data_3OFN
# 
_entry.id   3OFN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OFN         
RCSB  RCSB061055   
WWPDB D_1000061055 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HLD 'YEAST MITOCHONDRIAL F1 ATPASE'                       unspecified 
PDB 3FKS 'YEAST F1 ATPASE IN THE ABSENCE OF BOUND NUCLEOTIDES' unspecified 
PDB 1W0J 'BERYLLIUM FLUORIDE INHIBITED BOVINE F1 ATPASE'       unspecified 
PDB 3OE7 'YEAST F1 ATPASE MUTANT GAMMA-I270T'                  unspecified 
PDB 3OEE 'YEAST F1 ATPASE MUTANT ALPHA-F405S'                  unspecified 
PDB 3OEH 'YEAST F1 ATPASE MUTANT BETA-V279F'                   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OFN 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arsenieva, D.' 1 
'Symersky, J.'  2 
'Wang, Y.'      3 
'Pagadala, V.'  4 
'Mueller, D.M.' 5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of mutant forms of the yeast f1 ATPase reveal two modes of uncoupling.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                36561 
_citation.page_last                 36569 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20843806 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.174383 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arsenieva, D.' 1 
primary 'Symersky, J.'  2 
primary 'Wang, Y.'      3 
primary 'Pagadala, V.'  4 
primary 'Mueller, D.M.' 5 
# 
_cell.entry_id           3OFN 
_cell.length_a           112.019 
_cell.length_b           290.619 
_cell.length_c           188.465 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.34 
_cell.angle_gamma        90.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OFN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP synthase subunit alpha'                  55006.457 9  3.6.3.14 N67I 'UNP RESIDUES 36-545' ? 
2 polymer     man 'ATP synthase subunit beta'                   52009.965 9  3.6.3.14 ?    'UNP RESIDUES 34-511' ? 
3 polymer     man 'ATP synthase subunit gamma'                  30657.160 3  3.6.3.14 ?    'UNP RESIDUES 34-311' ? 
4 polymer     man 'ATP synthase subunit delta'                  14565.385 2  3.6.3.14 ?    'UNP RESIDUES 23-160' ? 
5 polymer     man 'ATP synthase subunit epsilon'                6618.359  2  3.6.3.14 ?    'UNP RESIDUES 2-62'   ? 
6 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   15 ?        ?    ?                     ? 
7 non-polymer syn 'MAGNESIUM ION'                               24.305    15 ?        ?    ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'F-ATPase gamma subunit' 
4 'F-ATPase delta subunit' 
5 'ATPase subunit epsilon' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALILEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALILEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
A,B,C,J,K,L,S,T,U ? 
2 'polypeptide(L)' no no 
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
;ASHHHHHHAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE
KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIG
LFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVAL
TGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMD
ELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLA
AEAN
;
D,E,F,M,N,O,V,W,X ? 
3 'polypeptide(L)' no no 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
G,P,Y             ? 
4 'polypeptide(L)' no no 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
H,Q               ? 
5 'polypeptide(L)' no no SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK I,R               ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   THR n 
1 4   LYS n 
1 5   ALA n 
1 6   GLN n 
1 7   PRO n 
1 8   THR n 
1 9   GLU n 
1 10  VAL n 
1 11  SER n 
1 12  SER n 
1 13  ILE n 
1 14  LEU n 
1 15  GLU n 
1 16  GLU n 
1 17  ARG n 
1 18  ILE n 
1 19  LYS n 
1 20  GLY n 
1 21  VAL n 
1 22  SER n 
1 23  ASP n 
1 24  GLU n 
1 25  ALA n 
1 26  ASN n 
1 27  LEU n 
1 28  ASN n 
1 29  GLU n 
1 30  THR n 
1 31  GLY n 
1 32  ARG n 
1 33  VAL n 
1 34  LEU n 
1 35  ALA n 
1 36  VAL n 
1 37  GLY n 
1 38  ASP n 
1 39  GLY n 
1 40  ILE n 
1 41  ALA n 
1 42  ARG n 
1 43  VAL n 
1 44  PHE n 
1 45  GLY n 
1 46  LEU n 
1 47  ASN n 
1 48  ASN n 
1 49  ILE n 
1 50  GLN n 
1 51  ALA n 
1 52  GLU n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  GLU n 
1 57  PHE n 
1 58  SER n 
1 59  SER n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  GLY n 
1 64  MET n 
1 65  ALA n 
1 66  LEU n 
1 67  ILE n 
1 68  LEU n 
1 69  GLU n 
1 70  PRO n 
1 71  GLY n 
1 72  GLN n 
1 73  VAL n 
1 74  GLY n 
1 75  ILE n 
1 76  VAL n 
1 77  LEU n 
1 78  PHE n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  ARG n 
1 83  LEU n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  GLY n 
1 88  GLU n 
1 89  LEU n 
1 90  VAL n 
1 91  LYS n 
1 92  ARG n 
1 93  THR n 
1 94  GLY n 
1 95  ASN n 
1 96  ILE n 
1 97  VAL n 
1 98  ASP n 
1 99  VAL n 
1 100 PRO n 
1 101 VAL n 
1 102 GLY n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 ARG n 
1 109 VAL n 
1 110 VAL n 
1 111 ASP n 
1 112 ALA n 
1 113 LEU n 
1 114 GLY n 
1 115 ASN n 
1 116 PRO n 
1 117 ILE n 
1 118 ASP n 
1 119 GLY n 
1 120 LYS n 
1 121 GLY n 
1 122 PRO n 
1 123 ILE n 
1 124 ASP n 
1 125 ALA n 
1 126 ALA n 
1 127 GLY n 
1 128 ARG n 
1 129 SER n 
1 130 ARG n 
1 131 ALA n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 ALA n 
1 136 PRO n 
1 137 GLY n 
1 138 ILE n 
1 139 LEU n 
1 140 PRO n 
1 141 ARG n 
1 142 ARG n 
1 143 SER n 
1 144 VAL n 
1 145 HIS n 
1 146 GLU n 
1 147 PRO n 
1 148 VAL n 
1 149 GLN n 
1 150 THR n 
1 151 GLY n 
1 152 LEU n 
1 153 LYS n 
1 154 ALA n 
1 155 VAL n 
1 156 ASP n 
1 157 ALA n 
1 158 LEU n 
1 159 VAL n 
1 160 PRO n 
1 161 ILE n 
1 162 GLY n 
1 163 ARG n 
1 164 GLY n 
1 165 GLN n 
1 166 ARG n 
1 167 GLU n 
1 168 LEU n 
1 169 ILE n 
1 170 ILE n 
1 171 GLY n 
1 172 ASP n 
1 173 ARG n 
1 174 GLN n 
1 175 THR n 
1 176 GLY n 
1 177 LYS n 
1 178 THR n 
1 179 ALA n 
1 180 VAL n 
1 181 ALA n 
1 182 LEU n 
1 183 ASP n 
1 184 THR n 
1 185 ILE n 
1 186 LEU n 
1 187 ASN n 
1 188 GLN n 
1 189 LYS n 
1 190 ARG n 
1 191 TRP n 
1 192 ASN n 
1 193 ASN n 
1 194 GLY n 
1 195 SER n 
1 196 ASP n 
1 197 GLU n 
1 198 SER n 
1 199 LYS n 
1 200 LYS n 
1 201 LEU n 
1 202 TYR n 
1 203 CYS n 
1 204 VAL n 
1 205 TYR n 
1 206 VAL n 
1 207 ALA n 
1 208 VAL n 
1 209 GLY n 
1 210 GLN n 
1 211 LYS n 
1 212 ARG n 
1 213 SER n 
1 214 THR n 
1 215 VAL n 
1 216 ALA n 
1 217 GLN n 
1 218 LEU n 
1 219 VAL n 
1 220 GLN n 
1 221 THR n 
1 222 LEU n 
1 223 GLU n 
1 224 GLN n 
1 225 HIS n 
1 226 ASP n 
1 227 ALA n 
1 228 MET n 
1 229 LYS n 
1 230 TYR n 
1 231 SER n 
1 232 ILE n 
1 233 ILE n 
1 234 VAL n 
1 235 ALA n 
1 236 ALA n 
1 237 THR n 
1 238 ALA n 
1 239 SER n 
1 240 GLU n 
1 241 ALA n 
1 242 ALA n 
1 243 PRO n 
1 244 LEU n 
1 245 GLN n 
1 246 TYR n 
1 247 LEU n 
1 248 ALA n 
1 249 PRO n 
1 250 PHE n 
1 251 THR n 
1 252 ALA n 
1 253 ALA n 
1 254 SER n 
1 255 ILE n 
1 256 GLY n 
1 257 GLU n 
1 258 TRP n 
1 259 PHE n 
1 260 ARG n 
1 261 ASP n 
1 262 ASN n 
1 263 GLY n 
1 264 LYS n 
1 265 HIS n 
1 266 ALA n 
1 267 LEU n 
1 268 ILE n 
1 269 VAL n 
1 270 TYR n 
1 271 ASP n 
1 272 ASP n 
1 273 LEU n 
1 274 SER n 
1 275 LYS n 
1 276 GLN n 
1 277 ALA n 
1 278 VAL n 
1 279 ALA n 
1 280 TYR n 
1 281 ARG n 
1 282 GLN n 
1 283 LEU n 
1 284 SER n 
1 285 LEU n 
1 286 LEU n 
1 287 LEU n 
1 288 ARG n 
1 289 ARG n 
1 290 PRO n 
1 291 PRO n 
1 292 GLY n 
1 293 ARG n 
1 294 GLU n 
1 295 ALA n 
1 296 TYR n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 VAL n 
1 301 PHE n 
1 302 TYR n 
1 303 LEU n 
1 304 HIS n 
1 305 SER n 
1 306 ARG n 
1 307 LEU n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 ALA n 
1 312 ALA n 
1 313 LYS n 
1 314 LEU n 
1 315 SER n 
1 316 GLU n 
1 317 LYS n 
1 318 GLU n 
1 319 GLY n 
1 320 SER n 
1 321 GLY n 
1 322 SER n 
1 323 LEU n 
1 324 THR n 
1 325 ALA n 
1 326 LEU n 
1 327 PRO n 
1 328 VAL n 
1 329 ILE n 
1 330 GLU n 
1 331 THR n 
1 332 GLN n 
1 333 GLY n 
1 334 GLY n 
1 335 ASP n 
1 336 VAL n 
1 337 SER n 
1 338 ALA n 
1 339 TYR n 
1 340 ILE n 
1 341 PRO n 
1 342 THR n 
1 343 ASN n 
1 344 VAL n 
1 345 ILE n 
1 346 SER n 
1 347 ILE n 
1 348 THR n 
1 349 ASP n 
1 350 GLY n 
1 351 GLN n 
1 352 ILE n 
1 353 PHE n 
1 354 LEU n 
1 355 GLU n 
1 356 ALA n 
1 357 GLU n 
1 358 LEU n 
1 359 PHE n 
1 360 TYR n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ARG n 
1 365 PRO n 
1 366 ALA n 
1 367 ILE n 
1 368 ASN n 
1 369 VAL n 
1 370 GLY n 
1 371 LEU n 
1 372 SER n 
1 373 VAL n 
1 374 SER n 
1 375 ARG n 
1 376 VAL n 
1 377 GLY n 
1 378 SER n 
1 379 ALA n 
1 380 ALA n 
1 381 GLN n 
1 382 VAL n 
1 383 LYS n 
1 384 ALA n 
1 385 LEU n 
1 386 LYS n 
1 387 GLN n 
1 388 VAL n 
1 389 ALA n 
1 390 GLY n 
1 391 SER n 
1 392 LEU n 
1 393 LYS n 
1 394 LEU n 
1 395 PHE n 
1 396 LEU n 
1 397 ALA n 
1 398 GLN n 
1 399 TYR n 
1 400 ARG n 
1 401 GLU n 
1 402 VAL n 
1 403 ALA n 
1 404 ALA n 
1 405 PHE n 
1 406 ALA n 
1 407 GLN n 
1 408 PHE n 
1 409 GLY n 
1 410 SER n 
1 411 ASP n 
1 412 LEU n 
1 413 ASP n 
1 414 ALA n 
1 415 SER n 
1 416 THR n 
1 417 LYS n 
1 418 GLN n 
1 419 THR n 
1 420 LEU n 
1 421 VAL n 
1 422 ARG n 
1 423 GLY n 
1 424 GLU n 
1 425 ARG n 
1 426 LEU n 
1 427 THR n 
1 428 GLN n 
1 429 LEU n 
1 430 LEU n 
1 431 LYS n 
1 432 GLN n 
1 433 ASN n 
1 434 GLN n 
1 435 TYR n 
1 436 SER n 
1 437 PRO n 
1 438 LEU n 
1 439 ALA n 
1 440 THR n 
1 441 GLU n 
1 442 GLU n 
1 443 GLN n 
1 444 VAL n 
1 445 PRO n 
1 446 LEU n 
1 447 ILE n 
1 448 TYR n 
1 449 ALA n 
1 450 GLY n 
1 451 VAL n 
1 452 ASN n 
1 453 GLY n 
1 454 HIS n 
1 455 LEU n 
1 456 ASP n 
1 457 GLY n 
1 458 ILE n 
1 459 GLU n 
1 460 LEU n 
1 461 SER n 
1 462 ARG n 
1 463 ILE n 
1 464 GLY n 
1 465 GLU n 
1 466 PHE n 
1 467 GLU n 
1 468 SER n 
1 469 SER n 
1 470 PHE n 
1 471 LEU n 
1 472 SER n 
1 473 TYR n 
1 474 LEU n 
1 475 LYS n 
1 476 SER n 
1 477 ASN n 
1 478 HIS n 
1 479 ASN n 
1 480 GLU n 
1 481 LEU n 
1 482 LEU n 
1 483 THR n 
1 484 GLU n 
1 485 ILE n 
1 486 ARG n 
1 487 GLU n 
1 488 LYS n 
1 489 GLY n 
1 490 GLU n 
1 491 LEU n 
1 492 SER n 
1 493 LYS n 
1 494 GLU n 
1 495 LEU n 
1 496 LEU n 
1 497 ALA n 
1 498 SER n 
1 499 LEU n 
1 500 LYS n 
1 501 SER n 
1 502 ALA n 
1 503 THR n 
1 504 GLU n 
1 505 SER n 
1 506 PHE n 
1 507 VAL n 
1 508 ALA n 
1 509 THR n 
1 510 PHE n 
2 1   ALA n 
2 2   SER n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   ALA n 
2 10  ALA n 
2 11  GLN n 
2 12  SER n 
2 13  THR n 
2 14  PRO n 
2 15  ILE n 
2 16  THR n 
2 17  GLY n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  ALA n 
2 22  VAL n 
2 23  ILE n 
2 24  GLY n 
2 25  ALA n 
2 26  ILE n 
2 27  VAL n 
2 28  ASP n 
2 29  VAL n 
2 30  HIS n 
2 31  PHE n 
2 32  GLU n 
2 33  GLN n 
2 34  SER n 
2 35  GLU n 
2 36  LEU n 
2 37  PRO n 
2 38  ALA n 
2 39  ILE n 
2 40  LEU n 
2 41  ASN n 
2 42  ALA n 
2 43  LEU n 
2 44  GLU n 
2 45  ILE n 
2 46  LYS n 
2 47  THR n 
2 48  PRO n 
2 49  GLN n 
2 50  GLY n 
2 51  LYS n 
2 52  LEU n 
2 53  VAL n 
2 54  LEU n 
2 55  GLU n 
2 56  VAL n 
2 57  ALA n 
2 58  GLN n 
2 59  HIS n 
2 60  LEU n 
2 61  GLY n 
2 62  GLU n 
2 63  ASN n 
2 64  THR n 
2 65  VAL n 
2 66  ARG n 
2 67  THR n 
2 68  ILE n 
2 69  ALA n 
2 70  MET n 
2 71  ASP n 
2 72  GLY n 
2 73  THR n 
2 74  GLU n 
2 75  GLY n 
2 76  LEU n 
2 77  VAL n 
2 78  ARG n 
2 79  GLY n 
2 80  GLU n 
2 81  LYS n 
2 82  VAL n 
2 83  LEU n 
2 84  ASP n 
2 85  THR n 
2 86  GLY n 
2 87  GLY n 
2 88  PRO n 
2 89  ILE n 
2 90  SER n 
2 91  VAL n 
2 92  PRO n 
2 93  VAL n 
2 94  GLY n 
2 95  ARG n 
2 96  GLU n 
2 97  THR n 
2 98  LEU n 
2 99  GLY n 
2 100 ARG n 
2 101 ILE n 
2 102 ILE n 
2 103 ASN n 
2 104 VAL n 
2 105 ILE n 
2 106 GLY n 
2 107 GLU n 
2 108 PRO n 
2 109 ILE n 
2 110 ASP n 
2 111 GLU n 
2 112 ARG n 
2 113 GLY n 
2 114 PRO n 
2 115 ILE n 
2 116 LYS n 
2 117 SER n 
2 118 LYS n 
2 119 LEU n 
2 120 ARG n 
2 121 LYS n 
2 122 PRO n 
2 123 ILE n 
2 124 HIS n 
2 125 ALA n 
2 126 ASP n 
2 127 PRO n 
2 128 PRO n 
2 129 SER n 
2 130 PHE n 
2 131 ALA n 
2 132 GLU n 
2 133 GLN n 
2 134 SER n 
2 135 THR n 
2 136 SER n 
2 137 ALA n 
2 138 GLU n 
2 139 ILE n 
2 140 LEU n 
2 141 GLU n 
2 142 THR n 
2 143 GLY n 
2 144 ILE n 
2 145 LYS n 
2 146 VAL n 
2 147 VAL n 
2 148 ASP n 
2 149 LEU n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 TYR n 
2 154 ALA n 
2 155 ARG n 
2 156 GLY n 
2 157 GLY n 
2 158 LYS n 
2 159 ILE n 
2 160 GLY n 
2 161 LEU n 
2 162 PHE n 
2 163 GLY n 
2 164 GLY n 
2 165 ALA n 
2 166 GLY n 
2 167 VAL n 
2 168 GLY n 
2 169 LYS n 
2 170 THR n 
2 171 VAL n 
2 172 PHE n 
2 173 ILE n 
2 174 GLN n 
2 175 GLU n 
2 176 LEU n 
2 177 ILE n 
2 178 ASN n 
2 179 ASN n 
2 180 ILE n 
2 181 ALA n 
2 182 LYS n 
2 183 ALA n 
2 184 HIS n 
2 185 GLY n 
2 186 GLY n 
2 187 PHE n 
2 188 SER n 
2 189 VAL n 
2 190 PHE n 
2 191 THR n 
2 192 GLY n 
2 193 VAL n 
2 194 GLY n 
2 195 GLU n 
2 196 ARG n 
2 197 THR n 
2 198 ARG n 
2 199 GLU n 
2 200 GLY n 
2 201 ASN n 
2 202 ASP n 
2 203 LEU n 
2 204 TYR n 
2 205 ARG n 
2 206 GLU n 
2 207 MET n 
2 208 LYS n 
2 209 GLU n 
2 210 THR n 
2 211 GLY n 
2 212 VAL n 
2 213 ILE n 
2 214 ASN n 
2 215 LEU n 
2 216 GLU n 
2 217 GLY n 
2 218 GLU n 
2 219 SER n 
2 220 LYS n 
2 221 VAL n 
2 222 ALA n 
2 223 LEU n 
2 224 VAL n 
2 225 PHE n 
2 226 GLY n 
2 227 GLN n 
2 228 MET n 
2 229 ASN n 
2 230 GLU n 
2 231 PRO n 
2 232 PRO n 
2 233 GLY n 
2 234 ALA n 
2 235 ARG n 
2 236 ALA n 
2 237 ARG n 
2 238 VAL n 
2 239 ALA n 
2 240 LEU n 
2 241 THR n 
2 242 GLY n 
2 243 LEU n 
2 244 THR n 
2 245 ILE n 
2 246 ALA n 
2 247 GLU n 
2 248 TYR n 
2 249 PHE n 
2 250 ARG n 
2 251 ASP n 
2 252 GLU n 
2 253 GLU n 
2 254 GLY n 
2 255 GLN n 
2 256 ASP n 
2 257 VAL n 
2 258 LEU n 
2 259 LEU n 
2 260 PHE n 
2 261 ILE n 
2 262 ASP n 
2 263 ASN n 
2 264 ILE n 
2 265 PHE n 
2 266 ARG n 
2 267 PHE n 
2 268 THR n 
2 269 GLN n 
2 270 ALA n 
2 271 GLY n 
2 272 SER n 
2 273 GLU n 
2 274 VAL n 
2 275 SER n 
2 276 ALA n 
2 277 LEU n 
2 278 LEU n 
2 279 GLY n 
2 280 ARG n 
2 281 ILE n 
2 282 PRO n 
2 283 SER n 
2 284 ALA n 
2 285 VAL n 
2 286 GLY n 
2 287 TYR n 
2 288 GLN n 
2 289 PRO n 
2 290 THR n 
2 291 LEU n 
2 292 ALA n 
2 293 THR n 
2 294 ASP n 
2 295 MET n 
2 296 GLY n 
2 297 LEU n 
2 298 LEU n 
2 299 GLN n 
2 300 GLU n 
2 301 ARG n 
2 302 ILE n 
2 303 THR n 
2 304 THR n 
2 305 THR n 
2 306 LYS n 
2 307 LYS n 
2 308 GLY n 
2 309 SER n 
2 310 VAL n 
2 311 THR n 
2 312 SER n 
2 313 VAL n 
2 314 GLN n 
2 315 ALA n 
2 316 VAL n 
2 317 TYR n 
2 318 VAL n 
2 319 PRO n 
2 320 ALA n 
2 321 ASP n 
2 322 ASP n 
2 323 LEU n 
2 324 THR n 
2 325 ASP n 
2 326 PRO n 
2 327 ALA n 
2 328 PRO n 
2 329 ALA n 
2 330 THR n 
2 331 THR n 
2 332 PHE n 
2 333 ALA n 
2 334 HIS n 
2 335 LEU n 
2 336 ASP n 
2 337 ALA n 
2 338 THR n 
2 339 THR n 
2 340 VAL n 
2 341 LEU n 
2 342 SER n 
2 343 ARG n 
2 344 GLY n 
2 345 ILE n 
2 346 SER n 
2 347 GLU n 
2 348 LEU n 
2 349 GLY n 
2 350 ILE n 
2 351 TYR n 
2 352 PRO n 
2 353 ALA n 
2 354 VAL n 
2 355 ASP n 
2 356 PRO n 
2 357 LEU n 
2 358 ASP n 
2 359 SER n 
2 360 LYS n 
2 361 SER n 
2 362 ARG n 
2 363 LEU n 
2 364 LEU n 
2 365 ASP n 
2 366 ALA n 
2 367 ALA n 
2 368 VAL n 
2 369 VAL n 
2 370 GLY n 
2 371 GLN n 
2 372 GLU n 
2 373 HIS n 
2 374 TYR n 
2 375 ASP n 
2 376 VAL n 
2 377 ALA n 
2 378 SER n 
2 379 LYS n 
2 380 VAL n 
2 381 GLN n 
2 382 GLU n 
2 383 THR n 
2 384 LEU n 
2 385 GLN n 
2 386 THR n 
2 387 TYR n 
2 388 LYS n 
2 389 SER n 
2 390 LEU n 
2 391 GLN n 
2 392 ASP n 
2 393 ILE n 
2 394 ILE n 
2 395 ALA n 
2 396 ILE n 
2 397 LEU n 
2 398 GLY n 
2 399 MET n 
2 400 ASP n 
2 401 GLU n 
2 402 LEU n 
2 403 SER n 
2 404 GLU n 
2 405 GLN n 
2 406 ASP n 
2 407 LYS n 
2 408 LEU n 
2 409 THR n 
2 410 VAL n 
2 411 GLU n 
2 412 ARG n 
2 413 ALA n 
2 414 ARG n 
2 415 LYS n 
2 416 ILE n 
2 417 GLN n 
2 418 ARG n 
2 419 PHE n 
2 420 LEU n 
2 421 SER n 
2 422 GLN n 
2 423 PRO n 
2 424 PHE n 
2 425 ALA n 
2 426 VAL n 
2 427 ALA n 
2 428 GLU n 
2 429 VAL n 
2 430 PHE n 
2 431 THR n 
2 432 GLY n 
2 433 ILE n 
2 434 PRO n 
2 435 GLY n 
2 436 LYS n 
2 437 LEU n 
2 438 VAL n 
2 439 ARG n 
2 440 LEU n 
2 441 LYS n 
2 442 ASP n 
2 443 THR n 
2 444 VAL n 
2 445 ALA n 
2 446 SER n 
2 447 PHE n 
2 448 LYS n 
2 449 ALA n 
2 450 VAL n 
2 451 LEU n 
2 452 GLU n 
2 453 GLY n 
2 454 LYS n 
2 455 TYR n 
2 456 ASP n 
2 457 ASN n 
2 458 ILE n 
2 459 PRO n 
2 460 GLU n 
2 461 HIS n 
2 462 ALA n 
2 463 PHE n 
2 464 TYR n 
2 465 MET n 
2 466 VAL n 
2 467 GLY n 
2 468 GLY n 
2 469 ILE n 
2 470 GLU n 
2 471 ASP n 
2 472 VAL n 
2 473 VAL n 
2 474 ALA n 
2 475 LYS n 
2 476 ALA n 
2 477 GLU n 
2 478 LYS n 
2 479 LEU n 
2 480 ALA n 
2 481 ALA n 
2 482 GLU n 
2 483 ALA n 
2 484 ASN n 
3 1   ALA n 
3 2   THR n 
3 3   LEU n 
3 4   LYS n 
3 5   GLU n 
3 6   VAL n 
3 7   GLU n 
3 8   MET n 
3 9   ARG n 
3 10  LEU n 
3 11  LYS n 
3 12  SER n 
3 13  ILE n 
3 14  LYS n 
3 15  ASN n 
3 16  ILE n 
3 17  GLU n 
3 18  LYS n 
3 19  ILE n 
3 20  THR n 
3 21  LYS n 
3 22  THR n 
3 23  MET n 
3 24  LYS n 
3 25  ILE n 
3 26  VAL n 
3 27  ALA n 
3 28  SER n 
3 29  THR n 
3 30  ARG n 
3 31  LEU n 
3 32  SER n 
3 33  LYS n 
3 34  ALA n 
3 35  GLU n 
3 36  LYS n 
3 37  ALA n 
3 38  LYS n 
3 39  ILE n 
3 40  SER n 
3 41  ALA n 
3 42  LYS n 
3 43  LYS n 
3 44  MET n 
3 45  ASP n 
3 46  GLU n 
3 47  ALA n 
3 48  GLU n 
3 49  GLN n 
3 50  LEU n 
3 51  PHE n 
3 52  TYR n 
3 53  LYS n 
3 54  ASN n 
3 55  ALA n 
3 56  GLU n 
3 57  THR n 
3 58  LYS n 
3 59  ASN n 
3 60  LEU n 
3 61  ASP n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  THR n 
3 66  GLU n 
3 67  THR n 
3 68  GLY n 
3 69  ALA n 
3 70  PRO n 
3 71  LYS n 
3 72  GLU n 
3 73  LEU n 
3 74  ILE n 
3 75  VAL n 
3 76  ALA n 
3 77  ILE n 
3 78  THR n 
3 79  SER n 
3 80  ASP n 
3 81  LYS n 
3 82  GLY n 
3 83  LEU n 
3 84  CYS n 
3 85  GLY n 
3 86  SER n 
3 87  ILE n 
3 88  HIS n 
3 89  SER n 
3 90  GLN n 
3 91  LEU n 
3 92  ALA n 
3 93  LYS n 
3 94  ALA n 
3 95  VAL n 
3 96  ARG n 
3 97  ARG n 
3 98  HIS n 
3 99  LEU n 
3 100 ASN n 
3 101 ASP n 
3 102 GLN n 
3 103 PRO n 
3 104 ASN n 
3 105 ALA n 
3 106 ASP n 
3 107 ILE n 
3 108 VAL n 
3 109 THR n 
3 110 ILE n 
3 111 GLY n 
3 112 ASP n 
3 113 LYS n 
3 114 ILE n 
3 115 LYS n 
3 116 MET n 
3 117 GLN n 
3 118 LEU n 
3 119 LEU n 
3 120 ARG n 
3 121 THR n 
3 122 HIS n 
3 123 PRO n 
3 124 ASN n 
3 125 ASN n 
3 126 ILE n 
3 127 LYS n 
3 128 LEU n 
3 129 SER n 
3 130 ILE n 
3 131 ASN n 
3 132 GLY n 
3 133 ILE n 
3 134 GLY n 
3 135 LYS n 
3 136 ASP n 
3 137 ALA n 
3 138 PRO n 
3 139 THR n 
3 140 PHE n 
3 141 GLN n 
3 142 GLU n 
3 143 SER n 
3 144 ALA n 
3 145 LEU n 
3 146 ILE n 
3 147 ALA n 
3 148 ASP n 
3 149 LYS n 
3 150 LEU n 
3 151 LEU n 
3 152 SER n 
3 153 VAL n 
3 154 MET n 
3 155 LYS n 
3 156 ALA n 
3 157 GLY n 
3 158 THR n 
3 159 TYR n 
3 160 PRO n 
3 161 LYS n 
3 162 ILE n 
3 163 SER n 
3 164 ILE n 
3 165 PHE n 
3 166 TYR n 
3 167 ASN n 
3 168 ASP n 
3 169 PRO n 
3 170 VAL n 
3 171 SER n 
3 172 SER n 
3 173 LEU n 
3 174 SER n 
3 175 PHE n 
3 176 GLU n 
3 177 PRO n 
3 178 SER n 
3 179 GLU n 
3 180 LYS n 
3 181 PRO n 
3 182 ILE n 
3 183 PHE n 
3 184 ASN n 
3 185 ALA n 
3 186 LYS n 
3 187 THR n 
3 188 ILE n 
3 189 GLU n 
3 190 GLN n 
3 191 SER n 
3 192 PRO n 
3 193 SER n 
3 194 PHE n 
3 195 GLY n 
3 196 LYS n 
3 197 PHE n 
3 198 GLU n 
3 199 ILE n 
3 200 ASP n 
3 201 THR n 
3 202 ASP n 
3 203 ALA n 
3 204 ASN n 
3 205 VAL n 
3 206 PRO n 
3 207 ARG n 
3 208 ASP n 
3 209 LEU n 
3 210 PHE n 
3 211 GLU n 
3 212 TYR n 
3 213 THR n 
3 214 LEU n 
3 215 ALA n 
3 216 ASN n 
3 217 GLN n 
3 218 MET n 
3 219 LEU n 
3 220 THR n 
3 221 ALA n 
3 222 MET n 
3 223 ALA n 
3 224 GLN n 
3 225 GLY n 
3 226 TYR n 
3 227 ALA n 
3 228 ALA n 
3 229 GLU n 
3 230 ILE n 
3 231 SER n 
3 232 ALA n 
3 233 ARG n 
3 234 ARG n 
3 235 ASN n 
3 236 ALA n 
3 237 MET n 
3 238 ASP n 
3 239 ASN n 
3 240 ALA n 
3 241 SER n 
3 242 LYS n 
3 243 ASN n 
3 244 ALA n 
3 245 GLY n 
3 246 ASP n 
3 247 MET n 
3 248 ILE n 
3 249 ASN n 
3 250 ARG n 
3 251 TYR n 
3 252 SER n 
3 253 ILE n 
3 254 LEU n 
3 255 TYR n 
3 256 ASN n 
3 257 ARG n 
3 258 THR n 
3 259 ARG n 
3 260 GLN n 
3 261 ALA n 
3 262 VAL n 
3 263 ILE n 
3 264 THR n 
3 265 ASN n 
3 266 GLU n 
3 267 LEU n 
3 268 VAL n 
3 269 ASP n 
3 270 ILE n 
3 271 ILE n 
3 272 THR n 
3 273 GLY n 
3 274 ALA n 
3 275 SER n 
3 276 SER n 
3 277 LEU n 
3 278 GLY n 
4 1   ALA n 
4 2   GLU n 
4 3   ALA n 
4 4   ALA n 
4 5   ALA n 
4 6   ALA n 
4 7   SER n 
4 8   SER n 
4 9   GLY n 
4 10  LEU n 
4 11  LYS n 
4 12  LEU n 
4 13  GLN n 
4 14  PHE n 
4 15  ALA n 
4 16  LEU n 
4 17  PRO n 
4 18  HIS n 
4 19  GLU n 
4 20  THR n 
4 21  LEU n 
4 22  TYR n 
4 23  SER n 
4 24  GLY n 
4 25  SER n 
4 26  GLU n 
4 27  VAL n 
4 28  THR n 
4 29  GLN n 
4 30  VAL n 
4 31  ASN n 
4 32  LEU n 
4 33  PRO n 
4 34  ALA n 
4 35  LYS n 
4 36  SER n 
4 37  GLY n 
4 38  ARG n 
4 39  ILE n 
4 40  GLY n 
4 41  VAL n 
4 42  LEU n 
4 43  ALA n 
4 44  ASN n 
4 45  HIS n 
4 46  VAL n 
4 47  PRO n 
4 48  THR n 
4 49  VAL n 
4 50  GLU n 
4 51  GLN n 
4 52  LEU n 
4 53  LEU n 
4 54  PRO n 
4 55  GLY n 
4 56  VAL n 
4 57  VAL n 
4 58  GLU n 
4 59  VAL n 
4 60  MET n 
4 61  GLU n 
4 62  GLY n 
4 63  SER n 
4 64  ASN n 
4 65  SER n 
4 66  LYS n 
4 67  LYS n 
4 68  PHE n 
4 69  PHE n 
4 70  ILE n 
4 71  SER n 
4 72  GLY n 
4 73  GLY n 
4 74  PHE n 
4 75  ALA n 
4 76  THR n 
4 77  VAL n 
4 78  GLN n 
4 79  PRO n 
4 80  ASP n 
4 81  SER n 
4 82  GLN n 
4 83  LEU n 
4 84  CYS n 
4 85  VAL n 
4 86  THR n 
4 87  ALA n 
4 88  ILE n 
4 89  GLU n 
4 90  ALA n 
4 91  PHE n 
4 92  PRO n 
4 93  LEU n 
4 94  GLU n 
4 95  SER n 
4 96  PHE n 
4 97  SER n 
4 98  GLN n 
4 99  GLU n 
4 100 ASN n 
4 101 ILE n 
4 102 LYS n 
4 103 ASN n 
4 104 LEU n 
4 105 LEU n 
4 106 ALA n 
4 107 GLU n 
4 108 ALA n 
4 109 LYS n 
4 110 LYS n 
4 111 ASN n 
4 112 VAL n 
4 113 SER n 
4 114 SER n 
4 115 SER n 
4 116 ASP n 
4 117 ALA n 
4 118 ARG n 
4 119 GLU n 
4 120 ALA n 
4 121 ALA n 
4 122 GLU n 
4 123 ALA n 
4 124 ALA n 
4 125 ILE n 
4 126 GLN n 
4 127 VAL n 
4 128 GLU n 
4 129 VAL n 
4 130 LEU n 
4 131 GLU n 
4 132 ASN n 
4 133 LEU n 
4 134 GLN n 
4 135 SER n 
4 136 VAL n 
4 137 LEU n 
4 138 LYS n 
5 1   SER n 
5 2   ALA n 
5 3   TRP n 
5 4   ARG n 
5 5   LYS n 
5 6   ALA n 
5 7   GLY n 
5 8   ILE n 
5 9   SER n 
5 10  TYR n 
5 11  ALA n 
5 12  ALA n 
5 13  TYR n 
5 14  LEU n 
5 15  ASN n 
5 16  VAL n 
5 17  ALA n 
5 18  ALA n 
5 19  GLN n 
5 20  ALA n 
5 21  ILE n 
5 22  ARG n 
5 23  SER n 
5 24  SER n 
5 25  LEU n 
5 26  LYS n 
5 27  THR n 
5 28  GLU n 
5 29  LEU n 
5 30  GLN n 
5 31  THR n 
5 32  ALA n 
5 33  SER n 
5 34  VAL n 
5 35  LEU n 
5 36  ASN n 
5 37  ARG n 
5 38  SER n 
5 39  GLN n 
5 40  THR n 
5 41  ASP n 
5 42  ALA n 
5 43  PHE n 
5 44  TYR n 
5 45  THR n 
5 46  GLN n 
5 47  TYR n 
5 48  LYS n 
5 49  ASN n 
5 50  GLY n 
5 51  THR n 
5 52  ALA n 
5 53  ALA n 
5 54  SER n 
5 55  GLU n 
5 56  PRO n 
5 57  THR n 
5 58  PRO n 
5 59  ILE n 
5 60  THR n 
5 61  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP1, YBL0827, YBL099W'               ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP2, J2041, YJR121W'                 ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP3, ATP3a, ATP3b, YBR039W, YBR0408' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP16, D2935, YD8119.03, YDL004W'     ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 
;brewer's yeast,lager beer yeast,yeast
;
? 'ATP15, P0345, YPL271W'                ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 
4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATPA_YEAST  P07251 1 
;ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGS
DRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVP
IGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGS
GSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYR
EVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNE
LLTEIREKGELSKELLASLKSATESFVATF
;
36 ? 
2 UNP ATPB_YEAST  P00830 2 
;AAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGP
ISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVG
KTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEY
FRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAP
ATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKL
TVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN
;
36 ? 
3 UNP ATPG_YEAST  P38077 3 
;ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSD
KGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYP
KISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNA
SKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG
;
34 ? 
4 UNP ATPD_YEAST  Q12165 4 
;AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPD
SQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK
;
23 ? 
5 UNP ATP5E_YEAST P21306 5 SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 2  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3OFN A 1 ? 510 ? P07251 36 ? 545 ? 1 510 
2  1 3OFN B 1 ? 510 ? P07251 36 ? 545 ? 1 510 
3  1 3OFN C 1 ? 510 ? P07251 36 ? 545 ? 1 510 
4  2 3OFN D 9 ? 484 ? P00830 36 ? 511 ? 3 478 
5  2 3OFN E 9 ? 484 ? P00830 36 ? 511 ? 3 478 
6  2 3OFN F 9 ? 484 ? P00830 36 ? 511 ? 3 478 
7  3 3OFN G 1 ? 278 ? P38077 34 ? 311 ? 1 278 
8  4 3OFN H 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
9  5 3OFN I 1 ? 61  ? P21306 2  ? 62  ? 1 61  
10 1 3OFN J 1 ? 510 ? P07251 36 ? 545 ? 1 510 
11 1 3OFN K 1 ? 510 ? P07251 36 ? 545 ? 1 510 
12 1 3OFN L 1 ? 510 ? P07251 36 ? 545 ? 1 510 
13 2 3OFN M 9 ? 484 ? P00830 36 ? 511 ? 3 478 
14 2 3OFN N 9 ? 484 ? P00830 36 ? 511 ? 3 478 
15 2 3OFN O 9 ? 484 ? P00830 36 ? 511 ? 3 478 
16 3 3OFN P 1 ? 278 ? P38077 34 ? 311 ? 1 278 
17 4 3OFN Q 1 ? 138 ? Q12165 23 ? 160 ? 1 138 
18 5 3OFN R 1 ? 61  ? P21306 2  ? 62  ? 1 61  
19 1 3OFN S 1 ? 510 ? P07251 36 ? 545 ? 1 510 
20 1 3OFN T 1 ? 510 ? P07251 36 ? 545 ? 1 510 
21 1 3OFN U 1 ? 510 ? P07251 36 ? 545 ? 1 510 
22 2 3OFN V 9 ? 484 ? P00830 36 ? 511 ? 3 478 
23 2 3OFN W 9 ? 484 ? P00830 36 ? 511 ? 3 478 
24 2 3OFN X 9 ? 484 ? P00830 36 ? 511 ? 3 478 
25 3 3OFN Y 1 ? 278 ? P38077 34 ? 311 ? 1 278 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3OFN ILE A 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 1  
2  3OFN ILE B 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 2  
3  3OFN ILE C 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 3  
4  3OFN ALA D 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 4  
4  3OFN SER D 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 5  
4  3OFN HIS D 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 6  
4  3OFN HIS D 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 7  
4  3OFN HIS D 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 8  
4  3OFN HIS D 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  9  
4  3OFN HIS D 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  10 
4  3OFN HIS D 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  11 
5  3OFN ALA E 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 12 
5  3OFN SER E 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 13 
5  3OFN HIS E 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 14 
5  3OFN HIS E 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 15 
5  3OFN HIS E 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 16 
5  3OFN HIS E 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  17 
5  3OFN HIS E 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  18 
5  3OFN HIS E 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  19 
6  3OFN ALA F 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 20 
6  3OFN SER F 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 21 
6  3OFN HIS F 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 22 
6  3OFN HIS F 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 23 
6  3OFN HIS F 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 24 
6  3OFN HIS F 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  25 
6  3OFN HIS F 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  26 
6  3OFN HIS F 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  27 
10 3OFN ILE J 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 28 
11 3OFN ILE K 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 29 
12 3OFN ILE L 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 30 
13 3OFN ALA M 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 31 
13 3OFN SER M 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 32 
13 3OFN HIS M 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 33 
13 3OFN HIS M 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 34 
13 3OFN HIS M 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 35 
13 3OFN HIS M 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  36 
13 3OFN HIS M 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  37 
13 3OFN HIS M 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  38 
14 3OFN ALA N 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 39 
14 3OFN SER N 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 40 
14 3OFN HIS N 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 41 
14 3OFN HIS N 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 42 
14 3OFN HIS N 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 43 
14 3OFN HIS N 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  44 
14 3OFN HIS N 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  45 
14 3OFN HIS N 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  46 
15 3OFN ALA O 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 47 
15 3OFN SER O 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 48 
15 3OFN HIS O 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 49 
15 3OFN HIS O 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 50 
15 3OFN HIS O 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 51 
15 3OFN HIS O 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  52 
15 3OFN HIS O 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  53 
15 3OFN HIS O 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  54 
19 3OFN ILE S 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 55 
20 3OFN ILE T 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 56 
21 3OFN ILE U 67 ? UNP P07251 ASN 102 'ENGINEERED MUTATION' 67 57 
22 3OFN ALA V 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 58 
22 3OFN SER V 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 59 
22 3OFN HIS V 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 60 
22 3OFN HIS V 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 61 
22 3OFN HIS V 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 62 
22 3OFN HIS V 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  63 
22 3OFN HIS V 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  64 
22 3OFN HIS V 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  65 
23 3OFN ALA W 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 66 
23 3OFN SER W 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 67 
23 3OFN HIS W 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 68 
23 3OFN HIS W 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 69 
23 3OFN HIS W 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 70 
23 3OFN HIS W 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  71 
23 3OFN HIS W 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  72 
23 3OFN HIS W 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  73 
24 3OFN ALA X 1  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -5 74 
24 3OFN SER X 2  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -4 75 
24 3OFN HIS X 3  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -3 76 
24 3OFN HIS X 4  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -2 77 
24 3OFN HIS X 5  ? UNP P00830 ?   ?   'EXPRESSION TAG'      -1 78 
24 3OFN HIS X 6  ? UNP P00830 ?   ?   'EXPRESSION TAG'      0  79 
24 3OFN HIS X 7  ? UNP P00830 ?   ?   'EXPRESSION TAG'      1  80 
24 3OFN HIS X 8  ? UNP P00830 ?   ?   'EXPRESSION TAG'      2  81 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OFN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   54.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
;5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-11-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3OFN 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.2 
_reflns.number_obs                   173078 
_reflns.number_all                   173078 
_reflns.percent_possible_obs         91.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        6.7 
_reflns.B_iso_Wilson_estimate        92.5 
_reflns.pdbx_redundancy              2.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.2 
_reflns_shell.d_res_low              3.31 
_reflns_shell.percent_possible_all   92.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.55 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3OFN 
_refine.ls_number_reflns_obs                     173078 
_refine.ls_number_reflns_all                     173078 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    91.17 
_refine.ls_R_factor_obs                          0.21160 
_refine.ls_R_factor_all                          0.21160 
_refine.ls_R_factor_R_work                       0.21030 
_refine.ls_R_factor_R_free                       0.27599 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  3557 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.935 
_refine.correlation_coeff_Fo_to_Fc_free          0.884 
_refine.B_iso_mean                               97.42 
_refine.aniso_B[1][1]                            0.53 
_refine.aniso_B[2][2]                            1.28 
_refine.aniso_B[3][3]                            -2.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.61 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2HLD' 
_refine.pdbx_method_to_determine_struct          Molrep 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.584 
_refine.overall_SU_ML                            0.458 
_refine.overall_SU_B                             58.611 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3OFN 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.584 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        70001 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         480 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               70481 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.008  0.022  ? 71594 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.164  1.986  ? 97279 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.510  5.000  ? 9388  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.686 24.499 ? 2832  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 18.585 15.000 ? 11679 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 16.293 15.000 ? 444   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.073  0.200  ? 11551 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.004  0.021  ? 53294 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.220  1.500  ? 46673 'X-RAY DIFFRACTION' ? 
r_mcangle_it           0.426  2.000  ? 74616 'X-RAY DIFFRACTION' ? 
r_scbond_it            0.663  3.000  ? 24921 'X-RAY DIFFRACTION' ? 
r_scangle_it           1.186  4.500  ? 22663 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.2 
_refine_ls_shell.d_res_low                        3.279 
_refine_ls_shell.number_reflns_R_work             12146 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.percent_reflns_obs               87.28 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             239 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                12146 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OFN 
_struct.title                     'Structure of four mutant forms of yeast F1 ATPase: alpha-N67I' 
_struct.pdbx_descriptor           
;ATP synthase subunit alpha (E.C.3.6.3.14), ATP synthase subunit beta (E.C.3.6.3.14), ATP synthase subunit gamma (E.C.3.6.3.14), ATP synthase subunit delta (E.C.3.6.3.14), ATP synthase subunit epsilon (E.C.3.6.3.14)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OFN 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ATP SYNTHASE, ATP PHOSPHATASE, F1F0 ATPASE, ATP SYNTHESIS, HYDROLASE, ADP, PO4, MITOCHONDRIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 6 ? 
AA N N 7 ? 
BA N N 6 ? 
CA N N 7 ? 
DA N N 6 ? 
EA N N 7 ? 
FA N N 6 ? 
GA N N 7 ? 
HA N N 6 ? 
IA N N 7 ? 
JA N N 6 ? 
KA N N 7 ? 
LA N N 6 ? 
MA N N 7 ? 
NA N N 6 ? 
OA N N 7 ? 
PA N N 6 ? 
QA N N 7 ? 
RA N N 6 ? 
SA N N 7 ? 
TA N N 6 ? 
UA N N 7 ? 
VA N N 6 ? 
WA N N 7 ? 
XA N N 6 ? 
YA N N 7 ? 
ZA N N 6 ? 
AB N N 7 ? 
BB N N 6 ? 
CB N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 102 ? LEU A 106 ? GLY A 102 LEU A 106 5 ? 5  
HELX_P HELX_P2   2   LEU A 152 ? VAL A 159 ? LEU A 152 VAL A 159 1 ? 8  
HELX_P HELX_P3   3   GLY A 176 ? GLN A 188 ? GLY A 176 GLN A 188 1 ? 13 
HELX_P HELX_P4   4   GLN A 188 ? ASN A 193 ? GLN A 188 ASN A 193 1 ? 6  
HELX_P HELX_P5   5   ASP A 196 ? LYS A 200 ? ASP A 196 LYS A 200 5 ? 5  
HELX_P HELX_P6   6   LYS A 211 ? HIS A 225 ? LYS A 211 HIS A 225 1 ? 15 
HELX_P HELX_P7   7   ALA A 227 ? LYS A 229 ? ALA A 227 LYS A 229 5 ? 3  
HELX_P HELX_P8   8   ALA A 241 ? ASN A 262 ? ALA A 241 ASN A 262 1 ? 22 
HELX_P HELX_P9   9   ASP A 272 ? LEU A 287 ? ASP A 272 LEU A 287 1 ? 16 
HELX_P HELX_P10  10  GLY A 292 ? TYR A 296 ? GLY A 292 TYR A 296 5 ? 5  
HELX_P HELX_P11  11  ASP A 299 ? GLU A 309 ? ASP A 299 GLU A 309 1 ? 11 
HELX_P HELX_P12  12  SER A 315 ? GLY A 319 ? SER A 315 GLY A 319 5 ? 5  
HELX_P HELX_P13  13  ALA A 338 ? SER A 346 ? ALA A 338 SER A 346 1 ? 9  
HELX_P HELX_P14  14  GLU A 355 ? GLY A 362 ? GLU A 355 GLY A 362 1 ? 8  
HELX_P HELX_P15  15  VAL A 376 ? GLN A 381 ? VAL A 376 GLN A 381 5 ? 6  
HELX_P HELX_P16  16  VAL A 382 ? GLY A 390 ? VAL A 382 GLY A 390 1 ? 9  
HELX_P HELX_P17  17  SER A 391 ? ALA A 404 ? SER A 391 ALA A 404 1 ? 14 
HELX_P HELX_P18  18  ASP A 413 ? LEU A 430 ? ASP A 413 LEU A 430 1 ? 18 
HELX_P HELX_P19  19  ALA A 439 ? ASN A 452 ? ALA A 439 ASN A 452 1 ? 14 
HELX_P HELX_P20  20  GLU A 459 ? SER A 461 ? GLU A 459 SER A 461 5 ? 3  
HELX_P HELX_P21  21  ARG A 462 ? HIS A 478 ? ARG A 462 HIS A 478 1 ? 17 
HELX_P HELX_P22  22  HIS A 478 ? GLY A 489 ? HIS A 478 GLY A 489 1 ? 12 
HELX_P HELX_P23  23  SER A 492 ? PHE A 510 ? SER A 492 PHE A 510 1 ? 19 
HELX_P HELX_P24  24  SER B 80  ? VAL B 84  ? SER B 80  VAL B 84  5 ? 5  
HELX_P HELX_P25  25  GLY B 102 ? LEU B 106 ? GLY B 102 LEU B 106 5 ? 5  
HELX_P HELX_P26  26  LEU B 152 ? VAL B 159 ? LEU B 152 VAL B 159 1 ? 8  
HELX_P HELX_P27  27  GLY B 176 ? GLN B 188 ? GLY B 176 GLN B 188 1 ? 13 
HELX_P HELX_P28  28  LYS B 189 ? GLY B 194 ? LYS B 189 GLY B 194 5 ? 6  
HELX_P HELX_P29  29  LYS B 211 ? GLN B 224 ? LYS B 211 GLN B 224 1 ? 14 
HELX_P HELX_P30  30  ALA B 227 ? LYS B 229 ? ALA B 227 LYS B 229 5 ? 3  
HELX_P HELX_P31  31  ALA B 241 ? ASP B 261 ? ALA B 241 ASP B 261 1 ? 21 
HELX_P HELX_P32  32  ASP B 272 ? LEU B 287 ? ASP B 272 LEU B 287 1 ? 16 
HELX_P HELX_P33  33  GLY B 292 ? TYR B 296 ? GLY B 292 TYR B 296 5 ? 5  
HELX_P HELX_P34  34  PRO B 297 ? GLY B 298 ? PRO B 297 GLY B 298 5 ? 2  
HELX_P HELX_P35  35  ASP B 299 ? GLU B 309 ? ASP B 299 GLU B 309 1 ? 11 
HELX_P HELX_P36  36  ALA B 338 ? SER B 346 ? ALA B 338 SER B 346 1 ? 9  
HELX_P HELX_P37  37  GLU B 355 ? LYS B 361 ? GLU B 355 LYS B 361 1 ? 7  
HELX_P HELX_P38  38  VAL B 382 ? ALA B 389 ? VAL B 382 ALA B 389 1 ? 8  
HELX_P HELX_P39  39  SER B 391 ? ALA B 406 ? SER B 391 ALA B 406 1 ? 16 
HELX_P HELX_P40  40  GLN B 418 ? LYS B 431 ? GLN B 418 LYS B 431 1 ? 14 
HELX_P HELX_P41  41  ALA B 439 ? ASN B 452 ? ALA B 439 ASN B 452 1 ? 14 
HELX_P HELX_P42  42  GLU B 459 ? SER B 461 ? GLU B 459 SER B 461 5 ? 3  
HELX_P HELX_P43  43  ARG B 462 ? ASN B 477 ? ARG B 462 ASN B 477 1 ? 16 
HELX_P HELX_P44  44  HIS B 478 ? GLY B 489 ? HIS B 478 GLY B 489 1 ? 12 
HELX_P HELX_P45  45  SER B 492 ? ALA B 508 ? SER B 492 ALA B 508 1 ? 17 
HELX_P HELX_P46  46  GLY C 102 ? LEU C 106 ? GLY C 102 LEU C 106 5 ? 5  
HELX_P HELX_P47  47  LEU C 152 ? VAL C 159 ? LEU C 152 VAL C 159 1 ? 8  
HELX_P HELX_P48  48  GLY C 176 ? GLN C 188 ? GLY C 176 GLN C 188 1 ? 13 
HELX_P HELX_P49  49  GLN C 188 ? ASN C 193 ? GLN C 188 ASN C 193 1 ? 6  
HELX_P HELX_P50  50  LYS C 211 ? HIS C 225 ? LYS C 211 HIS C 225 1 ? 15 
HELX_P HELX_P51  51  ALA C 241 ? ASP C 261 ? ALA C 241 ASP C 261 1 ? 21 
HELX_P HELX_P52  52  ASP C 272 ? LEU C 287 ? ASP C 272 LEU C 287 1 ? 16 
HELX_P HELX_P53  53  GLY C 292 ? TYR C 296 ? GLY C 292 TYR C 296 5 ? 5  
HELX_P HELX_P54  54  PHE C 301 ? ARG C 310 ? PHE C 301 ARG C 310 1 ? 10 
HELX_P HELX_P55  55  SER C 315 ? GLY C 319 ? SER C 315 GLY C 319 5 ? 5  
HELX_P HELX_P56  56  ALA C 338 ? THR C 348 ? ALA C 338 THR C 348 1 ? 11 
HELX_P HELX_P57  57  GLU C 355 ? TYR C 360 ? GLU C 355 TYR C 360 1 ? 6  
HELX_P HELX_P58  58  VAL C 376 ? GLN C 381 ? VAL C 376 GLN C 381 5 ? 6  
HELX_P HELX_P59  59  VAL C 382 ? ALA C 389 ? VAL C 382 ALA C 389 1 ? 8  
HELX_P HELX_P60  60  SER C 391 ? ALA C 404 ? SER C 391 ALA C 404 1 ? 14 
HELX_P HELX_P61  61  SER C 415 ? LEU C 430 ? SER C 415 LEU C 430 1 ? 16 
HELX_P HELX_P62  62  ALA C 439 ? ASN C 452 ? ALA C 439 ASN C 452 1 ? 14 
HELX_P HELX_P63  63  GLU C 459 ? SER C 461 ? GLU C 459 SER C 461 5 ? 3  
HELX_P HELX_P64  64  ARG C 462 ? ASN C 477 ? ARG C 462 ASN C 477 1 ? 16 
HELX_P HELX_P65  65  HIS C 478 ? GLY C 489 ? HIS C 478 GLY C 489 1 ? 12 
HELX_P HELX_P66  66  SER C 492 ? SER C 505 ? SER C 492 SER C 505 1 ? 14 
HELX_P HELX_P67  67  GLY D 94  ? LEU D 98  ? GLY D 88  LEU D 92  5 ? 5  
HELX_P HELX_P68  68  SER D 129 ? GLN D 133 ? SER D 123 GLN D 127 5 ? 5  
HELX_P HELX_P69  69  ILE D 144 ? ALA D 151 ? ILE D 138 ALA D 145 1 ? 8  
HELX_P HELX_P70  70  GLY D 168 ? ILE D 180 ? GLY D 162 ILE D 174 1 ? 13 
HELX_P HELX_P71  71  ARG D 196 ? THR D 210 ? ARG D 190 THR D 204 1 ? 15 
HELX_P HELX_P72  72  PRO D 231 ? GLU D 252 ? PRO D 225 GLU D 246 1 ? 22 
HELX_P HELX_P73  73  ASN D 263 ? LEU D 278 ? ASN D 257 LEU D 272 1 ? 16 
HELX_P HELX_P74  74  SER D 283 ? TYR D 287 ? SER D 277 TYR D 281 5 ? 5  
HELX_P HELX_P75  75  THR D 290 ? GLU D 300 ? THR D 284 GLU D 294 1 ? 11 
HELX_P HELX_P76  76  PRO D 319 ? ASP D 322 ? PRO D 313 ASP D 316 5 ? 4  
HELX_P HELX_P77  77  ASP D 325 ? ALA D 333 ? ASP D 319 ALA D 327 1 ? 9  
HELX_P HELX_P78  78  SER D 342 ? GLU D 347 ? SER D 336 GLU D 341 1 ? 6  
HELX_P HELX_P79  79  ASP D 365 ? GLY D 370 ? ASP D 359 GLY D 364 1 ? 6  
HELX_P HELX_P80  80  GLY D 370 ? GLY D 398 ? GLY D 364 GLY D 392 1 ? 29 
HELX_P HELX_P81  81  SER D 403 ? LEU D 420 ? SER D 397 LEU D 414 1 ? 18 
HELX_P HELX_P82  82  ALA D 427 ? GLY D 432 ? ALA D 421 GLY D 426 1 ? 6  
HELX_P HELX_P83  83  ARG D 439 ? GLU D 452 ? ARG D 433 GLU D 446 1 ? 14 
HELX_P HELX_P84  84  GLU D 460 ? TYR D 464 ? GLU D 454 TYR D 458 5 ? 5  
HELX_P HELX_P85  85  GLY D 468 ? LEU D 479 ? GLY D 462 LEU D 473 1 ? 12 
HELX_P HELX_P86  86  GLY E 94  ? LEU E 98  ? GLY E 88  LEU E 92  5 ? 5  
HELX_P HELX_P87  87  ILE E 144 ? ALA E 151 ? ILE E 138 ALA E 145 1 ? 8  
HELX_P HELX_P88  88  GLY E 168 ? ALA E 183 ? GLY E 162 ALA E 177 1 ? 16 
HELX_P HELX_P89  89  ARG E 196 ? GLY E 211 ? ARG E 190 GLY E 205 1 ? 16 
HELX_P HELX_P90  90  PRO E 231 ? GLU E 252 ? PRO E 225 GLU E 246 1 ? 22 
HELX_P HELX_P91  91  ASN E 263 ? GLY E 279 ? ASN E 257 GLY E 273 1 ? 17 
HELX_P HELX_P92  92  SER E 283 ? TYR E 287 ? SER E 277 TYR E 281 5 ? 5  
HELX_P HELX_P93  93  THR E 290 ? GLU E 300 ? THR E 284 GLU E 294 1 ? 11 
HELX_P HELX_P94  94  VAL E 318 ? ASP E 322 ? VAL E 312 ASP E 316 5 ? 5  
HELX_P HELX_P95  95  ASP E 325 ? ALA E 333 ? ASP E 319 ALA E 327 1 ? 9  
HELX_P HELX_P96  96  SER E 342 ? GLU E 347 ? SER E 336 GLU E 341 1 ? 6  
HELX_P HELX_P97  97  ASP E 365 ? GLY E 370 ? ASP E 359 GLY E 364 1 ? 6  
HELX_P HELX_P98  98  GLY E 370 ? LEU E 397 ? GLY E 364 LEU E 391 1 ? 28 
HELX_P HELX_P99  99  GLN E 405 ? LEU E 420 ? GLN E 399 LEU E 414 1 ? 16 
HELX_P HELX_P100 100 ALA E 427 ? GLY E 432 ? ALA E 421 GLY E 426 1 ? 6  
HELX_P HELX_P101 101 ARG E 439 ? GLY E 453 ? ARG E 433 GLY E 447 1 ? 15 
HELX_P HELX_P102 102 PRO E 459 ? TYR E 464 ? PRO E 453 TYR E 458 1 ? 6  
HELX_P HELX_P103 103 GLY E 468 ? LEU E 479 ? GLY E 462 LEU E 473 1 ? 12 
HELX_P HELX_P104 104 GLY F 94  ? LEU F 98  ? GLY F 88  LEU F 92  5 ? 5  
HELX_P HELX_P105 105 ILE F 144 ? ALA F 151 ? ILE F 138 ALA F 145 1 ? 8  
HELX_P HELX_P106 106 GLY F 168 ? ILE F 180 ? GLY F 162 ILE F 174 1 ? 13 
HELX_P HELX_P107 107 ARG F 196 ? THR F 210 ? ARG F 190 THR F 204 1 ? 15 
HELX_P HELX_P108 108 PRO F 231 ? GLU F 252 ? PRO F 225 GLU F 246 1 ? 22 
HELX_P HELX_P109 109 ILE F 264 ? ALA F 276 ? ILE F 258 ALA F 270 1 ? 13 
HELX_P HELX_P110 110 SER F 283 ? TYR F 287 ? SER F 277 TYR F 281 5 ? 5  
HELX_P HELX_P111 111 THR F 290 ? GLU F 300 ? THR F 284 GLU F 294 1 ? 11 
HELX_P HELX_P112 112 PRO F 319 ? ASP F 322 ? PRO F 313 ASP F 316 5 ? 4  
HELX_P HELX_P113 113 ASP F 325 ? PHE F 332 ? ASP F 319 PHE F 326 1 ? 8  
HELX_P HELX_P114 114 ALA F 333 ? LEU F 335 ? ALA F 327 LEU F 329 5 ? 3  
HELX_P HELX_P115 115 SER F 342 ? GLU F 347 ? SER F 336 GLU F 341 1 ? 6  
HELX_P HELX_P116 116 ASP F 365 ? GLY F 370 ? ASP F 359 GLY F 364 1 ? 6  
HELX_P HELX_P117 117 GLY F 370 ? GLY F 398 ? GLY F 364 GLY F 392 1 ? 29 
HELX_P HELX_P118 118 MET F 399 ? LEU F 402 ? MET F 393 LEU F 396 5 ? 4  
HELX_P HELX_P119 119 SER F 403 ? LEU F 420 ? SER F 397 LEU F 414 1 ? 18 
HELX_P HELX_P120 120 PHE F 424 ? VAL F 426 ? PHE F 418 VAL F 420 5 ? 3  
HELX_P HELX_P121 121 ALA F 427 ? GLY F 432 ? ALA F 421 GLY F 426 1 ? 6  
HELX_P HELX_P122 122 ARG F 439 ? GLU F 452 ? ARG F 433 GLU F 446 1 ? 14 
HELX_P HELX_P123 123 PRO F 459 ? PHE F 463 ? PRO F 453 PHE F 457 5 ? 5  
HELX_P HELX_P124 124 GLY F 468 ? LEU F 479 ? GLY F 462 LEU F 473 1 ? 12 
HELX_P HELX_P125 125 THR G 2   ? GLU G 56  ? THR G 2   GLU G 56  1 ? 55 
HELX_P HELX_P126 126 HIS G 88  ? ASN G 100 ? HIS G 88  ASN G 100 1 ? 13 
HELX_P HELX_P127 127 GLY G 111 ? ARG G 120 ? GLY G 111 ARG G 120 1 ? 10 
HELX_P HELX_P128 128 THR G 139 ? VAL G 153 ? THR G 139 VAL G 153 1 ? 15 
HELX_P HELX_P129 129 LYS G 155 ? TYR G 159 ? LYS G 155 TYR G 159 5 ? 5  
HELX_P HELX_P130 130 ASN G 184 ? GLN G 190 ? ASN G 184 GLN G 190 1 ? 7  
HELX_P HELX_P131 131 SER G 191 ? PHE G 197 ? SER G 191 PHE G 197 5 ? 7  
HELX_P HELX_P132 132 ASN G 204 ? GLY G 273 ? ASN G 204 GLY G 273 1 ? 70 
HELX_P HELX_P133 133 GLU H 94  ? PHE H 96  ? GLU H 94  PHE H 96  5 ? 3  
HELX_P HELX_P134 134 LYS H 102 ? ASN H 111 ? LYS H 102 ASN H 111 1 ? 10 
HELX_P HELX_P135 135 GLU H 119 ? ALA H 124 ? GLU H 119 ALA H 124 1 ? 6  
HELX_P HELX_P136 136 GLN H 126 ? GLN H 134 ? GLN H 126 GLN H 134 1 ? 9  
HELX_P HELX_P137 137 ALA I 11  ? SER I 23  ? ALA I 11  SER I 23  1 ? 13 
HELX_P HELX_P138 138 SER I 24  ? LEU I 25  ? SER I 24  LEU I 25  5 ? 2  
HELX_P HELX_P139 139 LYS I 26  ? GLN I 30  ? LYS I 26  GLN I 30  5 ? 5  
HELX_P HELX_P140 140 THR I 31  ? GLN I 39  ? THR I 31  GLN I 39  1 ? 9  
HELX_P HELX_P141 141 SER J 80  ? VAL J 84  ? SER J 80  VAL J 84  5 ? 5  
HELX_P HELX_P142 142 GLY J 102 ? LEU J 106 ? GLY J 102 LEU J 106 5 ? 5  
HELX_P HELX_P143 143 LEU J 152 ? VAL J 159 ? LEU J 152 VAL J 159 1 ? 8  
HELX_P HELX_P144 144 GLY J 176 ? GLN J 188 ? GLY J 176 GLN J 188 1 ? 13 
HELX_P HELX_P145 145 LYS J 189 ? TRP J 191 ? LYS J 189 TRP J 191 5 ? 3  
HELX_P HELX_P146 146 LYS J 211 ? HIS J 225 ? LYS J 211 HIS J 225 1 ? 15 
HELX_P HELX_P147 147 ASP J 226 ? LYS J 229 ? ASP J 226 LYS J 229 5 ? 4  
HELX_P HELX_P148 148 ALA J 241 ? ASP J 261 ? ALA J 241 ASP J 261 1 ? 21 
HELX_P HELX_P149 149 ASP J 272 ? LEU J 287 ? ASP J 272 LEU J 287 1 ? 16 
HELX_P HELX_P150 150 GLY J 292 ? TYR J 296 ? GLY J 292 TYR J 296 5 ? 5  
HELX_P HELX_P151 151 VAL J 300 ? GLU J 309 ? VAL J 300 GLU J 309 1 ? 10 
HELX_P HELX_P152 152 ALA J 338 ? THR J 348 ? ALA J 338 THR J 348 1 ? 11 
HELX_P HELX_P153 153 GLU J 355 ? LYS J 361 ? GLU J 355 LYS J 361 1 ? 7  
HELX_P HELX_P154 154 VAL J 376 ? GLN J 381 ? VAL J 376 GLN J 381 5 ? 6  
HELX_P HELX_P155 155 VAL J 382 ? GLY J 390 ? VAL J 382 GLY J 390 1 ? 9  
HELX_P HELX_P156 156 LEU J 392 ? GLU J 401 ? LEU J 392 GLU J 401 1 ? 10 
HELX_P HELX_P157 157 VAL J 402 ? ALA J 406 ? VAL J 402 ALA J 406 5 ? 5  
HELX_P HELX_P158 158 THR J 416 ? LYS J 431 ? THR J 416 LYS J 431 1 ? 16 
HELX_P HELX_P159 159 ALA J 439 ? ASN J 452 ? ALA J 439 ASN J 452 1 ? 14 
HELX_P HELX_P160 160 GLU J 459 ? SER J 461 ? GLU J 459 SER J 461 5 ? 3  
HELX_P HELX_P161 161 ARG J 462 ? ASN J 477 ? ARG J 462 ASN J 477 1 ? 16 
HELX_P HELX_P162 162 HIS J 478 ? GLY J 489 ? HIS J 478 GLY J 489 1 ? 12 
HELX_P HELX_P163 163 SER J 492 ? ALA J 508 ? SER J 492 ALA J 508 1 ? 17 
HELX_P HELX_P164 164 SER K 80  ? VAL K 84  ? SER K 80  VAL K 84  5 ? 5  
HELX_P HELX_P165 165 LEU K 152 ? VAL K 159 ? LEU K 152 VAL K 159 1 ? 8  
HELX_P HELX_P166 166 GLY K 176 ? GLN K 188 ? GLY K 176 GLN K 188 1 ? 13 
HELX_P HELX_P167 167 GLN K 188 ? ASN K 193 ? GLN K 188 ASN K 193 1 ? 6  
HELX_P HELX_P168 168 LYS K 211 ? HIS K 225 ? LYS K 211 HIS K 225 1 ? 15 
HELX_P HELX_P169 169 ALA K 241 ? ASN K 262 ? ALA K 241 ASN K 262 1 ? 22 
HELX_P HELX_P170 170 ASP K 272 ? LEU K 287 ? ASP K 272 LEU K 287 1 ? 16 
HELX_P HELX_P171 171 GLY K 292 ? TYR K 296 ? GLY K 292 TYR K 296 5 ? 5  
HELX_P HELX_P172 172 PRO K 297 ? GLY K 298 ? PRO K 297 GLY K 298 5 ? 2  
HELX_P HELX_P173 173 ASP K 299 ? GLU K 309 ? ASP K 299 GLU K 309 1 ? 11 
HELX_P HELX_P174 174 ALA K 338 ? SER K 346 ? ALA K 338 SER K 346 1 ? 9  
HELX_P HELX_P175 175 GLU K 355 ? LYS K 361 ? GLU K 355 LYS K 361 1 ? 7  
HELX_P HELX_P176 176 VAL K 382 ? ALA K 389 ? VAL K 382 ALA K 389 1 ? 8  
HELX_P HELX_P177 177 SER K 391 ? ALA K 403 ? SER K 391 ALA K 403 1 ? 13 
HELX_P HELX_P178 178 THR K 416 ? LEU K 430 ? THR K 416 LEU K 430 1 ? 15 
HELX_P HELX_P179 179 ALA K 439 ? ASN K 452 ? ALA K 439 ASN K 452 1 ? 14 
HELX_P HELX_P180 180 ARG K 462 ? TYR K 473 ? ARG K 462 TYR K 473 1 ? 12 
HELX_P HELX_P181 181 HIS K 478 ? GLY K 489 ? HIS K 478 GLY K 489 1 ? 12 
HELX_P HELX_P182 182 SER K 492 ? VAL K 507 ? SER K 492 VAL K 507 1 ? 16 
HELX_P HELX_P183 183 GLY L 102 ? LEU L 106 ? GLY L 102 LEU L 106 5 ? 5  
HELX_P HELX_P184 184 LEU L 152 ? VAL L 159 ? LEU L 152 VAL L 159 1 ? 8  
HELX_P HELX_P185 185 GLY L 176 ? ASN L 187 ? GLY L 176 ASN L 187 1 ? 12 
HELX_P HELX_P186 186 GLN L 188 ? ASN L 193 ? GLN L 188 ASN L 193 1 ? 6  
HELX_P HELX_P187 187 ASP L 196 ? LYS L 199 ? ASP L 196 LYS L 199 5 ? 4  
HELX_P HELX_P188 188 LYS L 211 ? HIS L 225 ? LYS L 211 HIS L 225 1 ? 15 
HELX_P HELX_P189 189 ALA L 227 ? LYS L 229 ? ALA L 227 LYS L 229 5 ? 3  
HELX_P HELX_P190 190 ALA L 241 ? ASN L 262 ? ALA L 241 ASN L 262 1 ? 22 
HELX_P HELX_P191 191 ASP L 272 ? ARG L 288 ? ASP L 272 ARG L 288 1 ? 17 
HELX_P HELX_P192 192 GLY L 292 ? TYR L 296 ? GLY L 292 TYR L 296 5 ? 5  
HELX_P HELX_P193 193 VAL L 300 ? GLU L 309 ? VAL L 300 GLU L 309 1 ? 10 
HELX_P HELX_P194 194 ALA L 338 ? SER L 346 ? ALA L 338 SER L 346 1 ? 9  
HELX_P HELX_P195 195 GLU L 355 ? TYR L 360 ? GLU L 355 TYR L 360 1 ? 6  
HELX_P HELX_P196 196 VAL L 376 ? GLN L 381 ? VAL L 376 GLN L 381 5 ? 6  
HELX_P HELX_P197 197 VAL L 382 ? VAL L 388 ? VAL L 382 VAL L 388 1 ? 7  
HELX_P HELX_P198 198 SER L 391 ? GLU L 401 ? SER L 391 GLU L 401 1 ? 11 
HELX_P HELX_P199 199 LYS L 417 ? GLN L 428 ? LYS L 417 GLN L 428 1 ? 12 
HELX_P HELX_P200 200 ALA L 439 ? GLY L 453 ? ALA L 439 GLY L 453 1 ? 15 
HELX_P HELX_P201 201 GLU L 465 ? ASN L 477 ? GLU L 465 ASN L 477 1 ? 13 
HELX_P HELX_P202 202 HIS L 478 ? GLY L 489 ? HIS L 478 GLY L 489 1 ? 12 
HELX_P HELX_P203 203 SER L 492 ? VAL L 507 ? SER L 492 VAL L 507 1 ? 16 
HELX_P HELX_P204 204 ILE M 144 ? ALA M 151 ? ILE M 138 ALA M 145 1 ? 8  
HELX_P HELX_P205 205 GLY M 168 ? ALA M 181 ? GLY M 162 ALA M 175 1 ? 14 
HELX_P HELX_P206 206 THR M 197 ? GLU M 209 ? THR M 191 GLU M 203 1 ? 13 
HELX_P HELX_P207 207 PRO M 231 ? GLU M 252 ? PRO M 225 GLU M 246 1 ? 22 
HELX_P HELX_P208 208 ILE M 264 ? LEU M 278 ? ILE M 258 LEU M 272 1 ? 15 
HELX_P HELX_P209 209 SER M 283 ? TYR M 287 ? SER M 277 TYR M 281 5 ? 5  
HELX_P HELX_P210 210 THR M 290 ? GLU M 300 ? THR M 284 GLU M 294 1 ? 11 
HELX_P HELX_P211 211 PRO M 319 ? ASP M 322 ? PRO M 313 ASP M 316 5 ? 4  
HELX_P HELX_P212 212 ASP M 325 ? ALA M 333 ? ASP M 319 ALA M 327 1 ? 9  
HELX_P HELX_P213 213 SER M 342 ? LEU M 348 ? SER M 336 LEU M 342 1 ? 7  
HELX_P HELX_P214 214 ASP M 365 ? GLY M 370 ? ASP M 359 GLY M 364 1 ? 6  
HELX_P HELX_P215 215 GLY M 370 ? LEU M 390 ? GLY M 364 LEU M 384 1 ? 21 
HELX_P HELX_P216 216 SER M 403 ? ARG M 418 ? SER M 397 ARG M 412 1 ? 16 
HELX_P HELX_P217 217 PHE M 419 ? SER M 421 ? PHE M 413 SER M 415 5 ? 3  
HELX_P HELX_P218 218 ALA M 427 ? GLY M 432 ? ALA M 421 GLY M 426 1 ? 6  
HELX_P HELX_P219 219 ARG M 439 ? GLY M 453 ? ARG M 433 GLY M 447 1 ? 15 
HELX_P HELX_P220 220 SER N 129 ? GLN N 133 ? SER N 123 GLN N 127 5 ? 5  
HELX_P HELX_P221 221 ILE N 144 ? ALA N 151 ? ILE N 138 ALA N 145 1 ? 8  
HELX_P HELX_P222 222 GLY N 168 ? ALA N 183 ? GLY N 162 ALA N 177 1 ? 16 
HELX_P HELX_P223 223 ARG N 196 ? GLU N 209 ? ARG N 190 GLU N 203 1 ? 14 
HELX_P HELX_P224 224 PRO N 231 ? GLU N 252 ? PRO N 225 GLU N 246 1 ? 22 
HELX_P HELX_P225 225 ILE N 264 ? LEU N 278 ? ILE N 258 LEU N 272 1 ? 15 
HELX_P HELX_P226 226 SER N 283 ? TYR N 287 ? SER N 277 TYR N 281 5 ? 5  
HELX_P HELX_P227 227 THR N 290 ? GLU N 300 ? THR N 284 GLU N 294 1 ? 11 
HELX_P HELX_P228 228 VAL N 318 ? ASP N 322 ? VAL N 312 ASP N 316 5 ? 5  
HELX_P HELX_P229 229 ASP N 325 ? PHE N 332 ? ASP N 319 PHE N 326 1 ? 8  
HELX_P HELX_P230 230 SER N 342 ? GLU N 347 ? SER N 336 GLU N 341 1 ? 6  
HELX_P HELX_P231 231 ASP N 365 ? LEU N 390 ? ASP N 359 LEU N 384 1 ? 26 
HELX_P HELX_P232 232 ASP N 392 ? LEU N 397 ? ASP N 386 LEU N 391 1 ? 6  
HELX_P HELX_P233 233 GLU N 404 ? SER N 421 ? GLU N 398 SER N 415 1 ? 18 
HELX_P HELX_P234 234 ALA N 427 ? GLY N 432 ? ALA N 421 GLY N 426 1 ? 6  
HELX_P HELX_P235 235 ARG N 439 ? GLY N 453 ? ARG N 433 GLY N 447 1 ? 15 
HELX_P HELX_P236 236 PRO N 459 ? PHE N 463 ? PRO N 453 PHE N 457 5 ? 5  
HELX_P HELX_P237 237 GLY N 468 ? GLU N 470 ? GLY N 462 GLU N 464 5 ? 3  
HELX_P HELX_P238 238 ASP N 471 ? GLU N 477 ? ASP N 465 GLU N 471 1 ? 7  
HELX_P HELX_P239 239 GLY O 94  ? LEU O 98  ? GLY O 88  LEU O 92  5 ? 5  
HELX_P HELX_P240 240 ILE O 144 ? LEU O 150 ? ILE O 138 LEU O 144 1 ? 7  
HELX_P HELX_P241 241 GLY O 168 ? GLY O 185 ? GLY O 162 GLY O 179 1 ? 18 
HELX_P HELX_P242 242 THR O 197 ? THR O 210 ? THR O 191 THR O 204 1 ? 14 
HELX_P HELX_P243 243 PRO O 231 ? GLU O 252 ? PRO O 225 GLU O 246 1 ? 22 
HELX_P HELX_P244 244 ILE O 264 ? LEU O 278 ? ILE O 258 LEU O 272 1 ? 15 
HELX_P HELX_P245 245 SER O 283 ? TYR O 287 ? SER O 277 TYR O 281 5 ? 5  
HELX_P HELX_P246 246 GLN O 288 ? PRO O 289 ? GLN O 282 PRO O 283 5 ? 2  
HELX_P HELX_P247 247 THR O 290 ? GLU O 300 ? THR O 284 GLU O 294 1 ? 11 
HELX_P HELX_P248 248 PRO O 319 ? ASP O 322 ? PRO O 313 ASP O 316 5 ? 4  
HELX_P HELX_P249 249 ASP O 325 ? PHE O 332 ? ASP O 319 PHE O 326 1 ? 8  
HELX_P HELX_P250 250 ALA O 333 ? LEU O 335 ? ALA O 327 LEU O 329 5 ? 3  
HELX_P HELX_P251 251 SER O 342 ? GLU O 347 ? SER O 336 GLU O 341 1 ? 6  
HELX_P HELX_P252 252 ASP O 365 ? GLY O 370 ? ASP O 359 GLY O 364 1 ? 6  
HELX_P HELX_P253 253 GLY O 370 ? SER O 389 ? GLY O 364 SER O 383 1 ? 20 
HELX_P HELX_P254 254 LEU O 390 ? GLY O 398 ? LEU O 384 GLY O 392 1 ? 9  
HELX_P HELX_P255 255 ASP O 406 ? LEU O 420 ? ASP O 400 LEU O 414 1 ? 15 
HELX_P HELX_P256 256 ALA O 427 ? GLY O 432 ? ALA O 421 GLY O 426 1 ? 6  
HELX_P HELX_P257 257 ARG O 439 ? GLU O 452 ? ARG O 433 GLU O 446 1 ? 14 
HELX_P HELX_P258 258 PRO O 459 ? PHE O 463 ? PRO O 453 PHE O 457 5 ? 5  
HELX_P HELX_P259 259 GLY O 468 ? ALA O 481 ? GLY O 462 ALA O 475 1 ? 14 
HELX_P HELX_P260 260 THR P 2   ? ALA P 27  ? THR P 2   ALA P 27  1 ? 26 
HELX_P HELX_P261 261 SER P 28  ? ALA P 47  ? SER P 28  ALA P 47  1 ? 20 
HELX_P HELX_P262 262 SER P 86  ? ASN P 100 ? SER P 86  ASN P 100 1 ? 15 
HELX_P HELX_P263 263 ASP P 112 ? HIS P 122 ? ASP P 112 HIS P 122 1 ? 11 
HELX_P HELX_P264 264 THR P 139 ? VAL P 153 ? THR P 139 VAL P 153 1 ? 15 
HELX_P HELX_P265 265 LYS P 155 ? TYR P 159 ? LYS P 155 TYR P 159 5 ? 5  
HELX_P HELX_P266 266 ASN P 184 ? GLN P 190 ? ASN P 184 GLN P 190 1 ? 7  
HELX_P HELX_P267 267 PRO P 206 ? ALA P 228 ? PRO P 206 ALA P 228 1 ? 23 
HELX_P HELX_P268 268 ALA P 228 ? ALA P 244 ? ALA P 228 ALA P 244 1 ? 17 
HELX_P HELX_P269 269 ASP P 246 ? SER P 276 ? ASP P 246 SER P 276 1 ? 31 
HELX_P HELX_P270 270 ALA Q 106 ? ASN Q 111 ? ALA Q 106 ASN Q 111 1 ? 6  
HELX_P HELX_P271 271 GLU Q 119 ? GLN Q 134 ? GLU Q 119 GLN Q 134 1 ? 16 
HELX_P HELX_P272 272 SER R 9   ? ILE R 21  ? SER R 9   ILE R 21  1 ? 13 
HELX_P HELX_P273 273 THR R 31  ? ASN R 36  ? THR R 31  ASN R 36  1 ? 6  
HELX_P HELX_P274 274 SER S 80  ? VAL S 84  ? SER S 80  VAL S 84  5 ? 5  
HELX_P HELX_P275 275 GLY S 102 ? LEU S 106 ? GLY S 102 LEU S 106 5 ? 5  
HELX_P HELX_P276 276 LEU S 152 ? VAL S 159 ? LEU S 152 VAL S 159 1 ? 8  
HELX_P HELX_P277 277 GLY S 176 ? GLN S 188 ? GLY S 176 GLN S 188 1 ? 13 
HELX_P HELX_P278 278 GLN S 188 ? ASN S 193 ? GLN S 188 ASN S 193 1 ? 6  
HELX_P HELX_P279 279 LYS S 211 ? HIS S 225 ? LYS S 211 HIS S 225 1 ? 15 
HELX_P HELX_P280 280 ALA S 241 ? ASN S 262 ? ALA S 241 ASN S 262 1 ? 22 
HELX_P HELX_P281 281 ASP S 272 ? LEU S 287 ? ASP S 272 LEU S 287 1 ? 16 
HELX_P HELX_P282 282 GLY S 292 ? TYR S 296 ? GLY S 292 TYR S 296 5 ? 5  
HELX_P HELX_P283 283 ASP S 299 ? GLU S 309 ? ASP S 299 GLU S 309 1 ? 11 
HELX_P HELX_P284 284 SER S 315 ? GLY S 319 ? SER S 315 GLY S 319 5 ? 5  
HELX_P HELX_P285 285 ALA S 338 ? SER S 346 ? ALA S 338 SER S 346 1 ? 9  
HELX_P HELX_P286 286 GLU S 355 ? LYS S 361 ? GLU S 355 LYS S 361 1 ? 7  
HELX_P HELX_P287 287 VAL S 376 ? GLN S 381 ? VAL S 376 GLN S 381 5 ? 6  
HELX_P HELX_P288 288 VAL S 382 ? ALA S 389 ? VAL S 382 ALA S 389 1 ? 8  
HELX_P HELX_P289 289 SER S 391 ? ALA S 403 ? SER S 391 ALA S 403 1 ? 13 
HELX_P HELX_P290 290 ALA S 404 ? ALA S 406 ? ALA S 404 ALA S 406 5 ? 3  
HELX_P HELX_P291 291 ASP S 413 ? LYS S 431 ? ASP S 413 LYS S 431 1 ? 19 
HELX_P HELX_P292 292 ALA S 439 ? ASN S 452 ? ALA S 439 ASN S 452 1 ? 14 
HELX_P HELX_P293 293 GLU S 459 ? SER S 461 ? GLU S 459 SER S 461 5 ? 3  
HELX_P HELX_P294 294 ARG S 462 ? HIS S 478 ? ARG S 462 HIS S 478 1 ? 17 
HELX_P HELX_P295 295 HIS S 478 ? GLY S 489 ? HIS S 478 GLY S 489 1 ? 12 
HELX_P HELX_P296 296 SER S 492 ? PHE S 510 ? SER S 492 PHE S 510 1 ? 19 
HELX_P HELX_P297 297 SER T 80  ? VAL T 84  ? SER T 80  VAL T 84  5 ? 5  
HELX_P HELX_P298 298 LEU T 152 ? VAL T 159 ? LEU T 152 VAL T 159 1 ? 8  
HELX_P HELX_P299 299 GLY T 176 ? GLN T 188 ? GLY T 176 GLN T 188 1 ? 13 
HELX_P HELX_P300 300 GLN T 188 ? ASN T 193 ? GLN T 188 ASN T 193 1 ? 6  
HELX_P HELX_P301 301 ASP T 196 ? LYS T 200 ? ASP T 196 LYS T 200 5 ? 5  
HELX_P HELX_P302 302 LYS T 211 ? HIS T 225 ? LYS T 211 HIS T 225 1 ? 15 
HELX_P HELX_P303 303 ALA T 227 ? LYS T 229 ? ALA T 227 LYS T 229 5 ? 3  
HELX_P HELX_P304 304 ALA T 241 ? ASN T 262 ? ALA T 241 ASN T 262 1 ? 22 
HELX_P HELX_P305 305 ASP T 272 ? LEU T 287 ? ASP T 272 LEU T 287 1 ? 16 
HELX_P HELX_P306 306 GLY T 292 ? TYR T 296 ? GLY T 292 TYR T 296 5 ? 5  
HELX_P HELX_P307 307 ASP T 299 ? GLU T 309 ? ASP T 299 GLU T 309 1 ? 11 
HELX_P HELX_P308 308 SER T 315 ? GLY T 319 ? SER T 315 GLY T 319 5 ? 5  
HELX_P HELX_P309 309 ALA T 338 ? SER T 346 ? ALA T 338 SER T 346 1 ? 9  
HELX_P HELX_P310 310 GLU T 355 ? GLY T 362 ? GLU T 355 GLY T 362 1 ? 8  
HELX_P HELX_P311 311 VAL T 382 ? GLY T 390 ? VAL T 382 GLY T 390 1 ? 9  
HELX_P HELX_P312 312 SER T 391 ? PHE T 405 ? SER T 391 PHE T 405 1 ? 15 
HELX_P HELX_P313 313 SER T 415 ? LYS T 431 ? SER T 415 LYS T 431 1 ? 17 
HELX_P HELX_P314 314 ALA T 439 ? ASN T 452 ? ALA T 439 ASN T 452 1 ? 14 
HELX_P HELX_P315 315 GLU T 459 ? SER T 461 ? GLU T 459 SER T 461 5 ? 3  
HELX_P HELX_P316 316 ARG T 462 ? HIS T 478 ? ARG T 462 HIS T 478 1 ? 17 
HELX_P HELX_P317 317 HIS T 478 ? GLY T 489 ? HIS T 478 GLY T 489 1 ? 12 
HELX_P HELX_P318 318 SER T 492 ? THR T 509 ? SER T 492 THR T 509 1 ? 18 
HELX_P HELX_P319 319 SER U 80  ? VAL U 84  ? SER U 80  VAL U 84  5 ? 5  
HELX_P HELX_P320 320 GLY U 102 ? LEU U 106 ? GLY U 102 LEU U 106 5 ? 5  
HELX_P HELX_P321 321 LEU U 152 ? VAL U 159 ? LEU U 152 VAL U 159 1 ? 8  
HELX_P HELX_P322 322 GLY U 176 ? GLN U 188 ? GLY U 176 GLN U 188 1 ? 13 
HELX_P HELX_P323 323 LYS U 189 ? TRP U 191 ? LYS U 189 TRP U 191 5 ? 3  
HELX_P HELX_P324 324 LYS U 211 ? GLN U 224 ? LYS U 211 GLN U 224 1 ? 14 
HELX_P HELX_P325 325 ALA U 227 ? LYS U 229 ? ALA U 227 LYS U 229 5 ? 3  
HELX_P HELX_P326 326 ALA U 241 ? ASN U 262 ? ALA U 241 ASN U 262 1 ? 22 
HELX_P HELX_P327 327 ASP U 272 ? LEU U 287 ? ASP U 272 LEU U 287 1 ? 16 
HELX_P HELX_P328 328 GLY U 292 ? TYR U 296 ? GLY U 292 TYR U 296 5 ? 5  
HELX_P HELX_P329 329 ASP U 299 ? GLU U 309 ? ASP U 299 GLU U 309 1 ? 11 
HELX_P HELX_P330 330 SER U 315 ? GLY U 319 ? SER U 315 GLY U 319 5 ? 5  
HELX_P HELX_P331 331 ALA U 338 ? THR U 348 ? ALA U 338 THR U 348 1 ? 11 
HELX_P HELX_P332 332 GLU U 355 ? LYS U 361 ? GLU U 355 LYS U 361 1 ? 7  
HELX_P HELX_P333 333 VAL U 376 ? GLN U 381 ? VAL U 376 GLN U 381 5 ? 6  
HELX_P HELX_P334 334 VAL U 382 ? ALA U 389 ? VAL U 382 ALA U 389 1 ? 8  
HELX_P HELX_P335 335 SER U 391 ? ALA U 404 ? SER U 391 ALA U 404 1 ? 14 
HELX_P HELX_P336 336 PHE U 405 ? GLY U 409 ? PHE U 405 GLY U 409 5 ? 5  
HELX_P HELX_P337 337 SER U 415 ? LEU U 430 ? SER U 415 LEU U 430 1 ? 16 
HELX_P HELX_P338 338 ALA U 439 ? ASN U 452 ? ALA U 439 ASN U 452 1 ? 14 
HELX_P HELX_P339 339 GLY U 453 ? ILE U 458 ? GLY U 453 ILE U 458 5 ? 6  
HELX_P HELX_P340 340 GLU U 459 ? SER U 461 ? GLU U 459 SER U 461 5 ? 3  
HELX_P HELX_P341 341 ARG U 462 ? ASN U 477 ? ARG U 462 ASN U 477 1 ? 16 
HELX_P HELX_P342 342 HIS U 478 ? GLY U 489 ? HIS U 478 GLY U 489 1 ? 12 
HELX_P HELX_P343 343 SER U 492 ? ALA U 508 ? SER U 492 ALA U 508 1 ? 17 
HELX_P HELX_P344 344 GLY V 94  ? LEU V 98  ? GLY V 88  LEU V 92  5 ? 5  
HELX_P HELX_P345 345 LYS V 169 ? ASN V 179 ? LYS V 163 ASN V 173 1 ? 11 
HELX_P HELX_P346 346 ARG V 196 ? MET V 207 ? ARG V 190 MET V 201 1 ? 12 
HELX_P HELX_P347 347 PRO V 231 ? GLU V 252 ? PRO V 225 GLU V 246 1 ? 22 
HELX_P HELX_P348 348 ASN V 263 ? GLY V 279 ? ASN V 257 GLY V 273 1 ? 17 
HELX_P HELX_P349 349 SER V 283 ? TYR V 287 ? SER V 277 TYR V 281 5 ? 5  
HELX_P HELX_P350 350 THR V 290 ? GLU V 300 ? THR V 284 GLU V 294 1 ? 11 
HELX_P HELX_P351 351 VAL V 318 ? ASP V 322 ? VAL V 312 ASP V 316 5 ? 5  
HELX_P HELX_P352 352 ASP V 325 ? PHE V 332 ? ASP V 319 PHE V 326 1 ? 8  
HELX_P HELX_P353 353 VAL V 369 ? TYR V 387 ? VAL V 363 TYR V 381 1 ? 19 
HELX_P HELX_P354 354 GLY W 94  ? LEU W 98  ? GLY W 88  LEU W 92  5 ? 5  
HELX_P HELX_P355 355 ILE W 144 ? ALA W 151 ? ILE W 138 ALA W 145 1 ? 8  
HELX_P HELX_P356 356 GLY W 168 ? GLY W 185 ? GLY W 162 GLY W 179 1 ? 18 
HELX_P HELX_P357 357 ARG W 196 ? GLU W 209 ? ARG W 190 GLU W 203 1 ? 14 
HELX_P HELX_P358 358 PRO W 231 ? GLY W 254 ? PRO W 225 GLY W 248 1 ? 24 
HELX_P HELX_P359 359 ASN W 263 ? LEU W 278 ? ASN W 257 LEU W 272 1 ? 16 
HELX_P HELX_P360 360 SER W 283 ? TYR W 287 ? SER W 277 TYR W 281 5 ? 5  
HELX_P HELX_P361 361 THR W 290 ? GLU W 300 ? THR W 284 GLU W 294 1 ? 11 
HELX_P HELX_P362 362 VAL W 318 ? ASP W 322 ? VAL W 312 ASP W 316 5 ? 5  
HELX_P HELX_P363 363 ASP W 325 ? ALA W 333 ? ASP W 319 ALA W 327 1 ? 9  
HELX_P HELX_P364 364 SER W 342 ? GLU W 347 ? SER W 336 GLU W 341 1 ? 6  
HELX_P HELX_P365 365 ASP W 365 ? LEU W 397 ? ASP W 359 LEU W 391 1 ? 33 
HELX_P HELX_P366 366 SER W 403 ? LEU W 420 ? SER W 397 LEU W 414 1 ? 18 
HELX_P HELX_P367 367 ALA W 427 ? GLY W 432 ? ALA W 421 GLY W 426 1 ? 6  
HELX_P HELX_P368 368 ARG W 439 ? GLU W 452 ? ARG W 433 GLU W 446 1 ? 14 
HELX_P HELX_P369 369 PRO W 459 ? TYR W 464 ? PRO W 453 TYR W 458 5 ? 6  
HELX_P HELX_P370 370 GLY W 468 ? ALA W 481 ? GLY W 462 ALA W 475 1 ? 14 
HELX_P HELX_P371 371 GLY X 94  ? LEU X 98  ? GLY X 88  LEU X 92  5 ? 5  
HELX_P HELX_P372 372 ILE X 144 ? LEU X 150 ? ILE X 138 LEU X 144 1 ? 7  
HELX_P HELX_P373 373 GLY X 168 ? ILE X 180 ? GLY X 162 ILE X 174 1 ? 13 
HELX_P HELX_P374 374 ARG X 196 ? GLY X 211 ? ARG X 190 GLY X 205 1 ? 16 
HELX_P HELX_P375 375 PRO X 231 ? ALA X 236 ? PRO X 225 ALA X 230 1 ? 6  
HELX_P HELX_P376 376 ARG X 237 ? GLU X 252 ? ARG X 231 GLU X 246 1 ? 16 
HELX_P HELX_P377 377 PHE X 265 ? GLY X 279 ? PHE X 259 GLY X 273 1 ? 15 
HELX_P HELX_P378 378 SER X 283 ? TYR X 287 ? SER X 277 TYR X 281 5 ? 5  
HELX_P HELX_P379 379 THR X 290 ? GLU X 300 ? THR X 284 GLU X 294 1 ? 11 
HELX_P HELX_P380 380 PRO X 319 ? ASP X 322 ? PRO X 313 ASP X 316 5 ? 4  
HELX_P HELX_P381 381 ASP X 325 ? PHE X 332 ? ASP X 319 PHE X 326 1 ? 8  
HELX_P HELX_P382 382 ALA X 333 ? LEU X 335 ? ALA X 327 LEU X 329 5 ? 3  
HELX_P HELX_P383 383 SER X 342 ? LEU X 348 ? SER X 336 LEU X 342 1 ? 7  
HELX_P HELX_P384 384 ASP X 365 ? GLY X 370 ? ASP X 359 GLY X 364 1 ? 6  
HELX_P HELX_P385 385 GLY X 370 ? LEU X 390 ? GLY X 364 LEU X 384 1 ? 21 
HELX_P HELX_P386 386 LEU X 390 ? GLY X 398 ? LEU X 384 GLY X 392 1 ? 9  
HELX_P HELX_P387 387 SER X 403 ? LEU X 420 ? SER X 397 LEU X 414 1 ? 18 
HELX_P HELX_P388 388 ALA X 427 ? GLY X 432 ? ALA X 421 GLY X 426 1 ? 6  
HELX_P HELX_P389 389 ARG X 439 ? GLU X 452 ? ARG X 433 GLU X 446 1 ? 14 
HELX_P HELX_P390 390 PRO X 459 ? PHE X 463 ? PRO X 453 PHE X 457 5 ? 5  
HELX_P HELX_P391 391 GLY X 468 ? ALA X 480 ? GLY X 462 ALA X 474 1 ? 13 
HELX_P HELX_P392 392 THR Y 2   ? ARG Y 30  ? THR Y 2   ARG Y 30  1 ? 29 
HELX_P HELX_P393 393 LEU Y 31  ? ILE Y 39  ? LEU Y 31  ILE Y 39  1 ? 9  
HELX_P HELX_P394 394 THR Y 139 ? LEU Y 145 ? THR Y 139 LEU Y 145 1 ? 7  
HELX_P HELX_P395 395 THR Y 213 ? GLY Y 273 ? THR Y 213 GLY Y 273 1 ? 61 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? DA ANP .   O2G ? ? ? 1_555 EA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc2  metalc ? ? D  THR 170 OG1 ? ? ? 1_555 GA MG . MG ? ? D THR 164 D MG 700 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc3  metalc ? ? C  THR 178 OG1 ? ? ? 1_555 EA MG . MG ? ? C THR 178 C MG 700 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc4  metalc ? ? Z  ANP .   O2G ? ? ? 1_555 AA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc5  metalc ? ? J  THR 178 OG1 ? ? ? 1_555 KA MG . MG ? ? J THR 178 J MG 700 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc6  metalc ? ? A  THR 178 OG1 ? ? ? 1_555 AA MG . MG ? ? A THR 178 A MG 700 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc7  metalc ? ? VA ANP .   O2B ? ? ? 1_555 WA MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc8  metalc ? ? F  THR 170 OG1 ? ? ? 1_555 IA MG . MG ? ? F THR 164 F MG 700 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc9  metalc ? ? TA ANP .   O2B ? ? ? 1_555 UA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc10 metalc ? ? XA ANP .   O2B ? ? ? 1_555 YA MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc11 metalc ? ? S  THR 178 OG1 ? ? ? 1_555 UA MG . MG ? ? S THR 178 S MG 700 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc12 metalc ? ? BA ANP .   O2G ? ? ? 1_555 CA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc13 metalc ? ? U  THR 178 OG1 ? ? ? 1_555 YA MG . MG ? ? U THR 178 U MG 700 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc14 metalc ? ? BB ANP .   O2G ? ? ? 1_555 CB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc15 metalc ? ? X  THR 170 OG1 ? ? ? 1_555 CB MG . MG ? ? X THR 164 X MG 700 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc16 metalc ? ? JA ANP .   O2G ? ? ? 1_555 KA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc17 metalc ? ? HA ANP .   O2G ? ? ? 1_555 IA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc18 metalc ? ? RA ANP .   O2G ? ? ? 1_555 SA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc19 metalc ? ? LA ANP .   O2B ? ? ? 1_555 MA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc20 metalc ? ? M  THR 170 OG1 ? ? ? 1_555 QA MG . MG ? ? M THR 164 M MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc21 metalc ? ? L  THR 178 OG1 ? ? ? 1_555 OA MG . MG ? ? L THR 178 L MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc22 metalc ? ? K  THR 178 OG1 ? ? ? 1_555 MA MG . MG ? ? K THR 178 K MG 700 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc23 metalc ? ? B  THR 178 OG1 ? ? ? 1_555 CA MG . MG ? ? B THR 178 B MG 700 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc24 metalc ? ? DA ANP .   O2B ? ? ? 1_555 EA MG . MG ? ? C ANP 600 C MG 700 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc25 metalc ? ? FA ANP .   O2G ? ? ? 1_555 GA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc26 metalc ? ? Z  ANP .   O2B ? ? ? 1_555 AA MG . MG ? ? A ANP 600 A MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc27 metalc ? ? LA ANP .   O2G ? ? ? 1_555 MA MG . MG ? ? K ANP 600 K MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc28 metalc ? ? T  THR 178 OG1 ? ? ? 1_555 WA MG . MG ? ? T THR 178 T MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc29 metalc ? ? BB ANP .   O2B ? ? ? 1_555 CB MG . MG ? ? X ANP 600 X MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc30 metalc ? ? VA ANP .   O2G ? ? ? 1_555 WA MG . MG ? ? T ANP 600 T MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc31 metalc ? ? JA ANP .   O2B ? ? ? 1_555 KA MG . MG ? ? J ANP 600 J MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc32 metalc ? ? TA ANP .   O2G ? ? ? 1_555 UA MG . MG ? ? S ANP 600 S MG 700 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc33 metalc ? ? NA ANP .   O2G ? ? ? 1_555 OA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc34 metalc ? ? V  THR 170 OG1 ? ? ? 1_555 AB MG . MG ? ? V THR 164 V MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc35 metalc ? ? BA ANP .   O2B ? ? ? 1_555 CA MG . MG ? ? B ANP 600 B MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc36 metalc ? ? RA ANP .   O2B ? ? ? 1_555 SA MG . MG ? ? O ANP 600 O MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc37 metalc ? ? PA ANP .   O2G ? ? ? 1_555 QA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc38 metalc ? ? NA ANP .   O2B ? ? ? 1_555 OA MG . MG ? ? L ANP 600 L MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc39 metalc ? ? HA ANP .   O2B ? ? ? 1_555 IA MG . MG ? ? F ANP 600 F MG 700 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc40 metalc ? ? ZA ANP .   O2G ? ? ? 1_555 AB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc41 metalc ? ? O  THR 170 OG1 ? ? ? 1_555 SA MG . MG ? ? O THR 164 O MG 700 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc42 metalc ? ? XA ANP .   O2G ? ? ? 1_555 YA MG . MG ? ? U ANP 600 U MG 700 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc43 metalc ? ? FA ANP .   O2B ? ? ? 1_555 GA MG . MG ? ? D ANP 600 D MG 700 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc44 metalc ? ? PA ANP .   O2B ? ? ? 1_555 QA MG . MG ? ? M ANP 600 M MG 700 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc45 metalc ? ? ZA ANP .   O2B ? ? ? 1_555 AB MG . MG ? ? V ANP 600 V MG 700 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc46 metalc ? ? X  GLU 195 OE1 ? ? ? 1_555 CB MG . MG ? ? X GLU 189 X MG 700 1_555 ? ? ? ? ? ? ? 2.733 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 271 A . ? ASP 271 A ASP 272 A ? ASP 272 A 1 -9.40 
2  ARG 364 A . ? ARG 364 A PRO 365 A ? PRO 365 A 1 -0.61 
3  ASP 271 B . ? ASP 271 B ASP 272 B ? ASP 272 B 1 -9.53 
4  ARG 364 B . ? ARG 364 B PRO 365 B ? PRO 365 B 1 5.68  
5  PHE 408 B . ? PHE 408 B GLY 409 B ? GLY 409 B 1 0.90  
6  ASP 271 C . ? ASP 271 C ASP 272 C ? ASP 272 C 1 -8.95 
7  ARG 364 C . ? ARG 364 C PRO 365 C ? PRO 365 C 1 -4.62 
8  ASP 262 D . ? ASP 256 D ASN 263 D ? ASN 257 D 1 0.27  
9  TYR 351 D . ? TYR 345 D PRO 352 D ? PRO 346 D 1 -1.32 
10 ASP 262 E . ? ASP 256 E ASN 263 E ? ASN 257 E 1 6.86  
11 TYR 351 E . ? TYR 345 E PRO 352 E ? PRO 346 E 1 2.79  
12 ASP 262 F . ? ASP 256 F ASN 263 F ? ASN 257 F 1 2.95  
13 TYR 351 F . ? TYR 345 F PRO 352 F ? PRO 346 F 1 -8.10 
14 ASP 271 J . ? ASP 271 J ASP 272 J ? ASP 272 J 1 -3.99 
15 ARG 364 J . ? ARG 364 J PRO 365 J ? PRO 365 J 1 -0.07 
16 ASP 271 K . ? ASP 271 K ASP 272 K ? ASP 272 K 1 -1.64 
17 ARG 364 K . ? ARG 364 K PRO 365 K ? PRO 365 K 1 5.35  
18 ASP 271 L . ? ASP 271 L ASP 272 L ? ASP 272 L 1 -1.11 
19 ARG 364 L . ? ARG 364 L PRO 365 L ? PRO 365 L 1 3.28  
20 ASP 262 M . ? ASP 256 M ASN 263 M ? ASN 257 M 1 3.59  
21 TYR 351 M . ? TYR 345 M PRO 352 M ? PRO 346 M 1 2.23  
22 ASP 262 N . ? ASP 256 N ASN 263 N ? ASN 257 N 1 0.63  
23 TYR 351 N . ? TYR 345 N PRO 352 N ? PRO 346 N 1 2.51  
24 ASP 262 O . ? ASP 256 O ASN 263 O ? ASN 257 O 1 9.46  
25 TYR 351 O . ? TYR 345 O PRO 352 O ? PRO 346 O 1 -6.39 
26 ASP 271 S . ? ASP 271 S ASP 272 S ? ASP 272 S 1 -0.87 
27 ARG 364 S . ? ARG 364 S PRO 365 S ? PRO 365 S 1 -1.43 
28 ASP 271 T . ? ASP 271 T ASP 272 T ? ASP 272 T 1 -0.10 
29 ARG 364 T . ? ARG 364 T PRO 365 T ? PRO 365 T 1 0.98  
30 ASP 271 U . ? ASP 271 U ASP 272 U ? ASP 272 U 1 1.50  
31 ARG 364 U . ? ARG 364 U PRO 365 U ? PRO 365 U 1 -2.35 
32 ASP 262 V . ? ASP 256 V ASN 263 V ? ASN 257 V 1 6.70  
33 TYR 351 V . ? TYR 345 V PRO 352 V ? PRO 346 V 1 -3.30 
34 ASP 262 W . ? ASP 256 W ASN 263 W ? ASN 257 W 1 0.70  
35 TYR 351 W . ? TYR 345 W PRO 352 W ? PRO 346 W 1 0.95  
36 ASP 262 X . ? ASP 256 X ASN 263 X ? ASN 257 X 1 10.76 
37 TYR 351 X . ? TYR 345 X PRO 352 X ? PRO 346 X 1 2.78  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 14 ? 
B  ? 2  ? 
C  ? 7  ? 
D  ? 20 ? 
E  ? 20 ? 
F  ? 2  ? 
G  ? 8  ? 
H  ? 2  ? 
I  ? 2  ? 
J  ? 8  ? 
K  ? 2  ? 
L  ? 7  ? 
M  ? 2  ? 
N  ? 2  ? 
O  ? 6  ? 
P  ? 7  ? 
Q  ? 2  ? 
R  ? 8  ? 
S  ? 2  ? 
T  ? 6  ? 
U  ? 5  ? 
V  ? 4  ? 
W  ? 3  ? 
X  ? 14 ? 
Y  ? 2  ? 
Z  ? 8  ? 
AA ? 2  ? 
AB ? 20 ? 
AC ? 20 ? 
AD ? 2  ? 
AE ? 8  ? 
AF ? 2  ? 
AG ? 8  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 7  ? 
AK ? 2  ? 
AL ? 2  ? 
AM ? 7  ? 
AN ? 2  ? 
AO ? 7  ? 
AP ? 2  ? 
AQ ? 6  ? 
AR ? 4  ? 
AS ? 3  ? 
AT ? 14 ? 
AU ? 2  ? 
AV ? 8  ? 
AW ? 2  ? 
AX ? 20 ? 
AY ? 16 ? 
AZ ? 9  ? 
BA ? 2  ? 
BB ? 8  ? 
BC ? 2  ? 
BD ? 2  ? 
BE ? 8  ? 
BF ? 2  ? 
BG ? 8  ? 
BH ? 2  ? 
BI ? 7  ? 
BJ ? 2  ? 
BK ? 2  ? 
BL ? 8  ? 
