  C  CB    . PRO B  1 327 ? 21.105  -25.263  30.964  1.00 67.09  ? 327 PRO B CB    1 
ATOM   5952  C  CG    . PRO B  1 327 ? 21.519  -24.887  29.597  1.00 68.87  ? 327 PRO B CG    1 
ATOM   5953  C  CD    . PRO B  1 327 ? 21.517  -26.177  28.832  1.00 71.23  ? 327 PRO B CD    1 
ATOM   5954  N  N     . VAL B  1 328 ? 17.968  -25.743  31.832  1.00 67.62  ? 328 VAL B N     1 
ATOM   5955  C  CA    . VAL B  1 328 ? 16.665  -25.091  31.929  1.00 67.51  ? 328 VAL B CA    1 
ATOM   5956  C  C     . VAL B  1 328 ? 16.725  -23.869  32.830  1.00 65.41  ? 328 VAL B C     1 
ATOM   5957  O  O     . VAL B  1 328 ? 17.174  -23.958  33.970  1.00 64.13  ? 328 VAL B O     1 
ATOM   5958  C  CB    . VAL B  1 328 ? 15.620  -26.026  32.506  1.00 68.01  ? 328 VAL B CB    1 
ATOM   5959  C  CG1   . VAL B  1 328 ? 14.251  -25.374  32.424  1.00 68.66  ? 328 VAL B CG1   1 
ATOM   5960  C  CG2   . VAL B  1 328 ? 15.641  -27.365  31.770  1.00 70.46  ? 328 VAL B CG2   1 
ATOM   5961  N  N     . ILE B  1 329 ? 16.279  -22.727  32.316  1.00 65.58  ? 329 ILE B N     1 
ATOM   5962  C  CA    . ILE B  1 329 ? 16.094  -21.527  33.131  1.00 63.35  ? 329 ILE B CA    1 
ATOM   5963  C  C     . ILE B  1 329 ? 14.608  -21.181  33.189  1.00 64.26  ? 329 ILE B C     1 
ATOM   5964  O  O     . ILE B  1 329 ? 13.871  -21.378  32.224  1.00 66.33  ? 329 ILE B O     1 
ATOM   5965  C  CB    . ILE B  1 329 ? 16.939  -20.347  32.595  1.00 62.88  ? 329 ILE B CB    1 
ATOM   5966  C  CG1   . ILE B  1 329 ? 18.388  -20.435  33.103  1.00 61.48  ? 329 ILE B CG1   1 
ATOM   5967  C  CG2   . ILE B  1 329 ? 16.320  -18.998  32.927  1.00 62.06  ? 329 ILE B CG2   1 
ATOM   5968  C  CD1   . ILE B  1 329 ? 18.576  -20.226  34.584  1.00 58.99  ? 329 ILE B CD1   1 
ATOM   5969  N  N     . GLU B  1 330 ? 14.171  -20.694  34.341  1.00 63.14  ? 330 GLU B N     1 
ATOM   5970  C  CA    . GLU B  1 330 ? 12.804  -20.239  34.526  1.00 64.54  ? 330 GLU B CA    1 
ATOM   5971  C  C     . GLU B  1 330 ? 12.771  -18.712  34.570  1.00 63.89  ? 330 GLU B C     1 
ATOM   5972  O  O     . GLU B  1 330 ? 13.255  -18.118  35.532  1.00 62.04  ? 330 GLU B O     1 
ATOM   5973  C  CB    . GLU B  1 330 ? 12.263  -20.808  35.839  1.00 64.05  ? 330 GLU B CB    1 
ATOM   5974  C  CG    . GLU B  1 330 ? 10.780  -20.537  36.123  1.00 66.77  ? 330 GLU B CG    1 
ATOM   5975  C  CD    . GLU B  1 330 ? 10.385  -20.900  37.559  1.00 68.10  ? 330 GLU B CD    1 
ATOM   5976  O  OE1   . GLU B  1 330 ? 9.515   -21.780  37.735  1.00 69.74  ? 330 GLU B OE1   1 
ATOM   5977  O  OE2   . GLU B  1 330 ? 10.953  -20.314  38.514  1.00 67.80  ? 330 GLU B OE2   1 
ATOM   5978  N  N     . THR B  1 331 ? 12.215  -18.075  33.539  1.00 65.67  ? 331 THR B N     1 
ATOM   5979  C  CA    . THR B  1 331 ? 11.974  -16.630  33.598  1.00 65.77  ? 331 THR B CA    1 
ATOM   5980  C  C     . THR B  1 331 ? 10.827  -16.299  34.543  1.00 65.80  ? 331 THR B C     1 
ATOM   5981  O  O     . THR B  1 331 ? 10.063  -17.178  34.938  1.00 66.48  ? 331 THR B O     1 
ATOM   5982  C  CB    . THR B  1 331 ? 11.630  -16.016  32.229  1.00 68.08  ? 331 THR B CB    1 
ATOM   5983  O  OG1   . THR B  1 331 ? 10.590  -16.777  31.597  1.00 70.50  ? 331 THR B OG1   1 
ATOM   5984  C  CG2   . THR B  1 331 ? 12.864  -15.936  31.339  1.00 68.27  ? 331 THR B CG2   1 
ATOM   5985  N  N     . GLN B  1 332 ? 10.717  -15.028  34.907  1.00 65.36  ? 332 GLN B N     1 
ATOM   5986  C  CA    . GLN B  1 332 ? 9.564   -14.559  35.653  1.00 66.36  ? 332 GLN B CA    1 
ATOM   5987  C  C     . GLN B  1 332 ? 8.745   -13.644  34.763  1.00 68.59  ? 332 GLN B C     1 
ATOM   5988  O  O     . GLN B  1 332 ? 9.226   -12.615  34.290  1.00 68.12  ? 332 GLN B O     1 
ATOM   5989  C  CB    . GLN B  1 332 ? 9.984   -13.829  36.929  1.00 64.58  ? 332 GLN B CB    1 
ATOM   5990  C  CG    . GLN B  1 332 ? 10.755  -14.683  37.927  1.00 63.85  ? 332 GLN B CG    1 
ATOM   5991  C  CD    . GLN B  1 332 ? 9.879   -15.682  38.651  1.00 65.83  ? 332 GLN B CD    1 
ATOM   5992  O  OE1   . GLN B  1 332 ? 8.676   -15.455  38.834  1.00 67.64  ? 332 GLN B OE1   1 
ATOM   5993  N  NE2   . GLN B  1 332 ? 10.477  -16.803  39.068  1.00 65.51  ? 332 GLN B NE2   1 
ATOM   5994  N  N     . GLY B  1 333 ? 7.507   -14.042  34.510  1.00 71.43  ? 333 GLY B N     1 
ATOM   5995  C  CA    . GLY B  1 333 ? 6.610   -13.245  33.687  1.00 74.72  ? 333 GLY B CA    1 
ATOM   5996  C  C     . GLY B  1 333 ? 7.218   -12.832  32.361  1.00 76.13  ? 333 GLY B C     1 
ATOM   5997  O  O     . GLY B  1 333 ? 7.143   -11.656  31.975  1.00 77.23  ? 333 GLY B O     1 
ATOM   5998  N  N     . GLY B  1 334 ? 7.835   -13.799  31.683  1.00 76.47  ? 334 GLY B N     1 
ATOM   5999  C  CA    . GLY B  1 334 ? 8.367   -13.619  30.334  1.00 78.29  ? 334 GLY B CA    1 
ATOM   6000  C  C     . GLY B  1 334 ? 9.573   -12.712  30.151  1.00 77.29  ? 334 GLY B C     1 
ATOM   6001  O  O     . GLY B  1 334 ? 9.955   -12.430  29.013  1.00 78.91  ? 334 GLY B O     1 
ATOM   6002  N  N     . ASP B  1 335 ? 10.185  -12.262  31.250  1.00 75.04  ? 335 ASP B N     1 
ATOM   6003  C  CA    . ASP B  1 335 ? 11.284  -11.291  31.182  1.00 74.13  ? 335 ASP B CA    1 
ATOM   6004  C  C     . ASP B  1 335 ? 12.628  -11.973  31.021  1.00 72.68  ? 335 ASP B C     1 
ATOM   6005  O  O     . ASP B  1 335 ? 13.111  -12.593  31.957  1.00 71.06  ? 335 ASP B O     1 
ATOM   6006  C  CB    . ASP B  1 335 ? 11.293  -10.399  32.426  1.00 72.55  ? 335 ASP B CB    1 
ATOM   6007  C  CG    . ASP B  1 335 ? 12.495  -9.451   32.469  1.00 72.98  ? 335 ASP B CG    1 
ATOM   6008  O  OD1   . ASP B  1 335 ? 12.852  -8.879   31.412  1.00 75.87  ? 335 ASP B OD1   1 
ATOM   6009  O  OD2   . ASP B  1 335 ? 13.070  -9.262   33.571  1.00 72.50  ? 335 ASP B OD2   1 
ATOM   6010  N  N     . VAL B  1 336 ? 13.229  -11.855  29.836  1.00 74.00  ? 336 VAL B N     1 
ATOM   6011  C  CA    . VAL B  1 336 ? 14.515  -12.526  29.556  1.00 73.00  ? 336 VAL B CA    1 
ATOM   6012  C  C     . VAL B  1 336 ? 15.723  -11.658  29.891  1.00 71.17  ? 336 VAL B C     1 
ATOM   6013  O  O     . VAL B  1 336 ? 16.854  -12.130  29.826  1.00 70.60  ? 336 VAL B O     1 
ATOM   6014  C  CB    . VAL B  1 336 ? 14.644  -13.047  28.086  1.00 75.60  ? 336 VAL B CB    1 
ATOM   6015  C  CG1   . VAL B  1 336 ? 13.626  -14.125  27.805  1.00 76.86  ? 336 VAL B CG1   1 
ATOM   6016  C  CG2   . VAL B  1 336 ? 14.532  -11.911  27.075  1.00 77.74  ? 336 VAL B CG2   1 
ATOM   6017  N  N     . SER B  1 337 ? 15.474  -10.402  30.254  1.00 70.37  ? 337 SER B N     1 
ATOM   6018  C  CA    . SER B  1 337 ? 16.537  -9.448   30.589  1.00 68.92  ? 337 SER B CA    1 
ATOM   6019  C  C     . SER B  1 337 ? 16.946  -9.531   32.050  1.00 65.87  ? 337 SER B C     1 
ATOM   6020  O  O     . SER B  1 337 ? 17.754  -8.726   32.521  1.00 65.08  ? 337 SER B O     1 
ATOM   6021  C  CB    . SER B  1 337 ? 16.076  -8.026   30.304  1.00 69.87  ? 337 SER B CB    1 
ATOM   6022  O  OG    . SER B  1 337 ? 15.238  -8.022   29.172  1.00 74.24  ? 337 SER B OG    1 
ATOM   6023  N  N     . ALA B  1 338 ? 16.362  -10.472  32.782  1.00 64.07  ? 338 ALA B N     1 
ATOM   6024  C  CA    . ALA B  1 338 ? 16.741  -10.670  34.156  1.00 61.25  ? 338 ALA B CA    1 
ATOM   6025  C  C     . ALA B  1 338 ? 18.199  -11.137  34.180  1.00 60.25  ? 338 ALA B C     1 
ATOM   6026  O  O     . ALA B  1 338 ? 18.726  -11.595  33.162  1.00 61.27  ? 338 ALA B O     1 
ATOM   6027  C  CB    . ALA B  1 338 ? 15.821  -11.672  34.801  1.00 61.09  ? 338 ALA B CB    1 
ATOM   6028  N  N     . TYR B  1 339 ? 18.849  -10.996  35.331  1.00 58.19  ? 339 TYR B N     1 
ATOM   6029  C  CA    . TYR B  1 339 ? 20.267  -11.299  35.489  1.00 57.19  ? 339 TYR B CA    1 
ATOM   6030  C  C     . TYR B  1 339 ? 20.627  -12.734  35.096  1.00 57.41  ? 339 TYR B C     1 
ATOM   6031  O  O     . TYR B  1 339 ? 21.494  -12.966  34.251  1.00 58.36  ? 339 TYR B O     1 
ATOM   6032  C  CB    . TYR B  1 339 ? 20.666  -11.040  36.939  1.00 55.70  ? 339 TYR B CB    1 
ATOM   6033  C  CG    . TYR B  1 339 ? 22.151  -11.030  37.221  1.00 56.19  ? 339 TYR B CG    1 
ATOM   6034  C  CD1   . TYR B  1 339 ? 23.067  -10.627  36.254  1.00 58.76  ? 339 TYR B CD1   1 
ATOM   6035  C  CD2   . TYR B  1 339 ? 22.635  -11.375  38.476  1.00 56.08  ? 339 TYR B CD2   1 
ATOM   6036  C  CE1   . TYR B  1 339 ? 24.425  -10.594  36.519  1.00 59.33  ? 339 TYR B CE1   1 
ATOM   6037  C  CE2   . TYR B  1 339 ? 23.987  -11.336  38.755  1.00 57.22  ? 339 TYR B CE2   1 
ATOM   6038  C  CZ    . TYR B  1 339 ? 24.874  -10.950  37.771  1.00 58.90  ? 339 TYR B CZ    1 
ATOM   6039  O  OH    . TYR B  1 339 ? 26.218  -10.923  38.034  1.00 61.41  ? 339 TYR B OH    1 
ATOM   6040  N  N     . ILE B  1 340 ? 19.955  -13.699  35.709  1.00 56.41  ? 340 ILE B N     1 
ATOM   6041  C  CA    . ILE B  1 340 ? 20.306  -15.091  35.493  1.00 56.17  ? 340 ILE B CA    1 
ATOM   6042  C  C     . ILE B  1 340 ? 19.929  -15.573  34.072  1.00 57.79  ? 340 ILE B C     1 
ATOM   6043  O  O     . ILE B  1 340 ? 20.711  -16.324  33.457  1.00 58.74  ? 340 ILE B O     1 
ATOM   6044  C  CB    . ILE B  1 340 ? 19.768  -16.001  36.642  1.00 55.25  ? 340 ILE B CB    1 
ATOM   6045  C  CG1   . ILE B  1 340 ? 20.163  -15.423  38.009  1.00 53.53  ? 340 ILE B CG1   1 
ATOM   6046  C  CG2   . ILE B  1 340 ? 20.245  -17.461  36.510  1.00 55.58  ? 340 ILE B CG2   1 
ATOM   6047  C  CD1   . ILE B  1 340 ? 21.630  -14.984  38.164  1.00 51.92  ? 340 ILE B CD1   1 
ATOM   6048  N  N     . PRO B  1 341 ? 18.754  -15.142  33.538  1.00 58.08  ? 341 PRO B N     1 
ATOM   6049  C  CA    . PRO B  1 341 ? 18.470  -15.470  32.140  1.00 59.97  ? 341 PRO B CA    1 
ATOM   6050  C  C     . PRO B  1 341 ? 19.552  -14.991  31.156  1.00 61.17  ? 341 PRO B C     1 
ATOM   6051  O  O     . PRO B  1 341 ? 20.034  -15.811  30.358  1.00 62.35  ? 341 PRO B O     1 
ATOM   6052  C  CB    . PRO B  1 341 ? 17.128  -14.792  31.892  1.00 60.51  ? 341 PRO B CB    1 
ATOM   6053  C  CG    . PRO B  1 341 ? 16.465  -14.875  33.192  1.00 58.74  ? 341 PRO B CG    1 
ATOM   6054  C  CD    . PRO B  1 341 ? 17.545  -14.632  34.207  1.00 57.30  ? 341 PRO B CD    1 
ATOM   6055  N  N     . THR B  1 342 ? 19.956  -13.714  31.238  1.00 60.51  ? 342 THR B N     1 
ATOM   6056  C  CA    . THR B  1 342 ? 20.971  -13.175  30.327  1.00 61.71  ? 342 THR B CA    1 
ATOM   6057  C  C     . THR B  1 342 ? 22.356  -13.774  30.531  1.00 61.22  ? 342 THR B C     1 
ATOM   6058  O  O     . THR B  1 342 ? 23.159  -13.773  29.601  1.00 62.65  ? 342 THR B O     1 
ATOM   6059  C  CB    . THR B  1 342 ? 21.112  -11.620  30.353  1.00 61.96  ? 342 THR B CB    1 
ATOM   6060  O  OG1   . THR B  1 342 ? 21.665  -11.169  31.606  1.00 60.81  ? 342 THR B OG1   1 
ATOM   6061  C  CG2   . THR B  1 342 ? 19.792  -10.934  30.070  1.00 63.12  ? 342 THR B CG2   1 
ATOM   6062  N  N     . ASN B  1 343 ? 22.658  -14.265  31.731  1.00 59.39  ? 343 ASN B N     1 
ATOM   6063  C  CA    . ASN B  1 343 ? 23.982  -14.848  31.948  1.00 59.60  ? 343 ASN B CA    1 
ATOM   6064  C  C     . ASN B  1 343 ? 24.105  -16.134  31.152  1.00 61.37  ? 343 ASN B C     1 
ATOM   6065  O  O     . ASN B  1 343 ? 25.001  -16.276  30.310  1.00 63.16  ? 343 ASN B O     1 
ATOM   6066  C  CB    . ASN B  1 343 ? 24.285  -15.086  33.429  1.00 57.61  ? 343 ASN B CB    1 
ATOM   6067  C  CG    . ASN B  1 343 ? 24.753  -13.825  34.151  1.00 57.14  ? 343 ASN B CG    1 
ATOM   6068  O  OD1   . ASN B  1 343 ? 25.100  -12.817  33.531  1.00 60.17  ? 343 ASN B OD1   1 
ATOM   6069  N  ND2   . ASN B  1 343 ? 24.771  -13.883  35.474  1.00 55.55  ? 343 ASN B ND2   1 
ATOM   6070  N  N     . VAL B  1 344 ? 23.170  -17.048  31.390  1.00 61.12  ? 344 VAL B N     1 
ATOM   6071  C  CA    . VAL B  1 344 ? 23.175  -18.343  30.737  1.00 62.35  ? 344 VAL B CA    1 
ATOM   6072  C  C     . VAL B  1 344 ? 22.946  -18.201  29.227  1.00 64.83  ? 344 VAL B C     1 
ATOM   6073  O  O     . VAL B  1 344 ? 23.543  -18.945  28.445  1.00 66.66  ? 344 VAL B O     1 
ATOM   6074  C  CB    . VAL B  1 344 ? 22.157  -19.291  31.394  1.00 61.82  ? 344 VAL B CB    1 
ATOM   6075  C  CG1   . VAL B  1 344 ? 22.220  -20.685  30.778  1.00 62.84  ? 344 VAL B CG1   1 
ATOM   6076  C  CG2   . VAL B  1 344 ? 22.407  -19.354  32.898  1.00 59.77  ? 344 VAL B CG2   1 
ATOM   6077  N  N     . ILE B  1 345 ? 22.114  -17.244  28.813  1.00 65.08  ? 345 ILE B N     1 
ATOM   6078  C  CA    . ILE B  1 345 ? 21.968  -16.953  27.376  1.00 67.80  ? 345 ILE B CA    1 
ATOM   6079  C  C     . ILE B  1 345 ? 23.317  -16.544  26.756  1.00 69.33  ? 345 ILE B C     1 
ATOM   6080  O  O     . ILE B  1 345 ? 23.566  -16.784  25.577  1.00 72.06  ? 345 ILE B O     1 
ATOM   6081  C  CB    . ILE B  1 345 ? 20.840  -15.919  27.063  1.00 68.14  ? 345 ILE B CB    1 
ATOM   6082  C  CG1   . ILE B  1 345 ? 19.467  -16.569  27.260  1.00 67.91  ? 345 ILE B CG1   1 
ATOM   6083  C  CG2   . ILE B  1 345 ? 20.954  -15.389  25.627  1.00 70.23  ? 345 ILE B CG2   1 
ATOM   6084  C  CD1   . ILE B  1 345 ? 18.277  -15.615  27.252  1.00 67.98  ? 345 ILE B CD1   1 
ATOM   6085  N  N     . SER B  1 346 ? 24.190  -15.949  27.562  1.00 67.99  ? 346 SER B N     1 
ATOM   6086  C  CA    . SER B  1 346 ? 25.523  -15.583  27.104  1.00 69.35  ? 346 SER B CA    1 
ATOM   6087  C  C     . SER B  1 346 ? 26.597  -16.610  27.501  1.00 69.13  ? 346 SER B C     1 
ATOM   6088  O  O     . SER B  1 346 ? 27.784  -16.287  27.584  1.00 69.51  ? 346 SER B O     1 
ATOM   6089  C  CB    . SER B  1 346 ? 25.883  -14.193  27.608  1.00 68.37  ? 346 SER B CB    1 
ATOM   6090  O  OG    . SER B  1 346 ? 25.763  -14.136  29.017  1.00 66.84  ? 346 SER B OG    1 
ATOM   6091  N  N     . ILE B  1 347 ? 26.160  -17.844  27.743  1.00 68.82  ? 347 ILE B N     1 
ATOM   6092  C  CA    . ILE B  1 347 ? 27.052  -18.998  27.901  1.00 69.14  ? 347 ILE B CA    1 
ATOM   6093  C  C     . ILE B  1 347 ? 26.686  -20.004  26.821  1.00 71.46  ? 347 ILE B C     1 
ATOM   6094  O  O     . ILE B  1 347 ? 27.559  -20.477  26.084  1.00 73.52  ? 347 ILE B O     1 
ATOM   6095  C  CB    . ILE B  1 347 ? 26.921  -19.661  29.303  1.00 66.89  ? 347 ILE B CB    1 
ATOM   6096  C  CG1   . ILE B  1 347 ? 27.482  -18.742  30.384  1.00 65.41  ? 347 ILE B CG1   1 
ATOM   6097  C  CG2   . ILE B  1 347 ? 27.658  -20.976  29.364  1.00 67.09  ? 347 ILE B CG2   1 
ATOM   6098  C  CD1   . ILE B  1 347 ? 26.969  -19.033  31.773  1.00 62.61  ? 347 ILE B CD1   1 
ATOM   6099  N  N     . THR B  1 348 ? 25.386  -20.302  26.722  1.00 71.35  ? 348 THR B N     1 
ATOM   6100  C  CA    . THR B  1 348 ? 24.856  -21.326  25.808  1.00 73.54  ? 348 THR B CA    1 
ATOM   6101  C  C     . THR B  1 348 ? 25.014  -20.982  24.326  1.00 76.49  ? 348 THR B C     1 
ATOM   6102  O  O     . THR B  1 348 ? 25.351  -19.858  23.963  1.00 76.98  ? 348 THR B O     1 
ATOM   6103  C  CB    . THR B  1 348 ? 23.356  -21.623  26.074  1.00 72.82  ? 348 THR B CB    1 
ATOM   6104  O  OG1   . THR B  1 348 ? 22.578  -20.443  25.834  1.00 73.27  ? 348 THR B OG1   1 
ATOM   6105  C  CG2   . THR B  1 348 ? 23.137  -22.101  27.493  1.00 70.16  ? 348 THR B CG2   1 
ATOM   6106  N  N     . ASP B  1 349 ? 24.746  -21.969  23.481  1.00 78.92  ? 349 ASP B N     1 
ATOM   6107  C  CA    . ASP B  1 349 ? 24.806  -21.817  22.038  1.00 82.37  ? 349 ASP B CA    1 
ATOM   6108  C  C     . ASP B  1 349 ? 23.409  -21.683  21.441  1.00 83.53  ? 349 ASP B C     1 
ATOM   6109  O  O     . ASP B  1 349 ? 23.142  -22.213  20.370  1.00 86.89  ? 349 ASP B O     1 
ATOM   6110  C  CB    . ASP B  1 349 ? 25.516  -23.026  21.424  1.00 84.77  ? 349 ASP B CB    1 
ATOM   6111  C  CG    . ASP B  1 349 ? 26.883  -23.277  22.039  1.00 84.65  ? 349 ASP B CG    1 
ATOM   6112  O  OD1   . ASP B  1 349 ? 27.698  -22.320  22.094  1.00 84.22  ? 349 ASP B OD1   1 
ATOM   6113  O  OD2   . ASP B  1 349 ? 27.138  -24.436  22.458  1.00 84.86  ? 349 ASP B OD2   1 
ATOM   6114  N  N     . GLY B  1 350 ? 22.522  -20.977  22.134  1.00 81.53  ? 350 GLY B N     1 
ATOM   6115  C  CA    . GLY B  1 350 ? 21.156  -20.771  21.655  1.00 82.72  ? 350 GLY B CA    1 
ATOM   6116  C  C     . GLY B  1 350 ? 20.078  -21.014  22.697  1.00 80.63  ? 350 GLY B C     1 
ATOM   6117  O  O     . GLY B  1 350 ? 20.344  -21.560  23.769  1.00 78.61  ? 350 GLY B O     1 
ATOM   6118  N  N     . GLN B  1 351 ? 18.853  -20.600  22.385  1.00 81.46  ? 351 GLN B N     1 
ATOM   6119  C  CA    . GLN B  1 351 ? 17.731  -20.789  23.299  1.00 79.83  ? 351 GLN B CA    1 
ATOM   6120  C  C     . GLN B  1 351 ? 16.480  -21.282  22.583  1.00 82.63  ? 351 GLN B C     1 
ATOM   6121  O  O     . GLN B  1 351 ? 16.118  -20.786  21.515  1.00 85.21  ? 351 GLN B O     1 
ATOM   6122  C  CB    . GLN B  1 351 ? 17.389  -19.502  24.053  1.00 77.60  ? 351 GLN B CB    1 
ATOM   6123  C  CG    . GLN B  1 351 ? 18.558  -18.604  24.368  1.00 76.08  ? 351 GLN B CG    1 
ATOM   6124  C  CD    . GLN B  1 351 ? 18.967  -17.772  23.184  1.00 77.89  ? 351 GLN B CD    1 
ATOM   6125  O  OE1   . GLN B  1 351 ? 18.118  -17.264  22.460  1.00 79.95  ? 351 GLN B OE1   1 
ATOM   6126  N  NE2   . GLN B  1 351 ? 20.275  -17.640  22.965  1.00 77.96  ? 351 GLN B NE2   1 
ATOM   6127  N  N     . ILE B  1 352 ? 15.840  -22.281  23.178  1.00 82.23  ? 352 ILE B N     1 
ATOM   6128  C  CA    . ILE B  1 352 ? 14.480  -22.635  22.826  1.00 84.38  ? 352 ILE B CA    1 
ATOM   6129  C  C     . ILE B  1 352 ? 13.616  -21.934  23.873  1.00 82.48  ? 352 ILE B C     1 
ATOM   6130  O  O     . ILE B  1 352 ? 13.544  -22.362  25.028  1.00 80.25  ? 352 ILE B O     1 
ATOM   6131  C  CB    . ILE B  1 352 ? 14.268  -24.171  22.821  1.00 85.52  ? 352 ILE B CB    1 
ATOM   6132  C  CG1   . ILE B  1 352 ? 15.184  -24.831  21.784  1.00 87.50  ? 352 ILE B CG1   1 
ATOM   6133  C  CG2   . ILE B  1 352 ? 12.814  -24.517  22.534  1.00 87.68  ? 352 ILE B CG2   1 
ATOM   6134  C  CD1   . ILE B  1 352 ? 15.368  -26.320  21.978  1.00 87.92  ? 352 ILE B CD1   1 
ATOM   6135  N  N     . PHE B  1 353 ? 13.007  -20.822  23.475  1.00 83.62  ? 353 PHE B N     1 
ATOM   6136  C  CA    . PHE B  1 353 ? 12.192  -20.027  24.386  1.00 82.22  ? 353 PHE B CA    1 
ATOM   6137  C  C     . PHE B  1 353 ? 10.732  -20.434  24.278  1.00 84.37  ? 353 PHE B C     1 
ATOM   6138  O  O     . PHE B  1 353 ? 10.141  -20.366  23.201  1.00 87.48  ? 353 PHE B O     1 
ATOM   6139  C  CB    . PHE B  1 353 ? 12.365  -18.529  24.112  1.00 82.24  ? 353 PHE B CB    1 
ATOM   6140  C  CG    . PHE B  1 353 ? 11.559  -17.649  25.026  1.00 81.23  ? 353 PHE B CG    1 
ATOM   6141  C  CD1   . PHE B  1 353 ? 11.987  -17.393  26.326  1.00 78.74  ? 353 PHE B CD1   1 
ATOM   6142  C  CD2   . PHE B  1 353 ? 10.369  -17.081  24.591  1.00 83.55  ? 353 PHE B CD2   1 
ATOM   6143  C  CE1   . PHE B  1 353 ? 11.230  -16.578  27.181  1.00 77.79  ? 353 PHE B CE1   1 
ATOM   6144  C  CE2   . PHE B  1 353 ? 9.610   -16.269  25.432  1.00 82.83  ? 353 PHE B CE2   1 
ATOM   6145  C  CZ    . PHE B  1 353 ? 10.042  -16.013  26.728  1.00 79.73  ? 353 PHE B CZ    1 
ATOM   6146  N  N     . LEU B  1 354 ? 10.159  -20.864  25.399  1.00 82.95  ? 354 LEU B N     1 
ATOM   6147  C  CA    . LEU B  1 354 ? 8.776   -21.359  25.424  1.00 85.15  ? 354 LEU B CA    1 
ATOM   6148  C  C     . LEU B  1 354 ? 7.875   -20.327  26.086  1.00 84.80  ? 354 LEU B C     1 
ATOM   6149  O  O     . LEU B  1 354 ? 8.237   -19.761  27.119  1.00 82.04  ? 354 LEU B O     1 
ATOM   6150  C  CB    . LEU B  1 354 ? 8.688   -22.715  26.139  1.00 84.29  ? 354 LEU B CB    1 
ATOM   6151  C  CG    . LEU B  1 354 ? 9.744   -23.756  25.762  1.00 83.03  ? 354 LEU B CG    1 
ATOM   6152  C  CD1   . LEU B  1 354 ? 9.556   -24.995  26.571  1.00 81.74  ? 354 LEU B CD1   1 
ATOM   6153  C  CD2   . LEU B  1 354 ? 9.674   -24.083  24.301  1.00 86.13  ? 354 LEU B CD2   1 
ATOM   6154  N  N     . GLU B  1 355 ? 6.708   -20.083  25.497  1.00 88.00  ? 355 GLU B N     1 
ATOM   6155  C  CA    . GLU B  1 355 ? 5.943   -18.886  25.844  1.00 88.43  ? 355 GLU B CA    1 
ATOM   6156  C  C     . GLU B  1 355 ? 4.581   -19.125  26.496  1.00 89.68  ? 355 GLU B C     1 
ATOM   6157  O  O     . GLU B  1 355 ? 3.726   -19.816  25.944  1.00 92.84  ? 355 GLU B O     1 
ATOM   6158  C  CB    . GLU B  1 355 ? 5.793   -17.989  24.619  1.00 91.09  ? 355 GLU B CB    1 
ATOM   6159  C  CG    . GLU B  1 355 ? 5.653   -16.525  24.966  1.00 91.13  ? 355 GLU B CG    1 
ATOM   6160  C  CD    . GLU B  1 355 ? 5.010   -15.731  23.858  1.00 96.19  ? 355 GLU B CD    1 
ATOM   6161  O  OE1   . GLU B  1 355 ? 4.796   -16.296  22.761  1.00 99.69  ? 355 GLU B OE1   1 
ATOM   6162  O  OE2   . GLU B  1 355 ? 4.713   -14.539  24.086  1.00 96.76  ? 355 GLU B OE2   1 
ATOM   6163  N  N     . ALA B  1 356 ? 4.387   -18.512  27.663  1.00 87.70  ? 356 ALA B N     1 
ATOM   6164  C  CA    . ALA B  1 356 ? 3.151   -18.639  28.438  1.00 88.99  ? 356 ALA B CA    1 
ATOM   6165  C  C     . ALA B  1 356 ? 1.897   -18.327  27.623  1.00 93.45  ? 356 ALA B C     1 
ATOM   6166  O  O     . ALA B  1 356 ? 0.880   -19.009  27.766  1.00 95.89  ? 356 ALA B O     1 
ATOM   6167  C  CB    . ALA B  1 356 ? 3.211   -17.760  29.672  1.00 86.22  ? 356 ALA B CB    1 
ATOM   6168  N  N     . GLU B  1 357 ? 1.986   -17.307  26.769  1.00 95.00  ? 357 GLU B N     1 
ATOM   6169  C  CA    . GLU B  1 357 ? 0.879   -16.880  25.901  1.00 99.39  ? 357 GLU B CA    1 
ATOM   6170  C  C     . GLU B  1 357 ? 0.484   -17.938  24.856  1.00 102.89 ? 357 GLU B C     1 
ATOM   6171  O  O     . GLU B  1 357 ? -0.701  -18.089  24.545  1.00 106.45 ? 357 GLU B O     1 
ATOM   6172  C  CB    . GLU B  1 357 ? 1.229   -15.538  25.227  1.00 100.08 ? 357 GLU B CB    1 
ATOM   6173  C  CG    . GLU B  1 357 ? 0.117   -14.876  24.388  1.00 104.93 ? 357 GLU B CG    1 
ATOM   6174  C  CD    . GLU B  1 357 ? -1.089  -14.425  25.212  1.00 106.99 ? 357 GLU B CD    1 
ATOM   6175  O  OE1   . GLU B  1 357 ? -0.903  -13.912  26.341  1.00 103.43 ? 357 GLU B OE1   1 
ATOM   6176  O  OE2   . GLU B  1 357 ? -2.230  -14.577  24.714  1.00 112.05 ? 357 GLU B OE2   1 
ATOM   6177  N  N     . LEU B  1 358 ? 1.471   -18.658  24.319  1.00 102.07 ? 358 LEU B N     1 
ATOM   6178  C  CA    . LEU B  1 358 ? 1.213   -19.738  23.357  1.00 105.41 ? 358 LEU B CA    1 
ATOM   6179  C  C     . LEU B  1 358 ? 0.668   -20.979  24.058  1.00 105.81 ? 358 LEU B C     1 
ATOM   6180  O  O     . LEU B  1 358 ? -0.348  -21.549  23.648  1.00 109.42 ? 358 LEU B O     1 
ATOM   6181  C  CB    . LEU B  1 358 ? 2.484   -20.111  22.585  1.00 104.48 ? 358 LEU B CB    1 
ATOM   6182  C  CG    . LEU B  1 358 ? 3.190   -19.109  21.671  1.00 104.32 ? 358 LEU B CG    1 
ATOM   6183  C  CD1   . LEU B  1 358 ? 4.428   -19.755  21.084  1.00 103.24 ? 358 LEU B CD1   1 
ATOM   6184  C  CD2   . LEU B  1 358 ? 2.283   -18.614  20.565  1.00 108.72 ? 358 LEU B CD2   1 
ATOM   6185  N  N     . PHE B  1 359 ? 1.366   -21.384  25.117  1.00 102.27 ? 359 PHE B N     1 
ATOM   6186  C  CA    . PHE B  1 359 ? 0.978   -22.513  25.951  1.00 102.34 ? 359 PHE B CA    1 
ATOM   6187  C  C     . PHE B  1 359 ? -0.456  -22.400  26.471  1.00 104.72 ? 359 PHE B C     1 
ATOM   6188  O  O     . PHE B  1 359 ? -1.172  -23.401  26.521  1.00 107.07 ? 359 PHE B O     1 
ATOM   6189  C  CB    . PHE B  1 359 ? 1.949   -22.650  27.122  1.00 97.85  ? 359 PHE B CB    1 
ATOM   6190  C  CG    . PHE B  1 359 ? 1.837   -23.953  27.856  1.00 97.84  ? 359 PHE B CG    1 
ATOM   6191  C  CD1   . PHE B  1 359 ? 2.585   -25.060  27.451  1.00 97.78  ? 359 PHE B CD1   1 
ATOM   6192  C  CD2   . PHE B  1 359 ? 0.996   -24.074  28.963  1.00 97.75  ? 359 PHE B CD2   1 
ATOM   6193  C  CE1   . PHE B  1 359 ? 2.491   -26.267  28.131  1.00 97.31  ? 359 PHE B CE1   1 
ATOM   6194  C  CE2   . PHE B  1 359 ? 0.896   -25.278  29.648  1.00 97.52  ? 359 PHE B CE2   1 
ATOM   6195  C  CZ    . PHE B  1 359 ? 1.643   -26.375  29.229  1.00 97.36  ? 359 PHE B CZ    1 
ATOM   6196  N  N     . TYR B  1 360 ? -0.871  -21.191  26.860  1.00 104.37 ? 360 TYR B N     1 
ATOM   6197  C  CA    . TYR B  1 360 ? -2.254  -20.957  27.287  1.00 107.09 ? 360 TYR B CA    1 
ATOM   6198  C  C     . TYR B  1 360 ? -3.241  -21.378  26.199  1.00 111.95 ? 360 TYR B C     1 
ATOM   6199  O  O     . TYR B  1 360 ? -4.274  -21.971  26.502  1.00 114.62 ? 360 TYR B O     1 
ATOM   6200  C  CB    . TYR B  1 360 ? -2.497  -19.490  27.728  1.00 106.43 ? 360 TYR B CB    1 
ATOM   6201  C  CG    . TYR B  1 360 ? -3.960  -19.033  27.638  1.00 111.97 ? 360 TYR B CG    1 
ATOM   6202  C  CD1   . TYR B  1 360 ? -4.947  -19.577  28.477  1.00 114.46 ? 360 TYR B CD1   1 
ATOM   6203  C  CD2   . TYR B  1 360 ? -4.355  -18.063  26.705  1.00 116.01 ? 360 TYR B CD2   1 
ATOM   6204  C  CE1   . TYR B  1 360 ? -6.287  -19.176  28.383  1.00 119.03 ? 360 TYR B CE1   1 
ATOM   6205  C  CE2   . TYR B  1 360 ? -5.694  -17.652  26.605  1.00 120.76 ? 360 TYR B CE2   1 
ATOM   6206  C  CZ    . TYR B  1 360 ? -6.654  -18.214  27.446  1.00 122.34 ? 360 TYR B CZ    1 
ATOM   6207  O  OH    . TYR B  1 360 ? -7.975  -17.815  27.349  1.00 126.29 ? 360 TYR B OH    1 
ATOM   6208  N  N     . LYS B  1 361 ? -2.902  -21.094  24.941  1.00 113.32 ? 361 LYS B N     1 
ATOM   6209  C  CA    . LYS B  1 361 ? -3.823  -21.287  23.817  1.00 118.27 ? 361 LYS B CA    1 
ATOM   6210  C  C     . LYS B  1 361 ? -3.901  -22.721  23.282  1.00 120.50 ? 361 LYS B C     1 
ATOM   6211  O  O     . LYS B  1 361 ? -4.963  -23.160  22.822  1.00 124.99 ? 361 LYS B O     1 
ATOM   6212  C  CB    . LYS B  1 361 ? -3.500  -20.304  22.694  1.00 119.53 ? 361 LYS B CB    1 
ATOM   6213  C  CG    . LYS B  1 361 ? -3.977  -18.907  23.001  1.00 119.91 ? 361 LYS B CG    1 
ATOM   6214  C  CD    . LYS B  1 361 ? -3.459  -17.889  22.012  1.00 121.93 ? 361 LYS B CD    1 
ATOM   6215  C  CE    . LYS B  1 361 ? -3.641  -16.489  22.576  1.00 121.43 ? 361 LYS B CE    1 
ATOM   6216  N  NZ    . LYS B  1 361 ? -3.543  -15.435  21.528  1.00 124.63 ? 361 LYS B NZ    1 
ATOM   6217  N  N     . GLY B  1 362 ? -2.785  -23.442  23.341  1.00 117.50 ? 362 GLY B N     1 
ATOM   6218  C  CA    . GLY B  1 362 ? -2.740  -24.833  22.894  1.00 119.12 ? 362 GLY B CA    1 
ATOM   6219  C  C     . GLY B  1 362 ? -1.519  -25.173  22.061  1.00 118.00 ? 362 GLY B C     1 
ATOM   6220  O  O     . GLY B  1 362 ? -1.135  -26.340  21.963  1.00 118.34 ? 362 GLY B O     1 
ATOM   6221  N  N     . ILE B  1 363 ? -0.918  -24.153  21.452  1.00 116.94 ? 363 ILE B N     1 
ATOM   6222  C  CA    . ILE B  1 363 ? 0.294   -24.304  20.644  1.00 115.83 ? 363 ILE B CA    1 
ATOM   6223  C  C     . ILE B  1 363 ? 1.433   -24.840  21.513  1.00 111.06 ? 363 ILE B C     1 
ATOM   6224  O  O     . ILE B  1 363 ? 2.212   -24.070  22.070  1.00 107.33 ? 363 ILE B O     1 
ATOM   6225  C  CB    . ILE B  1 363 ? 0.690   -22.958  19.990  1.00 115.69 ? 363 ILE B CB    1 
ATOM   6226  C  CG1   . ILE B  1 363 ? -0.527  -22.331  19.303  1.00 120.31 ? 363 ILE B CG1   1 
ATOM   6227  C  CG2   . ILE B  1 363 ? 1.838   -23.147  18.998  1.00 115.80 ? 363 ILE B CG2   1 
ATOM   6228  C  CD1   . ILE B  1 363 ? -0.618  -20.823  19.449  1.00 119.46 ? 363 ILE B CD1   1 
ATOM   6229  N  N     . ARG B  1 364 ? 1.495   -26.168  21.630  1.00 111.36 ? 364 ARG B N     1 
ATOM   6230  C  CA    . ARG B  1 364 ? 2.445   -26.864  22.500  1.00 107.31 ? 364 ARG B CA    1 
ATOM   6231  C  C     . ARG B  1 364 ? 3.142   -27.976  21.706  1.00 108.63 ? 364 ARG B C     1 
ATOM   6232  O  O     . ARG B  1 364 ? 2.460   -28.827  21.126  1.00 112.61 ? 364 ARG B O     1 
ATOM   6233  C  CB    . ARG B  1 364 ? 1.720   -27.481  23.704  1.00 106.56 ? 364 ARG B CB    1 
ATOM   6234  C  CG    . ARG B  1 364 ? 0.864   -26.532  24.538  1.00 106.01 ? 364 ARG B CG    1 
ATOM   6235  C  CD    . ARG B  1 364 ? 0.051   -27.310  25.566  1.00 107.39 ? 364 ARG B CD    1 
ATOM   6236  N  NE    . ARG B  1 364 ? -0.605  -26.458  26.562  1.00 107.21 ? 364 ARG B NE    1 
ATOM   6237  C  CZ    . ARG B  1 364 ? -1.421  -26.900  27.522  1.00 108.14 ? 364 ARG B CZ    1 
ATOM   6238  N  NH1   . ARG B  1 364 ? -1.700  -28.195  27.635  1.00 110.01 ? 364 ARG B NH1   1 
ATOM   6239  N  NH2   . ARG B  1 364 ? -1.969  -26.044  28.375  1.00 107.21 ? 364 ARG B NH2   1 
ATOM   6240  N  N     . PRO B  1 365 ? 4.495   -27.988  21.666  1.00 105.61 ? 365 PRO B N     1 
ATOM   6241  C  CA    . PRO B  1 365 ? 5.478   -27.092  22.288  1.00 101.14 ? 365 PRO B CA    1 
ATOM   6242  C  C     . PRO B  1 365 ? 5.209   -25.623  21.990  1.00 101.04 ? 365 PRO B C     1 
ATOM   6243  O  O     . PRO B  1 365 ? 4.890   -25.265  20.847  1.00 104.48 ? 365 PRO B O     1 
ATOM   6244  C  CB    . PRO B  1 365 ? 6.799   -27.508  21.634  1.00 100.70 ? 365 PRO B CB    1 
ATOM   6245  C  CG    . PRO B  1 365 ? 6.592   -28.906  21.223  1.00 103.58 ? 365 PRO B CG    1 
ATOM   6246  C  CD    . PRO B  1 365 ? 5.153   -29.018  20.840  1.00 107.41 ? 365 PRO B CD    1 
ATOM   6247  N  N     . ALA B  1 366 ? 5.335   -24.784  23.014  1.00 97.23  ? 366 ALA B N     1 
ATOM   6248  C  CA    . ALA B  1 366 ? 5.077   -23.357  22.864  1.00 96.68  ? 366 ALA B CA    1 
ATOM   6249  C  C     . ALA B  1 366 ? 6.334   -22.613  22.412  1.00 94.73  ? 366 ALA B C     1 
ATOM   6250  O  O     . ALA B  1 366 ? 6.630   -21.520  22.900  1.00 92.50  ? 366 ALA B O     1 
ATOM   6251  C  CB    . ALA B  1 366 ? 4.512   -22.778  24.159  1.00 94.22  ? 366 ALA B CB    1 
ATOM   6252  N  N     . ILE B  1 367 ? 7.064   -23.215  21.471  1.00 95.76  ? 367 ILE B N     1 
ATOM   6253  C  CA    . ILE B  1 367 ? 8.301   -22.635  20.962  1.00 94.20  ? 367 ILE B CA    1 
ATOM   6254  C  C     . ILE B  1 367 ? 8.003   -21.374  20.185  1.00 95.90  ? 367 ILE B C     1 
ATOM   6255  O  O     . ILE B  1 367 ? 7.603   -21.424  19.024  1.00 99.82  ? 367 ILE B O     1 
ATOM   6256  C  CB    . ILE B  1 367 ? 9.106   -23.616  20.092  1.00 95.85  ? 367 ILE B CB    1 
ATOM   6257  C  CG1   . ILE B  1 367 ? 9.608   -24.772  20.955  1.00 93.82  ? 367 ILE B CG1   1 
ATOM   6258  C  CG2   . ILE B  1 367 ? 10.281  -22.903  19.416  1.00 94.90  ? 367 ILE B CG2   1 
ATOM   6259  C  CD1   . ILE B  1 367 ? 9.992   -26.003  20.192  1.00 96.59  ? 367 ILE B CD1   1 
ATOM   6260  N  N     . ASN B  1 368 ? 8.167   -20.249  20.869  1.00 93.11  ? 368 ASN B N     1 
ATOM   6261  C  CA    . ASN B  1 368 ? 8.160   -18.943  20.253  1.00 94.15  ? 368 ASN B CA    1 
ATOM   6262  C  C     . ASN B  1 368 ? 9.328   -18.903  19.279  1.00 95.03  ? 368 ASN B C     1 
ATOM   6263  O  O     . ASN B  1 368 ? 10.484  -18.785  19.691  1.00 92.13  ? 368 ASN B O     1 
ATOM   6264  C  CB    . ASN B  1 368 ? 8.301   -17.872  21.339  1.00 90.74  ? 368 ASN B CB    1 
ATOM   6265  C  CG    . ASN B  1 368 ? 8.178   -16.459  20.803  1.00 91.94  ? 368 ASN B CG    1 
ATOM   6266  O  OD1   . ASN B  1 368 ? 8.942   -16.032  19.935  1.00 93.02  ? 368 ASN B OD1   1 
ATOM   6267  N  ND2   . ASN B  1 368 ? 7.226   -15.714  21.345  1.00 92.30  ? 368 ASN B ND2   1 
ATOM   6268  N  N     . VAL B  1 369 ? 9.015   -19.026  17.990  1.00 99.30  ? 369 VAL B N     1 
ATOM   6269  C  CA    . VAL B  1 369 ? 10.035  -19.171  16.949  1.00 101.02 ? 369 VAL B CA    1 
ATOM   6270  C  C     . VAL B  1 369 ? 10.927  -17.934  16.844  1.00 99.89  ? 369 VAL B C     1 
ATOM   6271  O  O     . VAL B  1 369 ? 12.149  -18.041  16.988  1.00 97.93  ? 369 VAL B O     1 
ATOM   6272  C  CB    . VAL B  1 369 ? 9.422   -19.555  15.578  1.00 106.17 ? 369 VAL B CB    1 
ATOM   6273  C  CG1   . VAL B  1 369 ? 10.501  -19.629  14.506  1.00 107.98 ? 369 VAL B CG1   1 
ATOM   6274  C  CG2   . VAL B  1 369 ? 8.701   -20.891  15.680  1.00 107.45 ? 369 VAL B CG2   1 
ATOM   6275  N  N     . GLY B  1 370 ? 10.313  -16.772  16.617  1.00 101.22 ? 370 GLY B N     1 
ATOM   6276  C  CA    . GLY B  1 370 ? 11.039  -15.509  16.568  1.00 100.51 ? 370 GLY B CA    1 
ATOM   6277  C  C     . GLY B  1 370 ? 12.158  -15.455  17.596  1.00 96.48  ? 370 GLY B C     1 
ATOM   6278  O  O     . GLY B  1 370 ? 13.322  -15.258  17.245  1.00 96.46  ? 370 GLY B O     1 
ATOM   6279  N  N     . LEU B  1 371 ? 11.809  -15.681  18.862  1.00 93.38  ? 371 LEU B N     1 
ATOM   6280  C  CA    . LEU B  1 371 ? 12.754  -15.535  19.973  1.00 89.30  ? 371 LEU B CA    1 
ATOM   6281  C  C     . LEU B  1 371 ? 13.561  -16.799  20.296  1.00 87.79  ? 371 LEU B C     1 
ATOM   6282  O  O     . LEU B  1 371 ? 14.102  -16.937  21.400  1.00 84.43  ? 371 LEU B O     1 
ATOM   6283  C  CB    . LEU B  1 371 ? 12.023  -15.030  21.227  1.00 86.79  ? 371 LEU B CB    1 
ATOM   6284  C  CG    . LEU B  1 371 ? 11.738  -13.528  21.351  1.00 86.66  ? 371 LEU B CG    1 
ATOM   6285  C  CD1   . LEU B  1 371 ? 10.690  -13.028  20.328  1.00 91.19  ? 371 LEU B CD1   1 
ATOM   6286  C  CD2   . LEU B  1 371 ? 11.295  -13.220  22.770  1.00 83.39  ? 371 LEU B CD2   1 
ATOM   6287  N  N     . SER B  1 372 ? 13.650  -17.712  19.335  1.00 90.39  ? 372 SER B N     1 
ATOM   6288  C  CA    . SER B  1 372 ? 14.406  -18.945  19.537  1.00 89.53  ? 372 SER B CA    1 
ATOM   6289  C  C     . SER B  1 372 ? 15.473  -19.125  18.470  1.00 91.56  ? 372 SER B C     1 
ATOM   6290  O  O     . SER B  1 372 ? 15.246  -18.803  17.304  1.00 95.16  ? 372 SER B O     1 
ATOM   6291  C  CB    . SER B  1 372 ? 13.474  -20.154  19.582  1.00 90.73  ? 372 SER B CB    1 
ATOM   6292  O  OG    . SER B  1 372 ? 12.597  -20.060  20.691  1.00 88.68  ? 372 SER B OG    1 
ATOM   6293  N  N     . VAL B  1 373 ? 16.632  -19.638  18.881  1.00 89.59  ? 373 VAL B N     1 
ATOM   6294  C  CA    . VAL B  1 373 ? 17.800  -19.770  18.007  1.00 91.25  ? 373 VAL B CA    1 
ATOM   6295  C  C     . VAL B  1 373 ? 18.724  -20.928  18.430  1.00 90.35  ? 373 VAL B C     1 
ATOM   6296  O  O     . VAL B  1 373 ? 18.893  -21.203  19.621  1.00 87.26  ? 373 VAL B O     1 
ATOM   6297  C  CB    . VAL B  1 373 ? 18.591  -18.429  17.930  1.00 90.33  ? 373 VAL B CB    1 
ATOM   6298  C  CG1   . VAL B  1 373 ? 20.079  -18.651  17.714  1.00 90.10  ? 373 VAL B CG1   1 
ATOM   6299  C  CG2   . VAL B  1 373 ? 18.029  -17.537  16.839  1.00 93.75  ? 373 VAL B CG2   1 
ATOM   6300  N  N     . SER B  1 374 ? 19.282  -21.619  17.435  1.00 93.32  ? 374 SER B N     1 
ATOM   6301  C  CA    . SER B  1 374 ? 20.435  -22.492  17.622  1.00 92.88  ? 374 SER B CA    1 
ATOM   6302  C  C     . SER B  1 374 ? 21.607  -21.834  16.904  1.00 94.26  ? 374 SER B C     1 
ATOM   6303  O  O     . SER B  1 374 ? 21.453  -21.345  15.790  1.00 97.31  ? 374 SER B O     1 
ATOM   6304  C  CB    . SER B  1 374 ? 20.159  -23.879  17.044  1.00 95.65  ? 374 SER B CB    1 
ATOM   6305  O  OG    . SER B  1 374 ? 21.320  -24.694  17.082  1.00 96.05  ? 374 SER B OG    1 
ATOM   6306  N  N     . ARG B  1 375 ? 22.772  -21.814  17.542  1.00 92.45  ? 375 ARG B N     1 
ATOM   6307  C  CA    . ARG B  1 375 ? 23.904  -21.039  17.035  1.00 93.90  ? 375 ARG B CA    1 
ATOM   6308  C  C     . ARG B  1 375 ? 24.911  -21.880  16.287  1.00 96.86  ? 375 ARG B C     1 
ATOM   6309  O  O     . ARG B  1 375 ? 25.659  -21.363  15.458  1.00 99.50  ? 375 ARG B O     1 
ATOM   6310  C  CB    . ARG B  1 375 ? 24.625  -20.317  18.166  1.00 90.50  ? 375 ARG B CB    1 
ATOM   6311  C  CG    . ARG B  1 375 ? 23.831  -19.207  18.796  1.00 88.80  ? 375 ARG B CG    1 
ATOM   6312  C  CD    . ARG B  1 375 ? 24.575  -18.636  19.975  1.00 86.65  ? 375 ARG B CD    1 
ATOM   6313  N  NE    . ARG B  1 375 ? 23.812  -17.579  20.627  1.00 85.34  ? 375 ARG B NE    1 
ATOM   6314  C  CZ    . ARG B  1 375 ? 24.335  -16.707  21.475  1.00 83.94  ? 375 ARG B CZ    1 
ATOM   6315  N  NH1   . ARG B  1 375 ? 25.624  -16.770  21.771  1.00 84.19  ? 375 ARG B NH1   1 
ATOM   6316  N  NH2   . ARG B  1 375 ? 23.574  -15.768  22.022  1.00 83.09  ? 375 ARG B NH2   1 
ATOM   6317  N  N     . VAL B  1 376 ? 24.951  -23.172  16.590  1.00 96.83  ? 376 VAL B N     1 
ATOM   6318  C  CA    . VAL B  1 376 ? 25.907  -24.056  15.934  1.00 99.59  ? 376 VAL B CA    1 
ATOM   6319  C  C     . VAL B  1 376 ? 25.246  -25.289  15.329  1.00 102.19 ? 376 VAL B C     1 
ATOM   6320  O  O     . VAL B  1 376 ? 25.812  -25.937  14.436  1.00 105.54 ? 376 VAL B O     1 
ATOM   6321  C  CB    . VAL B  1 376 ? 27.067  -24.447  16.876  1.00 97.44  ? 376 VAL B CB    1 
ATOM   6322  C  CG1   . VAL B  1 376 ? 28.071  -23.307  16.974  1.00 96.85  ? 376 VAL B CG1   1 
ATOM   6323  C  CG2   . VAL B  1 376 ? 26.549  -24.836  18.251  1.00 93.47  ? 376 VAL B CG2   1 
ATOM   6324  N  N     . GLY B  1 377 ? 24.036  -25.587  15.800  1.00 100.83 ? 377 GLY B N     1 
ATOM   6325  C  CA    . GLY B  1 377 ? 23.295  -26.768  15.364  1.00 103.12 ? 377 GLY B CA    1 
ATOM   6326  C  C     . GLY B  1 377 ? 22.886  -26.748  13.905  1.00 107.59 ? 377 GLY B C     1 
ATOM   6327  O  O     . GLY B  1 377 ? 22.249  -27.682  13.420  1.00 110.01 ? 377 GLY B O     1 
ATOM   6328  N  N     . SER B  1 378 ? 23.253  -25.678  13.207  1.00 108.97 ? 378 SER B N     1 
ATOM   6329  C  CA    . SER B  1 378 ? 22.945  -25.533  11.791  1.00 113.37 ? 378 SER B CA    1 
ATOM   6330  C  C     . SER B  1 378 ? 23.486  -26.744  11.053  1.00 116.41 ? 378 SER B C     1 
ATOM   6331  O  O     . SER B  1 378 ? 22.723  -27.489  10.443  1.00 119.19 ? 378 SER B O     1 
ATOM   6332  C  CB    . SER B  1 378 ? 23.539  -24.230  11.246  1.00 114.37 ? 378 SER B CB    1 
ATOM   6333  O  OG    . SER B  1 378 ? 23.309  -23.150  12.153  1.00 111.38 ? 378 SER B OG    1 
ATOM   6334  N  N     . ALA B  1 379 ? 24.796  -26.959  11.164  1.00 115.89 ? 379 ALA B N     1 
ATOM   6335  C  CA    . ALA B  1 379 ? 25.481  -28.086  10.529  1.00 118.78 ? 379 ALA B CA    1 
ATOM   6336  C  C     . ALA B  1 379 ? 24.875  -29.438  10.899  1.00 118.45 ? 379 ALA B C     1 
ATOM   6337  O  O     . ALA B  1 379 ? 24.985  -30.404  10.147  1.00 122.16 ? 379 ALA B O     1 
ATOM   6338  C  CB    . ALA B  1 379 ? 26.957  -28.063  10.885  1.00 117.77 ? 379 ALA B CB    1 
ATOM   6339  N  N     . ALA B  1 380 ? 24.217  -29.490  12.049  1.00 114.32 ? 380 ALA B N     1 
ATOM   6340  C  CA    . ALA B  1 380 ? 23.721  -30.740  12.605  1.00 113.48 ? 380 ALA B CA    1 
ATOM   6341  C  C     . ALA B  1 380 ? 22.316  -31.128  12.159  1.00 115.32 ? 380 ALA B C     1 
ATOM   6342  O  O     . ALA B  1 380 ? 21.790  -32.147  12.594  1.00 115.10 ? 380 ALA B O     1 
ATOM   6343  C  CB    . ALA B  1 380 ? 23.797  -30.698  14.130  1.00 108.60 ? 380 ALA B CB    1 
ATOM   6344  N  N     . GLN B  1 381 ? 21.696  -30.329  11.302  1.00 117.40 ? 381 GLN B N     1 
ATOM   6345  C  CA    . GLN B  1 381 ? 20.342  -30.649  10.874  1.00 119.65 ? 381 GLN B CA    1 
ATOM   6346  C  C     . GLN B  1 381 ? 20.349  -31.730  9.788   1.00 124.64 ? 381 GLN B C     1 
ATOM   6347  O  O     . GLN B  1 381 ? 21.098  -31.633  8.807   1.00 127.86 ? 381 GLN B O     1 
ATOM   6348  C  CB    . GLN B  1 381 ? 19.596  -29.396  10.406  1.00 120.34 ? 381 GLN B CB    1 
ATOM   6349  C  CG    . GLN B  1 381 ? 18.077  -29.493  10.555  1.00 120.90 ? 381 GLN B CG    1 
ATOM   6350  C  CD    . GLN B  1 381 ? 17.326  -28.259  10.062  1.00 122.51 ? 381 GLN B CD    1 
ATOM   6351  O  OE1   . GLN B  1 381 ? 17.852  -27.447  9.295   1.00 124.51 ? 381 GLN B OE1   1 
ATOM   6352  N  NE2   . GLN B  1 381 ? 16.079  -28.120  10.501  1.00 121.80 ? 381 GLN B NE2   1 
ATOM   6353  N  N     . VAL B  1 382 ? 19.533  -32.765  9.989   1.00 125.26 ? 382 VAL B N     1 
ATOM   6354  C  CA    . VAL B  1 382 ? 19.274  -33.763  8.955   1.00 130.30 ? 382 VAL B CA    1 
ATOM   6355  C  C     . VAL B  1 382 ? 18.809  -33.037  7.694   1.00 134.46 ? 382 VAL B C     1 
ATOM   6356  O  O     . VAL B  1 382 ? 17.855  -32.256  7.735   1.00 133.93 ? 382 VAL B O     1 
ATOM   6357  C  CB    . VAL B  1 382 ? 18.204  -34.801  9.401   1.00 130.54 ? 382 VAL B CB    1 
ATOM   6358  C  CG1   . VAL B  1 382 ? 17.742  -35.638  8.220   1.00 136.28 ? 382 VAL B CG1   1 
ATOM   6359  C  CG2   . VAL B  1 382 ? 18.740  -35.702  10.515  1.00 127.12 ? 382 VAL B CG2   1 
ATOM   6360  N  N     . LYS B  1 383 ? 19.499  -33.295  6.586   1.00 129.05 ? 383 LYS B N     1 
ATOM   6361  C  CA    . LYS B  1 383 ? 19.264  -32.592  5.324   1.00 130.22 ? 383 LYS B CA    1 
ATOM   6362  C  C     . LYS B  1 383 ? 17.790  -32.560  4.902   1.00 129.16 ? 383 LYS B C     1 
ATOM   6363  O  O     . LYS B  1 383 ? 17.302  -31.528  4.442   1.00 128.76 ? 383 LYS B O     1 
ATOM   6364  C  CB    . LYS B  1 383 ? 20.131  -33.194  4.212   1.00 133.42 ? 383 LYS B CB    1 
ATOM   6365  C  CG    . LYS B  1 383 ? 20.231  -32.350  2.947   1.00 134.89 ? 383 LYS B CG    1 
ATOM   6366  C  CD    . LYS B  1 383 ? 20.915  -33.123  1.829   1.00 137.92 ? 383 LYS B CD    1 
ATOM   6367  C  CE    . LYS B  1 383 ? 21.099  -32.272  0.587   1.00 139.71 ? 383 LYS B CE    1 
ATOM   6368  N  NZ    . LYS B  1 383 ? 21.793  -33.021  -0.494  1.00 143.35 ? 383 LYS B NZ    1 
ATOM   6369  N  N     . ALA B  1 384 ? 17.092  -33.686  5.074   1.00 129.16 ? 384 ALA B N     1 
ATOM   6370  C  CA    . ALA B  1 384 ? 15.680  -33.831  4.670   1.00 128.48 ? 384 ALA B CA    1 
ATOM   6371  C  C     . ALA B  1 384 ? 14.722  -32.894  5.414   1.00 126.11 ? 384 ALA B C     1 
ATOM   6372  O  O     . ALA B  1 384 ? 13.714  -32.460  4.847   1.00 125.71 ? 384 ALA B O     1 
ATOM   6373  C  CB    . ALA B  1 384 ? 15.227  -35.278  4.808   1.00 128.86 ? 384 ALA B CB    1 
ATOM   6374  N  N     . LEU B  1 385 ? 15.036  -32.605  6.679   1.00 124.93 ? 385 LEU B N     1 
ATOM   6375  C  CA    . LEU B  1 385 ? 14.340  -31.577  7.451   1.00 123.09 ? 385 LEU B CA    1 
ATOM   6376  C  C     . LEU B  1 385 ? 14.679  -30.212  6.881   1.00 123.82 ? 385 LEU B C     1 
ATOM   6377  O  O     . LEU B  1 385 ? 13.788  -29.450  6.513   1.00 123.44 ? 385 LEU B O     1 
ATOM   6378  C  CB    . LEU B  1 385 ? 14.745  -31.627  8.924   1.00 121.89 ? 385 LEU B CB    1 
ATOM   6379  C  CG    . LEU B  1 385 ? 14.039  -32.601  9.865   1.00 121.10 ? 385 LEU B CG    1 
ATOM   6380  C  CD1   . LEU B  1 385 ? 14.759  -32.610  11.205  1.00 120.88 ? 385 LEU B CD1   1 
ATOM   6381  C  CD2   . LEU B  1 385 ? 12.569  -32.240  10.047  1.00 119.86 ? 385 LEU B CD2   1 
ATOM   6382  N  N     . LYS B  1 386 ? 15.979  -29.929  6.795   1.00 125.22 ? 386 LYS B N     1 
ATOM   6383  C  CA    . LYS B  1 386 ? 16.503  -28.682  6.241   1.00 126.59 ? 386 LYS B CA    1 
ATOM   6384  C  C     . LYS B  1 386 ? 15.890  -28.359  4.880   1.00 128.03 ? 386 LYS B C     1 
ATOM   6385  O  O     . LYS B  1 386 ? 15.715  -27.189  4.539   1.00 128.52 ? 386 LYS B O     1 
ATOM   6386  C  CB    . LYS B  1 386 ? 18.026  -28.780  6.126   1.00 128.27 ? 386 LYS B CB    1 
ATOM   6387  C  CG    . LYS B  1 386 ? 18.772  -27.459  5.985   1.00 129.22 ? 386 LYS B CG    1 
ATOM   6388  C  CD    . LYS B  1 386 ? 20.212  -27.643  6.448   1.00 130.22 ? 386 LYS B CD    1 
ATOM   6389  C  CE    . LYS B  1 386 ? 21.169  -26.675  5.780   1.00 132.41 ? 386 LYS B CE    1 
ATOM   6390  N  NZ    . LYS B  1 386 ? 22.575  -26.964  6.183   1.00 133.53 ? 386 LYS B NZ    1 
ATOM   6391  N  N     . GLN B  1 387 ? 15.552  -29.405  4.125   1.00 129.16 ? 387 GLN B N     1 
ATOM   6392  C  CA    . GLN B  1 387 ? 15.005  -29.275  2.771   1.00 130.98 ? 387 GLN B CA    1 
ATOM   6393  C  C     . GLN B  1 387 ? 13.520  -28.885  2.719   1.00 129.99 ? 387 GLN B C     1 
ATOM   6394  O  O     . GLN B  1 387 ? 13.156  -27.952  2.000   1.00 130.89 ? 387 GLN B O     1 
ATOM   6395  C  CB    . GLN B  1 387 ? 15.281  -30.538  1.951   1.00 132.65 ? 387 GLN B CB    1 
ATOM   6396  C  CG    . GLN B  1 387 ? 16.709  -30.606  1.410   1.00 135.44 ? 387 GLN B CG    1 
ATOM   6397  C  CD    . GLN B  1 387 ? 16.977  -31.845  0.561   1.00 138.08 ? 387 GLN B CD    1 
ATOM   6398  O  OE1   . GLN B  1 387 ? 16.400  -32.907  0.789   1.00 137.39 ? 387 GLN B OE1   1 
ATOM   6399  N  NE2   . GLN B  1 387 ? 17.869  -31.711  -0.417  1.00 140.87 ? 387 GLN B NE2   1 
ATOM   6400  N  N     . VAL B  1 388 ? 12.671  -29.598  3.465   1.00 128.68 ? 388 VAL B N     1 
ATOM   6401  C  CA    . VAL B  1 388 ? 11.239  -29.243  3.568   1.00 127.90 ? 388 VAL B CA    1 
ATOM   6402  C  C     . VAL B  1 388 ? 10.986  -28.105  4.572   1.00 126.87 ? 388 VAL B C     1 
ATOM   6403  O  O     . VAL B  1 388 ? 9.930   -27.472  4.547   1.00 126.58 ? 388 VAL B O     1 
ATOM   6404  C  CB    . VAL B  1 388 ? 10.296  -30.469  3.862   1.00 126.93 ? 388 VAL B CB    1 
ATOM   6405  C  CG1   . VAL B  1 388 ? 10.290  -31.449  2.694   1.00 128.75 ? 388 VAL B CG1   1 
ATOM   6406  C  CG2   . VAL B  1 388 ? 10.668  -31.174  5.158   1.00 125.55 ? 388 VAL B CG2   1 
ATOM   6407  N  N     . ALA B  1 389 ? 11.959  -27.854  5.446   1.00 126.75 ? 389 ALA B N     1 
ATOM   6408  C  CA    . ALA B  1 389 ? 11.906  -26.718  6.364   1.00 126.49 ? 389 ALA B CA    1 
ATOM   6409  C  C     . ALA B  1 389 ? 12.763  -25.541  5.868   1.00 128.45 ? 389 ALA B C     1 
ATOM   6410  O  O     . ALA B  1 389 ? 13.197  -24.691  6.652   1.00 128.46 ? 389 ALA B O     1 
ATOM   6411  C  CB    . ALA B  1 389 ? 12.318  -27.146  7.765   1.00 125.07 ? 389 ALA B CB    1 
ATOM   6412  N  N     . GLY B  1 390 ? 12.990  -25.501  4.556   1.00 130.57 ? 390 GLY B N     1 
ATOM   6413  C  CA    . GLY B  1 390 ? 13.729  -24.416  3.916   1.00 132.94 ? 390 GLY B CA    1 
ATOM   6414  C  C     . GLY B  1 390 ? 13.060  -23.082  4.159   1.00 133.52 ? 390 GLY B C     1 
ATOM   6415  O  O     . GLY B  1 390 ? 11.964  -22.821  3.653   1.00 133.73 ? 390 GLY B O     1 
ATOM   6416  N  N     . SER B  1 391 ? 13.725  -22.252  4.960   1.00 134.11 ? 391 SER B N     1 
ATOM   6417  C  CA    . SER B  1 391 ? 13.231  -20.926  5.362   1.00 135.20 ? 391 SER B CA    1 
ATOM   6418  C  C     . SER B  1 391 ? 11.833  -20.919  6.016   1.00 133.90 ? 391 SER B C     1 
ATOM   6419  O  O     . SER B  1 391 ? 11.214  -19.852  6.167   1.00 135.09 ? 391 SER B O     1 
ATOM   6420  C  CB    . SER B  1 391 ? 13.328  -19.915  4.205   1.00 138.05 ? 391 SER B CB    1 
ATOM   6421  O  OG    . SER B  1 391 ? 14.678  -19.569  3.943   1.00 139.73 ? 391 SER B OG    1 
ATOM   6422  N  N     . LEU B  1 392 ? 11.351  -22.106  6.404   1.00 131.70 ? 392 LEU B N     1 
ATOM   6423  C  CA    . LEU B  1 392 ? 10.187  -22.226  7.283   1.00 130.10 ? 392 LEU B CA    1 
ATOM   6424  C  C     . LEU B  1 392 ? 10.503  -21.441  8.548   1.00 130.05 ? 392 LEU B C     1 
ATOM   6425  O  O     . LEU B  1 392 ? 9.620   -20.824  9.149   1.00 130.10 ? 392 LEU B O     1 
ATOM   6426  C  CB    . LEU B  1 392 ? 9.906   -23.694  7.626   1.00 128.04 ? 392 LEU B CB    1 
ATOM   6427  C  CG    . LEU B  1 392 ? 8.758   -24.005  8.600   1.00 126.42 ? 392 LEU B CG    1 
ATOM   6428  C  CD1   . LEU B  1 392 ? 7.399   -23.948  7.912   1.00 126.70 ? 392 LEU B CD1   1 
ATOM   6429  C  CD2   . LEU B  1 392 ? 8.952   -25.353  9.277   1.00 124.43 ? 392 LEU B CD2   1 
ATOM   6430  N  N     . LYS B  1 393 ? 11.782  -21.478  8.923   1.00 130.19 ? 393 LYS B N     1 
ATOM   6431  C  CA    . LYS B  1 393 ? 12.326  -20.708  10.037  1.00 130.75 ? 393 LYS B CA    1 
ATOM   6432  C  C     . LYS B  1 393 ? 11.981  -19.232  9.911   1.00 133.04 ? 393 LYS B C     1 
ATOM   6433  O  O     . LYS B  1 393 ? 11.406  -18.643  10.833  1.00 133.42 ? 393 LYS B O     1 
ATOM   6434  C  CB    . LYS B  1 393 ? 13.852  -20.884  10.109  1.00 131.18 ? 393 LYS B CB    1 
ATOM   6435  C  CG    . LYS B  1 393 ? 14.555  -20.100  11.226  1.00 131.41 ? 393 LYS B CG    1 
ATOM   6436  C  CD    . LYS B  1 393 ? 14.440  -20.802  12.572  1.00 129.16 ? 393 LYS B CD    1 
ATOM   6437  C  CE    . LYS B  1 393 ? 15.353  -20.173  13.622  1.00 130.03 ? 393 LYS B CE    1 
ATOM   6438  N  NZ    . LYS B  1 393 ? 14.821  -18.900  14.188  1.00 131.19 ? 393 LYS B NZ    1 
ATOM   6439  N  N     . LEU B  1 394 ? 12.327  -18.646  8.765   1.00 134.93 ? 394 LEU B N     1 
ATOM   6440  C  CA    . LEU B  1 394 ? 12.161  -17.210  8.559   1.00 137.52 ? 394 LEU B CA    1 
ATOM   6441  C  C     . LEU B  1 394 ? 10.801  -16.807  7.986   1.00 138.33 ? 394 LEU B C     1 
ATOM   6442  O  O     . LEU B  1 394 ? 10.453  -15.624  8.009   1.00 140.84 ? 394 LEU B O     1 
ATOM   6443  C  CB    . LEU B  1 394 ? 13.322  -16.627  7.741   1.00 139.71 ? 394 LEU B CB    1 
ATOM   6444  C  CG    . LEU B  1 394 ? 14.593  -16.368  8.562   1.00 140.01 ? 394 LEU B CG    1 
ATOM   6445  C  CD1   . LEU B  1 394 ? 15.816  -16.229  7.670   1.00 141.69 ? 394 LEU B CD1   1 
ATOM   6446  C  CD2   . LEU B  1 394 ? 14.436  -15.146  9.467   1.00 141.46 ? 394 LEU B CD2   1 
ATOM   6447  N  N     . PHE B  1 395 ? 10.034  -17.777  7.485   1.00 136.54 ? 395 PHE B N     1 
ATOM   6448  C  CA    . PHE B  1 395 ? 8.643   -17.510  7.118   1.00 137.04 ? 395 PHE B CA    1 
ATOM   6449  C  C     . PHE B  1 395 ? 7.764   -17.372  8.365   1.00 136.26 ? 395 PHE B C     1 
ATOM   6450  O  O     . PHE B  1 395 ? 6.994   -16.422  8.473   1.00 138.25 ? 395 PHE B O     1 
ATOM   6451  C  CB    . PHE B  1 395 ? 8.059   -18.574  6.176   1.00 135.82 ? 395 PHE B CB    1 
ATOM   6452  C  CG    . PHE B  1 395 ? 6.550   -18.592  6.162   1.00 135.85 ? 395 PHE B CG    1 
ATOM   6453  C  CD1   . PHE B  1 395 ? 5.835   -17.617  5.477   1.00 138.61 ? 395 PHE B CD1   1 
ATOM   6454  C  CD2   . PHE B  1 395 ? 5.845   -19.562  6.867   1.00 133.86 ? 395 PHE B CD2   1 
ATOM   6455  C  CE1   . PHE B  1 395 ? 4.439   -17.618  5.480   1.00 139.23 ? 395 PHE B CE1   1 
ATOM   6456  C  CE2   . PHE B  1 395 ? 4.450   -19.568  6.875   1.00 134.33 ? 395 PHE B CE2   1 
ATOM   6457  C  CZ    . PHE B  1 395 ? 3.747   -18.597  6.180   1.00 136.92 ? 395 PHE B CZ    1 
ATOM   6458  N  N     . LEU B  1 396 ? 7.873   -18.332  9.286   1.00 133.66 ? 396 LEU B N     1 
ATOM   6459  C  CA    . LEU B  1 396 ? 7.048   -18.363  10.503  1.00 132.66 ? 396 LEU B CA    1 
ATOM   6460  C  C     . LEU B  1 396 ? 7.283   -17.154  11.414  1.00 134.44 ? 396 LEU B C     1 
ATOM   6461  O  O     . LEU B  1 396 ? 6.349   -16.636  12.038  1.00 135.65 ? 396 LEU B O     1 
ATOM   6462  C  CB    . LEU B  1 396 ? 7.277   -19.663  11.281  1.00 129.83 ? 396 LEU B CB    1 
ATOM   6463  C  CG    . LEU B  1 396 ? 6.635   -20.947  10.755  1.00 127.75 ? 396 LEU B CG    1 
ATOM   6464  C  CD1   . LEU B  1 396 ? 7.229   -22.131  11.483  1.00 125.75 ? 396 LEU B CD1   1 
ATOM   6465  C  CD2   . LEU B  1 396 ? 5.121   -20.930  10.915  1.00 127.67 ? 396 LEU B CD2   1 
ATOM   6466  N  N     . ALA B  1 397 ? 8.536   -16.713  11.486  1.00 134.74 ? 397 ALA B N     1 
ATOM   6467  C  CA    . ALA B  1 397 ? 8.878   -15.478  12.167  1.00 136.65 ? 397 ALA B CA    1 
ATOM   6468  C  C     . ALA B  1 397 ? 8.293   -14.273  11.414  1.00 139.62 ? 397 ALA B C     1 
ATOM   6469  O  O     . ALA B  1 397 ? 8.314   -13.149  11.922  1.00 142.41 ? 397 ALA B O     1 
ATOM   6470  C  CB    . ALA B  1 397 ? 10.389  -15.355  12.296  1.00 136.81 ? 397 ALA B CB    1 
ATOM   6471  N  N     . GLN B  1 398 ? 7.763   -14.523  10.212  1.00 139.17 ? 398 GLN B N     1 
ATOM   6472  C  CA    . GLN B  1 398 ? 7.171   -13.477  9.362   1.00 141.83 ? 398 GLN B CA    1 
ATOM   6473  C  C     . GLN B  1 398 ? 5.677   -13.672  9.041   1.00 141.62 ? 398 GLN B C     1 
ATOM   6474  O  O     . GLN B  1 398 ? 5.035   -12.775  8.492   1.00 144.46 ? 398 GLN B O     1 
ATOM   6475  C  CB    . GLN B  1 398 ? 7.994   -13.283  8.079   1.00 143.00 ? 398 GLN B CB    1 
ATOM   6476  C  CG    . GLN B  1 398 ? 9.229   -12.398  8.269   1.00 144.78 ? 398 GLN B CG    1 
ATOM   6477  C  CD    . GLN B  1 398 ? 10.088  -12.284  7.020   1.00 145.53 ? 398 GLN B CD    1 
ATOM   6478  O  OE1   . GLN B  1 398 ? 10.095  -11.252  6.348   1.00 148.22 ? 398 GLN B OE1   1 
ATOM   6479  N  NE2   . GLN B  1 398 ? 10.820  -13.347  6.707   1.00 143.18 ? 398 GLN B NE2   1 
ATOM   6480  N  N     . TYR B  1 399 ? 5.132   -14.843  9.368   1.00 138.39 ? 399 TYR B N     1 
ATOM   6481  C  CA    . TYR B  1 399 ? 3.681   -15.015  9.432   1.00 138.21 ? 399 TYR B CA    1 
ATOM   6482  C  C     . TYR B  1 399 ? 3.235   -14.249  10.667  1.00 139.96 ? 399 TYR B C     1 
ATOM   6483  O  O     . TYR B  1 399 ? 2.150   -13.674  10.704  1.00 141.94 ? 399 TYR B O     1 
ATOM   6484  C  CB    . TYR B  1 399 ? 3.287   -16.500  9.511   1.00 134.68 ? 399 TYR B CB    1 
ATOM   6485  C  CG    . TYR B  1 399 ? 2.008   -16.778  10.283  1.00 133.42 ? 399 TYR B CG    1 
ATOM   6486  C  CD1   . TYR B  1 399 ? 0.779   -16.255  9.868   1.00 134.68 ? 399 TYR B CD1   1 
ATOM   6487  C  CD2   . TYR B  1 399 ? 2.028   -17.567  11.430  1.00 130.54 ? 399 TYR B CD2   1 
ATOM   6488  C  CE1   . TYR B  1 399 ? -0.389  -16.501  10.586  1.00 134.18 ? 399 TYR B CE1   1 
ATOM   6489  C  CE2   . TYR B  1 399 ? 0.864   -17.824  12.150  1.00 130.14 ? 399 TYR B CE2   1 
ATOM   6490  C  CZ    . TYR B  1 399 ? -0.338  -17.289  11.724  1.00 132.02 ? 399 TYR B CZ    1 
ATOM   6491  O  OH    . TYR B  1 399 ? -1.486  -17.544  12.439  1.00 132.04 ? 399 TYR B OH    1 
ATOM   6492  N  N     . ARG B  1 400 ? 4.115   -14.252  11.666  1.00 139.52 ? 400 ARG B N     1 
ATOM   6493  C  CA    . ARG B  1 400 ? 4.010   -13.424  12.861  1.00 141.85 ? 400 ARG B CA    1 
ATOM   6494  C  C     . ARG B  1 400 ? 3.946   -11.923  12.547  1.00 146.43 ? 400 ARG B C     1 
ATOM   6495  O  O     . ARG B  1 400 ? 3.459   -11.139  13.365  1.00 148.96 ? 400 ARG B O     1 
ATOM   6496  C  CB    . ARG B  1 400 ? 5.199   -13.699  13.779  1.00 140.30 ? 400 ARG B CB    1 
ATOM   6497  C  CG    . ARG B  1 400 ? 4.931   -14.673  14.918  1.00 138.04 ? 400 ARG B CG    1 
ATOM   6498  C  CD    . ARG B  1 400 ? 5.776   -14.290  16.135  1.00 139.16 ? 400 ARG B CD    1 
ATOM   6499  N  NE    . ARG B  1 400 ? 5.921   -12.833  16.222  1.00 143.24 ? 400 ARG B NE    1 
ATOM   6500  C  CZ    . ARG B  1 400 ? 6.355   -12.151  17.281  1.00 145.21 ? 400 ARG B CZ    1 
ATOM   6501  N  NH1   . ARG B  1 400 ? 6.706   -12.765  18.409  1.00 143.67 ? 400 ARG B NH1   1 
ATOM   6502  N  NH2   . ARG B  1 400 ? 6.431   -10.831  17.206  1.00 149.38 ? 400 ARG B NH2   1 
ATOM   6503  N  N     . GLU B  1 401 ? 4.444   -11.527  11.373  1.00 147.96 ? 401 GLU B N     1 
ATOM   6504  C  CA    . GLU B  1 401 ? 4.363   -10.131  10.929  1.00 152.80 ? 401 GLU B CA    1 
ATOM   6505  C  C     . GLU B  1 401 ? 2.923   -9.725   10.627  1.00 155.30 ? 401 GLU B C     1 
ATOM   6506  O  O     . GLU B  1 401 ? 2.372   -8.832   11.277  1.00 158.67 ? 401 GLU B O     1 
ATOM   6507  C  CB    . GLU B  1 401 ? 5.253   -9.863   9.703   1.00 153.63 ? 401 GLU B CB    1 
ATOM   6508  C  CG    . GLU B  1 401 ? 6.761   -9.998   9.939   1.00 152.84 ? 401 GLU B CG    1 
ATOM   6509  C  CD    . GLU B  1 401 ? 7.253   -9.266   11.182  1.00 155.16 ? 401 GLU B CD    1 
ATOM   6510  O  OE1   . GLU B  1 401 ? 7.056   -8.030   11.281  1.00 159.59 ? 401 GLU B OE1   1 
ATOM   6511  O  OE2   . GLU B  1 401 ? 7.848   -9.932   12.058  1.00 152.45 ? 401 GLU B OE2   1 
ATOM   6512  N  N     . VAL B  1 402 ? 2.319   -10.393  9.649   1.00 154.12 ? 402 VAL B N     1 
ATOM   6513  C  CA    . VAL B  1 402 ? 0.971   -10.062  9.198   1.00 156.71 ? 402 VAL B CA    1 
ATOM   6514  C  C     . VAL B  1 402 ? -0.086  -10.347  10.270  1.00 156.60 ? 402 VAL B C     1 
ATOM   6515  O  O     . VAL B  1 402 ? -1.004  -9.549   10.460  1.00 160.15 ? 402 VAL B O     1 
ATOM   6516  C  CB    . VAL B  1 402 ? 0.609   -10.804  7.893   1.00 155.20 ? 402 VAL B CB    1 
ATOM   6517  C  CG1   . VAL B  1 402 ? -0.559  -10.112  7.196   1.00 158.92 ? 402 VAL B CG1   1 
ATOM   6518  C  CG2   . VAL B  1 402 ? 1.815   -10.865  6.962   1.00 154.74 ? 402 VAL B CG2   1 
ATOM   6519  N  N     . ALA B  1 403 ? 0.065   -11.471  10.974  1.00 153.04 ? 403 ALA B N     1 
ATOM   6520  C  CA    . ALA B  1 403 ? -0.889  -11.910  12.006  1.00 152.67 ? 403 ALA B CA    1 
ATOM   6521  C  C     . ALA B  1 403 ? -1.049  -10.933  13.171  1.00 156.02 ? 403 ALA B C     1 
ATOM   6522  O  O     . ALA B  1 403 ? -2.049  -10.988  13.894  1.00 157.10 ? 403 ALA B O     1 
ATOM   6523  C  CB    . ALA B  1 403 ? -0.511  -13.296  12.527  1.00 148.20 ? 403 ALA B CB    1 
ATOM   6524  N  N     . ALA B  1 404 ? -0.060  -10.055  13.345  1.00 157.99 ? 404 ALA B N     1 
ATOM   6525  C  CA    . ALA B  1 404 ? -0.083  -9.026   14.383  1.00 161.72 ? 404 ALA B CA    1 
ATOM   6526  C  C     . ALA B  1 404 ? -0.528  -7.676   13.827  1.00 167.10 ? 404 ALA B C     1 
ATOM   6527  O  O     . ALA B  1 404 ? -0.751  -6.732   14.590  1.00 171.06 ? 404 ALA B O     1 
ATOM   6528  C  CB    . ALA B  1 404 ? 1.286   -8.904   15.042  1.00 160.85 ? 404 ALA B CB    1 
ATOM   6529  N  N     . PHE B  1 405 ? -0.649  -7.590   12.501  1.00 167.63 ? 405 PHE B N     1 
ATOM   6530  C  CA    . PHE B  1 405 ? -1.112  -6.367   11.832  1.00 172.95 ? 405 PHE B CA    1 
ATOM   6531  C  C     . PHE B  1 405 ? -2.366  -6.587   10.976  1.00 173.66 ? 405 PHE B C     1 
ATOM   6532  O  O     . PHE B  1 405 ? -2.827  -5.672   10.283  1.00 177.79 ? 405 PHE B O     1 
ATOM   6533  C  CB    . PHE B  1 405 ? 0.019   -5.728   11.013  1.00 174.29 ? 405 PHE B CB    1 
ATOM   6534  C  CG    . PHE B  1 405 ? 1.039   -5.004   11.855  1.00 176.36 ? 405 PHE B CG    1 
ATOM   6535  C  CD1   . PHE B  1 405 ? 0.881   -3.649   12.154  1.00 182.27 ? 405 PHE B CD1   1 
ATOM   6536  C  CD2   . PHE B  1 405 ? 2.154   -5.676   12.357  1.00 172.93 ? 405 PHE B CD2   1 
ATOM   6537  C  CE1   . PHE B  1 405 ? 1.821   -2.970   12.939  1.00 184.28 ? 405 PHE B CE1   1 
ATOM   6538  C  CE2   . PHE B  1 405 ? 3.100   -5.008   13.142  1.00 174.90 ? 405 PHE B CE2   1 
ATOM   6539  C  CZ    . PHE B  1 405 ? 2.931   -3.650   13.433  1.00 180.44 ? 405 PHE B CZ    1 
ATOM   6540  N  N     . ALA B  1 406 ? -2.906  -7.805   11.039  1.00 169.82 ? 406 ALA B N     1 
ATOM   6541  C  CA    . ALA B  1 406 ? -4.178  -8.144   10.402  1.00 170.32 ? 406 ALA B CA    1 
ATOM   6542  C  C     . ALA B  1 406 ? -5.332  -8.075   11.406  1.00 172.18 ? 406 ALA B C     1 
ATOM   6543  O  O     . ALA B  1 406 ? -6.501  -8.130   11.018  1.00 173.81 ? 406 ALA B O     1 
ATOM   6544  C  CB    . ALA B  1 406 ? -4.108  -9.526   9.762   1.00 165.45 ? 406 ALA B CB    1 
ATOM   6545  N  N     . GLN B  1 407 ? -4.994  -7.954   12.690  1.00 172.21 ? 407 GLN B N     1 
ATOM   6546  C  CA    . GLN B  1 407 ? -5.990  -7.814   13.754  1.00 174.42 ? 407 GLN B CA    1 
ATOM   6547  C  C     . GLN B  1 407 ? -6.179  -6.349   14.141  1.00 180.44 ? 407 GLN B C     1 
ATOM   6548  O  O     . GLN B  1 407 ? -6.447  -5.501   13.288  1.00 183.98 ? 407 GLN B O     1 
ATOM   6549  C  CB    . GLN B  1 407 ? -5.606  -8.648   14.983  1.00 171.06 ? 407 GLN B CB    1 
ATOM   6550  C  CG    . GLN B  1 407 ? -5.705  -10.164  14.783  1.00 165.90 ? 407 GLN B CG    1 
ATOM   6551  C  CD    . GLN B  1 407 ? -7.135  -10.656  14.598  1.00 166.50 ? 407 GLN B CD    1 
ATOM   6552  O  OE1   . GLN B  1 407 ? -8.012  -10.383  15.420  1.00 169.17 ? 407 GLN B OE1   1 
ATOM   6553  N  NE2   . GLN B  1 407 ? -7.369  -11.395  13.518  1.00 164.04 ? 407 GLN B NE2   1 
ATOM   6554  N  N     . SER B  1 410 ? -6.901  -5.386   10.560  1.00 182.45 ? 410 SER B N     1 
ATOM   6555  C  CA    . SER B  1 410 ? -6.734  -4.096   9.903   1.00 187.63 ? 410 SER B CA    1 
ATOM   6556  C  C     . SER B  1 410 ? -7.114  -4.130   8.421   1.00 188.29 ? 410 SER B C     1 
ATOM   6557  O  O     . SER B  1 410 ? -7.383  -3.083   7.828   1.00 193.38 ? 410 SER B O     1 
ATOM   6558  C  CB    . SER B  1 410 ? -5.298  -3.593   10.069  1.00 187.49 ? 410 SER B CB    1 
ATOM   6559  N  N     . ASP B  1 411 ? -7.137  -5.328   7.831   1.00 183.55 ? 411 ASP B N     1 
ATOM   6560  C  CA    . ASP B  1 411 ? -7.441  -5.489   6.402   1.00 183.84 ? 411 ASP B CA    1 
ATOM   6561  C  C     . ASP B  1 411 ? -7.869  -6.911   6.015   1.00 179.09 ? 411 ASP B C     1 
ATOM   6562  O  O     . ASP B  1 411 ? -7.440  -7.891   6.628   1.00 174.50 ? 411 ASP B O     1 
ATOM   6563  C  CB    . ASP B  1 411 ? -6.231  -5.073   5.552   1.00 184.01 ? 411 ASP B CB    1 
ATOM   6564  C  CG    . ASP B  1 411 ? -6.623  -4.608   4.162   1.00 187.13 ? 411 ASP B CG    1 
ATOM   6565  O  OD1   . ASP B  1 411 ? -6.391  -5.364   3.195   1.00 184.20 ? 411 ASP B OD1   1 
ATOM   6566  O  OD2   . ASP B  1 411 ? -7.164  -3.488   4.038   1.00 192.56 ? 411 ASP B OD2   1 
ATOM   6567  N  N     . LEU B  1 412 ? -8.725  -7.000   4.996   1.00 180.62 ? 412 LEU B N     1 
ATOM   6568  C  CA    . LEU B  1 412 ? -9.058  -8.267   4.342   1.00 176.83 ? 412 LEU B CA    1 
ATOM   6569  C  C     . LEU B  1 412 ? -8.376  -8.305   2.974   1.00 176.42 ? 412 LEU B C     1 
ATOM   6570  O  O     . LEU B  1 412 ? -9.002  -8.038   1.944   1.00 179.05 ? 412 LEU B O     1 
ATOM   6571  C  CB    . LEU B  1 412 ? -10.578 -8.436   4.186   1.00 178.88 ? 412 LEU B CB    1 
ATOM   6572  C  CG    . LEU B  1 412 ? -11.491 -8.658   5.400   1.00 179.27 ? 412 LEU B CG    1 
ATOM   6573  C  CD1   . LEU B  1 412 ? -12.950 -8.478   4.991   1.00 182.76 ? 412 LEU B CD1   1 
ATOM   6574  C  CD2   . LEU B  1 412 ? -11.277 -10.023  6.061   1.00 173.55 ? 412 LEU B CD2   1 
ATOM   6575  N  N     . ASP B  1 413 ? -7.086  -8.629   2.978   1.00 173.39 ? 413 ASP B N     1 
ATOM   6576  C  CA    . ASP B  1 413 ? -6.270  -8.642   1.765   1.00 173.16 ? 413 ASP B CA    1 
ATOM   6577  C  C     . ASP B  1 413 ? -6.139  -10.064  1.214   1.00 168.76 ? 413 ASP B C     1 
ATOM   6578  O  O     . ASP B  1 413 ? -5.730  -10.975  1.934   1.00 164.67 ? 413 ASP B O     1 
ATOM   6579  C  CB    . ASP B  1 413 ? -4.882  -8.062   2.067   1.00 173.17 ? 413 ASP B CB    1 
ATOM   6580  C  CG    . ASP B  1 413 ? -4.129  -7.626   0.817   1.00 174.66 ? 413 ASP B CG    1 
ATOM   6581  O  OD1   . ASP B  1 413 ? -4.351  -8.190   -0.275  1.00 173.40 ? 413 ASP B OD1   1 
ATOM   6582  O  OD2   . ASP B  1 413 ? -3.289  -6.712   0.934   1.00 176.96 ? 413 ASP B OD2   1 
ATOM   6583  N  N     . ALA B  1 414 ? -6.479  -10.240  -0.062  1.00 169.94 ? 414 ALA B N     1 
ATOM   6584  C  CA    . ALA B  1 414 ? -6.364  -11.539  -0.739  1.00 166.54 ? 414 ALA B CA    1 
ATOM   6585  C  C     . ALA B  1 414 ? -4.910  -12.012  -0.852  1.00 163.66 ? 414 ALA B C     1 
ATOM   6586  O  O     . ALA B  1 414 ? -4.626  -13.202  -0.688  1.00 159.87 ? 414 ALA B O     1 
ATOM   6587  C  CB    . ALA B  1 414 ? -7.024  -11.488  -2.118  1.00 168.99 ? 414 ALA B CB    1 
ATOM   6588  N  N     . SER B  1 415 ? -4.006  -11.070  -1.131  1.00 165.90 ? 415 SER B N     1 
ATOM   6589  C  CA    . SER B  1 415 ? -2.564  -11.326  -1.206  1.00 163.83 ? 415 SER B CA    1 
ATOM   6590  C  C     . SER B  1 415 ? -2.041  -11.895  0.114   1.00 160.05 ? 415 SER B C     1 
ATOM   6591  O  O     . SER B  1 415 ? -1.489  -13.000  0.152   1.00 156.39 ? 415 SER B O     1 
ATOM   6592  C  CB    . SER B  1 415 ? -1.818  -10.035  -1.574  1.00 167.66 ? 415 SER B CB    1 
ATOM   6593  O  OG    . SER B  1 415 ? -0.413  -10.208  -1.515  1.00 166.21 ? 415 SER B OG    1 
ATOM   6594  N  N     . THR B  1 416 ? -2.226  -11.133  1.188   1.00 161.23 ? 416 THR B N     1 
ATOM   6595  C  CA    . THR B  1 416 ? -1.887  -11.598  2.528   1.00 158.18 ? 416 THR B CA    1 
ATOM   6596  C  C     . THR B  1 416 ? -3.110  -12.220  3.214   1.00 156.82 ? 416 THR B C     1 
ATOM   6597  O  O     . THR B  1 416 ? -3.740  -11.618  4.089   1.00 158.70 ? 416 THR B O     1 
ATOM   6598  C  CB    . THR B  1 416 ? -1.239  -10.488  3.398   1.00 160.22 ? 416 THR B CB    1 
ATOM   6599  O  OG1   . THR B  1 416 ? -1.944  -9.254   3.214   1.00 164.99 ? 416 THR B OG1   1 
ATOM   6600  C  CG2   . THR B  1 416 ? 0.225   -10.298  3.016   1.00 159.86 ? 416 THR B CG2   1 
ATOM   6601  N  N     . LYS B  1 417 ? -3.447  -13.424  2.764   1.00 153.93 ? 417 LYS B N     1 
ATOM   6602  C  CA    . LYS B  1 417 ? -4.438  -14.283  3.402   1.00 151.87 ? 417 LYS B CA    1 
ATOM   6603  C  C     . LYS B  1 417 ? -4.012  -15.722  3.197   1.00 147.77 ? 417 LYS B C     1 
ATOM   6604  O  O     . LYS B  1 417 ? -4.432  -16.610  3.934   1.00 145.47 ? 417 LYS B O     1 
ATOM   6605  C  CB    . LYS B  1 417 ? -5.835  -14.068  2.822   1.00 154.55 ? 417 LYS B CB    1 
ATOM   6606  C  CG    . LYS B  1 417 ? -6.775  -13.300  3.735   1.00 157.15 ? 417 LYS B CG    1 
ATOM   6607  C  CD    . LYS B  1 417 ? -8.108  -13.045  3.053   1.00 160.33 ? 417 LYS B CD    1 
ATOM   6608  C  CE    . LYS B  1 417 ? -8.995  -12.149  3.901   1.00 163.88 ? 417 LYS B CE    1 
ATOM   6609  N  NZ    . LYS B  1 417 ? -10.230 -11.739  3.177   1.00 167.41 ? 417 LYS B NZ    1 
ATOM   6610  N  N     . GLN B  1 418 ? -3.177  -15.938  2.182   1.00 147.16 ? 418 GLN B N     1 
ATOM   6611  C  CA    . GLN B  1 418 ? -2.578  -17.243  1.926   1.00 143.84 ? 418 GLN B CA    1 
ATOM   6612  C  C     . GLN B  1 418 ? -1.451  -17.476  2.920   1.00 141.23 ? 418 GLN B C     1 
ATOM   6613  O  O     . GLN B  1 418 ? -1.256  -18.594  3.390   1.00 138.39 ? 418 GLN B O     1 
ATOM   6614  C  CB    . GLN B  1 418 ? -2.059  -17.327  0.489   1.00 144.93 ? 418 GLN B CB    1 
ATOM   6615  C  CG    . GLN B  1 418 ? -1.897  -18.746  -0.054  1.00 142.82 ? 418 GLN B CG    1 
ATOM   6616  C  CD    . GLN B  1 418 ? -1.802  -18.780  -1.576  1.00 145.50 ? 418 GLN B CD    1 
ATOM   6617  O  OE1   . GLN B  1 418 ? -1.649  -17.742  -2.229  1.00 148.51 ? 418 GLN B OE1   1 
ATOM   6618  N  NE2   . GLN B  1 418 ? -1.897  -19.978  -2.148  1.00 144.37 ? 418 GLN B NE2   1 
ATOM   6619  N  N     . THR B  1 419 ? -0.720  -16.409  3.238   1.00 142.43 ? 419 THR B N     1 
ATOM   6620  C  CA    . THR B  1 419 ? 0.307   -16.443  4.284   1.00 140.40 ? 419 THR B CA    1 
ATOM   6621  C  C     . THR B  1 419 ? -0.334  -16.736  5.650   1.00 138.88 ? 419 THR B C     1 
ATOM   6622  O  O     . THR B  1 419 ? 0.139   -17.597  6.393   1.00 136.04 ? 419 THR B O     1 
ATOM   6623  C  CB    . THR B  1 419 ? 1.124   -15.122  4.335   1.00 142.88 ? 419 THR B CB    1 
ATOM   6624  O  OG1   . THR B  1 419 ? 0.352   -14.092  4.964   1.00 145.18 ? 419 THR B OG1   1 
ATOM   6625  C  CG2   . THR B  1 419 ? 1.523   -14.675  2.926   1.00 144.87 ? 419 THR B CG2   1 
ATOM   6626  N  N     . LEU B  1 420 ? -1.424  -16.027  5.946   1.00 140.90 ? 420 LEU B N     1 
ATOM   6627  C  CA    . LEU B  1 420 ? -2.222  -16.232  7.157   1.00 140.25 ? 420 LEU B CA    1 
ATOM   6628  C  C     . LEU B  1 420 ? -2.931  -17.584  7.192   1.00 137.77 ? 420 LEU B C     1 
ATOM   6629  O  O     . LEU B  1 420 ? -3.493  -17.963  8.217   1.00 137.08 ? 420 LEU B O     1 
ATOM   6630  C  CB    . LEU B  1 420 ? -3.270  -15.121  7.311   1.00 143.95 ? 420 LEU B CB    1 
ATOM   6631  C  CG    . LEU B  1 420 ? -2.870  -13.691  7.692   1.00 147.29 ? 420 LEU B CG    1 
ATOM   6632  C  CD1   . LEU B  1 420 ? -4.099  -12.792  7.703   1.00 151.18 ? 420 LEU B CD1   1 
ATOM   6633  C  CD2   . LEU B  1 420 ? -2.171  -13.641  9.041   1.00 146.28 ? 420 LEU B CD2   1 
ATOM   6634  N  N     . VAL B  1 421 ? -2.926  -18.294  6.068   1.00 136.83 ? 421 VAL B N     1 
ATOM   6635  C  CA    . VAL B  1 421 ? -3.532  -19.625  5.992   1.00 134.79 ? 421 VAL B CA    1 
ATOM   6636  C  C     . VAL B  1 421 ? -2.460  -20.708  5.798   1.00 131.94 ? 421 VAL B C     1 
ATOM   6637  O  O     . VAL B  1 421 ? -2.705  -21.880  6.070   1.00 130.15 ? 421 VAL B O     1 
ATOM   6638  C  CB    . VAL B  1 421 ? -4.684  -19.684  4.934   1.00 136.57 ? 421 VAL B CB    1 
ATOM   6639  C  CG1   . VAL B  1 421 ? -5.016  -21.114  4.523   1.00 134.80 ? 421 VAL B CG1   1 
ATOM   6640  C  CG2   . VAL B  1 421 ? -5.933  -18.994  5.477   1.00 138.84 ? 421 VAL B CG2   1 
ATOM   6641  N  N     . ARG B  1 422 ? -1.273  -20.313  5.338   1.00 131.75 ? 422 ARG B N     1 
ATOM   6642  C  CA    . ARG B  1 422 ? -0.104  -21.180  5.442   1.00 129.28 ? 422 ARG B CA    1 
ATOM   6643  C  C     . ARG B  1 422 ? 0.290   -21.204  6.904   1.00 128.00 ? 422 ARG B C     1 
ATOM   6644  O  O     . ARG B  1 422 ? 0.387   -22.270  7.519   1.00 126.06 ? 422 ARG B O     1 
ATOM   6645  C  CB    . ARG B  1 422 ? 1.067   -20.658  4.610   1.00 129.97 ? 422 ARG B CB    1 
ATOM   6646  C  CG    . ARG B  1 422 ? 0.920   -20.852  3.119   1.00 131.23 ? 422 ARG B CG    1 
ATOM   6647  C  CD    . ARG B  1 422 ? 0.877   -22.323  2.722   1.00 128.83 ? 422 ARG B CD    1 
ATOM   6648  N  NE    . ARG B  1 422 ? 0.587   -22.475  1.301   1.00 129.48 ? 422 ARG B NE    1 
ATOM   6649  C  CZ    . ARG B  1 422 ? 1.501   -22.416  0.337   1.00 130.40 ? 422 ARG B CZ    1 
ATOM   6650  N  NH1   . ARG B  1 422 ? 2.777   -22.206  0.633   1.00 129.89 ? 422 ARG B NH1   1 
ATOM   6651  N  NH2   . ARG B  1 422 ? 1.138   -22.570  -0.930  1.00 132.12 ? 422 ARG B NH2   1 
ATOM   6652  N  N     . GLY B  1 423 ? 0.490   -20.008  7.453   1.00 129.29 ? 423 GLY B N     1 
ATOM   6653  C  CA    . GLY B  1 423 ? 0.876   -19.835  8.836   1.00 128.47 ? 423 GLY B CA    1 
ATOM   6654  C  C     . GLY B  1 423 ? -0.029  -20.578  9.791   1.00 127.40 ? 423 GLY B C     1 
ATOM   6655  O  O     . GLY B  1 423 ? 0.448   -21.386  10.585  1.00 125.61 ? 423 GLY B O     1 
ATOM   6656  N  N     . GLU B  1 424 ? -1.333  -20.320  9.700   1.00 128.85 ? 424 GLU B N     1 
ATOM   6657  C  CA    . GLU B  1 424 ? -2.307  -20.902  10.632  1.00 128.52 ? 424 GLU B CA    1 
ATOM   6658  C  C     . GLU B  1 424 ? -2.295  -22.429  10.577  1.00 126.06 ? 424 GLU B C     1 
ATOM   6659  O  O     . GLU B  1 424 ? -2.331  -23.086  11.623  1.00 125.04 ? 424 GLU B O     1 
ATOM   6660  C  CB    . GLU B  1 424 ? -3.720  -20.358  10.375  1.00 131.07 ? 424 GLU B CB    1 
ATOM   6661  C  CG    . GLU B  1 424 ? -4.525  -20.023  11.648  1.00 132.60 ? 424 GLU B CG    1 
ATOM   6662  C  CD    . GLU B  1 424 ? -5.881  -19.379  11.346  1.00 135.65 ? 424 GLU B CD    1 
ATOM   6663  O  OE1   . GLU B  1 424 ? -6.700  -20.015  10.644  1.00 136.01 ? 424 GLU B OE1   1 
ATOM   6664  O  OE2   . GLU B  1 424 ? -6.129  -18.245  11.816  1.00 137.16 ? 424 GLU B OE2   1 
ATOM   6665  N  N     . ARG B  1 425 ? -2.227  -22.979  9.361   1.00 125.41 ? 425 ARG B N     1 
ATOM   6666  C  CA    . ARG B  1 425 ? -2.126  -24.425  9.151   1.00 123.42 ? 425 ARG B CA    1 
ATOM   6667  C  C     . ARG B  1 425 ? -0.809  -24.972  9.711   1.00 121.52 ? 425 ARG B C     1 
ATOM   6668  O  O     . ARG B  1 425 ? -0.802  -25.997  10.401  1.00 120.35 ? 425 ARG B O     1 
ATOM   6669  C  CB    . ARG B  1 425 ? -2.255  -24.799  7.661   1.00 123.93 ? 425 ARG B CB    1 
ATOM   6670  C  CG    . ARG B  1 425 ? -3.574  -24.424  6.963   1.00 125.40 ? 425 ARG B CG    1 
ATOM   6671  C  CD    . ARG B  1 425 ? -4.788  -25.156  7.515   1.00 124.88 ? 425 ARG B CD    1 
ATOM   6672  N  NE    . ARG B  1 425 ? -5.944  -25.026  6.632   1.00 126.19 ? 425 ARG B NE    1 
ATOM   6673  C  CZ    . ARG B  1 425 ? -6.826  -24.029  6.669   1.00 128.28 ? 425 ARG B CZ    1 
ATOM   6674  N  NH1   . ARG B  1 425 ? -6.708  -23.048  7.551   1.00 128.92 ? 425 ARG B NH1   1 
ATOM   6675  N  NH2   . ARG B  1 425 ? -7.838  -24.015  5.814   1.00 130.56 ? 425 ARG B NH2   1 
ATOM   6676  N  N     . LEU B  1 426 ? 0.295   -24.286  9.415   1.00 121.33 ? 426 LEU B N     1 
ATOM   6677  C  CA    . LEU B  1 426 ? 1.610   -24.684  9.919   1.00 119.80 ? 426 LEU B CA    1 
ATOM   6678  C  C     . LEU B  1 426 ? 1.702   -24.603  11.449  1.00 119.10 ? 426 LEU B C     1 
ATOM   6679  O  O     . LEU B  1 426 ? 2.350   -25.444  12.082  1.00 117.81 ? 426 LEU B O     1 
ATOM   6680  C  CB    . LEU B  1 426 ? 2.714   -23.851  9.265   1.00 120.53 ? 426 LEU B CB    1 
ATOM   6681  C  CG    . LEU B  1 426 ? 3.008   -24.142  7.791   1.00 120.96 ? 426 LEU B CG    1 
ATOM   6682  C  CD1   . LEU B  1 426 ? 3.701   -22.954  7.156   1.00 122.50 ? 426 LEU B CD1   1 
ATOM   6683  C  CD2   . LEU B  1 426 ? 3.845   -25.400  7.628   1.00 119.59 ? 426 LEU B CD2   1 
ATOM   6684  N  N     . THR B  1 427 ? 1.042   -23.595  12.024  1.00 120.10 ? 427 THR B N     1 
ATOM   6685  C  CA    . THR B  1 427 ? 0.927   -23.423  13.476  1.00 119.83 ? 427 THR B CA    1 
ATOM   6686  C  C     . THR B  1 427 ? 0.242   -24.637  14.133  1.00 118.87 ? 427 THR B C     1 
ATOM   6687  O  O     . THR B  1 427 ? 0.631   -25.064  15.226  1.00 118.16 ? 427 THR B O     1 
ATOM   6688  C  CB    . THR B  1 427 ? 0.180   -22.101  13.825  1.00 122.03 ? 427 THR B CB    1 
ATOM   6689  O  OG1   . THR B  1 427 ? 0.849   -20.994  13.211  1.00 122.75 ? 427 THR B OG1   1 
ATOM   6690  C  CG2   . THR B  1 427 ? 0.132   -21.863  15.325  1.00 122.28 ? 427 THR B CG2   1 
ATOM   6691  N  N     . GLN B  1 428 ? -0.767  -25.186  13.456  1.00 118.99 ? 428 GLN B N     1 
ATOM   6692  C  CA    . GLN B  1 428 ? -1.455  -26.401  13.903  1.00 118.26 ? 428 GLN B CA    1 
ATOM   6693  C  C     . GLN B  1 428 ? -0.660  -27.661  13.562  1.00 116.55 ? 428 GLN B C     1 
ATOM   6694  O  O     . GLN B  1 428 ? -0.811  -28.692  14.226  1.00 115.92 ? 428 GLN B O     1 
ATOM   6695  C  CB    . GLN B  1 428 ? -2.857  -26.491  13.288  1.00 119.53 ? 428 GLN B CB    1 
ATOM   6696  C  CG    . GLN B  1 428 ? -3.899  -25.546  13.904  1.00 121.80 ? 428 GLN B CG    1 
ATOM   6697  C  CD    . GLN B  1 428 ? -4.594  -26.115  15.143  1.00 122.49 ? 428 GLN B CD    1 
ATOM   6698  O  OE1   . GLN B  1 428 ? -5.214  -25.375  15.912  1.00 124.14 ? 428 GLN B OE1   1 
ATOM   6699  N  NE2   . GLN B  1 428 ? -4.496  -27.429  15.336  1.00 120.96 ? 428 GLN B NE2   1 
ATOM   6700  N  N     . LEU B  1 429 ? 0.174   -27.565  12.522  1.00 116.02 ? 429 LEU B N     1 
ATOM   6701  C  CA    . LEU B  1 429 ? 1.016   -28.677  12.061  1.00 114.87 ? 429 LEU B CA    1 
ATOM   6702  C  C     . LEU B  1 429 ? 2.151   -28.984  13.029  1.00 113.75 ? 429 LEU B C     1 
ATOM   6703  O  O     . LEU B  1 429 ? 2.583   -30.135  13.138  1.00 113.21 ? 429 LEU B O     1 
ATOM   6704  C  CB    . LEU B  1 429 ? 1.596   -28.385  10.669  1.00 115.28 ? 429 LEU B CB    1 
ATOM   6705  C  CG    . LEU B  1 429 ? 2.544   -29.414  10.033  1.00 114.85 ? 429 LEU B CG    1 
ATOM   6706  C  CD1   . LEU B  1 429 ? 1.783   -30.648  9.559   1.00 115.57 ? 429 LEU B CD1   1 
ATOM   6707  C  CD2   . LEU B  1 429 ? 3.330   -28.805  8.887   1.00 115.23 ? 429 LEU B CD2   1 
ATOM   6708  N  N     . LEU B  1 430 ? 2.636   -27.955  13.720  1.00 113.51 ? 430 LEU B N     1 
ATOM   6709  C  CA    . LEU B  1 430 ? 3.745   -28.120  14.660  1.00 112.42 ? 430 LEU B CA    1 
ATOM   6710  C  C     . LEU B  1 430 ? 3.285   -28.391  16.091  1.00 112.02 ? 430 LEU B C     1 
ATOM   6711  O  O     . LEU B  1 430 ? 4.109   -28.687  16.962  1.00 111.60 ? 430 LEU B O     1 
ATOM   6712  C  CB    . LEU B  1 430 ? 4.689   -26.915  14.610  1.00 112.83 ? 430 LEU B CB    1 
ATOM   6713  C  CG    . LEU B  1 430 ? 5.300   -26.501  13.265  1.00 113.27 ? 430 LEU B CG    1 
ATOM   6714  C  CD1   . LEU B  1 430 ? 6.205   -25.310  13.510  1.00 114.37 ? 430 LEU B CD1   1 
ATOM   6715  C  CD2   . LEU B  1 430 ? 6.065   -27.624  12.559  1.00 112.17 ? 430 LEU B CD2   1 
ATOM   6716  N  N     . LYS B  1 431 ? 1.975   -28.282  16.325  1.00 112.35 ? 431 LYS B N     1 
ATOM   6717  C  CA    . LYS B  1 431 ? 1.361   -28.707  17.585  1.00 112.29 ? 431 LYS B CA    1 
ATOM   6718  C  C     . LYS B  1 431 ? 1.631   -30.191  17.787  1.00 111.40 ? 431 LYS B C     1 
ATOM   6719  O  O     . LYS B  1 431 ? 1.620   -30.965  16.827  1.00 111.29 ? 431 LYS B O     1 
ATOM   6720  C  CB    . LYS B  1 431 ? -0.149  -28.490  17.560  1.00 113.45 ? 431 LYS B CB    1 
ATOM   6721  C  CG    . LYS B  1 431 ? -0.638  -27.148  18.055  1.00 114.88 ? 431 LYS B CG    1 
ATOM   6722  C  CD    . LYS B  1 431 ? -2.099  -27.276  18.457  1.00 116.63 ? 431 LYS B CD    1 
ATOM   6723  C  CE    . LYS B  1 431 ? -2.690  -25.962  18.918  1.00 119.12 ? 431 LYS B CE    1 
ATOM   6724  N  NZ    . LYS B  1 431 ? -3.855  -26.200  19.820  1.00 120.84 ? 431 LYS B NZ    1 
ATOM   6725  N  N     . GLN B  1 432 ? 1.869   -30.590  19.030  1.00 111.07 ? 432 GLN B N     1 
ATOM   6726  C  CA    . GLN B  1 432 ? 2.240   -31.968  19.306  1.00 110.45 ? 432 GLN B CA    1 
ATOM   6727  C  C     . GLN B  1 432 ? 1.760   -32.440  20.675  1.00 111.47 ? 432 GLN B C     1 
ATOM   6728  O  O     . GLN B  1 432 ? 1.806   -31.694  21.660  1.00 111.84 ? 432 GLN B O     1 
ATOM   6729  C  CB    . GLN B  1 432 ? 3.755   -32.122  19.181  1.00 109.38 ? 432 GLN B CB    1 
ATOM   6730  C  CG    . GLN B  1 432 ? 4.244   -33.541  19.038  1.00 108.18 ? 432 GLN B CG    1 
ATOM   6731  C  CD    . GLN B  1 432 ? 5.601   -33.614  18.375  1.00 106.66 ? 432 GLN B CD    1 
ATOM   6732  O  OE1   . GLN B  1 432 ? 5.932   -32.795  17.515  1.00 105.58 ? 432 GLN B OE1   1 