BM ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? anti-parallel 
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
A  7  8  ? anti-parallel 
A  8  9  ? anti-parallel 
A  9  10 ? anti-parallel 
A  10 11 ? anti-parallel 
A  11 12 ? anti-parallel 
A  12 13 ? anti-parallel 
A  13 14 ? anti-parallel 
B  1  2  ? anti-parallel 
C  1  2  ? parallel      
C  2  3  ? parallel      
C  3  4  ? parallel      
C  4  5  ? parallel      
C  5  6  ? parallel      
C  6  7  ? parallel      
D  1  2  ? anti-parallel 
D  2  3  ? anti-parallel 
D  3  4  ? anti-parallel 
D  4  5  ? anti-parallel 
D  5  6  ? anti-parallel 
D  6  7  ? anti-parallel 
D  7  8  ? anti-parallel 
D  8  9  ? anti-parallel 
D  9  10 ? anti-parallel 
D  10 11 ? anti-parallel 
D  11 12 ? anti-parallel 
D  12 13 ? anti-parallel 
D  13 14 ? anti-parallel 
D  14 15 ? anti-parallel 
D  15 16 ? anti-parallel 
D  16 17 ? anti-parallel 
D  17 18 ? anti-parallel 
D  18 19 ? anti-parallel 
D  19 20 ? anti-parallel 
E  1  2  ? anti-parallel 
E  2  3  ? anti-parallel 
E  3  4  ? anti-parallel 
E  4  5  ? anti-parallel 
E  5  6  ? anti-parallel 
E  6  7  ? anti-parallel 
E  7  8  ? anti-parallel 
E  8  9  ? anti-parallel 
E  9  10 ? anti-parallel 
E  10 11 ? anti-parallel 
E  11 12 ? anti-parallel 
E  12 13 ? anti-parallel 
E  13 14 ? anti-parallel 
E  14 15 ? anti-parallel 
E  15 16 ? anti-parallel 
E  16 17 ? anti-parallel 
E  17 18 ? anti-parallel 
E  18 19 ? anti-parallel 
E  19 20 ? anti-parallel 
F  1  2  ? anti-parallel 
G  1  2  ? parallel      
G  2  3  ? parallel      
G  3  4  ? parallel      
G  4  5  ? parallel      
G  5  6  ? parallel      
G  6  7  ? parallel      
G  7  8  ? anti-parallel 
H  1  2  ? anti-parallel 
I  1  2  ? anti-parallel 
J  1  2  ? parallel      
J  2  3  ? parallel      
J  3  4  ? parallel      
J  4  5  ? parallel      
J  5  6  ? parallel      
J  6  7  ? parallel      
J  7  8  ? anti-parallel 
K  1  2  ? anti-parallel 
L  1  2  ? parallel      
L  2  3  ? parallel      
L  3  4  ? parallel      
L  4  5  ? parallel      
L  5  6  ? parallel      
L  6  7  ? parallel      
M  1  2  ? anti-parallel 
N  1  2  ? anti-parallel 
O  1  2  ? parallel      
O  2  3  ? parallel      
O  3  4  ? parallel      
O  4  5  ? parallel      
O  5  6  ? anti-parallel 
P  1  2  ? parallel      
P  2  3  ? parallel      
P  3  4  ? parallel      
P  4  5  ? parallel      
P  5  6  ? parallel      
P  6  7  ? parallel      
Q  1  2  ? anti-parallel 
R  1  2  ? parallel      
R  2  3  ? parallel      
R  3  4  ? parallel      
R  4  5  ? parallel      
R  5  6  ? parallel      
R  6  7  ? parallel      
R  7  8  ? anti-parallel 
S  1  2  ? anti-parallel 
T  1  2  ? anti-parallel 
T  2  3  ? parallel      
T  3  4  ? parallel      
T  4  5  ? parallel      
T  5  6  ? anti-parallel 
U  1  2  ? anti-parallel 
U  2  3  ? parallel      
U  3  4  ? anti-parallel 
U  4  5  ? anti-parallel 
V  1  2  ? anti-parallel 
V  2  3  ? anti-parallel 
V  3  4  ? anti-parallel 
W  1  2  ? anti-parallel 
W  2  3  ? anti-parallel 
X  1  2  ? anti-parallel 
X  2  3  ? anti-parallel 
X  3  4  ? anti-parallel 
X  4  5  ? anti-parallel 
X  5  6  ? anti-parallel 
X  6  7  ? anti-parallel 
X  7  8  ? anti-parallel 
X  8  9  ? anti-parallel 
X  9  10 ? anti-parallel 
X  10 11 ? anti-parallel 
X  11 12 ? anti-parallel 
X  12 13 ? anti-parallel 
X  13 14 ? anti-parallel 
Y  1  2  ? anti-parallel 
Z  1  2  ? parallel      
Z  2  3  ? parallel      
Z  3  4  ? parallel      
Z  4  5  ? parallel      
Z  5  6  ? parallel      
Z  6  7  ? parallel      
Z  7  8  ? anti-parallel 
AA 1  2  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? anti-parallel 
AB 5  6  ? anti-parallel 
AB 6  7  ? anti-parallel 
AB 7  8  ? anti-parallel 
AB 8  9  ? anti-parallel 
AB 9  10 ? anti-parallel 
AB 10 11 ? anti-parallel 
AB 11 12 ? anti-parallel 
AB 12 13 ? anti-parallel 
AB 13 14 ? anti-parallel 
AB 14 15 ? anti-parallel 
AB 15 16 ? anti-parallel 
AB 16 17 ? anti-parallel 
AB 17 18 ? anti-parallel 
AB 18 19 ? anti-parallel 
AB 19 20 ? anti-parallel 
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
AC 3  4  ? anti-parallel 
AC 4  5  ? anti-parallel 
AC 5  6  ? anti-parallel 
AC 6  7  ? anti-parallel 
AC 7  8  ? anti-parallel 
AC 8  9  ? anti-parallel 
AC 9  10 ? anti-parallel 
AC 10 11 ? anti-parallel 
AC 11 12 ? anti-parallel 
AC 12 13 ? anti-parallel 
AC 13 14 ? anti-parallel 
AC 14 15 ? anti-parallel 
AC 15 16 ? anti-parallel 
AC 16 17 ? anti-parallel 
AC 17 18 ? anti-parallel 
AC 18 19 ? anti-parallel 
AC 19 20 ? anti-parallel 
AD 1  2  ? anti-parallel 
AE 1  2  ? parallel      
AE 2  3  ? parallel      
AE 3  4  ? parallel      
AE 4  5  ? parallel      
AE 5  6  ? parallel      
AE 6  7  ? parallel      
AE 7  8  ? anti-parallel 
AF 1  2  ? anti-parallel 
AG 1  2  ? parallel      
AG 2  3  ? parallel      
AG 3  4  ? parallel      
AG 4  5  ? parallel      
AG 5  6  ? parallel      
AG 6  7  ? parallel      
AG 7  8  ? anti-parallel 
AH 1  2  ? anti-parallel 
AI 1  2  ? anti-parallel 
AJ 1  2  ? parallel      
AJ 2  3  ? parallel      
AJ 3  4  ? parallel      
AJ 4  5  ? parallel      
AJ 5  6  ? parallel      
AJ 6  7  ? parallel      
AK 1  2  ? anti-parallel 
AL 1  2  ? anti-parallel 
AM 1  2  ? parallel      
AM 2  3  ? parallel      
AM 3  4  ? parallel      
AM 4  5  ? parallel      
AM 5  6  ? parallel      
AM 6  7  ? parallel      
AN 1  2  ? anti-parallel 
AO 1  2  ? parallel      
AO 2  3  ? parallel      
AO 3  4  ? parallel      
AO 4  5  ? parallel      
AO 5  6  ? parallel      
AO 6  7  ? parallel      
AP 1  2  ? anti-parallel 
AQ 1  2  ? anti-parallel 
AQ 2  3  ? parallel      
AQ 3  4  ? parallel      
AQ 4  5  ? parallel      
AQ 5  6  ? anti-parallel 
AR 1  2  ? parallel      
AR 2  3  ? anti-parallel 
AR 3  4  ? anti-parallel 
AS 1  2  ? anti-parallel 
AS 2  3  ? anti-parallel 
AT 1  2  ? anti-parallel 
AT 2  3  ? anti-parallel 
AT 3  4  ? anti-parallel 
AT 4  5  ? anti-parallel 
AT 5  6  ? anti-parallel 
AT 6  7  ? anti-parallel 
AT 7  8  ? anti-parallel 
AT 8  9  ? anti-parallel 
AT 9  10 ? anti-parallel 
AT 10 11 ? anti-parallel 
AT 11 12 ? anti-parallel 
AT 12 13 ? anti-parallel 
AT 13 14 ? anti-parallel 
AU 1  2  ? anti-parallel 
AV 1  2  ? parallel      
AV 2  3  ? parallel      
AV 3  4  ? parallel      
AV 4  5  ? parallel      
AV 5  6  ? parallel      
AV 6  7  ? parallel      
AV 7  8  ? anti-parallel 
AW 1  2  ? anti-parallel 
AX 1  2  ? anti-parallel 
AX 2  3  ? anti-parallel 
AX 3  4  ? anti-parallel 
AX 4  5  ? anti-parallel 
AX 5  6  ? anti-parallel 
AX 6  7  ? anti-parallel 
AX 7  8  ? anti-parallel 
AX 8  9  ? anti-parallel 
AX 9  10 ? anti-parallel 
AX 10 11 ? anti-parallel 
AX 11 12 ? anti-parallel 
AX 12 13 ? anti-parallel 
AX 13 14 ? anti-parallel 
AX 14 15 ? anti-parallel 
AX 15 16 ? anti-parallel 
AX 16 17 ? anti-parallel 
AX 17 18 ? anti-parallel 
AX 18 19 ? anti-parallel 
AX 19 20 ? anti-parallel 
AY 1  2  ? anti-parallel 
AY 2  3  ? anti-parallel 
AY 3  4  ? anti-parallel 
AY 4  5  ? anti-parallel 
AY 5  6  ? anti-parallel 
AY 6  7  ? anti-parallel 
AY 7  8  ? anti-parallel 
AY 8  9  ? anti-parallel 
AY 9  10 ? anti-parallel 
AY 10 11 ? anti-parallel 
AY 11 12 ? anti-parallel 
AY 12 13 ? anti-parallel 
AY 13 14 ? anti-parallel 
AY 14 15 ? anti-parallel 
AY 15 16 ? anti-parallel 
AZ 1  2  ? anti-parallel 
AZ 2  3  ? anti-parallel 
AZ 3  4  ? anti-parallel 
AZ 4  5  ? anti-parallel 
AZ 5  6  ? anti-parallel 
AZ 6  7  ? anti-parallel 
AZ 7  8  ? anti-parallel 
AZ 8  9  ? anti-parallel 
BA 1  2  ? anti-parallel 
BB 1  2  ? parallel      
BB 2  3  ? parallel      
BB 3  4  ? parallel      
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? anti-parallel 
BC 1  2  ? anti-parallel 
BD 1  2  ? anti-parallel 
BE 1  2  ? parallel      
BE 2  3  ? parallel      
BE 3  4  ? parallel      
BE 4  5  ? parallel      
BE 5  6  ? parallel      
BE 6  7  ? parallel      
BE 7  8  ? anti-parallel 
BF 1  2  ? anti-parallel 
BG 1  2  ? parallel      
BG 2  3  ? parallel      
BG 3  4  ? parallel      
BG 4  5  ? parallel      
BG 5  6  ? parallel      
BG 6  7  ? parallel      
BG 7  8  ? anti-parallel 
BH 1  2  ? anti-parallel 
BI 1  2  ? parallel      
BI 2  3  ? parallel      
BI 3  4  ? parallel      
BI 4  5  ? parallel      
BI 5  6  ? parallel      
BI 6  7  ? parallel      
BJ 1  2  ? anti-parallel 
BK 1  2  ? anti-parallel 
BL 1  2  ? parallel      
BL 2  3  ? parallel      
BL 3  4  ? parallel      
BL 4  5  ? parallel      
BL 5  6  ? parallel      
BL 6  7  ? parallel      
BL 7  8  ? anti-parallel 
BM 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  2  GLU A 53  ? PHE A 57  ? GLU A 53  PHE A 57  
A  3  LEU A 89  ? ILE A 96  ? LEU A 89  ILE A 96  
A  4  THR A 30  ? GLY A 37  ? THR A 30  GLY A 37  
A  5  ILE A 40  ? GLY A 45  ? ILE A 40  GLY A 45  
A  6  VAL A 73  ? LEU A 77  ? VAL A 73  LEU A 77  
A  7  LYS A 62  ? LEU A 68  ? LYS A 62  LEU A 68  
A  8  THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
A  9  LYS E 81  ? ASP E 84  ? LYS E 75  ASP E 78  
A  10 ALA E 42  ? GLU E 44  ? ALA E 36  GLU E 38  
A  11 LEU E 54  ? GLY E 61  ? LEU E 48  GLY E 55  
A  12 THR E 64  ? ALA E 69  ? THR E 58  ALA E 63  
A  13 ILE E 26  ? HIS E 30  ? ILE E 20  HIS E 24  
A  14 THR E 16  ? ILE E 23  ? THR E 10  ILE E 17  
B  1  ASP A 98  ? VAL A 101 ? ASP A 98  VAL A 101 
B  2  GLY A 127 ? ARG A 130 ? GLY A 127 ARG A 130 
C  1  VAL A 109 ? ASP A 111 ? VAL A 109 ASP A 111 
C  2  SER A 231 ? ALA A 236 ? SER A 231 ALA A 236 
C  3  TYR A 202 ? VAL A 208 ? TYR A 202 VAL A 208 
C  4  HIS A 265 ? ASP A 271 ? HIS A 265 ASP A 271 
C  5  SER A 322 ? GLU A 330 ? SER A 322 GLU A 330 
C  6  LEU A 168 ? GLY A 171 ? LEU A 168 GLY A 171 
C  7  GLN A 351 ? LEU A 354 ? GLN A 351 LEU A 354 
D  1  GLN B 72  ? LEU B 77  ? GLN B 72  LEU B 77  
D  2  ILE B 40  ? GLY B 45  ? ILE B 40  GLY B 45  
D  3  THR B 30  ? GLY B 37  ? THR B 30  GLY B 37  
D  4  LEU B 89  ? ILE B 96  ? LEU B 89  ILE B 96  
D  5  GLU B 53  ? PHE B 57  ? GLU B 53  PHE B 57  
D  6  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
D  7  ILE F 15  ? ILE F 23  ? ILE F 9   ILE F 17  
D  8  ILE F 26  ? PHE F 31  ? ILE F 20  PHE F 25  
D  9  THR F 64  ? ALA F 69  ? THR F 58  ALA F 63  
D  10 LYS F 51  ? GLY F 61  ? LYS F 45  GLY F 55  
D  11 THR C 30  ? GLY C 37  ? THR C 30  GLY C 37  
D  12 LEU C 89  ? ILE C 96  ? LEU C 89  ILE C 96  
D  13 GLU C 53  ? PHE C 57  ? GLU C 53  PHE C 57  
D  14 LYS C 62  ? LEU C 68  ? LYS C 62  LEU C 68  
D  15 THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
D  16 LYS D 81  ? ASP D 84  ? LYS D 75  ASP D 78  
D  17 ALA D 42  ? LYS D 46  ? ALA D 36  LYS D 40  
D  18 LYS D 51  ? GLY D 61  ? LYS D 45  GLY D 55  
D  19 THR D 64  ? ALA D 69  ? THR D 58  ALA D 63  
D  20 ILE D 26  ? HIS D 30  ? ILE D 20  HIS D 24  
E  1  GLU B 53  ? PHE B 57  ? GLU B 53  PHE B 57  
E  2  LEU B 89  ? ILE B 96  ? LEU B 89  ILE B 96  
E  3  THR B 30  ? GLY B 37  ? THR B 30  GLY B 37  
E  4  ILE B 40  ? GLY B 45  ? ILE B 40  GLY B 45  
E  5  GLN B 72  ? LEU B 77  ? GLN B 72  LEU B 77  
E  6  LYS B 62  ? GLU B 69  ? LYS B 62  GLU B 69  
E  7  ILE F 15  ? ILE F 23  ? ILE F 9   ILE F 17  
E  8  LYS F 81  ? PRO F 88  ? LYS F 75  PRO F 82  
E  9  ASN F 41  ? LYS F 46  ? ASN F 35  LYS F 40  
E  10 LYS F 51  ? GLY F 61  ? LYS F 45  GLY F 55  
E  11 THR C 30  ? GLY C 37  ? THR C 30  GLY C 37  
E  12 ILE C 40  ? GLY C 45  ? ILE C 40  GLY C 45  
E  13 VAL C 73  ? LEU C 77  ? VAL C 73  LEU C 77  
E  14 LYS C 62  ? LEU C 68  ? LYS C 62  LEU C 68  
E  15 THR D 16  ? ILE D 23  ? THR D 10  ILE D 17  
E  16 ILE D 26  ? HIS D 30  ? ILE D 20  HIS D 24  
E  17 THR D 64  ? ALA D 69  ? THR D 58  ALA D 63  
E  18 LYS D 51  ? GLY D 61  ? LYS D 45  GLY D 55  
E  19 ALA D 42  ? LYS D 46  ? ALA D 36  LYS D 40  
E  20 LYS D 81  ? ASP D 84  ? LYS D 75  ASP D 78  
F  1  ASP B 98  ? VAL B 101 ? ASP B 98  VAL B 101 
F  2  GLY B 127 ? ARG B 130 ? GLY B 127 ARG B 130 
G  1  VAL B 109 ? VAL B 110 ? VAL B 109 VAL B 110 
G  2  SER B 231 ? ALA B 236 ? SER B 231 ALA B 236 
G  3  LEU B 201 ? VAL B 208 ? LEU B 201 VAL B 208 
G  4  HIS B 265 ? ASP B 271 ? HIS B 265 ASP B 271 
G  5  SER B 322 ? GLU B 330 ? SER B 322 GLU B 330 
G  6  LEU B 168 ? GLY B 171 ? LEU B 168 GLY B 171 
G  7  GLY B 350 ? LEU B 354 ? GLY B 350 LEU B 354 
G  8  VAL B 373 ? SER B 374 ? VAL B 373 SER B 374 
H  1  PRO B 147 ? VAL B 148 ? PRO B 147 VAL B 148 
H  2  ILE B 161 ? GLY B 162 ? ILE B 161 GLY B 162 
I  1  ASP C 98  ? VAL C 101 ? ASP C 98  VAL C 101 
I  2  GLY C 127 ? ARG C 130 ? GLY C 127 ARG C 130 
J  1  VAL C 109 ? VAL C 110 ? VAL C 109 VAL C 110 
J  2  SER C 231 ? ALA C 236 ? SER C 231 ALA C 236 
J  3  TYR C 202 ? VAL C 208 ? TYR C 202 VAL C 208 
J  4  HIS C 265 ? ASP C 271 ? HIS C 265 ASP C 271 
J  5  SER C 322 ? THR C 331 ? SER C 322 THR C 331 
J  6  LEU C 168 ? ASP C 172 ? LEU C 168 ASP C 172 
J  7  GLY C 350 ? LEU C 354 ? GLY C 350 LEU C 354 
J  8  VAL C 373 ? SER C 374 ? VAL C 373 SER C 374 
K  1  SER D 90  ? PRO D 92  ? SER D 84  PRO D 86  
K  2  ARG D 120 ? PRO D 122 ? ARG D 114 PRO D 116 
L  1  ILE D 101 ? ILE D 102 ? ILE D 95  ILE D 96  
L  2  VAL D 221 ? GLY D 226 ? VAL D 215 GLY D 220 
L  3  SER D 188 ? VAL D 193 ? SER D 182 VAL D 187 
L  4  ASP D 256 ? ILE D 261 ? ASP D 250 ILE D 255 
L  5  SER D 309 ? TYR D 317 ? SER D 303 TYR D 311 
L  6  LYS D 158 ? GLY D 163 ? LYS D 152 GLY D 157 
L  7  ALA D 337 ? LEU D 341 ? ALA D 331 LEU D 335 
M  1  ILE D 139 ? LEU D 140 ? ILE D 133 LEU D 134 
M  2  TYR D 153 ? ALA D 154 ? TYR D 147 ALA D 148 
N  1  SER E 90  ? PRO E 92  ? SER E 84  PRO E 86  
N  2  ARG E 120 ? PRO E 122 ? ARG E 114 PRO E 116 
O  1  ILE E 101 ? ILE E 102 ? ILE E 95  ILE E 96  
O  2  VAL E 221 ? GLY E 226 ? VAL E 215 GLY E 220 
O  3  SER E 188 ? VAL E 193 ? SER E 182 VAL E 187 
O  4  ASP E 256 ? ASP E 262 ? ASP E 250 ASP E 256 
O  5  GLY E 308 ? ALA E 315 ? GLY E 302 ALA E 309 
O  6  THR E 304 ? THR E 305 ? THR E 298 THR E 299 
P  1  ILE E 101 ? ILE E 102 ? ILE E 95  ILE E 96  
P  2  VAL E 221 ? GLY E 226 ? VAL E 215 GLY E 220 
P  3  SER E 188 ? VAL E 193 ? SER E 182 VAL E 187 
P  4  ASP E 256 ? ASP E 262 ? ASP E 250 ASP E 256 
P  5  GLY E 308 ? ALA E 315 ? GLY E 302 ALA E 309 
P  6  LYS E 158 ? PHE E 162 ? LYS E 152 PHE E 156 
P  7  ALA E 337 ? VAL E 340 ? ALA E 331 VAL E 334 
Q  1  SER F 90  ? VAL F 93  ? SER F 84  VAL F 87  
Q  2  LEU F 119 ? PRO F 122 ? LEU F 113 PRO F 116 
R  1  ILE F 101 ? ILE F 102 ? ILE F 95  ILE F 96  
R  2  VAL F 221 ? GLY F 226 ? VAL F 215 GLY F 220 
R  3  PHE F 187 ? VAL F 193 ? PHE F 181 VAL F 187 
R  4  ASP F 256 ? ASP F 262 ? ASP F 250 ASP F 256 
R  5  SER F 309 ? TYR F 317 ? SER F 303 TYR F 311 
R  6  LYS F 158 ? GLY F 163 ? LYS F 152 GLY F 157 
R  7  ALA F 337 ? LEU F 341 ? ALA F 331 LEU F 335 
R  8  LYS F 360 ? SER F 361 ? LYS F 354 SER F 355 
S  1  ILE F 139 ? LEU F 140 ? ILE F 133 LEU F 134 
S  2  TYR F 153 ? ALA F 154 ? TYR F 147 ALA F 148 
T  1  GLU G 176 ? ILE G 182 ? GLU G 176 ILE G 182 
T  2  LYS G 161 ? ASP G 168 ? LYS G 161 ASP G 168 
T  3  GLU G 72  ? ILE G 77  ? GLU G 72  ILE G 77  
T  4  ASP G 106 ? ILE G 110 ? ASP G 106 ILE G 110 
T  5  ILE G 126 ? ASN G 131 ? ILE G 126 ASN G 131 
T  6  PHE I 43  ? GLN I 46  ? PHE I 43  GLN I 46  
U  1  TYR H 22  ? SER H 23  ? TYR H 22  SER H 23  
U  2  LEU H 12  ? ALA H 15  ? LEU H 12  ALA H 15  
U  3  LEU H 83  ? THR H 86  ? LEU H 83  THR H 86  
U  4  PHE H 74  ? VAL H 77  ? PHE H 74  VAL H 77  
U  5  VAL H 49  ? GLN H 51  ? VAL H 49  GLN H 51  
V  1  GLY H 37  ? VAL H 41  ? GLY H 37  VAL H 41  
V  2  GLN H 29  ? ALA H 34  ? GLN H 29  ALA H 34  
V  3  VAL H 59  ? MET H 60  ? VAL H 59  MET H 60  
V  4  SER H 65  ? LYS H 66  ? SER H 65  LYS H 66  
W  1  GLY H 55  ? VAL H 56  ? GLY H 55  VAL H 56  
W  2  PHE H 68  ? ILE H 70  ? PHE H 68  ILE H 70  
W  3  ALA H 90  ? PRO H 92  ? ALA H 90  PRO H 92  
X  1  LYS J 62  ? LEU J 68  ? LYS J 62  LEU J 68  
X  2  GLU J 53  ? PHE J 57  ? GLU J 53  PHE J 57  
X  3  LEU J 89  ? ILE J 96  ? LEU J 89  ILE J 96  
X  4  THR J 30  ? GLY J 37  ? THR J 30  GLY J 37  
X  5  ILE J 40  ? GLY J 45  ? ILE J 40  GLY J 45  
X  6  GLN J 72  ? LEU J 77  ? GLN J 72  LEU J 77  
X  7  LYS J 62  ? LEU J 68  ? LYS J 62  LEU J 68  
X  8  THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
X  9  LYS N 81  ? ASP N 84  ? LYS N 75  ASP N 78  
X  10 ALA N 42  ? LYS N 46  ? ALA N 36  LYS N 40  
X  11 LYS N 51  ? GLY N 61  ? LYS N 45  GLY N 55  
X  12 THR N 64  ? ALA N 69  ? THR N 58  ALA N 63  
X  13 ILE N 26  ? HIS N 30  ? ILE N 20  HIS N 24  
X  14 THR N 16  ? ILE N 23  ? THR N 10  ILE N 17  
Y  1  ASP J 98  ? VAL J 101 ? ASP J 98  VAL J 101 
Y  2  GLY J 127 ? ARG J 130 ? GLY J 127 ARG J 130 
Z  1  VAL J 109 ? VAL J 110 ? VAL J 109 VAL J 110 
Z  2  SER J 231 ? ALA J 236 ? SER J 231 ALA J 236 
Z  3  LEU J 201 ? VAL J 208 ? LEU J 201 VAL J 208 
Z  4  HIS J 265 ? ASP J 271 ? HIS J 265 ASP J 271 
Z  5  SER J 322 ? GLU J 330 ? SER J 322 GLU J 330 
Z  6  LEU J 168 ? GLY J 171 ? LEU J 168 GLY J 171 
Z  7  GLY J 350 ? PHE J 353 ? GLY J 350 PHE J 353 
Z  8  VAL J 373 ? SER J 374 ? VAL J 373 SER J 374 
AA 1  PRO J 147 ? VAL J 148 ? PRO J 147 VAL J 148 
AA 2  ILE J 161 ? GLY J 162 ? ILE J 161 GLY J 162 
AB 1  GLN K 72  ? LEU K 77  ? GLN K 72  LEU K 77  
AB 2  ILE K 40  ? GLY K 45  ? ILE K 40  GLY K 45  
AB 3  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AB 4  LEU K 89  ? ILE K 96  ? LEU K 89  ILE K 96  
AB 5  GLU K 53  ? PHE K 57  ? GLU K 53  PHE K 57  
AB 6  LYS K 62  ? GLU K 69  ? LYS K 62  GLU K 69  
AB 7  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AB 8  ILE O 26  ? HIS O 30  ? ILE O 20  HIS O 24  
AB 9  THR O 64  ? ALA O 69  ? THR O 58  ALA O 63  
AB 10 LYS O 51  ? GLY O 61  ? LYS O 45  GLY O 55  
AB 11 THR L 30  ? GLY L 37  ? THR L 30  GLY L 37  
AB 12 LEU L 89  ? ILE L 96  ? LEU L 89  ILE L 96  
AB 13 GLU L 53  ? PHE L 57  ? GLU L 53  PHE L 57  
AB 14 LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AB 15 ILE M 15  ? ILE M 23  ? ILE M 9   ILE M 17  
AB 16 LYS M 81  ? ASP M 84  ? LYS M 75  ASP M 78  
AB 17 ALA M 42  ? LYS M 46  ? ALA M 36  LYS M 40  
AB 18 LYS M 51  ? GLY M 61  ? LYS M 45  GLY M 55  
AB 19 THR M 64  ? ALA M 69  ? THR M 58  ALA M 63  
AB 20 ILE M 26  ? HIS M 30  ? ILE M 20  HIS M 24  
AC 1  GLU K 53  ? PHE K 57  ? GLU K 53  PHE K 57  
AC 2  LEU K 89  ? ILE K 96  ? LEU K 89  ILE K 96  
AC 3  THR K 30  ? GLY K 37  ? THR K 30  GLY K 37  
AC 4  ILE K 40  ? GLY K 45  ? ILE K 40  GLY K 45  
AC 5  GLN K 72  ? LEU K 77  ? GLN K 72  LEU K 77  
AC 6  LYS K 62  ? GLU K 69  ? LYS K 62  GLU K 69  
AC 7  THR O 16  ? ILE O 23  ? THR O 10  ILE O 17  
AC 8  LYS O 81  ? ASP O 84  ? LYS O 75  ASP O 78  
AC 9  ALA O 42  ? LYS O 46  ? ALA O 36  LYS O 40  
AC 10 LYS O 51  ? GLY O 61  ? LYS O 45  GLY O 55  
AC 11 THR L 30  ? GLY L 37  ? THR L 30  GLY L 37  
AC 12 ILE L 40  ? GLY L 45  ? ILE L 40  GLY L 45  
AC 13 VAL L 73  ? LEU L 77  ? VAL L 73  LEU L 77  
AC 14 LYS L 62  ? LEU L 68  ? LYS L 62  LEU L 68  
AC 15 ILE M 15  ? ILE M 23  ? ILE M 9   ILE M 17  
AC 16 ILE M 26  ? HIS M 30  ? ILE M 20  HIS M 24  
AC 17 THR M 64  ? ALA M 69  ? THR M 58  ALA M 63  
AC 18 LYS M 51  ? GLY M 61  ? LYS M 45  GLY M 55  
AC 19 ALA M 42  ? LYS M 46  ? ALA M 36  LYS M 40  
AC 20 LYS M 81  ? ASP M 84  ? LYS M 75  ASP M 78  
AD 1  ASP K 98  ? VAL K 101 ? ASP K 98  VAL K 101 
AD 2  GLY K 127 ? ARG K 130 ? GLY K 127 ARG K 130 
AE 1  VAL K 109 ? VAL K 110 ? VAL K 109 VAL K 110 
AE 2  SER K 231 ? ALA K 236 ? SER K 231 ALA K 236 
AE 3  TYR K 202 ? VAL K 208 ? TYR K 202 VAL K 208 
AE 4  HIS K 265 ? ASP K 271 ? HIS K 265 ASP K 271 
AE 5  SER K 322 ? GLU K 330 ? SER K 322 GLU K 330 
AE 6  LEU K 168 ? GLY K 171 ? LEU K 168 GLY K 171 
AE 7  GLY K 350 ? LEU K 354 ? GLY K 350 LEU K 354 
AE 8  ILE K 367 ? SER K 374 ? ILE K 367 SER K 374 
AF 1  ASP L 98  ? VAL L 101 ? ASP L 98  VAL L 101 
AF 2  GLY L 127 ? ARG L 130 ? GLY L 127 ARG L 130 
AG 1  VAL L 109 ? VAL L 110 ? VAL L 109 VAL L 110 
AG 2  SER L 231 ? ALA L 236 ? SER L 231 ALA L 236 
AG 3  LEU L 201 ? VAL L 208 ? LEU L 201 VAL L 208 
AG 4  HIS L 265 ? ASP L 271 ? HIS L 265 ASP L 271 
AG 5  SER L 322 ? GLU L 330 ? SER L 322 GLU L 330 
AG 6  LEU L 168 ? GLY L 171 ? LEU L 168 GLY L 171 
AG 7  GLY L 350 ? LEU L 354 ? GLY L 350 LEU L 354 
AG 8  VAL L 373 ? SER L 374 ? VAL L 373 SER L 374 
AH 1  PRO L 147 ? VAL L 148 ? PRO L 147 VAL L 148 
AH 2  ILE L 161 ? GLY L 162 ? ILE L 161 GLY L 162 
AI 1  SER M 90  ? PRO M 92  ? SER M 84  PRO M 86  
AI 2  ARG M 120 ? PRO M 122 ? ARG M 114 PRO M 116 
AJ 1  ILE M 101 ? ILE M 102 ? ILE M 95  ILE M 96  
AJ 2  VAL M 221 ? GLY M 226 ? VAL M 215 GLY M 220 
AJ 3  SER M 188 ? VAL M 193 ? SER M 182 VAL M 187 
AJ 4  ASP M 256 ? ASP M 262 ? ASP M 250 ASP M 256 
AJ 5  SER M 309 ? TYR M 317 ? SER M 303 TYR M 311 
AJ 6  LYS M 158 ? GLY M 163 ? LYS M 152 GLY M 157 
AJ 7  ALA M 337 ? VAL M 340 ? ALA M 331 VAL M 334 
AK 1  GLU M 138 ? LEU M 140 ? GLU M 132 LEU M 134 
AK 2  TYR M 153 ? ARG M 155 ? TYR M 147 ARG M 149 
AL 1  SER N 90  ? PRO N 92  ? SER N 84  PRO N 86  
AL 2  ARG N 120 ? PRO N 122 ? ARG N 114 PRO N 116 
AM 1  ILE N 101 ? ILE N 102 ? ILE N 95  ILE N 96  
AM 2  VAL N 221 ? GLN N 227 ? VAL N 215 GLN N 221 
AM 3  SER N 188 ? GLU N 195 ? SER N 182 GLU N 189 
AM 4  ASP N 256 ? ASP N 262 ? ASP N 250 ASP N 256 
AM 5  SER N 309 ? ALA N 315 ? SER N 303 ALA N 309 
AM 6  LYS N 158 ? PHE N 162 ? LYS N 152 PHE N 156 
AM 7  LEU N 335 ? VAL N 340 ? LEU N 329 VAL N 334 
AN 1  SER O 90  ? PRO O 92  ? SER O 84  PRO O 86  
AN 2  ARG O 120 ? PRO O 122 ? ARG O 114 PRO O 116 
AO 1  ILE O 101 ? ILE O 102 ? ILE O 95  ILE O 96  
AO 2  ALA O 222 ? GLY O 226 ? ALA O 216 GLY O 220 
AO 3  PHE O 187 ? VAL O 193 ? PHE O 181 VAL O 187 
AO 4  ASP O 256 ? ASP O 262 ? ASP O 250 ASP O 256 
AO 5  SER O 309 ? VAL O 318 ? SER O 303 VAL O 312 
AO 6  LYS O 158 ? GLY O 164 ? LYS O 152 GLY O 158 
AO 7  ALA O 337 ? THR O 338 ? ALA O 331 THR O 332 
AP 1  ILE O 139 ? LEU O 140 ? ILE O 133 LEU O 134 
AP 2  TYR O 153 ? ALA O 154 ? TYR O 147 ALA O 148 
AQ 1  SER P 178 ? PRO P 181 ? SER P 178 PRO P 181 
AQ 2  LYS P 161 ? TYR P 166 ? LYS P 161 TYR P 166 
AQ 3  GLU P 72  ? ILE P 77  ? GLU P 72  ILE P 77  
AQ 4  ASP P 106 ? ILE P 110 ? ASP P 106 ILE P 110 
AQ 5  ILE P 126 ? ASN P 131 ? ILE P 126 ASN P 131 
AQ 6  PHE R 43  ? GLN R 46  ? PHE R 43  GLN R 46  
AR 1  GLN Q 13  ? ALA Q 15  ? GLN Q 13  ALA Q 15  
AR 2  LEU Q 83  ? ALA Q 87  ? LEU Q 83  ALA Q 87  
AR 3  GLY Q 73  ? VAL Q 77  ? GLY Q 73  VAL Q 77  
AR 4  VAL Q 49  ? LEU Q 52  ? VAL Q 49  LEU Q 52  
AS 1  GLY Q 37  ? VAL Q 41  ? GLY Q 37  VAL Q 41  
AS 2  GLN Q 29  ? ALA Q 34  ? GLN Q 29  ALA Q 34  
AS 3  VAL Q 59  ? MET Q 60  ? VAL Q 59  MET Q 60  
AT 1  LYS S 62  ? LEU S 68  ? LYS S 62  LEU S 68  
AT 2  GLU S 53  ? PHE S 57  ? GLU S 53  PHE S 57  
AT 3  LEU S 89  ? ILE S 96  ? LEU S 89  ILE S 96  
AT 4  THR S 30  ? GLY S 37  ? THR S 30  GLY S 37  
AT 5  ILE S 40  ? GLY S 45  ? ILE S 40  GLY S 45  
AT 6  VAL S 73  ? LEU S 77  ? VAL S 73  LEU S 77  
AT 7  LYS S 62  ? LEU S 68  ? LYS S 62  LEU S 68  
AT 8  ILE W 15  ? ILE W 23  ? ILE W 9   ILE W 17  
AT 9  LYS W 81  ? PRO W 88  ? LYS W 75  PRO W 82  
AT 10 ASN W 41  ? LYS W 46  ? ASN W 35  LYS W 40  
AT 11 LYS W 51  ? GLY W 61  ? LYS W 45  GLY W 55  
AT 12 THR W 64  ? ALA W 69  ? THR W 58  ALA W 63  
AT 13 ILE W 26  ? HIS W 30  ? ILE W 20  HIS W 24  
AT 14 ILE W 15  ? ILE W 23  ? ILE W 9   ILE W 17  
AU 1  ASP S 98  ? VAL S 101 ? ASP S 98  VAL S 101 
AU 2  GLY S 127 ? ARG S 130 ? GLY S 127 ARG S 130 
AV 1  VAL S 109 ? ASP S 111 ? VAL S 109 ASP S 111 
AV 2  SER S 231 ? ALA S 236 ? SER S 231 ALA S 236 
AV 3  LEU S 201 ? VAL S 208 ? LEU S 201 VAL S 208 
AV 4  HIS S 265 ? ASP S 271 ? HIS S 265 ASP S 271 
AV 5  SER S 322 ? GLU S 330 ? SER S 322 GLU S 330 
AV 6  LEU S 168 ? GLY S 171 ? LEU S 168 GLY S 171 
AV 7  GLY S 350 ? LEU S 354 ? GLY S 350 LEU S 354 
AV 8  VAL S 373 ? SER S 374 ? VAL S 373 SER S 374 
AW 1  PRO S 147 ? VAL S 148 ? PRO S 147 VAL S 148 
AW 2  ILE S 161 ? GLY S 162 ? ILE S 161 GLY S 162 
AX 1  LEU T 54  ? PHE T 57  ? LEU T 54  PHE T 57  
AX 2  LEU T 89  ? LYS T 91  ? LEU T 89  LYS T 91  
AX 3  THR T 30  ? GLY T 37  ? THR T 30  GLY T 37  
AX 4  ILE T 40  ? GLY T 45  ? ILE T 40  GLY T 45  
AX 5  GLN T 72  ? LEU T 77  ? GLN T 72  LEU T 77  
AX 6  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
AX 7  THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
AX 8  LYS X 81  ? ASP X 84  ? LYS X 75  ASP X 78  
AX 9  ALA X 42  ? LYS X 46  ? ALA X 36  LYS X 40  
AX 10 LYS X 51  ? GLY X 61  ? LYS X 45  GLY X 55  
AX 11 GLY U 31  ? GLY U 37  ? GLY U 31  GLY U 37  
AX 12 ILE U 40  ? GLY U 45  ? ILE U 40  GLY U 45  
AX 13 VAL U 73  ? LEU U 77  ? VAL U 73  LEU U 77  
AX 14 LYS U 62  ? LEU U 68  ? LYS U 62  LEU U 68  
AX 15 THR V 16  ? ILE V 23  ? THR V 10  ILE V 17  
AX 16 ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
AX 17 THR V 64  ? ALA V 69  ? THR V 58  ALA V 63  
AX 18 LYS V 51  ? GLY V 61  ? LYS V 45  GLY V 55  
AX 19 ASN V 41  ? LYS V 46  ? ASN V 35  LYS V 40  
AX 20 LYS V 81  ? PRO V 88  ? LYS V 75  PRO V 82  
AY 1  GLN T 72  ? LEU T 77  ? GLN T 72  LEU T 77  
AY 2  ILE T 40  ? GLY T 45  ? ILE T 40  GLY T 45  
AY 3  THR T 30  ? GLY T 37  ? THR T 30  GLY T 37  
AY 4  LEU T 89  ? LYS T 91  ? LEU T 89  LYS T 91  
AY 5  LEU T 54  ? PHE T 57  ? LEU T 54  PHE T 57  
AY 6  LYS T 62  ? LEU T 68  ? LYS T 62  LEU T 68  
AY 7  THR X 16  ? ILE X 23  ? THR X 10  ILE X 17  
AY 8  ILE X 26  ? HIS X 30  ? ILE X 20  HIS X 24  
AY 9  THR X 64  ? ALA X 69  ? THR X 58  ALA X 63  
AY 10 LYS X 51  ? GLY X 61  ? LYS X 45  GLY X 55  
AY 11 GLY U 31  ? GLY U 37  ? GLY U 31  GLY U 37  
AY 12 ILE U 40  ? GLY U 45  ? ILE U 40  GLY U 45  
AY 13 VAL U 73  ? LEU U 77  ? VAL U 73  LEU U 77  
AY 14 LYS U 62  ? LEU U 68  ? LYS U 62  LEU U 68  
AY 15 GLU U 53  ? PHE U 57  ? GLU U 53  PHE U 57  
AY 16 VAL U 90  ? ILE U 96  ? VAL U 90  ILE U 96  
AZ 1  VAL U 90  ? ILE U 96  ? VAL U 90  ILE U 96  
AZ 2  GLU U 53  ? PHE U 57  ? GLU U 53  PHE U 57  
AZ 3  LYS U 62  ? LEU U 68  ? LYS U 62  LEU U 68  
AZ 4  THR V 16  ? ILE V 23  ? THR V 10  ILE V 17  
AZ 5  LYS V 81  ? PRO V 88  ? LYS V 75  PRO V 82  
AZ 6  ASN V 41  ? LYS V 46  ? ASN V 35  LYS V 40  
AZ 7  LYS V 51  ? GLY V 61  ? LYS V 45  GLY V 55  
AZ 8  THR V 64  ? ALA V 69  ? THR V 58  ALA V 63  
AZ 9  ILE V 26  ? HIS V 30  ? ILE V 20  HIS V 24  
BA 1  ASP T 98  ? PRO T 100 ? ASP T 98  PRO T 100 
BA 2  ARG T 128 ? ARG T 130 ? ARG T 128 ARG T 130 
BB 1  VAL T 109 ? ASP T 111 ? VAL T 109 ASP T 111 
BB 2  SER T 231 ? ALA T 236 ? SER T 231 ALA T 236 
BB 3  TYR T 202 ? VAL T 208 ? TYR T 202 VAL T 208 
BB 4  HIS T 265 ? ASP T 271 ? HIS T 265 ASP T 271 
BB 5  SER T 322 ? GLU T 330 ? SER T 322 GLU T 330 
BB 6  LEU T 168 ? GLY T 171 ? LEU T 168 GLY T 171 
BB 7  GLY T 350 ? LEU T 354 ? GLY T 350 LEU T 354 
BB 8  VAL T 373 ? SER T 374 ? VAL T 373 SER T 374 
BC 1  PRO T 147 ? VAL T 148 ? PRO T 147 VAL T 148 
BC 2  ILE T 161 ? GLY T 162 ? ILE T 161 GLY T 162 
BD 1  ASP U 98  ? VAL U 101 ? ASP U 98  VAL U 101 
BD 2  GLY U 127 ? ARG U 130 ? GLY U 127 ARG U 130 
BE 1  VAL U 109 ? ASP U 111 ? VAL U 109 ASP U 111 
BE 2  SER U 231 ? ALA U 236 ? SER U 231 ALA U 236 
BE 3  LEU U 201 ? VAL U 208 ? LEU U 201 VAL U 208 
BE 4  HIS U 265 ? ASP U 271 ? HIS U 265 ASP U 271 
BE 5  SER U 322 ? GLU U 330 ? SER U 322 GLU U 330 
BE 6  LEU U 168 ? GLY U 171 ? LEU U 168 GLY U 171 
BE 7  GLY U 350 ? LEU U 354 ? GLY U 350 LEU U 354 
BE 8  VAL U 373 ? SER U 374 ? VAL U 373 SER U 374 
BF 1  SER V 90  ? PRO V 92  ? SER V 84  PRO V 86  
BF 2  ARG V 120 ? PRO V 122 ? ARG V 114 PRO V 116 
BG 1  ILE V 101 ? ASN V 103 ? ILE V 95  ASN V 97  
BG 2  VAL V 221 ? GLY V 226 ? VAL V 215 GLY V 220 
BG 3  SER V 188 ? VAL V 193 ? SER V 182 VAL V 187 
BG 4  VAL V 257 ? ASP V 262 ? VAL V 251 ASP V 256 
BG 5  VAL V 310 ? ALA V 315 ? VAL V 304 ALA V 309 
BG 6  LYS V 158 ? LEU V 161 ? LYS V 152 LEU V 155 
BG 7  ALA V 337 ? THR V 339 ? ALA V 331 THR V 333 
BG 8  LYS V 360 ? SER V 361 ? LYS V 354 SER V 355 
BH 1  SER W 90  ? PRO W 92  ? SER W 84  PRO W 86  
BH 2  ARG W 120 ? PRO W 122 ? ARG W 114 PRO W 116 
BI 1  ILE W 101 ? ILE W 102 ? ILE W 95  ILE W 96  
BI 2  VAL W 221 ? GLY W 226 ? VAL W 215 GLY W 220 
BI 3  SER W 188 ? VAL W 193 ? SER W 182 VAL W 187 
BI 4  ASP W 256 ? ILE W 261 ? ASP W 250 ILE W 255 
BI 5  SER W 309 ? ALA W 315 ? SER W 303 ALA W 309 
BI 6  LYS W 158 ? PHE W 162 ? LYS W 152 PHE W 156 
BI 7  ALA W 337 ? VAL W 340 ? ALA W 331 VAL W 334 
BJ 1  ILE W 139 ? LEU W 140 ? ILE W 133 LEU W 134 
BJ 2  TYR W 153 ? ALA W 154 ? TYR W 147 ALA W 148 
BK 1  SER X 90  ? PRO X 92  ? SER X 84  PRO X 86  
BK 2  ARG X 120 ? PRO X 122 ? ARG X 114 PRO X 116 
BL 1  ILE X 101 ? ILE X 102 ? ILE X 95  ILE X 96  
BL 2  VAL X 221 ? GLY X 226 ? VAL X 215 GLY X 220 
BL 3  SER X 188 ? VAL X 193 ? SER X 182 VAL X 187 
BL 4  ASP X 256 ? ASP X 262 ? ASP X 250 ASP X 256 
BL 5  SER X 309 ? VAL X 318 ? SER X 303 VAL X 312 
BL 6  LYS X 158 ? GLY X 164 ? LYS X 152 GLY X 158 
BL 7  ALA X 337 ? VAL X 340 ? ALA X 331 VAL X 334 
BL 8  LYS X 360 ? SER X 361 ? LYS X 354 SER X 355 
BM 1  ILE X 139 ? LEU X 140 ? ILE X 133 LEU X 134 
BM 2  TYR X 153 ? ALA X 154 ? TYR X 147 ALA X 148 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O GLY A 63  ? O GLY A 63  N VAL A 55  ? N VAL A 55  
A  2  3  N LEU A 54  ? N LEU A 54  O ASN A 95  ? O ASN A 95  
A  3  4  O VAL A 90  ? O VAL A 90  N GLY A 31  ? N GLY A 31  
A  4  5  N ARG A 32  ? N ARG A 32  O PHE A 44  ? O PHE A 44  
A  5  6  N ALA A 41  ? N ALA A 41  O ILE A 75  ? O ILE A 75  
A  6  7  O GLY A 74  ? O GLY A 74  N ILE A 67  ? N ILE A 67  
A  7  8  N LEU A 68  ? N LEU A 68  O VAL E 22  ? O VAL E 16  
A  8  9  N GLY E 17  ? N GLY E 11  O VAL E 82  ? O VAL E 76  
A  9  10 O LEU E 83  ? O LEU E 77  N GLU E 44  ? N GLU E 38  
A  10 11 N LEU E 43  ? N LEU E 37  O LEU E 54  ? O LEU E 48  
A  11 12 N ALA E 57  ? N ALA E 51  O ARG E 66  ? O ARG E 60  
A  12 13 O VAL E 65  ? O VAL E 59  N VAL E 29  ? N VAL E 23  
A  13 14 O ILE E 26  ? O ILE E 20  N ILE E 23  ? N ILE E 17  
B  1  2  N VAL A 99  ? N VAL A 99  O SER A 129 ? O SER A 129 
C  1  2  N VAL A 110 ? N VAL A 110 O ILE A 233 ? O ILE A 233 
C  2  3  O ALA A 236 ? O ALA A 236 N ALA A 207 ? N ALA A 207 
C  3  4  N VAL A 208 ? N VAL A 208 O ASP A 271 ? O ASP A 271 
C  4  5  N ILE A 268 ? N ILE A 268 O THR A 324 ? O THR A 324 
C  5  6  O PRO A 327 ? O PRO A 327 N ILE A 169 ? N ILE A 169 
C  6  7  N ILE A 170 ? N ILE A 170 O LEU A 354 ? O LEU A 354 
D  1  2  O VAL B 73  ? O VAL B 73  N VAL B 43  ? N VAL B 43  
D  2  3  O ARG B 42  ? O ARG B 42  N LEU B 34  ? N LEU B 34  
D  3  4  N GLY B 31  ? N GLY B 31  O VAL B 90  ? O VAL B 90  
D  4  5  O ASN B 95  ? O ASN B 95  N LEU B 54  ? N LEU B 54  
D  5  6  N VAL B 55  ? N VAL B 55  O GLY B 63  ? O GLY B 63  
D  6  7  N LEU B 68  ? N LEU B 68  O VAL F 22  ? O VAL F 16  
D  7  8  N THR F 20  ? N THR F 14  O ASP F 28  ? O ASP F 22  
D  8  9  N VAL F 29  ? N VAL F 23  O VAL F 65  ? O VAL F 59  
D  9  10 O ARG F 66  ? O ARG F 60  N ALA F 57  ? N ALA F 51  
D  10 11 O HIS F 59  ? O HIS F 53  N VAL C 36  ? N VAL C 36  
D  11 12 N GLY C 31  ? N GLY C 31  O VAL C 90  ? O VAL C 90  
D  12 13 O ASN C 95  ? O ASN C 95  N LEU C 54  ? N LEU C 54  
D  13 14 N GLU C 53  ? N GLU C 53  O ALA C 65  ? O ALA C 65  
D  14 15 N LEU C 68  ? N LEU C 68  O VAL D 22  ? O VAL D 16  
D  15 16 N GLY D 17  ? N GLY D 11  O VAL D 82  ? O VAL D 76  
D  16 17 O LEU D 83  ? O LEU D 77  N GLU D 44  ? N GLU D 38  
D  17 18 N LEU D 43  ? N LEU D 37  O LEU D 54  ? O LEU D 48  
D  18 19 N ALA D 57  ? N ALA D 51  O ARG D 66  ? O ARG D 60  
D  19 20 O VAL D 65  ? O VAL D 59  N VAL D 29  ? N VAL D 23  
E  1  2  N LEU B 54  ? N LEU B 54  O ASN B 95  ? O ASN B 95  
E  2  3  O VAL B 90  ? O VAL B 90  N GLY B 31  ? N GLY B 31  
E  3  4  N LEU B 34  ? N LEU B 34  O ARG B 42  ? O ARG B 42  
E  4  5  N VAL B 43  ? N VAL B 43  O VAL B 73  ? O VAL B 73  
E  5  6  O VAL B 76  ? O VAL B 76  N MET B 64  ? N MET B 64  
E  6  7  N LEU B 68  ? N LEU B 68  O VAL F 22  ? O VAL F 16  
E  7  8  N ILE F 15  ? N ILE F 9   O ASP F 84  ? O ASP F 78  
E  8  9  O LEU F 83  ? O LEU F 77  N GLU F 44  ? N GLU F 38  
E  9  10 N ILE F 45  ? N ILE F 39  O LEU F 52  ? O LEU F 46  
E  10 11 O HIS F 59  ? O HIS F 53  N VAL C 36  ? N VAL C 36  
E  11 12 N ALA C 35  ? N ALA C 35  O ARG C 42  ? O ARG C 42  
E  12 13 N VAL C 43  ? N VAL C 43  O VAL C 73  ? O VAL C 73  
E  13 14 O GLY C 74  ? O GLY C 74  N ILE C 67  ? N ILE C 67  
E  14 15 N LEU C 68  ? N LEU C 68  O VAL D 22  ? O VAL D 16  
E  15 16 N ILE D 23  ? N ILE D 17  O ILE D 26  ? O ILE D 20  
E  16 17 N VAL D 29  ? N VAL D 23  O VAL D 65  ? O VAL D 59  
E  17 18 O ARG D 66  ? O ARG D 60  N ALA D 57  ? N ALA D 51  
E  18 19 O LEU D 54  ? O LEU D 48  N LEU D 43  ? N LEU D 37  
E  19 20 N GLU D 44  ? N GLU D 38  O LEU D 83  ? O LEU D 77  
F  1  2  N VAL B 99  ? N VAL B 99  O SER B 129 ? O SER B 129 
G  1  2  N VAL B 110 ? N VAL B 110 O ILE B 233 ? O ILE B 233 
G  2  3  O VAL B 234 ? O VAL B 234 N ALA B 207 ? N ALA B 207 
G  3  4  N VAL B 204 ? N VAL B 204 O LEU B 267 ? O LEU B 267 
G  4  5  N ILE B 268 ? N ILE B 268 O LEU B 326 ? O LEU B 326 
G  5  6  O PRO B 327 ? O PRO B 327 N ILE B 169 ? N ILE B 169 
G  6  7  N LEU B 168 ? N LEU B 168 O ILE B 352 ? O ILE B 352 
G  7  8  N GLN B 351 ? N GLN B 351 O VAL B 373 ? O VAL B 373 
H  1  2  N VAL B 148 ? N VAL B 148 O ILE B 161 ? O ILE B 161 
I  1  2  N VAL C 99  ? N VAL C 99  O SER C 129 ? O SER C 129 
J  1  2  N VAL C 110 ? N VAL C 110 O ILE C 233 ? O ILE C 233 
J  2  3  O ALA C 236 ? O ALA C 236 N ALA C 207 ? N ALA C 207 
J  3  4  N VAL C 206 ? N VAL C 206 O VAL C 269 ? O VAL C 269 
J  4  5  N TYR C 270 ? N TYR C 270 O VAL C 328 ? O VAL C 328 
J  5  6  O PRO C 327 ? O PRO C 327 N ILE C 169 ? N ILE C 169 
J  6  7  N LEU C 168 ? N LEU C 168 O ILE C 352 ? O ILE C 352 
J  7  8  N GLN C 351 ? N GLN C 351 O VAL C 373 ? O VAL C 373 
K  1  2  N VAL D 91  ? N VAL D 85  O LYS D 121 ? O LYS D 115 
L  1  2  N ILE D 102 ? N ILE D 96  O LEU D 223 ? O LEU D 217 
L  2  3  O VAL D 224 ? O VAL D 218 N GLY D 192 ? N GLY D 186 
L  3  4  N VAL D 189 ? N VAL D 183 O PHE D 260 ? O PHE D 254 
L  4  5  N VAL D 257 ? N VAL D 251 O SER D 309 ? O SER D 303 
L  5  6  O GLN D 314 ? O GLN D 308 N LEU D 161 ? N LEU D 155 
L  6  7  N GLY D 160 ? N GLY D 154 O THR D 339 ? O THR D 333 
M  1  2  N LEU D 140 ? N LEU D 134 O TYR D 153 ? O TYR D 147 
N  1  2  N VAL E 91  ? N VAL E 85  O LYS E 121 ? O LYS E 115 
O  1  2  N ILE E 102 ? N ILE E 96  O LEU E 223 ? O LEU E 217 
O  2  3  O GLY E 226 ? O GLY E 220 N GLY E 192 ? N GLY E 186 
O  3  4  N VAL E 189 ? N VAL E 183 O LEU E 258 ? O LEU E 252 
O  4  5  N VAL E 257 ? N VAL E 251 O THR E 311 ? O THR E 305 
O  5  6  O GLY E 308 ? O GLY E 302 N THR E 305 ? N THR E 299 
P  1  2  N ILE E 102 ? N ILE E 96  O LEU E 223 ? O LEU E 217 
P  2  3  O GLY E 226 ? O GLY E 220 N GLY E 192 ? N GLY E 186 
P  3  4  N VAL E 189 ? N VAL E 183 O LEU E 258 ? O LEU E 252 
P  4  5  N VAL E 257 ? N VAL E 251 O THR E 311 ? O THR E 305 
P  5  6  O GLN E 314 ? O GLN E 308 N ILE E 159 ? N ILE E 153 
P  6  7  N GLY E 160 ? N GLY E 154 O ALA E 337 ? O ALA E 331 
Q  1  2  N VAL F 91  ? N VAL F 85  O LYS F 121 ? O LYS F 115 
R  1  2  N ILE F 102 ? N ILE F 96  O LEU F 223 ? O LEU F 217 
R  2  3  O VAL F 224 ? O VAL F 218 N PHE F 190 ? N PHE F 184 
R  3  4  N VAL F 189 ? N VAL F 183 O LEU F 258 ? O LEU F 252 
R  4  5  N VAL F 257 ? N VAL F 251 O THR F 311 ? O THR F 305 
R  5  6  O GLN F 314 ? O GLN F 308 N LEU F 161 ? N LEU F 155 
R  6  7  N PHE F 162 ? N PHE F 156 O LEU F 341 ? O LEU F 335 
R  7  8  N THR F 338 ? N THR F 332 O LYS F 360 ? O LYS F 354 
S  1  2  N LEU F 140 ? N LEU F 134 O TYR F 153 ? O TYR F 147 
T  1  2  O GLU G 176 ? O GLU G 176 N ASP G 168 ? N ASP G 168 
T  2  3  O PHE G 165 ? O PHE G 165 N VAL G 75  ? N VAL G 75  
T  3  4  N ILE G 74  ? N ILE G 74  O ASP G 106 ? O ASP G 106 
T  4  5  N ILE G 107 ? N ILE G 107 O LYS G 127 ? O LYS G 127 
T  5  6  N ASN G 131 ? N ASN G 131 O PHE I 43  ? O PHE I 43  
U  1  2  O TYR H 22  ? O TYR H 22  N PHE H 14  ? N PHE H 14  
U  2  3  N GLN H 13  ? N GLN H 13  O LEU H 83  ? O LEU H 83  
U  3  4  O THR H 86  ? O THR H 86  N PHE H 74  ? N PHE H 74  
U  4  5  O ALA H 75  ? O ALA H 75  N GLU H 50  ? N GLU H 50  
V  1  2  O VAL H 41  ? O VAL H 41  N VAL H 30  ? N VAL H 30  
V  2  3  N GLN H 29  ? N GLN H 29  O MET H 60  ? O MET H 60  
V  3  4  N VAL H 59  ? N VAL H 59  O LYS H 66  ? O LYS H 66  
W  1  2  N GLY H 55  ? N GLY H 55  O ILE H 70  ? O ILE H 70  
W  2  3  N PHE H 69  ? N PHE H 69  O PHE H 91  ? O PHE H 91  
X  1  2  O GLY J 63  ? O GLY J 63  N VAL J 55  ? N VAL J 55  
X  2  3  N LEU J 54  ? N LEU J 54  O ASN J 95  ? O ASN J 95  
X  3  4  O VAL J 90  ? O VAL J 90  N GLY J 31  ? N GLY J 31  
X  4  5  N LEU J 34  ? N LEU J 34  O ARG J 42  ? O ARG J 42  
X  5  6  N VAL J 43  ? N VAL J 43  O VAL J 73  ? O VAL J 73  
X  6  7  O GLY J 74  ? O GLY J 74  N ILE J 67  ? N ILE J 67  
X  7  8  N LEU J 68  ? N LEU J 68  O VAL N 22  ? O VAL N 16  
X  8  9  N GLY N 17  ? N GLY N 11  O VAL N 82  ? O VAL N 76  
X  9  10 O LEU N 83  ? O LEU N 77  N GLU N 44  ? N GLU N 38  
X  10 11 N LEU N 43  ? N LEU N 37  O LEU N 54  ? O LEU N 48  
X  11 12 N ALA N 57  ? N ALA N 51  O ARG N 66  ? O ARG N 60  
X  12 13 O VAL N 65  ? O VAL N 59  N VAL N 29  ? N VAL N 23  
X  13 14 O HIS N 30  ? O HIS N 24  N LYS N 18  ? N LYS N 12  
Y  1  2  N VAL J 99  ? N VAL J 99  O SER J 129 ? O SER J 129 
Z  1  2  N VAL J 110 ? N VAL J 110 O ILE J 233 ? O ILE J 233 
Z  2  3  O ALA J 236 ? O ALA J 236 N ALA J 207 ? N ALA J 207 
Z  3  4  N VAL J 208 ? N VAL J 208 O ASP J 271 ? O ASP J 271 
Z  4  5  N ILE J 268 ? N ILE J 268 O LEU J 326 ? O LEU J 326 
Z  5  6  O PRO J 327 ? O PRO J 327 N ILE J 169 ? N ILE J 169 
Z  6  7  N LEU J 168 ? N LEU J 168 O GLY J 350 ? O GLY J 350 
Z  7  8  N GLN J 351 ? N GLN J 351 O VAL J 373 ? O VAL J 373 
AA 1  2  N VAL J 148 ? N VAL J 148 O ILE J 161 ? O ILE J 161 
AB 1  2  O VAL K 73  ? O VAL K 73  N VAL K 43  ? N VAL K 43  
AB 2  3  O PHE K 44  ? O PHE K 44  N ARG K 32  ? N ARG K 32  
AB 3  4  N GLY K 31  ? N GLY K 31  O VAL K 90  ? O VAL K 90  
AB 4  5  O LYS K 91  ? O LYS K 91  N GLU K 56  ? N GLU K 56  
AB 5  6  N VAL K 55  ? N VAL K 55  O GLY K 63  ? O GLY K 63  
AB 6  7  N LEU K 68  ? N LEU K 68  O VAL O 22  ? O VAL O 16  
AB 7  8  N THR O 20  ? N THR O 14  O ASP O 28  ? O ASP O 22  
AB 8  9  N VAL O 29  ? N VAL O 23  O VAL O 65  ? O VAL O 59  
AB 9  10 O ARG O 66  ? O ARG O 60  N ALA O 57  ? N ALA O 51  
AB 10 11 O HIS O 59  ? O HIS O 53  N VAL L 36  ? N VAL L 36  
AB 11 12 N GLY L 31  ? N GLY L 31  O VAL L 90  ? O VAL L 90  
AB 12 13 O LYS L 91  ? O LYS L 91  N GLU L 56  ? N GLU L 56  
AB 13 14 N VAL L 55  ? N VAL L 55  O GLY L 63  ? O GLY L 63  
AB 14 15 N LEU L 68  ? N LEU L 68  O VAL M 22  ? O VAL M 16  
AB 15 16 N GLY M 17  ? N GLY M 11  O VAL M 82  ? O VAL M 76  
AB 16 17 O LEU M 83  ? O LEU M 77  N GLU M 44  ? N GLU M 38  
AB 17 18 N LEU M 43  ? N LEU M 37  O LEU M 54  ? O LEU M 48  
AB 18 19 N ALA M 57  ? N ALA M 51  O ARG M 66  ? O ARG M 60  
AB 19 20 O VAL M 65  ? O VAL M 59  N VAL M 29  ? N VAL M 23  
AC 1  2  N GLU K 56  ? N GLU K 56  O LYS K 91  ? O LYS K 91  
AC 2  3  O VAL K 90  ? O VAL K 90  N GLY K 31  ? N GLY K 31  
AC 3  4  N ARG K 32  ? N ARG K 32  O PHE K 44  ? O PHE K 44  
AC 4  5  N VAL K 43  ? N VAL K 43  O VAL K 73  ? O VAL K 73  
AC 5  6  O GLY K 74  ? O GLY K 74  N LEU K 66  ? N LEU K 66  
AC 6  7  N LEU K 68  ? N LEU K 68  O VAL O 22  ? O VAL O 16  
AC 7  8  N GLY O 17  ? N GLY O 11  O VAL O 82  ? O VAL O 76  
AC 8  9  O LEU O 83  ? O LEU O 77  N GLU O 44  ? N GLU O 38  
AC 9  10 N LEU O 43  ? N LEU O 37  O LEU O 54  ? O LEU O 48  
AC 10 11 O HIS O 59  ? O HIS O 53  N VAL L 36  ? N VAL L 36  
AC 11 12 N ARG L 32  ? N ARG L 32  O PHE L 44  ? O PHE L 44  
AC 12 13 N ALA L 41  ? N ALA L 41  O ILE L 75  ? O ILE L 75  
AC 13 14 O GLY L 74  ? O GLY L 74  N ILE L 67  ? N ILE L 67  
AC 14 15 N LEU L 68  ? N LEU L 68  O VAL M 22  ? O VAL M 16  
AC 15 16 N THR M 20  ? N THR M 14  O ASP M 28  ? O ASP M 22  
AC 16 17 N VAL M 29  ? N VAL M 23  O VAL M 65  ? O VAL M 59  
AC 17 18 O ARG M 66  ? O ARG M 60  N ALA M 57  ? N ALA M 51  
AC 18 19 O LEU M 54  ? O LEU M 48  N LEU M 43  ? N LEU M 37  
AC 19 20 N GLU M 44  ? N GLU M 38  O LEU M 83  ? O LEU M 77  
AD 1  2  N VAL K 101 ? N VAL K 101 O GLY K 127 ? O GLY K 127 
AE 1  2  N VAL K 110 ? N VAL K 110 O ILE K 233 ? O ILE K 233 
AE 2  3  O ILE K 232 ? O ILE K 232 N TYR K 205 ? N TYR K 205 
AE 3  4  N VAL K 206 ? N VAL K 206 O VAL K 269 ? O VAL K 269 
AE 4  5  N ALA K 266 ? N ALA K 266 O SER K 322 ? O SER K 322 
AE 5  6  O PRO K 327 ? O PRO K 327 N ILE K 169 ? N ILE K 169 
AE 6  7  N LEU K 168 ? N LEU K 168 O ILE K 352 ? O ILE K 352 
AE 7  8  N PHE K 353 ? N PHE K 353 O ASN K 368 ? O ASN K 368 
AF 1  2  N VAL L 101 ? N VAL L 101 O GLY L 127 ? O GLY L 127 
AG 1  2  N VAL L 110 ? N VAL L 110 O ILE L 233 ? O ILE L 233 
AG 2  3  O ILE L 232 ? O ILE L 232 N CYS L 203 ? N CYS L 203 
AG 3  4  N VAL L 206 ? N VAL L 206 O VAL L 269 ? O VAL L 269 
AG 4  5  N ILE L 268 ? N ILE L 268 O THR L 324 ? O THR L 324 
AG 5  6  O PRO L 327 ? O PRO L 327 N ILE L 169 ? N ILE L 169 
AG 6  7  N ILE L 170 ? N ILE L 170 O ILE L 352 ? O ILE L 352 
AG 7  8  N GLN L 351 ? N GLN L 351 O VAL L 373 ? O VAL L 373 
AH 1  2  N VAL L 148 ? N VAL L 148 O ILE L 161 ? O ILE L 161 
AI 1  2  N VAL M 91  ? N VAL M 85  O LYS M 121 ? O LYS M 115 
AJ 1  2  N ILE M 102 ? N ILE M 96  O LEU M 223 ? O LEU M 217 
AJ 2  3  O VAL M 224 ? O VAL M 218 N GLY M 192 ? N GLY M 186 
AJ 3  4  N VAL M 189 ? N VAL M 183 O LEU M 258 ? O LEU M 252 
AJ 4  5  N VAL M 257 ? N VAL M 251 O THR M 311 ? O THR M 305 
AJ 5  6  O VAL M 316 ? O VAL M 310 N LEU M 161 ? N LEU M 155 
AJ 6  7  N GLY M 160 ? N GLY M 154 O THR M 339 ? O THR M 333 
AK 1  2  N GLU M 138 ? N GLU M 132 O ARG M 155 ? O ARG M 149 
AL 1  2  N VAL N 91  ? N VAL N 85  O LYS N 121 ? O LYS N 115 
AM 1  2  N ILE N 102 ? N ILE N 96  O LEU N 223 ? O LEU N 217 
AM 2  3  O GLY N 226 ? O GLY N 220 N GLY N 192 ? N GLY N 186 
AM 3  4  N VAL N 189 ? N VAL N 183 O PHE N 260 ? O PHE N 254 
AM 4  5  N VAL N 257 ? N VAL N 251 O SER N 309 ? O SER N 303 
AM 5  6  O GLN N 314 ? O GLN N 308 N LEU N 161 ? N LEU N 155 
AM 6  7  N GLY N 160 ? N GLY N 154 O ALA N 337 ? O ALA N 331 
AN 1  2  N VAL O 91  ? N VAL O 85  O LYS O 121 ? O LYS O 115 
AO 1  2  N ILE O 102 ? N ILE O 96  O PHE O 225 ? O PHE O 219 
AO 2  3  O VAL O 224 ? O VAL O 218 N PHE O 190 ? N PHE O 184 
AO 3  4  N THR O 191 ? N THR O 185 O PHE O 260 ? O PHE O 254 
AO 4  5  N VAL O 257 ? N VAL O 251 O SER O 309 ? O SER O 303 
AO 5  6  O VAL O 316 ? O VAL O 310 N LEU O 161 ? N LEU O 155 
AO 6  7  N LYS O 158 ? N LYS O 152 O ALA O 337 ? O ALA O 331 
AP 1  2  N LEU O 140 ? N LEU O 134 O TYR O 153 ? O TYR O 147 
AQ 1  2  O SER P 178 ? O SER P 178 N TYR P 166 ? N TYR P 166 
AQ 2  3  O SER P 163 ? O SER P 163 N LEU P 73  ? N LEU P 73  
AQ 3  4  N ILE P 74  ? N ILE P 74  O VAL P 108 ? O VAL P 108 
AQ 4  5  N THR P 109 ? N THR P 109 O ILE P 130 ? O ILE P 130 
AQ 5  6  N SER P 129 ? N SER P 129 O THR R 45  ? O THR R 45  
AR 1  2  N GLN Q 13  ? N GLN Q 13  O VAL Q 85  ? O VAL Q 85  
AR 2  3  O CYS Q 84  ? O CYS Q 84  N THR Q 76  ? N THR Q 76  
AR 3  4  O GLY Q 73  ? O GLY Q 73  N LEU Q 52  ? N LEU Q 52  
AS 1  2  O GLY Q 37  ? O GLY Q 37  N ALA Q 34  ? N ALA Q 34  
AS 2  3  N GLN Q 29  ? N GLN Q 29  O MET Q 60  ? O MET Q 60  
AT 1  2  O GLY S 63  ? O GLY S 63  N VAL S 55  ? N VAL S 55  
AT 2  3  N LEU S 54  ? N LEU S 54  O ASN S 95  ? O ASN S 95  
AT 3  4  O VAL S 90  ? O VAL S 90  N GLY S 31  ? N GLY S 31  
AT 4  5  N ARG S 32  ? N ARG S 32  O PHE S 44  ? O PHE S 44  
AT 5  6  N VAL S 43  ? N VAL S 43  O VAL S 73  ? O VAL S 73  
AT 6  7  O GLY S 74  ? O GLY S 74  N ILE S 67  ? N ILE S 67  
AT 7  8  N LEU S 68  ? N LEU S 68  O VAL W 22  ? O VAL W 16  
AT 8  9  N ILE W 15  ? N ILE W 9   O ASP W 84  ? O ASP W 78  
AT 9  10 O LEU W 83  ? O LEU W 77  N GLU W 44  ? N GLU W 38  
AT 10 11 N ILE W 45  ? N ILE W 39  O LEU W 52  ? O LEU W 46  
AT 11 12 N GLU W 55  ? N GLU W 49  O ILE W 68  ? O ILE W 62  
AT 12 13 O VAL W 65  ? O VAL W 59  N VAL W 29  ? N VAL W 23  
AT 13 14 O ASP W 28  ? O ASP W 22  N THR W 20  ? N THR W 14  
AU 1  2  N VAL S 99  ? N VAL S 99  O SER S 129 ? O SER S 129 
AV 1  2  N VAL S 110 ? N VAL S 110 O ALA S 235 ? O ALA S 235 
AV 2  3  O VAL S 234 ? O VAL S 234 N ALA S 207 ? N ALA S 207 
AV 3  4  N VAL S 204 ? N VAL S 204 O LEU S 267 ? O LEU S 267 
AV 4  5  N ILE S 268 ? N ILE S 268 O THR S 324 ? O THR S 324 
AV 5  6  O PRO S 327 ? O PRO S 327 N ILE S 169 ? N ILE S 169 
AV 6  7  N ILE S 170 ? N ILE S 170 O ILE S 352 ? O ILE S 352 
AV 7  8  N GLN S 351 ? N GLN S 351 O VAL S 373 ? O VAL S 373 
AW 1  2  N VAL S 148 ? N VAL S 148 O ILE S 161 ? O ILE S 161 
AX 1  2  N GLU T 56  ? N GLU T 56  O LYS T 91  ? O LYS T 91  
AX 2  3  O VAL T 90  ? O VAL T 90  N GLY T 31  ? N GLY T 31  
AX 3  4  N GLY T 37  ? N GLY T 37  O ILE T 40  ? O ILE T 40  
AX 4  5  N VAL T 43  ? N VAL T 43  O VAL T 73  ? O VAL T 73  
AX 5  6  O GLY T 74  ? O GLY T 74  N ILE T 67  ? N ILE T 67  
AX 6  7  N LEU T 68  ? N LEU T 68  O VAL X 22  ? O VAL X 16  
AX 7  8  N GLY X 17  ? N GLY X 11  O VAL X 82  ? O VAL X 76  
AX 8  9  O LEU X 83  ? O LEU X 77  N GLU X 44  ? N GLU X 38  
AX 9  10 N LEU X 43  ? N LEU X 37  O LEU X 54  ? O LEU X 48  
AX 10 11 O HIS X 59  ? O HIS X 53  N VAL U 36  ? N VAL U 36  
AX 11 12 N ARG U 32  ? N ARG U 32  O PHE U 44  ? O PHE U 44  
AX 12 13 N VAL U 43  ? N VAL U 43  O VAL U 73  ? O VAL U 73  
AX 13 14 O GLY U 74  ? O GLY U 74  N ILE U 67  ? N ILE U 67  
AX 14 15 N LEU U 68  ? N LEU U 68  O VAL V 22  ? O VAL V 16  
AX 15 16 N THR V 20  ? N THR V 14  O ASP V 28  ? O ASP V 22  
AX 16 17 N VAL V 27  ? N VAL V 21  O THR V 67  ? O THR V 61  
AX 17 18 O ARG V 66  ? O ARG V 60  N ALA V 57  ? N ALA V 51  
AX 18 19 O LEU V 54  ? O LEU V 48  N LEU V 43  ? N LEU V 37  
AX 19 20 N ALA V 42  ? N ALA V 36  O GLY V 87  ? O GLY V 81  
AY 1  2  O VAL T 73  ? O VAL T 73  N VAL T 43  ? N VAL T 43  
AY 2  3  O ILE T 40  ? O ILE T 40  N GLY T 37  ? N GLY T 37  
AY 3  4  N GLY T 31  ? N GLY T 31  O VAL T 90  ? O VAL T 90  
AY 4  5  O LYS T 91  ? O LYS T 91  N GLU T 56  ? N GLU T 56  
AY 5  6  N VAL T 55  ? N VAL T 55  O GLY T 63  ? O GLY T 63  
AY 6  7  N LEU T 68  ? N LEU T 68  O VAL X 22  ? O VAL X 16  
AY 7  8  N ALA X 21  ? N ALA X 15  O ASP X 28  ? O ASP X 22  
AY 8  9  N VAL X 27  ? N VAL X 21  O THR X 67  ? O THR X 61  
AY 9  10 O ARG X 66  ? O ARG X 60  N ALA X 57  ? N ALA X 51  
AY 10 11 O HIS X 59  ? O HIS X 53  N VAL U 36  ? N VAL U 36  
AY 11 12 N ARG U 32  ? N ARG U 32  O PHE U 44  ? O PHE U 44  
AY 12 13 N VAL U 43  ? N VAL U 43  O VAL U 73  ? O VAL U 73  
AY 13 14 O GLY U 74  ? O GLY U 74  N ILE U 67  ? N ILE U 67  
AY 14 15 O ALA U 65  ? O ALA U 65  N GLU U 53  ? N GLU U 53  
AY 15 16 N GLU U 56  ? N GLU U 56  O LYS U 91  ? O LYS U 91  
AZ 1  2  O LYS U 91  ? O LYS U 91  N GLU U 56  ? N GLU U 56  
AZ 2  3  N GLU U 53  ? N GLU U 53  O ALA U 65  ? O ALA U 65  
AZ 3  4  N LEU U 68  ? N LEU U 68  O VAL V 22  ? O VAL V 16  
AZ 4  5  N GLY V 17  ? N GLY V 11  O VAL V 82  ? O VAL V 76  
AZ 5  6  O GLY V 87  ? O GLY V 81  N ALA V 42  ? N ALA V 36  
AZ 6  7  N LEU V 43  ? N LEU V 37  O LEU V 54  ? O LEU V 48  
AZ 7  8  N ALA V 57  ? N ALA V 51  O ARG V 66  ? O ARG V 60  
AZ 8  9  O THR V 67  ? O THR V 61  N VAL V 27  ? N VAL V 21  
BA 1  2  N VAL T 99  ? N VAL T 99  O SER T 129 ? O SER T 129 
BB 1  2  N VAL T 110 ? N VAL T 110 O ALA T 235 ? O ALA T 235 
BB 2  3  O ILE T 232 ? O ILE T 232 N CYS T 203 ? N CYS T 203 
BB 3  4  N TYR T 202 ? N TYR T 202 O LEU T 267 ? O LEU T 267 
BB 4  5  N ILE T 268 ? N ILE T 268 O LEU T 326 ? O LEU T 326 
BB 5  6  O PRO T 327 ? O PRO T 327 N ILE T 169 ? N ILE T 169 
BB 6  7  N LEU T 168 ? N LEU T 168 O ILE T 352 ? O ILE T 352 
BB 7  8  N GLN T 351 ? N GLN T 351 O VAL T 373 ? O VAL T 373 
BC 1  2  N VAL T 148 ? N VAL T 148 O ILE T 161 ? O ILE T 161 
BD 1  2  N VAL U 99  ? N VAL U 99  O SER U 129 ? O SER U 129 
BE 1  2  N VAL U 110 ? N VAL U 110 O ILE U 233 ? O ILE U 233 
BE 2  3  O VAL U 234 ? O VAL U 234 N TYR U 205 ? N TYR U 205 
BE 3  4  N TYR U 202 ? N TYR U 202 O HIS U 265 ? O HIS U 265 
BE 4  5  N ILE U 268 ? N ILE U 268 O THR U 324 ? O THR U 324 
BE 5  6  O PRO U 327 ? O PRO U 327 N ILE U 169 ? N ILE U 169 
BE 6  7  N LEU U 168 ? N LEU U 168 O ILE U 352 ? O ILE U 352 
BE 7  8  N GLN U 351 ? N GLN U 351 O VAL U 373 ? O VAL U 373 
BF 1  2  N VAL V 91  ? N VAL V 85  O LYS V 121 ? O LYS V 115 
BG 1  2  N ILE V 102 ? N ILE V 96  O LEU V 223 ? O LEU V 217 
BG 2  3  O ALA V 222 ? O ALA V 216 N PHE V 190 ? N PHE V 184 
BG 3  4  N THR V 191 ? N THR V 185 O PHE V 260 ? O PHE V 254 
BG 4  5  N VAL V 257 ? N VAL V 251 O THR V 311 ? O THR V 305 
BG 5  6  O GLN V 314 ? O GLN V 308 N LEU V 161 ? N LEU V 155 
BG 6  7  N GLY V 160 ? N GLY V 154 O THR V 339 ? O THR V 333 
BG 7  8  N THR V 338 ? N THR V 332 O LYS V 360 ? O LYS V 354 
BH 1  2  N VAL W 91  ? N VAL W 85  O LYS W 121 ? O LYS W 115 
BI 1  2  N ILE W 102 ? N ILE W 96  O LEU W 223 ? O LEU W 217 
BI 2  3  O ALA W 222 ? O ALA W 216 N SER W 188 ? N SER W 182 
BI 3  4  N THR W 191 ? N THR W 185 O PHE W 260 ? O PHE W 254 
BI 4  5  N VAL W 257 ? N VAL W 251 O THR W 311 ? O THR W 305 
BI 5  6  O GLN W 314 ? O GLN W 308 N LEU W 161 ? N LEU W 155 
BI 6  7  N GLY W 160 ? N GLY W 154 O THR W 339 ? O THR W 333 
BJ 1  2  N LEU W 140 ? N LEU W 134 O TYR W 153 ? O TYR W 147 
BK 1  2  N VAL X 91  ? N VAL X 85  O LYS X 121 ? O LYS X 115 
BL 1  2  N ILE X 102 ? N ILE X 96  O PHE X 225 ? O PHE X 219 
BL 2  3  O VAL X 224 ? O VAL X 218 N PHE X 190 ? N PHE X 184 
BL 3  4  N VAL X 189 ? N VAL X 183 O LEU X 258 ? O LEU X 252 
BL 4  5  N LEU X 259 ? N LEU X 253 O THR X 311 ? O THR X 305 
BL 5  6  O GLN X 314 ? O GLN X 308 N ILE X 159 ? N ILE X 153 
BL 6  7  N GLY X 160 ? N GLY X 154 O ALA X 337 ? O ALA X 331 
BL 7  8  N THR X 338 ? N THR X 332 O LYS X 360 ? O LYS X 354 
BM 1  2  N LEU X 140 ? N LEU X 134 O TYR X 153 ? O TYR X 147 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP A 600' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 700'  
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP B 600' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 700'  
AC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANP C 600' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 700'  
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP D 600' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 700'  
AC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP F 600' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG F 700'  
BC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP J 600' 
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG J 700'  
BC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP K 600' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG K 700'  
BC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANP L 600' 
BC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG L 700'  
BC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ANP M 600' 
BC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG M 700'  
CC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ANP O 600' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG O 700'  
CC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP S 600' 
CC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG S 700'  
CC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANP T 600' 
CC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG T 700'  
CC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANP U 600' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG U 700'  
CC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANP V 600' 
DC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG V 700'  
DC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ANP X 600' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG X 700'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 ARG A  173 ? ARG A 173 . ? 1_555 ? 