ATOM   6733  N  NE2   . GLN B  1 432 ? 6.397   -34.602  18.766  1.00 106.85 ? 432 GLN B NE2   1 
ATOM   6734  N  N     . ASN B  1 433 ? 1.284   -33.682  20.719  1.00 112.16 ? 433 ASN B N     1 
ATOM   6735  C  CA    . ASN B  1 433 ? 0.988   -34.357  21.979  1.00 113.44 ? 433 ASN B CA    1 
ATOM   6736  C  C     . ASN B  1 433 ? 2.284   -34.686  22.717  1.00 113.00 ? 433 ASN B C     1 
ATOM   6737  O  O     . ASN B  1 433 ? 3.366   -34.728  22.117  1.00 112.04 ? 433 ASN B O     1 
ATOM   6738  C  CB    . ASN B  1 433 ? 0.175   -35.640  21.740  1.00 114.71 ? 433 ASN B CB    1 
ATOM   6739  C  CG    . ASN B  1 433 ? -1.291  -35.368  21.396  1.00 116.15 ? 433 ASN B CG    1 
ATOM   6740  O  OD1   . ASN B  1 433 ? -1.604  -34.522  20.555  1.00 117.28 ? 433 ASN B OD1   1 
ATOM   6741  N  ND2   . ASN B  1 433 ? -2.193  -36.105  22.037  1.00 117.62 ? 433 ASN B ND2   1 
ATOM   6742  N  N     . GLN B  1 434 ? 2.181   -34.915  24.020  1.00 113.87 ? 434 GLN B N     1 
ATOM   6743  C  CA    . GLN B  1 434 ? 3.366   -35.227  24.796  1.00 113.90 ? 434 GLN B CA    1 
ATOM   6744  C  C     . GLN B  1 434 ? 3.622   -36.735  24.846  1.00 114.81 ? 434 GLN B C     1 
ATOM   6745  O  O     . GLN B  1 434 ? 2.694   -37.541  24.716  1.00 115.77 ? 434 GLN B O     1 
ATOM   6746  C  CB    . GLN B  1 434 ? 3.286   -34.623  26.196  1.00 114.59 ? 434 GLN B CB    1 
ATOM   6747  C  CG    . GLN B  1 434 ? 4.650   -34.296  26.760  1.00 114.13 ? 434 GLN B CG    1 
ATOM   6748  C  CD    . GLN B  1 434 ? 4.633   -34.052  28.248  1.00 115.66 ? 434 GLN B CD    1 
ATOM   6749  O  OE1   . GLN B  1 434 ? 3.601   -33.705  28.822  1.00 116.73 ? 434 GLN B OE1   1 
ATOM   6750  N  NE2   . GLN B  1 434 ? 5.786   -34.227  28.887  1.00 115.57 ? 434 GLN B NE2   1 
ATOM   6751  N  N     . TYR B  1 435 ? 4.894   -37.093  25.038  1.00 114.68 ? 435 TYR B N     1 
ATOM   6752  C  CA    . TYR B  1 435 ? 5.379   -38.479  25.011  1.00 115.59 ? 435 TYR B CA    1 
ATOM   6753  C  C     . TYR B  1 435 ? 5.180   -39.114  23.632  1.00 115.81 ? 435 TYR B C     1 
ATOM   6754  O  O     . TYR B  1 435 ? 5.162   -40.340  23.498  1.00 117.52 ? 435 TYR B O     1 
ATOM   6755  C  CB    . TYR B  1 435 ? 4.751   -39.325  26.130  1.00 117.17 ? 435 TYR B CB    1 
ATOM   6756  C  CG    . TYR B  1 435 ? 4.567   -38.581  27.434  1.00 116.38 ? 435 TYR B CG    1 
ATOM   6757  C  CD1   . TYR B  1 435 ? 5.651   -38.318  28.273  1.00 115.47 ? 435 TYR B CD1   1 
ATOM   6758  C  CD2   . TYR B  1 435 ? 3.307   -38.136  27.829  1.00 115.98 ? 435 TYR B CD2   1 
ATOM   6759  C  CE1   . TYR B  1 435 ? 5.483   -37.624  29.476  1.00 115.23 ? 435 TYR B CE1   1 
ATOM   6760  C  CE2   . TYR B  1 435 ? 3.129   -37.445  29.025  1.00 116.29 ? 435 TYR B CE2   1 
ATOM   6761  C  CZ    . TYR B  1 435 ? 4.219   -37.191  29.844  1.00 115.43 ? 435 TYR B CZ    1 
ATOM   6762  O  OH    . TYR B  1 435 ? 4.034   -36.514  31.025  1.00 115.03 ? 435 TYR B OH    1 
ATOM   6763  N  N     . SER B  1 436 ? 5.057   -38.268  22.611  1.00 114.67 ? 436 SER B N     1 
ATOM   6764  C  CA    . SER B  1 436 ? 4.825   -38.723  21.239  1.00 115.03 ? 436 SER B CA    1 
ATOM   6765  C  C     . SER B  1 436 ? 5.925   -38.270  20.267  1.00 114.38 ? 436 SER B C     1 
ATOM   6766  O  O     . SER B  1 436 ? 5.618   -37.720  19.202  1.00 113.67 ? 436 SER B O     1 
ATOM   6767  C  CB    . SER B  1 436 ? 3.456   -38.238  20.741  1.00 114.68 ? 436 SER B CB    1 
ATOM   6768  O  OG    . SER B  1 436 ? 2.427   -38.544  21.664  1.00 115.66 ? 436 SER B OG    1 
ATOM   6769  N  N     . PRO B  1 437 ? 7.210   -38.517  20.610  1.00 114.91 ? 437 PRO B N     1 
ATOM   6770  C  CA    . PRO B  1 437 ? 8.270   -38.033  19.728  1.00 114.52 ? 437 PRO B CA    1 
ATOM   6771  C  C     . PRO B  1 437 ? 8.263   -38.800  18.411  1.00 115.65 ? 437 PRO B C     1 
ATOM   6772  O  O     . PRO B  1 437 ? 7.908   -39.978  18.393  1.00 117.35 ? 437 PRO B O     1 
ATOM   6773  C  CB    . PRO B  1 437 ? 9.555   -38.333  20.512  1.00 115.00 ? 437 PRO B CB    1 
ATOM   6774  C  CG    . PRO B  1 437 ? 9.127   -38.914  21.819  1.00 115.66 ? 437 PRO B CG    1 
ATOM   6775  C  CD    . PRO B  1 437 ? 7.747   -39.412  21.648  1.00 116.11 ? 437 PRO B CD    1 
ATOM   6776  N  N     . LEU B  1 438 ? 8.643   -38.134  17.324  1.00 115.42 ? 438 LEU B N     1 
ATOM   6777  C  CA    . LEU B  1 438 ? 8.580   -38.729  15.988  1.00 116.71 ? 438 LEU B CA    1 
ATOM   6778  C  C     . LEU B  1 438 ? 9.945   -38.904  15.330  1.00 117.85 ? 438 LEU B C     1 
ATOM   6779  O  O     . LEU B  1 438 ? 10.865  -38.123  15.554  1.00 117.09 ? 438 LEU B O     1 
ATOM   6780  C  CB    . LEU B  1 438 ? 7.664   -37.910  15.069  1.00 115.81 ? 438 LEU B CB    1 
ATOM   6781  C  CG    . LEU B  1 438 ? 6.164   -37.857  15.386  1.00 115.65 ? 438 LEU B CG    1 
ATOM   6782  C  CD1   . LEU B  1 438 ? 5.518   -36.668  14.695  1.00 114.72 ? 438 LEU B CD1   1 
ATOM   6783  C  CD2   . LEU B  1 438 ? 5.446   -39.158  15.011  1.00 117.32 ? 438 LEU B CD2   1 
ATOM   6784  N  N     . ALA B  1 439 ? 10.058  -39.937  14.503  1.00 120.34 ? 439 ALA B N     1 
ATOM   6785  C  CA    . ALA B  1 439 ? 11.252  -40.147  13.692  1.00 122.20 ? 439 ALA B CA    1 
ATOM   6786  C  C     . ALA B  1 439 ? 11.406  -39.021  12.664  1.00 121.66 ? 439 ALA B C     1 
ATOM   6787  O  O     . ALA B  1 439 ? 10.457  -38.277  12.388  1.00 120.38 ? 439 ALA B O     1 
ATOM   6788  C  CB    . ALA B  1 439 ? 11.193  -41.507  13.001  1.00 124.55 ? 439 ALA B CB    1 
ATOM   6789  N  N     . THR B  1 440 ? 12.614  -38.893  12.123  1.00 123.03 ? 440 THR B N     1 
ATOM   6790  C  CA    . THR B  1 440 ? 12.893  -37.974  11.026  1.00 123.19 ? 440 THR B CA    1 
ATOM   6791  C  C     . THR B  1 440 ? 11.951  -38.245  9.856   1.00 124.17 ? 440 THR B C     1 
ATOM   6792  O  O     . THR B  1 440 ? 11.313  -37.325  9.329   1.00 123.07 ? 440 THR B O     1 
ATOM   6793  C  CB    . THR B  1 440 ? 14.350  -38.126  10.558  1.00 124.93 ? 440 THR B CB    1 
ATOM   6794  O  OG1   . THR B  1 440 ? 15.231  -37.618  11.571  1.00 124.12 ? 440 THR B OG1   1 
ATOM   6795  C  CG2   . THR B  1 440 ? 14.585  -37.379  9.249   1.00 125.56 ? 440 THR B CG2   1 
ATOM   6796  N  N     . GLU B  1 441 ? 11.860  -39.518  9.476   1.00 126.60 ? 441 GLU B N     1 
ATOM   6797  C  CA    . GLU B  1 441 ? 11.057  -39.943  8.333   1.00 128.25 ? 441 GLU B CA    1 
ATOM   6798  C  C     . GLU B  1 441 ? 9.574   -39.586  8.463   1.00 127.07 ? 441 GLU B C     1 
ATOM   6799  O  O     . GLU B  1 441 ? 8.916   -39.323  7.459   1.00 127.57 ? 441 GLU B O     1 
ATOM   6800  C  CB    . GLU B  1 441 ? 11.239  -41.442  8.042   1.00 131.12 ? 441 GLU B CB    1 
ATOM   6801  C  CG    . GLU B  1 441 ? 11.142  -42.372  9.251   1.00 131.34 ? 441 GLU B CG    1 
ATOM   6802  C  CD    . GLU B  1 441 ? 12.493  -42.694  9.866   1.00 132.14 ? 441 GLU B CD    1 
ATOM   6803  O  OE1   . GLU B  1 441 ? 13.333  -41.776  10.005  1.00 130.99 ? 441 GLU B OE1   1 
ATOM   6804  O  OE2   . GLU B  1 441 ? 12.710  -43.873  10.220  1.00 133.91 ? 441 GLU B OE2   1 
ATOM   6805  N  N     . GLU B  1 442 ? 9.059   -39.582  9.691   1.00 126.08 ? 442 GLU B N     1 
ATOM   6806  C  CA    . GLU B  1 442 ? 7.660   -39.220  9.950   1.00 125.21 ? 442 GLU B CA    1 
ATOM   6807  C  C     . GLU B  1 442 ? 7.440   -37.703  9.851   1.00 123.51 ? 442 GLU B C     1 
ATOM   6808  O  O     . GLU B  1 442 ? 6.320   -37.232  9.632   1.00 122.88 ? 442 GLU B O     1 
ATOM   6809  C  CB    . GLU B  1 442 ? 7.211   -39.737  11.328  1.00 124.87 ? 442 GLU B CB    1 
ATOM   6810  C  CG    . GLU B  1 442 ? 6.906   -41.240  11.389  1.00 127.10 ? 442 GLU B CG    1 
ATOM   6811  C  CD    . GLU B  1 442 ? 6.751   -41.777  12.819  1.00 127.29 ? 442 GLU B CD    1 
ATOM   6812  O  OE1   . GLU B  1 442 ? 7.601   -41.465  13.687  1.00 125.97 ? 442 GLU B OE1   1 
ATOM   6813  O  OE2   . GLU B  1 442 ? 5.783   -42.532  13.068  1.00 128.41 ? 442 GLU B OE2   1 
ATOM   6814  N  N     . GLN B  1 443 ? 8.520   -36.945  10.002  1.00 123.09 ? 443 GLN B N     1 
ATOM   6815  C  CA    . GLN B  1 443 ? 8.422   -35.497  10.051  1.00 121.95 ? 443 GLN B CA    1 
ATOM   6816  C  C     . GLN B  1 443 ? 8.449   -34.860  8.670   1.00 122.69 ? 443 GLN B C     1 
ATOM   6817  O  O     . GLN B  1 443 ? 7.582   -34.043  8.353   1.00 122.30 ? 443 GLN B O     1 
ATOM   6818  C  CB    . GLN B  1 443 ? 9.514   -34.904  10.951  1.00 121.27 ? 443 GLN B CB    1 
ATOM   6819  C  CG    . GLN B  1 443 ? 9.238   -35.078  12.444  1.00 120.59 ? 443 GLN B CG    1 
ATOM   6820  C  CD    . GLN B  1 443 ? 10.311  -34.474  13.333  1.00 120.50 ? 443 GLN B CD    1 
ATOM   6821  O  OE1   . GLN B  1 443 ? 10.964  -33.493  12.971  1.00 120.78 ? 443 GLN B OE1   1 
ATOM   6822  N  NE2   . GLN B  1 443 ? 10.491  -35.056  14.512  1.00 120.65 ? 443 GLN B NE2   1 
ATOM   6823  N  N     . VAL B  1 444 ? 9.420   -35.246  7.843   1.00 124.18 ? 444 VAL B N     1 
ATOM   6824  C  CA    . VAL B  1 444 ? 9.645   -34.560  6.560   1.00 125.07 ? 444 VAL B CA    1 
ATOM   6825  C  C     . VAL B  1 444 ? 8.394   -34.440  5.657   1.00 125.41 ? 444 VAL B C     1 
ATOM   6826  O  O     . VAL B  1 444 ? 8.183   -33.391  5.045   1.00 125.45 ? 444 VAL B O     1 
ATOM   6827  C  CB    . VAL B  1 444 ? 10.917  -35.071  5.785   1.00 127.04 ? 444 VAL B CB    1 
ATOM   6828  C  CG1   . VAL B  1 444 ? 12.065  -35.353  6.751   1.00 126.77 ? 444 VAL B CG1   1 
ATOM   6829  C  CG2   . VAL B  1 444 ? 10.618  -36.300  4.948   1.00 128.99 ? 444 VAL B CG2   1 
ATOM   6830  N  N     . PRO B  1 445 ? 7.554   -35.500  5.593   1.00 125.89 ? 445 PRO B N     1 
ATOM   6831  C  CA    . PRO B  1 445 ? 6.353   -35.415  4.767   1.00 126.42 ? 445 PRO B CA    1 
ATOM   6832  C  C     . PRO B  1 445 ? 5.264   -34.544  5.388   1.00 124.83 ? 445 PRO B C     1 
ATOM   6833  O  O     . PRO B  1 445 ? 4.428   -34.007  4.661   1.00 125.34 ? 445 PRO B O     1 
ATOM   6834  C  CB    . PRO B  1 445 ? 5.871   -36.873  4.682   1.00 127.68 ? 445 PRO B CB    1 
ATOM   6835  C  CG    . PRO B  1 445 ? 6.998   -37.700  5.190   1.00 128.26 ? 445 PRO B CG    1 
ATOM   6836  C  CD    . PRO B  1 445 ? 7.675   -36.840  6.191   1.00 126.51 ? 445 PRO B CD    1 
ATOM   6837  N  N     . LEU B  1 446 ? 5.259   -34.416  6.712   1.00 123.32 ? 446 LEU B N     1 
ATOM   6838  C  CA    . LEU B  1 446 ? 4.308   -33.521  7.366   1.00 122.20 ? 446 LEU B CA    1 
ATOM   6839  C  C     . LEU B  1 446 ? 4.626   -32.072  7.007   1.00 121.96 ? 446 LEU B C     1 
ATOM   6840  O  O     . LEU B  1 446 ? 3.718   -31.285  6.745   1.00 122.26 ? 446 LEU B O     1 
ATOM   6841  C  CB    . LEU B  1 446 ? 4.288   -33.709  8.892   1.00 121.09 ? 446 LEU B CB    1 
ATOM   6842  C  CG    . LEU B  1 446 ? 3.764   -35.006  9.527   1.00 121.44 ? 446 LEU B CG    1 
ATOM   6843  C  CD1   . LEU B  1 446 ? 3.569   -34.801  11.027  1.00 120.08 ? 446 LEU B CD1   1 
ATOM   6844  C  CD2   . LEU B  1 446 ? 2.466   -35.512  8.882   1.00 122.14 ? 446 LEU B CD2   1 
ATOM   6845  N  N     . ILE B  1 447 ? 5.915   -31.737  6.972   1.00 121.76 ? 447 ILE B N     1 
ATOM   6846  C  CA    . ILE B  1 447 ? 6.357   -30.378  6.655   1.00 121.68 ? 447 ILE B CA    1 
ATOM   6847  C  C     . ILE B  1 447 ? 6.343   -30.131  5.141   1.00 122.98 ? 447 ILE B C     1 
ATOM   6848  O  O     . ILE B  1 447 ? 6.303   -28.987  4.693   1.00 123.43 ? 447 ILE B O     1 
ATOM   6849  C  CB    . ILE B  1 447 ? 7.744   -30.058  7.277   1.00 121.39 ? 447 ILE B CB    1 
ATOM   6850  C  CG1   . ILE B  1 447 ? 7.776   -30.459  8.754   1.00 119.88 ? 447 ILE B CG1   1 
ATOM   6851  C  CG2   . ILE B  1 447 ? 8.072   -28.572  7.147   1.00 121.68 ? 447 ILE B CG2   1 
ATOM   6852  C  CD1   . ILE B  1 447 ? 9.175   -30.665  9.306   1.00 119.71 ? 447 ILE B CD1   1 
ATOM   6853  N  N     . TYR B  1 448 ? 6.361   -31.201  4.353   1.00 123.81 ? 448 TYR B N     1 
ATOM   6854  C  CA    . TYR B  1 448 ? 6.144   -31.056  2.917   1.00 125.38 ? 448 TYR B CA    1 
ATOM   6855  C  C     . TYR B  1 448 ? 4.688   -30.660  2.647   1.00 125.34 ? 448 TYR B C     1 
ATOM   6856  O  O     . TYR B  1 448 ? 4.431   -29.713  1.897   1.00 126.37 ? 448 TYR B O     1 
ATOM   6857  C  CB    . TYR B  1 448 ? 6.530   -32.320  2.140   1.00 126.75 ? 448 TYR B CB    1 
ATOM   6858  C  CG    . TYR B  1 448 ? 6.402   -32.142  0.642   1.00 129.16 ? 448 TYR B CG    1 
ATOM   6859  C  CD1   . TYR B  1 448 ? 7.418   -31.538  -0.096  1.00 130.85 ? 448 TYR B CD1   1 
ATOM   6860  C  CD2   . TYR B  1 448 ? 5.251   -32.563  -0.040  1.00 130.43 ? 448 TYR B CD2   1 
ATOM   6861  C  CE1   . TYR B  1 448 ? 7.297   -31.358  -1.481  1.00 133.40 ? 448 TYR B CE1   1 
ATOM   6862  C  CE2   . TYR B  1 448 ? 5.121   -32.390  -1.425  1.00 132.42 ? 448 TYR B CE2   1 
ATOM   6863  C  CZ    . TYR B  1 448 ? 6.148   -31.785  -2.136  1.00 133.80 ? 448 TYR B CZ    1 
ATOM   6864  O  OH    . TYR B  1 448 ? 6.036   -31.603  -3.494  1.00 135.76 ? 448 TYR B OH    1 
ATOM   6865  N  N     . ALA B  1 449 ? 3.755   -31.377  3.281   1.00 124.36 ? 449 ALA B N     1 
ATOM   6866  C  CA    . ALA B  1 449 ? 2.309   -31.118  3.169   1.00 124.32 ? 449 ALA B CA    1 
ATOM   6867  C  C     . ALA B  1 449 ? 1.917   -29.728  3.670   1.00 123.74 ? 449 ALA B C     1 
ATOM   6868  O  O     . ALA B  1 449 ? 0.891   -29.178  3.270   1.00 124.65 ? 449 ALA B O     1 
ATOM   6869  C  CB    . ALA B  1 449 ? 1.517   -32.185  3.913   1.00 123.68 ? 449 ALA B CB    1 
ATOM   6870  N  N     . GLY B  1 450 ? 2.735   -29.170  4.553   1.00 122.44 ? 450 GLY B N     1 
ATOM   6871  C  CA    . GLY B  1 450 ? 2.509   -27.832  5.049   1.00 122.16 ? 450 GLY B CA    1 
ATOM   6872  C  C     . GLY B  1 450 ? 3.104   -26.818  4.100   1.00 123.38 ? 450 GLY B C     1 
ATOM   6873  O  O     . GLY B  1 450 ? 2.375   -26.046  3.474   1.00 124.79 ? 450 GLY B O     1 
ATOM   6874  N  N     . VAL B  1 451 ? 4.432   -26.838  3.983   1.00 123.11 ? 451 VAL B N     1 
ATOM   6875  C  CA    . VAL B  1 451 ? 5.176   -25.834  3.218   1.00 124.29 ? 451 VAL B CA    1 
ATOM   6876  C  C     . VAL B  1 451 ? 4.608   -25.646  1.812   1.00 126.03 ? 451 VAL B C     1 
ATOM   6877  O  O     . VAL B  1 451 ? 4.411   -24.514  1.368   1.00 127.44 ? 451 VAL B O     1 
ATOM   6878  C  CB    . VAL B  1 451 ? 6.701   -26.146  3.189   1.00 124.19 ? 451 VAL B CB    1 
ATOM   6879  C  CG1   . VAL B  1 451 ? 7.428   -25.329  2.124   1.00 126.23 ? 451 VAL B CG1   1 
ATOM   6880  C  CG2   . VAL B  1 451 ? 7.306   -25.875  4.550   1.00 122.87 ? 451 VAL B CG2   1 
ATOM   6881  N  N     . ASN B  1 452 ? 4.312   -26.758  1.142   1.00 126.17 ? 452 ASN B N     1 
ATOM   6882  C  CA    . ASN B  1 452 ? 3.820   -26.732  -0.240  1.00 127.91 ? 452 ASN B CA    1 
ATOM   6883  C  C     . ASN B  1 452 ? 2.306   -26.505  -0.377  1.00 128.26 ? 452 ASN B C     1 
ATOM   6884  O  O     . ASN B  1 452 ? 1.766   -26.516  -1.483  1.00 129.88 ? 452 ASN B O     1 
ATOM   6885  C  CB    . ASN B  1 452 ? 4.297   -27.970  -1.004  1.00 128.47 ? 452 ASN B CB    1 
ATOM   6886  C  CG    . ASN B  1 452 ? 5.815   -28.053  -1.081  1.00 128.56 ? 452 ASN B CG    1 
ATOM   6887  O  OD1   . ASN B  1 452 ? 6.411   -27.742  -2.110  1.00 130.44 ? 452 ASN B OD1   1 
ATOM   6888  N  ND2   . ASN B  1 452 ? 6.446   -28.454  0.017   1.00 126.49 ? 452 ASN B ND2   1 
ATOM   6889  N  N     . GLY B  1 453 ? 1.640   -26.306  0.760   1.00 126.94 ? 453 GLY B N     1 
ATOM   6890  C  CA    . GLY B  1 453 ? 0.280   -25.769  0.802   1.00 127.60 ? 453 GLY B CA    1 
ATOM   6891  C  C     . GLY B  1 453 ? -0.846  -26.770  0.713   1.00 127.48 ? 453 GLY B C     1 
ATOM   6892  O  O     . GLY B  1 453 ? -2.005  -26.388  0.549   1.00 128.50 ? 453 GLY B O     1 
ATOM   6893  N  N     . HIS B  1 454 ? -0.510  -28.049  0.844   1.00 126.62 ? 454 HIS B N     1 
ATOM   6894  C  CA    . HIS B  1 454 ? -1.468  -29.141  0.643   1.00 127.02 ? 454 HIS B CA    1 
ATOM   6895  C  C     . HIS B  1 454 ? -2.593  -29.197  1.691   1.00 126.37 ? 454 HIS B C     1 
ATOM   6896  O  O     . HIS B  1 454 ? -3.483  -30.046  1.609   1.00 126.56 ? 454 HIS B O     1 
ATOM   6897  C  CB    . HIS B  1 454 ? -0.725  -30.481  0.560   1.00 126.61 ? 454 HIS B CB    1 
ATOM   6898  C  CG    . HIS B  1 454 ? 0.244   -30.566  -0.584  1.00 128.30 ? 454 HIS B CG    1 
ATOM   6899  N  ND1   . HIS B  1 454 ? -0.119  -31.012  -1.839  1.00 130.34 ? 454 HIS B ND1   1 
ATOM   6900  C  CD2   . HIS B  1 454 ? 1.561   -30.258  -0.662  1.00 128.33 ? 454 HIS B CD2   1 
ATOM   6901  C  CE1   . HIS B  1 454 ? 0.933   -30.975  -2.639  1.00 131.33 ? 454 HIS B CE1   1 
ATOM   6902  N  NE2   . HIS B  1 454 ? 1.965   -30.523  -1.950  1.00 130.33 ? 454 HIS B NE2   1 
ATOM   6903  N  N     . LEU B  1 455 ? -2.554  -28.276  2.658   1.00 125.83 ? 455 LEU B N     1 
ATOM   6904  C  CA    . LEU B  1 455 ? -3.529  -28.237  3.755   1.00 125.49 ? 455 LEU B CA    1 
ATOM   6905  C  C     . LEU B  1 455 ? -4.550  -27.099  3.625   1.00 127.05 ? 455 LEU B C     1 
ATOM   6906  O  O     . LEU B  1 455 ? -5.530  -27.061  4.373   1.00 127.36 ? 455 LEU B O     1 
ATOM   6907  C  CB    . LEU B  1 455 ? -2.820  -28.120  5.116   1.00 123.92 ? 455 LEU B CB    1 
ATOM   6908  C  CG    . LEU B  1 455 ? -1.642  -28.995  5.574   1.00 122.63 ? 455 LEU B CG    1 
ATOM   6909  C  CD1   . LEU B  1 455 ? -1.220  -28.606  6.997   1.00 121.09 ? 455 LEU B CD1   1 
ATOM   6910  C  CD2   . LEU B  1 455 ? -1.949  -30.490  5.500   1.00 122.81 ? 455 LEU B CD2   1 
ATOM   6911  N  N     . ASP B  1 456 ? -4.320  -26.189  2.676   1.00 128.40 ? 456 ASP B N     1 
ATOM   6912  C  CA    . ASP B  1 456 ? -5.085  -24.930  2.557   1.00 130.26 ? 456 ASP B CA    1 
ATOM   6913  C  C     . ASP B  1 456 ? -6.608  -25.082  2.477   1.00 131.60 ? 456 ASP B C     1 
ATOM   6914  O  O     . ASP B  1 456 ? -7.347  -24.197  2.920   1.00 132.77 ? 456 ASP B O     1 
ATOM   6915  C  CB    . ASP B  1 456 ? -4.584  -24.099  1.366   1.00 131.91 ? 456 ASP B CB    1 
ATOM   6916  C  CG    . ASP B  1 456 ? -3.221  -23.462  1.614   1.00 131.30 ? 456 ASP B CG    1 
ATOM   6917  O  OD1   . ASP B  1 456 ? -2.568  -23.765  2.639   1.00 129.33 ? 456 ASP B OD1   1 
ATOM   6918  O  OD2   . ASP B  1 456 ? -2.801  -22.647  0.765   1.00 133.02 ? 456 ASP B OD2   1 
ATOM   6919  N  N     . GLY B  1 457 ? -7.064  -26.195  1.905   1.00 131.64 ? 457 GLY B N     1 
ATOM   6920  C  CA    . GLY B  1 457 ? -8.495  -26.483  1.777   1.00 133.21 ? 457 GLY B CA    1 
ATOM   6921  C  C     . GLY B  1 457 ? -9.067  -27.267  2.947   1.00 132.25 ? 457 GLY B C     1 
ATOM   6922  O  O     . GLY B  1 457 ? -10.277 -27.241  3.194   1.00 133.62 ? 457 GLY B O     1 
ATOM   6923  N  N     . ILE B  1 458 ? -8.190  -27.967  3.664   1.00 130.13 ? 458 ILE B N     1 
ATOM   6924  C  CA    . ILE B  1 458 ? -8.576  -28.752  4.834   1.00 129.21 ? 458 ILE B CA    1 
ATOM   6925  C  C     . ILE B  1 458 ? -8.856  -27.846  6.034   1.00 129.34 ? 458 ILE B C     1 
ATOM   6926  O  O     . ILE B  1 458 ? -8.074  -26.940  6.334   1.00 128.77 ? 458 ILE B O     1 
ATOM   6927  C  CB    . ILE B  1 458 ? -7.497  -29.818  5.177   1.00 127.26 ? 458 ILE B CB    1 
ATOM   6928  C  CG1   . ILE B  1 458 ? -7.564  -30.972  4.171   1.00 127.64 ? 458 ILE B CG1   1 
ATOM   6929  C  CG2   . ILE B  1 458 ? -7.667  -30.344  6.607   1.00 126.28 ? 458 ILE B CG2   1 
ATOM   6930  C  CD1   . ILE B  1 458 ? -6.324  -31.839  4.124   1.00 126.31 ? 458 ILE B CD1   1 
ATOM   6931  N  N     . GLU B  1 459 ? -9.984  -28.103  6.699   1.00 130.37 ? 459 GLU B N     1 
ATOM   6932  C  CA    . GLU B  1 459 ? -10.402 -27.376  7.898   1.00 131.01 ? 459 GLU B CA    1 
ATOM   6933  C  C     . GLU B  1 459 ? -9.302  -27.341  8.953   1.00 129.18 ? 459 GLU B C     1 
ATOM   6934  O  O     . GLU B  1 459 ? -8.444  -28.227  9.004   1.00 127.51 ? 459 GLU B O     1 
ATOM   6935  C  CB    . GLU B  1 459 ? -11.645 -28.021  8.511   1.00 132.23 ? 459 GLU B CB    1 
ATOM   6936  C  CG    . GLU B  1 459 ? -12.905 -27.936  7.672   1.00 134.69 ? 459 GLU B CG    1 
ATOM   6937  C  CD    . GLU B  1 459 ? -14.074 -28.661  8.317   1.00 136.18 ? 459 GLU B CD    1 
ATOM   6938  O  OE1   . GLU B  1 459 ? -14.475 -28.280  9.438   1.00 136.92 ? 459 GLU B OE1   1 
ATOM   6939  O  OE2   . GLU B  1 459 ? -14.593 -29.613  7.700   1.00 136.96 ? 459 GLU B OE2   1 
ATOM   6940  N  N     . LEU B  1 460 ? -9.338  -26.318  9.799   1.00 129.81 ? 460 LEU B N     1 
ATOM   6941  C  CA    . LEU B  1 460 ? -8.355  -26.180  10.857  1.00 128.24 ? 460 LEU B CA    1 
ATOM   6942  C  C     . LEU B  1 460 ? -8.528  -27.284  11.900  1.00 127.50 ? 460 LEU B C     1 
ATOM   6943  O  O     . LEU B  1 460 ? -7.554  -27.931  12.288  1.00 125.70 ? 460 LEU B O     1 
ATOM   6944  C  CB    . LEU B  1 460 ? -8.443  -24.789  11.488  1.00 129.71 ? 460 LEU B CB    1 
ATOM   6945  C  CG    . LEU B  1 460 ? -7.153  -24.175  12.042  1.00 128.37 ? 460 LEU B CG    1 
ATOM   6946  C  CD1   . LEU B  1 460 ? -6.014  -24.226  11.027  1.00 126.70 ? 460 LEU B CD1   1 
ATOM   6947  C  CD2   . LEU B  1 460 ? -7.405  -22.745  12.484  1.00 130.44 ? 460 LEU B CD2   1 
ATOM   6948  N  N     . SER B  1 461 ? -9.771  -27.521  12.315  1.00 129.20 ? 461 SER B N     1 
ATOM   6949  C  CA    . SER B  1 461 ? -10.084 -28.532  13.334  1.00 129.06 ? 461 SER B CA    1 
ATOM   6950  C  C     . SER B  1 461 ? -9.800  -29.981  12.897  1.00 127.83 ? 461 SER B C     1 
ATOM   6951  O  O     . SER B  1 461 ? -9.948  -30.916  13.690  1.00 127.75 ? 461 SER B O     1 
ATOM   6952  C  CB    . SER B  1 461 ? -11.532 -28.376  13.823  1.00 131.52 ? 461 SER B CB    1 
ATOM   6953  O  OG    . SER B  1 461 ? -12.437 -28.286  12.737  1.00 133.03 ? 461 SER B OG    1 
ATOM   6954  N  N     . ARG B  1 462 ? -9.375  -30.161  11.648  1.00 127.16 ? 462 ARG B N     1 
ATOM   6955  C  CA    . ARG B  1 462 ? -9.051  -31.495  11.136  1.00 126.52 ? 462 ARG B CA    1 
ATOM   6956  C  C     . ARG B  1 462 ? -7.559  -31.697  10.831  1.00 124.58 ? 462 ARG B C     1 
ATOM   6957  O  O     . ARG B  1 462 ? -7.159  -32.761  10.358  1.00 124.21 ? 462 ARG B O     1 
ATOM   6958  C  CB    . ARG B  1 462 ? -9.901  -31.840  9.901   1.00 127.98 ? 462 ARG B CB    1 
ATOM   6959  C  CG    . ARG B  1 462 ? -11.415 -31.844  10.134  1.00 130.33 ? 462 ARG B CG    1 
ATOM   6960  C  CD    . ARG B  1 462 ? -12.083 -33.084  9.542   1.00 131.64 ? 462 ARG B CD    1 
ATOM   6961  N  NE    . ARG B  1 462 ? -11.656 -33.359  8.170   1.00 131.66 ? 462 ARG B NE    1 
ATOM   6962  C  CZ    . ARG B  1 462 ? -11.772 -34.536  7.560   1.00 132.00 ? 462 ARG B CZ    1 
ATOM   6963  N  NH1   . ARG B  1 462 ? -12.305 -35.582  8.183   1.00 132.41 ? 462 ARG B NH1   1 
ATOM   6964  N  NH2   . ARG B  1 462 ? -11.343 -34.668  6.315   1.00 132.26 ? 462 ARG B NH2   1 
ATOM   6965  N  N     . ILE B  1 463 ? -6.742  -30.683  11.107  1.00 123.75 ? 463 ILE B N     1 
ATOM   6966  C  CA    . ILE B  1 463 ? -5.294  -30.766  10.875  1.00 122.16 ? 463 ILE B CA    1 
ATOM   6967  C  C     . ILE B  1 463 ? -4.642  -31.859  11.737  1.00 121.23 ? 463 ILE B C     1 
ATOM   6968  O  O     . ILE B  1 463 ? -3.744  -32.573  11.274  1.00 120.42 ? 463 ILE B O     1 
ATOM   6969  C  CB    . ILE B  1 463 ? -4.601  -29.385  11.088  1.00 121.77 ? 463 ILE B CB    1 
ATOM   6970  C  CG1   . ILE B  1 463 ? -5.156  -28.335  10.111  1.00 122.84 ? 463 ILE B CG1   1 
ATOM   6971  C  CG2   . ILE B  1 463 ? -3.077  -29.494  10.969  1.00 120.42 ? 463 ILE B CG2   1 
ATOM   6972  C  CD1   . ILE B  1 463 ? -4.994  -28.675  8.633   1.00 122.80 ? 463 ILE B CD1   1 
ATOM   6973  N  N     . GLY B  1 464 ? -5.118  -31.985  12.978  1.00 121.64 ? 464 GLY B N     1 
ATOM   6974  C  CA    . GLY B  1 464 ? -4.666  -33.023  13.908  1.00 121.38 ? 464 GLY B CA    1 
ATOM   6975  C  C     . GLY B  1 464 ? -5.098  -34.421  13.503  1.00 122.41 ? 464 GLY B C     1 
ATOM   6976  O  O     . GLY B  1 464 ? -4.411  -35.401  13.799  1.00 122.11 ? 464 GLY B O     1 
ATOM   6977  N  N     . GLU B  1 465 ? -6.243  -34.507  12.827  1.00 123.94 ? 465 GLU B N     1 
ATOM   6978  C  CA    . GLU B  1 465 ? -6.746  -35.765  12.275  1.00 125.26 ? 465 GLU B CA    1 
ATOM   6979  C  C     . GLU B  1 465 ? -6.055  -36.107  10.947  1.00 125.15 ? 465 GLU B C     1 
ATOM   6980  O  O     . GLU B  1 465 ? -6.003  -37.278  10.552  1.00 126.08 ? 465 GLU B O     1 
ATOM   6981  C  CB    . GLU B  1 465 ? -8.267  -35.692  12.082  1.00 127.05 ? 465 GLU B CB    1 
ATOM   6982  C  CG    . GLU B  1 465 ? -8.936  -37.029  11.748  1.00 128.92 ? 465 GLU B CG    1 
ATOM   6983  C  CD    . GLU B  1 465 ? -10.045 -36.898  10.713  1.00 130.51 ? 465 GLU B CD    1 
ATOM   6984  O  OE1   . GLU B  1 465 ? -10.710 -35.838  10.669  1.00 130.63 ? 465 GLU B OE1   1 
ATOM   6985  O  OE2   . GLU B  1 465 ? -10.248 -37.862  9.943   1.00 131.57 ? 465 GLU B OE2   1 
ATOM   6986  N  N     . PHE B  1 466 ? -5.544  -35.083  10.259  1.00 124.45 ? 466 PHE B N     1 
ATOM   6987  C  CA    . PHE B  1 466 ? -4.795  -35.274  9.015   1.00 124.43 ? 466 PHE B CA    1 
ATOM   6988  C  C     . PHE B  1 466 ? -3.494  -36.008  9.291   1.00 123.96 ? 466 PHE B C     1 
ATOM   6989  O  O     . PHE B  1 466 ? -3.166  -36.966  8.597   1.00 124.50 ? 466 PHE B O     1 
ATOM   6990  C  CB    . PHE B  1 466 ? -4.500  -33.936  8.327   1.00 123.84 ? 466 PHE B CB    1 
ATOM   6991  C  CG    . PHE B  1 466 ? -3.587  -34.053  7.129   1.00 123.57 ? 466 PHE B CG    1 
ATOM   6992  C  CD1   . PHE B  1 466 ? -2.208  -34.177  7.291   1.00 122.49 ? 466 PHE B CD1   1 
ATOM   6993  C  CD2   . PHE B  1 466 ? -4.104  -34.030  5.841   1.00 124.67 ? 466 PHE B CD2   1 
ATOM   6994  C  CE1   . PHE B  1 466 ? -1.365  -34.287  6.194   1.00 122.44 ? 466 PHE B CE1   1 
ATOM   6995  C  CE2   . PHE B  1 466 ? -3.266  -34.134  4.734   1.00 124.89 ? 466 PHE B CE2   1 
ATOM   6996  C  CZ    . PHE B  1 466 ? -1.892  -34.263  4.914   1.00 123.89 ? 466 PHE B CZ    1 
ATOM   6997  N  N     . GLU B  1 467 ? -2.758  -35.544  10.302  1.00 123.20 ? 467 GLU B N     1 
ATOM   6998  C  CA    . GLU B  1 467 ? -1.493  -36.163  10.686  1.00 123.07 ? 467 GLU B CA    1 
ATOM   6999  C  C     . GLU B  1 467 ? -1.658  -37.671  10.896  1.00 124.32 ? 467 GLU B C     1 
ATOM   7000  O  O     . GLU B  1 467 ? -1.063  -38.474  10.168  1.00 125.13 ? 467 GLU B O     1 
ATOM   7001  C  CB    . GLU B  1 467 ? -0.908  -35.494  11.934  1.00 121.89 ? 467 GLU B CB    1 
ATOM   7002  C  CG    . GLU B  1 467 ? 0.209   -36.311  12.591  1.00 122.68 ? 467 GLU B CG    1 
ATOM   7003  C  CD    . GLU B  1 467 ? 1.027   -35.541  13.615  1.00 122.95 ? 467 GLU B CD    1 
ATOM   7004  O  OE1   . GLU B  1 467 ? 0.791   -34.327  13.821  1.00 122.34 ? 467 GLU B OE1   1 
ATOM   7005  O  OE2   . GLU B  1 467 ? 1.921   -36.169  14.216  1.00 123.92 ? 467 GLU B OE2   1 
ATOM   7006  N  N     . SER B  1 468 ? -2.489  -38.036  11.871  1.00 124.89 ? 468 SER B N     1 
ATOM   7007  C  CA    . SER B  1 468 ? -2.705  -39.435  12.250  1.00 126.62 ? 468 SER B CA    1 
ATOM   7008  C  C     . SER B  1 468 ? -3.232  -40.336  11.116  1.00 128.66 ? 468 SER B C     1 
ATOM   7009  O  O     . SER B  1 468 ? -2.810  -41.489  10.992  1.00 130.11 ? 468 SER B O     1 
ATOM   7010  C  CB    . SER B  1 468 ? -3.592  -39.528  13.501  1.00 127.04 ? 468 SER B CB    1 
ATOM   7011  O  OG    . SER B  1 468 ? -4.467  -38.417  13.605  1.00 126.56 ? 468 SER B OG    1 
ATOM   7012  N  N     . SER B  1 469 ? -4.141  -39.815  10.294  1.00 129.08 ? 469 SER B N     1 
ATOM   7013  C  CA    . SER B  1 469 ? -4.616  -40.550  9.119   1.00 131.05 ? 469 SER B CA    1 
ATOM   7014  C  C     . SER B  1 469 ? -3.524  -40.665  8.055   1.00 131.09 ? 469 SER B C     1 
ATOM   7015  O  O     . SER B  1 469 ? -3.345  -41.725  7.449   1.00 132.90 ? 469 SER B O     1 
ATOM   7016  C  CB    . SER B  1 469 ? -5.864  -39.888  8.526   1.00 131.57 ? 469 SER B CB    1 
ATOM   7017  O  OG    . SER B  1 469 ? -7.048  -40.331  9.167   1.00 133.27 ? 469 SER B OG    1 
ATOM   7018  N  N     . PHE B  1 470 ? -2.798  -39.565  7.853   1.00 129.48 ? 470 PHE B N     1 
ATOM   7019  C  CA    . PHE B  1 470 ? -1.758  -39.460  6.829   1.00 129.64 ? 470 PHE B CA    1 
ATOM   7020  C  C     . PHE B  1 470 ? -0.576  -40.373  7.124   1.00 130.12 ? 470 PHE B C     1 
ATOM   7021  O  O     . PHE B  1 470 ? -0.121  -41.107  6.242   1.00 131.71 ? 470 PHE B O     1 
ATOM   7022  C  CB    . PHE B  1 470 ? -1.294  -38.001  6.706   1.00 128.02 ? 470 PHE B CB    1 
ATOM   7023  C  CG    . PHE B  1 470 ? -0.288  -37.753  5.609   1.00 128.44 ? 470 PHE B CG    1 
ATOM   7024  C  CD1   . PHE B  1 470 ? -0.366  -38.425  4.390   1.00 130.37 ? 470 PHE B CD1   1 
ATOM   7025  C  CD2   . PHE B  1 470 ? 0.720   -36.808  5.789   1.00 126.92 ? 470 PHE B CD2   1 
ATOM   7026  C  CE1   . PHE B  1 470 ? 0.562   -38.178  3.382   1.00 131.28 ? 470 PHE B CE1   1 
ATOM   7027  C  CE2   . PHE B  1 470 ? 1.646   -36.550  4.787   1.00 127.44 ? 470 PHE B CE2   1 
ATOM   7028  C  CZ    . PHE B  1 470 ? 1.570   -37.236  3.583   1.00 129.81 ? 470 PHE B CZ    1 
ATOM   7029  N  N     . LEU B  1 471 ? -0.091  -40.327  8.364   1.00 128.87 ? 471 LEU B N     1 
ATOM   7030  C  CA    . LEU B  1 471 ? 1.042   -41.153  8.774   1.00 129.53 ? 471 LEU B CA    1 
ATOM   7031  C  C     . LEU B  1 471 ? 0.743   -42.653  8.700   1.00 132.10 ? 471 LEU B C     1 
ATOM   7032  O  O     . LEU B  1 471 ? 1.642   -43.446  8.417   1.00 133.67 ? 471 LEU B O     1 
ATOM   7033  C  CB    . LEU B  1 471 ? 1.558   -40.741  10.160  1.00 127.89 ? 471 LEU B CB    1 
ATOM   7034  C  CG    . LEU B  1 471 ? 2.449   -39.485  10.190  1.00 126.09 ? 471 LEU B CG    1 
ATOM   7035  C  CD1   . LEU B  1 471 ? 2.598   -38.918  11.602  1.00 124.72 ? 471 LEU B CD1   1 
ATOM   7036  C  CD2   . LEU B  1 471 ? 3.825   -39.744  9.574   1.00 126.58 ? 471 LEU B CD2   1 
ATOM   7037  N  N     . SER B  1 472 ? -0.517  -43.029  8.935   1.00 132.89 ? 472 SER B N     1 
ATOM   7038  C  CA    . SER B  1 472 ? -0.976  -44.411  8.746   1.00 135.73 ? 472 SER B CA    1 
ATOM   7039  C  C     . SER B  1 472 ? -0.991  -44.771  7.272   1.00 137.50 ? 472 SER B C     1 
ATOM   7040  O  O     . SER B  1 472 ? -0.475  -45.817  6.878   1.00 140.06 ? 472 SER B O     1 
ATOM   7041  C  CB    . SER B  1 472 ? -2.378  -44.619  9.322   1.00 136.32 ? 472 SER B CB    1 
ATOM   7042  O  OG    . SER B  1 472 ? -2.343  -44.734  10.733  1.00 136.05 ? 472 SER B OG    1 
ATOM   7043  N  N     . TYR B  1 473 ? -1.593  -43.897  6.469   1.00 136.46 ? 473 TYR B N     1 
ATOM   7044  C  CA    . TYR B  1 473 ? -1.629  -44.060  5.022   1.00 138.06 ? 473 TYR B CA    1 
ATOM   7045  C  C     . TYR B  1 473 ? -0.215  -44.209  4.447   1.00 138.51 ? 473 TYR B C     1 
ATOM   7046  O  O     . TYR B  1 473 ? 0.012   -45.013  3.540   1.00 141.25 ? 473 TYR B O     1 
ATOM   7047  C  CB    . TYR B  1 473 ? -2.379  -42.890  4.370   1.00 136.79 ? 473 TYR B CB    1 
ATOM   7048  C  CG    . TYR B  1 473 ? -2.323  -42.883  2.858   1.00 138.56 ? 473 TYR B CG    1 
ATOM   7049  C  CD1   . TYR B  1 473 ? -3.022  -43.835  2.108   1.00 141.54 ? 473 TYR B CD1   1 
ATOM   7050  C  CD2   . TYR B  1 473 ? -1.566  -41.927  2.174   1.00 137.48 ? 473 TYR B CD2   1 
ATOM   7051  C  CE1   . TYR B  1 473 ? -2.968  -43.835  0.720   1.00 143.22 ? 473 TYR B CE1   1 
ATOM   7052  C  CE2   . TYR B  1 473 ? -1.506  -41.917  0.784   1.00 139.40 ? 473 TYR B CE2   1 
ATOM   7053  C  CZ    . TYR B  1 473 ? -2.211  -42.875  0.066   1.00 142.26 ? 473 TYR B CZ    1 
ATOM   7054  O  OH    . TYR B  1 473 ? -2.159  -42.875  -1.306  1.00 144.72 ? 473 TYR B OH    1 
ATOM   7055  N  N     . LEU B  1 474 ? 0.724   -43.441  4.996   1.00 136.09 ? 474 LEU B N     1 
ATOM   7056  C  CA    . LEU B  1 474 ? 2.132   -43.522  4.615   1.00 136.37 ? 474 LEU B CA    1 
ATOM   7057  C  C     . LEU B  1 474 ? 2.741   -44.869  4.985   1.00 138.62 ? 474 LEU B C     1 
ATOM   7058  O  O     . LEU B  1 474 ? 3.422   -45.488  4.171   1.00 140.95 ? 474 LEU B O     1 
ATOM   7059  C  CB    . LEU B  1 474 ? 2.928   -42.385  5.266   1.00 133.51 ? 474 LEU B CB    1 
ATOM   7060  C  CG    . LEU B  1 474 ? 2.887   -41.030  4.555   1.00 131.86 ? 474 LEU B CG    1 
ATOM   7061  C  CD1   . LEU B  1 474 ? 3.013   -39.894  5.551   1.00 129.07 ? 474 LEU B CD1   1 
ATOM   7062  C  CD2   . LEU B  1 474 ? 3.970   -40.942  3.484   1.00 133.03 ? 474 LEU B CD2   1 
ATOM   7063  N  N     . LYS B  1 475 ? 2.480   -45.316  6.213   1.00 138.18 ? 475 LYS B N     1 
ATOM   7064  C  CA    . LYS B  1 475 ? 3.046   -46.562  6.735   1.00 140.50 ? 475 LYS B CA    1 
ATOM   7065  C  C     . LYS B  1 475 ? 2.461   -47.806  6.076   1.00 144.10 ? 475 LYS B C     1 
ATOM   7066  O  O     . LYS B  1 475 ? 3.143   -48.823  5.955   1.00 147.20 ? 475 LYS B O     1 
ATOM   7067  C  CB    . LYS B  1 475 ? 2.873   -46.647  8.256   1.00 139.26 ? 475 LYS B CB    1 
ATOM   7068  C  CG    . LYS B  1 475 ? 3.843   -45.779  9.035   1.00 137.03 ? 475 LYS B CG    1 
ATOM   7069  C  CD    . LYS B  1 475 ? 3.829   -46.104  10.518  1.00 137.34 ? 475 LYS B CD    1 
ATOM   7070  C  CE    . LYS B  1 475 ? 4.776   -45.183  11.274  1.00 135.41 ? 475 LYS B CE    1 
ATOM   7071  N  NZ    . LYS B  1 475 ? 4.972   -45.611  12.687  1.00 136.10 ? 475 LYS B NZ    1 
ATOM   7072  N  N     . SER B  1 476 ? 1.204   -47.719  5.652   1.00 144.07 ? 476 SER B N     1 
ATOM   7073  C  CA    . SER B  1 476 ? 0.509   -48.861  5.061   1.00 147.53 ? 476 SER B CA    1 
ATOM   7074  C  C     . SER B  1 476 ? 0.841   -49.085  3.581   1.00 149.93 ? 476 SER B C     1 
ATOM   7075  O  O     . SER B  1 476 ? 0.944   -50.232  3.136   1.00 153.76 ? 476 SER B O     1 
ATOM   7076  C  CB    . SER B  1 476 ? -1.005  -48.749  5.277   1.00 147.06 ? 476 SER B CB    1 
ATOM   7077  O  OG    . SER B  1 476 ? -1.483  -47.455  4.959   1.00 143.80 ? 476 SER B OG    1 
ATOM   7078  N  N     . ASN B  1 477 ? 1.010   -47.994  2.830   1.00 147.94 ? 477 ASN B N     1 
ATOM   7079  C  CA    . ASN B  1 477 ? 1.330   -48.068  1.397   1.00 150.19 ? 477 ASN B CA    1 
ATOM   7080  C  C     . ASN B  1 477 ? 2.787   -47.732  1.094   1.00 149.91 ? 477 ASN B C     1 
ATOM   7081  O  O     . ASN B  1 477 ? 3.545   -48.572  0.598   1.00 153.14 ? 477 ASN B O     1 
ATOM   7082  C  CB    . ASN B  1 477 ? 0.432   -47.132  0.568   1.00 148.99 ? 477 ASN B CB    1 
ATOM   7083  C  CG    . ASN B  1 477 ? -1.048  -47.422  0.737   1.00 149.73 ? 477 ASN B CG    1 
ATOM   7084  O  OD1   . ASN B  1 477 ? -1.660  -47.027  1.732   1.00 147.88 ? 477 ASN B OD1   1 
ATOM   7085  N  ND2   . ASN B  1 477 ? -1.638  -48.084  -0.254  1.00 152.51 ? 477 ASN B ND2   1 
ATOM   7086  N  N     . HIS B  1 478 ? 3.161   -46.493  1.402   1.00 146.24 ? 478 HIS B N     1 
ATOM   7087  C  CA    . HIS B  1 478 ? 4.440   -45.931  0.990   1.00 145.77 ? 478 HIS B CA    1 
ATOM   7088  C  C     . HIS B  1 478 ? 5.512   -46.094  2.067   1.00 145.04 ? 478 HIS B C     1 
ATOM   7089  O  O     . HIS B  1 478 ? 6.063   -45.107  2.560   1.00 142.32 ? 478 HIS B O     1 
ATOM   7090  C  CB    . HIS B  1 478 ? 4.273   -44.447  0.645   1.00 142.77 ? 478 HIS B CB    1 
ATOM   7091  C  CG    . HIS B  1 478 ? 3.175   -44.164  -0.333  1.00 142.53 ? 478 HIS B CG    1 
ATOM   7092  N  ND1   . HIS B  1 478 ? 3.379   -44.141  -1.696  1.00 143.97 ? 478 HIS B ND1   1 
ATOM   7093  C  CD2   . HIS B  1 478 ? 1.867   -43.870  -0.142  1.00 140.56 ? 478 HIS B CD2   1 
ATOM   7094  C  CE1   . HIS B  1 478 ? 2.242   -43.852  -2.302  1.00 143.89 ? 478 HIS B CE1   1 
ATOM   7095  N  NE2   . HIS B  1 478 ? 1.309   -43.685  -1.383  1.00 141.59 ? 478 HIS B NE2   1 
ATOM   7096  N  N     . ASN B  1 479 ? 5.800   -47.338  2.436   1.00 147.85 ? 479 ASN B N     1 
ATOM   7097  C  CA    . ASN B  1 479 ? 6.866   -47.618  3.395   1.00 147.81 ? 479 ASN B CA    1 
ATOM   7098  C  C     . ASN B  1 479 ? 8.229   -47.698  2.700   1.00 150.02 ? 479 ASN B C     1 
ATOM   7099  O  O     . ASN B  1 479 ? 9.270   -47.726  3.356   1.00 149.90 ? 479 ASN B O     1 
ATOM   7100  C  CB    . ASN B  1 479 ? 6.572   -48.901  4.182   1.00 150.10 ? 479 ASN B CB    1 
ATOM   7101  C  CG    . ASN B  1 479 ? 6.915   -48.773  5.662   1.00 147.85 ? 479 ASN B CG    1 
ATOM   7102  O  OD1   . ASN B  1 479 ? 6.335   -47.955  6.379   1.00 144.25 ? 479 ASN B OD1   1 
ATOM   7103  N  ND2   . ASN B  1 479 ? 7.850   -49.595  6.127   1.00 150.01 ? 479 ASN B ND2   1 
ATOM   7104  N  N     . GLU B  1 480 ? 8.208   -47.734  1.368   1.00 152.36 ? 480 GLU B N     1 
ATOM   7105  C  CA    . GLU B  1 480 ? 9.428   -47.705  0.562   1.00 154.69 ? 480 GLU B CA    1 
ATOM   7106  C  C     . GLU B  1 480 ? 10.060  -46.315  0.629   1.00 151.38 ? 480 GLU B C     1 
ATOM   7107  O  O     . GLU B  1 480 ? 11.281  -46.181  0.739   1.00 151.96 ? 480 GLU B O     1 
ATOM   7108  C  CB    . GLU B  1 480 ? 9.136   -48.105  -0.893  1.00 158.19 ? 480 GLU B CB    1 
ATOM   7109  C  CG    . GLU B  1 480 ? 8.642   -49.545  -1.069  1.00 162.47 ? 480 GLU B CG    1 
ATOM   7110  C  CD    . GLU B  1 480 ? 8.591   -50.000  -2.530  1.00 167.38 ? 480 GLU B CD    1 
ATOM   7111  O  OE1   . GLU B  1 480 ? 8.724   -49.149  -3.437  1.00 167.07 ? 480 GLU B OE1   1 
ATOM   7112  O  OE2   . GLU B  1 480 ? 8.414   -51.216  -2.775  1.00 171.32 ? 480 GLU B OE2   1 
ATOM   7113  N  N     . LEU B  1 481 ? 9.216   -45.287  0.581   1.00 148.19 ? 481 LEU B N     1 
ATOM   7114  C  CA    . LEU B  1 481 ? 9.669   -43.901  0.671   1.00 145.33 ? 481 LEU B CA    1 
ATOM   7115  C  C     . LEU B  1 481 ? 10.121  -43.564  2.093   1.00 142.59 ? 481 LEU B C     1 
ATOM   7116  O  O     . LEU B  1 481 ? 11.095  -42.831  2.285   1.00 141.60 ? 481 LEU B O     1 
ATOM   7117  C  CB    . LEU B  1 481 ? 8.567   -42.923  0.233   1.00 143.21 ? 481 LEU B CB    1 
ATOM   7118  C  CG    . LEU B  1 481 ? 7.508   -43.262  -0.830  1.00 145.42 ? 481 LEU B CG    1 
ATOM   7119  C  CD1   . LEU B  1 481 ? 6.645   -42.026  -1.096  1.00 142.87 ? 481 LEU B CD1   1 
ATOM   7120  C  CD2   . LEU B  1 481 ? 8.084   -43.826  -2.151  1.00 149.78 ? 481 LEU B CD2   1 
ATOM   7121  N  N     . LEU B  1 482 ? 9.409   -44.108  3.081   1.00 141.58 ? 482 LEU B N     1 
ATOM   7122  C  CA    . LEU B  1 482 ? 9.699   -43.856  4.493   1.00 139.04 ? 482 LEU B CA    1 
ATOM   7123  C  C     . LEU B  1 482 ? 11.011  -44.493  4.959   1.00 140.70 ? 482 LEU B C     1 
ATOM   7124  O  O     . LEU B  1 482 ? 11.755  -43.881  5.716   1.00 138.98 ? 482 LEU B O     1 
ATOM   7125  C  CB    . LEU B  1 482 ? 8.526   -44.287  5.390   1.00 138.02 ? 482 LEU B CB    1 
ATOM   7126  C  CG    . LEU B  1 482 ? 7.188   -43.530  5.295   1.00 135.71 ? 482 LEU B CG    1 
ATOM   7127  C  CD1   . LEU B  1 482 ? 6.217   -44.013  6.364   1.00 134.69 ? 482 LEU B CD1   1 
ATOM   7128  C  CD2   . LEU B  1 482 ? 7.359   -42.017  5.390   1.00 132.50 ? 482 LEU B CD2   1 
ATOM   7129  N  N     . THR B  1 483 ? 11.290  -45.712  4.501   1.00 144.43 ? 483 THR B N     1 
ATOM   7130  C  CA    . THR B  1 483 ? 12.563  -46.385  4.786   1.00 146.83 ? 483 THR B CA    1 
ATOM   7131  C  C     . THR B  1 483 ? 13.736  -45.594  4.196   1.00 146.96 ? 483 THR B C     1 
ATOM   7132  O  O     . THR B  1 483 ? 14.807  -45.510  4.804   1.00 147.00 ? 483 THR B O     1 
ATOM   7133  C  CB    . THR B  1 483 ? 12.589  -47.843  4.223   1.00 151.59 ? 483 THR B CB    1 
ATOM   7134  O  OG1   . THR B  1 483 ? 11.400  -48.540  4.611   1.00 151.55 ? 483 THR B OG1   1 
ATOM   7135  C  CG2   . THR B  1 483 ? 13.800  -48.615  4.738   1.00 154.20 ? 483 THR B CG2   1 
ATOM   7136  N  N     . GLU B  1 484 ? 13.511  -45.003  3.023   1.00 147.14 ? 484 GLU B N     1 
ATOM   7137  C  CA    . GLU B  1 484 ? 14.576  -44.367  2.248   1.00 148.24 ? 484 GLU B CA    1 
ATOM   7138  C  C     . GLU B  1 484 ? 15.067  -43.032  2.821   1.00 144.83 ? 484 GLU B C     1 
ATOM   7139  O  O     . GLU B  1 484 ? 16.261  -42.727  2.743   1.00 145.80 ? 484 GLU B O     1 
ATOM   7140  C  CB    . GLU B  1 484 ? 14.156  -44.203  0.786   1.00 149.89 ? 484 GLU B CB    1 
ATOM   7141  C  CG    . GLU B  1 484 ? 15.291  -44.476  -0.189  1.00 154.28 ? 484 GLU B CG    1 
ATOM   7142  C  CD    . GLU B  1 484 ? 15.033  -43.919  -1.576  1.00 156.16 ? 484 GLU B CD    1 
ATOM   7143  O  OE1   . GLU B  1 484 ? 15.010  -42.675  -1.719  1.00 153.84 ? 484 GLU B OE1   1 
ATOM   7144  O  OE2   . GLU B  1 484 ? 14.874  -44.723  -2.524  1.00 159.91 ? 484 GLU B OE2   1 
ATOM   7145  N  N     . ILE B  1 485 ? 14.151  -42.243  3.383   1.00 141.19 ? 485 ILE B N     1 
ATOM   7146  C  CA    . ILE B  1 485 ? 14.501  -40.974  4.043   1.00 138.19 ? 485 ILE B CA    1 
ATOM   7147  C  C     . ILE B  1 485 ? 15.426  -41.240  5.239   1.00 138.05 ? 485 ILE B C     1 
ATOM   7148  O  O     . ILE B  1 485 ? 16.421  -40.536  5.440   1.00 137.67 ? 485 ILE B O     1 
ATOM   7149  C  CB    . ILE B  1 485 ? 13.234  -40.188  4.495   1.00 134.80 ? 485 ILE B CB    1 
ATOM   7150  C  CG1   . ILE B  1 485 ? 12.341  -39.864  3.293   1.00 135.16 ? 485 ILE B CG1   1 
ATOM   7151  C  CG2   . ILE B  1 485 ? 13.614  -38.903  5.220   1.00 131.89 ? 485 ILE B CG2   1 
ATOM   7152  C  CD1   . ILE B  1 485 ? 10.867  -39.721  3.628   1.00 133.13 ? 485 ILE B CD1   1 
ATOM   7153  N  N     . ARG B  1 486 ? 15.083  -42.271  6.008   1.00 138.63 ? 486 ARG B N     1 
ATOM   7154  C  CA    . ARG B  1 486 ? 15.858  -42.733  7.155   1.00 139.06 ? 486 ARG B CA    1 
ATOM   7155  C  C     . ARG B  1 486 ? 17.278  -43.157  6.769   1.00 142.33 ? 486 ARG B C     1 
ATOM   7156  O  O     . ARG B  1 486 ? 18.241  -42.814  7.457   1.00 141.85 ? 486 ARG B O     1 
ATOM   7157  C  CB    . ARG B  1 486 ? 15.128  -43.909  7.813   1.00 139.98 ? 486 ARG B CB    1 
ATOM   7158  C  CG    . ARG B  1 486 ? 15.763  -44.464  9.087   1.00 140.53 ? 486 ARG B CG    1 
ATOM   7159  C  CD    . ARG B  1 486 ? 15.457  -45.954  9.254   1.00 143.31 ? 486 ARG B CD    1 
ATOM   7160  N  NE    . ARG B  1 486 ? 14.057  -46.276  8.973   1.00 142.57 ? 486 ARG B NE    1 
ATOM   7161  C  CZ    . ARG B  1 486 ? 13.546  -47.504  8.976   1.00 144.92 ? 486 ARG B CZ    1 
ATOM   7162  N  NH1   . ARG B  1 486 ? 14.311  -48.552  9.253   1.00 148.40 ? 486 ARG B NH1   1 
ATOM   7163  N  NH2   . ARG B  1 486 ? 12.261  -47.684  8.704   1.00 144.23 ? 486 ARG B NH2   1 
ATOM   7164  N  N     . GLU B  1 487 ? 17.396  -43.907  5.673   1.00 145.88 ? 487 GLU B N     1 
ATOM   7165  C  CA    . GLU B  1 487 ? 18.682  -44.470  5.259   1.00 149.82 ? 487 GLU B CA    1 
ATOM   7166  C  C     . GLU B  1 487 ? 19.667  -43.413  4.759   1.00 149.69 ? 487 GLU B C     1 
ATOM   7167  O  O     . GLU B  1 487 ? 20.815  -43.369  5.212   1.00 150.75 ? 487 GLU B O     1 
ATOM   7168  C  CB    . GLU B  1 487 ? 18.487  -45.579  4.222   1.00 153.89 ? 487 GLU B CB    1 
ATOM   7169  C  CG    . GLU B  1 487 ? 18.070  -46.913  4.830   1.00 156.23 ? 487 GLU B CG    1 
ATOM   7170  C  CD    . GLU B  1 487 ? 18.022  -48.051  3.817   1.00 161.53 ? 487 GLU B CD    1 
ATOM   7171  O  OE1   . GLU B  1 487 ? 16.981  -48.739  3.755   1.00 162.17 ? 487 GLU B OE1   1 
ATOM   7172  O  OE2   . GLU B  1 487 ? 19.016  -48.262  3.085   1.00 165.03 ? 487 GLU B OE2   1 
ATOM   7173  N  N     . LYS B  1 488 ? 19.214  -42.562  3.843   1.00 148.66 ? 488 LYS B N     1 
ATOM   7174  C  CA    . LYS B  1 488 ? 20.065  -41.519  3.267   1.00 148.93 ? 488 LYS B CA    1 
ATOM   7175  C  C     . LYS B  1 488 ? 20.310  -40.342  4.216   1.00 145.48 ? 488 LYS B C     1 
ATOM   7176  O  O     . LYS B  1 488 ? 21.457  -39.936  4.436   1.00 146.27 ? 488 LYS B O     1 
ATOM   7177  C  CB    . LYS B  1 488 ? 19.480  -41.001  1.945   1.00 149.37 ? 488 LYS B CB    1 
ATOM   7178  C  CG    . LYS B  1 488 ? 19.841  -41.816  0.705   1.00 153.75 ? 488 LYS B CG    1 
ATOM   7179  C  CD    . LYS B  1 488 ? 19.884  -40.917  -0.528  1.00 154.10 ? 488 LYS B CD    1 
ATOM   7180  C  CE    . LYS B  1 488 ? 20.057  -41.714  -1.805  1.00 158.61 ? 488 LYS B CE    1 
ATOM   7181  N  NZ    . LYS B  1 488 ? 18.793  -42.390  -2.195  1.00 158.70 ? 488 LYS B NZ    1 
ATOM   7182  N  N     . GLY B  1 489 ? 19.227  -39.804  4.773   1.00 141.98 ? 489 GLY B N     1 
ATOM   7183  C  CA    . GLY B  1 489 ? 19.277  -38.539  5.504   1.00 138.92 ? 489 GLY B CA    1 
ATOM   7184  C  C     . GLY B  1 489 ? 19.148  -37.367  4.543   1.00 138.49 ? 489 GLY B C     1 
ATOM   7185  O  O     . GLY B  1 489 ? 19.344  -36.210  4.932   1.00 136.60 ? 489 GLY B O     1 
ATOM   7186  N  N     . GLU B  1 490 ? 18.819  -37.687  3.286   1.00 140.37 ? 490 GLU B N     1 
ATOM   7187  C  CA    . GLU B  1 490 ? 18.674  -36.719  2.190   1.00 140.58 ? 490 GLU B CA    1 
ATOM   7188  C  C     . GLU B  1 490 ? 17.355  -36.953  1.450   1.00 140.20 ? 490 GLU B C     1 
ATOM   7189  O  O     . GLU B  1 490 ? 16.742  -38.013  1.588   1.00 140.54 ? 490 GLU B O     1 
ATOM   7190  C  CB    . GLU B  1 490 ? 19.832  -36.856  1.188   1.00 144.28 ? 490 GLU B CB    1 
ATOM   7191  C  CG    . GLU B  1 490 ? 21.242  -36.758  1.780   1.00 145.30 ? 490 GLU B CG    1 
ATOM   7192  C  CD    . GLU B  1 490 ? 22.342  -36.963  0.744   1.00 149.49 ? 490 GLU B CD    1 
ATOM   7193  O  OE1   . GLU B  1 490 ? 22.038  -37.369  -0.401  1.00 151.60 ? 490 GLU B OE1   1 
ATOM   7194  O  OE2   . GLU B  1 490 ? 23.520  -36.721  1.080   1.00 150.70 ? 490 GLU B OE2   1 
ATOM   7195  N  N     . LEU B  1 491 ? 16.921  -35.963  0.672   1.00 139.70 ? 491 LEU B N     1 
ATOM   7196  C  CA    . LEU B  1 491 ? 15.779  -36.140  -0.226  1.00 140.10 ? 491 LEU B CA    1 
ATOM   7197  C  C     . LEU B  1 491 ? 16.197  -36.008  -1.685  1.00 143.31 ? 491 LEU B C     1 
ATOM   7198  O  O     . LEU B  1 491 ? 16.496  -34.906  -2.162  1.00 143.49 ? 491 LEU B O     1 
ATOM   7199  C  CB    . LEU B  1 491 ? 14.641  -35.159  0.086   1.00 137.16 ? 491 LEU B CB    1 
ATOM   7200  C  CG    . LEU B  1 491 ? 13.510  -35.548  1.045   1.00 134.83 ? 491 LEU B CG    1 
ATOM   7201  C  CD1   . LEU B  1 491 ? 12.662  -34.329  1.369   1.00 132.85 ? 491 LEU B CD1   1 
ATOM   7202  C  CD2   . LEU B  1 491 ? 12.634  -36.661  0.483   1.00 136.16 ? 491 LEU B CD2   1 
ATOM   7203  N  N     . SER B  1 492 ? 16.222  -37.142  -2.384  1.00 146.06 ? 492 SER B N     1 
ATOM   7204  C  CA    . SER B  1 492 ? 16.481  -37.163  -3.817  1.00 149.37 ? 492 SER B CA    1 
ATOM   7205  C  C     . SER B  1 492 ? 15.297  -36.558  -4.559  1.00 148.48 ? 492 SER B C     1 
ATOM   7206  O  O     . SER B  1 492 ? 14.149  -36.694  -4.132  1.00 146.15 ? 492 SER B O     1 
ATOM   7207  C  CB    . SER B  1 492 ? 16.751  -38.591  -4.302  1.00 153.03 ? 492 SER B CB    1 
ATOM   7208  O  OG    . SER B  1 492 ? 15.751  -39.489  -3.853  1.00 152.17 ? 492 SER B OG    1 
ATOM   7209  N  N     . LYS B  1 493 ? 15.590  -35.875  -5.661  1.00 150.48 ? 493 LYS B N     1 
ATOM   7210  C  CA    . LYS B  1 493 ? 14.572  -35.244  -6.501  1.00 150.45 ? 493 LYS B CA    1 
ATOM   7211  C  C     . LYS B  1 493 ? 13.490  -36.235  -6.938  1.00 151.27 ? 493 LYS B C     1 
ATOM   7212  O  O     . LYS B  1 493 ? 12.359  -35.845  -7.223  1.00 150.29 ? 493 LYS B O     1 
ATOM   7213  C  CB    . LYS B  1 493 ? 15.234  -34.574  -7.710  1.00 153.63 ? 493 LYS B CB    1 
ATOM   7214  C  CG    . LYS B  1 493 ? 16.356  -35.395  -8.344  1.00 157.96 ? 493 LYS B CG    1 
ATOM   7215  C  CD    . LYS B  1 493 ? 17.603  -34.554  -8.562  1.00 159.77 ? 493 LYS B CD    1 
ATOM   7216  C  CE    . LYS B  1 493 ? 18.784  -35.414  -8.984  1.00 164.01 ? 493 LYS B CE    1 
ATOM   7217  N  NZ    . LYS B  1 493 ? 20.060  -34.647  -8.949  1.00 165.42 ? 493 LYS B NZ    1 
ATOM   7218  N  N     . GLU B  1 494 ? 13.861  -37.515  -6.973  1.00 153.42 ? 494 GLU B N     1 
ATOM   7219  C  CA    . GLU B  1 494 ? 12.954  -38.631  -7.235  1.00 154.43 ? 494 GLU B CA    1 
ATOM   7220  C  C     . GLU B  1 494 ? 11.960  -38.808  -6.085  1.00 150.69 ? 494 GLU B C     1 
ATOM   7221  O  O     . GLU B  1 494 ? 10.753  -38.914  -6.300  1.00 149.98 ? 494 GLU B O     1 
ATOM   7222  C  CB    . GLU B  1 494 ? 13.782  -39.909  -7.419  1.00 158.11 ? 494 GLU B CB    1 
ATOM   7223  C  CG    . GLU B  1 494 ? 13.001  -41.171  -7.777  1.00 160.33 ? 494 GLU B CG    1 
ATOM   7224  C  CD    . GLU B  1 494 ? 13.892  -42.404  -7.856  1.00 164.09 ? 494 GLU B CD    1 
ATOM   7225  O  OE1   . GLU B  1 494 ? 14.593  -42.703  -6.864  1.00 162.99 ? 494 GLU B OE1   1 
ATOM   7226  O  OE2   . GLU B  1 494 ? 13.887  -43.076  -8.910  1.00 168.33 ? 494 GLU B OE2   1 
ATOM   7227  N  N     . LEU B  1 495 ? 12.493  -38.827  -4.866  1.00 148.56 ? 495 LEU B N     1 
ATOM   7228  C  CA    . LEU B  1 495 ? 11.713  -39.008  -3.641  1.00 145.30 ? 495 LEU B CA    1 
ATOM   7229  C  C     . LEU B  1 495 ? 10.816  -37.808  -3.312  1.00 141.99 ? 495 LEU B C     1 
ATOM   7230  O  O     . LEU B  1 495 ? 9.818   -37.953  -2.605  1.00 139.97 ? 495 LEU B O     1 
ATOM   7231  C  CB    . LEU B  1 495 ? 12.661  -39.301  -2.472  1.00 144.30 ? 495 LEU B CB    1 
ATOM   7232  C  CG    . LEU B  1 495 ? 12.166  -40.036  -1.224  1.00 142.43 ? 495 LEU B CG    1 
ATOM   7233  C  CD1   . LEU B  1 495 ? 11.475  -41.348  -1.558  1.00 144.51 ? 495 LEU B CD1   1 
ATOM   7234  C  CD2   . LEU B  1 495 ? 13.340  -40.283  -0.300  1.00 142.51 ? 495 LEU B CD2   1 
ATOM   7235  N  N     . LEU B  1 496 ? 11.177  -36.630  -3.818  1.00 141.78 ? 496 LEU B N     1 
ATOM   7236  C  CA    . LEU B  1 496 ? 10.348  -35.437  -3.652  1.00 139.35 ? 496 LEU B CA    1 
ATOM   7237  C  C     . LEU B  1 496 ? 9.237   -35.378  -4.704  1.00 140.66 ? 496 LEU B C     1 
ATOM   7238  O  O     . LEU B  1 496 ? 8.133   -34.915  -4.419  1.00 138.85 ? 496 LEU B O     1 
ATOM   7239  C  CB    . LEU B  1 496 ? 11.203  -34.165  -3.688  1.00 138.95 ? 496 LEU B CB    1 
ATOM   7240  C  CG    . LEU B  1 496 ? 10.600  -32.905  -3.056  1.00 135.94 ? 496 LEU B CG    1 
ATOM   7241  C  CD1   . LEU B  1 496 ? 10.627  -32.981  -1.533  1.00 132.89 ? 496 LEU B CD1   1 
ATOM   7242  C  CD2   . LEU B  1 496 ? 11.335  -31.670  -3.538  1.00 136.81 ? 496 LEU B CD2   1 
ATOM   7243  N  N     . ALA B  1 497 ? 9.536   -35.854  -5.912  1.00 144.13 ? 497 ALA B N     1 
ATOM   7244  C  CA    . ALA B  1 497 ? 8.539   -35.973  -6.979  1.00 146.01 ? 497 ALA B CA    1 
ATOM   7245  C  C     . ALA B  1 497 ? 7.510   -37.066  -6.677  1.00 145.91 ? 497 ALA B C     1 
ATOM   7246  O  O     . ALA B  1 497 ? 6.445   -37.114  -7.299  1.00 146.67 ? 497 ALA B O     1 
ATOM   7247  C  CB    . ALA B  1 497 ? 9.216   -36.233  -8.319  1.00 149.96 ? 497 ALA B CB    1 
ATOM   7248  N  N     . SER B  1 498 ? 7.842   -37.936  -5.722  1.00 145.24 ? 498 SER B N     1 
ATOM   7249  C  CA    . SER B  1 498 ? 6.954   -39.009  -5.272  1.00 145.24 ? 498 SER B CA    1 
ATOM   7250  C  C     . SER B  1 498 ? 6.116   -38.578  -4.066  1.00 141.64 ? 498 SER B C     1 
ATOM   7251  O  O     . SER B  1 498 ? 4.927   -38.884  -3.986  1.00 141.31 ? 498 SER B O     1 
ATOM   7252  C  CB    . SER B  1 498 ? 7.761   -40.267  -4.938  1.00 147.08 ? 498 SER B CB    1 
ATOM   7253  O  OG    . SER B  1 498 ? 6.909   -41.385  -4.749  1.00 148.21 ? 498 SER B OG    1 
ATOM   7254  N  N     . LEU B  1 499 ? 6.745   -37.868  -3.133  1.00 139.34 ? 499 LEU B N     1 
ATOM   7255  C  CA    . LEU B  1 499 ? 6.051   -37.284  -1.983  1.00 136.24 ? 499 LEU B CA    1 
ATOM   7256  C  C     . LEU B  1 499 ? 4.874   -36.414  -2.434  1.00 135.72 ? 499 LEU B C     1 
ATOM   7257  O  O     . LEU B  1 499 ? 3.860   -36.317  -1.742  1.00 134.22 ? 499 LEU B O     1 
ATOM   7258  C  CB    . LEU B  1 499 ? 7.035   -36.466  -1.140  1.00 134.24 ? 499 LEU B CB    1 
ATOM   7259  C  CG    . LEU B  1 499 ? 6.657   -35.978  0.264   1.00 131.35 ? 499 LEU B CG    1 
ATOM   7260  C  CD1   . LEU B  1 499 ? 5.757   -36.955  1.014   1.00 131.19 ? 499 LEU B CD1   1 
ATOM   7261  C  CD2   . LEU B  1 499 ? 7.919   -35.699  1.068   1.00 130.51 ? 499 LEU B CD2   1 
ATOM   7262  N  N     . LYS B  1 500 ? 5.030   -35.803  -3.607  1.00 137.35 ? 500 LYS B N     1 
ATOM   7263  C  CA    . LYS B  1 500 ? 3.998   -34.997  -4.254  1.00 137.46 ? 500 LYS B CA    1 
ATOM   7264  C  C     . LYS B  1 500 ? 2.760   -35.826  -4.609  1.00 138.55 ? 500 LYS B C     1 
ATOM   7265  O  O     . LYS B  1 500 ? 1.633   -35.385  -4.384  1.00 137.61 ? 500 LYS B O     1 
ATOM   7266  C  CB    . LYS B  1 500 ? 4.577   -34.350  -5.517  1.00 139.63 ? 500 LYS B CB    1 
ATOM   7267  C  CG    . LYS B  1 500 ? 4.014   -32.987  -5.870  1.00 139.00 ? 500 LYS B CG    1 
ATOM   7268  C  CD    . LYS B  1 500 ? 5.055   -32.185  -6.636  1.00 140.53 ? 500 LYS B CD    1 
ATOM   7269  C  CE    . LYS B  1 500 ? 4.523   -30.833  -7.071  1.00 141.14 ? 500 LYS B CE    1 
ATOM   7270  N  NZ    . LYS B  1 500 ? 3.652   -30.955  -8.273  1.00 143.86 ? 500 LYS B NZ    1 
ATOM   7271  N  N     . SER B  1 501 ? 2.980   -37.024  -5.153  1.00 140.77 ? 501 SER B N     1 
ATOM   7272  C  CA    . SER B  1 501 ? 1.889   -37.910  -5.579  1.00 142.42 ? 501 SER B CA    1 
ATOM   7273  C  C     . SER B  1 501 ? 1.069   -38.483  -4.422  1.00 140.75 ? 501 SER B C     1 
ATOM   7274  O  O     . SER B  1 501 ? -0.152  -38.591  -4.526  1.00 141.12 ? 501 SER B O     1 
ATOM   7275  C  CB    . SER B  1 501 ? 2.421   -39.062  -6.439  1.00 145.74 ? 501 SER B CB    1 
ATOM   7276  O  OG    . SER B  1 501 ? 2.893   -38.596  -7.689  1.00 148.05 ? 501 SER B OG    1 
ATOM   7277  N  N     . ALA B  1 502 ? 1.742   -38.853  -3.333  1.00 139.18 ? 502 ALA B N     1 
ATOM   7278  C  CA    . ALA B  1 502 ? 1.097   -39.542  -2.216  1.00 138.00 ? 502 ALA B CA    1 
ATOM   7279  C  C     . ALA B  1 502 ? 0.260   -38.604  -1.357  1.00 135.41 ? 502 ALA B C     1 
ATOM   7280  O  O     . ALA B  1 502 ? -0.708  -39.032  -0.722  1.00 135.04 ? 502 ALA B O     1 
ATOM   7281  C  CB    . ALA B  1 502 ? 2.134   -40.257  -1.364  1.00 137.69 ? 502 ALA B CB    1 
ATOM   7282  N  N     . THR B  1 503 ? 0.647   -37.329  -1.345  1.00 133.99 ? 503 THR B N     1 
ATOM   7283  C  CA    . THR B  1 503 ? -0.015  -36.303  -0.537  1.00 131.86 ? 503 THR B CA    1 
ATOM   7284  C  C     . THR B  1 503 ? -1.266  -35.775  -1.233  1.00 132.78 ? 503 THR B C     1 
ATOM   7285  O  O     . THR B  1 503 ? -2.293  -35.545  -0.591  1.00 132.05 ? 503 THR B O     1 
ATOM   7286  C  CB    . THR B  1 503 ? 0.938   -35.124  -0.226  1.00 130.28 ? 503 THR B CB    1 
ATOM   7287  O  OG1   . THR B  1 503 ? 2.161   -35.628  0.321   1.00 129.94 ? 503 THR B OG1   1 
ATOM   7288  C  CG2   . THR B  1 503 ? 0.306   -34.160  0.768   1.00 128.08 ? 503 THR B CG2   1 
ATOM   7289  N  N     . GLU B  1 504 ? -1.167  -35.581  -2.545  1.00 134.65 ? 504 GLU B N     1 
ATOM   7290  C  CA    . GLU B  1 504 ? -2.291  -35.112  -3.347  1.00 135.92 ? 504 GLU B CA    1 
ATOM   7291  C  C     . GLU B  1 504 ? -3.384  -36.175  -3.396  1.00 137.14 ? 504 GLU B C     1 
ATOM   7292  O  O     . GLU B  1 504 ? -4.574  -35.852  -3.403  1.00 137.42 ? 504 GLU B O     1 
ATOM   7293  C  CB    . GLU B  1 504 ? -1.826  -34.746  -4.759  1.00 138.00 ? 504 GLU B CB    1 
ATOM   7294  C  CG    . GLU B  1 504 ? -0.960  -33.486  -4.837  1.00 137.39 ? 504 GLU B CG    1 
ATOM   7295  C  CD    . GLU B  1 504 ? -0.316  -33.269  -6.205  1.00 139.96 ? 504 GLU B CD    1 
ATOM   7296  O  OE1   . GLU B  1 504 ? -0.785  -33.862  -7.203  1.00 142.46 ? 504 GLU B OE1   1 
ATOM   7297  O  OE2   . GLU B  1 504 ? 0.663   -32.493  -6.280  1.00 139.60 ? 504 GLU B OE2   1 
ATOM   7298  N  N     . SER B  1 505 ? -2.958  -37.439  -3.408  1.00 138.17 ? 505 SER B N     1 
ATOM   7299  C  CA    . SER B  1 505 ? -3.847  -38.600  -3.467  1.00 139.81 ? 505 SER B CA    1 
ATOM   7300  C  C     . SER B  1 505 ? -4.679  -38.775  -2.202  1.00 138.36 ? 505 SER B C     1 
ATOM   7301  O  O     . SER B  1 505 ? -5.852  -39.130  -2.274  1.00 139.43 ? 505 SER B O     1 
ATOM   7302  C  CB    . SER B  1 505 ? -3.035  -39.870  -3.733  1.00 141.59 ? 505 SER B CB    1 
ATOM   7303  O  OG    . SER B  1 505 ? -3.850  -41.028  -3.694  1.00 143.46 ? 505 SER B OG    1 
ATOM   7304  N  N     . PHE B  1 506 ? -4.061  -38.532  -1.050  1.00 136.26 ? 506 PHE B N     1 
ATOM   7305  C  CA    . PHE B  1 506 ? -4.733  -38.670  0.243   1.00 135.13 ? 506 PHE B CA    1 
ATOM   7306  C  C     . PHE B  1 506 ? -5.608  -37.462  0.597   1.00 134.02 ? 506 PHE B C     1 
ATOM   7307  O  O     . PHE B  1 506 ? -6.647  -37.615  1.248   1.00 134.13 ? 506 PHE B O     1 
ATOM   7308  C  CB    . PHE B  1 506 ? -3.707  -38.941  1.351   1.00 133.51 ? 506 PHE B CB    1 
ATOM   7309  C  CG    . PHE B  1 506 ? -4.280  -38.871  2.740   1.00 132.27 ? 506 PHE B CG    1 
ATOM   7310  C  CD1   . PHE B  1 506 ? -5.126  -39.877  3.213   1.00 133.60 ? 506 PHE B CD1   1 
ATOM   7311  C  CD2   . PHE B  1 506 ? -3.981  -37.792  3.575   1.00 129.63 ? 506 PHE B CD2   1 
ATOM   7312  C  CE1   . PHE B  1 506 ? -5.663  -39.807  4.499   1.00 132.64 ? 506 PHE B CE1   1 
ATOM   7313  C  CE2   . PHE B  1 506 ? -4.511  -37.712  4.858   1.00 128.18 ? 506 PHE B CE2   1 
ATOM   7314  C  CZ    . PHE B  1 506 ? -5.351  -38.717  5.322   1.00 129.91 ? 506 PHE B CZ    1 
ATOM   7315  N  N     . VAL B  1 507 ? -5.178  -36.273  0.172   1.00 133.33 ? 507 VAL B N     1 
ATOM   7316  C  CA    . VAL B  1 507 ? -5.904  -35.017  0.420   1.00 132.70 ? 507 VAL B CA    1 
ATOM   7317  C  C     . VAL B  1 507 ? -7.269  -34.971  -0.288  1.00 134.76 ? 507 VAL B C     1 
ATOM   7318  O  O     . VAL B  1 507 ? -8.227  -34.402  0.249   1.00 134.77 ? 507 VAL B O     1 
ATOM   7319  C  CB    . VAL B  1 507 ? -5.026  -33.776  0.067   1.00 131.84 ? 507 VAL B CB    1 
ATOM   7320  C  CG1   . VAL B  1 507 ? -5.867  -32.530  -0.188  1.00 132.09 ? 507 VAL B CG1   1 
ATOM   7321  C  CG2   . VAL B  1 507 ? -4.025  -33.519  1.171   1.00 129.68 ? 507 VAL B CG2   1 
ATOM   7322  N  N     . ALA B  1 508 ? -7.353  -35.586  -1.470  1.00 136.69 ? 508 ALA B N     1 
ATOM   7323  C  CA    . ALA B  1 508 ? -8.606  -35.672  -2.236  1.00 139.00 ? 508 ALA B CA    1 
ATOM   7324  C  C     . ALA B  1 508 ? -9.650  -36.602  -1.605  1.00 139.84 ? 508 ALA B C     1 
ATOM   7325  O  O     . ALA B  1 508 ? -10.795 -36.658  -2.065  1.00 141.66 ? 508 ALA B O     1 
ATOM   7326  C  CB    . ALA B  1 508 ? -8.322  -36.101  -3.673  1.00 141.19 ? 508 ALA B CB    1 
ATOM   7327  N  N     . THR B  1 509 ? -9.240  -37.325  -0.561  1.00 138.78 ? 509 THR B N     1 
ATOM   7328  C  CA    . THR B  1 509 ? -10.090 -38.291  0.144   1.00 139.70 ? 509 THR B CA    1 
ATOM   7329  C  C     . THR B  1 509 ? -9.709  -38.408  1.618   1.00 137.68 ? 509 THR B C     1 
ATOM   7330  O  O     . THR B  1 509 ? -10.074 -37.563  2.434   1.00 136.53 ? 509 THR B O     1 
ATOM   7331  C  CB    . THR B  1 509 ? -10.040 -39.697  -0.513  1.00 142.03 ? 509 THR B CB    1 
ATOM   7332  O  OG1   . THR B  1 509 ? -10.458 -40.686  0.436   1.00 143.07 ? 509 THR B OG1   1 
ATOM   7333  C  CG2   . THR B  1 509 ? -8.634  -40.037  -0.984  1.00 141.75 ? 509 THR B CG2   1 
ATOM   7334  N  N     . ASN C  1 26  ? 62.080  7.888    69.169  1.00 113.37 ? 26  ASN C N     1 
ATOM   7335  C  CA    . ASN C  1 26  ? 61.515  8.876    68.208  1.00 108.96 ? 26  ASN C CA    1 
ATOM   7336  C  C     . ASN C  1 26  ? 60.946  8.217    66.955  1.00 103.96 ? 26  ASN C C     1 
ATOM   7337  O  O     . ASN C  1 26  ? 61.690  7.655    66.144  1.00 105.20 ? 26  ASN C O     1 
ATOM   7338  C  CB    . ASN C  1 26  ? 62.585  9.914    67.821  1.00 112.23 ? 26  ASN C CB    1 
ATOM   7339  C  CG    . ASN C  1 26  ? 62.054  11.004   66.872  1.00 109.04 ? 26  ASN C CG    1 
ATOM   7340  O  OD1   . ASN C  1 26  ? 61.033  10.839   66.201  1.00 102.81 ? 26  ASN C OD1   1 
ATOM   7341  N  ND2   . ASN C  1 26  ? 62.772  12.122   66.813  1.00 113.22 ? 26  ASN C ND2   1 
ATOM   7342  N  N     . LEU C  1 27  ? 59.623  8.283    66.824  1.00 98.74  ? 27  LEU C N     1 
ATOM   7343  C  CA    . LEU C  1 27  ? 58.918  8.023    65.568  1.00 93.56  ? 27  LEU C CA    1 
ATOM   7344  C  C     . LEU C  1 27  ? 57.941  9.170    65.347  1.00 89.95  ? 27  LEU C C     1 
ATOM   7345  O  O     . LEU C  1 27  ? 56.729  8.965    65.285  1.00 86.76  ? 27  LEU C O     1 
ATOM   7346  C  CB    . LEU C  1 27  ? 58.144  6.712    65.637  1.00 91.67  ? 27  LEU C CB    1 
ATOM   7347  C  CG    . LEU C  1 27  ? 58.797  5.398    65.225  1.00 93.53  ? 27  LEU C CG    1 
ATOM   7348  C  CD1   . LEU C  1 27  ? 58.102  4.252    65.941  1.00 94.32  ? 27  LEU C CD1   1 
ATOM   7349  C  CD2   . LEU C  1 27  ? 58.755  5.202    63.712  1.00 90.85  ? 27  LEU C CD2   1 
ATOM   7350  N  N     . ASN C  1 28  ? 58.471  10.384   65.258  1.00 90.83  ? 28  ASN C N     1 
ATOM   7351  C  CA    . ASN C  1 28  ? 57.644  11.567   65.129  1.00 87.95  ? 28  ASN C CA    1 
ATOM   7352  C  C     . ASN C  1 28  ? 57.511  11.994   63.691  1.00 85.37  ? 28  ASN C C     1 
ATOM   7353  O  O     . ASN C  1 28  ? 56.396  12.093   63.174  1.00 81.97  ? 28  ASN C O     1 
ATOM   7354  C  CB    . ASN C  1 28  ? 58.195  12.718   65.967  1.00 91.41  ? 28  ASN C CB    1 
ATOM   7355  C  CG    . ASN C  1 28  ? 58.039  12.480   67.451  1.00 93.68  ? 28  ASN C CG    1 
ATOM   7356  O  OD1   . ASN C  1 28  ? 57.126  11.777   67.886  1.00 91.51  ? 28  ASN C OD1   1 
ATOM   7357  N  ND2   . ASN C  1 28  ? 58.934  13.065   68.241  1.00 98.75  ? 28  ASN C ND2   1 
ATOM   7358  N  N     . GLU C  1 29  ? 58.646  12.242   63.046  1.00 87.32  ? 29  GLU C N     1 
ATOM   7359  C  CA    . GLU C  1 29  ? 58.649  12.791   61.695  1.00 85.95  ? 29  GLU C CA    1 
ATOM   7360  C  C     . GLU C  1 29  ? 58.658  11.698   60.623  1.00 84.10  ? 29  GLU C C     1 
ATOM   7361  O  O     . GLU C  1 29  ? 58.508  11.972   59.431  1.00 82.87  ? 29  GLU C O     1 
ATOM   7362  C  CB    . GLU C  1 29  ? 59.821  13.756   61.518  1.00 89.78  ? 29  GLU C CB    1 
ATOM   7363  C  CG    . GLU C  1 29  ? 60.038  14.684   62.705  1.00 93.17  ? 29  GLU C CG    1 
ATOM   7364  C  CD    . GLU C  1 29  ? 58.879  15.632   62.933  1.00 92.78  ? 29  GLU C CD    1 
ATOM   7365  O  OE1   . GLU C  1 29  ? 58.413  16.260   61.952  1.00 91.98  ? 29  GLU C OE1   1 
ATOM   7366  O  OE2   . GLU C  1 29  ? 58.436  15.756   64.098  1.00 93.70  ? 29  GLU C OE2   1 
ATOM   7367  N  N     . THR C  1 30  ? 58.819  10.456   61.065  1.00 84.36  ? 30  THR C N     1 
ATOM   7368  C  CA    . THR C  1 30  ? 58.906  9.312    60.164  1.00 83.20  ? 30  THR C CA    1 
ATOM   7369  C  C     . THR C  1 30  ? 58.097  8.142    60.694  1.00 81.09  ? 30  THR C C     1 
ATOM   7370  O  O     . THR C  1 30  ? 57.876  8.019    61.900  1.00 81.91  ? 30  THR C O     1 
ATOM   7371  C  CB    . THR C  1 30  ? 60.356  8.827    60.010  1.00 87.34  ? 30  THR C CB    1 
ATOM   7372  O  OG1   . THR C  1 30  ? 60.890  8.517    61.306  1.00 90.60  ? 30  THR C OG1   1 
ATOM   7373  C  CG2   . THR C  1 30  ? 61.227  9.886    59.327  1.00 89.88  ? 30  THR C CG2   1 
ATOM   7374  N  N     . GLY C  1 31  ? 57.679  7.269    59.788  1.00 78.90  ? 31  GLY C N     1 
ATOM   7375  C  CA    . GLY C  1 31  ? 56.910  6.098    60.176  1.00 77.47  ? 31  GLY C CA    1 
ATOM   7376  C  C     . GLY C  1 31  ? 57.218  4.885    59.333  1.00 77.62  ? 31  GLY C C     1 
ATOM   7377  O  O     . GLY C  1 31  ? 57.921  4.985    58.331  1.00 78.83  ? 31  GLY C O     1 
ATOM   7378  N  N     . ARG C  1 32  ? 56.693  3.734    59.744  1.00 76.91  ? 32  ARG C N     1 
ATOM   7379  C  CA    . ARG C  1 32  ? 56.904  2.497    59.005  1.00 77.07  ? 32  ARG C CA    1 
ATOM   7380  C  C     . ARG C  1 32  ? 55.579  1.910    58.503  1.00 73.44  ? 32  ARG C C     1 
ATOM   7381  O  O     . ARG C  1 32  ? 54.621  1.757    59.268  1.00 72.18  ? 32  ARG C O     1 
ATOM   7382  C  CB    . ARG C  1 32  ? 57.698  1.496    59.854  1.00 80.80  ? 32  ARG C CB    1 
ATOM   7383  C  CG    . ARG C  1 32  ? 59.134  1.971    60.154  1.00 86.49  ? 32  ARG C CG    1 
ATOM   7384  C  CD    . ARG C  1 32  ? 59.920  1.058    61.108  1.00 92.78  ? 32  ARG C CD    1 
ATOM   7385  N  NE    . ARG C  1 32  ? 59.481  1.190    62.501  1.00 95.09  ? 32  ARG C NE    1 
ATOM   7386  C  CZ    . ARG C  1 32  ? 60.270  1.041    63.568  1.00 100.39 ? 32  ARG C CZ    1 
ATOM   7387  N  NH1   . ARG C  1 32  ? 61.567  0.761    63.428  1.00 104.63 ? 32  ARG C NH1   1 
ATOM   7388  N  NH2   . ARG C  1 32  ? 59.759  1.187    64.789  1.00 100.85 ? 32  ARG C NH2   1 
ATOM   7389  N  N     . VAL C  1 33  ? 55.535  1.608    57.206  1.00 71.63  ? 33  VAL C N     1 
ATOM   7390  C  CA    . VAL C  1 33  ? 54.403  0.932    56.579  1.00 68.45  ? 33  VAL C CA    1 
ATOM   7391  C  C     . VAL C  1 33  ? 54.076  -0.380   57.309  1.00 68.96  ? 33  VAL C C     1 
ATOM   7392  O  O     . VAL C  1 33  ? 54.942  -1.225   57.505  1.00 71.53  ? 33  VAL C O     1 
ATOM   7393  C  CB    . VAL C  1 33  ? 54.688  0.652    55.078  1.00 68.32  ? 33  VAL C CB    1 
ATOM   7394  C  CG1   . VAL C  1 33  ? 53.534  -0.095   54.440  1.00 67.52  ? 33  VAL C CG1   1 
ATOM   7395  C  CG2   . VAL C  1 33  ? 54.913  1.933    54.337  1.00 67.02  ? 33  VAL C CG2   1 
ATOM   7396  N  N     . LEU C  1 34  ? 52.820  -0.534   57.710  1.00 66.86  ? 34  LEU C N     1 
ATOM   7397  C  CA    . LEU C  1 34  ? 52.361  -1.735   58.411  1.00 67.62  ? 34  LEU C CA    1 
ATOM   7398  C  C     . LEU C  1 34  ? 51.719  -2.736   57.470  1.00 67.07  ? 34  LEU C C     1 
ATOM   7399  O  O     . LEU C  1 34  ? 51.838  -3.952   57.672  1.00 69.11  ? 34  LEU C O     1 
ATOM   7400  C  CB    . LEU C  1 34  ? 51.356  -1.366   59.495  1.00 66.52  ? 34  LEU C CB    1 
ATOM   7401  C  CG    . LEU C  1 34  ? 51.909  -0.757   60.773  1.00 67.11  ? 34  LEU C CG    1 
ATOM   7402  C  CD1   . LEU C  1 34  ? 50.845  0.111    61.405  1.00 65.55  ? 34  LEU C CD1   1 
ATOM   7403  C  CD2   . LEU C  1 34  ? 52.361  -1.846   61.719  1.00 69.75  ? 34  LEU C CD2   1 
ATOM   7404  N  N     . ALA C  1 35  ? 51.014  -2.203   56.472  1.00 64.51  ? 35  ALA C N     1 
ATOM   7405  C  CA    . ALA C  1 35  ? 50.354  -2.973   55.421  1.00 63.96  ? 35  ALA C CA    1 
ATOM   7406  C  C     . ALA C  1 35  ? 50.140  -2.059   54.217  1.00 62.25  ? 35  ALA C C     1 
ATOM   7407  O  O     . ALA C  1 35  ? 50.127  -0.829   54.358  1.00 61.01  ? 35  ALA C O     1 
ATOM   7408  C  CB    . ALA C  1 35  ? 49.050  -3.517   55.911  1.00 63.22  ? 35  ALA C CB    1 
ATOM   7409  N  N     . VAL C  1 36  ? 50.009  -2.644   53.030  1.00 62.74  ? 36  VAL C N     1 
ATOM   7410  C  CA    . VAL C  1 36  ? 49.806  -1.843   51.821  1.00 62.04  ? 36  VAL C CA    1 
ATOM   7411  C  C     . VAL C  1 36  ? 49.168  -2.623   50.686  1.00 62.98  ? 36  VAL C C     1 
ATOM   7412  O  O     . VAL C  1 36  ? 49.382  -3.824   50.539  1.00 64.55  ? 36  VAL C O     1 
ATOM   7413  C  CB    . VAL C  1 36  ? 51.116  -1.170   51.314  1.00 62.84  ? 36  VAL C CB    1 
ATOM   7414  C  CG1   . VAL C  1 36  ? 52.140  -2.209   50.877  1.00 65.30  ? 36  VAL C CG1   1 
ATOM   7415  C  CG2   . VAL C  1 36  ? 50.824  -0.193   50.175  1.00 61.94  ? 36  VAL C CG2   1 
ATOM   7416  N  N     . GLY C  1 37  ? 48.392  -1.908   49.882  1.00 62.35  ? 37  GLY C N     1 
ATOM   7417  C  CA    . GLY C  1 37  ? 47.706  -2.480   48.739  1.00 63.80  ? 37  GLY C CA    1 
ATOM   7418  C  C     . GLY C  1 37  ? 46.550  -1.592   48.353  1.00 63.00  ? 37  GLY C C     1 
ATOM   7419  O  O     . GLY C  1 37  ? 46.038  -0.827   49.185  1.00 61.65  ? 37  GLY C O     1 
ATOM   7420  N  N     . ASP C  1 38  ? 46.159  -1.682   47.082  1.00 64.34  ? 38  ASP C N     1 
ATOM   7421  C  CA    . ASP C  1 38  ? 45.020  -0.936   46.543  1.00 64.16  ? 38  ASP C CA    1 
ATOM   7422  C  C     . ASP C  1 38  ? 45.220  0.584    46.584  1.00 62.93  ? 38  ASP C C     1 
ATOM   7423  O  O     . ASP C  1 38  ? 44.248  1.342    46.548  1.00 62.73  ? 38  ASP C O     1 
ATOM   7424  C  CB    . ASP C  1 38  ? 43.738  -1.334   47.278  1.00 63.94  ? 38  ASP C CB    1 
ATOM   7425  C  CG    . ASP C  1 38  ? 43.467  -2.820   47.202  1.00 66.61  ? 38  ASP C CG    1 
ATOM   7426  O  OD1   . ASP C  1 38  ? 44.090  -3.487   46.348  1.00 69.40  ? 38  ASP C OD1   1 
ATOM   7427  O  OD2   . ASP C  1 38  ? 42.629  -3.328   47.979  1.00 67.28  ? 38  ASP C OD2   1 
ATOM   7428  N  N     . GLY C  1 39  ? 46.478  1.019    46.648  1.00 62.42  ? 39  GLY C N     1 
ATOM   7429  C  CA    . GLY C  1 39  ? 46.798  2.430    46.695  1.00 61.48  ? 39  GLY C CA    1 
ATOM   7430  C  C     . GLY C  1 39  ? 46.638  3.010    48.082  1.00 60.05  ? 39  GLY C C     1 
ATOM   7431  O  O     . GLY C  1 39  ? 46.833  4.215    48.275  1.00 59.76  ? 39  GLY C O     1 
ATOM   7432  N  N     . ILE C  1 40  ? 46.277  2.168    49.048  1.00 59.60  ? 40  ILE C N     1 
ATOM   7433  C  CA    . ILE C  1 40  ? 46.251  2.583    50.451  1.00 59.03  ? 40  ILE C CA    1 
ATOM   7434  C  C     . ILE C  1 40  ? 47.460  2.045    51.197  1.00 59.90  ? 40  ILE C C     1 
ATOM   7435  O  O     . ILE C  1 40  ? 47.894  0.913    50.958  1.00 61.61  ? 40  ILE C O     1 
ATOM   7436  C  CB    . ILE C  1 40  ? 44.994  2.091    51.191  1.00 58.76  ? 40  ILE C CB    1 
ATOM   7437  C  CG1   . ILE C  1 40  ? 43.721  2.726    50.620  1.00 58.75  ? 40  ILE C CG1   1 
ATOM   7438  C  CG2   . ILE C  1 40  ? 45.100  2.376    52.687  1.00 58.56  ? 40  ILE C CG2   1 
ATOM   7439  C  CD1   . ILE C  1 40  ? 43.666  4.218    50.684  1.00 57.60  ? 40  ILE C CD1   1 
ATOM   7440  N  N     . ALA C  1 41  ? 47.992  2.854    52.107  1.00 59.52  ? 41  ALA C N     1 
ATOM   7441  C  CA    . ALA C  1 41  ? 49.068  2.426    52.999  1.00 60.38  ? 41  ALA C CA    1 
ATOM   7442  C  C     . ALA C  1 41  ? 48.686  2.731    54.445  1.00 60.10  ? 41  ALA C C     1 
ATOM   7443  O  O     . ALA C  1 41  ? 48.174  3.818    54.746  1.00 59.46  ? 41  ALA C O     1 
ATOM   7444  C  CB    . ALA C  1 41  ? 50.357  3.114    52.642  1.00 60.96  ? 41  ALA C CB    1 
ATOM   7445  N  N     . ARG C  1 42  ? 48.908  1.759    55.327  1.00 60.96  ? 42  ARG C N     1 
ATOM   7446  C  CA    . ARG C  1 42  ? 48.729  1.963    56.753  1.00 60.96  ? 42  ARG C CA    1 
ATOM   7447  C  C     . ARG C  1 42  ? 50.106  2.071    57.353  1.00 62.73  ? 42  ARG C C     1 
ATOM   7448  O  O     . ARG C  1 42  ? 50.904  1.134    57.255  1.00 64.49  ? 42  ARG C O     1 
ATOM   7449  C  CB    . ARG C  1 42  ? 47.972  0.806    57.376  1.00 61.61  ? 42  ARG C CB    1 
ATOM   7450  C  CG    . ARG C  1 42  ? 46.453  0.895    57.244  1.00 60.72  ? 42  ARG C CG    1 
ATOM   7451  C  CD    . ARG C  1 42  ? 45.809  -0.472   57.478  1.00 61.98  ? 42  ARG C CD    1 
ATOM   7452  N  NE    . ARG C  1 42  ? 46.492  -1.236   58.528  1.00 62.96  ? 42  ARG C NE    1 
ATOM   7453  C  CZ    . ARG C  1 42  ? 46.538  -2.561   58.585  1.00 63.58  ? 42  ARG C CZ    1 
ATOM   7454  N  NH1   . ARG C  1 42  ? 45.939  -3.287   57.650  1.00 63.22  ? 42  ARG C NH1   1 
ATOM   7455  N  NH2   . ARG C  1 42  ? 47.196  -3.156   59.572  1.00 65.18  ? 42  ARG C NH2   1 
ATOM   7456  N  N     . VAL C  1 43  ? 50.381  3.225    57.960  1.00 62.59  ? 43  VAL C N     1 
ATOM   7457  C  CA    . VAL C  1 43  ? 51.713  3.569    58.458  1.00 63.99  ? 43  VAL C CA    1 
ATOM   7458  C  C     . VAL C  1 43  ? 51.763  3.641    59.983  1.00 65.26  ? 43  VAL C C     1 
ATOM   7459  O  O     . VAL C  1 43  ? 50.930  4.275    60.609  1.00 64.59  ? 43  VAL C O     1 
ATOM   7460  C  CB    . VAL C  1 43  ? 52.166  4.918    57.884  1.00 63.36  ? 43  VAL C CB    1 
ATOM   7461  C  CG1   . VAL C  1 43  ? 53.628  5.179    58.221  1.00 66.29  ? 43  VAL C CG1   1 
ATOM   7462  C  CG2   . VAL C  1 43  ? 51.964  4.937    56.394  1.00 61.99  ? 43  VAL C CG2   1 
ATOM   7463  N  N     . PHE C  1 44  ? 52.750  2.985    60.571  1.00 67.98  ? 44  PHE C N     1 
ATOM   7464  C  CA    . PHE C  1 44  ? 53.032  3.122    61.997  1.00 70.08  ? 44  PHE C CA    1 
ATOM   7465  C  C     . PHE C  1 44  ? 53.825  4.396    62.273  1.00 71.08  ? 44  PHE C C     1 
ATOM   7466  O  O     . PHE C  1 44  ? 54.617  4.831    61.439  1.00 71.30  ? 44  PHE C O     1 
ATOM   7467  C  CB    . PHE C  1 44  ? 53.832  1.922    62.502  1.00 72.96  ? 44  PHE C CB    1 
ATOM   7468  C  CG    . PHE C  1 44  ? 53.896  1.838    63.986  1.00 75.43  ? 44  PHE C CG    1 
ATOM   7469  C  CD1   . PHE C  1 44  ? 52.739  1.592    64.729  1.00 74.62  ? 44  PHE C CD1   1 
ATOM   7470  C  CD2   . PHE C  1 44  ? 55.106  2.016    64.652  1.00 78.76  ? 44  PHE C CD2   1 
ATOM   7471  C  CE1   . PHE C  1 44  ? 52.783  1.519    66.116  1.00 77.34  ? 44  PHE C CE1   1 
ATOM   7472  C  CE2   . PHE C  1 44  ? 55.167  1.946    66.036  1.00 81.71  ? 44  PHE C CE2   1 
ATOM   7473  C  CZ    . PHE C  1 44  ? 53.998  1.699    66.774  1.00 81.08  ? 44  PHE C CZ    1 
ATOM   7474  N  N     . GLY C  1 45  ? 53.627  4.977    63.453  1.00 71.90  ? 45  GLY C N     1 
ATOM   7475  C  CA    . GLY C  1 45  ? 54.355  6.177    63.833  1.00 73.34  ? 45  GLY C CA    1 
ATOM   7476  C  C     . GLY C  1 45  ? 53.778  7.411    63.176  1.00 71.02  ? 45  GLY C C     1 
ATOM   7477  O  O     . GLY C  1 45  ? 52.557  7.548    63.085  1.00 68.81  ? 45  GLY C O     1 
ATOM   7478  N  N     . LEU C  1 46  ? 54.659  8.291    62.699  1.00 71.97  ? 46  LEU C N     1 
ATOM   7479  C  CA    . LEU C  1 46  ? 54.282  9.609    62.166  1.00 70.61  ? 46  LEU C CA    1 
ATOM   7480  C  C     . LEU C  1 46  ? 53.530  10.413   63.221  1.00 70.71  ? 46  LEU C C     1 
ATOM   7481  O  O     . LEU C  1 46  ? 52.589  11.141   62.917  1.00 68.80  ? 46  LEU C O     1 
ATOM   7482  C  CB    . LEU C  1 46  ? 53.468  9.497    60.867  1.00 67.50  ? 46  LEU C CB    1 
ATOM   7483  C  CG    . LEU C  1 46  ? 54.164  8.982    59.603  1.00 67.59  ? 46  LEU C CG    1 
ATOM   7484  C  CD1   . LEU C  1 46  ? 53.165  8.790    58.481  1.00 65.14  ? 46  LEU C CD1   1 
ATOM   7485  C  CD2   . LEU C  1 46  ? 55.270  9.924    59.148  1.00 70.89  ? 46  LEU C CD2   1 
ATOM   7486  N  N     . ASN C  1 47  ? 53.988  10.282   64.462  1.00 73.36  ? 47  ASN C N     1 
ATOM   7487  C  CA    . ASN C  1 47  ? 53.300  10.801   65.636  1.00 74.21  ? 47  ASN C CA    1 
ATOM   7488  C  C     . ASN C  1 47  ? 53.045  12.304   65.685  1.00 74.58  ? 47  ASN C C     1 
ATOM   7489  O  O     . ASN C  1 47  ? 52.253  12.766   66.502  1.00 75.06  ? 47  ASN C O     1 
ATOM   7490  C  CB    . ASN C  1 47  ? 54.038  10.360   66.905  1.00 77.76  ? 47  ASN C CB    1 
ATOM   7491  C  CG    . ASN C  1 47  ? 53.818  8.896    67.226  1.00 77.72  ? 47  ASN C CG    1 
ATOM   7492  O  OD1   . ASN C  1 47  ? 53.391  8.118    66.374  1.00 74.99  ? 47  ASN C OD1   1 
ATOM   7493  N  ND2   . ASN C  1 47  ? 54.100  8.513    68.468  1.00 80.88  ? 47  ASN C ND2   1 
ATOM   7494  N  N     . ASN C  1 48  ? 53.713  13.076   64.839  1.00 75.13  ? 48  ASN C N     1 
ATOM   7495  C  CA    . ASN C  1 48  ? 53.485  14.518   64.842  1.00 75.99  ? 48  ASN C CA    1 
ATOM   7496  C  C     . ASN C  1 48  ? 52.922  15.046   63.528  1.00 73.77  ? 48  ASN C C     1 
ATOM   7497  O  O     . ASN C  1 48  ? 52.956  16.260   63.270  1.00 74.79  ? 48  ASN C O     1 
ATOM   7498  C  CB    . ASN C  1 48  ? 54.746  15.280   65.263  1.00 79.99  ? 48  ASN C CB    1 
ATOM   7499  C  CG    . ASN C  1 48  ? 54.950  15.290   66.776  1.00 83.31  ? 48  ASN C CG    1 
ATOM   7500  O  OD1   . ASN C  1 48  ? 53.997  15.203   67.551  1.00 82.99  ? 48  ASN C OD1   1 
ATOM   7501  N  ND2   . ASN C  1 48  ? 56.202  15.404   67.197  1.00 87.90  ? 48  ASN C ND2   1 
ATOM   7502  N  N     . ILE C  1 49  ? 52.391  14.125   62.719  1.00 71.21  ? 49  ILE C N     1 
ATOM   7503  C  CA    . ILE C  1 49  ? 51.821  14.452   61.419  1.00 69.14  ? 49  ILE C CA    1 
ATOM   7504  C  C     . ILE C  1 49  ? 50.470  15.098   61.610  1.00 67.70  ? 49  ILE C C     1 
ATOM   7505  O  O     . ILE C  1 49  ? 49.736  14.756   62.537  1.00 67.24  ? 49  ILE C O     1 
ATOM   7506  C  CB    . ILE C  1 49  ? 51.681  13.213   60.493  1.00 67.48  ? 49  ILE C CB    1 
ATOM   7507  C  CG1   . ILE C  1 49  ? 51.368  13.656   59.056  1.00 66.83  ? 49  ILE C CG1   1 
ATOM   7508  C  CG2   . ILE C  1 49  ? 50.599  12.244   61.009  1.00 65.66  ? 49  ILE C CG2   1 
ATOM   7509  C  CD1   . ILE C  1 49  ? 51.384  12.536   58.035  1.00 65.94  ? 49  ILE C CD1   1 
ATOM   7510  N  N     . GLN C  1 50  ? 50.172  16.048   60.729  1.00 67.68  ? 50  GLN C N     1 
ATOM   7511  C  CA    . GLN C  1 50  ? 48.897  16.745   60.702  1.00 66.87  ? 50  GLN C CA    1 
ATOM   7512  C  C     . GLN C  1 50  ? 47.946  15.999   59.793  1.00 64.64  ? 50  GLN C C     1 
ATOM   7513  O  O     . GLN C  1 50  ? 48.374  15.407   58.800  1.00 64.29  ? 50  GLN C O     1 