2   AC1 12 GLN A  174 ? GLN A 174 . ? 1_555 ? 
3   AC1 12 THR A  175 ? THR A 175 . ? 1_555 ? 
4   AC1 12 GLY A  176 ? GLY A 176 . ? 1_555 ? 
5   AC1 12 LYS A  177 ? LYS A 177 . ? 1_555 ? 
6   AC1 12 THR A  178 ? THR A 178 . ? 1_555 ? 
7   AC1 12 ALA A  179 ? ALA A 179 . ? 1_555 ? 
8   AC1 12 PHE A  359 ? PHE A 359 . ? 1_555 ? 
9   AC1 12 ARG A  364 ? ARG A 364 . ? 1_555 ? 
10  AC1 12 GLN A  432 ? GLN A 432 . ? 1_555 ? 
11  AC1 12 GLN A  434 ? GLN A 434 . ? 1_555 ? 
12  AC1 12 MG  AA .   ? MG  A 700 . ? 1_555 ? 
13  AC2 2  THR A  178 ? THR A 178 . ? 1_555 ? 
14  AC2 2  ANP Z  .   ? ANP A 600 . ? 1_555 ? 
15  AC3 11 GLN B  174 ? GLN B 174 . ? 1_555 ? 
16  AC3 11 THR B  175 ? THR B 175 . ? 1_555 ? 
17  AC3 11 GLY B  176 ? GLY B 176 . ? 1_555 ? 
18  AC3 11 LYS B  177 ? LYS B 177 . ? 1_555 ? 
19  AC3 11 THR B  178 ? THR B 178 . ? 1_555 ? 
20  AC3 11 ALA B  179 ? ALA B 179 . ? 1_555 ? 
21  AC3 11 PHE B  359 ? PHE B 359 . ? 1_555 ? 
22  AC3 11 ARG B  364 ? ARG B 364 . ? 1_555 ? 
23  AC3 11 GLN B  432 ? GLN B 432 . ? 1_555 ? 
24  AC3 11 GLN B  434 ? GLN B 434 . ? 1_555 ? 
25  AC3 11 MG  CA .   ? MG  B 700 . ? 1_555 ? 
26  AC4 2  THR B  178 ? THR B 178 . ? 1_555 ? 
27  AC4 2  ANP BA .   ? ANP B 600 . ? 1_555 ? 
28  AC5 14 ARG C  173 ? ARG C 173 . ? 1_555 ? 
29  AC5 14 GLN C  174 ? GLN C 174 . ? 1_555 ? 
30  AC5 14 THR C  175 ? THR C 175 . ? 1_555 ? 
31  AC5 14 GLY C  176 ? GLY C 176 . ? 1_555 ? 
32  AC5 14 LYS C  177 ? LYS C 177 . ? 1_555 ? 
33  AC5 14 THR C  178 ? THR C 178 . ? 1_555 ? 
34  AC5 14 ALA C  179 ? ALA C 179 . ? 1_555 ? 
35  AC5 14 GLU C  330 ? GLU C 330 . ? 1_555 ? 
36  AC5 14 PHE C  359 ? PHE C 359 . ? 1_555 ? 
37  AC5 14 ARG C  364 ? ARG C 364 . ? 1_555 ? 
38  AC5 14 GLN C  432 ? GLN C 432 . ? 1_555 ? 
39  AC5 14 GLN C  434 ? GLN C 434 . ? 1_555 ? 
40  AC5 14 MG  EA .   ? MG  C 700 . ? 1_555 ? 
41  AC5 14 TYR F  374 ? TYR F 368 . ? 1_555 ? 
42  AC6 2  THR C  178 ? THR C 178 . ? 1_555 ? 
43  AC6 2  ANP DA .   ? ANP C 600 . ? 1_555 ? 
44  AC7 13 ARG C  375 ? ARG C 375 . ? 1_555 ? 
45  AC7 13 GLY D  166 ? GLY D 160 . ? 1_555 ? 
46  AC7 13 GLY D  168 ? GLY D 162 . ? 1_555 ? 
47  AC7 13 LYS D  169 ? LYS D 163 . ? 1_555 ? 
48  AC7 13 THR D  170 ? THR D 164 . ? 1_555 ? 
49  AC7 13 VAL D  171 ? VAL D 165 . ? 1_555 ? 
50  AC7 13 ARG D  196 ? ARG D 190 . ? 1_555 ? 
51  AC7 13 TYR D  317 ? TYR D 311 . ? 1_555 ? 
52  AC7 13 TYR D  351 ? TYR D 345 . ? 1_555 ? 
53  AC7 13 PHE D  424 ? PHE D 418 . ? 1_555 ? 
54  AC7 13 ALA D  427 ? ALA D 421 . ? 1_555 ? 
55  AC7 13 PHE D  430 ? PHE D 424 . ? 1_555 ? 
56  AC7 13 MG  GA .   ? MG  D 700 . ? 1_555 ? 
57  AC8 2  THR D  170 ? THR D 164 . ? 1_555 ? 
58  AC8 2  ANP FA .   ? ANP D 600 . ? 1_555 ? 
59  AC9 18 SER B  346 ? SER B 346 . ? 1_555 ? 
60  AC9 18 VAL B  373 ? VAL B 373 . ? 1_555 ? 
61  AC9 18 ARG B  375 ? ARG B 375 . ? 1_555 ? 
62  AC9 18 GLY F  164 ? GLY F 158 . ? 1_555 ? 
63  AC9 18 ALA F  165 ? ALA F 159 . ? 1_555 ? 
64  AC9 18 GLY F  166 ? GLY F 160 . ? 1_555 ? 
65  AC9 18 VAL F  167 ? VAL F 161 . ? 1_555 ? 
66  AC9 18 GLY F  168 ? GLY F 162 . ? 1_555 ? 
67  AC9 18 LYS F  169 ? LYS F 163 . ? 1_555 ? 
68  AC9 18 THR F  170 ? THR F 164 . ? 1_555 ? 
69  AC9 18 VAL F  171 ? VAL F 165 . ? 1_555 ? 
70  AC9 18 GLU F  195 ? GLU F 189 . ? 1_555 ? 
71  AC9 18 ARG F  196 ? ARG F 190 . ? 1_555 ? 
72  AC9 18 TYR F  351 ? TYR F 345 . ? 1_555 ? 
73  AC9 18 PHE F  424 ? PHE F 418 . ? 1_555 ? 
74  AC9 18 ALA F  427 ? ALA F 421 . ? 1_555 ? 
75  AC9 18 PHE F  430 ? PHE F 424 . ? 1_555 ? 
76  AC9 18 MG  IA .   ? MG  F 700 . ? 1_555 ? 
77  BC1 5  THR F  170 ? THR F 164 . ? 1_555 ? 
78  BC1 5  GLU F  195 ? GLU F 189 . ? 1_555 ? 
79  BC1 5  ARG F  196 ? ARG F 190 . ? 1_555 ? 
80  BC1 5  GLU F  199 ? GLU F 193 . ? 1_555 ? 
81  BC1 5  ANP HA .   ? ANP F 600 . ? 1_555 ? 
82  BC2 11 ARG J  173 ? ARG J 173 . ? 1_555 ? 
83  BC2 11 GLN J  174 ? GLN J 174 . ? 1_555 ? 
84  BC2 11 THR J  175 ? THR J 175 . ? 1_555 ? 
85  BC2 11 GLY J  176 ? GLY J 176 . ? 1_555 ? 
86  BC2 11 LYS J  177 ? LYS J 177 . ? 1_555 ? 
87  BC2 11 THR J  178 ? THR J 178 . ? 1_555 ? 
88  BC2 11 ALA J  179 ? ALA J 179 . ? 1_555 ? 
89  BC2 11 PHE J  359 ? PHE J 359 . ? 1_555 ? 
90  BC2 11 ARG J  364 ? ARG J 364 . ? 1_555 ? 
91  BC2 11 GLN J  434 ? GLN J 434 . ? 1_555 ? 
92  BC2 11 MG  KA .   ? MG  J 700 . ? 1_555 ? 
93  BC3 2  THR J  178 ? THR J 178 . ? 1_555 ? 
94  BC3 2  ANP JA .   ? ANP J 600 . ? 1_555 ? 
95  BC4 12 ARG K  173 ? ARG K 173 . ? 1_555 ? 
96  BC4 12 GLN K  174 ? GLN K 174 . ? 1_555 ? 
97  BC4 12 THR K  175 ? THR K 175 . ? 1_555 ? 
98  BC4 12 GLY K  176 ? GLY K 176 . ? 1_555 ? 
99  BC4 12 LYS K  177 ? LYS K 177 . ? 1_555 ? 
100 BC4 12 THR K  178 ? THR K 178 . ? 1_555 ? 
101 BC4 12 ALA K  179 ? ALA K 179 . ? 1_555 ? 
102 BC4 12 PHE K  359 ? PHE K 359 . ? 1_555 ? 
103 BC4 12 ARG K  364 ? ARG K 364 . ? 1_555 ? 
104 BC4 12 GLN K  432 ? GLN K 432 . ? 1_555 ? 
105 BC4 12 GLN K  434 ? GLN K 434 . ? 1_555 ? 
106 BC4 12 MG  MA .   ? MG  K 700 . ? 1_555 ? 
107 BC5 3  THR K  178 ? THR K 178 . ? 1_555 ? 
108 BC5 3  ASP K  271 ? ASP K 271 . ? 1_555 ? 
109 BC5 3  ANP LA .   ? ANP K 600 . ? 1_555 ? 
110 BC6 14 ARG L  173 ? ARG L 173 . ? 1_555 ? 
111 BC6 14 GLN L  174 ? GLN L 174 . ? 1_555 ? 
112 BC6 14 THR L  175 ? THR L 175 . ? 1_555 ? 
113 BC6 14 GLY L  176 ? GLY L 176 . ? 1_555 ? 
114 BC6 14 LYS L  177 ? LYS L 177 . ? 1_555 ? 
115 BC6 14 THR L  178 ? THR L 178 . ? 1_555 ? 
116 BC6 14 ALA L  179 ? ALA L 179 . ? 1_555 ? 
117 BC6 14 GLU L  330 ? GLU L 330 . ? 1_555 ? 
118 BC6 14 PHE L  359 ? PHE L 359 . ? 1_555 ? 
119 BC6 14 ARG L  364 ? ARG L 364 . ? 1_555 ? 
120 BC6 14 GLN L  432 ? GLN L 432 . ? 1_555 ? 
121 BC6 14 GLN L  434 ? GLN L 434 . ? 1_555 ? 
122 BC6 14 MG  OA .   ? MG  L 700 . ? 1_555 ? 
123 BC6 14 ASP O  365 ? ASP O 359 . ? 1_555 ? 
124 BC7 2  THR L  178 ? THR L 178 . ? 1_555 ? 
125 BC7 2  ANP NA .   ? ANP L 600 . ? 1_555 ? 
126 BC8 15 ARG L  375 ? ARG L 375 . ? 1_555 ? 
127 BC8 15 ALA M  165 ? ALA M 159 . ? 1_555 ? 
128 BC8 15 GLY M  166 ? GLY M 160 . ? 1_555 ? 
129 BC8 15 VAL M  167 ? VAL M 161 . ? 1_555 ? 
130 BC8 15 GLY M  168 ? GLY M 162 . ? 1_555 ? 
131 BC8 15 LYS M  169 ? LYS M 163 . ? 1_555 ? 
132 BC8 15 THR M  170 ? THR M 164 . ? 1_555 ? 
133 BC8 15 VAL M  171 ? VAL M 165 . ? 1_555 ? 
134 BC8 15 ARG M  196 ? ARG M 190 . ? 1_555 ? 
135 BC8 15 TYR M  317 ? TYR M 311 . ? 1_555 ? 
136 BC8 15 TYR M  351 ? TYR M 345 . ? 1_555 ? 
137 BC8 15 PHE M  424 ? PHE M 418 . ? 1_555 ? 
138 BC8 15 ALA M  427 ? ALA M 421 . ? 1_555 ? 
139 BC8 15 PHE M  430 ? PHE M 424 . ? 1_555 ? 
140 BC8 15 MG  QA .   ? MG  M 700 . ? 1_555 ? 
141 BC9 2  THR M  170 ? THR M 164 . ? 1_555 ? 
142 BC9 2  ANP PA .   ? ANP M 600 . ? 1_555 ? 
143 CC1 18 ILE K  345 ? ILE K 345 . ? 1_555 ? 
144 CC1 18 SER K  346 ? SER K 346 . ? 1_555 ? 
145 CC1 18 VAL K  373 ? VAL K 373 . ? 1_555 ? 
146 CC1 18 ARG K  375 ? ARG K 375 . ? 1_555 ? 
147 CC1 18 ALA O  165 ? ALA O 159 . ? 1_555 ? 
148 CC1 18 GLY O  166 ? GLY O 160 . ? 1_555 ? 
149 CC1 18 VAL O  167 ? VAL O 161 . ? 1_555 ? 
150 CC1 18 GLY O  168 ? GLY O 162 . ? 1_555 ? 
151 CC1 18 LYS O  169 ? LYS O 163 . ? 1_555 ? 
152 CC1 18 THR O  170 ? THR O 164 . ? 1_555 ? 
153 CC1 18 VAL O  171 ? VAL O 165 . ? 1_555 ? 
154 CC1 18 GLU O  195 ? GLU O 189 . ? 1_555 ? 
155 CC1 18 ARG O  196 ? ARG O 190 . ? 1_555 ? 
156 CC1 18 TYR O  351 ? TYR O 345 . ? 1_555 ? 
157 CC1 18 PHE O  424 ? PHE O 418 . ? 1_555 ? 
158 CC1 18 PHE O  430 ? PHE O 424 . ? 1_555 ? 
159 CC1 18 THR O  431 ? THR O 425 . ? 1_555 ? 
160 CC1 18 MG  SA .   ? MG  O 700 . ? 1_555 ? 
161 CC2 5  THR O  170 ? THR O 164 . ? 1_555 ? 
162 CC2 5  GLU O  195 ? GLU O 189 . ? 1_555 ? 
163 CC2 5  ARG O  196 ? ARG O 190 . ? 1_555 ? 
164 CC2 5  GLU O  199 ? GLU O 193 . ? 1_555 ? 
165 CC2 5  ANP RA .   ? ANP O 600 . ? 1_555 ? 
166 CC3 12 ARG S  173 ? ARG S 173 . ? 1_555 ? 
167 CC3 12 GLN S  174 ? GLN S 174 . ? 1_555 ? 
168 CC3 12 THR S  175 ? THR S 175 . ? 1_555 ? 
169 CC3 12 GLY S  176 ? GLY S 176 . ? 1_555 ? 
170 CC3 12 LYS S  177 ? LYS S 177 . ? 1_555 ? 
171 CC3 12 THR S  178 ? THR S 178 . ? 1_555 ? 
172 CC3 12 ALA S  179 ? ALA S 179 . ? 1_555 ? 
173 CC3 12 PHE S  359 ? PHE S 359 . ? 1_555 ? 
174 CC3 12 ARG S  364 ? ARG S 364 . ? 1_555 ? 
175 CC3 12 GLN S  432 ? GLN S 432 . ? 1_555 ? 
176 CC3 12 GLN S  434 ? GLN S 434 . ? 1_555 ? 
177 CC3 12 MG  UA .   ? MG  S 700 . ? 1_555 ? 
178 CC4 2  THR S  178 ? THR S 178 . ? 1_555 ? 
179 CC4 2  ANP TA .   ? ANP S 600 . ? 1_555 ? 
180 CC5 13 GLN T  174 ? GLN T 174 . ? 1_555 ? 
181 CC5 13 THR T  175 ? THR T 175 . ? 1_555 ? 
182 CC5 13 GLY T  176 ? GLY T 176 . ? 1_555 ? 
183 CC5 13 LYS T  177 ? LYS T 177 . ? 1_555 ? 
184 CC5 13 THR T  178 ? THR T 178 . ? 1_555 ? 
185 CC5 13 ALA T  179 ? ALA T 179 . ? 1_555 ? 
186 CC5 13 GLU T  330 ? GLU T 330 . ? 1_555 ? 
187 CC5 13 PHE T  359 ? PHE T 359 . ? 1_555 ? 
188 CC5 13 ARG T  364 ? ARG T 364 . ? 1_555 ? 
189 CC5 13 GLN T  432 ? GLN T 432 . ? 1_555 ? 
190 CC5 13 GLN T  434 ? GLN T 434 . ? 1_555 ? 
191 CC5 13 MG  WA .   ? MG  T 700 . ? 1_555 ? 
192 CC5 13 ASP W  365 ? ASP W 359 . ? 1_555 ? 
193 CC6 2  THR T  178 ? THR T 178 . ? 1_555 ? 
194 CC6 2  ANP VA .   ? ANP T 600 . ? 1_555 ? 
195 CC7 14 ARG U  173 ? ARG U 173 . ? 1_555 ? 
196 CC7 14 GLN U  174 ? GLN U 174 . ? 1_555 ? 
197 CC7 14 THR U  175 ? THR U 175 . ? 1_555 ? 
198 CC7 14 GLY U  176 ? GLY U 176 . ? 1_555 ? 
199 CC7 14 LYS U  177 ? LYS U 177 . ? 1_555 ? 
200 CC7 14 THR U  178 ? THR U 178 . ? 1_555 ? 
201 CC7 14 ALA U  179 ? ALA U 179 . ? 1_555 ? 
202 CC7 14 PHE U  359 ? PHE U 359 . ? 1_555 ? 
203 CC7 14 ARG U  364 ? ARG U 364 . ? 1_555 ? 
204 CC7 14 GLN U  432 ? GLN U 432 . ? 1_555 ? 
205 CC7 14 GLN U  434 ? GLN U 434 . ? 1_555 ? 
206 CC7 14 MG  YA .   ? MG  U 700 . ? 1_555 ? 
207 CC7 14 SER X  361 ? SER X 355 . ? 1_555 ? 
208 CC7 14 TYR X  374 ? TYR X 368 . ? 1_555 ? 
209 CC8 3  THR U  178 ? THR U 178 . ? 1_555 ? 
210 CC8 3  ASP U  271 ? ASP U 271 . ? 1_555 ? 
211 CC8 3  ANP XA .   ? ANP U 600 . ? 1_555 ? 
212 CC9 14 SER U  374 ? SER U 374 . ? 1_555 ? 
213 CC9 14 ARG U  375 ? ARG U 375 . ? 1_555 ? 
214 CC9 14 GLY V  164 ? GLY V 158 . ? 1_555 ? 
215 CC9 14 GLY V  166 ? GLY V 160 . ? 1_555 ? 
216 CC9 14 VAL V  167 ? VAL V 161 . ? 1_555 ? 
217 CC9 14 GLY V  168 ? GLY V 162 . ? 1_555 ? 
218 CC9 14 LYS V  169 ? LYS V 163 . ? 1_555 ? 
219 CC9 14 THR V  170 ? THR V 164 . ? 1_555 ? 
220 CC9 14 VAL V  171 ? VAL V 165 . ? 1_555 ? 
221 CC9 14 GLU V  195 ? GLU V 189 . ? 1_555 ? 
222 CC9 14 ARG V  196 ? ARG V 190 . ? 1_555 ? 
223 CC9 14 TYR V  317 ? TYR V 311 . ? 1_555 ? 
224 CC9 14 TYR V  351 ? TYR V 345 . ? 1_555 ? 
225 CC9 14 MG  AB .   ? MG  V 700 . ? 1_555 ? 
226 DC1 3  LYS V  169 ? LYS V 163 . ? 1_555 ? 
227 DC1 3  THR V  170 ? THR V 164 . ? 1_555 ? 
228 DC1 3  ANP ZA .   ? ANP V 600 . ? 1_555 ? 
229 DC2 17 ILE T  345 ? ILE T 345 . ? 1_555 ? 
230 DC2 17 SER T  346 ? SER T 346 . ? 1_555 ? 
231 DC2 17 VAL T  373 ? VAL T 373 . ? 1_555 ? 
232 DC2 17 ARG T  375 ? ARG T 375 . ? 1_555 ? 
233 DC2 17 ALA X  165 ? ALA X 159 . ? 1_555 ? 
234 DC2 17 GLY X  166 ? GLY X 160 . ? 1_555 ? 
235 DC2 17 GLY X  168 ? GLY X 162 . ? 1_555 ? 
236 DC2 17 LYS X  169 ? LYS X 163 . ? 1_555 ? 
237 DC2 17 THR X  170 ? THR X 164 . ? 1_555 ? 
238 DC2 17 VAL X  171 ? VAL X 165 . ? 1_555 ? 
239 DC2 17 GLU X  195 ? GLU X 189 . ? 1_555 ? 
240 DC2 17 ARG X  196 ? ARG X 190 . ? 1_555 ? 
241 DC2 17 TYR X  351 ? TYR X 345 . ? 1_555 ? 
242 DC2 17 PHE X  424 ? PHE X 418 . ? 1_555 ? 
243 DC2 17 ALA X  427 ? ALA X 421 . ? 1_555 ? 
244 DC2 17 PHE X  430 ? PHE X 424 . ? 1_555 ? 
245 DC2 17 MG  CB .   ? MG  X 700 . ? 1_555 ? 
246 DC3 3  THR X  170 ? THR X 164 . ? 1_555 ? 
247 DC3 3  GLU X  195 ? GLU X 189 . ? 1_555 ? 
248 DC3 3  ANP BB .   ? ANP X 600 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OFN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OFN 
_atom_sites.fract_transf_matrix[1][1]   0.008927 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001953 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003441 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005432 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1 26  ? 29.831  -2.697   94.854  1.00 103.58 ? 26  ASN A N     1 
ATOM   2     C  CA    . ASN A  1 26  ? 28.813  -3.775   94.686  1.00 102.10 ? 26  ASN A CA    1 
ATOM   3     C  C     . ASN A  1 26  ? 29.008  -4.615   93.407  1.00 99.16  ? 26  ASN A C     1 
ATOM   4     O  O     . ASN A  1 26  ? 29.679  -5.653   93.450  1.00 100.64 ? 26  ASN A O     1 
ATOM   5     C  CB    . ASN A  1 26  ? 27.401  -3.186   94.760  1.00 100.72 ? 26  ASN A CB    1 
ATOM   6     C  CG    . ASN A  1 26  ? 26.335  -4.242   95.007  1.00 101.08 ? 26  ASN A CG    1 
ATOM   7     O  OD1   . ASN A  1 26  ? 26.191  -5.202   94.245  1.00 99.64  ? 26  ASN A OD1   1 
ATOM   8     N  ND2   . ASN A  1 26  ? 25.570  -4.059   96.075  1.00 103.75 ? 26  ASN A ND2   1 
ATOM   9     N  N     . LEU A  1 27  ? 28.414  -4.163   92.294  1.00 95.25  ? 27  LEU A N     1 
ATOM   10    C  CA    . LEU A  1 27  ? 28.503  -4.807   90.962  1.00 92.23  ? 27  LEU A CA    1 
ATOM   11    C  C     . LEU A  1 27  ? 27.411  -5.816   90.647  1.00 90.79  ? 27  LEU A C     1 
ATOM   12    O  O     . LEU A  1 27  ? 27.278  -6.254   89.502  1.00 88.66  ? 27  LEU A O     1 
ATOM   13    C  CB    . LEU A  1 27  ? 29.879  -5.430   90.686  1.00 93.48  ? 27  LEU A CB    1 
ATOM   14    C  CG    . LEU A  1 27  ? 30.999  -4.523   90.180  1.00 93.41  ? 27  LEU A CG    1 
ATOM   15    C  CD1   . LEU A  1 27  ? 32.202  -5.373   89.786  1.00 94.95  ? 27  LEU A CD1   1 
ATOM   16    C  CD2   . LEU A  1 27  ? 30.547  -3.649   89.013  1.00 89.66  ? 27  LEU A CD2   1 
ATOM   17    N  N     . ASN A  1 28  ? 26.638  -6.199   91.652  1.00 92.33  ? 28  ASN A N     1 
ATOM   18    C  CA    . ASN A  1 28  ? 25.583  -7.173   91.438  1.00 91.59  ? 28  ASN A CA    1 
ATOM   19    C  C     . ASN A  1 28  ? 24.264  -6.490   91.111  1.00 89.55  ? 28  ASN A C     1 
ATOM   20    O  O     . ASN A  1 28  ? 23.464  -7.004   90.328  1.00 87.92  ? 28  ASN A O     1 
ATOM   21    C  CB    . ASN A  1 28  ? 25.436  -8.076   92.657  1.00 94.92  ? 28  ASN A CB    1 
ATOM   22    C  CG    . ASN A  1 28  ? 25.302  -9.535   92.283  1.00 95.30  ? 28  ASN A CG    1 
ATOM   23    O  OD1   . ASN A  1 28  ? 25.621  -9.933   91.160  1.00 93.18  ? 28  ASN A OD1   1 
ATOM   24    N  ND2   . ASN A  1 28  ? 24.841  -10.348  93.228  1.00 98.40  ? 28  ASN A ND2   1 
ATOM   25    N  N     . GLU A  1 29  ? 24.061  -5.322   91.718  1.00 89.97  ? 29  GLU A N     1 
ATOM   26    C  CA    . GLU A  1 29  ? 22.865  -4.510   91.514  1.00 88.29  ? 29  GLU A CA    1 
ATOM   27    C  C     . GLU A  1 29  ? 23.239  -3.172   90.897  1.00 86.20  ? 29  GLU A C     1 
ATOM   28    O  O     . GLU A  1 29  ? 22.387  -2.478   90.357  1.00 84.55  ? 29  GLU A O     1 
ATOM   29    C  CB    . GLU A  1 29  ? 22.150  -4.265   92.845  1.00 91.17  ? 29  GLU A CB    1 
ATOM   30    C  CG    . GLU A  1 29  ? 22.016  -5.494   93.731  1.00 94.64  ? 29  GLU A CG    1 
ATOM   31    C  CD    . GLU A  1 29  ? 21.031  -6.504   93.183  1.00 94.79  ? 29  GLU A CD    1 
ATOM   32    O  OE1   . GLU A  1 29  ? 19.825  -6.175   93.113  1.00 94.77  ? 29  GLU A OE1   1 
ATOM   33    O  OE2   . GLU A  1 29  ? 21.465  -7.623   92.826  1.00 95.00  ? 29  GLU A OE2   1 
ATOM   34    N  N     . THR A  1 30  ? 24.513  -2.803   91.002  1.00 86.64  ? 30  THR A N     1 
ATOM   35    C  CA    . THR A  1 30  ? 25.007  -1.559   90.410  1.00 84.85  ? 30  THR A CA    1 
ATOM   36    C  C     . THR A  1 30  ? 25.973  -1.820   89.257  1.00 82.94  ? 30  THR A C     1 
ATOM   37    O  O     . THR A  1 30  ? 26.407  -2.951   89.042  1.00 83.30  ? 30  THR A O     1 
ATOM   38    C  CB    . THR A  1 30  ? 25.694  -0.682   91.447  1.00 87.44  ? 30  THR A CB    1 
ATOM   39    O  OG1   . THR A  1 30  ? 26.662  -1.464   92.155  1.00 90.51  ? 30  THR A OG1   1 
ATOM   40    C  CG2   . THR A  1 30  ? 24.674  -0.120   92.418  1.00 88.94  ? 30  THR A CG2   1 
ATOM   41    N  N     . GLY A  1 31  ? 26.304  -0.771   88.513  1.00 81.14  ? 31  GLY A N     1 
ATOM   42    C  CA    . GLY A  1 31  ? 27.171  -0.921   87.357  1.00 79.53  ? 31  GLY A CA    1 
ATOM   43    C  C     . GLY A  1 31  ? 28.044  0.280    87.085  1.00 79.63  ? 31  GLY A C     1 
ATOM   44    O  O     . GLY A  1 31  ? 27.836  1.355    87.651  1.00 80.30  ? 31  GLY A O     1 
ATOM   45    N  N     . ARG A  1 32  ? 29.026  0.085    86.212  1.00 79.32  ? 32  ARG A N     1 
ATOM   46    C  CA    . ARG A  1 32  ? 29.948  1.143    85.815  1.00 79.83  ? 32  ARG A CA    1 
ATOM   47    C  C     . ARG A  1 32  ? 29.827  1.408    84.331  1.00 77.48  ? 32  ARG A C     1 
ATOM   48    O  O     . ARG A  1 32  ? 29.902  0.482    83.523  1.00 76.74  ? 32  ARG A O     1 
ATOM   49    C  CB    . ARG A  1 32  ? 31.395  0.762    86.145  1.00 82.65  ? 32  ARG A CB    1 
ATOM   50    C  CG    . ARG A  1 32  ? 31.674  0.550    87.618  1.00 86.08  ? 32  ARG A CG    1 
ATOM   51    C  CD    . ARG A  1 32  ? 31.134  1.698    88.452  1.00 87.93  ? 32  ARG A CD    1 
ATOM   52    N  NE    . ARG A  1 32  ? 31.985  1.957    89.607  1.00 92.92  ? 32  ARG A NE    1 
ATOM   53    C  CZ    . ARG A  1 32  ? 31.928  3.057    90.350  1.00 94.94  ? 32  ARG A CZ    1 
ATOM   54    N  NH1   . ARG A  1 32  ? 31.046  4.013    90.066  1.00 93.20  ? 32  ARG A NH1   1 
ATOM   55    N  NH2   . ARG A  1 32  ? 32.756  3.199    91.380  1.00 98.40  ? 32  ARG A NH2   1 
ATOM   56    N  N     . VAL A  1 33  ? 29.651  2.675    83.976  1.00 76.49  ? 33  VAL A N     1 
ATOM   57    C  CA    . VAL A  1 33  ? 29.538  3.066    82.577  1.00 74.83  ? 33  VAL A CA    1 
ATOM   58    C  C     . VAL A  1 33  ? 30.900  2.974    81.880  1.00 76.19  ? 33  VAL A C     1 
ATOM   59    O  O     . VAL A  1 33  ? 31.796  3.769    82.160  1.00 78.24  ? 33  VAL A O     1 
ATOM   60    C  CB    . VAL A  1 33  ? 28.934  4.480    82.442  1.00 74.03  ? 33  VAL A CB    1 
ATOM   61    C  CG1   . VAL A  1 33  ? 28.861  4.909    80.982  1.00 73.00  ? 33  VAL A CG1   1 
ATOM   62    C  CG2   . VAL A  1 33  ? 27.550  4.514    83.063  1.00 73.11  ? 33  VAL A CG2   1 
ATOM   63    N  N     . LEU A  1 34  ? 31.043  1.993    80.988  1.00 75.40  ? 34  LEU A N     1 
ATOM   64    C  CA    . LEU A  1 34  ? 32.272  1.781    80.225  1.00 76.95  ? 34  LEU A CA    1 
ATOM   65    C  C     . LEU A  1 34  ? 32.452  2.824    79.130  1.00 77.15  ? 34  LEU A C     1 
ATOM   66    O  O     . LEU A  1 34  ? 33.533  3.395    78.969  1.00 79.10  ? 34  LEU A O     1 
ATOM   67    C  CB    . LEU A  1 34  ? 32.243  0.410    79.565  1.00 76.78  ? 34  LEU A CB    1 
ATOM   68    C  CG    . LEU A  1 34  ? 32.210  -0.876   80.379  1.00 76.84  ? 34  LEU A CG    1 
ATOM   69    C  CD1   . LEU A  1 34  ? 31.761  -2.016   79.481  1.00 75.58  ? 34  LEU A CD1   1 
ATOM   70    C  CD2   . LEU A  1 34  ? 33.576  -1.161   80.956  1.00 79.93  ? 34  LEU A CD2   1 
ATOM   71    N  N     . ALA A  1 35  ? 31.384  3.030    78.359  1.00 75.42  ? 35  ALA A N     1 
ATOM   72    C  CA    . ALA A  1 35  ? 31.323  4.027    77.284  1.00 75.52  ? 35  ALA A CA    1 
ATOM   73    C  C     . ALA A  1 35  ? 29.876  4.502    77.114  1.00 73.26  ? 35  ALA A C     1 
ATOM   74    O  O     . ALA A  1 35  ? 28.940  3.858    77.610  1.00 71.70  ? 35  ALA A O     1 
ATOM   75    C  CB    . ALA A  1 35  ? 31.864  3.451    75.976  1.00 76.39  ? 35  ALA A CB    1 
ATOM   76    N  N     . VAL A  1 36  ? 29.703  5.627    76.420  1.00 73.41  ? 36  VAL A N     1 
ATOM   77    C  CA    . VAL A  1 36  ? 28.387  6.234    76.220  1.00 71.70  ? 36  VAL A CA    1 
ATOM   78    C  C     . VAL A  1 36  ? 28.354  7.071    74.933  1.00 72.39  ? 36  VAL A C     1 
ATOM   79    O  O     . VAL A  1 36  ? 29.342  7.731    74.589  1.00 74.31  ? 36  VAL A O     1 
ATOM   80    C  CB    . VAL A  1 36  ? 27.971  7.075    77.470  1.00 71.29  ? 36  VAL A CB    1 
ATOM   81    C  CG1   . VAL A  1 36  ? 28.929  8.230    77.712  1.00 73.26  ? 36  VAL A CG1   1 
ATOM   82    C  CG2   . VAL A  1 36  ? 26.549  7.578    77.355  1.00 69.95  ? 36  VAL A CG2   1 
ATOM   83    N  N     . GLY A  1 37  ? 27.221  7.034    74.229  1.00 71.29  ? 37  GLY A N     1 
ATOM   84    C  CA    . GLY A  1 37  ? 27.023  7.806    72.992  1.00 72.23  ? 37  GLY A CA    1 
ATOM   85    C  C     . GLY A  1 37  ? 26.031  7.141    72.050  1.00 71.77  ? 37  GLY A C     1 
ATOM   86    O  O     . GLY A  1 37  ? 25.894  5.920    72.062  1.00 71.65  ? 37  GLY A O     1 
ATOM   87    N  N     . ASP A  1 38  ? 25.338  7.929    71.227  1.00 71.93  ? 38  ASP A N     1 
ATOM   88    C  CA    . ASP A  1 38  ? 24.286  7.394    70.348  1.00 71.65  ? 38  ASP A CA    1 
ATOM   89    C  C     . ASP A  1 38  ? 23.017  6.989    71.112  1.00 69.66  ? 38  ASP A C     1 
ATOM   90    O  O     . ASP A  1 38  ? 22.269  6.109    70.671  1.00 69.41  ? 38  ASP A O     1 
ATOM   91    C  CB    . ASP A  1 38  ? 24.801  6.190    69.547  1.00 72.90  ? 38  ASP A CB    1 
ATOM   92    C  CG    . ASP A  1 38  ? 25.998  6.521    68.697  1.00 75.99  ? 38  ASP A CG    1 
ATOM   93    O  OD1   . ASP A  1 38  ? 26.238  7.725    68.462  1.00 78.49  ? 38  ASP A OD1   1 
ATOM   94    O  OD2   . ASP A  1 38  ? 26.693  5.579    68.257  1.00 77.31  ? 38  ASP A OD2   1 
ATOM   95    N  N     . GLY A  1 39  ? 22.776  7.626    72.254  1.00 68.50  ? 39  GLY A N     1 
ATOM   96    C  CA    . GLY A  1 39  ? 21.644  7.265    73.103  1.00 67.12  ? 39  GLY A CA    1 
ATOM   97    C  C     . GLY A  1 39  ? 21.835  5.947    73.832  1.00 66.56  ? 39  GLY A C     1 
ATOM   98    O  O     . GLY A  1 39  ? 20.922  5.469    74.511  1.00 65.77  ? 39  GLY A O     1 
ATOM   99    N  N     . ILE A  1 40  ? 23.021  5.362    73.691  1.00 67.33  ? 40  ILE A N     1 
ATOM   100   C  CA    . ILE A  1 40  ? 23.358  4.128    74.378  1.00 67.58  ? 40  ILE A CA    1 
ATOM   101   C  C     . ILE A  1 40  ? 24.430  4.379    75.443  1.00 68.59  ? 40  ILE A C     1 
ATOM   102   O  O     . ILE A  1 40  ? 25.411  5.093    75.199  1.00 69.82  ? 40  ILE A O     1 
ATOM   103   C  CB    . ILE A  1 40  ? 23.897  3.047    73.405  1.00 68.47  ? 40  ILE A CB    1 
ATOM   104   C  CG1   . ILE A  1 40  ? 23.234  3.125    72.022  1.00 68.53  ? 40  ILE A CG1   1 
ATOM   105   C  CG2   . ILE A  1 40  ? 23.789  1.662    74.031  1.00 68.55  ? 40  ILE A CG2   1 
ATOM   106   C  CD1   . ILE A  1 40  ? 21.783  2.745    71.980  1.00 67.85  ? 40  ILE A CD1   1 
ATOM   107   N  N     . ALA A  1 41  ? 24.235  3.798    76.625  1.00 68.57  ? 41  ALA A N     1 
ATOM   108   C  CA    . ALA A  1 41  ? 25.291  3.728    77.626  1.00 69.86  ? 41  ALA A CA    1 
ATOM   109   C  C     . ALA A  1 41  ? 25.633  2.265    77.845  1.00 70.70  ? 41  ALA A C     1 
ATOM   110   O  O     . ALA A  1 41  ? 24.768  1.459    78.214  1.00 70.39  ? 41  ALA A O     1 
ATOM   111   C  CB    . ALA A  1 41  ? 24.859  4.373    78.923  1.00 69.75  ? 41  ALA A CB    1 
ATOM   112   N  N     . ARG A  1 42  ? 26.892  1.919    77.584  1.00 72.36  ? 42  ARG A N     1 
ATOM   113   C  CA    . ARG A  1 42  ? 27.379  0.552    77.772  1.00 73.04  ? 42  ARG A CA    1 
ATOM   114   C  C     . ARG A  1 42  ? 27.937  0.437    79.176  1.00 73.88  ? 42  ARG A C     1 
ATOM   115   O  O     . ARG A  1 42  ? 28.731  1.279    79.607  1.00 74.79  ? 42  ARG A O     1 
ATOM   116   C  CB    . ARG A  1 42  ? 28.403  0.184    76.690  1.00 74.51  ? 42  ARG A CB    1 
ATOM   117   C  CG    . ARG A  1 42  ? 27.727  -0.085   75.340  1.00 74.14  ? 42  ARG A CG    1 
ATOM   118   C  CD    . ARG A  1 42  ? 28.646  -0.030   74.133  1.00 75.63  ? 42  ARG A CD    1 
ATOM   119   N  NE    . ARG A  1 42  ? 29.877  -0.784   74.324  1.00 77.43  ? 42  ARG A NE    1 
ATOM   120   C  CZ    . ARG A  1 42  ? 31.091  -0.266   74.177  1.00 79.81  ? 42  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A  1 42  ? 31.226  1.004    73.819  1.00 79.95  ? 42  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A  1 42  ? 32.172  -1.016   74.371  1.00 81.83  ? 42  ARG A NH2   1 
ATOM   123   N  N     . VAL A  1 43  ? 27.486  -0.588   79.893  1.00 73.78  ? 43  VAL A N     1 
ATOM   124   C  CA    . VAL A  1 43  ? 27.680  -0.657   81.340  1.00 75.00  ? 43  VAL A CA    1 
ATOM   125   C  C     . VAL A  1 43  ? 28.259  -1.991   81.813  1.00 76.49  ? 43  VAL A C     1 
ATOM   126   O  O     . VAL A  1 43  ? 27.745  -3.050   81.470  1.00 76.22  ? 43  VAL A O     1 
ATOM   127   C  CB    . VAL A  1 43  ? 26.349  -0.343   82.090  1.00 73.98  ? 43  VAL A CB    1 
ATOM   128   C  CG1   . VAL A  1 43  ? 26.487  -0.562   83.584  1.00 75.51  ? 43  VAL A CG1   1 
ATOM   129   C  CG2   . VAL A  1 43  ? 25.909  1.092    81.823  1.00 73.51  ? 43  VAL A CG2   1 
ATOM   130   N  N     . PHE A  1 44  ? 29.331  -1.919   82.603  1.00 78.57  ? 44  PHE A N     1 
ATOM   131   C  CA    . PHE A  1 44  ? 29.954  -3.088   83.229  1.00 80.47  ? 44  PHE A CA    1 
ATOM   132   C  C     . PHE A  1 44  ? 29.326  -3.359   84.595  1.00 80.84  ? 44  PHE A C     1 
ATOM   133   O  O     . PHE A  1 44  ? 29.252  -2.469   85.442  1.00 81.37  ? 44  PHE A O     1 
ATOM   134   C  CB    . PHE A  1 44  ? 31.462  -2.849   83.377  1.00 82.92  ? 44  PHE A CB    1 
ATOM   135   C  CG    . PHE A  1 44  ? 32.203  -3.945   84.110  1.00 85.85  ? 44  PHE A CG    1 
ATOM   136   C  CD1   . PHE A  1 44  ? 32.557  -5.132   83.459  1.00 87.36  ? 44  PHE A CD1   1 
ATOM   137   C  CD2   . PHE A  1 44  ? 32.589  -3.775   85.442  1.00 87.66  ? 44  PHE A CD2   1 
ATOM   138   C  CE1   . PHE A  1 44  ? 33.267  -6.141   84.139  1.00 89.83  ? 44  PHE A CE1   1 
ATOM   139   C  CE2   . PHE A  1 44  ? 33.294  -4.776   86.126  1.00 90.06  ? 44  PHE A CE2   1 
ATOM   140   C  CZ    . PHE A  1 44  ? 33.634  -5.955   85.476  1.00 90.85  ? 44  PHE A CZ    1 
ATOM   141   N  N     . GLY A  1 45  ? 28.883  -4.592   84.804  1.00 81.01  ? 45  GLY A N     1 
ATOM   142   C  CA    . GLY A  1 45  ? 28.311  -4.993   86.086  1.00 81.93  ? 45  GLY A CA    1 
ATOM   143   C  C     . GLY A  1 45  ? 26.844  -5.329   85.957  1.00 80.26  ? 45  GLY A C     1 
ATOM   144   O  O     . GLY A  1 45  ? 26.439  -6.012   85.012  1.00 79.09  ? 45  GLY A O     1 
ATOM   145   N  N     . LEU A  1 46  ? 26.053  -4.850   86.914  1.00 80.54  ? 46  LEU A N     1 
ATOM   146   C  CA    . LEU A  1 46  ? 24.603  -5.051   86.919  1.00 79.70  ? 46  LEU A CA    1 
ATOM   147   C  C     . LEU A  1 46  ? 24.202  -6.523   86.737  1.00 80.40  ? 46  LEU A C     1 
ATOM   148   O  O     . LEU A  1 46  ? 23.216  -6.822   86.062  1.00 79.19  ? 46  LEU A O     1 
ATOM   149   C  CB    . LEU A  1 46  ? 23.938  -4.189   85.833  1.00 77.09  ? 46  LEU A CB    1 
ATOM   150   C  CG    . LEU A  1 46  ? 23.838  -2.672   85.998  1.00 76.20  ? 46  LEU A CG    1 
ATOM   151   C  CD1   . LEU A  1 46  ? 23.374  -2.034   84.709  1.00 73.96  ? 46  LEU A CD1   1 
ATOM   152   C  CD2   . LEU A  1 46  ? 22.886  -2.312   87.105  1.00 77.46  ? 46  LEU A CD2   1 
ATOM   153   N  N     . ASN A  1 47  ? 24.948  -7.435   87.355  1.00 82.75  ? 47  ASN A N     1 
ATOM   154   C  CA    . ASN A  1 47  ? 24.838  -8.861   87.031  1.00 83.76  ? 47  ASN A CA    1 
ATOM   155   C  C     . ASN A  1 47  ? 23.445  -9.464   87.129  1.00 83.87  ? 47  ASN A C     1 
ATOM   156   O  O     . ASN A  1 47  ? 23.088  -10.336  86.337  1.00 83.91  ? 47  ASN A O     1 
ATOM   157   C  CB    . ASN A  1 47  ? 25.825  -9.681   87.850  1.00 86.44  ? 47  ASN A CB    1 
ATOM   158   C  CG    . ASN A  1 47  ? 27.253  -9.257   87.615  1.00 87.36  ? 47  ASN A CG    1 
ATOM   159   O  OD1   . ASN A  1 47  ? 27.673  -9.049   86.474  1.00 86.09  ? 47  ASN A OD1   1 
ATOM   160   N  ND2   . ASN A  1 47  ? 28.012  -9.118   88.697  1.00 90.01  ? 47  ASN A ND2   1 
ATOM   161   N  N     . ASN A  1 48  ? 22.656  -8.993   88.082  1.00 84.62  ? 48  ASN A N     1 
ATOM   162   C  CA    . ASN A  1 48  ? 21.325  -9.543   88.290  1.00 85.28  ? 48  ASN A CA    1 
ATOM   163   C  C     . ASN A  1 48  ? 20.195  -8.882   87.490  1.00 83.25  ? 48  ASN A C     1 
ATOM   164   O  O     . ASN A  1 48  ? 19.033  -9.306   87.584  1.00 84.18  ? 48  ASN A O     1 
ATOM   165   C  CB    . ASN A  1 48  ? 21.001  -9.554   89.781  1.00 88.08  ? 48  ASN A CB    1 
ATOM   166   C  CG    . ASN A  1 48  ? 21.851  -10.540  90.538  1.00 91.27  ? 48  ASN A CG    1 
ATOM   167   O  OD1   . ASN A  1 48  ? 22.430  -11.458  89.949  1.00 91.87  ? 48  ASN A OD1   1 
ATOM   168   N  ND2   . ASN A  1 48  ? 21.938  -10.363  91.851  1.00 94.57  ? 48  ASN A ND2   1 
ATOM   169   N  N     . ILE A  1 49  ? 20.528  -7.862   86.701  1.00 80.71  ? 49  ILE A N     1 
ATOM   170   C  CA    . ILE A  1 49  ? 19.527  -7.137   85.928  1.00 78.63  ? 49  ILE A CA    1 
ATOM   171   C  C     . ILE A  1 49  ? 18.774  -8.100   85.012  1.00 78.10  ? 49  ILE A C     1 
ATOM   172   O  O     . ILE A  1 49  ? 19.329  -9.109   84.566  1.00 78.58  ? 49  ILE A O     1 
ATOM   173   C  CB    . ILE A  1 49  ? 20.178  -5.993   85.115  1.00 76.82  ? 49  ILE A CB    1 
ATOM   174   C  CG1   . ILE A  1 49  ? 19.171  -4.884   84.805  1.00 75.92  ? 49  ILE A CG1   1 
ATOM   175   C  CG2   . ILE A  1 49  ? 20.828  -6.515   83.830  1.00 76.17  ? 49  ILE A CG2   1 
ATOM   176   C  CD1   . ILE A  1 49  ? 19.794  -3.653   84.159  1.00 74.53  ? 49  ILE A CD1   1 
ATOM   177   N  N     . GLN A  1 50  ? 17.506  -7.801   84.753  1.00 77.58  ? 50  GLN A N     1 
ATOM   178   C  CA    . GLN A  1 50  ? 16.713  -8.565   83.788  1.00 77.21  ? 50  GLN A CA    1 
ATOM   179   C  C     . GLN A  1 50  ? 16.695  -7.882   82.425  1.00 75.65  ? 50  GLN A C     1 
ATOM   180   O  O     . GLN A  1 50  ? 16.813  -6.655   82.321  1.00 74.44  ? 50  GLN A O     1 
ATOM   181   C  CB    . GLN A  1 50  ? 15.264  -8.694   84.250  1.00 78.33  ? 50  GLN A CB    1 
ATOM   182   C  CG    . GLN A  1 50  ? 15.046  -9.388   85.557  1.00 78.95  ? 50  GLN A CG    1 
ATOM   183   C  CD    . GLN A  1 50  ? 13.787  -8.914   86.216  1.00 78.03  ? 50  GLN A CD    1 
ATOM   184   O  OE1   . GLN A  1 50  ? 13.707  -7.780   86.685  1.00 75.99  ? 50  GLN A OE1   1 
ATOM   185   N  NE2   . GLN A  1 50  ? 12.785  -9.776   86.252  1.00 80.31  ? 50  GLN A NE2   1 
ATOM   186   N  N     . ALA A  1 51  ? 16.526  -8.687   81.381  1.00 75.96  ? 51  ALA A N     1 
ATOM   187   C  CA    . ALA A  1 51  ? 16.220  -8.171   80.052  1.00 75.11  ? 51  ALA A CA    1 
ATOM   188   C  C     . ALA A  1 51  ? 14.981  -7.277   80.110  1.00 75.08  ? 51  ALA A C     1 
ATOM   189   O  O     . ALA A  1 51  ? 13.952  -7.647   80.691  1.00 76.32  ? 51  ALA A O     1 
ATOM   190   C  CB    . ALA A  1 51  ? 16.008  -9.321   79.072  1.00 76.08  ? 51  ALA A CB    1 
ATOM   191   N  N     . GLU A  1 52  ? 15.101  -6.094   79.515  1.00 74.00  ? 52  GLU A N     1 
ATOM   192   C  CA    . GLU A  1 52  ? 14.031  -5.100   79.492  1.00 74.26  ? 52  GLU A CA    1 
ATOM   193   C  C     . GLU A  1 52  ? 13.839  -4.409   80.843  1.00 74.48  ? 52  GLU A C     1 
ATOM   194   O  O     . GLU A  1 52  ? 12.823  -3.757   81.068  1.00 75.10  ? 52  GLU A O     1 
ATOM   195   C  CB    . GLU A  1 52  ? 12.711  -5.704   78.988  1.00 75.76  ? 52  GLU A CB    1 
ATOM   196   C  CG    . GLU A  1 52  ? 12.683  -6.002   77.491  1.00 77.38  ? 52  GLU A CG    1 
ATOM   197   C  CD    . GLU A  1 52  ? 11.265  -6.088   76.925  1.00 81.55  ? 52  GLU A CD    1 
ATOM   198   O  OE1   . GLU A  1 52  ? 10.386  -5.318   77.383  1.00 83.26  ? 52  GLU A OE1   1 
ATOM   199   O  OE2   . GLU A  1 52  ? 11.027  -6.912   76.008  1.00 83.45  ? 52  GLU A OE2   1 
ATOM   200   N  N     . GLU A  1 53  ? 14.816  -4.542   81.736  1.00 74.54  ? 53  GLU A N     1 
ATOM   201   C  CA    . GLU A  1 53  ? 14.709  -3.937   83.064  1.00 75.44  ? 53  GLU A CA    1 
ATOM   202   C  C     . GLU A  1 53  ? 15.149  -2.477   83.038  1.00 74.25  ? 53  GLU A C     1 
ATOM   203   O  O     . GLU A  1 53  ? 16.142  -2.128   82.391  1.00 73.08  ? 53  GLU A O     1 
ATOM   204   C  CB    . GLU A  1 53  ? 15.516  -4.726   84.103  1.00 76.60  ? 53  GLU A CB    1 
ATOM   205   C  CG    . GLU A  1 53  ? 15.206  -4.344   85.548  1.00 78.98  ? 53  GLU A CG    1 
ATOM   206   C  CD    . GLU A  1 53  ? 16.165  -4.952   86.566  1.00 80.75  ? 53  GLU A CD    1 
ATOM   207   O  OE1   . GLU A  1 53  ? 16.404  -6.181   86.544  1.00 81.35  ? 53  GLU A OE1   1 
ATOM   208   O  OE2   . GLU A  1 53  ? 16.666  -4.184   87.412  1.00 81.75  ? 53  GLU A OE2   1 
ATOM   209   N  N     . LEU A  1 54  ? 14.399  -1.635   83.743  1.00 74.90  ? 54  LEU A N     1 
ATOM   210   C  CA    . LEU A  1 54  ? 14.673  -0.208   83.824  1.00 74.09  ? 54  LEU A CA    1 
ATOM   211   C  C     . LEU A  1 54  ? 15.875  0.037    84.725  1.00 74.45  ? 54  LEU A C     1 
ATOM   212   O  O     . LEU A  1 54  ? 16.079  -0.696   85.701  1.00 76.04  ? 54  LEU A O     1 
ATOM   213   C  CB    . LEU A  1 54  ? 13.455  0.506    84.403  1.00 75.47  ? 54  LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 54  ? 12.902  1.711    83.648  1.00 74.78  ? 54  LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 54  ? 12.203  1.258    82.374  1.00 74.02  ? 54  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 54  ? 11.948  2.498    84.536  1.00 76.72  ? 54  LEU A CD2   1 
ATOM   217   N  N     . VAL A  1 55  ? 16.678  1.050    84.392  1.00 73.32  ? 55  VAL A N     1 
ATOM   218   C  CA    . VAL A  1 55  ? 17.788  1.493    85.261  1.00 73.84  ? 55  VAL A CA    1 
ATOM   219   C  C     . VAL A  1 55  ? 17.799  3.011    85.473  1.00 74.15  ? 55  VAL A C     1 
ATOM   220   O  O     . VAL A  1 55  ? 17.197  3.756    84.695  1.00 73.33  ? 55  VAL A O     1 
ATOM   221   C  CB    . VAL A  1 55  ? 19.193  1.037    84.761  1.00 72.88  ? 55  VAL A CB    1 
ATOM   222   C  CG1   . VAL A  1 55  ? 19.285  -0.478   84.689  1.00 72.59  ? 55  VAL A CG1   1 
ATOM   223   C  CG2   . VAL A  1 55  ? 19.551  1.693    83.432  1.00 70.87  ? 55  VAL A CG2   1 
ATOM   224   N  N     . GLU A  1 56  ? 18.493  3.450    86.525  1.00 75.53  ? 56  GLU A N     1 
ATOM   225   C  CA    . GLU A  1 56  ? 18.628  4.864    86.858  1.00 76.29  ? 56  GLU A CA    1 
ATOM   226   C  C     . GLU A  1 56  ? 20.109  5.246    86.966  1.00 76.41  ? 56  GLU A C     1 
ATOM   227   O  O     . GLU A  1 56  ? 20.902  4.514    87.570  1.00 77.66  ? 56  GLU A O     1 
ATOM   228   C  CB    . GLU A  1 56  ? 17.875  5.159    88.158  1.00 79.07  ? 56  GLU A CB    1 
ATOM   229   C  CG    . GLU A  1 56  ? 18.209  6.490    88.838  1.00 82.33  ? 56  GLU A CG    1 
ATOM   230   C  CD    . GLU A  1 56  ? 17.254  6.826    89.981  1.00 86.88  ? 56  GLU A CD    1 
ATOM   231   O  OE1   . GLU A  1 56  ? 16.059  7.090    89.709  1.00 87.70  ? 56  GLU A OE1   1 
ATOM   232   O  OE2   . GLU A  1 56  ? 17.699  6.835    91.151  1.00 90.12  ? 56  GLU A OE2   1 
ATOM   233   N  N     . PHE A  1 57  ? 20.469  6.386    86.371  1.00 75.42  ? 57  PHE A N     1 
ATOM   234   C  CA    . PHE A  1 57  ? 21.851  6.881    86.351  1.00 75.46  ? 57  PHE A CA    1 
ATOM   235   C  C     . PHE A  1 57  ? 22.064  8.021    87.345  1.00 77.55  ? 57  PHE A C     1 
ATOM   236   O  O     . PHE A  1 57  ? 21.097  8.600    87.843  1.00 77.95  ? 57  PHE A O     1 
ATOM   237   C  CB    . PHE A  1 57  ? 22.224  7.345    84.945  1.00 73.68  ? 57  PHE A CB    1 
ATOM   238   C  CG    . PHE A  1 57  ? 22.318  6.230    83.937  1.00 72.00  ? 57  PHE A CG    1 
ATOM   239   C  CD1   . PHE A  1 57  ? 21.170  5.679    83.378  1.00 70.76  ? 57  PHE A CD1   1 
ATOM   240   C  CD2   . PHE A  1 57  ? 23.559  5.742    83.531  1.00 72.27  ? 57  PHE A CD2   1 
ATOM   241   C  CE1   . PHE A  1 57  ? 21.257  4.646    82.445  1.00 69.66  ? 57  PHE A CE1   1 
ATOM   242   C  CE2   . PHE A  1 57  ? 23.658  4.716    82.593  1.00 70.66  ? 57  PHE A CE2   1 
ATOM   243   C  CZ    . PHE A  1 57  ? 22.503  4.164    82.052  1.00 69.67  ? 57  PHE A CZ    1 
ATOM   244   N  N     . SER A  1 58  ? 23.334  8.324    87.628  1.00 78.86  ? 58  SER A N     1 
ATOM   245   C  CA    . SER A  1 58  ? 23.708  9.394    88.566  1.00 81.65  ? 58  SER A CA    1 
ATOM   246   C  C     . SER A  1 58  ? 22.925  10.675   88.347  1.00 81.60  ? 58  SER A C     1 
ATOM   247   O  O     . SER A  1 58  ? 22.309  11.206   89.270  1.00 83.72  ? 58  SER A O     1 
ATOM   248   C  CB    . SER A  1 58  ? 25.193  9.724    88.455  1.00 82.71  ? 58  SER A CB    1 
ATOM   249   O  OG    . SER A  1 58  ? 25.889  9.281    89.593  1.00 85.73  ? 58  SER A OG    1 
ATOM   250   N  N     . SER A  1 59  ? 22.956  11.160   87.111  1.00 79.42  ? 59  SER A N     1 
ATOM   251   C  CA    . SER A  1 59  ? 22.317  12.407   86.751  1.00 79.20  ? 59  SER A CA    1 
ATOM   252   C  C     . SER A  1 59  ? 20.823  12.360   86.998  1.00 78.82  ? 59  SER A C     1 
ATOM   253   O  O     . SER A  1 59  ? 20.159  13.385   86.934  1.00 79.72  ? 59  SER A O     1 
ATOM   254   C  CB    . SER A  1 59  ? 22.593  12.728   85.285  1.00 77.28  ? 59  SER A CB    1 
ATOM   255   O  OG    . SER A  1 59  ? 22.333  11.601   84.462  1.00 75.47  ? 59  SER A OG    1 
ATOM   256   N  N     . GLY A  1 60  ? 20.298  11.173   87.287  1.00 78.08  ? 60  GLY A N     1 
ATOM   257   C  CA    . GLY A  1 60  ? 18.858  10.989   87.478  1.00 78.09  ? 60  GLY A CA    1 
ATOM   258   C  C     . GLY A  1 60  ? 18.143  10.435   86.253  1.00 75.32  ? 60  GLY A C     1 
ATOM   259   O  O     . GLY A  1 60  ? 17.044  9.884    86.361  1.00 75.24  ? 60  GLY A O     1 
ATOM   260   N  N     . VAL A  1 61  ? 18.776  10.579   85.091  1.00 73.33  ? 61  VAL A N     1 
ATOM   261   C  CA    . VAL A  1 61  ? 18.265  10.054   83.834  1.00 71.51  ? 61  VAL A CA    1 
ATOM   262   C  C     . VAL A  1 61  ? 17.964  8.547    83.933  1.00 71.09  ? 61  VAL A C     1 
ATOM   263   O  O     . VAL A  1 61  ? 18.509  7.858    84.797  1.00 72.17  ? 61  VAL A O     1 
ATOM   264   C  CB    . VAL A  1 61  ? 19.262  10.346   82.689  1.00 70.29  ? 61  VAL A CB    1 
ATOM   265   C  CG1   . VAL A  1 61  ? 20.347  9.290    82.626  1.00 70.37  ? 61  VAL A CG1   1 
ATOM   266   C  CG2   . VAL A  1 61  ? 18.551  10.456   81.355  1.00 69.00  ? 61  VAL A CG2   1 
ATOM   267   N  N     . LYS A  1 62  ? 17.086  8.046    83.061  1.00 70.12  ? 62  LYS A N     1 
ATOM   268   C  CA    . LYS A  1 62  ? 16.675  6.637    83.086  1.00 69.67  ? 62  LYS A CA    1 
ATOM   269   C  C     . LYS A  1 62  ? 16.888  5.942    81.745  1.00 68.08  ? 62  LYS A C     1 
ATOM   270   O  O     . LYS A  1 62  ? 16.839  6.574    80.689  1.00 67.55  ? 62  LYS A O     1 
ATOM   271   C  CB    . LYS A  1 62  ? 15.211  6.507    83.506  1.00 70.66  ? 62  LYS A CB    1 
ATOM   272   C  CG    . LYS A  1 62  ? 14.910  7.042    84.893  1.00 73.45  ? 62  LYS A CG    1 
ATOM   273   C  CD    . LYS A  1 62  ? 13.758  6.284    85.508  1.00 75.80  ? 62  LYS A CD    1 
ATOM   274   C  CE    . LYS A  1 62  ? 13.701  6.499    87.007  1.00 78.97  ? 62  LYS A CE    1 
ATOM   275   N  NZ    . LYS A  1 62  ? 12.874  7.683    87.359  1.00 81.58  ? 62  LYS A NZ    1 
ATOM   276   N  N     . GLY A  1 63  ? 17.127  4.636    81.791  1.00 67.71  ? 63  GLY A N     1 
ATOM   277   C  CA    . GLY A  1 63  ? 17.263  3.840    80.574  1.00 66.41  ? 63  GLY A CA    1 
ATOM   278   C  C     . GLY A  1 63  ? 16.682  2.451    80.740  1.00 66.66  ? 63  GLY A C     1 
ATOM   279   O  O     . GLY A  1 63  ? 16.333  2.031    81.848  1.00 67.58  ? 63  GLY A O     1 
ATOM   280   N  N     . MET A  1 64  ? 16.563  1.722    79.642  1.00 66.03  ? 64  MET A N     1 
ATOM   281   C  CA    . MET A  1 64  ? 16.178  0.332    79.774  1.00 66.71  ? 64  MET A CA    1 
ATOM   282   C  C     . MET A  1 64  ? 17.189  -0.611   79.134  1.00 66.44  ? 64  MET A C     1 
ATOM   283   O  O     . MET A  1 64  ? 17.721  -0.335   78.057  1.00 66.07  ? 64  MET A O     1 
ATOM   284   C  CB    . MET A  1 64  ? 14.755  0.093    79.274  1.00 67.23  ? 64  MET A CB    1 
ATOM   285   C  CG    . MET A  1 64  ? 14.592  0.034    77.779  1.00 66.97  ? 64  MET A CG    1 
ATOM   286   S  SD    . MET A  1 64  ? 12.963  -0.621   77.403  1.00 67.92  ? 64  MET A SD    1 
ATOM   287   C  CE    . MET A  1 64  ? 13.212  -2.318   77.892  1.00 68.67  ? 64  MET A CE    1 
ATOM   288   N  N     . ALA A  1 65  ? 17.456  -1.713   79.831  1.00 66.95  ? 65  ALA A N     1 
ATOM   289   C  CA    . ALA A  1 65  ? 18.450  -2.687   79.410  1.00 67.03  ? 65  ALA A CA    1 
ATOM   290   C  C     . ALA A  1 65  ? 17.912  -3.602   78.300  1.00 67.24  ? 65  ALA A C     1 
ATOM   291   O  O     . ALA A  1 65  ? 17.041  -4.440   78.534  1.00 68.28  ? 65  ALA A O     1 
ATOM   292   C  CB    . ALA A  1 65  ? 18.919  -3.495   80.612  1.00 67.90  ? 65  ALA A CB    1 
ATOM   293   N  N     . LEU A  1 66  ? 18.430  -3.437   77.089  1.00 66.65  ? 66  LEU A N     1 
ATOM   294   C  CA    . LEU A  1 66  ? 17.939  -4.217   75.965  1.00 66.97  ? 66  LEU A CA    1 
ATOM   295   C  C     . LEU A  1 66  ? 18.886  -5.341   75.563  1.00 67.91  ? 66  LEU A C     1 
ATOM   296   O  O     . LEU A  1 66  ? 18.470  -6.304   74.943  1.00 69.30  ? 66  LEU A O     1 
ATOM   297   C  CB    . LEU A  1 66  ? 17.591  -3.317   74.766  1.00 66.72  ? 66  LEU A CB    1 
ATOM   298   C  CG    . LEU A  1 66  ? 16.318  -2.451   74.842  1.00 65.70  ? 66  LEU A CG    1 
ATOM   299   C  CD1   . LEU A  1 66  ? 16.200  -1.548   73.635  1.00 64.29  ? 66  LEU A CD1   1 
ATOM   300   C  CD2   . LEU A  1 66  ? 15.064  -3.299   74.974  1.00 66.64  ? 66  LEU A CD2   1 
ATOM   301   N  N     . ILE A  1 67  ? 20.158  -5.231   75.916  1.00 67.86  ? 67  ILE A N     1 
ATOM   302   C  CA    . ILE A  1 67  ? 21.115  -6.271   75.550  1.00 69.04  ? 67  ILE A CA    1 
ATOM   303   C  C     . ILE A  1 67  ? 21.913  -6.749   76.756  1.00 69.55  ? 67  ILE A C     1 
ATOM   304   O  O     . ILE A  1 67  ? 22.610  -5.962   77.407  1.00 69.30  ? 67  ILE A O     1 
ATOM   305   C  CB    . ILE A  1 67  ? 22.078  -5.807   74.428  1.00 69.42  ? 67  ILE A CB    1 
ATOM   306   C  CG1   . ILE A  1 67  ? 21.298  -5.439   73.169  1.00 69.64  ? 67  ILE A CG1   1 
ATOM   307   C  CG2   . ILE A  1 67  ? 23.063  -6.909   74.082  1.00 71.07  ? 67  ILE A CG2   1 
ATOM   308   C  CD1   . ILE A  1 67  ? 22.116  -4.703   72.125  1.00 70.54  ? 67  ILE A CD1   1 
ATOM   309   N  N     . LEU A  1 68  ? 21.801  -8.041   77.050  1.00 70.61  ? 68  LEU A N     1 
ATOM   310   C  CA    . LEU A  1 68  ? 22.633  -8.670   78.068  1.00 71.31  ? 68  LEU A CA    1 
ATOM   311   C  C     . LEU A  1 68  ? 23.695  -9.500   77.373  1.00 73.00  ? 68  LEU A C     1 
ATOM   312   O  O     . LEU A  1 68  ? 23.381  -10.468  76.684  1.00 73.93  ? 68  LEU A O     1 
ATOM   313   C  CB    . LEU A  1 68  ? 21.798  -9.551   79.005  1.00 71.73  ? 68  LEU A CB    1 
ATOM   314   C  CG    . LEU A  1 68  ? 20.563  -8.982   79.712  1.00 70.47  ? 68  LEU A CG    1 
ATOM   315   C  CD1   . LEU A  1 68  ? 20.168  -9.891   80.856  1.00 71.81  ? 68  LEU A CD1   1 
ATOM   316   C  CD2   . LEU A  1 68  ? 20.783  -7.576   80.233  1.00 69.12  ? 68  LEU A CD2   1 
ATOM   317   N  N     . GLU A  1 69  ? 24.949  -9.095   77.531  1.00 73.75  ? 69  GLU A N     1 
ATOM   318   C  CA    . GLU A  1 69  ? 26.083  -9.841   76.993  1.00 76.13  ? 69  GLU A CA    1 
ATOM   319   C  C     . GLU A  1 69  ? 27.031  -10.257  78.124  1.00 77.25  ? 69  GLU A C     1 
ATOM   320   O  O     . GLU A  1 69  ? 26.880  -9.779   79.245  1.00 76.44  ? 69  GLU A O     1 
ATOM   321   C  CB    . GLU A  1 69  ? 26.815  -9.004   75.940  1.00 76.59  ? 69  GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 69  ? 26.460  -9.359   74.495  1.00 78.68  ? 69  GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 69  ? 27.185  -8.486   73.468  1.00 81.89  ? 69  GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 69  ? 27.337  -7.265   73.713  1.00 81.64  ? 69  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 69  ? 27.599  -9.017   72.409  1.00 84.86  ? 69  GLU A OE2   1 
ATOM   326   N  N     . PRO A  1 70  ? 27.994  -11.164  77.842  1.00 79.53  ? 70  PRO A N     1 
ATOM   327   C  CA    . PRO A  1 70  ? 29.029  -11.531  78.811  1.00 81.26  ? 70  PRO A CA    1 
ATOM   328   C  C     . PRO A  1 70  ? 29.617  -10.357  79.605  1.00 80.89  ? 70  PRO A C     1 
ATOM   329   O  O     . PRO A  1 70  ? 29.290  -10.199  80.783  1.00 80.70  ? 70  PRO A O     1 
ATOM   330   C  CB    . PRO A  1 70  ? 30.102  -12.187  77.935  1.00 83.49  ? 70  PRO A CB    1 
ATOM   331   C  CG    . PRO A  1 70  ? 29.326  -12.856  76.861  1.00 83.61  ? 70  PRO A CG    1 
ATOM   332   C  CD    . PRO A  1 70  ? 28.039  -12.055  76.665  1.00 81.18  ? 70  PRO A CD    1 
ATOM   333   N  N     . GLY A  1 71  ? 30.456  -9.539   78.974  1.00 81.26  ? 71  GLY A N     1 
ATOM   334   C  CA    . GLY A  1 71  ? 31.197  -8.498   79.694  1.00 81.63  ? 71  GLY A CA    1 
ATOM   335   C  C     . GLY A  1 71  ? 30.402  -7.308   80.223  1.00 79.53  ? 71  GLY A C     1 
ATOM   336   O  O     . GLY A  1 71  ? 30.804  -6.662   81.208  1.00 79.97  ? 71  GLY A O     1 
ATOM   337   N  N     . GLN A  1 72  ? 29.270  -7.021   79.582  1.00 77.33  ? 72  GLN A N     1 
ATOM   338   C  CA    . GLN A  1 72  ? 28.590  -5.742   79.765  1.00 75.23  ? 72  GLN A CA    1 
ATOM   339   C  C     . GLN A  1 72  ? 27.091  -5.821   79.508  1.00 73.17  ? 72  GLN A C     1 
ATOM   340   O  O     . GLN A  1 72  ? 26.570  -6.875   79.133  1.00 73.66  ? 72  GLN A O     1 
ATOM   341   C  CB    . GLN A  1 72  ? 29.191  -4.719   78.810  1.00 75.19  ? 72  GLN A CB    1 
ATOM   342   C  CG    . GLN A  1 72  ? 28.937  -5.053   77.349  1.00 76.01  ? 72  GLN A CG    1 
ATOM   343   C  CD    . GLN A  1 72  ? 29.716  -4.169   76.419  1.00 78.31  ? 72  GLN A CD    1 
ATOM   344   O  OE1   . GLN A  1 72  ? 29.173  -3.234   75.832  1.00 78.44  ? 72  GLN A OE1   1 
ATOM   345   N  NE2   . GLN A  1 72  ? 31.006  -4.442   76.290  1.00 81.41  ? 72  GLN A NE2   1 
ATOM   346   N  N     . VAL A  1 73  ? 26.415  -4.689   79.709  1.00 71.16  ? 73  VAL A N     1 
ATOM   347   C  CA    . VAL A  1 73  ? 25.009  -4.527   79.382  1.00 69.15  ? 73  VAL A CA    1 
ATOM   348   C  C     . VAL A  1 73  ? 24.852  -3.290   78.509  1.00 68.36  ? 73  VAL A C     1 
ATOM   349   O  O     . VAL A  1 73  ? 25.411  -2.228   78.816  1.00 68.52  ? 73  VAL A O     1 
ATOM   350   C  CB    . VAL A  1 73  ? 24.154  -4.333   80.629  1.00 68.47  ? 73  VAL A CB    1 
ATOM   351   C  CG1   . VAL A  1 73  ? 22.712  -4.183   80.243  1.00 67.53  ? 73  VAL A CG1   1 
ATOM   352   C  CG2   . VAL A  1 73  ? 24.300  -5.490   81.561  1.00 69.53  ? 73  VAL A CG2   1 
ATOM   353   N  N     . GLY A  1 74  ? 24.093  -3.435   77.421  1.00 67.98  ? 74  GLY A N     1 
ATOM   354   C  CA    . GLY A  1 74  ? 23.734  -2.311   76.543  1.00 67.01  ? 74  GLY A CA    1 
ATOM   355   C  C     . GLY A  1 74  ? 22.442  -1.656   76.995  1.00 65.57  ? 74  GLY A C     1 
ATOM   356   O  O     . GLY A  1 74  ? 21.417  -2.329   77.135  1.00 65.46  ? 74  GLY A O     1 
ATOM   357   N  N     . ILE A  1 75  ? 22.483  -0.349   77.239  1.00 64.69  ? 75  ILE A N     1 
ATOM   358   C  CA    . ILE A  1 75  ? 21.305  0.350    77.760  1.00 63.73  ? 75  ILE A CA    1 
ATOM   359   C  C     . ILE A  1 75  ? 20.944  1.595    76.944  1.00 63.12  ? 75  ILE A C     1 
ATOM   360   O  O     . ILE A  1 75  ? 21.773  2.487    76.737  1.00 63.43  ? 75  ILE A O     1 
ATOM   361   C  CB    . ILE A  1 75  ? 21.456  0.678    79.273  1.00 64.04  ? 75  ILE A CB    1 
ATOM   362   C  CG1   . ILE A  1 75  ? 21.614  -0.623   80.070  1.00 65.06  ? 75  ILE A CG1   1 
ATOM   363   C  CG2   . ILE A  1 75  ? 20.260  1.463    79.787  1.00 63.34  ? 75  ILE A CG2   1 
ATOM   364   C  CD1   . ILE A  1 75  ? 22.066  -0.458   81.505  1.00 66.26  ? 75  ILE A CD1   1 
ATOM   365   N  N     . VAL A  1 76  ? 19.698  1.631    76.479  1.00 62.42  ? 76  VAL A N     1 
ATOM   366   C  CA    . VAL A  1 76  ? 19.176  2.765    75.728  1.00 61.91  ? 76  VAL A CA    1 
ATOM   367   C  C     . VAL A  1 76  ? 18.579  3.804    76.679  1.00 61.84  ? 76  VAL A C     1 
ATOM   368   O  O     . VAL A  1 76  ? 17.786  3.469    77.564  1.00 62.08  ? 76  VAL A O     1 
ATOM   369   C  CB    . VAL A  1 76  ? 18.160  2.308    74.662  1.00 62.11  ? 76  VAL A CB    1 
ATOM   370   C  CG1   . VAL A  1 76  ? 18.804  1.260    73.771  1.00 62.50  ? 76  VAL A CG1   1 
ATOM   371   C  CG2   . VAL A  1 76  ? 16.892  1.751    75.304  1.00 61.49  ? 76  VAL A CG2   1 
ATOM   372   N  N     . LEU A  1 77  ? 18.971  5.062    76.492  1.00 61.89  ? 77  LEU A N     1 
ATOM   373   C  CA    . LEU A  1 77  ? 18.652  6.132    77.440  1.00 62.05  ? 77  LEU A CA    1 
ATOM   374   C  C     . LEU A  1 77  ? 17.341  6.838    77.138  1.00 62.44  ? 77  LEU A C     1 
ATOM   375   O  O     . LEU A  1 77  ? 16.921  6.899    75.986  1.00 62.60  ? 77  LEU A O     1 
ATOM   376   C  CB    . LEU A  1 77  ? 19.786  7.155    77.464  1.00 62.38  ? 77  LEU A CB    1 
ATOM   377   C  CG    . LEU A  1 77  ? 21.188  6.632    77.772  1.00 61.74  ? 77  LEU A CG    1 
ATOM   378   C  CD1   . LEU A  1 77  ? 22.185  7.745    77.638  1.00 60.86  ? 77  LEU A CD1   1 
ATOM   379   C  CD2   . LEU A  1 77  ? 21.226  6.045    79.163  1.00 61.82  ? 77  LEU A CD2   1 
ATOM   380   N  N     . PHE A  1 78  ? 16.704  7.374    78.180  1.00 63.18  ? 78  PHE A N     1 
ATOM   381   C  CA    . PHE A  1 78  ? 15.426  8.071    78.033  1.00 64.03  ? 78  PHE A CA    1 
ATOM   382   C  C     . PHE A  1 78  ? 15.601  9.577    77.965  1.00 64.80  ? 78  PHE A C     1 
ATOM   383   O  O     . PHE A  1 78  ? 14.718  10.294   77.507  1.00 65.40  ? 78  PHE A O     1 
ATOM   384   C  CB    . PHE A  1 78  ? 14.458  7.708    79.161  1.00 64.67  ? 78  PHE A CB    1 
ATOM   385   C  CG    . PHE A  1 78  ? 14.008  6.268    79.148  1.00 64.91  ? 78  PHE A CG    1 
ATOM   386   C  CD1   . PHE A  1 78  ? 14.166  5.469    78.014  1.00 64.37  ? 78  PHE A CD1   1 
ATOM   387   C  CD2   . PHE A  1 78  ? 13.386  5.717    80.263  1.00 66.49  ? 78  PHE A CD2   1 
ATOM   388   C  CE1   . PHE A  1 78  ? 13.740  4.142    78.008  1.00 64.03  ? 78  PHE A CE1   1 
ATOM   389   C  CE2   . PHE A  1 78  ? 12.954  4.383    80.263  1.00 66.34  ? 78  PHE A CE2   1 
ATOM   390   C  CZ    . PHE A  1 78  ? 13.133  3.600    79.136  1.00 65.10  ? 78  PHE A CZ    1 
ATOM   391   N  N     . GLY A  1 79  ? 16.743  10.051   78.432  1.00 65.39  ? 79  GLY A N     1 
ATOM   392   C  CA    . GLY A  1 79  ? 17.051  11.466   78.387  1.00 66.89  ? 79  GLY A CA    1 
ATOM   393   C  C     . GLY A  1 79  ? 18.279  11.629   77.534  1.00 67.16  ? 79  GLY A C     1 
ATOM   394   O  O     . GLY A  1 79  ? 18.703  10.670   76.884  1.00 66.76  ? 79  GLY A O     1 
ATOM   395   N  N     . SER A  1 80  ? 18.844  12.838   77.547  1.00 68.49  ? 80  SER A N     1 
ATOM   396   C  CA    . SER A  1 80  ? 20.030  13.196   76.759  1.00 68.94  ? 80  SER A CA    1 
ATOM   397   C  C     . SER A  1 80  ? 21.226  12.343   77.130  1.00 69.04  ? 80  SER A C     1 
ATOM   398   O  O     . SER A  1 80  ? 21.545  12.203   78.303  1.00 69.58  ? 80  SER A O     1 
ATOM   399   C  CB    . SER A  1 80  ? 20.379  14.664   76.995  1.00 70.21  ? 80  SER A CB    1 
ATOM   400   O  OG    . SER A  1 80  ? 21.560  15.024   76.312  1.00 71.01  ? 80  SER A OG    1 
ATOM   401   N  N     . ASP A  1 81  ? 21.892  11.777   76.134  1.00 69.22  ? 81  ASP A N     1 
ATOM   402   C  CA    . ASP A  1 81  ? 23.110  11.027   76.395  1.00 70.10  ? 81  ASP A CA    1 
ATOM   403   C  C     . ASP A  1 81  ? 24.287  11.927   76.771  1.00 71.35  ? 81  ASP A C     1 
ATOM   404   O  O     . ASP A  1 81  ? 25.430  11.484   76.785  1.00 72.35  ? 81  ASP A O     1 
ATOM   405   C  CB    . ASP A  1 81  ? 23.460  10.060   75.241  1.00 70.53  ? 81  ASP A CB    1 
ATOM   406   C  CG    . ASP A  1 81  ? 23.661  10.757   73.890  1.00 73.14  ? 81  ASP A CG    1 
ATOM   407   O  OD1   . ASP A  1 81  ? 22.935  11.727   73.560  1.00 75.56  ? 81  ASP A OD1   1 
ATOM   408   O  OD2   . ASP A  1 81  ? 24.540  10.292   73.130  1.00 75.46  ? 81  ASP A OD2   1 
ATOM   409   N  N     . ARG A  1 82  ? 23.991  13.186   77.079  1.00 71.86  ? 82  ARG A N     1 
ATOM   410   C  CA    . ARG A  1 82  ? 24.972  14.125   77.626  1.00 73.55  ? 82  ARG A CA    1 
ATOM   411   C  C     . ARG A  1 82  ? 25.010  13.990   79.142  1.00 74.39  ? 82  ARG A C     1 
ATOM   412   O  O     . ARG A  1 82  ? 26.037  14.227   79.778  1.00 76.20  ? 82  ARG A O     1 
ATOM   413   C  CB    . ARG A  1 82  ? 24.619  15.562   77.222  1.00 74.13  ? 82  ARG A CB    1 
ATOM   414   C  CG    . ARG A  1 82  ? 25.029  16.619   78.213  1.00 74.30  ? 82  ARG A CG    1 
ATOM   415   C  CD    . ARG A  1 82  ? 24.973  17.974   77.591  1.00 73.92  ? 82  ARG A CD    1 
ATOM   416   N  NE    . ARG A  1 82  ? 25.601  18.984   78.441  1.00 74.91  ? 82  ARG A NE    1 
ATOM   417   C  CZ    . ARG A  1 82  ? 26.834  19.460   78.284  1.00 75.75  ? 82  ARG A CZ    1 
ATOM   418   N  NH1   . ARG A  1 82  ? 27.618  19.025   77.304  1.00 75.45  ? 82  ARG A NH1   1 
ATOM   419   N  NH2   . ARG A  1 82  ? 27.283  20.382   79.120  1.00 77.53  ? 82  ARG A NH2   1 
ATOM   420   N  N     . LEU A  1 83  ? 23.879  13.587   79.702  1.00 73.70  ? 83  LEU A N     1 
ATOM   421   C  CA    . LEU A  1 83  ? 23.712  13.440   81.135  1.00 74.92  ? 83  LEU A CA    1 
ATOM   422   C  C     . LEU A  1 83  ? 24.466  12.234   81.695  1.00 75.47  ? 83  LEU A C     1 
ATOM   423   O  O     . LEU A  1 83  ? 24.439  11.988   82.903  1.00 76.88  ? 83  LEU A O     1 
ATOM   424   C  CB    . LEU A  1 83  ? 22.223  13.332   81.466  1.00 74.02  ? 83  LEU A CB    1 
ATOM   425   C  CG    . LEU A  1 83  ? 21.375  14.526   81.040  1.00 73.85  ? 83  LEU A CG    1 
ATOM   426   C  CD1   . LEU A  1 83  ? 19.949  14.081   80.804  1.00 73.16  ? 83  LEU A CD1   1 
ATOM   427   C  CD2   . LEU A  1 83  ? 21.450  15.651   82.064  1.00 75.21  ? 83  LEU A CD2   1 
ATOM   428   N  N     . VAL A  1 84  ? 25.142  11.488   80.825  1.00 75.09  ? 84  VAL A N     1 
ATOM   429   C  CA    . VAL A  1 84  ? 25.920  10.326   81.254  1.00 75.70  ? 84  VAL A CA    1 
ATOM   430   C  C     . VAL A  1 84  ? 27.420  10.508   80.961  1.00 77.59  ? 84  VAL A C     1 
ATOM   431   O  O     . VAL A  1 84  ? 27.802  11.226   80.023  1.00 78.21  ? 84  VAL A O     1 
ATOM   432   C  CB    . VAL A  1 84  ? 25.361  9.029    80.618  1.00 73.93  ? 84  VAL A CB    1 
ATOM   433   C  CG1   . VAL A  1 84  ? 26.092  7.790    81.141  1.00 74.84  ? 84  VAL A CG1   1 
ATOM   434   C  CG2   . VAL A  1 84  ? 23.871  8.902    80.903  1.00 72.52  ? 84  VAL A CG2   1 
ATOM   435   N  N     . LYS A  1 85  ? 28.261  9.884    81.784  1.00 79.03  ? 85  LYS A N     1 
ATOM   436   C  CA    . LYS A  1 85  ? 29.705  9.892    81.569  1.00 81.32  ? 85  LYS A CA    1 
ATOM   437   C  C     . LYS A  1 85  ? 30.299  8.515    81.821  1.00 82.13  ? 85  LYS A C     1 
ATOM   438   O  O     . LYS A  1 85  ? 29.689  7.687    82.492  1.00 81.37  ? 85  LYS A O     1 
ATOM   439   C  CB    . LYS A  1 85  ? 30.386  10.912   82.484  1.00 83.80  ? 85  LYS A CB    1 
ATOM   440   C  CG    . LYS A  1 85  ? 30.009  12.357   82.210  1.00 84.08  ? 85  LYS A CG    1 
ATOM   441   C  CD    . LYS A  1 85  ? 31.020  13.328   82.798  1.00 86.74  ? 85  LYS A CD    1 
ATOM   442   C  CE    . LYS A  1 85  ? 30.465  14.737   82.801  1.00 86.97  ? 85  LYS A CE    1 
ATOM   443   N  NZ    . LYS A  1 85  ? 31.541  15.754   82.830  1.00 89.90  ? 85  LYS A NZ    1 
ATOM   444   N  N     . GLU A  1 86  ? 31.491  8.276    81.276  1.00 84.25  ? 86  GLU A N     1 
ATOM   445   C  CA    . GLU A  1 86  ? 32.276  7.079    81.594  1.00 85.79  ? 86  GLU A CA    1 
ATOM   446   C  C     . GLU A  1 86  ? 32.690  7.126    83.054  1.00 87.92  ? 86  GLU A C     1 
ATOM   447   O  O     . GLU A  1 86  ? 33.016  8.194    83.570  1.00 89.73  ? 86  GLU A O     1 
ATOM   448   C  CB    . GLU A  1 86  ? 33.530  7.001    80.720  1.00 87.74  ? 86  GLU A CB    1 
ATOM   449   C  CG    . GLU A  1 86  ? 34.432  5.807    81.021  1.00 90.26  ? 86  GLU A CG    1 
ATOM   450   C  CD    . GLU A  1 86  ? 35.853  5.989    80.519  1.00 95.12  ? 86  GLU A CD    1 
ATOM   451   O  OE1   . GLU A  1 86  ? 36.056  6.780    79.568  1.00 96.61  ? 86  GLU A OE1   1 
ATOM   452   O  OE2   . GLU A  1 86  ? 36.770  5.336    81.073  1.00 97.81  ? 86  GLU A OE2   1 
ATOM   453   N  N     . GLY A  1 87  ? 32.681  5.967    83.708  1.00 88.27  ? 87  GLY A N     1 
ATOM   454   C  CA    . GLY A  1 87  ? 33.037  5.865    85.122  1.00 90.79  ? 87  GLY A CA    1 
ATOM   455   C  C     . GLY A  1 87  ? 31.842  6.057    86.039  1.00 90.06  ? 87  GLY A C     1 
ATOM   456   O  O     . GLY A  1 87  ? 31.909  5.752    87.228  1.00 91.85  ? 87  GLY A O     1 
ATOM   457   N  N     . GLU A  1 88  ? 30.747  6.557    85.472  1.00 87.88  ? 88  GLU A N     1 
ATOM   458   C  CA    . GLU A  1 88  ? 29.513  6.826    86.200  1.00 87.52  ? 88  GLU A CA    1 
ATOM   459   C  C     . GLU A  1 88  ? 28.896  5.560    86.805  1.00 86.89  ? 88  GLU A C     1 
ATOM   460   O  O     . GLU A  1 88  ? 29.090  4.454    86.287  1.00 86.04  ? 88  GLU A O     1 
ATOM   461   C  CB    . GLU A  1 88  ? 28.526  7.481    85.247  1.00 85.33  ? 88  GLU A CB    1 
ATOM   462   C  CG    . GLU A  1 88  ? 27.520  8.364    85.908  1.00 87.34  ? 88  GLU A CG    1 
ATOM   463   C  CD    . GLU A  1 88  ? 27.452  9.721    85.247  1.00 89.55  ? 88  GLU A CD    1 
ATOM   464   O  OE1   . GLU A  1 88  ? 28.468  10.466   85.314  1.00 91.16  ? 88  GLU A OE1   1 
ATOM   465   O  OE2   . GLU A  1 88  ? 26.381  10.034   84.669  1.00 88.66  ? 88  GLU A OE2   1 
ATOM   466   N  N     . LEU A  1 89  ? 28.158  5.733    87.902  1.00 87.59  ? 89  LEU A N     1 
ATOM   467   C  CA    . LEU A  1 89  ? 27.503  4.622    88.592  1.00 87.48  ? 89  LEU A CA    1 
ATOM   468   C  C     . LEU A  1 89  ? 26.069  4.441    88.098  1.00 84.84  ? 89  LEU A C     1 
ATOM   469   O  O     . LEU A  1 89  ? 25.386  5.424    87.790  1.00 84.03  ? 89  LEU A O     1 
ATOM   470   C  CB    . LEU A  1 89  ? 27.533  4.851    90.110  1.00 90.80  ? 89  LEU A CB    1 
ATOM   471   C  CG    . LEU A  1 89  ? 26.764  3.924    91.066  1.00 92.12  ? 89  LEU A CG    1 
ATOM   472   C  CD1   . LEU A  1 89  ? 27.403  2.544    91.173  1.00 93.22  ? 89  LEU A CD1   1 
ATOM   473   C  CD2   . LEU A  1 89  ? 26.665  4.558    92.439  1.00 95.76  ? 89  LEU A CD2   1 
ATOM   474   N  N     . VAL A  1 90  ? 25.625  3.182    88.022  1.00 83.81  ? 90  VAL A N     1 
ATOM   475   C  CA    . VAL A  1 90  ? 24.274  2.829    87.540  1.00 81.70  ? 90  VAL A CA    1 
ATOM   476   C  C     . VAL A  1 90  ? 23.542  1.939    88.546  1.00 82.70  ? 90  VAL A C     1 
ATOM   477   O  O     . VAL A  1 90  ? 24.139  1.021    89.107  1.00 84.16  ? 90  VAL A O     1 
ATOM   478   C  CB    . VAL A  1 90  ? 24.310  2.067    86.185  1.00 79.60  ? 90  VAL A CB    1 
ATOM   479   C  CG1   . VAL A  1 90  ? 22.915  1.971    85.592  1.00 78.02  ? 90  VAL A CG1   1 
ATOM   480   C  CG2   . VAL A  1 90  ? 25.261  2.729    85.187  1.00 79.06  ? 90  VAL A CG2   1 
ATOM   481   N  N     . LYS A  1 91  ? 22.249  2.200    88.750  1.00 82.10  ? 91  LYS A N     1 
ATOM   482   C  CA    . LYS A  1 91  ? 21.445  1.452    89.730  1.00 83.42  ? 91  LYS A CA    1 
ATOM   483   C  C     . LYS A  1 91  ? 20.325  0.620    89.084  1.00 81.34  ? 91  LYS A C     1 
ATOM   484   O  O     . LYS A  1 91  ? 19.736  1.023    88.075  1.00 79.14  ? 91  LYS A O     1 
ATOM   485   C  CB    . LYS A  1 91  ? 20.856  2.396    90.793  1.00 85.83  ? 91  LYS A CB    1 
ATOM   486   C  CG    . LYS A  1 91  ? 21.805  3.491    91.273  1.00 88.51  ? 91  LYS A CG    1 
ATOM   487   C  CD    . LYS A  1 91  ? 21.265  4.218    92.515  1.00 94.08  ? 91  LYS A CD    1 
ATOM   488   C  CE    . LYS A  1 91  ? 21.902  5.605    92.691  1.00 96.05  ? 91  LYS A CE    1 
ATOM   489   N  NZ    . LYS A  1 91  ? 21.683  6.475    91.478  1.00 93.89  ? 91  LYS A NZ    1 
ATOM   490   N  N     . ARG A  1 92  ? 20.044  -0.539   89.678  1.00 82.00  ? 92  ARG A N     1 
ATOM   491   C  CA    . ARG A  1 92  ? 18.957  -1.416   89.241  1.00 80.78  ? 92  ARG A CA    1 
ATOM   492   C  C     . ARG A  1 92  ? 17.643  -0.963   89.841  1.00 81.99  ? 92  ARG A C     1 
ATOM   493   O  O     . ARG A  1 92  ? 17.553  -0.813   91.060  1.00 85.02  ? 92  ARG A O     1 
ATOM   494   C  CB    . ARG A  1 92  ? 19.201  -2.835   89.738  1.00 82.07  ? 92  ARG A CB    1 
ATOM   495   C  CG    . ARG A  1 92  ? 19.794  -3.785   88.739  1.00 80.39  ? 92  ARG A CG    1 
ATOM   496   C  CD    . ARG A  1 92  ? 19.567  -5.212   89.211  1.00 82.85  ? 92  ARG A CD    1 
ATOM   497   N  NE    . ARG A  1 92  ? 18.173  -5.619   89.020  1.00 83.59  ? 92  ARG A NE    1 
ATOM   498   C  CZ    . ARG A  1 92  ? 17.613  -6.708   89.540  1.00 85.22  ? 92  ARG A CZ    1 
ATOM   499   N  NH1   . ARG A  1 92  ? 18.317  -7.529   90.311  1.00 87.52  ? 92  ARG A NH1   1 
ATOM   500   N  NH2   . ARG A  1 92  ? 16.338  -6.972   89.288  1.00 84.90  ? 92  ARG A NH2   1 
ATOM   501   N  N     . THR A  1 93  ? 16.616  -0.761   89.021  1.00 79.99  ? 93  THR A N     1 
ATOM   502   C  CA    . THR A  1 93  ? 15.296  -0.472   89.585  1.00 81.28  ? 93  THR A CA    1 
ATOM   503   C  C     . THR A  1 93  ? 14.526  -1.753   89.863  1.00 82.35  ? 93  THR A C     1 
ATOM   504   O  O     . THR A  1 93  ? 13.530  -1.733   90.577  1.00 84.70  ? 93  THR A O     1 
ATOM   505   C  CB    . THR A  1 93  ? 14.442  0.452    88.698  1.00 79.95  ? 93  THR A CB    1 
ATOM   506   O  OG1   . THR A  1 93  ? 13.821  -0.306   87.648  1.00 78.61  ? 93  THR A OG1   1 
ATOM   507   C  CG2   . THR A  1 93  ? 15.290  1.568    88.112  1.00 78.47  ? 93  THR A CG2   1 
ATOM   508   N  N     . GLY A  1 94  ? 14.981  -2.861   89.284  1.00 80.91  ? 94  GLY A N     1 
ATOM   509   C  CA    . GLY A  1 94  ? 14.331  -4.159   89.461  1.00 82.01  ? 94  GLY A CA    1 
ATOM   510   C  C     . GLY A  1 94  ? 12.943  -4.251   88.857  1.00 81.85  ? 94  GLY A C     1 
ATOM   511   O  O     . GLY A  1 94  ? 12.124  -5.062   89.287  1.00 83.93  ? 94  GLY A O     1 
ATOM   512   N  N     . ASN A  1 95  ? 12.680  -3.408   87.863  1.00 79.71  ? 95  ASN A N     1 
ATOM   513   C  CA    . ASN A  1 95  ? 11.401  -3.399   87.169  1.00 79.68  ? 95  ASN A CA    1 
ATOM   514   C  C     . ASN A  1 95  ? 11.555  -3.440   85.659  1.00 77.04  ? 95  ASN A C     1 
ATOM   515   O  O     . ASN A  1 95  ? 12.313  -2.655   85.079  1.00 75.06  ? 95  ASN A O     1 
ATOM   516   C  CB    . ASN A  1 95  ? 10.611  -2.157   87.557  1.00 80.80  ? 95  ASN A CB    1 
ATOM   517   C  CG    . ASN A  1 95  ? 10.423  -2.035   89.048  1.00 84.11  ? 95  ASN A CG    1 
ATOM   518   O  OD1   . ASN A  1 95  ? 10.268  -3.037   89.747  1.00 86.25  ? 95  ASN A OD1   1 
ATOM   519   N  ND2   . ASN A  1 95  ? 10.429  -0.803   89.550  1.00 85.04  ? 95  ASN A ND2   1 
ATOM   520   N  N     . ILE A  1 96  ? 10.845  -4.371   85.030  1.00 77.36  ? 96  ILE A N     1 
ATOM   521   C  CA    . ILE A  1 96  ? 10.633  -4.336   83.589  1.00 75.63  ? 96  ILE A CA    1 
ATOM   522   C  C     . ILE A  1 96  ? 9.901   -3.029   83.309  1.00 75.54  ? 96  ILE A C     1 
ATOM   523   O  O     . ILE A  1 96  ? 9.140   -2.554   84.157  1.00 77.54  ? 96  ILE A O     1 
ATOM   524   C  CB    . ILE A  1 96  ? 9.732   -5.505   83.114  1.00 76.92  ? 96  ILE A CB    1 
ATOM   525   C  CG1   . ILE A  1 96  ? 10.140  -6.835   83.757  1.00 77.47  ? 96  ILE A CG1   1 
ATOM   526   C  CG2   . ILE A  1 96  ? 9.729   -5.601   81.597  1.00 75.96  ? 96  ILE A CG2   1 
ATOM   527   C  CD1   . ILE A  1 96  ? 11.295  -7.516   83.096  1.00 75.62  ? 96  ILE A CD1   1 
ATOM   528   N  N     . VAL A  1 97  ? 10.131  -2.435   82.143  1.00 73.57  ? 97  VAL A N     1 
ATOM   529   C  CA    . VAL A  1 97  ? 9.375   -1.257   81.746  1.00 73.66  ? 97  VAL A CA    1 
ATOM   530   C  C     . VAL A  1 97  ? 7.915   -1.507   82.027  1.00 76.01  ? 97  VAL A C     1 
ATOM   531   O  O     . VAL A  1 97  ? 7.352   -2.480   81.531  1.00 77.14  ? 97  VAL A O     1 
ATOM   532   C  CB    . VAL A  1 97  ? 9.457   -1.000   80.248  1.00 72.42  ? 97  VAL A CB    1 
ATOM   533   C  CG1   . VAL A  1 97  ? 9.016   0.417    79.952  1.00 72.69  ? 97  VAL A CG1   1 
ATOM   534   C  CG2   . VAL A  1 97  ? 10.851  -1.238   79.746  1.00 71.06  ? 97  VAL A CG2   1 
ATOM   535   N  N     . ASP A  1 98  ? 7.303   -0.639   82.822  1.00 65.18  ? 98  ASP A N     1 
ATOM   536   C  CA    . ASP A  1 98  ? 5.876   -0.762   83.099  1.00 64.82  ? 98  ASP A CA    1 
ATOM   537   C  C     . ASP A  1 98  ? 5.155   0.586    83.152  1.00 63.56  ? 98  ASP A C     1 
ATOM   538   O  O     . ASP A  1 98  ? 5.775   1.641    83.015  1.00 63.34  ? 98  ASP A O     1 
ATOM   539   C  CB    . ASP A  1 98  ? 5.615   -1.623   84.358  1.00 66.92  ? 98  ASP A CB    1 
ATOM   540   C  CG    . ASP A  1 98  ? 5.927   -0.903   85.676  1.00 68.38  ? 98  ASP A CG    1 
ATOM   541   O  OD1   . ASP A  1 98  ? 5.941   0.345    85.738  1.00 67.24  ? 98  ASP A OD1   1 
ATOM   542   O  OD2   . ASP A  1 98  ? 6.137   -1.614   86.682  1.00 71.08  ? 98  ASP A OD2   1 
ATOM   543   N  N     . VAL A  1 99  ? 3.847   0.545    83.364  1.00 63.04  ? 99  VAL A N     1 
ATOM   544   C  CA    . VAL A  1 99  ? 3.049   1.754    83.373  1.00 61.94  ? 99  VAL A CA    1 
ATOM   545   C  C     . VAL A  1 99  ? 1.902   1.661    84.392  1.00 62.93  ? 99  VAL A C     1 
ATOM   546   O  O     . VAL A  1 99  ? 1.375   0.576    84.634  1.00 63.64  ? 99  VAL A O     1 
ATOM   547   C  CB    . VAL A  1 99  ? 2.555   2.085    81.936  1.00 59.87  ? 99  VAL A CB    1 
ATOM   548   C  CG1   . VAL A  1 99  ? 1.590   1.017    81.409  1.00 59.39  ? 99  VAL A CG1   1 
ATOM   549   C  CG2   . VAL A  1 99  ? 1.949   3.471    81.872  1.00 59.04  ? 99  VAL A CG2   1 
ATOM   550   N  N     . PRO A  1 100 ? 1.544   2.794    85.029  1.00 63.20  ? 100 PRO A N     1 
ATOM   551   C  CA    . PRO A  1 100 ? 0.355   2.808    85.872  1.00 64.16  ? 100 PRO A CA    1 
ATOM   552   C  C     . PRO A  1 100 ? -0.924  2.655    85.038  1.00 63.23  ? 100 PRO A C     1 
ATOM   553   O  O     . PRO A  1 100 ? -1.022  3.195    83.931  1.00 61.69  ? 100 PRO A O     1 
ATOM   554   C  CB    . PRO A  1 100 ? 0.413   4.189    86.540  1.00 64.32  ? 100 PRO A CB    1 
ATOM   555   C  CG    . PRO A  1 100 ? 1.291   5.002    85.677  1.00 62.98  ? 100 PRO A CG    1 
ATOM   556   C  CD    . PRO A  1 100 ? 2.298   4.055    85.138  1.00 63.14  ? 100 PRO A CD    1 
ATOM   557   N  N     . VAL A  1 101 ? -1.888  1.908    85.571  1.00 64.25  ? 101 VAL A N     1 
ATOM   558   C  CA    . VAL A  1 101 ? -3.118  1.591    84.853  1.00 63.28  ? 101 VAL A CA    1 
ATOM   559   C  C     . VAL A  1 101 ? -4.327  1.846    85.743  1.00 64.40  ? 101 VAL A C     1 
ATOM   560   O  O     . VAL A  1 101 ? -4.215  1.806    86.962  1.00 66.08  ? 101 VAL A O     1 
ATOM   561   C  CB    . VAL A  1 101 ? -3.127  0.120    84.389  1.00 63.45  ? 101 VAL A CB    1 
ATOM   562   C  CG1   . VAL A  1 101 ? -2.010  -0.135   83.384  1.00 62.23  ? 101 VAL A CG1   1 
ATOM   563   C  CG2   . VAL A  1 101 ? -3.006  -0.818   85.572  1.00 64.93  ? 101 VAL A CG2   1 
ATOM   564   N  N     . GLY A  1 102 ? -5.480  2.104    85.136  1.00 63.75  ? 102 GLY A N     1 
ATOM   565   C  CA    . GLY A  1 102 ? -6.707  2.309    85.901  1.00 64.79  ? 102 GLY A CA    1 
ATOM   566   C  C     . GLY A  1 102 ? -7.518  3.516    85.463  1.00 63.97  ? 102 GLY A C     1 
ATOM   567   O  O     . GLY A  1 102 ? -6.998  4.403    84.768  1.00 62.85  ? 102 GLY A O     1 
ATOM   568   N  N     . PRO A  1 103 ? -8.798  3.574    85.882  1.00 64.53  ? 103 PRO A N     1 
ATOM   569   C  CA    . PRO A  1 103 ? -9.661  4.665    85.465  1.00 63.81  ? 103 PRO A CA    1 
ATOM   570   C  C     . PRO A  1 103 ? -9.177  6.005    86.017  1.00 64.00  ? 103 PRO A C     1 
ATOM   571   O  O     . PRO A  1 103 ? -9.538  7.049    85.480  1.00 63.58  ? 103 PRO A O     1 
ATOM   572   C  CB    . PRO A  1 103 ? -11.015 4.290    86.061  1.00 65.10  ? 103 PRO A CB    1 
ATOM   573   C  CG    . PRO A  1 103 ? -10.691 3.479    87.250  1.00 66.74  ? 103 PRO A CG    1 
ATOM   574   C  CD    . PRO A  1 103 ? -9.407  2.769    86.954  1.00 66.32  ? 103 PRO A CD    1 
ATOM   575   N  N     . GLY A  1 104 ? -8.355  5.971    87.068  1.00 64.88  ? 104 GLY A N     1 
ATOM   576   C  CA    . GLY A  1 104 ? -7.718  7.176    87.600  1.00 64.70  ? 104 GLY A CA    1 
ATOM   577   C  C     . GLY A  1 104 ? -6.996  7.992    86.542  1.00 62.88  ? 104 GLY A C     1 
ATOM   578   O  O     . GLY A  1 104 ? -6.861  9.208    86.689  1.00 62.84  ? 104 GLY A O     1 
ATOM   579   N  N     . LEU A  1 105 ? -6.551  7.317    85.475  1.00 61.31  ? 105 LEU A N     1 
ATOM   580   C  CA    . LEU A  1 105 ? -5.851  7.948    84.352  1.00 59.85  ? 105 LEU A CA    1 
ATOM   581   C  C     . LEU A  1 105 ? -6.780  8.737    83.425  1.00 58.97  ? 105 LEU A C     1 
ATOM   582   O  O     . LEU A  1 105 ? -6.329  9.614    82.679  1.00 58.08  ? 105 LEU A O     1 
ATOM   583   C  CB    . LEU A  1 105 ? -5.087  6.905    83.534  1.00 59.08  ? 105 LEU A CB    1 
ATOM   584   C  CG    . LEU A  1 105 ? -3.642  6.525    83.900  1.00 59.66  ? 105 LEU A CG    1 
ATOM   585   C  CD1   . LEU A  1 105 ? -3.569  5.359    84.885  1.00 61.06  ? 105 LEU A CD1   1 
ATOM   586   C  CD2   . LEU A  1 105 ? -2.892  6.162    82.635  1.00 57.95  ? 105 LEU A CD2   1 
ATOM   587   N  N     . LEU A  1 106 ? -8.073  8.415    83.467  1.00 59.19  ? 106 LEU A N     1 
ATOM   588   C  CA    . LEU A  1 106 ? -9.087  9.164    82.721  1.00 58.49  ? 106 LEU A CA    1 
ATOM   589   C  C     . LEU A  1 106 ? -8.949  10.664   82.965  1.00 59.04  ? 106 LEU A C     1 
ATOM   590   O  O     . LEU A  1 106 ? -8.843  11.118   84.117  1.00 60.15  ? 106 LEU A O     1 
ATOM   591   C  CB    . LEU A  1 106 ? -10.499 8.682    83.074  1.00 59.02  ? 106 LEU A CB    1 
ATOM   592   C  CG    . LEU A  1 106 ? -10.924 7.343    82.456  1.00 58.66  ? 106 LEU A CG    1 
ATOM   593   C  CD1   . LEU A  1 106 ? -12.062 6.667    83.203  1.00 60.25  ? 106 LEU A CD1   1 
ATOM   594   C  CD2   . LEU A  1 106 ? -11.305 7.518    81.004  1.00 58.36  ? 106 LEU A CD2   1 
ATOM   595   N  N     . GLY A  1 107 ? -8.917  11.417   81.868  1.00 58.31  ? 107 GLY A N     1 
ATOM   596   C  CA    . GLY A  1 107 ? -8.807  12.878   81.915  1.00 58.88  ? 107 GLY A CA    1 
ATOM   597   C  C     . GLY A  1 107 ? -7.388  13.420   81.995  1.00 58.80  ? 107 GLY A C     1 
ATOM   598   O  O     . GLY A  1 107 ? -7.196  14.638   82.026  1.00 59.04  ? 107 GLY A O     1 
ATOM   599   N  N     . ARG A  1 108 ? -6.403  12.513   82.020  1.00 58.55  ? 108 ARG A N     1 
ATOM   600   C  CA    . ARG A  1 108 ? -4.974  12.869   82.132  1.00 58.67  ? 108 ARG A CA    1 
ATOM   601   C  C     . ARG A  1 108 ? -4.182  12.760   80.815  1.00 57.58  ? 108 ARG A C     1 
ATOM   602   O  O     . ARG A  1 108 ? -4.528  11.981   79.903  1.00 56.56  ? 108 ARG A O     1 
ATOM   603   C  CB    . ARG A  1 108 ? -4.291  12.021   83.208  1.00 59.02  ? 108 ARG A CB    1 
ATOM   604   C  CG    . ARG A  1 108 ? -5.093  11.865   84.482  1.00 61.43  ? 108 ARG A CG    1 
ATOM   605   C  CD    . ARG A  1 108 ? -5.379  13.217   85.156  1.00 64.05  ? 108 ARG A CD    1 
ATOM   606   N  NE    . ARG A  1 108 ? -4.163  14.015   85.284  1.00 65.11  ? 108 ARG A NE    1 
ATOM   607   C  CZ    . ARG A  1 108 ? -3.266  13.875   86.259  1.00 66.73  ? 108 ARG A CZ    1 
ATOM   608   N  NH1   . ARG A  1 108 ? -3.443  12.969   87.215  1.00 67.47  ? 108 ARG A NH1   1 
ATOM   609   N  NH2   . ARG A  1 108 ? -2.181  14.642   86.278  1.00 66.76  ? 108 ARG A NH2   1 
ATOM   610   N  N     . VAL A  1 109 ? -3.117  13.555   80.731  1.00 57.76  ? 109 VAL A N     1 
ATOM   611   C  CA    . VAL A  1 109 ? -2.167  13.486   79.629  1.00 56.83  ? 109 VAL A CA    1 
ATOM   612   C  C     . VAL A  1 109 ? -0.825  13.055   80.198  1.00 57.29  ? 109 VAL A C     1 
ATOM   613   O  O     . VAL A  1 109 ? -0.211  13.788   80.968  1.00 58.58  ? 109 VAL A O     1 
ATOM   614   C  CB    . VAL A  1 109 ? -2.010  14.850   78.940  1.00 56.89  ? 109 VAL A CB    1 
ATOM   615   C  CG1   . VAL A  1 109 ? -0.981  14.769   77.802  1.00 55.86  ? 109 VAL A CG1   1 
ATOM   616   C  CG2   . VAL A  1 109 ? -3.355  15.343   78.432  1.00 56.88  ? 109 VAL A CG2   1 
ATOM   617   N  N     . VAL A  1 110 ? -0.370  11.866   79.827  1.00 56.67  ? 110 VAL A N     1 
ATOM   618   C  CA    . VAL A  1 110 ? 0.839   11.303   80.422  1.00 57.30  ? 110 VAL A CA    1 
ATOM   619   C  C     . VAL A  1 110 ? 1.923   11.076   79.391  1.00 56.71  ? 110 VAL A C     1 
ATOM   620   O  O     . VAL A  1 110 ? 1.631   10.969   78.200  1.00 55.65  ? 110 VAL A O     1 
ATOM   621   C  CB    . VAL A  1 110 ? 0.552   9.963    81.122  1.00 57.68  ? 110 VAL A CB    1 
ATOM   622   C  CG1   . VAL A  1 110 ? -0.138  10.196   82.446  1.00 58.66  ? 110 VAL A CG1   1 
ATOM   623   C  CG2   . VAL A  1 110 ? -0.283  9.048    80.218  1.00 57.05  ? 110 VAL A CG2   1 
ATOM   624   N  N     . ASP A  1 111 ? 3.171   10.990   79.846  1.00 57.60  ? 111 ASP A N     1 
ATOM   625   C  CA    . ASP A  1 111 ? 4.257   10.601   78.952  1.00 57.42  ? 111 ASP A CA    1 
ATOM   626   C  C     . ASP A  1 111 ? 4.327   9.079    78.770  1.00 57.45  ? 111 ASP A C     1 
ATOM   627   O  O     . ASP A  1 111 ? 3.513   8.346    79.335  1.00 57.66  ? 111 ASP A O     1 
ATOM   628   C  CB    . ASP A  1 111 ? 5.592   11.202   79.389  1.00 58.22  ? 111 ASP A CB    1 
ATOM   629   C  CG    . ASP A  1 111 ? 6.211   10.492   80.581  1.00 59.71  ? 111 ASP A CG    1 
ATOM   630   O  OD1   . ASP A  1 111 ? 5.729   9.415    80.997  1.00 59.05  ? 111 ASP A OD1   1 
ATOM   631   O  OD2   . ASP A  1 111 ? 7.213   11.030   81.101  1.00 61.73  ? 111 ASP A OD2   1 
ATOM   632   N  N     . ALA A  1 112 ? 5.300   8.621    77.983  1.00 57.63  ? 112 ALA A N     1 
ATOM   633   C  CA    . ALA A  1 112 ? 5.422   7.211    77.598  1.00 57.93  ? 112 ALA A CA    1 
ATOM   634   C  C     . ALA A  1 112 ? 5.360   6.235    78.766  1.00 59.54  ? 112 ALA A C     1 
ATOM   635   O  O     . ALA A  1 112 ? 4.792   5.156    78.634  1.00 59.86  ? 112 ALA A O     1 
ATOM   636   C  CB    . ALA A  1 112 ? 6.689   6.987    76.812  1.00 57.87  ? 112 ALA A CB    1 
ATOM   637   N  N     . LEU A  1 113 ? 5.940   6.612    79.903  1.00 60.99  ? 113 LEU A N     1 
ATOM   638   C  CA    . LEU A  1 113 ? 5.988   5.730    81.064  1.00 62.40  ? 113 LEU A CA    1 
ATOM   639   C  C     . LEU A  1 113 ? 4.876   6.004    82.092  1.00 63.03  ? 113 LEU A C     1 
ATOM   640   O  O     . LEU A  1 113 ? 4.829   5.353    83.145  1.00 64.86  ? 113 LEU A O     1 
ATOM   641   C  CB    . LEU A  1 113 ? 7.371   5.803    81.720  1.00 63.82  ? 113 LEU A CB    1 
ATOM   642   C  CG    . LEU A  1 113 ? 8.576   5.464    80.825  1.00 64.17  ? 113 LEU A CG    1 
ATOM   643   C  CD1   . LEU A  1 113 ? 9.904   5.964    81.404  1.00 65.68  ? 113 LEU A CD1   1 
ATOM   644   C  CD2   . LEU A  1 113 ? 8.657   3.977    80.549  1.00 65.32  ? 113 LEU A CD2   1 
ATOM   645   N  N     . GLY A  1 114 ? 3.991   6.960    81.793  1.00 61.83  ? 114 GLY A N     1 
ATOM   646   C  CA    . GLY A  1 114 ? 2.890   7.314    82.695  1.00 61.74  ? 114 GLY A CA    1 
ATOM   647   C  C     . GLY A  1 114 ? 3.173   8.440    83.683  1.00 62.66  ? 114 GLY A C     1 
ATOM   648   O  O     . GLY A  1 114 ? 2.490   8.565    84.695  1.00 63.81  ? 114 GLY A O     1 
ATOM   649   N  N     . ASN A  1 115 ? 4.183   9.258    83.414  1.00 62.35  ? 115 ASN A N     1 
ATOM   650   C  CA    . ASN A  1 115 ? 4.401   10.455   84.215  1.00 63.17  ? 115 ASN A CA    1 
ATOM   651   C  C     . ASN A  1 115 ? 3.426   11.539   83.767  1.00 62.05  ? 115 ASN A C     1 
ATOM   652   O  O     . ASN A  1 115 ? 3.256   11.754   82.562  1.00 61.27  ? 115 ASN A O     1 
ATOM   653   C  CB    . ASN A  1 115 ? 5.845   10.945   84.079  1.00 63.87  ? 115 ASN A CB    1 
ATOM   654   C  CG    . ASN A  1 115 ? 6.847   9.987    84.699  1.00 65.98  ? 115 ASN A CG    1 
ATOM   655   O  OD1   . ASN A  1 115 ? 6.818   9.736    85.907  1.00 68.85  ? 115 ASN A OD1   1 
ATOM   656   N  ND2   . ASN A  1 115 ? 7.742   9.448    83.876  1.00 66.06  ? 115 ASN A ND2   1 
ATOM   657   N  N     . PRO A  1 116 ? 2.768   12.220   84.717  1.00 62.32  ? 116 PRO A N     1 
ATOM   658   C  CA    . PRO A  1 116 ? 1.804   13.213   84.278  1.00 61.55  ? 116 PRO A CA    1 
ATOM   659   C  C     . PRO A  1 116 ? 2.527   14.433   83.746  1.00 61.50  ? 116 PRO A C     1 
ATOM   660   O  O     . PRO A  1 116 ? 3.362   14.993   84.435  1.00 63.10  ? 116 PRO A O     1 
ATOM   661   C  CB    . PRO A  1 116 ? 1.036   13.538   85.551  1.00 62.90  ? 116 PRO A CB    1 
ATOM   662   C  CG    . PRO A  1 116 ? 1.965   13.208   86.659  1.00 64.37  ? 116 PRO A CG    1 
ATOM   663   C  CD    . PRO A  1 116 ? 2.923   12.187   86.178  1.00 64.05  ? 116 PRO A CD    1 
ATOM   664   N  N     . ILE A  1 117 ? 2.243   14.817   82.512  1.00 60.23  ? 117 ILE A N     1 
ATOM   665   C  CA    . ILE A  1 117 ? 2.913   15.968   81.919  1.00 60.38  ? 117 ILE A CA    1 
ATOM   666   C  C     . ILE A  1 117 ? 1.944   17.127   81.817  1.00 60.73  ? 117 ILE A C     1 
ATOM   667   O  O     . ILE A  1 117 ? 2.280   18.179   81.272  1.00 61.03  ? 117 ILE A O     1 
ATOM   668   C  CB    . ILE A  1 117 ? 3.490   15.646   80.524  1.00 59.08  ? 117 ILE A CB    1 
ATOM   669   C  CG1   . ILE A  1 117 ? 2.363   15.478   79.490  1.00 57.79  ? 117 ILE A CG1   1 
ATOM   670   C  CG2   . ILE A  1 117 ? 4.399   14.425   80.609  1.00 59.15  ? 117 ILE A CG2   1 
ATOM   671   C  CD1   . ILE A  1 117 ? 2.812   14.970   78.130  1.00 57.87  ? 117 ILE A CD1   1 
ATOM   672   N  N     . ASP A  1 118 ? 0.748   16.925   82.365  1.00 60.92  ? 118 ASP A N     1 
ATOM   673   C  CA    . ASP A  1 118 ? -0.367  17.834   82.147  1.00 61.39  ? 118 ASP A CA    1 
ATOM   674   C  C     . ASP A  1 118 ? -0.612  18.848   83.261  1.00 63.25  ? 118 ASP A C     1 
ATOM   675   O  O     . ASP A  1 118 ? -1.594  19.579   83.214  1.00 63.60  ? 118 ASP A O     1 
ATOM   676   C  CB    . ASP A  1 118 ? -1.642  17.035   81.868  1.00 60.64  ? 118 ASP A CB    1 
ATOM   677   C  CG    . ASP A  1 118 ? -2.119  16.238   83.069  1.00 61.98  ? 118 ASP A CG    1 
ATOM   678   O  OD1   . ASP A  1 118 ? -1.458  16.268   84.132  1.00 62.81  ? 118 ASP A OD1   1 
ATOM   679   O  OD2   . ASP A  1 118 ? -3.174  15.571   82.941  1.00 62.78  ? 118 ASP A OD2   1 
ATOM   680   N  N     . GLY A  1 119 ? 0.276   18.878   84.255  1.00 64.79  ? 119 GLY A N     1 
ATOM   681   C  CA    . GLY A  1 119 ? 0.208   19.827   85.366  1.00 66.95  ? 119 GLY A CA    1 
ATOM   682   C  C     . GLY A  1 119 ? -1.015  19.703   86.254  1.00 68.09  ? 119 GLY A C     1 
ATOM   683   O  O     . GLY A  1 119 ? -1.564  20.714   86.709  1.00 69.51  ? 119 GLY A O     1 
ATOM   684   N  N     . LYS A  1 120 ? -1.446  18.467   86.495  1.00 67.81  ? 120 LYS A N     1 
ATOM   685   C  CA    . LYS A  1 120 ? -2.584  18.189   87.378  1.00 69.09  ? 120 LYS A CA    1 
ATOM   686   C  C     . LYS A  1 120 ? -2.220  17.231   88.511  1.00 70.12  ? 120 LYS A C     1 
ATOM   687   O  O     . LYS A  1 120 ? -3.049  16.414   88.935  1.00 70.40  ? 120 LYS A O     1 
ATOM   688   C  CB    . LYS A  1 120 ? -3.758  17.613   86.594  1.00 67.69  ? 120 LYS A CB    1 
ATOM   689   C  CG    . LYS A  1 120 ? -4.646  18.632   85.933  1.00 68.81  ? 120 LYS A CG    1 
ATOM   690   C  CD    . LYS A  1 120 ? -5.674  17.922   85.068  1.00 69.59  ? 120 LYS A CD    1 
ATOM   691   C  CE    . LYS A  1 120 ? -6.589  18.884   84.342  1.00 70.48  ? 120 LYS A CE    1 
ATOM   692   N  NZ    . LYS A  1 120 ? -7.853  18.177   84.009  1.00 71.49  ? 120 LYS A NZ    1 
ATOM   693   N  N     . GLY A  1 121 ? -0.983  17.328   88.997  1.00 70.85  ? 121 GLY A N     1 
ATOM   694   C  CA    . GLY A  1 121 ? -0.511  16.462   90.074  1.00 71.91  ? 121 GLY A CA    1 
ATOM   695   C  C     . GLY A  1 121 ? -0.289  15.030   89.621  1.00 70.62  ? 121 GLY A C     1 
ATOM   696   O  O     . GLY A  1 121 ? -0.394  14.750   88.427  1.00 68.96  ? 121 GLY A O     1 
ATOM   697   N  N     . PRO A  1 122 ? -0.010  14.109   90.576  1.00 71.74  ? 122 PRO A N     1 
ATOM   698   C  CA    . PRO A  1 122 ? 0.355   12.709   90.285  1.00 70.98  ? 122 PRO A CA    1 
ATOM   699   C  C     . PRO A  1 122 ? -0.787  11.901   89.661  1.00 69.50  ? 122 PRO A C     1 
ATOM   700   O  O     . PRO A  1 122 ? -1.913  12.391   89.584  1.00 69.52  ? 122 PRO A O     1 
ATOM   701   C  CB    . PRO A  1 122 ? 0.696   12.133   91.670  1.00 73.10  ? 122 PRO A CB    1 
ATOM   702   C  CG    . PRO A  1 122 ? 0.693   13.289   92.621  1.00 74.49  ? 122 PRO A CG    1 
ATOM   703   C  CD    . PRO A  1 122 ? -0.169  14.331   92.024  1.00 73.96  ? 122 PRO A CD    1 
ATOM   704   N  N     . ILE A  1 123 ? -0.483  10.679   89.224  1.00 68.42  ? 123 ILE A N     1 
ATOM   705   C  CA    . ILE A  1 123 ? -1.473  9.752    88.652  1.00 66.88  ? 123 ILE A CA    1 
ATOM   706   C  C     . ILE A  1 123 ? -1.975  8.805    89.740  1.00 68.06  ? 123 ILE A C     1 
ATOM   707   O  O     . ILE A  1 123 ? -1.190  8.366    90.564  1.00 69.67  ? 123 ILE A O     1 
ATOM   708   C  CB    . ILE A  1 123 ? -0.848  8.923    87.480  1.00 65.39  ? 123 ILE A CB    1 
ATOM   709   C  CG1   . ILE A  1 123 ? -0.565  9.809    86.257  1.00 63.12  ? 123 ILE A CG1   1 
ATOM   710   C  CG2   . ILE A  1 123 ? -1.719  7.722    87.103  1.00 64.80  ? 123 ILE A CG2   1 
ATOM   711   C  CD1   . ILE A  1 123 ? -1.778  10.471   85.669  1.00 62.02  ? 123 ILE A CD1   1 
ATOM   712   N  N     . ASP A  1 124 ? -3.272  8.504    89.755  1.00 67.64  ? 124 ASP A N     1 
ATOM   713   C  CA    . ASP A  1 124 ? -3.828  7.536    90.708  1.00 68.96  ? 124 ASP A CA    1 
ATOM   714   C  C     . ASP A  1 124 ? -4.010  6.177    90.047  1.00 68.12  ? 124 ASP A C     1 
ATOM   715   O  O     . ASP A  1 124 ? -4.968  5.957    89.300  1.00 67.40  ? 124 ASP A O     1 
ATOM   716   C  CB    . ASP A  1 124 ? -5.153  8.029    91.293  1.00 69.73  ? 124 ASP A CB    1 
ATOM   717   C  CG    . ASP A  1 124 ? -4.961  9.043    92.406  1.00 72.06  ? 124 ASP A CG    1 
ATOM   718   O  OD1   . ASP A  1 124 ? -3.804  9.416    92.696  1.00 73.64  ? 124 ASP A OD1   1 
ATOM   719   O  OD2   . ASP A  1 124 ? -5.970  9.471    93.004  1.00 73.75  ? 124 ASP A OD2   1 
ATOM   720   N  N     . ALA A  1 125 ? -3.082  5.266    90.315  1.00 68.46  ? 125 ALA A N     1 
ATOM   721   C  CA    . ALA A  1 125 ? -3.080  3.973    89.646  1.00 67.38  ? 125 ALA A CA    1 
ATOM   722   C  C     . ALA A  1 125 ? -3.862  2.939    90.432  1.00 68.73  ? 125 ALA A C     1 
ATOM   723   O  O     . ALA A  1 125 ? -3.917  2.990    91.652  1.00 70.51  ? 125 ALA A O     1 
ATOM   724   C  CB    . ALA A  1 125 ? -1.664  3.503    89.411  1.00 67.30  ? 125 ALA A CB    1 
ATOM   725   N  N     . ALA A  1 126 ? -4.481  2.013    89.713  1.00 68.17  ? 126 ALA A N     1 
ATOM   726   C  CA    . ALA A  1 126 ? -5.134  0.860    90.317  1.00 69.78  ? 126 ALA A CA    1 
ATOM   727   C  C     . ALA A  1 126 ? -4.145  -0.298   90.426  1.00 70.77  ? 126 ALA A C     1 
ATOM   728   O  O     . ALA A  1 126 ? -4.363  -1.238   91.185  1.00 72.76  ? 126 ALA A O     1 
ATOM   729   C  CB    . ALA A  1 126 ? -6.358  0.452    89.503  1.00 68.77  ? 126 ALA A CB    1 
ATOM   730   N  N     . GLY A  1 127 ? -3.059  -0.209   89.666  1.00 69.63  ? 127 GLY A N     1 
ATOM   731   C  CA    . GLY A  1 127 ? -1.994  -1.200   89.666  1.00 70.75  ? 127 GLY A CA    1 
ATOM   732   C  C     . GLY A  1 127 ? -0.995  -0.796   88.604  1.00 69.45  ? 127 GLY A C     1 
ATOM   733   O  O     . GLY A  1 127 ? -1.043  0.329    88.108  1.00 68.05  ? 127 GLY A O     1 
ATOM   734   N  N     . ARG A  1 128 ? -0.094  -1.709   88.243  1.00 70.24  ? 128 ARG A N     1 
ATOM   735   C  CA    . ARG A  1 128 ? 0.913   -1.444   87.206  1.00 69.19  ? 128 ARG A CA    1 
ATOM   736   C  C     . ARG A  1 128 ? 1.042   -2.620   86.231  1.00 69.13  ? 128 ARG A C     1 
ATOM   737   O  O     . ARG A  1 128 ? 0.882   -3.771   86.629  1.00 70.97  ? 128 ARG A O     1 
ATOM   738   C  CB    . ARG A  1 128 ? 2.262   -1.113   87.853  1.00 70.30  ? 128 ARG A CB    1 
ATOM   739   C  CG    . ARG A  1 128 ? 2.202   0.096    88.775  1.00 70.93  ? 128 ARG A CG    1 
ATOM   740   C  CD    . ARG A  1 128 ? 3.533   0.456    89.393  1.00 72.54  ? 128 ARG A CD    1 
ATOM   741   N  NE    . ARG A  1 128 ? 4.417   1.152    88.458  1.00 71.77  ? 128 ARG A NE    1 
ATOM   742   C  CZ    . ARG A  1 128 ? 4.347   2.449    88.162  1.00 71.54  ? 128 ARG A CZ    1 
ATOM   743   N  NH1   . ARG A  1 128 ? 3.420   3.235    88.706  1.00 71.79  ? 128 ARG A NH1   1 
ATOM   744   N  NH2   . ARG A  1 128 ? 5.209   2.967    87.302  1.00 71.55  ? 128 ARG A NH2   1 
ATOM   745   N  N     . SER A  1 129 ? 1.320   -2.330   84.962  1.00 67.62  ? 129 SER A N     1 
ATOM   746   C  CA    . SER A  1 129 ? 1.411   -3.371   83.925  1.00 67.70  ? 129 SER A CA    1 
ATOM   747   C  C     . SER A  1 129 ? 2.638   -3.198   83.040  1.00 66.99  ? 129 SER A C     1 
ATOM   748   O  O     . SER A  1 129 ? 2.988   -2.074   82.680  1.00 66.17  ? 129 SER A O     1 
ATOM   749   C  CB    . SER A  1 129 ? 0.162   -3.352   83.039  1.00 66.26  ? 129 SER A CB    1 
ATOM   750   O  OG    . SER A  1 129 ? -1.017  -3.397   83.822  1.00 67.88  ? 129 SER A OG    1 
ATOM   751   N  N     . ARG A  1 130 ? 3.274   -4.307   82.668  1.00 67.66  ? 130 ARG A N     1 
ATOM   752   C  CA    . ARG A  1 130 ? 4.398   -4.270   81.728  1.00 66.87  ? 130 ARG A CA    1 
ATOM   753   C  C     . ARG A  1 130 ? 4.003   -3.662   80.399  1.00 64.53  ? 130 ARG A C     1 
ATOM   754   O  O     . ARG A  1 130 ? 2.881   -3.842   79.933  1.00 63.69  ? 130 ARG A O     1 
ATOM   755   C  CB    . ARG A  1 130 ? 4.924   -5.675   81.471  1.00 68.37  ? 130 ARG A CB    1 
ATOM   756   C  CG    . ARG A  1 130 ? 5.793   -6.202   82.561  1.00 70.86  ? 130 ARG A CG    1 
ATOM   757   C  CD    . ARG A  1 130 ? 5.338   -7.578   82.946  1.00 73.76  ? 130 ARG A CD    1 
ATOM   758   N  NE    . ARG A  1 130 ? 6.187   -8.127   83.992  1.00 76.67  ? 130 ARG A NE    1 
ATOM   759   C  CZ    . ARG A  1 130 ? 7.172   -8.986   83.768  1.00 79.04  ? 130 ARG A CZ    1 
ATOM   760   N  NH1   . ARG A  1 130 ? 7.425   -9.411   82.529  1.00 77.92  ? 130 ARG A NH1   1 
ATOM   761   N  NH2   . ARG A  1 130 ? 7.898   -9.424   84.789  1.00 82.52  ? 130 ARG A NH2   1 
ATOM   762   N  N     . ALA A  1 131 ? 4.932   -2.946   79.783  1.00 63.76  ? 131 ALA A N     1 
ATOM   763   C  CA    . ALA A  1 131 ? 4.713   -2.441   78.437  1.00 62.20  ? 131 ALA A CA    1 
ATOM   764   C  C     . ALA A  1 131 ? 4.586   -3.607   77.458  1.00 62.39  ? 131 ALA A C     1 
ATOM   765   O  O     . ALA A  1 131 ? 3.837   -3.525   76.485  1.00 61.33  ? 131 ALA A O     1 
ATOM   766   C  CB    . ALA A  1 131 ? 5.829   -1.513   78.027  1.00 61.61  ? 131 ALA A CB    1 
ATOM   767   N  N     . GLN A  1 132 ? 5.303   -4.696   77.733  1.00 64.08  ? 132 GLN A N     1 
ATOM   768   C  CA    . GLN A  1 132 ? 5.211   -5.901   76.916  1.00 64.50  ? 132 GLN A CA    1 
ATOM   769   C  C     . GLN A  1 132 ? 4.322   -6.945   77.575  1.00 65.34  ? 132 GLN A C     1 
ATOM   770   O  O     . GLN A  1 132 ? 4.639   -7.466   78.653  1.00 67.08  ? 132 GLN A O     1 
ATOM   771   C  CB    . GLN A  1 132 ? 6.600   -6.468   76.596  1.00 65.88  ? 132 GLN A CB    1 
ATOM   772   C  CG    . GLN A  1 132 ? 7.500   -5.536   75.769  1.00 66.37  ? 132 GLN A CG    1 
ATOM   773   C  CD    . GLN A  1 132 ? 6.847   -5.020   74.476  1.00 67.06  ? 132 GLN A CD    1 
ATOM   774   O  OE1   . GLN A  1 132 ? 6.049   -5.716   73.833  1.00 68.02  ? 132 GLN A OE1   1 
ATOM   775   N  NE2   . GLN A  1 132 ? 7.198   -3.792   74.089  1.00 66.27  ? 132 GLN A NE2   1 
ATOM   776   N  N     . VAL A  1 133 ? 3.214   -7.239   76.895  1.00 64.16  ? 133 VAL A N     1 
ATOM   777   C  CA    . VAL A  1 133 ? 2.137   -8.090   77.401  1.00 64.61  ? 133 VAL A CA    1 
ATOM   778   C  C     . VAL A  1 133 ? 1.652   -9.053   76.318  1.00 64.63  ? 133 VAL A C     1 
ATOM   779   O  O     . VAL A  1 133 ? 1.415   -8.632   75.188  1.00 63.27  ? 133 VAL A O     1 
ATOM   780   C  CB    . VAL A  1 133 ? 0.963   -7.214   77.861  1.00 63.39  ? 133 VAL A CB    1 
ATOM   781   C  CG1   . VAL A  1 133 ? -0.328  -8.001   77.940  1.00 63.76  ? 133 VAL A CG1   1 
ATOM   782   C  CG2   . VAL A  1 133 ? 1.284   -6.558   79.183  1.00 63.84  ? 133 VAL A CG2   1 
ATOM   783   N  N     . LYS A  1 134 ? 1.511   -10.333  76.670  1.00 66.55  ? 134 LYS A N     1 
ATOM   784   C  CA    . LYS A  1 134 ? 0.963   -11.368  75.775  1.00 67.12  ? 134 LYS A CA    1 
ATOM   785   C  C     . LYS A  1 134 ? -0.395  -10.985  75.229  1.00 65.85  ? 134 LYS A C     1 
ATOM   786   O  O     . LYS A  1 134 ? -1.271  -10.571  75.982  1.00 65.87  ? 134 LYS A O     1 
ATOM   787   C  CB    . LYS A  1 134 ? 0.781   -12.689  76.521  1.00 69.68  ? 134 LYS A CB    1 
ATOM   788   C  CG    . LYS A  1 134 ? 2.048   -13.361  76.942  1.00 71.97  ? 134 LYS A CG    1 
ATOM   789   C  CD    . LYS A  1 134 ? 2.569   -14.284  75.867  1.00 74.01  ? 134 LYS A CD    1 
ATOM   790   C  CE    . LYS A  1 134 ? 3.963   -14.752  76.228  1.00 76.70  ? 134 LYS A CE    1 
ATOM   791   N  NZ    . LYS A  1 134 ? 4.050   -15.273  77.628  1.00 79.32  ? 134 LYS A NZ    1 
ATOM   792   N  N     . ALA A  1 135 ? -0.571  -11.133  73.922  1.00 65.23  ? 135 ALA A N     1 
ATOM   793   C  CA    . ALA A  1 135 ? -1.871  -10.926  73.296  1.00 64.46  ? 135 ALA A CA    1 
ATOM   794   C  C     . ALA A  1 135 ? -2.808  -12.050  73.710  1.00 66.22  ? 135 ALA A C     1 
ATOM   795   O  O     . ALA A  1 135 ? -2.353  -13.162  73.950  1.00 67.97  ? 135 ALA A O     1 
ATOM   796   C  CB    . ALA A  1 135 ? -1.730  -10.893  71.794  1.00 63.65  ? 135 ALA A CB    1 
ATOM   797   N  N     . PRO A  1 136 ? -4.117  -11.765  73.806  1.00 66.05  ? 136 PRO A N     1 
ATOM   798   C  CA    . PRO A  1 136 ? -5.088  -12.814  74.108  1.00 68.19  ? 136 PRO A CA    1 
ATOM   799   C  C     . PRO A  1 136 ? -4.936  -13.974  73.139  1.00 69.76  ? 136 PRO A C     1 
ATOM   800   O  O     . PRO A  1 136 ? -4.666  -13.760  71.954  1.00 69.09  ? 136 PRO A O     1 
ATOM   801   C  CB    . PRO A  1 136 ? -6.426  -12.129  73.877  1.00 67.18  ? 136 PRO A CB    1 
ATOM   802   C  CG    . PRO A  1 136 ? -6.141  -10.696  74.142  1.00 65.57  ? 136 PRO A CG    1 
ATOM   803   C  CD    . PRO A  1 136 ? -4.754  -10.446  73.672  1.00 64.30  ? 136 PRO A CD    1 
ATOM   804   N  N     . GLY A  1 137 ? -5.090  -15.194  73.637  1.00 72.23  ? 137 GLY A N     1 
ATOM   805   C  CA    . GLY A  1 137 ? -4.901  -16.369  72.797  1.00 73.93  ? 137 GLY A CA    1 
ATOM   806   C  C     . GLY A  1 137 ? -6.072  -16.629  71.866  1.00 74.12  ? 137 GLY A C     1 
ATOM   807   O  O     . GLY A  1 137 ? -6.945  -15.773  71.680  1.00 72.71  ? 137 GLY A O     1 
ATOM   808   N  N     . ILE A  1 138 ? -6.089  -17.835  71.303  1.00 76.12  ? 138 ILE A N     1 
ATOM   809   C  CA    . ILE A  1 138 ? -7.135  -18.275  70.382  1.00 76.56  ? 138 ILE A CA    1 
ATOM   810   C  C     . ILE A  1 138 ? -8.458  -18.489  71.103  1.00 77.31  ? 138 ILE A C     1 
ATOM   811   O  O     . ILE A  1 138 ? -9.520  -18.150  70.577  1.00 76.96  ? 138 ILE A O     1 
ATOM   812   C  CB    . ILE A  1 138 ? -6.727  -19.586  69.671  1.00 78.73  ? 138 ILE A CB    1 
ATOM   813   C  CG1   . ILE A  1 138 ? -5.264  -19.497  69.187  1.00 79.09  ? 138 ILE A CG1   1 
ATOM   814   C  CG2   . ILE A  1 138 ? -7.717  -19.945  68.546  1.00 78.68  ? 138 ILE A CG2   1 
ATOM   815   C  CD1   . ILE A  1 138 ? -5.149  -18.980  67.694  1.00 78.69  ? 138 ILE A CD1   1 
ATOM   816   N  N     . LEU A  1 139 ? -8.389  -19.044  72.308  1.00 78.51  ? 139 LEU A N     1 
ATOM   817   C  CA    . LEU A  1 139 ? -9.595  -19.356  73.066  1.00 79.32  ? 139 LEU A CA    1 
ATOM   818   C  C     . LEU A  1 139 ? -10.320 -18.159  73.714  1.00 77.54  ? 139 LEU A C     1 
ATOM   819   O  O     . LEU A  1 139 ? -11.523 -18.003  73.507  1.00 77.71  ? 139 LEU A O     1 
ATOM   820   C  CB    . LEU A  1 139 ? -9.326  -20.458  74.099  1.00 81.78  ? 139 LEU A CB    1 
ATOM   821   C  CG    . LEU A  1 139 ? -10.531 -20.888  74.927  1.00 82.34  ? 139 LEU A CG    1 
ATOM   822   C  CD1   . LEU A  1 139 ? -11.507 -21.678  74.078  1.00 82.79  ? 139 LEU A CD1   1 
ATOM   823   C  CD2   . LEU A  1 139 ? -10.056 -21.688  76.100  1.00 84.19  ? 139 LEU A CD2   1 
ATOM   824   N  N     . PRO A  1 140 ? -9.608  -17.316  74.489  1.00 76.03  ? 140 PRO A N     1 
ATOM   825   C  CA    . PRO A  1 140 ? -10.329 -16.364  75.340  1.00 75.29  ? 140 PRO A CA    1 
ATOM   826   C  C     . PRO A  1 140 ? -10.982 -15.189  74.594  1.00 73.25  ? 140 PRO A C     1 
ATOM   827   O  O     . PRO A  1 140 ? -10.932 -14.053  75.076  1.00 72.02  ? 140 PRO A O     1 
ATOM   828   C  CB    . PRO A  1 140 ? -9.236  -15.861  76.288  1.00 74.72  ? 140 PRO A CB    1 
ATOM   829   C  CG    . PRO A  1 140 ? -7.988  -15.988  75.516  1.00 73.78  ? 140 PRO A CG    1 
ATOM   830   C  CD    . PRO A  1 140 ? -8.148  -17.181  74.639  1.00 75.39  ? 140 PRO A CD    1 
ATOM   831   N  N     . ARG A  1 141 ? -11.612 -15.473  73.453  1.00 73.18  ? 141 ARG A N     1 
ATOM   832   C  CA    . ARG A  1 141 ? -12.090 -14.445  72.529  1.00 71.17  ? 141 ARG A CA    1 
ATOM   833   C  C     . ARG A  1 141 ? -13.435 -14.784  71.928  1.00 72.12  ? 141 ARG A C     1 
ATOM   834   O  O     . ARG A  1 141 ? -13.718 -15.936  71.613  1.00 73.99  ? 141 ARG A O     1 
ATOM   835   C  CB    . ARG A  1 141 ? -11.113 -14.260  71.370  1.00 69.85  ? 141 ARG A CB    1 
ATOM   836   C  CG    . ARG A  1 141 ? -9.811  -13.595  71.730  1.00 69.16  ? 141 ARG A CG    1 
ATOM   837   C  CD    . ARG A  1 141 ? -9.191  -12.922  70.530  1.00 67.59  ? 141 ARG A CD    1 
ATOM   838   N  NE    . ARG A  1 141 ? -7.740  -12.905  70.645  1.00 67.82  ? 141 ARG A NE    1 
ATOM   839   C  CZ    . ARG A  1 141 ? -6.941  -12.117  69.937  1.00 67.46  ? 141 ARG A CZ    1 
ATOM   840   N  NH1   . ARG A  1 141 ? -7.446  -11.254  69.061  1.00 67.49  ? 141 ARG A NH1   1 
ATOM   841   N  NH2   . ARG A  1 141 ? -5.631  -12.183  70.114  1.00 67.68  ? 141 ARG A NH2   1 
ATOM   842   N  N     . ARG A  1 142 ? -14.252 -13.757  71.740  1.00 71.13  ? 142 ARG A N     1 
ATOM   843   C  CA    . ARG A  1 142 ? -15.517 -13.896  71.047  1.00 71.74  ? 142 ARG A CA    1 
ATOM   844   C  C     . ARG A  1 142 ? -15.474 -13.114  69.725  1.00 70.09  ? 142 ARG A C     1 
ATOM   845   O  O     . ARG A  1 142 ? -14.832 -12.057  69.632  1.00 67.94  ? 142 ARG A O     1 
ATOM   846   C  CB    . ARG A  1 142 ? -16.656 -13.425  71.950  1.00 72.20  ? 142 ARG A CB    1 
ATOM   847   C  CG    . ARG A  1 142 ? -18.021 -13.942  71.554  1.00 74.55  ? 142 ARG A CG    1 
ATOM   848   C  CD    . ARG A  1 142 ? -18.769 -12.907  70.751  1.00 74.49  ? 142 ARG A CD    1 
ATOM   849   N  NE    . ARG A  1 142 ? -20.098 -13.340  70.333  1.00 77.68  ? 142 ARG A NE    1 
ATOM   850   C  CZ    . ARG A  1 142 ? -21.160 -13.434  71.136  1.00 80.58  ? 142 ARG A CZ    1 
ATOM   851   N  NH1   . ARG A  1 142 ? -21.077 -13.161  72.440  1.00 80.75  ? 142 ARG A NH1   1 
ATOM   852   N  NH2   . ARG A  1 142 ? -22.321 -13.820  70.629  1.00 83.24  ? 142 ARG A NH2   1 
ATOM   853   N  N     . SER A  1 143 ? -16.146 -13.649  68.706  1.00 70.90  ? 143 SER A N     1 
ATOM   854   C  CA    . SER A  1 143 ? -16.252 -12.989  67.413  1.00 69.90  ? 143 SER A CA    1 
ATOM   855   C  C     . SER A  1 143 ? -16.719 -11.555  67.576  1.00 68.70  ? 143 SER A C     1 
ATOM   856   O  O     . SER A  1 143 ? -17.588 -11.262  68.397  1.00 69.38  ? 143 SER A O     1 
ATOM   857   C  CB    . SER A  1 143 ? -17.224 -13.734  66.517  1.00 71.29  ? 143 SER A CB    1 
ATOM   858   O  OG    . SER A  1 143 ? -16.726 -15.018  66.212  1.00 73.17  ? 143 SER A OG    1 
ATOM   859   N  N     . VAL A  1 144 ? -16.135 -10.660  66.789  1.00 67.32  ? 144 VAL A N     1 
ATOM   860   C  CA    . VAL A  1 144 ? -16.493 -9.250   66.831  1.00 66.05  ? 144 VAL A CA    1 
ATOM   861   C  C     . VAL A  1 144 ? -17.935 -9.058   66.325  1.00 67.36  ? 144 VAL A C     1 
ATOM   862   O  O     . VAL A  1 144 ? -18.237 -9.399   65.178  1.00 68.04  ? 144 VAL A O     1 
ATOM   863   C  CB    . VAL A  1 144 ? -15.470 -8.418   66.022  1.00 64.28  ? 144 VAL A CB    1 
ATOM   864   C  CG1   . VAL A  1 144 ? -15.808 -6.938   66.046  1.00 62.90  ? 144 VAL A CG1   1 
ATOM   865   C  CG2   . VAL A  1 144 ? -14.075 -8.644   66.569  1.00 62.94  ? 144 VAL A CG2   1 
ATOM   866   N  N     . HIS A  1 145 ? -18.813 -8.542   67.192  1.00 67.93  ? 145 HIS A N     1 
ATOM   867   C  CA    . HIS A  1 145 ? -20.237 -8.381   66.855  1.00 69.50  ? 145 HIS A CA    1 
ATOM   868   C  C     . HIS A  1 145 ? -20.897 -7.049   67.265  1.00 69.39  ? 145 HIS A C     1 
ATOM   869   O  O     . HIS A  1 145 ? -21.888 -6.643   66.644  1.00 70.43  ? 145 HIS A O     1 
ATOM   870   C  CB    . HIS A  1 145 ? -21.067 -9.561   67.380  1.00 71.41  ? 145 HIS A CB    1 
ATOM   871   C  CG    . HIS A  1 145 ? -21.303 -9.535   68.862  1.00 71.78  ? 145 HIS A CG    1 
ATOM   872   N  ND1   . HIS A  1 145 ? -20.626 -10.360  69.735  1.00 72.16  ? 145 HIS A ND1   1 
ATOM   873   C  CD2   . HIS A  1 145 ? -22.145 -8.796   69.624  1.00 71.59  ? 145 HIS A CD2   1 
ATOM   874   C  CE1   . HIS A  1 145 ? -21.032 -10.123  70.971  1.00 72.17  ? 145 HIS A CE1   1 
ATOM   875   N  NE2   . HIS A  1 145 ? -21.950 -9.175   70.931  1.00 72.20  ? 145 HIS A NE2   1 
ATOM   876   N  N     . GLU A  1 146 ? -20.382 -6.391   68.309  1.00 68.60  ? 146 GLU A N     1 
ATOM   877   C  CA    . GLU A  1 146 ? -20.941 -5.107   68.769  1.00 68.30  ? 146 GLU A CA    1 
ATOM   878   C  C     . GLU A  1 146 ? -20.306 -3.932   68.018  1.00 66.66  ? 146 GLU A C     1 
ATOM   879   O  O     . GLU A  1 146 ? -19.086 -3.853   67.912  1.00 65.65  ? 146 GLU A O     1 
ATOM   880   C  CB    . GLU A  1 146 ? -20.714 -4.910   70.262  1.00 68.28  ? 146 GLU A CB    1 
ATOM   881   C  CG    . GLU A  1 146 ? -21.293 -5.966   71.164  1.00 71.07  ? 146 GLU A CG    1 
ATOM   882   C  CD    . GLU A  1 146 ? -20.302 -6.386   72.236  1.00 72.77  ? 146 GLU A CD    1 
ATOM   883   O  OE1   . GLU A  1 146 ? -19.223 -6.902   71.865  1.00 72.86  ? 146 GLU A OE1   1 
ATOM   884   O  OE2   . GLU A  1 146 ? -20.591 -6.205   73.442  1.00 74.56  ? 146 GLU A OE2   1 
ATOM   885   N  N     . PRO A  1 147 ? -21.129 -3.008   67.499  1.00 66.75  ? 147 PRO A N     1 
ATOM   886   C  CA    . PRO A  1 147 ? -20.604 -1.885   66.728  1.00 65.49  ? 147 PRO A CA    1 
ATOM   887   C  C     . PRO A  1 147 ? -19.894 -0.812   67.561  1.00 64.15  ? 147 PRO A C     1 
ATOM   888   O  O     . PRO A  1 147 ? -20.171 -0.637   68.755  1.00 64.27  ? 147 PRO A O     1 
ATOM   889   C  CB    . PRO A  1 147 ? -21.858 -1.292   66.070  1.00 66.73  ? 147 PRO A CB    1 
ATOM   890   C  CG    . PRO A  1 147 ? -22.889 -2.361   66.155  1.00 68.32  ? 147 PRO A CG    1 
ATOM   891   C  CD    . PRO A  1 147 ? -22.598 -3.055   67.440  1.00 68.51  ? 147 PRO A CD    1 
ATOM   892   N  N     . VAL A  1 148 ? -18.959 -0.129   66.906  1.00 62.73  ? 148 VAL A N     1 
ATOM   893   C  CA    . VAL A  1 148 ? -18.304 1.054    67.431  1.00 61.24  ? 148 VAL A CA    1 
ATOM   894   C  C     . VAL A  1 148 ? -18.736 2.154    66.492  1.00 61.39  ? 148 VAL A C     1 
ATOM   895   O  O     . VAL A  1 148 ? -18.095 2.377    65.470  1.00 61.09  ? 148 VAL A O     1 
ATOM   896   C  CB    . VAL A  1 148 ? -16.751 0.937    67.398  1.00 59.70  ? 148 VAL A CB    1 
ATOM   897   C  CG1   . VAL A  1 148 ? -16.096 2.242    67.838  1.00 58.17  ? 148 VAL A CG1   1 
ATOM   898   C  CG2   . VAL A  1 148 ? -16.273 -0.211   68.270  1.00 59.68  ? 148 VAL A CG2   1 
ATOM   899   N  N     . GLN A  1 149 ? -19.845 2.813    66.808  1.00 62.27  ? 149 GLN A N     1 
ATOM   900   C  CA    . GLN A  1 149 ? -20.320 3.931    65.989  1.00 62.51  ? 149 GLN A CA    1 
ATOM   901   C  C     . GLN A  1 149 ? -19.272 5.062    65.952  1.00 61.42  ? 149 GLN A C     1 
ATOM   902   O  O     . GLN A  1 149 ? -18.836 5.551    66.997  1.00 61.07  ? 149 GLN A O     1 
ATOM   903   C  CB    . GLN A  1 149 ? -21.684 4.424    66.498  1.00 63.73  ? 149 GLN A CB    1 
ATOM   904   C  CG    . GLN A  1 149 ? -22.851 3.465    66.171  1.00 64.63  ? 149 GLN A CG    1 
ATOM   905   C  CD    . GLN A  1 149 ? -24.005 3.528    67.175  1.00 64.19  ? 149 GLN A CD    1 
ATOM   906   O  OE1   . GLN A  1 149 ? -24.849 4.427    67.131  1.00 63.91  ? 149 GLN A OE1   1 
ATOM   907   N  NE2   . GLN A  1 149 ? -24.054 2.552    68.069  1.00 63.38  ? 149 GLN A NE2   1 
ATOM   908   N  N     . THR A  1 150 ? -18.832 5.438    64.751  1.00 60.94  ? 150 THR A N     1 
ATOM   909   C  CA    . THR A  1 150 ? -17.903 6.562    64.598  1.00 59.81  ? 150 THR A CA    1 
ATOM   910   C  C     . THR A  1 150 ? -18.684 7.850    64.511  1.00 60.48  ? 150 THR A C     1 
ATOM   911   O  O     . THR A  1 150 ? -18.209 8.902    64.918  1.00 60.12  ? 150 THR A O     1 
ATOM   912   C  CB    . THR A  1 150 ? -17.100 6.491    63.299  1.00 59.52  ? 150 THR A CB    1 
ATOM   913   O  OG1   . THR A  1 150 ? -18.011 6.470    62.189  1.00 61.44  ? 150 THR A OG1   1 
ATOM   914   C  CG2   . THR A  1 150 ? -16.175 5.271    63.274  1.00 58.37  ? 150 THR A CG2   1 
ATOM   915   N  N     . GLY A  1 151 ? -19.879 7.765    63.943  1.00 61.58  ? 151 GLY A N     1 
ATOM   916   C  CA    . GLY A  1 151 ? -20.712 8.938    63.765  1.00 62.85  ? 151 GLY A CA    1 
ATOM   917   C  C     . GLY A  1 151 ? -20.431 9.597    62.432  1.00 63.17  ? 151 GLY A C     1 
ATOM   918   O  O     . GLY A  1 151 ? -20.975 10.662   62.118  1.00 64.47  ? 151 GLY A O     1 
ATOM   919   N  N     . LEU A  1 152 ? -19.569 8.959    61.650  1.00 61.92  ? 152 LEU A N     1 
ATOM   920   C  CA    . LEU A  1 152 ? -19.282 9.409    60.306  1.00 61.86  ? 152 LEU A CA    1 
ATOM   921   C  C     . LEU A  1 152 ? -20.131 8.606    59.336  1.00 62.63  ? 152 LEU A C     1 
ATOM   922   O  O     . LEU A  1 152 ? -19.983 7.385    59.240  1.00 62.10  ? 152 LEU A O     1 
ATOM   923   C  CB    . LEU A  1 152 ? -17.802 9.210    59.994  1.00 60.54  ? 152 LEU A CB    1 
ATOM   924   C  CG    . LEU A  1 152 ? -16.796 9.855    60.941  1.00 59.60  ? 152 LEU A CG    1 
ATOM   925   C  CD1   . LEU A  1 152 ? -15.376 9.374    60.601  1.00 58.45  ? 152 LEU A CD1   1 
ATOM   926   C  CD2   . LEU A  1 152 ? -16.907 11.383   60.910  1.00 60.27  ? 152 LEU A CD2   1 
ATOM   927   N  N     . LYS A  1 153 ? -21.017 9.292    58.620  1.00 63.73  ? 153 LYS A N     1 
ATOM   928   C  CA    . LYS A  1 153 ? -21.895 8.632    57.666  1.00 64.98  ? 153 LYS A CA    1 
ATOM   929   C  C     . LYS A  1 153 ? -21.124 7.678    56.759  1.00 64.53  ? 153 LYS A C     1 
ATOM   930   O  O     . LYS A  1 153 ? -21.521 6.534    56.586  1.00 65.02  ? 153 LYS A O     1 
ATOM   931   C  CB    . LYS A  1 153 ? -22.651 9.651    56.817  1.00 66.85  ? 153 LYS A CB    1 
ATOM   932   C  CG    . LYS A  1 153 ? -23.713 10.444   57.550  1.00 66.95  ? 153 LYS A CG    1 
ATOM   933   C  CD    . LYS A  1 153 ? -24.177 11.628   56.704  1.00 67.22  ? 153 LYS A CD    1 
ATOM   934   C  CE    . LYS A  1 153 ? -23.125 12.718   56.648  1.00 66.07  ? 153 LYS A CE    1 
ATOM   935   N  NZ    . LYS A  1 153 ? -23.608 13.953   55.988  1.00 67.92  ? 153 LYS A NZ    1 
ATOM   936   N  N     . ALA A  1 154 ? -20.018 8.144    56.190  1.00 63.83  ? 154 ALA A N     1 
ATOM   937   C  CA    . ALA A  1 154 ? -19.224 7.302    55.304  1.00 63.57  ? 154 ALA A CA    1 
ATOM   938   C  C     . ALA A  1 154 ? -18.698 6.029    55.999  1.00 62.38  ? 154 ALA A C     1 
ATOM   939   O  O     . ALA A  1 154 ? -18.866 4.934    55.481  1.00 62.76  ? 154 ALA A O     1 
ATOM   940   C  CB    . ALA A  1 154 ? -18.090 8.108    54.667  1.00 62.88  ? 154 ALA A CB    1 
ATOM   941   N  N     . VAL A  1 155 ? -18.093 6.167    57.177  1.00 61.21  ? 155 VAL A N     1 
ATOM   942   C  CA    . VAL A  1 155 ? -17.506 5.013    57.864  1.00 60.40  ? 155 VAL A CA    1 
ATOM   943   C  C     . VAL A  1 155 ? -18.560 4.032    58.385  1.00 61.62  ? 155 VAL A C     1 
ATOM   944   O  O     . VAL A  1 155 ? -18.465 2.836    58.124  1.00 62.05  ? 155 VAL A O     1 
ATOM   945   C  CB    . VAL A  1 155 ? -16.558 5.427    59.008  1.00 58.68  ? 155 VAL A CB    1 
ATOM   946   C  CG1   . VAL A  1 155 ? -16.023 4.203    59.738  1.00 57.36  ? 155 VAL A CG1   1 
ATOM   947   C  CG2   . VAL A  1 155 ? -15.413 6.217    58.461  1.00 58.26  ? 155 VAL A CG2   1 
ATOM   948   N  N     . ASP A  1 156 ? -19.552 4.538    59.122  1.00 62.56  ? 156 ASP A N     1 
ATOM   949   C  CA    . ASP A  1 156 ? -20.638 3.708    59.657  1.00 63.58  ? 156 ASP A CA    1 
ATOM   950   C  C     . ASP A  1 156 ? -21.339 2.912    58.568  1.00 64.77  ? 156 ASP A C     1 
ATOM   951   O  O     . ASP A  1 156 ? -21.727 1.770    58.787  1.00 65.50  ? 156 ASP A O     1 
ATOM   952   C  CB    . ASP A  1 156 ? -21.673 4.570    60.379  1.00 64.64  ? 156 ASP A CB    1 
ATOM   953   C  CG    . ASP A  1 156 ? -21.425 4.668    61.886  1.00 65.21  ? 156 ASP A CG    1 
ATOM   954   O  OD1   . ASP A  1 156 ? -20.247 4.872    62.302  1.00 64.16  ? 156 ASP A OD1   1 
ATOM   955   O  OD2   . ASP A  1 156 ? -22.430 4.544    62.648  1.00 66.65  ? 156 ASP A OD2   1 
ATOM   956   N  N     . ALA A  1 157 ? -21.482 3.524    57.395  1.00 65.19  ? 157 ALA A N     1 
ATOM   957   C  CA    . ALA A  1 157 ? -22.207 2.935    56.274  1.00 66.15  ? 157 ALA A CA    1 
ATOM   958   C  C     . ALA A  1 157 ? -21.393 1.988    55.392  1.00 65.55  ? 157 ALA A C     1 
ATOM   959   O  O     . ALA A  1 157 ? -21.950 1.051    54.854  1.00 67.14  ? 157 ALA A O     1 
ATOM   960   C  CB    . ALA A  1 157 ? -22.832 4.020    55.427  1.00 67.47  ? 157 ALA A CB    1 
ATOM   961   N  N     . LEU A  1 158 ? -20.093 2.225    55.235  1.00 63.58  ? 158 LEU A N     1 
ATOM   962   C  CA    . LEU A  1 158 ? -19.296 1.487    54.247  1.00 62.93  ? 158 LEU A CA    1 
ATOM   963   C  C     . LEU A  1 158 ? -18.189 0.629    54.843  1.00 61.55  ? 158 LEU A C     1 
ATOM   964   O  O     . LEU A  1 158 ? -17.723 -0.319   54.220  1.00 61.86  ? 158 LEU A O     1 
ATOM   965   C  CB    . LEU A  1 158 ? -18.677 2.460    53.242  1.00 62.62  ? 158 LEU A CB    1 
ATOM   966   C  CG    . LEU A  1 158 ? -19.574 3.498    52.567  1.00 63.49  ? 158 LEU A CG    1 
ATOM   967   C  CD1   . LEU A  1 158 ? -18.741 4.483    51.747  1.00 62.03  ? 158 LEU A CD1   1 
ATOM   968   C  CD2   . LEU A  1 158 ? -20.637 2.827    51.711  1.00 64.58  ? 158 LEU A CD2   1 
ATOM   969   N  N     . VAL A  1 159 ? -17.744 0.993    56.038  1.00 60.52  ? 159 VAL A N     1 
ATOM   970   C  CA    . VAL A  1 159 ? -16.603 0.358    56.686  1.00 59.58  ? 159 VAL A CA    1 
ATOM   971   C  C     . VAL A  1 159 ? -16.890 0.290    58.180  1.00 59.34  ? 159 VAL A C     1 
ATOM   972   O  O     . VAL A  1 159 ? -16.234 0.977    58.962  1.00 58.11  ? 159 VAL A O     1 
ATOM   973   C  CB    . VAL A  1 159 ? -15.289 1.172    56.494  1.00 58.14  ? 159 VAL A CB    1 
ATOM   974   C  CG1   . VAL A  1 159 ? -14.091 0.300    56.768  1.00 57.96  ? 159 VAL A CG1   1 
ATOM   975   C  CG2   . VAL A  1 159 ? -15.167 1.734    55.097  1.00 59.00  ? 159 VAL A CG2   1 
ATOM   976   N  N     . PRO A  1 160 ? -17.893 -0.511   58.588  1.00 60.83  ? 160 PRO A N     1 
ATOM   977   C  CA    . PRO A  1 160 ? -18.268 -0.502   60.009  1.00 60.85  ? 160 PRO A CA    1 
ATOM   978   C  C     . PRO A  1 160 ? -17.215 -1.159   60.906  1.00 60.18  ? 160 PRO A C     1 
ATOM   979   O  O     . PRO A  1 160 ? -16.537 -2.094   60.486  1.00 60.54  ? 160 PRO A O     1 
ATOM   980   C  CB    . PRO A  1 160 ? -19.573 -1.294   60.036  1.00 62.34  ? 160 PRO A CB    1 
ATOM   981   C  CG    . PRO A  1 160 ? -19.520 -2.152   58.836  1.00 63.05  ? 160 PRO A CG    1 
ATOM   982   C  CD    . PRO A  1 160 ? -18.729 -1.432   57.798  1.00 62.27  ? 160 PRO A CD    1 
ATOM   983   N  N     . ILE A  1 161 ? -17.090 -0.657   62.129  1.00 59.70  ? 161 ILE A N     1 
ATOM   984   C  CA    . ILE A  1 161 ? -16.091 -1.124   63.086  1.00 58.86  ? 161 ILE A CA    1 
ATOM   985   C  C     . ILE A  1 161 ? -16.795 -1.761   64.306  1.00 59.84  ? 161 ILE A C     1 
ATOM   986   O  O     . ILE A  1 161 ? -17.772 -1.212   64.826  1.00 60.47  ? 161 ILE A O     1 
ATOM   987   C  CB    . ILE A  1 161 ? -15.164 0.058    63.496  1.00 57.37  ? 161 ILE A CB    1 
ATOM   988   C  CG1   . ILE A  1 161 ? -14.451 0.604    62.264  1.00 56.78  ? 161 ILE A CG1   1 
ATOM   989   C  CG2   . ILE A  1 161 ? -14.135 -0.356   64.534  1.00 56.79  ? 161 ILE A CG2   1 
ATOM   990   C  CD1   . ILE A  1 161 ? -13.725 1.888    62.502  1.00 56.35  ? 161 ILE A CD1   1 
ATOM   991   N  N     . GLY A  1 162 ? -16.312 -2.921   64.751  1.00 60.19  ? 162 GLY A N     1 
ATOM   992   C  CA    . GLY A  1 162 ? -16.847 -3.563   65.956  1.00 61.08  ? 162 GLY A CA    1 
ATOM   993   C  C     . GLY A  1 162 ? -15.917 -3.659   67.161  1.00 60.62  ? 162 GLY A C     1 
ATOM   994   O  O     . GLY A  1 162 ? -14.693 -3.521   67.027  1.00 59.54  ? 162 GLY A O     1 
ATOM   995   N  N     . ARG A  1 163 ? -16.504 -3.915   68.336  1.00 61.41  ? 163 ARG A N     1 
ATOM   996   C  CA    . ARG A  1 163 ? -15.748 -4.017   69.588  1.00 61.34  ? 163 ARG A CA    1 
ATOM   997   C  C     . ARG A  1 163 ? -14.741 -5.156   69.524  1.00 61.17  ? 163 ARG A C     1 
ATOM   998   O  O     . ARG A  1 163 ? -15.118 -6.329   69.554  1.00 62.39  ? 163 ARG A O     1 
ATOM   999   C  CB    . ARG A  1 163 ? -16.667 -4.179   70.809  1.00 62.77  ? 163 ARG A CB    1 
ATOM   1000  C  CG    . ARG A  1 163 ? -17.877 -3.280   70.789  1.00 64.61  ? 163 ARG A CG    1 
ATOM   1001  C  CD    . ARG A  1 163 ? -18.407 -2.873   72.159  1.00 67.46  ? 163 ARG A CD    1 
ATOM   1002  N  NE    . ARG A  1 163 ? -18.844 -1.478   72.035  1.00 70.03  ? 163 ARG A NE    1 
ATOM   1003  C  CZ    . ARG A  1 163 ? -19.804 -0.889   72.746  1.00 71.21  ? 163 ARG A CZ    1 
ATOM   1004  N  NH1   . ARG A  1 163 ? -20.469 -1.577   73.677  1.00 71.21  ? 163 ARG A NH1   1 
ATOM   1005  N  NH2   . ARG A  1 163 ? -20.095 0.401    72.512  1.00 70.49  ? 163 ARG A NH2   1 
ATOM   1006  N  N     . GLY A  1 164 ? -13.464 -4.784   69.428  1.00 59.71  ? 164 GLY A N     1 
ATOM   1007  C  CA    . GLY A  1 164 ? -12.365 -5.729   69.329  1.00 59.61  ? 164 GLY A CA    1 
ATOM   1008  C  C     . GLY A  1 164 ? -11.679 -5.678   67.977  1.00 58.99  ? 164 GLY A C     1 
ATOM   1009  O  O     . GLY A  1 164 ? -10.688 -6.388   67.745  1.00 59.22  ? 164 GLY A O     1 
ATOM   1010  N  N     . GLN A  1 165 ? -12.196 -4.843   67.075  1.00 58.37  ? 165 GLN A N     1 
ATOM   1011  C  CA    . GLN A  1 165 ? -11.628 -4.741   65.727  1.00 57.90  ? 165 GLN A CA    1 
ATOM   1012  C  C     . GLN A  1 165 ? -10.395 -3.853   65.665  1.00 56.62  ? 165 GLN A C     1 
ATOM   1013  O  O     . GLN A  1 165 ? -10.307 -2.834   66.361  1.00 56.29  ? 165 GLN A O     1 
ATOM   1014  C  CB    . GLN A  1 165 ? -12.666 -4.246   64.724  1.00 58.05  ? 165 GLN A CB    1 
ATOM   1015  C  CG    . GLN A  1 165 ? -12.201 -4.343   63.282  1.00 58.05  ? 165 GLN A CG    1 
ATOM   1016  C  CD    . GLN A  1 165 ? -13.325 -4.156   62.293  1.00 59.08  ? 165 GLN A CD    1 
ATOM   1017  O  OE1   . GLN A  1 165 ? -14.483 -4.032   62.676  1.00 60.31  ? 165 GLN A OE1   1 
ATOM   1018  N  NE2   . GLN A  1 165 ? -12.991 -4.142   61.009  1.00 59.54  ? 165 GLN A NE2   1 
ATOM   1019  N  N     . ARG A  1 166 ? -9.435  -4.249   64.839  1.00 56.30  ? 166 ARG A N     1 
ATOM   1020  C  CA    . ARG A  1 166 ? -8.328  -3.371   64.507  1.00 55.19  ? 166 ARG A CA    1 
ATOM   1021  C  C     . ARG A  1 166 ? -8.635  -2.859   63.118  1.00 55.35  ? 166 ARG A C     1 
ATOM   1022  O  O     . ARG A  1 166 ? -8.741  -3.649   62.172  1.00 56.26  ? 166 ARG A O     1 
ATOM   1023  C  CB    . ARG A  1 166 ? -6.986  -4.108   64.532  1.00 55.08  ? 166 ARG A CB    1 
ATOM   1024  C  CG    . ARG A  1 166 ? -6.573  -4.680   65.886  1.00 54.67  ? 166 ARG A CG    1 
ATOM   1025  C  CD    . ARG A  1 166 ? -7.222  -6.045   66.172  1.00 56.40  ? 166 ARG A CD    1 
ATOM   1026  N  NE    . ARG A  1 166 ? -7.275  -6.918   64.994  1.00 56.67  ? 166 ARG A NE    1 
ATOM   1027  C  CZ    . ARG A  1 166 ? -6.248  -7.622   64.518  1.00 56.68  ? 166 ARG A CZ    1 
ATOM   1028  N  NH1   . ARG A  1 166 ? -5.058  -7.574   65.114  1.00 56.31  ? 166 ARG A NH1   1 
ATOM   1029  N  NH2   . ARG A  1 166 ? -6.409  -8.375   63.439  1.00 56.35  ? 166 ARG A NH2   1 
ATOM   1030  N  N     . GLU A  1 167 ? -8.818  -1.548   63.000  1.00 54.75  ? 167 GLU A N     1 
ATOM   1031  C  CA    . GLU A  1 167 ? -9.151  -0.943   61.715  1.00 55.11  ? 167 GLU A CA    1 
ATOM   1032  C  C     . GLU A  1 167 ? -8.161  0.154    61.405  1.00 54.43  ? 167 GLU A C     1 
ATOM   1033  O  O     . GLU A  1 167 ? -8.102  1.163    62.109  1.00 54.09  ? 167 GLU A O     1 
ATOM   1034  C  CB    . GLU A  1 167 ? -10.572 -0.386   61.732  1.00 55.58  ? 167 GLU A CB    1 
ATOM   1035  C  CG    . GLU A  1 167 ? -11.006 0.287    60.437  1.00 56.47  ? 167 GLU A CG    1 
ATOM   1036  C  CD    . GLU A  1 167 ? -11.326 -0.693   59.322  1.00 58.56  ? 167 GLU A CD    1 
ATOM   1037  O  OE1   . GLU A  1 167 ? -11.752 -1.836   59.607  1.00 59.29  ? 167 GLU A OE1   1 
ATOM   1038  O  OE2   . GLU A  1 167 ? -11.159 -0.308   58.146  1.00 59.62  ? 167 GLU A OE2   1 
ATOM   1039  N  N     . LEU A  1 168 ? -7.376  -0.047   60.353  1.00 54.67  ? 168 LEU A N     1 
ATOM   1040  C  CA    . LEU A  1 168 ? -6.319  0.898    59.999  1.00 54.07  ? 168 LEU A CA    1 
ATOM   1041  C  C     . LEU A  1 168 ? -6.861  2.127    59.266  1.00 54.26  ? 168 LEU A C     1 
ATOM   1042  O  O     . LEU A  1 168 ? -7.638  2.004    58.320  1.00 55.52  ? 168 LEU A O     1 
ATOM   1043  C  CB    . LEU A  1 168 ? -5.250  0.196    59.163  1.00 54.04  ? 168 LEU A CB    1 
ATOM   1044  C  CG    . LEU A  1 168 ? -4.102  0.984    58.536  1.00 53.66  ? 168 LEU A CG    1 
ATOM   1045  C  CD1   . LEU A  1 168 ? -3.162  1.547    59.589  1.00 52.85  ? 168 LEU A CD1   1 
ATOM   1046  C  CD2   . LEU A  1 168 ? -3.341  0.074    57.579  1.00 54.59  ? 168 LEU A CD2   1 
ATOM   1047  N  N     . ILE A  1 169 ? -6.469  3.303    59.743  1.00 53.47  ? 169 ILE A N     1 
ATOM   1048  C  CA    . ILE A  1 169 ? -6.643  4.559    59.020  1.00 53.46  ? 169 ILE A CA    1 
ATOM   1049  C  C     . ILE A  1 169 ? -5.319  4.802    58.291  1.00 53.40  ? 169 ILE A C     1 
ATOM   1050  O  O     . ILE A  1 169 ? -4.253  4.777    58.906  1.00 53.16  ? 169 ILE A O     1 
ATOM   1051  C  CB    . ILE A  1 169 ? -6.949  5.726    59.997  1.00 53.01  ? 169 ILE A CB    1 
ATOM   1052  C  CG1   . ILE A  1 169 ? -8.275  5.485    60.732  1.00 53.05  ? 169 ILE A CG1   1 
ATOM   1053  C  CG2   . ILE A  1 169 ? -6.983  7.051    59.262  1.00 53.19  ? 169 ILE A CG2   1 
ATOM   1054  C  CD1   . ILE A  1 169 ? -8.403  6.221    62.059  1.00 51.55  ? 169 ILE A CD1   1 
ATOM   1055  N  N     . ILE A  1 170 ? -5.361  5.009    56.985  1.00 53.95  ? 170 ILE A N     1 
ATOM   1056  C  CA    . ILE A  1 170 ? -4.117  5.030    56.213  1.00 54.10  ? 170 ILE A CA    1 
ATOM   1057  C  C     . ILE A  1 170 ? -4.197  6.007    55.045  1.00 54.96  ? 170 ILE A C     1 
ATOM   1058  O  O     . ILE A  1 170 ? -5.264  6.184    54.441  1.00 56.16  ? 170 ILE A O     1 
ATOM   1059  C  CB    . ILE A  1 170 ? -3.724  3.595    55.735  1.00 54.37  ? 170 ILE A CB    1 
ATOM   1060  C  CG1   . ILE A  1 170 ? -2.414  3.601    54.943  1.00 54.71  ? 170 ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A  1 170 ? -4.856  2.946    54.930  1.00 55.34  ? 170 ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A  1 170 ? -1.859  2.208    54.627  1.00 54.86  ? 170 ILE A CD1   1 
ATOM   1063  N  N     . GLY A  1 171 ? -3.075  6.650    54.740  1.00 54.57  ? 171 GLY A N     1 
ATOM   1064  C  CA    . GLY A  1 171 ? -3.024  7.581    53.622  1.00 55.33  ? 171 GLY A CA    1 
ATOM   1065  C  C     . GLY A  1 171 ? -1.900  8.577    53.745  1.00 55.08  ? 171 GLY A C     1 
ATOM   1066  O  O     . GLY A  1 171 ? -1.230  8.635    54.775  1.00 54.16  ? 171 GLY A O     1 
ATOM   1067  N  N     . ASP A  1 172 ? -1.693  9.348    52.680  1.00 56.04  ? 172 ASP A N     1 
ATOM   1068  C  CA    . ASP A  1 172 ? -0.679  10.392   52.641  1.00 56.37  ? 172 ASP A CA    1 
ATOM   1069  C  C     . ASP A  1 172 ? -0.900  11.401   53.749  1.00 55.94  ? 172 ASP A C     1 
ATOM   1070  O  O     . ASP A  1 172 ? -1.966  11.426   54.362  1.00 55.69  ? 172 ASP A O     1 
ATOM   1071  C  CB    . ASP A  1 172 ? -0.741  11.127   51.307  1.00 58.01  ? 172 ASP A CB    1 
ATOM   1072  C  CG    . ASP A  1 172 ? -0.088  10.363   50.184  1.00 58.96  ? 172 ASP A CG    1 
ATOM   1073  O  OD1   . ASP A  1 172 ? 0.422   9.253    50.446  1.00 58.11  ? 172 ASP A OD1   1 
ATOM   1074  O  OD2   . ASP A  1 172 ? -0.086  10.880   49.037  1.00 61.09  ? 172 ASP A OD2   1 
ATOM   1075  N  N     . ARG A  1 173 ? 0.107   12.241   53.990  1.00 56.02  ? 173 ARG A N     1 
ATOM   1076  C  CA    . ARG A  1 173 ? 0.012   13.331   54.970  1.00 55.69  ? 173 ARG A CA    1 
ATOM   1077  C  C     . ARG A  1 173 ? -1.087  14.304   54.573  1.00 56.16  ? 173 ARG A C     1 
ATOM   1078  O  O     . ARG A  1 173 ? -1.409  14.425   53.396  1.00 57.50  ? 173 ARG A O     1 
ATOM   1079  C  CB    . ARG A  1 173 ? 1.334   14.084   55.060  1.00 56.15  ? 173 ARG A CB    1 
ATOM   1080  C  CG    . ARG A  1 173 ? 1.827   14.575   53.715  1.00 58.71  ? 173 ARG A CG    1 
ATOM   1081  C  CD    . ARG A  1 173 ? 2.451   15.936   53.859  1.00 62.91  ? 173 ARG A CD    1 
ATOM   1082  N  NE    . ARG A  1 173 ? 2.120   16.809   52.738  1.00 67.00  ? 173 ARG A NE    1 
ATOM   1083  C  CZ    . ARG A  1 173 ? 2.720   16.753   51.551  1.00 70.40  ? 173 ARG A CZ    1 
ATOM   1084  N  NH1   . ARG A  1 173 ? 3.682   15.855   51.330  1.00 71.11  ? 173 ARG A NH1   1 
ATOM   1085  N  NH2   . ARG A  1 173 ? 2.360   17.590   50.581  1.00 72.30  ? 173 ARG A NH2   1 
ATOM   1086  N  N     . GLN A  1 174 ? -1.655  14.981   55.563  1.00 55.38  ? 174 GLN A N     1 
ATOM   1087  C  CA    . GLN A  1 174 ? -2.716  15.967   55.365  1.00 56.05  ? 174 GLN A CA    1 
ATOM   1088  C  C     . GLN A  1 174 ? -3.947  15.472   54.571  1.00 56.51  ? 174 GLN A C     1 
ATOM   1089  O  O     . GLN A  1 174 ? -4.376  16.109   53.599  1.00 58.08  ? 174 GLN A O     1 
ATOM   1090  C  CB    . GLN A  1 174 ? -2.140  17.252   54.761  1.00 57.17  ? 174 GLN A CB    1 
ATOM   1091  C  CG    . GLN A  1 174 ? -1.394  18.141   55.728  1.00 57.66  ? 174 GLN A CG    1 
ATOM   1092  C  CD    . GLN A  1 174 ? -2.304  18.813   56.760  1.00 58.94  ? 174 GLN A CD    1 
ATOM   1093  O  OE1   . GLN A  1 174 ? -2.662  18.206   57.764  1.00 57.67  ? 174 GLN A OE1   1 
ATOM   1094  N  NE2   . GLN A  1 174 ? -2.655  20.083   56.525  1.00 61.58  ? 174 GLN A NE2   1 
ATOM   1095  N  N     . THR A  1 175 ? -4.536  14.353   54.996  1.00 55.32  ? 175 THR A N     1 
ATOM   1096  C  CA    . THR A  1 175 ? -5.716  13.810   54.297  1.00 55.54  ? 175 THR A CA    1 
ATOM   1097  C  C     . THR A  1 175 ? -6.921  13.483   55.196  1.00 55.02  ? 175 THR A C     1 
ATOM   1098  O  O     . THR A  1 175 ? -7.945  13.012   54.706  1.00 55.89  ? 175 THR A O     1 
ATOM   1099  C  CB    . THR A  1 175 ? -5.371  12.551   53.455  1.00 55.35  ? 175 THR A CB    1 
ATOM   1100  O  OG1   . THR A  1 175 ? -4.995  11.489   54.334  1.00 53.98  ? 175 THR A OG1   1 
ATOM   1101  C  CG2   . THR A  1 175 ? -4.243  12.814   52.448  1.00 55.08  ? 175 THR A CG2   1 
ATOM   1102  N  N     . GLY A  1 176 ? -6.807  13.725   56.496  1.00 53.96  ? 176 GLY A N     1 
ATOM   1103  C  CA    . GLY A  1 176 ? -7.929  13.517   57.409  1.00 53.88  ? 176 GLY A CA    1 
ATOM   1104  C  C     . GLY A  1 176 ? -7.837  12.301   58.312  1.00 52.71  ? 176 GLY A C     1 
ATOM   1105  O  O     . GLY A  1 176 ? -8.793  11.968   59.012  1.00 52.85  ? 176 GLY A O     1 
ATOM   1106  N  N     . LYS A  1 177 ? -6.684  11.642   58.291  1.00 52.08  ? 177 LYS A N     1 
ATOM   1107  C  CA    . LYS A  1 177 ? -6.390  10.496   59.159  1.00 51.10  ? 177 LYS A CA    1 
ATOM   1108  C  C     . LYS A  1 177 ? -6.739  10.749   60.627  1.00 50.64  ? 177 LYS A C     1 
ATOM   1109  O  O     . LYS A  1 177 ? -7.536  10.015   61.212  1.00 50.94  ? 177 LYS A O     1 
ATOM   1110  C  CB    . LYS A  1 177 ? -4.916  10.064   59.038  1.00 50.34  ? 177 LYS A CB    1 
ATOM   1111  C  CG    . LYS A  1 177 ? -4.508  9.604    57.650  1.00 50.74  ? 177 LYS A CG    1 
ATOM   1112  C  CD    . LYS A  1 177 ? -3.156  8.907    57.630  1.00 51.17  ? 177 LYS A CD    1 
ATOM   1113  C  CE    . LYS A  1 177 ? -1.977  9.859    57.893  1.00 53.13  ? 177 LYS A CE    1 
ATOM   1114  N  NZ    . LYS A  1 177 ? -1.766  10.945   56.874  1.00 53.71  ? 177 LYS A NZ    1 
ATOM   1115  N  N     . THR A  1 178 ? -6.151  11.784   61.222  1.00 50.28  ? 178 THR A N     1 
ATOM   1116  C  CA    . THR A  1 178 ? -6.375  12.041   62.636  1.00 49.45  ? 178 THR A CA    1 
ATOM   1117  C  C     . THR A  1 178 ? -7.806  12.449   62.805  1.00 50.73  ? 178 THR A C     1 
ATOM   1118  O  O     . THR A  1 178 ? -8.488  11.948   63.693  1.00 50.90  ? 178 THR A O     1 
ATOM   1119  C  CB    . THR A  1 178 ? -5.439  13.104   63.187  1.00 49.22  ? 178 THR A CB    1 
ATOM   1120  O  OG1   . THR A  1 178 ? -4.100  12.599   63.142  1.00 46.81  ? 178 THR A OG1   1 
ATOM   1121  C  CG2   . THR A  1 178 ? -5.765  13.393   64.611  1.00 48.27  ? 178 THR A CG2   1 
ATOM   1122  N  N     . ALA A  1 179 ? -8.278  13.314   61.912  1.00 52.16  ? 179 ALA A N     1 
ATOM   1123  C  CA    . ALA A  1 179 ? -9.667  13.788   61.947  1.00 53.56  ? 179 ALA A CA    1 
ATOM   1124  C  C     . ALA A  1 179 ? -10.691 12.648   62.035  1.00 53.75  ? 179 ALA A C     1 
ATOM   1125  O  O     . ALA A  1 179 ? -11.736 12.795   62.674  1.00 54.46  ? 179 ALA A O     1 
ATOM   1126  C  CB    . ALA A  1 179 ? -9.956  14.671   60.756  1.00 54.72  ? 179 ALA A CB    1 
ATOM   1127  N  N     . VAL A  1 180 ? -10.393 11.517   61.404  1.00 53.32  ? 180 VAL A N     1 
ATOM   1128  C  CA    . VAL A  1 180 ? -11.293 10.383   61.478  1.00 53.77  ? 180 VAL A CA    1 
ATOM   1129  C  C     . VAL A  1 180 ? -11.297 9.771    62.877  1.00 53.71  ? 180 VAL A C     1 
ATOM   1130  O  O     . VAL A  1 180 ? -12.364 9.460    63.423  1.00 54.50  ? 180 VAL A O     1 
ATOM   1131  C  CB    . VAL A  1 180 ? -11.001 9.348    60.389  1.00 53.48  ? 180 VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1 180 ? -11.684 8.007    60.695  1.00 53.30  ? 180 VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1 180 ? -11.470 9.886    59.063  1.00 54.18  ? 180 VAL A CG2   1 
ATOM   1134  N  N     . ALA A  1 181 ? -10.115 9.621    63.464  1.00 53.27  ? 181 ALA A N     1 
ATOM   1135  C  CA    . ALA A  1 181 ? -9.998  9.093    64.825  1.00 53.25  ? 181 ALA A CA    1 
ATOM   1136  C  C     . ALA A  1 181 ? -10.624 10.041   65.853  1.00 53.85  ? 181 ALA A C     1 
ATOM   1137  O  O     . ALA A  1 181 ? -11.355 9.614    66.752  1.00 54.00  ? 181 ALA A O     1 
ATOM   1138  C  CB    . ALA A  1 181 ? -8.540  8.831    65.163  1.00 52.59  ? 181 ALA A CB    1 
ATOM   1139  N  N     . LEU A  1 182 ? -10.335 11.328   65.699  1.00 54.25  ? 182 LEU A N     1 
ATOM   1140  C  CA    . LEU A  1 182 ? -10.824 12.339   66.612  1.00 55.23  ? 182 LEU A CA    1 
ATOM   1141  C  C     . LEU A  1 182 ? -12.361 12.421   66.601  1.00 56.56  ? 182 LEU A C     1 
ATOM   1142  O  O     . LEU A  1 182 ? -12.997 12.328   67.647  1.00 57.03  ? 182 LEU A O     1 
ATOM   1143  C  CB    . LEU A  1 182 ? -10.159 13.684   66.299  1.00 55.43  ? 182 LEU A CB    1 
ATOM   1144  C  CG    . LEU A  1 182 ? -10.502 14.938   67.106  1.00 56.53  ? 182 LEU A CG    1 
ATOM   1145  C  CD1   . LEU A  1 182 ? -10.375 14.722   68.600  1.00 55.54  ? 182 LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A  1 182 ? -9.588  16.051   66.660  1.00 57.96  ? 182 LEU A CD2   1 
ATOM   1147  N  N     . ASP A  1 183 ? -12.958 12.557   65.426  1.00 57.54  ? 183 ASP A N     1 
ATOM   1148  C  CA    . ASP A  1 183 ? -14.407 12.623   65.332  1.00 59.29  ? 183 ASP A CA    1 
ATOM   1149  C  C     . ASP A  1 183 ? -15.074 11.403   65.970  1.00 58.96  ? 183 ASP A C     1 
ATOM   1150  O  O     . ASP A  1 183 ? -16.133 11.520   66.600  1.00 59.85  ? 183 ASP A O     1 
ATOM   1151  C  CB    . ASP A  1 183 ? -14.830 12.791   63.874  1.00 60.63  ? 183 ASP A CB    1 
ATOM   1152  C  CG    . ASP A  1 183 ? -14.636 14.226   63.373  1.00 63.92  ? 183 ASP A CG    1 
ATOM   1153  O  OD1   . ASP A  1 183 ? -13.599 14.859   63.716  1.00 65.38  ? 183 ASP A OD1   1 
ATOM   1154  O  OD2   . ASP A  1 183 ? -15.532 14.728   62.643  1.00 67.49  ? 183 ASP A OD2   1 
ATOM   1155  N  N     . THR A  1 184 ? -14.432 10.242   65.815  1.00 57.73  ? 184 THR A N     1 
ATOM   1156  C  CA    . THR A  1 184 ? -14.884 8.980    66.408  1.00 57.05  ? 184 THR A CA    1 
ATOM   1157  C  C     . THR A  1 184 ? -14.857 9.053    67.933  1.00 56.85  ? 184 THR A C     1 
ATOM   1158  O  O     . THR A  1 184 ? -15.870 8.772    68.587  1.00 57.73  ? 184 THR A O     1 
ATOM   1159  C  CB    . THR A  1 184 ? -14.024 7.812    65.920  1.00 56.16  ? 184 THR A CB    1 
ATOM   1160  O  OG1   . THR A  1 184 ? -14.116 7.727    64.491  1.00 56.53  ? 184 THR A OG1   1 
ATOM   1161  C  CG2   . THR A  1 184 ? -14.467 6.497    66.558  1.00 56.04  ? 184 THR A CG2   1 
ATOM   1162  N  N     . ILE A  1 185 ? -13.708 9.445    68.491  1.00 55.71  ? 185 ILE A N     1 
ATOM   1163  C  CA    . ILE A  1 185 ? -13.586 9.722    69.932  1.00 55.17  ? 185 ILE A CA    1 
ATOM   1164  C  C     . ILE A  1 185 ? -14.692 10.673   70.406  1.00 56.23  ? 185 ILE A C     1 
ATOM   1165  O  O     . ILE A  1 185 ? -15.275 10.472   71.474  1.00 56.84  ? 185 ILE A O     1 
ATOM   1166  C  CB    . ILE A  1 185 ? -12.179 10.273   70.308  1.00 54.25  ? 185 ILE A CB    1 
ATOM   1167  C  CG1   . ILE A  1 185 ? -11.107 9.204    70.040  1.00 52.39  ? 185 ILE A CG1   1 
ATOM   1168  C  CG2   . ILE A  1 185 ? -12.155 10.776   71.765  1.00 53.95  ? 185 ILE A CG2   1 
ATOM   1169  C  CD1   . ILE A  1 185 ? -9.664  9.686    70.141  1.00 50.06  ? 185 ILE A CD1   1 
ATOM   1170  N  N     . LEU A  1 186 ? -14.993 11.677   69.583  1.00 56.46  ? 186 LEU A N     1 
ATOM   1171  C  CA    . LEU A  1 186 ? -16.046 12.645   69.875  1.00 57.58  ? 186 LEU A CA    1 
ATOM   1172  C  C     . LEU A  1 186 ? -17.448 12.037   69.950  1.00 58.80  ? 186 LEU A C     1 
ATOM   1173  O  O     . LEU A  1 186 ? -18.203 12.311   70.893  1.00 59.74  ? 186 LEU A O     1 
ATOM   1174  C  CB    . LEU A  1 186 ? -16.028 13.762   68.843  1.00 57.69  ? 186 LEU A CB    1 
ATOM   1175  C  CG    . LEU A  1 186 ? -14.791 14.639   68.844  1.00 56.32  ? 186 LEU A CG    1 
ATOM   1176  C  CD1   . LEU A  1 186 ? -14.928 15.649   67.729  1.00 57.04  ? 186 LEU A CD1   1 
ATOM   1177  C  CD2   . LEU A  1 186 ? -14.604 15.312   70.193  1.00 55.03  ? 186 LEU A CD2   1 
ATOM   1178  N  N     . ASN A  1 187 ? -17.782 11.212   68.959  1.00 58.89  ? 187 ASN A N     1 
ATOM   1179  C  CA    . ASN A  1 187 ? -19.086 10.544   68.871  1.00 60.16  ? 187 ASN A CA    1 
ATOM   1180  C  C     . ASN A  1 187 ? -19.476 9.693    70.092  1.00 60.63  ? 187 ASN A C     1 
ATOM   1181  O  O     . ASN A  1 187 ? -20.639 9.327    70.261  1.00 61.91  ? 187 ASN A O     1 
ATOM   1182  C  CB    . ASN A  1 187 ? -19.109 9.670    67.622  1.00 59.87  ? 187 ASN A CB    1 
ATOM   1183  C  CG    . ASN A  1 187 ? -20.460 9.054    67.366  1.00 60.61  ? 187 ASN A CG    1 
ATOM   1184  O  OD1   . ASN A  1 187 ? -21.397 9.737    66.967  1.00 61.55  ? 187 ASN A OD1   1 
ATOM   1185  N  ND2   . ASN A  1 187 ? -20.566 7.752    67.588  1.00 59.75  ? 187 ASN A ND2   1 
ATOM   1186  N  N     . GLN A  1 188 ? -18.497 9.387    70.939  1.00 59.89  ? 188 GLN A N     1 
ATOM   1187  C  CA    . GLN A  1 188 ? -18.687 8.484    72.075  1.00 59.88  ? 188 GLN A CA    1 
ATOM   1188  C  C     . GLN A  1 188 ? -19.328 9.144    73.286  1.00 60.38  ? 188 GLN A C     1 
ATOM   1189  O  O     . GLN A  1 188 ? -19.686 8.460    74.247  1.00 60.72  ? 188 GLN A O     1 
ATOM   1190  C  CB    . GLN A  1 188 ? -17.345 7.859    72.469  1.00 59.11  ? 188 GLN A CB    1 
ATOM   1191  C  CG    . GLN A  1 188 ? -16.648 7.119    71.316  1.00 59.04  ? 188 GLN A CG    1 
ATOM   1192  C  CD    . GLN A  1 188 ? -17.550 6.087    70.645  1.00 60.12  ? 188 GLN A CD    1 
ATOM   1193  O  OE1   . GLN A  1 188 ? -18.336 5.407    71.306  1.00 61.82  ? 188 GLN A OE1   1 
ATOM   1194  N  NE2   . GLN A  1 188 ? -17.437 5.968    69.329  1.00 59.77  ? 188 GLN A NE2   1 
ATOM   1195  N  N     . LYS A  1 189 ? -19.464 10.468   73.242  1.00 60.18  ? 189 LYS A N     1 
ATOM   1196  C  CA    . LYS A  1 189 ? -20.175 11.180   74.288  1.00 60.87  ? 189 LYS A CA    1 
ATOM   1197  C  C     . LYS A  1 189 ? -21.586 10.628   74.398  1.00 61.88  ? 189 LYS A C     1 
ATOM   1198  O  O     . LYS A  1 189 ? -22.096 10.466   75.502  1.00 63.21  ? 189 LYS A O     1 
ATOM   1199  C  CB    . LYS A  1 189 ? -20.226 12.678   74.014  1.00 61.54  ? 189 LYS A CB    1 
ATOM   1200  C  CG    . LYS A  1 189 ? -18.973 13.444   74.411  1.00 60.43  ? 189 LYS A CG    1 
ATOM   1201  C  CD    . LYS A  1 189 ? -19.166 14.948   74.269  1.00 60.98  ? 189 LYS A CD    1 
ATOM   1202  C  CE    . LYS A  1 189 ? -19.499 15.322   72.837  1.00 61.80  ? 189 LYS A CE    1 
ATOM   1203  N  NZ    . LYS A  1 189 ? -19.151 16.723   72.505  1.00 63.69  ? 189 LYS A NZ    1 
ATOM   1204  N  N     . ARG A  1 190 ? -22.203 10.319   73.255  1.00 61.25  ? 190 ARG A N     1 
ATOM   1205  C  CA    . ARG A  1 190 ? -23.544 9.723    73.218  1.00 61.68  ? 190 ARG A CA    1 
ATOM   1206  C  C     . ARG A  1 190 ? -23.792 8.717    74.326  1.00 61.99  ? 190 ARG A C     1 
ATOM   1207  O  O     . ARG A  1 190 ? -24.839 8.751    74.955  1.00 63.81  ? 190 ARG A O     1 
ATOM   1208  C  CB    . ARG A  1 190 ? -23.825 9.071    71.867  1.00 61.21  ? 190 ARG A CB    1 
ATOM   1209  C  CG    . ARG A  1 190 ? -24.215 10.059   70.818  1.00 60.69  ? 190 ARG A CG    1 
ATOM   1210  C  CD    . ARG A  1 190 ? -24.355 9.435    69.461  1.00 59.01  ? 190 ARG A CD    1 
ATOM   1211  N  NE    . ARG A  1 190 ? -23.632 10.243   68.493  1.00 58.18  ? 190 ARG A NE    1 
ATOM   1212  C  CZ    . ARG A  1 190 ? -24.034 11.419   68.022  1.00 59.08  ? 190 ARG A CZ    1 
ATOM   1213  N  NH1   . ARG A  1 190 ? -25.180 11.955   68.402  1.00 60.85  ? 190 ARG A NH1   1 
ATOM   1214  N  NH2   . ARG A  1 190 ? -23.275 12.064   67.158  1.00 59.16  ? 190 ARG A NH2   1 
ATOM   1215  N  N     . TRP A  1 191 ? -22.828 7.837    74.574  1.00 60.73  ? 191 TRP A N     1 
ATOM   1216  C  CA    . TRP A  1 191 ? -22.977 6.810    75.606  1.00 61.27  ? 191 TRP A CA    1 
ATOM   1217  C  C     . TRP A  1 191 ? -22.198 7.138    76.871  1.00 61.41  ? 191 TRP A C     1 
ATOM   1218  O  O     . TRP A  1 191 ? -22.629 6.799    77.984  1.00 62.53  ? 191 TRP A O     1 
ATOM   1219  C  CB    . TRP A  1 191 ? -22.611 5.422    75.065  1.00 60.18  ? 191 TRP A CB    1 
ATOM   1220  C  CG    . TRP A  1 191 ? -23.321 5.150    73.800  1.00 59.63  ? 191 TRP A CG    1 
ATOM   1221  C  CD1   . TRP A  1 191 ? -24.579 4.671    73.663  1.00 60.00  ? 191 TRP A CD1   1 
ATOM   1222  C  CD2   . TRP A  1 191 ? -22.836 5.400    72.479  1.00 58.87  ? 191 TRP A CD2   1 
ATOM   1223  N  NE1   . TRP A  1 191 ? -24.913 4.589    72.338  1.00 60.08  ? 191 TRP A NE1   1 
ATOM   1224  C  CE2   . TRP A  1 191 ? -23.859 5.034    71.586  1.00 59.10  ? 191 TRP A CE2   1 
ATOM   1225  C  CE3   . TRP A  1 191 ? -21.625 5.894    71.961  1.00 57.98  ? 191 TRP A CE3   1 
ATOM   1226  C  CZ2   . TRP A  1 191 ? -23.717 5.134    70.202  1.00 58.96  ? 191 TRP A CZ2   1 
ATOM   1227  C  CZ3   . TRP A  1 191 ? -21.486 5.997    70.586  1.00 57.99  ? 191 TRP A CZ3   1 
ATOM   1228  C  CH2   . TRP A  1 191 ? -22.529 5.614    69.721  1.00 58.44  ? 191 TRP A CH2   1 
ATOM   1229  N  N     . ASN A  1 192 ? -21.070 7.824    76.700  1.00 60.48  ? 192 ASN A N     1 
ATOM   1230  C  CA    . ASN A  1 192 ? -20.209 8.151    77.826  1.00 60.62  ? 192 ASN A CA    1 
ATOM   1231  C  C     . ASN A  1 192 ? -20.866 9.076    78.846  1.00 62.30  ? 192 ASN A C     1 
ATOM   1232  O  O     . ASN A  1 192 ? -20.574 9.002    80.030  1.00 62.82  ? 192 ASN A O     1 
ATOM   1233  C  CB    . ASN A  1 192 ? -18.860 8.671    77.335  1.00 58.97  ? 192 ASN A CB    1 
ATOM   1234  C  CG    . ASN A  1 192 ? -17.994 7.567    76.750  1.00 57.94  ? 192 ASN A CG    1 
ATOM   1235  O  OD1   . ASN A  1 192 ? -18.381 6.400    76.717  1.00 58.48  ? 192 ASN A OD1   1 
ATOM   1236  N  ND2   . ASN A  1 192 ? -16.821 7.929    76.286  1.00 57.65  ? 192 ASN A ND2   1 
ATOM   1237  N  N     . ASN A  1 193 ? -21.774 9.923    78.383  1.00 63.76  ? 193 ASN A N     1 
ATOM   1238  C  CA    . ASN A  1 193 ? -22.593 10.734   79.274  1.00 66.11  ? 193 ASN A CA    1 
ATOM   1239  C  C     . ASN A  1 193 ? -23.772 9.966    79.878  1.00 67.97  ? 193 ASN A C     1 
ATOM   1240  O  O     . ASN A  1 193 ? -24.617 10.549   80.556  1.00 69.68  ? 193 ASN A O     1 
ATOM   1241  C  CB    . ASN A  1 193 ? -23.073 12.000   78.559  1.00 66.71  ? 193 ASN A CB    1 
ATOM   1242  C  CG    . ASN A  1 193 ? -21.966 13.017   78.392  1.00 66.51  ? 193 ASN A CG    1 
ATOM   1243  O  OD1   . ASN A  1 193 ? -21.176 13.240   79.310  1.00 67.40  ? 193 ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A  1 193 ? -21.895 13.635   77.218  1.00 66.51  ? 193 ASN A ND2   1 
ATOM   1245  N  N     . GLY A  1 194 ? -23.813 8.659    79.641  1.00 67.91  ? 194 GLY A N     1 
ATOM   1246  C  CA    . GLY A  1 194 ? -24.854 7.809    80.197  1.00 69.98  ? 194 GLY A CA    1 
ATOM   1247  C  C     . GLY A  1 194 ? -24.421 6.988    81.399  1.00 70.75  ? 194 GLY A C     1 
ATOM   1248  O  O     . GLY A  1 194 ? -23.259 7.020    81.808  1.00 69.72  ? 194 GLY A O     1 
ATOM   1249  N  N     . SER A  1 195 ? -25.372 6.242    81.955  1.00 72.97  ? 195 SER A N     1 
ATOM   1250  C  CA    . SER A  1 195 ? -25.147 5.434    83.150  1.00 74.48  ? 195 SER A CA    1 
ATOM   1251  C  C     . SER A  1 195 ? -24.619 4.048    82.820  1.00 74.19  ? 195 SER A C     1 
ATOM   1252  O  O     . SER A  1 195 ? -23.818 3.489    83.571  1.00 74.30  ? 195 SER A O     1 
ATOM   1253  C  CB    . SER A  1 195 ? -26.445 5.295    83.934  1.00 76.67  ? 195 SER A CB    1 
ATOM   1254  O  OG    . SER A  1 195 ? -27.070 6.553    84.056  1.00 78.02  ? 195 SER A OG    1 
ATOM   1255  N  N     . ASP A  1 196 ? -25.079 3.501    81.698  1.00 74.39  ? 196 ASP A N     1 
ATOM   1256  C  CA    . ASP A  1 196 ? -24.806 2.123    81.334  1.00 74.52  ? 196 ASP A CA    1 
ATOM   1257  C  C     . ASP A  1 196 ? -23.352 1.937    80.956  1.00 73.02  ? 196 ASP A C     1 
ATOM   1258  O  O     . ASP A  1 196 ? -22.921 2.370    79.884  1.00 71.70  ? 196 ASP A O     1 
ATOM   1259  C  CB    . ASP A  1 196 ? -25.713 1.684    80.187  1.00 74.95  ? 196 ASP A CB    1 
ATOM   1260  C  CG    . ASP A  1 196 ? -25.597 0.202    79.886  1.00 75.45  ? 196 ASP A CG    1 
ATOM   1261  O  OD1   . ASP A  1 196 ? -24.686 -0.456   80.441  1.00 75.31  ? 196 ASP A OD1   1 
ATOM   1262  O  OD2   . ASP A  1 196 ? -26.417 -0.305   79.089  1.00 76.44  ? 196 ASP A OD2   1 
ATOM   1263  N  N     . GLU A  1 197 ? -22.616 1.281    81.853  1.00 73.72  ? 197 GLU A N     1 
ATOM   1264  C  CA    . GLU A  1 197 ? -21.181 1.033    81.700  1.00 72.58  ? 197 GLU A CA    1 
ATOM   1265  C  C     . GLU A  1 197 ? -20.905 0.200    80.489  1.00 71.32  ? 197 GLU A C     1 
ATOM   1266  O  O     . GLU A  1 197 ? -20.033 0.534    79.700  1.00 70.16  ? 197 GLU A O     1 
ATOM   1267  C  CB    . GLU A  1 197 ? -20.630 0.284    82.908  1.00 73.90  ? 197 GLU A CB    1 
ATOM   1268  C  CG    . GLU A  1 197 ? -20.413 1.152    84.116  1.00 76.97  ? 197 GLU A CG    1 
ATOM   1269  C  CD    . GLU A  1 197 ? -19.376 2.223    83.859  1.00 78.21  ? 197 GLU A CD    1 
ATOM   1270  O  OE1   . GLU A  1 197 ? -18.283 1.868    83.343  1.00 77.77  ? 197 GLU A OE1   1 
ATOM   1271  O  OE2   . GLU A  1 197 ? -19.662 3.409    84.172  1.00 79.12  ? 197 GLU A OE2   1 
ATOM   1272  N  N     . SER A  1 198 ? -21.657 -0.886   80.346  1.00 71.97  ? 198 SER A N     1 
ATOM   1273  C  CA    . SER A  1 198 ? -21.421 -1.848   79.288  1.00 71.13  ? 198 SER A CA    1 
ATOM   1274  C  C     . SER A  1 198 ? -21.471 -1.194   77.909  1.00 69.59  ? 198 SER A C     1 
ATOM   1275  O  O     . SER A  1 198 ? -20.979 -1.770   76.933  1.00 69.02  ? 198 SER A O     1 
ATOM   1276  C  CB    . SER A  1 198 ? -22.425 -2.997   79.374  1.00 72.98  ? 198 SER A CB    1 
ATOM   1277  O  OG    . SER A  1 198 ? -23.636 -2.669   78.717  1.00 73.77  ? 198 SER A OG    1 
ATOM   1278  N  N     . LYS A  1 199 ? -22.047 0.007    77.840  1.00 68.89  ? 199 LYS A N     1 
ATOM   1279  C  CA    . LYS A  1 199 ? -22.192 0.726    76.577  1.00 67.56  ? 199 LYS A CA    1 
ATOM   1280  C  C     . LYS A  1 199 ? -21.080 1.736    76.294  1.00 65.49  ? 199 LYS A C     1 
ATOM   1281  O  O     . LYS A  1 199 ? -20.819 2.057    75.137  1.00 64.69  ? 199 LYS A O     1 
ATOM   1282  C  CB    . LYS A  1 199 ? -23.572 1.371    76.482  1.00 68.82  ? 199 LYS A CB    1 
ATOM   1283  C  CG    . LYS A  1 199 ? -24.672 0.378    76.104  1.00 71.23  ? 199 LYS A CG    1 
ATOM   1284  C  CD    . LYS A  1 199 ? -26.033 1.044    76.070  1.00 74.28  ? 199 LYS A CD    1 
ATOM   1285  C  CE    . LYS A  1 199 ? -26.912 0.446    74.989  1.00 76.74  ? 199 LYS A CE    1 
ATOM   1286  N  NZ    . LYS A  1 199 ? -28.088 1.329    74.705  1.00 79.41  ? 199 LYS A NZ    1 
ATOM   1287  N  N     . LYS A  1 200 ? -20.423 2.214    77.345  1.00 64.80  ? 200 LYS A N     1 
ATOM   1288  C  CA    . LYS A  1 200 ? -19.360 3.213    77.235  1.00 63.11  ? 200 LYS A CA    1 
ATOM   1289  C  C     . LYS A  1 200 ? -18.133 2.721    76.475  1.00 61.63  ? 200 LYS A C     1 
ATOM   1290  O  O     . LYS A  1 200 ? -17.838 1.524    76.454  1.00 61.73  ? 200 LYS A O     1 
ATOM   1291  C  CB    . LYS A  1 200 ? -18.924 3.658    78.628  1.00 63.61  ? 200 LYS A CB    1 
ATOM   1292  C  CG    . LYS A  1 200 ? -19.930 4.522    79.354  1.00 65.33  ? 200 LYS A CG    1 
ATOM   1293  C  CD    . LYS A  1 200 ? -19.411 4.948    80.709  1.00 66.81  ? 200 LYS A CD    1 
ATOM   1294  C  CE    . LYS A  1 200 ? -20.216 6.105    81.268  1.00 68.61  ? 200 LYS A CE    1 
ATOM   1295  N  NZ    . LYS A  1 200 ? -19.922 6.332    82.713  1.00 71.27  ? 200 LYS A NZ    1 
ATOM   1296  N  N     . LEU A  1 201 ? -17.415 3.662    75.865  1.00 60.37  ? 201 LEU A N     1 
ATOM   1297  C  CA    . LEU A  1 201 ? -16.168 3.375    75.160  1.00 58.83  ? 201 LEU A CA    1 
ATOM   1298  C  C     . LEU A  1 201 ? -15.140 4.431    75.549  1.00 58.21  ? 201 LEU A C     1 
ATOM   1299  O  O     . LEU A  1 201 ? -15.216 5.567    75.080  1.00 58.09  ? 201 LEU A O     1 
ATOM   1300  C  CB    . LEU A  1 201 ? -16.404 3.377    73.645  1.00 57.97  ? 201 LEU A CB    1 
ATOM   1301  C  CG    . LEU A  1 201 ? -15.258 2.951    72.729  1.00 56.34  ? 201 LEU A CG    1 
ATOM   1302  C  CD1   . LEU A  1 201 ? -14.970 1.471    72.841  1.00 56.34  ? 201 LEU A CD1   1 
ATOM   1303  C  CD2   . LEU A  1 201 ? -15.577 3.302    71.300  1.00 55.05  ? 201 LEU A CD2   1 
ATOM   1304  N  N     . TYR A  1 202 ? -14.200 4.063    76.419  1.00 58.21  ? 202 TYR A N     1 
ATOM   1305  C  CA    . TYR A  1 202 ? -13.164 4.990    76.911  1.00 58.09  ? 202 TYR A CA    1 
ATOM   1306  C  C     . TYR A  1 202 ? -12.025 5.111    75.911  1.00 57.34  ? 202 TYR A C     1 
ATOM   1307  O  O     . TYR A  1 202 ? -11.602 4.120    75.310  1.00 57.49  ? 202 TYR A O     1 
ATOM   1308  C  CB    . TYR A  1 202 ? -12.620 4.539    78.267  1.00 58.60  ? 202 TYR A CB    1 
ATOM   1309  C  CG    . TYR A  1 202 ? -13.708 4.304    79.291  1.00 60.02  ? 202 TYR A CG    1 
ATOM   1310  C  CD1   . TYR A  1 202 ? -14.129 5.326    80.148  1.00 59.07  ? 202 TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A  1 202 ? -14.334 3.059    79.389  1.00 60.66  ? 202 TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A  1 202 ? -15.128 5.107    81.070  1.00 59.62  ? 202 TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A  1 202 ? -15.343 2.837    80.308  1.00 60.80  ? 202 TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A  1 202 ? -15.731 3.860    81.141  1.00 60.57  ? 202 TYR A CZ    1 
ATOM   1315  O  OH    . TYR A  1 202 ? -16.723 3.619    82.051  1.00 62.29  ? 202 TYR A OH    1 
ATOM   1316  N  N     . CYS A  1 203 ? -11.520 6.321    75.723  1.00 57.01  ? 203 CYS A N     1 
ATOM   1317  C  CA    . CYS A  1 203 ? -10.625 6.552    74.601  1.00 56.32  ? 203 CYS A CA    1 
ATOM   1318  C  C     . CYS A  1 203 ? -9.197  6.807    75.048  1.00 55.91  ? 203 CYS A C     1 
ATOM   1319  O  O     . CYS A  1 203 ? -8.960  7.603    75.965  1.00 56.78  ? 203 CYS A O     1 
ATOM   1320  C  CB    . CYS A  1 203 ? -11.158 7.694    73.740  1.00 56.26  ? 203 CYS A CB    1 
ATOM   1321  S  SG    . CYS A  1 203 ? -12.839 7.375    73.098  1.00 58.92  ? 203 CYS A SG    1 
ATOM   1322  N  N     . VAL A  1 204 ? -8.253  6.110    74.415  1.00 54.94  ? 204 VAL A N     1 
ATOM   1323  C  CA    . VAL A  1 204 ? -6.826  6.312    74.659  1.00 53.99  ? 204 VAL A CA    1 
ATOM   1324  C  C     . VAL A  1 204 ? -6.217  6.796    73.375  1.00 53.12  ? 204 VAL A C     1 
ATOM   1325  O  O     . VAL A  1 204 ? -6.247  6.081    72.380  1.00 52.85  ? 204 VAL A O     1 
ATOM   1326  C  CB    . VAL A  1 204 ? -6.108  5.010    75.058  1.00 54.10  ? 204 VAL A CB    1 
ATOM   1327  C  CG1   . VAL A  1 204 ? -4.637  5.285    75.350  1.00 53.34  ? 204 VAL A CG1   1 
ATOM   1328  C  CG2   . VAL A  1 204 ? -6.779  4.380    76.263  1.00 55.10  ? 204 VAL A CG2   1 
ATOM   1329  N  N     . TYR A  1 205 ? -5.668  8.005    73.395  1.00 53.06  ? 205 TYR A N     1 
ATOM   1330  C  CA    . TYR A  1 205 ? -4.985  8.564    72.226  1.00 52.79  ? 205 TYR A CA    1 
ATOM   1331  C  C     . TYR A  1 205 ? -3.469  8.574    72.427  1.00 52.48  ? 205 TYR A C     1 
ATOM   1332  O  O     . TYR A  1 205 ? -2.973  9.160    73.389  1.00 53.13  ? 205 TYR A O     1 
ATOM   1333  C  CB    . TYR A  1 205 ? -5.495  9.970    71.922  1.00 52.96  ? 205 TYR A CB    1 
ATOM   1334  C  CG    . TYR A  1 205 ? -4.987  10.533   70.625  1.00 53.92  ? 205 TYR A CG    1 
ATOM   1335  C  CD1   . TYR A  1 205 ? -5.599  10.198   69.412  1.00 55.59  ? 205 TYR A CD1   1 
ATOM   1336  C  CD2   . TYR A  1 205 ? -3.900  11.401   70.602  1.00 55.52  ? 205 TYR A CD2   1 
ATOM   1337  C  CE1   . TYR A  1 205 ? -5.144  10.714   68.196  1.00 56.34  ? 205 TYR A CE1   1 
ATOM   1338  C  CE2   . TYR A  1 205 ? -3.427  11.934   69.397  1.00 57.46  ? 205 TYR A CE2   1 
ATOM   1339  C  CZ    . TYR A  1 205 ? -4.058  11.584   68.193  1.00 58.12  ? 205 TYR A CZ    1 
ATOM   1340  O  OH    . TYR A  1 205 ? -3.600  12.109   66.996  1.00 59.26  ? 205 TYR A OH    1 
ATOM   1341  N  N     . VAL A  1 206 ? -2.749  7.924    71.512  1.00 51.77  ? 206 VAL A N     1 
ATOM   1342  C  CA    . VAL A  1 206 ? -1.297  7.760    71.600  1.00 51.36  ? 206 VAL A CA    1 
ATOM   1343  C  C     . VAL A  1 206 ? -0.572  8.598    70.547  1.00 50.80  ? 206 VAL A C     1 
ATOM   1344  O  O     . VAL A  1 206 ? -0.550  8.245    69.371  1.00 50.62  ? 206 VAL A O     1 
ATOM   1345  C  CB    . VAL A  1 206 ? -0.895  6.290    71.398  1.00 51.41  ? 206 VAL A CB    1 
ATOM   1346  C  CG1   . VAL A  1 206 ? 0.500   6.035    71.966  1.00 52.09  ? 206 VAL A CG1   1 
ATOM   1347  C  CG2   . VAL A  1 206 ? -1.906  5.376    72.040  1.00 51.80  ? 206 VAL A CG2   1 
ATOM   1348  N  N     . ALA A  1 207 ? 0.027   9.701    70.969  1.00 50.90  ? 207 ALA A N     1 
ATOM   1349  C  CA    . ALA A  1 207 ? 0.755   10.580   70.055  1.00 50.88  ? 207 ALA A CA    1 
ATOM   1350  C  C     . ALA A  1 207 ? 2.241   10.208   69.965  1.00 50.88  ? 207 ALA A C     1 
ATOM   1351  O  O     . ALA A  1 207 ? 2.995   10.335   70.940  1.00 51.29  ? 207 ALA A O     1 
ATOM   1352  C  CB    . ALA A  1 207 ? 0.582   12.045   70.468  1.00 51.43  ? 207 ALA A CB    1 
ATOM   1353  N  N     . VAL A  1 208 ? 2.663   9.738    68.798  1.00 50.28  ? 208 VAL A N     1 
ATOM   1354  C  CA    . VAL A  1 208 ? 4.051   9.344    68.627  1.00 50.28  ? 208 VAL A CA    1 
ATOM   1355  C  C     . VAL A  1 208 ? 4.718   10.243   67.608  1.00 50.44  ? 208 VAL A C     1 
ATOM   1356  O  O     . VAL A  1 208 ? 4.300   10.295   66.460  1.00 50.47  ? 208 VAL A O     1 
ATOM   1357  C  CB    . VAL A  1 208 ? 4.192   7.872    68.193  1.00 49.95  ? 208 VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1 208 ? 5.667   7.491    68.082  1.00 50.01  ? 208 VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1 208 ? 3.483   6.956    69.176  1.00 49.73  ? 208 VAL A CG2   1 
ATOM   1360  N  N     . GLY A  1 209 ? 5.744   10.963   68.043  1.00 50.76  ? 209 GLY A N     1 
ATOM   1361  C  CA    . GLY A  1 209 ? 6.589   11.724   67.138  1.00 50.72  ? 209 GLY A CA    1 
ATOM   1362  C  C     . GLY A  1 209 ? 5.942   12.947   66.543  1.00 50.69  ? 209 GLY A C     1 
ATOM   1363  O  O     . GLY A  1 209 ? 6.451   13.505   65.581  1.00 51.09  ? 209 GLY A O     1 
ATOM   1364  N  N     . GLN A  1 210 ? 4.811   13.354   67.104  1.00 50.50  ? 210 GLN A N     1 
ATOM   1365  C  CA    . GLN A  1 210 ? 4.189   14.628   66.744  1.00 50.75  ? 210 GLN A CA    1 
ATOM   1366  C  C     . GLN A  1 210 ? 4.914   15.773   67.456  1.00 51.18  ? 210 GLN A C     1 
ATOM   1367  O  O     . GLN A  1 210 ? 5.630   15.534   68.427  1.00 51.26  ? 210 GLN A O     1 
ATOM   1368  C  CB    . GLN A  1 210 ? 2.726   14.658   67.185  1.00 50.67  ? 210 GLN A CB    1 
ATOM   1369  C  CG    . GLN A  1 210 ? 1.918   13.399   66.975  1.00 49.99  ? 210 GLN A CG    1 
ATOM   1370  C  CD    . GLN A  1 210 ? 0.439   13.694   67.093  1.00 51.06  ? 210 GLN A CD    1 
ATOM   1371  O  OE1   . GLN A  1 210 ? 0.047   14.858   67.170  1.00 51.85  ? 210 GLN A OE1   1 
ATOM   1372  N  NE2   . GLN A  1 210 ? -0.392  12.652   67.102  1.00 50.73  ? 210 GLN A NE2   1 
ATOM   1373  N  N     . LYS A  1 211 ? 4.713   17.007   66.997  1.00 51.45  ? 211 LYS A N     1 
ATOM   1374  C  CA    . LYS A  1 211 ? 5.123   18.179   67.784  1.00 52.34  ? 211 LYS A CA    1 
ATOM   1375  C  C     . LYS A  1 211 ? 4.305   18.247   69.067  1.00 52.55  ? 211 LYS A C     1 
ATOM   1376  O  O     . LYS A  1 211 ? 3.297   17.554   69.188  1.00 52.04  ? 211 LYS A O     1 
ATOM   1377  C  CB    . LYS A  1 211 ? 5.018   19.500   66.997  1.00 53.14  ? 211 LYS A CB    1 
ATOM   1378  C  CG    . LYS A  1 211 ? 4.238   19.459   65.697  1.00 51.98  ? 211 LYS A CG    1 
ATOM   1379  C  CD    . LYS A  1 211 ? 4.435   20.739   64.906  1.00 52.22  ? 211 LYS A CD    1 
ATOM   1380  C  CE    . LYS A  1 211 ? 3.394   21.797   65.271  1.00 54.58  ? 211 LYS A CE    1 
ATOM   1381  N  NZ    . LYS A  1 211 ? 3.672   23.161   64.710  1.00 56.11  ? 211 LYS A NZ    1 
ATOM   1382  N  N     . ARG A  1 212 ? 4.741   19.051   70.033  1.00 53.62  ? 212 ARG A N     1 
ATOM   1383  C  CA    . ARG A  1 212 ? 3.986   19.192   71.279  1.00 54.04  ? 212 ARG A CA    1 
ATOM   1384  C  C     . ARG A  1 212 ? 2.794   20.127   71.148  1.00 54.78  ? 212 ARG A C     1 
ATOM   1385  O  O     . ARG A  1 212 ? 1.727   19.843   71.681  1.00 54.60  ? 212 ARG A O     1 
ATOM   1386  C  CB    . ARG A  1 212 ? 4.878   19.655   72.406  1.00 54.89  ? 212 ARG A CB    1 
ATOM   1387  C  CG    . ARG A  1 212 ? 5.404   18.533   73.218  1.00 55.04  ? 212 ARG A CG    1 
ATOM   1388  C  CD    . ARG A  1 212 ? 6.500   19.027   74.116  1.00 57.55  ? 212 ARG A CD    1 
ATOM   1389  N  NE    . ARG A  1 212 ? 7.302   17.933   74.647  1.00 58.13  ? 212 ARG A NE    1 
ATOM   1390  C  CZ    . ARG A  1 212 ? 8.592   18.032   74.944  1.00 59.50  ? 212 ARG A CZ    1 
ATOM   1391  N  NH1   . ARG A  1 212 ? 9.250   19.173   74.756  1.00 60.56  ? 212 ARG A NH1   1 
ATOM   1392  N  NH2   . ARG A  1 212 ? 9.229   16.978   75.424  1.00 60.02  ? 212 ARG A NH2   1 
ATOM   1393  N  N     . SER A  1 213 ? 2.975   21.239   70.441  1.00 55.92  ? 213 SER A N     1 
ATOM   1394  C  CA    . SER A  1 213 ? 1.869   22.146   70.159  1.00 56.93  ? 213 SER A CA    1 
ATOM   1395  C  C     . SER A  1 213 ? 0.687   21.436   69.456  1.00 56.36  ? 213 SER A C     1 
ATOM   1396  O  O     . SER A  1 213 ? -0.480  21.798   69.665  1.00 57.16  ? 213 SER A O     1 
ATOM   1397  C  CB    . SER A  1 213 ? 2.342   23.355   69.352  1.00 57.94  ? 213 SER A CB    1 
ATOM   1398  O  OG    . SER A  1 213 ? 2.836   22.961   68.090  1.00 57.69  ? 213 SER A OG    1 
ATOM   1399  N  N     . THR A  1 214 ? 0.971   20.432   68.634  1.00 55.05  ? 214 THR A N     1 
ATOM   1400  C  CA    . THR A  1 214 ? -0.109  19.673   68.034  1.00 54.35  ? 214 THR A CA    1 
ATOM   1401  C  C     . THR A  1 214 ? -0.924  18.948   69.101  1.00 54.12  ? 214 THR A C     1 
ATOM   1402  O  O     . THR A  1 214 ? -2.150  19.007   69.102  1.00 54.61  ? 214 THR A O     1 
ATOM   1403  C  CB    . THR A  1 214 ? 0.413   18.682   67.014  1.00 53.30  ? 214 THR A CB    1 
ATOM   1404  O  OG1   . THR A  1 214 ? 1.023   19.413   65.955  1.00 54.16  ? 214 THR A OG1   1 
ATOM   1405  C  CG2   . THR A  1 214 ? -0.719  17.856   66.445  1.00 52.45  ? 214 THR A CG2   1 
ATOM   1406  N  N     . VAL A  1 215 ? -0.233  18.272   70.007  1.00 53.93  ? 215 VAL A N     1 
ATOM   1407  C  CA    . VAL A  1 215 ? -0.877  17.496   71.047  1.00 53.76  ? 215 VAL A CA    1 
ATOM   1408  C  C     . VAL A  1 215 ? -1.595  18.438   72.011  1.00 55.43  ? 215 VAL A C     1 
ATOM   1409  O  O     . VAL A  1 215 ? -2.722  18.158   72.436  1.00 55.92  ? 215 VAL A O     1 
ATOM   1410  C  CB    . VAL A  1 215 ? 0.146   16.621   71.772  1.00 53.11  ? 215 VAL A CB    1 
ATOM   1411  C  CG1   . VAL A  1 215 ? -0.480  15.935   72.964  1.00 52.97  ? 215 VAL A CG1   1 
ATOM   1412  C  CG2   . VAL A  1 215 ? 0.719   15.600   70.804  1.00 52.26  ? 215 VAL A CG2   1 
ATOM   1413  N  N     . ALA A  1 216 ? -0.952  19.558   72.333  1.00 56.61  ? 216 ALA A N     1 
ATOM   1414  C  CA    . ALA A  1 216 ? -1.586  20.615   73.093  1.00 58.23  ? 216 ALA A CA    1 
ATOM   1415  C  C     . ALA A  1 216 ? -2.918  21.027   72.444  1.00 59.19  ? 216 ALA A C     1 
ATOM   1416  O  O     . ALA A  1 216 ? -3.959  20.999   73.097  1.00 59.93  ? 216 ALA A O     1 
ATOM   1417  C  CB    . ALA A  1 216 ? -0.657  21.791   73.222  1.00 59.11  ? 216 ALA A CB    1 
ATOM   1418  N  N     . GLN A  1 217 ? -2.904  21.371   71.158  1.00 59.87  ? 217 GLN A N     1 
ATOM   1419  C  CA    . GLN A  1 217 ? -4.144  21.756   70.479  1.00 61.17  ? 217 GLN A CA    1 
ATOM   1420  C  C     . GLN A  1 217 ? -5.181  20.630   70.476  1.00 60.51  ? 217 GLN A C     1 
ATOM   1421  O  O     . GLN A  1 217 ? -6.365  20.886   70.703  1.00 61.61  ? 217 GLN A O     1 
ATOM   1422  C  CB    . GLN A  1 217 ? -3.893  22.295   69.057  1.00 61.74  ? 217 GLN A CB    1 
ATOM   1423  C  CG    . GLN A  1 217 ? -5.177  22.755   68.294  1.00 64.14  ? 217 GLN A CG    1 
ATOM   1424  C  CD    . GLN A  1 217 ? -6.033  23.799   69.054  1.00 66.89  ? 217 GLN A CD    1 
ATOM   1425  O  OE1   . GLN A  1 217 ? -5.510  24.794   69.569  1.00 68.24  ? 217 GLN A OE1   1 
ATOM   1426  N  NE2   . GLN A  1 217 ? -7.356  23.571   69.110  1.00 66.72  ? 217 GLN A NE2   1 
ATOM   1427  N  N     . LEU A  1 218 ? -4.748  19.393   70.233  1.00 59.41  ? 218 LEU A N     1 
ATOM   1428  C  CA    . LEU A  1 218 ? -5.657  18.237   70.290  1.00 58.61  ? 218 LEU A CA    1 
ATOM   1429  C  C     . LEU A  1 218 ? -6.357  18.110   71.660  1.00 59.06  ? 218 LEU A C     1 
ATOM   1430  O  O     . LEU A  1 218 ? -7.590  17.985   71.737  1.00 59.40  ? 218 LEU A O     1 
ATOM   1431  C  CB    . LEU A  1 218 ? -4.922  16.944   69.952  1.00 57.09  ? 218 LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1 218 ? -5.867  15.747   69.868  1.00 56.65  ? 218 LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1 218 ? -6.164  15.380   68.436  1.00 56.48  ? 218 LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1 218 ? -5.276  14.566   70.586  1.00 56.82  ? 218 LEU A CD2   1 
ATOM   1435  N  N     . VAL A  1 219 ? -5.566  18.153   72.732  1.00 59.00  ? 219 VAL A N     1 
ATOM   1436  C  CA    . VAL A  1 219 ? -6.105  18.108   74.091  1.00 59.52  ? 219 VAL A CA    1 
ATOM   1437  C  C     . VAL A  1 219 ? -7.139  19.218   74.287  1.00 60.92  ? 219 VAL A C     1 
ATOM   1438  O  O     . VAL A  1 219 ? -8.240  18.991   74.798  1.00 61.32  ? 219 VAL A O     1 
ATOM   1439  C  CB    . VAL A  1 219 ? -4.972  18.173   75.149  1.00 59.69  ? 219 VAL A CB    1 
ATOM   1440  C  CG1   . VAL A  1 219 ? -5.515  18.487   76.553  1.00 60.43  ? 219 VAL A CG1   1 
ATOM   1441  C  CG2   . VAL A  1 219 ? -4.182  16.868   75.148  1.00 58.19  ? 219 VAL A CG2   1 
ATOM   1442  N  N     . GLN A  1 220 ? -6.775  20.411   73.843  1.00 61.83  ? 220 GLN A N     1 
ATOM   1443  C  CA    . GLN A  1 220 ? -7.658  21.558   73.863  1.00 63.67  ? 220 GLN A CA    1 
ATOM   1444  C  C     . GLN A  1 220 ? -8.996  21.254   73.178  1.00 63.41  ? 220 GLN A C     1 
ATOM   1445  O  O     . GLN A  1 220 ? -10.060 21.595   73.699  1.00 64.46  ? 220 GLN A O     1 
ATOM   1446  C  CB    . GLN A  1 220 ? -6.957  22.711   73.168  1.00 64.60  ? 220 GLN A CB    1 
ATOM   1447  C  CG    . GLN A  1 220 ? -7.270  24.062   73.711  1.00 68.77  ? 220 GLN A CG    1 
ATOM   1448  C  CD    . GLN A  1 220 ? -6.257  25.073   73.231  1.00 73.08  ? 220 GLN A CD    1 
ATOM   1449  O  OE1   . GLN A  1 220 ? -6.564  25.951   72.408  1.00 76.09  ? 220 GLN A OE1   1 
ATOM   1450  N  NE2   . GLN A  1 220 ? -5.020  24.940   73.718  1.00 73.01  ? 220 GLN A NE2   1 
ATOM   1451  N  N     . THR A  1 221 ? -8.935  20.593   72.025  1.00 62.14  ? 221 THR A N     1 
ATOM   1452  C  CA    . THR A  1 221 ? -10.127 20.294   71.229  1.00 62.12  ? 221 THR A CA    1 
ATOM   1453  C  C     . THR A  1 221 ? -11.064 19.296   71.922  1.00 61.71  ? 221 THR A C     1 
ATOM   1454  O  O     . THR A  1 221 ? -12.280 19.510   71.955  1.00 62.47  ? 221 THR A O     1 
ATOM   1455  C  CB    . THR A  1 221 ? -9.744  19.800   69.817  1.00 61.29  ? 221 THR A CB    1 
ATOM   1456  O  OG1   . THR A  1 221 ? -8.755  20.679   69.271  1.00 61.72  ? 221 THR A OG1   1 
ATOM   1457  C  CG2   . THR A  1 221 ? -10.959 19.759   68.885  1.00 61.37  ? 221 THR A CG2   1 
ATOM   1458  N  N     . LEU A  1 222 ? -10.499 18.223   72.477  1.00 60.40  ? 222 LEU A N     1 
ATOM   1459  C  CA    . LEU A  1 222 ? -11.270 17.271   73.279  1.00 60.31  ? 222 LEU A CA    1 
ATOM   1460  C  C     . LEU A  1 222 ? -12.009 17.970   74.433  1.00 61.97  ? 222 LEU A C     1 
ATOM   1461  O  O     . LEU A  1 222 ? -13.191 17.722   74.671  1.00 62.13  ? 222 LEU A O     1 
ATOM   1462  C  CB    . LEU A  1 222 ? -10.363 16.161   73.829  1.00 59.05  ? 222 LEU A CB    1 
ATOM   1463  C  CG    . LEU A  1 222 ? -9.672  15.145   72.907  1.00 57.18  ? 222 LEU A CG    1 
ATOM   1464  C  CD1   . LEU A  1 222 ? -8.811  14.216   73.726  1.00 55.83  ? 222 LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A  1 222 ? -10.656 14.322   72.103  1.00 56.27  ? 222 LEU A CD2   1 
ATOM   1466  N  N     . GLU A  1 223 ? -11.294 18.849   75.133  1.00 63.24  ? 223 GLU A N     1 
ATOM   1467  C  CA    . GLU A  1 223 ? -11.852 19.624   76.233  1.00 65.49  ? 223 GLU A CA    1 
ATOM   1468  C  C     . GLU A  1 223 ? -12.996 20.495   75.793  1.00 66.75  ? 223 GLU A C     1 
ATOM   1469  O  O     . GLU A  1 223 ? -14.028 20.523   76.443  1.00 67.83  ? 223 GLU A O     1 
ATOM   1470  C  CB    . GLU A  1 223 ? -10.782 20.486   76.874  1.00 66.26  ? 223 GLU A CB    1 
ATOM   1471  C  CG    . GLU A  1 223 ? -10.179 19.860   78.107  1.00 69.01  ? 223 GLU A CG    1 
ATOM   1472  C  CD    . GLU A  1 223 ? -8.906  20.560   78.560  1.00 73.88  ? 223 GLU A CD    1 
ATOM   1473  O  OE1   . GLU A  1 223 ? -8.745  21.782   78.286  1.00 76.02  ? 223 GLU A OE1   1 
ATOM   1474  O  OE2   . GLU A  1 223 ? -8.060  19.876   79.195  1.00 75.52  ? 223 GLU A OE2   1 
ATOM   1475  N  N     . GLN A  1 224 ? -12.808 21.207   74.688  1.00 67.24  ? 224 GLN A N     1 
ATOM   1476  C  CA    . GLN A  1 224 ? -13.867 22.037   74.114  1.00 69.07  ? 224 GLN A CA    1 
ATOM   1477  C  C     . GLN A  1 224 ? -15.124 21.224   73.806  1.00 68.46  ? 224 GLN A C     1 
ATOM   1478  O  O     . GLN A  1 224 ? -16.238 21.683   74.051  1.00 70.07  ? 224 GLN A O     1 
ATOM   1479  C  CB    . GLN A  1 224 ? -13.375 22.747   72.851  1.00 69.70  ? 224 GLN A CB    1 
ATOM   1480  C  CG    . GLN A  1 224 ? -12.400 23.887   73.116  1.00 73.23  ? 224 GLN A CG    1 
ATOM   1481  C  CD    . GLN A  1 224 ? -11.869 24.514   71.837  1.00 77.41  ? 224 GLN A CD    1 
ATOM   1482  O  OE1   . GLN A  1 224 ? -12.636 24.831   70.913  1.00 79.27  ? 224 GLN A OE1   1 
ATOM   1483  N  NE2   . GLN A  1 224 ? -10.545 24.705   71.777  1.00 78.50  ? 224 GLN A NE2   1 
ATOM   1484  N  N     . HIS A  1 225 ? -14.933 20.014   73.283  1.00 66.23  ? 225 HIS A N     1 
ATOM   1485  C  CA    . HIS A  1 225 ? -16.042 19.124   72.967  1.00 65.49  ? 225 HIS A CA    1 
ATOM   1486  C  C     . HIS A  1 225 ? -16.306 18.144   74.101  1.00 64.87  ? 225 HIS A C     1 
ATOM   1487  O  O     . HIS A  1 225 ? -16.823 17.055   73.873  1.00 64.47  ? 225 HIS A O     1 
ATOM   1488  C  CB    . HIS A  1 225 ? -15.761 18.362   71.675  1.00 64.19  ? 225 HIS A CB    1 
ATOM   1489  C  CG    . HIS A  1 225 ? -15.672 19.237   70.468  1.00 64.25  ? 225 HIS A CG    1 
ATOM   1490  N  ND1   . HIS A  1 225 ? -14.717 20.219   70.330  1.00 63.96  ? 225 HIS A ND1   1 
ATOM   1491  C  CD2   . HIS A  1 225 ? -16.417 19.277   69.340  1.00 64.71  ? 225 HIS A CD2   1 
ATOM   1492  C  CE1   . HIS A  1 225 ? -14.878 20.829   69.170  1.00 64.53  ? 225 HIS A CE1   1 
ATOM   1493  N  NE2   . HIS A  1 225 ? -15.903 20.275   68.550  1.00 64.77  ? 225 HIS A NE2   1 
ATOM   1494  N  N     . ASP A  1 226 ? -15.930 18.534   75.316  1.00 64.80  ? 226 ASP A N     1 
ATOM   1495  C  CA    . ASP A  1 226 ? -16.185 17.757   76.533  1.00 64.44  ? 226 ASP A CA    1 
ATOM   1496  C  C     . ASP A  1 226 ? -15.919 16.266   76.397  1.00 62.61  ? 226 ASP A C     1 
ATOM   1497  O  O     . ASP A  1 226 ? -16.676 15.461   76.933  1.00 62.85  ? 226 ASP A O     1 
ATOM   1498  C  CB    . ASP A  1 226 ? -17.620 17.994   77.020  1.00 66.28  ? 226 ASP A CB    1 
ATOM   1499  C  CG    . ASP A  1 226 ? -17.876 17.431   78.416  1.00 67.33  ? 226 ASP A CG    1 
ATOM   1500  O  OD1   . ASP A  1 226 ? -16.941 17.405   79.249  1.00 67.57  ? 226 ASP A OD1   1 
ATOM   1501  O  OD2   . ASP A  1 226 ? -19.025 17.014   78.676  1.00 69.01  ? 226 ASP A OD2   1 
ATOM   1502  N  N     . ALA A  1 227 ? -14.847 15.909   75.686  1.00 60.89  ? 227 ALA A N     1 
ATOM   1503  C  CA    . ALA A  1 227 ? -14.509 14.499   75.404  1.00 59.34  ? 227 ALA A CA    1 
ATOM   1504  C  C     . ALA A  1 227 ? -13.300 14.021   76.197  1.00 58.44  ? 227 ALA A C     1 
ATOM   1505  O  O     . ALA A  1 227 ? -13.081 12.819   76.351  1.00 57.39  ? 227 ALA A O     1 
ATOM   1506  C  CB    . ALA A  1 227 ? -14.283 14.286   73.915  1.00 58.39  ? 227 ALA A CB    1 
ATOM   1507  N  N     . MET A  1 228 ? -12.540 14.992   76.702  1.00 58.82  ? 228 MET A N     1 
ATOM   1508  C  CA    . MET A  1 228 ? -11.318 14.779   77.472  1.00 58.32  ? 228 MET A CA    1 
ATOM   1509  C  C     . MET A  1 228 ? -11.577 13.965   78.745  1.00 58.44  ? 228 MET A C     1 
ATOM   1510  O  O     . MET A  1 228 ? -10.725 13.164   79.165  1.00 58.04  ? 228 MET A O     1 
ATOM   1511  C  CB    . MET A  1 228 ? -10.702 16.148   77.802  1.00 59.12  ? 228 MET A CB    1 
ATOM   1512  C  CG    . MET A  1 228 ? -9.454  16.156   78.682  1.00 60.31  ? 228 MET A CG    1 
ATOM   1513  S  SD    . MET A  1 228 ? -8.076  15.148   78.082  1.00 61.81  ? 228 MET A SD    1 
ATOM   1514  C  CE    . MET A  1 228 ? -7.745  15.895   76.502  1.00 61.05  ? 228 MET A CE    1 
ATOM   1515  N  N     . LYS A  1 229 ? -12.761 14.155   79.332  1.00 58.89  ? 229 LYS A N     1 
ATOM   1516  C  CA    . LYS A  1 229 ? -13.130 13.502   80.589  1.00 59.03  ? 229 LYS A CA    1 
ATOM   1517  C  C     . LYS A  1 229 ? -13.224 11.998   80.481  1.00 58.27  ? 229 LYS A C     1 
ATOM   1518  O  O     . LYS A  1 229 ? -13.159 11.325   81.493  1.00 59.05  ? 229 LYS A O     1 
ATOM   1519  C  CB    . LYS A  1 229 ? -14.428 14.080   81.168  1.00 60.59  ? 229 LYS A CB    1 
ATOM   1520  C  CG    . LYS A  1 229 ? -15.705 13.676   80.448  1.00 60.59  ? 229 LYS A CG    1 
ATOM   1521  C  CD    . LYS A  1 229 ? -16.903 14.509   80.887  1.00 61.09  ? 229 LYS A CD    1 
ATOM   1522  C  CE    . LYS A  1 229 ? -18.124 14.184   80.034  1.00 60.47  ? 229 LYS A CE    1 
ATOM   1523  N  NZ    . LYS A  1 229 ? -19.352 14.868   80.532  1.00 62.38  ? 229 LYS A NZ    1 
ATOM   1524  N  N     . TYR A  1 230 ? -13.376 11.468   79.267  1.00 57.17  ? 230 TYR A N     1 
ATOM   1525  C  CA    . TYR A  1 230 ? -13.346 10.017   79.052  1.00 56.31  ? 230 TYR A CA    1 
ATOM   1526  C  C     . TYR A  1 230 ? -12.124 9.511    78.279  1.00 55.22  ? 230 TYR A C     1 
ATOM   1527  O  O     . TYR A  1 230 ? -12.082 8.357    77.846  1.00 54.74  ? 230 TYR A O     1 
ATOM   1528  C  CB    . TYR A  1 230 ? -14.641 9.524    78.402  1.00 56.48  ? 230 TYR A CB    1 
ATOM   1529  C  CG    . TYR A  1 230 ? -15.025 10.130   77.052  1.00 55.28  ? 230 TYR A CG    1 
ATOM   1530  C  CD1   . TYR A  1 230 ? -14.496 9.637    75.845  1.00 53.02  ? 230 TYR A CD1   1 
ATOM   1531  C  CD2   . TYR A  1 230 ? -15.978 11.145   76.982  1.00 54.98  ? 230 TYR A CD2   1 
ATOM   1532  C  CE1   . TYR A  1 230 ? -14.892 10.176   74.614  1.00 52.47  ? 230 TYR A CE1   1 
ATOM   1533  C  CE2   . TYR A  1 230 ? -16.375 11.685   75.769  1.00 54.10  ? 230 TYR A CE2   1 
ATOM   1534  C  CZ    . TYR A  1 230 ? -15.835 11.208   74.592  1.00 53.44  ? 230 TYR A CZ    1 
ATOM   1535  O  OH    . TYR A  1 230 ? -16.261 11.777   73.412  1.00 52.80  ? 230 TYR A OH    1 
ATOM   1536  N  N     . SER A  1 231 ? -11.120 10.363   78.123  1.00 55.05  ? 231 SER A N     1 
ATOM   1537  C  CA    . SER A  1 231 ? -9.949  9.983    77.355  1.00 54.52  ? 231 SER A CA    1 
ATOM   1538  C  C     . SER A  1 231 ? -8.696  10.028   78.179  1.00 54.55  ? 231 SER A C     1 
ATOM   1539  O  O     . SER A  1 231 ? -8.640  10.724   79.196  1.00 55.64  ? 231 SER A O     1 
ATOM   1540  C  CB    . SER A  1 231 ? -9.759  10.906   76.166  1.00 54.11  ? 231 SER A CB    1 
ATOM   1541  O  OG    . SER A  1 231 ? -10.999 11.213   75.580  1.00 56.48  ? 231 SER A OG    1 
ATOM   1542  N  N     . ILE A  1 232 ? -7.697  9.281    77.717  1.00 53.58  ? 232 ILE A N     1 
ATOM   1543  C  CA    . ILE A  1 232 ? -6.350  9.333    78.247  1.00 53.41  ? 232 ILE A CA    1 
ATOM   1544  C  C     . ILE A  1 232 ? -5.456  9.632    77.067  1.00 52.53  ? 232 ILE A C     1 
ATOM   1545  O  O     . ILE A  1 232 ? -5.568  8.990    76.025  1.00 51.79  ? 232 ILE A O     1 
ATOM   1546  C  CB    . ILE A  1 232 ? -5.938  7.982    78.857  1.00 53.74  ? 232 ILE A CB    1 
ATOM   1547  C  CG1   . ILE A  1 232 ? -6.901  7.582    79.976  1.00 54.56  ? 232 ILE A CG1   1 
ATOM   1548  C  CG2   . ILE A  1 232 ? -4.502  8.037    79.377  1.00 54.09  ? 232 ILE A CG2   1 
ATOM   1549  C  CD1   . ILE A  1 232 ? -6.891  6.119    80.303  1.00 54.51  ? 232 ILE A CD1   1 
ATOM   1550  N  N     . ILE A  1 233 ? -4.574  10.611   77.224  1.00 52.89  ? 233 ILE A N     1 
ATOM   1551  C  CA    . ILE A  1 233 ? -3.586  10.941   76.188  1.00 52.30  ? 233 ILE A CA    1 
ATOM   1552  C  C     . ILE A  1 233 ? -2.180  10.446   76.569  1.00 52.56  ? 233 ILE A C     1 
ATOM   1553  O  O     . ILE A  1 233 ? -1.659  10.794   77.632  1.00 53.53  ? 233 ILE A O     1 
ATOM   1554  C  CB    . ILE A  1 233 ? -3.519  12.472   75.942  1.00 52.51  ? 233 ILE A CB    1 
ATOM   1555  C  CG1   . ILE A  1 233 ? -4.921  13.080   75.705  1.00 52.09  ? 233 ILE A CG1   1 
ATOM   1556  C  CG2   . ILE A  1 233 ? -2.469  12.808   74.855  1.00 51.92  ? 233 ILE A CG2   1 
ATOM   1557  C  CD1   . ILE A  1 233 ? -5.622  12.674   74.423  1.00 49.99  ? 233 ILE A CD1   1 
ATOM   1558  N  N     . VAL A  1 234 ? -1.575  9.632    75.709  1.00 52.03  ? 234 VAL A N     1 
ATOM   1559  C  CA    . VAL A  1 234 ? -0.206  9.156    75.925  1.00 52.46  ? 234 VAL A CA    1 
ATOM   1560  C  C     . VAL A  1 234 ? 0.637   9.797    74.856  1.00 52.30  ? 234 VAL A C     1 
ATOM   1561  O  O     . VAL A  1 234 ? 0.422   9.534    73.680  1.00 51.97  ? 234 VAL A O     1 
ATOM   1562  C  CB    . VAL A  1 234 ? -0.091  7.617    75.817  1.00 52.19  ? 234 VAL A CB    1 
ATOM   1563  C  CG1   . VAL A  1 234 ? 1.349   7.198    75.680  1.00 52.06  ? 234 VAL A CG1   1 
ATOM   1564  C  CG2   . VAL A  1 234 ? -0.697  6.958    77.036  1.00 53.25  ? 234 VAL A CG2   1 
ATOM   1565  N  N     . ALA A  1 235 ? 1.583   10.644   75.253  1.00 53.24  ? 235 ALA A N     1 
ATOM   1566  C  CA    . ALA A  1 235 ? 2.381   11.406   74.289  1.00 53.33  ? 235 ALA A CA    1 
ATOM   1567  C  C     . ALA A  1 235 ? 3.862   11.062   74.370  1.00 54.00  ? 235 ALA A C     1 
ATOM   1568  O  O     . ALA A  1 235 ? 4.468   11.114   75.436  1.00 55.30  ? 235 ALA A O     1 
ATOM   1569  C  CB    . ALA A  1 235 ? 2.174   12.894   74.484  1.00 53.63  ? 235 ALA A CB    1 
ATOM   1570  N  N     . ALA A  1 236 ? 4.442   10.695   73.239  1.00 53.70  ? 236 ALA A N     1 
ATOM   1571  C  CA    . ALA A  1 236 ? 5.880   10.579   73.142  1.00 54.56  ? 236 ALA A CA    1 
ATOM   1572  C  C     . ALA A  1 236 ? 6.289   11.381   71.911  1.00 54.48  ? 236 ALA A C     1 
ATOM   1573  O  O     . ALA A  1 236 ? 6.325   10.870   70.788  1.00 53.96  ? 236 ALA A O     1 
ATOM   1574  C  CB    . ALA A  1 236 ? 6.295   9.116    73.044  1.00 54.70  ? 236 ALA A CB    1 
ATOM   1575  N  N     . THR A  1 237 ? 6.568   12.658   72.134  1.00 55.20  ? 237 THR A N     1 
ATOM   1576  C  CA    . THR A  1 237 ? 6.615   13.627   71.043  1.00 55.47  ? 237 THR A CA    1 
ATOM   1577  C  C     . THR A  1 237 ? 7.916   13.624   70.243  1.00 55.82  ? 237 THR A C     1 
ATOM   1578  O  O     . THR A  1 237 ? 8.775   12.758   70.427  1.00 56.07  ? 237 THR A O     1 
ATOM   1579  C  CB    . THR A  1 237 ? 6.272   15.033   71.543  1.00 56.25  ? 237 THR A CB    1 
ATOM   1580  O  OG1   . THR A  1 237 ? 7.121   15.374   72.647  1.00 58.14  ? 237 THR A OG1   1 
ATOM   1581  C  CG2   . THR A  1 237 ? 4.820   15.079   71.994  1.00 55.81  ? 237 THR A CG2   1 
ATOM   1582  N  N     . ALA A  1 238 ? 8.039   14.608   69.357  1.00 56.16  ? 238 ALA A N     1 
ATOM   1583  C  CA    . ALA A  1 238 ? 9.086   14.647   68.332  1.00 56.43  ? 238 ALA A CA    1 
ATOM   1584  C  C     . ALA A  1 238 ? 10.501  14.634   68.884  1.00 57.33  ? 238 ALA A C     1 
ATOM   1585  O  O     . ALA A  1 238 ? 11.378  13.999   68.316  1.00 57.53  ? 238 ALA A O     1 
ATOM   1586  C  CB    . ALA A  1 238 ? 8.893   15.863   67.435  1.00 56.69  ? 238 ALA A CB    1 
ATOM   1587  N  N     . SER A  1 239 ? 10.721  15.341   69.986  1.00 58.31  ? 239 SER A N     1 
ATOM   1588  C  CA    . SER A  1 239 ? 12.068  15.535   70.500  1.00 59.42  ? 239 SER A CA    1 
ATOM   1589  C  C     . SER A  1 239 ? 12.481  14.482   71.525  1.00 59.74  ? 239 SER A C     1 
ATOM   1590  O  O     . SER A  1 239 ? 13.643  14.462   71.932  1.00 61.42  ? 239 SER A O     1 
ATOM   1591  C  CB    . SER A  1 239 ? 12.206  16.925   71.114  1.00 60.39  ? 239 SER A CB    1 
ATOM   1592  O  OG    . SER A  1 239 ? 11.407  17.038   72.283  1.00 60.77  ? 239 SER A OG    1 
ATOM   1593  N  N     . GLU A  1 240 ? 11.552  13.616   71.937  1.00 58.55  ? 240 GLU A N     1 
ATOM   1594  C  CA    . GLU A  1 240 ? 11.820  12.649   73.007  1.00 58.60  ? 240 GLU A CA    1 
ATOM   1595  C  C     . GLU A  1 240 ? 12.630  11.485   72.498  1.00 58.27  ? 240 GLU A C     1 
ATOM   1596  O  O     . GLU A  1 240 ? 12.445  11.054   71.361  1.00 57.17  ? 240 GLU A O     1 
ATOM   1597  C  CB    . GLU A  1 240 ? 10.524  12.111   73.609  1.00 58.19  ? 240 GLU A CB    1 
ATOM   1598  C  CG    . GLU A  1 240 ? 9.407   13.117   73.680  1.00 58.96  ? 240 GLU A CG    1 
ATOM   1599  C  CD    . GLU A  1 240 ? 8.739   13.164   75.036  1.00 61.30  ? 240 GLU A CD    1 
ATOM   1600  O  OE1   . GLU A  1 240 ? 7.508   13.422   75.064  1.00 61.80  ? 240 GLU A OE1   1 
ATOM   1601  O  OE2   . GLU A  1 240 ? 9.449   12.961   76.061  1.00 62.47  ? 240 GLU A OE2   1 
ATOM   1602  N  N     . ALA A  1 241 ? 13.507  10.965   73.355  1.00 59.24  ? 241 ALA A N     1 
ATOM   1603  C  CA    . ALA A  1 241 ? 14.409  9.860    72.993  1.00 59.68  ? 241 ALA A CA    1 
ATOM   1604  C  C     . ALA A  1 241 ? 13.680  8.700    72.312  1.00 58.57  ? 241 ALA A C     1 
ATOM   1605  O  O     . ALA A  1 241 ? 12.564  8.341    72.704  1.00 57.70  ? 241 ALA A O     1 
ATOM   1606  C  CB    . ALA A  1 241 ? 15.162  9.373    74.213  1.00 61.04  ? 241 ALA A CB    1 
ATOM   1607  N  N     . ALA A  1 242 ? 14.315  8.117    71.294  1.00 58.55  ? 242 ALA A N     1 
ATOM   1608  C  CA    . ALA A  1 242 ? 13.703  7.012    70.539  1.00 57.74  ? 242 ALA A CA    1 
ATOM   1609  C  C     . ALA A  1 242 ? 12.987  5.978    71.424  1.00 57.79  ? 242 ALA A C     1 
ATOM   1610  O  O     . ALA A  1 242 ? 11.804  5.716    71.210  1.00 57.11  ? 242 ALA A O     1 
ATOM   1611  C  CB    . ALA A  1 242 ? 14.705  6.345    69.606  1.00 57.81  ? 242 ALA A CB    1 
ATOM   1612  N  N     . PRO A  1 243 ? 13.671  5.427    72.447  1.00 59.00  ? 243 PRO A N     1 
ATOM   1613  C  CA    . PRO A  1 243 ? 13.027  4.338    73.171  1.00 59.30  ? 243 PRO A CA    1 
ATOM   1614  C  C     . PRO A  1 243 ? 11.621  4.677    73.677  1.00 58.51  ? 243 PRO A C     1 
ATOM   1615  O  O     . PRO A  1 243 ? 10.777  3.784    73.762  1.00 58.45  ? 243 PRO A O     1 
ATOM   1616  C  CB    . PRO A  1 243 ? 13.970  4.099    74.353  1.00 61.16  ? 243 PRO A CB    1 
ATOM   1617  C  CG    . PRO A  1 243 ? 15.269  4.684    73.947  1.00 61.73  ? 243 PRO A CG    1 
ATOM   1618  C  CD    . PRO A  1 243 ? 14.922  5.847    73.105  1.00 60.48  ? 243 PRO A CD    1 
ATOM   1619  N  N     . LEU A  1 244 ? 11.372  5.949    73.992  1.00 58.08  ? 244 LEU A N     1 
ATOM   1620  C  CA    . LEU A  1 244 ? 10.083  6.384    74.538  1.00 57.40  ? 244 LEU A CA    1 
ATOM   1621  C  C     . LEU A  1 244 ? 8.959   6.392    73.491  1.00 56.62  ? 244 LEU A C     1 
ATOM   1622  O  O     . LEU A  1 244 ? 7.816   6.030    73.793  1.00 56.64  ? 244 LEU A O     1 
ATOM   1623  C  CB    . LEU A  1 244 ? 10.200  7.765    75.187  1.00 57.40  ? 244 LEU A CB    1 
ATOM   1624  C  CG    . LEU A  1 244 ? 10.974  7.933    76.493  1.00 57.74  ? 244 LEU A CG    1 
ATOM   1625  C  CD1   . LEU A  1 244 ? 11.280  9.399    76.723  1.00 56.93  ? 244 LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A  1 244 ? 10.213  7.356    77.666  1.00 57.30  ? 244 LEU A CD2   1 
ATOM   1627  N  N     . GLN A  1 245 ? 9.277   6.808    72.267  1.00 56.23  ? 245 GLN A N     1 
ATOM   1628  C  CA    . GLN A  1 245 ? 8.318   6.739    71.171  1.00 55.09  ? 245 GLN A CA    1 
ATOM   1629  C  C     . GLN A  1 245 ? 8.070   5.285    70.818  1.00 55.22  ? 245 GLN A C     1 
ATOM   1630  O  O     . GLN A  1 245 ? 6.951   4.905    70.491  1.00 54.62  ? 245 GLN A O     1 
ATOM   1631  C  CB    . GLN A  1 245 ? 8.853   7.464    69.956  1.00 54.75  ? 245 GLN A CB    1 
ATOM   1632  C  CG    . GLN A  1 245 ? 9.672   8.675    70.276  1.00 55.50  ? 245 GLN A CG    1 
ATOM   1633  C  CD    . GLN A  1 245 ? 9.669   9.644    69.141  1.00 55.80  ? 245 GLN A CD    1 
ATOM   1634  O  OE1   . GLN A  1 245 ? 8.691   9.745    68.416  1.00 56.45  ? 245 GLN A OE1   1 
ATOM   1635  N  NE2   . GLN A  1 245 ? 10.757  10.366   68.971  1.00 56.88  ? 245 GLN A NE2   1 
ATOM   1636  N  N     . TYR A  1 246 ? 9.131   4.483    70.879  1.00 56.20  ? 246 TYR A N     1 
ATOM   1637  C  CA    . TYR A  1 246 ? 9.034   3.042    70.718  1.00 56.95  ? 246 TYR A CA    1 
ATOM   1638  C  C     . TYR A  1 246 ? 8.115   2.429    71.779  1.00 57.20  ? 246 TYR A C     1 
ATOM   1639  O  O     . TYR A  1 246 ? 7.290   1.566    71.476  1.00 57.02  ? 246 TYR A O     1 
ATOM   1640  C  CB    . TYR A  1 246 ? 10.426  2.404    70.779  1.00 58.40  ? 246 TYR A CB    1 
ATOM   1641  C  CG    . TYR A  1 246 ? 10.412  0.918    71.060  1.00 60.23  ? 246 TYR A CG    1 
ATOM   1642  C  CD1   . TYR A  1 246 ? 9.962   0.018    70.100  1.00 61.34  ? 246 TYR A CD1   1 
ATOM   1643  C  CD2   . TYR A  1 246 ? 10.841  0.415    72.278  1.00 62.57  ? 246 TYR A CD2   1 
ATOM   1644  C  CE1   . TYR A  1 246 ? 9.931   -1.334   70.341  1.00 63.16  ? 246 TYR A CE1   1 
ATOM   1645  C  CE2   . TYR A  1 246 ? 10.820  -0.946   72.533  1.00 65.13  ? 246 TYR A CE2   1 
ATOM   1646  C  CZ    . TYR A  1 246 ? 10.360  -1.816   71.553  1.00 65.69  ? 246 TYR A CZ    1 
ATOM   1647  O  OH    . TYR A  1 246 ? 10.323  -3.178   71.770  1.00 68.70  ? 246 TYR A OH    1 
ATOM   1648  N  N     . LEU A  1 247 ? 8.251   2.882    73.018  1.00 57.76  ? 247 LEU A N     1 
ATOM   1649  C  CA    . LEU A  1 247 ? 7.450   2.333    74.105  1.00 58.27  ? 247 LEU A CA    1 
ATOM   1650  C  C     . LEU A  1 247 ? 6.015   2.824    74.145  1.00 57.45  ? 247 LEU A C     1 
ATOM   1651  O  O     . LEU A  1 247 ? 5.134   2.121    74.643  1.00 57.76  ? 247 LEU A O     1 
ATOM   1652  C  CB    . LEU A  1 247 ? 8.115   2.594    75.445  1.00 59.38  ? 247 LEU A CB    1 
ATOM   1653  C  CG    . LEU A  1 247 ? 9.130   1.508    75.755  1.00 60.79  ? 247 LEU A CG    1 
ATOM   1654  C  CD1   . LEU A  1 247 ? 9.931   1.868    76.986  1.00 62.30  ? 247 LEU A CD1   1 
ATOM   1655  C  CD2   . LEU A  1 247 ? 8.398   0.201    75.935  1.00 61.23  ? 247 LEU A CD2   1 
ATOM   1656  N  N     . ALA A  1 248 ? 5.781   4.024    73.625  1.00 56.58  ? 248 ALA A N     1 
ATOM   1657  C  CA    . ALA A  1 248 ? 4.459   4.637    73.714  1.00 55.96  ? 248 ALA A CA    1 
ATOM   1658  C  C     . ALA A  1 248 ? 3.315   3.675    73.346  1.00 55.54  ? 248 ALA A C     1 
ATOM   1659  O  O     . ALA A  1 248 ? 2.501   3.362    74.204  1.00 56.11  ? 248 ALA A O     1 
ATOM   1660  C  CB    . ALA A  1 248 ? 4.395   5.942    72.909  1.00 55.22  ? 248 ALA A CB    1 
ATOM   1661  N  N     . PRO A  1 249 ? 3.271   3.163    72.095  1.00 54.92  ? 249 PRO A N     1 
ATOM   1662  C  CA    . PRO A  1 249 ? 2.099   2.369    71.758  1.00 54.59  ? 249 PRO A CA    1 
ATOM   1663  C  C     . PRO A  1 249 ? 1.826   1.208    72.705  1.00 55.34  ? 249 PRO A C     1 
ATOM   1664  O  O     . PRO A  1 249 ? 0.661   0.918    72.969  1.00 55.68  ? 249 PRO A O     1 
ATOM   1665  C  CB    . PRO A  1 249 ? 2.423   1.866    70.347  1.00 54.28  ? 249 PRO A CB    1 
ATOM   1666  C  CG    . PRO A  1 249 ? 3.240   2.962    69.771  1.00 53.68  ? 249 PRO A CG    1 
ATOM   1667  C  CD    . PRO A  1 249 ? 4.155   3.302    70.920  1.00 54.78  ? 249 PRO A CD    1 
ATOM   1668  N  N     . PHE A  1 250 ? 2.879   0.570    73.219  1.00 55.91  ? 250 PHE A N     1 
ATOM   1669  C  CA    . PHE A  1 250 ? 2.731   -0.636   74.055  1.00 56.74  ? 250 PHE A CA    1 
ATOM   1670  C  C     . PHE A  1 250 ? 2.249   -0.268   75.434  1.00 56.92  ? 250 PHE A C     1 
ATOM   1671  O  O     . PHE A  1 250 ? 1.478   -0.991   76.052  1.00 57.74  ? 250 PHE A O     1 
ATOM   1672  C  CB    . PHE A  1 250 ? 4.050   -1.412   74.168  1.00 57.66  ? 250 PHE A CB    1 
ATOM   1673  C  CG    . PHE A  1 250 ? 4.543   -1.935   72.871  1.00 57.61  ? 250 PHE A CG    1 
ATOM   1674  C  CD1   . PHE A  1 250 ? 3.912   -3.009   72.262  1.00 58.78  ? 250 PHE A CD1   1 
ATOM   1675  C  CD2   . PHE A  1 250 ? 5.623   -1.342   72.239  1.00 57.45  ? 250 PHE A CD2   1 
ATOM   1676  C  CE1   . PHE A  1 250 ? 4.357   -3.490   71.043  1.00 59.40  ? 250 PHE A CE1   1 
ATOM   1677  C  CE2   . PHE A  1 250 ? 6.074   -1.814   71.019  1.00 57.91  ? 250 PHE A CE2   1 
ATOM   1678  C  CZ    . PHE A  1 250 ? 5.442   -2.888   70.419  1.00 58.66  ? 250 PHE A CZ    1 
ATOM   1679  N  N     . THR A  1 251 ? 2.733   0.868    75.903  1.00 56.30  ? 251 THR A N     1 
ATOM   1680  C  CA    . THR A  1 251 ? 2.424   1.377    77.210  1.00 56.61  ? 251 THR A CA    1 
ATOM   1681  C  C     . THR A  1 251 ? 0.946   1.732    77.267  1.00 56.00  ? 251 THR A C     1 
ATOM   1682  O  O     . THR A  1 251 ? 0.239   1.382    78.212  1.00 56.98  ? 251 THR A O     1 
ATOM   1683  C  CB    . THR A  1 251 ? 3.327   2.582    77.479  1.00 56.33  ? 251 THR A CB    1 
ATOM   1684  O  OG1   . THR A  1 251 ? 4.550   2.105    78.040  1.00 58.30  ? 251 THR A OG1   1 
ATOM   1685  C  CG2   . THR A  1 251 ? 2.699   3.565    78.432  1.00 56.41  ? 251 THR A CG2   1 
ATOM   1686  N  N     . ALA A  1 252 ? 0.480   2.404    76.228  1.00 54.62  ? 252 ALA A N     1 
ATOM   1687  C  CA    . ALA A  1 252 ? -0.888  2.846    76.168  1.00 54.00  ? 252 ALA A CA    1 
ATOM   1688  C  C     . ALA A  1 252 ? -1.787  1.641    75.968  1.00 54.21  ? 252 ALA A C     1 
ATOM   1689  O  O     . ALA A  1 252 ? -2.913  1.619    76.454  1.00 54.48  ? 252 ALA A O     1 
ATOM   1690  C  CB    . ALA A  1 252 ? -1.056  3.840    75.047  1.00 53.18  ? 252 ALA A CB    1 
ATOM   1691  N  N     . ALA A  1 253 ? -1.271  0.635    75.263  1.00 54.15  ? 253 ALA A N     1 
ATOM   1692  C  CA    . ALA A  1 253 ? -1.977  -0.634   75.076  1.00 54.59  ? 253 ALA A CA    1 
ATOM   1693  C  C     . ALA A  1 253 ? -2.275  -1.356   76.398  1.00 55.90  ? 253 ALA A C     1 
ATOM   1694  O  O     . ALA A  1 253 ? -3.293  -2.029   76.505  1.00 56.46  ? 253 ALA A O     1 
ATOM   1695  C  CB    . ALA A  1 253 ? -1.209  -1.545   74.124  1.00 54.41  ? 253 ALA A CB    1 
ATOM   1696  N  N     . SER A  1 254 ? -1.389  -1.212   77.388  1.00 56.49  ? 254 SER A N     1 
ATOM   1697  C  CA    . SER A  1 254 ? -1.601  -1.753   78.731  1.00 57.98  ? 254 SER A CA    1 
ATOM   1698  C  C     . SER A  1 254 ? -2.636  -0.925   79.464  1.00 57.99  ? 254 SER A C     1 
ATOM   1699  O  O     . SER A  1 254 ? -3.452  -1.458   80.215  1.00 59.10  ? 254 SER A O     1 
ATOM   1700  C  CB    . SER A  1 254 ? -0.303  -1.743   79.543  1.00 58.98  ? 254 SER A CB    1 
ATOM   1701  O  OG    . SER A  1 254 ? 0.656   -2.636   79.016  1.00 59.48  ? 254 SER A OG    1 
ATOM   1702  N  N     . ILE A  1 255 ? -2.572  0.384    79.247  1.00 57.12  ? 255 ILE A N     1 
ATOM   1703  C  CA    . ILE A  1 255 ? -3.492  1.334    79.848  1.00 57.50  ? 255 ILE A CA    1 
ATOM   1704  C  C     . ILE A  1 255 ? -4.922  1.031    79.388  1.00 57.89  ? 255 ILE A C     1 