ATOM   7514  C  CB    . GLN C  1 50  ? 49.059  18.135   60.106  1.00 68.16  ? 50  GLN C CB    1 
ATOM   7515  C  CG    . GLN C  1 50  ? 50.041  19.045   60.758  1.00 71.10  ? 50  GLN C CG    1 
ATOM   7516  C  CD    . GLN C  1 50  ? 50.376  20.197   59.839  1.00 74.30  ? 50  GLN C CD    1 
ATOM   7517  O  OE1   . GLN C  1 50  ? 51.016  20.007   58.804  1.00 75.04  ? 50  GLN C OE1   1 
ATOM   7518  N  NE2   . GLN C  1 50  ? 49.928  21.399   60.197  1.00 76.43  ? 50  GLN C NE2   1 
ATOM   7519  N  N     . ALA C  1 51  ? 46.659  16.047   60.118  1.00 63.80  ? 51  ALA C N     1 
ATOM   7520  C  CA    . ALA C  1 51  ? 45.616  15.612   59.206  1.00 62.23  ? 51  ALA C CA    1 
ATOM   7521  C  C     . ALA C  1 51  ? 45.745  16.355   57.874  1.00 62.80  ? 51  ALA C C     1 
ATOM   7522  O  O     . ALA C  1 51  ? 45.763  17.589   57.844  1.00 64.34  ? 51  ALA C O     1 
ATOM   7523  C  CB    . ALA C  1 51  ? 44.263  15.874   59.822  1.00 62.26  ? 51  ALA C CB    1 
ATOM   7524  N  N     . GLU C  1 52  ? 45.857  15.586   56.790  1.00 62.06  ? 52  GLU C N     1 
ATOM   7525  C  CA    . GLU C  1 52  ? 45.899  16.088   55.392  1.00 63.04  ? 52  GLU C CA    1 
ATOM   7526  C  C     . GLU C  1 52  ? 47.278  16.563   54.879  1.00 64.04  ? 52  GLU C C     1 
ATOM   7527  O  O     . GLU C  1 52  ? 47.391  17.241   53.849  1.00 65.20  ? 52  GLU C O     1 
ATOM   7528  C  CB    . GLU C  1 52  ? 44.775  17.094   55.117  1.00 63.94  ? 52  GLU C CB    1 
ATOM   7529  C  CG    . GLU C  1 52  ? 43.413  16.498   55.331  1.00 65.36  ? 52  GLU C CG    1 
ATOM   7530  C  CD    . GLU C  1 52  ? 42.298  17.436   54.938  1.00 71.49  ? 52  GLU C CD    1 
ATOM   7531  O  OE1   . GLU C  1 52  ? 42.565  18.335   54.101  1.00 75.39  ? 52  GLU C OE1   1 
ATOM   7532  O  OE2   . GLU C  1 52  ? 41.161  17.274   55.460  1.00 72.34  ? 52  GLU C OE2   1 
ATOM   7533  N  N     . GLU C  1 53  ? 48.318  16.181   55.602  1.00 63.91  ? 53  GLU C N     1 
ATOM   7534  C  CA    . GLU C  1 53  ? 49.684  16.509   55.251  1.00 65.43  ? 53  GLU C CA    1 
ATOM   7535  C  C     . GLU C  1 53  ? 50.173  15.626   54.111  1.00 64.72  ? 53  GLU C C     1 
ATOM   7536  O  O     . GLU C  1 53  ? 49.772  14.477   53.999  1.00 63.53  ? 53  GLU C O     1 
ATOM   7537  C  CB    . GLU C  1 53  ? 50.546  16.267   56.480  1.00 66.40  ? 53  GLU C CB    1 
ATOM   7538  C  CG    . GLU C  1 53  ? 51.933  16.817   56.421  1.00 69.94  ? 53  GLU C CG    1 
ATOM   7539  C  CD    . GLU C  1 53  ? 52.574  16.797   57.772  1.00 72.79  ? 53  GLU C CD    1 
ATOM   7540  O  OE1   . GLU C  1 53  ? 51.932  17.267   58.732  1.00 73.03  ? 53  GLU C OE1   1 
ATOM   7541  O  OE2   . GLU C  1 53  ? 53.717  16.312   57.879  1.00 75.89  ? 53  GLU C OE2   1 
ATOM   7542  N  N     . LEU C  1 54  ? 51.044  16.161   53.272  1.00 66.24  ? 54  LEU C N     1 
ATOM   7543  C  CA    . LEU C  1 54  ? 51.729  15.369   52.261  1.00 66.52  ? 54  LEU C CA    1 
ATOM   7544  C  C     . LEU C  1 54  ? 52.840  14.517   52.898  1.00 67.02  ? 54  LEU C C     1 
ATOM   7545  O  O     . LEU C  1 54  ? 53.605  15.015   53.726  1.00 68.56  ? 54  LEU C O     1 
ATOM   7546  C  CB    . LEU C  1 54  ? 52.338  16.322   51.232  1.00 69.32  ? 54  LEU C CB    1 
ATOM   7547  C  CG    . LEU C  1 54  ? 52.612  15.929   49.784  1.00 70.03  ? 54  LEU C CG    1 
ATOM   7548  C  CD1   . LEU C  1 54  ? 51.361  15.408   49.113  1.00 67.43  ? 54  LEU C CD1   1 
ATOM   7549  C  CD2   . LEU C  1 54  ? 53.120  17.160   49.054  1.00 73.99  ? 54  LEU C CD2   1 
ATOM   7550  N  N     . VAL C  1 55  ? 52.915  13.236   52.530  1.00 65.87  ? 55  VAL C N     1 
ATOM   7551  C  CA    . VAL C  1 55  ? 54.042  12.380   52.924  1.00 67.01  ? 55  VAL C CA    1 
ATOM   7552  C  C     . VAL C  1 55  ? 54.819  11.848   51.717  1.00 68.89  ? 55  VAL C C     1 
ATOM   7553  O  O     . VAL C  1 55  ? 54.298  11.794   50.596  1.00 68.27  ? 55  VAL C O     1 
ATOM   7554  C  CB    . VAL C  1 55  ? 53.632  11.175   53.808  1.00 64.99  ? 55  VAL C CB    1 
ATOM   7555  C  CG1   . VAL C  1 55  ? 52.900  11.631   55.039  1.00 63.83  ? 55  VAL C CG1   1 
ATOM   7556  C  CG2   . VAL C  1 55  ? 52.804  10.177   53.021  1.00 63.43  ? 55  VAL C CG2   1 
ATOM   7557  N  N     . GLU C  1 56  ? 56.072  11.458   51.967  1.00 71.48  ? 56  GLU C N     1 
ATOM   7558  C  CA    . GLU C  1 56  ? 56.938  10.861   50.950  1.00 73.62  ? 56  GLU C CA    1 
ATOM   7559  C  C     . GLU C  1 56  ? 57.386  9.473    51.370  1.00 73.60  ? 56  GLU C C     1 
ATOM   7560  O  O     . GLU C  1 56  ? 57.868  9.273    52.487  1.00 74.40  ? 56  GLU C O     1 
ATOM   7561  C  CB    . GLU C  1 56  ? 58.146  11.752   50.665  1.00 77.44  ? 56  GLU C CB    1 
ATOM   7562  C  CG    . GLU C  1 56  ? 57.779  13.053   49.978  1.00 79.18  ? 56  GLU C CG    1 
ATOM   7563  C  CD    . GLU C  1 56  ? 58.961  13.967   49.760  1.00 85.90  ? 56  GLU C CD    1 
ATOM   7564  O  OE1   . GLU C  1 56  ? 60.125  13.493   49.827  1.00 89.79  ? 56  GLU C OE1   1 
ATOM   7565  O  OE2   . GLU C  1 56  ? 58.721  15.172   49.519  1.00 87.65  ? 56  GLU C OE2   1 
ATOM   7566  N  N     . PHE C  1 57  ? 57.195  8.511    50.474  1.00 73.08  ? 57  PHE C N     1 
ATOM   7567  C  CA    . PHE C  1 57  ? 57.630  7.147    50.722  1.00 73.58  ? 57  PHE C CA    1 
ATOM   7568  C  C     . PHE C  1 57  ? 59.064  6.980    50.243  1.00 77.70  ? 57  PHE C C     1 
ATOM   7569  O  O     . PHE C  1 57  ? 59.469  7.615    49.274  1.00 79.77  ? 57  PHE C O     1 
ATOM   7570  C  CB    . PHE C  1 57  ? 56.692  6.158    50.036  1.00 71.34  ? 57  PHE C CB    1 
ATOM   7571  C  CG    . PHE C  1 57  ? 55.366  6.019    50.716  1.00 66.68  ? 57  PHE C CG    1 
ATOM   7572  C  CD1   . PHE C  1 57  ? 54.427  7.033    50.654  1.00 64.71  ? 57  PHE C CD1   1 
ATOM   7573  C  CD2   . PHE C  1 57  ? 55.060  4.872    51.427  1.00 64.98  ? 57  PHE C CD2   1 
ATOM   7574  C  CE1   . PHE C  1 57  ? 53.189  6.905    51.300  1.00 62.61  ? 57  PHE C CE1   1 
ATOM   7575  C  CE2   . PHE C  1 57  ? 53.832  4.732    52.070  1.00 62.49  ? 57  PHE C CE2   1 
ATOM   7576  C  CZ    . PHE C  1 57  ? 52.895  5.749    52.006  1.00 60.99  ? 57  PHE C CZ    1 
ATOM   7577  N  N     . SER C  1 58  ? 59.837  6.145    50.932  1.00 79.62  ? 58  SER C N     1 
ATOM   7578  C  CA    . SER C  1 58  ? 61.236  5.913    50.567  1.00 83.98  ? 58  SER C CA    1 
ATOM   7579  C  C     . SER C  1 58  ? 61.390  5.440    49.119  1.00 85.15  ? 58  SER C C     1 
ATOM   7580  O  O     . SER C  1 58  ? 62.402  5.704    48.486  1.00 88.92  ? 58  SER C O     1 
ATOM   7581  C  CB    . SER C  1 58  ? 61.903  4.929    51.535  1.00 85.89  ? 58  SER C CB    1 
ATOM   7582  O  OG    . SER C  1 58  ? 61.303  3.650    51.480  1.00 84.17  ? 58  SER C OG    1 
ATOM   7583  N  N     . SER C  1 59  ? 60.368  4.764    48.602  1.00 82.66  ? 59  SER C N     1 
ATOM   7584  C  CA    . SER C  1 59  ? 60.348  4.272    47.228  1.00 83.78  ? 59  SER C CA    1 
ATOM   7585  C  C     . SER C  1 59  ? 60.163  5.386    46.194  1.00 84.24  ? 59  SER C C     1 
ATOM   7586  O  O     . SER C  1 59  ? 60.310  5.149    45.003  1.00 86.05  ? 59  SER C O     1 
ATOM   7587  C  CB    . SER C  1 59  ? 59.234  3.236    47.056  1.00 81.10  ? 59  SER C CB    1 
ATOM   7588  O  OG    . SER C  1 59  ? 57.954  3.867    46.991  1.00 78.33  ? 59  SER C OG    1 
ATOM   7589  N  N     . GLY C  1 60  ? 59.818  6.589    46.644  1.00 83.24  ? 60  GLY C N     1 
ATOM   7590  C  CA    . GLY C  1 60  ? 59.616  7.717    45.738  1.00 84.20  ? 60  GLY C CA    1 
ATOM   7591  C  C     . GLY C  1 60  ? 58.193  8.240    45.660  1.00 81.19  ? 60  GLY C C     1 
ATOM   7592  O  O     . GLY C  1 60  ? 57.994  9.429    45.410  1.00 81.99  ? 60  GLY C O     1 
ATOM   7593  N  N     . VAL C  1 61  ? 57.205  7.367    45.873  1.00 78.22  ? 61  VAL C N     1 
ATOM   7594  C  CA    . VAL C  1 61  ? 55.793  7.735    45.729  1.00 75.69  ? 61  VAL C CA    1 
ATOM   7595  C  C     . VAL C  1 61  ? 55.269  8.613    46.876  1.00 73.95  ? 61  VAL C C     1 
ATOM   7596  O  O     . VAL C  1 61  ? 55.486  8.327    48.057  1.00 73.11  ? 61  VAL C O     1 
ATOM   7597  C  CB    . VAL C  1 61  ? 54.865  6.488    45.503  1.00 73.96  ? 61  VAL C CB    1 
ATOM   7598  C  CG1   . VAL C  1 61  ? 54.941  5.503    46.670  1.00 73.06  ? 61  VAL C CG1   1 
ATOM   7599  C  CG2   . VAL C  1 61  ? 53.413  6.908    45.264  1.00 71.37  ? 61  VAL C CG2   1 
ATOM   7600  N  N     . LYS C  1 62  ? 54.571  9.682    46.506  1.00 73.84  ? 62  LYS C N     1 
ATOM   7601  C  CA    . LYS C  1 62  ? 53.978  10.592   47.476  1.00 72.49  ? 62  LYS C CA    1 
ATOM   7602  C  C     . LYS C  1 62  ? 52.565  10.171   47.862  1.00 69.73  ? 62  LYS C C     1 
ATOM   7603  O  O     . LYS C  1 62  ? 51.933  9.375    47.169  1.00 69.22  ? 62  LYS C O     1 
ATOM   7604  C  CB    . LYS C  1 62  ? 54.007  12.032   46.958  1.00 74.15  ? 62  LYS C CB    1 
ATOM   7605  C  CG    . LYS C  1 62  ? 55.323  12.716   47.220  1.00 76.77  ? 62  LYS C CG    1 
ATOM   7606  C  CD    . LYS C  1 62  ? 55.475  13.992   46.426  1.00 79.64  ? 62  LYS C CD    1 
ATOM   7607  C  CE    . LYS C  1 62  ? 56.898  14.522   46.558  1.00 82.90  ? 62  LYS C CE    1 
ATOM   7608  N  NZ    . LYS C  1 62  ? 56.941  16.009   46.475  1.00 85.11  ? 62  LYS C NZ    1 
ATOM   7609  N  N     . GLY C  1 63  ? 52.089  10.709   48.980  1.00 68.51  ? 63  GLY C N     1 
ATOM   7610  C  CA    . GLY C  1 63  ? 50.815  10.323   49.552  1.00 66.33  ? 63  GLY C CA    1 
ATOM   7611  C  C     . GLY C  1 63  ? 50.289  11.397   50.477  1.00 65.98  ? 63  GLY C C     1 
ATOM   7612  O  O     . GLY C  1 63  ? 50.907  12.447   50.627  1.00 67.28  ? 63  GLY C O     1 
ATOM   7613  N  N     . MET C  1 64  ? 49.149  11.117   51.109  1.00 64.66  ? 64  MET C N     1 
ATOM   7614  C  CA    . MET C  1 64  ? 48.418  12.101   51.904  1.00 64.46  ? 64  MET C CA    1 
ATOM   7615  C  C     . MET C  1 64  ? 47.693  11.415   53.056  1.00 63.26  ? 64  MET C C     1 
ATOM   7616  O  O     . MET C  1 64  ? 46.921  10.468   52.843  1.00 62.61  ? 64  MET C O     1 
ATOM   7617  C  CB    . MET C  1 64  ? 47.415  12.825   51.010  1.00 64.71  ? 64  MET C CB    1 
ATOM   7618  C  CG    . MET C  1 64  ? 46.561  13.863   51.688  1.00 64.85  ? 64  MET C CG    1 
ATOM   7619  S  SD    . MET C  1 64  ? 45.169  14.220   50.606  1.00 66.78  ? 64  MET C SD    1 
ATOM   7620  C  CE    . MET C  1 64  ? 44.754  15.897   51.076  1.00 67.80  ? 64  MET C CE    1 
ATOM   7621  N  N     . ALA C  1 65  ? 47.933  11.910   54.269  1.00 63.36  ? 65  ALA C N     1 
ATOM   7622  C  CA    . ALA C  1 65  ? 47.335  11.344   55.474  1.00 62.54  ? 65  ALA C CA    1 
ATOM   7623  C  C     . ALA C  1 65  ? 45.904  11.813   55.671  1.00 61.99  ? 65  ALA C C     1 
ATOM   7624  O  O     . ALA C  1 65  ? 45.662  12.993   55.895  1.00 62.89  ? 65  ALA C O     1 
ATOM   7625  C  CB    . ALA C  1 65  ? 48.162  11.709   56.676  1.00 63.65  ? 65  ALA C CB    1 
ATOM   7626  N  N     . LEU C  1 66  ? 44.955  10.888   55.608  1.00 61.09  ? 66  LEU C N     1 
ATOM   7627  C  CA    . LEU C  1 66  ? 43.548  11.241   55.795  1.00 60.83  ? 66  LEU C CA    1 
ATOM   7628  C  C     . LEU C  1 66  ? 42.948  10.628   57.055  1.00 60.94  ? 66  LEU C C     1 
ATOM   7629  O  O     . LEU C  1 66  ? 41.944  11.134   57.582  1.00 61.54  ? 66  LEU C O     1 
ATOM   7630  C  CB    . LEU C  1 66  ? 42.724  10.849   54.569  1.00 60.59  ? 66  LEU C CB    1 
ATOM   7631  C  CG    . LEU C  1 66  ? 42.926  11.731   53.340  1.00 61.08  ? 66  LEU C CG    1 
ATOM   7632  C  CD1   . LEU C  1 66  ? 41.814  11.488   52.342  1.00 62.15  ? 66  LEU C CD1   1 
ATOM   7633  C  CD2   . LEU C  1 66  ? 42.973  13.201   53.722  1.00 60.52  ? 66  LEU C CD2   1 
ATOM   7634  N  N     . ASN C  1 67  ? 43.558  9.534    57.522  1.00 60.50  ? 67  ASN C N     1 
ATOM   7635  C  CA    . ASN C  1 67  ? 43.134  8.866    58.748  1.00 60.68  ? 67  ASN C CA    1 
ATOM   7636  C  C     . ASN C  1 67  ? 44.215  8.916    59.798  1.00 61.14  ? 67  ASN C C     1 
ATOM   7637  O  O     . ASN C  1 67  ? 45.272  8.302    59.632  1.00 61.60  ? 67  ASN C O     1 
ATOM   7638  C  CB    . ASN C  1 67  ? 42.773  7.406    58.479  1.00 60.75  ? 67  ASN C CB    1 
ATOM   7639  C  CG    . ASN C  1 67  ? 41.340  7.227    58.018  1.00 61.56  ? 67  ASN C CG    1 
ATOM   7640  O  OD1   . ASN C  1 67  ? 40.816  8.015    57.229  1.00 61.71  ? 67  ASN C OD1   1 
ATOM   7641  N  ND2   . ASN C  1 67  ? 40.698  6.176    58.505  1.00 63.44  ? 67  ASN C ND2   1 
ATOM   7642  N  N     . LEU C  1 68  ? 43.967  9.656    60.874  1.00 61.48  ? 68  LEU C N     1 
ATOM   7643  C  CA    . LEU C  1 68  ? 44.842  9.585    62.035  1.00 62.00  ? 68  LEU C CA    1 
ATOM   7644  C  C     . LEU C  1 68  ? 44.094  8.834    63.137  1.00 63.26  ? 68  LEU C C     1 
ATOM   7645  O  O     . LEU C  1 68  ? 43.189  9.377    63.773  1.00 63.88  ? 68  LEU C O     1 
ATOM   7646  C  CB    . LEU C  1 68  ? 45.304  10.979   62.497  1.00 62.46  ? 68  LEU C CB    1 
ATOM   7647  C  CG    . LEU C  1 68  ? 45.658  12.140   61.547  1.00 60.73  ? 68  LEU C CG    1 
ATOM   7648  C  CD1   . LEU C  1 68  ? 46.475  13.158   62.293  1.00 60.27  ? 68  LEU C CD1   1 
ATOM   7649  C  CD2   . LEU C  1 68  ? 46.390  11.741   60.282  1.00 59.19  ? 68  LEU C CD2   1 
ATOM   7650  N  N     . GLU C  1 69  ? 44.450  7.566    63.322  1.00 63.87  ? 69  GLU C N     1 
ATOM   7651  C  CA    . GLU C  1 69  ? 43.842  6.722    64.353  1.00 65.91  ? 69  GLU C CA    1 
ATOM   7652  C  C     . GLU C  1 69  ? 44.881  6.488    65.465  1.00 67.70  ? 69  GLU C C     1 
ATOM   7653  O  O     . GLU C  1 69  ? 46.066  6.800    65.270  1.00 67.71  ? 69  GLU C O     1 
ATOM   7654  C  CB    . GLU C  1 69  ? 43.382  5.394    63.744  1.00 65.89  ? 69  GLU C CB    1 
ATOM   7655  C  CG    . GLU C  1 69  ? 43.371  5.380    62.209  1.00 66.33  ? 69  GLU C CG    1 
ATOM   7656  C  CD    . GLU C  1 69  ? 42.351  4.415    61.603  1.00 68.89  ? 69  GLU C CD    1 
ATOM   7657  O  OE1   . GLU C  1 69  ? 41.570  3.805    62.370  1.00 71.22  ? 69  GLU C OE1   1 
ATOM   7658  O  OE2   . GLU C  1 69  ? 42.332  4.276    60.351  1.00 68.58  ? 69  GLU C OE2   1 
ATOM   7659  N  N     . PRO C  1 70  ? 44.459  5.958    66.634  1.00 69.52  ? 70  PRO C N     1 
ATOM   7660  C  CA    . PRO C  1 70  ? 45.464  5.697    67.656  1.00 71.95  ? 70  PRO C CA    1 
ATOM   7661  C  C     . PRO C  1 70  ? 46.632  4.853    67.149  1.00 72.28  ? 70  PRO C C     1 
ATOM   7662  O  O     . PRO C  1 70  ? 47.773  5.316    67.163  1.00 73.19  ? 70  PRO C O     1 
ATOM   7663  C  CB    . PRO C  1 70  ? 44.679  4.949    68.732  1.00 74.28  ? 70  PRO C CB    1 
ATOM   7664  C  CG    . PRO C  1 70  ? 43.317  5.492    68.619  1.00 73.26  ? 70  PRO C CG    1 
ATOM   7665  C  CD    . PRO C  1 70  ? 43.099  5.719    67.146  1.00 70.29  ? 70  PRO C CD    1 
ATOM   7666  N  N     . GLY C  1 71  ? 46.359  3.646    66.671  1.00 72.20  ? 71  GLY C N     1 
ATOM   7667  C  CA    . GLY C  1 71  ? 47.441  2.717    66.348  1.00 73.54  ? 71  GLY C CA    1 
ATOM   7668  C  C     . GLY C  1 71  ? 48.356  3.030    65.169  1.00 72.14  ? 71  GLY C C     1 
ATOM   7669  O  O     . GLY C  1 71  ? 49.440  2.455    65.063  1.00 73.73  ? 71  GLY C O     1 
ATOM   7670  N  N     . GLN C  1 72  ? 47.936  3.945    64.292  1.00 69.73  ? 72  GLN C N     1 
ATOM   7671  C  CA    . GLN C  1 72  ? 48.430  3.978    62.909  1.00 67.92  ? 72  GLN C CA    1 
ATOM   7672  C  C     . GLN C  1 72  ? 47.889  5.152    62.104  1.00 65.63  ? 72  GLN C C     1 
ATOM   7673  O  O     . GLN C  1 72  ? 46.928  5.802    62.523  1.00 65.45  ? 72  GLN C O     1 
ATOM   7674  C  CB    . GLN C  1 72  ? 47.990  2.690    62.205  1.00 67.70  ? 72  GLN C CB    1 
ATOM   7675  C  CG    . GLN C  1 72  ? 46.471  2.438    62.279  1.00 67.08  ? 72  GLN C CG    1 
ATOM   7676  C  CD    . GLN C  1 72  ? 46.094  1.041    61.845  1.00 67.67  ? 72  GLN C CD    1 
ATOM   7677  O  OE1   . GLN C  1 72  ? 45.716  0.206    62.666  1.00 69.51  ? 72  GLN C OE1   1 
ATOM   7678  N  NE2   . GLN C  1 72  ? 46.208  0.773    60.552  1.00 65.98  ? 72  GLN C NE2   1 
ATOM   7679  N  N     . VAL C  1 73  ? 48.477  5.393    60.931  1.00 64.39  ? 73  VAL C N     1 
ATOM   7680  C  CA    . VAL C  1 73  ? 47.994  6.432    60.014  1.00 62.90  ? 73  VAL C CA    1 
ATOM   7681  C  C     . VAL C  1 73  ? 47.581  5.860    58.652  1.00 61.73  ? 73  VAL C C     1 
ATOM   7682  O  O     . VAL C  1 73  ? 48.377  5.218    57.973  1.00 62.48  ? 73  VAL C O     1 
ATOM   7683  C  CB    . VAL C  1 73  ? 49.044  7.534    59.795  1.00 63.43  ? 73  VAL C CB    1 
ATOM   7684  C  CG1   . VAL C  1 73  ? 48.457  8.675    58.969  1.00 62.69  ? 73  VAL C CG1   1 
ATOM   7685  C  CG2   . VAL C  1 73  ? 49.533  8.057    61.111  1.00 65.29  ? 73  VAL C CG2   1 
ATOM   7686  N  N     . GLY C  1 74  ? 46.339  6.092    58.253  1.00 60.57  ? 74  GLY C N     1 
ATOM   7687  C  CA    . GLY C  1 74  ? 45.884  5.664    56.939  1.00 60.13  ? 74  GLY C CA    1 
ATOM   7688  C  C     . GLY C  1 74  ? 46.267  6.669    55.866  1.00 60.05  ? 74  GLY C C     1 
ATOM   7689  O  O     . GLY C  1 74  ? 45.896  7.853    55.934  1.00 60.07  ? 74  GLY C O     1 
ATOM   7690  N  N     . ILE C  1 75  ? 46.998  6.204    54.861  1.00 60.28  ? 75  ILE C N     1 
ATOM   7691  C  CA    . ILE C  1 75  ? 47.519  7.104    53.850  1.00 60.60  ? 75  ILE C CA    1 
ATOM   7692  C  C     . ILE C  1 75  ? 47.163  6.675    52.433  1.00 60.50  ? 75  ILE C C     1 
ATOM   7693  O  O     . ILE C  1 75  ? 47.366  5.528    52.054  1.00 61.05  ? 75  ILE C O     1 
ATOM   7694  C  CB    . ILE C  1 75  ? 49.037  7.274    54.012  1.00 61.84  ? 75  ILE C CB    1 
ATOM   7695  C  CG1   . ILE C  1 75  ? 49.333  8.050    55.303  1.00 62.49  ? 75  ILE C CG1   1 
ATOM   7696  C  CG2   . ILE C  1 75  ? 49.618  8.005    52.814  1.00 63.47  ? 75  ILE C CG2   1 
ATOM   7697  C  CD1   . ILE C  1 75  ? 50.808  8.229    55.613  1.00 65.19  ? 75  ILE C CD1   1 
ATOM   7698  N  N     . VAL C  1 76  ? 46.612  7.604    51.660  1.00 60.53  ? 76  VAL C N     1 
ATOM   7699  C  CA    . VAL C  1 76  ? 46.339  7.362    50.241  1.00 61.09  ? 76  VAL C CA    1 
ATOM   7700  C  C     . VAL C  1 76  ? 47.545  7.847    49.452  1.00 62.08  ? 76  VAL C C     1 
ATOM   7701  O  O     . VAL C  1 76  ? 48.128  8.884    49.788  1.00 62.41  ? 76  VAL C O     1 
ATOM   7702  C  CB    . VAL C  1 76  ? 45.061  8.084    49.744  1.00 61.17  ? 76  VAL C CB    1 
ATOM   7703  C  CG1   . VAL C  1 76  ? 43.871  7.730    50.607  1.00 60.69  ? 76  VAL C CG1   1 
ATOM   7704  C  CG2   . VAL C  1 76  ? 45.244  9.595    49.744  1.00 62.52  ? 76  VAL C CG2   1 
ATOM   7705  N  N     . LEU C  1 77  ? 47.923  7.091    48.420  1.00 62.68  ? 77  LEU C N     1 
ATOM   7706  C  CA    . LEU C  1 77  ? 49.089  7.430    47.596  1.00 63.62  ? 77  LEU C CA    1 
ATOM   7707  C  C     . LEU C  1 77  ? 48.668  8.136    46.321  1.00 64.56  ? 77  LEU C C     1 
ATOM   7708  O  O     . LEU C  1 77  ? 47.601  7.853    45.762  1.00 64.20  ? 77  LEU C O     1 
ATOM   7709  C  CB    . LEU C  1 77  ? 49.872  6.173    47.206  1.00 64.67  ? 77  LEU C CB    1 
ATOM   7710  C  CG    . LEU C  1 77  ? 49.945  4.962    48.132  1.00 63.47  ? 77  LEU C CG    1 
ATOM   7711  C  CD1   . LEU C  1 77  ? 50.561  3.818    47.372  1.00 64.42  ? 77  LEU C CD1   1 
ATOM   7712  C  CD2   . LEU C  1 77  ? 50.734  5.259    49.383  1.00 62.97  ? 77  LEU C CD2   1 
ATOM   7713  N  N     . PHE C  1 78  ? 49.524  9.039    45.856  1.00 65.78  ? 78  PHE C N     1 
ATOM   7714  C  CA    . PHE C  1 78  ? 49.294  9.740    44.601  1.00 67.73  ? 78  PHE C CA    1 
ATOM   7715  C  C     . PHE C  1 78  ? 49.966  9.034    43.419  1.00 69.97  ? 78  PHE C C     1 
ATOM   7716  O  O     . PHE C  1 78  ? 50.423  9.672    42.473  1.00 72.78  ? 78  PHE C O     1 
ATOM   7717  C  CB    . PHE C  1 78  ? 49.741  11.200   44.707  1.00 68.63  ? 78  PHE C CB    1 
ATOM   7718  C  CG    . PHE C  1 78  ? 48.931  12.008   45.675  1.00 67.61  ? 78  PHE C CG    1 
ATOM   7719  C  CD1   . PHE C  1 78  ? 47.560  12.200   45.474  1.00 67.33  ? 78  PHE C CD1   1 
ATOM   7720  C  CD2   . PHE C  1 78  ? 49.527  12.580   46.792  1.00 67.15  ? 78  PHE C CD2   1 
ATOM   7721  C  CE1   . PHE C  1 78  ? 46.809  12.947   46.369  1.00 65.87  ? 78  PHE C CE1   1 
ATOM   7722  C  CE2   . PHE C  1 78  ? 48.771  13.330   47.695  1.00 65.63  ? 78  PHE C CE2   1 
ATOM   7723  C  CZ    . PHE C  1 78  ? 47.420  13.514   47.484  1.00 64.65  ? 78  PHE C CZ    1 
ATOM   7724  N  N     . GLY C  1 79  ? 50.022  7.712    43.466  1.00 69.28  ? 79  GLY C N     1 
ATOM   7725  C  CA    . GLY C  1 79  ? 50.560  6.965    42.354  1.00 71.69  ? 79  GLY C CA    1 
ATOM   7726  C  C     . GLY C  1 79  ? 50.326  5.488    42.517  1.00 71.23  ? 79  GLY C C     1 
ATOM   7727  O  O     . GLY C  1 79  ? 49.287  5.070    43.024  1.00 69.61  ? 79  GLY C O     1 
ATOM   7728  N  N     . SER C  1 80  ? 51.299  4.701    42.071  1.00 73.30  ? 80  SER C N     1 
ATOM   7729  C  CA    . SER C  1 80  ? 51.251  3.261    42.196  1.00 73.67  ? 80  SER C CA    1 
ATOM   7730  C  C     . SER C  1 80  ? 51.581  2.875    43.631  1.00 72.03  ? 80  SER C C     1 
ATOM   7731  O  O     . SER C  1 80  ? 51.995  3.716    44.416  1.00 71.40  ? 80  SER C O     1 
ATOM   7732  C  CB    . SER C  1 80  ? 52.256  2.638    41.234  1.00 76.91  ? 80  SER C CB    1 
ATOM   7733  O  OG    . SER C  1 80  ? 51.912  1.299    40.921  1.00 78.25  ? 80  SER C OG    1 
ATOM   7734  N  N     . ASP C  1 81  ? 51.366  1.611    43.977  1.00 72.10  ? 81  ASP C N     1 
ATOM   7735  C  CA    . ASP C  1 81  ? 51.800  1.069    45.261  1.00 71.62  ? 81  ASP C CA    1 
ATOM   7736  C  C     . ASP C  1 81  ? 52.842  -0.012   45.025  1.00 74.09  ? 81  ASP C C     1 
ATOM   7737  O  O     . ASP C  1 81  ? 53.552  -0.407   45.943  1.00 74.72  ? 81  ASP C O     1 
ATOM   7738  C  CB    . ASP C  1 81  ? 50.619  0.490    46.049  1.00 69.74  ? 81  ASP C CB    1 
ATOM   7739  C  CG    . ASP C  1 81  ? 49.748  -0.448   45.213  1.00 71.74  ? 81  ASP C CG    1 
ATOM   7740  O  OD1   . ASP C  1 81  ? 50.202  -0.909   44.141  1.00 74.99  ? 81  ASP C OD1   1 
ATOM   7741  O  OD2   . ASP C  1 81  ? 48.596  -0.728   45.628  1.00 71.85  ? 81  ASP C OD2   1 
ATOM   7742  N  N     . ARG C  1 82  ? 52.928  -0.479   43.783  1.00 76.01  ? 82  ARG C N     1 
ATOM   7743  C  CA    . ARG C  1 82  ? 53.774  -1.605   43.414  1.00 78.72  ? 82  ARG C CA    1 
ATOM   7744  C  C     . ARG C  1 82  ? 55.152  -1.603   44.094  1.00 79.84  ? 82  ARG C C     1 
ATOM   7745  O  O     . ARG C  1 82  ? 55.681  -2.670   44.438  1.00 81.37  ? 82  ARG C O     1 
ATOM   7746  C  CB    . ARG C  1 82  ? 53.906  -1.695   41.882  1.00 81.61  ? 82  ARG C CB    1 
ATOM   7747  C  CG    . ARG C  1 82  ? 54.401  -0.412   41.208  1.00 83.98  ? 82  ARG C CG    1 
ATOM   7748  C  CD    . ARG C  1 82  ? 54.664  -0.560   39.702  1.00 89.14  ? 82  ARG C CD    1 
ATOM   7749  N  NE    . ARG C  1 82  ? 55.629  -1.614   39.382  1.00 93.18  ? 82  ARG C NE    1 
ATOM   7750  C  CZ    . ARG C  1 82  ? 55.450  -2.534   38.435  1.00 96.22  ? 82  ARG C CZ    1 
ATOM   7751  N  NH1   . ARG C  1 82  ? 54.350  -2.519   37.686  1.00 95.85  ? 82  ARG C NH1   1 
ATOM   7752  N  NH2   . ARG C  1 82  ? 56.377  -3.462   38.222  1.00 98.85  ? 82  ARG C NH2   1 
ATOM   7753  N  N     . LEU C  1 83  ? 55.715  -0.410   44.300  1.00 79.29  ? 83  LEU C N     1 
ATOM   7754  C  CA    . LEU C  1 83  ? 57.054  -0.278   44.883  1.00 80.90  ? 83  LEU C CA    1 
ATOM   7755  C  C     . LEU C  1 83  ? 57.088  -0.085   46.403  1.00 79.39  ? 83  LEU C C     1 
ATOM   7756  O  O     . LEU C  1 83  ? 58.166  0.019    46.990  1.00 81.41  ? 83  LEU C O     1 
ATOM   7757  C  CB    . LEU C  1 83  ? 57.860  0.823    44.181  1.00 82.76  ? 83  LEU C CB    1 
ATOM   7758  C  CG    . LEU C  1 83  ? 58.369  0.553    42.761  1.00 85.14  ? 83  LEU C CG    1 
ATOM   7759  C  CD1   . LEU C  1 83  ? 59.271  1.679    42.314  1.00 86.78  ? 83  LEU C CD1   1 
ATOM   7760  C  CD2   . LEU C  1 83  ? 59.100  -0.766   42.671  1.00 87.26  ? 83  LEU C CD2   1 
ATOM   7761  N  N     . VAL C  1 84  ? 55.920  -0.054   47.038  1.00 76.42  ? 84  VAL C N     1 
ATOM   7762  C  CA    . VAL C  1 84  ? 55.840  0.046    48.492  1.00 75.22  ? 84  VAL C CA    1 
ATOM   7763  C  C     . VAL C  1 84  ? 55.802  -1.340   49.135  1.00 76.07  ? 84  VAL C C     1 
ATOM   7764  O  O     . VAL C  1 84  ? 55.219  -2.279   48.584  1.00 76.00  ? 84  VAL C O     1 
ATOM   7765  C  CB    . VAL C  1 84  ? 54.630  0.864    48.929  1.00 72.16  ? 84  VAL C CB    1 
ATOM   7766  C  CG1   . VAL C  1 84  ? 54.755  1.262    50.394  1.00 71.78  ? 84  VAL C CG1   1 
ATOM   7767  C  CG2   . VAL C  1 84  ? 54.506  2.100    48.062  1.00 72.07  ? 84  VAL C CG2   1 
ATOM   7768  N  N     . LYS C  1 85  ? 56.450  -1.458   50.294  1.00 77.25  ? 85  LYS C N     1 
ATOM   7769  C  CA    . LYS C  1 85  ? 56.578  -2.723   51.015  1.00 78.82  ? 85  LYS C CA    1 
ATOM   7770  C  C     . LYS C  1 85  ? 56.328  -2.534   52.506  1.00 77.96  ? 85  LYS C C     1 
ATOM   7771  O  O     . LYS C  1 85  ? 56.644  -1.486   53.054  1.00 77.86  ? 85  LYS C O     1 
ATOM   7772  C  CB    . LYS C  1 85  ? 57.980  -3.288   50.820  1.00 82.63  ? 85  LYS C CB    1 
ATOM   7773  C  CG    . LYS C  1 85  ? 58.295  -3.705   49.389  1.00 85.12  ? 85  LYS C CG    1 
ATOM   7774  C  CD    . LYS C  1 85  ? 59.674  -4.362   49.274  1.00 90.08  ? 85  LYS C CD    1 
ATOM   7775  C  CE    . LYS C  1 85  ? 59.866  -4.991   47.904  1.00 92.08  ? 85  LYS C CE    1 
ATOM   7776  N  NZ    . LYS C  1 85  ? 61.293  -5.352   47.649  1.00 97.49  ? 85  LYS C NZ    1 
ATOM   7777  N  N     . GLU C  1 86  ? 55.764  -3.543   53.165  1.00 77.95  ? 86  GLU C N     1 
ATOM   7778  C  CA    . GLU C  1 86  ? 55.701  -3.545   54.624  1.00 78.04  ? 86  GLU C CA    1 
ATOM   7779  C  C     . GLU C  1 86  ? 57.088  -3.208   55.168  1.00 80.96  ? 86  GLU C C     1 
ATOM   7780  O  O     . GLU C  1 86  ? 58.107  -3.684   54.650  1.00 83.69  ? 86  GLU C O     1 
ATOM   7781  C  CB    . GLU C  1 86  ? 55.239  -4.906   55.154  1.00 79.23  ? 86  GLU C CB    1 
ATOM   7782  C  CG    . GLU C  1 86  ? 55.180  -5.005   56.683  1.00 80.19  ? 86  GLU C CG    1 
ATOM   7783  C  CD    . GLU C  1 86  ? 55.268  -6.439   57.200  1.00 83.87  ? 86  GLU C CD    1 
ATOM   7784  O  OE1   . GLU C  1 86  ? 55.058  -7.387   56.415  1.00 84.89  ? 86  GLU C OE1   1 
ATOM   7785  O  OE2   . GLU C  1 86  ? 55.548  -6.621   58.404  1.00 86.10  ? 86  GLU C OE2   1 
ATOM   7786  N  N     . GLY C  1 87  ? 57.124  -2.367   56.193  1.00 80.62  ? 87  GLY C N     1 
ATOM   7787  C  CA    . GLY C  1 87  ? 58.382  -1.998   56.822  1.00 83.99  ? 87  GLY C CA    1 
ATOM   7788  C  C     . GLY C  1 87  ? 59.042  -0.772   56.224  1.00 84.15  ? 87  GLY C C     1 
ATOM   7789  O  O     . GLY C  1 87  ? 59.812  -0.097   56.906  1.00 86.16  ? 87  GLY C O     1 
ATOM   7790  N  N     . GLU C  1 88  ? 58.756  -0.487   54.953  1.00 82.67  ? 88  GLU C N     1 
ATOM   7791  C  CA    . GLU C  1 88  ? 59.245  0.728    54.297  1.00 83.26  ? 88  GLU C CA    1 
ATOM   7792  C  C     . GLU C  1 88  ? 59.033  1.988    55.156  1.00 82.02  ? 88  GLU C C     1 
ATOM   7793  O  O     . GLU C  1 88  ? 58.135  2.042    55.999  1.00 80.20  ? 88  GLU C O     1 
ATOM   7794  C  CB    . GLU C  1 88  ? 58.620  0.875    52.905  1.00 81.44  ? 88  GLU C CB    1 
ATOM   7795  C  CG    . GLU C  1 88  ? 58.587  2.296    52.363  1.00 83.10  ? 88  GLU C CG    1 
ATOM   7796  C  CD    . GLU C  1 88  ? 58.620  2.374    50.842  1.00 86.82  ? 88  GLU C CD    1 
ATOM   7797  O  OE1   . GLU C  1 88  ? 58.419  1.336    50.169  1.00 88.83  ? 88  GLU C OE1   1 
ATOM   7798  O  OE2   . GLU C  1 88  ? 58.853  3.488    50.318  1.00 88.18  ? 88  GLU C OE2   1 
ATOM   7799  N  N     . LEU C  1 89  ? 59.875  2.992    54.929  1.00 83.71  ? 89  LEU C N     1 
ATOM   7800  C  CA    . LEU C  1 89  ? 59.934  4.184    55.758  1.00 83.79  ? 89  LEU C CA    1 
ATOM   7801  C  C     . LEU C  1 89  ? 59.257  5.378    55.079  1.00 81.46  ? 89  LEU C C     1 
ATOM   7802  O  O     . LEU C  1 89  ? 59.633  5.760    53.970  1.00 82.50  ? 89  LEU C O     1 
ATOM   7803  C  CB    . LEU C  1 89  ? 61.400  4.487    56.049  1.00 88.56  ? 89  LEU C CB    1 
ATOM   7804  C  CG    . LEU C  1 89  ? 61.835  5.472    57.130  1.00 90.45  ? 89  LEU C CG    1 
ATOM   7805  C  CD1   . LEU C  1 89  ? 63.116  4.975    57.797  1.00 94.65  ? 89  LEU C CD1   1 
ATOM   7806  C  CD2   . LEU C  1 89  ? 62.037  6.839    56.512  1.00 90.94  ? 89  LEU C CD2   1 
ATOM   7807  N  N     . VAL C  1 90  ? 58.263  5.959    55.759  1.00 78.94  ? 90  VAL C N     1 
ATOM   7808  C  CA    . VAL C  1 90  ? 57.457  7.076    55.241  1.00 76.28  ? 90  VAL C CA    1 
ATOM   7809  C  C     . VAL C  1 90  ? 57.791  8.348    55.999  1.00 77.13  ? 90  VAL C C     1 
ATOM   7810  O  O     . VAL C  1 90  ? 58.006  8.313    57.211  1.00 78.18  ? 90  VAL C O     1 
ATOM   7811  C  CB    . VAL C  1 90  ? 55.953  6.818    55.408  1.00 72.93  ? 90  VAL C CB    1 
ATOM   7812  C  CG1   . VAL C  1 90  ? 55.158  7.755    54.515  1.00 71.64  ? 90  VAL C CG1   1 
ATOM   7813  C  CG2   . VAL C  1 90  ? 55.612  5.374    55.092  1.00 72.22  ? 90  VAL C CG2   1 
ATOM   7814  N  N     . LYS C  1 91  ? 57.806  9.469    55.287  1.00 76.87  ? 91  LYS C N     1 
ATOM   7815  C  CA    . LYS C  1 91  ? 58.382  10.700   55.813  1.00 78.73  ? 91  LYS C CA    1 
ATOM   7816  C  C     . LYS C  1 91  ? 57.434  11.889   55.729  1.00 76.61  ? 91  LYS C C     1 
ATOM   7817  O  O     . LYS C  1 91  ? 56.874  12.165   54.668  1.00 75.36  ? 91  LYS C O     1 
ATOM   7818  C  CB    . LYS C  1 91  ? 59.674  11.019   55.054  1.00 82.46  ? 91  LYS C CB    1 
ATOM   7819  C  CG    . LYS C  1 91  ? 60.450  12.207   55.601  1.00 86.54  ? 91  LYS C CG    1 
ATOM   7820  C  CD    . LYS C  1 91  ? 61.356  12.834   54.544  1.00 90.30  ? 91  LYS C CD    1 
ATOM   7821  C  CE    . LYS C  1 91  ? 61.728  14.253   54.944  1.00 92.82  ? 91  LYS C CE    1 
ATOM   7822  N  NZ    . LYS C  1 91  ? 62.351  14.980   53.819  1.00 96.53  ? 91  LYS C NZ    1 
ATOM   7823  N  N     . ARG C  1 92  ? 57.272  12.592   56.851  1.00 76.55  ? 92  ARG C N     1 
ATOM   7824  C  CA    . ARG C  1 92  ? 56.575  13.880   56.884  1.00 75.33  ? 92  ARG C CA    1 
ATOM   7825  C  C     . ARG C  1 92  ? 57.176  14.893   55.923  1.00 77.39  ? 92  ARG C C     1 
ATOM   7826  O  O     . ARG C  1 92  ? 58.369  14.894   55.660  1.00 80.64  ? 92  ARG C O     1 
ATOM   7827  C  CB    . ARG C  1 92  ? 56.657  14.497   58.267  1.00 76.48  ? 92  ARG C CB    1 
ATOM   7828  C  CG    . ARG C  1 92  ? 55.807  13.865   59.321  1.00 74.77  ? 92  ARG C CG    1 
ATOM   7829  C  CD    . ARG C  1 92  ? 55.690  14.820   60.494  1.00 76.11  ? 92  ARG C CD    1 
ATOM   7830  N  NE    . ARG C  1 92  ? 54.840  15.963   60.164  1.00 75.20  ? 92  ARG C NE    1 
ATOM   7831  C  CZ    . ARG C  1 92  ? 54.843  17.116   60.819  1.00 77.37  ? 92  ARG C CZ    1 
ATOM   7832  N  NH1   . ARG C  1 92  ? 55.670  17.298   61.842  1.00 81.34  ? 92  ARG C NH1   1 
ATOM   7833  N  NH2   . ARG C  1 92  ? 54.026  18.091   60.448  1.00 76.25  ? 92  ARG C NH2   1 
ATOM   7834  N  N     . THR C  1 93  ? 56.329  15.771   55.421  1.00 76.29  ? 93  THR C N     1 
ATOM   7835  C  CA    . THR C  1 93  ? 56.745  16.911   54.634  1.00 78.71  ? 93  THR C CA    1 
ATOM   7836  C  C     . THR C  1 93  ? 56.535  18.133   55.520  1.00 79.95  ? 93  THR C C     1 
ATOM   7837  O  O     . THR C  1 93  ? 57.268  19.107   55.431  1.00 83.40  ? 93  THR C O     1 
ATOM   7838  C  CB    . THR C  1 93  ? 55.895  17.001   53.343  1.00 77.27  ? 93  THR C CB    1 
ATOM   7839  O  OG1   . THR C  1 93  ? 56.135  15.835   52.537  1.00 76.63  ? 93  THR C OG1   1 
ATOM   7840  C  CG2   . THR C  1 93  ? 56.198  18.257   52.531  1.00 79.95  ? 93  THR C CG2   1 
ATOM   7841  N  N     . GLY C  1 94  ? 55.542  18.050   56.400  1.00 77.65  ? 94  GLY C N     1 
ATOM   7842  C  CA    . GLY C  1 94  ? 55.185  19.145   57.285  1.00 78.73  ? 94  GLY C CA    1 
ATOM   7843  C  C     . GLY C  1 94  ? 54.143  20.065   56.678  1.00 78.16  ? 94  GLY C C     1 
ATOM   7844  O  O     . GLY C  1 94  ? 53.785  21.076   57.280  1.00 79.54  ? 94  GLY C O     1 
ATOM   7845  N  N     . ASN C  1 95  ? 53.645  19.718   55.492  1.00 76.68  ? 95  ASN C N     1 
ATOM   7846  C  CA    . ASN C  1 95  ? 52.758  20.612   54.737  1.00 76.70  ? 95  ASN C CA    1 
ATOM   7847  C  C     . ASN C  1 95  ? 51.408  20.026   54.361  1.00 73.55  ? 95  ASN C C     1 
ATOM   7848  O  O     . ASN C  1 95  ? 51.329  18.946   53.781  1.00 72.06  ? 95  ASN C O     1 
ATOM   7849  C  CB    . ASN C  1 95  ? 53.428  21.066   53.439  1.00 79.13  ? 95  ASN C CB    1 
ATOM   7850  C  CG    . ASN C  1 95  ? 54.816  21.610   53.643  1.00 82.50  ? 95  ASN C CG    1 
ATOM   7851  O  OD1   . ASN C  1 95  ? 55.650  21.487   52.758  1.00 85.49  ? 95  ASN C OD1   1 
ATOM   7852  N  ND2   . ASN C  1 95  ? 55.072  22.227   54.792  1.00 83.43  ? 95  ASN C ND2   1 
ATOM   7853  N  N     . ILE C  1 96  ? 50.347  20.761   54.655  1.00 73.30  ? 96  ILE C N     1 
ATOM   7854  C  CA    . ILE C  1 96  ? 49.031  20.432   54.124  1.00 71.36  ? 96  ILE C CA    1 
ATOM   7855  C  C     . ILE C  1 96  ? 49.131  20.548   52.601  1.00 72.59  ? 96  ILE C C     1 
ATOM   7856  O  O     . ILE C  1 96  ? 49.699  21.519   52.083  1.00 75.44  ? 96  ILE C O     1 
ATOM   7857  C  CB    . ILE C  1 96  ? 47.944  21.385   54.683  1.00 71.71  ? 96  ILE C CB    1 
ATOM   7858  C  CG1   . ILE C  1 96  ? 47.942  21.375   56.222  1.00 71.14  ? 96  ILE C CG1   1 
ATOM   7859  C  CG2   . ILE C  1 96  ? 46.576  21.063   54.105  1.00 70.41  ? 96  ILE C CG2   1 
ATOM   7860  C  CD1   . ILE C  1 96  ? 48.036  19.994   56.866  1.00 68.22  ? 96  ILE C CD1   1 
ATOM   7861  N  N     . VAL C  1 97  ? 48.607  19.544   51.898  1.00 70.78  ? 97  VAL C N     1 
ATOM   7862  C  CA    . VAL C  1 97  ? 48.714  19.447   50.437  1.00 71.86  ? 97  VAL C CA    1 
ATOM   7863  C  C     . VAL C  1 97  ? 48.441  20.781   49.729  1.00 75.00  ? 97  VAL C C     1 
ATOM   7864  O  O     . VAL C  1 97  ? 47.479  21.470   50.056  1.00 75.46  ? 97  VAL C O     1 
ATOM   7865  C  CB    . VAL C  1 97  ? 47.776  18.358   49.890  1.00 69.52  ? 97  VAL C CB    1 
ATOM   7866  C  CG1   . VAL C  1 97  ? 47.905  18.237   48.384  1.00 70.82  ? 97  VAL C CG1   1 
ATOM   7867  C  CG2   . VAL C  1 97  ? 48.088  17.041   50.538  1.00 67.06  ? 97  VAL C CG2   1 
ATOM   7868  N  N     . ASP C  1 98  ? 49.284  21.116   48.753  1.00 66.76  ? 98  ASP C N     1 
ATOM   7869  C  CA    . ASP C  1 98  ? 49.236  22.407   48.082  1.00 67.61  ? 98  ASP C CA    1 
ATOM   7870  C  C     . ASP C  1 98  ? 49.639  22.371   46.592  1.00 68.18  ? 98  ASP C C     1 
ATOM   7871  O  O     . ASP C  1 98  ? 49.909  21.300   46.042  1.00 68.40  ? 98  ASP C O     1 
ATOM   7872  C  CB    . ASP C  1 98  ? 50.175  23.337   48.818  1.00 70.52  ? 98  ASP C CB    1 
ATOM   7873  C  CG    . ASP C  1 98  ? 51.611  22.872   48.757  1.00 74.03  ? 98  ASP C CG    1 
ATOM   7874  O  OD1   . ASP C  1 98  ? 51.856  21.657   48.529  1.00 74.26  ? 98  ASP C OD1   1 
ATOM   7875  O  OD2   . ASP C  1 98  ? 52.493  23.737   48.947  1.00 78.10  ? 98  ASP C OD2   1 
ATOM   7876  N  N     . VAL C  1 99  ? 49.689  23.548   45.957  1.00 68.65  ? 99  VAL C N     1 
ATOM   7877  C  CA    . VAL C  1 99  ? 50.128  23.691   44.558  1.00 69.42  ? 99  VAL C CA    1 
ATOM   7878  C  C     . VAL C  1 99  ? 50.770  25.030   44.253  1.00 71.24  ? 99  VAL C C     1 
ATOM   7879  O  O     . VAL C  1 99  ? 50.416  26.032   44.875  1.00 71.18  ? 99  VAL C O     1 
ATOM   7880  C  CB    . VAL C  1 99  ? 48.974  23.593   43.549  1.00 67.52  ? 99  VAL C CB    1 
ATOM   7881  C  CG1   . VAL C  1 99  ? 48.881  22.190   42.980  1.00 67.33  ? 99  VAL C CG1   1 
ATOM   7882  C  CG2   . VAL C  1 99  ? 47.655  24.107   44.157  1.00 65.98  ? 99  VAL C CG2   1 
ATOM   7883  N  N     . PRO C  1 100 ? 51.699  25.048   43.268  1.00 72.92  ? 100 PRO C N     1 
ATOM   7884  C  CA    . PRO C  1 100 ? 52.237  26.265   42.682  1.00 74.57  ? 100 PRO C CA    1 
ATOM   7885  C  C     . PRO C  1 100 ? 51.127  27.032   41.984  1.00 73.27  ? 100 PRO C C     1 
ATOM   7886  O  O     . PRO C  1 100 ? 50.248  26.425   41.369  1.00 71.86  ? 100 PRO C O     1 
ATOM   7887  C  CB    . PRO C  1 100 ? 53.211  25.735   41.631  1.00 76.20  ? 100 PRO C CB    1 
ATOM   7888  C  CG    . PRO C  1 100 ? 52.755  24.367   41.329  1.00 74.43  ? 100 PRO C CG    1 
ATOM   7889  C  CD    . PRO C  1 100 ? 52.279  23.850   42.632  1.00 73.39  ? 100 PRO C CD    1 
ATOM   7890  N  N     . VAL C  1 101 ? 51.147  28.350   42.092  1.00 74.18  ? 101 VAL C N     1 
ATOM   7891  C  CA    . VAL C  1 101 ? 50.125  29.167   41.457  1.00 73.20  ? 101 VAL C CA    1 
ATOM   7892  C  C     . VAL C  1 101 ? 50.789  30.353   40.791  1.00 75.84  ? 101 VAL C C     1 
ATOM   7893  O  O     . VAL C  1 101 ? 51.926  30.701   41.121  1.00 78.32  ? 101 VAL C O     1 
ATOM   7894  C  CB    . VAL C  1 101 ? 49.037  29.653   42.463  1.00 71.33  ? 101 VAL C CB    1 
ATOM   7895  C  CG1   . VAL C  1 101 ? 48.274  28.476   43.033  1.00 69.79  ? 101 VAL C CG1   1 
ATOM   7896  C  CG2   . VAL C  1 101 ? 49.632  30.474   43.590  1.00 72.69  ? 101 VAL C CG2   1 
ATOM   7897  N  N     . GLY C  1 102 ? 50.092  30.977   39.852  1.00 75.60  ? 102 GLY C N     1 
ATOM   7898  C  CA    . GLY C  1 102 ? 50.618  32.185   39.237  1.00 77.99  ? 102 GLY C CA    1 
ATOM   7899  C  C     . GLY C  1 102 ? 50.453  32.220   37.738  1.00 78.58  ? 102 GLY C C     1 
ATOM   7900  O  O     . GLY C  1 102 ? 50.233  31.184   37.104  1.00 77.56  ? 102 GLY C O     1 
ATOM   7901  N  N     . PRO C  1 103 ? 50.579  33.417   37.150  1.00 80.45  ? 103 PRO C N     1 
ATOM   7902  C  CA    . PRO C  1 103 ? 50.368  33.560   35.722  1.00 81.26  ? 103 PRO C CA    1 
ATOM   7903  C  C     . PRO C  1 103 ? 51.366  32.710   34.937  1.00 82.87  ? 103 PRO C C     1 
ATOM   7904  O  O     . PRO C  1 103 ? 51.180  32.504   33.741  1.00 83.82  ? 103 PRO C O     1 