ATOM   1705  O  O     . ILE A  1 255 ? -5.877  1.071    80.184  1.00 58.88  ? 255 ILE A O     1 
ATOM   1706  C  CB    . ILE A  1 255 ? -3.080  2.787    79.493  1.00 56.28  ? 255 ILE A CB    1 
ATOM   1707  C  CG1   . ILE A  1 255 ? -1.829  3.185    80.283  1.00 56.45  ? 255 ILE A CG1   1 
ATOM   1708  C  CG2   . ILE A  1 255 ? -4.226  3.768    79.745  1.00 56.04  ? 255 ILE A CG2   1 
ATOM   1709  C  CD1   . ILE A  1 255 ? -1.233  4.539    79.918  1.00 54.46  ? 255 ILE A CD1   1 
ATOM   1710  N  N     . GLY A  1 256 ? -5.046  0.714    78.101  1.00 57.35  ? 256 GLY A N     1 
ATOM   1711  C  CA    . GLY A  1 256 ? -6.319  0.369    77.498  1.00 57.60  ? 256 GLY A CA    1 
ATOM   1712  C  C     . GLY A  1 256 ? -6.752  -1.014   77.921  1.00 59.14  ? 256 GLY A C     1 
ATOM   1713  O  O     . GLY A  1 256 ? -7.951  -1.299   77.982  1.00 59.95  ? 256 GLY A O     1 
ATOM   1714  N  N     . GLU A  1 257 ? -5.779  -1.872   78.222  1.00 59.91  ? 257 GLU A N     1 
ATOM   1715  C  CA    . GLU A  1 257 ? -6.075  -3.257   78.584  1.00 61.58  ? 257 GLU A CA    1 
ATOM   1716  C  C     . GLU A  1 257 ? -6.731  -3.363   79.943  1.00 63.10  ? 257 GLU A C     1 
ATOM   1717  O  O     . GLU A  1 257 ? -7.540  -4.276   80.159  1.00 64.42  ? 257 GLU A O     1 
ATOM   1718  C  CB    . GLU A  1 257 ? -4.836  -4.152   78.527  1.00 62.27  ? 257 GLU A CB    1 
ATOM   1719  C  CG    . GLU A  1 257 ? -4.590  -4.779   77.162  1.00 61.89  ? 257 GLU A CG    1 
ATOM   1720  C  CD    . GLU A  1 257 ? -3.181  -5.340   77.007  1.00 63.10  ? 257 GLU A CD    1 
ATOM   1721  O  OE1   . GLU A  1 257 ? -2.275  -4.948   77.782  1.00 62.86  ? 257 GLU A OE1   1 
ATOM   1722  O  OE2   . GLU A  1 257 ? -2.981  -6.180   76.101  1.00 64.16  ? 257 GLU A OE2   1 
ATOM   1723  N  N     . TRP A  1 258 ? -6.412  -2.432   80.849  1.00 63.07  ? 258 TRP A N     1 
ATOM   1724  C  CA    . TRP A  1 258 ? -7.089  -2.409   82.150  1.00 64.43  ? 258 TRP A CA    1 
ATOM   1725  C  C     . TRP A  1 258 ? -8.605  -2.478   81.972  1.00 64.43  ? 258 TRP A C     1 
ATOM   1726  O  O     . TRP A  1 258 ? -9.286  -3.223   82.673  1.00 65.90  ? 258 TRP A O     1 
ATOM   1727  C  CB    . TRP A  1 258 ? -6.728  -1.196   83.014  1.00 64.34  ? 258 TRP A CB    1 
ATOM   1728  C  CG    . TRP A  1 258 ? -7.468  -1.295   84.301  1.00 66.86  ? 258 TRP A CG    1 
ATOM   1729  C  CD1   . TRP A  1 258 ? -7.104  -2.023   85.396  1.00 69.65  ? 258 TRP A CD1   1 
ATOM   1730  C  CD2   . TRP A  1 258 ? -8.750  -0.730   84.604  1.00 68.36  ? 258 TRP A CD2   1 
ATOM   1731  N  NE1   . TRP A  1 258 ? -8.062  -1.922   86.380  1.00 71.27  ? 258 TRP A NE1   1 
ATOM   1732  C  CE2   . TRP A  1 258 ? -9.084  -1.134   85.921  1.00 70.61  ? 258 TRP A CE2   1 
ATOM   1733  C  CE3   . TRP A  1 258 ? -9.643  0.092    83.899  1.00 67.89  ? 258 TRP A CE3   1 
ATOM   1734  C  CZ2   . TRP A  1 258 ? -10.273 -0.742   86.551  1.00 71.89  ? 258 TRP A CZ2   1 
ATOM   1735  C  CZ3   . TRP A  1 258 ? -10.823 0.482    84.522  1.00 69.60  ? 258 TRP A CZ3   1 
ATOM   1736  C  CH2   . TRP A  1 258 ? -11.129 0.060    85.841  1.00 71.45  ? 258 TRP A CH2   1 
ATOM   1737  N  N     . PHE A  1 259 ? -9.111  -1.694   81.024  1.00 62.94  ? 259 PHE A N     1 
ATOM   1738  C  CA    . PHE A  1 259 ? -10.516 -1.702   80.652  1.00 62.87  ? 259 PHE A CA    1 
ATOM   1739  C  C     . PHE A  1 259 ? -10.942 -3.048   80.067  1.00 63.39  ? 259 PHE A C     1 
ATOM   1740  O  O     . PHE A  1 259 ? -11.896 -3.658   80.555  1.00 64.81  ? 259 PHE A O     1 
ATOM   1741  C  CB    . PHE A  1 259 ? -10.789 -0.576   79.660  1.00 61.27  ? 259 PHE A CB    1 
ATOM   1742  C  CG    . PHE A  1 259 ? -10.395 0.770    80.168  1.00 61.27  ? 259 PHE A CG    1 
ATOM   1743  C  CD1   . PHE A  1 259 ? -11.242 1.480    81.022  1.00 62.01  ? 259 PHE A CD1   1 
ATOM   1744  C  CD2   . PHE A  1 259 ? -9.169  1.331    79.810  1.00 60.79  ? 259 PHE A CD2   1 
ATOM   1745  C  CE1   . PHE A  1 259 ? -10.880 2.739    81.510  1.00 61.86  ? 259 PHE A CE1   1 
ATOM   1746  C  CE2   . PHE A  1 259 ? -8.788  2.594    80.298  1.00 60.93  ? 259 PHE A CE2   1 
ATOM   1747  C  CZ    . PHE A  1 259 ? -9.651  3.301    81.149  1.00 61.30  ? 259 PHE A CZ    1 
ATOM   1748  N  N     . ARG A  1 260 ? -10.225 -3.510   79.043  1.00 62.28  ? 260 ARG A N     1 
ATOM   1749  C  CA    . ARG A  1 260 ? -10.568 -4.734   78.339  1.00 62.64  ? 260 ARG A CA    1 
ATOM   1750  C  C     . ARG A  1 260 ? -10.633 -5.900   79.312  1.00 64.93  ? 260 ARG A C     1 
ATOM   1751  O  O     . ARG A  1 260 ? -11.452 -6.810   79.160  1.00 66.21  ? 260 ARG A O     1 
ATOM   1752  C  CB    . ARG A  1 260 ? -9.538  -5.019   77.247  1.00 61.61  ? 260 ARG A CB    1 
ATOM   1753  C  CG    . ARG A  1 260 ? -9.832  -6.248   76.386  1.00 61.26  ? 260 ARG A CG    1 
ATOM   1754  C  CD    . ARG A  1 260 ? -8.550  -6.852   75.836  1.00 59.96  ? 260 ARG A CD    1 
ATOM   1755  N  NE    . ARG A  1 260 ? -7.646  -7.300   76.898  1.00 60.11  ? 260 ARG A NE    1 
ATOM   1756  C  CZ    . ARG A  1 260 ? -6.390  -7.707   76.716  1.00 59.47  ? 260 ARG A CZ    1 
ATOM   1757  N  NH1   . ARG A  1 260 ? -5.842  -7.735   75.508  1.00 57.71  ? 260 ARG A NH1   1 
ATOM   1758  N  NH2   . ARG A  1 260 ? -5.668  -8.081   77.759  1.00 60.26  ? 260 ARG A NH2   1 
ATOM   1759  N  N     . ASP A  1 261 ? -9.781  -5.868   80.328  1.00 65.76  ? 261 ASP A N     1 
ATOM   1760  C  CA    . ASP A  1 261 ? -9.707  -6.993   81.252  1.00 68.16  ? 261 ASP A CA    1 
ATOM   1761  C  C     . ASP A  1 261 ? -10.843 -7.027   82.275  1.00 69.55  ? 261 ASP A C     1 
ATOM   1762  O  O     . ASP A  1 261 ? -11.091 -8.057   82.889  1.00 71.64  ? 261 ASP A O     1 
ATOM   1763  C  CB    . ASP A  1 261 ? -8.328  -7.057   81.918  1.00 68.65  ? 261 ASP A CB    1 
ATOM   1764  C  CG    . ASP A  1 261 ? -7.214  -7.382   80.921  1.00 68.56  ? 261 ASP A CG    1 
ATOM   1765  O  OD1   . ASP A  1 261 ? -7.514  -7.902   79.819  1.00 68.72  ? 261 ASP A OD1   1 
ATOM   1766  O  OD2   . ASP A  1 261 ? -6.035  -7.113   81.234  1.00 69.22  ? 261 ASP A OD2   1 
ATOM   1767  N  N     . ASN A  1 262 ? -11.548 -5.910   82.421  1.00 68.70  ? 262 ASN A N     1 
ATOM   1768  C  CA    . ASN A  1 262 ? -12.589 -5.775   83.426  1.00 70.08  ? 262 ASN A CA    1 
ATOM   1769  C  C     . ASN A  1 262 ? -13.982 -5.536   82.846  1.00 70.26  ? 262 ASN A C     1 
ATOM   1770  O  O     . ASN A  1 262 ? -14.776 -4.726   83.376  1.00 70.57  ? 262 ASN A O     1 
ATOM   1771  C  CB    . ASN A  1 262 ? -12.227 -4.646   84.373  1.00 69.87  ? 262 ASN A CB    1 
ATOM   1772  C  CG    . ASN A  1 262 ? -11.059 -4.979   85.231  1.00 70.30  ? 262 ASN A CG    1 
ATOM   1773  O  OD1   . ASN A  1 262 ? -11.173 -5.763   86.162  1.00 72.42  ? 262 ASN A OD1   1 
ATOM   1774  N  ND2   . ASN A  1 262 ? -9.920  -4.373   84.939  1.00 69.24  ? 262 ASN A ND2   1 
ATOM   1775  N  N     . GLY A  1 263 ? -14.279 -6.252   81.764  1.00 70.17  ? 263 GLY A N     1 
ATOM   1776  C  CA    . GLY A  1 263 ? -15.577 -6.152   81.100  1.00 70.46  ? 263 GLY A CA    1 
ATOM   1777  C  C     . GLY A  1 263 ? -15.981 -4.731   80.742  1.00 69.21  ? 263 GLY A C     1 
ATOM   1778  O  O     . GLY A  1 263 ? -17.147 -4.366   80.874  1.00 69.95  ? 263 GLY A O     1 
ATOM   1779  N  N     . LYS A  1 264 ? -15.011 -3.929   80.312  1.00 67.59  ? 264 LYS A N     1 
ATOM   1780  C  CA    . LYS A  1 264 ? -15.256 -2.566   79.865  1.00 66.51  ? 264 LYS A CA    1 
ATOM   1781  C  C     . LYS A  1 264 ? -14.595 -2.378   78.514  1.00 64.93  ? 264 LYS A C     1 
ATOM   1782  O  O     . LYS A  1 264 ? -13.770 -3.197   78.098  1.00 65.00  ? 264 LYS A O     1 
ATOM   1783  C  CB    . LYS A  1 264 ? -14.710 -1.565   80.872  1.00 66.40  ? 264 LYS A CB    1 
ATOM   1784  C  CG    . LYS A  1 264 ? -15.440 -1.612   82.194  1.00 69.40  ? 264 LYS A CG    1 
ATOM   1785  C  CD    . LYS A  1 264 ? -14.765 -0.754   83.225  1.00 71.47  ? 264 LYS A CD    1 
ATOM   1786  C  CE    . LYS A  1 264 ? -15.191 -1.166   84.619  1.00 74.98  ? 264 LYS A CE    1 
ATOM   1787  N  NZ    . LYS A  1 264 ? -14.333 -0.472   85.630  1.00 76.87  ? 264 LYS A NZ    1 
ATOM   1788  N  N     . HIS A  1 265 ? -14.953 -1.303   77.824  1.00 63.76  ? 265 HIS A N     1 
ATOM   1789  C  CA    . HIS A  1 265 ? -14.505 -1.125   76.459  1.00 62.12  ? 265 HIS A CA    1 
ATOM   1790  C  C     . HIS A  1 265 ? -13.677 0.122    76.296  1.00 60.87  ? 265 HIS A C     1 
ATOM   1791  O  O     . HIS A  1 265 ? -14.128 1.234    76.607  1.00 61.06  ? 265 HIS A O     1 
ATOM   1792  C  CB    . HIS A  1 265 ? -15.695 -1.101   75.519  1.00 62.23  ? 265 HIS A CB    1 
ATOM   1793  C  CG    . HIS A  1 265 ? -16.648 -2.220   75.756  1.00 64.35  ? 265 HIS A CG    1 
ATOM   1794  N  ND1   . HIS A  1 265 ? -16.267 -3.541   75.688  1.00 65.53  ? 265 HIS A ND1   1 
ATOM   1795  C  CD2   . HIS A  1 265 ? -17.959 -2.220   76.090  1.00 66.64  ? 265 HIS A CD2   1 
ATOM   1796  C  CE1   . HIS A  1 265 ? -17.307 -4.309   75.959  1.00 68.07  ? 265 HIS A CE1   1 
ATOM   1797  N  NE2   . HIS A  1 265 ? -18.347 -3.532   76.206  1.00 68.53  ? 265 HIS A NE2   1 
ATOM   1798  N  N     . ALA A  1 266 ? -12.454 -0.081   75.813  1.00 59.66  ? 266 ALA A N     1 
ATOM   1799  C  CA    . ALA A  1 266 ? -11.561 1.006    75.478  1.00 57.95  ? 266 ALA A CA    1 
ATOM   1800  C  C     . ALA A  1 266 ? -11.356 1.034    73.973  1.00 56.97  ? 266 ALA A C     1 
ATOM   1801  O  O     . ALA A  1 266 ? -11.321 -0.020   73.322  1.00 57.27  ? 266 ALA A O     1 
ATOM   1802  C  CB    . ALA A  1 266 ? -10.250 0.836    76.196  1.00 57.83  ? 266 ALA A CB    1 
ATOM   1803  N  N     . LEU A  1 267 ? -11.265 2.242    73.421  1.00 56.02  ? 267 LEU A N     1 
ATOM   1804  C  CA    . LEU A  1 267 ? -10.810 2.440    72.045  1.00 55.11  ? 267 LEU A CA    1 
ATOM   1805  C  C     . LEU A  1 267 ? -9.424  3.063    72.111  1.00 54.50  ? 267 LEU A C     1 
ATOM   1806  O  O     . LEU A  1 267 ? -9.249  4.090    72.780  1.00 54.87  ? 267 LEU A O     1 
ATOM   1807  C  CB    . LEU A  1 267 ? -11.748 3.384    71.285  1.00 54.90  ? 267 LEU A CB    1 
ATOM   1808  C  CG    . LEU A  1 267 ? -11.315 3.812    69.878  1.00 53.42  ? 267 LEU A CG    1 
ATOM   1809  C  CD1   . LEU A  1 267 ? -11.585 2.697    68.905  1.00 53.33  ? 267 LEU A CD1   1 
ATOM   1810  C  CD2   . LEU A  1 267 ? -12.012 5.083    69.426  1.00 52.87  ? 267 LEU A CD2   1 
ATOM   1811  N  N     . ILE A  1 268 ? -8.445  2.450    71.438  1.00 53.75  ? 268 ILE A N     1 
ATOM   1812  C  CA    . ILE A  1 268 ? -7.093  3.022    71.375  1.00 52.68  ? 268 ILE A CA    1 
ATOM   1813  C  C     . ILE A  1 268 ? -6.708  3.464    69.958  1.00 52.10  ? 268 ILE A C     1 
ATOM   1814  O  O     . ILE A  1 268 ? -6.916  2.736    68.988  1.00 51.85  ? 268 ILE A O     1 
ATOM   1815  C  CB    . ILE A  1 268 ? -6.027  2.088    72.000  1.00 52.89  ? 268 ILE A CB    1 
ATOM   1816  C  CG1   . ILE A  1 268 ? -4.728  2.849    72.264  1.00 51.74  ? 268 ILE A CG1   1 
ATOM   1817  C  CG2   . ILE A  1 268 ? -5.794  0.841    71.144  1.00 52.77  ? 268 ILE A CG2   1 
ATOM   1818  C  CD1   . ILE A  1 268 ? -3.696  2.050    73.032  1.00 51.11  ? 268 ILE A CD1   1 
ATOM   1819  N  N     . VAL A  1 269 ? -6.178  4.681    69.860  1.00 51.93  ? 269 VAL A N     1 
ATOM   1820  C  CA    . VAL A  1 269 ? -5.714  5.253    68.597  1.00 51.79  ? 269 VAL A CA    1 
ATOM   1821  C  C     . VAL A  1 269 ? -4.204  5.446    68.640  1.00 52.01  ? 269 VAL A C     1 
ATOM   1822  O  O     . VAL A  1 269 ? -3.676  6.195    69.463  1.00 51.92  ? 269 VAL A O     1 
ATOM   1823  C  CB    . VAL A  1 269 ? -6.371  6.621    68.290  1.00 51.71  ? 269 VAL A CB    1 
ATOM   1824  C  CG1   . VAL A  1 269 ? -5.885  7.147    66.948  1.00 51.31  ? 269 VAL A CG1   1 
ATOM   1825  C  CG2   . VAL A  1 269 ? -7.885  6.518    68.303  1.00 51.62  ? 269 VAL A CG2   1 
ATOM   1826  N  N     . TYR A  1 270 ? -3.513  4.761    67.745  1.00 52.62  ? 270 TYR A N     1 
ATOM   1827  C  CA    . TYR A  1 270 ? -2.072  4.851    67.677  1.00 53.21  ? 270 TYR A CA    1 
ATOM   1828  C  C     . TYR A  1 270 ? -1.693  5.813    66.557  1.00 53.44  ? 270 TYR A C     1 
ATOM   1829  O  O     . TYR A  1 270 ? -1.716  5.438    65.380  1.00 53.56  ? 270 TYR A O     1 
ATOM   1830  C  CB    . TYR A  1 270 ? -1.485  3.483    67.356  1.00 53.59  ? 270 TYR A CB    1 
ATOM   1831  C  CG    . TYR A  1 270 ? -1.720  2.375    68.364  1.00 54.23  ? 270 TYR A CG    1 
ATOM   1832  C  CD1   . TYR A  1 270 ? -1.069  2.371    69.592  1.00 55.07  ? 270 TYR A CD1   1 
ATOM   1833  C  CD2   . TYR A  1 270 ? -2.537  1.293    68.051  1.00 54.48  ? 270 TYR A CD2   1 
ATOM   1834  C  CE1   . TYR A  1 270 ? -1.250  1.332    70.496  1.00 56.03  ? 270 TYR A CE1   1 
ATOM   1835  C  CE2   . TYR A  1 270 ? -2.729  0.260    68.946  1.00 55.99  ? 270 TYR A CE2   1 
ATOM   1836  C  CZ    . TYR A  1 270 ? -2.085  0.284    70.166  1.00 56.69  ? 270 TYR A CZ    1 
ATOM   1837  O  OH    . TYR A  1 270 ? -2.278  -0.753   71.048  1.00 58.77  ? 270 TYR A OH    1 
ATOM   1838  N  N     . ASP A  1 271 ? -1.334  7.040    66.920  1.00 53.76  ? 271 ASP A N     1 
ATOM   1839  C  CA    . ASP A  1 271 ? -1.044  8.064    65.938  1.00 54.46  ? 271 ASP A CA    1 
ATOM   1840  C  C     . ASP A  1 271 ? 0.401   8.541    66.023  1.00 54.68  ? 271 ASP A C     1 
ATOM   1841  O  O     . ASP A  1 271 ? 0.749   9.299    66.930  1.00 55.15  ? 271 ASP A O     1 
ATOM   1842  C  CB    . ASP A  1 271 ? -1.978  9.251    66.138  1.00 55.10  ? 271 ASP A CB    1 
ATOM   1843  C  CG    . ASP A  1 271 ? -2.337  9.942    64.834  1.00 57.35  ? 271 ASP A CG    1 
ATOM   1844  O  OD1   . ASP A  1 271 ? -1.879  9.476    63.764  1.00 59.77  ? 271 ASP A OD1   1 
ATOM   1845  O  OD2   . ASP A  1 271 ? -3.096  10.943   64.876  1.00 59.57  ? 271 ASP A OD2   1 
ATOM   1846  N  N     . ASP A  1 272 ? 1.258   8.082    65.111  1.00 54.62  ? 272 ASP A N     1 
ATOM   1847  C  CA    . ASP A  1 272 ? 0.937   7.008    64.171  1.00 54.35  ? 272 ASP A CA    1 
ATOM   1848  C  C     . ASP A  1 272 ? 2.014   5.932    64.256  1.00 53.90  ? 272 ASP A C     1 
ATOM   1849  O  O     . ASP A  1 272 ? 3.084   6.164    64.824  1.00 54.13  ? 272 ASP A O     1 
ATOM   1850  C  CB    . ASP A  1 272 ? 0.834   7.551    62.750  1.00 54.84  ? 272 ASP A CB    1 
ATOM   1851  C  CG    . ASP A  1 272 ? 2.050   8.357    62.343  1.00 56.56  ? 272 ASP A CG    1 
ATOM   1852  O  OD1   . ASP A  1 272 ? 3.179   7.859    62.510  1.00 58.68  ? 272 ASP A OD1   1 
ATOM   1853  O  OD2   . ASP A  1 272 ? 1.881   9.484    61.834  1.00 58.43  ? 272 ASP A OD2   1 
ATOM   1854  N  N     . LEU A  1 273 ? 1.742   4.760    63.692  1.00 53.31  ? 273 LEU A N     1 
ATOM   1855  C  CA    . LEU A  1 273 ? 2.694   3.649    63.776  1.00 52.70  ? 273 LEU A CA    1 
ATOM   1856  C  C     . LEU A  1 273 ? 3.804   3.769    62.742  1.00 52.39  ? 273 LEU A C     1 
ATOM   1857  O  O     . LEU A  1 273 ? 4.765   3.006    62.767  1.00 52.87  ? 273 LEU A O     1 
ATOM   1858  C  CB    . LEU A  1 273 ? 1.986   2.293    63.670  1.00 52.81  ? 273 LEU A CB    1 
ATOM   1859  C  CG    . LEU A  1 273 ? 1.077   1.885    64.831  1.00 52.52  ? 273 LEU A CG    1 
ATOM   1860  C  CD1   . LEU A  1 273 ? 0.476   0.524    64.545  1.00 52.97  ? 273 LEU A CD1   1 
ATOM   1861  C  CD2   . LEU A  1 273 ? 1.793   1.892    66.193  1.00 51.72  ? 273 LEU A CD2   1 
ATOM   1862  N  N     . SER A  1 274 ? 3.665   4.726    61.832  1.00 51.47  ? 274 SER A N     1 
ATOM   1863  C  CA    . SER A  1 274 ? 4.714   5.001    60.885  1.00 51.23  ? 274 SER A CA    1 
ATOM   1864  C  C     . SER A  1 274 ? 5.898   5.556    61.654  1.00 51.32  ? 274 SER A C     1 
ATOM   1865  O  O     . SER A  1 274 ? 7.022   5.074    61.518  1.00 51.88  ? 274 SER A O     1 
ATOM   1866  C  CB    . SER A  1 274 ? 4.228   5.980    59.829  1.00 51.15  ? 274 SER A CB    1 
ATOM   1867  O  OG    . SER A  1 274 ? 3.747   5.290    58.687  1.00 51.93  ? 274 SER A OG    1 
ATOM   1868  N  N     . LYS A  1 275 ? 5.619   6.541    62.505  1.00 50.88  ? 275 LYS A N     1 
ATOM   1869  C  CA    . LYS A  1 275 ? 6.633   7.206    63.321  1.00 50.68  ? 275 LYS A CA    1 
ATOM   1870  C  C     . LYS A  1 275 ? 7.219   6.341    64.451  1.00 50.85  ? 275 LYS A C     1 
ATOM   1871  O  O     . LYS A  1 275 ? 8.380   6.522    64.816  1.00 51.35  ? 275 LYS A O     1 
ATOM   1872  C  CB    . LYS A  1 275 ? 6.079   8.513    63.895  1.00 50.48  ? 275 LYS A CB    1 
ATOM   1873  C  CG    . LYS A  1 275 ? 5.744   9.586    62.869  1.00 50.20  ? 275 LYS A CG    1 
ATOM   1874  C  CD    . LYS A  1 275 ? 5.122   10.770   63.569  1.00 50.94  ? 275 LYS A CD    1 
ATOM   1875  C  CE    . LYS A  1 275 ? 5.097   12.019   62.723  1.00 52.21  ? 275 LYS A CE    1 
ATOM   1876  N  NZ    . LYS A  1 275 ? 4.064   11.948   61.648  1.00 54.20  ? 275 LYS A NZ    1 
ATOM   1877  N  N     . GLN A  1 276 ? 6.431   5.422    65.016  1.00 50.49  ? 276 GLN A N     1 
ATOM   1878  C  CA    . GLN A  1 276 ? 6.970   4.489    66.013  1.00 50.73  ? 276 GLN A CA    1 
ATOM   1879  C  C     . GLN A  1 276 ? 8.012   3.564    65.372  1.00 51.42  ? 276 GLN A C     1 
ATOM   1880  O  O     . GLN A  1 276 ? 9.067   3.325    65.949  1.00 52.10  ? 276 GLN A O     1 
ATOM   1881  C  CB    . GLN A  1 276 ? 5.867   3.662    66.686  1.00 50.58  ? 276 GLN A CB    1 
ATOM   1882  C  CG    . GLN A  1 276 ? 6.393   2.635    67.720  1.00 50.60  ? 276 GLN A CG    1 
ATOM   1883  C  CD    . GLN A  1 276 ? 5.578   1.334    67.779  1.00 49.60  ? 276 GLN A CD    1 
ATOM   1884  O  OE1   . GLN A  1 276 ? 5.072   0.840    66.767  1.00 48.21  ? 276 GLN A OE1   1 
ATOM   1885  N  NE2   . GLN A  1 276 ? 5.464   0.772    68.976  1.00 49.74  ? 276 GLN A NE2   1 
ATOM   1886  N  N     . ALA A  1 277 ? 7.704   3.059    64.179  1.00 51.20  ? 277 ALA A N     1 
ATOM   1887  C  CA    . ALA A  1 277 ? 8.596   2.181    63.439  1.00 52.02  ? 277 ALA A CA    1 
ATOM   1888  C  C     . ALA A  1 277 ? 9.951   2.839    63.151  1.00 52.86  ? 277 ALA A C     1 
ATOM   1889  O  O     . ALA A  1 277 ? 11.004  2.193    63.220  1.00 53.59  ? 277 ALA A O     1 
ATOM   1890  C  CB    . ALA A  1 277 ? 7.940   1.763    62.164  1.00 51.90  ? 277 ALA A CB    1 
ATOM   1891  N  N     . VAL A  1 278 ? 9.915   4.129    62.832  1.00 52.81  ? 278 VAL A N     1 
ATOM   1892  C  CA    . VAL A  1 278 ? 11.130  4.918    62.667  1.00 53.54  ? 278 VAL A CA    1 
ATOM   1893  C  C     . VAL A  1 278 ? 11.881  4.968    63.999  1.00 54.37  ? 278 VAL A C     1 
ATOM   1894  O  O     . VAL A  1 278 ? 13.092  4.758    64.035  1.00 55.95  ? 278 VAL A O     1 
ATOM   1895  C  CB    . VAL A  1 278 ? 10.826  6.339    62.123  1.00 52.98  ? 278 VAL A CB    1 
ATOM   1896  C  CG1   . VAL A  1 278 ? 12.101  7.156    61.933  1.00 53.78  ? 278 VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A  1 278 ? 10.086  6.243    60.810  1.00 52.58  ? 278 VAL A CG2   1 
ATOM   1898  N  N     . ALA A  1 279 ? 11.167  5.201    65.094  1.00 54.09  ? 279 ALA A N     1 
ATOM   1899  C  CA    . ALA A  1 279 ? 11.811  5.239    66.396  1.00 55.23  ? 279 ALA A CA    1 
ATOM   1900  C  C     . ALA A  1 279 ? 12.441  3.895    66.751  1.00 56.56  ? 279 ALA A C     1 
ATOM   1901  O  O     . ALA A  1 279 ? 13.504  3.843    67.369  1.00 58.01  ? 279 ALA A O     1 
ATOM   1902  C  CB    . ALA A  1 279 ? 10.836  5.662    67.458  1.00 54.80  ? 279 ALA A CB    1 
ATOM   1903  N  N     . TYR A  1 280 ? 11.794  2.806    66.351  1.00 56.65  ? 280 TYR A N     1 
ATOM   1904  C  CA    . TYR A  1 280 ? 12.301  1.480    66.665  1.00 57.60  ? 280 TYR A CA    1 
ATOM   1905  C  C     . TYR A  1 280 ? 13.572  1.233    65.881  1.00 58.17  ? 280 TYR A C     1 
ATOM   1906  O  O     . TYR A  1 280 ? 14.572  0.771    66.428  1.00 59.21  ? 280 TYR A O     1 
ATOM   1907  C  CB    . TYR A  1 280 ? 11.254  0.409    66.361  1.00 57.62  ? 280 TYR A CB    1 
ATOM   1908  C  CG    . TYR A  1 280 ? 11.723  -0.983   66.691  1.00 60.13  ? 280 TYR A CG    1 
ATOM   1909  C  CD1   . TYR A  1 280 ? 12.347  -1.259   67.908  1.00 62.13  ? 280 TYR A CD1   1 
ATOM   1910  C  CD2   . TYR A  1 280 ? 11.549  -2.025   65.785  1.00 61.61  ? 280 TYR A CD2   1 
ATOM   1911  C  CE1   . TYR A  1 280 ? 12.792  -2.534   68.211  1.00 65.11  ? 280 TYR A CE1   1 
ATOM   1912  C  CE2   . TYR A  1 280 ? 11.986  -3.309   66.079  1.00 64.12  ? 280 TYR A CE2   1 
ATOM   1913  C  CZ    . TYR A  1 280 ? 12.614  -3.558   67.287  1.00 66.27  ? 280 TYR A CZ    1 
ATOM   1914  O  OH    . TYR A  1 280 ? 13.050  -4.835   67.579  1.00 69.36  ? 280 TYR A OH    1 
ATOM   1915  N  N     . ARG A  1 281 ? 13.522  1.567    64.597  1.00 57.60  ? 281 ARG A N     1 
ATOM   1916  C  CA    . ARG A  1 281 ? 14.690  1.490    63.734  1.00 58.36  ? 281 ARG A CA    1 
ATOM   1917  C  C     . ARG A  1 281 ? 15.851  2.238    64.365  1.00 59.13  ? 281 ARG A C     1 
ATOM   1918  O  O     . ARG A  1 281 ? 17.004  1.780    64.297  1.00 60.86  ? 281 ARG A O     1 
ATOM   1919  C  CB    . ARG A  1 281 ? 14.393  2.077    62.351  1.00 57.69  ? 281 ARG A CB    1 
ATOM   1920  C  CG    . ARG A  1 281 ? 15.612  2.136    61.452  1.00 58.16  ? 281 ARG A CG    1 
ATOM   1921  C  CD    . ARG A  1 281 ? 15.279  2.438    60.012  1.00 57.19  ? 281 ARG A CD    1 
ATOM   1922  N  NE    . ARG A  1 281 ? 14.644  3.739    59.848  1.00 56.19  ? 281 ARG A NE    1 
ATOM   1923  C  CZ    . ARG A  1 281 ? 14.235  4.218    58.679  1.00 55.92  ? 281 ARG A CZ    1 
ATOM   1924  N  NH1   . ARG A  1 281 ? 14.409  3.509    57.580  1.00 57.04  ? 281 ARG A NH1   1 
ATOM   1925  N  NH2   . ARG A  1 281 ? 13.658  5.405    58.603  1.00 55.68  ? 281 ARG A NH2   1 
ATOM   1926  N  N     . GLN A  1 282 ? 15.553  3.381    64.984  1.00 57.96  ? 282 GLN A N     1 
ATOM   1927  C  CA    . GLN A  1 282 ? 16.609  4.190    65.544  1.00 58.29  ? 282 GLN A CA    1 
ATOM   1928  C  C     . GLN A  1 282 ? 17.420  3.439    66.607  1.00 59.56  ? 282 GLN A C     1 
ATOM   1929  O  O     . GLN A  1 282 ? 18.640  3.329    66.448  1.00 60.90  ? 282 GLN A O     1 
ATOM   1930  C  CB    . GLN A  1 282 ? 16.108  5.533    66.046  1.00 57.44  ? 282 GLN A CB    1 
ATOM   1931  C  CG    . GLN A  1 282 ? 17.265  6.450    66.349  1.00 58.17  ? 282 GLN A CG    1 
ATOM   1932  C  CD    . GLN A  1 282 ? 16.875  7.662    67.131  1.00 57.47  ? 282 GLN A CD    1 
ATOM   1933  O  OE1   . GLN A  1 282 ? 15.966  8.398    66.752  1.00 56.49  ? 282 GLN A OE1   1 
ATOM   1934  N  NE2   . GLN A  1 282 ? 17.575  7.892    68.234  1.00 58.65  ? 282 GLN A NE2   1 
ATOM   1935  N  N     . LEU A  1 283 ? 16.763  2.900    67.647  1.00 59.11  ? 283 LEU A N     1 
ATOM   1936  C  CA    . LEU A  1 283 ? 17.450  2.053    68.644  1.00 60.53  ? 283 LEU A CA    1 
ATOM   1937  C  C     . LEU A  1 283 ? 18.344  1.029    67.960  1.00 61.76  ? 283 LEU A C     1 
ATOM   1938  O  O     . LEU A  1 283 ? 19.547  0.939    68.235  1.00 63.19  ? 283 LEU A O     1 
ATOM   1939  C  CB    . LEU A  1 283 ? 16.480  1.227    69.490  1.00 60.23  ? 283 LEU A CB    1 
ATOM   1940  C  CG    . LEU A  1 283 ? 15.189  1.713    70.112  1.00 59.59  ? 283 LEU A CG    1 
ATOM   1941  C  CD1   . LEU A  1 283 ? 14.534  0.544    70.817  1.00 60.29  ? 283 LEU A CD1   1 
ATOM   1942  C  CD2   . LEU A  1 283 ? 15.472  2.813    71.083  1.00 60.84  ? 283 LEU A CD2   1 
ATOM   1943  N  N     . SER A  1 284 ? 17.725  0.252    67.076  1.00 60.88  ? 284 SER A N     1 
ATOM   1944  C  CA    . SER A  1 284 ? 18.348  -0.920   66.510  1.00 62.21  ? 284 SER A CA    1 
ATOM   1945  C  C     . SER A  1 284 ? 19.594  -0.586   65.705  1.00 62.74  ? 284 SER A C     1 
ATOM   1946  O  O     . SER A  1 284 ? 20.644  -1.217   65.890  1.00 64.94  ? 284 SER A O     1 
ATOM   1947  C  CB    . SER A  1 284 ? 17.338  -1.699   65.675  1.00 61.88  ? 284 SER A CB    1 
ATOM   1948  O  OG    . SER A  1 284 ? 16.188  -1.985   66.461  1.00 62.65  ? 284 SER A OG    1 
ATOM   1949  N  N     . LEU A  1 285 ? 19.497  0.411    64.830  1.00 60.92  ? 285 LEU A N     1 
ATOM   1950  C  CA    . LEU A  1 285 ? 20.659  0.826    64.065  1.00 60.81  ? 285 LEU A CA    1 
ATOM   1951  C  C     . LEU A  1 285 ? 21.788  1.259    65.014  1.00 62.14  ? 285 LEU A C     1 
ATOM   1952  O  O     . LEU A  1 285 ? 22.975  0.972    64.770  1.00 63.78  ? 285 LEU A O     1 
ATOM   1953  C  CB    . LEU A  1 285 ? 20.283  1.928    63.081  1.00 59.10  ? 285 LEU A CB    1 
ATOM   1954  C  CG    . LEU A  1 285 ? 19.619  1.436    61.803  1.00 57.42  ? 285 LEU A CG    1 
ATOM   1955  C  CD1   . LEU A  1 285 ? 18.951  2.561    61.107  1.00 56.12  ? 285 LEU A CD1   1 
ATOM   1956  C  CD2   . LEU A  1 285 ? 20.620  0.822    60.876  1.00 58.27  ? 285 LEU A CD2   1 
ATOM   1957  N  N     . LEU A  1 286 ? 21.404  1.907    66.119  1.00 61.26  ? 286 LEU A N     1 
ATOM   1958  C  CA    . LEU A  1 286 ? 22.370  2.446    67.085  1.00 62.01  ? 286 LEU A CA    1 
ATOM   1959  C  C     . LEU A  1 286 ? 22.968  1.421    68.043  1.00 63.39  ? 286 LEU A C     1 
ATOM   1960  O  O     . LEU A  1 286 ? 24.092  1.592    68.500  1.00 64.82  ? 286 LEU A O     1 
ATOM   1961  C  CB    . LEU A  1 286 ? 21.765  3.617    67.859  1.00 60.88  ? 286 LEU A CB    1 
ATOM   1962  C  CG    . LEU A  1 286 ? 21.628  4.890    67.030  1.00 59.84  ? 286 LEU A CG    1 
ATOM   1963  C  CD1   . LEU A  1 286 ? 21.093  6.014    67.885  1.00 60.01  ? 286 LEU A CD1   1 
ATOM   1964  C  CD2   . LEU A  1 286 ? 22.960  5.279    66.423  1.00 61.60  ? 286 LEU A CD2   1 
ATOM   1965  N  N     . LEU A  1 287 ? 22.212  0.366    68.341  1.00 62.79  ? 287 LEU A N     1 
ATOM   1966  C  CA    . LEU A  1 287 ? 22.705  -0.738   69.150  1.00 64.31  ? 287 LEU A CA    1 
ATOM   1967  C  C     . LEU A  1 287 ? 23.518  -1.678   68.293  1.00 65.87  ? 287 LEU A C     1 
ATOM   1968  O  O     . LEU A  1 287 ? 24.062  -2.670   68.788  1.00 67.78  ? 287 LEU A O     1 
ATOM   1969  C  CB    . LEU A  1 287 ? 21.547  -1.516   69.753  1.00 63.48  ? 287 LEU A CB    1 
ATOM   1970  C  CG    . LEU A  1 287 ? 20.885  -0.923   70.979  1.00 62.42  ? 287 LEU A CG    1 
ATOM   1971  C  CD1   . LEU A  1 287 ? 19.611  -1.667   71.239  1.00 61.94  ? 287 LEU A CD1   1 
ATOM   1972  C  CD2   . LEU A  1 287 ? 21.806  -1.003   72.173  1.00 64.04  ? 287 LEU A CD2   1 
ATOM   1973  N  N     . ARG A  1 288 ? 23.582  -1.356   67.005  1.00 65.34  ? 288 ARG A N     1 
ATOM   1974  C  CA    . ARG A  1 288 ? 24.233  -2.182   65.986  1.00 67.03  ? 288 ARG A CA    1 
ATOM   1975  C  C     . ARG A  1 288 ? 23.611  -3.563   65.844  1.00 67.56  ? 288 ARG A C     1 
ATOM   1976  O  O     . ARG A  1 288 ? 24.283  -4.500   65.391  1.00 69.27  ? 288 ARG A O     1 
ATOM   1977  C  CB    . ARG A  1 288 ? 25.753  -2.268   66.193  1.00 69.19  ? 288 ARG A CB    1 
ATOM   1978  C  CG    . ARG A  1 288 ? 26.404  -0.914   66.185  1.00 69.50  ? 288 ARG A CG    1 
ATOM   1979  C  CD    . ARG A  1 288 ? 27.880  -0.996   66.011  1.00 72.20  ? 288 ARG A CD    1 
ATOM   1980  N  NE    . ARG A  1 288 ? 28.306  0.024    65.065  1.00 73.16  ? 288 ARG A NE    1 
ATOM   1981  C  CZ    . ARG A  1 288 ? 28.542  -0.216   63.778  1.00 74.97  ? 288 ARG A CZ    1 
ATOM   1982  N  NH1   . ARG A  1 288 ? 28.408  -1.446   63.297  1.00 76.39  ? 288 ARG A NH1   1 
ATOM   1983  N  NH2   . ARG A  1 288 ? 28.923  0.764    62.964  1.00 75.20  ? 288 ARG A NH2   1 
ATOM   1984  N  N     . ARG A  1 289 ? 22.334  -3.683   66.226  1.00 66.20  ? 289 ARG A N     1 
ATOM   1985  C  CA    . ARG A  1 289 ? 21.580  -4.902   65.975  1.00 66.64  ? 289 ARG A CA    1 
ATOM   1986  C  C     . ARG A  1 289 ? 21.445  -5.055   64.447  1.00 66.02  ? 289 ARG A C     1 
ATOM   1987  O  O     . ARG A  1 289 ? 21.465  -4.056   63.730  1.00 64.80  ? 289 ARG A O     1 
ATOM   1988  C  CB    . ARG A  1 289 ? 20.226  -4.876   66.701  1.00 65.46  ? 289 ARG A CB    1 
ATOM   1989  C  CG    . ARG A  1 289 ? 20.194  -5.587   68.087  1.00 68.38  ? 289 ARG A CG    1 
ATOM   1990  C  CD    . ARG A  1 289 ? 18.912  -6.487   68.248  1.00 71.33  ? 289 ARG A CD    1 
ATOM   1991  N  NE    . ARG A  1 289 ? 18.191  -6.320   69.529  1.00 72.99  ? 289 ARG A NE    1 
ATOM   1992  C  CZ    . ARG A  1 289 ? 17.037  -5.651   69.691  1.00 71.11  ? 289 ARG A CZ    1 
ATOM   1993  N  NH1   . ARG A  1 289 ? 16.439  -5.074   68.645  1.00 69.09  ? 289 ARG A NH1   1 
ATOM   1994  N  NH2   . ARG A  1 289 ? 16.473  -5.559   70.903  1.00 69.43  ? 289 ARG A NH2   1 
ATOM   1995  N  N     . PRO A  1 290 ? 21.361  -6.303   63.939  1.00 67.21  ? 290 PRO A N     1 
ATOM   1996  C  CA    . PRO A  1 290 ? 21.365  -6.537   62.479  1.00 67.26  ? 290 PRO A CA    1 
ATOM   1997  C  C     . PRO A  1 290 ? 20.196  -5.893   61.726  1.00 65.02  ? 290 PRO A C     1 
ATOM   1998  O  O     . PRO A  1 290 ? 19.033  -6.092   62.093  1.00 64.09  ? 290 PRO A O     1 
ATOM   1999  C  CB    . PRO A  1 290 ? 21.289  -8.066   62.357  1.00 68.85  ? 290 PRO A CB    1 
ATOM   2000  C  CG    . PRO A  1 290 ? 21.743  -8.585   63.675  1.00 70.62  ? 290 PRO A CG    1 
ATOM   2001  C  CD    . PRO A  1 290 ? 21.313  -7.569   64.693  1.00 68.95  ? 290 PRO A CD    1 
ATOM   2002  N  N     . PRO A  1 291 ? 20.503  -5.126   60.673  1.00 64.50  ? 291 PRO A N     1 
ATOM   2003  C  CA    . PRO A  1 291 ? 19.464  -4.435   59.943  1.00 62.98  ? 291 PRO A CA    1 
ATOM   2004  C  C     . PRO A  1 291 ? 18.893  -5.241   58.765  1.00 63.63  ? 291 PRO A C     1 
ATOM   2005  O  O     . PRO A  1 291 ? 19.540  -6.161   58.242  1.00 65.36  ? 291 PRO A O     1 
ATOM   2006  C  CB    . PRO A  1 291 ? 20.182  -3.180   59.446  1.00 62.53  ? 291 PRO A CB    1 
ATOM   2007  C  CG    . PRO A  1 291 ? 21.573  -3.614   59.242  1.00 64.54  ? 291 PRO A CG    1 
ATOM   2008  C  CD    . PRO A  1 291 ? 21.840  -4.775   60.173  1.00 65.91  ? 291 PRO A CD    1 
ATOM   2009  N  N     . GLY A  1 292 ? 17.678  -4.880   58.363  1.00 62.33  ? 292 GLY A N     1 
ATOM   2010  C  CA    . GLY A  1 292 ? 17.037  -5.490   57.214  1.00 62.87  ? 292 GLY A CA    1 
ATOM   2011  C  C     . GLY A  1 292 ? 16.599  -4.474   56.179  1.00 61.98  ? 292 GLY A C     1 
ATOM   2012  O  O     . GLY A  1 292 ? 17.217  -3.424   56.024  1.00 61.74  ? 292 GLY A O     1 
ATOM   2013  N  N     . ARG A  1 293 ? 15.530  -4.812   55.466  1.00 61.73  ? 293 ARG A N     1 
ATOM   2014  C  CA    . ARG A  1 293 ? 14.954  -3.986   54.413  1.00 60.93  ? 293 ARG A CA    1 
ATOM   2015  C  C     . ARG A  1 293 ? 14.587  -2.601   54.917  1.00 59.38  ? 293 ARG A C     1 
ATOM   2016  O  O     . ARG A  1 293 ? 13.900  -2.467   55.925  1.00 58.40  ? 293 ARG A O     1 
ATOM   2017  C  CB    . ARG A  1 293 ? 13.729  -4.695   53.857  1.00 60.88  ? 293 ARG A CB    1 
ATOM   2018  C  CG    . ARG A  1 293 ? 12.835  -3.865   52.991  1.00 60.07  ? 293 ARG A CG    1 
ATOM   2019  C  CD    . ARG A  1 293 ? 12.053  -4.791   52.106  1.00 61.73  ? 293 ARG A CD    1 
ATOM   2020  N  NE    . ARG A  1 293 ? 10.943  -4.128   51.447  1.00 60.80  ? 293 ARG A NE    1 
ATOM   2021  C  CZ    . ARG A  1 293 ? 9.886   -4.773   50.983  1.00 62.20  ? 293 ARG A CZ    1 
ATOM   2022  N  NH1   . ARG A  1 293 ? 9.807   -6.094   51.106  1.00 63.27  ? 293 ARG A NH1   1 
ATOM   2023  N  NH2   . ARG A  1 293 ? 8.905   -4.097   50.401  1.00 63.57  ? 293 ARG A NH2   1 
ATOM   2024  N  N     . GLU A  1 294 ? 15.057  -1.589   54.186  1.00 59.58  ? 294 GLU A N     1 
ATOM   2025  C  CA    . GLU A  1 294 ? 14.977  -0.167   54.547  1.00 58.63  ? 294 GLU A CA    1 
ATOM   2026  C  C     . GLU A  1 294 ? 15.602  0.122    55.902  1.00 58.53  ? 294 GLU A C     1 
ATOM   2027  O  O     . GLU A  1 294 ? 15.188  1.038    56.596  1.00 57.61  ? 294 GLU A O     1 
ATOM   2028  C  CB    . GLU A  1 294 ? 13.548  0.361    54.479  1.00 57.17  ? 294 GLU A CB    1 
ATOM   2029  C  CG    . GLU A  1 294 ? 12.911  0.289    53.104  1.00 58.87  ? 294 GLU A CG    1 
ATOM   2030  C  CD    . GLU A  1 294 ? 11.475  0.797    53.097  1.00 60.31  ? 294 GLU A CD    1 
ATOM   2031  O  OE1   . GLU A  1 294 ? 11.148  1.651    53.952  1.00 62.13  ? 294 GLU A OE1   1 
ATOM   2032  O  OE2   . GLU A  1 294 ? 10.668  0.357    52.243  1.00 60.46  ? 294 GLU A OE2   1 
ATOM   2033  N  N     . ALA A  1 295 ? 16.608  -0.672   56.262  1.00 60.13  ? 295 ALA A N     1 
ATOM   2034  C  CA    . ALA A  1 295 ? 17.349  -0.533   57.521  1.00 60.80  ? 295 ALA A CA    1 
ATOM   2035  C  C     . ALA A  1 295 ? 16.516  -0.734   58.799  1.00 60.20  ? 295 ALA A C     1 
ATOM   2036  O  O     . ALA A  1 295 ? 16.985  -0.415   59.897  1.00 60.80  ? 295 ALA A O     1 
ATOM   2037  C  CB    . ALA A  1 295 ? 18.102  0.808    57.568  1.00 60.81  ? 295 ALA A CB    1 
ATOM   2038  N  N     . TYR A  1 296 ? 15.295  -1.255   58.665  1.00 59.46  ? 296 TYR A N     1 
ATOM   2039  C  CA    . TYR A  1 296 ? 14.493  -1.618   59.833  1.00 58.68  ? 296 TYR A CA    1 
ATOM   2040  C  C     . TYR A  1 296 ? 14.994  -2.945   60.408  1.00 60.20  ? 296 TYR A C     1 
ATOM   2041  O  O     . TYR A  1 296 ? 15.577  -3.761   59.677  1.00 61.36  ? 296 TYR A O     1 
ATOM   2042  C  CB    . TYR A  1 296 ? 13.007  -1.732   59.482  1.00 57.63  ? 296 TYR A CB    1 
ATOM   2043  C  CG    . TYR A  1 296 ? 12.335  -0.426   59.137  1.00 56.19  ? 296 TYR A CG    1 
ATOM   2044  C  CD1   . TYR A  1 296 ? 12.003  0.494    60.129  1.00 55.54  ? 296 TYR A CD1   1 
ATOM   2045  C  CD2   . TYR A  1 296 ? 12.003  -0.114   57.819  1.00 55.60  ? 296 TYR A CD2   1 
ATOM   2046  C  CE1   . TYR A  1 296 ? 11.375  1.706    59.816  1.00 53.75  ? 296 TYR A CE1   1 
ATOM   2047  C  CE2   . TYR A  1 296 ? 11.381  1.096    57.495  1.00 54.00  ? 296 TYR A CE2   1 
ATOM   2048  C  CZ    . TYR A  1 296 ? 11.074  1.995    58.497  1.00 53.14  ? 296 TYR A CZ    1 
ATOM   2049  O  OH    . TYR A  1 296 ? 10.465  3.180    58.183  1.00 52.17  ? 296 TYR A OH    1 
ATOM   2050  N  N     . PRO A  1 297 ? 14.791  -3.154   61.723  1.00 60.23  ? 297 PRO A N     1 
ATOM   2051  C  CA    . PRO A  1 297 ? 15.104  -4.401   62.410  1.00 61.72  ? 297 PRO A CA    1 
ATOM   2052  C  C     . PRO A  1 297 ? 14.374  -5.568   61.783  1.00 62.35  ? 297 PRO A C     1 
ATOM   2053  O  O     . PRO A  1 297 ? 13.216  -5.424   61.400  1.00 61.15  ? 297 PRO A O     1 
ATOM   2054  C  CB    . PRO A  1 297 ? 14.579  -4.168   63.829  1.00 61.24  ? 297 PRO A CB    1 
ATOM   2055  C  CG    . PRO A  1 297 ? 13.923  -2.846   63.817  1.00 59.27  ? 297 PRO A CG    1 
ATOM   2056  C  CD    . PRO A  1 297 ? 14.453  -2.092   62.679  1.00 59.20  ? 297 PRO A CD    1 
ATOM   2057  N  N     . GLY A  1 298 ? 15.053  -6.710   61.690  1.00 64.50  ? 298 GLY A N     1 
ATOM   2058  C  CA    . GLY A  1 298 ? 14.540  -7.886   60.989  1.00 65.69  ? 298 GLY A CA    1 
ATOM   2059  C  C     . GLY A  1 298 ? 13.122  -8.250   61.370  1.00 65.32  ? 298 GLY A C     1 
ATOM   2060  O  O     . GLY A  1 298 ? 12.384  -8.819   60.570  1.00 65.86  ? 298 GLY A O     1 
ATOM   2061  N  N     . ASP A  1 299 ? 12.742  -7.887   62.591  1.00 64.81  ? 299 ASP A N     1 
ATOM   2062  C  CA    . ASP A  1 299 ? 11.427  -8.183   63.144  1.00 64.13  ? 299 ASP A CA    1 
ATOM   2063  C  C     . ASP A  1 299 ? 10.519  -6.951   63.200  1.00 61.91  ? 299 ASP A C     1 
ATOM   2064  O  O     . ASP A  1 299 ? 9.724   -6.817   64.129  1.00 61.70  ? 299 ASP A O     1 
ATOM   2065  C  CB    . ASP A  1 299 ? 11.611  -8.713   64.570  1.00 65.39  ? 299 ASP A CB    1 
ATOM   2066  C  CG    . ASP A  1 299 ? 12.123  -7.632   65.545  1.00 65.41  ? 299 ASP A CG    1 
ATOM   2067  O  OD1   . ASP A  1 299 ? 12.887  -6.726   65.116  1.00 64.59  ? 299 ASP A OD1   1 
ATOM   2068  O  OD2   . ASP A  1 299 ? 11.748  -7.693   66.742  1.00 66.17  ? 299 ASP A OD2   1 
ATOM   2069  N  N     . VAL A  1 300 ? 10.627  -6.040   62.238  1.00 60.57  ? 300 VAL A N     1 
ATOM   2070  C  CA    . VAL A  1 300 ? 9.810   -4.816   62.292  1.00 58.32  ? 300 VAL A CA    1 
ATOM   2071  C  C     . VAL A  1 300 ? 8.323   -5.170   62.183  1.00 57.50  ? 300 VAL A C     1 
ATOM   2072  O  O     . VAL A  1 300 ? 7.471   -4.445   62.672  1.00 56.36  ? 300 VAL A O     1 
ATOM   2073  C  CB    . VAL A  1 300 ? 10.274  -3.726   61.255  1.00 57.71  ? 300 VAL A CB    1 
ATOM   2074  C  CG1   . VAL A  1 300 ? 9.961   -4.143   59.833  1.00 58.27  ? 300 VAL A CG1   1 
ATOM   2075  C  CG2   . VAL A  1 300 ? 9.672   -2.361   61.564  1.00 55.47  ? 300 VAL A CG2   1 
ATOM   2076  N  N     . PHE A  1 301 ? 8.040   -6.311   61.562  1.00 58.36  ? 301 PHE A N     1 
ATOM   2077  C  CA    . PHE A  1 301 ? 6.685   -6.827   61.426  1.00 58.06  ? 301 PHE A CA    1 
ATOM   2078  C  C     . PHE A  1 301 ? 6.124   -7.151   62.799  1.00 58.44  ? 301 PHE A C     1 
ATOM   2079  O  O     . PHE A  1 301 ? 5.019   -6.706   63.147  1.00 58.01  ? 301 PHE A O     1 
ATOM   2080  C  CB    . PHE A  1 301 ? 6.683   -8.064   60.516  1.00 59.17  ? 301 PHE A CB    1 
ATOM   2081  C  CG    . PHE A  1 301 ? 5.386   -8.828   60.504  1.00 58.32  ? 301 PHE A CG    1 
ATOM   2082  C  CD1   . PHE A  1 301 ? 4.277   -8.346   59.804  1.00 56.71  ? 301 PHE A CD1   1 
ATOM   2083  C  CD2   . PHE A  1 301 ? 5.281   -10.050  61.172  1.00 58.10  ? 301 PHE A CD2   1 
ATOM   2084  C  CE1   . PHE A  1 301 ? 3.073   -9.062   59.788  1.00 56.28  ? 301 PHE A CE1   1 
ATOM   2085  C  CE2   . PHE A  1 301 ? 4.086   -10.770  61.165  1.00 57.76  ? 301 PHE A CE2   1 
ATOM   2086  C  CZ    . PHE A  1 301 ? 2.980   -10.276  60.468  1.00 56.89  ? 301 PHE A CZ    1 
ATOM   2087  N  N     . TYR A  1 302 ? 6.900   -7.901   63.578  1.00 59.62  ? 302 TYR A N     1 
ATOM   2088  C  CA    . TYR A  1 302 ? 6.504   -8.333   64.917  1.00 60.33  ? 302 TYR A CA    1 
ATOM   2089  C  C     . TYR A  1 302 ? 6.383   -7.193   65.927  1.00 59.09  ? 302 TYR A C     1 
ATOM   2090  O  O     . TYR A  1 302 ? 5.694   -7.320   66.939  1.00 59.41  ? 302 TYR A O     1 
ATOM   2091  C  CB    . TYR A  1 302 ? 7.468   -9.390   65.431  1.00 62.29  ? 302 TYR A CB    1 
ATOM   2092  C  CG    . TYR A  1 302 ? 7.104   -9.975   66.770  1.00 64.50  ? 302 TYR A CG    1 
ATOM   2093  C  CD1   . TYR A  1 302 ? 5.921   -10.698  66.942  1.00 66.08  ? 302 TYR A CD1   1 
ATOM   2094  C  CD2   . TYR A  1 302 ? 7.954   -9.821   67.868  1.00 66.56  ? 302 TYR A CD2   1 
ATOM   2095  C  CE1   . TYR A  1 302 ? 5.589   -11.247  68.181  1.00 68.58  ? 302 TYR A CE1   1 
ATOM   2096  C  CE2   . TYR A  1 302 ? 7.640   -10.373  69.114  1.00 68.87  ? 302 TYR A CE2   1 
ATOM   2097  C  CZ    . TYR A  1 302 ? 6.455   -11.088  69.261  1.00 70.09  ? 302 TYR A CZ    1 
ATOM   2098  O  OH    . TYR A  1 302 ? 6.127   -11.638  70.483  1.00 72.24  ? 302 TYR A OH    1 
ATOM   2099  N  N     . LEU A  1 303 ? 7.048   -6.078   65.654  1.00 57.96  ? 303 LEU A N     1 
ATOM   2100  C  CA    . LEU A  1 303 ? 6.877   -4.896   66.472  1.00 56.61  ? 303 LEU A CA    1 
ATOM   2101  C  C     . LEU A  1 303 ? 5.417   -4.499   66.436  1.00 55.98  ? 303 LEU A C     1 
ATOM   2102  O  O     . LEU A  1 303 ? 4.870   -4.058   67.441  1.00 56.21  ? 303 LEU A O     1 
ATOM   2103  C  CB    . LEU A  1 303 ? 7.722   -3.747   65.937  1.00 55.67  ? 303 LEU A CB    1 
ATOM   2104  C  CG    . LEU A  1 303 ? 7.420   -2.366   66.509  1.00 53.39  ? 303 LEU A CG    1 
ATOM   2105  C  CD1   . LEU A  1 303 ? 8.359   -2.066   67.647  1.00 52.55  ? 303 LEU A CD1   1 
ATOM   2106  C  CD2   . LEU A  1 303 ? 7.535   -1.323   65.421  1.00 51.97  ? 303 LEU A CD2   1 
ATOM   2107  N  N     . HIS A  1 304 ? 4.788   -4.668   65.276  1.00 55.72  ? 304 HIS A N     1 
ATOM   2108  C  CA    . HIS A  1 304 ? 3.431   -4.169   65.052  1.00 54.76  ? 304 HIS A CA    1 
ATOM   2109  C  C     . HIS A  1 304 ? 2.323   -5.201   65.230  1.00 55.49  ? 304 HIS A C     1 
ATOM   2110  O  O     . HIS A  1 304 ? 1.161   -4.842   65.473  1.00 54.91  ? 304 HIS A O     1 
ATOM   2111  C  CB    . HIS A  1 304 ? 3.327   -3.540   63.668  1.00 53.96  ? 304 HIS A CB    1 
ATOM   2112  C  CG    . HIS A  1 304 ? 3.862   -2.150   63.603  1.00 52.20  ? 304 HIS A CG    1 
ATOM   2113  N  ND1   . HIS A  1 304 ? 4.363   -1.600   62.444  1.00 52.14  ? 304 HIS A ND1   1 
ATOM   2114  C  CD2   . HIS A  1 304 ? 3.981   -1.198   64.555  1.00 51.01  ? 304 HIS A CD2   1 
ATOM   2115  C  CE1   . HIS A  1 304 ? 4.757   -0.363   62.681  1.00 51.38  ? 304 HIS A CE1   1 
ATOM   2116  N  NE2   . HIS A  1 304 ? 4.539   -0.096   63.957  1.00 51.24  ? 304 HIS A NE2   1 
ATOM   2117  N  N     . SER A  1 305 ? 2.679   -6.473   65.084  1.00 56.64  ? 305 SER A N     1 
ATOM   2118  C  CA    . SER A  1 305 ? 1.708   -7.543   65.183  1.00 57.52  ? 305 SER A CA    1 
ATOM   2119  C  C     . SER A  1 305 ? 1.582   -7.978   66.634  1.00 58.49  ? 305 SER A C     1 
ATOM   2120  O  O     . SER A  1 305 ? 0.526   -8.429   67.081  1.00 59.04  ? 305 SER A O     1 
ATOM   2121  C  CB    . SER A  1 305 ? 2.120   -8.703   64.290  1.00 58.58  ? 305 SER A CB    1 
ATOM   2122  O  OG    . SER A  1 305 ? 3.402   -9.170   64.641  1.00 59.02  ? 305 SER A OG    1 
ATOM   2123  N  N     . ARG A  1 306 ? 2.672   -7.822   67.372  1.00 58.93  ? 306 ARG A N     1 
ATOM   2124  C  CA    . ARG A  1 306 ? 2.670   -8.052   68.800  1.00 59.88  ? 306 ARG A CA    1 
ATOM   2125  C  C     . ARG A  1 306 ? 1.721   -7.054   69.443  1.00 58.28  ? 306 ARG A C     1 
ATOM   2126  O  O     . ARG A  1 306 ? 0.883   -7.422   70.263  1.00 58.75  ? 306 ARG A O     1 
ATOM   2127  C  CB    . ARG A  1 306 ? 4.072   -7.828   69.334  1.00 60.71  ? 306 ARG A CB    1 
ATOM   2128  C  CG    . ARG A  1 306 ? 4.451   -8.720   70.471  1.00 64.88  ? 306 ARG A CG    1 
ATOM   2129  C  CD    . ARG A  1 306 ? 5.685   -8.195   71.176  1.00 69.40  ? 306 ARG A CD    1 
ATOM   2130  N  NE    . ARG A  1 306 ? 6.505   -7.332   70.327  1.00 70.63  ? 306 ARG A NE    1 
ATOM   2131  C  CZ    . ARG A  1 306 ? 7.640   -6.774   70.734  1.00 73.26  ? 306 ARG A CZ    1 
ATOM   2132  N  NH1   . ARG A  1 306 ? 8.083   -7.009   71.966  1.00 76.03  ? 306 ARG A NH1   1 
ATOM   2133  N  NH2   . ARG A  1 306 ? 8.337   -5.993   69.918  1.00 73.38  ? 306 ARG A NH2   1 
ATOM   2134  N  N     . LEU A  1 307 ? 1.864   -5.791   69.039  1.00 56.52  ? 307 LEU A N     1 
ATOM   2135  C  CA    . LEU A  1 307 ? 1.053   -4.687   69.529  1.00 55.05  ? 307 LEU A CA    1 
ATOM   2136  C  C     . LEU A  1 307 ? -0.431  -4.848   69.193  1.00 54.97  ? 307 LEU A C     1 
ATOM   2137  O  O     . LEU A  1 307 ? -1.254  -4.831   70.096  1.00 55.38  ? 307 LEU A O     1 
ATOM   2138  C  CB    . LEU A  1 307 ? 1.581   -3.364   68.978  1.00 53.43  ? 307 LEU A CB    1 
ATOM   2139  C  CG    . LEU A  1 307 ? 0.706   -2.148   69.276  1.00 52.61  ? 307 LEU A CG    1 
ATOM   2140  C  CD1   . LEU A  1 307 ? 1.040   -1.534   70.625  1.00 52.25  ? 307 LEU A CD1   1 
ATOM   2141  C  CD2   . LEU A  1 307 ? 0.808   -1.105   68.165  1.00 51.56  ? 307 LEU A CD2   1 
ATOM   2142  N  N     . LEU A  1 308 ? -0.756  -5.027   67.909  1.00 54.77  ? 308 LEU A N     1 
ATOM   2143  C  CA    . LEU A  1 308 ? -2.139  -4.986   67.419  1.00 54.48  ? 308 LEU A CA    1 
ATOM   2144  C  C     . LEU A  1 308 ? -2.978  -6.227   67.690  1.00 55.94  ? 308 LEU A C     1 
ATOM   2145  O  O     . LEU A  1 308 ? -4.188  -6.225   67.444  1.00 56.06  ? 308 LEU A O     1 
ATOM   2146  C  CB    . LEU A  1 308 ? -2.174  -4.671   65.927  1.00 53.90  ? 308 LEU A CB    1 
ATOM   2147  C  CG    . LEU A  1 308 ? -1.989  -3.208   65.526  1.00 53.17  ? 308 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A  1 308 ? -1.897  -3.059   64.023  1.00 53.58  ? 308 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A  1 308 ? -3.112  -2.347   66.051  1.00 53.40  ? 308 LEU A CD2   1 
ATOM   2150  N  N     . GLU A  1 309 ? -2.352  -7.289   68.185  1.00 57.29  ? 309 GLU A N     1 
ATOM   2151  C  CA    . GLU A  1 309 ? -3.106  -8.481   68.576  1.00 58.96  ? 309 GLU A CA    1 
ATOM   2152  C  C     . GLU A  1 309 ? -3.634  -8.334   69.997  1.00 59.51  ? 309 GLU A C     1 
ATOM   2153  O  O     . GLU A  1 309 ? -4.468  -9.127   70.453  1.00 61.02  ? 309 GLU A O     1 
ATOM   2154  C  CB    . GLU A  1 309 ? -2.246  -9.729   68.451  1.00 60.14  ? 309 GLU A CB    1 
ATOM   2155  C  CG    . GLU A  1 309 ? -2.084  -10.205  67.036  1.00 60.61  ? 309 GLU A CG    1 
ATOM   2156  C  CD    . GLU A  1 309 ? -3.099  -11.243  66.673  1.00 62.54  ? 309 GLU A CD    1 
ATOM   2157  O  OE1   . GLU A  1 309 ? -2.717  -12.427  66.681  1.00 64.42  ? 309 GLU A OE1   1 
ATOM   2158  O  OE2   . GLU A  1 309 ? -4.271  -10.888  66.401  1.00 63.05  ? 309 GLU A OE2   1 
ATOM   2159  N  N     . ARG A  1 310 ? -3.145  -7.304   70.684  1.00 58.58  ? 310 ARG A N     1 
ATOM   2160  C  CA    . ARG A  1 310 ? -3.546  -7.016   72.051  1.00 58.77  ? 310 ARG A CA    1 
ATOM   2161  C  C     . ARG A  1 310 ? -4.938  -6.383   72.088  1.00 58.60  ? 310 ARG A C     1 
ATOM   2162  O  O     . ARG A  1 310 ? -5.641  -6.474   73.098  1.00 59.59  ? 310 ARG A O     1 
ATOM   2163  C  CB    . ARG A  1 310 ? -2.493  -6.154   72.745  1.00 57.91  ? 310 ARG A CB    1 
ATOM   2164  C  CG    . ARG A  1 310 ? -1.162  -6.858   72.886  1.00 57.71  ? 310 ARG A CG    1 
ATOM   2165  C  CD    . ARG A  1 310 ? -0.113  -5.964   73.480  1.00 57.30  ? 310 ARG A CD    1 
ATOM   2166  N  NE    . ARG A  1 310 ? -0.512  -5.410   74.778  1.00 57.73  ? 310 ARG A NE    1 
ATOM   2167  C  CZ    . ARG A  1 310 ? 0.272   -4.673   75.567  1.00 57.26  ? 310 ARG A CZ    1 
ATOM   2168  N  NH1   . ARG A  1 310 ? 1.525   -4.387   75.211  1.00 56.97  ? 310 ARG A NH1   1 
ATOM   2169  N  NH2   . ARG A  1 310 ? -0.197  -4.220   76.723  1.00 56.66  ? 310 ARG A NH2   1 
ATOM   2170  N  N     . ALA A  1 311 ? -5.334  -5.757   70.979  1.00 57.74  ? 311 ALA A N     1 
ATOM   2171  C  CA    . ALA A  1 311 ? -6.724  -5.358   70.780  1.00 57.78  ? 311 ALA A CA    1 
ATOM   2172  C  C     . ALA A  1 311 ? -7.525  -6.595   70.419  1.00 59.28  ? 311 ALA A C     1 
ATOM   2173  O  O     . ALA A  1 311 ? -7.202  -7.306   69.455  1.00 59.89  ? 311 ALA A O     1 
ATOM   2174  C  CB    . ALA A  1 311 ? -6.836  -4.331   69.694  1.00 56.49  ? 311 ALA A CB    1 
ATOM   2175  N  N     . ALA A  1 312 ? -8.559  -6.859   71.207  1.00 60.24  ? 312 ALA A N     1 
ATOM   2176  C  CA    . ALA A  1 312 ? -9.350  -8.070   71.046  1.00 62.02  ? 312 ALA A CA    1 
ATOM   2177  C  C     . ALA A  1 312 ? -10.723 -7.900   71.679  1.00 62.70  ? 312 ALA A C     1 
ATOM   2178  O  O     . ALA A  1 312 ? -10.908 -7.029   72.529  1.00 62.60  ? 312 ALA A O     1 
ATOM   2179  C  CB    . ALA A  1 312 ? -8.620  -9.262   71.671  1.00 63.30  ? 312 ALA A CB    1 
ATOM   2180  N  N     . LYS A  1 313 ? -11.684 -8.711   71.241  1.00 63.67  ? 313 LYS A N     1 
ATOM   2181  C  CA    . LYS A  1 313 ? -12.935 -8.905   71.972  1.00 64.69  ? 313 LYS A CA    1 
ATOM   2182  C  C     . LYS A  1 313 ? -12.797 -10.223  72.772  1.00 66.58  ? 313 LYS A C     1 
ATOM   2183  O  O     . LYS A  1 313 ? -12.252 -11.211  72.266  1.00 67.23  ? 313 LYS A O     1 
ATOM   2184  C  CB    . LYS A  1 313 ? -14.126 -8.916   71.003  1.00 64.82  ? 313 LYS A CB    1 
ATOM   2185  C  CG    . LYS A  1 313 ? -15.433 -9.486   71.551  1.00 66.30  ? 313 LYS A CG    1 
ATOM   2186  C  CD    . LYS A  1 313 ? -16.194 -8.482   72.386  1.00 65.49  ? 313 LYS A CD    1 
ATOM   2187  C  CE    . LYS A  1 313 ? -17.250 -9.170   73.236  1.00 66.91  ? 313 LYS A CE    1 
ATOM   2188  N  NZ    . LYS A  1 313 ? -18.035 -8.178   74.014  1.00 65.91  ? 313 LYS A NZ    1 
ATOM   2189  N  N     . LEU A  1 314 ? -13.257 -10.227  74.022  1.00 67.25  ? 314 LEU A N     1 
ATOM   2190  C  CA    . LEU A  1 314 ? -12.986 -11.352  74.905  1.00 69.09  ? 314 LEU A CA    1 
ATOM   2191  C  C     . LEU A  1 314 ? -14.192 -12.237  75.145  1.00 71.34  ? 314 LEU A C     1 
ATOM   2192  O  O     . LEU A  1 314 ? -15.329 -11.764  75.151  1.00 71.69  ? 314 LEU A O     1 
ATOM   2193  C  CB    . LEU A  1 314 ? -12.423 -10.873  76.244  1.00 68.94  ? 314 LEU A CB    1 
ATOM   2194  C  CG    . LEU A  1 314 ? -11.074 -10.151  76.253  1.00 67.53  ? 314 LEU A CG    1 
ATOM   2195  C  CD1   . LEU A  1 314 ? -10.633 -9.943   77.676  1.00 68.43  ? 314 LEU A CD1   1 
ATOM   2196  C  CD2   . LEU A  1 314 ? -9.994  -10.896  75.485  1.00 67.52  ? 314 LEU A CD2   1 
ATOM   2197  N  N     . SER A  1 315 ? -13.920 -13.527  75.351  1.00 73.33  ? 315 SER A N     1 
ATOM   2198  C  CA    . SER A  1 315 ? -14.933 -14.543  75.638  1.00 75.59  ? 315 SER A CA    1 
ATOM   2199  C  C     . SER A  1 315 ? -15.804 -14.211  76.845  1.00 76.64  ? 315 SER A C     1 
ATOM   2200  O  O     . SER A  1 315 ? -15.407 -13.434  77.719  1.00 75.75  ? 315 SER A O     1 
ATOM   2201  C  CB    . SER A  1 315 ? -14.259 -15.902  75.841  1.00 77.56  ? 315 SER A CB    1 
ATOM   2202  O  OG    . SER A  1 315 ? -13.201 -15.828  76.780  1.00 77.20  ? 315 SER A OG    1 
ATOM   2203  N  N     . GLU A  1 316 ? -16.995 -14.806  76.877  1.00 78.73  ? 316 GLU A N     1 
ATOM   2204  C  CA    . GLU A  1 316 ? -17.943 -14.634  77.988  1.00 80.51  ? 316 GLU A CA    1 
ATOM   2205  C  C     . GLU A  1 316 ? -17.207 -14.889  79.313  1.00 81.26  ? 316 GLU A C     1 
ATOM   2206  O  O     . GLU A  1 316 ? -17.186 -14.034  80.204  1.00 80.62  ? 316 GLU A O     1 
ATOM   2207  C  CB    . GLU A  1 316 ? -19.176 -15.566  77.840  1.00 82.95  ? 316 GLU A CB    1 
ATOM   2208  C  CG    . GLU A  1 316 ? -19.716 -15.782  76.388  1.00 84.43  ? 316 GLU A CG    1 
ATOM   2209  C  CD    . GLU A  1 316 ? -18.820 -16.705  75.500  1.00 86.38  ? 316 GLU A CD    1 
ATOM   2210  O  OE1   . GLU A  1 316 ? -18.929 -17.958  75.591  1.00 88.44  ? 316 GLU A OE1   1 
ATOM   2211  O  OE2   . GLU A  1 316 ? -18.017 -16.167  74.695  1.00 84.27  ? 316 GLU A OE2   1 
ATOM   2212  N  N     . LYS A  1 317 ? -16.558 -16.051  79.389  1.00 82.73  ? 317 LYS A N     1 
ATOM   2213  C  CA    . LYS A  1 317 ? -15.796 -16.499  80.555  1.00 84.00  ? 317 LYS A CA    1 
ATOM   2214  C  C     . LYS A  1 317 ? -14.752 -15.488  81.048  1.00 82.36  ? 317 LYS A C     1 
ATOM   2215  O  O     . LYS A  1 317 ? -14.203 -15.649  82.143  1.00 83.64  ? 317 LYS A O     1 
ATOM   2216  C  CB    . LYS A  1 317 ? -15.117 -17.842  80.237  1.00 85.61  ? 317 LYS A CB    1 
ATOM   2217  C  CG    . LYS A  1 317 ? -14.338 -18.461  81.387  1.00 87.18  ? 317 LYS A CG    1 
ATOM   2218  C  CD    . LYS A  1 317 ? -13.088 -19.167  80.890  1.00 87.57  ? 317 LYS A CD    1 
ATOM   2219  C  CE    . LYS A  1 317 ? -12.242 -19.699  82.044  1.00 89.24  ? 317 LYS A CE    1 
ATOM   2220  N  NZ    . LYS A  1 317 ? -12.851 -20.894  82.705  1.00 91.99  ? 317 LYS A NZ    1 
ATOM   2221  N  N     . GLU A  1 318 ? -14.473 -14.456  80.254  1.00 79.74  ? 318 GLU A N     1 
ATOM   2222  C  CA    . GLU A  1 318 ? -13.412 -13.515  80.612  1.00 78.17  ? 318 GLU A CA    1 
ATOM   2223  C  C     . GLU A  1 318 ? -13.856 -12.052  80.721  1.00 76.33  ? 318 GLU A C     1 
ATOM   2224  O  O     . GLU A  1 318 ? -13.028 -11.169  80.941  1.00 75.15  ? 318 GLU A O     1 
ATOM   2225  C  CB    . GLU A  1 318 ? -12.224 -13.659  79.660  1.00 76.87  ? 318 GLU A CB    1 
ATOM   2226  C  CG    . GLU A  1 318 ? -10.870 -13.536  80.343  1.00 77.49  ? 318 GLU A CG    1 
ATOM   2227  C  CD    . GLU A  1 318 ? -10.357 -14.858  80.905  1.00 81.10  ? 318 GLU A CD    1 
ATOM   2228  O  OE1   . GLU A  1 318 ? -10.671 -15.925  80.333  1.00 82.98  ? 318 GLU A OE1   1 
ATOM   2229  O  OE2   . GLU A  1 318 ? -9.623  -14.831  81.917  1.00 82.34  ? 318 GLU A OE2   1 
ATOM   2230  N  N     . GLY A  1 319 ? -15.153 -11.794  80.578  1.00 76.38  ? 319 GLY A N     1 
ATOM   2231  C  CA    . GLY A  1 319 ? -15.688 -10.457  80.845  1.00 74.97  ? 319 GLY A CA    1 
ATOM   2232  C  C     . GLY A  1 319 ? -16.380 -9.774   79.684  1.00 73.27  ? 319 GLY A C     1 
ATOM   2233  O  O     . GLY A  1 319 ? -17.092 -8.779   79.868  1.00 72.72  ? 319 GLY A O     1 
ATOM   2234  N  N     . SER A  1 320 ? -16.172 -10.312  78.486  1.00 72.58  ? 320 SER A N     1 
ATOM   2235  C  CA    . SER A  1 320 ? -16.707 -9.729   77.254  1.00 70.94  ? 320 SER A CA    1 
ATOM   2236  C  C     . SER A  1 320 ? -16.124 -8.330   76.999  1.00 68.61  ? 320 SER A C     1 
ATOM   2237  O  O     . SER A  1 320 ? -16.587 -7.594   76.123  1.00 67.52  ? 320 SER A O     1 
ATOM   2238  C  CB    . SER A  1 320 ? -18.243 -9.726   77.262  1.00 72.00  ? 320 SER A CB    1 
ATOM   2239  O  OG    . SER A  1 320 ? -18.752 -10.997  77.625  1.00 73.65  ? 320 SER A OG    1 
ATOM   2240  N  N     . GLY A  1 321 ? -15.095 -7.980   77.765  1.00 67.88  ? 321 GLY A N     1 
ATOM   2241  C  CA    . GLY A  1 321 ? -14.367 -6.744   77.555  1.00 66.07  ? 321 GLY A CA    1 
ATOM   2242  C  C     . GLY A  1 321 ? -13.737 -6.685   76.176  1.00 64.92  ? 321 GLY A C     1 
ATOM   2243  O  O     . GLY A  1 321 ? -13.497 -7.717   75.535  1.00 65.48  ? 321 GLY A O     1 
ATOM   2244  N  N     . SER A  1 322 ? -13.472 -5.466   75.715  1.00 63.41  ? 322 SER A N     1 
ATOM   2245  C  CA    . SER A  1 322 ? -12.950 -5.253   74.379  1.00 61.91  ? 322 SER A CA    1 
ATOM   2246  C  C     . SER A  1 322 ? -11.963 -4.100   74.340  1.00 60.67  ? 322 SER A C     1 
ATOM   2247  O  O     . SER A  1 322 ? -12.163 -3.071   74.987  1.00 60.20  ? 322 SER A O     1 
ATOM   2248  C  CB    . SER A  1 322 ? -14.095 -5.034   73.370  1.00 61.71  ? 322 SER A CB    1 
ATOM   2249  O  OG    . SER A  1 322 ? -14.788 -3.812   73.567  1.00 60.15  ? 322 SER A OG    1 
ATOM   2250  N  N     . LEU A  1 323 ? -10.882 -4.309   73.598  1.00 60.40  ? 323 LEU A N     1 
ATOM   2251  C  CA    . LEU A  1 323 ? -10.001 -3.230   73.163  1.00 59.45  ? 323 LEU A CA    1 
ATOM   2252  C  C     . LEU A  1 323 ? -10.053 -3.155   71.643  1.00 59.15  ? 323 LEU A C     1 
ATOM   2253  O  O     . LEU A  1 323 ? -9.787  -4.148   70.949  1.00 59.64  ? 323 LEU A O     1 
ATOM   2254  C  CB    . LEU A  1 323 ? -8.560  -3.455   73.632  1.00 59.29  ? 323 LEU A CB    1 
ATOM   2255  C  CG    . LEU A  1 323 ? -7.528  -2.406   73.214  1.00 57.59  ? 323 LEU A CG    1 
ATOM   2256  C  CD1   . LEU A  1 323 ? -7.660  -1.118   74.039  1.00 56.63  ? 323 LEU A CD1   1 
ATOM   2257  C  CD2   . LEU A  1 323 ? -6.127  -2.990   73.322  1.00 57.36  ? 323 LEU A CD2   1 
ATOM   2258  N  N     . THR A  1 324 ? -10.418 -1.977   71.145  1.00 58.68  ? 324 THR A N     1 
ATOM   2259  C  CA    . THR A  1 324 ? -10.511 -1.718   69.714  1.00 58.50  ? 324 THR A CA    1 
ATOM   2260  C  C     . THR A  1 324 ? -9.433  -0.726   69.355  1.00 57.47  ? 324 THR A C     1 
ATOM   2261  O  O     . THR A  1 324 ? -9.314  0.330    70.003  1.00 57.32  ? 324 THR A O     1 
ATOM   2262  C  CB    . THR A  1 324 ? -11.874 -1.118   69.347  1.00 58.87  ? 324 THR A CB    1 
ATOM   2263  O  OG1   . THR A  1 324 ? -12.898 -2.081   69.624  1.00 61.07  ? 324 THR A OG1   1 
ATOM   2264  C  CG2   . THR A  1 324 ? -11.928 -0.718   67.867  1.00 58.13  ? 324 THR A CG2   1 
ATOM   2265  N  N     . ALA A  1 325 ? -8.643  -1.073   68.339  1.00 56.80  ? 325 ALA A N     1 
ATOM   2266  C  CA    . ALA A  1 325 ? -7.535  -0.226   67.910  1.00 55.60  ? 325 ALA A CA    1 
ATOM   2267  C  C     . ALA A  1 325 ? -7.807  0.432    66.562  1.00 55.28  ? 325 ALA A C     1 
ATOM   2268  O  O     . ALA A  1 325 ? -8.261  -0.222   65.607  1.00 55.78  ? 325 ALA A O     1 
ATOM   2269  C  CB    . ALA A  1 325 ? -6.233  -1.006   67.874  1.00 55.24  ? 325 ALA A CB    1 
ATOM   2270  N  N     . LEU A  1 326 ? -7.548  1.738    66.512  1.00 54.45  ? 326 LEU A N     1 
ATOM   2271  C  CA    . LEU A  1 326 ? -7.481  2.480    65.261  1.00 53.84  ? 326 LEU A CA    1 
ATOM   2272  C  C     . LEU A  1 326 ? -6.032  2.937    65.052  1.00 53.32  ? 326 LEU A C     1 
ATOM   2273  O  O     . LEU A  1 326 ? -5.673  4.054    65.451  1.00 53.10  ? 326 LEU A O     1 
ATOM   2274  C  CB    . LEU A  1 326 ? -8.429  3.688    65.282  1.00 53.64  ? 326 LEU A CB    1 
ATOM   2275  C  CG    . LEU A  1 326 ? -9.948  3.508    65.208  1.00 54.04  ? 326 LEU A CG    1 
ATOM   2276  C  CD1   . LEU A  1 326 ? -10.662 4.846    65.430  1.00 53.42  ? 326 LEU A CD1   1 
ATOM   2277  C  CD2   . LEU A  1 326 ? -10.377 2.880    63.884  1.00 53.79  ? 326 LEU A CD2   1 
ATOM   2278  N  N     . PRO A  1 327 ? -5.179  2.060    64.466  1.00 53.34  ? 327 PRO A N     1 
ATOM   2279  C  CA    . PRO A  1 327 ? -3.809  2.476    64.109  1.00 52.80  ? 327 PRO A CA    1 
ATOM   2280  C  C     . PRO A  1 327 ? -3.799  3.418    62.915  1.00 52.40  ? 327 PRO A C     1 
ATOM   2281  O  O     . PRO A  1 327 ? -4.776  3.483    62.164  1.00 52.77  ? 327 PRO A O     1 
ATOM   2282  C  CB    . PRO A  1 327 ? -3.112  1.160    63.742  1.00 53.16  ? 327 PRO A CB    1 
ATOM   2283  C  CG    . PRO A  1 327 ? -4.207  0.225    63.405  1.00 54.08  ? 327 PRO A CG    1 
ATOM   2284  C  CD    . PRO A  1 327 ? -5.374  0.612    64.265  1.00 53.91  ? 327 PRO A CD    1 
ATOM   2285  N  N     . VAL A  1 328 ? -2.704  4.150    62.756  1.00 51.68  ? 328 VAL A N     1 
ATOM   2286  C  CA    . VAL A  1 328 ? -2.566  5.100    61.663  1.00 51.21  ? 328 VAL A CA    1 
ATOM   2287  C  C     . VAL A  1 328 ? -1.218  4.867    61.001  1.00 51.15  ? 328 VAL A C     1 
ATOM   2288  O  O     . VAL A  1 328 ? -0.189  4.770    61.674  1.00 50.97  ? 328 VAL A O     1 
ATOM   2289  C  CB    . VAL A  1 328 ? -2.660  6.566    62.158  1.00 50.94  ? 328 VAL A CB    1 
ATOM   2290  C  CG1   . VAL A  1 328 ? -2.498  7.538    61.009  1.00 51.07  ? 328 VAL A CG1   1 
ATOM   2291  C  CG2   . VAL A  1 328 ? -3.974  6.819    62.879  1.00 51.08  ? 328 VAL A CG2   1 
ATOM   2292  N  N     . ILE A  1 329 ? -1.231  4.748    59.681  1.00 51.39  ? 329 ILE A N     1 
ATOM   2293  C  CA    . ILE A  1 329 ? 0.004   4.704    58.913  1.00 51.45  ? 329 ILE A CA    1 
ATOM   2294  C  C     . ILE A  1 329 ? -0.004  5.820    57.869  1.00 52.18  ? 329 ILE A C     1 
ATOM   2295  O  O     . ILE A  1 329 ? -1.008  6.048    57.188  1.00 52.93  ? 329 ILE A O     1 
ATOM   2296  C  CB    . ILE A  1 329 ? 0.202   3.325    58.254  1.00 51.60  ? 329 ILE A CB    1 
ATOM   2297  C  CG1   . ILE A  1 329 ? 0.440   2.242    59.320  1.00 50.47  ? 329 ILE A CG1   1 
ATOM   2298  C  CG2   . ILE A  1 329 ? 1.312   3.365    57.205  1.00 52.06  ? 329 ILE A CG2   1 
ATOM   2299  C  CD1   . ILE A  1 329 ? 1.684   2.408    60.167  1.00 47.77  ? 329 ILE A CD1   1 
ATOM   2300  N  N     . GLU A  1 330 ? 1.103   6.537    57.773  1.00 52.27  ? 330 GLU A N     1 
ATOM   2301  C  CA    . GLU A  1 330 ? 1.272   7.501    56.713  1.00 53.53  ? 330 GLU A CA    1 
ATOM   2302  C  C     . GLU A  1 330 ? 1.926   6.812    55.526  1.00 54.24  ? 330 GLU A C     1 
ATOM   2303  O  O     . GLU A  1 330 ? 2.841   5.997    55.701  1.00 54.81  ? 330 GLU A O     1 
ATOM   2304  C  CB    . GLU A  1 330 ? 2.142   8.646    57.201  1.00 53.82  ? 330 GLU A CB    1 
ATOM   2305  C  CG    . GLU A  1 330 ? 2.721   9.506    56.104  1.00 56.79  ? 330 GLU A CG    1 
ATOM   2306  C  CD    . GLU A  1 330 ? 3.377   10.747   56.651  1.00 60.18  ? 330 GLU A CD    1 
ATOM   2307  O  OE1   . GLU A  1 330 ? 4.615   10.745   56.795  1.00 62.39  ? 330 GLU A OE1   1 
ATOM   2308  O  OE2   . GLU A  1 330 ? 2.654   11.720   56.958  1.00 62.65  ? 330 GLU A OE2   1 
ATOM   2309  N  N     . THR A  1 331 ? 1.462   7.129    54.322  1.00 54.70  ? 331 THR A N     1 
ATOM   2310  C  CA    . THR A  1 331 ? 2.065   6.583    53.118  1.00 55.40  ? 331 THR A CA    1 
ATOM   2311  C  C     . THR A  1 331 ? 2.815   7.678    52.392  1.00 56.25  ? 331 THR A C     1 
ATOM   2312  O  O     . THR A  1 331 ? 2.593   8.862    52.643  1.00 56.56  ? 331 THR A O     1 
ATOM   2313  C  CB    . THR A  1 331 ? 1.007   6.051    52.159  1.00 56.15  ? 331 THR A CB    1 
ATOM   2314  O  OG1   . THR A  1 331 ? -0.055  7.003    52.074  1.00 56.12  ? 331 THR A OG1   1 
ATOM   2315  C  CG2   . THR A  1 331 ? 0.452   4.719    52.623  1.00 56.05  ? 331 THR A CG2   1 
ATOM   2316  N  N     . GLN A  1 332 ? 3.691   7.280    51.479  1.00 57.09  ? 332 GLN A N     1 
ATOM   2317  C  CA    . GLN A  1 332 ? 4.330   8.218    50.575  1.00 58.29  ? 332 GLN A CA    1 
ATOM   2318  C  C     . GLN A  1 332 ? 3.705   8.079    49.203  1.00 60.00  ? 332 GLN A C     1 
ATOM   2319  O  O     . GLN A  1 332 ? 3.649   6.984    48.646  1.00 60.41  ? 332 GLN A O     1 
ATOM   2320  C  CB    . GLN A  1 332 ? 5.817   7.932    50.490  1.00 58.47  ? 332 GLN A CB    1 
ATOM   2321  C  CG    . GLN A  1 332 ? 6.511   7.976    51.821  1.00 57.44  ? 332 GLN A CG    1 
ATOM   2322  C  CD    . GLN A  1 332 ? 6.352   9.306    52.495  1.00 57.23  ? 332 GLN A CD    1 
ATOM   2323  O  OE1   . GLN A  1 332 ? 6.641   10.348   51.902  1.00 59.91  ? 332 GLN A OE1   1 
ATOM   2324  N  NE2   . GLN A  1 332 ? 5.885   9.292    53.738  1.00 54.89  ? 332 GLN A NE2   1 
ATOM   2325  N  N     . GLY A  1 333 ? 3.221   9.192    48.666  1.00 61.48  ? 333 GLY A N     1 
ATOM   2326  C  CA    . GLY A  1 333 ? 2.545   9.204    47.369  1.00 63.59  ? 333 GLY A CA    1 
ATOM   2327  C  C     . GLY A  1 333 ? 1.545   8.076    47.206  1.00 64.07  ? 333 GLY A C     1 
ATOM   2328  O  O     . GLY A  1 333 ? 1.525   7.408    46.178  1.00 65.86  ? 333 GLY A O     1 
ATOM   2329  N  N     . GLY A  1 334 ? 0.736   7.834    48.229  1.00 62.99  ? 334 GLY A N     1 
ATOM   2330  C  CA    . GLY A  1 334 ? -0.278  6.790    48.168  1.00 63.47  ? 334 GLY A CA    1 
ATOM   2331  C  C     . GLY A  1 334 ? 0.205   5.360    47.990  1.00 63.85  ? 334 GLY A C     1 
ATOM   2332  O  O     . GLY A  1 334 ? -0.613  4.440    47.918  1.00 64.39  ? 334 GLY A O     1 
ATOM   2333  N  N     . ASP A  1 335 ? 1.519   5.155    47.926  1.00 63.97  ? 335 ASP A N     1 
ATOM   2334  C  CA    . ASP A  1 335 ? 2.066   3.813    47.729  1.00 64.65  ? 335 ASP A CA    1 
ATOM   2335  C  C     . ASP A  1 335 ? 1.839   2.869    48.924  1.00 63.53  ? 335 ASP A C     1 
ATOM   2336  O  O     . ASP A  1 335 ? 2.625   2.865    49.893  1.00 62.84  ? 335 ASP A O     1 
ATOM   2337  C  CB    . ASP A  1 335 ? 3.548   3.878    47.373  1.00 65.34  ? 335 ASP A CB    1 
ATOM   2338  C  CG    . ASP A  1 335 ? 4.177   2.502    47.252  1.00 67.24  ? 335 ASP A CG    1 
ATOM   2339  O  OD1   . ASP A  1 335 ? 3.635   1.649    46.511  1.00 69.82  ? 335 ASP A OD1   1 
ATOM   2340  O  OD2   . ASP A  1 335 ? 5.212   2.268    47.911  1.00 69.11  ? 335 ASP A OD2   1 
ATOM   2341  N  N     . VAL A  1 336 ? 0.772   2.066    48.826  1.00 63.43  ? 336 VAL A N     1 
ATOM   2342  C  CA    . VAL A  1 336 ? 0.368   1.129    49.883  1.00 62.24  ? 336 VAL A CA    1 
ATOM   2343  C  C     . VAL A  1 336 ? 1.170   -0.171   49.862  1.00 62.55  ? 336 VAL A C     1 
ATOM   2344  O  O     . VAL A  1 336 ? 1.005   -1.015   50.750  1.00 62.06  ? 336 VAL A O     1 
ATOM   2345  C  CB    . VAL A  1 336 ? -1.141  0.771    49.812  1.00 62.41  ? 336 VAL A CB    1 
ATOM   2346  C  CG1   . VAL A  1 336 ? -1.987  2.006    49.788  1.00 61.89  ? 336 VAL A CG1   1 
ATOM   2347  C  CG2   . VAL A  1 336 ? -1.431  -0.067   48.597  1.00 64.07  ? 336 VAL A CG2   1 
ATOM   2348  N  N     . SER A  1 337 ? 2.019   -0.330   48.843  1.00 63.43  ? 337 SER A N     1 
ATOM   2349  C  CA    . SER A  1 337 ? 2.882   -1.512   48.705  1.00 63.92  ? 337 SER A CA    1 
ATOM   2350  C  C     . SER A  1 337 ? 4.210   -1.332   49.384  1.00 62.81  ? 337 SER A C     1 
ATOM   2351  O  O     . SER A  1 337 ? 5.026   -2.253   49.403  1.00 63.51  ? 337 SER A O     1 
ATOM   2352  C  CB    . SER A  1 337 ? 3.119   -1.856   47.246  1.00 65.57  ? 337 SER A CB    1 
ATOM   2353  O  OG    . SER A  1 337 ? 1.938   -2.415   46.715  1.00 67.94  ? 337 SER A OG    1 
ATOM   2354  N  N     . ALA A  1 338 ? 4.415   -0.140   49.935  1.00 61.31  ? 338 ALA A N     1 
ATOM   2355  C  CA    . ALA A  1 338 ? 5.597   0.178    50.720  1.00 60.43  ? 338 ALA A CA    1 
ATOM   2356  C  C     . ALA A  1 338 ? 5.767   -0.812   51.873  1.00 59.66  ? 338 ALA A C     1 
ATOM   2357  O  O     . ALA A  1 338 ? 4.791   -1.426   52.315  1.00 59.42  ? 338 ALA A O     1 
ATOM   2358  C  CB    . ALA A  1 338 ? 5.492   1.590    51.235  1.00 59.74  ? 338 ALA A CB    1 
ATOM   2359  N  N     . TYR A  1 339 ? 6.999   -0.973   52.348  1.00 59.14  ? 339 TYR A N     1 
ATOM   2360  C  CA    . TYR A  1 339 ? 7.296   -2.000   53.340  1.00 58.82  ? 339 TYR A CA    1 
ATOM   2361  C  C     . TYR A  1 339 ? 6.355   -1.990   54.599  1.00 57.40  ? 339 TYR A C     1 
ATOM   2362  O  O     . TYR A  1 339 ? 5.587   -2.939   54.822  1.00 57.51  ? 339 TYR A O     1 
ATOM   2363  C  CB    . TYR A  1 339 ? 8.793   -1.972   53.668  1.00 59.15  ? 339 TYR A CB    1 
ATOM   2364  C  CG    . TYR A  1 339 ? 9.272   -3.062   54.589  1.00 60.61  ? 339 TYR A CG    1 
ATOM   2365  C  CD1   . TYR A  1 339 ? 8.804   -4.374   54.467  1.00 62.30  ? 339 TYR A CD1   1 
ATOM   2366  C  CD2   . TYR A  1 339 ? 10.221  -2.786   55.576  1.00 61.70  ? 339 TYR A CD2   1 
ATOM   2367  C  CE1   . TYR A  1 339 ? 9.251   -5.380   55.332  1.00 64.32  ? 339 TYR A CE1   1 
ATOM   2368  C  CE2   . TYR A  1 339 ? 10.687  -3.786   56.438  1.00 63.43  ? 339 TYR A CE2   1 
ATOM   2369  C  CZ    . TYR A  1 339 ? 10.194  -5.076   56.315  1.00 64.28  ? 339 TYR A CZ    1 
ATOM   2370  O  OH    . TYR A  1 339 ? 10.639  -6.049   57.176  1.00 65.44  ? 339 TYR A OH    1 
ATOM   2371  N  N     . ILE A  1 340 ? 6.372   -0.907   55.372  1.00 55.62  ? 340 ILE A N     1 
ATOM   2372  C  CA    . ILE A  1 340 ? 5.578   -0.832   56.599  1.00 54.13  ? 340 ILE A CA    1 
ATOM   2373  C  C     . ILE A  1 340 ? 4.052   -0.789   56.371  1.00 53.88  ? 340 ILE A C     1 
ATOM   2374  O  O     . ILE A  1 340 ? 3.301   -1.509   57.041  1.00 54.02  ? 340 ILE A O     1 
ATOM   2375  C  CB    . ILE A  1 340 ? 6.058   0.324    57.505  1.00 53.06  ? 340 ILE A CB    1 
ATOM   2376  C  CG1   . ILE A  1 340 ? 7.547   0.170    57.794  1.00 53.84  ? 340 ILE A CG1   1 
ATOM   2377  C  CG2   . ILE A  1 340 ? 5.287   0.376    58.817  1.00 51.97  ? 340 ILE A CG2   1 
ATOM   2378  C  CD1   . ILE A  1 340 ? 7.988   -1.269   58.143  1.00 55.83  ? 340 ILE A CD1   1 
ATOM   2379  N  N     . PRO A  1 341 ? 3.577   0.046    55.431  1.00 53.70  ? 341 PRO A N     1 
ATOM   2380  C  CA    . PRO A  1 341 ? 2.141   0.010    55.163  1.00 53.58  ? 341 PRO A CA    1 
ATOM   2381  C  C     . PRO A  1 341 ? 1.596   -1.420   54.951  1.00 54.36  ? 341 PRO A C     1 
ATOM   2382  O  O     . PRO A  1 341 ? 0.678   -1.825   55.661  1.00 54.10  ? 341 PRO A O     1 
ATOM   2383  C  CB    . PRO A  1 341 ? 2.012   0.854    53.894  1.00 54.00  ? 341 PRO A CB    1 
ATOM   2384  C  CG    . PRO A  1 341 ? 3.122   1.816    53.992  1.00 53.42  ? 341 PRO A CG    1 
ATOM   2385  C  CD    . PRO A  1 341 ? 4.256   1.068    54.613  1.00 53.68  ? 341 PRO A CD    1 
ATOM   2386  N  N     . THR A  1 342 ? 2.174   -2.174   54.013  1.00 55.26  ? 342 THR A N     1 
ATOM   2387  C  CA    . THR A  1 342 ? 1.784   -3.565   53.780  1.00 56.16  ? 342 THR A CA    1 
ATOM   2388  C  C     . THR A  1 342 ? 1.863   -4.404   55.056  1.00 56.27  ? 342 THR A C     1 
ATOM   2389  O  O     . THR A  1 342 ? 0.983   -5.232   55.301  1.00 56.96  ? 342 THR A O     1 
ATOM   2390  C  CB    . THR A  1 342 ? 2.657   -4.255   52.716  1.00 57.27  ? 342 THR A CB    1 
ATOM   2391  O  OG1   . THR A  1 342 ? 3.139   -3.283   51.790  1.00 57.47  ? 342 THR A OG1   1 
ATOM   2392  C  CG2   . THR A  1 342 ? 1.863   -5.330   51.976  1.00 57.60  ? 342 THR A CG2   1 
ATOM   2393  N  N     . ASN A  1 343 ? 2.915   -4.210   55.854  1.00 55.72  ? 343 ASN A N     1 
ATOM   2394  C  CA    . ASN A  1 343 ? 3.046   -4.940   57.112  1.00 55.65  ? 343 ASN A CA    1 
ATOM   2395  C  C     . ASN A  1 343 ? 1.794   -4.774   57.953  1.00 54.81  ? 343 ASN A C     1 
ATOM   2396  O  O     . ASN A  1 343 ? 1.187   -5.754   58.376  1.00 55.63  ? 343 ASN A O     1 
ATOM   2397  C  CB    . ASN A  1 343 ? 4.263   -4.466   57.906  1.00 55.50  ? 343 ASN A CB    1 
ATOM   2398  C  CG    . ASN A  1 343 ? 5.495   -5.298   57.644  1.00 57.60  ? 343 ASN A CG    1 
ATOM   2399  O  OD1   . ASN A  1 343 ? 5.457   -6.276   56.893  1.00 60.80  ? 343 ASN A OD1   1 
ATOM   2400  N  ND2   . ASN A  1 343 ? 6.608   -4.913   58.267  1.00 58.18  ? 343 ASN A ND2   1 
ATOM   2401  N  N     . VAL A  1 344 ? 1.401   -3.524   58.163  1.00 53.34  ? 344 VAL A N     1 
ATOM   2402  C  CA    . VAL A  1 344 ? 0.263   -3.200   59.004  1.00 52.40  ? 344 VAL A CA    1 
ATOM   2403  C  C     . VAL A  1 344 ? -1.087  -3.511   58.320  1.00 52.91  ? 344 VAL A C     1 
ATOM   2404  O  O     . VAL A  1 344 ? -2.011  -4.009   58.970  1.00 53.05  ? 344 VAL A O     1 
ATOM   2405  C  CB    . VAL A  1 344 ? 0.360   -1.734   59.485  1.00 51.16  ? 344 VAL A CB    1 
ATOM   2406  C  CG1   . VAL A  1 344 ? -0.875  -1.320   60.263  1.00 50.40  ? 344 VAL A CG1   1 
ATOM   2407  C  CG2   . VAL A  1 344 ? 1.588   -1.563   60.331  1.00 50.16  ? 344 VAL A CG2   1 
ATOM   2408  N  N     . ILE A  1 345 ? -1.190  -3.237   57.016  1.00 53.21  ? 345 ILE A N     1 
ATOM   2409  C  CA    . ILE A  1 345 ? -2.391  -3.575   56.235  1.00 53.76  ? 345 ILE A CA    1 
ATOM   2410  C  C     . ILE A  1 345 ? -2.733  -5.050   56.416  1.00 54.98  ? 345 ILE A C     1 
ATOM   2411  O  O     . ILE A  1 345 ? -3.912  -5.415   56.511  1.00 55.38  ? 345 ILE A O     1 
ATOM   2412  C  CB    . ILE A  1 345 ? -2.225  -3.259   54.736  1.00 54.02  ? 345 ILE A CB    1 
ATOM   2413  C  CG1   . ILE A  1 345 ? -2.457  -1.776   54.479  1.00 53.43  ? 345 ILE A CG1   1 
ATOM   2414  C  CG2   . ILE A  1 345 ? -3.213  -4.037   53.914  1.00 54.47  ? 345 ILE A CG2   1 
ATOM   2415  C  CD1   . ILE A  1 345 ? -1.936  -1.295   53.127  1.00 54.13  ? 345 ILE A CD1   1 
ATOM   2416  N  N     . SER A  1 346 ? -1.687  -5.874   56.499  1.00 55.71  ? 346 SER A N     1 
ATOM   2417  C  CA    . SER A  1 346 ? -1.822  -7.325   56.620  1.00 57.29  ? 346 SER A CA    1 
ATOM   2418  C  C     . SER A  1 346 ? -2.059  -7.781   58.054  1.00 57.59  ? 346 SER A C     1 
ATOM   2419  O  O     . SER A  1 346 ? -2.414  -8.944   58.285  1.00 58.96  ? 346 SER A O     1 
ATOM   2420  C  CB    . SER A  1 346 ? -0.617  -8.066   56.004  1.00 58.06  ? 346 SER A CB    1 
ATOM   2421  O  OG    . SER A  1 346 ? 0.524   -8.030   56.837  1.00 56.91  ? 346 SER A OG    1 
ATOM   2422  N  N     . ILE A  1 347 ? -1.873  -6.871   59.007  1.00 56.64  ? 347 ILE A N     1 
ATOM   2423  C  CA    . ILE A  1 347 ? -2.105  -7.189   60.411  1.00 56.98  ? 347 ILE A CA    1 
ATOM   2424  C  C     . ILE A  1 347 ? -3.561  -6.882   60.790  1.00 57.36  ? 347 ILE A C     1 
ATOM   2425  O  O     . ILE A  1 347 ? -4.260  -7.719   61.376  1.00 58.15  ? 347 ILE A O     1 
ATOM   2426  C  CB    . ILE A  1 347 ? -1.094  -6.459   61.317  1.00 55.77  ? 347 ILE A CB    1 
ATOM   2427  C  CG1   . ILE A  1 347 ? 0.284   -7.093   61.160  1.00 56.86  ? 347 ILE A CG1   1 
ATOM   2428  C  CG2   . ILE A  1 347 ? -1.504  -6.545   62.757  1.00 55.44  ? 347 ILE A CG2   1 
ATOM   2429  C  CD1   . ILE A  1 347 ? 1.443   -6.223   61.635  1.00 57.18  ? 347 ILE A CD1   1 
ATOM   2430  N  N     . THR A  1 348 ? -4.012  -5.690   60.408  1.00 57.15  ? 348 THR A N     1 
ATOM   2431  C  CA    . THR A  1 348 ? -5.334  -5.165   60.762  1.00 57.60  ? 348 THR A CA    1 
ATOM   2432  C  C     . THR A  1 348 ? -6.484  -5.917   60.083  1.00 58.94  ? 348 THR A C     1 
ATOM   2433  O  O     . THR A  1 348 ? -6.269  -6.642   59.100  1.00 60.01  ? 348 THR A O     1 
ATOM   2434  C  CB    . THR A  1 348 ? -5.447  -3.686   60.338  1.00 56.87  ? 348 THR A CB    1 
ATOM   2435  O  OG1   . THR A  1 348 ? -5.280  -3.597   58.914  1.00 57.94  ? 348 THR A OG1   1 
ATOM   2436  C  CG2   . THR A  1 348 ? -4.397  -2.820   61.048  1.00 55.58  ? 348 THR A CG2   1 
ATOM   2437  N  N     . ASP A  1 349 ? -7.703  -5.712   60.592  1.00 59.05  ? 349 ASP A N     1 
ATOM   2438  C  CA    . ASP A  1 349 ? -8.911  -6.280   59.983  1.00 60.29  ? 349 ASP A CA    1 
ATOM   2439  C  C     . ASP A  1 349 ? -9.539  -5.343   58.950  1.00 59.87  ? 349 ASP A C     1 
ATOM   2440  O  O     . ASP A  1 349 ? -10.754 -5.343   58.765  1.00 60.82  ? 349 ASP A O     1 
ATOM   2441  C  CB    . ASP A  1 349 ? -9.964  -6.626   61.046  1.00 61.00  ? 349 ASP A CB    1 
ATOM   2442  C  CG    . ASP A  1 349 ? -9.360  -7.149   62.321  1.00 62.11  ? 349 ASP A CG    1 
ATOM   2443  O  OD1   . ASP A  1 349 ? -8.841  -8.283   62.319  1.00 64.23  ? 349 ASP A OD1   1 
ATOM   2444  O  OD2   . ASP A  1 349 ? -9.409  -6.420   63.335  1.00 63.46  ? 349 ASP A OD2   1 
ATOM   2445  N  N     . GLY A  1 350 ? -8.728  -4.542   58.272  1.00 58.80  ? 350 GLY A N     1 
ATOM   2446  C  CA    . GLY A  1 350 ? -9.280  -3.632   57.278  1.00 58.25  ? 350 GLY A CA    1 
ATOM   2447  C  C     . GLY A  1 350 ? -8.688  -2.238   57.271  1.00 56.68  ? 350 GLY A C     1 
ATOM   2448  O  O     . GLY A  1 350 ? -8.096  -1.776   58.255  1.00 55.59  ? 350 GLY A O     1 
ATOM   2449  N  N     . GLN A  1 351 ? -8.867  -1.569   56.142  1.00 56.47  ? 351 GLN A N     1 
ATOM   2450  C  CA    . GLN A  1 351 ? -8.284  -0.269   55.917  1.00 55.22  ? 351 GLN A CA    1 
ATOM   2451  C  C     . GLN A  1 351 ? -9.384  0.745    55.739  1.00 55.41  ? 351 GLN A C     1 
ATOM   2452  O  O     . GLN A  1 351 ? -10.496 0.406    55.334  1.00 56.92  ? 351 GLN A O     1 
ATOM   2453  C  CB    . GLN A  1 351 ? -7.445  -0.278   54.639  1.00 55.54  ? 351 GLN A CB    1 
ATOM   2454  C  CG    . GLN A  1 351 ? -6.371  -1.317   54.578  1.00 55.57  ? 351 GLN A CG    1 
ATOM   2455  C  CD    . GLN A  1 351 ? -6.944  -2.691   54.414  1.00 57.50  ? 351 GLN A CD    1 
ATOM   2456  O  OE1   . GLN A  1 351 ? -7.793  -2.910   53.552  1.00 58.46  ? 351 GLN A OE1   1 
ATOM   2457  N  NE2   . GLN A  1 351 ? -6.503  -3.633   55.260  1.00 58.26  ? 351 GLN A NE2   1 
ATOM   2458  N  N     . ILE A  1 352 ? -9.067  1.992    56.051  1.00 54.19  ? 352 ILE A N     1 
ATOM   2459  C  CA    . ILE A  1 352 ? -9.809  3.127    55.550  1.00 54.17  ? 352 ILE A CA    1 
ATOM   2460  C  C     . ILE A  1 352 ? -8.742  3.957    54.850  1.00 54.06  ? 352 ILE A C     1 
ATOM   2461  O  O     . ILE A  1 352 ? -7.969  4.657    55.491  1.00 53.26  ? 352 ILE A O     1 
ATOM   2462  C  CB    . ILE A  1 352 ? -10.524 3.889    56.685  1.00 53.64  ? 352 ILE A CB    1 
ATOM   2463  C  CG1   . ILE A  1 352 ? -11.598 2.988    57.312  1.00 53.75  ? 352 ILE A CG1   1 
ATOM   2464  C  CG2   . ILE A  1 352 ? -11.139 5.174    56.163  1.00 53.92  ? 352 ILE A CG2   1 
ATOM   2465  C  CD1   . ILE A  1 352 ? -12.220 3.495    58.608  1.00 53.15  ? 352 ILE A CD1   1 
ATOM   2466  N  N     . PHE A  1 353 ? -8.653  3.817    53.535  1.00 55.17  ? 353 PHE A N     1 
ATOM   2467  C  CA    . PHE A  1 353 ? -7.647  4.533    52.771  1.00 55.47  ? 353 PHE A CA    1 
ATOM   2468  C  C     . PHE A  1 353 ? -8.184  5.873    52.330  1.00 56.52  ? 353 PHE A C     1 
ATOM   2469  O  O     . PHE A  1 353 ? -9.224  5.949    51.652  1.00 57.90  ? 353 PHE A O     1 
ATOM   2470  C  CB    . PHE A  1 353 ? -7.212  3.734    51.549  1.00 56.42  ? 353 PHE A CB    1 
ATOM   2471  C  CG    . PHE A  1 353 ? -6.130  4.407    50.744  1.00 57.12  ? 353 PHE A CG    1 
ATOM   2472  C  CD1   . PHE A  1 353 ? -4.795  4.203    51.039  1.00 56.74  ? 353 PHE A CD1   1 
ATOM   2473  C  CD2   . PHE A  1 353 ? -6.449  5.251    49.691  1.00 58.43  ? 353 PHE A CD2   1 
ATOM   2474  C  CE1   . PHE A  1 353 ? -3.804  4.836    50.295  1.00 57.03  ? 353 PHE A CE1   1 
ATOM   2475  C  CE2   . PHE A  1 353 ? -5.462  5.875    48.947  1.00 58.23  ? 353 PHE A CE2   1 
ATOM   2476  C  CZ    . PHE A  1 353 ? -4.142  5.668    49.246  1.00 56.99  ? 353 PHE A CZ    1 
ATOM   2477  N  N     . LEU A  1 354 ? -7.471  6.932    52.702  1.00 56.21  ? 354 LEU A N     1 
ATOM   2478  C  CA    . LEU A  1 354 ? -7.888  8.288    52.335  1.00 57.41  ? 354 LEU A CA    1 
ATOM   2479  C  C     . LEU A  1 354 ? -7.035  8.831    51.190  1.00 58.65  ? 354 LEU A C     1 
ATOM   2480  O  O     . LEU A  1 354 ? -5.832  8.571    51.128  1.00 58.31  ? 354 LEU A O     1 
ATOM   2481  C  CB    . LEU A  1 354 ? -7.866  9.218    53.548  1.00 56.20  ? 354 LEU A CB    1 
ATOM   2482  C  CG    . LEU A  1 354 ? -8.432  8.649    54.850  1.00 54.51  ? 354 LEU A CG    1 
ATOM   2483  C  CD1   . LEU A  1 354 ? -8.232  9.638    55.970  1.00 54.15  ? 354 LEU A CD1   1 
ATOM   2484  C  CD2   . LEU A  1 354 ? -9.886  8.310    54.719  1.00 54.58  ? 354 LEU A CD2   1 
ATOM   2485  N  N     . GLU A  1 355 ? -7.659  9.572    50.281  1.00 60.62  ? 355 GLU A N     1 
ATOM   2486  C  CA    . GLU A  1 355 ? -6.984  9.981    49.052  1.00 62.68  ? 355 GLU A CA    1 
ATOM   2487  C  C     . GLU A  1 355 ? -6.967  11.509   48.849  1.00 63.54  ? 355 GLU A C     1 
ATOM   2488  O  O     . GLU A  1 355 ? -8.011  12.159   48.800  1.00 64.58  ? 355 GLU A O     1 
ATOM   2489  C  CB    . GLU A  1 355 ? -7.600  9.246    47.842  1.00 64.49  ? 355 GLU A CB    1 
ATOM   2490  C  CG    . GLU A  1 355 ? -6.645  9.010    46.647  1.00 67.48  ? 355 GLU A CG    1 
ATOM   2491  C  CD    . GLU A  1 355 ? -7.376  8.612    45.360  1.00 72.30  ? 355 GLU A CD    1 
ATOM   2492  O  OE1   . GLU A  1 355 ? -8.520  8.096    45.462  1.00 73.89  ? 355 GLU A OE1   1 
ATOM   2493  O  OE2   . GLU A  1 355 ? -6.808  8.819    44.251  1.00 73.97  ? 355 GLU A OE2   1 
ATOM   2494  N  N     . ALA A  1 356 ? -5.771  12.071   48.722  1.00 63.51  ? 356 ALA A N     1 
ATOM   2495  C  CA    . ALA A  1 356 ? -5.612  13.511   48.571  1.00 64.67  ? 356 ALA A CA    1 
ATOM   2496  C  C     . ALA A  1 356 ? -6.393  14.043   47.377  1.00 67.14  ? 356 ALA A C     1 
ATOM   2497  O  O     . ALA A  1 356 ? -6.885  15.176   47.405  1.00 68.22  ? 356 ALA A O     1 
ATOM   2498  C  CB    . ALA A  1 356 ? -4.149  13.863   48.444  1.00 64.44  ? 356 ALA A CB    1 
ATOM   2499  N  N     . GLU A  1 357 ? -6.480  13.215   46.334  1.00 68.24  ? 357 GLU A N     1 
ATOM   2500  C  CA    . GLU A  1 357 ? -7.283  13.473   45.142  1.00 70.74  ? 357 GLU A CA    1 
ATOM   2501  C  C     . GLU A  1 357 ? -8.676  13.875   45.551  1.00 71.26  ? 357 GLU A C     1 
ATOM   2502  O  O     . GLU A  1 357 ? -9.133  14.971   45.238  1.00 72.74  ? 357 GLU A O     1 
ATOM   2503  C  CB    . GLU A  1 357 ? -7.392  12.187   44.330  1.00 71.49  ? 357 GLU A CB    1 
ATOM   2504  C  CG    . GLU A  1 357 ? -6.561  12.133   43.086  1.00 73.94  ? 357 GLU A CG    1 
ATOM   2505  C  CD    . GLU A  1 357 ? -7.380  12.453   41.867  1.00 77.92  ? 357 GLU A CD    1 
ATOM   2506  O  OE1   . GLU A  1 357 ? -7.790  11.509   41.157  1.00 79.07  ? 357 GLU A OE1   1 
ATOM   2507  O  OE2   . GLU A  1 357 ? -7.631  13.652   41.632  1.00 80.37  ? 357 GLU A OE2   1 
ATOM   2508  N  N     . LEU A  1 358 ? -9.340  12.965   46.262  1.00 70.15  ? 358 LEU A N     1 
ATOM   2509  C  CA    . LEU A  1 358 ? -10.693 13.175   46.747  1.00 70.64  ? 358 LEU A CA    1 
ATOM   2510  C  C     . LEU A  1 358 ? -10.730 14.325   47.731  1.00 70.52  ? 358 LEU A C     1 
ATOM   2511  O  O     . LEU A  1 358 ? -11.662 15.121   47.728  1.00 72.05  ? 358 LEU A O     1 
ATOM   2512  C  CB    . LEU A  1 358 ? -11.217 11.911   47.422  1.00 69.15  ? 358 LEU A CB    1 
ATOM   2513  C  CG    . LEU A  1 358 ? -11.374 10.638   46.600  1.00 68.70  ? 358 LEU A CG    1 
ATOM   2514  C  CD1   . LEU A  1 358 ? -11.466 9.465    47.552  1.00 66.34  ? 358 LEU A CD1   1 
ATOM   2515  C  CD2   . LEU A  1 358 ? -12.602 10.718   45.710  1.00 69.71  ? 358 LEU A CD2   1 
ATOM   2516  N  N     . PHE A  1 359 ? -9.707  14.418   48.570  1.00 69.23  ? 359 PHE A N     1 
ATOM   2517  C  CA    . PHE A  1 359 ? -9.661  15.486   49.545  1.00 69.43  ? 359 PHE A CA    1 
ATOM   2518  C  C     . PHE A  1 359 ? -9.900  16.848   48.905  1.00 71.90  ? 359 PHE A C     1 
ATOM   2519  O  O     . PHE A  1 359 ? -10.811 17.554   49.321  1.00 72.95  ? 359 PHE A O     1 
ATOM   2520  C  CB    . PHE A  1 359 ? -8.355  15.485   50.334  1.00 67.72  ? 359 PHE A CB    1 
ATOM   2521  C  CG    . PHE A  1 359 ? -8.445  16.235   51.621  1.00 67.25  ? 359 PHE A CG    1 
ATOM   2522  C  CD1   . PHE A  1 359 ? -8.499  17.627   51.628  1.00 68.38  ? 359 PHE A CD1   1 
ATOM   2523  C  CD2   . PHE A  1 359 ? -8.504  15.554   52.828  1.00 65.75  ? 359 PHE A CD2   1 
ATOM   2524  C  CE1   . PHE A  1 359 ? -8.599  18.326   52.823  1.00 68.60  ? 359 PHE A CE1   1 
ATOM   2525  C  CE2   . PHE A  1 359 ? -8.606  16.247   54.033  1.00 65.74  ? 359 PHE A CE2   1 
ATOM   2526  C  CZ    . PHE A  1 359 ? -8.652  17.634   54.032  1.00 66.65  ? 359 PHE A CZ    1 
ATOM   2527  N  N     . TYR A  1 360 ? -9.104  17.203   47.891  1.00 73.31  ? 360 TYR A N     1 
ATOM   2528  C  CA    . TYR A  1 360 ? -9.218  18.520   47.243  1.00 75.94  ? 360 TYR A CA    1 
ATOM   2529  C  C     . TYR A  1 360 ? -10.502 18.686   46.456  1.00 77.74  ? 360 TYR A C     1 
ATOM   2530  O  O     . TYR A  1 360 ? -10.973 19.810   46.271  1.00 79.75  ? 360 TYR A O     1 
ATOM   2531  C  CB    . TYR A  1 360 ? -8.060  18.798   46.291  1.00 77.15  ? 360 TYR A CB    1 
ATOM   2532  C  CG    . TYR A  1 360 ? -6.688  18.560   46.845  1.00 77.88  ? 360 TYR A CG    1 
ATOM   2533  C  CD1   . TYR A  1 360 ? -6.217  19.284   47.948  1.00 79.58  ? 360 TYR A CD1   1 
ATOM   2534  C  CD2   . TYR A  1 360 ? -5.835  17.634   46.237  1.00 79.61  ? 360 TYR A CD2   1 
ATOM   2535  C  CE1   . TYR A  1 360 ? -4.926  19.062   48.455  1.00 80.32  ? 360 TYR A CE1   1 
ATOM   2536  C  CE2   . TYR A  1 360 ? -4.545  17.405   46.724  1.00 80.23  ? 360 TYR A CE2   1 
ATOM   2537  C  CZ    . TYR A  1 360 ? -4.092  18.120   47.832  1.00 80.42  ? 360 TYR A CZ    1 
ATOM   2538  O  OH    . TYR A  1 360 ? -2.814  17.888   48.304  1.00 80.12  ? 360 TYR A OH    1 
ATOM   2539  N  N     . LYS A  1 361 ? -11.042 17.572   45.964  1.00 77.38  ? 361 LYS A N     1 
ATOM   2540  C  CA    . LYS A  1 361 ? -12.325 17.583   45.270  1.00 79.16  ? 361 LYS A CA    1 
ATOM   2541  C  C     . LYS A  1 361 ? -13.414 18.118   46.204  1.00 79.24  ? 361 LYS A C     1 
ATOM   2542  O  O     . LYS A  1 361 ? -14.367 18.767   45.762  1.00 81.52  ? 361 LYS A O     1 
ATOM   2543  C  CB    . LYS A  1 361 ? -12.685 16.187   44.743  1.00 78.84  ? 361 LYS A CB    1 
ATOM   2544  C  CG    . LYS A  1 361 ? -11.961 15.788   43.459  1.00 79.66  ? 361 LYS A CG    1 
ATOM   2545  C  CD    . LYS A  1 361 ? -12.910 15.097   42.466  1.00 81.72  ? 361 LYS A CD    1 
ATOM   2546  C  CE    . LYS A  1 361 ? -12.276 14.925   41.083  1.00 83.02  ? 361 LYS A CE    1 
ATOM   2547  N  NZ    . LYS A  1 361 ? -11.200 13.886   41.091  1.00 80.88  ? 361 LYS A NZ    1 
ATOM   2548  N  N     . GLY A  1 362 ? -13.238 17.867   47.499  1.00 76.72  ? 362 GLY A N     1 
ATOM   2549  C  CA    . GLY A  1 362 ? -14.160 18.337   48.515  1.00 76.49  ? 362 GLY A CA    1 
ATOM   2550  C  C     . GLY A  1 362 ? -14.784 17.180   49.268  1.00 74.87  ? 362 GLY A C     1 
ATOM   2551  O  O     . GLY A  1 362 ? -15.395 17.379   50.326  1.00 74.91  ? 362 GLY A O     1 
ATOM   2552  N  N     . ILE A  1 363 ? -14.624 15.973   48.720  1.00 73.55  ? 363 ILE A N     1 
ATOM   2553  C  CA    . ILE A  1 363 ? -15.174 14.746   49.300  1.00 71.56  ? 363 ILE A CA    1 
ATOM   2554  C  C     . ILE A  1 363 ? -14.454 14.375   50.590  1.00 68.65  ? 363 ILE A C     1 
ATOM   2555  O  O     . ILE A  1 363 ? -13.409 13.729   50.560  1.00 67.09  ? 363 ILE A O     1 
ATOM   2556  C  CB    . ILE A  1 363 ? -15.091 13.593   48.287  1.00 71.91  ? 363 ILE A CB    1 
ATOM   2557  C  CG1   . ILE A  1 363 ? -15.857 13.981   47.018  1.00 74.65  ? 363 ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A  1 363 ? -15.615 12.284   48.896  1.00 70.52  ? 363 ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A  1 363 ? -15.168 13.584   45.742  1.00 75.56  ? 363 ILE A CD1   1 
ATOM   2560  N  N     . ARG A  1 364 ? -15.021 14.797   51.720  1.00 67.84  ? 364 ARG A N     1 
ATOM   2561  C  CA    . ARG A  1 364 ? -14.389 14.608   53.022  1.00 65.45  ? 364 ARG A CA    1 
ATOM   2562  C  C     . ARG A  1 364 ? -15.352 14.051   54.058  1.00 64.66  ? 364 ARG A C     1 
ATOM   2563  O  O     . ARG A  1 364 ? -16.451 14.573   54.205  1.00 65.79  ? 364 ARG A O     1 
ATOM   2564  C  CB    . ARG A  1 364 ? -13.783 15.914   53.509  1.00 65.37  ? 364 ARG A CB    1 
ATOM   2565  C  CG    . ARG A  1 364 ? -12.653 16.383   52.640  1.00 66.82  ? 364 ARG A CG    1 
ATOM   2566  C  CD    . ARG A  1 364 ? -12.195 17.750   53.039  1.00 70.67  ? 364 ARG A CD    1 
ATOM   2567  N  NE    . ARG A  1 364 ? -11.939 18.588   51.865  1.00 74.99  ? 364 ARG A NE    1 
ATOM   2568  C  CZ    . ARG A  1 364 ? -11.478 19.837   51.910  1.00 76.46  ? 364 ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A  1 364 ? -11.204 20.407   53.077  1.00 76.23  ? 364 ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A  1 364 ? -11.284 20.516   50.784  1.00 78.62  ? 364 ARG A NH2   1 
ATOM   2571  N  N     . PRO A  1 365 ? -14.952 12.974   54.769  1.00 62.77  ? 365 PRO A N     1 
ATOM   2572  C  CA    . PRO A  1 365 ? -13.693 12.219   54.691  1.00 61.28  ? 365 PRO A CA    1 
ATOM   2573  C  C     . PRO A  1 365 ? -13.399 11.665   53.306  1.00 62.04  ? 365 PRO A C     1 
ATOM   2574  O  O     . PRO A  1 365 ? -14.309 11.212   52.627  1.00 63.39  ? 365 PRO A O     1 
ATOM   2575  C  CB    . PRO A  1 365 ? -13.931 11.042   55.639  1.00 60.02  ? 365 PRO A CB    1 
ATOM   2576  C  CG    . PRO A  1 365 ? -15.401 10.972   55.807  1.00 61.37  ? 365 PRO A CG    1 
ATOM   2577  C  CD    . PRO A  1 365 ? -15.862 12.377   55.757  1.00 62.44  ? 365 PRO A CD    1 
ATOM   2578  N  N     . ALA A  1 366 ? -12.132 11.683   52.902  1.00 61.58  ? 366 ALA A N     1 
ATOM   2579  C  CA    . ALA A  1 366 ? -11.734 11.190   51.579  1.00 62.40  ? 366 ALA A CA    1 
ATOM   2580  C  C     . ALA A  1 366 ? -11.558 9.659    51.495  1.00 61.71  ? 366 ALA A C     1 
ATOM   2581  O  O     . ALA A  1 366 ? -10.528 9.156    51.027  1.00 61.08  ? 366 ALA A O     1 
ATOM   2582  C  CB    . ALA A  1 366 ? -10.482 11.909   51.116  1.00 62.40  ? 366 ALA A CB    1 
ATOM   2583  N  N     . ILE A  1 367 ? -12.578 8.923    51.933  1.00 61.76  ? 367 ILE A N     1 
ATOM   2584  C  CA    . ILE A  1 367 ? -12.512 7.470    51.924  1.00 61.44  ? 367 ILE A CA    1 
ATOM   2585  C  C     . ILE A  1 367 ? -12.554 6.972    50.496  1.00 62.93  ? 367 ILE A C     1 
ATOM   2586  O  O     . ILE A  1 367 ? -13.514 7.252    49.769  1.00 64.70  ? 367 ILE A O     1 
ATOM   2587  C  CB    . ILE A  1 367 ? -13.667 6.827    52.724  1.00 61.53  ? 367 ILE A CB    1 
ATOM   2588  C  CG1   . ILE A  1 367 ? -13.628 7.303    54.183  1.00 60.64  ? 367 ILE A CG1   1 
ATOM   2589  C  CG2   . ILE A  1 367 ? -13.590 5.296    52.640  1.00 60.87  ? 367 ILE A CG2   1 
ATOM   2590  C  CD1   . ILE A  1 367 ? -14.752 6.781    55.054  1.00 60.52  ? 367 ILE A CD1   1 
ATOM   2591  N  N     . ASN A  1 368 ? -11.504 6.256    50.096  1.00 62.19  ? 368 ASN A N     1 
ATOM   2592  C  CA    . ASN A  1 368 ? -11.511 5.537    48.824  1.00 63.51  ? 368 ASN A CA    1 
ATOM   2593  C  C     . ASN A  1 368 ? -12.324 4.257    48.970  1.00 63.93  ? 368 ASN A C     1 
ATOM   2594  O  O     . ASN A  1 368 ? -11.894 3.319    49.642  1.00 63.33  ? 368 ASN A O     1 
ATOM   2595  C  CB    . ASN A  1 368 ? -10.084 5.204    48.384  1.00 62.87  ? 368 ASN A CB    1 
ATOM   2596  C  CG    . ASN A  1 368 ? -10.027 4.556    47.009  1.00 64.26  ? 368 ASN A CG    1 
ATOM   2597  O  OD1   . ASN A  1 368 ? -10.561 3.471    46.792  1.00 64.86  ? 368 ASN A OD1   1 
ATOM   2598  N  ND2   . ASN A  1 368 ? -9.367  5.224    46.075  1.00 65.01  ? 368 ASN A ND2   1 
ATOM   2599  N  N     . VAL A  1 369 ? -13.499 4.206    48.351  1.00 65.39  ? 369 VAL A N     1 
ATOM   2600  C  CA    . VAL A  1 369 ? -14.388 3.065    48.578  1.00 65.57  ? 369 VAL A CA    1 
ATOM   2601  C  C     . VAL A  1 369 ? -13.756 1.780    48.026  1.00 65.95  ? 369 VAL A C     1 
ATOM   2602  O  O     . VAL A  1 369 ? -13.871 0.703    48.618  1.00 65.46  ? 369 VAL A O     1 
ATOM   2603  C  CB    . VAL A  1 369 ? -15.802 3.307    48.021  1.00 67.19  ? 369 VAL A CB    1 
ATOM   2604  C  CG1   . VAL A  1 369 ? -16.768 2.374    48.678  1.00 67.34  ? 369 VAL A CG1   1 
ATOM   2605  C  CG2   . VAL A  1 369 ? -16.242 4.743    48.263  1.00 66.64  ? 369 VAL A CG2   1 
ATOM   2606  N  N     . GLY A  1 370 ? -13.042 1.924    46.918  1.00 66.79  ? 370 GLY A N     1 
ATOM   2607  C  CA    . GLY A  1 370 ? -12.348 0.808    46.296  1.00 67.81  ? 370 GLY A CA    1 
ATOM   2608  C  C     . GLY A  1 370 ? -11.269 0.089    47.102  1.00 66.42  ? 370 GLY A C     1 
ATOM   2609  O  O     . GLY A  1 370 ? -11.165 -1.133   47.034  1.00 67.32  ? 370 GLY A O     1 
ATOM   2610  N  N     . LEU A  1 371 ? -10.449 0.815    47.850  1.00 64.59  ? 371 LEU A N     1 
ATOM   2611  C  CA    . LEU A  1 371 ? -9.360  0.162    48.560  1.00 63.21  ? 371 LEU A CA    1 
ATOM   2612  C  C     . LEU A  1 371 ? -9.609  0.064    50.047  1.00 61.95  ? 371 LEU A C     1 
ATOM   2613  O  O     . LEU A  1 371 ? -8.697  -0.243   50.812  1.00 60.92  ? 371 LEU A O     1 
ATOM   2614  C  CB    . LEU A  1 371 ? -8.037  0.887    48.332  1.00 62.69  ? 371 LEU A CB    1 
ATOM   2615  C  CG    . LEU A  1 371 ? -7.671  1.441    46.963  1.00 63.62  ? 371 LEU A CG    1 
ATOM   2616  C  CD1   . LEU A  1 371 ? -6.251  1.965    47.016  1.00 60.86  ? 371 LEU A CD1   1 
ATOM   2617  C  CD2   . LEU A  1 371 ? -7.839  0.366    45.893  1.00 65.95  ? 371 LEU A CD2   1 
ATOM   2618  N  N     . SER A  1 372 ? -10.835 0.336    50.465  1.00 62.45  ? 372 SER A N     1 
ATOM   2619  C  CA    . SER A  1 372 ? -11.162 0.277    51.881  1.00 61.57  ? 372 SER A CA    1 