ATOM   7905  C  CB    . PRO C  1 103 ? 50.605  35.055   35.483  1.00 83.61  ? 103 PRO C CB    1 
ATOM   7906  C  CG    . PRO C  1 103 ? 51.502  35.472   36.580  1.00 85.07  ? 103 PRO C CG    1 
ATOM   7907  C  CD    . PRO C  1 103 ? 51.108  34.648   37.758  1.00 82.41  ? 103 PRO C CD    1 
ATOM   7908  N  N     . GLY C  1 104 ? 52.404  32.216   35.614  1.00 83.48  ? 104 GLY C N     1 
ATOM   7909  C  CA    . GLY C  1 104 ? 53.381  31.318   35.003  1.00 84.31  ? 104 GLY C CA    1 
ATOM   7910  C  C     . GLY C  1 104 ? 52.801  30.003   34.497  1.00 82.13  ? 104 GLY C C     1 
ATOM   7911  O  O     . GLY C  1 104 ? 53.373  29.377   33.607  1.00 83.72  ? 104 GLY C O     1 
ATOM   7912  N  N     . LEU C  1 105 ? 51.668  29.580   35.052  1.00 78.49  ? 105 LEU C N     1 
ATOM   7913  C  CA    . LEU C  1 105 ? 51.037  28.330   34.640  1.00 76.14  ? 105 LEU C CA    1 
ATOM   7914  C  C     . LEU C  1 105 ? 50.300  28.429   33.304  1.00 75.55  ? 105 LEU C C     1 
ATOM   7915  O  O     . LEU C  1 105 ? 49.893  27.404   32.741  1.00 74.53  ? 105 LEU C O     1 
ATOM   7916  C  CB    . LEU C  1 105 ? 50.062  27.837   35.709  1.00 73.37  ? 105 LEU C CB    1 
ATOM   7917  C  CG    . LEU C  1 105 ? 50.631  27.109   36.922  1.00 73.37  ? 105 LEU C CG    1 
ATOM   7918  C  CD1   . LEU C  1 105 ? 51.067  28.077   38.001  1.00 74.77  ? 105 LEU C CD1   1 
ATOM   7919  C  CD2   . LEU C  1 105 ? 49.581  26.182   37.468  1.00 70.84  ? 105 LEU C CD2   1 
ATOM   7920  N  N     . LEU C  1 106 ? 50.118  29.651   32.806  1.00 75.88  ? 106 LEU C N     1 
ATOM   7921  C  CA    . LEU C  1 106 ? 49.335  29.871   31.588  1.00 75.49  ? 106 LEU C CA    1 
ATOM   7922  C  C     . LEU C  1 106 ? 49.952  29.200   30.368  1.00 77.05  ? 106 LEU C C     1 
ATOM   7923  O  O     . LEU C  1 106 ? 51.164  29.176   30.217  1.00 79.56  ? 106 LEU C O     1 
ATOM   7924  C  CB    . LEU C  1 106 ? 49.105  31.361   31.335  1.00 76.48  ? 106 LEU C CB    1 
ATOM   7925  C  CG    . LEU C  1 106 ? 48.262  32.089   32.385  1.00 74.53  ? 106 LEU C CG    1 
ATOM   7926  C  CD1   . LEU C  1 106 ? 48.402  33.596   32.216  1.00 75.52  ? 106 LEU C CD1   1 
ATOM   7927  C  CD2   . LEU C  1 106 ? 46.792  31.650   32.325  1.00 71.88  ? 106 LEU C CD2   1 
ATOM   7928  N  N     . GLY C  1 107 ? 49.103  28.645   29.512  1.00 75.98  ? 107 GLY C N     1 
ATOM   7929  C  CA    . GLY C  1 107 ? 49.550  27.932   28.330  1.00 77.39  ? 107 GLY C CA    1 
ATOM   7930  C  C     . GLY C  1 107 ? 50.121  26.567   28.642  1.00 77.10  ? 107 GLY C C     1 
ATOM   7931  O  O     . GLY C  1 107 ? 50.581  25.871   27.737  1.00 78.68  ? 107 GLY C O     1 
ATOM   7932  N  N     . ARG C  1 108 ? 50.067  26.172   29.915  1.00 75.24  ? 108 ARG C N     1 
ATOM   7933  C  CA    . ARG C  1 108 ? 50.693  24.921   30.374  1.00 74.92  ? 108 ARG C CA    1 
ATOM   7934  C  C     . ARG C  1 108 ? 49.703  23.811   30.704  1.00 72.33  ? 108 ARG C C     1 
ATOM   7935  O  O     . ARG C  1 108 ? 48.521  24.077   30.877  1.00 70.32  ? 108 ARG C O     1 
ATOM   7936  C  CB    . ARG C  1 108 ? 51.617  25.197   31.560  1.00 75.13  ? 108 ARG C CB    1 
ATOM   7937  C  CG    . ARG C  1 108 ? 52.742  26.189   31.230  1.00 77.20  ? 108 ARG C CG    1 
ATOM   7938  C  CD    . ARG C  1 108 ? 53.660  25.674   30.126  1.00 77.80  ? 108 ARG C CD    1 
ATOM   7939  N  NE    . ARG C  1 108 ? 54.242  24.382   30.482  1.00 76.38  ? 108 ARG C NE    1 
ATOM   7940  C  CZ    . ARG C  1 108 ? 55.404  24.221   31.107  1.00 76.58  ? 108 ARG C CZ    1 
ATOM   7941  N  NH1   . ARG C  1 108 ? 56.140  25.275   31.450  1.00 76.79  ? 108 ARG C NH1   1 
ATOM   7942  N  NH2   . ARG C  1 108 ? 55.820  22.998   31.397  1.00 75.80  ? 108 ARG C NH2   1 
ATOM   7943  N  N     . VAL C  1 109 ? 50.197  22.571   30.746  1.00 73.01  ? 109 VAL C N     1 
ATOM   7944  C  CA    . VAL C  1 109 ? 49.409  21.392   31.159  1.00 71.28  ? 109 VAL C CA    1 
ATOM   7945  C  C     . VAL C  1 109 ? 50.132  20.714   32.325  1.00 71.35  ? 109 VAL C C     1 
ATOM   7946  O  O     . VAL C  1 109 ? 51.301  20.344   32.204  1.00 73.59  ? 109 VAL C O     1 
ATOM   7947  C  CB    . VAL C  1 109 ? 49.216  20.348   30.009  1.00 72.06  ? 109 VAL C CB    1 
ATOM   7948  C  CG1   . VAL C  1 109 ? 48.302  19.208   30.455  1.00 69.40  ? 109 VAL C CG1   1 
ATOM   7949  C  CG2   . VAL C  1 109 ? 48.669  20.993   28.736  1.00 72.98  ? 109 VAL C CG2   1 
ATOM   7950  N  N     . VAL C  1 110 ? 49.437  20.555   33.446  1.00 69.35  ? 110 VAL C N     1 
ATOM   7951  C  CA    . VAL C  1 110 ? 50.057  20.099   34.688  1.00 69.68  ? 110 VAL C CA    1 
ATOM   7952  C  C     . VAL C  1 110 ? 49.264  18.960   35.313  1.00 68.10  ? 110 VAL C C     1 
ATOM   7953  O  O     . VAL C  1 110 ? 48.133  18.700   34.913  1.00 67.09  ? 110 VAL C O     1 
ATOM   7954  C  CB    . VAL C  1 110 ? 50.180  21.249   35.714  1.00 69.49  ? 110 VAL C CB    1 
ATOM   7955  C  CG1   . VAL C  1 110 ? 51.023  22.397   35.152  1.00 71.77  ? 110 VAL C CG1   1 
ATOM   7956  C  CG2   . VAL C  1 110 ? 48.805  21.749   36.142  1.00 67.02  ? 110 VAL C CG2   1 
ATOM   7957  N  N     . ASP C  1 111 ? 49.837  18.273   36.292  1.00 68.74  ? 111 ASP C N     1 
ATOM   7958  C  CA    . ASP C  1 111 ? 49.077  17.226   36.961  1.00 67.49  ? 111 ASP C CA    1 
ATOM   7959  C  C     . ASP C  1 111 ? 48.401  17.752   38.228  1.00 65.84  ? 111 ASP C C     1 
ATOM   7960  O  O     . ASP C  1 111 ? 48.437  18.955   38.493  1.00 66.13  ? 111 ASP C O     1 
ATOM   7961  C  CB    . ASP C  1 111 ? 49.897  15.929   37.166  1.00 68.96  ? 111 ASP C CB    1 
ATOM   7962  C  CG    . ASP C  1 111 ? 50.866  15.984   38.358  1.00 70.98  ? 111 ASP C CG    1 
ATOM   7963  O  OD1   . ASP C  1 111 ? 50.695  16.827   39.274  1.00 71.46  ? 111 ASP C OD1   1 
ATOM   7964  O  OD2   . ASP C  1 111 ? 51.798  15.143   38.381  1.00 72.95  ? 111 ASP C OD2   1 
ATOM   7965  N  N     . ALA C  1 112 ? 47.771  16.860   38.990  1.00 64.53  ? 112 ALA C N     1 
ATOM   7966  C  CA    . ALA C  1 112 ? 46.971  17.253   40.150  1.00 62.78  ? 112 ALA C CA    1 
ATOM   7967  C  C     . ALA C  1 112 ? 47.761  18.100   41.145  1.00 63.83  ? 112 ALA C C     1 
ATOM   7968  O  O     . ALA C  1 112 ? 47.253  19.086   41.664  1.00 63.36  ? 112 ALA C O     1 
ATOM   7969  C  CB    . ALA C  1 112 ? 46.374  16.026   40.828  1.00 61.40  ? 112 ALA C CB    1 
ATOM   7970  N  N     . LEU C  1 113 ? 49.011  17.730   41.384  1.00 65.76  ? 113 LEU C N     1 
ATOM   7971  C  CA    . LEU C  1 113 ? 49.859  18.467   42.311  1.00 67.33  ? 113 LEU C CA    1 
ATOM   7972  C  C     . LEU C  1 113 ? 50.642  19.585   41.610  1.00 69.44  ? 113 LEU C C     1 
ATOM   7973  O  O     . LEU C  1 113 ? 51.535  20.192   42.202  1.00 71.47  ? 113 LEU C O     1 
ATOM   7974  C  CB    . LEU C  1 113 ? 50.789  17.498   43.048  1.00 68.49  ? 113 LEU C CB    1 
ATOM   7975  C  CG    . LEU C  1 113 ? 50.041  16.488   43.930  1.00 66.96  ? 113 LEU C CG    1 
ATOM   7976  C  CD1   . LEU C  1 113 ? 50.750  15.146   43.975  1.00 67.56  ? 113 LEU C CD1   1 
ATOM   7977  C  CD2   . LEU C  1 113 ? 49.792  17.023   45.338  1.00 66.13  ? 113 LEU C CD2   1 
ATOM   7978  N  N     . GLY C  1 114 ? 50.291  19.855   40.351  1.00 69.45  ? 114 GLY C N     1 
ATOM   7979  C  CA    . GLY C  1 114 ? 50.881  20.942   39.567  1.00 71.07  ? 114 GLY C CA    1 
ATOM   7980  C  C     . GLY C  1 114 ? 52.177  20.626   38.838  1.00 73.90  ? 114 GLY C C     1 
ATOM   7981  O  O     . GLY C  1 114 ? 52.831  21.538   38.315  1.00 76.10  ? 114 GLY C O     1 
ATOM   7982  N  N     . ASN C  1 115 ? 52.567  19.350   38.800  1.00 74.05  ? 115 ASN C N     1 
ATOM   7983  C  CA    . ASN C  1 115 ? 53.806  18.953   38.114  1.00 76.58  ? 115 ASN C CA    1 
ATOM   7984  C  C     . ASN C  1 115 ? 53.651  19.072   36.599  1.00 77.05  ? 115 ASN C C     1 
ATOM   7985  O  O     . ASN C  1 115 ? 52.628  18.673   36.061  1.00 75.54  ? 115 ASN C O     1 
ATOM   7986  C  CB    . ASN C  1 115 ? 54.211  17.528   38.495  1.00 76.76  ? 115 ASN C CB    1 
ATOM   7987  C  CG    . ASN C  1 115 ? 54.412  17.361   39.982  1.00 76.38  ? 115 ASN C CG    1 
ATOM   7988  O  OD1   . ASN C  1 115 ? 55.438  17.732   40.531  1.00 78.77  ? 115 ASN C OD1   1 
ATOM   7989  N  ND2   . ASN C  1 115 ? 53.426  16.802   40.640  1.00 75.72  ? 115 ASN C ND2   1 
ATOM   7990  N  N     . PRO C  1 116 ? 54.658  19.624   35.901  1.00 79.59  ? 116 PRO C N     1 
ATOM   7991  C  CA    . PRO C  1 116 ? 54.475  19.811   34.456  1.00 80.29  ? 116 PRO C CA    1 
ATOM   7992  C  C     . PRO C  1 116 ? 54.402  18.486   33.681  1.00 80.26  ? 116 PRO C C     1 
ATOM   7993  O  O     . PRO C  1 116 ? 55.377  17.734   33.665  1.00 82.18  ? 116 PRO C O     1 
ATOM   7994  C  CB    . PRO C  1 116 ? 55.718  20.627   34.033  1.00 83.38  ? 116 PRO C CB    1 
ATOM   7995  C  CG    . PRO C  1 116 ? 56.384  21.053   35.300  1.00 83.91  ? 116 PRO C CG    1 
ATOM   7996  C  CD    . PRO C  1 116 ? 55.992  20.056   36.348  1.00 82.28  ? 116 PRO C CD    1 
ATOM   7997  N  N     . ILE C  1 117 ? 53.258  18.213   33.049  1.00 78.35  ? 117 ILE C N     1 
ATOM   7998  C  CA    . ILE C  1 117 ? 53.094  16.992   32.234  1.00 78.75  ? 117 ILE C CA    1 
ATOM   7999  C  C     . ILE C  1 117 ? 53.118  17.197   30.711  1.00 80.61  ? 117 ILE C C     1 
ATOM   8000  O  O     . ILE C  1 117 ? 52.966  16.234   29.949  1.00 81.08  ? 117 ILE C O     1 
ATOM   8001  C  CB    . ILE C  1 117 ? 51.837  16.172   32.607  1.00 75.74  ? 117 ILE C CB    1 
ATOM   8002  C  CG1   . ILE C  1 117 ? 50.561  16.980   32.354  1.00 73.91  ? 117 ILE C CG1   1 
ATOM   8003  C  CG2   . ILE C  1 117 ? 51.945  15.633   34.038  1.00 74.63  ? 117 ILE C CG2   1 
ATOM   8004  C  CD1   . ILE C  1 117 ? 49.326  16.128   32.180  1.00 72.61  ? 117 ILE C CD1   1 
ATOM   8005  N  N     . ASP C  1 118 ? 53.311  18.440   30.273  1.00 81.90  ? 118 ASP C N     1 
ATOM   8006  C  CA    . ASP C  1 118 ? 53.506  18.729   28.853  1.00 84.19  ? 118 ASP C CA    1 
ATOM   8007  C  C     . ASP C  1 118 ? 54.971  18.589   28.450  1.00 87.66  ? 118 ASP C C     1 
ATOM   8008  O  O     . ASP C  1 118 ? 55.332  18.842   27.300  1.00 90.18  ? 118 ASP C O     1 
ATOM   8009  C  CB    . ASP C  1 118 ? 52.948  20.109   28.466  1.00 84.13  ? 118 ASP C CB    1 
ATOM   8010  C  CG    . ASP C  1 118 ? 53.501  21.252   29.323  1.00 85.03  ? 118 ASP C CG    1 
ATOM   8011  O  OD1   . ASP C  1 118 ? 54.585  21.103   29.937  1.00 86.33  ? 118 ASP C OD1   1 
ATOM   8012  O  OD2   . ASP C  1 118 ? 52.836  22.316   29.366  1.00 84.40  ? 118 ASP C OD2   1 
ATOM   8013  N  N     . GLY C  1 119 ? 55.810  18.190   29.404  1.00 87.98  ? 119 GLY C N     1 
ATOM   8014  C  CA    . GLY C  1 119 ? 57.234  17.997   29.153  1.00 91.25  ? 119 GLY C CA    1 
ATOM   8015  C  C     . GLY C  1 119 ? 57.925  19.231   28.593  1.00 93.61  ? 119 GLY C C     1 
ATOM   8016  O  O     . GLY C  1 119 ? 58.751  19.125   27.680  1.00 96.92  ? 119 GLY C O     1 
ATOM   8017  N  N     . LYS C  1 120 ? 57.577  20.399   29.134  1.00 92.08  ? 120 LYS C N     1 
ATOM   8018  C  CA    . LYS C  1 120 ? 58.173  21.671   28.727  1.00 94.00  ? 120 LYS C CA    1 
ATOM   8019  C  C     . LYS C  1 120 ? 58.902  22.316   29.893  1.00 94.44  ? 120 LYS C C     1 
ATOM   8020  O  O     . LYS C  1 120 ? 59.085  23.533   29.926  1.00 95.21  ? 120 LYS C O     1 
ATOM   8021  C  CB    . LYS C  1 120 ? 57.118  22.629   28.171  1.00 92.67  ? 120 LYS C CB    1 
ATOM   8022  C  CG    . LYS C  1 120 ? 56.399  22.124   26.937  1.00 93.15  ? 120 LYS C CG    1 
ATOM   8023  C  CD    . LYS C  1 120 ? 55.492  23.188   26.343  1.00 93.29  ? 120 LYS C CD    1 
ATOM   8024  C  CE    . LYS C  1 120 ? 54.542  22.593   25.315  1.00 92.97  ? 120 LYS C CE    1 
ATOM   8025  N  NZ    . LYS C  1 120 ? 54.137  23.611   24.306  1.00 94.90  ? 120 LYS C NZ    1 
ATOM   8026  N  N     . GLY C  1 121 ? 59.309  21.491   30.853  1.00 94.15  ? 121 GLY C N     1 
ATOM   8027  C  CA    . GLY C  1 121 ? 60.188  21.937   31.928  1.00 95.88  ? 121 GLY C CA    1 
ATOM   8028  C  C     . GLY C  1 121 ? 59.490  22.674   33.046  1.00 93.73  ? 121 GLY C C     1 
ATOM   8029  O  O     . GLY C  1 121 ? 58.260  22.739   33.072  1.00 91.01  ? 121 GLY C O     1 
ATOM   8030  N  N     . PRO C  1 122 ? 60.271  23.260   33.969  1.00 95.41  ? 122 PRO C N     1 
ATOM   8031  C  CA    . PRO C  1 122 ? 59.709  23.769   35.228  1.00 93.65  ? 122 PRO C CA    1 
ATOM   8032  C  C     . PRO C  1 122 ? 58.666  24.882   35.050  1.00 91.95  ? 122 PRO C C     1 
ATOM   8033  O  O     . PRO C  1 122 ? 58.883  25.817   34.275  1.00 94.06  ? 122 PRO C O     1 
ATOM   8034  C  CB    . PRO C  1 122 ? 60.947  24.304   35.979  1.00 96.48  ? 122 PRO C CB    1 
ATOM   8035  C  CG    . PRO C  1 122 ? 62.123  23.746   35.261  1.00 99.39  ? 122 PRO C CG    1 
ATOM   8036  C  CD    . PRO C  1 122 ? 61.696  23.595   33.842  1.00 99.17  ? 122 PRO C CD    1 
ATOM   8037  N  N     . ILE C  1 123 ? 57.543  24.762   35.750  1.00 88.65  ? 123 ILE C N     1 
ATOM   8038  C  CA    . ILE C  1 123 ? 56.594  25.860   35.889  1.00 87.16  ? 123 ILE C CA    1 
ATOM   8039  C  C     . ILE C  1 123 ? 57.249  26.930   36.755  1.00 89.01  ? 123 ILE C C     1 
ATOM   8040  O  O     . ILE C  1 123 ? 57.968  26.596   37.698  1.00 90.13  ? 123 ILE C O     1 
ATOM   8041  C  CB    . ILE C  1 123 ? 55.300  25.384   36.604  1.00 83.45  ? 123 ILE C CB    1 
ATOM   8042  C  CG1   . ILE C  1 123 ? 54.585  24.293   35.801  1.00 81.73  ? 123 ILE C CG1   1 
ATOM   8043  C  CG2   . ILE C  1 123 ? 54.352  26.553   36.898  1.00 82.61  ? 123 ILE C CG2   1 
ATOM   8044  C  CD1   . ILE C  1 123 ? 54.325  24.640   34.348  1.00 82.37  ? 123 ILE C CD1   1 
ATOM   8045  N  N     . ASP C  1 124 ? 57.027  28.206   36.453  1.00 89.69  ? 124 ASP C N     1 
ATOM   8046  C  CA    . ASP C  1 124 ? 57.390  29.229   37.428  1.00 91.16  ? 124 ASP C CA    1 
ATOM   8047  C  C     . ASP C  1 124 ? 56.182  29.701   38.236  1.00 88.36  ? 124 ASP C C     1 
ATOM   8048  O  O     . ASP C  1 124 ? 55.121  30.035   37.688  1.00 86.80  ? 124 ASP C O     1 
ATOM   8049  C  CB    . ASP C  1 124 ? 58.213  30.363   36.820  1.00 94.60  ? 124 ASP C CB    1 
ATOM   8050  C  CG    . ASP C  1 124 ? 59.695  29.985   36.682  1.00 100.12 ? 124 ASP C CG    1 
ATOM   8051  O  OD1   . ASP C  1 124 ? 60.044  28.821   37.009  1.00 101.60 ? 124 ASP C OD1   1 
ATOM   8052  O  OD2   . ASP C  1 124 ? 60.519  30.834   36.254  1.00 104.90 ? 124 ASP C OD2   1 
ATOM   8053  N  N     . ALA C  1 125 ? 56.357  29.680   39.554  1.00 87.81  ? 125 ALA C N     1 
ATOM   8054  C  CA    . ALA C  1 125 ? 55.280  29.913   40.495  1.00 84.60  ? 125 ALA C CA    1 
ATOM   8055  C  C     . ALA C  1 125 ? 55.452  31.246   41.193  1.00 85.90  ? 125 ALA C C     1 
ATOM   8056  O  O     . ALA C  1 125 ? 56.517  31.553   41.726  1.00 88.54  ? 125 ALA C O     1 
ATOM   8057  C  CB    . ALA C  1 125 ? 55.244  28.797   41.517  1.00 83.14  ? 125 ALA C CB    1 
ATOM   8058  N  N     . ALA C  1 126 ? 54.390  32.035   41.185  1.00 84.27  ? 126 ALA C N     1 
ATOM   8059  C  CA    . ALA C  1 126 ? 54.311  33.234   42.001  1.00 84.98  ? 126 ALA C CA    1 
ATOM   8060  C  C     . ALA C  1 126 ? 54.269  32.867   43.481  1.00 84.18  ? 126 ALA C C     1 
ATOM   8061  O  O     . ALA C  1 126 ? 54.864  33.549   44.305  1.00 86.24  ? 126 ALA C O     1 
ATOM   8062  C  CB    . ALA C  1 126 ? 53.083  34.028   41.626  1.00 83.62  ? 126 ALA C CB    1 
ATOM   8063  N  N     . GLY C  1 127 ? 53.550  31.795   43.808  1.00 81.53  ? 127 GLY C N     1 
ATOM   8064  C  CA    . GLY C  1 127 ? 53.458  31.289   45.184  1.00 80.74  ? 127 GLY C CA    1 
ATOM   8065  C  C     . GLY C  1 127 ? 52.828  29.909   45.260  1.00 77.95  ? 127 GLY C C     1 
ATOM   8066  O  O     . GLY C  1 127 ? 52.721  29.213   44.250  1.00 76.85  ? 127 GLY C O     1 
ATOM   8067  N  N     . ARG C  1 128 ? 52.404  29.517   46.461  1.00 76.90  ? 128 ARG C N     1 
ATOM   8068  C  CA    . ARG C  1 128 ? 51.787  28.202   46.671  1.00 74.69  ? 128 ARG C CA    1 
ATOM   8069  C  C     . ARG C  1 128 ? 50.509  28.234   47.530  1.00 72.55  ? 128 ARG C C     1 
ATOM   8070  O  O     . ARG C  1 128 ? 50.575  28.309   48.762  1.00 73.44  ? 128 ARG C O     1 
ATOM   8071  C  CB    . ARG C  1 128 ? 52.794  27.219   47.288  1.00 75.82  ? 128 ARG C CB    1 
ATOM   8072  C  CG    . ARG C  1 128 ? 54.022  26.980   46.464  1.00 77.78  ? 128 ARG C CG    1 
ATOM   8073  C  CD    . ARG C  1 128 ? 54.934  25.952   47.111  1.00 79.75  ? 128 ARG C CD    1 
ATOM   8074  N  NE    . ARG C  1 128 ? 54.339  24.620   47.090  1.00 78.14  ? 128 ARG C NE    1 
ATOM   8075  C  CZ    . ARG C  1 128 ? 54.270  23.831   46.019  1.00 77.38  ? 128 ARG C CZ    1 
ATOM   8076  N  NH1   . ARG C  1 128 ? 54.763  24.219   44.851  1.00 78.14  ? 128 ARG C NH1   1 
ATOM   8077  N  NH2   . ARG C  1 128 ? 53.690  22.644   46.117  1.00 76.44  ? 128 ARG C NH2   1 
ATOM   8078  N  N     . SER C  1 129 ? 49.346  28.164   46.895  1.00 69.94  ? 129 SER C N     1 
ATOM   8079  C  CA    . SER C  1 129 ? 48.119  28.014   47.659  1.00 67.85  ? 129 SER C CA    1 
ATOM   8080  C  C     . SER C  1 129 ? 47.964  26.548   48.036  1.00 66.44  ? 129 SER C C     1 
ATOM   8081  O  O     . SER C  1 129 ? 48.346  25.671   47.265  1.00 66.68  ? 129 SER C O     1 
ATOM   8082  C  CB    . SER C  1 129 ? 46.904  28.481   46.850  1.00 66.30  ? 129 SER C CB    1 
ATOM   8083  O  OG    . SER C  1 129 ? 47.063  29.810   46.372  1.00 68.01  ? 129 SER C OG    1 
ATOM   8084  N  N     . ARG C  1 130 ? 47.424  26.283   49.224  1.00 65.51  ? 130 ARG C N     1 
ATOM   8085  C  CA    . ARG C  1 130 ? 46.976  24.949   49.599  1.00 63.84  ? 130 ARG C CA    1 
ATOM   8086  C  C     . ARG C  1 130 ? 45.850  24.516   48.660  1.00 61.81  ? 130 ARG C C     1 
ATOM   8087  O  O     . ARG C  1 130 ? 45.229  25.358   47.998  1.00 61.37  ? 130 ARG C O     1 
ATOM   8088  C  CB    . ARG C  1 130 ? 46.409  24.961   51.008  1.00 63.55  ? 130 ARG C CB    1 
ATOM   8089  C  CG    . ARG C  1 130 ? 47.387  24.854   52.130  1.00 66.63  ? 130 ARG C CG    1 
ATOM   8090  C  CD    . ARG C  1 130 ? 46.622  24.729   53.449  1.00 68.94  ? 130 ARG C CD    1 
ATOM   8091  N  NE    . ARG C  1 130 ? 47.422  25.120   54.611  1.00 74.05  ? 130 ARG C NE    1 
ATOM   8092  C  CZ    . ARG C  1 130 ? 46.964  25.193   55.862  1.00 75.51  ? 130 ARG C CZ    1 
ATOM   8093  N  NH1   . ARG C  1 130 ? 45.697  24.907   56.143  1.00 74.36  ? 130 ARG C NH1   1 
ATOM   8094  N  NH2   . ARG C  1 130 ? 47.780  25.562   56.840  1.00 78.74  ? 130 ARG C NH2   1 
ATOM   8095  N  N     . ALA C  1 131 ? 45.557  23.215   48.640  1.00 60.63  ? 131 ALA C N     1 
ATOM   8096  C  CA    . ALA C  1 131 ? 44.489  22.666   47.823  1.00 58.49  ? 131 ALA C CA    1 
ATOM   8097  C  C     . ALA C  1 131 ? 43.103  23.044   48.358  1.00 57.43  ? 131 ALA C C     1 
ATOM   8098  O  O     . ALA C  1 131 ? 42.240  23.484   47.591  1.00 56.27  ? 131 ALA C O     1 
ATOM   8099  C  CB    . ALA C  1 131 ? 44.636  21.177   47.731  1.00 57.90  ? 131 ALA C CB    1 
ATOM   8100  N  N     . GLN C  1 132 ? 42.898  22.870   49.666  1.00 57.95  ? 132 GLN C N     1 
ATOM   8101  C  CA    . GLN C  1 132 ? 41.607  23.154   50.311  1.00 57.18  ? 132 GLN C CA    1 
ATOM   8102  C  C     . GLN C  1 132 ? 41.621  24.536   50.946  1.00 58.49  ? 132 GLN C C     1 
ATOM   8103  O  O     . GLN C  1 132 ? 42.153  24.709   52.047  1.00 60.40  ? 132 GLN C O     1 
ATOM   8104  C  CB    . GLN C  1 132 ? 41.280  22.127   51.404  1.00 56.78  ? 132 GLN C CB    1 
ATOM   8105  C  CG    . GLN C  1 132 ? 41.042  20.705   50.946  1.00 56.81  ? 132 GLN C CG    1 
ATOM   8106  C  CD    . GLN C  1 132 ? 39.836  20.571   50.064  1.00 58.09  ? 132 GLN C CD    1 
ATOM   8107  O  OE1   . GLN C  1 132 ? 38.975  21.457   50.020  1.00 59.94  ? 132 GLN C OE1   1 
ATOM   8108  N  NE2   . GLN C  1 132 ? 39.753  19.457   49.350  1.00 59.08  ? 132 GLN C NE2   1 
ATOM   8109  N  N     . VAL C  1 133 ? 41.045  25.515   50.256  1.00 58.11  ? 133 VAL C N     1 
ATOM   8110  C  CA    . VAL C  1 133 ? 40.929  26.872   50.790  1.00 59.07  ? 133 VAL C CA    1 
ATOM   8111  C  C     . VAL C  1 133 ? 39.476  27.126   51.188  1.00 57.97  ? 133 VAL C C     1 
ATOM   8112  O  O     . VAL C  1 133 ? 38.549  26.664   50.509  1.00 56.51  ? 133 VAL C O     1 
ATOM   8113  C  CB    . VAL C  1 133 ? 41.365  27.954   49.756  1.00 59.84  ? 133 VAL C CB    1 
ATOM   8114  C  CG1   . VAL C  1 133 ? 41.542  29.303   50.428  1.00 60.15  ? 133 VAL C CG1   1 
ATOM   8115  C  CG2   . VAL C  1 133 ? 42.647  27.531   49.040  1.00 61.24  ? 133 VAL C CG2   1 
ATOM   8116  N  N     . LYS C  1 134 ? 39.292  27.852   52.290  1.00 58.74  ? 134 LYS C N     1 
ATOM   8117  C  CA    . LYS C  1 134 ? 38.002  28.407   52.653  1.00 58.17  ? 134 LYS C CA    1 
ATOM   8118  C  C     . LYS C  1 134 ? 37.468  29.261   51.510  1.00 57.59  ? 134 LYS C C     1 
ATOM   8119  O  O     . LYS C  1 134 ? 38.238  29.872   50.763  1.00 58.50  ? 134 LYS C O     1 
ATOM   8120  C  CB    . LYS C  1 134 ? 38.135  29.277   53.896  1.00 60.15  ? 134 LYS C CB    1 
ATOM   8121  C  CG    . LYS C  1 134 ? 38.365  28.522   55.184  1.00 61.81  ? 134 LYS C CG    1 
ATOM   8122  C  CD    . LYS C  1 134 ? 38.191  29.461   56.358  1.00 65.95  ? 134 LYS C CD    1 
ATOM   8123  C  CE    . LYS C  1 134 ? 38.290  28.710   57.673  1.00 69.21  ? 134 LYS C CE    1 
ATOM   8124  N  NZ    . LYS C  1 134 ? 37.700  29.506   58.798  1.00 72.64  ? 134 LYS C NZ    1 
ATOM   8125  N  N     . ALA C  1 135 ? 36.148  29.298   51.367  1.00 56.16  ? 135 ALA C N     1 
ATOM   8126  C  CA    . ALA C  1 135 ? 35.532  30.157   50.367  1.00 55.61  ? 135 ALA C CA    1 
ATOM   8127  C  C     . ALA C  1 135 ? 35.385  31.556   50.955  1.00 56.58  ? 135 ALA C C     1 
ATOM   8128  O  O     . ALA C  1 135 ? 35.264  31.691   52.166  1.00 57.44  ? 135 ALA C O     1 
ATOM   8129  C  CB    . ALA C  1 135 ? 34.189  29.603   49.955  1.00 54.24  ? 135 ALA C CB    1 
ATOM   8130  N  N     . PRO C  1 136 ? 35.409  32.601   50.109  1.00 56.81  ? 136 PRO C N     1 
ATOM   8131  C  CA    . PRO C  1 136 ? 35.154  33.952   50.629  1.00 58.23  ? 136 PRO C CA    1 
ATOM   8132  C  C     . PRO C  1 136 ? 33.789  34.034   51.321  1.00 57.63  ? 136 PRO C C     1 
ATOM   8133  O  O     . PRO C  1 136 ? 32.804  33.477   50.825  1.00 56.34  ? 136 PRO C O     1 
ATOM   8134  C  CB    . PRO C  1 136 ? 35.186  34.831   49.378  1.00 58.65  ? 136 PRO C CB    1 
ATOM   8135  C  CG    . PRO C  1 136 ? 35.078  33.867   48.224  1.00 57.29  ? 136 PRO C CG    1 
ATOM   8136  C  CD    . PRO C  1 136 ? 35.679  32.603   48.663  1.00 56.29  ? 136 PRO C CD    1 
ATOM   8137  N  N     . GLY C  1 137 ? 33.744  34.703   52.465  1.00 58.63  ? 137 GLY C N     1 
ATOM   8138  C  CA    . GLY C  1 137 ? 32.553  34.694   53.300  1.00 58.50  ? 137 GLY C CA    1 
ATOM   8139  C  C     . GLY C  1 137 ? 31.379  35.513   52.797  1.00 58.86  ? 137 GLY C C     1 
ATOM   8140  O  O     . GLY C  1 137 ? 31.341  35.959   51.642  1.00 58.49  ? 137 GLY C O     1 
ATOM   8141  N  N     . ILE C  1 138 ? 30.409  35.699   53.687  1.00 59.56  ? 138 ILE C N     1 
ATOM   8142  C  CA    . ILE C  1 138 ? 29.259  36.558   53.438  1.00 60.27  ? 138 ILE C CA    1 
ATOM   8143  C  C     . ILE C  1 138 ? 29.707  37.927   52.925  1.00 61.87  ? 138 ILE C C     1 
ATOM   8144  O  O     . ILE C  1 138 ? 29.072  38.507   52.041  1.00 62.61  ? 138 ILE C O     1 
ATOM   8145  C  CB    . ILE C  1 138 ? 28.425  36.753   54.743  1.00 61.28  ? 138 ILE C CB    1 
ATOM   8146  C  CG1   . ILE C  1 138 ? 27.308  35.712   54.862  1.00 60.40  ? 138 ILE C CG1   1 
ATOM   8147  C  CG2   . ILE C  1 138 ? 27.766  38.122   54.778  1.00 62.61  ? 138 ILE C CG2   1 
ATOM   8148  C  CD1   . ILE C  1 138 ? 27.698  34.281   54.550  1.00 58.81  ? 138 ILE C CD1   1 
ATOM   8149  N  N     . LEU C  1 139 ? 30.820  38.417   53.461  1.00 62.59  ? 139 LEU C N     1 
ATOM   8150  C  CA    . LEU C  1 139 ? 31.147  39.833   53.386  1.00 63.84  ? 139 LEU C CA    1 
ATOM   8151  C  C     . LEU C  1 139 ? 32.000  40.262   52.187  1.00 63.58  ? 139 LEU C C     1 
ATOM   8152  O  O     . LEU C  1 139 ? 31.721  41.306   51.586  1.00 64.79  ? 139 LEU C O     1 
ATOM   8153  C  CB    . LEU C  1 139 ? 31.800  40.265   54.701  1.00 65.66  ? 139 LEU C CB    1 
ATOM   8154  C  CG    . LEU C  1 139 ? 32.008  41.728   55.052  1.00 67.15  ? 139 LEU C CG    1 
ATOM   8155  C  CD1   . LEU C  1 139 ? 30.709  42.504   55.072  1.00 67.87  ? 139 LEU C CD1   1 
ATOM   8156  C  CD2   . LEU C  1 139 ? 32.635  41.735   56.416  1.00 69.33  ? 139 LEU C CD2   1 
ATOM   8157  N  N     . PRO C  1 140 ? 33.044  39.482   51.844  1.00 61.88  ? 140 PRO C N     1 
ATOM   8158  C  CA    . PRO C  1 140 ? 33.985  39.908   50.807  1.00 62.15  ? 140 PRO C CA    1 
ATOM   8159  C  C     . PRO C  1 140 ? 33.464  39.807   49.379  1.00 61.12  ? 140 PRO C C     1 
ATOM   8160  O  O     . PRO C  1 140 ? 34.257  39.612   48.459  1.00 61.30  ? 140 PRO C O     1 
ATOM   8161  C  CB    . PRO C  1 140 ? 35.155  38.934   50.979  1.00 61.16  ? 140 PRO C CB    1 
ATOM   8162  C  CG    . PRO C  1 140 ? 35.020  38.410   52.330  1.00 61.42  ? 140 PRO C CG    1 
ATOM   8163  C  CD    . PRO C  1 140 ? 33.564  38.329   52.587  1.00 60.84  ? 140 PRO C CD    1 
ATOM   8164  N  N     . ARG C  1 141 ? 32.158  39.934   49.177  1.00 60.45  ? 141 ARG C N     1 
ATOM   8165  C  CA    . ARG C  1 141 ? 31.596  39.657   47.865  1.00 59.49  ? 141 ARG C CA    1 
ATOM   8166  C  C     . ARG C  1 141 ? 30.821  40.805   47.267  1.00 61.44  ? 141 ARG C C     1 
ATOM   8167  O  O     . ARG C  1 141 ? 30.616  41.833   47.904  1.00 63.43  ? 141 ARG C O     1 
ATOM   8168  C  CB    . ARG C  1 141 ? 30.697  38.442   47.921  1.00 57.15  ? 141 ARG C CB    1 
ATOM   8169  C  CG    . ARG C  1 141 ? 31.389  37.197   48.297  1.00 54.38  ? 141 ARG C CG    1 
ATOM   8170  C  CD    . ARG C  1 141 ? 30.373  36.141   48.435  1.00 51.44  ? 141 ARG C CD    1 
ATOM   8171  N  NE    . ARG C  1 141 ? 30.999  34.877   48.767  1.00 50.17  ? 141 ARG C NE    1 
ATOM   8172  C  CZ    . ARG C  1 141 ? 31.110  33.865   47.922  1.00 47.61  ? 141 ARG C CZ    1 
ATOM   8173  N  NH1   . ARG C  1 141 ? 30.628  33.977   46.692  1.00 48.05  ? 141 ARG C NH1   1 
ATOM   8174  N  NH2   . ARG C  1 141 ? 31.696  32.748   48.316  1.00 45.25  ? 141 ARG C NH2   1 
ATOM   8175  N  N     . ARG C  1 142 ? 30.405  40.612   46.022  1.00 61.65  ? 142 ARG C N     1 
ATOM   8176  C  CA    . ARG C  1 142 ? 29.608  41.583   45.299  1.00 63.85  ? 142 ARG C CA    1 
ATOM   8177  C  C     . ARG C  1 142 ? 28.712  40.835   44.309  1.00 63.01  ? 142 ARG C C     1 
ATOM   8178  O  O     . ARG C  1 142 ? 29.054  39.745   43.842  1.00 61.30  ? 142 ARG C O     1 
ATOM   8179  C  CB    . ARG C  1 142 ? 30.509  42.578   44.569  1.00 65.73  ? 142 ARG C CB    1 
ATOM   8180  C  CG    . ARG C  1 142 ? 29.789  43.791   44.068  1.00 69.19  ? 142 ARG C CG    1 
ATOM   8181  C  CD    . ARG C  1 142 ? 30.215  44.123   42.658  1.00 74.12  ? 142 ARG C CD    1 
ATOM   8182  N  NE    . ARG C  1 142 ? 29.327  45.119   42.059  1.00 79.55  ? 142 ARG C NE    1 
ATOM   8183  C  CZ    . ARG C  1 142 ? 29.594  46.426   41.991  1.00 84.65  ? 142 ARG C CZ    1 
ATOM   8184  N  NH1   . ARG C  1 142 ? 30.736  46.921   42.478  1.00 85.89  ? 142 ARG C NH1   1 
ATOM   8185  N  NH2   . ARG C  1 142 ? 28.712  47.250   41.428  1.00 87.57  ? 142 ARG C NH2   1 
ATOM   8186  N  N     . SER C  1 143 ? 27.560  41.424   44.005  1.00 64.25  ? 143 SER C N     1 
ATOM   8187  C  CA    . SER C  1 143 ? 26.630  40.827   43.070  1.00 63.86  ? 143 SER C CA    1 
ATOM   8188  C  C     . SER C  1 143 ? 27.206  40.760   41.664  1.00 64.30  ? 143 SER C C     1 
ATOM   8189  O  O     . SER C  1 143 ? 27.715  41.748   41.135  1.00 66.42  ? 143 SER C O     1 
ATOM   8190  C  CB    . SER C  1 143 ? 25.314  41.586   43.081  1.00 65.11  ? 143 SER C CB    1 
ATOM   8191  O  OG    . SER C  1 143 ? 24.519  41.147   44.176  1.00 65.65  ? 143 SER C OG    1 
ATOM   8192  N  N     . VAL C  1 144 ? 27.137  39.574   41.075  1.00 62.83  ? 144 VAL C N     1 
ATOM   8193  C  CA    . VAL C  1 144 ? 27.589  39.355   39.713  1.00 62.87  ? 144 VAL C CA    1 
ATOM   8194  C  C     . VAL C  1 144 ? 26.878  40.303   38.754  1.00 65.09  ? 144 VAL C C     1 
ATOM   8195  O  O     . VAL C  1 144 ? 25.657  40.298   38.676  1.00 65.65  ? 144 VAL C O     1 
ATOM   8196  C  CB    . VAL C  1 144 ? 27.325  37.913   39.315  1.00 60.81  ? 144 VAL C CB    1 
ATOM   8197  C  CG1   . VAL C  1 144 ? 27.535  37.719   37.837  1.00 60.94  ? 144 VAL C CG1   1 
ATOM   8198  C  CG2   . VAL C  1 144 ? 28.214  36.990   40.129  1.00 58.74  ? 144 VAL C CG2   1 
ATOM   8199  N  N     . HIS C  1 145 ? 27.643  41.120   38.037  1.00 66.98  ? 145 HIS C N     1 
ATOM   8200  C  CA    . HIS C  1 145 ? 27.064  42.083   37.102  1.00 69.45  ? 145 HIS C CA    1 
ATOM   8201  C  C     . HIS C  1 145 ? 27.794  42.129   35.742  1.00 70.94  ? 145 HIS C C     1 
ATOM   8202  O  O     . HIS C  1 145 ? 27.656  43.104   34.987  1.00 73.36  ? 145 HIS C O     1 
ATOM   8203  C  CB    . HIS C  1 145 ? 27.058  43.472   37.743  1.00 71.01  ? 145 HIS C CB    1 
ATOM   8204  C  CG    . HIS C  1 145 ? 28.426  44.042   37.933  1.00 72.07  ? 145 HIS C CG    1 
ATOM   8205  N  ND1   . HIS C  1 145 ? 29.253  43.657   38.965  1.00 71.60  ? 145 HIS C ND1   1 
ATOM   8206  C  CD2   . HIS C  1 145 ? 29.129  44.937   37.201  1.00 74.37  ? 145 HIS C CD2   1 
ATOM   8207  C  CE1   . HIS C  1 145 ? 30.404  44.300   38.869  1.00 72.73  ? 145 HIS C CE1   1 
ATOM   8208  N  NE2   . HIS C  1 145 ? 30.354  45.084   37.808  1.00 74.57  ? 145 HIS C NE2   1 
ATOM   8209  N  N     . GLU C  1 146 ? 28.563  41.085   35.432  1.00 69.82  ? 146 GLU C N     1 
ATOM   8210  C  CA    . GLU C  1 146 ? 29.436  41.094   34.258  1.00 71.22  ? 146 GLU C CA    1 
ATOM   8211  C  C     . GLU C  1 146 ? 29.246  39.854   33.408  1.00 70.34  ? 146 GLU C C     1 
ATOM   8212  O  O     . GLU C  1 146 ? 29.246  38.739   33.936  1.00 68.66  ? 146 GLU C O     1 
ATOM   8213  C  CB    . GLU C  1 146 ? 30.900  41.123   34.680  1.00 71.33  ? 146 GLU C CB    1 
ATOM   8214  C  CG    . GLU C  1 146 ? 31.404  42.411   35.293  1.00 73.79  ? 146 GLU C CG    1 
ATOM   8215  C  CD    . GLU C  1 146 ? 32.565  42.140   36.224  1.00 74.50  ? 146 GLU C CD    1 
ATOM   8216  O  OE1   . GLU C  1 146 ? 32.380  41.314   37.154  1.00 73.98  ? 146 GLU C OE1   1 
ATOM   8217  O  OE2   . GLU C  1 146 ? 33.653  42.728   36.020  1.00 75.30  ? 146 GLU C OE2   1 
ATOM   8218  N  N     . PRO C  1 147 ? 29.118  40.033   32.081  1.00 71.76  ? 147 PRO C N     1 
ATOM   8219  C  CA    . PRO C  1 147 ? 28.970  38.885   31.185  1.00 70.98  ? 147 PRO C CA    1 
ATOM   8220  C  C     . PRO C  1 147 ? 30.218  38.011   31.118  1.00 69.57  ? 147 PRO C C     1 
ATOM   8221  O  O     . PRO C  1 147 ? 31.324  38.520   31.085  1.00 70.68  ? 147 PRO C O     1 
ATOM   8222  C  CB    . PRO C  1 147 ? 28.719  39.544   29.822  1.00 73.57  ? 147 PRO C CB    1 
ATOM   8223  C  CG    . PRO C  1 147 ? 28.206  40.900   30.147  1.00 74.91  ? 147 PRO C CG    1 
ATOM   8224  C  CD    . PRO C  1 147 ? 28.959  41.306   31.361  1.00 74.15  ? 147 PRO C CD    1 
ATOM   8225  N  N     . VAL C  1 148 ? 30.032  36.702   31.149  1.00 67.65  ? 148 VAL C N     1 
ATOM   8226  C  CA    . VAL C  1 148 ? 31.065  35.776   30.706  1.00 67.21  ? 148 VAL C CA    1 
ATOM   8227  C  C     . VAL C  1 148 ? 30.601  35.400   29.314  1.00 68.77  ? 148 VAL C C     1 
ATOM   8228  O  O     . VAL C  1 148 ? 29.947  34.366   29.121  1.00 68.11  ? 148 VAL C O     1 
ATOM   8229  C  CB    . VAL C  1 148 ? 31.175  34.500   31.602  1.00 64.38  ? 148 VAL C CB    1 
ATOM   8230  C  CG1   . VAL C  1 148 ? 32.075  33.457   30.962  1.00 63.69  ? 148 VAL C CG1   1 
ATOM   8231  C  CG2   . VAL C  1 148 ? 31.706  34.842   32.959  1.00 62.96  ? 148 VAL C CG2   1 
ATOM   8232  N  N     . GLN C  1 149 ? 30.894  36.257   28.342  1.00 71.09  ? 149 GLN C N     1 
ATOM   8233  C  CA    . GLN C  1 149 ? 30.358  36.044   27.001  1.00 72.81  ? 149 GLN C CA    1 
ATOM   8234  C  C     . GLN C  1 149 ? 30.833  34.730   26.367  1.00 72.09  ? 149 GLN C C     1 
ATOM   8235  O  O     . GLN C  1 149 ? 32.007  34.592   26.016  1.00 72.91  ? 149 GLN C O     1 
ATOM   8236  C  CB    . GLN C  1 149 ? 30.652  37.237   26.103  1.00 75.80  ? 149 GLN C CB    1 
ATOM   8237  C  CG    . GLN C  1 149 ? 29.728  38.417   26.348  1.00 77.66  ? 149 GLN C CG    1 
ATOM   8238  C  CD    . GLN C  1 149 ? 30.070  39.605   25.463  1.00 82.38  ? 149 GLN C CD    1 
ATOM   8239  O  OE1   . GLN C  1 149 ? 30.281  39.457   24.254  1.00 84.65  ? 149 GLN C OE1   1 
ATOM   8240  N  NE2   . GLN C  1 149 ? 30.126  40.792   26.062  1.00 83.08  ? 149 GLN C NE2   1 
ATOM   8241  N  N     . THR C  1 150 ? 29.908  33.776   26.239  1.00 70.65  ? 150 THR C N     1 
ATOM   8242  C  CA    . THR C  1 150 ? 30.216  32.448   25.692  1.00 70.06  ? 150 THR C CA    1 
ATOM   8243  C  C     . THR C  1 150 ? 30.218  32.375   24.162  1.00 72.36  ? 150 THR C C     1 
ATOM   8244  O  O     . THR C  1 150 ? 30.807  31.457   23.591  1.00 72.67  ? 150 THR C O     1 
ATOM   8245  C  CB    . THR C  1 150 ? 29.235  31.366   26.188  1.00 68.19  ? 150 THR C CB    1 
ATOM   8246  O  OG1   . THR C  1 150 ? 27.940  31.599   25.625  1.00 69.26  ? 150 THR C OG1   1 
ATOM   8247  C  CG2   . THR C  1 150 ? 29.151  31.342   27.707  1.00 65.73  ? 150 THR C CG2   1 
ATOM   8248  N  N     . GLY C  1 151 ? 29.543  33.316   23.507  1.00 74.02  ? 151 GLY C N     1 
ATOM   8249  C  CA    . GLY C  1 151 ? 29.467  33.337   22.048  1.00 76.53  ? 151 GLY C CA    1 
ATOM   8250  C  C     . GLY C  1 151 ? 28.557  32.291   21.415  1.00 76.74  ? 151 GLY C C     1 
ATOM   8251  O  O     . GLY C  1 151 ? 28.562  32.113   20.194  1.00 78.71  ? 151 GLY C O     1 
ATOM   8252  N  N     . LEU C  1 152 ? 27.783  31.592   22.246  1.00 74.47  ? 152 LEU C N     1 
ATOM   8253  C  CA    . LEU C  1 152 ? 26.764  30.662   21.766  1.00 74.45  ? 152 LEU C CA    1 
ATOM   8254  C  C     . LEU C  1 152 ? 25.428  31.358   21.883  1.00 75.02  ? 152 LEU C C     1 
ATOM   8255  O  O     . LEU C  1 152 ? 25.063  31.823   22.960  1.00 73.58  ? 152 LEU C O     1 
ATOM   8256  C  CB    . LEU C  1 152 ? 26.745  29.384   22.601  1.00 71.77  ? 152 LEU C CB    1 
ATOM   8257  C  CG    . LEU C  1 152 ? 28.029  28.570   22.729  1.00 70.45  ? 152 LEU C CG    1 
ATOM   8258  C  CD1   . LEU C  1 152 ? 28.056  27.905   24.083  1.00 68.09  ? 152 LEU C CD1   1 
ATOM   8259  C  CD2   . LEU C  1 152 ? 28.144  27.543   21.630  1.00 71.23  ? 152 LEU C CD2   1 
ATOM   8260  N  N     . LYS C  1 153 ? 24.702  31.428   20.775  1.00 77.50  ? 153 LYS C N     1 
ATOM   8261  C  CA    . LYS C  1 153 ? 23.443  32.168   20.714  1.00 78.56  ? 153 LYS C CA    1 
ATOM   8262  C  C     . LYS C  1 153 ? 22.455  31.747   21.800  1.00 76.56  ? 153 LYS C C     1 
ATOM   8263  O  O     . LYS C  1 153 ? 21.984  32.579   22.566  1.00 76.10  ? 153 LYS C O     1 
ATOM   8264  C  CB    . LYS C  1 153 ? 22.811  32.048   19.323  1.00 81.63  ? 153 LYS C CB    1 
ATOM   8265  C  CG    . LYS C  1 153 ? 23.583  32.767   18.233  1.00 83.00  ? 153 LYS C CG    1 
ATOM   8266  C  CD    . LYS C  1 153 ? 23.019  32.466   16.868  1.00 85.26  ? 153 LYS C CD    1 
ATOM   8267  C  CE    . LYS C  1 153 ? 23.557  31.161   16.324  1.00 85.25  ? 153 LYS C CE    1 
ATOM   8268  N  NZ    . LYS C  1 153 ? 23.049  30.879   14.953  1.00 87.98  ? 153 LYS C NZ    1 
ATOM   8269  N  N     . ALA C  1 154 ? 22.168  30.456   21.882  1.00 75.69  ? 154 ALA C N     1 
ATOM   8270  C  CA    . ALA C  1 154 ? 21.229  29.951   22.880  1.00 74.26  ? 154 ALA C CA    1 
ATOM   8271  C  C     . ALA C  1 154 ? 21.646  30.186   24.343  1.00 71.65  ? 154 ALA C C     1 
ATOM   8272  O  O     . ALA C  1 154 ? 20.782  30.412   25.190  1.00 71.04  ? 154 ALA C O     1 
ATOM   8273  C  CB    . ALA C  1 154 ? 20.930  28.472   22.633  1.00 73.97  ? 154 ALA C CB    1 
ATOM   8274  N  N     . VAL C  1 155 ? 22.945  30.136   24.648  1.00 70.60  ? 155 VAL C N     1 
ATOM   8275  C  CA    . VAL C  1 155 ? 23.400  30.331   26.042  1.00 68.32  ? 155 VAL C CA    1 
ATOM   8276  C  C     . VAL C  1 155 ? 23.330  31.800   26.411  1.00 69.25  ? 155 VAL C C     1 
ATOM   8277  O  O     . VAL C  1 155 ? 22.606  32.170   27.327  1.00 68.57  ? 155 VAL C O     1 
ATOM   8278  C  CB    . VAL C  1 155 ? 24.825  29.744   26.339  1.00 66.79  ? 155 VAL C CB    1 
ATOM   8279  C  CG1   . VAL C  1 155 ? 25.448  30.395   27.572  1.00 64.51  ? 155 VAL C CG1   1 
ATOM   8280  C  CG2   . VAL C  1 155 ? 24.765  28.234   26.529  1.00 64.99  ? 155 VAL C CG2   1 
ATOM   8281  N  N     . ASP C  1 156 ? 24.069  32.622   25.670  1.00 71.14  ? 156 ASP C N     1 
ATOM   8282  C  CA    . ASP C  1 156 ? 24.128  34.057   25.882  1.00 72.49  ? 156 ASP C CA    1 
ATOM   8283  C  C     . ASP C  1 156 ? 22.777  34.772   25.846  1.00 74.16  ? 156 ASP C C     1 
ATOM   8284  O  O     . ASP C  1 156 ? 22.592  35.770   26.538  1.00 74.14  ? 156 ASP C O     1 
ATOM   8285  C  CB    . ASP C  1 156 ? 25.064  34.681   24.855  1.00 74.61  ? 156 ASP C CB    1 
ATOM   8286  C  CG    . ASP C  1 156 ? 26.502  34.727   25.328  1.00 74.03  ? 156 ASP C CG    1 
ATOM   8287  O  OD1   . ASP C  1 156 ? 26.820  34.128   26.392  1.00 71.67  ? 156 ASP C OD1   1 
ATOM   8288  O  OD2   . ASP C  1 156 ? 27.310  35.381   24.629  1.00 75.94  ? 156 ASP C OD2   1 
ATOM   8289  N  N     . ALA C  1 157 ? 21.838  34.273   25.046  1.00 76.07  ? 157 ALA C N     1 
ATOM   8290  C  CA    . ALA C  1 157 ? 20.511  34.895   24.961  1.00 78.03  ? 157 ALA C CA    1 
ATOM   8291  C  C     . ALA C  1 157 ? 19.531  34.401   26.038  1.00 76.63  ? 157 ALA C C     1 
ATOM   8292  O  O     . ALA C  1 157 ? 18.843  35.215   26.659  1.00 77.33  ? 157 ALA C O     1 
ATOM   8293  C  CB    . ALA C  1 157 ? 19.916  34.739   23.564  1.00 80.59  ? 157 ALA C CB    1 
ATOM   8294  N  N     . LEU C  1 158 ? 19.484  33.089   26.273  1.00 74.92  ? 158 LEU C N     1 