ATOM   2620  C  C     . SER A  1 372 ? -12.106 -0.868   52.188  1.00 62.60  ? 372 SER A C     1 
ATOM   2621  O  O     . SER A  1 372 ? -12.999 -1.184   51.390  1.00 64.35  ? 372 SER A O     1 
ATOM   2622  C  CB    . SER A  1 372 ? -11.755 1.599    52.340  1.00 61.01  ? 372 SER A CB    1 
ATOM   2623  O  OG    . SER A  1 372 ? -10.754 2.592    52.305  1.00 60.15  ? 372 SER A OG    1 
ATOM   2624  N  N     . VAL A  1 373 ? -11.883 -1.506   53.332  1.00 61.71  ? 373 VAL A N     1 
ATOM   2625  C  CA    . VAL A  1 373 ? -12.764 -2.559   53.800  1.00 62.67  ? 373 VAL A CA    1 
ATOM   2626  C  C     . VAL A  1 373 ? -12.791 -2.644   55.309  1.00 61.88  ? 373 VAL A C     1 
ATOM   2627  O  O     . VAL A  1 373 ? -11.868 -2.188   56.000  1.00 60.23  ? 373 VAL A O     1 
ATOM   2628  C  CB    . VAL A  1 373 ? -12.346 -3.949   53.294  1.00 63.34  ? 373 VAL A CB    1 
ATOM   2629  C  CG1   . VAL A  1 373 ? -12.501 -4.054   51.792  1.00 65.23  ? 373 VAL A CG1   1 
ATOM   2630  C  CG2   . VAL A  1 373 ? -10.929 -4.272   53.737  1.00 62.53  ? 373 VAL A CG2   1 
ATOM   2631  N  N     . SER A  1 374 ? -13.876 -3.233   55.803  1.00 63.01  ? 374 SER A N     1 
ATOM   2632  C  CA    . SER A  1 374 ? -13.912 -3.781   57.145  1.00 62.67  ? 374 SER A CA    1 
ATOM   2633  C  C     . SER A  1 374 ? -14.053 -5.287   56.962  1.00 64.20  ? 374 SER A C     1 
ATOM   2634  O  O     . SER A  1 374 ? -15.062 -5.756   56.423  1.00 65.69  ? 374 SER A O     1 
ATOM   2635  C  CB    . SER A  1 374 ? -15.074 -3.201   57.950  1.00 62.49  ? 374 SER A CB    1 
ATOM   2636  O  OG    . SER A  1 374 ? -15.120 -3.785   59.234  1.00 61.40  ? 374 SER A OG    1 
ATOM   2637  N  N     . ARG A  1 375 ? -13.026 -6.035   57.366  1.00 64.14  ? 375 ARG A N     1 
ATOM   2638  C  CA    . ARG A  1 375 ? -13.038 -7.484   57.200  1.00 66.07  ? 375 ARG A CA    1 
ATOM   2639  C  C     . ARG A  1 375 ? -14.066 -8.136   58.106  1.00 66.93  ? 375 ARG A C     1 
ATOM   2640  O  O     . ARG A  1 375 ? -14.603 -9.188   57.767  1.00 68.86  ? 375 ARG A O     1 
ATOM   2641  C  CB    . ARG A  1 375 ? -11.642 -8.098   57.347  1.00 65.92  ? 375 ARG A CB    1 
ATOM   2642  C  CG    . ARG A  1 375 ? -10.879 -8.103   56.015  1.00 68.47  ? 375 ARG A CG    1 
ATOM   2643  C  CD    . ARG A  1 375 ? -9.438  -8.627   56.087  1.00 71.76  ? 375 ARG A CD    1 
ATOM   2644  N  NE    . ARG A  1 375 ? -8.665  -8.245   54.886  1.00 75.03  ? 375 ARG A NE    1 
ATOM   2645  C  CZ    . ARG A  1 375 ? -7.908  -7.140   54.759  1.00 74.75  ? 375 ARG A CZ    1 
ATOM   2646  N  NH1   . ARG A  1 375 ? -7.792  -6.266   55.764  1.00 73.62  ? 375 ARG A NH1   1 
ATOM   2647  N  NH2   . ARG A  1 375 ? -7.251  -6.902   53.618  1.00 74.24  ? 375 ARG A NH2   1 
ATOM   2648  N  N     . VAL A  1 376 ? -14.365 -7.485   59.231  1.00 66.04  ? 376 VAL A N     1 
ATOM   2649  C  CA    . VAL A  1 376 ? -15.504 -7.862   60.079  1.00 66.58  ? 376 VAL A CA    1 
ATOM   2650  C  C     . VAL A  1 376 ? -16.800 -7.663   59.311  1.00 67.78  ? 376 VAL A C     1 
ATOM   2651  O  O     . VAL A  1 376 ? -17.738 -8.434   59.477  1.00 69.53  ? 376 VAL A O     1 
ATOM   2652  C  CB    . VAL A  1 376 ? -15.556 -7.050   61.390  1.00 65.30  ? 376 VAL A CB    1 
ATOM   2653  C  CG1   . VAL A  1 376 ? -16.814 -7.369   62.161  1.00 65.92  ? 376 VAL A CG1   1 
ATOM   2654  C  CG2   . VAL A  1 376 ? -14.334 -7.347   62.251  1.00 64.64  ? 376 VAL A CG2   1 
ATOM   2655  N  N     . GLY A  1 377 ? -16.841 -6.635   58.465  1.00 67.27  ? 377 GLY A N     1 
ATOM   2656  C  CA    . GLY A  1 377 ? -17.995 -6.377   57.610  1.00 68.56  ? 377 GLY A CA    1 
ATOM   2657  C  C     . GLY A  1 377 ? -19.252 -6.113   58.412  1.00 69.24  ? 377 GLY A C     1 
ATOM   2658  O  O     . GLY A  1 377 ? -19.202 -5.466   59.453  1.00 68.46  ? 377 GLY A O     1 
ATOM   2659  N  N     . SER A  1 378 ? -20.376 -6.643   57.945  1.00 71.05  ? 378 SER A N     1 
ATOM   2660  C  CA    . SER A  1 378 ? -21.673 -6.355   58.551  1.00 71.97  ? 378 SER A CA    1 
ATOM   2661  C  C     . SER A  1 378 ? -21.803 -6.739   60.009  1.00 71.37  ? 378 SER A C     1 
ATOM   2662  O  O     . SER A  1 378 ? -22.514 -6.071   60.750  1.00 71.21  ? 378 SER A O     1 
ATOM   2663  C  CB    . SER A  1 378 ? -22.797 -7.013   57.754  1.00 74.47  ? 378 SER A CB    1 
ATOM   2664  O  OG    . SER A  1 378 ? -23.463 -6.036   56.975  1.00 76.30  ? 378 SER A OG    1 
ATOM   2665  N  N     . ALA A  1 379 ? -21.116 -7.810   60.407  1.00 71.11  ? 379 ALA A N     1 
ATOM   2666  C  CA    . ALA A  1 379 ? -21.250 -8.392   61.744  1.00 71.13  ? 379 ALA A CA    1 
ATOM   2667  C  C     . ALA A  1 379 ? -21.207 -7.371   62.883  1.00 69.85  ? 379 ALA A C     1 
ATOM   2668  O  O     . ALA A  1 379 ? -21.721 -7.624   63.976  1.00 70.54  ? 379 ALA A O     1 
ATOM   2669  C  CB    . ALA A  1 379 ? -20.206 -9.467   61.952  1.00 70.95  ? 379 ALA A CB    1 
ATOM   2670  N  N     . ALA A  1 380 ? -20.612 -6.212   62.609  1.00 68.22  ? 380 ALA A N     1 
ATOM   2671  C  CA    . ALA A  1 380 ? -20.507 -5.134   63.582  1.00 66.94  ? 380 ALA A CA    1 
ATOM   2672  C  C     . ALA A  1 380 ? -21.002 -3.798   63.013  1.00 66.65  ? 380 ALA A C     1 
ATOM   2673  O  O     . ALA A  1 380 ? -20.408 -2.736   63.232  1.00 65.61  ? 380 ALA A O     1 
ATOM   2674  C  CB    . ALA A  1 380 ? -19.086 -5.021   64.067  1.00 65.47  ? 380 ALA A CB    1 
ATOM   2675  N  N     . GLN A  1 381 ? -22.104 -3.868   62.280  1.00 67.89  ? 381 GLN A N     1 
ATOM   2676  C  CA    . GLN A  1 381 ? -22.814 -2.688   61.812  1.00 67.80  ? 381 GLN A CA    1 
ATOM   2677  C  C     . GLN A  1 381 ? -24.193 -2.687   62.468  1.00 69.18  ? 381 GLN A C     1 
ATOM   2678  O  O     . GLN A  1 381 ? -24.798 -3.750   62.633  1.00 70.48  ? 381 GLN A O     1 
ATOM   2679  C  CB    . GLN A  1 381 ? -22.938 -2.749   60.294  1.00 68.40  ? 381 GLN A CB    1 
ATOM   2680  C  CG    . GLN A  1 381 ? -23.481 -1.497   59.659  1.00 68.02  ? 381 GLN A CG    1 
ATOM   2681  C  CD    . GLN A  1 381 ? -23.349 -1.510   58.157  1.00 68.06  ? 381 GLN A CD    1 
ATOM   2682  O  OE1   . GLN A  1 381 ? -23.355 -2.572   57.520  1.00 69.08  ? 381 GLN A OE1   1 
ATOM   2683  N  NE2   . GLN A  1 381 ? -23.230 -0.325   57.574  1.00 67.26  ? 381 GLN A NE2   1 
ATOM   2684  N  N     . VAL A  1 382 ? -24.692 -1.516   62.854  1.00 69.05  ? 382 VAL A N     1 
ATOM   2685  C  CA    . VAL A  1 382 ? -26.033 -1.434   63.456  1.00 70.69  ? 382 VAL A CA    1 
ATOM   2686  C  C     . VAL A  1 382 ? -27.095 -1.947   62.461  1.00 72.80  ? 382 VAL A C     1 
ATOM   2687  O  O     . VAL A  1 382 ? -27.289 -1.351   61.402  1.00 73.21  ? 382 VAL A O     1 
ATOM   2688  C  CB    . VAL A  1 382 ? -26.361 0.004    63.959  1.00 70.37  ? 382 VAL A CB    1 
ATOM   2689  C  CG1   . VAL A  1 382 ? -27.814 0.112    64.397  1.00 72.27  ? 382 VAL A CG1   1 
ATOM   2690  C  CG2   . VAL A  1 382 ? -25.440 0.390    65.105  1.00 68.56  ? 382 VAL A CG2   1 
ATOM   2691  N  N     . LYS A  1 383 ? -27.767 -3.055   62.789  1.00 77.55  ? 383 LYS A N     1 
ATOM   2692  C  CA    . LYS A  1 383 ? -28.686 -3.687   61.823  1.00 79.28  ? 383 LYS A CA    1 
ATOM   2693  C  C     . LYS A  1 383 ? -29.552 -2.668   61.080  1.00 78.59  ? 383 LYS A C     1 
ATOM   2694  O  O     . LYS A  1 383 ? -29.667 -2.734   59.864  1.00 79.15  ? 383 LYS A O     1 
ATOM   2695  C  CB    . LYS A  1 383 ? -29.558 -4.783   62.453  1.00 81.85  ? 383 LYS A CB    1 
ATOM   2696  C  CG    . LYS A  1 383 ? -30.530 -5.417   61.453  1.00 84.32  ? 383 LYS A CG    1 
ATOM   2697  C  CD    . LYS A  1 383 ? -31.167 -6.705   61.960  1.00 89.08  ? 383 LYS A CD    1 
ATOM   2698  C  CE    . LYS A  1 383 ? -32.208 -7.219   60.958  1.00 92.29  ? 383 LYS A CE    1 
ATOM   2699  N  NZ    . LYS A  1 383 ? -32.725 -8.587   61.262  1.00 96.13  ? 383 LYS A NZ    1 
ATOM   2700  N  N     . ALA A  1 384 ? -30.136 -1.723   61.813  1.00 77.82  ? 384 ALA A N     1 
ATOM   2701  C  CA    . ALA A  1 384 ? -30.927 -0.654   61.217  1.00 77.29  ? 384 ALA A CA    1 
ATOM   2702  C  C     . ALA A  1 384 ? -30.188 -0.022   60.043  1.00 75.86  ? 384 ALA A C     1 
ATOM   2703  O  O     . ALA A  1 384 ? -30.766 0.227    58.991  1.00 76.42  ? 384 ALA A O     1 
ATOM   2704  C  CB    . ALA A  1 384 ? -31.255 0.394    62.259  1.00 76.48  ? 384 ALA A CB    1 
ATOM   2705  N  N     . LEU A  1 385 ? -28.899 0.216    60.234  1.00 74.46  ? 385 LEU A N     1 
ATOM   2706  C  CA    . LEU A  1 385 ? -28.058 0.822    59.215  1.00 73.63  ? 385 LEU A CA    1 
ATOM   2707  C  C     . LEU A  1 385 ? -27.771 -0.186   58.107  1.00 74.93  ? 385 LEU A C     1 
ATOM   2708  O  O     . LEU A  1 385 ? -27.938 0.129    56.939  1.00 75.25  ? 385 LEU A O     1 
ATOM   2709  C  CB    . LEU A  1 385 ? -26.758 1.356    59.842  1.00 72.03  ? 385 LEU A CB    1 
ATOM   2710  C  CG    . LEU A  1 385 ? -25.807 2.270    59.065  1.00 70.56  ? 385 LEU A CG    1 
ATOM   2711  C  CD1   . LEU A  1 385 ? -26.449 3.611    58.786  1.00 70.24  ? 385 LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A  1 385 ? -24.534 2.458    59.859  1.00 69.55  ? 385 LEU A CD2   1 
ATOM   2713  N  N     . LYS A  1 386 ? -27.368 -1.402   58.472  1.00 76.05  ? 386 LYS A N     1 
ATOM   2714  C  CA    . LYS A  1 386 ? -27.162 -2.466   57.486  1.00 77.97  ? 386 LYS A CA    1 
ATOM   2715  C  C     . LYS A  1 386 ? -28.401 -2.680   56.613  1.00 80.02  ? 386 LYS A C     1 
ATOM   2716  O  O     . LYS A  1 386 ? -28.292 -3.132   55.479  1.00 81.59  ? 386 LYS A O     1 
ATOM   2717  C  CB    . LYS A  1 386 ? -26.770 -3.784   58.163  1.00 79.15  ? 386 LYS A CB    1 
ATOM   2718  C  CG    . LYS A  1 386 ? -26.670 -4.962   57.205  1.00 81.47  ? 386 LYS A CG    1 
ATOM   2719  C  CD    . LYS A  1 386 ? -26.744 -6.307   57.910  1.00 84.36  ? 386 LYS A CD    1 
ATOM   2720  C  CE    . LYS A  1 386 ? -26.908 -7.430   56.882  1.00 87.90  ? 386 LYS A CE    1 
ATOM   2721  N  NZ    . LYS A  1 386 ? -26.092 -8.645   57.202  1.00 90.46  ? 386 LYS A NZ    1 
ATOM   2722  N  N     . GLN A  1 387 ? -29.573 -2.349   57.143  1.00 80.65  ? 387 GLN A N     1 
ATOM   2723  C  CA    . GLN A  1 387 ? -30.824 -2.553   56.426  1.00 82.83  ? 387 GLN A CA    1 
ATOM   2724  C  C     . GLN A  1 387 ? -30.999 -1.581   55.267  1.00 82.75  ? 387 GLN A C     1 
ATOM   2725  O  O     . GLN A  1 387 ? -31.323 -1.993   54.154  1.00 84.64  ? 387 GLN A O     1 
ATOM   2726  C  CB    . GLN A  1 387 ? -32.017 -2.475   57.380  1.00 83.58  ? 387 GLN A CB    1 
ATOM   2727  C  CG    . GLN A  1 387 ? -32.249 -3.752   58.170  1.00 84.97  ? 387 GLN A CG    1 
ATOM   2728  C  CD    . GLN A  1 387 ? -33.485 -3.681   59.027  1.00 85.45  ? 387 GLN A CD    1 
ATOM   2729  O  OE1   . GLN A  1 387 ? -33.405 -3.713   60.252  1.00 85.44  ? 387 GLN A OE1   1 
ATOM   2730  N  NE2   . GLN A  1 387 ? -34.639 -3.571   58.388  1.00 86.88  ? 387 GLN A NE2   1 
ATOM   2731  N  N     . VAL A  1 388 ? -30.789 -0.296   55.527  1.00 80.96  ? 388 VAL A N     1 
ATOM   2732  C  CA    . VAL A  1 388 ? -30.896 0.702    54.474  1.00 81.19  ? 388 VAL A CA    1 
ATOM   2733  C  C     . VAL A  1 388 ? -29.576 0.845    53.720  1.00 80.80  ? 388 VAL A C     1 
ATOM   2734  O  O     . VAL A  1 388 ? -29.560 1.134    52.522  1.00 81.89  ? 388 VAL A O     1 
ATOM   2735  C  CB    . VAL A  1 388 ? -31.365 2.082    55.009  1.00 79.85  ? 388 VAL A CB    1 
ATOM   2736  C  CG1   . VAL A  1 388 ? -32.743 1.973    55.598  1.00 81.43  ? 388 VAL A CG1   1 
ATOM   2737  C  CG2   . VAL A  1 388 ? -30.399 2.651    56.045  1.00 77.73  ? 388 VAL A CG2   1 
ATOM   2738  N  N     . ALA A  1 389 ? -28.469 0.627    54.421  1.00 79.88  ? 389 ALA A N     1 
ATOM   2739  C  CA    . ALA A  1 389 ? -27.154 0.986    53.892  1.00 79.08  ? 389 ALA A CA    1 
ATOM   2740  C  C     . ALA A  1 389 ? -26.553 -0.081   52.998  1.00 80.61  ? 389 ALA A C     1 
ATOM   2741  O  O     . ALA A  1 389 ? -25.826 0.251    52.065  1.00 81.11  ? 389 ALA A O     1 
ATOM   2742  C  CB    . ALA A  1 389 ? -26.188 1.345    55.023  1.00 77.10  ? 389 ALA A CB    1 
ATOM   2743  N  N     . GLY A  1 390 ? -26.858 -1.348   53.284  1.00 81.93  ? 390 GLY A N     1 
ATOM   2744  C  CA    . GLY A  1 390 ? -26.294 -2.492   52.555  1.00 83.47  ? 390 GLY A CA    1 
ATOM   2745  C  C     . GLY A  1 390 ? -26.166 -2.277   51.056  1.00 84.65  ? 390 GLY A C     1 
ATOM   2746  O  O     . GLY A  1 390 ? -27.030 -1.638   50.431  1.00 85.16  ? 390 GLY A O     1 
ATOM   2747  N  N     . SER A  1 391 ? -25.073 -2.795   50.491  1.00 85.02  ? 391 SER A N     1 
ATOM   2748  C  CA    . SER A  1 391 ? -24.775 -2.702   49.048  1.00 86.40  ? 391 SER A CA    1 
ATOM   2749  C  C     . SER A  1 391 ? -24.506 -1.282   48.531  1.00 84.68  ? 391 SER A C     1 
ATOM   2750  O  O     . SER A  1 391 ? -24.353 -1.090   47.324  1.00 86.34  ? 391 SER A O     1 
ATOM   2751  C  CB    . SER A  1 391 ? -25.863 -3.388   48.192  1.00 89.40  ? 391 SER A CB    1 
ATOM   2752  O  OG    . SER A  1 391 ? -27.010 -2.558   48.021  1.00 89.80  ? 391 SER A OG    1 
ATOM   2753  N  N     . LEU A  1 392 ? -24.450 -0.300   49.428  1.00 81.51  ? 392 LEU A N     1 
ATOM   2754  C  CA    . LEU A  1 392 ? -24.136 1.070    49.035  1.00 79.94  ? 392 LEU A CA    1 
ATOM   2755  C  C     . LEU A  1 392 ? -22.717 1.139    48.479  1.00 80.39  ? 392 LEU A C     1 
ATOM   2756  O  O     . LEU A  1 392 ? -22.480 1.748    47.429  1.00 81.58  ? 392 LEU A O     1 
ATOM   2757  C  CB    . LEU A  1 392 ? -24.299 2.031    50.216  1.00 77.02  ? 392 LEU A CB    1 
ATOM   2758  C  CG    . LEU A  1 392 ? -23.871 3.491    50.077  1.00 74.20  ? 392 LEU A CG    1 
ATOM   2759  C  CD1   . LEU A  1 392 ? -24.449 4.153    48.839  1.00 74.37  ? 392 LEU A CD1   1 
ATOM   2760  C  CD2   . LEU A  1 392 ? -24.272 4.246    51.316  1.00 71.32  ? 392 LEU A CD2   1 
ATOM   2761  N  N     . LYS A  1 393 ? -21.788 0.496    49.190  1.00 79.68  ? 393 LYS A N     1 
ATOM   2762  C  CA    . LYS A  1 393 ? -20.383 0.433    48.810  1.00 79.70  ? 393 LYS A CA    1 
ATOM   2763  C  C     . LYS A  1 393 ? -20.245 -0.158   47.405  1.00 82.67  ? 393 LYS A C     1 
ATOM   2764  O  O     . LYS A  1 393 ? -19.460 0.330    46.587  1.00 83.62  ? 393 LYS A O     1 
ATOM   2765  C  CB    . LYS A  1 393 ? -19.616 -0.389   49.852  1.00 78.80  ? 393 LYS A CB    1 
ATOM   2766  C  CG    . LYS A  1 393 ? -18.120 -0.466   49.649  1.00 78.59  ? 393 LYS A CG    1 
ATOM   2767  C  CD    . LYS A  1 393 ? -17.391 -0.611   50.969  1.00 76.31  ? 393 LYS A CD    1 
ATOM   2768  C  CE    . LYS A  1 393 ? -16.238 -1.599   50.871  1.00 78.23  ? 393 LYS A CE    1 
ATOM   2769  N  NZ    . LYS A  1 393 ? -15.260 -1.310   49.777  1.00 78.85  ? 393 LYS A NZ    1 
ATOM   2770  N  N     . LEU A  1 394 ? -21.036 -1.190   47.126  1.00 84.42  ? 394 LEU A N     1 
ATOM   2771  C  CA    . LEU A  1 394 ? -21.061 -1.809   45.809  1.00 87.47  ? 394 LEU A CA    1 
ATOM   2772  C  C     . LEU A  1 394 ? -21.632 -0.876   44.726  1.00 88.54  ? 394 LEU A C     1 
ATOM   2773  O  O     . LEU A  1 394 ? -21.159 -0.899   43.597  1.00 90.66  ? 394 LEU A O     1 
ATOM   2774  C  CB    . LEU A  1 394 ? -21.838 -3.131   45.875  1.00 89.48  ? 394 LEU A CB    1 
ATOM   2775  C  CG    . LEU A  1 394 ? -21.705 -4.295   44.870  1.00 92.86  ? 394 LEU A CG    1 
ATOM   2776  C  CD1   . LEU A  1 394 ? -22.815 -4.287   43.815  1.00 94.96  ? 394 LEU A CD1   1 
ATOM   2777  C  CD2   . LEU A  1 394 ? -20.317 -4.407   44.234  1.00 93.82  ? 394 LEU A CD2   1 
ATOM   2778  N  N     . PHE A  1 395 ? -22.639 -0.064   45.057  1.00 87.41  ? 395 PHE A N     1 
ATOM   2779  C  CA    . PHE A  1 395 ? -23.193 0.866    44.073  1.00 88.47  ? 395 PHE A CA    1 
ATOM   2780  C  C     . PHE A  1 395 ? -22.136 1.886    43.746  1.00 88.02  ? 395 PHE A C     1 
ATOM   2781  O  O     . PHE A  1 395 ? -21.778 2.063    42.585  1.00 90.16  ? 395 PHE A O     1 
ATOM   2782  C  CB    . PHE A  1 395 ? -24.454 1.579    44.565  1.00 87.32  ? 395 PHE A CB    1 
ATOM   2783  C  CG    . PHE A  1 395 ? -24.856 2.746    43.698  1.00 87.47  ? 395 PHE A CG    1 
ATOM   2784  C  CD1   . PHE A  1 395 ? -25.514 2.536    42.490  1.00 89.86  ? 395 PHE A CD1   1 
ATOM   2785  C  CD2   . PHE A  1 395 ? -24.550 4.049    44.078  1.00 84.93  ? 395 PHE A CD2   1 
ATOM   2786  C  CE1   . PHE A  1 395 ? -25.872 3.604    41.687  1.00 90.94  ? 395 PHE A CE1   1 
ATOM   2787  C  CE2   . PHE A  1 395 ? -24.902 5.119    43.280  1.00 85.83  ? 395 PHE A CE2   1 
ATOM   2788  C  CZ    . PHE A  1 395 ? -25.560 4.897    42.081  1.00 88.96  ? 395 PHE A CZ    1 
ATOM   2789  N  N     . LEU A  1 396 ? -21.637 2.554    44.783  1.00 85.71  ? 396 LEU A N     1 
ATOM   2790  C  CA    . LEU A  1 396 ? -20.524 3.483    44.641  1.00 85.50  ? 396 LEU A CA    1 
ATOM   2791  C  C     . LEU A  1 396 ? -19.409 2.815    43.839  1.00 87.96  ? 396 LEU A C     1 
ATOM   2792  O  O     . LEU A  1 396 ? -18.654 3.492    43.134  1.00 88.79  ? 396 LEU A O     1 
ATOM   2793  C  CB    . LEU A  1 396 ? -20.011 3.920    46.013  1.00 82.41  ? 396 LEU A CB    1 
ATOM   2794  C  CG    . LEU A  1 396 ? -20.937 4.826    46.831  1.00 80.52  ? 396 LEU A CG    1 
ATOM   2795  C  CD1   . LEU A  1 396 ? -20.739 4.604    48.319  1.00 77.97  ? 396 LEU A CD1   1 
ATOM   2796  C  CD2   . LEU A  1 396 ? -20.746 6.295    46.476  1.00 80.48  ? 396 LEU A CD2   1 
ATOM   2797  N  N     . ALA A  1 397 ? -19.331 1.484    43.941  1.00 89.39  ? 397 ALA A N     1 
ATOM   2798  C  CA    . ALA A  1 397 ? -18.369 0.697    43.176  1.00 91.93  ? 397 ALA A CA    1 
ATOM   2799  C  C     . ALA A  1 397 ? -18.592 0.848    41.684  1.00 95.25  ? 397 ALA A C     1 
ATOM   2800  O  O     . ALA A  1 397 ? -17.732 1.351    40.970  1.00 96.30  ? 397 ALA A O     1 
ATOM   2801  C  CB    . ALA A  1 397 ? -18.395 -0.771   43.598  1.00 92.83  ? 397 ALA A CB    1 
ATOM   2802  N  N     . GLN A  1 398 ? -19.763 0.432    41.224  1.00 97.23  ? 398 GLN A N     1 
ATOM   2803  C  CA    . GLN A  1 398 ? -20.113 0.541    39.820  1.00 100.92 ? 398 GLN A CA    1 
ATOM   2804  C  C     . GLN A  1 398 ? -20.177 2.014    39.375  1.00 100.95 ? 398 GLN A C     1 
ATOM   2805  O  O     . GLN A  1 398 ? -19.861 2.336    38.230  1.00 103.69 ? 398 GLN A O     1 
ATOM   2806  C  CB    . GLN A  1 398 ? -21.431 -0.194   39.560  1.00 102.62 ? 398 GLN A CB    1 
ATOM   2807  C  CG    . GLN A  1 398 ? -21.440 -1.636   40.072  1.00 102.75 ? 398 GLN A CG    1 
ATOM   2808  C  CD    . GLN A  1 398 ? -22.807 -2.084   40.557  1.00 102.67 ? 398 GLN A CD    1 
ATOM   2809  O  OE1   . GLN A  1 398 ? -23.773 -1.319   40.548  1.00 102.22 ? 398 GLN A OE1   1 
ATOM   2810  N  NE2   . GLN A  1 398 ? -22.892 -3.333   40.988  1.00 103.75 ? 398 GLN A NE2   1 
ATOM   2811  N  N     . TYR A  1 399 ? -20.559 2.902    40.291  1.00 98.40  ? 399 TYR A N     1 
ATOM   2812  C  CA    . TYR A  1 399 ? -20.602 4.330    39.998  1.00 98.49  ? 399 TYR A CA    1 
ATOM   2813  C  C     . TYR A  1 399 ? -19.211 4.902    39.688  1.00 99.55  ? 399 TYR A C     1 
ATOM   2814  O  O     . TYR A  1 399 ? -19.088 5.809    38.869  1.00 101.24 ? 399 TYR A O     1 
ATOM   2815  C  CB    . TYR A  1 399 ? -21.296 5.105    41.124  1.00 95.07  ? 399 TYR A CB    1 
ATOM   2816  C  CG    . TYR A  1 399 ? -21.055 6.597    41.083  1.00 93.39  ? 399 TYR A CG    1 
ATOM   2817  C  CD1   . TYR A  1 399 ? -21.549 7.376    40.039  1.00 94.55  ? 399 TYR A CD1   1 
ATOM   2818  C  CD2   . TYR A  1 399 ? -20.325 7.229    42.089  1.00 89.92  ? 399 TYR A CD2   1 
ATOM   2819  C  CE1   . TYR A  1 399 ? -21.317 8.741    39.998  1.00 93.61  ? 399 TYR A CE1   1 
ATOM   2820  C  CE2   . TYR A  1 399 ? -20.094 8.593    42.058  1.00 88.26  ? 399 TYR A CE2   1 
ATOM   2821  C  CZ    . TYR A  1 399 ? -20.590 9.339    41.010  1.00 90.45  ? 399 TYR A CZ    1 
ATOM   2822  O  OH    . TYR A  1 399 ? -20.363 10.688   40.974  1.00 89.95  ? 399 TYR A OH    1 
ATOM   2823  N  N     . ARG A  1 400 ? -18.173 4.368    40.329  1.00 99.29  ? 400 ARG A N     1 
ATOM   2824  C  CA    . ARG A  1 400 ? -16.796 4.764    40.020  1.00 100.94 ? 400 ARG A CA    1 
ATOM   2825  C  C     . ARG A  1 400 ? -16.539 4.560    38.536  1.00 104.87 ? 400 ARG A C     1 
ATOM   2826  O  O     . ARG A  1 400 ? -16.297 5.521    37.801  1.00 106.29 ? 400 ARG A O     1 
ATOM   2827  C  CB    . ARG A  1 400 ? -15.769 3.920    40.790  1.00 100.38 ? 400 ARG A CB    1 
ATOM   2828  C  CG    . ARG A  1 400 ? -16.234 3.340    42.115  1.00 99.84  ? 400 ARG A CG    1 
ATOM   2829  C  CD    . ARG A  1 400 ? -15.209 2.358    42.715  1.00 102.98 ? 400 ARG A CD    1 
ATOM   2830  N  NE    . ARG A  1 400 ? -15.768 1.471    43.751  1.00 103.97 ? 400 ARG A NE    1 
ATOM   2831  C  CZ    . ARG A  1 400 ? -16.383 1.866    44.875  1.00 102.82 ? 400 ARG A CZ    1 
ATOM   2832  N  NH1   . ARG A  1 400 ? -16.586 3.155    45.134  1.00 101.75 ? 400 ARG A NH1   1 
ATOM   2833  N  NH2   . ARG A  1 400 ? -16.837 0.960    45.737  1.00 102.61 ? 400 ARG A NH2   1 
ATOM   2834  N  N     . GLU A  1 401 ? -16.593 3.290    38.127  1.00 107.05 ? 401 GLU A N     1 
ATOM   2835  C  CA    . GLU A  1 401 ? -16.362 2.840    36.749  1.00 111.47 ? 401 GLU A CA    1 
ATOM   2836  C  C     . GLU A  1 401 ? -17.115 3.700    35.739  1.00 113.57 ? 401 GLU A C     1 
ATOM   2837  O  O     . GLU A  1 401 ? -16.500 4.361    34.905  1.00 115.53 ? 401 GLU A O     1 
ATOM   2838  C  CB    . GLU A  1 401 ? -16.697 1.327    36.619  1.00 113.23 ? 401 GLU A CB    1 
ATOM   2839  C  CG    . GLU A  1 401 ? -17.608 0.874    35.435  1.00 117.62 ? 401 GLU A CG    1 
ATOM   2840  C  CD    . GLU A  1 401 ? -16.857 0.331    34.201  1.00 123.05 ? 401 GLU A CD    1 
ATOM   2841  O  OE1   . GLU A  1 401 ? -15.785 -0.306   34.348  1.00 123.53 ? 401 GLU A OE1   1 
ATOM   2842  O  OE2   . GLU A  1 401 ? -17.366 0.523    33.069  1.00 126.45 ? 401 GLU A OE2   1 
ATOM   2843  N  N     . VAL A  1 402 ? -18.440 3.713    35.864  1.00 113.37 ? 402 VAL A N     1 
ATOM   2844  C  CA    . VAL A  1 402 ? -19.334 4.375    34.921  1.00 115.93 ? 402 VAL A CA    1 
ATOM   2845  C  C     . VAL A  1 402 ? -19.027 5.872    34.785  1.00 115.73 ? 402 VAL A C     1 
ATOM   2846  O  O     . VAL A  1 402 ? -19.003 6.393    33.670  1.00 118.82 ? 402 VAL A O     1 
ATOM   2847  C  CB    . VAL A  1 402 ? -20.827 4.093    35.283  1.00 115.24 ? 402 VAL A CB    1 
ATOM   2848  C  CG1   . VAL A  1 402 ? -21.773 5.106    34.650  1.00 116.77 ? 402 VAL A CG1   1 
ATOM   2849  C  CG2   . VAL A  1 402 ? -21.212 2.665    34.877  1.00 117.52 ? 402 VAL A CG2   1 
ATOM   2850  N  N     . ALA A  1 403 ? -18.767 6.543    35.911  1.00 112.48 ? 403 ALA A N     1 
ATOM   2851  C  CA    . ALA A  1 403 ? -18.441 7.980    35.923  1.00 112.25 ? 403 ALA A CA    1 
ATOM   2852  C  C     . ALA A  1 403 ? -17.190 8.327    35.105  1.00 114.94 ? 403 ALA A C     1 
ATOM   2853  O  O     . ALA A  1 403 ? -17.155 9.361    34.431  1.00 116.70 ? 403 ALA A O     1 
ATOM   2854  C  CB    . ALA A  1 403 ? -18.308 8.494    37.352  1.00 108.04 ? 403 ALA A CB    1 
ATOM   2855  N  N     . ALA A  1 404 ? -16.177 7.457    35.174  1.00 115.61 ? 404 ALA A N     1 
ATOM   2856  C  CA    . ALA A  1 404 ? -14.955 7.571    34.362  1.00 118.69 ? 404 ALA A CA    1 
ATOM   2857  C  C     . ALA A  1 404 ? -15.086 6.865    32.995  1.00 123.42 ? 404 ALA A C     1 
ATOM   2858  O  O     . ALA A  1 404 ? -14.109 6.736    32.246  1.00 126.23 ? 404 ALA A O     1 
ATOM   2859  C  CB    . ALA A  1 404 ? -13.746 7.044    35.141  1.00 116.92 ? 404 ALA A CB    1 
ATOM   2860  N  N     . PHE A  1 405 ? -16.306 6.415    32.695  1.00 124.64 ? 405 PHE A N     1 
ATOM   2861  C  CA    . PHE A  1 405 ? -16.676 5.788    31.419  1.00 129.39 ? 405 PHE A CA    1 
ATOM   2862  C  C     . PHE A  1 405 ? -17.682 6.702    30.709  1.00 131.52 ? 405 PHE A C     1 
ATOM   2863  O  O     . PHE A  1 405 ? -17.875 6.605    29.492  1.00 135.84 ? 405 PHE A O     1 
ATOM   2864  C  CB    . PHE A  1 405 ? -17.215 4.365    31.688  1.00 129.26 ? 405 PHE A CB    1 
ATOM   2865  C  CG    . PHE A  1 405 ? -18.103 3.794    30.604  1.00 133.35 ? 405 PHE A CG    1 
ATOM   2866  C  CD1   . PHE A  1 405 ? -17.561 3.215    29.464  1.00 137.76 ? 405 PHE A CD1   1 
ATOM   2867  C  CD2   . PHE A  1 405 ? -19.488 3.777    30.765  1.00 133.25 ? 405 PHE A CD2   1 
ATOM   2868  C  CE1   . PHE A  1 405 ? -18.387 2.667    28.479  1.00 142.02 ? 405 PHE A CE1   1 
ATOM   2869  C  CE2   . PHE A  1 405 ? -20.325 3.231    29.788  1.00 137.09 ? 405 PHE A CE2   1 
ATOM   2870  C  CZ    . PHE A  1 405 ? -19.772 2.676    28.644  1.00 141.55 ? 405 PHE A CZ    1 
ATOM   2871  N  N     . ALA A  1 406 ? -18.297 7.599    31.488  1.00 128.76 ? 406 ALA A N     1 
ATOM   2872  C  CA    . ALA A  1 406 ? -19.133 8.694    30.980  1.00 130.41 ? 406 ALA A CA    1 
ATOM   2873  C  C     . ALA A  1 406 ? -18.304 9.961    30.785  1.00 131.13 ? 406 ALA A C     1 
ATOM   2874  O  O     . ALA A  1 406 ? -18.786 10.947   30.222  1.00 132.99 ? 406 ALA A O     1 
ATOM   2875  C  CB    . ALA A  1 406 ? -20.285 8.967    31.928  1.00 127.21 ? 406 ALA A CB    1 
ATOM   2876  N  N     . GLN A  1 407 ? -17.062 9.918    31.275  1.00 129.99 ? 407 GLN A N     1 
ATOM   2877  C  CA    . GLN A  1 407 ? -16.060 10.966   31.066  1.00 131.24 ? 407 GLN A CA    1 
ATOM   2878  C  C     . GLN A  1 407 ? -16.108 11.463   29.638  1.00 136.26 ? 407 GLN A C     1 
ATOM   2879  O  O     . GLN A  1 407 ? -16.311 12.650   29.387  1.00 137.29 ? 407 GLN A O     1 
ATOM   2880  C  CB    . GLN A  1 407 ? -14.656 10.420   31.345  1.00 130.82 ? 407 GLN A CB    1 
ATOM   2881  C  CG    . GLN A  1 407 ? -14.147 10.622   32.761  1.00 127.23 ? 407 GLN A CG    1 
ATOM   2882  C  CD    . GLN A  1 407 ? -13.544 11.995   32.984  1.00 127.95 ? 407 GLN A CD    1 
ATOM   2883  O  OE1   . GLN A  1 407 ? -14.205 13.019   32.788  1.00 129.21 ? 407 GLN A OE1   1 
ATOM   2884  N  NE2   . GLN A  1 407 ? -12.283 12.025   33.406  1.00 127.38 ? 407 GLN A NE2   1 
ATOM   2885  N  N     . PHE A  1 408 ? -15.928 10.528   28.712  1.00 139.71 ? 408 PHE A N     1 
ATOM   2886  C  CA    . PHE A  1 408 ? -15.945 10.822   27.293  1.00 145.22 ? 408 PHE A CA    1 
ATOM   2887  C  C     . PHE A  1 408 ? -17.171 10.255   26.588  1.00 147.82 ? 408 PHE A C     1 
ATOM   2888  O  O     . PHE A  1 408 ? -17.474 10.637   25.456  1.00 152.31 ? 408 PHE A O     1 
ATOM   2889  C  CB    . PHE A  1 408 ? -14.651 10.355   26.620  1.00 148.28 ? 408 PHE A CB    1 
ATOM   2890  C  CG    . PHE A  1 408 ? -13.957 9.224    27.330  1.00 146.04 ? 408 PHE A CG    1 
ATOM   2891  C  CD1   . PHE A  1 408 ? -14.217 7.906    26.978  1.00 147.61 ? 408 PHE A CD1   1 
ATOM   2892  C  CD2   . PHE A  1 408 ? -13.019 9.480    28.332  1.00 142.69 ? 408 PHE A CD2   1 
ATOM   2893  C  CE1   . PHE A  1 408 ? -13.568 6.863    27.619  1.00 145.70 ? 408 PHE A CE1   1 
ATOM   2894  C  CE2   . PHE A  1 408 ? -12.367 8.439    28.984  1.00 140.63 ? 408 PHE A CE2   1 
ATOM   2895  C  CZ    . PHE A  1 408 ? -12.642 7.128    28.626  1.00 142.27 ? 408 PHE A CZ    1 
ATOM   2896  N  N     . GLY A  1 409 ? -17.876 9.349    27.259  1.00 145.36 ? 409 GLY A N     1 
ATOM   2897  C  CA    . GLY A  1 409 ? -19.142 8.837    26.746  1.00 147.61 ? 409 GLY A CA    1 
ATOM   2898  C  C     . GLY A  1 409 ? -20.266 9.838    26.949  1.00 146.91 ? 409 GLY A C     1 
ATOM   2899  O  O     . GLY A  1 409 ? -20.890 9.870    28.013  1.00 142.96 ? 409 GLY A O     1 
ATOM   2900  N  N     . SER A  1 410 ? -20.513 10.665   25.932  1.00 151.00 ? 410 SER A N     1 
ATOM   2901  C  CA    . SER A  1 410 ? -21.621 11.630   25.958  1.00 151.26 ? 410 SER A CA    1 
ATOM   2902  C  C     . SER A  1 410 ? -22.939 10.976   25.522  1.00 153.55 ? 410 SER A C     1 
ATOM   2903  O  O     . SER A  1 410 ? -24.019 11.563   25.662  1.00 153.46 ? 410 SER A O     1 
ATOM   2904  C  CB    . SER A  1 410 ? -21.303 12.860   25.101  1.00 154.66 ? 410 SER A CB    1 
ATOM   2905  O  OG    . SER A  1 410 ? -20.986 12.490   23.775  1.00 159.77 ? 410 SER A OG    1 
ATOM   2906  N  N     . ASP A  1 411 ? -22.827 9.757    24.995  1.00 155.81 ? 411 ASP A N     1 
ATOM   2907  C  CA    . ASP A  1 411 ? -23.974 8.915    24.689  1.00 157.67 ? 411 ASP A CA    1 
ATOM   2908  C  C     . ASP A  1 411 ? -24.400 8.221    25.977  1.00 152.76 ? 411 ASP A C     1 
ATOM   2909  O  O     . ASP A  1 411 ? -23.643 7.426    26.544  1.00 150.30 ? 411 ASP A O     1 
ATOM   2910  C  CB    . ASP A  1 411 ? -23.600 7.886    23.621  1.00 162.29 ? 411 ASP A CB    1 
ATOM   2911  C  CG    . ASP A  1 411 ? -24.670 7.735    22.558  1.00 167.58 ? 411 ASP A CG    1 
ATOM   2912  O  OD1   . ASP A  1 411 ? -25.336 8.739    22.229  1.00 169.28 ? 411 ASP A OD1   1 
ATOM   2913  O  OD2   . ASP A  1 411 ? -24.843 6.609    22.045  1.00 170.55 ? 411 ASP A OD2   1 
ATOM   2914  N  N     . LEU A  1 412 ? -25.608 8.534    26.436  1.00 151.52 ? 412 LEU A N     1 
ATOM   2915  C  CA    . LEU A  1 412 ? -26.062 8.110    27.756  1.00 146.90 ? 412 LEU A CA    1 
ATOM   2916  C  C     . LEU A  1 412 ? -27.409 7.389    27.709  1.00 148.27 ? 412 LEU A C     1 
ATOM   2917  O  O     . LEU A  1 412 ? -28.457 8.029    27.575  1.00 149.48 ? 412 LEU A O     1 
ATOM   2918  C  CB    . LEU A  1 412 ? -26.150 9.324    28.695  1.00 143.25 ? 412 LEU A CB    1 
ATOM   2919  C  CG    . LEU A  1 412 ? -24.996 10.338   28.739  1.00 142.36 ? 412 LEU A CG    1 
ATOM   2920  C  CD1   . LEU A  1 412 ? -25.461 11.679   29.304  1.00 140.59 ? 412 LEU A CD1   1 
ATOM   2921  C  CD2   . LEU A  1 412 ? -23.811 9.796    29.533  1.00 138.96 ? 412 LEU A CD2   1 
ATOM   2922  N  N     . ASP A  1 413 ? -27.375 6.060    27.810  1.00 148.36 ? 413 ASP A N     1 
ATOM   2923  C  CA    . ASP A  1 413 ? -28.599 5.272    27.952  1.00 149.24 ? 413 ASP A CA    1 
ATOM   2924  C  C     . ASP A  1 413 ? -29.220 5.581    29.311  1.00 144.53 ? 413 ASP A C     1 
ATOM   2925  O  O     . ASP A  1 413 ? -28.513 5.612    30.325  1.00 140.34 ? 413 ASP A O     1 
ATOM   2926  C  CB    . ASP A  1 413 ? -28.334 3.765    27.783  1.00 150.67 ? 413 ASP A CB    1 
ATOM   2927  C  CG    . ASP A  1 413 ? -27.219 3.248    28.687  1.00 146.89 ? 413 ASP A CG    1 
ATOM   2928  O  OD1   . ASP A  1 413 ? -26.110 3.826    28.676  1.00 145.47 ? 413 ASP A OD1   1 
ATOM   2929  O  OD2   . ASP A  1 413 ? -27.450 2.245    29.398  1.00 145.69 ? 413 ASP A OD2   1 
ATOM   2930  N  N     . ALA A  1 414 ? -30.532 5.829    29.319  1.00 145.49 ? 414 ALA A N     1 
ATOM   2931  C  CA    . ALA A  1 414 ? -31.270 6.235    30.525  1.00 141.55 ? 414 ALA A CA    1 
ATOM   2932  C  C     . ALA A  1 414 ? -30.953 5.367    31.748  1.00 137.30 ? 414 ALA A C     1 
ATOM   2933  O  O     . ALA A  1 414 ? -31.192 5.767    32.891  1.00 133.63 ? 414 ALA A O     1 
ATOM   2934  C  CB    . ALA A  1 414 ? -32.769 6.246    30.246  1.00 144.37 ? 414 ALA A CB    1 
ATOM   2935  N  N     . SER A  1 415 ? -30.408 4.181    31.481  1.00 137.99 ? 415 SER A N     1 
ATOM   2936  C  CA    . SER A  1 415 ? -29.995 3.232    32.504  1.00 134.43 ? 415 SER A CA    1 
ATOM   2937  C  C     . SER A  1 415 ? -28.788 3.742    33.294  1.00 129.91 ? 415 SER A C     1 
ATOM   2938  O  O     . SER A  1 415 ? -28.857 3.879    34.516  1.00 125.98 ? 415 SER A O     1 
ATOM   2939  C  CB    . SER A  1 415 ? -29.679 1.882    31.854  1.00 137.50 ? 415 SER A CB    1 
ATOM   2940  O  OG    . SER A  1 415 ? -29.768 0.828    32.793  1.00 135.68 ? 415 SER A OG    1 
ATOM   2941  N  N     . THR A  1 416 ? -27.695 4.033    32.592  1.00 130.58 ? 416 THR A N     1 
ATOM   2942  C  CA    . THR A  1 416 ? -26.447 4.466    33.235  1.00 126.92 ? 416 THR A CA    1 
ATOM   2943  C  C     . THR A  1 416 ? -26.448 5.939    33.660  1.00 124.18 ? 416 THR A C     1 
ATOM   2944  O  O     . THR A  1 416 ? -25.815 6.301    34.651  1.00 120.51 ? 416 THR A O     1 
ATOM   2945  C  CB    . THR A  1 416 ? -25.192 4.172    32.354  1.00 129.32 ? 416 THR A CB    1 
ATOM   2946  O  OG1   . THR A  1 416 ? -25.451 4.539    30.991  1.00 133.92 ? 416 THR A OG1   1 
ATOM   2947  C  CG2   . THR A  1 416 ? -24.805 2.688    32.421  1.00 130.20 ? 416 THR A CG2   1 
ATOM   2948  N  N     . LYS A  1 417 ? -27.154 6.777    32.905  1.00 126.09 ? 417 LYS A N     1 
ATOM   2949  C  CA    . LYS A  1 417 ? -27.253 8.210    33.194  1.00 124.07 ? 417 LYS A CA    1 
ATOM   2950  C  C     . LYS A  1 417 ? -27.997 8.456    34.510  1.00 120.02 ? 417 LYS A C     1 
ATOM   2951  O  O     . LYS A  1 417 ? -27.601 9.307    35.302  1.00 116.97 ? 417 LYS A O     1 
ATOM   2952  C  CB    . LYS A  1 417 ? -27.925 8.938    32.014  1.00 128.37 ? 417 LYS A CB    1 
ATOM   2953  C  CG    . LYS A  1 417 ? -28.264 10.409   32.237  1.00 127.62 ? 417 LYS A CG    1 
ATOM   2954  C  CD    . LYS A  1 417 ? -29.721 10.581   32.644  1.00 127.51 ? 417 LYS A CD    1 
ATOM   2955  C  CE    . LYS A  1 417 ? -29.918 11.835   33.476  1.00 125.20 ? 417 LYS A CE    1 
ATOM   2956  N  NZ    . LYS A  1 417 ? -31.344 12.006   33.874  1.00 125.55 ? 417 LYS A NZ    1 
ATOM   2957  N  N     . GLN A  1 418 ? -29.076 7.704    34.718  1.00 120.00 ? 418 GLN A N     1 
ATOM   2958  C  CA    . GLN A  1 418 ? -29.852 7.722    35.960  1.00 116.51 ? 418 GLN A CA    1 
ATOM   2959  C  C     . GLN A  1 418 ? -28.994 7.244    37.135  1.00 111.87 ? 418 GLN A C     1 
ATOM   2960  O  O     . GLN A  1 418 ? -29.128 7.728    38.260  1.00 108.48 ? 418 GLN A O     1 
ATOM   2961  C  CB    . GLN A  1 418 ? -31.108 6.849    35.782  1.00 118.87 ? 418 GLN A CB    1 
ATOM   2962  C  CG    . GLN A  1 418 ? -31.637 6.137    37.031  1.00 116.99 ? 418 GLN A CG    1 
ATOM   2963  C  CD    . GLN A  1 418 ? -32.613 6.975    37.835  1.00 116.34 ? 418 GLN A CD    1 
ATOM   2964  O  OE1   . GLN A  1 418 ? -32.422 8.179    38.021  1.00 115.89 ? 418 GLN A OE1   1 
ATOM   2965  N  NE2   . GLN A  1 418 ? -33.667 6.333    38.326  1.00 116.66 ? 418 GLN A NE2   1 
ATOM   2966  N  N     . THR A  1 419 ? -28.105 6.297    36.841  1.00 111.66 ? 419 THR A N     1 
ATOM   2967  C  CA    . THR A  1 419 ? -27.175 5.725    37.815  1.00 107.87 ? 419 THR A CA    1 
ATOM   2968  C  C     . THR A  1 419 ? -26.060 6.707    38.196  1.00 104.89 ? 419 THR A C     1 
ATOM   2969  O  O     . THR A  1 419 ? -25.505 6.620    39.291  1.00 101.85 ? 419 THR A O     1 
ATOM   2970  C  CB    . THR A  1 419 ? -26.615 4.360    37.306  1.00 109.78 ? 419 THR A CB    1 
ATOM   2971  O  OG1   . THR A  1 419 ? -27.670 3.384    37.309  1.00 111.63 ? 419 THR A OG1   1 
ATOM   2972  C  CG2   . THR A  1 419 ? -25.454 3.851    38.166  1.00 106.86 ? 419 THR A CG2   1 
ATOM   2973  N  N     . LEU A  1 420 ? -25.744 7.649    37.308  1.00 105.80 ? 420 LEU A N     1 
ATOM   2974  C  CA    . LEU A  1 420 ? -24.845 8.749    37.661  1.00 103.12 ? 420 LEU A CA    1 
ATOM   2975  C  C     . LEU A  1 420 ? -25.503 9.667    38.690  1.00 100.22 ? 420 LEU A C     1 
ATOM   2976  O  O     . LEU A  1 420 ? -24.839 10.138   39.607  1.00 97.64  ? 420 LEU A O     1 
ATOM   2977  C  CB    . LEU A  1 420 ? -24.430 9.571    36.432  1.00 106.09 ? 420 LEU A CB    1 
ATOM   2978  C  CG    . LEU A  1 420 ? -23.407 9.070    35.404  1.00 108.08 ? 420 LEU A CG    1 
ATOM   2979  C  CD1   . LEU A  1 420 ? -23.234 10.105   34.295  1.00 110.49 ? 420 LEU A CD1   1 
ATOM   2980  C  CD2   . LEU A  1 420 ? -22.068 8.753    36.044  1.00 105.29 ? 420 LEU A CD2   1 
ATOM   2981  N  N     . VAL A  1 421 ? -26.805 9.907    38.529  1.00 100.80 ? 421 VAL A N     1 
ATOM   2982  C  CA    . VAL A  1 421 ? -27.564 10.799   39.409  1.00 98.34  ? 421 VAL A CA    1 
ATOM   2983  C  C     . VAL A  1 421 ? -27.613 10.223   40.821  1.00 94.56  ? 421 VAL A C     1 
ATOM   2984  O  O     . VAL A  1 421 ? -27.436 10.947   41.796  1.00 92.05  ? 421 VAL A O     1 
ATOM   2985  C  CB    . VAL A  1 421 ? -29.015 11.045   38.888  1.00 100.95 ? 421 VAL A CB    1 
ATOM   2986  C  CG1   . VAL A  1 421 ? -29.672 12.190   39.645  1.00 99.59  ? 421 VAL A CG1   1 
ATOM   2987  C  CG2   . VAL A  1 421 ? -29.024 11.340   37.387  1.00 104.75 ? 421 VAL A CG2   1 
ATOM   2988  N  N     . ARG A  1 422 ? -27.844 8.915    40.918  1.00 94.27  ? 422 ARG A N     1 
ATOM   2989  C  CA    . ARG A  1 422 ? -27.848 8.213    42.200  1.00 91.10  ? 422 ARG A CA    1 
ATOM   2990  C  C     . ARG A  1 422 ? -26.457 8.270    42.818  1.00 88.51  ? 422 ARG A C     1 
ATOM   2991  O  O     . ARG A  1 422 ? -26.314 8.396    44.036  1.00 85.86  ? 422 ARG A O     1 
ATOM   2992  C  CB    . ARG A  1 422 ? -28.294 6.757    42.015  1.00 92.26  ? 422 ARG A CB    1 
ATOM   2993  C  CG    . ARG A  1 422 ? -28.680 6.022    43.301  1.00 89.74  ? 422 ARG A CG    1 
ATOM   2994  C  CD    . ARG A  1 422 ? -29.997 6.531    43.869  1.00 89.70  ? 422 ARG A CD    1 
ATOM   2995  N  NE    . ARG A  1 422 ? -31.055 6.570    42.861  1.00 92.31  ? 422 ARG A NE    1 
ATOM   2996  C  CZ    . ARG A  1 422 ? -32.061 5.705    42.786  1.00 93.91  ? 422 ARG A CZ    1 
ATOM   2997  N  NH1   . ARG A  1 422 ? -32.173 4.726    43.676  1.00 92.47  ? 422 ARG A NH1   1 
ATOM   2998  N  NH2   . ARG A  1 422 ? -32.966 5.831    41.824  1.00 97.36  ? 422 ARG A NH2   1 
ATOM   2999  N  N     . GLY A  1 423 ? -25.444 8.191    41.957  1.00 89.46  ? 423 GLY A N     1 
ATOM   3000  C  CA    . GLY A  1 423 ? -24.050 8.221    42.370  1.00 87.53  ? 423 GLY A CA    1 
ATOM   3001  C  C     . GLY A  1 423 ? -23.647 9.554    42.955  1.00 85.74  ? 423 GLY A C     1 
ATOM   3002  O  O     . GLY A  1 423 ? -23.140 9.619    44.075  1.00 83.48  ? 423 GLY A O     1 
ATOM   3003  N  N     . GLU A  1 424 ? -23.891 10.620   42.200  1.00 87.10  ? 424 GLU A N     1 
ATOM   3004  C  CA    . GLU A  1 424 ? -23.521 11.973   42.606  1.00 85.94  ? 424 GLU A CA    1 
ATOM   3005  C  C     . GLU A  1 424 ? -24.240 12.401   43.869  1.00 83.54  ? 424 GLU A C     1 
ATOM   3006  O  O     . GLU A  1 424 ? -23.730 13.212   44.640  1.00 82.11  ? 424 GLU A O     1 
ATOM   3007  C  CB    . GLU A  1 424 ? -23.808 12.961   41.481  1.00 88.71  ? 424 GLU A CB    1 
ATOM   3008  C  CG    . GLU A  1 424 ? -22.990 12.671   40.244  1.00 91.79  ? 424 GLU A CG    1 
ATOM   3009  C  CD    . GLU A  1 424 ? -23.392 13.497   39.051  1.00 96.10  ? 424 GLU A CD    1 
ATOM   3010  O  OE1   . GLU A  1 424 ? -24.585 13.876   38.941  1.00 97.34  ? 424 GLU A OE1   1 
ATOM   3011  O  OE2   . GLU A  1 424 ? -22.500 13.754   38.213  1.00 98.53  ? 424 GLU A OE2   1 
ATOM   3012  N  N     . ARG A  1 425 ? -25.422 11.839   44.083  1.00 83.38  ? 425 ARG A N     1 
ATOM   3013  C  CA    . ARG A  1 425 ? -26.213 12.162   45.258  1.00 81.46  ? 425 ARG A CA    1 
ATOM   3014  C  C     . ARG A  1 425 ? -25.738 11.445   46.518  1.00 78.75  ? 425 ARG A C     1 
ATOM   3015  O  O     . ARG A  1 425 ? -25.627 12.059   47.591  1.00 77.00  ? 425 ARG A O     1 
ATOM   3016  C  CB    . ARG A  1 425 ? -27.695 11.916   44.984  1.00 83.00  ? 425 ARG A CB    1 
ATOM   3017  C  CG    . ARG A  1 425 ? -28.412 13.184   44.614  1.00 83.90  ? 425 ARG A CG    1 
ATOM   3018  C  CD    . ARG A  1 425 ? -29.207 13.025   43.365  1.00 86.22  ? 425 ARG A CD    1 
ATOM   3019  N  NE    . ARG A  1 425 ? -29.641 14.326   42.873  1.00 87.54  ? 425 ARG A NE    1 
ATOM   3020  C  CZ    . ARG A  1 425 ? -28.985 15.034   41.963  1.00 88.48  ? 425 ARG A CZ    1 
ATOM   3021  N  NH1   . ARG A  1 425 ? -27.867 14.565   41.432  1.00 88.36  ? 425 ARG A NH1   1 
ATOM   3022  N  NH2   . ARG A  1 425 ? -29.452 16.210   41.578  1.00 90.44  ? 425 ARG A NH2   1 
ATOM   3023  N  N     . LEU A  1 426 ? -25.456 10.152   46.382  1.00 78.50  ? 426 LEU A N     1 
ATOM   3024  C  CA    . LEU A  1 426 ? -24.925 9.373    47.494  1.00 76.13  ? 426 LEU A CA    1 
ATOM   3025  C  C     . LEU A  1 426 ? -23.519 9.849    47.888  1.00 74.56  ? 426 LEU A C     1 
ATOM   3026  O  O     . LEU A  1 426 ? -23.211 9.979    49.081  1.00 72.77  ? 426 LEU A O     1 
ATOM   3027  C  CB    . LEU A  1 426 ? -24.982 7.875    47.182  1.00 76.79  ? 426 LEU A CB    1 
ATOM   3028  C  CG    . LEU A  1 426 ? -26.419 7.341    47.216  1.00 77.64  ? 426 LEU A CG    1 
ATOM   3029  C  CD1   . LEU A  1 426 ? -26.558 6.051    46.449  1.00 79.88  ? 426 LEU A CD1   1 
ATOM   3030  C  CD2   . LEU A  1 426 ? -26.897 7.154    48.637  1.00 75.59  ? 426 LEU A CD2   1 
ATOM   3031  N  N     . THR A  1 427 ? -22.695 10.156   46.888  1.00 75.20  ? 427 THR A N     1 
ATOM   3032  C  CA    . THR A  1 427 ? -21.393 10.770   47.130  1.00 74.10  ? 427 THR A CA    1 
ATOM   3033  C  C     . THR A  1 427 ? -21.510 12.076   47.939  1.00 72.80  ? 427 THR A C     1 
ATOM   3034  O  O     . THR A  1 427 ? -20.753 12.283   48.892  1.00 71.34  ? 427 THR A O     1 
ATOM   3035  C  CB    . THR A  1 427 ? -20.602 10.969   45.803  1.00 76.28  ? 427 THR A CB    1 
ATOM   3036  O  OG1   . THR A  1 427 ? -19.991 9.726    45.425  1.00 77.07  ? 427 THR A OG1   1 
ATOM   3037  C  CG2   . THR A  1 427 ? -19.518 12.062   45.922  1.00 75.65  ? 427 THR A CG2   1 
ATOM   3038  N  N     . GLN A  1 428 ? -22.468 12.932   47.576  1.00 73.36  ? 428 GLN A N     1 
ATOM   3039  C  CA    . GLN A  1 428 ? -22.607 14.246   48.215  1.00 72.48  ? 428 GLN A CA    1 
ATOM   3040  C  C     . GLN A  1 428 ? -23.192 14.131   49.618  1.00 70.67  ? 428 GLN A C     1 
ATOM   3041  O  O     . GLN A  1 428 ? -22.934 14.966   50.485  1.00 69.80  ? 428 GLN A O     1 
ATOM   3042  C  CB    . GLN A  1 428 ? -23.444 15.198   47.348  1.00 74.27  ? 428 GLN A CB    1 
ATOM   3043  C  CG    . GLN A  1 428 ? -23.728 16.574   47.968  1.00 73.62  ? 428 GLN A CG    1 
ATOM   3044  C  CD    . GLN A  1 428 ? -22.566 17.548   47.862  1.00 74.02  ? 428 GLN A CD    1 
ATOM   3045  O  OE1   . GLN A  1 428 ? -21.861 17.594   46.858  1.00 75.10  ? 428 GLN A OE1   1 
ATOM   3046  N  NE2   . GLN A  1 428 ? -22.376 18.350   48.901  1.00 73.94  ? 428 GLN A NE2   1 
ATOM   3047  N  N     . LEU A  1 429 ? -23.979 13.086   49.833  1.00 70.38  ? 429 LEU A N     1 
ATOM   3048  C  CA    . LEU A  1 429 ? -24.608 12.866   51.119  1.00 69.10  ? 429 LEU A CA    1 
ATOM   3049  C  C     . LEU A  1 429 ? -23.540 12.447   52.127  1.00 67.25  ? 429 LEU A C     1 
ATOM   3050  O  O     . LEU A  1 429 ? -23.648 12.728   53.325  1.00 66.15  ? 429 LEU A O     1 
ATOM   3051  C  CB    . LEU A  1 429 ? -25.670 11.774   50.991  1.00 69.77  ? 429 LEU A CB    1 
ATOM   3052  C  CG    . LEU A  1 429 ? -27.003 11.863   51.743  1.00 70.53  ? 429 LEU A CG    1 
ATOM   3053  C  CD1   . LEU A  1 429 ? -27.819 10.627   51.411  1.00 72.80  ? 429 LEU A CD1   1 
ATOM   3054  C  CD2   . LEU A  1 429 ? -26.869 11.988   53.255  1.00 69.06  ? 429 LEU A CD2   1 
ATOM   3055  N  N     . LEU A  1 430 ? -22.501 11.781   51.629  1.00 66.98  ? 430 LEU A N     1 
ATOM   3056  C  CA    . LEU A  1 430 ? -21.506 11.180   52.499  1.00 65.36  ? 430 LEU A CA    1 
ATOM   3057  C  C     . LEU A  1 430 ? -20.373 12.125   52.897  1.00 64.87  ? 430 LEU A C     1 
ATOM   3058  O  O     . LEU A  1 430 ? -19.500 11.762   53.701  1.00 64.50  ? 430 LEU A O     1 
ATOM   3059  C  CB    . LEU A  1 430 ? -20.982 9.897    51.876  1.00 65.76  ? 430 LEU A CB    1 
ATOM   3060  C  CG    . LEU A  1 430 ? -22.047 8.800    51.865  1.00 66.57  ? 430 LEU A CG    1 
ATOM   3061  C  CD1   . LEU A  1 430 ? -21.442 7.483    51.403  1.00 68.25  ? 430 LEU A CD1   1 
ATOM   3062  C  CD2   . LEU A  1 430 ? -22.704 8.636    53.237  1.00 65.24  ? 430 LEU A CD2   1 
ATOM   3063  N  N     . LYS A  1 431 ? -20.404 13.341   52.346  1.00 65.09  ? 431 LYS A N     1 
ATOM   3064  C  CA    . LYS A  1 431 ? -19.538 14.425   52.790  1.00 64.15  ? 431 LYS A CA    1 
ATOM   3065  C  C     . LYS A  1 431 ? -19.935 14.805   54.194  1.00 62.87  ? 431 LYS A C     1 
ATOM   3066  O  O     . LYS A  1 431 ? -21.088 14.663   54.567  1.00 62.53  ? 431 LYS A O     1 
ATOM   3067  C  CB    . LYS A  1 431 ? -19.681 15.632   51.880  1.00 65.45  ? 431 LYS A CB    1 
ATOM   3068  C  CG    . LYS A  1 431 ? -19.049 15.433   50.533  1.00 66.53  ? 431 LYS A CG    1 
ATOM   3069  C  CD    . LYS A  1 431 ? -18.924 16.734   49.811  1.00 67.45  ? 431 LYS A CD    1 
ATOM   3070  C  CE    . LYS A  1 431 ? -18.710 16.487   48.349  1.00 69.48  ? 431 LYS A CE    1 
ATOM   3071  N  NZ    . LYS A  1 431 ? -19.162 17.658   47.560  1.00 72.37  ? 431 LYS A NZ    1 
ATOM   3072  N  N     . GLN A  1 432 ? -18.977 15.277   54.980  1.00 62.54  ? 432 GLN A N     1 
ATOM   3073  C  CA    . GLN A  1 432 ? -19.241 15.589   56.370  1.00 61.96  ? 432 GLN A CA    1 
ATOM   3074  C  C     . GLN A  1 432 ? -18.286 16.621   56.929  1.00 62.35  ? 432 GLN A C     1 
ATOM   3075  O  O     . GLN A  1 432 ? -17.080 16.571   56.694  1.00 62.44  ? 432 GLN A O     1 
ATOM   3076  C  CB    . GLN A  1 432 ? -19.171 14.321   57.214  1.00 61.05  ? 432 GLN A CB    1 
ATOM   3077  C  CG    . GLN A  1 432 ? -20.126 14.304   58.385  1.00 61.41  ? 432 GLN A CG    1 
ATOM   3078  C  CD    . GLN A  1 432 ? -20.234 12.940   59.032  1.00 62.11  ? 432 GLN A CD    1 
ATOM   3079  O  OE1   . GLN A  1 432 ? -20.104 11.905   58.366  1.00 63.01  ? 432 GLN A OE1   1 
ATOM   3080  N  NE2   . GLN A  1 432 ? -20.482 12.928   60.341  1.00 62.47  ? 432 GLN A NE2   1 
ATOM   3081  N  N     . ASN A  1 433 ? -18.848 17.565   57.671  1.00 62.93  ? 433 ASN A N     1 
ATOM   3082  C  CA    . ASN A  1 433 ? -18.053 18.495   58.438  1.00 63.68  ? 433 ASN A CA    1 
ATOM   3083  C  C     . ASN A  1 433 ? -17.349 17.798   59.590  1.00 62.91  ? 433 ASN A C     1 
ATOM   3084  O  O     . ASN A  1 433 ? -17.867 16.832   60.168  1.00 61.96  ? 433 ASN A O     1 
ATOM   3085  C  CB    . ASN A  1 433 ? -18.926 19.636   58.936  1.00 64.70  ? 433 ASN A CB    1 
ATOM   3086  C  CG    . ASN A  1 433 ? -19.314 20.582   57.829  1.00 66.31  ? 433 ASN A CG    1 
ATOM   3087  O  OD1   . ASN A  1 433 ? -18.756 20.529   56.739  1.00 67.81  ? 433 ASN A OD1   1 
ATOM   3088  N  ND2   . ASN A  1 433 ? -20.264 21.461   58.103  1.00 67.86  ? 433 ASN A ND2   1 
ATOM   3089  N  N     . GLN A  1 434 ? -16.149 18.282   59.896  1.00 63.56  ? 434 GLN A N     1 
ATOM   3090  C  CA    . GLN A  1 434 ? -15.339 17.745   60.989  1.00 63.20  ? 434 GLN A CA    1 
ATOM   3091  C  C     . GLN A  1 434 ? -15.971 18.131   62.322  1.00 63.61  ? 434 GLN A C     1 
ATOM   3092  O  O     . GLN A  1 434 ? -16.635 19.170   62.423  1.00 64.66  ? 434 GLN A O     1 
ATOM   3093  C  CB    . GLN A  1 434 ? -13.934 18.313   60.897  1.00 64.12  ? 434 GLN A CB    1 
ATOM   3094  C  CG    . GLN A  1 434 ? -12.859 17.504   61.558  1.00 63.17  ? 434 GLN A CG    1 
ATOM   3095  C  CD    . GLN A  1 434 ? -11.503 18.143   61.365  1.00 63.61  ? 434 GLN A CD    1 
ATOM   3096  O  OE1   . GLN A  1 434 ? -11.385 19.192   60.735  1.00 63.06  ? 434 GLN A OE1   1 
ATOM   3097  N  NE2   . GLN A  1 434 ? -10.472 17.513   61.902  1.00 64.56  ? 434 GLN A NE2   1 
ATOM   3098  N  N     . TYR A  1 435 ? -15.767 17.296   63.338  1.00 63.00  ? 435 TYR A N     1 
ATOM   3099  C  CA    . TYR A  1 435 ? -16.370 17.490   64.660  1.00 63.27  ? 435 TYR A CA    1 
ATOM   3100  C  C     . TYR A  1 435 ? -17.904 17.553   64.626  1.00 63.42  ? 435 TYR A C     1 
ATOM   3101  O  O     . TYR A  1 435 ? -18.508 18.201   65.474  1.00 64.48  ? 435 TYR A O     1 
ATOM   3102  C  CB    . TYR A  1 435 ? -15.825 18.748   65.363  1.00 64.41  ? 435 TYR A CB    1 
ATOM   3103  C  CG    . TYR A  1 435 ? -14.388 19.104   65.056  1.00 64.32  ? 435 TYR A CG    1 
ATOM   3104  C  CD1   . TYR A  1 435 ? -13.328 18.480   65.729  1.00 64.37  ? 435 TYR A CD1   1 
ATOM   3105  C  CD2   . TYR A  1 435 ? -14.083 20.075   64.106  1.00 63.40  ? 435 TYR A CD2   1 
ATOM   3106  C  CE1   . TYR A  1 435 ? -12.005 18.799   65.443  1.00 63.20  ? 435 TYR A CE1   1 
ATOM   3107  C  CE2   . TYR A  1 435 ? -12.774 20.395   63.816  1.00 63.62  ? 435 TYR A CE2   1 
ATOM   3108  C  CZ    . TYR A  1 435 ? -11.745 19.760   64.488  1.00 63.42  ? 435 TYR A CZ    1 
ATOM   3109  O  OH    . TYR A  1 435 ? -10.457 20.107   64.200  1.00 64.60  ? 435 TYR A OH    1 
ATOM   3110  N  N     . SER A  1 436 ? -18.539 16.883   63.667  1.00 62.97  ? 436 SER A N     1 
ATOM   3111  C  CA    . SER A  1 436 ? -20.005 16.842   63.640  1.00 63.34  ? 436 SER A CA    1 
ATOM   3112  C  C     . SER A  1 436 ? -20.523 15.425   63.422  1.00 62.81  ? 436 SER A C     1 
ATOM   3113  O  O     . SER A  1 436 ? -21.263 15.172   62.456  1.00 62.66  ? 436 SER A O     1 
ATOM   3114  C  CB    . SER A  1 436 ? -20.548 17.760   62.558  1.00 63.72  ? 436 SER A CB    1 
ATOM   3115  O  OG    . SER A  1 436 ? -19.562 18.686   62.179  1.00 64.61  ? 436 SER A OG    1 
ATOM   3116  N  N     . PRO A  1 437 ? -20.150 14.492   64.323  1.00 62.70  ? 437 PRO A N     1 
ATOM   3117  C  CA    . PRO A  1 437 ? -20.587 13.116   64.130  1.00 62.30  ? 437 PRO A CA    1 
ATOM   3118  C  C     . PRO A  1 437 ? -22.100 13.018   64.315  1.00 62.93  ? 437 PRO A C     1 
ATOM   3119  O  O     . PRO A  1 437 ? -22.671 13.805   65.071  1.00 63.88  ? 437 PRO A O     1 
ATOM   3120  C  CB    . PRO A  1 437 ? -19.855 12.366   65.239  1.00 62.48  ? 437 PRO A CB    1 
ATOM   3121  C  CG    . PRO A  1 437 ? -19.669 13.374   66.310  1.00 62.96  ? 437 PRO A CG    1 
ATOM   3122  C  CD    . PRO A  1 437 ? -19.499 14.689   65.632  1.00 63.01  ? 437 PRO A CD    1 
ATOM   3123  N  N     . LEU A  1 438 ? -22.746 12.086   63.620  1.00 62.82  ? 438 LEU A N     1 
ATOM   3124  C  CA    . LEU A  1 438 ? -24.200 11.922   63.715  1.00 63.39  ? 438 LEU A CA    1 
ATOM   3125  C  C     . LEU A  1 438 ? -24.553 10.651   64.466  1.00 64.04  ? 438 LEU A C     1 
ATOM   3126  O  O     . LEU A  1 438 ? -23.782 9.694    64.488  1.00 63.56  ? 438 LEU A O     1 
ATOM   3127  C  CB    . LEU A  1 438 ? -24.833 11.895   62.320  1.00 63.24  ? 438 LEU A CB    1 
ATOM   3128  C  CG    . LEU A  1 438 ? -24.987 13.221   61.576  1.00 62.78  ? 438 LEU A CG    1 
ATOM   3129  C  CD1   . LEU A  1 438 ? -25.039 13.014   60.079  1.00 61.57  ? 438 LEU A CD1   1 
ATOM   3130  C  CD2   . LEU A  1 438 ? -26.229 13.915   62.050  1.00 64.00  ? 438 LEU A CD2   1 
ATOM   3131  N  N     . ALA A  1 439 ? -25.720 10.642   65.093  1.00 65.54  ? 439 ALA A N     1 
ATOM   3132  C  CA    . ALA A  1 439 ? -26.213 9.423    65.705  1.00 66.93  ? 439 ALA A CA    1 
ATOM   3133  C  C     . ALA A  1 439 ? -26.726 8.490    64.606  1.00 67.55  ? 439 ALA A C     1 
ATOM   3134  O  O     . ALA A  1 439 ? -27.048 8.942    63.505  1.00 67.35  ? 439 ALA A O     1 
ATOM   3135  C  CB    . ALA A  1 439 ? -27.300 9.740    66.688  1.00 68.14  ? 439 ALA A CB    1 
ATOM   3136  N  N     . THR A  1 440 ? -26.790 7.193    64.898  1.00 68.76  ? 440 THR A N     1 
ATOM   3137  C  CA    . THR A  1 440 ? -27.276 6.215    63.925  1.00 69.91  ? 440 THR A CA    1 
ATOM   3138  C  C     . THR A  1 440 ? -28.743 6.466    63.573  1.00 71.28  ? 440 THR A C     1 
ATOM   3139  O  O     . THR A  1 440 ? -29.147 6.315    62.415  1.00 71.92  ? 440 THR A O     1 
ATOM   3140  C  CB    . THR A  1 440 ? -27.077 4.769    64.418  1.00 70.76  ? 440 THR A CB    1 
ATOM   3141  O  OG1   . THR A  1 440 ? -25.721 4.597    64.850  1.00 70.84  ? 440 THR A OG1   1 
ATOM   3142  C  CG2   . THR A  1 440 ? -27.366 3.764    63.300  1.00 71.56  ? 440 THR A CG2   1 
ATOM   3143  N  N     . GLU A  1 441 ? -29.540 6.874    64.557  1.00 72.45  ? 441 GLU A N     1 
ATOM   3144  C  CA    . GLU A  1 441 ? -30.939 7.191    64.281  1.00 73.83  ? 441 GLU A CA    1 
ATOM   3145  C  C     . GLU A  1 441 ? -31.093 8.459    63.436  1.00 73.63  ? 441 GLU A C     1 
ATOM   3146  O  O     . GLU A  1 441 ? -32.173 8.745    62.947  1.00 75.02  ? 441 GLU A O     1 
ATOM   3147  C  CB    . GLU A  1 441 ? -31.780 7.251    65.563  1.00 75.07  ? 441 GLU A CB    1 
ATOM   3148  C  CG    . GLU A  1 441 ? -31.591 8.490    66.395  1.00 74.91  ? 441 GLU A CG    1 
ATOM   3149  C  CD    . GLU A  1 441 ? -30.503 8.347    67.421  1.00 74.56  ? 441 GLU A CD    1 
ATOM   3150  O  OE1   . GLU A  1 441 ? -29.621 7.478    67.264  1.00 73.86  ? 441 GLU A OE1   1 
ATOM   3151  O  OE2   . GLU A  1 441 ? -30.528 9.119    68.397  1.00 76.07  ? 441 GLU A OE2   1 
ATOM   3152  N  N     . GLU A  1 442 ? -30.012 9.211    63.271  1.00 72.61  ? 442 GLU A N     1 
ATOM   3153  C  CA    . GLU A  1 442 ? -29.992 10.349   62.354  1.00 72.65  ? 442 GLU A CA    1 
ATOM   3154  C  C     . GLU A  1 442 ? -29.439 9.907    61.006  1.00 72.02  ? 442 GLU A C     1 
ATOM   3155  O  O     . GLU A  1 442 ? -29.787 10.466   59.965  1.00 72.70  ? 442 GLU A O     1 
ATOM   3156  C  CB    . GLU A  1 442 ? -29.141 11.494   62.918  1.00 72.15  ? 442 GLU A CB    1 
ATOM   3157  C  CG    . GLU A  1 442 ? -29.742 12.184   64.140  1.00 74.00  ? 442 GLU A CG    1 
ATOM   3158  C  CD    . GLU A  1 442 ? -28.852 13.276   64.695  1.00 74.46  ? 442 GLU A CD    1 
ATOM   3159  O  OE1   . GLU A  1 442 ? -27.673 12.989   64.995  1.00 74.20  ? 442 GLU A OE1   1 
ATOM   3160  O  OE2   . GLU A  1 442 ? -29.338 14.419   64.837  1.00 75.78  ? 442 GLU A OE2   1 
ATOM   3161  N  N     . GLN A  1 443 ? -28.576 8.895    61.045  1.00 71.19  ? 443 GLN A N     1 
ATOM   3162  C  CA    . GLN A  1 443 ? -27.911 8.358    59.865  1.00 70.64  ? 443 GLN A CA    1 
ATOM   3163  C  C     . GLN A  1 443 ? -28.814 7.524    58.971  1.00 71.61  ? 443 GLN A C     1 
ATOM   3164  O  O     . GLN A  1 443 ? -28.720 7.631    57.745  1.00 72.17  ? 443 GLN A O     1 
ATOM   3165  C  CB    . GLN A  1 443 ? -26.740 7.480    60.283  1.00 70.02  ? 443 GLN A CB    1 
ATOM   3166  C  CG    . GLN A  1 443 ? -25.400 8.155    60.293  1.00 69.51  ? 443 GLN A CG    1 
ATOM   3167  C  CD    . GLN A  1 443 ? -24.281 7.145    60.441  1.00 69.94  ? 443 GLN A CD    1 
ATOM   3168  O  OE1   . GLN A  1 443 ? -23.997 6.368    59.518  1.00 71.05  ? 443 GLN A OE1   1 
ATOM   3169  N  NE2   . GLN A  1 443 ? -23.643 7.141    61.606  1.00 69.03  ? 443 GLN A NE2   1 
ATOM   3170  N  N     . VAL A  1 444 ? -29.661 6.671    59.557  1.00 72.02  ? 444 VAL A N     1 
ATOM   3171  C  CA    . VAL A  1 444 ? -30.447 5.763    58.715  1.00 72.93  ? 444 VAL A CA    1 
ATOM   3172  C  C     . VAL A  1 444 ? -31.517 6.500    57.894  1.00 73.71  ? 444 VAL A C     1 
ATOM   3173  O  O     . VAL A  1 444 ? -31.648 6.211    56.710  1.00 74.58  ? 444 VAL A O     1 
ATOM   3174  C  CB    . VAL A  1 444 ? -30.964 4.451    59.422  1.00 73.86  ? 444 VAL A CB    1 
ATOM   3175  C  CG1   . VAL A  1 444 ? -30.002 3.978    60.493  1.00 72.58  ? 444 VAL A CG1   1 
ATOM   3176  C  CG2   . VAL A  1 444 ? -32.338 4.618    59.995  1.00 75.63  ? 444 VAL A CG2   1 
ATOM   3177  N  N     . PRO A  1 445 ? -32.241 7.478    58.496  1.00 73.60  ? 445 PRO A N     1 
ATOM   3178  C  CA    . PRO A  1 445 ? -33.241 8.199    57.710  1.00 74.80  ? 445 PRO A CA    1 
ATOM   3179  C  C     . PRO A  1 445 ? -32.617 8.981    56.572  1.00 74.42  ? 445 PRO A C     1 
ATOM   3180  O  O     . PRO A  1 445 ? -33.270 9.213    55.552  1.00 75.88  ? 445 PRO A O     1 
ATOM   3181  C  CB    . PRO A  1 445 ? -33.868 9.162    58.722  1.00 74.87  ? 445 PRO A CB    1 
ATOM   3182  C  CG    . PRO A  1 445 ? -32.920 9.270    59.799  1.00 73.46  ? 445 PRO A CG    1 
ATOM   3183  C  CD    . PRO A  1 445 ? -32.231 7.948    59.890  1.00 73.05  ? 445 PRO A CD    1 
ATOM   3184  N  N     . LEU A  1 446 ? -31.358 9.368    56.754  1.00 72.79  ? 446 LEU A N     1 
ATOM   3185  C  CA    . LEU A  1 446 ? -30.610 10.101   55.740  1.00 72.55  ? 446 LEU A CA    1 
ATOM   3186  C  C     . LEU A  1 446 ? -30.147 9.220    54.588  1.00 72.97  ? 446 LEU A C     1 
ATOM   3187  O  O     . LEU A  1 446 ? -30.237 9.619    53.424  1.00 74.29  ? 446 LEU A O     1 
ATOM   3188  C  CB    . LEU A  1 446 ? -29.417 10.812   56.368  1.00 70.83  ? 446 LEU A CB    1 
ATOM   3189  C  CG    . LEU A  1 446 ? -29.689 12.244   56.797  1.00 70.92  ? 446 LEU A CG    1 
ATOM   3190  C  CD1   . LEU A  1 446 ? -28.458 12.784   57.466  1.00 69.87  ? 446 LEU A CD1   1 
ATOM   3191  C  CD2   . LEU A  1 446 ? -30.038 13.078   55.589  1.00 72.39  ? 446 LEU A CD2   1 
ATOM   3192  N  N     . ILE A  1 447 ? -29.646 8.032    54.913  1.00 72.21  ? 447 ILE A N     1 
ATOM   3193  C  CA    . ILE A  1 447 ? -29.196 7.097    53.896  1.00 72.58  ? 447 ILE A CA    1 
ATOM   3194  C  C     . ILE A  1 447 ? -30.397 6.527    53.152  1.00 74.58  ? 447 ILE A C     1 
ATOM   3195  O  O     . ILE A  1 447 ? -30.338 6.332    51.937  1.00 75.84  ? 447 ILE A O     1 
ATOM   3196  C  CB    . ILE A  1 447 ? -28.260 6.021    54.498  1.00 71.72  ? 447 ILE A CB    1 
ATOM   3197  C  CG1   . ILE A  1 447 ? -26.837 6.594    54.561  1.00 70.03  ? 447 ILE A CG1   1 
ATOM   3198  C  CG2   . ILE A  1 447 ? -28.293 4.713    53.688  1.00 72.52  ? 447 ILE A CG2   1 
ATOM   3199  C  CD1   . ILE A  1 447 ? -25.994 6.060    55.687  1.00 68.70  ? 447 ILE A CD1   1 
ATOM   3200  N  N     . TYR A  1 448 ? -31.490 6.313    53.888  1.00 75.17  ? 448 TYR A N     1 
ATOM   3201  C  CA    . TYR A  1 448 ? -32.735 5.743    53.353  1.00 77.11  ? 448 TYR A CA    1 
ATOM   3202  C  C     . TYR A  1 448 ? -33.255 6.565    52.180  1.00 78.45  ? 448 TYR A C     1 
ATOM   3203  O  O     . TYR A  1 448 ? -33.531 6.024    51.104  1.00 80.21  ? 448 TYR A O     1 
ATOM   3204  C  CB    . TYR A  1 448 ? -33.810 5.643    54.451  1.00 77.54  ? 448 TYR A CB    1 
ATOM   3205  C  CG    . TYR A  1 448 ? -35.122 5.103    53.946  1.00 80.14  ? 448 TYR A CG    1 
ATOM   3206  C  CD1   . TYR A  1 448 ? -35.435 3.762    54.087  1.00 80.98  ? 448 TYR A CD1   1 
ATOM   3207  C  CD2   . TYR A  1 448 ? -36.043 5.935    53.303  1.00 81.93  ? 448 TYR A CD2   1 
ATOM   3208  C  CE1   . TYR A  1 448 ? -36.619 3.262    53.607  1.00 84.24  ? 448 TYR A CE1   1 
ATOM   3209  C  CE2   . TYR A  1 448 ? -37.231 5.445    52.817  1.00 84.41  ? 448 TYR A CE2   1 
ATOM   3210  C  CZ    . TYR A  1 448 ? -37.513 4.105    52.971  1.00 86.20  ? 448 TYR A CZ    1 
ATOM   3211  O  OH    . TYR A  1 448 ? -38.695 3.593    52.489  1.00 90.44  ? 448 TYR A OH    1 
ATOM   3212  N  N     . ALA A  1 449 ? -33.387 7.870    52.410  1.00 77.71  ? 449 ALA A N     1 
ATOM   3213  C  CA    . ALA A  1 449 ? -33.770 8.825    51.378  1.00 79.04  ? 449 ALA A CA    1 
ATOM   3214  C  C     . ALA A  1 449 ? -32.846 8.725    50.172  1.00 79.27  ? 449 ALA A C     1 
ATOM   3215  O  O     . ALA A  1 449 ? -33.306 8.718    49.034  1.00 81.51  ? 449 ALA A O     1 
ATOM   3216  C  CB    . ALA A  1 449 ? -33.730 10.235   51.938  1.00 78.25  ? 449 ALA A CB    1 
ATOM   3217  N  N     . GLY A  1 450 ? -31.543 8.643    50.436  1.00 77.22  ? 450 GLY A N     1 
ATOM   3218  C  CA    . GLY A  1 450 ? -30.535 8.589    49.391  1.00 77.20  ? 450 GLY A CA    1 
ATOM   3219  C  C     . GLY A  1 450 ? -30.676 7.399    48.465  1.00 78.85  ? 450 GLY A C     1 
ATOM   3220  O  O     . GLY A  1 450 ? -30.928 7.567    47.269  1.00 80.89  ? 450 GLY A O     1 
ATOM   3221  N  N     . VAL A  1 451 ? -30.520 6.204    49.034  1.00 78.19  ? 451 VAL A N     1 
ATOM   3222  C  CA    . VAL A  1 451 ? -30.471 4.948    48.284  1.00 79.78  ? 451 VAL A CA    1 
ATOM   3223  C  C     . VAL A  1 451 ? -31.755 4.681    47.500  1.00 82.82  ? 451 VAL A C     1 
ATOM   3224  O  O     . VAL A  1 451 ? -31.708 4.152    46.382  1.00 85.09  ? 451 VAL A O     1 
ATOM   3225  C  CB    . VAL A  1 451 ? -30.161 3.746    49.218  1.00 78.77  ? 451 VAL A CB    1 
ATOM   3226  C  CG1   . VAL A  1 451 ? -30.368 2.418    48.500  1.00 80.88  ? 451 VAL A CG1   1 
ATOM   3227  C  CG2   . VAL A  1 451 ? -28.745 3.842    49.751  1.00 76.05  ? 451 VAL A CG2   1 
ATOM   3228  N  N     . ASN A  1 452 ? -32.892 5.062    48.076  1.00 83.15  ? 452 ASN A N     1 
ATOM   3229  C  CA    . ASN A  1 452 ? -34.188 4.796    47.457  1.00 86.03  ? 452 ASN A CA    1 
ATOM   3230  C  C     . ASN A  1 452 ? -34.615 5.829    46.421  1.00 87.91  ? 452 ASN A C     1 
ATOM   3231  O  O     . ASN A  1 452 ? -35.779 5.885    46.033  1.00 90.45  ? 452 ASN A O     1 
ATOM   3232  C  CB    . ASN A  1 452 ? -35.257 4.611    48.528  1.00 85.96  ? 452 ASN A CB    1 
ATOM   3233  C  CG    . ASN A  1 452 ? -34.995 3.403    49.394  1.00 84.96  ? 452 ASN A CG    1 
ATOM   3234  O  OD1   . ASN A  1 452 ? -34.883 2.281    48.900  1.00 85.79  ? 452 ASN A OD1   1 
ATOM   3235  N  ND2   . ASN A  1 452 ? -34.887 3.626    50.697  1.00 83.03  ? 452 ASN A ND2   1 
ATOM   3236  N  N     . GLY A  1 453 ? -33.665 6.642    45.976  1.00 87.22  ? 453 GLY A N     1 
ATOM   3237  C  CA    . GLY A  1 453 ? -33.886 7.569    44.882  1.00 89.61  ? 453 GLY A CA    1 
ATOM   3238  C  C     . GLY A  1 453 ? -34.614 8.846    45.229  1.00 90.05  ? 453 GLY A C     1 
ATOM   3239  O  O     . GLY A  1 453 ? -34.781 9.703    44.366  1.00 92.16  ? 453 GLY A O     1 
ATOM   3240  N  N     . HIS A  1 454 ? -35.047 8.988    46.481  1.00 88.72  ? 454 HIS A N     1 
ATOM   3241  C  CA    . HIS A  1 454 ? -35.755 10.197   46.927  1.00 89.22  ? 454 HIS A CA    1 
ATOM   3242  C  C     . HIS A  1 454 ? -34.934 11.482   46.751  1.00 88.47  ? 454 HIS A C     1 
ATOM   3243  O  O     . HIS A  1 454 ? -35.471 12.586   46.870  1.00 89.16  ? 454 HIS A O     1 
ATOM   3244  C  CB    . HIS A  1 454 ? -36.179 10.081   48.394  1.00 87.60  ? 454 HIS A CB    1 
ATOM   3245  C  CG    . HIS A  1 454 ? -37.186 9.008    48.660  1.00 89.19  ? 454 HIS A CG    1 
ATOM   3246  N  ND1   . HIS A  1 454 ? -36.846 7.792    49.214  1.00 88.52  ? 454 HIS A ND1   1 
ATOM   3247  C  CD2   . HIS A  1 454 ? -38.528 8.975    48.477  1.00 91.68  ? 454 HIS A CD2   1 
ATOM   3248  C  CE1   . HIS A  1 454 ? -37.932 7.050    49.346  1.00 90.30  ? 454 HIS A CE1   1 
ATOM   3249  N  NE2   . HIS A  1 454 ? -38.966 7.746    48.910  1.00 92.22  ? 454 HIS A NE2   1 
ATOM   3250  N  N     . LEU A  1 455 ? -33.639 11.339   46.473  1.00 87.41  ? 455 LEU A N     1 
ATOM   3251  C  CA    . LEU A  1 455 ? -32.755 12.498   46.350  1.00 86.83  ? 455 LEU A CA    1 
ATOM   3252  C  C     . LEU A  1 455 ? -32.412 12.869   44.916  1.00 89.28  ? 455 LEU A C     1 
ATOM   3253  O  O     . LEU A  1 455 ? -31.909 13.968   44.667  1.00 89.32  ? 455 LEU A O     1 
ATOM   3254  C  CB    . LEU A  1 455 ? -31.486 12.303   47.181  1.00 83.77  ? 455 LEU A CB    1 
ATOM   3255  C  CG    . LEU A  1 455 ? -31.738 12.427   48.688  1.00 81.35  ? 455 LEU A CG    1 
ATOM   3256  C  CD1   . LEU A  1 455 ? -30.469 12.170   49.470  1.00 78.13  ? 455 LEU A CD1   1 
ATOM   3257  C  CD2   . LEU A  1 455 ? -32.328 13.792   49.031  1.00 80.69  ? 455 LEU A CD2   1 
ATOM   3258  N  N     . ASP A  1 456 ? -32.708 11.956   43.987  1.00 91.70  ? 456 ASP A N     1 
ATOM   3259  C  CA    . ASP A  1 456 ? -32.420 12.125   42.559  1.00 94.68  ? 456 ASP A CA    1 
ATOM   3260  C  C     . ASP A  1 456 ? -33.070 13.383   42.003  1.00 97.30  ? 456 ASP A C     1 
ATOM   3261  O  O     . ASP A  1 456 ? -32.498 14.063   41.146  1.00 98.64  ? 456 ASP A O     1 
ATOM   3262  C  CB    . ASP A  1 456 ? -32.887 10.906   41.756  1.00 96.92  ? 456 ASP A CB    1 
ATOM   3263  C  CG    . ASP A  1 456 ? -32.309 9.591    42.271  1.00 95.53  ? 456 ASP A CG    1 
ATOM   3264  O  OD1   . ASP A  1 456 ? -31.617 9.577    43.317  1.00 92.69  ? 456 ASP A OD1   1 
ATOM   3265  O  OD2   . ASP A  1 456 ? -32.567 8.556    41.620  1.00 97.82  ? 456 ASP A OD2   1 
ATOM   3266  N  N     . GLY A  1 457 ? -34.266 13.684   42.508  1.00 98.39  ? 457 GLY A N     1 
ATOM   3267  C  CA    . GLY A  1 457 ? -35.009 14.883   42.119  1.00 101.28 ? 457 GLY A CA    1 
ATOM   3268  C  C     . GLY A  1 457 ? -34.414 16.185   42.633  1.00 100.23 ? 457 GLY A C     1 
ATOM   3269  O  O     . GLY A  1 457 ? -34.410 17.197   41.932  1.00 102.37 ? 457 GLY A O     1 
ATOM   3270  N  N     . ILE A  1 458 ? -33.914 16.168   43.861  1.00 97.41  ? 458 ILE A N     1 
ATOM   3271  C  CA    . ILE A  1 458 ? -33.310 17.364   44.439  1.00 96.66  ? 458 ILE A CA    1 
ATOM   3272  C  C     . ILE A  1 458 ? -31.945 17.647   43.800  1.00 96.70  ? 458 ILE A C     1 
ATOM   3273  O  O     . ILE A  1 458 ? -31.078 16.765   43.738  1.00 95.12  ? 458 ILE A O     1 
ATOM   3274  C  CB    . ILE A  1 458 ? -33.221 17.274   45.989  1.00 93.69  ? 458 ILE A CB    1 
ATOM   3275  C  CG1   . ILE A  1 458 ? -34.629 17.216   46.587  1.00 94.05  ? 458 ILE A CG1   1 
ATOM   3276  C  CG2   . ILE A  1 458 ? -32.440 18.466   46.570  1.00 92.52  ? 458 ILE A CG2   1 
ATOM   3277  C  CD1   . ILE A  1 458 ? -34.715 16.441   47.864  1.00 91.41  ? 458 ILE A CD1   1 
ATOM   3278  N  N     . GLU A  1 459 ? -31.788 18.882   43.314  1.00 98.76  ? 459 GLU A N     1 
ATOM   3279  C  CA    . GLU A  1 459 ? -30.544 19.359   42.691  1.00 99.37  ? 459 GLU A CA    1 
ATOM   3280  C  C     . GLU A  1 459 ? -29.353 19.329   43.650  1.00 96.04  ? 459 GLU A C     1 
ATOM   3281  O  O     . GLU A  1 459 ? -29.495 19.609   44.841  1.00 94.19  ? 459 GLU A O     1 
ATOM   3282  C  CB    . GLU A  1 459 ? -30.729 20.760   42.102  1.00 102.25 ? 459 GLU A CB    1 
ATOM   3283  C  CG    . GLU A  1 459 ? -31.274 21.792   43.082  1.00 102.86 ? 459 GLU A CG    1 
ATOM   3284  C  CD    . GLU A  1 459 ? -31.496 23.152   42.440  1.00 107.41 ? 459 GLU A CD    1 
ATOM   3285  O  OE1   . GLU A  1 459 ? -30.702 23.528   41.547  1.00 109.75 ? 459 GLU A OE1   1 
ATOM   3286  O  OE2   . GLU A  1 459 ? -32.462 23.848   42.835  1.00 108.52 ? 459 GLU A OE2   1 
ATOM   3287  N  N     . LEU A  1 460 ? -28.183 19.011   43.098  1.00 95.74  ? 460 LEU A N     1 
ATOM   3288  C  CA    . LEU A  1 460 ? -26.998 18.615   43.873  1.00 92.73  ? 460 LEU A CA    1 
ATOM   3289  C  C     . LEU A  1 460 ? -26.524 19.630   44.908  1.00 91.28  ? 460 LEU A C     1 
ATOM   3290  O  O     . LEU A  1 460 ? -26.076 19.253   45.989  1.00 88.49  ? 460 LEU A O     1 
ATOM   3291  C  CB    . LEU A  1 460 ? -25.847 18.257   42.923  1.00 93.50  ? 460 LEU A CB    1 
ATOM   3292  C  CG    . LEU A  1 460 ? -24.880 17.138   43.323  1.00 90.98  ? 460 LEU A CG    1 
ATOM   3293  C  CD1   . LEU A  1 460 ? -25.595 15.799   43.485  1.00 90.12  ? 460 LEU A CD1   1 
ATOM   3294  C  CD2   . LEU A  1 460 ? -23.770 17.010   42.293  1.00 92.62  ? 460 LEU A CD2   1 
ATOM   3295  N  N     . SER A  1 461 ? -26.631 20.914   44.577  1.00 93.42  ? 461 SER A N     1 
ATOM   3296  C  CA    . SER A  1 461 ? -26.156 21.973   45.465  1.00 92.81  ? 461 SER A CA    1 
ATOM   3297  C  C     . SER A  1 461 ? -26.907 22.044   46.786  1.00 91.25  ? 461 SER A C     1 
ATOM   3298  O  O     . SER A  1 461 ? -26.410 22.626   47.746  1.00 90.26  ? 461 SER A O     1 
ATOM   3299  C  CB    . SER A  1 461 ? -26.226 23.337   44.785  1.00 95.81  ? 461 SER A CB    1 
ATOM   3300  O  OG    . SER A  1 461 ? -25.843 24.350   45.701  1.00 95.16  ? 461 SER A OG    1 
ATOM   3301  N  N     . ARG A  1 462 ? -28.095 21.454   46.837  1.00 91.43  ? 462 ARG A N     1 
ATOM   3302  C  CA    . ARG A  1 462 ? -28.925 21.562   48.030  1.00 90.63  ? 462 ARG A CA    1 
ATOM   3303  C  C     . ARG A  1 462 ? -29.087 20.262   48.819  1.00 88.11  ? 462 ARG A C     1 
ATOM   3304  O  O     . ARG A  1 462 ? -29.974 20.158   49.668  1.00 87.87  ? 462 ARG A O     1 
ATOM   3305  C  CB    . ARG A  1 462 ? -30.284 22.195   47.690  1.00 93.30  ? 462 ARG A CB    1 
ATOM   3306  C  CG    . ARG A  1 462 ? -30.173 23.655   47.241  1.00 96.59  ? 462 ARG A CG    1 
ATOM   3307  C  CD    . ARG A  1 462 ? -31.514 24.374   47.218  1.00 100.49 ? 462 ARG A CD    1 
ATOM   3308  N  NE    . ARG A  1 462 ? -32.530 23.643   46.458  1.00 103.25 ? 462 ARG A NE    1 
ATOM   3309  C  CZ    . ARG A  1 462 ? -33.683 23.201   46.958  1.00 103.55 ? 462 ARG A CZ    1 
ATOM   3310  N  NH1   . ARG A  1 462 ? -33.998 23.424   48.229  1.00 102.36 ? 462 ARG A NH1   1 
ATOM   3311  N  NH2   . ARG A  1 462 ? -34.532 22.544   46.178  1.00 105.12 ? 462 ARG A NH2   1 
ATOM   3312  N  N     . ILE A  1 463 ? -28.225 19.282   48.550  1.00 86.62  ? 463 ILE A N     1 
ATOM   3313  C  CA    . ILE A  1 463 ? -28.232 18.017   49.297  1.00 84.44  ? 463 ILE A CA    1 
ATOM   3314  C  C     . ILE A  1 463 ? -27.901 18.275   50.770  1.00 82.42  ? 463 ILE A C     1 
ATOM   3315  O  O     . ILE A  1 463 ? -28.499 17.674   51.664  1.00 81.50  ? 463 ILE A O     1 
ATOM   3316  C  CB    . ILE A  1 463 ? -27.245 16.958   48.690  1.00 83.84  ? 463 ILE A CB    1 
ATOM   3317  C  CG1   . ILE A  1 463 ? -27.524 16.708   47.197  1.00 85.90  ? 463 ILE A CG1   1 
ATOM   3318  C  CG2   . ILE A  1 463 ? -27.255 15.633   49.491  1.00 82.07  ? 463 ILE A CG2   1 
ATOM   3319  C  CD1   . ILE A  1 463 ? -28.836 16.017   46.884  1.00 87.19  ? 463 ILE A CD1   1 
ATOM   3320  N  N     . GLY A  1 464 ? -26.957 19.180   51.010  1.00 82.14  ? 464 GLY A N     1 
ATOM   3321  C  CA    . GLY A  1 464 ? -26.547 19.556   52.362  1.00 80.64  ? 464 GLY A CA    1 
ATOM   3322  C  C     . GLY A  1 464 ? -27.668 20.169   53.176  1.00 81.19  ? 464 GLY A C     1 
ATOM   3323  O  O     . GLY A  1 464 ? -27.975 19.700   54.276  1.00 79.91  ? 464 GLY A O     1 
ATOM   3324  N  N     . GLU A  1 465 ? -28.283 21.216   52.628  1.00 83.37  ? 465 GLU A N     1 
ATOM   3325  C  CA    . GLU A  1 465 ? -29.427 21.855   53.278  1.00 84.59  ? 465 GLU A CA    1 
ATOM   3326  C  C     . GLU A  1 465 ? -30.604 20.889   53.413  1.00 84.29  ? 465 GLU A C     1 
ATOM   3327  O  O     . GLU A  1 465 ? -31.507 21.120   54.212  1.00 84.95  ? 465 GLU A O     1 
ATOM   3328  C  CB    . GLU A  1 465 ? -29.859 23.137   52.546  1.00 87.42  ? 465 GLU A CB    1 
ATOM   3329  C  CG    . GLU A  1 465 ? -30.813 22.923   51.363  1.00 89.90  ? 465 GLU A CG    1 
ATOM   3330  C  CD    . GLU A  1 465 ? -31.917 23.973   51.277  1.00 93.42  ? 465 GLU A CD    1 
ATOM   3331  O  OE1   . GLU A  1 465 ? -32.300 24.539   52.327  1.00 93.57  ? 465 GLU A OE1   1 
ATOM   3332  O  OE2   . GLU A  1 465 ? -32.419 24.220   50.157  1.00 95.82  ? 465 GLU A OE2   1 
ATOM   3333  N  N     . PHE A  1 466 ? -30.594 19.821   52.619  1.00 83.68  ? 466 PHE A N     1 
ATOM   3334  C  CA    . PHE A  1 466 ? -31.584 18.770   52.762  1.00 83.39  ? 466 PHE A CA    1 
ATOM   3335  C  C     . PHE A  1 466 ? -31.309 18.010   54.051  1.00 81.39  ? 466 PHE A C     1 
ATOM   3336  O  O     . PHE A  1 466 ? -32.181 17.926   54.915  1.00 81.69  ? 466 PHE A O     1 
ATOM   3337  C  CB    . PHE A  1 466 ? -31.586 17.818   51.565  1.00 83.73  ? 466 PHE A CB    1 
ATOM   3338  C  CG    . PHE A  1 466 ? -32.493 16.635   51.740  1.00 82.98  ? 466 PHE A CG    1 
ATOM   3339  C  CD1   . PHE A  1 466 ? -32.035 15.476   52.355  1.00 80.30  ? 466 PHE A CD1   1 
ATOM   3340  C  CD2   . PHE A  1 466 ? -33.808 16.688   51.306  1.00 84.45  ? 466 PHE A CD2   1 
ATOM   3341  C  CE1   . PHE A  1 466 ? -32.872 14.390   52.532  1.00 80.69  ? 466 PHE A CE1   1 
ATOM   3342  C  CE2   . PHE A  1 466 ? -34.652 15.606   51.472  1.00 84.87  ? 466 PHE A CE2   1 
ATOM   3343  C  CZ    . PHE A  1 466 ? -34.185 14.454   52.087  1.00 83.17  ? 466 PHE A CZ    1 
ATOM   3344  N  N     . GLU A  1 467 ? -30.100 17.466   54.189  1.00 79.63  ? 467 GLU A N     1 
ATOM   3345  C  CA    . GLU A  1 467 ? -29.731 16.777   55.423  1.00 78.07  ? 467 GLU A CA    1 
ATOM   3346  C  C     . GLU A  1 467 ? -30.209 17.609   56.606  1.00 78.10  ? 467 GLU A C     1 
ATOM   3347  O  O     . GLU A  1 467 ? -30.762 17.080   57.576  1.00 77.86  ? 467 GLU A O     1 
ATOM   3348  C  CB    . GLU A  1 467 ? -28.220 16.528   55.505  1.00 76.70  ? 467 GLU A CB    1 
ATOM   3349  C  CG    . GLU A  1 467 ? -27.686 16.360   56.941  1.00 77.21  ? 467 GLU A CG    1 
ATOM   3350  C  CD    . GLU A  1 467 ? -26.323 15.678   57.010  1.00 78.76  ? 467 GLU A CD    1 
ATOM   3351  O  OE1   . GLU A  1 467 ? -26.079 14.758   56.197  1.00 79.99  ? 467 GLU A OE1   1 
ATOM   3352  O  OE2   . GLU A  1 467 ? -25.499 16.048   57.885  1.00 78.63  ? 467 GLU A OE2   1 
ATOM   3353  N  N     . SER A  1 468 ? -30.028 18.920   56.490  1.00 78.66  ? 468 SER A N     1 
ATOM   3354  C  CA    . SER A  1 468 ? -30.333 19.838   57.569  1.00 78.93  ? 468 SER A CA    1 
ATOM   3355  C  C     . SER A  1 468 ? -31.833 19.899   57.878  1.00 80.29  ? 468 SER A C     1 
ATOM   3356  O  O     . SER A  1 468 ? -32.258 19.491   58.955  1.00 80.11  ? 468 SER A O     1 
ATOM   3357  C  CB    . SER A  1 468 ? -29.771 21.219   57.250  1.00 79.95  ? 468 SER A CB    1 
ATOM   3358  O  OG    . SER A  1 468 ? -29.230 21.805   58.416  1.00 79.59  ? 468 SER A OG    1 
ATOM   3359  N  N     . SER A  1 469 ? -32.627 20.384   56.930  1.00 81.82  ? 469 SER A N     1 
ATOM   3360  C  CA    . SER A  1 469 ? -34.065 20.502   57.118  1.00 83.60  ? 469 SER A CA    1 
ATOM   3361  C  C     . SER A  1 469 ? -34.742 19.171   57.433  1.00 83.11  ? 469 SER A C     1 
ATOM   3362  O  O     . SER A  1 469 ? -35.657 19.116   58.258  1.00 84.01  ? 469 SER A O     1 
ATOM   3363  C  CB    . SER A  1 469 ? -34.711 21.121   55.884  1.00 85.79  ? 469 SER A CB    1 
ATOM   3364  O  OG    . SER A  1 469 ? -34.291 22.456   55.718  1.00 87.37  ? 469 SER A OG    1 
ATOM   3365  N  N     . PHE A  1 470 ? -34.288 18.103   56.778  1.00 81.87  ? 470 PHE A N     1 
ATOM   3366  C  CA    . PHE A  1 470 ? -34.905 16.789   56.936  1.00 81.60  ? 470 PHE A CA    1 
ATOM   3367  C  C     . PHE A  1 470 ? -34.779 16.276   58.371  1.00 80.61  ? 470 PHE A C     1 
ATOM   3368  O  O     . PHE A  1 470 ? -35.774 15.849   58.963  1.00 81.80  ? 470 PHE A O     1 
ATOM   3369  C  CB    . PHE A  1 470 ? -34.328 15.786   55.935  1.00 80.53  ? 470 PHE A CB    1 
ATOM   3370  C  CG    . PHE A  1 470 ? -35.022 14.454   55.939  1.00 81.11  ? 470 PHE A CG    1 
ATOM   3371  C  CD1   . PHE A  1 470 ? -36.389 14.357   56.186  1.00 83.29  ? 470 PHE A CD1   1 
ATOM   3372  C  CD2   . PHE A  1 470 ? -34.312 13.290   55.672  1.00 80.39  ? 470 PHE A CD2   1 
ATOM   3373  C  CE1   . PHE A  1 470 ? -37.036 13.119   56.182  1.00 84.22  ? 470 PHE A CE1   1 
ATOM   3374  C  CE2   . PHE A  1 470 ? -34.954 12.040   55.664  1.00 81.30  ? 470 PHE A CE2   1 
ATOM   3375  C  CZ    . PHE A  1 470 ? -36.319 11.958   55.918  1.00 82.97  ? 470 PHE A CZ    1 
ATOM   3376  N  N     . LEU A  1 471 ? -33.566 16.346   58.925  1.00 78.72  ? 471 LEU A N     1 
ATOM   3377  C  CA    . LEU A  1 471 ? -33.310 15.917   60.299  1.00 77.56  ? 471 LEU A CA    1 
ATOM   3378  C  C     . LEU A  1 471 ? -34.178 16.655   61.311  1.00 79.22  ? 471 LEU A C     1 
ATOM   3379  O  O     . LEU A  1 471 ? -34.851 16.027   62.126  1.00 79.80  ? 471 LEU A O     1 
ATOM   3380  C  CB    . LEU A  1 471 ? -31.828 16.056   60.659  1.00 75.55  ? 471 LEU A CB    1 
ATOM   3381  C  CG    . LEU A  1 471 ? -30.894 14.917   60.237  1.00 73.69  ? 471 LEU A CG    1 
ATOM   3382  C  CD1   . LEU A  1 471 ? -29.516 15.107   60.846  1.00 71.77  ? 471 LEU A CD1   1 
ATOM   3383  C  CD2   . LEU A  1 471 ? -31.447 13.553   60.628  1.00 73.63  ? 471 LEU A CD2   1 
ATOM   3384  N  N     . SER A  1 472 ? -34.180 17.985   61.245  1.00 80.32  ? 472 SER A N     1 
ATOM   3385  C  CA    . SER A  1 472 ? -34.943 18.789   62.201  1.00 82.23  ? 472 SER A CA    1 
ATOM   3386  C  C     . SER A  1 472 ? -36.437 18.684   61.951  1.00 84.27  ? 472 SER A C     1 
ATOM   3387  O  O     . SER A  1 472 ? -37.235 18.801   62.889  1.00 85.92  ? 472 SER A O     1 
ATOM   3388  C  CB    . SER A  1 472 ? -34.501 20.257   62.199  1.00 83.05  ? 472 SER A CB    1 
ATOM   3389  O  OG    . SER A  1 472 ? -34.591 20.816   60.906  1.00 83.88  ? 472 SER A OG    1 
ATOM   3390  N  N     . TYR A  1 473 ? -36.812 18.462   60.692  1.00 84.44  ? 473 TYR A N     1 
ATOM   3391  C  CA    . TYR A  1 473 ? -38.202 18.191   60.371  1.00 86.31  ? 473 TYR A CA    1 
ATOM   3392  C  C     . TYR A  1 473 ? -38.606 16.890   61.050  1.00 85.68  ? 473 TYR A C     1 
ATOM   3393  O  O     . TYR A  1 473 ? -39.621 16.842   61.736  1.00 87.38  ? 473 TYR A O     1 
ATOM   3394  C  CB    . TYR A  1 473 ? -38.423 18.122   58.859  1.00 87.08  ? 473 TYR A CB    1 
ATOM   3395  C  CG    . TYR A  1 473 ? -39.720 17.448   58.471  1.00 89.60  ? 473 TYR A CG    1 
ATOM   3396  C  CD1   . TYR A  1 473 ? -40.947 18.098   58.622  1.00 92.59  ? 473 TYR A CD1   1 
ATOM   3397  C  CD2   . TYR A  1 473 ? -39.718 16.152   57.962  1.00 89.33  ? 473 TYR A CD2   1 
ATOM   3398  C  CE1   . TYR A  1 473 ? -42.130 17.471   58.278  1.00 94.79  ? 473 TYR A CE1   1 
ATOM   3399  C  CE2   . TYR A  1 473 ? -40.892 15.520   57.611  1.00 91.46  ? 473 TYR A CE2   1 
ATOM   3400  C  CZ    . TYR A  1 473 ? -42.091 16.179   57.771  1.00 94.43  ? 473 TYR A CZ    1 
ATOM   3401  O  OH    . TYR A  1 473 ? -43.249 15.533   57.417  1.00 97.25  ? 473 TYR A OH    1 
ATOM   3402  N  N     . LEU A  1 474 ? -37.789 15.852   60.874  1.00 83.50  ? 474 LEU A N     1 
ATOM   3403  C  CA    . LEU A  1 474 ? -38.007 14.555   61.523  1.00 83.04  ? 474 LEU A CA    1 
ATOM   3404  C  C     . LEU A  1 474 ? -38.009 14.681   63.038  1.00 83.42  ? 474 LEU A C     1 
ATOM   3405  O  O     . LEU A  1 474 ? -38.785 14.011   63.720  1.00 84.48  ? 474 LEU A O     1 
ATOM   3406  C  CB    . LEU A  1 474 ? -36.948 13.532   61.097  1.00 80.67  ? 474 LEU A CB    1 
ATOM   3407  C  CG    . LEU A  1 474 ? -36.979 12.953   59.682  1.00 79.86  ? 474 LEU A CG    1 
ATOM   3408  C  CD1   . LEU A  1 474 ? -35.803 12.046   59.501  1.00 77.33  ? 474 LEU A CD1   1 
ATOM   3409  C  CD2   . LEU A  1 474 ? -38.251 12.183   59.438  1.00 81.98  ? 474 LEU A CD2   1 
ATOM   3410  N  N     . LYS A  1 475 ? -37.134 15.546   63.551  1.00 82.84  ? 475 LYS A N     1 
ATOM   3411  C  CA    . LYS A  1 475 ? -37.039 15.820   64.991  1.00 83.70  ? 475 LYS A CA    1 
ATOM   3412  C  C     . LYS A  1 475 ? -38.320 16.430   65.574  1.00 86.51  ? 475 LYS A C     1 
ATOM   3413  O  O     . LYS A  1 475 ? -38.810 15.972   66.612  1.00 87.51  ? 475 LYS A O     1 
ATOM   3414  C  CB    . LYS A  1 475 ? -35.818 16.697   65.309  1.00 82.50  ? 475 LYS A CB    1 
ATOM   3415  C  CG    . LYS A  1 475 ? -34.560 15.891   65.555  1.00 80.57  ? 475 LYS A CG    1 
ATOM   3416  C  CD    . LYS A  1 475 ? -33.327 16.751   65.710  1.00 79.91  ? 475 LYS A CD    1 
ATOM   3417  C  CE    . LYS A  1 475 ? -32.088 15.861   65.787  1.00 78.31  ? 475 LYS A CE    1 
ATOM   3418  N  NZ    . LYS A  1 475 ? -31.045 16.419   66.706  1.00 78.77  ? 475 LYS A NZ    1 
ATOM   3419  N  N     . SER A  1 476 ? -38.847 17.453   64.897  1.00 87.91  ? 476 SER A N     1 
ATOM   3420  C  CA    . SER A  1 476 ? -40.107 18.092   65.285  1.00 91.01  ? 476 SER A CA    1 
ATOM   3421  C  C     . SER A  1 476 ? -41.296 17.160   65.096  1.00 92.47  ? 476 SER A C     1 
ATOM   3422  O  O     . SER A  1 476 ? -42.052 16.899   66.031  1.00 94.12  ? 476 SER A O     1 
ATOM   3423  C  CB    . SER A  1 476 ? -40.335 19.374   64.474  1.00 92.22  ? 476 SER A CB    1 
ATOM   3424  O  OG    . SER A  1 476 ? -39.447 20.399   64.877  1.00 92.11  ? 476 SER A OG    1 
ATOM   3425  N  N     . ASN A  1 477 ? -41.417 16.636   63.882  1.00 92.11  ? 477 ASN A N     1 
ATOM   3426  C  CA    . ASN A  1 477 ? -42.638 16.003   63.417  1.00 94.28  ? 477 ASN A CA    1 
ATOM   3427  C  C     . ASN A  1 477 ? -42.683 14.482   63.498  1.00 93.94  ? 477 ASN A C     1 
ATOM   3428  O  O     . ASN A  1 477 ? -43.704 13.920   63.870  1.00 96.20  ? 477 ASN A O     1 
ATOM   3429  C  CB    . ASN A  1 477 ? -42.936 16.487   62.002  1.00 94.84  ? 477 ASN A CB    1 
ATOM   3430  C  CG    . ASN A  1 477 ? -43.184 17.978   61.954  1.00 96.36  ? 477 ASN A CG    1 
ATOM   3431  O  OD1   . ASN A  1 477 ? -44.270 18.445   62.293  1.00 99.40  ? 477 ASN A OD1   1 
ATOM   3432  N  ND2   . ASN A  1 477 ? -42.173 18.737   61.551  1.00 94.92  ? 477 ASN A ND2   1 
ATOM   3433  N  N     . HIS A  1 478 ? -41.587 13.814   63.166  1.00 91.80  ? 478 HIS A N     1 
ATOM   3434  C  CA    . HIS A  1 478 ? -41.589 12.355   63.130  1.00 91.84  ? 478 HIS A CA    1 
ATOM   3435  C  C     . HIS A  1 478 ? -40.580 11.788   64.116  1.00 90.18  ? 478 HIS A C     1 
ATOM   3436  O  O     . HIS A  1 478 ? -39.726 10.955   63.772  1.00 88.56  ? 478 HIS A O     1 
ATOM   3437  C  CB    . HIS A  1 478 ? -41.329 11.869   61.710  1.00 91.12  ? 478 HIS A CB    1 
ATOM   3438  C  CG    . HIS A  1 478 ? -42.248 12.478   60.704  1.00 93.55  ? 478 HIS A CG    1 
ATOM   3439  N  ND1   . HIS A  1 478 ? -43.491 11.954   60.422  1.00 96.54  ? 478 HIS A ND1   1 
ATOM   3440  C  CD2   . HIS A  1 478 ? -42.120 13.586   59.937  1.00 93.81  ? 478 HIS A CD2   1 
ATOM   3441  C  CE1   . HIS A  1 478 ? -44.082 12.702   59.507  1.00 98.44  ? 478 HIS A CE1   1 
ATOM   3442  N  NE2   . HIS A  1 478 ? -43.271 13.698   59.195  1.00 96.92  ? 478 HIS A NE2   1 
ATOM   3443  N  N     . ASN A  1 479 ? -40.700 12.256   65.352  1.00 90.98  ? 479 ASN A N     1 
ATOM   3444  C  CA    . ASN A  1 479 ? -39.783 11.895   66.417  1.00 89.76  ? 479 ASN A CA    1 
ATOM   3445  C  C     . ASN A  1 479 ? -39.903 10.439   66.870  1.00 90.36  ? 479 ASN A C     1 
ATOM   3446  O  O     . ASN A  1 479 ? -38.897 9.817    67.210  1.00 88.57  ? 479 ASN A O     1 
ATOM   3447  C  CB    . ASN A  1 479 ? -39.992 12.830   67.603  1.00 91.09  ? 479 ASN A CB    1 
ATOM   3448  C  CG    . ASN A  1 479 ? -38.761 12.978   68.445  1.00 88.61  ? 479 ASN A CG    1 
ATOM   3449  O  OD1   . ASN A  1 479 ? -37.808 13.644   68.048  1.00 86.55  ? 479 ASN A OD1   1 
ATOM   3450  N  ND2   . ASN A  1 479 ? -38.773 12.371   69.624  1.00 88.41  ? 479 ASN A ND2   1 
ATOM   3451  N  N     . GLU A  1 480 ? -41.125 9.901    66.869  1.00 93.08  ? 480 GLU A N     1 
ATOM   3452  C  CA    . GLU A  1 480 ? -41.380 8.523    67.324  1.00 94.62  ? 480 GLU A CA    1 
ATOM   3453  C  C     . GLU A  1 480 ? -40.547 7.527    66.526  1.00 92.73  ? 480 GLU A C     1 
ATOM   3454  O  O     . GLU A  1 480 ? -40.083 6.518    67.063  1.00 92.67  ? 480 GLU A O     1 
ATOM   3455  C  CB    . GLU A  1 480 ? -42.864 8.120    67.213  1.00 97.93  ? 480 GLU A CB    1 
ATOM   3456  C  CG    . GLU A  1 480 ? -43.879 9.254    67.093  1.00 101.40 ? 480 GLU A CG    1 
ATOM   3457  C  CD    . GLU A  1 480 ? -43.821 9.954    65.738  1.00 102.42 ? 480 GLU A CD    1 
ATOM   3458  O  OE1   . GLU A  1 480 ? -43.775 9.264    64.693  1.00 102.48 ? 480 GLU A OE1   1 
ATOM   3459  O  OE2   . GLU A  1 480 ? -43.807 11.202   65.721  1.00 103.69 ? 480 GLU A OE2   1 
ATOM   3460  N  N     . LEU A  1 481 ? -40.367 7.824    65.240  1.00 91.56  ? 481 LEU A N     1 
ATOM   3461  C  CA    . LEU A  1 481 ? -39.647 6.948    64.326  1.00 90.00  ? 481 LEU A CA    1 
ATOM   3462  C  C     . LEU A  1 481 ? -38.189 6.867    64.720  1.00 87.14  ? 481 LEU A C     1 
ATOM   3463  O  O     . LEU A  1 481 ? -37.618 5.779    64.760  1.00 86.55  ? 481 LEU A O     1 
ATOM   3464  C  CB    . LEU A  1 481 ? -39.775 7.442    62.883  1.00 89.95  ? 481 LEU A CB    1 
ATOM   3465  C  CG    . LEU A  1 481 ? -41.160 7.887    62.375  1.00 93.61  ? 481 LEU A CG    1 
ATOM   3466  C  CD1   . LEU A  1 481 ? -41.100 8.108    60.858  1.00 94.40  ? 481 LEU A CD1   1 
ATOM   3467  C  CD2   . LEU A  1 481 ? -42.328 6.931    62.753  1.00 96.19  ? 481 LEU A CD2   1 
ATOM   3468  N  N     . LEU A  1 482 ? -37.606 8.026    65.030  1.00 85.57  ? 482 LEU A N     1 
ATOM   3469  C  CA    . LEU A  1 482 ? -36.195 8.120    65.410  1.00 82.91  ? 482 LEU A CA    1 
ATOM   3470  C  C     . LEU A  1 482 ? -35.922 7.390    66.717  1.00 83.23  ? 482 LEU A C     1 
ATOM   3471  O  O     . LEU A  1 482 ? -34.947 6.644    66.813  1.00 82.27  ? 482 LEU A O     1 
ATOM   3472  C  CB    . LEU A  1 482 ? -35.732 9.581    65.503  1.00 81.73  ? 482 LEU A CB    1 
ATOM   3473  C  CG    . LEU A  1 482 ? -35.843 10.489   64.270  1.00 80.89  ? 482 LEU A CG    1 
ATOM   3474  C  CD1   . LEU A  1 482 ? -35.422 11.899   64.635  1.00 80.50  ? 482 LEU A CD1   1 
ATOM   3475  C  CD2   . LEU A  1 482 ? -35.029 9.989    63.084  1.00 78.05  ? 482 LEU A CD2   1 
ATOM   3476  N  N     . THR A  1 483 ? -36.795 7.586    67.706  1.00 84.91  ? 483 THR A N     1 
ATOM   3477  C  CA    . THR A  1 483 ? -36.649 6.950    69.015  1.00 85.64  ? 483 THR A CA    1 
ATOM   3478  C  C     . THR A  1 483 ? -36.610 5.438    68.867  1.00 86.10  ? 483 THR A C     1 
ATOM   3479  O  O     . THR A  1 483 ? -35.813 4.766    69.525  1.00 85.80  ? 483 THR A O     1 
ATOM   3480  C  CB    . THR A  1 483 ? -37.795 7.324    69.977  1.00 88.22  ? 483 THR A CB    1 
ATOM   3481  O  OG1   . THR A  1 483 ? -38.086 8.719    69.868  1.00 88.43  ? 483 THR A OG1   1 
ATOM   3482  C  CG2   . THR A  1 483 ? -37.411 7.019    71.407  1.00 88.97  ? 483 THR A CG2   1 
ATOM   3483  N  N     . GLU A  1 484 ? -37.467 4.918    67.989  1.00 87.11  ? 484 GLU A N     1 
ATOM   3484  C  CA    . GLU A  1 484 ? -37.573 3.483    67.761  1.00 88.06  ? 484 GLU A CA    1 
ATOM   3485  C  C     . GLU A  1 484 ? -36.343 2.955    67.024  1.00 85.54  ? 484 GLU A C     1 
ATOM   3486  O  O     . GLU A  1 484 ? -35.865 1.859    67.316  1.00 85.85  ? 484 GLU A O     1 
ATOM   3487  C  CB    . GLU A  1 484 ? -38.860 3.150    67.009  1.00 90.20  ? 484 GLU A CB    1 
ATOM   3488  C  CG    . GLU A  1 484 ? -39.498 1.833    67.441  1.00 94.42  ? 484 GLU A CG    1 
ATOM   3489  C  CD    . GLU A  1 484 ? -40.834 1.554    66.746  1.00 99.29  ? 484 GLU A CD    1 
ATOM   3490  O  OE1   . GLU A  1 484 ? -41.053 2.086    65.634  1.00 99.62  ? 484 GLU A OE1   1 
ATOM   3491  O  OE2   . GLU A  1 484 ? -41.670 0.803    67.311  1.00 102.68 ? 484 GLU A OE2   1 
ATOM   3492  N  N     . ILE A  1 485 ? -35.820 3.747    66.091  1.00 83.30  ? 485 ILE A N     1 
ATOM   3493  C  CA    . ILE A  1 485 ? -34.569 3.400    65.424  1.00 81.07  ? 485 ILE A CA    1 
ATOM   3494  C  C     . ILE A  1 485 ? -33.463 3.254    66.464  1.00 80.13  ? 485 ILE A C     1 
ATOM   3495  O  O     . ILE A  1 485 ? -32.699 2.294    66.422  1.00 79.86  ? 485 ILE A O     1 
ATOM   3496  C  CB    . ILE A  1 485 ? -34.150 4.432    64.346  1.00 79.18  ? 485 ILE A CB    1 
ATOM   3497  C  CG1   . ILE A  1 485 ? -35.157 4.458    63.201  1.00 80.09  ? 485 ILE A CG1   1 
ATOM   3498  C  CG2   . ILE A  1 485 ? -32.801 4.065    63.766  1.00 77.40  ? 485 ILE A CG2   1 
ATOM   3499  C  CD1   . ILE A  1 485 ? -35.036 5.667    62.306  1.00 78.41  ? 485 ILE A CD1   1 
ATOM   3500  N  N     . ARG A  1 486 ? -33.403 4.191    67.406  1.00 79.99  ? 486 ARG A N     1 
ATOM   3501  C  CA    . ARG A  1 486 ? -32.318 4.220    68.389  1.00 79.38  ? 486 ARG A CA    1 
ATOM   3502  C  C     . ARG A  1 486 ? -32.399 3.106    69.430  1.00 81.15  ? 486 ARG A C     1 
ATOM   3503  O  O     . ARG A  1 486 ? -31.373 2.561    69.839  1.00 80.64  ? 486 ARG A O     1 
ATOM   3504  C  CB    . ARG A  1 486 ? -32.239 5.581    69.084  1.00 78.97  ? 486 ARG A CB    1 
ATOM   3505  C  CG    . ARG A  1 486 ? -31.054 5.704    70.025  1.00 78.60  ? 486 ARG A CG    1 
ATOM   3506  C  CD    . ARG A  1 486 ? -31.050 7.007    70.775  1.00 79.96  ? 486 ARG A CD    1 
ATOM   3507  N  NE    . ARG A  1 486 ? -32.196 7.123    71.671  1.00 83.42  ? 486 ARG A NE    1 
ATOM   3508  C  CZ    . ARG A  1 486 ? -33.222 7.949    71.481  1.00 85.28  ? 486 ARG A CZ    1 
ATOM   3509  N  NH1   . ARG A  1 486 ? -33.254 8.753    70.420  1.00 84.46  ? 486 ARG A NH1   1 
ATOM   3510  N  NH2   . ARG A  1 486 ? -34.221 7.972    72.359  1.00 87.88  ? 486 ARG A NH2   1 
ATOM   3511  N  N     . GLU A  1 487 ? -33.612 2.764    69.854  1.00 83.52  ? 487 GLU A N     1 
ATOM   3512  C  CA    . GLU A  1 487 ? -33.783 1.808    70.955  1.00 85.72  ? 487 GLU A CA    1 
ATOM   3513  C  C     . GLU A  1 487 ? -33.801 0.361    70.504  1.00 86.31  ? 487 GLU A C     1 
ATOM   3514  O  O     . GLU A  1 487 ? -33.735 -0.557   71.327  1.00 87.97  ? 487 GLU A O     1 
ATOM   3515  C  CB    . GLU A  1 487 ? -35.037 2.129    71.766  1.00 88.15  ? 487 GLU A CB    1 
ATOM   3516  C  CG    . GLU A  1 487 ? -34.836 3.273    72.728  1.00 89.28  ? 487 GLU A CG    1 
ATOM   3517  C  CD    . GLU A  1 487 ? -36.130 3.962    73.095  1.00 93.33  ? 487 GLU A CD    1 
ATOM   3518  O  OE1   . GLU A  1 487 ? -37.212 3.346    72.934  1.00 95.70  ? 487 GLU A OE1   1 
ATOM   3519  O  OE2   . GLU A  1 487 ? -36.059 5.125    73.554  1.00 94.28  ? 487 GLU A OE2   1 
ATOM   3520  N  N     . LYS A  1 488 ? -33.887 0.160    69.197  1.00 85.17  ? 488 LYS A N     1 
ATOM   3521  C  CA    . LYS A  1 488 ? -33.976 -1.182   68.664  1.00 86.27  ? 488 LYS A CA    1 
ATOM   3522  C  C     . LYS A  1 488 ? -32.911 -1.468   67.613  1.00 84.44  ? 488 LYS A C     1 
ATOM   3523  O  O     . LYS A  1 488 ? -32.488 -2.606   67.458  1.00 85.32  ? 488 LYS A O     1 
ATOM   3524  C  CB    . LYS A  1 488 ? -35.402 -1.473   68.175  1.00 88.39  ? 488 LYS A CB    1 
ATOM   3525  C  CG    . LYS A  1 488 ? -36.377 -1.711   69.343  1.00 90.84  ? 488 LYS A CG    1 
ATOM   3526  C  CD    . LYS A  1 488 ? -37.833 -1.747   68.945  1.00 91.76  ? 488 LYS A CD    1 
ATOM   3527  C  CE    . LYS A  1 488 ? -38.676 -2.031   70.174  1.00 94.81  ? 488 LYS A CE    1 
ATOM   3528  N  NZ    . LYS A  1 488 ? -40.083 -2.406   69.839  1.00 97.76  ? 488 LYS A NZ    1 
ATOM   3529  N  N     . GLY A  1 489 ? -32.456 -0.436   66.914  1.00 82.28  ? 489 GLY A N     1 
ATOM   3530  C  CA    . GLY A  1 489 ? -31.342 -0.583   65.979  1.00 80.73  ? 489 GLY A CA    1 
ATOM   3531  C  C     . GLY A  1 489 ? -31.662 -1.569   64.884  1.00 81.92  ? 489 GLY A C     1 
ATOM   3532  O  O     . GLY A  1 489 ? -30.769 -2.172   64.298  1.00 81.49  ? 489 GLY A O     1 
ATOM   3533  N  N     . GLU A  1 490 ? -32.958 -1.725   64.636  1.00 83.89  ? 490 GLU A N     1 