ATOM   8295  C  CA    . LEU C  1 158 ? 18.511  32.505   27.202  1.00 73.67  ? 158 LEU C CA    1 
ATOM   8296  C  C     . LEU C  1 158 ? 19.031  32.272   28.625  1.00 71.14  ? 158 LEU C C     1 
ATOM   8297  O  O     . LEU C  1 158 ? 18.340  32.581   29.596  1.00 70.70  ? 158 LEU C O     1 
ATOM   8298  C  CB    . LEU C  1 158 ? 17.989  31.183   26.655  1.00 73.77  ? 158 LEU C CB    1 
ATOM   8299  C  CG    . LEU C  1 158 ? 17.443  31.178   25.235  1.00 76.69  ? 158 LEU C CG    1 
ATOM   8300  C  CD1   . LEU C  1 158 ? 17.580  29.786   24.649  1.00 76.33  ? 158 LEU C CD1   1 
ATOM   8301  C  CD2   . LEU C  1 158 ? 16.000  31.650   25.221  1.00 78.57  ? 158 LEU C CD2   1 
ATOM   8302  N  N     . VAL C  1 159 ? 20.233  31.708   28.746  1.00 69.70  ? 159 VAL C N     1 
ATOM   8303  C  CA    . VAL C  1 159 ? 20.785  31.325   30.055  1.00 67.05  ? 159 VAL C CA    1 
ATOM   8304  C  C     . VAL C  1 159 ? 22.162  31.983   30.357  1.00 66.43  ? 159 VAL C C     1 
ATOM   8305  O  O     . VAL C  1 159 ? 23.145  31.286   30.628  1.00 64.97  ? 159 VAL C O     1 
ATOM   8306  C  CB    . VAL C  1 159 ? 20.813  29.774   30.209  1.00 65.52  ? 159 VAL C CB    1 
ATOM   8307  C  CG1   . VAL C  1 159 ? 19.449  29.197   29.881  1.00 66.40  ? 159 VAL C CG1   1 
ATOM   8308  C  CG2   . VAL C  1 159 ? 21.846  29.137   29.293  1.00 66.08  ? 159 VAL C CG2   1 
ATOM   8309  N  N     . PRO C  1 160 ? 22.215  33.338   30.343  1.00 67.62  ? 160 PRO C N     1 
ATOM   8310  C  CA    . PRO C  1 160 ? 23.463  34.119   30.366  1.00 67.77  ? 160 PRO C CA    1 
ATOM   8311  C  C     . PRO C  1 160 ? 24.290  33.916   31.624  1.00 65.73  ? 160 PRO C C     1 
ATOM   8312  O  O     . PRO C  1 160 ? 23.741  33.901   32.719  1.00 64.98  ? 160 PRO C O     1 
ATOM   8313  C  CB    . PRO C  1 160 ? 22.968  35.563   30.314  1.00 69.47  ? 160 PRO C CB    1 
ATOM   8314  C  CG    . PRO C  1 160 ? 21.624  35.503   30.942  1.00 69.41  ? 160 PRO C CG    1 
ATOM   8315  C  CD    . PRO C  1 160 ? 21.037  34.218   30.473  1.00 68.86  ? 160 PRO C CD    1 
ATOM   8316  N  N     . ILE C  1 161 ? 25.604  33.789   31.458  1.00 65.44  ? 161 ILE C N     1 
ATOM   8317  C  CA    . ILE C  1 161 ? 26.511  33.459   32.557  1.00 63.58  ? 161 ILE C CA    1 
ATOM   8318  C  C     . ILE C  1 161 ? 27.353  34.682   32.970  1.00 64.26  ? 161 ILE C C     1 
ATOM   8319  O  O     . ILE C  1 161 ? 28.033  35.284   32.143  1.00 65.80  ? 161 ILE C O     1 
ATOM   8320  C  CB    . ILE C  1 161 ? 27.374  32.208   32.192  1.00 62.63  ? 161 ILE C CB    1 
ATOM   8321  C  CG1   . ILE C  1 161 ? 26.470  30.981   32.077  1.00 61.99  ? 161 ILE C CG1   1 
ATOM   8322  C  CG2   . ILE C  1 161 ? 28.443  31.936   33.232  1.00 61.18  ? 161 ILE C CG2   1 
ATOM   8323  C  CD1   . ILE C  1 161 ? 26.897  29.967   31.037  1.00 62.35  ? 161 ILE C CD1   1 
ATOM   8324  N  N     . GLY C  1 162 ? 27.273  35.054   34.248  1.00 63.32  ? 162 GLY C N     1 
ATOM   8325  C  CA    . GLY C  1 162 ? 28.012  36.201   34.791  1.00 63.68  ? 162 GLY C CA    1 
ATOM   8326  C  C     . GLY C  1 162 ? 29.291  35.859   35.544  1.00 62.58  ? 162 GLY C C     1 
ATOM   8327  O  O     . GLY C  1 162 ? 29.442  34.755   36.069  1.00 61.07  ? 162 GLY C O     1 
ATOM   8328  N  N     . ARG C  1 163 ? 30.217  36.811   35.597  1.00 63.39  ? 163 ARG C N     1 
ATOM   8329  C  CA    . ARG C  1 163 ? 31.499  36.599   36.241  1.00 62.82  ? 163 ARG C CA    1 
ATOM   8330  C  C     . ARG C  1 163 ? 31.344  36.476   37.750  1.00 61.79  ? 163 ARG C C     1 
ATOM   8331  O  O     . ARG C  1 163 ? 31.075  37.470   38.439  1.00 62.64  ? 163 ARG C O     1 
ATOM   8332  C  CB    . ARG C  1 163 ? 32.463  37.728   35.882  1.00 64.94  ? 163 ARG C CB    1 
ATOM   8333  C  CG    . ARG C  1 163 ? 33.286  37.451   34.640  1.00 66.21  ? 163 ARG C CG    1 
ATOM   8334  C  CD    . ARG C  1 163 ? 33.595  38.700   33.840  1.00 68.63  ? 163 ARG C CD    1 
ATOM   8335  N  NE    . ARG C  1 163 ? 33.799  38.354   32.435  1.00 70.44  ? 163 ARG C NE    1 
ATOM   8336  C  CZ    . ARG C  1 163 ? 34.916  38.564   31.737  1.00 72.82  ? 163 ARG C CZ    1 
ATOM   8337  N  NH1   . ARG C  1 163 ? 35.975  39.154   32.296  1.00 73.10  ? 163 ARG C NH1   1 
ATOM   8338  N  NH2   . ARG C  1 163 ? 34.963  38.188   30.459  1.00 73.82  ? 163 ARG C NH2   1 
ATOM   8339  N  N     . GLY C  1 164 ? 31.503  35.246   38.246  1.00 60.08  ? 164 GLY C N     1 
ATOM   8340  C  CA    . GLY C  1 164 ? 31.410  34.928   39.674  1.00 58.88  ? 164 GLY C CA    1 
ATOM   8341  C  C     . GLY C  1 164 ? 30.365  33.864   39.959  1.00 57.38  ? 164 GLY C C     1 
ATOM   8342  O  O     . GLY C  1 164 ? 30.266  33.343   41.075  1.00 56.70  ? 164 GLY C O     1 
ATOM   8343  N  N     . GLN C  1 165 ? 29.585  33.552   38.935  1.00 57.22  ? 165 GLN C N     1 
ATOM   8344  C  CA    . GLN C  1 165 ? 28.538  32.539   38.978  1.00 56.10  ? 165 GLN C CA    1 
ATOM   8345  C  C     . GLN C  1 165 ? 29.087  31.114   38.965  1.00 54.59  ? 165 GLN C C     1 
ATOM   8346  O  O     . GLN C  1 165 ? 30.206  30.867   38.521  1.00 54.71  ? 165 GLN C O     1 
ATOM   8347  C  CB    . GLN C  1 165 ? 27.648  32.748   37.751  1.00 57.15  ? 165 GLN C CB    1 
ATOM   8348  C  CG    . GLN C  1 165 ? 26.456  31.836   37.588  1.00 57.05  ? 165 GLN C CG    1 
ATOM   8349  C  CD    . GLN C  1 165 ? 25.483  32.384   36.555  1.00 60.18  ? 165 GLN C CD    1 
ATOM   8350  O  OE1   . GLN C  1 165 ? 25.804  33.333   35.835  1.00 62.12  ? 165 GLN C OE1   1 
ATOM   8351  N  NE2   . GLN C  1 165 ? 24.281  31.802   36.486  1.00 60.08  ? 165 GLN C NE2   1 
ATOM   8352  N  N     . ARG C  1 166 ? 28.283  30.177   39.450  1.00 53.57  ? 166 ARG C N     1 
ATOM   8353  C  CA    . ARG C  1 166 ? 28.526  28.752   39.209  1.00 52.48  ? 166 ARG C CA    1 
ATOM   8354  C  C     . ARG C  1 166 ? 27.401  28.161   38.351  1.00 52.34  ? 166 ARG C C     1 
ATOM   8355  O  O     . ARG C  1 166 ? 26.284  27.962   38.829  1.00 52.37  ? 166 ARG C O     1 
ATOM   8356  C  CB    . ARG C  1 166 ? 28.632  27.996   40.527  1.00 51.23  ? 166 ARG C CB    1 
ATOM   8357  C  CG    . ARG C  1 166 ? 29.871  28.320   41.331  1.00 51.44  ? 166 ARG C CG    1 
ATOM   8358  C  CD    . ARG C  1 166 ? 29.622  29.310   42.466  1.00 51.43  ? 166 ARG C CD    1 
ATOM   8359  N  NE    . ARG C  1 166 ? 28.216  29.578   42.745  1.00 50.87  ? 166 ARG C NE    1 
ATOM   8360  C  CZ    . ARG C  1 166 ? 27.516  29.031   43.734  1.00 51.15  ? 166 ARG C CZ    1 
ATOM   8361  N  NH1   . ARG C  1 166 ? 28.060  28.140   44.554  1.00 51.51  ? 166 ARG C NH1   1 
ATOM   8362  N  NH2   . ARG C  1 166 ? 26.249  29.373   43.897  1.00 52.17  ? 166 ARG C NH2   1 
ATOM   8363  N  N     . GLU C  1 167 ? 27.682  27.894   37.082  1.00 52.56  ? 167 GLU C N     1 
ATOM   8364  C  CA    . GLU C  1 167 ? 26.650  27.391   36.181  1.00 52.56  ? 167 GLU C CA    1 
ATOM   8365  C  C     . GLU C  1 167 ? 26.939  25.950   35.778  1.00 51.78  ? 167 GLU C C     1 
ATOM   8366  O  O     . GLU C  1 167 ? 27.992  25.667   35.208  1.00 52.18  ? 167 GLU C O     1 
ATOM   8367  C  CB    . GLU C  1 167 ? 26.540  28.292   34.949  1.00 54.26  ? 167 GLU C CB    1 
ATOM   8368  C  CG    . GLU C  1 167 ? 25.475  27.879   33.954  1.00 54.43  ? 167 GLU C CG    1 
ATOM   8369  C  CD    . GLU C  1 167 ? 24.082  28.354   34.318  1.00 55.18  ? 167 GLU C CD    1 
ATOM   8370  O  OE1   . GLU C  1 167 ? 23.873  28.957   35.402  1.00 54.58  ? 167 GLU C OE1   1 
ATOM   8371  O  OE2   . GLU C  1 167 ? 23.175  28.110   33.499  1.00 57.54  ? 167 GLU C OE2   1 
ATOM   8372  N  N     . LEU C  1 168 ? 26.005  25.050   36.082  1.00 50.81  ? 168 LEU C N     1 
ATOM   8373  C  CA    . LEU C  1 168 ? 26.185  23.613   35.860  1.00 50.00  ? 168 LEU C CA    1 
ATOM   8374  C  C     . LEU C  1 168 ? 25.870  23.225   34.416  1.00 51.10  ? 168 LEU C C     1 
ATOM   8375  O  O     . LEU C  1 168 ? 24.830  23.601   33.890  1.00 52.04  ? 168 LEU C O     1 
ATOM   8376  C  CB    . LEU C  1 168 ? 25.300  22.832   36.836  1.00 48.80  ? 168 LEU C CB    1 
ATOM   8377  C  CG    . LEU C  1 168 ? 25.090  21.320   36.707  1.00 48.76  ? 168 LEU C CG    1 
ATOM   8378  C  CD1   . LEU C  1 168 ? 26.390  20.552   36.932  1.00 48.96  ? 168 LEU C CD1   1 
ATOM   8379  C  CD2   . LEU C  1 168 ? 24.037  20.844   37.683  1.00 46.21  ? 168 LEU C CD2   1 
ATOM   8380  N  N     . ILE C  1 169 ? 26.772  22.494   33.765  1.00 51.20  ? 169 ILE C N     1 
ATOM   8381  C  CA    . ILE C  1 169 ? 26.450  21.896   32.463  1.00 52.51  ? 169 ILE C CA    1 
ATOM   8382  C  C     . ILE C  1 169 ? 26.138  20.415   32.708  1.00 51.87  ? 169 ILE C C     1 
ATOM   8383  O  O     . ILE C  1 169 ? 26.986  19.680   33.200  1.00 51.20  ? 169 ILE C O     1 
ATOM   8384  C  CB    . ILE C  1 169 ? 27.603  22.034   31.438  1.00 53.49  ? 169 ILE C CB    1 
ATOM   8385  C  CG1   . ILE C  1 169 ? 28.003  23.485   31.247  1.00 53.53  ? 169 ILE C CG1   1 
ATOM   8386  C  CG2   . ILE C  1 169 ? 27.186  21.488   30.087  1.00 55.32  ? 169 ILE C CG2   1 
ATOM   8387  C  CD1   . ILE C  1 169 ? 29.415  23.631   30.735  1.00 54.46  ? 169 ILE C CD1   1 
ATOM   8388  N  N     . ILE C  1 170 ? 24.927  19.981   32.389  1.00 52.43  ? 170 ILE C N     1 
ATOM   8389  C  CA    . ILE C  1 170 ? 24.491  18.637   32.777  1.00 52.42  ? 170 ILE C CA    1 
ATOM   8390  C  C     . ILE C  1 170 ? 23.797  17.885   31.639  1.00 54.13  ? 170 ILE C C     1 
ATOM   8391  O  O     . ILE C  1 170 ? 22.977  18.457   30.914  1.00 55.67  ? 170 ILE C O     1 
ATOM   8392  C  CB    . ILE C  1 170 ? 23.583  18.678   34.039  1.00 51.50  ? 170 ILE C CB    1 
ATOM   8393  C  CG1   . ILE C  1 170 ? 22.892  17.323   34.273  1.00 51.31  ? 170 ILE C CG1   1 
ATOM   8394  C  CG2   . ILE C  1 170 ? 22.550  19.810   33.932  1.00 52.21  ? 170 ILE C CG2   1 
ATOM   8395  C  CD1   . ILE C  1 170 ? 22.281  17.165   35.650  1.00 50.09  ? 170 ILE C CD1   1 
ATOM   8396  N  N     . GLY C  1 171 ? 24.131  16.610   31.483  1.00 54.04  ? 171 GLY C N     1 
ATOM   8397  C  CA    . GLY C  1 171 ? 23.533  15.813   30.432  1.00 56.41  ? 171 GLY C CA    1 
ATOM   8398  C  C     . GLY C  1 171 ? 24.039  14.394   30.423  1.00 57.15  ? 171 GLY C C     1 
ATOM   8399  O  O     . GLY C  1 171 ? 24.948  14.045   31.183  1.00 56.15  ? 171 GLY C O     1 
ATOM   8400  N  N     . ASP C  1 172 ? 23.439  13.563   29.571  1.00 59.30  ? 172 ASP C N     1 
ATOM   8401  C  CA    . ASP C  1 172 ? 23.939  12.203   29.331  1.00 60.10  ? 172 ASP C CA    1 
ATOM   8402  C  C     . ASP C  1 172 ? 25.263  12.261   28.568  1.00 60.78  ? 172 ASP C C     1 
ATOM   8403  O  O     . ASP C  1 172 ? 25.639  13.324   28.058  1.00 61.41  ? 172 ASP C O     1 
ATOM   8404  C  CB    . ASP C  1 172 ? 22.916  11.390   28.548  1.00 61.95  ? 172 ASP C CB    1 
ATOM   8405  C  CG    . ASP C  1 172 ? 21.788  10.865   29.423  1.00 63.11  ? 172 ASP C CG    1 
ATOM   8406  O  OD1   . ASP C  1 172 ? 21.758  11.174   30.644  1.00 61.50  ? 172 ASP C OD1   1 
ATOM   8407  O  OD2   . ASP C  1 172 ? 20.922  10.131   28.879  1.00 67.55  ? 172 ASP C OD2   1 
ATOM   8408  N  N     . ARG C  1 173 ? 25.975  11.136   28.493  1.00 60.65  ? 173 ARG C N     1 
ATOM   8409  C  CA    . ARG C  1 173 ? 27.208  11.095   27.710  1.00 61.32  ? 173 ARG C CA    1 
ATOM   8410  C  C     . ARG C  1 173 ? 26.930  11.532   26.267  1.00 62.86  ? 173 ARG C C     1 
ATOM   8411  O  O     . ARG C  1 173 ? 25.828  11.340   25.748  1.00 63.71  ? 173 ARG C O     1 
ATOM   8412  C  CB    . ARG C  1 173 ? 27.833  9.700    27.743  1.00 62.01  ? 173 ARG C CB    1 
ATOM   8413  C  CG    . ARG C  1 173 ? 27.110  8.693    26.885  1.00 65.37  ? 173 ARG C CG    1 
ATOM   8414  C  CD    . ARG C  1 173 ? 27.477  7.278    27.227  1.00 68.66  ? 173 ARG C CD    1 
ATOM   8415  N  NE    . ARG C  1 173 ? 26.280  6.444    27.216  1.00 73.56  ? 173 ARG C NE    1 
ATOM   8416  C  CZ    . ARG C  1 173 ? 25.598  6.102    26.118  1.00 78.82  ? 173 ARG C CZ    1 
ATOM   8417  N  NH1   . ARG C  1 173 ? 26.002  6.517    24.909  1.00 81.16  ? 173 ARG C NH1   1 
ATOM   8418  N  NH2   . ARG C  1 173 ? 24.507  5.334    26.224  1.00 80.20  ? 173 ARG C NH2   1 
ATOM   8419  N  N     . GLN C  1 174 ? 27.925  12.155   25.644  1.00 63.03  ? 174 GLN C N     1 
ATOM   8420  C  CA    . GLN C  1 174 ? 27.856  12.528   24.230  1.00 64.99  ? 174 GLN C CA    1 
ATOM   8421  C  C     . GLN C  1 174 ? 26.710  13.490   23.849  1.00 65.42  ? 174 GLN C C     1 
ATOM   8422  O  O     . GLN C  1 174 ? 26.191  13.430   22.737  1.00 67.38  ? 174 GLN C O     1 
ATOM   8423  C  CB    . GLN C  1 174 ? 27.851  11.266   23.346  1.00 66.81  ? 174 GLN C CB    1 
ATOM   8424  C  CG    . GLN C  1 174 ? 29.210  10.594   23.213  1.00 66.48  ? 174 GLN C CG    1 
ATOM   8425  C  CD    . GLN C  1 174 ? 30.225  11.450   22.450  1.00 67.25  ? 174 GLN C CD    1 
ATOM   8426  O  OE1   . GLN C  1 174 ? 31.167  11.982   23.040  1.00 64.07  ? 174 GLN C OE1   1 
ATOM   8427  N  NE2   . GLN C  1 174 ? 30.030  11.586   21.134  1.00 69.67  ? 174 GLN C NE2   1 
ATOM   8428  N  N     . THR C  1 175 ? 26.331  14.381   24.762  1.00 63.69  ? 175 THR C N     1 
ATOM   8429  C  CA    . THR C  1 175 ? 25.295  15.373   24.464  1.00 64.34  ? 175 THR C CA    1 
ATOM   8430  C  C     . THR C  1 175 ? 25.839  16.759   24.163  1.00 65.00  ? 175 THR C C     1 
ATOM   8431  O  O     . THR C  1 175 ? 25.085  17.622   23.732  1.00 66.33  ? 175 THR C O     1 
ATOM   8432  C  CB    . THR C  1 175 ? 24.232  15.489   25.566  1.00 62.47  ? 175 THR C CB    1 
ATOM   8433  O  OG1   . THR C  1 175 ? 24.863  15.480   26.849  1.00 60.91  ? 175 THR C OG1   1 
ATOM   8434  C  CG2   . THR C  1 175 ? 23.261  14.346   25.487  1.00 62.80  ? 175 THR C CG2   1 
ATOM   8435  N  N     . GLY C  1 176 ? 27.134  16.977   24.381  1.00 64.66  ? 176 GLY C N     1 
ATOM   8436  C  CA    . GLY C  1 176 ? 27.763  18.238   23.989  1.00 65.90  ? 176 GLY C CA    1 
ATOM   8437  C  C     . GLY C  1 176 ? 28.211  19.104   25.148  1.00 64.41  ? 176 GLY C C     1 
ATOM   8438  O  O     . GLY C  1 176 ? 28.477  20.293   24.977  1.00 65.25  ? 176 GLY C O     1 
ATOM   8439  N  N     . LYS C  1 177 ? 28.307  18.507   26.328  1.00 62.72  ? 177 LYS C N     1 
ATOM   8440  C  CA    . LYS C  1 177 ? 28.667  19.239   27.533  1.00 61.43  ? 177 LYS C CA    1 
ATOM   8441  C  C     . LYS C  1 177 ? 29.991  19.989   27.380  1.00 62.68  ? 177 LYS C C     1 
ATOM   8442  O  O     . LYS C  1 177 ? 30.041  21.196   27.574  1.00 62.59  ? 177 LYS C O     1 
ATOM   8443  C  CB    . LYS C  1 177 ? 28.701  18.305   28.752  1.00 59.33  ? 177 LYS C CB    1 
ATOM   8444  C  CG    . LYS C  1 177 ? 27.401  17.567   29.038  1.00 57.90  ? 177 LYS C CG    1 
ATOM   8445  C  CD    . LYS C  1 177 ? 27.484  16.745   30.317  1.00 55.34  ? 177 LYS C CD    1 
ATOM   8446  C  CE    . LYS C  1 177 ? 28.330  15.500   30.164  1.00 56.53  ? 177 LYS C CE    1 
ATOM   8447  N  NZ    . LYS C  1 177 ? 27.711  14.457   29.281  1.00 58.33  ? 177 LYS C NZ    1 
ATOM   8448  N  N     . THR C  1 178 ? 31.056  19.279   27.022  1.00 64.43  ? 178 THR C N     1 
ATOM   8449  C  CA    . THR C  1 178 ? 32.373  19.899   26.889  1.00 66.74  ? 178 THR C CA    1 
ATOM   8450  C  C     . THR C  1 178 ? 32.335  21.017   25.858  1.00 68.29  ? 178 THR C C     1 
ATOM   8451  O  O     . THR C  1 178 ? 32.854  22.114   26.104  1.00 68.38  ? 178 THR C O     1 
ATOM   8452  C  CB    . THR C  1 178 ? 33.458  18.878   26.513  1.00 67.50  ? 178 THR C CB    1 
ATOM   8453  O  OG1   . THR C  1 178 ? 33.460  17.817   27.473  1.00 73.22  ? 178 THR C OG1   1 
ATOM   8454  C  CG2   . THR C  1 178 ? 34.828  19.533   26.491  1.00 68.13  ? 178 THR C CG2   1 
ATOM   8455  N  N     . ALA C  1 179 ? 31.695  20.733   24.721  1.00 70.00  ? 179 ALA C N     1 
ATOM   8456  C  CA    . ALA C  1 179 ? 31.540  21.699   23.626  1.00 72.08  ? 179 ALA C CA    1 
ATOM   8457  C  C     . ALA C  1 179 ? 31.009  23.044   24.110  1.00 71.46  ? 179 ALA C C     1 
ATOM   8458  O  O     . ALA C  1 179 ? 31.426  24.085   23.616  1.00 73.07  ? 179 ALA C O     1 
ATOM   8459  C  CB    . ALA C  1 179 ? 30.644  21.139   22.544  1.00 73.81  ? 179 ALA C CB    1 
ATOM   8460  N  N     . VAL C  1 180 ? 30.097  23.024   25.079  1.00 69.24  ? 180 VAL C N     1 
ATOM   8461  C  CA    . VAL C  1 180 ? 29.630  24.262   25.691  1.00 68.28  ? 180 VAL C CA    1 
ATOM   8462  C  C     . VAL C  1 180 ? 30.774  24.982   26.417  1.00 67.51  ? 180 VAL C C     1 
ATOM   8463  O  O     . VAL C  1 180 ? 31.042  26.145   26.125  1.00 68.97  ? 180 VAL C O     1 
ATOM   8464  C  CB    . VAL C  1 180 ? 28.413  24.032   26.600  1.00 66.66  ? 180 VAL C CB    1 
ATOM   8465  C  CG1   . VAL C  1 180 ? 28.058  25.303   27.376  1.00 66.12  ? 180 VAL C CG1   1 
ATOM   8466  C  CG2   . VAL C  1 180 ? 27.231  23.563   25.766  1.00 66.99  ? 180 VAL C CG2   1 
ATOM   8467  N  N     . ALA C  1 181 ? 31.460  24.289   27.324  1.00 65.64  ? 181 ALA C N     1 
ATOM   8468  C  CA    . ALA C  1 181 ? 32.615  24.854   28.035  1.00 65.01  ? 181 ALA C CA    1 
ATOM   8469  C  C     . ALA C  1 181 ? 33.697  25.303   27.070  1.00 67.08  ? 181 ALA C C     1 
ATOM   8470  O  O     . ALA C  1 181 ? 34.257  26.398   27.211  1.00 67.63  ? 181 ALA C O     1 
ATOM   8471  C  CB    . ALA C  1 181 ? 33.190  23.845   28.992  1.00 63.37  ? 181 ALA C CB    1 
ATOM   8472  N  N     . LEU C  1 182 ? 33.981  24.444   26.092  1.00 68.19  ? 182 LEU C N     1 
ATOM   8473  C  CA    . LEU C  1 182 ? 35.070  24.668   25.138  1.00 70.18  ? 182 LEU C CA    1 
ATOM   8474  C  C     . LEU C  1 182 ? 34.835  25.874   24.228  1.00 72.05  ? 182 LEU C C     1 
ATOM   8475  O  O     . LEU C  1 182 ? 35.732  26.694   24.048  1.00 73.34  ? 182 LEU C O     1 
ATOM   8476  C  CB    . LEU C  1 182 ? 35.335  23.412   24.307  1.00 70.98  ? 182 LEU C CB    1 
ATOM   8477  C  CG    . LEU C  1 182 ? 36.421  23.536   23.242  1.00 73.91  ? 182 LEU C CG    1 
ATOM   8478  C  CD1   . LEU C  1 182 ? 37.807  23.681   23.869  1.00 74.37  ? 182 LEU C CD1   1 
ATOM   8479  C  CD2   . LEU C  1 182 ? 36.369  22.347   22.311  1.00 75.47  ? 182 LEU C CD2   1 
ATOM   8480  N  N     . ASP C  1 183 ? 33.635  25.979   23.666  1.00 72.39  ? 183 ASP C N     1 
ATOM   8481  C  CA    . ASP C  1 183 ? 33.292  27.109   22.814  1.00 74.58  ? 183 ASP C CA    1 
ATOM   8482  C  C     . ASP C  1 183 ? 33.451  28.438   23.589  1.00 73.71  ? 183 ASP C C     1 
ATOM   8483  O  O     . ASP C  1 183 ? 33.871  29.451   23.017  1.00 75.37  ? 183 ASP C O     1 
ATOM   8484  C  CB    . ASP C  1 183 ? 31.882  26.933   22.213  1.00 75.53  ? 183 ASP C CB    1 
ATOM   8485  C  CG    . ASP C  1 183 ? 31.821  25.846   21.085  1.00 79.23  ? 183 ASP C CG    1 
ATOM   8486  O  OD1   . ASP C  1 183 ? 32.718  25.808   20.206  1.00 81.81  ? 183 ASP C OD1   1 
ATOM   8487  O  OD2   . ASP C  1 183 ? 30.854  25.032   21.063  1.00 80.78  ? 183 ASP C OD2   1 
ATOM   8488  N  N     . THR C  1 184 ? 33.151  28.401   24.895  1.00 70.84  ? 184 THR C N     1 
ATOM   8489  C  CA    . THR C  1 184 ? 33.289  29.548   25.813  1.00 69.59  ? 184 THR C CA    1 
ATOM   8490  C  C     . THR C  1 184 ? 34.747  29.995   25.969  1.00 70.28  ? 184 THR C C     1 
ATOM   8491  O  O     . THR C  1 184 ? 35.050  31.183   25.940  1.00 71.35  ? 184 THR C O     1 
ATOM   8492  C  CB    . THR C  1 184 ? 32.712  29.215   27.220  1.00 66.68  ? 184 THR C CB    1 
ATOM   8493  O  OG1   . THR C  1 184 ? 31.354  28.790   27.097  1.00 65.61  ? 184 THR C OG1   1 
ATOM   8494  C  CG2   . THR C  1 184 ? 32.761  30.412   28.135  1.00 65.73  ? 184 THR C CG2   1 
ATOM   8495  N  N     . ILE C  1 185 ? 35.643  29.036   26.161  1.00 69.75  ? 185 ILE C N     1 
ATOM   8496  C  CA    . ILE C  1 185 ? 37.072  29.328   26.243  1.00 70.50  ? 185 ILE C CA    1 
ATOM   8497  C  C     . ILE C  1 185 ? 37.499  29.922   24.900  1.00 73.41  ? 185 ILE C C     1 
ATOM   8498  O  O     . ILE C  1 185 ? 38.056  31.027   24.847  1.00 74.93  ? 185 ILE C O     1 
ATOM   8499  C  CB    . ILE C  1 185 ? 37.897  28.054   26.633  1.00 69.55  ? 185 ILE C CB    1 
ATOM   8500  C  CG1   . ILE C  1 185 ? 37.483  27.568   28.032  1.00 66.41  ? 185 ILE C CG1   1 
ATOM   8501  C  CG2   . ILE C  1 185 ? 39.400  28.311   26.559  1.00 70.03  ? 185 ILE C CG2   1 
ATOM   8502  C  CD1   . ILE C  1 185 ? 38.013  26.211   28.405  1.00 66.22  ? 185 ILE C CD1   1 
ATOM   8503  N  N     . LEU C  1 186 ? 37.179  29.209   23.822  1.00 74.21  ? 186 LEU C N     1 
ATOM   8504  C  CA    . LEU C  1 186 ? 37.461  29.663   22.460  1.00 77.02  ? 186 LEU C CA    1 
ATOM   8505  C  C     . LEU C  1 186 ? 36.955  31.088   22.136  1.00 78.35  ? 186 LEU C C     1 
ATOM   8506  O  O     . LEU C  1 186 ? 37.465  31.739   21.224  1.00 81.10  ? 186 LEU C O     1 
ATOM   8507  C  CB    . LEU C  1 186 ? 36.891  28.665   21.443  1.00 77.77  ? 186 LEU C CB    1 
ATOM   8508  C  CG    . LEU C  1 186 ? 37.414  27.226   21.358  1.00 77.09  ? 186 LEU C CG    1 
ATOM   8509  C  CD1   . LEU C  1 186 ? 36.883  26.553   20.100  1.00 78.30  ? 186 LEU C CD1   1 
ATOM   8510  C  CD2   . LEU C  1 186 ? 38.930  27.156   21.388  1.00 77.90  ? 186 LEU C CD2   1 
ATOM   8511  N  N     . ASN C  1 187 ? 35.956  31.563   22.874  1.00 76.53  ? 187 ASN C N     1 
ATOM   8512  C  CA    . ASN C  1 187 ? 35.364  32.867   22.615  1.00 77.44  ? 187 ASN C CA    1 
ATOM   8513  C  C     . ASN C  1 187 ? 36.134  34.001   23.260  1.00 78.15  ? 187 ASN C C     1 
ATOM   8514  O  O     . ASN C  1 187 ? 36.118  35.124   22.754  1.00 80.50  ? 187 ASN C O     1 
ATOM   8515  C  CB    . ASN C  1 187 ? 33.918  32.909   23.098  1.00 75.63  ? 187 ASN C CB    1 
ATOM   8516  C  CG    . ASN C  1 187 ? 33.138  34.068   22.513  1.00 76.49  ? 187 ASN C CG    1 
ATOM   8517  O  OD1   . ASN C  1 187 ? 33.232  34.357   21.325  1.00 78.18  ? 187 ASN C OD1   1 
ATOM   8518  N  ND2   . ASN C  1 187 ? 32.348  34.727   23.346  1.00 74.80  ? 187 ASN C ND2   1 
ATOM   8519  N  N     . GLN C  1 188 ? 36.808  33.712   24.370  1.00 76.54  ? 188 GLN C N     1 
ATOM   8520  C  CA    . GLN C  1 188 ? 37.488  34.752   25.155  1.00 76.88  ? 188 GLN C CA    1 
ATOM   8521  C  C     . GLN C  1 188 ? 38.688  35.369   24.431  1.00 79.81  ? 188 GLN C C     1 
ATOM   8522  O  O     . GLN C  1 188 ? 39.229  36.382   24.872  1.00 80.67  ? 188 GLN C O     1 
ATOM   8523  C  CB    . GLN C  1 188 ? 37.908  34.213   26.528  1.00 74.54  ? 188 GLN C CB    1 
ATOM   8524  C  CG    . GLN C  1 188 ? 36.789  33.535   27.324  1.00 71.53  ? 188 GLN C CG    1 
ATOM   8525  C  CD    . GLN C  1 188 ? 35.537  34.375   27.412  1.00 70.53  ? 188 GLN C CD    1 
ATOM   8526  O  OE1   . GLN C  1 188 ? 35.593  35.556   27.737  1.00 72.56  ? 188 GLN C OE1   1 
ATOM   8527  N  NE2   . GLN C  1 188 ? 34.398  33.766   27.131  1.00 69.10  ? 188 GLN C NE2   1 
ATOM   8528  N  N     . LYS C  1 189 ? 39.090  34.753   23.319  1.00 81.63  ? 189 LYS C N     1 
ATOM   8529  C  CA    . LYS C  1 189 ? 40.111  35.302   22.436  1.00 84.75  ? 189 LYS C CA    1 
ATOM   8530  C  C     . LYS C  1 189 ? 39.786  36.755   22.081  1.00 86.74  ? 189 LYS C C     1 
ATOM   8531  O  O     . LYS C  1 189 ? 40.683  37.593   21.977  1.00 88.62  ? 189 LYS C O     1 
ATOM   8532  C  CB    . LYS C  1 189 ? 40.220  34.460   21.164  1.00 86.40  ? 189 LYS C CB    1 
ATOM   8533  C  CG    . LYS C  1 189 ? 41.654  34.140   20.774  1.00 89.13  ? 189 LYS C CG    1 
ATOM   8534  C  CD    . LYS C  1 189 ? 41.837  34.043   19.266  1.00 93.71  ? 189 LYS C CD    1 
ATOM   8535  C  CE    . LYS C  1 189 ? 43.320  34.115   18.890  1.00 97.18  ? 189 LYS C CE    1 
ATOM   8536  N  NZ    . LYS C  1 189 ? 43.587  34.740   17.542  1.00 101.11 ? 189 LYS C NZ    1 
ATOM   8537  N  N     . ARG C  1 190 ? 38.496  37.049   21.930  1.00 86.48  ? 190 ARG C N     1 
ATOM   8538  C  CA    . ARG C  1 190 ? 38.020  38.401   21.618  1.00 88.60  ? 190 ARG C CA    1 
ATOM   8539  C  C     . ARG C  1 190 ? 38.567  39.468   22.554  1.00 88.52  ? 190 ARG C C     1 
ATOM   8540  O  O     . ARG C  1 190 ? 38.766  40.610   22.136  1.00 91.20  ? 190 ARG C O     1 
ATOM   8541  C  CB    . ARG C  1 190 ? 36.491  38.474   21.650  1.00 87.74  ? 190 ARG C CB    1 
ATOM   8542  C  CG    . ARG C  1 190 ? 35.788  37.457   20.795  1.00 88.62  ? 190 ARG C CG    1 
ATOM   8543  C  CD    . ARG C  1 190 ? 34.320  37.802   20.619  1.00 90.35  ? 190 ARG C CD    1 
ATOM   8544  N  NE    . ARG C  1 190 ? 33.591  36.680   20.034  1.00 91.61  ? 190 ARG C NE    1 
ATOM   8545  C  CZ    . ARG C  1 190 ? 33.678  36.283   18.760  1.00 94.68  ? 190 ARG C CZ    1 
ATOM   8546  N  NH1   . ARG C  1 190 ? 34.463  36.908   17.883  1.00 96.64  ? 190 ARG C NH1   1 
ATOM   8547  N  NH2   . ARG C  1 190 ? 32.966  35.240   18.359  1.00 94.90  ? 190 ARG C NH2   1 
ATOM   8548  N  N     . TRP C  1 191 ? 38.795  39.104   23.813  1.00 85.80  ? 191 TRP C N     1 
ATOM   8549  C  CA    . TRP C  1 191 ? 39.217  40.074   24.817  1.00 85.70  ? 191 TRP C CA    1 
ATOM   8550  C  C     . TRP C  1 191 ? 40.610  39.816   25.351  1.00 85.97  ? 191 TRP C C     1 
ATOM   8551  O  O     . TRP C  1 191 ? 41.372  40.758   25.594  1.00 87.79  ? 191 TRP C O     1 
ATOM   8552  C  CB    . TRP C  1 191 ? 38.211  40.134   25.956  1.00 82.98  ? 191 TRP C CB    1 
ATOM   8553  C  CG    . TRP C  1 191 ? 36.858  40.468   25.464  1.00 83.00  ? 191 TRP C CG    1 
ATOM   8554  C  CD1   . TRP C  1 191 ? 36.369  41.710   25.196  1.00 84.23  ? 191 TRP C CD1   1 
ATOM   8555  C  CD2   . TRP C  1 191 ? 35.815  39.543   25.145  1.00 81.49  ? 191 TRP C CD2   1 
ATOM   8556  N  NE1   . TRP C  1 191 ? 35.079  41.621   24.739  1.00 84.03  ? 191 TRP C NE1   1 
ATOM   8557  C  CE2   . TRP C  1 191 ? 34.712  40.301   24.699  1.00 82.16  ? 191 TRP C CE2   1 
ATOM   8558  C  CE3   . TRP C  1 191 ? 35.703  38.145   25.197  1.00 79.50  ? 191 TRP C CE3   1 
ATOM   8559  C  CZ2   . TRP C  1 191 ? 33.509  39.712   24.305  1.00 81.54  ? 191 TRP C CZ2   1 
ATOM   8560  C  CZ3   . TRP C  1 191 ? 34.507  37.559   24.804  1.00 78.79  ? 191 TRP C CZ3   1 
ATOM   8561  C  CH2   . TRP C  1 191 ? 33.426  38.344   24.362  1.00 79.97  ? 191 TRP C CH2   1 
ATOM   8562  N  N     . ASN C  1 192 ? 40.941  38.541   25.516  1.00 84.54  ? 192 ASN C N     1 
ATOM   8563  C  CA    . ASN C  1 192 ? 42.253  38.138   26.005  1.00 84.95  ? 192 ASN C CA    1 
ATOM   8564  C  C     . ASN C  1 192 ? 43.429  38.667   25.177  1.00 88.71  ? 192 ASN C C     1 
ATOM   8565  O  O     . ASN C  1 192 ? 44.544  38.777   25.687  1.00 89.64  ? 192 ASN C O     1 
ATOM   8566  C  CB    . ASN C  1 192 ? 42.323  36.615   26.167  1.00 82.78  ? 192 ASN C CB    1 
ATOM   8567  C  CG    . ASN C  1 192 ? 41.535  36.119   27.372  1.00 78.71  ? 192 ASN C CG    1 
ATOM   8568  O  OD1   . ASN C  1 192 ? 41.243  36.879   28.290  1.00 77.41  ? 192 ASN C OD1   1 
ATOM   8569  N  ND2   . ASN C  1 192 ? 41.195  34.841   27.375  1.00 75.92  ? 192 ASN C ND2   1 
ATOM   8570  N  N     . ASN C  1 193 ? 43.173  39.018   23.916  1.00 91.37  ? 193 ASN C N     1 
ATOM   8571  C  CA    . ASN C  1 193 ? 44.212  39.561   23.034  1.00 95.26  ? 193 ASN C CA    1 
ATOM   8572  C  C     . ASN C  1 193 ? 44.454  41.050   23.199  1.00 97.36  ? 193 ASN C C     1 
ATOM   8573  O  O     . ASN C  1 193 ? 45.418  41.582   22.658  1.00 100.24 ? 193 ASN C O     1 
ATOM   8574  C  CB    . ASN C  1 193 ? 43.898  39.259   21.566  1.00 97.31  ? 193 ASN C CB    1 
ATOM   8575  C  CG    . ASN C  1 193 ? 44.376  37.885   21.132  1.00 97.51  ? 193 ASN C CG    1 
ATOM   8576  O  OD1   . ASN C  1 193 ? 45.355  37.353   21.664  1.00 97.63  ? 193 ASN C OD1   1 
ATOM   8577  N  ND2   . ASN C  1 193 ? 43.692  37.308   20.149  1.00 98.34  ? 193 ASN C ND2   1 
ATOM   8578  N  N     . GLY C  1 194 ? 43.571  41.718   23.935  1.00 96.26  ? 194 GLY C N     1 
ATOM   8579  C  CA    . GLY C  1 194 ? 43.669  43.159   24.140  1.00 98.52  ? 194 GLY C CA    1 
ATOM   8580  C  C     . GLY C  1 194 ? 44.548  43.561   25.310  1.00 98.65  ? 194 GLY C C     1 
ATOM   8581  O  O     . GLY C  1 194 ? 45.041  42.708   26.059  1.00 96.83  ? 194 GLY C O     1 
ATOM   8582  N  N     . SER C  1 195 ? 44.737  44.871   25.456  1.00 101.11 ? 195 SER C N     1 
ATOM   8583  C  CA    . SER C  1 195 ? 45.533  45.450   26.539  1.00 101.91 ? 195 SER C CA    1 
ATOM   8584  C  C     . SER C  1 195 ? 44.782  45.367   27.864  1.00 99.47  ? 195 SER C C     1 
ATOM   8585  O  O     . SER C  1 195 ? 45.392  45.175   28.920  1.00 98.82  ? 195 SER C O     1 
ATOM   8586  C  CB    . SER C  1 195 ? 45.869  46.915   26.232  1.00 105.17 ? 195 SER C CB    1 
ATOM   8587  O  OG    . SER C  1 195 ? 44.732  47.751   26.397  1.00 104.16 ? 195 SER C OG    1 
ATOM   8588  N  N     . ASP C  1 196 ? 43.455  45.490   27.776  1.00 98.59  ? 196 ASP C N     1 
ATOM   8589  C  CA    . ASP C  1 196 ? 42.542  45.671   28.917  1.00 96.59  ? 196 ASP C CA    1 
ATOM   8590  C  C     . ASP C  1 196 ? 42.353  44.425   29.782  1.00 93.40  ? 196 ASP C C     1 
ATOM   8591  O  O     . ASP C  1 196 ? 41.778  43.433   29.329  1.00 91.99  ? 196 ASP C O     1 
ATOM   8592  C  CB    . ASP C  1 196 ? 41.181  46.119   28.389  1.00 96.53  ? 196 ASP C CB    1 
ATOM   8593  C  CG    . ASP C  1 196 ? 40.359  46.830   29.430  1.00 96.44  ? 196 ASP C CG    1 
ATOM   8594  O  OD1   . ASP C  1 196 ? 40.125  46.256   30.518  1.00 94.72  ? 196 ASP C OD1   1 
ATOM   8595  O  OD2   . ASP C  1 196 ? 39.936  47.972   29.150  1.00 99.87  ? 196 ASP C OD2   1 
ATOM   8596  N  N     . GLU C  1 197 ? 42.789  44.499   31.039  1.00 92.61  ? 197 GLU C N     1 
ATOM   8597  C  CA    . GLU C  1 197 ? 42.802  43.320   31.924  1.00 89.75  ? 197 GLU C CA    1 
ATOM   8598  C  C     . GLU C  1 197 ? 41.446  42.962   32.557  1.00 86.71  ? 197 GLU C C     1 
ATOM   8599  O  O     . GLU C  1 197 ? 41.139  41.775   32.747  1.00 84.46  ? 197 GLU C O     1 
ATOM   8600  C  CB    . GLU C  1 197 ? 43.890  43.466   33.006  1.00 90.55  ? 197 GLU C CB    1 
ATOM   8601  C  CG    . GLU C  1 197 ? 44.514  42.139   33.491  1.00 88.96  ? 197 GLU C CG    1 
ATOM   8602  C  CD    . GLU C  1 197 ? 45.326  41.410   32.412  1.00 90.62  ? 197 GLU C CD    1 
ATOM   8603  O  OE1   . GLU C  1 197 ? 45.021  40.224   32.167  1.00 88.66  ? 197 GLU C OE1   1 
ATOM   8604  O  OE2   . GLU C  1 197 ? 46.256  42.010   31.808  1.00 93.07  ? 197 GLU C OE2   1 
ATOM   8605  N  N     . SER C  1 198 ? 40.645  43.981   32.879  1.00 86.61  ? 198 SER C N     1 
ATOM   8606  C  CA    . SER C  1 198 ? 39.349  43.780   33.548  1.00 83.83  ? 198 SER C CA    1 
ATOM   8607  C  C     . SER C  1 198 ? 38.384  42.938   32.711  1.00 81.95  ? 198 SER C C     1 
ATOM   8608  O  O     . SER C  1 198 ? 37.488  42.278   33.246  1.00 79.51  ? 198 SER C O     1 
ATOM   8609  C  CB    . SER C  1 198 ? 38.695  45.126   33.879  1.00 85.12  ? 198 SER C CB    1 
ATOM   8610  O  OG    . SER C  1 198 ? 37.631  45.420   32.984  1.00 85.32  ? 198 SER C OG    1 
ATOM   8611  N  N     . LYS C  1 199 ? 38.579  42.988   31.395  1.00 82.98  ? 199 LYS C N     1 
ATOM   8612  C  CA    . LYS C  1 199 ? 37.701  42.328   30.439  1.00 81.79  ? 199 LYS C CA    1 
ATOM   8613  C  C     . LYS C  1 199 ? 38.246  40.943   30.107  1.00 80.23  ? 199 LYS C C     1 
ATOM   8614  O  O     . LYS C  1 199 ? 37.479  40.029   29.804  1.00 78.69  ? 199 LYS C O     1 
ATOM   8615  C  CB    . LYS C  1 199 ? 37.523  43.204   29.188  1.00 84.51  ? 199 LYS C CB    1 
ATOM   8616  C  CG    . LYS C  1 199 ? 36.966  44.618   29.507  1.00 86.06  ? 199 LYS C CG    1 
ATOM   8617  C  CD    . LYS C  1 199 ? 36.895  45.558   28.303  1.00 88.99  ? 199 LYS C CD    1 
ATOM   8618  C  CE    . LYS C  1 199 ? 36.695  47.018   28.763  1.00 91.51  ? 199 LYS C CE    1 
ATOM   8619  N  NZ    . LYS C  1 199 ? 36.511  48.032   27.661  1.00 93.36  ? 199 LYS C NZ    1 
ATOM   8620  N  N     . LYS C  1 200 ? 39.567  40.793   30.206  1.00 80.53  ? 200 LYS C N     1 
ATOM   8621  C  CA    . LYS C  1 200 ? 40.247  39.513   29.984  1.00 79.26  ? 200 LYS C CA    1 
ATOM   8622  C  C     . LYS C  1 200 ? 39.764  38.442   30.948  1.00 75.90  ? 200 LYS C C     1 
ATOM   8623  O  O     . LYS C  1 200 ? 39.543  38.726   32.128  1.00 74.91  ? 200 LYS C O     1 
ATOM   8624  C  CB    . LYS C  1 200 ? 41.767  39.679   30.105  1.00 80.95  ? 200 LYS C CB    1 
ATOM   8625  C  CG    . LYS C  1 200 ? 42.417  40.208   28.849  1.00 84.38  ? 200 LYS C CG    1 
ATOM   8626  C  CD    . LYS C  1 200 ? 43.744  40.897   29.116  1.00 88.42  ? 200 LYS C CD    1 
ATOM   8627  C  CE    . LYS C  1 200 ? 44.938  40.089   28.622  1.00 90.38  ? 200 LYS C CE    1 
ATOM   8628  N  NZ    . LYS C  1 200 ? 46.011  40.997   28.099  1.00 93.48  ? 200 LYS C NZ    1 
ATOM   8629  N  N     . LEU C  1 201 ? 39.599  37.221   30.431  1.00 74.31  ? 201 LEU C N     1 
ATOM   8630  C  CA    . LEU C  1 201 ? 39.111  36.071   31.211  1.00 71.09  ? 201 LEU C CA    1 
ATOM   8631  C  C     . LEU C  1 201 ? 39.963  34.818   31.003  1.00 70.48  ? 201 LEU C C     1 
ATOM   8632  O  O     . LEU C  1 201 ? 39.885  34.150   29.972  1.00 70.77  ? 201 LEU C O     1 
ATOM   8633  C  CB    . LEU C  1 201 ? 37.640  35.771   30.910  1.00 69.61  ? 201 LEU C CB    1 
ATOM   8634  C  CG    . LEU C  1 201 ? 37.018  34.619   31.701  1.00 66.83  ? 201 LEU C CG    1 
ATOM   8635  C  CD1   . LEU C  1 201 ? 36.560  35.065   33.067  1.00 65.16  ? 201 LEU C CD1   1 
ATOM   8636  C  CD2   . LEU C  1 201 ? 35.856  34.038   30.941  1.00 66.83  ? 201 LEU C CD2   1 
ATOM   8637  N  N     . TYR C  1 202 ? 40.759  34.506   32.015  1.00 69.64  ? 202 TYR C N     1 
ATOM   8638  C  CA    . TYR C  1 202 ? 41.685  33.394   31.982  1.00 69.67  ? 202 TYR C CA    1 
ATOM   8639  C  C     . TYR C  1 202 ? 40.983  32.052   32.217  1.00 67.52  ? 202 TYR C C     1 
ATOM   8640  O  O     . TYR C  1 202 ? 40.047  31.964   33.010  1.00 65.83  ? 202 TYR C O     1 
ATOM   8641  C  CB    . TYR C  1 202 ? 42.785  33.652   33.007  1.00 70.18  ? 202 TYR C CB    1 
ATOM   8642  C  CG    . TYR C  1 202 ? 43.649  34.862   32.662  1.00 73.25  ? 202 TYR C CG    1 
ATOM   8643  C  CD1   . TYR C  1 202 ? 44.699  34.749   31.748  1.00 74.66  ? 202 TYR C CD1   1 
ATOM   8644  C  CD2   . TYR C  1 202 ? 43.414  36.115   33.243  1.00 73.66  ? 202 TYR C CD2   1 
ATOM   8645  C  CE1   . TYR C  1 202 ? 45.491  35.835   31.428  1.00 77.53  ? 202 TYR C CE1   1 
ATOM   8646  C  CE2   . TYR C  1 202 ? 44.207  37.214   32.928  1.00 75.76  ? 202 TYR C CE2   1 
ATOM   8647  C  CZ    . TYR C  1 202 ? 45.246  37.067   32.015  1.00 78.14  ? 202 TYR C CZ    1 
ATOM   8648  O  OH    . TYR C  1 202 ? 46.053  38.138   31.675  1.00 80.35  ? 202 TYR C OH    1 
ATOM   8649  N  N     . CYS C  1 203 ? 41.419  31.008   31.522  1.00 67.84  ? 203 CYS C N     1 
ATOM   8650  C  CA    . CYS C  1 203 ? 40.662  29.750   31.529  1.00 66.31  ? 203 CYS C CA    1 
ATOM   8651  C  C     . CYS C  1 203 ? 41.407  28.558   32.118  1.00 65.51  ? 203 CYS C C     1 
ATOM   8652  O  O     . CYS C  1 203 ? 42.558  28.295   31.756  1.00 67.06  ? 203 CYS C O     1 
ATOM   8653  C  CB    . CYS C  1 203 ? 40.177  29.407   30.119  1.00 67.29  ? 203 CYS C CB    1 
ATOM   8654  S  SG    . CYS C  1 203 ? 38.988  30.592   29.431  1.00 69.18  ? 203 CYS C SG    1 
ATOM   8655  N  N     . VAL C  1 204 ? 40.741  27.840   33.023  1.00 63.18  ? 204 VAL C N     1 
ATOM   8656  C  CA    . VAL C  1 204 ? 41.276  26.596   33.582  1.00 62.25  ? 204 VAL C CA    1 
ATOM   8657  C  C     . VAL C  1 204 ? 40.355  25.436   33.221  1.00 61.20  ? 204 VAL C C     1 
ATOM   8658  O  O     . VAL C  1 204 ? 39.177  25.421   33.597  1.00 60.22  ? 204 VAL C O     1 
ATOM   8659  C  CB    . VAL C  1 204 ? 41.418  26.656   35.118  1.00 60.95  ? 204 VAL C CB    1 
ATOM   8660  C  CG1   . VAL C  1 204 ? 42.093  25.386   35.647  1.00 59.87  ? 204 VAL C CG1   1 
ATOM   8661  C  CG2   . VAL C  1 204 ? 42.187  27.886   35.542  1.00 62.45  ? 204 VAL C CG2   1 
ATOM   8662  N  N     . TYR C  1 205 ? 40.871  24.460   32.493  1.00 61.78  ? 205 TYR C N     1 
ATOM   8663  C  CA    . TYR C  1 205 ? 40.044  23.316   32.179  1.00 61.06  ? 205 TYR C CA    1 
ATOM   8664  C  C     . TYR C  1 205 ? 40.521  22.100   32.967  1.00 60.51  ? 205 TYR C C     1 
ATOM   8665  O  O     . TYR C  1 205 ? 41.618  21.587   32.725  1.00 61.96  ? 205 TYR C O     1 
ATOM   8666  C  CB    . TYR C  1 205 ? 40.019  23.058   30.674  1.00 62.57  ? 205 TYR C CB    1 
ATOM   8667  C  CG    . TYR C  1 205 ? 39.237  21.827   30.284  1.00 61.96  ? 205 TYR C CG    1 
ATOM   8668  C  CD1   . TYR C  1 205 ? 39.876  20.595   30.136  1.00 62.67  ? 205 TYR C CD1   1 
ATOM   8669  C  CD2   . TYR C  1 205 ? 37.858  21.891   30.057  1.00 60.77  ? 205 TYR C CD2   1 
ATOM   8670  C  CE1   . TYR C  1 205 ? 39.161  19.448   29.776  1.00 63.28  ? 205 TYR C CE1   1 
ATOM   8671  C  CE2   . TYR C  1 205 ? 37.128  20.750   29.696  1.00 60.58  ? 205 TYR C CE2   1 
ATOM   8672  C  CZ    . TYR C  1 205 ? 37.788  19.533   29.559  1.00 61.91  ? 205 TYR C CZ    1 
ATOM   8673  O  OH    . TYR C  1 205 ? 37.099  18.399   29.204  1.00 61.24  ? 205 TYR C OH    1 
ATOM   8674  N  N     . VAL C  1 206 ? 39.705  21.655   33.926  1.00 58.73  ? 206 VAL C N     1 
ATOM   8675  C  CA    . VAL C  1 206 ? 40.070  20.509   34.766  1.00 57.67  ? 206 VAL C CA    1 
ATOM   8676  C  C     . VAL C  1 206 ? 39.522  19.232   34.169  1.00 57.56  ? 206 VAL C C     1 
ATOM   8677  O  O     . VAL C  1 206 ? 38.308  19.059   34.058  1.00 56.57  ? 206 VAL C O     1 
ATOM   8678  C  CB    . VAL C  1 206 ? 39.547  20.617   36.210  1.00 55.88  ? 206 VAL C CB    1 
ATOM   8679  C  CG1   . VAL C  1 206 ? 40.358  19.691   37.124  1.00 55.17  ? 206 VAL C CG1   1 
ATOM   8680  C  CG2   . VAL C  1 206 ? 39.589  22.041   36.704  1.00 55.42  ? 206 VAL C CG2   1 
ATOM   8681  N  N     . ALA C  1 207 ? 40.427  18.341   33.790  1.00 58.90  ? 207 ALA C N     1 
ATOM   8682  C  CA    . ALA C  1 207 ? 40.058  17.046   33.236  1.00 59.21  ? 207 ALA C CA    1 
ATOM   8683  C  C     . ALA C  1 207 ? 40.138  15.993   34.328  1.00 58.34  ? 207 ALA C C     1 
ATOM   8684  O  O     . ALA C  1 207 ? 41.215  15.784   34.914  1.00 59.23  ? 207 ALA C O     1 
ATOM   8685  C  CB    . ALA C  1 207 ? 40.982  16.693   32.079  1.00 61.20  ? 207 ALA C CB    1 