ATOM   3534  C  CA    . GLU A  1 490 ? -33.515 -2.593   63.614  1.00 85.81  ? 490 GLU A CA    1 
ATOM   3535  C  C     . GLU A  1 490 ? -34.580 -1.775   62.938  1.00 86.22  ? 490 GLU A C     1 
ATOM   3536  O  O     . GLU A  1 490 ? -35.053 -0.794   63.505  1.00 86.16  ? 490 GLU A O     1 
ATOM   3537  C  CB    . GLU A  1 490 ? -34.230 -3.773   64.262  1.00 88.71  ? 490 GLU A CB    1 
ATOM   3538  C  CG    . GLU A  1 490 ? -33.412 -5.028   64.485  1.00 90.30  ? 490 GLU A CG    1 
ATOM   3539  C  CD    . GLU A  1 490 ? -34.264 -6.172   65.019  1.00 94.30  ? 490 GLU A CD    1 
ATOM   3540  O  OE1   . GLU A  1 490 ? -35.148 -5.919   65.873  1.00 95.11  ? 490 GLU A OE1   1 
ATOM   3541  O  OE2   . GLU A  1 490 ? -34.053 -7.325   64.579  1.00 96.70  ? 490 GLU A OE2   1 
ATOM   3542  N  N     . LEU A  1 491 ? -34.995 -2.180   61.747  1.00 87.32  ? 491 LEU A N     1 
ATOM   3543  C  CA    . LEU A  1 491 ? -36.148 -1.544   61.132  1.00 88.33  ? 491 LEU A CA    1 
ATOM   3544  C  C     . LEU A  1 491 ? -37.288 -2.536   60.876  1.00 91.74  ? 491 LEU A C     1 
ATOM   3545  O  O     . LEU A  1 491 ? -37.130 -3.504   60.131  1.00 92.94  ? 491 LEU A O     1 
ATOM   3546  C  CB    . LEU A  1 491 ? -35.742 -0.791   59.861  1.00 86.84  ? 491 LEU A CB    1 
ATOM   3547  C  CG    . LEU A  1 491 ? -34.670 0.299    59.992  1.00 83.62  ? 491 LEU A CG    1 
ATOM   3548  C  CD1   . LEU A  1 491 ? -34.319 0.820    58.619  1.00 82.95  ? 491 LEU A CD1   1 
ATOM   3549  C  CD2   . LEU A  1 491 ? -35.104 1.446    60.903  1.00 82.45  ? 491 LEU A CD2   1 
ATOM   3550  N  N     . SER A  1 492 ? -38.429 -2.294   61.519  1.00 93.63  ? 492 SER A N     1 
ATOM   3551  C  CA    . SER A  1 492 ? -39.655 -3.069   61.274  1.00 97.32  ? 492 SER A CA    1 
ATOM   3552  C  C     . SER A  1 492 ? -40.253 -2.701   59.916  1.00 97.99  ? 492 SER A C     1 
ATOM   3553  O  O     . SER A  1 492 ? -39.955 -1.638   59.367  1.00 95.96  ? 492 SER A O     1 
ATOM   3554  C  CB    . SER A  1 492 ? -40.712 -2.811   62.362  1.00 99.18  ? 492 SER A CB    1 
ATOM   3555  O  OG    . SER A  1 492 ? -40.163 -2.199   63.519  1.00 98.59  ? 492 SER A OG    1 
ATOM   3556  N  N     . LYS A  1 493 ? -41.108 -3.575   59.389  1.00 101.12 ? 493 LYS A N     1 
ATOM   3557  C  CA    . LYS A  1 493 ? -41.809 -3.302   58.132  1.00 102.73 ? 493 LYS A CA    1 
ATOM   3558  C  C     . LYS A  1 493 ? -42.743 -2.091   58.250  1.00 102.99 ? 493 LYS A C     1 
ATOM   3559  O  O     . LYS A  1 493 ? -42.920 -1.335   57.283  1.00 102.85 ? 493 LYS A O     1 
ATOM   3560  C  CB    . LYS A  1 493 ? -42.559 -4.539   57.641  1.00 106.45 ? 493 LYS A CB    1 
ATOM   3561  C  CG    . LYS A  1 493 ? -41.627 -5.657   57.239  1.00 107.02 ? 493 LYS A CG    1 
ATOM   3562  C  CD    . LYS A  1 493 ? -42.004 -6.237   55.894  1.00 110.80 ? 493 LYS A CD    1 
ATOM   3563  C  CE    . LYS A  1 493 ? -40.789 -6.868   55.226  1.00 110.67 ? 493 LYS A CE    1 
ATOM   3564  N  NZ    . LYS A  1 493 ? -41.182 -7.765   54.098  1.00 114.73 ? 493 LYS A NZ    1 
ATOM   3565  N  N     . GLU A  1 494 ? -43.322 -1.920   59.441  1.00 103.49 ? 494 GLU A N     1 
ATOM   3566  C  CA    . GLU A  1 494 ? -44.073 -0.719   59.804  1.00 103.34 ? 494 GLU A CA    1 
ATOM   3567  C  C     . GLU A  1 494 ? -43.107 0.450    59.949  1.00 99.56  ? 494 GLU A C     1 
ATOM   3568  O  O     . GLU A  1 494 ? -43.356 1.535    59.423  1.00 99.13  ? 494 GLU A O     1 
ATOM   3569  C  CB    . GLU A  1 494 ? -44.835 -0.920   61.120  1.00 105.24 ? 494 GLU A CB    1 
ATOM   3570  C  CG    . GLU A  1 494 ? -45.828 -2.085   61.129  1.00 109.73 ? 494 GLU A CG    1 
ATOM   3571  C  CD    . GLU A  1 494 ? -45.167 -3.450   61.323  1.00 110.63 ? 494 GLU A CD    1 
ATOM   3572  O  OE1   . GLU A  1 494 ? -43.953 -3.501   61.627  1.00 108.36 ? 494 GLU A OE1   1 
ATOM   3573  O  OE2   . GLU A  1 494 ? -45.868 -4.476   61.172  1.00 113.97 ? 494 GLU A OE2   1 
ATOM   3574  N  N     . LEU A  1 495 ? -41.997 0.214    60.649  1.00 97.04  ? 495 LEU A N     1 
ATOM   3575  C  CA    . LEU A  1 495 ? -40.982 1.242    60.873  1.00 93.56  ? 495 LEU A CA    1 
ATOM   3576  C  C     . LEU A  1 495 ? -40.394 1.716    59.544  1.00 92.02  ? 495 LEU A C     1 
ATOM   3577  O  O     . LEU A  1 495 ? -40.082 2.896    59.381  1.00 90.50  ? 495 LEU A O     1 
ATOM   3578  C  CB    . LEU A  1 495 ? -39.878 0.717    61.795  1.00 91.78  ? 495 LEU A CB    1 
ATOM   3579  C  CG    . LEU A  1 495 ? -39.522 1.490    63.072  1.00 90.25  ? 495 LEU A CG    1 
ATOM   3580  C  CD1   . LEU A  1 495 ? -38.511 0.694    63.898  1.00 89.11  ? 495 LEU A CD1   1 
ATOM   3581  C  CD2   . LEU A  1 495 ? -39.009 2.901    62.794  1.00 87.82  ? 495 LEU A CD2   1 
ATOM   3582  N  N     . LEU A  1 496 ? -40.261 0.789    58.597  1.00 92.71  ? 496 LEU A N     1 
ATOM   3583  C  CA    . LEU A  1 496 ? -39.860 1.120    57.236  1.00 92.09  ? 496 LEU A CA    1 
ATOM   3584  C  C     . LEU A  1 496 ? -40.904 1.986    56.520  1.00 93.69  ? 496 LEU A C     1 
ATOM   3585  O  O     . LEU A  1 496 ? -40.553 3.003    55.907  1.00 92.46  ? 496 LEU A O     1 
ATOM   3586  C  CB    . LEU A  1 496 ? -39.586 -0.154   56.432  1.00 93.36  ? 496 LEU A CB    1 
ATOM   3587  C  CG    . LEU A  1 496 ? -38.141 -0.656   56.373  1.00 91.46  ? 496 LEU A CG    1 
ATOM   3588  C  CD1   . LEU A  1 496 ? -38.092 -2.153   56.088  1.00 93.33  ? 496 LEU A CD1   1 
ATOM   3589  C  CD2   . LEU A  1 496 ? -37.346 0.117    55.326  1.00 90.08  ? 496 LEU A CD2   1 
ATOM   3590  N  N     . ALA A  1 497 ? -42.176 1.576    56.604  1.00 96.56  ? 497 ALA A N     1 
ATOM   3591  C  CA    . ALA A  1 497 ? -43.298 2.279    55.959  1.00 98.49  ? 497 ALA A CA    1 
ATOM   3592  C  C     . ALA A  1 497 ? -43.432 3.719    56.455  1.00 97.22  ? 497 ALA A C     1 
ATOM   3593  O  O     . ALA A  1 497 ? -43.714 4.633    55.675  1.00 97.53  ? 497 ALA A O     1 
ATOM   3594  C  CB    . ALA A  1 497 ? -44.596 1.519    56.177  1.00 101.98 ? 497 ALA A CB    1 
ATOM   3595  N  N     . SER A  1 498 ? -43.223 3.898    57.758  1.00 95.89  ? 498 SER A N     1 
ATOM   3596  C  CA    . SER A  1 498 ? -43.160 5.212    58.389  1.00 94.71  ? 498 SER A CA    1 
ATOM   3597  C  C     . SER A  1 498 ? -42.005 6.060    57.841  1.00 92.04  ? 498 SER A C     1 
ATOM   3598  O  O     . SER A  1 498 ? -42.138 7.277    57.681  1.00 91.87  ? 498 SER A O     1 
ATOM   3599  C  CB    . SER A  1 498 ? -43.015 5.059    59.906  1.00 93.97  ? 498 SER A CB    1 
ATOM   3600  O  OG    . SER A  1 498 ? -44.267 5.130    60.562  1.00 96.65  ? 498 SER A OG    1 
ATOM   3601  N  N     . LEU A  1 499 ? -40.875 5.413    57.559  1.00 90.14  ? 499 LEU A N     1 
ATOM   3602  C  CA    . LEU A  1 499 ? -39.709 6.106    57.028  1.00 87.69  ? 499 LEU A CA    1 
ATOM   3603  C  C     . LEU A  1 499 ? -39.922 6.531    55.585  1.00 88.79  ? 499 LEU A C     1 
ATOM   3604  O  O     . LEU A  1 499 ? -39.583 7.652    55.215  1.00 87.93  ? 499 LEU A O     1 
ATOM   3605  C  CB    . LEU A  1 499 ? -38.463 5.237    57.146  1.00 85.86  ? 499 LEU A CB    1 
ATOM   3606  C  CG    . LEU A  1 499 ? -37.155 5.991    57.371  1.00 83.10  ? 499 LEU A CG    1 
ATOM   3607  C  CD1   . LEU A  1 499 ? -37.287 6.946    58.554  1.00 82.36  ? 499 LEU A CD1   1 
ATOM   3608  C  CD2   . LEU A  1 499 ? -36.021 5.001    57.595  1.00 81.69  ? 499 LEU A CD2   1 
ATOM   3609  N  N     . LYS A  1 500 ? -40.492 5.634    54.778  1.00 91.05  ? 500 LYS A N     1 
ATOM   3610  C  CA    . LYS A  1 500 ? -40.852 5.952    53.397  1.00 92.85  ? 500 LYS A CA    1 
ATOM   3611  C  C     . LYS A  1 500 ? -41.771 7.165    53.365  1.00 94.18  ? 500 LYS A C     1 
ATOM   3612  O  O     . LYS A  1 500 ? -41.473 8.162    52.698  1.00 93.94  ? 500 LYS A O     1 
ATOM   3613  C  CB    . LYS A  1 500 ? -41.529 4.760    52.719  1.00 95.58  ? 500 LYS A CB    1 
ATOM   3614  C  CG    . LYS A  1 500 ? -41.476 4.809    51.190  1.00 97.88  ? 500 LYS A CG    1 
ATOM   3615  C  CD    . LYS A  1 500 ? -42.312 3.689    50.555  1.00 102.22 ? 500 LYS A CD    1 
ATOM   3616  C  CE    . LYS A  1 500 ? -42.103 3.594    49.041  1.00 103.91 ? 500 LYS A CE    1 
ATOM   3617  N  NZ    . LYS A  1 500 ? -42.663 4.761    48.290  1.00 105.38 ? 500 LYS A NZ    1 
ATOM   3618  N  N     . SER A  1 501 ? -42.870 7.074    54.115  1.00 95.78  ? 501 SER A N     1 
ATOM   3619  C  CA    . SER A  1 501 ? -43.855 8.149    54.232  1.00 97.37  ? 501 SER A CA    1 
ATOM   3620  C  C     . SER A  1 501 ? -43.215 9.498    54.594  1.00 95.19  ? 501 SER A C     1 
ATOM   3621  O  O     . SER A  1 501 ? -43.299 10.458   53.824  1.00 95.74  ? 501 SER A O     1 
ATOM   3622  C  CB    . SER A  1 501 ? -44.934 7.767    55.255  1.00 99.19  ? 501 SER A CB    1 
ATOM   3623  O  OG    . SER A  1 501 ? -46.032 8.662    55.208  1.00 101.80 ? 501 SER A OG    1 
ATOM   3624  N  N     . ALA A  1 502 ? -42.558 9.549    55.752  1.00 92.78  ? 502 ALA A N     1 
ATOM   3625  C  CA    . ALA A  1 502 ? -41.983 10.787   56.276  1.00 91.04  ? 502 ALA A CA    1 
ATOM   3626  C  C     . ALA A  1 502 ? -40.954 11.410   55.332  1.00 89.61  ? 502 ALA A C     1 
ATOM   3627  O  O     . ALA A  1 502 ? -40.818 12.638   55.286  1.00 89.66  ? 502 ALA A O     1 
ATOM   3628  C  CB    . ALA A  1 502 ? -41.381 10.554   57.658  1.00 88.96  ? 502 ALA A CB    1 
ATOM   3629  N  N     . THR A  1 503 ? -40.240 10.567   54.583  1.00 88.58  ? 503 THR A N     1 
ATOM   3630  C  CA    . THR A  1 503 ? -39.299 11.045   53.575  1.00 87.57  ? 503 THR A CA    1 
ATOM   3631  C  C     . THR A  1 503 ? -40.061 11.784   52.483  1.00 90.22  ? 503 THR A C     1 
ATOM   3632  O  O     . THR A  1 503 ? -39.824 12.972   52.248  1.00 89.94  ? 503 THR A O     1 
ATOM   3633  C  CB    . THR A  1 503 ? -38.499 9.895    52.943  1.00 86.68  ? 503 THR A CB    1 
ATOM   3634  O  OG1   . THR A  1 503 ? -37.926 9.087    53.972  1.00 84.99  ? 503 THR A OG1   1 
ATOM   3635  C  CG2   . THR A  1 503 ? -37.381 10.436   52.079  1.00 85.52  ? 503 THR A CG2   1 
ATOM   3636  N  N     . GLU A  1 504 ? -40.992 11.069   51.847  1.00 92.98  ? 504 GLU A N     1 
ATOM   3637  C  CA    . GLU A  1 504 ? -41.824 11.592   50.755  1.00 96.27  ? 504 GLU A CA    1 
ATOM   3638  C  C     . GLU A  1 504 ? -42.667 12.794   51.168  1.00 97.68  ? 504 GLU A C     1 
ATOM   3639  O  O     . GLU A  1 504 ? -42.837 13.736   50.390  1.00 99.11  ? 504 GLU A O     1 
ATOM   3640  C  CB    . GLU A  1 504 ? -42.715 10.483   50.191  1.00 98.85  ? 504 GLU A CB    1 
ATOM   3641  C  CG    . GLU A  1 504 ? -41.939 9.437    49.392  1.00 99.37  ? 504 GLU A CG    1 
ATOM   3642  C  CD    . GLU A  1 504 ? -42.682 8.111    49.217  1.00 102.67 ? 504 GLU A CD    1 
ATOM   3643  O  OE1   . GLU A  1 504 ? -43.319 7.637    50.190  1.00 103.17 ? 504 GLU A OE1   1 
ATOM   3644  O  OE2   . GLU A  1 504 ? -42.605 7.532    48.104  1.00 104.36 ? 504 GLU A OE2   1 
ATOM   3645  N  N     . SER A  1 505 ? -43.178 12.755   52.396  1.00 97.56  ? 505 SER A N     1 
ATOM   3646  C  CA    . SER A  1 505 ? -43.901 13.882   52.969  1.00 99.17  ? 505 SER A CA    1 
ATOM   3647  C  C     . SER A  1 505 ? -43.013 15.123   52.954  1.00 97.83  ? 505 SER A C     1 
ATOM   3648  O  O     . SER A  1 505 ? -43.431 16.174   52.475  1.00 99.62  ? 505 SER A O     1 
ATOM   3649  C  CB    . SER A  1 505 ? -44.371 13.559   54.392  1.00 98.95  ? 505 SER A CB    1 
ATOM   3650  O  OG    . SER A  1 505 ? -45.638 14.147   54.670  1.00 102.13 ? 505 SER A OG    1 
ATOM   3651  N  N     . PHE A  1 506 ? -41.781 14.986   53.449  1.00 95.15  ? 506 PHE A N     1 
ATOM   3652  C  CA    . PHE A  1 506 ? -40.808 16.081   53.424  1.00 94.04  ? 506 PHE A CA    1 
ATOM   3653  C  C     . PHE A  1 506 ? -40.363 16.442   52.005  1.00 94.78  ? 506 PHE A C     1 
ATOM   3654  O  O     . PHE A  1 506 ? -40.489 17.595   51.595  1.00 95.95  ? 506 PHE A O     1 
ATOM   3655  C  CB    . PHE A  1 506 ? -39.583 15.773   54.293  1.00 90.76  ? 506 PHE A CB    1 
ATOM   3656  C  CG    . PHE A  1 506 ? -38.540 16.873   54.279  1.00 90.41  ? 506 PHE A CG    1 
ATOM   3657  C  CD1   . PHE A  1 506 ? -38.604 17.930   55.196  1.00 90.94  ? 506 PHE A CD1   1 
ATOM   3658  C  CD2   . PHE A  1 506 ? -37.501 16.866   53.337  1.00 89.49  ? 506 PHE A CD2   1 
ATOM   3659  C  CE1   . PHE A  1 506 ? -37.645 18.951   55.184  1.00 89.69  ? 506 PHE A CE1   1 
ATOM   3660  C  CE2   . PHE A  1 506 ? -36.546 17.888   53.314  1.00 88.20  ? 506 PHE A CE2   1 
ATOM   3661  C  CZ    . PHE A  1 506 ? -36.619 18.927   54.238  1.00 88.54  ? 506 PHE A CZ    1 
ATOM   3662  N  N     . VAL A  1 507 ? -39.836 15.457   51.273  1.00 94.31  ? 507 VAL A N     1 
ATOM   3663  C  CA    . VAL A  1 507 ? -39.324 15.666   49.911  1.00 95.41  ? 507 VAL A CA    1 
ATOM   3664  C  C     . VAL A  1 507 ? -40.240 16.578   49.087  1.00 98.98  ? 507 VAL A C     1 
ATOM   3665  O  O     . VAL A  1 507 ? -39.767 17.545   48.477  1.00 99.74  ? 507 VAL A O     1 
ATOM   3666  C  CB    . VAL A  1 507 ? -39.071 14.324   49.168  1.00 95.33  ? 507 VAL A CB    1 
ATOM   3667  C  CG1   . VAL A  1 507 ? -38.839 14.556   47.681  1.00 97.16  ? 507 VAL A CG1   1 
ATOM   3668  C  CG2   . VAL A  1 507 ? -37.880 13.595   49.773  1.00 92.12  ? 507 VAL A CG2   1 
ATOM   3669  N  N     . ALA A  1 508 ? -41.541 16.275   49.098  1.00 101.48 ? 508 ALA A N     1 
ATOM   3670  C  CA    . ALA A  1 508 ? -42.555 17.056   48.384  1.00 105.13 ? 508 ALA A CA    1 
ATOM   3671  C  C     . ALA A  1 508 ? -42.684 18.493   48.896  1.00 105.95 ? 508 ALA A C     1 
ATOM   3672  O  O     . ALA A  1 508 ? -42.901 19.414   48.117  1.00 108.37 ? 508 ALA A O     1 
ATOM   3673  C  CB    . ALA A  1 508 ? -43.892 16.356   48.454  1.00 107.40 ? 508 ALA A CB    1 
ATOM   3674  N  N     . THR A  1 509 ? -42.531 18.681   50.203  1.00 104.42 ? 509 THR A N     1 
ATOM   3675  C  CA    . THR A  1 509 ? -42.689 19.992   50.838  1.00 105.42 ? 509 THR A CA    1 
ATOM   3676  C  C     . THR A  1 509 ? -41.451 20.903   50.650  1.00 104.32 ? 509 THR A C     1 
ATOM   3677  O  O     . THR A  1 509 ? -41.411 22.035   51.146  1.00 105.03 ? 509 THR A O     1 
ATOM   3678  C  CB    . THR A  1 509 ? -43.080 19.816   52.350  1.00 104.44 ? 509 THR A CB    1 
ATOM   3679  O  OG1   . THR A  1 509 ? -44.002 20.834   52.745  1.00 106.73 ? 509 THR A OG1   1 
ATOM   3680  C  CG2   . THR A  1 509 ? -41.858 19.796   53.295  1.00 100.98 ? 509 THR A CG2   1 
ATOM   3681  N  N     . PHE A  1 510 ? -40.461 20.413   49.907  1.00 103.07 ? 510 PHE A N     1 
ATOM   3682  C  CA    . PHE A  1 510 ? -39.164 21.073   49.795  1.00 101.81 ? 510 PHE A CA    1 
ATOM   3683  C  C     . PHE A  1 510 ? -38.487 20.672   48.492  1.00 102.04 ? 510 PHE A C     1 
ATOM   3684  O  O     . PHE A  1 510 ? -37.784 21.474   47.877  1.00 102.70 ? 510 PHE A O     1 
ATOM   3685  C  CB    . PHE A  1 510 ? -38.316 20.713   51.028  1.00 98.69  ? 510 PHE A CB    1 
ATOM   3686  C  CG    . PHE A  1 510 ? -36.821 20.641   50.783  1.00 97.10  ? 510 PHE A CG    1 
ATOM   3687  C  CD1   . PHE A  1 510 ? -35.972 21.614   51.309  1.00 96.99  ? 510 PHE A CD1   1 
ATOM   3688  C  CD2   . PHE A  1 510 ? -36.258 19.574   50.086  1.00 96.29  ? 510 PHE A CD2   1 
ATOM   3689  C  CE1   . PHE A  1 510 ? -34.589 21.547   51.114  1.00 95.18  ? 510 PHE A CE1   1 
ATOM   3690  C  CE2   . PHE A  1 510 ? -34.878 19.505   49.881  1.00 95.23  ? 510 PHE A CE2   1 
ATOM   3691  C  CZ    . PHE A  1 510 ? -34.041 20.491   50.400  1.00 94.23  ? 510 PHE A CZ    1 
ATOM   3692  N  N     . ALA B  1 25  ? 44.213  -37.633  70.195  1.00 119.81 ? 25  ALA B N     1 
ATOM   3693  C  CA    . ALA B  1 25  ? 44.752  -36.321  69.724  1.00 117.57 ? 25  ALA B CA    1 
ATOM   3694  C  C     . ALA B  1 25  ? 46.048  -36.453  68.902  1.00 117.74 ? 25  ALA B C     1 
ATOM   3695  O  O     . ALA B  1 25  ? 47.139  -36.648  69.447  1.00 120.59 ? 25  ALA B O     1 
ATOM   3696  C  CB    . ALA B  1 25  ? 44.942  -35.360  70.906  1.00 119.10 ? 25  ALA B CB    1 
ATOM   3697  N  N     . ASN B  1 26  ? 45.896  -36.366  67.581  1.00 114.77 ? 26  ASN B N     1 
ATOM   3698  C  CA    . ASN B  1 26  ? 47.013  -36.237  66.648  1.00 114.10 ? 26  ASN B CA    1 
ATOM   3699  C  C     . ASN B  1 26  ? 46.735  -35.061  65.701  1.00 110.22 ? 26  ASN B C     1 
ATOM   3700  O  O     . ASN B  1 26  ? 46.282  -35.256  64.569  1.00 108.01 ? 26  ASN B O     1 
ATOM   3701  C  CB    . ASN B  1 26  ? 47.233  -37.540  65.866  1.00 115.00 ? 26  ASN B CB    1 
ATOM   3702  C  CG    . ASN B  1 26  ? 48.455  -37.480  64.961  1.00 115.54 ? 26  ASN B CG    1 
ATOM   3703  O  OD1   . ASN B  1 26  ? 48.346  -37.227  63.760  1.00 113.91 ? 26  ASN B OD1   1 
ATOM   3704  N  ND2   . ASN B  1 26  ? 49.627  -37.697  65.539  1.00 119.56 ? 26  ASN B ND2   1 
ATOM   3705  N  N     . LEU B  1 27  ? 47.008  -33.846  66.184  1.00 109.58 ? 27  LEU B N     1 
ATOM   3706  C  CA    . LEU B  1 27  ? 46.716  -32.587  65.477  1.00 106.20 ? 27  LEU B CA    1 
ATOM   3707  C  C     . LEU B  1 27  ? 47.228  -32.499  64.039  1.00 104.23 ? 27  LEU B C     1 
ATOM   3708  O  O     . LEU B  1 27  ? 46.976  -31.511  63.349  1.00 102.18 ? 27  LEU B O     1 
ATOM   3709  C  CB    . LEU B  1 27  ? 47.261  -31.390  66.261  1.00 107.27 ? 27  LEU B CB    1 
ATOM   3710  C  CG    . LEU B  1 27  ? 46.774  -31.112  67.682  1.00 108.99 ? 27  LEU B CG    1 
ATOM   3711  C  CD1   . LEU B  1 27  ? 47.283  -29.744  68.124  1.00 109.97 ? 27  LEU B CD1   1 
ATOM   3712  C  CD2   . LEU B  1 27  ? 45.256  -31.197  67.798  1.00 106.38 ? 27  LEU B CD2   1 
ATOM   3713  N  N     . ASN B  1 28  ? 47.953  -33.520  63.597  1.00 105.05 ? 28  ASN B N     1 
ATOM   3714  C  CA    . ASN B  1 28  ? 48.428  -33.594  62.223  1.00 103.37 ? 28  ASN B CA    1 
ATOM   3715  C  C     . ASN B  1 28  ? 47.408  -34.284  61.315  1.00 101.45 ? 28  ASN B C     1 
ATOM   3716  O  O     . ASN B  1 28  ? 47.179  -33.844  60.182  1.00 99.46  ? 28  ASN B O     1 
ATOM   3717  C  CB    . ASN B  1 28  ? 49.784  -34.301  62.171  1.00 105.77 ? 28  ASN B CB    1 
ATOM   3718  C  CG    . ASN B  1 28  ? 50.821  -33.630  63.059  1.00 108.01 ? 28  ASN B CG    1 
ATOM   3719  O  OD1   . ASN B  1 28  ? 51.385  -32.595  62.702  1.00 107.30 ? 28  ASN B OD1   1 
ATOM   3720  N  ND2   . ASN B  1 28  ? 51.071  -34.216  64.226  1.00 111.18 ? 28  ASN B ND2   1 
ATOM   3721  N  N     . GLU B  1 29  ? 46.788  -35.348  61.829  1.00 102.16 ? 29  GLU B N     1 
ATOM   3722  C  CA    . GLU B  1 29  ? 45.807  -36.136  61.076  1.00 100.83 ? 29  GLU B CA    1 
ATOM   3723  C  C     . GLU B  1 29  ? 44.403  -35.988  61.637  1.00 99.51  ? 29  GLU B C     1 
ATOM   3724  O  O     . GLU B  1 29  ? 43.423  -36.355  60.989  1.00 98.42  ? 29  GLU B O     1 
ATOM   3725  C  CB    . GLU B  1 29  ? 46.205  -37.614  61.051  1.00 103.48 ? 29  GLU B CB    1 
ATOM   3726  C  CG    . GLU B  1 29  ? 47.571  -37.887  60.418  1.00 104.78 ? 29  GLU B CG    1 
ATOM   3727  C  CD    . GLU B  1 29  ? 47.755  -37.179  59.086  1.00 102.50 ? 29  GLU B CD    1 
ATOM   3728  O  OE1   . GLU B  1 29  ? 46.916  -37.375  58.175  1.00 101.18 ? 29  GLU B OE1   1 
ATOM   3729  O  OE2   . GLU B  1 29  ? 48.742  -36.424  58.956  1.00 102.35 ? 29  GLU B OE2   1 
ATOM   3730  N  N     . THR B  1 30  ? 44.325  -35.440  62.844  1.00 99.77  ? 30  THR B N     1 
ATOM   3731  C  CA    . THR B  1 30  ? 43.067  -35.249  63.562  1.00 98.76  ? 30  THR B CA    1 
ATOM   3732  C  C     . THR B  1 30  ? 42.794  -33.763  63.810  1.00 96.70  ? 30  THR B C     1 
ATOM   3733  O  O     . THR B  1 30  ? 43.713  -32.938  63.808  1.00 96.58  ? 30  THR B O     1 
ATOM   3734  C  CB    . THR B  1 30  ? 43.062  -36.079  64.887  1.00 101.65 ? 30  THR B CB    1 
ATOM   3735  O  OG1   . THR B  1 30  ? 42.417  -37.334  64.652  1.00 102.39 ? 30  THR B OG1   1 
ATOM   3736  C  CG2   . THR B  1 30  ? 42.345  -35.361  66.033  1.00 101.52 ? 30  THR B CG2   1 
ATOM   3737  N  N     . GLY B  1 31  ? 41.518  -33.433  63.988  1.00 95.07  ? 31  GLY B N     1 
ATOM   3738  C  CA    . GLY B  1 31  ? 41.111  -32.098  64.403  1.00 93.31  ? 31  GLY B CA    1 
ATOM   3739  C  C     . GLY B  1 31  ? 40.144  -32.119  65.573  1.00 93.53  ? 31  GLY B C     1 
ATOM   3740  O  O     . GLY B  1 31  ? 39.556  -33.157  65.896  1.00 94.37  ? 31  GLY B O     1 
ATOM   3741  N  N     . ARG B  1 32  ? 40.001  -30.966  66.220  1.00 92.99  ? 32  ARG B N     1 
ATOM   3742  C  CA    . ARG B  1 32  ? 38.947  -30.754  67.213  1.00 92.96  ? 32  ARG B CA    1 
ATOM   3743  C  C     . ARG B  1 32  ? 38.018  -29.609  66.770  1.00 90.33  ? 32  ARG B C     1 
ATOM   3744  O  O     . ARG B  1 32  ? 38.478  -28.557  66.314  1.00 89.57  ? 32  ARG B O     1 
ATOM   3745  C  CB    . ARG B  1 32  ? 39.537  -30.487  68.605  1.00 95.52  ? 32  ARG B CB    1 
ATOM   3746  N  N     . VAL B  1 33  ? 36.713  -29.830  66.892  1.00 88.89  ? 33  VAL B N     1 
ATOM   3747  C  CA    . VAL B  1 33  ? 35.731  -28.822  66.519  1.00 86.35  ? 33  VAL B CA    1 
ATOM   3748  C  C     . VAL B  1 33  ? 35.807  -27.650  67.488  1.00 86.83  ? 33  VAL B C     1 
ATOM   3749  O  O     . VAL B  1 33  ? 35.730  -27.827  68.709  1.00 88.42  ? 33  VAL B O     1 
ATOM   3750  C  CB    . VAL B  1 33  ? 34.296  -29.399  66.492  1.00 85.68  ? 33  VAL B CB    1 
ATOM   3751  C  CG1   . VAL B  1 33  ? 33.304  -28.361  65.951  1.00 83.87  ? 33  VAL B CG1   1 
ATOM   3752  C  CG2   . VAL B  1 33  ? 34.239  -30.687  65.660  1.00 85.32  ? 33  VAL B CG2   1 
ATOM   3753  N  N     . LEU B  1 34  ? 35.984  -26.458  66.929  1.00 85.48  ? 34  LEU B N     1 
ATOM   3754  C  CA    . LEU B  1 34  ? 35.986  -25.228  67.708  1.00 86.30  ? 34  LEU B CA    1 
ATOM   3755  C  C     . LEU B  1 34  ? 34.591  -24.619  67.789  1.00 85.24  ? 34  LEU B C     1 
ATOM   3756  O  O     . LEU B  1 34  ? 34.151  -24.198  68.859  1.00 86.43  ? 34  LEU B O     1 
ATOM   3757  C  CB    . LEU B  1 34  ? 36.958  -24.222  67.105  1.00 86.28  ? 34  LEU B CB    1 
ATOM   3758  C  CG    . LEU B  1 34  ? 38.435  -24.356  67.467  1.00 88.41  ? 34  LEU B CG    1 
ATOM   3759  C  CD1   . LEU B  1 34  ? 39.297  -23.648  66.432  1.00 88.11  ? 34  LEU B CD1   1 
ATOM   3760  C  CD2   . LEU B  1 34  ? 38.704  -23.805  68.864  1.00 91.04  ? 34  LEU B CD2   1 
ATOM   3761  N  N     . ALA B  1 35  ? 33.911  -24.572  66.644  1.00 83.38  ? 35  ALA B N     1 
ATOM   3762  C  CA    . ALA B  1 35  ? 32.550  -24.037  66.522  1.00 82.25  ? 35  ALA B CA    1 
ATOM   3763  C  C     . ALA B  1 35  ? 31.868  -24.619  65.283  1.00 80.52  ? 35  ALA B C     1 
ATOM   3764  O  O     . ALA B  1 35  ? 32.534  -25.145  64.384  1.00 80.09  ? 35  ALA B O     1 
ATOM   3765  C  CB    . ALA B  1 35  ? 32.583  -22.515  66.446  1.00 82.32  ? 35  ALA B CB    1 
ATOM   3766  N  N     . VAL B  1 36  ? 30.542  -24.532  65.243  1.00 79.92  ? 36  VAL B N     1 
ATOM   3767  C  CA    . VAL B  1 36  ? 29.766  -24.981  64.082  1.00 78.78  ? 36  VAL B CA    1 
ATOM   3768  C  C     . VAL B  1 36  ? 28.420  -24.266  64.017  1.00 78.35  ? 36  VAL B C     1 
ATOM   3769  O  O     . VAL B  1 36  ? 27.756  -24.078  65.043  1.00 78.99  ? 36  VAL B O     1 
ATOM   3770  C  CB    . VAL B  1 36  ? 29.566  -26.527  64.064  1.00 79.01  ? 36  VAL B CB    1 
ATOM   3771  C  CG1   . VAL B  1 36  ? 28.959  -27.030  65.377  1.00 79.83  ? 36  VAL B CG1   1 
ATOM   3772  C  CG2   . VAL B  1 36  ? 28.729  -26.960  62.864  1.00 78.05  ? 36  VAL B CG2   1 
ATOM   3773  N  N     . GLY B  1 37  ? 28.030  -23.873  62.808  1.00 77.49  ? 37  GLY B N     1 
ATOM   3774  C  CA    . GLY B  1 37  ? 26.764  -23.181  62.578  1.00 77.27  ? 37  GLY B CA    1 
ATOM   3775  C  C     . GLY B  1 37  ? 26.778  -22.452  61.250  1.00 76.98  ? 37  GLY B C     1 
ATOM   3776  O  O     . GLY B  1 37  ? 27.822  -21.975  60.814  1.00 77.30  ? 37  GLY B O     1 
ATOM   3777  N  N     . ASP B  1 38  ? 25.616  -22.358  60.608  1.00 76.79  ? 38  ASP B N     1 
ATOM   3778  C  CA    . ASP B  1 38  ? 25.515  -21.835  59.243  1.00 76.68  ? 38  ASP B CA    1 
ATOM   3779  C  C     . ASP B  1 38  ? 26.164  -22.806  58.244  1.00 76.58  ? 38  ASP B C     1 
ATOM   3780  O  O     . ASP B  1 38  ? 26.636  -22.401  57.179  1.00 76.88  ? 38  ASP B O     1 
ATOM   3781  C  CB    . ASP B  1 38  ? 26.117  -20.419  59.141  1.00 77.08  ? 38  ASP B CB    1 
ATOM   3782  C  CG    . ASP B  1 38  ? 25.317  -19.372  59.922  1.00 77.34  ? 38  ASP B CG    1 
ATOM   3783  O  OD1   . ASP B  1 38  ? 24.345  -19.747  60.611  1.00 76.85  ? 38  ASP B OD1   1 
ATOM   3784  O  OD2   . ASP B  1 38  ? 25.656  -18.168  59.841  1.00 76.99  ? 38  ASP B OD2   1 
ATOM   3785  N  N     . GLY B  1 39  ? 26.176  -24.091  58.601  1.00 76.50  ? 39  GLY B N     1 
ATOM   3786  C  CA    . GLY B  1 39  ? 26.732  -25.142  57.750  1.00 76.84  ? 39  GLY B CA    1 
ATOM   3787  C  C     . GLY B  1 39  ? 28.246  -25.169  57.702  1.00 77.03  ? 39  GLY B C     1 
ATOM   3788  O  O     . GLY B  1 39  ? 28.837  -25.931  56.936  1.00 77.19  ? 39  GLY B O     1 
ATOM   3789  N  N     . ILE B  1 40  ? 28.876  -24.326  58.513  1.00 77.34  ? 40  ILE B N     1 
ATOM   3790  C  CA    . ILE B  1 40  ? 30.329  -24.280  58.598  1.00 78.01  ? 40  ILE B CA    1 
ATOM   3791  C  C     . ILE B  1 40  ? 30.782  -24.777  59.971  1.00 78.69  ? 40  ILE B C     1 
ATOM   3792  O  O     . ILE B  1 40  ? 30.170  -24.458  60.998  1.00 78.90  ? 40  ILE B O     1 
ATOM   3793  C  CB    . ILE B  1 40  ? 30.909  -22.849  58.389  1.00 78.23  ? 40  ILE B CB    1 
ATOM   3794  C  CG1   . ILE B  1 40  ? 29.914  -21.881  57.712  1.00 78.69  ? 40  ILE B CG1   1 
ATOM   3795  C  CG2   . ILE B  1 40  ? 32.257  -22.929  57.676  1.00 78.85  ? 40  ILE B CG2   1 
ATOM   3796  C  CD1   . ILE B  1 40  ? 29.832  -21.939  56.171  1.00 80.02  ? 40  ILE B CD1   1 
ATOM   3797  N  N     . ALA B  1 41  ? 31.859  -25.553  59.988  1.00 79.29  ? 41  ALA B N     1 
ATOM   3798  C  CA    . ALA B  1 41  ? 32.418  -26.017  61.239  1.00 80.49  ? 41  ALA B CA    1 
ATOM   3799  C  C     . ALA B  1 41  ? 33.893  -25.681  61.290  1.00 81.51  ? 41  ALA B C     1 
ATOM   3800  O  O     . ALA B  1 41  ? 34.685  -26.215  60.507  1.00 81.84  ? 41  ALA B O     1 
ATOM   3801  C  CB    . ALA B  1 41  ? 32.209  -27.502  61.389  1.00 81.11  ? 41  ALA B CB    1 
ATOM   3802  N  N     . ARG B  1 42  ? 34.260  -24.790  62.206  1.00 82.49  ? 42  ARG B N     1 
ATOM   3803  C  CA    . ARG B  1 42  ? 35.658  -24.399  62.368  1.00 83.75  ? 42  ARG B CA    1 
ATOM   3804  C  C     . ARG B  1 42  ? 36.420  -25.415  63.219  1.00 85.01  ? 42  ARG B C     1 
ATOM   3805  O  O     . ARG B  1 42  ? 35.959  -25.810  64.298  1.00 85.99  ? 42  ARG B O     1 
ATOM   3806  C  CB    . ARG B  1 42  ? 35.762  -22.975  62.916  1.00 84.52  ? 42  ARG B CB    1 
ATOM   3807  C  CG    . ARG B  1 42  ? 35.698  -21.920  61.798  1.00 85.29  ? 42  ARG B CG    1 
ATOM   3808  C  CD    . ARG B  1 42  ? 35.307  -20.515  62.277  1.00 87.40  ? 42  ARG B CD    1 
ATOM   3809  N  NE    . ARG B  1 42  ? 35.819  -20.237  63.617  1.00 90.22  ? 42  ARG B NE    1 
ATOM   3810  C  CZ    . ARG B  1 42  ? 35.100  -19.732  64.616  1.00 91.86  ? 42  ARG B CZ    1 
ATOM   3811  N  NH1   . ARG B  1 42  ? 33.818  -19.398  64.435  1.00 90.97  ? 42  ARG B NH1   1 
ATOM   3812  N  NH2   . ARG B  1 42  ? 35.679  -19.535  65.799  1.00 94.03  ? 42  ARG B NH2   1 
ATOM   3813  N  N     . VAL B  1 43  ? 37.575  -25.854  62.712  1.00 85.20  ? 43  VAL B N     1 
ATOM   3814  C  CA    . VAL B  1 43  ? 38.325  -26.952  63.332  1.00 86.35  ? 43  VAL B CA    1 
ATOM   3815  C  C     . VAL B  1 43  ? 39.806  -26.624  63.608  1.00 87.66  ? 43  VAL B C     1 
ATOM   3816  O  O     . VAL B  1 43  ? 40.525  -26.180  62.718  1.00 87.20  ? 43  VAL B O     1 
ATOM   3817  C  CB    . VAL B  1 43  ? 38.212  -28.243  62.482  1.00 85.88  ? 43  VAL B CB    1 
ATOM   3818  C  CG1   . VAL B  1 43  ? 38.969  -29.385  63.127  1.00 87.81  ? 43  VAL B CG1   1 
ATOM   3819  C  CG2   . VAL B  1 43  ? 36.751  -28.633  62.287  1.00 85.13  ? 43  VAL B CG2   1 
ATOM   3820  N  N     . PHE B  1 44  ? 40.229  -26.851  64.856  1.00 89.49  ? 44  PHE B N     1 
ATOM   3821  C  CA    . PHE B  1 44  ? 41.624  -26.737  65.317  1.00 91.23  ? 44  PHE B CA    1 
ATOM   3822  C  C     . PHE B  1 44  ? 42.378  -28.029  65.016  1.00 91.78  ? 44  PHE B C     1 
ATOM   3823  O  O     . PHE B  1 44  ? 41.830  -29.122  65.168  1.00 91.85  ? 44  PHE B O     1 
ATOM   3824  C  CB    . PHE B  1 44  ? 41.620  -26.516  66.831  1.00 93.58  ? 44  PHE B CB    1 
ATOM   3825  C  CG    . PHE B  1 44  ? 42.958  -26.135  67.419  1.00 96.34  ? 44  PHE B CG    1 
ATOM   3826  C  CD1   . PHE B  1 44  ? 43.221  -24.810  67.775  1.00 97.63  ? 44  PHE B CD1   1 
ATOM   3827  C  CD2   . PHE B  1 44  ? 43.932  -27.099  67.675  1.00 98.01  ? 44  PHE B CD2   1 
ATOM   3828  C  CE1   . PHE B  1 44  ? 44.444  -24.447  68.346  1.00 100.24 ? 44  PHE B CE1   1 
ATOM   3829  C  CE2   . PHE B  1 44  ? 45.161  -26.746  68.238  1.00 100.79 ? 44  PHE B CE2   1 
ATOM   3830  C  CZ    . PHE B  1 44  ? 45.416  -25.416  68.577  1.00 101.89 ? 44  PHE B CZ    1 
ATOM   3831  N  N     . GLY B  1 45  ? 43.637  -27.907  64.610  1.00 92.42  ? 45  GLY B N     1 
ATOM   3832  C  CA    . GLY B  1 45  ? 44.453  -29.073  64.272  1.00 93.07  ? 45  GLY B CA    1 
ATOM   3833  C  C     . GLY B  1 45  ? 44.383  -29.402  62.795  1.00 91.07  ? 45  GLY B C     1 
ATOM   3834  O  O     . GLY B  1 45  ? 44.336  -28.494  61.955  1.00 89.43  ? 45  GLY B O     1 
ATOM   3835  N  N     . LEU B  1 46  ? 44.362  -30.700  62.482  1.00 91.48  ? 46  LEU B N     1 
ATOM   3836  C  CA    . LEU B  1 46  ? 44.392  -31.186  61.099  1.00 90.47  ? 46  LEU B CA    1 
ATOM   3837  C  C     . LEU B  1 46  ? 45.511  -30.512  60.314  1.00 90.48  ? 46  LEU B C     1 
ATOM   3838  O  O     . LEU B  1 46  ? 45.273  -29.946  59.250  1.00 89.08  ? 46  LEU B O     1 
ATOM   3839  C  CB    . LEU B  1 46  ? 43.064  -30.904  60.382  1.00 88.20  ? 46  LEU B CB    1 
ATOM   3840  C  CG    . LEU B  1 46  ? 41.774  -31.660  60.650  1.00 87.28  ? 46  LEU B CG    1 
ATOM   3841  C  CD1   . LEU B  1 46  ? 40.781  -31.219  59.598  1.00 84.99  ? 46  LEU B CD1   1 
ATOM   3842  C  CD2   . LEU B  1 46  ? 41.986  -33.147  60.574  1.00 88.57  ? 46  LEU B CD2   1 
ATOM   3843  N  N     . ASN B  1 47  ? 46.727  -30.560  60.835  1.00 92.50  ? 47  ASN B N     1 
ATOM   3844  C  CA    . ASN B  1 47  ? 47.795  -29.755  60.263  1.00 92.84  ? 47  ASN B CA    1 
ATOM   3845  C  C     . ASN B  1 47  ? 48.136  -30.085  58.809  1.00 92.23  ? 47  ASN B C     1 
ATOM   3846  O  O     . ASN B  1 47  ? 48.182  -29.181  57.971  1.00 91.29  ? 47  ASN B O     1 
ATOM   3847  C  CB    . ASN B  1 47  ? 49.025  -29.765  61.166  1.00 95.31  ? 47  ASN B CB    1 
ATOM   3848  C  CG    . ASN B  1 47  ? 48.771  -29.068  62.485  1.00 96.12  ? 47  ASN B CG    1 
ATOM   3849  O  OD1   . ASN B  1 47  ? 48.309  -27.922  62.520  1.00 94.23  ? 47  ASN B OD1   1 
ATOM   3850  N  ND2   . ASN B  1 47  ? 49.059  -29.759  63.582  1.00 98.03  ? 47  ASN B ND2   1 
ATOM   3851  N  N     . ASN B  1 48  ? 48.325  -31.371  58.507  1.00 93.26  ? 48  ASN B N     1 
ATOM   3852  C  CA    . ASN B  1 48  ? 48.739  -31.808  57.162  1.00 92.99  ? 48  ASN B CA    1 
ATOM   3853  C  C     . ASN B  1 48  ? 47.629  -31.909  56.102  1.00 91.26  ? 48  ASN B C     1 
ATOM   3854  O  O     . ASN B  1 48  ? 47.893  -32.350  54.976  1.00 91.32  ? 48  ASN B O     1 
ATOM   3855  C  CB    . ASN B  1 48  ? 49.530  -33.115  57.240  1.00 95.06  ? 48  ASN B CB    1 
ATOM   3856  C  CG    . ASN B  1 48  ? 50.806  -32.973  58.045  1.00 97.74  ? 48  ASN B CG    1 
ATOM   3857  O  OD1   . ASN B  1 48  ? 51.490  -31.945  57.979  1.00 98.34  ? 48  ASN B OD1   1 
ATOM   3858  N  ND2   . ASN B  1 48  ? 51.137  -34.008  58.811  1.00 100.41 ? 48  ASN B ND2   1 
ATOM   3859  N  N     . ILE B  1 49  ? 46.408  -31.494  56.457  1.00 89.92  ? 49  ILE B N     1 
ATOM   3860  C  CA    . ILE B  1 49  ? 45.253  -31.560  55.546  1.00 88.34  ? 49  ILE B CA    1 
ATOM   3861  C  C     . ILE B  1 49  ? 45.387  -30.625  54.345  1.00 87.14  ? 49  ILE B C     1 
ATOM   3862  O  O     . ILE B  1 49  ? 45.842  -29.484  54.475  1.00 86.90  ? 49  ILE B O     1 
ATOM   3863  C  CB    . ILE B  1 49  ? 43.898  -31.303  56.274  1.00 87.49  ? 49  ILE B CB    1 
ATOM   3864  C  CG1   . ILE B  1 49  ? 42.726  -31.647  55.349  1.00 86.57  ? 49  ILE B CG1   1 
ATOM   3865  C  CG2   . ILE B  1 49  ? 43.791  -29.852  56.769  1.00 86.60  ? 49  ILE B CG2   1 
ATOM   3866  C  CD1   . ILE B  1 49  ? 41.373  -31.674  56.016  1.00 86.04  ? 49  ILE B CD1   1 
ATOM   3867  N  N     . GLN B  1 50  ? 44.980  -31.120  53.182  1.00 86.71  ? 50  GLN B N     1 
ATOM   3868  C  CA    . GLN B  1 50  ? 45.044  -30.352  51.944  1.00 85.85  ? 50  GLN B CA    1 
ATOM   3869  C  C     . GLN B  1 50  ? 43.833  -29.435  51.761  1.00 84.78  ? 50  GLN B C     1 
ATOM   3870  O  O     . GLN B  1 50  ? 42.794  -29.599  52.411  1.00 84.18  ? 50  GLN B O     1 
ATOM   3871  C  CB    . GLN B  1 50  ? 45.148  -31.298  50.751  1.00 86.50  ? 50  GLN B CB    1 
ATOM   3872  C  CG    . GLN B  1 50  ? 46.113  -32.438  50.953  1.00 87.18  ? 50  GLN B CG    1 
ATOM   3873  C  CD    . GLN B  1 50  ? 45.724  -33.646  50.151  1.00 87.61  ? 50  GLN B CD    1 
ATOM   3874  O  OE1   . GLN B  1 50  ? 45.239  -34.634  50.700  1.00 88.00  ? 50  GLN B OE1   1 
ATOM   3875  N  NE2   . GLN B  1 50  ? 45.914  -33.572  48.838  1.00 87.97  ? 50  GLN B NE2   1 
ATOM   3876  N  N     . ALA B  1 51  ? 43.980  -28.471  50.858  1.00 84.58  ? 51  ALA B N     1 
ATOM   3877  C  CA    . ALA B  1 51  ? 42.892  -27.578  50.493  1.00 83.91  ? 51  ALA B CA    1 
ATOM   3878  C  C     . ALA B  1 51  ? 41.844  -28.315  49.661  1.00 84.14  ? 51  ALA B C     1 
ATOM   3879  O  O     . ALA B  1 51  ? 42.158  -28.887  48.612  1.00 85.07  ? 51  ALA B O     1 
ATOM   3880  C  CB    . ALA B  1 51  ? 43.435  -26.367  49.738  1.00 84.08  ? 51  ALA B CB    1 
ATOM   3881  N  N     . GLU B  1 52  ? 40.601  -28.283  50.142  1.00 83.55  ? 52  GLU B N     1 
ATOM   3882  C  CA    . GLU B  1 52  ? 39.462  -28.986  49.527  1.00 84.05  ? 52  GLU B CA    1 
ATOM   3883  C  C     . GLU B  1 52  ? 39.490  -30.497  49.767  1.00 84.88  ? 52  GLU B C     1 
ATOM   3884  O  O     . GLU B  1 52  ? 38.876  -31.261  49.023  1.00 85.85  ? 52  GLU B O     1 
ATOM   3885  C  CB    . GLU B  1 52  ? 39.324  -28.652  48.041  1.00 84.71  ? 52  GLU B CB    1 
ATOM   3886  C  CG    . GLU B  1 52  ? 38.979  -27.204  47.808  1.00 84.90  ? 52  GLU B CG    1 
ATOM   3887  C  CD    . GLU B  1 52  ? 39.448  -26.702  46.464  1.00 86.86  ? 52  GLU B CD    1 
ATOM   3888  O  OE1   . GLU B  1 52  ? 38.849  -27.098  45.436  1.00 88.76  ? 52  GLU B OE1   1 
ATOM   3889  O  OE2   . GLU B  1 52  ? 40.411  -25.902  46.442  1.00 86.45  ? 52  GLU B OE2   1 
ATOM   3890  N  N     . GLU B  1 53  ? 40.195  -30.908  50.820  1.00 84.84  ? 53  GLU B N     1 
ATOM   3891  C  CA    . GLU B  1 53  ? 40.238  -32.302  51.240  1.00 86.08  ? 53  GLU B CA    1 
ATOM   3892  C  C     . GLU B  1 53  ? 38.961  -32.673  51.998  1.00 85.81  ? 53  GLU B C     1 
ATOM   3893  O  O     . GLU B  1 53  ? 38.493  -31.912  52.842  1.00 84.75  ? 53  GLU B O     1 
ATOM   3894  C  CB    . GLU B  1 53  ? 41.473  -32.554  52.115  1.00 86.59  ? 53  GLU B CB    1 
ATOM   3895  C  CG    . GLU B  1 53  ? 41.778  -34.031  52.388  1.00 89.11  ? 53  GLU B CG    1 
ATOM   3896  C  CD    . GLU B  1 53  ? 42.859  -34.243  53.439  1.00 90.75  ? 53  GLU B CD    1 
ATOM   3897  O  OE1   . GLU B  1 53  ? 44.019  -33.823  53.219  1.00 91.37  ? 53  GLU B OE1   1 
ATOM   3898  O  OE2   . GLU B  1 53  ? 42.548  -34.845  54.489  1.00 91.96  ? 53  GLU B OE2   1 
ATOM   3899  N  N     . LEU B  1 54  ? 38.409  -33.845  51.690  1.00 87.14  ? 54  LEU B N     1 
ATOM   3900  C  CA    . LEU B  1 54  ? 37.233  -34.382  52.374  1.00 87.41  ? 54  LEU B CA    1 
ATOM   3901  C  C     . LEU B  1 54  ? 37.555  -34.755  53.826  1.00 87.60  ? 54  LEU B C     1 
ATOM   3902  O  O     . LEU B  1 54  ? 38.674  -35.187  54.113  1.00 88.37  ? 54  LEU B O     1 
ATOM   3903  C  CB    . LEU B  1 54  ? 36.750  -35.614  51.614  1.00 89.53  ? 54  LEU B CB    1 
ATOM   3904  C  CG    . LEU B  1 54  ? 35.271  -35.976  51.648  1.00 90.36  ? 54  LEU B CG    1 
ATOM   3905  C  CD1   . LEU B  1 54  ? 34.432  -34.820  51.135  1.00 89.36  ? 54  LEU B CD1   1 
ATOM   3906  C  CD2   . LEU B  1 54  ? 35.029  -37.232  50.815  1.00 93.34  ? 54  LEU B CD2   1 
ATOM   3907  N  N     . VAL B  1 55  ? 36.598  -34.579  54.740  1.00 87.09  ? 55  VAL B N     1 
ATOM   3908  C  CA    . VAL B  1 55  ? 36.781  -34.994  56.153  1.00 87.86  ? 55  VAL B CA    1 
ATOM   3909  C  C     . VAL B  1 55  ? 35.605  -35.821  56.683  1.00 89.03  ? 55  VAL B C     1 
ATOM   3910  O  O     . VAL B  1 55  ? 34.494  -35.693  56.185  1.00 88.78  ? 55  VAL B O     1 
ATOM   3911  C  CB    . VAL B  1 55  ? 37.069  -33.792  57.131  1.00 86.39  ? 55  VAL B CB    1 
ATOM   3912  C  CG1   . VAL B  1 55  ? 38.205  -32.922  56.628  1.00 85.75  ? 55  VAL B CG1   1 
ATOM   3913  C  CG2   . VAL B  1 55  ? 35.844  -32.946  57.369  1.00 84.82  ? 55  VAL B CG2   1 
ATOM   3914  N  N     . GLU B  1 56  ? 35.850  -36.668  57.683  1.00 90.85  ? 56  GLU B N     1 
ATOM   3915  C  CA    . GLU B  1 56  ? 34.766  -37.424  58.328  1.00 92.49  ? 56  GLU B CA    1 
ATOM   3916  C  C     . GLU B  1 56  ? 34.664  -37.127  59.831  1.00 92.38  ? 56  GLU B C     1 
ATOM   3917  O  O     . GLU B  1 56  ? 35.637  -37.281  60.582  1.00 93.32  ? 56  GLU B O     1 
ATOM   3918  C  CB    . GLU B  1 56  ? 34.894  -38.937  58.072  1.00 95.50  ? 56  GLU B CB    1 
ATOM   3919  C  CG    . GLU B  1 56  ? 33.603  -39.742  58.334  1.00 98.20  ? 56  GLU B CG    1 
ATOM   3920  C  CD    . GLU B  1 56  ? 33.734  -41.268  58.108  1.00 103.66 ? 56  GLU B CD    1 
ATOM   3921  O  OE1   . GLU B  1 56  ? 34.851  -41.778  57.827  1.00 104.77 ? 56  GLU B OE1   1 
ATOM   3922  O  OE2   . GLU B  1 56  ? 32.695  -41.967  58.220  1.00 106.33 ? 56  GLU B OE2   1 
ATOM   3923  N  N     . PHE B  1 57  ? 33.469  -36.703  60.245  1.00 91.44  ? 57  PHE B N     1 
ATOM   3924  C  CA    . PHE B  1 57  ? 33.169  -36.347  61.635  1.00 91.26  ? 57  PHE B CA    1 
ATOM   3925  C  C     . PHE B  1 57  ? 32.693  -37.551  62.453  1.00 93.61  ? 57  PHE B C     1 
ATOM   3926  O  O     . PHE B  1 57  ? 32.269  -38.565  61.892  1.00 94.95  ? 57  PHE B O     1 
ATOM   3927  C  CB    . PHE B  1 57  ? 32.094  -35.256  61.679  1.00 89.05  ? 57  PHE B CB    1 
ATOM   3928  C  CG    . PHE B  1 57  ? 32.565  -33.912  61.206  1.00 87.02  ? 57  PHE B CG    1 
ATOM   3929  C  CD1   . PHE B  1 57  ? 32.852  -32.904  62.117  1.00 87.11  ? 57  PHE B CD1   1 
ATOM   3930  C  CD2   . PHE B  1 57  ? 32.700  -33.638  59.851  1.00 86.43  ? 57  PHE B CD2   1 
ATOM   3931  C  CE1   . PHE B  1 57  ? 33.280  -31.635  61.680  1.00 85.76  ? 57  PHE B CE1   1 
ATOM   3932  C  CE2   . PHE B  1 57  ? 33.124  -32.377  59.405  1.00 84.83  ? 57  PHE B CE2   1 
ATOM   3933  C  CZ    . PHE B  1 57  ? 33.417  -31.379  60.319  1.00 84.38  ? 57  PHE B CZ    1 
ATOM   3934  N  N     . SER B  1 58  ? 32.749  -37.410  63.780  1.00 94.34  ? 58  SER B N     1 
ATOM   3935  C  CA    . SER B  1 58  ? 32.266  -38.419  64.732  1.00 96.78  ? 58  SER B CA    1 
ATOM   3936  C  C     . SER B  1 58  ? 30.913  -39.016  64.347  1.00 97.14  ? 58  SER B C     1 
ATOM   3937  O  O     . SER B  1 58  ? 30.740  -40.234  64.387  1.00 99.66  ? 58  SER B O     1 
ATOM   3938  C  CB    . SER B  1 58  ? 32.170  -37.830  66.145  1.00 96.91  ? 58  SER B CB    1 
ATOM   3939  O  OG    . SER B  1 58  ? 33.444  -37.480  66.650  1.00 97.75  ? 58  SER B OG    1 
ATOM   3940  N  N     . SER B  1 59  ? 29.964  -38.158  63.977  1.00 94.91  ? 59  SER B N     1 
ATOM   3941  C  CA    . SER B  1 59  ? 28.614  -38.600  63.624  1.00 95.37  ? 59  SER B CA    1 
ATOM   3942  C  C     . SER B  1 59  ? 28.614  -39.547  62.429  1.00 96.74  ? 59  SER B C     1 
ATOM   3943  O  O     . SER B  1 59  ? 27.774  -40.451  62.334  1.00 98.52  ? 59  SER B O     1 
ATOM   3944  C  CB    . SER B  1 59  ? 27.722  -37.397  63.318  1.00 92.81  ? 59  SER B CB    1 
ATOM   3945  O  OG    . SER B  1 59  ? 27.710  -36.489  64.401  1.00 91.84  ? 59  SER B OG    1 
ATOM   3946  N  N     . GLY B  1 60  ? 29.568  -39.330  61.528  1.00 95.98  ? 60  GLY B N     1 
ATOM   3947  C  CA    . GLY B  1 60  ? 29.606  -40.032  60.254  1.00 97.30  ? 60  GLY B CA    1 
ATOM   3948  C  C     . GLY B  1 60  ? 29.534  -39.053  59.098  1.00 95.13  ? 60  GLY B C     1 
ATOM   3949  O  O     . GLY B  1 60  ? 30.090  -39.320  58.027  1.00 95.78  ? 60  GLY B O     1 
ATOM   3950  N  N     . VAL B  1 61  ? 28.851  -37.924  59.326  1.00 92.79  ? 61  VAL B N     1 
ATOM   3951  C  CA    . VAL B  1 61  ? 28.728  -36.832  58.346  1.00 90.72  ? 61  VAL B CA    1 
ATOM   3952  C  C     . VAL B  1 61  ? 30.091  -36.387  57.826  1.00 89.84  ? 61  VAL B C     1 
ATOM   3953  O  O     . VAL B  1 61  ? 31.040  -36.221  58.596  1.00 89.57  ? 61  VAL B O     1 
ATOM   3954  C  CB    . VAL B  1 61  ? 27.929  -35.605  58.909  1.00 88.67  ? 61  VAL B CB    1 
ATOM   3955  C  CG1   . VAL B  1 61  ? 28.549  -35.068  60.194  1.00 87.81  ? 61  VAL B CG1   1 
ATOM   3956  C  CG2   . VAL B  1 61  ? 27.817  -34.500  57.869  1.00 86.75  ? 61  VAL B CG2   1 
ATOM   3957  N  N     . LYS B  1 62  ? 30.182  -36.217  56.513  1.00 89.64  ? 62  LYS B N     1 
ATOM   3958  C  CA    . LYS B  1 62  ? 31.435  -35.834  55.890  1.00 89.05  ? 62  LYS B CA    1 
ATOM   3959  C  C     . LYS B  1 62  ? 31.461  -34.332  55.652  1.00 86.54  ? 62  LYS B C     1 
ATOM   3960  O  O     . LYS B  1 62  ? 30.415  -33.695  55.609  1.00 85.91  ? 62  LYS B O     1 
ATOM   3961  C  CB    . LYS B  1 62  ? 31.655  -36.632  54.595  1.00 91.02  ? 62  LYS B CB    1 
ATOM   3962  C  CG    . LYS B  1 62  ? 32.073  -38.099  54.836  1.00 94.22  ? 62  LYS B CG    1 
ATOM   3963  C  CD    . LYS B  1 62  ? 31.741  -39.011  53.648  1.00 97.63  ? 62  LYS B CD    1 
ATOM   3964  C  CE    . LYS B  1 62  ? 32.132  -40.469  53.911  1.00 101.12 ? 62  LYS B CE    1 
ATOM   3965  N  NZ    . LYS B  1 62  ? 31.300  -41.133  54.963  1.00 102.54 ? 62  LYS B NZ    1 
ATOM   3966  N  N     . GLY B  1 63  ? 32.657  -33.770  55.529  1.00 85.52  ? 63  GLY B N     1 
ATOM   3967  C  CA    . GLY B  1 63  ? 32.826  -32.340  55.287  1.00 83.75  ? 63  GLY B CA    1 
ATOM   3968  C  C     . GLY B  1 63  ? 34.014  -32.060  54.383  1.00 83.78  ? 63  GLY B C     1 
ATOM   3969  O  O     . GLY B  1 63  ? 34.782  -32.975  54.053  1.00 85.02  ? 63  GLY B O     1 
ATOM   3970  N  N     . MET B  1 64  ? 34.164  -30.795  53.989  1.00 82.44  ? 64  MET B N     1 
ATOM   3971  C  CA    . MET B  1 64  ? 35.232  -30.371  53.081  1.00 82.23  ? 64  MET B CA    1 
ATOM   3972  C  C     . MET B  1 64  ? 35.945  -29.126  53.595  1.00 81.19  ? 64  MET B C     1 
ATOM   3973  O  O     . MET B  1 64  ? 35.309  -28.106  53.855  1.00 80.73  ? 64  MET B O     1 
ATOM   3974  C  CB    . MET B  1 64  ? 34.659  -30.119  51.694  1.00 82.43  ? 64  MET B CB    1 
ATOM   3975  C  CG    . MET B  1 64  ? 35.468  -29.170  50.850  1.00 82.68  ? 64  MET B CG    1 
ATOM   3976  S  SD    . MET B  1 64  ? 34.554  -28.589  49.411  1.00 85.39  ? 64  MET B SD    1 
ATOM   3977  C  CE    . MET B  1 64  ? 33.141  -27.750  50.143  1.00 83.99  ? 64  MET B CE    1 
ATOM   3978  N  N     . ALA B  1 65  ? 37.263  -29.213  53.735  1.00 81.34  ? 65  ALA B N     1 
ATOM   3979  C  CA    . ALA B  1 65  ? 38.062  -28.112  54.258  1.00 80.91  ? 65  ALA B CA    1 
ATOM   3980  C  C     . ALA B  1 65  ? 38.326  -27.072  53.179  1.00 80.89  ? 65  ALA B C     1 
ATOM   3981  O  O     . ALA B  1 65  ? 39.086  -27.305  52.244  1.00 81.51  ? 65  ALA B O     1 
ATOM   3982  C  CB    . ALA B  1 65  ? 39.354  -28.632  54.825  1.00 81.65  ? 65  ALA B CB    1 
ATOM   3983  N  N     . LEU B  1 66  ? 37.697  -25.915  53.314  1.00 80.66  ? 66  LEU B N     1 
ATOM   3984  C  CA    . LEU B  1 66  ? 37.724  -24.921  52.253  1.00 81.05  ? 66  LEU B CA    1 
ATOM   3985  C  C     . LEU B  1 66  ? 38.628  -23.735  52.598  1.00 81.33  ? 66  LEU B C     1 
ATOM   3986  O  O     . LEU B  1 66  ? 39.038  -22.974  51.718  1.00 81.99  ? 66  LEU B O     1 
ATOM   3987  C  CB    . LEU B  1 66  ? 36.292  -24.457  51.947  1.00 80.88  ? 66  LEU B CB    1 
ATOM   3988  C  CG    . LEU B  1 66  ? 35.986  -24.072  50.497  1.00 82.03  ? 66  LEU B CG    1 
ATOM   3989  C  CD1   . LEU B  1 66  ? 36.195  -25.266  49.561  1.00 82.96  ? 66  LEU B CD1   1 
ATOM   3990  C  CD2   . LEU B  1 66  ? 34.571  -23.513  50.355  1.00 81.82  ? 66  LEU B CD2   1 
ATOM   3991  N  N     . ILE B  1 67  ? 38.934  -23.587  53.884  1.00 81.22  ? 67  ILE B N     1 
ATOM   3992  C  CA    . ILE B  1 67  ? 39.710  -22.456  54.375  1.00 81.71  ? 67  ILE B CA    1 
ATOM   3993  C  C     . ILE B  1 67  ? 40.831  -22.991  55.257  1.00 82.28  ? 67  ILE B C     1 
ATOM   3994  O  O     . ILE B  1 67  ? 40.569  -23.582  56.306  1.00 82.49  ? 67  ILE B O     1 
ATOM   3995  C  CB    . ILE B  1 67  ? 38.827  -21.476  55.198  1.00 81.72  ? 67  ILE B CB    1 
ATOM   3996  C  CG1   . ILE B  1 67  ? 37.560  -21.094  54.418  1.00 81.32  ? 67  ILE B CG1   1 
ATOM   3997  C  CG2   . ILE B  1 67  ? 39.630  -20.236  55.618  1.00 82.48  ? 67  ILE B CG2   1 
ATOM   3998  C  CD1   . ILE B  1 67  ? 36.422  -20.552  55.285  1.00 81.19  ? 67  ILE B CD1   1 
ATOM   3999  N  N     . LEU B  1 68  ? 42.074  -22.790  54.830  1.00 82.67  ? 68  LEU B N     1 
ATOM   4000  C  CA    . LEU B  1 68  ? 43.215  -23.227  55.618  1.00 83.40  ? 68  LEU B CA    1 
ATOM   4001  C  C     . LEU B  1 68  ? 43.948  -22.041  56.229  1.00 84.71  ? 68  LEU B C     1 
ATOM   4002  O  O     . LEU B  1 68  ? 44.704  -21.352  55.551  1.00 85.25  ? 68  LEU B O     1 
ATOM   4003  C  CB    . LEU B  1 68  ? 44.163  -24.076  54.767  1.00 83.65  ? 68  LEU B CB    1 
ATOM   4004  C  CG    . LEU B  1 68  ? 43.643  -25.385  54.169  1.00 82.75  ? 68  LEU B CG    1 
ATOM   4005  C  CD1   . LEU B  1 68  ? 44.726  -25.997  53.306  1.00 83.45  ? 68  LEU B CD1   1 
ATOM   4006  C  CD2   . LEU B  1 68  ? 43.199  -26.372  55.243  1.00 82.88  ? 68  LEU B CD2   1 
ATOM   4007  N  N     . GLU B  1 69  ? 43.715  -21.814  57.517  1.00 85.48  ? 69  GLU B N     1 
ATOM   4008  C  CA    . GLU B  1 69  ? 44.264  -20.660  58.229  1.00 87.53  ? 69  GLU B CA    1 
ATOM   4009  C  C     . GLU B  1 69  ? 45.233  -21.068  59.332  1.00 88.90  ? 69  GLU B C     1 
ATOM   4010  O  O     . GLU B  1 69  ? 45.165  -22.196  59.829  1.00 88.84  ? 69  GLU B O     1 
ATOM   4011  C  CB    . GLU B  1 69  ? 43.137  -19.857  58.866  1.00 87.77  ? 69  GLU B CB    1 
ATOM   4012  C  CG    . GLU B  1 69  ? 42.539  -18.789  57.993  1.00 89.45  ? 69  GLU B CG    1 
ATOM   4013  C  CD    . GLU B  1 69  ? 41.506  -17.972  58.745  1.00 93.19  ? 69  GLU B CD    1 
ATOM   4014  O  OE1   . GLU B  1 69  ? 41.268  -18.279  59.942  1.00 94.90  ? 69  GLU B OE1   1 
ATOM   4015  O  OE2   . GLU B  1 69  ? 40.934  -17.024  58.145  1.00 94.76  ? 69  GLU B OE2   1 
ATOM   4016  N  N     . PRO B  1 70  ? 46.127  -20.145  59.736  1.00 90.59  ? 70  PRO B N     1 
ATOM   4017  C  CA    . PRO B  1 70  ? 47.027  -20.421  60.851  1.00 92.42  ? 70  PRO B CA    1 
ATOM   4018  C  C     . PRO B  1 70  ? 46.265  -20.568  62.166  1.00 92.66  ? 70  PRO B C     1 
ATOM   4019  O  O     . PRO B  1 70  ? 45.865  -19.576  62.756  1.00 93.97  ? 70  PRO B O     1 
ATOM   4020  C  CB    . PRO B  1 70  ? 47.927  -19.179  60.888  1.00 94.79  ? 70  PRO B CB    1 
ATOM   4021  C  CG    . PRO B  1 70  ? 47.150  -18.114  60.182  1.00 94.07  ? 70  PRO B CG    1 
ATOM   4022  C  CD    . PRO B  1 70  ? 46.394  -18.829  59.124  1.00 91.37  ? 70  PRO B CD    1 
ATOM   4023  N  N     . GLY B  1 71  ? 46.048  -21.800  62.609  1.00 91.88  ? 71  GLY B N     1 
ATOM   4024  C  CA    . GLY B  1 71  ? 45.397  -22.037  63.892  1.00 92.49  ? 71  GLY B CA    1 
ATOM   4025  C  C     . GLY B  1 71  ? 44.079  -22.784  63.829  1.00 90.31  ? 71  GLY B C     1 
ATOM   4026  O  O     . GLY B  1 71  ? 43.650  -23.362  64.834  1.00 91.20  ? 71  GLY B O     1 
ATOM   4027  N  N     . GLN B  1 72  ? 43.432  -22.766  62.660  1.00 87.71  ? 72  GLN B N     1 
ATOM   4028  C  CA    . GLN B  1 72  ? 42.138  -23.435  62.460  1.00 85.40  ? 72  GLN B CA    1 
ATOM   4029  C  C     . GLN B  1 72  ? 41.752  -23.603  60.987  1.00 83.34  ? 72  GLN B C     1 
ATOM   4030  O  O     . GLN B  1 72  ? 42.281  -22.918  60.120  1.00 83.20  ? 72  GLN B O     1 
ATOM   4031  C  CB    . GLN B  1 72  ? 41.029  -22.703  63.212  1.00 85.25  ? 72  GLN B CB    1 
ATOM   4032  C  CG    . GLN B  1 72  ? 40.942  -21.235  62.897  1.00 84.98  ? 72  GLN B CG    1 
ATOM   4033  C  CD    . GLN B  1 72  ? 39.521  -20.777  62.840  1.00 83.33  ? 72  GLN B CD    1 
ATOM   4034  O  OE1   . GLN B  1 72  ? 38.932  -20.407  63.856  1.00 83.63  ? 72  GLN B OE1   1 
ATOM   4035  N  NE2   . GLN B  1 72  ? 38.944  -20.812  61.644  1.00 81.67  ? 72  GLN B NE2   1 
ATOM   4036  N  N     . VAL B  1 73  ? 40.821  -24.518  60.723  1.00 82.16  ? 73  VAL B N     1 
ATOM   4037  C  CA    . VAL B  1 73  ? 40.372  -24.832  59.362  1.00 80.89  ? 73  VAL B CA    1 
ATOM   4038  C  C     . VAL B  1 73  ? 38.858  -24.614  59.201  1.00 80.02  ? 73  VAL B C     1 
ATOM   4039  O  O     . VAL B  1 73  ? 38.054  -25.166  59.969  1.00 80.04  ? 73  VAL B O     1 
ATOM   4040  C  CB    . VAL B  1 73  ? 40.712  -26.301  58.969  1.00 80.84  ? 73  VAL B CB    1 
ATOM   4041  C  CG1   . VAL B  1 73  ? 40.181  -26.626  57.594  1.00 79.60  ? 73  VAL B CG1   1 
ATOM   4042  C  CG2   . VAL B  1 73  ? 42.211  -26.557  59.015  1.00 82.17  ? 73  VAL B CG2   1 
ATOM   4043  N  N     . GLY B  1 74  ? 38.482  -23.811  58.204  1.00 79.50  ? 74  GLY B N     1 
ATOM   4044  C  CA    . GLY B  1 74  ? 37.077  -23.610  57.851  1.00 78.78  ? 74  GLY B CA    1 
ATOM   4045  C  C     . GLY B  1 74  ? 36.622  -24.789  57.018  1.00 78.37  ? 74  GLY B C     1 
ATOM   4046  O  O     . GLY B  1 74  ? 37.249  -25.094  55.999  1.00 78.48  ? 74  GLY B O     1 
ATOM   4047  N  N     . ILE B  1 75  ? 35.549  -25.457  57.460  1.00 78.14  ? 75  ILE B N     1 
ATOM   4048  C  CA    . ILE B  1 75  ? 35.049  -26.691  56.823  1.00 78.15  ? 75  ILE B CA    1 
ATOM   4049  C  C     . ILE B  1 75  ? 33.543  -26.659  56.563  1.00 77.68  ? 75  ILE B C     1 
ATOM   4050  O  O     . ILE B  1 75  ? 32.746  -26.465  57.484  1.00 77.70  ? 75  ILE B O     1 
ATOM   4051  C  CB    . ILE B  1 75  ? 35.385  -27.960  57.654  1.00 78.94  ? 75  ILE B CB    1 
ATOM   4052  C  CG1   . ILE B  1 75  ? 36.903  -28.169  57.745  1.00 79.85  ? 75  ILE B CG1   1 
ATOM   4053  C  CG2   . ILE B  1 75  ? 34.689  -29.195  57.060  1.00 79.49  ? 75  ILE B CG2   1 
ATOM   4054  C  CD1   . ILE B  1 75  ? 37.356  -29.224  58.758  1.00 81.58  ? 75  ILE B CD1   1 
ATOM   4055  N  N     . VAL B  1 76  ? 33.173  -26.882  55.304  1.00 77.69  ? 76  VAL B N     1 
ATOM   4056  C  CA    . VAL B  1 76  ? 31.784  -26.821  54.841  1.00 77.58  ? 76  VAL B CA    1 
ATOM   4057  C  C     . VAL B  1 76  ? 31.131  -28.221  54.823  1.00 78.28  ? 76  VAL B C     1 
ATOM   4058  O  O     . VAL B  1 76  ? 31.636  -29.142  54.167  1.00 79.05  ? 76  VAL B O     1 
ATOM   4059  C  CB    . VAL B  1 76  ? 31.723  -26.100  53.461  1.00 77.78  ? 76  VAL B CB    1 
ATOM   4060  C  CG1   . VAL B  1 76  ? 30.626  -26.635  52.585  1.00 78.56  ? 76  VAL B CG1   1 
ATOM   4061  C  CG2   . VAL B  1 76  ? 31.569  -24.599  53.656  1.00 77.47  ? 76  VAL B CG2   1 
ATOM   4062  N  N     . LEU B  1 77  ? 30.017  -28.369  55.547  1.00 78.15  ? 77  LEU B N     1 
ATOM   4063  C  CA    . LEU B  1 77  ? 29.412  -29.688  55.810  1.00 79.10  ? 77  LEU B CA    1 
ATOM   4064  C  C     . LEU B  1 77  ? 28.548  -30.191  54.673  1.00 80.33  ? 77  LEU B C     1 
ATOM   4065  O  O     . LEU B  1 77  ? 27.805  -29.419  54.065  1.00 80.50  ? 77  LEU B O     1 
ATOM   4066  C  CB    . LEU B  1 77  ? 28.576  -29.680  57.096  1.00 78.63  ? 77  LEU B CB    1 
ATOM   4067  C  CG    . LEU B  1 77  ? 29.130  -29.030  58.369  1.00 78.28  ? 77  LEU B CG    1 
ATOM   4068  C  CD1   . LEU B  1 77  ? 28.095  -29.084  59.488  1.00 78.10  ? 77  LEU B CD1   1 
ATOM   4069  C  CD2   . LEU B  1 77  ? 30.451  -29.662  58.814  1.00 79.34  ? 77  LEU B CD2   1 
ATOM   4070  N  N     . PHE B  1 78  ? 28.636  -31.493  54.408  1.00 81.92  ? 78  PHE B N     1 
ATOM   4071  C  CA    . PHE B  1 78  ? 27.796  -32.147  53.409  1.00 83.71  ? 78  PHE B CA    1 
ATOM   4072  C  C     . PHE B  1 78  ? 26.564  -32.809  54.035  1.00 84.87  ? 78  PHE B C     1 
ATOM   4073  O  O     . PHE B  1 78  ? 26.064  -33.816  53.530  1.00 86.94  ? 78  PHE B O     1 
ATOM   4074  C  CB    . PHE B  1 78  ? 28.613  -33.159  52.602  1.00 85.19  ? 78  PHE B CB    1 
ATOM   4075  C  CG    . PHE B  1 78  ? 29.595  -32.527  51.661  1.00 84.80  ? 78  PHE B CG    1 
ATOM   4076  C  CD1   . PHE B  1 78  ? 29.155  -31.842  50.528  1.00 85.13  ? 78  PHE B CD1   1 
ATOM   4077  C  CD2   . PHE B  1 78  ? 30.960  -32.615  51.901  1.00 84.30  ? 78  PHE B CD2   1 
ATOM   4078  C  CE1   . PHE B  1 78  ? 30.059  -31.248  49.651  1.00 84.46  ? 78  PHE B CE1   1 
ATOM   4079  C  CE2   . PHE B  1 78  ? 31.874  -32.025  51.027  1.00 84.01  ? 78  PHE B CE2   1 
ATOM   4080  C  CZ    . PHE B  1 78  ? 31.419  -31.339  49.899  1.00 84.09  ? 78  PHE B CZ    1 
ATOM   4081  N  N     . GLY B  1 79  ? 26.075  -32.233  55.131  1.00 83.92  ? 79  GLY B N     1 
ATOM   4082  C  CA    . GLY B  1 79  ? 24.891  -32.738  55.815  1.00 85.04  ? 79  GLY B CA    1 
ATOM   4083  C  C     . GLY B  1 79  ? 24.321  -31.706  56.763  1.00 83.96  ? 79  GLY B C     1 
ATOM   4084  O  O     . GLY B  1 79  ? 24.663  -30.531  56.678  1.00 82.77  ? 79  GLY B O     1 
ATOM   4085  N  N     . SER B  1 80  ? 23.463  -32.155  57.676  1.00 84.88  ? 80  SER B N     1 
ATOM   4086  C  CA    . SER B  1 80  ? 22.757  -31.276  58.612  1.00 84.23  ? 80  SER B CA    1 
ATOM   4087  C  C     . SER B  1 80  ? 23.653  -30.805  59.761  1.00 83.54  ? 80  SER B C     1 
ATOM   4088  O  O     . SER B  1 80  ? 24.339  -31.625  60.379  1.00 84.23  ? 80  SER B O     1 
ATOM   4089  C  CB    . SER B  1 80  ? 21.516  -31.999  59.155  1.00 85.42  ? 80  SER B CB    1 
ATOM   4090  O  OG    . SER B  1 80  ? 20.955  -31.330  60.273  1.00 84.63  ? 80  SER B OG    1 
ATOM   4091  N  N     . ASP B  1 81  ? 23.625  -29.492  60.040  1.00 82.75  ? 81  ASP B N     1 
ATOM   4092  C  CA    . ASP B  1 81  ? 24.414  -28.841  61.119  1.00 82.47  ? 81  ASP B CA    1 
ATOM   4093  C  C     . ASP B  1 81  ? 24.364  -29.612  62.430  1.00 82.92  ? 81  ASP B C     1 
ATOM   4094  O  O     . ASP B  1 81  ? 25.368  -29.737  63.134  1.00 83.23  ? 81  ASP B O     1 
ATOM   4095  C  CB    . ASP B  1 81  ? 23.901  -27.421  61.404  1.00 82.17  ? 81  ASP B CB    1 
ATOM   4096  C  CG    . ASP B  1 81  ? 24.234  -26.427  60.296  1.00 83.58  ? 81  ASP B CG    1 
ATOM   4097  O  OD1   . ASP B  1 81  ? 24.090  -26.781  59.101  1.00 86.21  ? 81  ASP B OD1   1 
ATOM   4098  O  OD2   . ASP B  1 81  ? 24.613  -25.274  60.625  1.00 84.63  ? 81  ASP B OD2   1 
ATOM   4099  N  N     . ARG B  1 82  ? 23.168  -30.102  62.741  1.00 83.04  ? 82  ARG B N     1 
ATOM   4100  C  CA    . ARG B  1 82  ? 22.869  -30.880  63.938  1.00 83.60  ? 82  ARG B CA    1 
ATOM   4101  C  C     . ARG B  1 82  ? 23.909  -31.970  64.263  1.00 84.64  ? 82  ARG B C     1 
ATOM   4102  O  O     . ARG B  1 82  ? 24.219  -32.216  65.432  1.00 85.43  ? 82  ARG B O     1 
ATOM   4103  C  CB    . ARG B  1 82  ? 21.463  -31.470  63.771  1.00 84.20  ? 82  ARG B CB    1 
ATOM   4104  C  CG    . ARG B  1 82  ? 20.956  -32.326  64.901  1.00 84.71  ? 82  ARG B CG    1 
ATOM   4105  C  CD    . ARG B  1 82  ? 19.443  -32.337  64.898  1.00 83.10  ? 82  ARG B CD    1 
ATOM   4106  N  NE    . ARG B  1 82  ? 18.901  -33.336  65.810  1.00 83.74  ? 82  ARG B NE    1 
ATOM   4107  C  CZ    . ARG B  1 82  ? 19.063  -33.331  67.130  1.00 83.74  ? 82  ARG B CZ    1 
ATOM   4108  N  NH1   . ARG B  1 82  ? 19.775  -32.381  67.732  1.00 82.15  ? 82  ARG B NH1   1 
ATOM   4109  N  NH2   . ARG B  1 82  ? 18.514  -34.294  67.853  1.00 85.84  ? 82  ARG B NH2   1 
ATOM   4110  N  N     . LEU B  1 83  ? 24.466  -32.589  63.225  1.00 84.69  ? 83  LEU B N     1 
ATOM   4111  C  CA    . LEU B  1 83  ? 25.356  -33.736  63.389  1.00 86.07  ? 83  LEU B CA    1 
ATOM   4112  C  C     . LEU B  1 83  ? 26.833  -33.390  63.664  1.00 85.71  ? 83  LEU B C     1 
ATOM   4113  O  O     . LEU B  1 83  ? 27.712  -34.211  63.420  1.00 87.01  ? 83  LEU B O     1 
ATOM   4114  C  CB    . LEU B  1 83  ? 25.253  -34.663  62.166  1.00 86.99  ? 83  LEU B CB    1 
ATOM   4115  C  CG    . LEU B  1 83  ? 23.899  -34.903  61.490  1.00 87.07  ? 83  LEU B CG    1 
ATOM   4116  C  CD1   . LEU B  1 83  ? 24.114  -35.680  60.206  1.00 88.22  ? 83  LEU B CD1   1 
ATOM   4117  C  CD2   . LEU B  1 83  ? 22.897  -35.617  62.399  1.00 87.75  ? 83  LEU B CD2   1 
ATOM   4118  N  N     . VAL B  1 84  ? 27.113  -32.189  64.163  1.00 84.33  ? 84  VAL B N     1 
ATOM   4119  C  CA    . VAL B  1 84  ? 28.481  -31.824  64.550  1.00 84.28  ? 84  VAL B CA    1 
ATOM   4120  C  C     . VAL B  1 84  ? 28.440  -31.046  65.861  1.00 84.56  ? 84  VAL B C     1 
ATOM   4121  O  O     . VAL B  1 84  ? 27.873  -29.957  65.911  1.00 83.66  ? 84  VAL B O     1 
ATOM   4122  C  CB    . VAL B  1 84  ? 29.188  -30.936  63.482  1.00 82.91  ? 84  VAL B CB    1 
ATOM   4123  C  CG1   . VAL B  1 84  ? 30.628  -30.660  63.883  1.00 83.32  ? 84  VAL B CG1   1 
ATOM   4124  C  CG2   . VAL B  1 84  ? 29.138  -31.559  62.093  1.00 82.52  ? 84  VAL B CG2   1 
ATOM   4125  N  N     . LYS B  1 85  ? 29.021  -31.594  66.924  1.00 86.18  ? 85  LYS B N     1 
ATOM   4126  C  CA    . LYS B  1 85  ? 29.111  -30.844  68.181  1.00 86.83  ? 85  LYS B CA    1 
ATOM   4127  C  C     . LYS B  1 85  ? 30.501  -30.223  68.327  1.00 87.47  ? 85  LYS B C     1 
ATOM   4128  O  O     . LYS B  1 85  ? 31.458  -30.695  67.719  1.00 87.83  ? 85  LYS B O     1 
ATOM   4129  C  CB    . LYS B  1 85  ? 28.750  -31.716  69.396  1.00 88.66  ? 85  LYS B CB    1 
ATOM   4130  C  CG    . LYS B  1 85  ? 27.313  -32.223  69.388  1.00 87.90  ? 85  LYS B CG    1 
ATOM   4131  C  CD    . LYS B  1 85  ? 26.825  -32.708  70.754  1.00 89.41  ? 85  LYS B CD    1 
ATOM   4132  C  CE    . LYS B  1 85  ? 25.601  -33.627  70.589  1.00 89.63  ? 85  LYS B CE    1 
ATOM   4133  N  NZ    . LYS B  1 85  ? 24.755  -33.798  71.807  1.00 90.07  ? 85  LYS B NZ    1 
ATOM   4134  N  N     . GLU B  1 86  ? 30.607  -29.148  69.106  1.00 87.98  ? 86  GLU B N     1 
ATOM   4135  C  CA    . GLU B  1 86  ? 31.908  -28.615  69.476  1.00 89.26  ? 86  GLU B CA    1 
ATOM   4136  C  C     . GLU B  1 86  ? 32.629  -29.668  70.315  1.00 91.84  ? 86  GLU B C     1 
ATOM   4137  O  O     . GLU B  1 86  ? 31.993  -30.406  71.085  1.00 93.21  ? 86  GLU B O     1 
ATOM   4138  C  CB    . GLU B  1 86  ? 31.765  -27.320  70.272  1.00 89.88  ? 86  GLU B CB    1 
ATOM   4139  C  CG    . GLU B  1 86  ? 33.102  -26.712  70.707  1.00 92.17  ? 86  GLU B CG    1 
ATOM   4140  C  CD    . GLU B  1 86  ? 33.005  -25.848  71.960  1.00 95.05  ? 86  GLU B CD    1 
ATOM   4141  O  OE1   . GLU B  1 86  ? 32.044  -25.058  72.095  1.00 95.40  ? 86  GLU B OE1   1 
ATOM   4142  O  OE2   . GLU B  1 86  ? 33.909  -25.947  72.812  1.00 97.38  ? 86  GLU B OE2   1 
ATOM   4143  N  N     . GLY B  1 87  ? 33.950  -29.742  70.154  1.00 92.74  ? 87  GLY B N     1 
ATOM   4144  C  CA    . GLY B  1 87  ? 34.767  -30.711  70.878  1.00 95.12  ? 87  GLY B CA    1 
ATOM   4145  C  C     . GLY B  1 87  ? 35.043  -31.965  70.074  1.00 94.96  ? 87  GLY B C     1 
ATOM   4146  O  O     . GLY B  1 87  ? 36.126  -32.534  70.175  1.00 96.71  ? 87  GLY B O     1 
ATOM   4147  N  N     . GLU B  1 88  ? 34.072  -32.378  69.261  1.00 93.22  ? 88  GLU B N     1 
ATOM   4148  C  CA    . GLU B  1 88  ? 34.147  -33.623  68.486  1.00 93.65  ? 88  GLU B CA    1 
ATOM   4149  C  C     . GLU B  1 88  ? 35.431  -33.804  67.674  1.00 93.66  ? 88  GLU B C     1 
ATOM   4150  O  O     . GLU B  1 88  ? 36.197  -32.855  67.470  1.00 93.03  ? 88  GLU B O     1 
ATOM   4151  C  CB    . GLU B  1 88  ? 32.934  -33.757  67.564  1.00 91.77  ? 88  GLU B CB    1 
ATOM   4152  C  CG    . GLU B  1 88  ? 31.654  -34.112  68.294  1.00 93.29  ? 88  GLU B CG    1 
ATOM   4153  C  CD    . GLU B  1 88  ? 30.617  -34.768  67.399  1.00 93.96  ? 88  GLU B CD    1 
ATOM   4154  O  OE1   . GLU B  1 88  ? 30.789  -34.757  66.155  1.00 93.42  ? 88  GLU B OE1   1 
ATOM   4155  O  OE2   . GLU B  1 88  ? 29.627  -35.301  67.948  1.00 95.21  ? 88  GLU B OE2   1 
ATOM   4156  N  N     . LEU B  1 89  ? 35.655  -35.032  67.213  1.00 94.54  ? 89  LEU B N     1 
ATOM   4157  C  CA    . LEU B  1 89  ? 36.837  -35.351  66.429  1.00 94.53  ? 89  LEU B CA    1 
ATOM   4158  C  C     . LEU B  1 89  ? 36.597  -35.074  64.947  1.00 91.96  ? 89  LEU B C     1 
ATOM   4159  O  O     . LEU B  1 89  ? 35.469  -35.155  64.462  1.00 90.68  ? 89  LEU B O     1 
ATOM   4160  C  CB    . LEU B  1 89  ? 37.235  -36.812  66.645  1.00 97.42  ? 89  LEU B CB    1 
ATOM   4161  C  CG    . LEU B  1 89  ? 38.706  -37.090  66.977  1.00 99.68  ? 89  LEU B CG    1 
ATOM   4162  C  CD1   . LEU B  1 89  ? 38.967  -37.007  68.488  1.00 101.72 ? 89  LEU B CD1   1 
ATOM   4163  C  CD2   . LEU B  1 89  ? 39.119  -38.452  66.440  1.00 101.51 ? 89  LEU B CD2   1 
ATOM   4164  N  N     . VAL B  1 90  ? 37.666  -34.721  64.242  1.00 91.42  ? 90  VAL B N     1 
ATOM   4165  C  CA    . VAL B  1 90  ? 37.613  -34.499  62.797  1.00 89.62  ? 90  VAL B CA    1 
ATOM   4166  C  C     . VAL B  1 90  ? 38.745  -35.284  62.126  1.00 90.82  ? 90  VAL B C     1 
ATOM   4167  O  O     . VAL B  1 90  ? 39.923  -34.922  62.243  1.00 91.10  ? 90  VAL B O     1 
ATOM   4168  C  CB    . VAL B  1 90  ? 37.718  -32.995  62.434  1.00 87.56  ? 90  VAL B CB    1 
ATOM   4169  C  CG1   . VAL B  1 90  ? 37.306  -32.757  60.978  1.00 85.94  ? 90  VAL B CG1   1 
ATOM   4170  C  CG2   . VAL B  1 90  ? 36.865  -32.150  63.370  1.00 87.07  ? 90  VAL B CG2   1 
ATOM   4171  N  N     . LYS B  1 91  ? 38.374  -36.370  61.445  1.00 91.58  ? 91  LYS B N     1 
ATOM   4172  C  CA    . LYS B  1 91  ? 39.335  -37.257  60.789  1.00 92.99  ? 91  LYS B CA    1 
ATOM   4173  C  C     . LYS B  1 91  ? 39.654  -36.795  59.375  1.00 91.28  ? 91  LYS B C     1 
ATOM   4174  O  O     . LYS B  1 91  ? 38.748  -36.505  58.594  1.00 90.10  ? 91  LYS B O     1 
ATOM   4175  C  CB    . LYS B  1 91  ? 38.795  -38.689  60.742  1.00 95.26  ? 91  LYS B CB    1 
ATOM   4176  C  CG    . LYS B  1 91  ? 39.028  -39.501  62.009  1.00 98.55  ? 91  LYS B CG    1 
ATOM   4177  C  CD    . LYS B  1 91  ? 37.931  -40.544  62.225  1.00 101.17 ? 91  LYS B CD    1 
ATOM   4178  C  CE    . LYS B  1 91  ? 36.653  -39.897  62.780  1.00 100.51 ? 91  LYS B CE    1 
ATOM   4179  N  NZ    . LYS B  1 91  ? 35.598  -40.902  63.117  1.00 102.84 ? 91  LYS B NZ    1 
ATOM   4180  N  N     . ARG B  1 92  ? 40.943  -36.734  59.052  1.00 91.45  ? 92  ARG B N     1 
ATOM   4181  C  CA    . ARG B  1 92  ? 41.394  -36.528  57.680  1.00 90.42  ? 92  ARG B CA    1 
ATOM   4182  C  C     . ARG B  1 92  ? 40.970  -37.683  56.774  1.00 91.85  ? 92  ARG B C     1 
ATOM   4183  O  O     . ARG B  1 92  ? 40.640  -38.770  57.247  1.00 93.82  ? 92  ARG B O     1 
ATOM   4184  C  CB    . ARG B  1 92  ? 42.909  -36.400  57.640  1.00 90.93  ? 92  ARG B CB    1 
ATOM   4185  C  CG    . ARG B  1 92  ? 43.420  -35.005  57.878  1.00 89.25  ? 92  ARG B CG    1 
ATOM   4186  C  CD    . ARG B  1 92  ? 44.851  -34.881  57.398  1.00 89.62  ? 92  ARG B CD    1 
ATOM   4187  N  NE    . ARG B  1 92  ? 44.974  -35.297  56.004  1.00 88.69  ? 92  ARG B NE    1 
ATOM   4188  C  CZ    . ARG B  1 92  ? 46.122  -35.478  55.363  1.00 89.08  ? 92  ARG B CZ    1 
ATOM   4189  N  NH1   . ARG B  1 92  ? 47.283  -35.288  55.979  1.00 90.02  ? 92  ARG B NH1   1 
ATOM   4190  N  NH2   . ARG B  1 92  ? 46.101  -35.854  54.096  1.00 89.22  ? 92  ARG B NH2   1 
ATOM   4191  N  N     . THR B  1 93  ? 40.980  -37.443  55.469  1.00 91.30  ? 93  THR B N     1 
ATOM   4192  C  CA    . THR B  1 93  ? 40.644  -38.479  54.500  1.00 93.24  ? 93  THR B CA    1 
ATOM   4193  C  C     . THR B  1 93  ? 41.847  -38.733  53.612  1.00 94.13  ? 93  THR B C     1 
ATOM   4194  O  O     . THR B  1 93  ? 42.002  -39.819  53.057  1.00 96.41  ? 93  THR B O     1 
ATOM   4195  C  CB    . THR B  1 93  ? 39.434  -38.066  53.626  1.00 92.31  ? 93  THR B CB    1 
ATOM   4196  O  OG1   . THR B  1 93  ? 38.366  -37.619  54.473  1.00 91.53  ? 93  THR B OG1   1 
ATOM   4197  C  CG2   . THR B  1 93  ? 38.936  -39.239  52.772  1.00 94.73  ? 93  THR B CG2   1 
ATOM   4198  N  N     . GLY B  1 94  ? 42.700  -37.720  53.496  1.00 92.68  ? 94  GLY B N     1 
ATOM   4199  C  CA    . GLY B  1 94  ? 43.821  -37.749  52.571  1.00 93.25  ? 94  GLY B CA    1 
ATOM   4200  C  C     . GLY B  1 94  ? 43.360  -37.621  51.131  1.00 93.19  ? 94  GLY B C     1 
ATOM   4201  O  O     . GLY B  1 94  ? 44.107  -37.949  50.209  1.00 94.54  ? 94  GLY B O     1 
ATOM   4202  N  N     . ASN B  1 95  ? 42.134  -37.137  50.931  1.00 91.97  ? 95  ASN B N     1 
ATOM   4203  C  CA    . ASN B  1 95  ? 41.558  -37.031  49.593  1.00 92.03  ? 95  ASN B CA    1 
ATOM   4204  C  C     . ASN B  1 95  ? 40.836  -35.730  49.309  1.00 89.80  ? 95  ASN B C     1 
ATOM   4205  O  O     . ASN B  1 95  ? 39.925  -35.350  50.044  1.00 88.64  ? 95  ASN B O     1 
ATOM   4206  C  CB    . ASN B  1 95  ? 40.586  -38.181  49.348  1.00 94.14  ? 95  ASN B CB    1 
ATOM   4207  C  CG    . ASN B  1 95  ? 41.280  -39.501  49.227  1.00 97.16  ? 95  ASN B CG    1 
ATOM   4208  O  OD1   . ASN B  1 95  ? 42.267  -39.630  48.506  1.00 98.85  ? 95  ASN B OD1   1 
ATOM   4209  N  ND2   . ASN B  1 95  ? 40.773  -40.502  49.933  1.00 99.60  ? 95  ASN B ND2   1 
ATOM   4210  N  N     . ILE B  1 96  ? 41.236  -35.070  48.224  1.00 89.40  ? 96  ILE B N     1 
ATOM   4211  C  CA    . ILE B  1 96  ? 40.447  -33.992  47.632  1.00 88.24  ? 96  ILE B CA    1 
ATOM   4212  C  C     . ILE B  1 96  ? 39.050  -34.563  47.396  1.00 89.47  ? 96  ILE B C     1 
ATOM   4213  O  O     . ILE B  1 96  ? 38.908  -35.761  47.120  1.00 91.54  ? 96  ILE B O     1 
ATOM   4214  C  CB    . ILE B  1 96  ? 41.049  -33.485  46.279  1.00 88.54  ? 96  ILE B CB    1 
ATOM   4215  C  CG1   . ILE B  1 96  ? 42.510  -33.032  46.428  1.00 87.68  ? 96  ILE B CG1   1 
ATOM   4216  C  CG2   . ILE B  1 96  ? 40.192  -32.379  45.658  1.00 87.85  ? 96  ILE B CG2   1 
ATOM   4217  C  CD1   . ILE B  1 96  ? 42.784  -32.040  47.550  1.00 85.96  ? 96  ILE B CD1   1 
ATOM   4218  N  N     . VAL B  1 97  ? 38.024  -33.721  47.533  1.00 88.49  ? 97  VAL B N     1 
ATOM   4219  C  CA    . VAL B  1 97  ? 36.641  -34.152  47.336  1.00 89.38  ? 97  VAL B CA    1 
ATOM   4220  C  C     . VAL B  1 97  ? 36.540  -34.851  45.991  1.00 91.93  ? 97  VAL B C     1 
ATOM   4221  O  O     . VAL B  1 97  ? 36.820  -34.248  44.952  1.00 92.24  ? 97  VAL B O     1 
ATOM   4222  C  CB    . VAL B  1 97  ? 35.647  -32.977  47.412  1.00 87.85  ? 97  VAL B CB    1 
ATOM   4223  C  CG1   . VAL B  1 97  ? 34.218  -33.472  47.216  1.00 89.23  ? 97  VAL B CG1   1 
ATOM   4224  C  CG2   . VAL B  1 97  ? 35.771  -32.272  48.742  1.00 85.49  ? 97  VAL B CG2   1 
ATOM   4225  N  N     . ASP B  1 98  ? 36.168  -36.130  46.033  1.00 86.44  ? 98  ASP B N     1 
ATOM   4226  C  CA    . ASP B  1 98  ? 36.170  -36.986  44.853  1.00 87.71  ? 98  ASP B CA    1 
ATOM   4227  C  C     . ASP B  1 98  ? 34.952  -37.915  44.784  1.00 87.89  ? 98  ASP B C     1 
ATOM   4228  O  O     . ASP B  1 98  ? 34.181  -38.014  45.742  1.00 87.31  ? 98  ASP B O     1 
ATOM   4229  C  CB    . ASP B  1 98  ? 37.471  -37.802  44.802  1.00 90.23  ? 98  ASP B CB    1 
ATOM   4230  C  CG    . ASP B  1 98  ? 37.607  -38.785  45.962  1.00 91.87  ? 98  ASP B CG    1 
ATOM   4231  O  OD1   . ASP B  1 98  ? 37.090  -38.515  47.071  1.00 91.52  ? 98  ASP B OD1   1 
ATOM   4232  O  OD2   . ASP B  1 98  ? 38.250  -39.832  45.761  1.00 93.53  ? 98  ASP B OD2   1 
ATOM   4233  N  N     . VAL B  1 99  ? 34.794  -38.589  43.644  1.00 88.85  ? 99  VAL B N     1 
ATOM   4234  C  CA    . VAL B  1 99  ? 33.713  -39.559  43.442  1.00 89.40  ? 99  VAL B CA    1 
ATOM   4235  C  C     . VAL B  1 99  ? 34.208  -40.911  42.984  1.00 91.89  ? 99  VAL B C     1 
ATOM   4236  O  O     . VAL B  1 99  ? 35.272  -40.999  42.371  1.00 92.98  ? 99  VAL B O     1 
ATOM   4237  C  CB    . VAL B  1 99  ? 32.712  -39.126  42.348  1.00 87.98  ? 99  VAL B CB    1 
ATOM   4238  C  CG1   . VAL B  1 99  ? 31.356  -38.810  42.952  1.00 86.72  ? 99  VAL B CG1   1 
ATOM   4239  C  CG2   . VAL B  1 99  ? 33.278  -38.004  41.488  1.00 87.20  ? 99  VAL B CG2   1 
ATOM   4240  N  N     . PRO B  1 100 ? 33.421  -41.970  43.270  1.00 92.97  ? 100 PRO B N     1 
ATOM   4241  C  CA    . PRO B  1 100 ? 33.552  -43.221  42.532  1.00 95.10  ? 100 PRO B CA    1 
ATOM   4242  C  C     . PRO B  1 100 ? 33.077  -43.012  41.095  1.00 94.53  ? 100 PRO B C     1 
ATOM   4243  O  O     . PRO B  1 100 ? 31.923  -42.636  40.874  1.00 93.11  ? 100 PRO B O     1 
ATOM   4244  C  CB    . PRO B  1 100 ? 32.601  -44.171  43.271  1.00 95.75  ? 100 PRO B CB    1 
ATOM   4245  C  CG    . PRO B  1 100 ? 32.408  -43.564  44.619  1.00 94.74  ? 100 PRO B CG    1 
ATOM   4246  C  CD    . PRO B  1 100 ? 32.481  -42.093  44.401  1.00 92.41  ? 100 PRO B CD    1 
ATOM   4247  N  N     . VAL B  1 101 ? 33.974  -43.225  40.135  1.00 95.83  ? 101 VAL B N     1 
ATOM   4248  C  CA    . VAL B  1 101 ? 33.641  -43.123  38.711  1.00 95.58  ? 101 VAL B CA    1 
ATOM   4249  C  C     . VAL B  1 101 ? 33.599  -44.510  38.084  1.00 97.86  ? 101 VAL B C     1 
ATOM   4250  O  O     . VAL B  1 101 ? 33.806  -45.513  38.776  1.00 99.66  ? 101 VAL B O     1 
ATOM   4251  C  CB    . VAL B  1 101 ? 34.657  -42.247  37.936  1.00 95.45  ? 101 VAL B CB    1 
ATOM   4252  C  CG1   . VAL B  1 101 ? 34.583  -40.795  38.408  1.00 93.13  ? 101 VAL B CG1   1 
ATOM   4253  C  CG2   . VAL B  1 101 ? 36.091  -42.820  38.039  1.00 97.36  ? 101 VAL B CG2   1 
ATOM   4254  N  N     . GLY B  1 102 ? 33.327  -44.568  36.782  1.00 97.92  ? 102 GLY B N     1 
ATOM   4255  C  CA    . GLY B  1 102 ? 33.431  -45.828  36.043  1.00 100.16 ? 102 GLY B CA    1 
ATOM   4256  C  C     . GLY B  1 102 ? 32.119  -46.518  35.707  1.00 100.08 ? 102 GLY B C     1 
ATOM   4257  O  O     . GLY B  1 102 ? 31.052  -46.121  36.196  1.00 98.50  ? 102 GLY B O     1 
ATOM   4258  N  N     . PRO B  1 103 ? 32.196  -47.572  34.875  1.00 101.86 ? 103 PRO B N     1 
ATOM   4259  C  CA    . PRO B  1 103 ? 31.054  -48.258  34.271  1.00 102.13 ? 103 PRO B CA    1 
ATOM   4260  C  C     . PRO B  1 103 ? 30.195  -49.036  35.258  1.00 102.38 ? 103 PRO B C     1 
ATOM   4261  O  O     . PRO B  1 103 ? 29.018  -49.258  34.986  1.00 102.01 ? 103 PRO B O     1 
ATOM   4262  C  CB    . PRO B  1 103 ? 31.706  -49.208  33.278  1.00 104.57 ? 103 PRO B CB    1 
ATOM   4263  C  CG    . PRO B  1 103 ? 33.041  -49.465  33.843  1.00 106.25 ? 103 PRO B CG    1 
ATOM   4264  C  CD    . PRO B  1 103 ? 33.470  -48.188  34.478  1.00 104.10 ? 103 PRO B CD    1 
ATOM   4265  N  N     . GLY B  1 104 ? 30.765  -49.433  36.393  1.00 103.08 ? 104 GLY B N     1 
ATOM   4266  C  CA    . GLY B  1 104 ? 30.007  -50.146  37.423  1.00 103.56 ? 104 GLY B CA    1 
ATOM   4267  C  C     . GLY B  1 104 ? 28.917  -49.325  38.099  1.00 101.23 ? 104 GLY B C     1 
ATOM   4268  O  O     . GLY B  1 104 ? 28.245  -49.809  39.014  1.00 101.47 ? 104 GLY B O     1 
ATOM   4269  N  N     . LEU B  1 105 ? 28.754  -48.080  37.648  1.00 99.11  ? 105 LEU B N     1 
ATOM   4270  C  CA    . LEU B  1 105 ? 27.711  -47.171  38.140  1.00 96.74  ? 105 LEU B CA    1 
ATOM   4271  C  C     . LEU B  1 105 ? 26.457  -47.199  37.256  1.00 96.30  ? 105 LEU B C     1 
ATOM   4272  O  O     . LEU B  1 105 ? 25.356  -46.902  37.724  1.00 95.14  ? 105 LEU B O     1 
ATOM   4273  C  CB    . LEU B  1 105 ? 28.238  -45.730  38.231  1.00 94.61  ? 105 LEU B CB    1 
ATOM   4274  C  CG    . LEU B  1 105 ? 28.973  -45.224  39.475  1.00 93.54  ? 105 LEU B CG    1 
ATOM   4275  C  CD1   . LEU B  1 105 ? 30.446  -45.539  39.402  1.00 94.84  ? 105 LEU B CD1   1 
ATOM   4276  C  CD2   . LEU B  1 105 ? 28.784  -43.731  39.598  1.00 90.78  ? 105 LEU B CD2   1 
ATOM   4277  N  N     . LEU B  1 106 ? 26.633  -47.539  35.980  1.00 97.15  ? 106 LEU B N     1 
ATOM   4278  C  CA    . LEU B  1 106 ? 25.517  -47.657  35.051  1.00 97.03  ? 106 LEU B CA    1 
ATOM   4279  C  C     . LEU B  1 106 ? 24.341  -48.358  35.730  1.00 97.70  ? 106 LEU B C     1 
ATOM   4280  O  O     . LEU B  1 106 ? 24.502  -49.423  36.327  1.00 99.51  ? 106 LEU B O     1 
ATOM   4281  C  CB    . LEU B  1 106 ? 25.956  -48.426  33.803  1.00 98.81  ? 106 LEU B CB    1 
ATOM   4282  C  CG    . LEU B  1 106 ? 26.565  -47.721  32.580  1.00 98.15  ? 106 LEU B CG    1 
ATOM   4283  C  CD1   . LEU B  1 106 ? 26.802  -46.231  32.775  1.00 95.66  ? 106 LEU B CD1   1 
ATOM   4284  C  CD2   . LEU B  1 106 ? 27.843  -48.436  32.113  1.00 99.55  ? 106 LEU B CD2   1 
ATOM   4285  N  N     . GLY B  1 107 ? 23.171  -47.733  35.676  1.00 96.46  ? 107 GLY B N     1 
ATOM   4286  C  CA    . GLY B  1 107 ? 21.965  -48.326  36.246  1.00 96.96  ? 107 GLY B CA    1 
ATOM   4287  C  C     . GLY B  1 107 ? 21.712  -47.975  37.699  1.00 96.06  ? 107 GLY B C     1 
ATOM   4288  O  O     . GLY B  1 107 ? 20.655  -48.297  38.237  1.00 96.35  ? 107 GLY B O     1 
ATOM   4289  N  N     . ARG B  1 108 ? 22.667  -47.305  38.338  1.00 95.07  ? 108 ARG B N     1 
ATOM   4290  C  CA    . ARG B  1 108 ? 22.531  -46.951  39.754  1.00 94.22  ? 108 ARG B CA    1 
ATOM   4291  C  C     . ARG B  1 108 ? 22.029  -45.521  39.973  1.00 91.92  ? 108 ARG B C     1 
ATOM   4292  O  O     . ARG B  1 108 ? 22.104  -44.679  39.072  1.00 90.64  ? 108 ARG B O     1 
ATOM   4293  C  CB    . ARG B  1 108 ? 23.859  -47.149  40.493  1.00 94.80  ? 108 ARG B CB    1 
ATOM   4294  C  CG    . ARG B  1 108 ? 24.564  -48.486  40.249  1.00 96.84  ? 108 ARG B CG    1 
ATOM   4295  C  CD    . ARG B  1 108 ? 23.812  -49.650  40.855  1.00 98.30  ? 108 ARG B CD    1 
ATOM   4296  N  NE    . ARG B  1 108 ? 23.303  -49.364  42.197  1.00 97.04  ? 108 ARG B NE    1 
ATOM   4297  C  CZ    . ARG B  1 108 ? 23.930  -49.667  43.332  1.00 97.53  ? 108 ARG B CZ    1 
ATOM   4298  N  NH1   . ARG B  1 108 ? 25.117  -50.268  43.321  1.00 98.24  ? 108 ARG B NH1   1 
ATOM   4299  N  NH2   . ARG B  1 108 ? 23.360  -49.364  44.490  1.00 96.92  ? 108 ARG B NH2   1 
ATOM   4300  N  N     . VAL B  1 109 ? 21.512  -45.270  41.178  1.00 91.49  ? 109 VAL B N     1 
ATOM   4301  C  CA    . VAL B  1 109 ? 21.107  -43.929  41.621  1.00 89.51  ? 109 VAL B CA    1 
ATOM   4302  C  C     . VAL B  1 109 ? 21.910  -43.534  42.858  1.00 89.10  ? 109 VAL B C     1 
ATOM   4303  O  O     . VAL B  1 109 ? 21.850  -44.196  43.897  1.00 90.08  ? 109 VAL B O     1 
ATOM   4304  C  CB    . VAL B  1 109 ? 19.591  -43.841  41.927  1.00 89.14  ? 109 VAL B CB    1 
ATOM   4305  C  CG1   . VAL B  1 109 ? 19.259  -42.556  42.648  1.00 87.16  ? 109 VAL B CG1   1 
ATOM   4306  C  CG2   . VAL B  1 109 ? 18.796  -43.906  40.651  1.00 89.67  ? 109 VAL B CG2   1 
ATOM   4307  N  N     . VAL B  1 110 ? 22.666  -42.449  42.737  1.00 87.88  ? 110 VAL B N     1 
ATOM   4308  C  CA    . VAL B  1 110 ? 23.539  -42.006  43.822  1.00 87.59  ? 110 VAL B CA    1 
ATOM   4309  C  C     . VAL B  1 110 ? 23.288  -40.559  44.279  1.00 85.73  ? 110 VAL B C     1 
ATOM   4310  O  O     . VAL B  1 110 ? 22.775  -39.720  43.527  1.00 84.28  ? 110 VAL B O     1 
ATOM   4311  C  CB    . VAL B  1 110 ? 25.056  -42.250  43.496  1.00 88.30  ? 110 VAL B CB    1 
ATOM   4312  C  CG1   . VAL B  1 110 ? 25.328  -43.724  43.362  1.00 90.75  ? 110 VAL B CG1   1 
ATOM   4313  C  CG2   . VAL B  1 110 ? 25.498  -41.524  42.224  1.00 87.41  ? 110 VAL B CG2   1 
ATOM   4314  N  N     . ASP B  1 111 ? 23.646  -40.286  45.529  1.00 85.75  ? 111 ASP B N     1 
ATOM   4315  C  CA    . ASP B  1 111 ? 23.692  -38.927  46.031  1.00 84.45  ? 111 ASP B CA    1 
ATOM   4316  C  C     . ASP B  1 111 ? 24.922  -38.193  45.471  1.00 84.13  ? 111 ASP B C     1 
ATOM   4317  O  O     . ASP B  1 111 ? 25.624  -38.710  44.599  1.00 85.02  ? 111 ASP B O     1 
ATOM   4318  C  CB    . ASP B  1 111 ? 23.677  -38.927  47.566  1.00 84.68  ? 111 ASP B CB    1 
ATOM   4319  C  CG    . ASP B  1 111 ? 25.011  -39.350  48.182  1.00 85.86  ? 111 ASP B CG    1 
ATOM   4320  O  OD1   . ASP B  1 111 ? 26.064  -39.217  47.523  1.00 85.86  ? 111 ASP B OD1   1 
ATOM   4321  O  OD2   . ASP B  1 111 ? 25.007  -39.798  49.348  1.00 86.90  ? 111 ASP B OD2   1 
ATOM   4322  N  N     . ALA B  1 112 ? 25.194  -37.000  45.991  1.00 83.19  ? 112 ALA B N     1 
ATOM   4323  C  CA    . ALA B  1 112 ? 26.259  -36.156  45.450  1.00 82.89  ? 112 ALA B CA    1 
ATOM   4324  C  C     . ALA B  1 112 ? 27.678  -36.725  45.595  1.00 84.33  ? 112 ALA B C     1 
ATOM   4325  O  O     . ALA B  1 112 ? 28.512  -36.535  44.710  1.00 84.44  ? 112 ALA B O     1 
ATOM   4326  C  CB    . ALA B  1 112 ? 26.177  -34.770  46.051  1.00 81.53  ? 112 ALA B CB    1 
ATOM   4327  N  N     . LEU B  1 113 ? 27.943  -37.415  46.703  1.00 85.68  ? 113 LEU B N     1 
ATOM   4328  C  CA    . LEU B  1 113 ? 29.283  -37.956  46.993  1.00 87.47  ? 113 LEU B CA    1 
ATOM   4329  C  C     . LEU B  1 113 ? 29.555  -39.365  46.414  1.00 89.44  ? 113 LEU B C     1 
ATOM   4330  O  O     . LEU B  1 113 ? 30.686  -39.855  46.459  1.00 90.81  ? 113 LEU B O     1 
ATOM   4331  C  CB    . LEU B  1 113 ? 29.566  -37.917  48.503  1.00 87.84  ? 113 LEU B CB    1 
ATOM   4332  C  CG    . LEU B  1 113 ? 29.838  -36.533  49.107  1.00 86.94  ? 113 LEU B CG    1 
ATOM   4333  C  CD1   . LEU B  1 113 ? 29.532  -36.502  50.602  1.00 87.51  ? 113 LEU B CD1   1 
ATOM   4334  C  CD2   . LEU B  1 113 ? 31.273  -36.079  48.836  1.00 87.59  ? 113 LEU B CD2   1 
ATOM   4335  N  N     . GLY B  1 114 ? 28.525  -39.998  45.861  1.00 89.58  ? 114 GLY B N     1 
ATOM   4336  C  CA    . GLY B  1 114 ? 28.684  -41.298  45.238  1.00 91.38  ? 114 GLY B CA    1 
ATOM   4337  C  C     . GLY B  1 114 ? 27.937  -42.397  45.959  1.00 92.69  ? 114 GLY B C     1 
ATOM   4338  O  O     . GLY B  1 114 ? 27.664  -43.447  45.377  1.00 94.12  ? 114 GLY B O     1 
ATOM   4339  N  N     . ASN B  1 115 ? 27.617  -42.166  47.229  1.00 92.39  ? 115 ASN B N     1 
ATOM   4340  C  CA    . ASN B  1 115 ? 26.874  -43.143  48.030  1.00 93.90  ? 115 ASN B CA    1 
ATOM   4341  C  C     . ASN B  1 115 ? 25.549  -43.531  47.360  1.00 93.83  ? 115 ASN B C     1 
ATOM   4342  O  O     . ASN B  1 115 ? 24.843  -42.655  46.846  1.00 92.53  ? 115 ASN B O     1 
ATOM   4343  C  CB    . ASN B  1 115 ? 26.615  -42.608  49.443  1.00 93.26  ? 115 ASN B CB    1 
ATOM   4344  C  CG    . ASN B  1 115 ? 27.835  -41.944  50.051  1.00 93.43  ? 115 ASN B CG    1 
ATOM   4345  O  OD1   . ASN B  1 115 ? 28.512  -42.521  50.900  1.00 94.87  ? 115 ASN B OD1   1 
ATOM   4346  N  ND2   . ASN B  1 115 ? 28.119  -40.719  49.619  1.00 92.87  ? 115 ASN B ND2   1 
ATOM   4347  N  N     . PRO B  1 116 ? 25.206  -44.837  47.358  1.00 95.51  ? 116 PRO B N     1 
ATOM   4348  C  CA    . PRO B  1 116 ? 24.010  -45.296  46.643  1.00 95.56  ? 116 PRO B CA    1 
ATOM   4349  C  C     . PRO B  1 116 ? 22.731  -45.152  47.462  1.00 95.02  ? 116 PRO B C     1 
ATOM   4350  O  O     . PRO B  1 116 ? 22.754  -45.354  48.677  1.00 95.69  ? 116 PRO B O     1 
ATOM   4351  C  CB    . PRO B  1 116 ? 24.308  -46.767  46.378  1.00 97.95  ? 116 PRO B CB    1 
ATOM   4352  C  CG    . PRO B  1 116 ? 25.328  -47.162  47.417  1.00 99.47  ? 116 PRO B CG    1 
ATOM   4353  C  CD    . PRO B  1 116 ? 25.869  -45.934  48.082  1.00 97.54  ? 116 PRO B CD    1 
ATOM   4354  N  N     . ILE B  1 117 ? 21.628  -44.812  46.797  1.00 94.03  ? 117 ILE B N     1 
ATOM   4355  C  CA    . ILE B  1 117 ? 20.346  -44.581  47.477  1.00 93.52  ? 117 ILE B CA    1 
ATOM   4356  C  C     . ILE B  1 117 ? 19.150  -45.375  46.913  1.00 94.79  ? 117 ILE B C     1 
ATOM   4357  O  O     . ILE B  1 117 ? 18.032  -45.295  47.446  1.00 94.60  ? 117 ILE B O     1 
ATOM   4358  C  CB    . ILE B  1 117 ? 20.008  -43.079  47.540  1.00 91.21  ? 117 ILE B CB    1 
ATOM   4359  C  CG1   . ILE B  1 117 ? 20.202  -42.425  46.165  1.00 89.78  ? 117 ILE B CG1   1 
ATOM   4360  C  CG2   . ILE B  1 117 ? 20.863  -42.399  48.608  1.00 90.68  ? 117 ILE B CG2   1 
ATOM   4361  C  CD1   . ILE B  1 117 ? 19.397  -41.159  45.949  1.00 87.10  ? 117 ILE B CD1   1 
ATOM   4362  N  N     . ASP B  1 118 ? 19.395  -46.147  45.851  1.00 96.21  ? 118 ASP B N     1 
ATOM   4363  C  CA    . ASP B  1 118 ? 18.381  -47.045  45.276  1.00 97.83  ? 118 ASP B CA    1 
ATOM   4364  C  C     . ASP B  1 118 ? 18.368  -48.431  45.937  1.00 100.23 ? 118 ASP B C     1 
ATOM   4365  O  O     . ASP B  1 118 ? 17.656  -49.335  45.490  1.00 101.70 ? 118 ASP B O     1 
ATOM   4366  C  CB    . ASP B  1 118 ? 18.502  -47.139  43.738  1.00 98.03  ? 118 ASP B CB    1 
ATOM   4367  C  CG    . ASP B  1 118 ? 19.876  -47.626  43.261  1.00 99.32  ? 118 ASP B CG    1 
ATOM   4368  O  OD1   . ASP B  1 118 ? 20.716  -48.042  44.093  1.00 100.28 ? 118 ASP B OD1   1 
ATOM   4369  O  OD2   . ASP B  1 118 ? 20.111  -47.598  42.028  1.00 99.48  ? 118 ASP B OD2   1 
ATOM   4370  N  N     . GLY B  1 119 ? 19.154  -48.570  47.006  1.00 100.82 ? 119 GLY B N     1 
ATOM   4371  C  CA    . GLY B  1 119 ? 19.199  -49.778  47.835  1.00 103.45 ? 119 GLY B CA    1 
ATOM   4372  C  C     . GLY B  1 119 ? 19.718  -51.031  47.148  1.00 105.91 ? 119 GLY B C     1 
ATOM   4373  O  O     . GLY B  1 119 ? 19.345  -52.145  47.519  1.00 108.11 ? 119 GLY B O     1 
ATOM   4374  N  N     . LYS B  1 120 ? 20.595  -50.855  46.163  1.00 105.73 ? 120 LYS B N     1 
ATOM   4375  C  CA    . LYS B  1 120 ? 21.015  -51.961  45.307  1.00 107.81 ? 120 LYS B CA    1 
ATOM   4376  C  C     . LYS B  1 120 ? 22.457  -52.422  45.558  1.00 109.26 ? 120 LYS B C     1 
ATOM   4377  O  O     . LYS B  1 120 ? 23.122  -52.950  44.662  1.00 110.30 ? 120 LYS B O     1 
ATOM   4378  C  CB    . LYS B  1 120 ? 20.771  -51.603  43.833  1.00 106.98 ? 120 LYS B CB    1 
ATOM   4379  C  CG    . LYS B  1 120 ? 19.351  -51.127  43.562  1.00 105.42 ? 120 LYS B CG    1 
ATOM   4380  C  CD    . LYS B  1 120 ? 18.923  -51.364  42.136  1.00 105.85 ? 120 LYS B CD    1 
ATOM   4381  C  CE    . LYS B  1 120 ? 17.483  -50.921  41.941  1.00 105.33 ? 120 LYS B CE    1 
ATOM   4382  N  NZ    . LYS B  1 120 ? 16.934  -51.357  40.626  1.00 106.33 ? 120 LYS B NZ    1 
ATOM   4383  N  N     . GLY B  1 121 ? 22.925  -52.228  46.788  1.00 109.54 ? 121 GLY B N     1 
ATOM   4384  C  CA    . GLY B  1 121 ? 24.270  -52.643  47.188  1.00 111.53 ? 121 GLY B CA    1 
ATOM   4385  C  C     . GLY B  1 121 ? 25.362  -51.594  46.991  1.00 110.39 ? 121 GLY B C     1 
ATOM   4386  O  O     . GLY B  1 121 ? 25.086  -50.481  46.525  1.00 108.09 ? 121 GLY B O     1 
ATOM   4387  N  N     . PRO B  1 122 ? 26.614  -51.941  47.360  1.00 112.03 ? 122 PRO B N     1 
ATOM   4388  C  CA    . PRO B  1 122 ? 27.784  -51.085  47.121  1.00 111.26 ? 122 PRO B CA    1 
ATOM   4389  C  C     . PRO B  1 122 ? 28.005  -50.778  45.632  1.00 110.75 ? 122 PRO B C     1 
ATOM   4390  O  O     . PRO B  1 122 ? 27.607  -51.569  44.774  1.00 111.93 ? 122 PRO B O     1 
ATOM   4391  C  CB    . PRO B  1 122 ? 28.942  -51.930  47.667  1.00 113.73 ? 122 PRO B CB    1 
ATOM   4392  C  CG    . PRO B  1 122 ? 28.315  -52.777  48.720  1.00 114.94 ? 122 PRO B CG    1 
ATOM   4393  C  CD    . PRO B  1 122 ? 26.968  -53.130  48.161  1.00 114.68 ? 122 PRO B CD    1 
ATOM   4394  N  N     . ILE B  1 123 ? 28.629  -49.639  45.336  1.00 109.10 ? 123 ILE B N     1 
ATOM   4395  C  CA    . ILE B  1 123 ? 28.911  -49.249  43.951  1.00 108.57 ? 123 ILE B CA    1 
ATOM   4396  C  C     . ILE B  1 123 ? 30.124  -49.987  43.399  1.00 110.64 ? 123 ILE B C     1 
ATOM   4397  O  O     . ILE B  1 123 ? 31.187  -50.009  44.025  1.00 111.58 ? 123 ILE B O     1 
ATOM   4398  C  CB    . ILE B  1 123 ? 29.138  -47.722  43.798  1.00 106.14 ? 123 ILE B CB    1 
ATOM   4399  C  CG1   . ILE B  1 123 ? 27.886  -46.922  44.198  1.00 104.51 ? 123 ILE B CG1   1 
ATOM   4400  C  CG2   . ILE B  1 123 ? 29.573  -47.380  42.375  1.00 106.00 ? 123 ILE B CG2   1 
ATOM   4401  C  CD1   . ILE B  1 123 ? 26.646  -47.163  43.329  1.00 104.34 ? 123 ILE B CD1   1 
ATOM   4402  N  N     . ASP B  1 124 ? 29.951  -50.574  42.216  1.00 111.49 ? 124 ASP B N     1 
ATOM   4403  C  CA    . ASP B  1 124 ? 31.009  -51.296  41.515  1.00 113.46 ? 124 ASP B CA    1 
ATOM   4404  C  C     . ASP B  1 124 ? 32.056  -50.304  40.982  1.00 112.18 ? 124 ASP B C     1 
ATOM   4405  O  O     . ASP B  1 124 ? 32.037  -49.923  39.808  1.00 111.58 ? 124 ASP B O     1 
ATOM   4406  C  CB    . ASP B  1 124 ? 30.390  -52.143  40.396  1.00 114.74 ? 124 ASP B CB    1 
ATOM   4407  C  CG    . ASP B  1 124 ? 31.407  -52.991  39.663  1.00 117.80 ? 124 ASP B CG    1 
ATOM   4408  O  OD1   . ASP B  1 124 ? 32.408  -53.406  40.287  1.00 120.17 ? 124 ASP B OD1   1 
ATOM   4409  O  OD2   . ASP B  1 124 ? 31.199  -53.249  38.457  1.00 118.86 ? 124 ASP B OD2   1 
ATOM   4410  N  N     . ALA B  1 125 ? 32.966  -49.897  41.866  1.00 111.75 ? 125 ALA B N     1 
ATOM   4411  C  CA    . ALA B  1 125 ? 33.897  -48.802  41.594  1.00 110.24 ? 125 ALA B CA    1 
ATOM   4412  C  C     . ALA B  1 125 ? 35.074  -49.189  40.700  1.00 111.86 ? 125 ALA B C     1 
ATOM   4413  O  O     . ALA B  1 125 ? 35.943  -49.962  41.106  1.00 114.30 ? 125 ALA B O     1 
ATOM   4414  C  CB    . ALA B  1 125 ? 34.400  -48.200  42.908  1.00 109.75 ? 125 ALA B CB    1 
ATOM   4415  N  N     . ALA B  1 126 ? 35.097  -48.644  39.485  1.00 110.50 ? 126 ALA B N     1 
ATOM   4416  C  CA    . ALA B  1 126 ? 36.251  -48.772  38.600  1.00 111.60 ? 126 ALA B CA    1 
ATOM   4417  C  C     . ALA B  1 126 ? 37.436  -48.004  39.181  1.00 111.25 ? 126 ALA B C     1 
ATOM   4418  O  O     . ALA B  1 126 ? 38.592  -48.342  38.935  1.00 113.20 ? 126 ALA B O     1 
ATOM   4419  C  CB    . ALA B  1 126 ? 35.915  -48.249  37.221  1.00 110.48 ? 126 ALA B CB    1 
ATOM   4420  N  N     . GLY B  1 127 ? 37.126  -46.973  39.962  1.00 108.80 ? 127 GLY B N     1 
ATOM   4421  C  CA    . GLY B  1 127 ? 38.124  -46.095  40.561  1.00 108.12 ? 127 GLY B CA    1 
ATOM   4422  C  C     . GLY B  1 127 ? 37.491  -44.778  40.975  1.00 104.92 ? 127 GLY B C     1 
ATOM   4423  O  O     . GLY B  1 127 ? 36.268  -44.622  40.921  1.00 103.24 ? 127 GLY B O     1 
ATOM   4424  N  N     . ARG B  1 128 ? 38.326  -43.827  41.383  1.00 104.13 ? 128 ARG B N     1 
ATOM   4425  C  CA    . ARG B  1 128 ? 37.847  -42.539  41.886  1.00 101.21 ? 128 ARG B CA    1 
ATOM   4426  C  C     . ARG B  1 128 ? 38.490  -41.351  41.149  1.00 100.30 ? 128 ARG B C     1 
ATOM   4427  O  O     . ARG B  1 128 ? 39.650  -41.427  40.731  1.00 102.03 ? 128 ARG B O     1 
ATOM   4428  C  CB    . ARG B  1 128 ? 38.054  -42.449  43.410  1.00 101.16 ? 128 ARG B CB    1 
ATOM   4429  C  CG    . ARG B  1 128 ? 37.217  -43.469  44.216  1.00 101.12 ? 128 ARG B CG    1 
ATOM   4430  C  CD    . ARG B  1 128 ? 37.411  -43.374  45.735  1.00 99.60  ? 128 ARG B CD    1 
ATOM   4431  N  NE    . ARG B  1 128 ? 36.846  -42.148  46.297  1.00 96.46  ? 128 ARG B NE    1 
ATOM   4432  C  CZ    . ARG B  1 128 ? 35.606  -42.012  46.765  1.00 94.38  ? 128 ARG B CZ    1 
ATOM   4433  N  NH1   . ARG B  1 128 ? 34.753  -43.028  46.760  1.00 94.74  ? 128 ARG B NH1   1 
ATOM   4434  N  NH2   . ARG B  1 128 ? 35.218  -40.843  47.248  1.00 92.00  ? 128 ARG B NH2   1 
ATOM   4435  N  N     . SER B  1 129 ? 37.719  -40.277  40.970  1.00 97.69  ? 129 SER B N     1 
ATOM   4436  C  CA    . SER B  1 129 ? 38.183  -39.056  40.300  1.00 96.53  ? 129 SER B CA    1 
ATOM   4437  C  C     . SER B  1 129 ? 37.844  -37.860  41.153  1.00 94.50  ? 129 SER B C     1 
ATOM   4438  O  O     . SER B  1 129 ? 36.861  -37.887  41.897  1.00 93.57  ? 129 SER B O     1 
ATOM   4439  C  CB    . SER B  1 129 ? 37.487  -38.860  38.954  1.00 95.53  ? 129 SER B CB    1 
ATOM   4440  O  OG    . SER B  1 129 ? 37.837  -39.866  38.033  1.00 98.11  ? 129 SER B OG    1 
ATOM   4441  N  N     . ARG B  1 130 ? 38.630  -36.796  41.021  1.00 93.94  ? 130 ARG B N     1 
ATOM   4442  C  CA    . ARG B  1 130 ? 38.328  -35.546  41.711  1.00 91.80  ? 130 ARG B CA    1 
ATOM   4443  C  C     . ARG B  1 130 ? 37.032  -34.912  41.203  1.00 89.37  ? 130 ARG B C     1 
ATOM   4444  O  O     . ARG B  1 130 ? 36.736  -34.941  40.007  1.00 89.29  ? 130 ARG B O     1 
ATOM   4445  C  CB    . ARG B  1 130 ? 39.498  -34.569  41.603  1.00 92.05  ? 130 ARG B CB    1 
ATOM   4446  C  CG    . ARG B  1 130 ? 40.600  -34.883  42.579  1.00 94.43  ? 130 ARG B CG    1 
ATOM   4447  C  CD    . ARG B  1 130 ? 41.755  -33.916  42.474  1.00 96.77  ? 130 ARG B CD    1 
ATOM   4448  N  NE    . ARG B  1 130 ? 42.907  -34.417  43.225  1.00 100.53 ? 130 ARG B NE    1 