ATOM   8686  N  N     . VAL C  1 208 ? 39.010  15.347   34.620  1.00 56.78  ? 208 VAL C N     1 
ATOM   8687  C  CA    . VAL C  1 208 ? 38.980  14.331   35.672  1.00 55.90  ? 208 VAL C CA    1 
ATOM   8688  C  C     . VAL C  1 208 ? 38.391  13.042   35.143  1.00 56.14  ? 208 VAL C C     1 
ATOM   8689  O  O     . VAL C  1 208 ? 37.215  12.991   34.798  1.00 55.99  ? 208 VAL C O     1 
ATOM   8690  C  CB    . VAL C  1 208 ? 38.131  14.760   36.892  1.00 54.17  ? 208 VAL C CB    1 
ATOM   8691  C  CG1   . VAL C  1 208 ? 38.362  13.801   38.047  1.00 53.21  ? 208 VAL C CG1   1 
ATOM   8692  C  CG2   . VAL C  1 208 ? 38.448  16.176   37.318  1.00 54.27  ? 208 VAL C CG2   1 
ATOM   8693  N  N     . GLY C  1 209 ? 39.195  11.991   35.087  1.00 57.08  ? 209 GLY C N     1 
ATOM   8694  C  CA    . GLY C  1 209 ? 38.688  10.692   34.658  1.00 57.03  ? 209 GLY C CA    1 
ATOM   8695  C  C     . GLY C  1 209 ? 38.580  10.538   33.155  1.00 58.50  ? 209 GLY C C     1 
ATOM   8696  O  O     . GLY C  1 209 ? 38.332  9.434    32.670  1.00 59.60  ? 209 GLY C O     1 
ATOM   8697  N  N     . GLN C  1 210 ? 38.755  11.639   32.420  1.00 58.95  ? 210 GLN C N     1 
ATOM   8698  C  CA    . GLN C  1 210 ? 38.955  11.613   30.966  1.00 60.38  ? 210 GLN C CA    1 
ATOM   8699  C  C     . GLN C  1 210 ? 40.234  10.841   30.693  1.00 61.56  ? 210 GLN C C     1 
ATOM   8700  O  O     . GLN C  1 210 ? 41.090  10.757   31.566  1.00 61.43  ? 210 GLN C O     1 
ATOM   8701  C  CB    . GLN C  1 210 ? 39.129  13.035   30.414  1.00 61.23  ? 210 GLN C CB    1 
ATOM   8702  C  CG    . GLN C  1 210 ? 38.018  14.034   30.745  1.00 60.66  ? 210 GLN C CG    1 
ATOM   8703  C  CD    . GLN C  1 210 ? 38.089  15.285   29.885  1.00 63.38  ? 210 GLN C CD    1 
ATOM   8704  O  OE1   . GLN C  1 210 ? 38.048  15.223   28.657  1.00 65.13  ? 210 GLN C OE1   1 
ATOM   8705  N  NE2   . GLN C  1 210 ? 38.187  16.432   30.531  1.00 64.40  ? 210 GLN C NE2   1 
ATOM   8706  N  N     . LYS C  1 211 ? 40.370  10.274   29.498  1.00 62.89  ? 211 LYS C N     1 
ATOM   8707  C  CA    . LYS C  1 211 ? 41.586  9.552    29.137  1.00 64.41  ? 211 LYS C CA    1 
ATOM   8708  C  C     . LYS C  1 211 ? 42.578  10.509   28.489  1.00 66.13  ? 211 LYS C C     1 
ATOM   8709  O  O     . LYS C  1 211 ? 42.173  11.517   27.910  1.00 66.51  ? 211 LYS C O     1 
ATOM   8710  C  CB    . LYS C  1 211 ? 41.265  8.392    28.197  1.00 65.92  ? 211 LYS C CB    1 
ATOM   8711  C  CG    . LYS C  1 211 ? 40.777  8.809    26.827  1.00 67.51  ? 211 LYS C CG    1 
ATOM   8712  C  CD    . LYS C  1 211 ? 40.319  7.631    26.005  1.00 69.51  ? 211 LYS C CD    1 
ATOM   8713  C  CE    . LYS C  1 211 ? 39.852  8.123    24.654  1.00 72.53  ? 211 LYS C CE    1 
ATOM   8714  N  NZ    . LYS C  1 211 ? 39.053  7.114    23.927  1.00 75.25  ? 211 LYS C NZ    1 
ATOM   8715  N  N     . ARG C  1 212 ? 43.870  10.189   28.572  1.00 67.35  ? 212 ARG C N     1 
ATOM   8716  C  CA    . ARG C  1 212 ? 44.933  11.083   28.102  1.00 68.69  ? 212 ARG C CA    1 
ATOM   8717  C  C     . ARG C  1 212 ? 44.761  11.577   26.666  1.00 70.49  ? 212 ARG C C     1 
ATOM   8718  O  O     . ARG C  1 212 ? 44.919  12.769   26.393  1.00 70.73  ? 212 ARG C O     1 
ATOM   8719  C  CB    . ARG C  1 212 ? 46.309  10.455   28.325  1.00 70.25  ? 212 ARG C CB    1 
ATOM   8720  C  CG    . ARG C  1 212 ? 46.812  10.615   29.757  1.00 69.17  ? 212 ARG C CG    1 
ATOM   8721  C  CD    . ARG C  1 212 ? 47.954  9.662    30.110  1.00 70.81  ? 212 ARG C CD    1 
ATOM   8722  N  NE    . ARG C  1 212 ? 48.403  9.868    31.489  1.00 69.63  ? 212 ARG C NE    1 
ATOM   8723  C  CZ    . ARG C  1 212 ? 49.269  9.090    32.139  1.00 70.76  ? 212 ARG C CZ    1 
ATOM   8724  N  NH1   . ARG C  1 212 ? 49.803  8.016    31.557  1.00 71.57  ? 212 ARG C NH1   1 
ATOM   8725  N  NH2   . ARG C  1 212 ? 49.596  9.388    33.391  1.00 69.63  ? 212 ARG C NH2   1 
ATOM   8726  N  N     . SER C  1 213 ? 44.393  10.672   25.767  1.00 71.97  ? 213 SER C N     1 
ATOM   8727  C  CA    . SER C  1 213 ? 44.210  11.017   24.354  1.00 74.76  ? 213 SER C CA    1 
ATOM   8728  C  C     . SER C  1 213 ? 43.108  12.053   24.091  1.00 73.89  ? 213 SER C C     1 
ATOM   8729  O  O     . SER C  1 213 ? 43.148  12.749   23.078  1.00 76.09  ? 213 SER C O     1 
ATOM   8730  C  CB    . SER C  1 213 ? 43.946  9.767    23.511  1.00 76.43  ? 213 SER C CB    1 
ATOM   8731  O  OG    . SER C  1 213 ? 42.602  9.332    23.641  1.00 75.46  ? 213 SER C OG    1 
ATOM   8732  N  N     . THR C  1 214 ? 42.126  12.139   24.979  1.00 71.20  ? 214 THR C N     1 
ATOM   8733  C  CA    . THR C  1 214 ? 41.050  13.116   24.835  1.00 70.33  ? 214 THR C CA    1 
ATOM   8734  C  C     . THR C  1 214 ? 41.514  14.510   25.294  1.00 70.20  ? 214 THR C C     1 
ATOM   8735  O  O     . THR C  1 214 ? 41.219  15.528   24.641  1.00 71.03  ? 214 THR C O     1 
ATOM   8736  C  CB    . THR C  1 214 ? 39.784  12.654   25.588  1.00 67.81  ? 214 THR C CB    1 
ATOM   8737  O  OG1   . THR C  1 214 ? 39.340  11.415   25.027  1.00 69.15  ? 214 THR C OG1   1 
ATOM   8738  C  CG2   . THR C  1 214 ? 38.663  13.669   25.479  1.00 66.17  ? 214 THR C CG2   1 
ATOM   8739  N  N     . VAL C  1 215 ? 42.248  14.543   26.408  1.00 69.27  ? 215 VAL C N     1 
ATOM   8740  C  CA    . VAL C  1 215 ? 42.840  15.777   26.930  1.00 69.02  ? 215 VAL C CA    1 
ATOM   8741  C  C     . VAL C  1 215 ? 43.856  16.306   25.932  1.00 71.92  ? 215 VAL C C     1 
ATOM   8742  O  O     . VAL C  1 215 ? 43.947  17.513   25.716  1.00 72.43  ? 215 VAL C O     1 
ATOM   8743  C  CB    . VAL C  1 215 ? 43.545  15.555   28.286  1.00 67.86  ? 215 VAL C CB    1 
ATOM   8744  C  CG1   . VAL C  1 215 ? 43.712  16.879   29.021  1.00 66.74  ? 215 VAL C CG1   1 
ATOM   8745  C  CG2   . VAL C  1 215 ? 42.767  14.553   29.143  1.00 65.42  ? 215 VAL C CG2   1 
ATOM   8746  N  N     . ALA C  1 216 ? 44.612  15.392   25.324  1.00 73.87  ? 216 ALA C N     1 
ATOM   8747  C  CA    . ALA C  1 216 ? 45.562  15.754   24.284  1.00 77.00  ? 216 ALA C CA    1 
ATOM   8748  C  C     . ALA C  1 216 ? 44.805  16.420   23.154  1.00 78.22  ? 216 ALA C C     1 
ATOM   8749  O  O     . ALA C  1 216 ? 45.018  17.587   22.867  1.00 79.16  ? 216 ALA C O     1 
ATOM   8750  C  CB    . ALA C  1 216 ? 46.313  14.525   23.789  1.00 78.77  ? 216 ALA C CB    1 
ATOM   8751  N  N     . GLN C  1 217 ? 43.885  15.675   22.553  1.00 78.71  ? 217 GLN C N     1 
ATOM   8752  C  CA    . GLN C  1 217 ? 43.051  16.164   21.457  1.00 80.43  ? 217 GLN C CA    1 
ATOM   8753  C  C     . GLN C  1 217 ? 42.429  17.533   21.762  1.00 79.16  ? 217 GLN C C     1 
ATOM   8754  O  O     . GLN C  1 217 ? 42.299  18.367   20.864  1.00 80.85  ? 217 GLN C O     1 
ATOM   8755  C  CB    . GLN C  1 217 ? 41.975  15.117   21.108  1.00 80.20  ? 217 GLN C CB    1 
ATOM   8756  C  CG    . GLN C  1 217 ? 41.187  15.373   19.822  1.00 83.60  ? 217 GLN C CG    1 
ATOM   8757  C  CD    . GLN C  1 217 ? 42.012  15.183   18.556  1.00 89.59  ? 217 GLN C CD    1 
ATOM   8758  O  OE1   . GLN C  1 217 ? 42.190  14.054   18.066  1.00 91.46  ? 217 GLN C OE1   1 
ATOM   8759  N  NE2   . GLN C  1 217 ? 42.507  16.296   18.004  1.00 91.38  ? 217 GLN C NE2   1 
ATOM   8760  N  N     . LEU C  1 218 ? 42.070  17.764   23.027  1.00 76.47  ? 218 LEU C N     1 
ATOM   8761  C  CA    . LEU C  1 218 ? 41.512  19.059   23.446  1.00 75.21  ? 218 LEU C CA    1 
ATOM   8762  C  C     . LEU C  1 218 ? 42.526  20.210   23.453  1.00 76.51  ? 218 LEU C C     1 
ATOM   8763  O  O     . LEU C  1 218 ? 42.194  21.295   22.982  1.00 77.58  ? 218 LEU C O     1 
ATOM   8764  C  CB    . LEU C  1 218 ? 40.765  18.969   24.783  1.00 71.87  ? 218 LEU C CB    1 
ATOM   8765  C  CG    . LEU C  1 218 ? 40.109  20.271   25.263  1.00 70.45  ? 218 LEU C CG    1 
ATOM   8766  C  CD1   . LEU C  1 218 ? 38.662  20.081   25.673  1.00 68.46  ? 218 LEU C CD1   1 
ATOM   8767  C  CD2   . LEU C  1 218 ? 40.897  20.893   26.402  1.00 70.14  ? 218 LEU C CD2   1 
ATOM   8768  N  N     . VAL C  1 219 ? 43.738  19.994   23.975  1.00 76.78  ? 219 VAL C N     1 
ATOM   8769  C  CA    . VAL C  1 219 ? 44.764  21.053   23.920  1.00 78.47  ? 219 VAL C CA    1 
ATOM   8770  C  C     . VAL C  1 219 ? 45.163  21.356   22.472  1.00 81.72  ? 219 VAL C C     1 
ATOM   8771  O  O     . VAL C  1 219 ? 45.465  22.498   22.116  1.00 83.13  ? 219 VAL C O     1 
ATOM   8772  C  CB    . VAL C  1 219 ? 46.027  20.791   24.805  1.00 78.25  ? 219 VAL C CB    1 
ATOM   8773  C  CG1   . VAL C  1 219 ? 45.636  20.252   26.153  1.00 75.70  ? 219 VAL C CG1   1 
ATOM   8774  C  CG2   . VAL C  1 219 ? 47.016  19.874   24.129  1.00 81.03  ? 219 VAL C CG2   1 
ATOM   8775  N  N     . GLN C  1 220 ? 45.128  20.325   21.639  1.00 83.08  ? 220 GLN C N     1 
ATOM   8776  C  CA    . GLN C  1 220 ? 45.432  20.471   20.230  1.00 86.58  ? 220 GLN C CA    1 
ATOM   8777  C  C     . GLN C  1 220 ? 44.396  21.366   19.528  1.00 87.02  ? 220 GLN C C     1 
ATOM   8778  O  O     . GLN C  1 220 ? 44.748  22.149   18.648  1.00 89.60  ? 220 GLN C O     1 
ATOM   8779  C  CB    . GLN C  1 220 ? 45.514  19.096   19.572  1.00 87.71  ? 220 GLN C CB    1 
ATOM   8780  C  CG    . GLN C  1 220 ? 46.383  19.057   18.344  1.00 91.91  ? 220 GLN C CG    1 
ATOM   8781  C  CD    . GLN C  1 220 ? 45.729  18.294   17.217  1.00 94.86  ? 220 GLN C CD    1 
ATOM   8782  O  OE1   . GLN C  1 220 ? 46.292  17.324   16.691  1.00 97.20  ? 220 GLN C OE1   1 
ATOM   8783  N  NE2   . GLN C  1 220 ? 44.521  18.721   16.839  1.00 94.23  ? 220 GLN C NE2   1 
ATOM   8784  N  N     . THR C  1 221 ? 43.129  21.250   19.925  1.00 84.75  ? 221 THR C N     1 
ATOM   8785  C  CA    . THR C  1 221 ? 42.071  22.112   19.402  1.00 85.01  ? 221 THR C CA    1 
ATOM   8786  C  C     . THR C  1 221 ? 42.270  23.532   19.918  1.00 85.10  ? 221 THR C C     1 
ATOM   8787  O  O     . THR C  1 221 ? 42.014  24.509   19.202  1.00 86.88  ? 221 THR C O     1 
ATOM   8788  C  CB    . THR C  1 221 ? 40.668  21.570   19.764  1.00 82.45  ? 221 THR C CB    1 
ATOM   8789  O  OG1   . THR C  1 221 ? 40.289  20.580   18.805  1.00 83.96  ? 221 THR C OG1   1 
ATOM   8790  C  CG2   . THR C  1 221 ? 39.615  22.658   19.747  1.00 81.61  ? 221 THR C CG2   1 
ATOM   8791  N  N     . LEU C  1 222 ? 42.750  23.633   21.155  1.00 83.54  ? 222 LEU C N     1 
ATOM   8792  C  CA    . LEU C  1 222 ? 42.967  24.914   21.803  1.00 83.57  ? 222 LEU C CA    1 
ATOM   8793  C  C     . LEU C  1 222 ? 44.091  25.717   21.151  1.00 86.98  ? 222 LEU C C     1 
ATOM   8794  O  O     . LEU C  1 222 ? 43.991  26.939   21.040  1.00 87.83  ? 222 LEU C O     1 
ATOM   8795  C  CB    . LEU C  1 222 ? 43.237  24.721   23.293  1.00 80.97  ? 222 LEU C CB    1 
ATOM   8796  C  CG    . LEU C  1 222 ? 42.036  24.481   24.211  1.00 78.40  ? 222 LEU C CG    1 
ATOM   8797  C  CD1   . LEU C  1 222 ? 42.492  24.375   25.656  1.00 76.95  ? 222 LEU C CD1   1 
ATOM   8798  C  CD2   . LEU C  1 222 ? 40.990  25.586   24.078  1.00 78.25  ? 222 LEU C CD2   1 
ATOM   8799  N  N     . GLU C  1 223 ? 45.149  25.031   20.720  1.00 89.27  ? 223 GLU C N     1 
ATOM   8800  C  CA    . GLU C  1 223 ? 46.273  25.683   20.038  1.00 92.89  ? 223 GLU C CA    1 
ATOM   8801  C  C     . GLU C  1 223 ? 45.894  26.154   18.635  1.00 95.81  ? 223 GLU C C     1 
ATOM   8802  O  O     . GLU C  1 223 ? 46.338  27.225   18.202  1.00 98.21  ? 223 GLU C O     1 
ATOM   8803  C  CB    . GLU C  1 223 ? 47.505  24.768   19.993  1.00 94.30  ? 223 GLU C CB    1 
ATOM   8804  C  CG    . GLU C  1 223 ? 48.454  24.926   21.185  1.00 93.96  ? 223 GLU C CG    1 
ATOM   8805  C  CD    . GLU C  1 223 ? 48.964  23.589   21.730  1.00 93.60  ? 223 GLU C CD    1 
ATOM   8806  O  OE1   . GLU C  1 223 ? 49.849  22.963   21.109  1.00 96.15  ? 223 GLU C OE1   1 
ATOM   8807  O  OE2   . GLU C  1 223 ? 48.480  23.164   22.799  1.00 91.45  ? 223 GLU C OE2   1 
ATOM   8808  N  N     . GLN C  1 224 ? 45.068  25.367   17.939  1.00 96.02  ? 224 GLN C N     1 
ATOM   8809  C  CA    . GLN C  1 224 ? 44.596  25.720   16.592  1.00 98.97  ? 224 GLN C CA    1 
ATOM   8810  C  C     . GLN C  1 224 ? 43.810  27.035   16.560  1.00 99.01  ? 224 GLN C C     1 
ATOM   8811  O  O     . GLN C  1 224 ? 43.898  27.802   15.585  1.00 102.09 ? 224 GLN C O     1 
ATOM   8812  C  CB    . GLN C  1 224 ? 43.806  24.576   15.961  1.00 98.82  ? 224 GLN C CB    1 
ATOM   8813  C  CG    . GLN C  1 224 ? 44.684  23.685   15.095  1.00 102.64 ? 224 GLN C CG    1 
ATOM   8814  C  CD    . GLN C  1 224 ? 44.353  22.201   15.201  1.00 102.99 ? 224 GLN C CD    1 
ATOM   8815  O  OE1   . GLN C  1 224 ? 43.187  21.811   15.304  1.00 102.51 ? 224 GLN C OE1   1 
ATOM   8816  N  NE2   . GLN C  1 224 ? 45.387  21.363   15.164  1.00 103.98 ? 224 GLN C NE2   1 
ATOM   8817  N  N     . HIS C  1 225 ? 43.075  27.301   17.639  1.00 95.73  ? 225 HIS C N     1 
ATOM   8818  C  CA    . HIS C  1 225 ? 42.387  28.575   17.810  1.00 95.19  ? 225 HIS C CA    1 
ATOM   8819  C  C     . HIS C  1 225 ? 43.242  29.623   18.537  1.00 95.27  ? 225 HIS C C     1 
ATOM   8820  O  O     . HIS C  1 225 ? 42.801  30.762   18.732  1.00 95.46  ? 225 HIS C O     1 
ATOM   8821  C  CB    . HIS C  1 225 ? 41.053  28.353   18.522  1.00 92.01  ? 225 HIS C CB    1 
ATOM   8822  C  CG    . HIS C  1 225 ? 40.058  27.601   17.695  1.00 92.44  ? 225 HIS C CG    1 
ATOM   8823  N  ND1   . HIS C  1 225 ? 38.971  28.209   17.103  1.00 92.94  ? 225 HIS C ND1   1 
ATOM   8824  C  CD2   . HIS C  1 225 ? 40.002  26.297   17.336  1.00 92.27  ? 225 HIS C CD2   1 
ATOM   8825  C  CE1   . HIS C  1 225 ? 38.283  27.309   16.423  1.00 93.23  ? 225 HIS C CE1   1 
ATOM   8826  N  NE2   . HIS C  1 225 ? 38.888  26.141   16.549  1.00 93.03  ? 225 HIS C NE2   1 
ATOM   8827  N  N     . ASP C  1 226 ? 44.468  29.243   18.903  1.00 95.46  ? 226 ASP C N     1 
ATOM   8828  C  CA    . ASP C  1 226 ? 45.362  30.085   19.708  1.00 95.47  ? 226 ASP C CA    1 
ATOM   8829  C  C     . ASP C  1 226 ? 44.669  30.490   21.018  1.00 92.01  ? 226 ASP C C     1 
ATOM   8830  O  O     . ASP C  1 226 ? 44.574  31.674   21.348  1.00 92.46  ? 226 ASP C O     1 
ATOM   8831  C  CB    . ASP C  1 226 ? 45.840  31.314   18.905  1.00 98.99  ? 226 ASP C CB    1 
ATOM   8832  C  CG    . ASP C  1 226 ? 47.034  32.034   19.552  1.00 100.72 ? 226 ASP C CG    1 
ATOM   8833  O  OD1   . ASP C  1 226 ? 47.469  31.637   20.655  1.00 100.44 ? 226 ASP C OD1   1 
ATOM   8834  O  OD2   . ASP C  1 226 ? 47.541  33.009   18.955  1.00 104.07 ? 226 ASP C OD2   1 
ATOM   8835  N  N     . ALA C  1 227 ? 44.172  29.490   21.747  1.00 88.72  ? 227 ALA C N     1 
ATOM   8836  C  CA    . ALA C  1 227 ? 43.453  29.702   23.009  1.00 85.12  ? 227 ALA C CA    1 
ATOM   8837  C  C     . ALA C  1 227 ? 44.216  29.141   24.209  1.00 83.11  ? 227 ALA C C     1 
ATOM   8838  O  O     . ALA C  1 227 ? 43.945  29.513   25.360  1.00 81.15  ? 227 ALA C O     1 
ATOM   8839  C  CB    . ALA C  1 227 ? 42.066  29.087   22.936  1.00 83.32  ? 227 ALA C CB    1 
ATOM   8840  N  N     . MET C  1 228 ? 45.162  28.245   23.927  1.00 83.43  ? 228 MET C N     1 
ATOM   8841  C  CA    . MET C  1 228 ? 46.016  27.634   24.942  1.00 81.72  ? 228 MET C CA    1 
ATOM   8842  C  C     . MET C  1 228 ? 46.810  28.674   25.744  1.00 81.79  ? 228 MET C C     1 
ATOM   8843  O  O     . MET C  1 228 ? 46.969  28.527   26.954  1.00 79.76  ? 228 MET C O     1 
ATOM   8844  C  CB    . MET C  1 228 ? 46.936  26.583   24.295  1.00 83.34  ? 228 MET C CB    1 
ATOM   8845  C  CG    . MET C  1 228 ? 47.829  25.785   25.256  1.00 82.72  ? 228 MET C CG    1 
ATOM   8846  S  SD    . MET C  1 228 ? 46.976  24.884   26.575  1.00 80.18  ? 228 MET C SD    1 
ATOM   8847  C  CE    . MET C  1 228 ? 45.807  23.957   25.616  1.00 79.26  ? 228 MET C CE    1 
ATOM   8848  N  N     . LYS C  1 229 ? 47.272  29.733   25.077  1.00 83.97  ? 229 LYS C N     1 
ATOM   8849  C  CA    . LYS C  1 229 ? 48.058  30.792   25.742  1.00 84.64  ? 229 LYS C CA    1 
ATOM   8850  C  C     . LYS C  1 229 ? 47.398  31.430   26.981  1.00 81.88  ? 229 LYS C C     1 
ATOM   8851  O  O     . LYS C  1 229 ? 48.092  31.786   27.934  1.00 81.89  ? 229 LYS C O     1 
ATOM   8852  C  CB    . LYS C  1 229 ? 48.506  31.874   24.747  1.00 87.94  ? 229 LYS C CB    1 
ATOM   8853  C  CG    . LYS C  1 229 ? 47.390  32.714   24.140  1.00 88.23  ? 229 LYS C CG    1 
ATOM   8854  C  CD    . LYS C  1 229 ? 47.970  33.794   23.255  1.00 92.38  ? 229 LYS C CD    1 
ATOM   8855  C  CE    . LYS C  1 229 ? 46.893  34.503   22.459  1.00 93.88  ? 229 LYS C CE    1 
ATOM   8856  N  NZ    . LYS C  1 229 ? 47.504  35.495   21.516  1.00 99.28  ? 229 LYS C NZ    1 
ATOM   8857  N  N     . TYR C  1 230 ? 46.073  31.565   26.966  1.00 79.54  ? 230 TYR C N     1 
ATOM   8858  C  CA    . TYR C  1 230 ? 45.345  32.069   28.134  1.00 76.88  ? 230 TYR C CA    1 
ATOM   8859  C  C     . TYR C  1 230 ? 44.662  30.976   28.980  1.00 73.74  ? 230 TYR C C     1 
ATOM   8860  O  O     . TYR C  1 230 ? 43.777  31.263   29.795  1.00 71.78  ? 230 TYR C O     1 
ATOM   8861  C  CB    . TYR C  1 230 ? 44.351  33.161   27.724  1.00 77.04  ? 230 TYR C CB    1 
ATOM   8862  C  CG    . TYR C  1 230 ? 43.305  32.768   26.700  1.00 76.72  ? 230 TYR C CG    1 
ATOM   8863  C  CD1   . TYR C  1 230 ? 42.276  31.879   27.017  1.00 74.47  ? 230 TYR C CD1   1 
ATOM   8864  C  CD2   . TYR C  1 230 ? 43.315  33.322   25.425  1.00 79.14  ? 230 TYR C CD2   1 
ATOM   8865  C  CE1   . TYR C  1 230 ? 41.299  31.538   26.083  1.00 74.09  ? 230 TYR C CE1   1 
ATOM   8866  C  CE2   . TYR C  1 230 ? 42.338  32.990   24.483  1.00 79.47  ? 230 TYR C CE2   1 
ATOM   8867  C  CZ    . TYR C  1 230 ? 41.335  32.097   24.820  1.00 76.96  ? 230 TYR C CZ    1 
ATOM   8868  O  OH    . TYR C  1 230 ? 40.369  31.768   23.894  1.00 77.44  ? 230 TYR C OH    1 
ATOM   8869  N  N     . SER C  1 231 ? 45.100  29.731   28.790  1.00 73.33  ? 231 SER C N     1 
ATOM   8870  C  CA    . SER C  1 231 ? 44.533  28.567   29.477  1.00 70.54  ? 231 SER C CA    1 
ATOM   8871  C  C     . SER C  1 231 ? 45.514  27.847   30.402  1.00 69.83  ? 231 SER C C     1 
ATOM   8872  O  O     . SER C  1 231 ? 46.723  27.996   30.292  1.00 71.62  ? 231 SER C O     1 
ATOM   8873  C  CB    . SER C  1 231 ? 44.011  27.553   28.454  1.00 70.67  ? 231 SER C CB    1 
ATOM   8874  O  OG    . SER C  1 231 ? 42.936  28.074   27.702  1.00 71.19  ? 231 SER C OG    1 
ATOM   8875  N  N     . ILE C  1 232 ? 44.967  27.053   31.311  1.00 67.28  ? 232 ILE C N     1 
ATOM   8876  C  CA    . ILE C  1 232 ? 45.740  26.078   32.067  1.00 66.62  ? 232 ILE C CA    1 
ATOM   8877  C  C     . ILE C  1 232 ? 44.952  24.781   32.105  1.00 64.69  ? 232 ILE C C     1 
ATOM   8878  O  O     . ILE C  1 232 ? 43.787  24.774   32.509  1.00 63.16  ? 232 ILE C O     1 
ATOM   8879  C  CB    . ILE C  1 232 ? 45.975  26.529   33.513  1.00 65.79  ? 232 ILE C CB    1 
ATOM   8880  C  CG1   . ILE C  1 232 ? 46.787  27.831   33.544  1.00 67.43  ? 232 ILE C CG1   1 
ATOM   8881  C  CG2   . ILE C  1 232 ? 46.653  25.404   34.308  1.00 64.85  ? 232 ILE C CG2   1 
ATOM   8882  C  CD1   . ILE C  1 232 ? 46.426  28.772   34.677  1.00 65.99  ? 232 ILE C CD1   1 
ATOM   8883  N  N     . ILE C  1 233 ? 45.575  23.686   31.686  1.00 65.10  ? 233 ILE C N     1 
ATOM   8884  C  CA    . ILE C  1 233 ? 44.952  22.377   31.816  1.00 63.13  ? 233 ILE C CA    1 
ATOM   8885  C  C     . ILE C  1 233 ? 45.507  21.685   33.057  1.00 62.71  ? 233 ILE C C     1 
ATOM   8886  O  O     . ILE C  1 233 ? 46.717  21.546   33.220  1.00 64.04  ? 233 ILE C O     1 
ATOM   8887  C  CB    . ILE C  1 233 ? 45.160  21.490   30.571  1.00 64.19  ? 233 ILE C CB    1 
ATOM   8888  C  CG1   . ILE C  1 233 ? 44.964  22.275   29.264  1.00 65.20  ? 233 ILE C CG1   1 
ATOM   8889  C  CG2   . ILE C  1 233 ? 44.262  20.270   30.632  1.00 62.57  ? 233 ILE C CG2   1 
ATOM   8890  C  CD1   . ILE C  1 233 ? 43.688  23.112   29.151  1.00 62.97  ? 233 ILE C CD1   1 
ATOM   8891  N  N     . VAL C  1 234 ? 44.604  21.301   33.952  1.00 61.20  ? 234 VAL C N     1 
ATOM   8892  C  CA    . VAL C  1 234 ? 44.939  20.516   35.138  1.00 60.80  ? 234 VAL C CA    1 
ATOM   8893  C  C     . VAL C  1 234 ? 44.329  19.144   34.899  1.00 60.26  ? 234 VAL C C     1 
ATOM   8894  O  O     . VAL C  1 234 ? 43.109  19.002   34.908  1.00 58.97  ? 234 VAL C O     1 
ATOM   8895  C  CB    . VAL C  1 234 ? 44.349  21.142   36.427  1.00 58.90  ? 234 VAL C CB    1 
ATOM   8896  C  CG1   . VAL C  1 234 ? 44.546  20.219   37.613  1.00 57.66  ? 234 VAL C CG1   1 
ATOM   8897  C  CG2   . VAL C  1 234 ? 44.989  22.489   36.709  1.00 60.10  ? 234 VAL C CG2   1 
ATOM   8898  N  N     . ALA C  1 235 ? 45.158  18.144   34.649  1.00 61.76  ? 235 ALA C N     1 
ATOM   8899  C  CA    . ALA C  1 235 ? 44.610  16.874   34.196  1.00 62.35  ? 235 ALA C CA    1 
ATOM   8900  C  C     . ALA C  1 235 ? 44.977  15.693   35.087  1.00 62.42  ? 235 ALA C C     1 
ATOM   8901  O  O     . ALA C  1 235 ? 46.153  15.339   35.221  1.00 64.68  ? 235 ALA C O     1 
ATOM   8902  C  CB    . ALA C  1 235 ? 45.008  16.609   32.739  1.00 64.10  ? 235 ALA C CB    1 
ATOM   8903  N  N     . ALA C  1 236 ? 43.971  15.087   35.699  1.00 60.64  ? 236 ALA C N     1 
ATOM   8904  C  CA    . ALA C  1 236 ? 44.196  13.861   36.450  1.00 60.56  ? 236 ALA C CA    1 
ATOM   8905  C  C     . ALA C  1 236 ? 43.392  12.726   35.818  1.00 60.20  ? 236 ALA C C     1 
ATOM   8906  O  O     . ALA C  1 236 ? 42.212  12.518   36.146  1.00 58.54  ? 236 ALA C O     1 
ATOM   8907  C  CB    . ALA C  1 236 ? 43.852  14.051   37.920  1.00 59.23  ? 236 ALA C CB    1 
ATOM   8908  N  N     . THR C  1 237 ? 44.046  12.000   34.912  1.00 61.77  ? 237 THR C N     1 
ATOM   8909  C  CA    . THR C  1 237 ? 43.353  11.100   33.990  1.00 62.39  ? 237 THR C CA    1 
ATOM   8910  C  C     . THR C  1 237 ? 43.016  9.684    34.510  1.00 62.07  ? 237 THR C C     1 
ATOM   8911  O  O     . THR C  1 237 ? 43.441  9.266    35.594  1.00 61.92  ? 237 THR C O     1 
ATOM   8912  C  CB    . THR C  1 237 ? 44.084  11.001   32.637  1.00 64.55  ? 237 THR C CB    1 
ATOM   8913  O  OG1   . THR C  1 237 ? 45.432  10.573   32.848  1.00 67.42  ? 237 THR C OG1   1 
ATOM   8914  C  CG2   . THR C  1 237 ? 44.088  12.337   31.925  1.00 65.32  ? 237 THR C CG2   1 
ATOM   8915  N  N     . ALA C  1 238 ? 42.248  8.965    33.694  1.00 62.21  ? 238 ALA C N     1 
ATOM   8916  C  CA    . ALA C  1 238 ? 41.701  7.642    33.995  1.00 61.80  ? 238 ALA C CA    1 
ATOM   8917  C  C     . ALA C  1 238 ? 42.640  6.616    34.644  1.00 62.69  ? 238 ALA C C     1 
ATOM   8918  O  O     . ALA C  1 238 ? 42.187  5.757    35.398  1.00 61.78  ? 238 ALA C O     1 
ATOM   8919  C  CB    . ALA C  1 238 ? 41.078  7.058    32.735  1.00 62.55  ? 238 ALA C CB    1 
ATOM   8920  N  N     . SER C  1 239 ? 43.932  6.695    34.352  1.00 64.87  ? 239 SER C N     1 
ATOM   8921  C  CA    . SER C  1 239 ? 44.896  5.733    34.902  1.00 66.55  ? 239 SER C CA    1 
ATOM   8922  C  C     . SER C  1 239 ? 45.546  6.210    36.212  1.00 66.23  ? 239 SER C C     1 
ATOM   8923  O  O     . SER C  1 239 ? 46.133  5.419    36.951  1.00 66.88  ? 239 SER C O     1 
ATOM   8924  C  CB    . SER C  1 239 ? 45.965  5.401    33.860  1.00 69.03  ? 239 SER C CB    1 
ATOM   8925  O  OG    . SER C  1 239 ? 46.560  6.594    33.359  1.00 70.53  ? 239 SER C OG    1 
ATOM   8926  N  N     . GLU C  1 240 ? 45.424  7.499    36.499  1.00 65.44  ? 240 GLU C N     1 
ATOM   8927  C  CA    . GLU C  1 240 ? 46.057  8.084    37.672  1.00 65.84  ? 240 GLU C CA    1 
ATOM   8928  C  C     . GLU C  1 240 ? 45.367  7.693    38.982  1.00 63.74  ? 240 GLU C C     1 
ATOM   8929  O  O     . GLU C  1 240 ? 44.182  7.378    38.996  1.00 62.15  ? 240 GLU C O     1 
ATOM   8930  C  CB    . GLU C  1 240 ? 46.137  9.607    37.519  1.00 66.02  ? 240 GLU C CB    1 
ATOM   8931  C  CG    . GLU C  1 240 ? 46.983  10.030   36.333  1.00 70.53  ? 240 GLU C CG    1 
ATOM   8932  C  CD    . GLU C  1 240 ? 47.428  11.477   36.400  1.00 75.16  ? 240 GLU C CD    1 
ATOM   8933  O  OE1   . GLU C  1 240 ? 48.641  11.735   36.609  1.00 78.19  ? 240 GLU C OE1   1 
ATOM   8934  O  OE2   . GLU C  1 240 ? 46.561  12.361   36.238  1.00 76.37  ? 240 GLU C OE2   1 
ATOM   8935  N  N     . ALA C  1 241 ? 46.127  7.703    40.073  1.00 63.91  ? 241 ALA C N     1 
ATOM   8936  C  CA    . ALA C  1 241 ? 45.616  7.338    41.387  1.00 62.52  ? 241 ALA C CA    1 
ATOM   8937  C  C     . ALA C  1 241 ? 44.365  8.128    41.734  1.00 60.35  ? 241 ALA C C     1 
ATOM   8938  O  O     . ALA C  1 241 ? 44.295  9.337    41.513  1.00 60.11  ? 241 ALA C O     1 
ATOM   8939  C  CB    . ALA C  1 241 ? 46.683  7.562    42.435  1.00 63.88  ? 241 ALA C CB    1 
ATOM   8940  N  N     . ALA C  1 242 ? 43.370  7.446    42.285  1.00 59.08  ? 242 ALA C N     1 
ATOM   8941  C  CA    . ALA C  1 242 ? 42.098  8.098    42.594  1.00 56.88  ? 242 ALA C CA    1 
ATOM   8942  C  C     . ALA C  1 242 ? 42.309  9.382    43.399  1.00 56.34  ? 242 ALA C C     1 
ATOM   8943  O  O     . ALA C  1 242 ? 41.659  10.387   43.116  1.00 55.84  ? 242 ALA C O     1 
ATOM   8944  C  CB    . ALA C  1 242 ? 41.137  7.141    43.306  1.00 55.78  ? 242 ALA C CB    1 
ATOM   8945  N  N     . PRO C  1 243 ? 43.222  9.363    44.395  1.00 56.76  ? 243 PRO C N     1 
ATOM   8946  C  CA    . PRO C  1 243 ? 43.425  10.594   45.138  1.00 56.48  ? 243 PRO C CA    1 
ATOM   8947  C  C     . PRO C  1 243 ? 43.960  11.742   44.289  1.00 57.09  ? 243 PRO C C     1 
ATOM   8948  O  O     . PRO C  1 243 ? 43.773  12.895   44.657  1.00 56.99  ? 243 PRO C O     1 
ATOM   8949  C  CB    . PRO C  1 243 ? 44.434  10.181   46.201  1.00 57.76  ? 243 PRO C CB    1 
ATOM   8950  C  CG    . PRO C  1 243 ? 44.102  8.773    46.444  1.00 57.53  ? 243 PRO C CG    1 
ATOM   8951  C  CD    . PRO C  1 243 ? 43.866  8.230    45.080  1.00 57.64  ? 243 PRO C CD    1 
ATOM   8952  N  N     . LEU C  1 244 ? 44.602  11.444   43.162  1.00 57.97  ? 244 LEU C N     1 
ATOM   8953  C  CA    . LEU C  1 244 ? 44.966  12.503   42.217  1.00 58.38  ? 244 LEU C CA    1 
ATOM   8954  C  C     . LEU C  1 244 ? 43.693  13.079   41.595  1.00 57.03  ? 244 LEU C C     1 
ATOM   8955  O  O     . LEU C  1 244 ? 43.504  14.296   41.568  1.00 56.82  ? 244 LEU C O     1 
ATOM   8956  C  CB    . LEU C  1 244 ? 45.951  12.013   41.141  1.00 59.97  ? 244 LEU C CB    1 
ATOM   8957  C  CG    . LEU C  1 244 ? 47.370  11.573   41.539  1.00 60.53  ? 244 LEU C CG    1 
ATOM   8958  C  CD1   . LEU C  1 244 ? 47.999  10.807   40.411  1.00 61.05  ? 244 LEU C CD1   1 
ATOM   8959  C  CD2   . LEU C  1 244 ? 48.223  12.755   41.886  1.00 61.20  ? 244 LEU C CD2   1 
ATOM   8960  N  N     . GLN C  1 245 ? 42.806  12.193   41.143  1.00 56.42  ? 245 GLN C N     1 
ATOM   8961  C  CA    . GLN C  1 245 ? 41.497  12.596   40.592  1.00 55.28  ? 245 GLN C CA    1 
ATOM   8962  C  C     . GLN C  1 245 ? 40.626  13.362   41.598  1.00 54.00  ? 245 GLN C C     1 
ATOM   8963  O  O     . GLN C  1 245 ? 40.026  14.382   41.257  1.00 53.39  ? 245 GLN C O     1 
ATOM   8964  C  CB    . GLN C  1 245 ? 40.752  11.386   40.029  1.00 54.41  ? 245 GLN C CB    1 
ATOM   8965  C  CG    . GLN C  1 245 ? 41.619  10.547   39.121  1.00 56.31  ? 245 GLN C CG    1 
ATOM   8966  C  CD    . GLN C  1 245 ? 40.831  9.529    38.342  1.00 57.37  ? 245 GLN C CD    1 
ATOM   8967  O  OE1   . GLN C  1 245 ? 39.833  9.859    37.703  1.00 58.29  ? 245 GLN C OE1   1 
ATOM   8968  N  NE2   . GLN C  1 245 ? 41.270  8.278    38.389  1.00 57.13  ? 245 GLN C NE2   1 
ATOM   8969  N  N     . TYR C  1 246 ? 40.584  12.869   42.832  1.00 53.96  ? 246 TYR C N     1 
ATOM   8970  C  CA    . TYR C  1 246 ? 39.892  13.531   43.931  1.00 53.51  ? 246 TYR C CA    1 
ATOM   8971  C  C     . TYR C  1 246 ? 40.376  14.971   44.106  1.00 54.14  ? 246 TYR C C     1 
ATOM   8972  O  O     . TYR C  1 246 ? 39.570  15.888   44.311  1.00 53.58  ? 246 TYR C O     1 
ATOM   8973  C  CB    . TYR C  1 246 ? 40.097  12.734   45.234  1.00 53.80  ? 246 TYR C CB    1 
ATOM   8974  C  CG    . TYR C  1 246 ? 39.845  13.512   46.515  1.00 54.01  ? 246 TYR C CG    1 
ATOM   8975  C  CD1   . TYR C  1 246 ? 38.566  13.626   47.049  1.00 52.97  ? 246 TYR C CD1   1 
ATOM   8976  C  CD2   . TYR C  1 246 ? 40.887  14.137   47.185  1.00 56.42  ? 246 TYR C CD2   1 
ATOM   8977  C  CE1   . TYR C  1 246 ? 38.332  14.340   48.213  1.00 52.90  ? 246 TYR C CE1   1 
ATOM   8978  C  CE2   . TYR C  1 246 ? 40.661  14.857   48.350  1.00 57.33  ? 246 TYR C CE2   1 
ATOM   8979  C  CZ    . TYR C  1 246 ? 39.384  14.949   48.859  1.00 55.61  ? 246 TYR C CZ    1 
ATOM   8980  O  OH    . TYR C  1 246 ? 39.169  15.656   50.020  1.00 57.18  ? 246 TYR C OH    1 
ATOM   8981  N  N     . LEU C  1 247 ? 41.691  15.153   44.009  1.00 55.50  ? 247 LEU C N     1 
ATOM   8982  C  CA    . LEU C  1 247 ? 42.348  16.398   44.393  1.00 56.17  ? 247 LEU C CA    1 
ATOM   8983  C  C     . LEU C  1 247 ? 42.334  17.450   43.293  1.00 56.37  ? 247 LEU C C     1 
ATOM   8984  O  O     . LEU C  1 247 ? 42.320  18.656   43.590  1.00 56.66  ? 247 LEU C O     1 
ATOM   8985  C  CB    . LEU C  1 247 ? 43.794  16.107   44.797  1.00 57.95  ? 247 LEU C CB    1 
ATOM   8986  C  CG    . LEU C  1 247 ? 44.649  17.200   45.431  1.00 58.90  ? 247 LEU C CG    1 
ATOM   8987  C  CD1   . LEU C  1 247 ? 44.191  17.494   46.845  1.00 58.32  ? 247 LEU C CD1   1 
ATOM   8988  C  CD2   . LEU C  1 247 ? 46.086  16.746   45.419  1.00 60.39  ? 247 LEU C CD2   1 
ATOM   8989  N  N     . ALA C  1 248 ? 42.340  16.989   42.040  1.00 56.13  ? 248 ALA C N     1 
ATOM   8990  C  CA    . ALA C  1 248 ? 42.479  17.860   40.868  1.00 56.66  ? 248 ALA C CA    1 
ATOM   8991  C  C     . ALA C  1 248 ? 41.615  19.141   40.871  1.00 56.04  ? 248 ALA C C     1 
ATOM   8992  O  O     . ALA C  1 248 ? 42.162  20.249   40.718  1.00 57.02  ? 248 ALA C O     1 
ATOM   8993  C  CB    . ALA C  1 248 ? 42.268  17.071   39.594  1.00 56.84  ? 248 ALA C CB    1 
ATOM   8994  N  N     . PRO C  1 249 ? 40.281  19.004   41.070  1.00 54.27  ? 249 PRO C N     1 
ATOM   8995  C  CA    . PRO C  1 249 ? 39.424  20.171   41.024  1.00 53.82  ? 249 PRO C CA    1 
ATOM   8996  C  C     . PRO C  1 249 ? 39.719  21.190   42.125  1.00 54.43  ? 249 PRO C C     1 
ATOM   8997  O  O     . PRO C  1 249 ? 39.464  22.377   41.921  1.00 55.28  ? 249 PRO C O     1 
ATOM   8998  C  CB    . PRO C  1 249 ? 38.026  19.577   41.214  1.00 52.35  ? 249 PRO C CB    1 
ATOM   8999  C  CG    . PRO C  1 249 ? 38.147  18.187   40.785  1.00 51.99  ? 249 PRO C CG    1 
ATOM   9000  C  CD    . PRO C  1 249 ? 39.479  17.798   41.326  1.00 53.22  ? 249 PRO C CD    1 
ATOM   9001  N  N     . PHE C  1 250 ? 40.254  20.750   43.265  1.00 54.41  ? 250 PHE C N     1 
ATOM   9002  C  CA    . PHE C  1 250 ? 40.601  21.687   44.342  1.00 54.96  ? 250 PHE C CA    1 
ATOM   9003  C  C     . PHE C  1 250 ? 41.895  22.463   44.043  1.00 56.61  ? 250 PHE C C     1 
ATOM   9004  O  O     . PHE C  1 250 ? 41.946  23.683   44.191  1.00 57.27  ? 250 PHE C O     1 
ATOM   9005  C  CB    . PHE C  1 250 ? 40.686  20.984   45.713  1.00 54.86  ? 250 PHE C CB    1 
ATOM   9006  C  CG    . PHE C  1 250 ? 39.438  20.232   46.101  1.00 52.92  ? 250 PHE C CG    1 
ATOM   9007  C  CD1   . PHE C  1 250 ? 38.278  20.908   46.457  1.00 51.83  ? 250 PHE C CD1   1 
ATOM   9008  C  CD2   . PHE C  1 250 ? 39.429  18.844   46.123  1.00 52.10  ? 250 PHE C CD2   1 
ATOM   9009  C  CE1   . PHE C  1 250 ? 37.133  20.208   46.811  1.00 50.11  ? 250 PHE C CE1   1 
ATOM   9010  C  CE2   . PHE C  1 250 ? 38.283  18.144   46.483  1.00 50.36  ? 250 PHE C CE2   1 
ATOM   9011  C  CZ    . PHE C  1 250 ? 37.137  18.827   46.822  1.00 49.06  ? 250 PHE C CZ    1 
ATOM   9012  N  N     . THR C  1 251 ? 42.942  21.761   43.628  1.00 57.39  ? 251 THR C N     1 
ATOM   9013  C  CA    . THR C  1 251 ? 44.187  22.440   43.255  1.00 59.08  ? 251 THR C CA    1 
ATOM   9014  C  C     . THR C  1 251 ? 43.932  23.379   42.072  1.00 59.54  ? 251 THR C C     1 
ATOM   9015  O  O     . THR C  1 251 ? 44.483  24.466   42.009  1.00 60.43  ? 251 THR C O     1 
ATOM   9016  C  CB    . THR C  1 251 ? 45.317  21.441   42.901  1.00 60.00  ? 251 THR C CB    1 
ATOM   9017  O  OG1   . THR C  1 251 ? 44.822  20.476   41.970  1.00 58.34  ? 251 THR C OG1   1 
ATOM   9018  C  CG2   . THR C  1 251 ? 45.814  20.718   44.143  1.00 59.48  ? 251 THR C CG2   1 
ATOM   9019  N  N     . ALA C  1 252 ? 43.081  22.945   41.142  1.00 58.93  ? 252 ALA C N     1 
ATOM   9020  C  CA    . ALA C  1 252 ? 42.712  23.763   39.987  1.00 59.34  ? 252 ALA C CA    1 
ATOM   9021  C  C     . ALA C  1 252 ? 41.936  25.003   40.455  1.00 59.02  ? 252 ALA C C     1 
ATOM   9022  O  O     . ALA C  1 252 ? 42.150  26.118   39.959  1.00 59.87  ? 252 ALA C O     1 
ATOM   9023  C  CB    . ALA C  1 252 ? 41.905  22.947   38.988  1.00 58.03  ? 252 ALA C CB    1 
ATOM   9024  N  N     . ALA C  1 253 ? 41.041  24.801   41.420  1.00 57.58  ? 253 ALA C N     1 
ATOM   9025  C  CA    . ALA C  1 253 ? 40.397  25.919   42.083  1.00 57.72  ? 253 ALA C CA    1 
ATOM   9026  C  C     . ALA C  1 253 ? 41.478  26.884   42.628  1.00 59.68  ? 253 ALA C C     1 
ATOM   9027  O  O     . ALA C  1 253 ? 41.428  28.082   42.373  1.00 60.67  ? 253 ALA C O     1 
ATOM   9028  C  CB    . ALA C  1 253 ? 39.464  25.428   43.187  1.00 55.84  ? 253 ALA C CB    1 
ATOM   9029  N  N     . SER C  1 254 ? 42.477  26.354   43.331  1.00 60.41  ? 254 SER C N     1 
ATOM   9030  C  CA    . SER C  1 254 ? 43.541  27.188   43.874  1.00 62.48  ? 254 SER C CA    1 
ATOM   9031  C  C     . SER C  1 254 ? 44.342  27.919   42.789  1.00 64.22  ? 254 SER C C     1 
ATOM   9032  O  O     . SER C  1 254 ? 44.645  29.104   42.941  1.00 65.73  ? 254 SER C O     1 
ATOM   9033  C  CB    . SER C  1 254 ? 44.466  26.357   44.757  1.00 63.29  ? 254 SER C CB    1 
ATOM   9034  O  OG    . SER C  1 254 ? 43.735  25.804   45.832  1.00 62.90  ? 254 SER C OG    1 
ATOM   9035  N  N     . ILE C  1 255 ? 44.679  27.209   41.711  1.00 64.12  ? 255 ILE C N     1 
ATOM   9036  C  CA    . ILE C  1 255 ? 45.309  27.793   40.527  1.00 65.39  ? 255 ILE C CA    1 
ATOM   9037  C  C     . ILE C  1 255 ? 44.419  28.888   39.915  1.00 65.47  ? 255 ILE C C     1 
ATOM   9038  O  O     . ILE C  1 255 ? 44.914  29.939   39.494  1.00 67.07  ? 255 ILE C O     1 
ATOM   9039  C  CB    . ILE C  1 255 ? 45.623  26.702   39.486  1.00 65.29  ? 255 ILE C CB    1 
ATOM   9040  C  CG1   . ILE C  1 255 ? 46.863  25.914   39.912  1.00 66.76  ? 255 ILE C CG1   1 
ATOM   9041  C  CG2   . ILE C  1 255 ? 45.812  27.297   38.091  1.00 66.14  ? 255 ILE C CG2   1 
ATOM   9042  C  CD1   . ILE C  1 255 ? 46.981  24.541   39.277  1.00 66.77  ? 255 ILE C CD1   1 
ATOM   9043  N  N     . GLY C  1 256 ? 43.110  28.636   39.885  1.00 63.67  ? 256 GLY C N     1 
ATOM   9044  C  CA    . GLY C  1 256 ? 42.141  29.615   39.412  1.00 63.68  ? 256 GLY C CA    1 
ATOM   9045  C  C     . GLY C  1 256 ? 41.991  30.796   40.354  1.00 64.45  ? 256 GLY C C     1 
ATOM   9046  O  O     . GLY C  1 256 ? 41.766  31.932   39.912  1.00 65.78  ? 256 GLY C O     1 
ATOM   9047  N  N     . GLU C  1 257 ? 42.135  30.542   41.654  1.00 63.93  ? 257 GLU C N     1 
ATOM   9048  C  CA    . GLU C  1 257 ? 41.926  31.574   42.664  1.00 64.53  ? 257 GLU C CA    1 
ATOM   9049  C  C     . GLU C  1 257 ? 42.937  32.703   42.560  1.00 66.87  ? 257 GLU C C     1 
ATOM   9050  O  O     . GLU C  1 257 ? 42.621  33.858   42.871  1.00 67.86  ? 257 GLU C O     1 
ATOM   9051  C  CB    . GLU C  1 257 ? 41.897  30.966   44.062  1.00 63.66  ? 257 GLU C CB    1 
ATOM   9052  C  CG    . GLU C  1 257 ? 40.511  30.410   44.377  1.00 64.05  ? 257 GLU C CG    1 
ATOM   9053  C  CD    . GLU C  1 257 ? 40.439  29.512   45.598  1.00 65.46  ? 257 GLU C CD    1 
ATOM   9054  O  OE1   . GLU C  1 257 ? 41.427  28.810   45.915  1.00 67.83  ? 257 GLU C OE1   1 
ATOM   9055  O  OE2   . GLU C  1 257 ? 39.368  29.514   46.241  1.00 64.91  ? 257 GLU C OE2   1 
ATOM   9056  N  N     . TRP C  1 258 ? 44.140  32.377   42.091  1.00 67.89  ? 258 TRP C N     1 
ATOM   9057  C  CA    . TRP C  1 258 ? 45.186  33.364   41.973  1.00 70.04  ? 258 TRP C CA    1 
ATOM   9058  C  C     . TRP C  1 258 ? 44.712  34.559   41.163  1.00 71.02  ? 258 TRP C C     1 
ATOM   9059  O  O     . TRP C  1 258 ? 45.036  35.704   41.487  1.00 72.68  ? 258 TRP C O     1 
ATOM   9060  C  CB    . TRP C  1 258 ? 46.449  32.775   41.352  1.00 71.50  ? 258 TRP C CB    1 
ATOM   9061  C  CG    . TRP C  1 258 ? 47.561  33.760   41.384  1.00 73.24  ? 258 TRP C CG    1 
ATOM   9062  C  CD1   . TRP C  1 258 ? 48.480  33.914   42.369  1.00 74.23  ? 258 TRP C CD1   1 
ATOM   9063  C  CD2   . TRP C  1 258 ? 47.837  34.769   40.407  1.00 74.72  ? 258 TRP C CD2   1 
ATOM   9064  N  NE1   . TRP C  1 258 ? 49.330  34.951   42.063  1.00 77.97  ? 258 TRP C NE1   1 
ATOM   9065  C  CE2   . TRP C  1 258 ? 48.956  35.495   40.863  1.00 77.10  ? 258 TRP C CE2   1 
ATOM   9066  C  CE3   . TRP C  1 258 ? 47.252  35.127   39.185  1.00 74.85  ? 258 TRP C CE3   1 
ATOM   9067  C  CZ2   . TRP C  1 258 ? 49.499  36.561   40.151  1.00 78.60  ? 258 TRP C CZ2   1 
ATOM   9068  C  CZ3   . TRP C  1 258 ? 47.802  36.194   38.470  1.00 77.06  ? 258 TRP C CZ3   1 
ATOM   9069  C  CH2   . TRP C  1 258 ? 48.911  36.894   38.959  1.00 78.26  ? 258 TRP C CH2   1 
ATOM   9070  N  N     . PHE C  1 259 ? 43.938  34.297   40.116  1.00 70.03  ? 259 PHE C N     1 
ATOM   9071  C  CA    . PHE C  1 259 ? 43.436  35.379   39.268  1.00 71.11  ? 259 PHE C CA    1 
ATOM   9072  C  C     . PHE C  1 259 ? 42.454  36.279   40.031  1.00 70.75  ? 259 PHE C C     1 
ATOM   9073  O  O     . PHE C  1 259 ? 42.662  37.497   40.121  1.00 72.12  ? 259 PHE C O     1 
ATOM   9074  C  CB    . PHE C  1 259 ? 42.842  34.809   37.972  1.00 70.20  ? 259 PHE C CB    1 
ATOM   9075  C  CG    . PHE C  1 259 ? 43.850  34.068   37.143  1.00 71.30  ? 259 PHE C CG    1 
ATOM   9076  C  CD1   . PHE C  1 259 ? 44.716  34.759   36.300  1.