ATOM   4449  C  CZ    . ARG B  1 130 ? 44.112  -33.855  43.234  1.00 102.19 ? 130 ARG B CZ    1 
ATOM   4450  N  NH1   . ARG B  1 130 ? 44.337  -32.752  42.531  1.00 101.89 ? 130 ARG B NH1   1 
ATOM   4451  N  NH2   . ARG B  1 130 ? 45.095  -34.396  43.951  1.00 104.33 ? 130 ARG B NH2   1 
ATOM   4452  N  N     . ALA B  1 131 ? 36.255  -34.363  42.132  1.00 87.55  ? 131 ALA B N     1 
ATOM   4453  C  CA    . ALA B  1 131 ? 35.036  -33.632  41.805  1.00 85.22  ? 131 ALA B CA    1 
ATOM   4454  C  C     . ALA B  1 131 ? 35.350  -32.452  40.896  1.00 84.14  ? 131 ALA B C     1 
ATOM   4455  O  O     . ALA B  1 131 ? 34.684  -32.252  39.883  1.00 83.26  ? 131 ALA B O     1 
ATOM   4456  C  CB    . ALA B  1 131 ? 34.354  -33.158  43.074  1.00 84.02  ? 131 ALA B CB    1 
ATOM   4457  N  N     . GLN B  1 132 ? 36.377  -31.688  41.262  1.00 84.19  ? 132 GLN B N     1 
ATOM   4458  C  CA    . GLN B  1 132 ? 36.824  -30.556  40.463  1.00 83.71  ? 132 GLN B CA    1 
ATOM   4459  C  C     . GLN B  1 132 ? 38.081  -30.908  39.652  1.00 85.22  ? 132 GLN B C     1 
ATOM   4460  O  O     . GLN B  1 132 ? 39.116  -31.279  40.206  1.00 86.44  ? 132 GLN B O     1 
ATOM   4461  C  CB    . GLN B  1 132 ? 37.074  -29.336  41.351  1.00 82.95  ? 132 GLN B CB    1 
ATOM   4462  C  CG    . GLN B  1 132 ? 35.994  -29.083  42.418  1.00 82.96  ? 132 GLN B CG    1 
ATOM   4463  C  CD    . GLN B  1 132 ? 34.819  -28.226  41.940  1.00 82.33  ? 132 GLN B CD    1 
ATOM   4464  O  OE1   . GLN B  1 132 ? 34.937  -27.439  40.995  1.00 82.44  ? 132 GLN B OE1   1 
ATOM   4465  N  NE2   . GLN B  1 132 ? 33.683  -28.362  42.618  1.00 81.31  ? 132 GLN B NE2   1 
ATOM   4466  N  N     . VAL B  1 133 ? 37.956  -30.811  38.332  1.00 85.13  ? 133 VAL B N     1 
ATOM   4467  C  CA    . VAL B  1 133 ? 39.057  -31.031  37.401  1.00 86.81  ? 133 VAL B CA    1 
ATOM   4468  C  C     . VAL B  1 133 ? 39.082  -29.891  36.395  1.00 86.13  ? 133 VAL B C     1 
ATOM   4469  O  O     . VAL B  1 133 ? 38.036  -29.307  36.080  1.00 84.65  ? 133 VAL B O     1 
ATOM   4470  C  CB    . VAL B  1 133 ? 38.892  -32.332  36.577  1.00 88.19  ? 133 VAL B CB    1 
ATOM   4471  C  CG1   . VAL B  1 133 ? 40.270  -32.862  36.116  1.00 90.51  ? 133 VAL B CG1   1 
ATOM   4472  C  CG2   . VAL B  1 133 ? 38.128  -33.397  37.355  1.00 88.31  ? 133 VAL B CG2   1 
ATOM   4473  N  N     . LYS B  1 134 ? 40.270  -29.581  35.877  1.00 87.33  ? 134 LYS B N     1 
ATOM   4474  C  CA    . LYS B  1 134 ? 40.386  -28.595  34.811  1.00 86.82  ? 134 LYS B CA    1 
ATOM   4475  C  C     . LYS B  1 134 ? 39.859  -29.203  33.515  1.00 87.29  ? 134 LYS B C     1 
ATOM   4476  O  O     . LYS B  1 134 ? 40.146  -30.365  33.208  1.00 88.80  ? 134 LYS B O     1 
ATOM   4477  C  CB    . LYS B  1 134 ? 41.832  -28.126  34.646  1.00 88.15  ? 134 LYS B CB    1 
ATOM   4478  C  CG    . LYS B  1 134 ? 41.955  -26.720  34.085  1.00 86.92  ? 134 LYS B CG    1 
ATOM   4479  C  CD    . LYS B  1 134 ? 43.239  -26.051  34.550  1.00 87.97  ? 134 LYS B CD    1 
ATOM   4480  C  CE    . LYS B  1 134 ? 43.028  -24.556  34.735  1.00 86.85  ? 134 LYS B CE    1 
ATOM   4481  N  NZ    . LYS B  1 134 ? 44.237  -23.819  35.207  1.00 87.61  ? 134 LYS B NZ    1 
ATOM   4482  N  N     . ALA B  1 135 ? 39.062  -28.422  32.786  1.00 85.90  ? 135 ALA B N     1 
ATOM   4483  C  CA    . ALA B  1 135 ? 38.578  -28.810  31.468  1.00 86.22  ? 135 ALA B CA    1 
ATOM   4484  C  C     . ALA B  1 135 ? 39.767  -28.927  30.527  1.00 88.20  ? 135 ALA B C     1 
ATOM   4485  O  O     . ALA B  1 135 ? 40.731  -28.181  30.674  1.00 88.84  ? 135 ALA B O     1 
ATOM   4486  C  CB    . ALA B  1 135 ? 37.621  -27.776  30.953  1.00 84.71  ? 135 ALA B CB    1 
ATOM   4487  N  N     . PRO B  1 136 ? 39.708  -29.858  29.554  1.00 89.43  ? 136 PRO B N     1 
ATOM   4488  C  CA    . PRO B  1 136 ? 40.840  -30.063  28.650  1.00 91.42  ? 136 PRO B CA    1 
ATOM   4489  C  C     . PRO B  1 136 ? 41.187  -28.789  27.894  1.00 91.24  ? 136 PRO B C     1 
ATOM   4490  O  O     . PRO B  1 136 ? 40.299  -28.002  27.556  1.00 89.60  ? 136 PRO B O     1 
ATOM   4491  C  CB    . PRO B  1 136 ? 40.329  -31.120  27.671  1.00 92.29  ? 136 PRO B CB    1 
ATOM   4492  C  CG    . PRO B  1 136 ? 39.188  -31.761  28.353  1.00 91.43  ? 136 PRO B CG    1 
ATOM   4493  C  CD    . PRO B  1 136 ? 38.557  -30.696  29.180  1.00 89.20  ? 136 PRO B CD    1 
ATOM   4494  N  N     . GLY B  1 137 ? 42.476  -28.598  27.634  1.00 93.03  ? 137 GLY B N     1 
ATOM   4495  C  CA    . GLY B  1 137 ? 42.969  -27.372  27.025  1.00 93.26  ? 137 GLY B CA    1 
ATOM   4496  C  C     . GLY B  1 137 ? 42.538  -27.146  25.590  1.00 93.63  ? 137 GLY B C     1 
ATOM   4497  O  O     . GLY B  1 137 ? 41.634  -27.811  25.081  1.00 93.23  ? 137 GLY B O     1 
ATOM   4498  N  N     . ILE B  1 138 ? 43.211  -26.201  24.941  1.00 94.52  ? 138 ILE B N     1 
ATOM   4499  C  CA    . ILE B  1 138 ? 42.901  -25.781  23.570  1.00 95.09  ? 138 ILE B CA    1 
ATOM   4500  C  C     . ILE B  1 138 ? 43.201  -26.885  22.536  1.00 97.09  ? 138 ILE B C     1 
ATOM   4501  O  O     . ILE B  1 138 ? 42.518  -27.001  21.517  1.00 97.06  ? 138 ILE B O     1 
ATOM   4502  C  CB    . ILE B  1 138 ? 43.658  -24.447  23.212  1.00 95.56  ? 138 ILE B CB    1 
ATOM   4503  C  CG1   . ILE B  1 138 ? 43.051  -23.246  23.947  1.00 93.71  ? 138 ILE B CG1   1 
ATOM   4504  C  CG2   . ILE B  1 138 ? 43.639  -24.162  21.715  1.00 96.60  ? 138 ILE B CG2   1 
ATOM   4505  C  CD1   . ILE B  1 138 ? 43.511  -23.068  25.408  1.00 94.48  ? 138 ILE B CD1   1 
ATOM   4506  N  N     . LEU B  1 139 ? 44.206  -27.703  22.822  1.00 98.81  ? 139 LEU B N     1 
ATOM   4507  C  CA    . LEU B  1 139 ? 44.730  -28.632  21.837  1.00 101.14 ? 139 LEU B CA    1 
ATOM   4508  C  C     . LEU B  1 139 ? 44.034  -29.996  21.809  1.00 101.73 ? 139 LEU B C     1 
ATOM   4509  O  O     . LEU B  1 139 ? 43.694  -30.489  20.725  1.00 102.74 ? 139 LEU B O     1 
ATOM   4510  C  CB    . LEU B  1 139 ? 46.240  -28.789  22.014  1.00 103.10 ? 139 LEU B CB    1 
ATOM   4511  C  CG    . LEU B  1 139 ? 47.058  -28.915  20.735  1.00 104.92 ? 139 LEU B CG    1 
ATOM   4512  C  CD1   . LEU B  1 139 ? 46.986  -27.660  19.891  1.00 103.83 ? 139 LEU B CD1   1 
ATOM   4513  C  CD2   . LEU B  1 139 ? 48.470  -29.187  21.114  1.00 106.98 ? 139 LEU B CD2   1 
ATOM   4514  N  N     . PRO B  1 140 ? 43.812  -30.615  22.988  1.00 101.28 ? 140 PRO B N     1 
ATOM   4515  C  CA    . PRO B  1 140 ? 43.257  -31.976  22.985  1.00 102.01 ? 140 PRO B CA    1 
ATOM   4516  C  C     . PRO B  1 140 ? 41.775  -32.066  22.585  1.00 100.54 ? 140 PRO B C     1 
ATOM   4517  O  O     . PRO B  1 140 ? 41.158  -33.114  22.765  1.00 100.60 ? 140 PRO B O     1 
ATOM   4518  C  CB    . PRO B  1 140 ? 43.446  -32.437  24.442  1.00 101.66 ? 140 PRO B CB    1 
ATOM   4519  C  CG    . PRO B  1 140 ? 44.384  -31.438  25.062  1.00 101.52 ? 140 PRO B CG    1 
ATOM   4520  C  CD    . PRO B  1 140 ? 44.105  -30.161  24.358  1.00 100.16 ? 140 PRO B CD    1 
ATOM   4521  N  N     . ARG B  1 141 ? 41.224  -30.981  22.040  1.00 99.44  ? 141 ARG B N     1 
ATOM   4522  C  CA    . ARG B  1 141 ? 39.818  -30.932  21.633  1.00 98.17  ? 141 ARG B CA    1 
ATOM   4523  C  C     . ARG B  1 141 ? 39.673  -31.016  20.124  1.00 99.51  ? 141 ARG B C     1 
ATOM   4524  O  O     . ARG B  1 141 ? 40.560  -30.598  19.382  1.00 101.09 ? 141 ARG B O     1 
ATOM   4525  C  CB    . ARG B  1 141 ? 39.162  -29.638  22.107  1.00 95.91  ? 141 ARG B CB    1 
ATOM   4526  C  CG    . ARG B  1 141 ? 39.049  -29.485  23.599  1.00 94.69  ? 141 ARG B CG    1 
ATOM   4527  C  CD    . ARG B  1 141 ? 38.825  -28.029  23.940  1.00 93.75  ? 141 ARG B CD    1 
ATOM   4528  N  NE    . ARG B  1 141 ? 38.642  -27.838  25.372  1.00 92.71  ? 141 ARG B NE    1 
ATOM   4529  C  CZ    . ARG B  1 141 ? 37.464  -27.647  25.955  1.00 91.31  ? 141 ARG B CZ    1 
ATOM   4530  N  NH1   . ARG B  1 141 ? 36.355  -27.603  25.227  1.00 90.74  ? 141 ARG B NH1   1 
ATOM   4531  N  NH2   . ARG B  1 141 ? 37.396  -27.488  27.268  1.00 90.92  ? 141 ARG B NH2   1 
ATOM   4532  N  N     . ARG B  1 142 ? 38.533  -31.536  19.684  1.00 99.19  ? 142 ARG B N     1 
ATOM   4533  C  CA    . ARG B  1 142 ? 38.224  -31.686  18.269  1.00 100.48 ? 142 ARG B CA    1 
ATOM   4534  C  C     . ARG B  1 142 ? 36.870  -31.037  18.002  1.00 98.80  ? 142 ARG B C     1 
ATOM   4535  O  O     . ARG B  1 142 ? 35.936  -31.220  18.787  1.00 97.41  ? 142 ARG B O     1 
ATOM   4536  C  CB    . ARG B  1 142 ? 38.159  -33.176  17.931  1.00 102.14 ? 142 ARG B CB    1 
ATOM   4537  C  CG    . ARG B  1 142 ? 38.321  -33.495  16.479  1.00 104.40 ? 142 ARG B CG    1 
ATOM   4538  C  CD    . ARG B  1 142 ? 37.510  -34.720  16.114  1.00 106.07 ? 142 ARG B CD    1 
ATOM   4539  N  NE    . ARG B  1 142 ? 37.684  -35.057  14.703  1.00 109.12 ? 142 ARG B NE    1 
ATOM   4540  C  CZ    . ARG B  1 142 ? 37.158  -34.369  13.691  1.00 109.02 ? 142 ARG B CZ    1 
ATOM   4541  N  NH1   . ARG B  1 142 ? 36.412  -33.290  13.919  1.00 106.25 ? 142 ARG B NH1   1 
ATOM   4542  N  NH2   . ARG B  1 142 ? 37.382  -34.764  12.443  1.00 111.16 ? 142 ARG B NH2   1 
ATOM   4543  N  N     . SER B  1 143 ? 36.749  -30.279  16.912  1.00 99.03  ? 143 SER B N     1 
ATOM   4544  C  CA    . SER B  1 143 ? 35.466  -29.647  16.591  1.00 97.85  ? 143 SER B CA    1 
ATOM   4545  C  C     . SER B  1 143 ? 34.373  -30.694  16.411  1.00 98.14  ? 143 SER B C     1 
ATOM   4546  O  O     . SER B  1 143 ? 34.616  -31.753  15.836  1.00 100.16 ? 143 SER B O     1 
ATOM   4547  C  CB    . SER B  1 143 ? 35.574  -28.764  15.353  1.00 98.53  ? 143 SER B CB    1 
ATOM   4548  O  OG    . SER B  1 143 ? 36.015  -29.507  14.241  1.00 101.15 ? 143 SER B OG    1 
ATOM   4549  N  N     . VAL B  1 144 ? 33.178  -30.398  16.917  1.00 96.70  ? 144 VAL B N     1 
ATOM   4550  C  CA    . VAL B  1 144 ? 32.056  -31.355  16.915  1.00 97.03  ? 144 VAL B CA    1 
ATOM   4551  C  C     . VAL B  1 144 ? 31.502  -31.653  15.510  1.00 98.56  ? 144 VAL B C     1 
ATOM   4552  O  O     . VAL B  1 144 ? 31.296  -30.736  14.710  1.00 98.74  ? 144 VAL B O     1 
ATOM   4553  C  CB    . VAL B  1 144 ? 30.887  -30.896  17.854  1.00 94.98  ? 144 VAL B CB    1 
ATOM   4554  C  CG1   . VAL B  1 144 ? 31.222  -31.134  19.326  1.00 93.42  ? 144 VAL B CG1   1 
ATOM   4555  C  CG2   . VAL B  1 144 ? 30.533  -29.441  17.613  1.00 94.07  ? 144 VAL B CG2   1 
ATOM   4556  N  N     . HIS B  1 145 ? 31.270  -32.933  15.222  1.00 99.90  ? 145 HIS B N     1 
ATOM   4557  C  CA    . HIS B  1 145 ? 30.703  -33.348  13.931  1.00 101.70 ? 145 HIS B CA    1 
ATOM   4558  C  C     . HIS B  1 145 ? 29.630  -34.427  14.081  1.00 102.07 ? 145 HIS B C     1 
ATOM   4559  O  O     . HIS B  1 145 ? 28.668  -34.454  13.315  1.00 102.74 ? 145 HIS B O     1 
ATOM   4560  C  CB    . HIS B  1 145 ? 31.797  -33.804  12.949  1.00 103.95 ? 145 HIS B CB    1 
ATOM   4561  C  CG    . HIS B  1 145 ? 32.598  -34.977  13.429  1.00 105.36 ? 145 HIS B CG    1 
ATOM   4562  N  ND1   . HIS B  1 145 ? 33.712  -34.841  14.231  1.00 105.44 ? 145 HIS B ND1   1 
ATOM   4563  C  CD2   . HIS B  1 145 ? 32.449  -36.306  13.218  1.00 106.90 ? 145 HIS B CD2   1 
ATOM   4564  C  CE1   . HIS B  1 145 ? 34.213  -36.035  14.496  1.00 106.47 ? 145 HIS B CE1   1 
ATOM   4565  N  NE2   . HIS B  1 145 ? 33.464  -36.941  13.895  1.00 107.56 ? 145 HIS B NE2   1 
ATOM   4566  N  N     . GLU B  1 146 ? 29.805  -35.310  15.064  1.00 101.95 ? 146 GLU B N     1 
ATOM   4567  C  CA    . GLU B  1 146 ? 28.859  -36.398  15.335  1.00 102.20 ? 146 GLU B CA    1 
ATOM   4568  C  C     . GLU B  1 146 ? 27.577  -35.871  15.987  1.00 100.34 ? 146 GLU B C     1 
ATOM   4569  O  O     . GLU B  1 146 ? 27.638  -35.230  17.040  1.00 98.56  ? 146 GLU B O     1 
ATOM   4570  C  CB    . GLU B  1 146 ? 29.505  -37.453  16.235  1.00 102.68 ? 146 GLU B CB    1 
ATOM   4571  C  CG    . GLU B  1 146 ? 30.828  -37.984  15.713  1.00 104.87 ? 146 GLU B CG    1 
ATOM   4572  C  CD    . GLU B  1 146 ? 31.686  -38.600  16.798  1.00 105.66 ? 146 GLU B CD    1 
ATOM   4573  O  OE1   . GLU B  1 146 ? 32.278  -37.839  17.594  1.00 104.66 ? 146 GLU B OE1   1 
ATOM   4574  O  OE2   . GLU B  1 146 ? 31.777  -39.846  16.848  1.00 107.79 ? 146 GLU B OE2   1 
ATOM   4575  N  N     . PRO B  1 147 ? 26.410  -36.147  15.369  1.00 100.90 ? 147 PRO B N     1 
ATOM   4576  C  CA    . PRO B  1 147 ? 25.135  -35.631  15.880  1.00 99.47  ? 147 PRO B CA    1 
ATOM   4577  C  C     . PRO B  1 147 ? 24.685  -36.295  17.184  1.00 98.73  ? 147 PRO B C     1 
ATOM   4578  O  O     . PRO B  1 147 ? 24.853  -37.509  17.355  1.00 99.86  ? 147 PRO B O     1 
ATOM   4579  C  CB    . PRO B  1 147 ? 24.149  -35.967  14.757  1.00 100.78 ? 147 PRO B CB    1 
ATOM   4580  C  CG    . PRO B  1 147 ? 24.740  -37.148  14.079  1.00 102.70 ? 147 PRO B CG    1 
ATOM   4581  C  CD    . PRO B  1 147 ? 26.223  -36.985  14.168  1.00 103.03 ? 147 PRO B CD    1 
ATOM   4582  N  N     . VAL B  1 148 ? 24.141  -35.495  18.101  1.00 96.94  ? 148 VAL B N     1 
ATOM   4583  C  CA    . VAL B  1 148 ? 23.363  -36.042  19.209  1.00 96.29  ? 148 VAL B CA    1 
ATOM   4584  C  C     . VAL B  1 148 ? 21.905  -36.010  18.801  1.00 96.64  ? 148 VAL B C     1 
ATOM   4585  O  O     . VAL B  1 148 ? 21.279  -34.939  18.704  1.00 95.52  ? 148 VAL B O     1 
ATOM   4586  C  CB    . VAL B  1 148 ? 23.562  -35.313  20.544  1.00 94.32  ? 148 VAL B CB    1 
ATOM   4587  C  CG1   . VAL B  1 148 ? 22.451  -35.692  21.523  1.00 93.50  ? 148 VAL B CG1   1 
ATOM   4588  C  CG2   . VAL B  1 148 ? 24.921  -35.660  21.134  1.00 94.56  ? 148 VAL B CG2   1 
ATOM   4589  N  N     . GLN B  1 149 ? 21.396  -37.212  18.541  1.00 98.19  ? 149 GLN B N     1 
ATOM   4590  C  CA    . GLN B  1 149 ? 20.036  -37.420  18.097  1.00 98.86  ? 149 GLN B CA    1 
ATOM   4591  C  C     . GLN B  1 149 ? 19.086  -37.454  19.285  1.00 97.35  ? 149 GLN B C     1 
ATOM   4592  O  O     . GLN B  1 149 ? 19.196  -38.308  20.172  1.00 97.19  ? 149 GLN B O     1 
ATOM   4593  C  CB    . GLN B  1 149 ? 19.949  -38.701  17.272  1.00 101.38 ? 149 GLN B CB    1 
ATOM   4594  C  CG    . GLN B  1 149 ? 20.405  -38.532  15.823  1.00 104.42 ? 149 GLN B CG    1 
ATOM   4595  C  CD    . GLN B  1 149 ? 19.551  -37.525  15.049  1.00 106.28 ? 149 GLN B CD    1 
ATOM   4596  O  OE1   . GLN B  1 149 ? 18.320  -37.532  15.145  1.00 107.06 ? 149 GLN B OE1   1 
ATOM   4597  N  NE2   . GLN B  1 149 ? 20.204  -36.659  14.277  1.00 106.79 ? 149 GLN B NE2   1 
ATOM   4598  N  N     . THR B  1 150 ? 18.163  -36.498  19.293  1.00 96.04  ? 150 THR B N     1 
ATOM   4599  C  CA    . THR B  1 150 ? 17.206  -36.359  20.376  1.00 94.74  ? 150 THR B CA    1 
ATOM   4600  C  C     . THR B  1 150 ? 15.967  -37.190  20.119  1.00 95.89  ? 150 THR B C     1 
ATOM   4601  O  O     . THR B  1 150 ? 15.368  -37.715  21.050  1.00 95.98  ? 150 THR B O     1 
ATOM   4602  C  CB    . THR B  1 150 ? 16.771  -34.903  20.553  1.00 93.34  ? 150 THR B CB    1 
ATOM   4603  O  OG1   . THR B  1 150 ? 16.103  -34.451  19.364  1.00 94.22  ? 150 THR B OG1   1 
ATOM   4604  C  CG2   . THR B  1 150 ? 17.980  -34.026  20.841  1.00 92.15  ? 150 THR B CG2   1 
ATOM   4605  N  N     . GLY B  1 151 ? 15.587  -37.302  18.852  1.00 97.01  ? 151 GLY B N     1 
ATOM   4606  C  CA    . GLY B  1 151 ? 14.345  -37.962  18.475  1.00 98.13  ? 151 GLY B CA    1 
ATOM   4607  C  C     . GLY B  1 151 ? 13.218  -36.955  18.398  1.00 97.47  ? 151 GLY B C     1 
ATOM   4608  O  O     . GLY B  1 151 ? 12.083  -37.300  18.078  1.00 98.70  ? 151 GLY B O     1 
ATOM   4609  N  N     . LEU B  1 152 ? 13.542  -35.702  18.695  1.00 95.69  ? 152 LEU B N     1 
ATOM   4610  C  CA    . LEU B  1 152 ? 12.571  -34.624  18.666  1.00 95.05  ? 152 LEU B CA    1 
ATOM   4611  C  C     . LEU B  1 152 ? 12.716  -33.883  17.359  1.00 95.57  ? 152 LEU B C     1 
ATOM   4612  O  O     . LEU B  1 152 ? 13.770  -33.302  17.086  1.00 94.71  ? 152 LEU B O     1 
ATOM   4613  C  CB    . LEU B  1 152 ? 12.787  -33.674  19.845  1.00 93.01  ? 152 LEU B CB    1 
ATOM   4614  C  CG    . LEU B  1 152 ? 12.588  -34.259  21.245  1.00 92.16  ? 152 LEU B CG    1 
ATOM   4615  C  CD1   . LEU B  1 152 ? 13.301  -33.406  22.277  1.00 90.38  ? 152 LEU B CD1   1 
ATOM   4616  C  CD2   . LEU B  1 152 ? 11.109  -34.393  21.574  1.00 92.78  ? 152 LEU B CD2   1 
ATOM   4617  N  N     . LYS B  1 153 ? 11.653  -33.921  16.557  1.00 96.96  ? 153 LYS B N     1 
ATOM   4618  C  CA    . LYS B  1 153 ? 11.623  -33.279  15.247  1.00 97.98  ? 153 LYS B CA    1 
ATOM   4619  C  C     . LYS B  1 153 ? 12.086  -31.836  15.335  1.00 96.59  ? 153 LYS B C     1 
ATOM   4620  O  O     . LYS B  1 153 ? 12.959  -31.419  14.577  1.00 96.70  ? 153 LYS B O     1 
ATOM   4621  C  CB    . LYS B  1 153 ? 10.223  -33.340  14.643  1.00 99.63  ? 153 LYS B CB    1 
ATOM   4622  C  CG    . LYS B  1 153 ? 9.726   -34.751  14.392  1.00 101.70 ? 153 LYS B CG    1 
ATOM   4623  C  CD    . LYS B  1 153 ? 8.247   -34.773  14.037  1.00 103.86 ? 153 LYS B CD    1 
ATOM   4624  C  CE    . LYS B  1 153 ? 7.377   -34.467  15.247  1.00 103.24 ? 153 LYS B CE    1 
ATOM   4625  N  NZ    . LYS B  1 153 ? 5.930   -34.513  14.919  1.00 105.39 ? 153 LYS B NZ    1 
ATOM   4626  N  N     . ALA B  1 154 ? 11.515  -31.091  16.279  1.00 95.39  ? 154 ALA B N     1 
ATOM   4627  C  CA    . ALA B  1 154 ? 11.852  -29.681  16.472  1.00 94.01  ? 154 ALA B CA    1 
ATOM   4628  C  C     . ALA B  1 154 ? 13.336  -29.438  16.805  1.00 92.57  ? 154 ALA B C     1 
ATOM   4629  O  O     . ALA B  1 154 ? 13.945  -28.503  16.281  1.00 92.15  ? 154 ALA B O     1 
ATOM   4630  C  CB    . ALA B  1 154 ? 10.942  -29.062  17.529  1.00 93.08  ? 154 ALA B CB    1 
ATOM   4631  N  N     . VAL B  1 155 ? 13.912  -30.285  17.659  1.00 91.93  ? 155 VAL B N     1 
ATOM   4632  C  CA    . VAL B  1 155 ? 15.325  -30.158  18.043  1.00 90.96  ? 155 VAL B CA    1 
ATOM   4633  C  C     . VAL B  1 155 ? 16.257  -30.616  16.914  1.00 92.21  ? 155 VAL B C     1 
ATOM   4634  O  O     . VAL B  1 155 ? 17.087  -29.832  16.432  1.00 91.92  ? 155 VAL B O     1 
ATOM   4635  C  CB    . VAL B  1 155 ? 15.661  -30.910  19.373  1.00 90.02  ? 155 VAL B CB    1 
ATOM   4636  C  CG1   . VAL B  1 155 ? 17.111  -30.654  19.800  1.00 88.40  ? 155 VAL B CG1   1 
ATOM   4637  C  CG2   . VAL B  1 155 ? 14.721  -30.473  20.488  1.00 89.50  ? 155 VAL B CG2   1 
ATOM   4638  N  N     . ASP B  1 156 ? 16.100  -31.875  16.492  1.00 93.58  ? 156 ASP B N     1 
ATOM   4639  C  CA    . ASP B  1 156 ? 16.939  -32.477  15.445  1.00 94.76  ? 156 ASP B CA    1 
ATOM   4640  C  C     . ASP B  1 156 ? 16.872  -31.736  14.103  1.00 95.51  ? 156 ASP B C     1 
ATOM   4641  O  O     . ASP B  1 156 ? 17.724  -31.940  13.240  1.00 96.53  ? 156 ASP B O     1 
ATOM   4642  C  CB    . ASP B  1 156 ? 16.581  -33.958  15.235  1.00 96.44  ? 156 ASP B CB    1 
ATOM   4643  C  CG    . ASP B  1 156 ? 17.025  -34.862  16.392  1.00 96.34  ? 156 ASP B CG    1 
ATOM   4644  O  OD1   . ASP B  1 156 ? 17.857  -34.455  17.238  1.00 95.42  ? 156 ASP B OD1   1 
ATOM   4645  O  OD2   . ASP B  1 156 ? 16.535  -36.010  16.445  1.00 98.10  ? 156 ASP B OD2   1 
ATOM   4646  N  N     . ALA B  1 157 ? 15.861  -30.890  13.926  1.00 95.13  ? 157 ALA B N     1 
ATOM   4647  C  CA    . ALA B  1 157 ? 15.767  -30.060  12.731  1.00 95.83  ? 157 ALA B CA    1 
ATOM   4648  C  C     . ALA B  1 157 ? 16.348  -28.664  12.944  1.00 94.47  ? 157 ALA B C     1 
ATOM   4649  O  O     . ALA B  1 157 ? 17.222  -28.243  12.189  1.00 95.15  ? 157 ALA B O     1 
ATOM   4650  C  CB    . ALA B  1 157 ? 14.336  -29.970  12.246  1.00 96.92  ? 157 ALA B CB    1 
ATOM   4651  N  N     . LEU B  1 158 ? 15.882  -27.964  13.980  1.00 92.73  ? 158 LEU B N     1 
ATOM   4652  C  CA    . LEU B  1 158 ? 16.126  -26.521  14.119  1.00 91.29  ? 158 LEU B CA    1 
ATOM   4653  C  C     . LEU B  1 158 ? 17.250  -26.123  15.073  1.00 89.45  ? 158 LEU B C     1 
ATOM   4654  O  O     . LEU B  1 158 ? 17.860  -25.068  14.913  1.00 88.96  ? 158 LEU B O     1 
ATOM   4655  C  CB    . LEU B  1 158 ? 14.836  -25.806  14.523  1.00 90.92  ? 158 LEU B CB    1 
ATOM   4656  C  CG    . LEU B  1 158 ? 13.598  -26.090  13.681  1.00 92.08  ? 158 LEU B CG    1 
ATOM   4657  C  CD1   . LEU B  1 158 ? 12.395  -25.543  14.396  1.00 91.58  ? 158 LEU B CD1   1 
ATOM   4658  C  CD2   . LEU B  1 158 ? 13.727  -25.497  12.289  1.00 93.09  ? 158 LEU B CD2   1 
ATOM   4659  N  N     . VAL B  1 159 ? 17.504  -26.943  16.082  1.00 88.44  ? 159 VAL B N     1 
ATOM   4660  C  CA    . VAL B  1 159 ? 18.622  -26.690  16.983  1.00 87.03  ? 159 VAL B CA    1 
ATOM   4661  C  C     . VAL B  1 159 ? 19.365  -27.988  17.258  1.00 87.31  ? 159 VAL B C     1 
ATOM   4662  O  O     . VAL B  1 159 ? 19.333  -28.510  18.374  1.00 86.47  ? 159 VAL B O     1 
ATOM   4663  C  CB    . VAL B  1 159 ? 18.191  -25.999  18.299  1.00 85.34  ? 159 VAL B CB    1 
ATOM   4664  C  CG1   . VAL B  1 159 ? 18.045  -24.502  18.085  1.00 85.14  ? 159 VAL B CG1   1 
ATOM   4665  C  CG2   . VAL B  1 159 ? 16.896  -26.593  18.832  1.00 85.64  ? 159 VAL B CG2   1 
ATOM   4666  N  N     . PRO B  1 160 ? 20.036  -28.522  16.226  1.00 88.67  ? 160 PRO B N     1 
ATOM   4667  C  CA    . PRO B  1 160 ? 20.682  -29.818  16.382  1.00 89.13  ? 160 PRO B CA    1 
ATOM   4668  C  C     . PRO B  1 160 ? 21.913  -29.736  17.286  1.00 87.85  ? 160 PRO B C     1 
ATOM   4669  O  O     . PRO B  1 160 ? 22.654  -28.758  17.237  1.00 87.12  ? 160 PRO B O     1 
ATOM   4670  C  CB    . PRO B  1 160 ? 21.051  -30.207  14.948  1.00 91.12  ? 160 PRO B CB    1 
ATOM   4671  C  CG    . PRO B  1 160 ? 21.124  -28.924  14.195  1.00 91.16  ? 160 PRO B CG    1 
ATOM   4672  C  CD    . PRO B  1 160 ? 20.270  -27.925  14.895  1.00 89.80  ? 160 PRO B CD    1 
ATOM   4673  N  N     . ILE B  1 161 ? 22.098  -30.768  18.104  1.00 87.62  ? 161 ILE B N     1 
ATOM   4674  C  CA    . ILE B  1 161 ? 23.161  -30.849  19.101  1.00 86.61  ? 161 ILE B CA    1 
ATOM   4675  C  C     . ILE B  1 161 ? 24.224  -31.856  18.658  1.00 88.24  ? 161 ILE B C     1 
ATOM   4676  O  O     . ILE B  1 161 ? 23.897  -32.863  18.029  1.00 89.84  ? 161 ILE B O     1 
ATOM   4677  C  CB    . ILE B  1 161 ? 22.565  -31.272  20.459  1.00 85.44  ? 161 ILE B CB    1 
ATOM   4678  C  CG1   . ILE B  1 161 ? 21.607  -30.189  20.975  1.00 83.79  ? 161 ILE B CG1   1 
ATOM   4679  C  CG2   . ILE B  1 161 ? 23.661  -31.576  21.480  1.00 84.91  ? 161 ILE B CG2   1 
ATOM   4680  C  CD1   . ILE B  1 161 ? 20.499  -30.708  21.873  1.00 82.75  ? 161 ILE B CD1   1 
ATOM   4681  N  N     . GLY B  1 162 ? 25.488  -31.583  18.981  1.00 88.19  ? 162 GLY B N     1 
ATOM   4682  C  CA    . GLY B  1 162 ? 26.603  -32.476  18.627  1.00 89.95  ? 162 GLY B CA    1 
ATOM   4683  C  C     . GLY B  1 162 ? 27.355  -33.023  19.828  1.00 89.85  ? 162 GLY B C     1 
ATOM   4684  O  O     . GLY B  1 162 ? 27.318  -32.433  20.902  1.00 88.44  ? 162 GLY B O     1 
ATOM   4685  N  N     . ARG B  1 163 ? 28.043  -34.148  19.646  1.00 91.73  ? 163 ARG B N     1 
ATOM   4686  C  CA    . ARG B  1 163 ? 28.753  -34.823  20.747  1.00 92.11  ? 163 ARG B CA    1 
ATOM   4687  C  C     . ARG B  1 163 ? 30.012  -34.076  21.222  1.00 91.77  ? 163 ARG B C     1 
ATOM   4688  O  O     . ARG B  1 163 ? 31.091  -34.196  20.631  1.00 93.19  ? 163 ARG B O     1 
ATOM   4689  C  CB    . ARG B  1 163 ? 29.095  -36.268  20.371  1.00 94.12  ? 163 ARG B CB    1 
ATOM   4690  C  CG    . ARG B  1 163 ? 27.919  -37.038  19.838  1.00 95.47  ? 163 ARG B CG    1 
ATOM   4691  C  CD    . ARG B  1 163 ? 28.117  -38.531  19.947  1.00 98.39  ? 163 ARG B CD    1 
ATOM   4692  N  NE    . ARG B  1 163 ? 26.829  -39.220  19.961  1.00 99.28  ? 163 ARG B NE    1 
ATOM   4693  C  CZ    . ARG B  1 163 ? 26.665  -40.514  20.214  1.00 100.98 ? 163 ARG B CZ    1 
ATOM   4694  N  NH1   . ARG B  1 163 ? 27.711  -41.290  20.470  1.00 102.53 ? 163 ARG B NH1   1 
ATOM   4695  N  NH2   . ARG B  1 163 ? 25.444  -41.035  20.206  1.00 101.41 ? 163 ARG B NH2   1 
ATOM   4696  N  N     . GLY B  1 164 ? 29.862  -33.322  22.308  1.00 90.03  ? 164 GLY B N     1 
ATOM   4697  C  CA    . GLY B  1 164 ? 30.920  -32.445  22.809  1.00 89.34  ? 164 GLY B CA    1 
ATOM   4698  C  C     . GLY B  1 164 ? 30.402  -31.032  23.002  1.00 87.47  ? 164 GLY B C     1 
ATOM   4699  O  O     . GLY B  1 164 ? 30.979  -30.242  23.750  1.00 86.44  ? 164 GLY B O     1 
ATOM   4700  N  N     . GLN B  1 165 ? 29.308  -30.730  22.305  1.00 87.11  ? 165 GLN B N     1 
ATOM   4701  C  CA    . GLN B  1 165 ? 28.602  -29.463  22.404  1.00 85.58  ? 165 GLN B CA    1 
ATOM   4702  C  C     . GLN B  1 165 ? 27.890  -29.360  23.738  1.00 84.06  ? 165 GLN B C     1 
ATOM   4703  O  O     . GLN B  1 165 ? 27.521  -30.372  24.340  1.00 84.44  ? 165 GLN B O     1 
ATOM   4704  C  CB    . GLN B  1 165 ? 27.579  -29.365  21.274  1.00 86.10  ? 165 GLN B CB    1 
ATOM   4705  C  CG    . GLN B  1 165 ? 26.633  -28.182  21.340  1.00 85.41  ? 165 GLN B CG    1 
ATOM   4706  C  CD    . GLN B  1 165 ? 25.847  -27.986  20.053  1.00 87.03  ? 165 GLN B CD    1 
ATOM   4707  O  OE1   . GLN B  1 165 ? 25.888  -28.821  19.147  1.00 88.47  ? 165 GLN B OE1   1 
ATOM   4708  N  NE2   . GLN B  1 165 ? 25.134  -26.866  19.962  1.00 86.78  ? 165 GLN B NE2   1 
ATOM   4709  N  N     . ARG B  1 166 ? 27.706  -28.129  24.196  1.00 82.59  ? 166 ARG B N     1 
ATOM   4710  C  CA    . ARG B  1 166 ? 26.917  -27.856  25.384  1.00 80.88  ? 166 ARG B CA    1 
ATOM   4711  C  C     . ARG B  1 166 ? 25.747  -26.986  24.967  1.00 80.21  ? 166 ARG B C     1 
ATOM   4712  O  O     . ARG B  1 166 ? 25.926  -25.899  24.422  1.00 79.99  ? 166 ARG B O     1 
ATOM   4713  C  CB    . ARG B  1 166 ? 27.765  -27.163  26.443  1.00 79.99  ? 166 ARG B CB    1 
ATOM   4714  C  CG    . ARG B  1 166 ? 29.056  -27.897  26.758  1.00 80.37  ? 166 ARG B CG    1 
ATOM   4715  C  CD    . ARG B  1 166 ? 30.186  -26.921  26.966  1.00 79.53  ? 166 ARG B CD    1 
ATOM   4716  N  NE    . ARG B  1 166 ? 30.540  -26.210  25.743  1.00 79.51  ? 166 ARG B NE    1 
ATOM   4717  C  CZ    . ARG B  1 166 ? 31.045  -24.982  25.713  1.00 79.16  ? 166 ARG B CZ    1 
ATOM   4718  N  NH1   . ARG B  1 166 ? 31.261  -24.306  26.840  1.00 78.48  ? 166 ARG B NH1   1 
ATOM   4719  N  NH2   . ARG B  1 166 ? 31.336  -24.426  24.552  1.00 79.59  ? 166 ARG B NH2   1 
ATOM   4720  N  N     . GLU B  1 167 ? 24.545  -27.487  25.205  1.00 79.97  ? 167 GLU B N     1 
ATOM   4721  C  CA    . GLU B  1 167 ? 23.347  -26.810  24.757  1.00 79.73  ? 167 GLU B CA    1 
ATOM   4722  C  C     . GLU B  1 167 ? 22.444  -26.513  25.940  1.00 78.33  ? 167 GLU B C     1 
ATOM   4723  O  O     . GLU B  1 167 ? 21.978  -27.425  26.622  1.00 78.53  ? 167 GLU B O     1 
ATOM   4724  C  CB    . GLU B  1 167 ? 22.623  -27.668  23.717  1.00 81.18  ? 167 GLU B CB    1 
ATOM   4725  C  CG    . GLU B  1 167 ? 21.397  -27.016  23.093  1.00 82.01  ? 167 GLU B CG    1 
ATOM   4726  C  CD    . GLU B  1 167 ? 21.742  -25.831  22.209  1.00 82.98  ? 167 GLU B CD    1 
ATOM   4727  O  OE1   . GLU B  1 167 ? 22.947  -25.600  21.955  1.00 83.10  ? 167 GLU B OE1   1 
ATOM   4728  O  OE2   . GLU B  1 167 ? 20.800  -25.133  21.767  1.00 83.40  ? 167 GLU B OE2   1 
ATOM   4729  N  N     . LEU B  1 168 ? 22.212  -25.231  26.187  1.00 77.09  ? 168 LEU B N     1 
ATOM   4730  C  CA    . LEU B  1 168 ? 21.323  -24.821  27.255  1.00 75.84  ? 168 LEU B CA    1 
ATOM   4731  C  C     . LEU B  1 168 ? 19.875  -25.086  26.861  1.00 76.36  ? 168 LEU B C     1 
ATOM   4732  O  O     . LEU B  1 168 ? 19.457  -24.750  25.752  1.00 77.07  ? 168 LEU B O     1 
ATOM   4733  C  CB    . LEU B  1 168 ? 21.519  -23.334  27.582  1.00 74.88  ? 168 LEU B CB    1 
ATOM   4734  C  CG    . LEU B  1 168 ? 20.529  -22.677  28.554  1.00 73.66  ? 168 LEU B CG    1 
ATOM   4735  C  CD1   . LEU B  1 168 ? 20.608  -23.290  29.942  1.00 72.69  ? 168 LEU B CD1   1 
ATOM   4736  C  CD2   . LEU B  1 168 ? 20.753  -21.182  28.622  1.00 73.04  ? 168 LEU B CD2   1 
ATOM   4737  N  N     . ILE B  1 169 ? 19.129  -25.717  27.767  1.00 76.05  ? 169 ILE B N     1 
ATOM   4738  C  CA    . ILE B  1 169 ? 17.668  -25.755  27.682  1.00 76.14  ? 169 ILE B CA    1 
ATOM   4739  C  C     . ILE B  1 169 ? 17.154  -24.753  28.710  1.00 74.97  ? 169 ILE B C     1 
ATOM   4740  O  O     . ILE B  1 169 ? 17.247  -24.990  29.922  1.00 74.26  ? 169 ILE B O     1 
ATOM   4741  C  CB    . ILE B  1 169 ? 17.074  -27.151  27.980  1.00 76.77  ? 169 ILE B CB    1 
ATOM   4742  C  CG1   . ILE B  1 169 ? 17.765  -28.235  27.145  1.00 77.77  ? 169 ILE B CG1   1 
ATOM   4743  C  CG2   . ILE B  1 169 ? 15.573  -27.141  27.718  1.00 77.40  ? 169 ILE B CG2   1 
ATOM   4744  C  CD1   . ILE B  1 169 ? 17.734  -29.624  27.771  1.00 78.13  ? 169 ILE B CD1   1 
ATOM   4745  N  N     . ILE B  1 170 ? 16.629  -23.635  28.214  1.00 74.62  ? 170 ILE B N     1 
ATOM   4746  C  CA    . ILE B  1 170 ? 16.227  -22.516  29.058  1.00 73.49  ? 170 ILE B CA    1 
ATOM   4747  C  C     . ILE B  1 170 ? 14.752  -22.184  28.862  1.00 73.99  ? 170 ILE B C     1 
ATOM   4748  O  O     . ILE B  1 170 ? 14.245  -22.242  27.752  1.00 75.30  ? 170 ILE B O     1 
ATOM   4749  C  CB    . ILE B  1 170 ? 17.119  -21.274  28.781  1.00 72.97  ? 170 ILE B CB    1 
ATOM   4750  C  CG1   . ILE B  1 170 ? 16.741  -20.098  29.685  1.00 72.02  ? 170 ILE B CG1   1 
ATOM   4751  C  CG2   . ILE B  1 170 ? 17.086  -20.887  27.300  1.00 73.97  ? 170 ILE B CG2   1 
ATOM   4752  C  CD1   . ILE B  1 170 ? 17.755  -18.991  29.701  1.00 71.08  ? 170 ILE B CD1   1 
ATOM   4753  N  N     . GLY B  1 171 ? 14.062  -21.853  29.944  1.00 73.35  ? 171 GLY B N     1 
ATOM   4754  C  CA    . GLY B  1 171 ? 12.670  -21.449  29.845  1.00 74.06  ? 171 GLY B CA    1 
ATOM   4755  C  C     . GLY B  1 171 ? 12.043  -21.180  31.192  1.00 73.58  ? 171 GLY B C     1 
ATOM   4756  O  O     . GLY B  1 171 ? 12.731  -21.149  32.206  1.00 72.72  ? 171 GLY B O     1 
ATOM   4757  N  N     . ASP B  1 172 ? 10.730  -20.976  31.196  1.00 74.38  ? 172 ASP B N     1 
ATOM   4758  C  CA    . ASP B  1 172 ? 9.983   -20.754  32.422  1.00 74.15  ? 172 ASP B CA    1 
ATOM   4759  C  C     . ASP B  1 172 ? 9.709   -22.044  33.159  1.00 74.34  ? 172 ASP B C     1 
ATOM   4760  O  O     . ASP B  1 172 ? 9.960   -23.127  32.646  1.00 74.81  ? 172 ASP B O     1 
ATOM   4761  C  CB    . ASP B  1 172 ? 8.655   -20.094  32.099  1.00 75.35  ? 172 ASP B CB    1 
ATOM   4762  C  CG    . ASP B  1 172 ? 8.697   -18.608  32.271  1.00 75.35  ? 172 ASP B CG    1 
ATOM   4763  O  OD1   . ASP B  1 172 ? 9.770   -18.074  32.626  1.00 74.18  ? 172 ASP B OD1   1 
ATOM   4764  O  OD2   . ASP B  1 172 ? 7.645   -17.972  32.053  1.00 77.18  ? 172 ASP B OD2   1 
ATOM   4765  N  N     . ARG B  1 173 ? 9.181   -21.917  34.369  1.00 74.34  ? 173 ARG B N     1 
ATOM   4766  C  CA    . ARG B  1 173 ? 8.697   -23.061  35.129  1.00 74.98  ? 173 ARG B CA    1 
ATOM   4767  C  C     . ARG B  1 173 ? 7.699   -23.839  34.274  1.00 76.24  ? 173 ARG B C     1 
ATOM   4768  O  O     . ARG B  1 173 ? 6.974   -23.244  33.467  1.00 77.22  ? 173 ARG B O     1 
ATOM   4769  C  CB    . ARG B  1 173 ? 8.027   -22.581  36.419  1.00 75.13  ? 173 ARG B CB    1 
ATOM   4770  C  CG    . ARG B  1 173 ? 7.856   -23.645  37.485  1.00 76.78  ? 173 ARG B CG    1 
ATOM   4771  C  CD    . ARG B  1 173 ? 6.927   -23.171  38.591  1.00 80.46  ? 173 ARG B CD    1 
ATOM   4772  N  NE    . ARG B  1 173 ? 5.524   -23.172  38.170  1.00 84.44  ? 173 ARG B NE    1 
ATOM   4773  C  CZ    . ARG B  1 173 ? 4.835   -22.079  37.841  1.00 86.39  ? 173 ARG B CZ    1 
ATOM   4774  N  NH1   . ARG B  1 173 ? 5.413   -20.881  37.888  1.00 85.64  ? 173 ARG B NH1   1 
ATOM   4775  N  NH2   . ARG B  1 173 ? 3.562   -22.184  37.467  1.00 88.53  ? 173 ARG B NH2   1 
ATOM   4776  N  N     . GLN B  1 174 ? 7.684   -25.161  34.444  1.00 76.31  ? 174 GLN B N     1 
ATOM   4777  C  CA    . GLN B  1 174 ? 6.754   -26.041  33.749  1.00 77.30  ? 174 GLN B CA    1 
ATOM   4778  C  C     . GLN B  1 174 ? 6.606   -25.653  32.287  1.00 77.75  ? 174 GLN B C     1 
ATOM   4779  O  O     . GLN B  1 174 ? 5.545   -25.183  31.874  1.00 78.79  ? 174 GLN B O     1 
ATOM   4780  C  CB    . GLN B  1 174 ? 5.388   -26.023  34.441  1.00 78.28  ? 174 GLN B CB    1 
ATOM   4781  C  CG    . GLN B  1 174 ? 5.319   -26.789  35.745  1.00 78.78  ? 174 GLN B CG    1 
ATOM   4782  C  CD    . GLN B  1 174 ? 4.906   -28.249  35.566  1.00 81.48  ? 174 GLN B CD    1 
ATOM   4783  O  OE1   . GLN B  1 174 ? 4.025   -28.573  34.753  1.00 83.71  ? 174 GLN B OE1   1 
ATOM   4784  N  NE2   . GLN B  1 174 ? 5.525   -29.139  36.349  1.00 80.74  ? 174 GLN B NE2   1 
ATOM   4785  N  N     . THR B  1 175 ? 7.669   -25.826  31.509  1.00 77.04  ? 175 THR B N     1 
ATOM   4786  C  CA    . THR B  1 175 ? 7.573   -25.585  30.065  1.00 78.17  ? 175 THR B CA    1 
ATOM   4787  C  C     . THR B  1 175 ? 8.044   -26.764  29.193  1.00 79.00  ? 175 THR B C     1 
ATOM   4788  O  O     . THR B  1 175 ? 8.199   -26.627  27.974  1.00 79.59  ? 175 THR B O     1 
ATOM   4789  C  CB    . THR B  1 175 ? 8.248   -24.256  29.626  1.00 77.14  ? 175 THR B CB    1 
ATOM   4790  O  OG1   . THR B  1 175 ? 9.549   -24.160  30.203  1.00 76.26  ? 175 THR B OG1   1 
ATOM   4791  C  CG2   . THR B  1 175 ? 7.429   -23.065  30.065  1.00 77.11  ? 175 THR B CG2   1 
ATOM   4792  N  N     . GLY B  1 176 ? 8.230   -27.926  29.810  1.00 79.22  ? 176 GLY B N     1 
ATOM   4793  C  CA    . GLY B  1 176 ? 8.684   -29.102  29.079  1.00 80.32  ? 176 GLY B CA    1 
ATOM   4794  C  C     . GLY B  1 176 ? 10.191  -29.138  28.913  1.00 79.69  ? 176 GLY B C     1 
ATOM   4795  O  O     . GLY B  1 176 ? 10.698  -29.819  28.019  1.00 80.58  ? 176 GLY B O     1 
ATOM   4796  N  N     . LYS B  1 177 ? 10.907  -28.407  29.772  1.00 78.36  ? 177 LYS B N     1 
ATOM   4797  C  CA    . LYS B  1 177 ? 12.375  -28.433  29.792  1.00 77.56  ? 177 LYS B CA    1 
ATOM   4798  C  C     . LYS B  1 177 ? 12.895  -29.858  30.024  1.00 78.31  ? 177 LYS B C     1 
ATOM   4799  O  O     . LYS B  1 177 ? 13.605  -30.401  29.167  1.00 78.95  ? 177 LYS B O     1 
ATOM   4800  C  CB    . LYS B  1 177 ? 12.959  -27.437  30.813  1.00 75.84  ? 177 LYS B CB    1 
ATOM   4801  C  CG    . LYS B  1 177 ? 12.489  -25.988  30.603  1.00 75.27  ? 177 LYS B CG    1 
ATOM   4802  C  CD    . LYS B  1 177 ? 13.312  -24.934  31.340  1.00 73.07  ? 177 LYS B CD    1 
ATOM   4803  C  CE    . LYS B  1 177 ? 13.238  -25.059  32.857  1.00 72.36  ? 177 LYS B CE    1 
ATOM   4804  N  NZ    . LYS B  1 177 ? 11.924  -24.673  33.427  1.00 72.42  ? 177 LYS B NZ    1 
ATOM   4805  N  N     . THR B  1 178 ? 12.513  -30.471  31.148  1.00 78.46  ? 178 THR B N     1 
ATOM   4806  C  CA    . THR B  1 178 ? 12.946  -31.840  31.458  1.00 79.30  ? 178 THR B CA    1 
ATOM   4807  C  C     . THR B  1 178 ? 12.484  -32.817  30.382  1.00 81.27  ? 178 THR B C     1 
ATOM   4808  O  O     . THR B  1 178 ? 13.193  -33.779  30.057  1.00 81.89  ? 178 THR B O     1 
ATOM   4809  C  CB    . THR B  1 178 ? 12.445  -32.334  32.836  1.00 79.23  ? 178 THR B CB    1 
ATOM   4810  O  OG1   . THR B  1 178 ? 12.634  -31.306  33.814  1.00 77.98  ? 178 THR B OG1   1 
ATOM   4811  C  CG2   . THR B  1 178 ? 13.219  -33.577  33.282  1.00 78.99  ? 178 THR B CG2   1 
ATOM   4812  N  N     . ALA B  1 179 ? 11.302  -32.560  29.826  1.00 82.41  ? 179 ALA B N     1 
ATOM   4813  C  CA    . ALA B  1 179 ? 10.734  -33.413  28.777  1.00 84.47  ? 179 ALA B CA    1 
ATOM   4814  C  C     . ALA B  1 179 ? 11.716  -33.624  27.609  1.00 84.94  ? 179 ALA B C     1 
ATOM   4815  O  O     . ALA B  1 179 ? 11.916  -34.757  27.139  1.00 85.89  ? 179 ALA B O     1 
ATOM   4816  C  CB    . ALA B  1 179 ? 9.414   -32.827  28.284  1.00 85.16  ? 179 ALA B CB    1 
ATOM   4817  N  N     . VAL B  1 180 ? 12.323  -32.514  27.177  1.00 84.15  ? 180 VAL B N     1 
ATOM   4818  C  CA    . VAL B  1 180 ? 13.319  -32.474  26.104  1.00 84.40  ? 180 VAL B CA    1 
ATOM   4819  C  C     . VAL B  1 180 ? 14.576  -33.271  26.467  1.00 84.23  ? 180 VAL B C     1 
ATOM   4820  O  O     . VAL B  1 180 ? 15.133  -33.989  25.634  1.00 84.96  ? 180 VAL B O     1 
ATOM   4821  C  CB    . VAL B  1 180 ? 13.687  -31.012  25.776  1.00 83.33  ? 180 VAL B CB    1 
ATOM   4822  C  CG1   . VAL B  1 180 ? 14.829  -30.946  24.765  1.00 83.65  ? 180 VAL B CG1   1 
ATOM   4823  C  CG2   . VAL B  1 180 ? 12.460  -30.268  25.258  1.00 83.70  ? 180 VAL B CG2   1 
ATOM   4824  N  N     . ALA B  1 181 ? 15.011  -33.140  27.717  1.00 83.31  ? 181 ALA B N     1 
ATOM   4825  C  CA    . ALA B  1 181 ? 16.116  -33.940  28.236  1.00 83.44  ? 181 ALA B CA    1 
ATOM   4826  C  C     . ALA B  1 181 ? 15.749  -35.426  28.311  1.00 84.98  ? 181 ALA B C     1 
ATOM   4827  O  O     . ALA B  1 181 ? 16.553  -36.283  27.924  1.00 85.77  ? 181 ALA B O     1 
ATOM   4828  C  CB    . ALA B  1 181 ? 16.566  -33.421  29.598  1.00 81.77  ? 181 ALA B CB    1 
ATOM   4829  N  N     . LEU B  1 182 ? 14.533  -35.719  28.783  1.00 85.47  ? 182 LEU B N     1 
ATOM   4830  C  CA    . LEU B  1 182 ? 14.086  -37.104  28.983  1.00 87.00  ? 182 LEU B CA    1 
ATOM   4831  C  C     . LEU B  1 182 ? 13.916  -37.879  27.678  1.00 88.92  ? 182 LEU B C     1 
ATOM   4832  O  O     . LEU B  1 182 ? 14.355  -39.026  27.581  1.00 89.93  ? 182 LEU B O     1 
ATOM   4833  C  CB    . LEU B  1 182 ? 12.800  -37.173  29.822  1.00 86.96  ? 182 LEU B CB    1 
ATOM   4834  C  CG    . LEU B  1 182 ? 12.416  -38.549  30.386  1.00 87.61  ? 182 LEU B CG    1 
ATOM   4835  C  CD1   . LEU B  1 182 ? 13.541  -39.177  31.189  1.00 86.47  ? 182 LEU B CD1   1 
ATOM   4836  C  CD2   . LEU B  1 182 ? 11.184  -38.431  31.244  1.00 87.79  ? 182 LEU B CD2   1 
ATOM   4837  N  N     . ASP B  1 183 ? 13.286  -37.250  26.684  1.00 89.49  ? 183 ASP B N     1 
ATOM   4838  C  CA    . ASP B  1 183 ? 13.098  -37.881  25.378  1.00 91.40  ? 183 ASP B CA    1 
ATOM   4839  C  C     . ASP B  1 183 ? 14.439  -38.166  24.710  1.00 91.59  ? 183 ASP B C     1 
ATOM   4840  O  O     . ASP B  1 183 ? 14.617  -39.202  24.074  1.00 93.27  ? 183 ASP B O     1 
ATOM   4841  C  CB    . ASP B  1 183 ? 12.174  -37.049  24.478  1.00 91.84  ? 183 ASP B CB    1 
ATOM   4842  C  CG    . ASP B  1 183 ? 10.685  -37.292  24.770  1.00 93.74  ? 183 ASP B CG    1 
ATOM   4843  O  OD1   . ASP B  1 183 ? 10.355  -37.840  25.847  1.00 94.95  ? 183 ASP B OD1   1 
ATOM   4844  O  OD2   . ASP B  1 183 ? 9.833   -36.935  23.923  1.00 95.19  ? 183 ASP B OD2   1 
ATOM   4845  N  N     . THR B  1 184 ? 15.389  -37.257  24.883  1.00 90.13  ? 184 THR B N     1 
ATOM   4846  C  CA    . THR B  1 184 ? 16.738  -37.480  24.398  1.00 90.43  ? 184 THR B CA    1 
ATOM   4847  C  C     . THR B  1 184 ? 17.338  -38.743  25.016  1.00 91.24  ? 184 THR B C     1 
ATOM   4848  O  O     . THR B  1 184 ? 17.799  -39.617  24.280  1.00 92.99  ? 184 THR B O     1 
ATOM   4849  C  CB    . THR B  1 184 ? 17.634  -36.250  24.638  1.00 88.81  ? 184 THR B CB    1 
ATOM   4850  O  OG1   . THR B  1 184 ? 17.145  -35.168  23.842  1.00 88.47  ? 184 THR B OG1   1 
ATOM   4851  C  CG2   . THR B  1 184 ? 19.085  -36.531  24.244  1.00 89.21  ? 184 THR B CG2   1 
ATOM   4852  N  N     . ILE B  1 185 ? 17.302  -38.841  26.349  1.00 90.30  ? 185 ILE B N     1 
ATOM   4853  C  CA    . ILE B  1 185 ? 17.852  -39.994  27.090  1.00 90.79  ? 185 ILE B CA    1 
ATOM   4854  C  C     . ILE B  1 185 ? 17.157  -41.307  26.726  1.00 92.76  ? 185 ILE B C     1 
ATOM   4855  O  O     . ILE B  1 185 ? 17.795  -42.361  26.696  1.00 94.15  ? 185 ILE B O     1 
ATOM   4856  C  CB    . ILE B  1 185 ? 17.788  -39.802  28.630  1.00 89.53  ? 185 ILE B CB    1 
ATOM   4857  C  CG1   . ILE B  1 185 ? 18.602  -38.576  29.066  1.00 87.68  ? 185 ILE B CG1   1 
ATOM   4858  C  CG2   . ILE B  1 185 ? 18.287  -41.054  29.348  1.00 90.54  ? 185 ILE B CG2   1 
ATOM   4859  C  CD1   . ILE B  1 185 ? 18.496  -38.227  30.548  1.00 85.40  ? 185 ILE B CD1   1 
ATOM   4860  N  N     . LEU B  1 186 ? 15.854  -41.244  26.459  1.00 93.05  ? 186 LEU B N     1 
ATOM   4861  C  CA    . LEU B  1 186 ? 15.120  -42.417  25.985  1.00 94.90  ? 186 LEU B CA    1 
ATOM   4862  C  C     . LEU B  1 186 ? 15.612  -42.787  24.588  1.00 96.50  ? 186 LEU B C     1 
ATOM   4863  O  O     . LEU B  1 186 ? 16.044  -43.916  24.354  1.00 98.11  ? 186 LEU B O     1 
ATOM   4864  C  CB    . LEU B  1 186 ? 13.600  -42.176  25.983  1.00 94.86  ? 186 LEU B CB    1 
ATOM   4865  C  CG    . LEU B  1 186 ? 12.827  -41.900  27.281  1.00 92.87  ? 186 LEU B CG    1 
ATOM   4866  C  CD1   . LEU B  1 186 ? 11.383  -41.592  26.963  1.00 92.72  ? 186 LEU B CD1   1 
ATOM   4867  C  CD2   . LEU B  1 186 ? 12.911  -43.040  28.267  1.00 92.70  ? 186 LEU B CD2   1 
ATOM   4868  N  N     . ASN B  1 187 ? 15.581  -41.816  23.678  1.00 96.31  ? 187 ASN B N     1 
ATOM   4869  C  CA    . ASN B  1 187 ? 15.978  -42.035  22.286  1.00 97.96  ? 187 ASN B CA    1 
ATOM   4870  C  C     . ASN B  1 187 ? 17.296  -42.785  22.120  1.00 98.92  ? 187 ASN B C     1 
ATOM   4871  O  O     . ASN B  1 187 ? 17.493  -43.482  21.119  1.00 100.80 ? 187 ASN B O     1 
ATOM   4872  C  CB    . ASN B  1 187 ? 16.043  -40.713  21.521  1.00 97.00  ? 187 ASN B CB    1 
ATOM   4873  C  CG    . ASN B  1 187 ? 16.055  -40.914  20.017  1.00 98.48  ? 187 ASN B CG    1 
ATOM   4874  O  OD1   . ASN B  1 187 ? 15.049  -41.283  19.418  1.00 99.20  ? 187 ASN B OD1   1 
ATOM   4875  N  ND2   . ASN B  1 187 ? 17.202  -40.670  19.401  1.00 98.80  ? 187 ASN B ND2   1 
ATOM   4876  N  N     . GLN B  1 188 ? 18.182  -42.649  23.104  1.00 97.86  ? 188 GLN B N     1 
ATOM   4877  C  CA    . GLN B  1 188 ? 19.499  -43.282  23.046  1.00 98.92  ? 188 GLN B CA    1 
ATOM   4878  C  C     . GLN B  1 188 ? 19.458  -44.810  23.094  1.00 101.10 ? 188 GLN B C     1 
ATOM   4879  O  O     . GLN B  1 188 ? 20.421  -45.470  22.695  1.00 102.43 ? 188 GLN B O     1 
ATOM   4880  C  CB    . GLN B  1 188 ? 20.432  -42.710  24.116  1.00 97.26  ? 188 GLN B CB    1 
ATOM   4881  C  CG    . GLN B  1 188 ? 20.771  -41.242  23.900  1.00 95.79  ? 188 GLN B CG    1 
ATOM   4882  C  CD    . GLN B  1 188 ? 20.998  -40.910  22.439  1.00 97.14  ? 188 GLN B CD    1 
ATOM   4883  O  OE1   . GLN B  1 188 ? 22.045  -41.231  21.871  1.00 98.33  ? 188 GLN B OE1   1 
ATOM   4884  N  NE2   . GLN B  1 188 ? 20.012  -40.264  21.818  1.00 97.01  ? 188 GLN B NE2   1 
ATOM   4885  N  N     . LYS B  1 189 ? 18.335  -45.362  23.550  1.00 101.56 ? 189 LYS B N     1 
ATOM   4886  C  CA    . LYS B  1 189 ? 18.122  -46.804  23.555  1.00 103.79 ? 189 LYS B CA    1 
ATOM   4887  C  C     . LYS B  1 189 ? 18.431  -47.415  22.187  1.00 105.78 ? 189 LYS B C     1 
ATOM   4888  O  O     . LYS B  1 189 ? 18.953  -48.531  22.106  1.00 107.53 ? 189 LYS B O     1 
ATOM   4889  C  CB    . LYS B  1 189 ? 16.685  -47.117  23.972  1.00 104.24 ? 189 LYS B CB    1 
ATOM   4890  C  CG    . LYS B  1 189 ? 16.390  -48.594  24.224  1.00 106.92 ? 189 LYS B CG    1 
ATOM   4891  C  CD    . LYS B  1 189 ? 14.950  -48.804  24.693  1.00 108.34 ? 189 LYS B CD    1 
ATOM   4892  C  CE    . LYS B  1 189 ? 13.927  -48.421  23.621  1.00 109.68 ? 189 LYS B CE    1 
ATOM   4893  N  NZ    . LYS B  1 189 ? 12.522  -48.584  24.086  1.00 110.68 ? 189 LYS B NZ    1 
ATOM   4894  N  N     . ARG B  1 190 ? 18.116  -46.669  21.126  1.00 105.53 ? 190 ARG B N     1 
ATOM   4895  C  CA    . ARG B  1 190 ? 18.365  -47.099  19.748  1.00 107.37 ? 190 ARG B CA    1 
ATOM   4896  C  C     . ARG B  1 190 ? 19.752  -47.674  19.592  1.00 108.47 ? 190 ARG B C     1 
ATOM   4897  O  O     . ARG B  1 190 ? 19.918  -48.839  19.247  1.00 110.69 ? 190 ARG B O     1 
ATOM   4898  C  CB    . ARG B  1 190 ? 18.213  -45.925  18.784  1.00 106.37 ? 190 ARG B CB    1 
ATOM   4899  C  CG    . ARG B  1 190 ? 16.819  -45.715  18.290  1.00 106.48 ? 190 ARG B CG    1 
ATOM   4900  C  CD    . ARG B  1 190 ? 16.703  -44.408  17.539  1.00 105.30 ? 190 ARG B CD    1 
ATOM   4901  N  NE    . ARG B  1 190 ? 15.357  -44.232  17.008  1.00 106.30 ? 190 ARG B NE    1 
ATOM   4902  C  CZ    . ARG B  1 190 ? 14.296  -43.888  17.736  1.00 106.15 ? 190 ARG B CZ    1 
ATOM   4903  N  NH1   . ARG B  1 190 ? 14.405  -43.673  19.041  1.00 104.82 ? 190 ARG B NH1   1 
ATOM   4904  N  NH2   . ARG B  1 190 ? 13.114  -43.763  17.157  1.00 107.60 ? 190 ARG B NH2   1 
ATOM   4905  N  N     . TRP B  1 191 ? 20.741  -46.841  19.881  1.00 107.26 ? 191 TRP B N     1 
ATOM   4906  C  CA    . TRP B  1 191 ? 22.133  -47.154  19.625  1.00 108.43 ? 191 TRP B CA    1 
ATOM   4907  C  C     . TRP B  1 191 ? 22.783  -47.918  20.783  1.00 108.94 ? 191 TRP B C     1 
ATOM   4908  O  O     . TRP B  1 191 ? 23.890  -48.435  20.645  1.00 110.24 ? 191 TRP B O     1 
ATOM   4909  C  CB    . TRP B  1 191 ? 22.894  -45.859  19.280  1.00 106.90 ? 191 TRP B CB    1 
ATOM   4910  C  CG    . TRP B  1 191 ? 22.452  -45.267  17.950  1.00 107.24 ? 191 TRP B CG    1 
ATOM   4911  C  CD1   . TRP B  1 191 ? 22.841  -45.679  16.703  1.00 109.16 ? 191 TRP B CD1   1 
ATOM   4912  C  CD2   . TRP B  1 191 ? 21.525  -44.185  17.739  1.00 105.63 ? 191 TRP B CD2   1 
ATOM   4913  N  NE1   . TRP B  1 191 ? 22.221  -44.923  15.735  1.00 108.87 ? 191 TRP B NE1   1 
ATOM   4914  C  CE2   . TRP B  1 191 ? 21.408  -44.000  16.340  1.00 106.74 ? 191 TRP B CE2   1 
ATOM   4915  C  CE3   . TRP B  1 191 ? 20.786  -43.354  18.592  1.00 103.38 ? 191 TRP B CE3   1 
ATOM   4916  C  CZ2   . TRP B  1 191 ? 20.583  -43.014  15.774  1.00 105.63 ? 191 TRP B CZ2   1 
ATOM   4917  C  CZ3   . TRP B  1 191 ? 19.961  -42.377  18.025  1.00 102.65 ? 191 TRP B CZ3   1 
ATOM   4918  C  CH2   . TRP B  1 191 ? 19.870  -42.218  16.627  1.00 103.36 ? 191 TRP B CH2   1 
ATOM   4919  N  N     . ASN B  1 192 ? 22.082  -48.017  21.909  1.00 108.29 ? 192 ASN B N     1 
ATOM   4920  C  CA    . ASN B  1 192 ? 22.660  -48.611  23.117  1.00 108.69 ? 192 ASN B CA    1 
ATOM   4921  C  C     . ASN B  1 192 ? 22.401  -50.102  23.279  1.00 111.25 ? 192 ASN B C     1 
ATOM   4922  O  O     . ASN B  1 192 ? 22.710  -50.676  24.325  1.00 111.63 ? 192 ASN B O     1 
ATOM   4923  C  CB    . ASN B  1 192 ? 22.214  -47.843  24.368  1.00 106.34 ? 192 ASN B CB    1 
ATOM   4924  C  CG    . ASN B  1 192 ? 22.781  -46.428  24.424  1.00 104.24 ? 192 ASN B CG    1 
ATOM   4925  O  OD1   . ASN B  1 192 ? 23.890  -46.164  23.961  1.00 104.39 ? 192 ASN B OD1   1 
ATOM   4926  N  ND2   . ASN B  1 192 ? 22.014  -45.513  24.995  1.00 102.52 ? 192 ASN B ND2   1 
ATOM   4927  N  N     . ASN B  1 193 ? 21.842  -50.719  22.241  1.00 113.36 ? 193 ASN B N     1 
ATOM   4928  C  CA    . ASN B  1 193 ? 21.574  -52.160  22.226  1.00 116.19 ? 193 ASN B CA    1 
ATOM   4929  C  C     . ASN B  1 193 ? 22.453  -52.890  21.215  1.00 118.64 ? 193 ASN B C     1 
ATOM   4930  O  O     . ASN B  1 193 ? 22.061  -53.926  20.677  1.00 120.98 ? 193 ASN B O     1 
ATOM   4931  C  CB    . ASN B  1 193 ? 20.093  -52.429  21.931  1.00 116.75 ? 193 ASN B CB    1 
ATOM   4932  C  CG    . ASN B  1 193 ? 19.169  -51.786  22.948  1.00 115.18 ? 193 ASN B CG    1 
ATOM   4933  O  OD1   . ASN B  1 193 ? 19.351  -51.940  24.157  1.00 114.80 ? 193 ASN B OD1   1 
ATOM   4934  N  ND2   . ASN B  1 193 ? 18.169  -51.060  22.462  1.00 114.76 ? 193 ASN B ND2   1 
ATOM   4935  N  N     . GLY B  1 194 ? 23.642  -52.341  20.969  1.00 118.35 ? 194 GLY B N     1 
ATOM   4936  C  CA    . GLY B  1 194 ? 24.572  -52.872  19.970  1.00 120.78 ? 194 GLY B CA    1 
ATOM   4937  C  C     . GLY B  1 194 ? 26.026  -52.816  20.410  1.00 121.12 ? 194 GLY B C     1 
ATOM   4938  O  O     . GLY B  1 194 ? 26.341  -52.257  21.467  1.00 119.27 ? 194 GLY B O     1 
ATOM   4939  N  N     . SER B  1 195 ? 26.907  -53.396  19.588  1.00 123.54 ? 195 SER B N     1 
ATOM   4940  C  CA    . SER B  1 195 ? 28.345  -53.520  19.891  1.00 124.45 ? 195 SER B CA    1 
ATOM   4941  C  C     . SER B  1 195 ? 29.079  -52.178  19.895  1.00 122.40 ? 195 SER B C     1 
ATOM   4942  O  O     . SER B  1 195 ? 30.023  -51.975  20.668  1.00 122.05 ? 195 SER B O     1 
ATOM   4943  C  CB    . SER B  1 195 ? 29.037  -54.435  18.874  1.00 127.51 ? 195 SER B CB    1 
ATOM   4944  O  OG    . SER B  1 195 ? 28.137  -55.369  18.309  1.00 129.66 ? 195 SER B OG    1 
ATOM   4945  N  N     . ASP B  1 196 ? 28.636  -51.277  19.021  1.00 121.22 ? 196 ASP B N     1 
ATOM   4946  C  CA    . ASP B  1 196 ? 29.365  -50.056  18.696  1.00 119.72 ? 196 ASP B CA    1 
ATOM   4947  C  C     . ASP B  1 196 ? 29.419  -49.068  19.865  1.00 116.97 ? 196 ASP B C     1 
ATOM   4948  O  O     . ASP B  1 196 ? 28.423  -48.420  20.202  1.00 115.09 ? 196 ASP B O     1 
ATOM   4949  C  CB    . ASP B  1 196 ? 28.743  -49.396  17.456  1.00 119.38 ? 196 ASP B CB    1 
ATOM   4950  C  CG    . ASP B  1 196 ? 29.748  -49.176  16.333  1.00 120.66 ? 196 ASP B CG    1 
ATOM   4951  O  OD1   . ASP B  1 196 ? 30.899  -49.649  16.444  1.00 122.14 ? 196 ASP B OD1   1 
ATOM   4952  O  OD2   . ASP B  1 196 ? 29.379  -48.539  15.322  1.00 120.28 ? 196 ASP B OD2   1 
ATOM   4953  N  N     . GLU B  1 197 ? 30.590  -48.963  20.485  1.00 116.87 ? 197 GLU B N     1 
ATOM   4954  C  CA    . GLU B  1 197 ? 30.814  -47.981  21.537  1.00 114.19 ? 197 GLU B CA    1 
ATOM   4955  C  C     . GLU B  1 197 ? 30.865  -46.589  20.939  1.00 112.25 ? 197 GLU B C     1 
ATOM   4956  O  O     . GLU B  1 197 ? 30.488  -45.615  21.595  1.00 110.23 ? 197 GLU B O     1 
ATOM   4957  C  CB    . GLU B  1 197 ? 32.114  -48.261  22.294  1.00 115.15 ? 197 GLU B CB    1 
ATOM   4958  C  CG    . GLU B  1 197 ? 32.119  -49.557  23.099  1.00 117.36 ? 197 GLU B CG    1 
ATOM   4959  C  CD    . GLU B  1 197 ? 30.971  -49.644  24.085  1.00 116.41 ? 197 GLU B CD    1 
ATOM   4960  O  OE1   . GLU B  1 197 ? 30.890  -48.771  24.981  1.00 114.20 ? 197 GLU B OE1   1 
ATOM   4961  O  OE2   . GLU B  1 197 ? 30.156  -50.589  23.959  1.00 117.72 ? 197 GLU B OE2   1 
ATOM   4962  N  N     . SER B  1 198 ? 31.332  -46.496  19.694  1.00 113.12 ? 198 SER B N     1 
ATOM   4963  C  CA    . SER B  1 198 ? 31.396  -45.219  18.981  1.00 111.38 ? 198 SER B CA    1 
ATOM   4964  C  C     . SER B  1 198 ? 30.003  -44.629  18.714  1.00 109.47 ? 198 SER B C     1 
ATOM   4965  O  O     . SER B  1 198 ? 29.849  -43.407  18.628  1.00 107.77 ? 198 SER B O     1 
ATOM   4966  C  CB    . SER B  1 198 ? 32.186  -45.357  17.675  1.00 113.46 ? 198 SER B CB    1 
ATOM   4967  O  OG    . SER B  1 198 ? 31.434  -46.025  16.678  1.00 114.66 ? 198 SER B OG    1 
ATOM   4968  N  N     . LYS B  1 199 ? 28.999  -45.498  18.601  1.00 109.71 ? 199 LYS B N     1 
ATOM   4969  C  CA    . LYS B  1 199 ? 27.615  -45.070  18.369  1.00 108.00 ? 199 LYS B CA    1 
ATOM   4970  C  C     . LYS B  1 199 ? 26.813  -44.900  19.671  1.00 105.78 ? 199 LYS B C     1 
ATOM   4971  O  O     . LYS B  1 199 ? 25.832  -44.155  19.707  1.00 104.06 ? 199 LYS B O     1 
ATOM   4972  C  CB    . LYS B  1 199 ? 26.911  -46.050  17.425  1.00 109.99 ? 199 LYS B CB    1 
ATOM   4973  C  CG    . LYS B  1 199 ? 27.589  -46.211  16.073  1.00 111.70 ? 199 LYS B CG    1 
ATOM   4974  C  CD    . LYS B  1 199 ? 26.697  -45.816  14.909  1.00 111.39 ? 199 LYS B CD    1 
ATOM   4975  C  CE    . LYS B  1 199 ? 27.150  -46.528  13.637  1.00 113.46 ? 199 LYS B CE    1 
ATOM   4976  N  NZ    . LYS B  1 199 ? 26.079  -46.601  12.608  1.00 113.65 ? 199 LYS B NZ    1 
ATOM   4977  N  N     . LYS B  1 200 ? 27.236  -45.597  20.724  1.00 105.72 ? 200 LYS B N     1 
ATOM   4978  C  CA    . LYS B  1 200 ? 26.595  -45.525  22.038  1.00 103.95 ? 200 LYS B CA    1 
ATOM   4979  C  C     . LYS B  1 200 ? 26.823  -44.186  22.743  1.00 101.47 ? 200 LYS B C     1 
ATOM   4980  O  O     . LYS B  1 200 ? 27.914  -43.601  22.658  1.00 101.21 ? 200 LYS B O     1 
ATOM   4981  C  CB    . LYS B  1 200 ? 27.109  -46.643  22.945  1.00 105.17 ? 200 LYS B CB    1 
ATOM   4982  C  CG    . LYS B  1 200 ? 26.369  -47.954  22.861  1.00 106.48 ? 200 LYS B CG    1 
ATOM   4983  C  CD    . LYS B  1 200 ? 26.946  -48.939  23.863  1.00 107.21 ? 200 LYS B CD    1 
ATOM   4984  C  CE    . LYS B  1 200 ? 26.074  -50.165  24.001  1.00 108.88 ? 200 LYS B CE    1 
ATOM   4985  N  NZ    . LYS B  1 200 ? 26.907  -51.397  24.058  1.00 111.76 ? 200 LYS B NZ    1 
ATOM   4986  N  N     . LEU B  1 201 ? 25.785  -43.733  23.452  1.00 99.71  ? 201 LEU B N     1 
ATOM   4987  C  CA    . LEU B  1 201 ? 25.799  -42.504  24.262  1.00 97.12  ? 201 LEU B CA    1 
ATOM   4988  C  C     . LEU B  1 201 ? 25.207  -42.780  25.652  1.00 96.08  ? 201 LEU B C     1 
ATOM   4989  O  O     . LEU B  1 201 ? 23.993  -42.690  25.857  1.00 95.32  ? 201 LEU B O     1 
ATOM   4990  C  CB    . LEU B  1 201 ? 25.030  -41.369  23.555  1.00 95.87  ? 201 LEU B CB    1 
ATOM   4991  C  CG    . LEU B  1 201 ? 25.019  -39.954  24.158  1.00 93.54  ? 201 LEU B CG    1 
ATOM   4992  C  CD1   . LEU B  1 201 ? 26.376  -39.274  24.006  1.00 93.75  ? 201 LEU B CD1   1 
ATOM   4993  C  CD2   . LEU B  1 201 ? 23.935  -39.100  23.523  1.00 92.11  ? 201 LEU B CD2   1 
ATOM   4994  N  N     . TYR B  1 202 ? 26.077  -43.125  26.596  1.00 96.10  ? 202 TYR B N     1 
ATOM   4995  C  CA    . TYR B  1 202 ? 25.687  -43.370  27.983  1.00 95.50  ? 202 TYR B CA    1 
ATOM   4996  C  C     . TYR B  1 202 ? 25.143  -42.061  28.559  1.00 93.27  ? 202 TYR B C     1 
ATOM   4997  O  O     . TYR B  1 202 ? 25.503  -40.991  28.067  1.00 92.57  ? 202 TYR B O     1 
ATOM   4998  C  CB    . TYR B  1 202 ? 26.897  -43.888  28.776  1.00 96.24  ? 202 TYR B CB    1 
ATOM   4999  C  CG    . TYR B  1 202 ? 27.441  -45.202  28.241  1.00 98.97  ? 202 TYR B CG    1 
ATOM   5000  C  CD1   . TYR B  1 202 ? 28.329  -45.228  27.157  1.00 100.46 ? 202 TYR B CD1   1 
ATOM   5001  C  CD2   . TYR B  1 202 ? 27.051  -46.422  28.799  1.00 100.18 ? 202 TYR B CD2   1 
ATOM   5002  C  CE1   . TYR B  1 202 ? 28.819  -46.434  26.647  1.00 102.58 ? 202 TYR B CE1   1 
ATOM   5003  C  CE2   . TYR B  1 202 ? 27.535  -47.632  28.301  1.00 102.53 ? 202 TYR B CE2   1 
ATOM   5004  C  CZ    . TYR B  1 202 ? 28.418  -47.630  27.225  1.00 103.97 ? 202 TYR B CZ    1 
ATOM   5005  O  OH    . TYR B  1 202 ? 28.900  -48.821  26.733  1.00 106.34 ? 202 TYR B OH    1 
ATOM   5006  N  N     . CYS B  1 203 ? 24.272  -42.127  29.572  1.00 92.43  ? 203 CYS B N     1 
ATOM   5007  C  CA    . CYS B  1 203 ? 23.616  -40.904  30.086  1.00 90.30  ? 203 CYS B CA    1 
ATOM   5008  C  C     . CYS B  1 203 ? 23.794  -40.602  31.583  1.00 89.03  ? 203 CYS B C     1 
ATOM   5009  O  O     . CYS B  1 203 ? 23.585  -41.467  32.434  1.00 89.71  ? 203 CYS B O     1 
ATOM   5010  C  CB    . CYS B  1 203 ? 22.124  -40.896  29.733  1.00 90.29  ? 203 CYS B CB    1 
ATOM   5011  S  SG    . CYS B  1 203 ? 21.746  -40.854  27.959  1.00 91.89  ? 203 CYS B SG    1 
ATOM   5012  N  N     . VAL B  1 204 ? 24.178  -39.363  31.895  1.00 87.14  ? 204 VAL B N     1 
ATOM   5013  C  CA    . VAL B  1 204 ? 24.215  -38.894  33.282  1.00 85.58  ? 204 VAL B CA    1 
ATOM   5014  C  C     . VAL B  1 204 ? 23.132  -37.827  33.467  1.00 83.84  ? 204 VAL B C     1 
ATOM   5015  O  O     . VAL B  1 204 ? 23.115  -36.822  32.747  1.00 82.96  ? 204 VAL B O     1 
ATOM   5016  C  CB    . VAL B  1 204 ? 25.611  -38.333  33.707  1.00 85.13  ? 204 VAL B CB    1 
ATOM   5017  C  CG1   . VAL B  1 204 ? 25.707  -38.236  35.222  1.00 84.45  ? 204 VAL B CG1   1 
ATOM   5018  C  CG2   . VAL B  1 204 ? 26.749  -39.198  33.188  1.00 86.66  ? 204 VAL B CG2   1 
ATOM   5019  N  N     . TYR B  1 205 ? 22.216  -38.064  34.408  1.00 83.29  ? 205 TYR B N     1 
ATOM   5020  C  CA    . TYR B  1 205 ? 21.183  -37.081  34.751  1.00 81.73  ? 205 TYR B CA    1 
ATOM   5021  C  C     . TYR B  1 205 ? 21.374  -36.588  36.188  1.00 80.68  ? 205 TYR B C     1 
ATOM   5022  O  O     . TYR B  1 205 ? 21.437  -37.394  37.130  1.00 81.21  ? 205 TYR B O     1 
ATOM   5023  C  CB    . TYR B  1 205 ? 19.772  -37.645  34.530  1.00 82.32  ? 205 TYR B CB    1 
ATOM   5024  C  CG    . TYR B  1 205 ? 18.654  -36.699  34.923  1.00 81.09  ? 205 TYR B CG    1 
ATOM   5025  C  CD1   . TYR B  1 205 ? 18.141  -35.765  34.015  1.00 80.79  ? 205 TYR B CD1   1 
ATOM   5026  C  CD2   . TYR B  1 205 ? 18.112  -36.734  36.205  1.00 80.69  ? 205 TYR B CD2   1 
ATOM   5027  C  CE1   . TYR B  1 205 ? 17.112  -34.889  34.379  1.00 79.89  ? 205 TYR B CE1   1 
ATOM   5028  C  CE2   . TYR B  1 205 ? 17.092  -35.865  36.581  1.00 80.31  ? 205 TYR B CE2   1 
ATOM   5029  C  CZ    . TYR B  1 205 ? 16.591  -34.950  35.668  1.00 79.99  ? 205 TYR B CZ    1 
ATOM   5030  O  OH    . TYR B  1 205 ? 15.576  -34.104  36.062  1.00 79.60  ? 205 TYR B OH    1 
ATOM   5031  N  N     . VAL B  1 206 ? 21.461  -35.261  36.333  1.00 79.04  ? 206 VAL B N     1 
ATOM   5032  C  CA    . VAL B  1 206 ? 21.818  -34.606  37.593  1.00 77.87  ? 206 VAL B CA    1 
ATOM   5033  C  C     . VAL B  1 206 ? 20.610  -33.914  38.165  1.00 76.80  ? 206 VAL B C     1 
ATOM   5034  O  O     . VAL B  1 206 ? 20.128  -32.952  37.584  1.00 76.26  ? 206 VAL B O     1 
ATOM   5035  C  CB    . VAL B  1 206 ? 22.893  -33.519  37.381  1.00 77.04  ? 206 VAL B CB    1 
ATOM   5036  C  CG1   . VAL B  1 206 ? 23.523  -33.134  38.702  1.00 76.52  ? 206 VAL B CG1   1 
ATOM   5037  C  CG2   . VAL B  1 206 ? 23.965  -33.986  36.399  1.00 78.48  ? 206 VAL B CG2   1 
ATOM   5038  N  N     . ALA B  1 207 ? 20.124  -34.394  39.303  1.00 76.98  ? 207 ALA B N     1 
ATOM   5039  C  CA    . ALA B  1 207 ? 18.956  -33.801  39.950  1.00 76.34  ? 207 ALA B CA    1 
ATOM   5040  C  C     . ALA B  1 207 ? 19.375  -32.896  41.112  1.00 75.40  ? 207 ALA B C     1 
ATOM   5041  O  O     . ALA B  1 207 ? 19.664  -33.372  42.216  1.00 75.71  ? 207 ALA B O     1 
ATOM   5042  C  CB    . ALA B  1 207 ? 17.996  -34.882  40.415  1.00 77.26  ? 207 ALA B CB    1 
ATOM   5043  N  N     . VAL B  1 208 ? 19.419  -31.590  40.847  1.00 74.31  ? 208 VAL B N     1 
ATOM   5044  C  CA    . VAL B  1 208 ? 19.840  -30.615  41.851  1.00 73.25  ? 208 VAL B CA    1 
ATOM   5045  C  C     . VAL B  1 208 ? 18.636  -29.845  42.379  1.00 72.71  ? 208 VAL B C     1 
ATOM   5046  O  O     . VAL B  1 208 ? 18.073  -28.996  41.685  1.00 72.27  ? 208 VAL B O     1 
ATOM   5047  C  CB    . VAL B  1 208 ? 20.920  -29.624  41.313  1.00 72.48  ? 208 VAL B CB    1 
ATOM   5048  C  CG1   . VAL B  1 208 ? 21.413  -28.710  42.431  1.00 71.47  ? 208 VAL B CG1   1 
ATOM   5049  C  CG2   . VAL B  1 208 ? 22.093  -30.366  40.719  1.00 72.84  ? 208 VAL B CG2   1 
ATOM   5050  N  N     . GLY B  1 209 ? 18.241  -30.162  43.607  1.00 72.87  ? 209 GLY B N     1 
ATOM   5051  C  CA    . GLY B  1 209 ? 17.198  -29.408  44.306  1.00 72.45  ? 209 GLY B CA    1 
ATOM   5052  C  C     . GLY B  1 209 ? 15.763  -29.726  43.928  1.00 72.87  ? 209 GLY B C     1 
ATOM   5053  O  O     . GLY B  1 209 ? 14.837  -29.014  44.320  1.00 72.48  ? 209 GLY B O     1 
ATOM   5054  N  N     . GLN B  1 210 ? 15.580  -30.797  43.164  1.00 73.66  ? 210 GLN B N     1 
ATOM   5055  C  CA    . GLN B  1 210 ? 14.257  -31.200  42.724  1.00 74.34  ? 210 GLN B CA    1 
ATOM   5056  C  C     . GLN B  1 210 ? 13.538  -31.864  43.891  1.00 74.90  ? 210 GLN B C     1 
ATOM   5057  O  O     . GLN B  1 210 ? 14.155  -32.121  44.930  1.00 74.80  ? 210 GLN B O     1 
ATOM   5058  C  CB    . GLN B  1 210 ? 14.365  -32.137  41.525  1.00 75.11  ? 210 GLN B CB    1 
ATOM   5059  C  CG    . GLN B  1 210 ? 14.899  -31.461  40.274  1.00 75.34  ? 210 GLN B CG    1 
ATOM   5060  C  CD    . GLN B  1 210 ? 15.081  -32.429  39.115  1.00 78.45  ? 210 GLN B CD    1 
ATOM   5061  O  OE1   . GLN B  1 210 ? 14.316  -33.383  38.948  1.00 80.93  ? 210 GLN B OE1   1 
ATOM   5062  N  NE2   . GLN B  1 210 ? 16.097  -32.186  38.306  1.00 78.41  ? 210 GLN B NE2   1 
ATOM   5063  N  N     . LYS B  1 211 ? 12.235  -32.100  43.736  1.00 75.41  ? 211 LYS B N     1 
ATOM   5064  C  CA    . LYS B  1 211 ? 11.474  -32.874  44.708  1.00 76.09  ? 211 LYS B CA    1 
ATOM   5065  C  C     . LYS B  1 211 ? 12.028  -34.288  44.656  1.00 76.76  ? 211 LYS B C     1 
ATOM   5066  O  O     . LYS B  1 211 ? 12.300  -34.801  43.575  1.00 77.19  ? 211 LYS B O     1 
ATOM   5067  C  CB    . LYS B  1 211 ? 9.984   -32.877  44.352  1.00 77.06  ? 211 LYS B CB    1 
ATOM   5068  C  CG    . LYS B  1 211 ? 9.233   -31.591  44.702  1.00 77.21  ? 211 LYS B CG    1 
ATOM   5069  C  CD    . LYS B  1 211 ? 7.831   -31.507  44.058  1.00 79.35  ? 211 LYS B CD    1 
ATOM   5070  C  CE    . LYS B  1 211 ? 6.857   -32.561  44.624  1.00 82.01  ? 211 LYS B CE    1 
ATOM   5071  N  NZ    . LYS B  1 211 ? 5.411   -32.142  44.647  1.00 82.42  ? 211 LYS B NZ    1 
ATOM   5072  N  N     . ARG B  1 212 ? 12.220  -34.909  45.812  1.00 76.97  ? 212 ARG B N     1 
ATOM   5073  C  CA    . ARG B  1 212 ? 12.680  -36.292  45.857  1.00 77.91  ? 212 ARG B CA    1 
ATOM   5074  C  C     . ARG B  1 212 ? 11.718  -37.204  45.081  1.00 79.34  ? 212 ARG B C     1 
ATOM   5075  O  O     . ARG B  1 212 ? 12.152  -38.072  44.325  1.00 79.90  ? 212 ARG B O     1 
ATOM   5076  C  CB    . ARG B  1 212 ? 12.807  -36.761  47.305  1.00 78.40  ? 212 ARG B CB    1 
ATOM   5077  C  CG    . ARG B  1 212 ? 14.132  -37.409  47.627  1.00 78.22  ? 212 ARG B CG    1 
ATOM   5078  C  CD    . ARG B  1 212 ? 14.318  -37.563  49.128  1.00 78.35  ? 212 ARG B CD    1 
ATOM   5079  N  NE    . ARG B  1 212 ? 15.734  -37.500  49.493  1.00 78.06  ? 212 ARG B NE    1 
ATOM   5080  C  CZ    . ARG B  1 212 ? 16.199  -37.489  50.740  1.00 77.97  ? 212 ARG B CZ    1 
ATOM   5081  N  NH1   . ARG B  1 212 ? 15.363  -37.540  51.770  1.00 78.15  ? 212 ARG B NH1   1 
ATOM   5082  N  NH2   . ARG B  1 212 ? 17.508  -37.424  50.957  1.00 77.55  ? 212 ARG B NH2   1 
ATOM   5083  N  N     . SER B  1 213 ? 10.416  -36.979  45.260  1.00 80.00  ? 213 SER B N     1 
ATOM   5084  C  CA    . SER B  1 213 ? 9.368   -37.761  44.598  1.00 81.79  ? 213 SER B CA    1 
ATOM   5085  C  C     . SER B  1 213 ? 9.394   -37.646  43.072  1.00 82.12  ? 213 SER B C     1 
ATOM   5086  O  O     . SER B  1 213 ? 9.091   -38.613  42.369  1.00 83.63  ? 213 SER B O     1 
ATOM   5087  C  CB    . SER B  1 213 ? 7.992   -37.347  45.113  1.00 82.13  ? 213 SER B CB    1 
ATOM   5088  O  OG    . SER B  1 213 ? 7.726   -35.997  44.785  1.00 80.72  ? 213 SER B OG    1 
ATOM   5089  N  N     . THR B  1 214 ? 9.742   -36.461  42.573  1.00 81.11  ? 214 THR B N     1 
ATOM   5090  C  CA    . THR B  1 214 ? 9.869   -36.204  41.135  1.00 81.23  ? 214 THR B CA    1 
ATOM   5091  C  C     . THR B  1 214 ? 10.930  -37.116  40.507  1.00 81.90  ? 214 THR B C     1 
ATOM   5092  O  O     . THR B  1 214 ? 10.659  -37.791  39.505  1.00 83.10  ? 214 THR B O     1 
ATOM   5093  C  CB    . THR B  1 214 ? 10.213  -34.718  40.854  1.00 79.52  ? 214 THR B CB    1 
ATOM   5094  O  OG1   . THR B  1 214 ? 9.198   -33.875  41.416  1.00 79.11  ? 214 THR B OG1   1 
ATOM   5095  C  CG2   . THR B  1 214 ? 10.319  -34.455  39.353  1.00 79.57  ? 214 THR B CG2   1 
ATOM   5096  N  N     . VAL B  1 215 ? 12.122  -37.132  41.112  1.00 81.35  ? 215 VAL B N     1 
ATOM   5097  C  CA    . VAL B  1 215 ? 13.244  -37.979  40.681  1.00 81.74  ? 215 VAL B CA    1 
ATOM   5098  C  C     . VAL B  1 215 ? 12.838  -39.449  40.745  1.00 83.50  ? 215 VAL B C     1 
ATOM   5099  O  O     . VAL B  1 215 ? 13.012  -40.181  39.774  1.00 84.53  ? 215 VAL B O     1 
ATOM   5100  C  CB    . VAL B  1 215 ? 14.538  -37.735  41.531  1.00 80.91  ? 215 VAL B CB    1 
ATOM   5101  C  CG1   . VAL B  1 215 ? 15.728  -38.465  40.943  1.00 81.53  ? 215 VAL B CG1   1 
ATOM   5102  C  CG2   . VAL B  1 215 ? 14.864  -36.248  41.630  1.00 79.35  ? 215 VAL B CG2   1 
ATOM   5103  N  N     . ALA B  1 216 ? 12.283  -39.867  41.882  1.00 84.08  ? 216 ALA B N     1 
ATOM   5104  C  CA    . ALA B  1 216 ? 11.732  -41.214  42.032  1.00 86.12  ? 216 ALA B CA    1 
ATOM   5105  C  C     . ALA B  1 216 ? 10.863  -41.595  40.831  1.00 87.31  ? 216 ALA B C     1 
ATOM   5106  O  O     . ALA B  1 216 ? 11.079  -42.632  40.195  1.00 88.59  ? 216 ALA B O     1 
ATOM   5107  C  CB    . ALA B  1 216 ? 10.932  -41.312  43.318  1.00 86.50  ? 216 ALA B CB    1 
ATOM   5108  N  N     . GLN B  1 217 ? 9.896   -40.732  40.523  1.00 86.93  ? 217 GLN B N     1 
ATOM   5109  C  CA    . GLN B  1 217 ? 9.003   -40.914  39.383  1.00 88.01  ? 217 GLN B CA    1 
ATOM   5110  C  C     . GLN B  1 217 ? 9.749   -40.847  38.054  1.00 87.71  ? 217 GLN B C     1 
ATOM   5111  O  O     . GLN B  1 217 ? 9.346   -41.491  37.088  1.00 89.23  ? 217 GLN B O     1 
ATOM   5112  C  CB    . GLN B  1 217 ? 7.884   -39.867  39.402  1.00 87.64  ? 217 GLN B CB    1 
ATOM   5113  C  CG    . GLN B  1 217 ? 6.862   -40.035  40.529  1.00 88.70  ? 217 GLN B CG    1 
ATOM   5114  C  CD    . GLN B  1 217 ? 5.956   -38.821  40.699  1.00 88.18  ? 217 GLN B CD    1 
ATOM   5115  O  OE1   . GLN B  1 217 ? 5.936   -37.924  39.860  1.00 87.75  ? 217 GLN B OE1   1 
ATOM   5116  N  NE2   . GLN B  1 217 ? 5.202   -38.793  41.790  1.00 88.84  ? 217 GLN B NE2   1 
ATOM   5117  N  N     . LEU B  1 218 ? 10.826  -40.067  38.002  1.00 86.09  ? 218 LEU B N     1 
ATOM   5118  C  CA    . LEU B  1 218 ? 11.595  -39.910  36.767  1.00 85.84  ? 218 LEU B CA    1 
ATOM   5119  C  C     . LEU B  1 218 ? 12.467  -41.130  36.497  1.00 87.05  ? 218 LEU B C     1 
ATOM   5120  O  O     . LEU B  1 218 ? 12.619  -41.546  35.346  1.00 87.86  ? 218 LEU B O     1 
ATOM   5121  C  CB    . LEU B  1 218 ? 12.470  -38.656  36.813  1.00 83.88  ? 218 LEU B CB    1 
ATOM   5122  C  CG    . LEU B  1 218 ? 13.028  -38.216  35.457  1.00 83.30  ? 218 LEU B CG    1 
ATOM   5123  C  CD1   . LEU B  1 218 ? 12.236  -37.032  34.918  1.00 82.57  ? 218 LEU B CD1   1 
ATOM   5124  C  CD2   . LEU B  1 218 ? 14.494  -37.874  35.575  1.00 81.50  ? 218 LEU B CD2   1 
ATOM   5125  N  N     . VAL B  1 219 ? 13.044  -41.685  37.563  1.00 87.25  ? 219 VAL B N     1 
ATOM   5126  C  CA    . VAL B  1 219 ? 13.881  -42.880  37.473  1.00 88.59  ? 219 VAL B CA    1 
ATOM   5127  C  C     . VAL B  1 219 ? 13.018  -44.077  37.084  1.00 90.96  ? 219 VAL B C     1 
ATOM   5128  O  O     . VAL B  1 219 ? 13.417  -44.899  36.258  1.00 92.07  ? 219 VAL B O     1 
ATOM   5129  C  CB    . VAL B  1 219 ? 14.652  -43.134  38.793  1.00 88.15  ? 219 VAL B CB    1 
ATOM   5130  C  CG1   . VAL B  1 219 ? 15.151  -44.565  38.874  1.00 90.02  ? 219 VAL B CG1   1 
ATOM   5131  C  CG2   . VAL B  1 219 ? 15.818  -42.179  38.910  1.00 86.19  ? 219 VAL B CG2   1 
ATOM   5132  N  N     . GLN B  1 220 ? 11.826  -44.142  37.673  1.00 91.95  ? 220 GLN B N     1 
ATOM   5133  C  CA    . GLN B  1 220 ? 10.836  -45.168  37.361  1.00 94.45  ? 220 GLN B CA    1 
ATOM   5134  C  C     . GLN B  1 220 ? 10.478  -45.142  35.883  1.00 95.22  ? 220 GLN B C     1 
ATOM   5135  O  O     . GLN B  1 220 ? 10.356  -46.195  35.260  1.00 97.16  ? 220 GLN B O     1 
ATOM   5136  C  CB    . GLN B  1 220 ? 9.581   -44.964  38.213  1.00 94.78  ? 220 GLN B CB    1 
ATOM   5137  C  CG    . GLN B  1 220 ? 8.375   -45.791  37.788  1.00 97.58  ? 220 GLN B CG    1 
ATOM   5138  C  CD    . GLN B  1 220 ? 8.522   -47.254  38.143  1.00 100.43 ? 220 GLN B CD    1 
ATOM   5139  O  OE1   . GLN B  1 220 ? 8.353   -47.649  39.296  1.00 101.34 ? 220 GLN B OE1   1 
ATOM   5140  N  NE2   . GLN B  1 220 ? 8.832   -48.070  37.148  1.00 102.16 ? 220 GLN B NE2   1 
ATOM   5141  N  N     . THR B  1 221 ? 10.321  -43.940  35.332  1.00 94.11  ? 221 THR B N     1 
ATOM   5142  C  CA    . THR B  1 221 ? 9.993   -43.766  33.914  1.00 94.99  ? 221 THR B CA    1 
ATOM   5143  C  C     . THR B  1 221 ? 11.139  -44.215  32.995  1.00 95.60  ? 221 THR B C     1 
ATOM   5144  O  O     . THR B  1 221 ? 10.890  -44.741  31.907  1.00 97.11  ? 221 THR B O     1 
ATOM   5145  C  CB    . THR B  1 221 ? 9.568   -42.317  33.595  1.00 93.50  ? 221 THR B CB    1 
ATOM   5146  O  OG1   . THR B  1 221 ? 8.627   -41.878  34.580  1.00 93.33  ? 221 THR B OG1   1 
ATOM   5147  C  CG2   . THR B  1 221 ? 8.920   -42.224  32.210  1.00 94.13  ? 221 THR B CG2   1 
ATOM   5148  N  N     . LEU B  1 222 ? 12.381  -44.015  33.438  1.00 94.75  ? 222 LEU B N     1 
ATOM   5149  C  CA    . LEU B  1 222 ? 13.553  -44.536  32.723  1.00 95.62  ? 222 LEU B CA    1 
ATOM   5150  C  C     . LEU B  1 222 ? 13.567  -46.072  32.703  1.00 98.01  ? 222 LEU B C     1 
ATOM   5151  O  O     . LEU B  1 222 ? 13.945  -46.693  31.704  1.00 99.19  ? 222 LEU B O     1 
ATOM   5152  C  CB    . LEU B  1 222 ? 14.856  -44.000  33.336  1.00 94.15  ? 222 LEU B CB    1 
ATOM   5153  C  CG    . LEU B  1 222 ? 15.209  -42.528  33.093  1.00 92.30  ? 222 LEU B CG    1 
ATOM   5154  C  CD1   . LEU B  1 222 ? 16.365  -42.101  33.965  1.00 91.05  ? 222 LEU B CD1   1 
ATOM   5155  C  CD2   . LEU B  1 222 ? 15.540  -42.276  31.634  1.00 93.12  ? 222 LEU B CD2   1 
ATOM   5156  N  N     . GLU B  1 223 ? 13.142  -46.662  33.817  1.00 98.83  ? 223 GLU B N     1 
ATOM   5157  C  CA    . GLU B  1 223 ? 13.044  -48.105  33.973  1.00 101.27 ? 223 GLU B CA    1 
ATOM   5158  C  C     . GLU B  1 223 ? 11.937  -48.686  33.085  1.00 102.98 ? 223 GLU B C     1 
ATOM   5159  O  O     . GLU B  1 223 ? 12.062  -49.807  32.593  1.00 105.04 ? 223 GLU B O     1 
ATOM   5160  C  CB    . GLU B  1 223 ? 12.770  -48.442  35.439  1.00 101.56 ? 223 GLU B CB    1 
ATOM   5161  C  CG    . GLU B  1 223 ? 13.132  -49.860  35.852  1.00 104.60 ? 223 GLU B CG    1 
ATOM   5162  C  CD    . GLU B  1 223 ? 14.487  -49.954  36.539  1.00 105.65 ? 223 GLU B CD    1 
ATOM   5163  O  OE1   . GLU B  1 223 ? 15.025  -48.903  36.971  1.00 103.25 ? 223 GLU B OE1   1 
ATOM   5164  O  OE2   . GLU B  1 223 ? 15.003  -51.092  36.657  1.00 108.26 ? 223 GLU B OE2   1 
ATOM   5165  N  N     . GLN B  1 224 ? 10.863  -47.923  32.882  1.00 102.26 ? 224 GLN B N     1 
ATOM   5166  C  CA    . GLN B  1 224 ? 9.741   -48.367  32.055  1.00 103.99 ? 224 GLN B CA    1 
ATOM   5167  C  C     . GLN B  1 224 ? 10.040  -48.287  30.560  1.00 104.56 ? 224 GLN B C     1 
ATOM   5168  O  O     . GLN B  1 224 ? 9.190   -48.603  29.726  1.00 106.04 ? 224 GLN B O     1 
ATOM   5169  C  CB    . GLN B  1 224 ? 8.479   -47.571  32.391  1.00 103.42 ? 224 GLN B CB    1 
ATOM   5170  C  CG    . GLN B  1 224 ? 7.525   -48.293  33.339  1.00 104.80 ? 224 GLN B CG    1 
ATOM   5171  C  CD    . GLN B  1 224 ? 6.799   -47.351  34.292  1.00 103.31 ? 224 GLN B CD    1 
ATOM   5172  O  OE1   . GLN B  1 224 ? 6.752   -46.140  34.083  1.00 101.86 ? 224 GLN B OE1   1 
ATOM   5173  N  NE2   . GLN B  1 224 ? 6.237   -47.911  35.353  1.00 104.11 ? 224 GLN B NE2   1 
ATOM   5174  N  N     . HIS B  1 225 ? 11.253  -47.859  30.228  1.00 103.68 ? 225 HIS B N     1 
ATOM   5175  C  CA    . HIS B  1 225 ? 11.681  -47.748  28.837  1.00 104.40 ? 225 HIS B CA    1 
ATOM   5176  C  C     . HIS B  1 225 ? 13.034  -48.436  28.599  1.00 105.06 ? 225 HIS B C     1 
ATOM   5177  O  O     . HIS B  1 225 ? 13.637  -48.273  27.534  1.00 105.28 ? 225 HIS B O     1 
ATOM   5178  C  CB    . HIS B  1 225 ? 11.742  -46.272  28.417  1.00 102.47 ? 225 HIS B CB    1 
ATOM   5179  C  CG    . HIS B  1 225 ? 10.397  -45.625  28.234  1.00 102.73 ? 225 HIS B CG    1 
ATOM   5180  N  ND1   . HIS B  1 225 ? 9.511   -45.429  29.274  1.00 102.48 ? 225 HIS B ND1   1 
ATOM   5181  C  CD2   . HIS B  1 225 ? 9.803   -45.103  27.134  1.00 102.95 ? 225 HIS B CD2   1 
ATOM   5182  C  CE1   . HIS B  1 225 ? 8.424   -44.831  28.819  1.00 102.31 ? 225 HIS B CE1   1 
ATOM   5183  N  NE2   . HIS B  1 225 ? 8.578   -44.618  27.524  1.00 102.60 ? 225 HIS B NE2   1 
ATOM   5184  N  N     . ASP B  1 226 ? 13.487  -49.207  29.595  1.00 105.56 ? 226 ASP B N     1 
ATOM   5185  C  CA    . ASP B  1 226 ? 14.788  -49.900  29.589  1.00 106.29 ? 226 ASP B CA    1 
ATOM   5186  C  C     . ASP B  1 226 ? 15.954  -48.952  29.280  1.00 104.74 ? 226 ASP B C     1 
ATOM   5187  O  O     . ASP B  1 226 ? 16.908  -49.316  28.586  1.00 105.68 ? 226 ASP B O     1 
ATOM   5188  C  CB    . ASP B  1 226 ? 14.771  -51.095  28.622  1.00 108.85 ? 226 ASP B CB    1 
ATOM   5189  C  CG    . ASP B  1 226 ? 15.713  -52.220  29.046  1.00 110.32 ? 226 ASP B CG    1 
ATOM   5190  O  OD1   . ASP B  1 226 ? 16.652  -51.985  29.834  1.00 109.38 ? 226 ASP B OD1   1 
ATOM   5191  O  OD2   . ASP B  1 226 ? 15.507  -53.357  28.581  1.00 112.81 ? 226 ASP B OD2   1 
ATOM   5192  N  N     . ALA B  1 227 ? 15.860  -47.733  29.803  1.00 102.57 ? 227 ALA B N     1 
ATOM   5193  C  CA    . ALA B  1 227 ? 16.861  -46.699  29.567  1.00 100.93 ? 227 ALA B CA    1 
ATOM   5194  C  C     . ALA B  1 227 ? 17.783  -46.538  30.770  1.00 99.97  ? 227 ALA B C     1 
ATOM   5195  O  O     . ALA B  1 227 ? 18.927  -46.102  30.629  1.00 99.36  ? 227 ALA B O     1 
ATOM   5196  C  CB    . ALA B  1 227 ? 16.189  -45.380  29.228  1.00 99.28  ? 227 ALA B CB    1 
ATOM   5197  N  N     . MET B  1 228 ? 17.267  -46.896  31.946  1.00 100.01 ? 228 MET B N     1 
ATOM   5198  C  CA    . MET B  1 228 ? 18.025  -46.911  33.196  1.00 99.37  ? 228 MET B CA    1 
ATOM   5199  C  C     . MET B  1 228 ? 19.353  -47.666  33.061  1.00 100.48 ? 228 MET B C     1 
ATOM   5200  O  O     . MET B  1 228 ? 20.374  -47.247  33.618  1.00 99.49  ? 228 MET B O     1 
ATOM   5201  C  CB    . MET B  1 228 ? 17.174  -47.540  34.307  1.00 100.09 ? 228 MET B CB    1 
ATOM   5202  C  CG    . MET B  1 228 ? 17.722  -47.343  35.710  1.00 99.43  ? 228 MET B CG    1 
ATOM   5203  S  SD    . MET B  1 228 ? 17.626  -45.622  36.241  1.00 97.30  ? 228 MET B SD    1 
ATOM   5204  C  CE    . MET B  1 228 ? 18.818  -45.619  37.575  1.00 96.23  ? 228 MET B CE    1 
ATOM   5205  N  N     . LYS B  1 229 ? 19.327  -48.766  32.305  1.00 102.51 ? 229 LYS B N     1 
ATOM   5206  C  CA    . LYS B  1 229 ? 20.499  -49.630  32.117  1.00 104.01 ? 229 LYS B CA    1 
ATOM   5207  C  C     . LYS B  1 229 ? 21.723  -48.934  31.506  1.00 103.14 ? 229 LYS B C     1 
ATOM   5208  O  O     . LYS B  1 229 ? 22.840  -49.426  31.653  1.00 104.31 ? 229 LYS B O     1 
ATOM   5209  C  CB    . LYS B  1 229 ? 20.139  -50.879  31.304  1.00 106.36 ? 229 LYS B CB    1 
ATOM   5210  C  CG    . LYS B  1 229 ? 19.802  -50.601  29.855  1.00 106.96 ? 229 LYS B CG    1 
ATOM   5211  C  CD    . LYS B  1 229 ? 19.760  -51.882  29.066  1.00 110.86 ? 229 LYS B CD    1 
ATOM   5212  C  CE    . LYS B  1 229 ? 19.243  -51.655  27.659  1.00 111.90 ? 229 LYS B CE    1 
ATOM   5213  N  NZ    . LYS B  1 229 ? 19.096  -52.961  26.945  1.00 115.49 ? 229 LYS B NZ    1 
ATOM   5214  N  N     . TYR B  1 230 ? 21.517  -47.808  30.821  1.00 101.32 ? 230 TYR B N     1 
ATOM   5215  C  CA    . TYR B  1 230 ? 22.633  -47.055  30.240  1.00 100.33 ? 230 TYR B CA    1 
ATOM   5216  C  C     . TYR B  1 230 ? 22.758  -45.651  30.808  1.00 97.78  ? 230 TYR B C     1 
ATOM   5217  O  O     . TYR B  1 230 ? 23.389  -44.776  30.207  1.00 96.90  ? 230 TYR B O     1 
ATOM   5218  C  CB    . TYR B  1 230 ? 22.567  -47.023  28.707  1.00 101.01 ? 230 TYR B CB    1 
ATOM   5219  C  CG    . TYR B  1 230 ? 21.310  -46.430  28.095  1.00 100.31 ? 230 TYR B CG    1 
ATOM   5220  C  CD1   . TYR B  1 230 ? 21.176  -45.051  27.906  1.00 98.14  ? 230 TYR B CD1   1 
ATOM   5221  C  CD2   . TYR B  1 230 ? 20.269  -47.257  27.661  1.00 101.89 ? 230 TYR B CD2   1 
ATOM   5222  C  CE1   . TYR B  1 230 ? 20.030  -44.515  27.322  1.00 97.37  ? 230 TYR B CE1   1 
ATOM   5223  C  CE2   . TYR B  1 230 ? 19.123  -46.731  27.076  1.00 100.85 ? 230 TYR B CE2   1 
ATOM   5224  C  CZ    . TYR B  1 230 ? 19.011  -45.364  26.910  1.00 98.90  ? 230 TYR B CZ    1 
ATOM   5225  O  OH    . TYR B  1 230 ? 17.876  -44.852  26.332  1.00 98.68  ? 230 TYR B OH    1 
ATOM   5226  N  N     . SER B  1 231 ? 22.165  -45.438  31.976  1.00 96.66  ? 231 SER B N     1 
ATOM   5227  C  CA    . SER B  1 231 ? 22.212  -44.121  32.592  1.00 94.38  ? 231 SER B CA    1 
ATOM   5228  C  C     . SER B  1 231 ? 22.466  -44.121  34.100  1.00 93.68  ? 231 SER B C     1 
ATOM   5229  O  O     . SER B  1 231 ? 22.098  -45.062  34.816  1.00 94.64  ? 231 SER B O     1 
ATOM   5230  C  CB    . SER B  1 231 ? 20.987  -43.262  32.213  1.00 93.18  ? 231 SER B CB    1 
ATOM   5231  O  OG    . SER B  1 231 ? 19.793  -44.017  32.116  1.00 94.59  ? 231 SER B OG    1 
ATOM   5232  N  N     . ILE B  1 232 ? 23.127  -43.053  34.548  1.00 91.88  ? 232 ILE B N     1 
ATOM   5233  C  CA    . ILE B  1 232 ? 23.478  -42.840  35.944  1.00 90.86  ? 232 ILE B CA    1 
ATOM   5234  C  C     . ILE B  1 232 ? 22.717  -41.609  36.424  1.00 88.83  ? 232 ILE B C     1 
ATOM   5235  O  O     . ILE B  1 232 ? 22.635  -40.609  35.703  1.00 87.87  ? 232 ILE B O     1 
ATOM   5236  C  CB    . ILE B  1 232 ? 25.009  -42.641  36.107  1.00 90.89  ? 232 ILE B CB    1 
ATOM   5237  C  CG1   . ILE B  1 232 ? 25.763  -43.896  35.640  1.00 93.01  ? 232 ILE B CG1   1 
ATOM   5238  C  CG2   . ILE B  1 232 ? 25.370  -42.310  37.554  1.00 89.99  ? 232 ILE B CG2   1 
ATOM   5239  C  CD1   . ILE B  1 232 ? 27.241  -43.684  35.329  1.00 92.90  ? 232 ILE B CD1   1 
ATOM   5240  N  N     . ILE B  1 233 ? 22.149  -41.701  37.629  1.00 88.36  ? 233 ILE B N     1 
ATOM   5241  C  CA    . ILE B  1 233 ? 21.380  -40.608  38.244  1.00 86.35  ? 233 ILE B CA    1 
ATOM   5242  C  C     . ILE B  1 233 ? 22.092  -40.030  39.469  1.00 85.24  ? 233 ILE B C     1 
ATOM   5243  O  O     . ILE B  1 233 ? 22.286  -40.724  40.469  1.00 85.74  ? 233 ILE B O     1 
ATOM   5244  C  CB    . ILE B  1 233 ? 19.958  -41.081  38.669  1.00 86.78  ? 233 ILE B CB    1 
ATOM   5245  C  CG1   . ILE B  1 233 ? 19.206  -41.747  37.500  1.00 87.74  ? 233 ILE B CG1   1 
ATOM   5246  C  CG2   . ILE B  1 233 ? 19.161  -39.933  39.314  1.00 85.26  ? 233 ILE B CG2   1 
ATOM   5247  C  CD1   . ILE B  1 233 ? 18.823  -40.824  36.348  1.00 86.15  ? 233 ILE B CD1   1 
ATOM   5248  N  N     . VAL B  1 234 ? 22.474  -38.758  39.389  1.00 83.73  ? 234 VAL B N     1 
ATOM   5249  C  CA    . VAL B  1 234 ? 23.062  -38.056  40.543  1.00 82.73  ? 234 VAL B CA    1 
ATOM   5250  C  C     . VAL B  1 234 ? 22.031  -37.112  41.163  1.00 81.20  ? 234 VAL B C     1 
ATOM   5251  O  O     . VAL B  1 234 ? 21.496  -36.234  40.484  1.00 80.22  ? 234 VAL B O     1 
ATOM   5252  C  CB    . VAL B  1 234 ? 24.364  -37.276  40.187  1.00 82.12  ? 234 VAL B CB    1 
ATOM   5253  C  CG1   . VAL B  1 234 ? 25.025  -36.749  41.453  1.00 81.23  ? 234 VAL B CG1   1 
ATOM   5254  C  CG2   . VAL B  1 234 ? 25.339  -38.161  39.412  1.00 83.45  ? 234 VAL B CG2   1 
ATOM   5255  N  N     . ALA B  1 235 ? 21.760  -37.297  42.452  1.00 81.01  ? 235 ALA B N     1 
ATOM   5256  C  CA    . ALA B  1 235 ? 20.695  -36.556  43.101  1.00 79.92  ? 235 ALA B CA    1 
ATOM   5257  C  C     . ALA B  1 235 ? 21.051  -36.016  44.483  1.00 79.44  ? 235 ALA B C     1 
ATOM   5258  O  O     . ALA B  1 235 ? 21.242  -36.763  45.448  1.00 80.28  ? 235 ALA B O     1 
ATOM   5259  C  CB    . ALA B  1 235 ? 19.420  -37.393  43.160  1.00 80.76  ? 235 ALA B CB    1 
ATOM   5260  N  N     . ALA B  1 236 ? 21.147  -34.695  44.549  1.00 78.22  ? 236 ALA B N     1 
ATOM   5261  C  CA    . ALA B  1 236 ? 21.080  -33.958  45.802  1.00 77.54  ? 236 ALA B CA    1 
ATOM   5262  C  C     . ALA B  1 236 ? 19.807  -33.109  45.744  1.00 76.57  ? 236 ALA B C     1 
ATOM   5263  O  O     . ALA B  1 236 ? 19.749  -32.083  45.052  1.00 75.54  ? 236 ALA B O     1 
ATOM   5264  C  CB    . ALA B  1 236 ? 22.315  -33.089  45.983  1.00 76.90  ? 236 ALA B CB    1 
ATOM   5265  N  N     . THR B  1 237 ? 18.780  -33.562  46.453  1.00 76.92  ? 237 THR B N     1 
ATOM   5266  C  CA    . THR B  1 237 ? 17.450  -32.981  46.314  1.00 76.66  ? 237 THR B CA    1 
ATOM   5267  C  C     . THR B  1 237 ? 17.182  -31.755  47.221  1.00 75.62  ? 237 THR B C     1 
ATOM   5268  O  O     . THR B  1 237 ? 18.097  -31.228  47.876  1.00 74.80  ? 237 THR B O     1 
ATOM   5269  C  CB    . THR B  1 237 ? 16.355  -34.065  46.479  1.00 78.03  ? 237 THR B CB    1 
ATOM   5270  O  OG1   . THR B  1 237 ? 16.643  -34.873  47.629  1.00 79.30  ? 237 THR B OG1   1 
ATOM   5271  C  CG2   . THR B  1 237 ? 16.284  -34.953  45.239  1.00 78.56  ? 237 THR B CG2   1 
ATOM   5272  N  N     . ALA B  1 238 ? 15.918  -31.323  47.238  1.00 75.47  ? 238 ALA B N     1 
ATOM   5273  C  CA    . ALA B  1 238 ? 15.469  -30.083  47.890  1.00 74.70  ? 238 ALA B CA    1 
ATOM   5274  C  C     . ALA B  1 238 ? 15.710  -29.946  49.409  1.00 74.63  ? 238 ALA B C     1 
ATOM   5275  O  O     . ALA B  1 238 ? 15.844  -28.832  49.919  1.00 74.14  ? 238 ALA B O     1 
ATOM   5276  C  CB    . ALA B  1 238 ? 13.990  -29.813  47.554  1.00 74.90  ? 238 ALA B CB    1 
ATOM   5277  N  N     . SER B  1 239 ? 15.756  -31.053  50.136  1.00 75.29  ? 239 SER B N     1 
ATOM   5278  C  CA    . SER B  1 239 ? 16.017  -30.965  51.569  1.00 75.22  ? 239 SER B CA    1 
ATOM   5279  C  C     . SER B  1 239 ? 17.496  -31.142  51.897  1.00 74.84  ? 239 SER B C     1 
ATOM   5280  O  O     . SER B  1 239 ? 17.892  -31.055  53.054  1.00 74.86  ? 239 SER B O     1 
ATOM   5281  C  CB    . SER B  1 239 ? 15.160  -31.968  52.344  1.00 76.54  ? 239 SER B CB    1 
ATOM   5282  O  OG    . SER B  1 239 ? 15.091  -33.210  51.667  1.00 77.87  ? 239 SER B OG    1 
ATOM   5283  N  N     . GLU B  1 240 ? 18.313  -31.374  50.878  1.00 74.58  ? 240 GLU B N     1 
ATOM   5284  C  CA    . GLU B  1 240 ? 19.716  -31.688  51.115  1.00 75.12  ? 240 GLU B CA    1 
ATOM   5285  C  C     . GLU B  1 240 ? 20.592  -30.445  51.267  1.00 73.99  ? 240 GLU B C     1 
ATOM   5286  O  O     . GLU B  1 240 ? 20.321  -29.398  50.675  1.00 73.18  ? 240 GLU B O     1 
ATOM   5287  C  CB    . GLU B  1 240 ? 20.261  -32.651  50.050  1.00 75.79  ? 240 GLU B CB    1 
ATOM   5288  C  CG    . GLU B  1 240 ? 19.790  -34.092  50.257  1.00 78.18  ? 240 GLU B CG    1 
ATOM   5289  C  CD    . GLU B  1 240 ? 20.431  -35.085  49.305  1.00 80.74  ? 240 GLU B CD    1 
ATOM   5290  O  OE1   . GLU B  1 240 ? 21.654  -35.339  49.438  1.00 81.38  ? 240 GLU B OE1   1 
ATOM   5291  O  OE2   . GLU B  1 240 ? 19.703  -35.629  48.437  1.00 81.83  ? 240 GLU B OE2   1 
ATOM   5292  N  N     . ALA B  1 241 ? 21.638  -30.573  52.080  1.00 74.16  ? 241 ALA B N     1 
ATOM   5293  C  CA    . ALA B  1 241 ? 22.575  -29.484  52.323  1.00 73.23  ? 241 ALA B CA    1 
ATOM   5294  C  C     . ALA B  1 241 ? 23.021  -28.813  51.025  1.00 72.32  ? 241 ALA B C     1 
ATOM   5295  O  O     . ALA B  1 241 ? 23.350  -29.489  50.043  1.00 72.55  ? 241 ALA B O     1 
ATOM   5296  C  CB    . ALA B  1 241 ? 23.777  -29.997  53.102  1.00 74.22  ? 241 ALA B CB    1 
ATOM   5297  N  N     . ALA B  1 242 ? 23.019  -27.479  51.031  1.00 71.30  ? 242 ALA B N     1 
ATOM   5298  C  CA    . ALA B  1 242 ? 23.447  -26.689  49.868  1.00 70.49  ? 242 ALA B CA    1 
ATOM   5299  C  C     . ALA B  1 242 ? 24.797  -27.158  49.285  1.00 70.85  ? 242 ALA B C     1 
ATOM   5300  O  O     . ALA B  1 242 ? 24.930  -27.289  48.062  1.00 70.95  ? 242 ALA B O     1 
ATOM   5301  C  CB    . ALA B  1 242 ? 23.464  -25.188  50.192  1.00 69.17  ? 242 ALA B CB    1 
ATOM   5302  N  N     . PRO B  1 243 ? 25.794  -27.439  50.146  1.00 71.23  ? 243 PRO B N     1 
ATOM   5303  C  CA    . PRO B  1 243 ? 27.044  -27.887  49.547  1.00 71.74  ? 243 PRO B CA    1 
ATOM   5304  C  C     . PRO B  1 243 ? 26.921  -29.212  48.775  1.00 72.59  ? 243 PRO B C     1 
ATOM   5305  O  O     . PRO B  1 243 ? 27.756  -29.488  47.903  1.00 73.14  ? 243 PRO B O     1 
ATOM   5306  C  CB    . PRO B  1 243 ? 27.967  -28.030  50.757  1.00 72.54  ? 243 PRO B CB    1 
ATOM   5307  C  CG    . PRO B  1 243 ? 27.387  -27.087  51.777  1.00 71.60  ? 243 PRO B CG    1 
ATOM   5308  C  CD    . PRO B  1 243 ? 25.929  -27.259  51.606  1.00 71.38  ? 243 PRO B CD    1 
ATOM   5309  N  N     . LEU B  1 244 ? 25.895  -30.013  49.082  1.00 72.65  ? 244 LEU B N     1 
ATOM   5310  C  CA    . LEU B  1 244 ? 25.633  -31.257  48.345  1.00 73.32  ? 244 LEU B CA    1 
ATOM   5311  C  C     . LEU B  1 244 ? 24.985  -30.976  46.988  1.00 72.79  ? 244 LEU B C     1 
ATOM   5312  O  O     . LEU B  1 244 ? 25.120  -31.748  46.040  1.00 73.32  ? 244 LEU B O     1 
ATOM   5313  C  CB    . LEU B  1 244 ? 24.741  -32.200  49.157  1.00 73.95  ? 244 LEU B CB    1 
ATOM   5314  C  CG    . LEU B  1 244 ? 25.314  -33.094  50.263  1.00 74.74  ? 244 LEU B CG    1 
ATOM   5315  C  CD1   . LEU B  1 244 ? 24.168  -33.729  51.051  1.00 74.80  ? 244 LEU B CD1   1 
ATOM   5316  C  CD2   . LEU B  1 244 ? 26.244  -34.168  49.705  1.00 75.31  ? 244 LEU B CD2   1 
ATOM   5317  N  N     . GLN B  1 245 ? 24.278  -29.858  46.907  1.00 71.74  ? 245 GLN B N     1 
ATOM   5318  C  CA    . GLN B  1 245 ? 23.629  -29.443  45.676  1.00 71.25  ? 245 GLN B CA    1 
ATOM   5319  C  C     . GLN B  1 245 ? 24.610  -28.749  44.738  1.00 71.00  ? 245 GLN B C     1 
ATOM   5320  O  O     . GLN B  1 245 ? 24.601  -28.985  43.539  1.00 71.04  ? 245 GLN B O     1 
ATOM   5321  C  CB    . GLN B  1 245 ? 22.470  -28.509  46.004  1.00 70.54  ? 245 GLN B CB    1 
ATOM   5322  C  CG    . GLN B  1 245 ? 21.526  -29.036  47.073  1.00 70.48  ? 245 GLN B CG    1 
ATOM   5323  C  CD    . GLN B  1 245 ? 20.251  -28.241  47.144  1.00 69.21  ? 245 GLN B CD    1 
ATOM   5324  O  OE1   . GLN B  1 245 ? 19.598  -27.998  46.126  1.00 68.39  ? 245 GLN B OE1   1 
ATOM   5325  N  NE2   . GLN B  1 245 ? 19.885  -27.823  48.348  1.00 69.15  ? 245 GLN B NE2   1 
ATOM   5326  N  N     . TYR B  1 246 ? 25.439  -27.875  45.294  1.00 71.02  ? 246 TYR B N     1 
ATOM   5327  C  CA    . TYR B  1 246 ? 26.497  -27.211  44.544  1.00 71.50  ? 246 TYR B CA    1 
ATOM   5328  C  C     . TYR B  1 246 ? 27.478  -28.241  43.971  1.00 72.51  ? 246 TYR B C     1 
ATOM   5329  O  O     . TYR B  1 246 ? 27.911  -28.125  42.825  1.00 72.52  ? 246 TYR B O     1 
ATOM   5330  C  CB    . TYR B  1 246 ? 27.190  -26.171  45.442  1.00 71.31  ? 246 TYR B CB    1 
ATOM   5331  C  CG    . TYR B  1 246 ? 28.706  -26.080  45.324  1.00 74.03  ? 246 TYR B CG    1 
ATOM   5332  C  CD1   . TYR B  1 246 ? 29.305  -25.280  44.348  1.00 75.22  ? 246 TYR B CD1   1 
ATOM   5333  C  CD2   . TYR B  1 246 ? 29.543  -26.781  46.208  1.00 76.77  ? 246 TYR B CD2   1 
ATOM   5334  C  CE1   . TYR B  1 246 ? 30.694  -25.188  44.239  1.00 77.27  ? 246 TYR B CE1   1 
ATOM   5335  C  CE2   . TYR B  1 246 ? 30.936  -26.696  46.111  1.00 78.45  ? 246 TYR B CE2   1 
ATOM   5336  C  CZ    . TYR B  1 246 ? 31.502  -25.896  45.120  1.00 79.12  ? 246 TYR B CZ    1 
ATOM   5337  O  OH    . TYR B  1 246 ? 32.874  -25.793  45.002  1.00 81.28  ? 246 TYR B OH    1 
ATOM   5338  N  N     . LEU B  1 247 ? 27.794  -29.256  44.775  1.00 73.52  ? 247 LEU B N     1 
ATOM   5339  C  CA    . LEU B  1 247 ? 28.764  -30.301  44.412  1.00 74.91  ? 247 LEU B CA    1 
ATOM   5340  C  C     . LEU B  1 247 ? 28.287  -31.278  43.324  1.00 75.27  ? 247 LEU B C     1 
ATOM   5341  O  O     . LEU B  1 247 ? 29.065  -31.632  42.434  1.00 75.97  ? 247 LEU B O     1 
ATOM   5342  C  CB    . LEU B  1 247 ? 29.194  -31.093  45.659  1.00 76.02  ? 247 LEU B CB    1 
ATOM   5343  C  CG    . LEU B  1 247 ? 30.144  -32.288  45.475  1.00 77.91  ? 247 LEU B CG    1 
ATOM   5344  C  CD1   . LEU B  1 247 ? 31.573  -31.847  45.177  1.00 78.17  ? 247 LEU B CD1   1 
ATOM   5345  C  CD2   . LEU B  1 247 ? 30.120  -33.181  46.701  1.00 79.64  ? 247 LEU B CD2   1 
ATOM   5346  N  N     . ALA B  1 248 ? 27.023  -31.704  43.415  1.00 74.60  ? 248 ALA B N     1 
ATOM   5347  C  CA    . ALA B  1 248 ? 26.457  -32.760  42.563  1.00 74.74  ? 248 ALA B CA    1 
ATOM   5348  C  C     . ALA B  1 248 ? 26.801  -32.653  41.074  1.00 74.67  ? 248 ALA B C     1 
ATOM   5349  O  O     . ALA B  1 248 ? 27.270  -33.628  40.493  1.00 75.75  ? 248 ALA B O     1 
ATOM   5350  C  CB    . ALA B  1 248 ? 24.952  -32.881  42.769  1.00 74.10  ? 248 ALA B CB    1 
ATOM   5351  N  N     . PRO B  1 249 ? 26.599  -31.472  40.456  1.00 73.55  ? 249 PRO B N     1 
ATOM   5352  C  CA    . PRO B  1 249 ? 26.925  -31.361  39.032  1.00 73.97  ? 249 PRO B CA    1 
ATOM   5353  C  C     . PRO B  1 249 ? 28.414  -31.551  38.728  1.00 74.92  ? 249 PRO B C     1 
ATOM   5354  O  O     . PRO B  1 249 ? 28.764  -31.920  37.609  1.00 75.72  ? 249 PRO B O     1 
ATOM   5355  C  CB    . PRO B  1 249 ? 26.494  -29.929  38.684  1.00 72.62  ? 249 PRO B CB    1 
ATOM   5356  C  CG    . PRO B  1 249 ? 25.506  -29.570  39.717  1.00 71.60  ? 249 PRO B CG    1 
ATOM   5357  C  CD    . PRO B  1 249 ? 26.016  -30.216  40.959  1.00 72.16  ? 249 PRO B CD    1 
ATOM   5358  N  N     . PHE B  1 250 ? 29.270  -31.301  39.715  1.00 74.98  ? 250 PHE B N     1 
ATOM   5359  C  CA    . PHE B  1 250 ? 30.719  -31.443  39.554  1.00 75.96  ? 250 PHE B CA    1 
ATOM   5360  C  C     . PHE B  1 250 ? 31.202  -32.886  39.663  1.00 77.69  ? 250 PHE B C     1 
ATOM   5361  O  O     . PHE B  1 250 ? 32.038  -33.317  38.871  1.00 78.79  ? 250 PHE B O     1 
ATOM   5362  C  CB    . PHE B  1 250 ? 31.459  -30.573  40.568  1.00 75.39  ? 250 PHE B CB    1 
ATOM   5363  C  CG    . PHE B  1 250 ? 31.350  -29.116  40.293  1.00 74.14  ? 250 PHE B CG    1 
ATOM   5364  C  CD1   . PHE B  1 250 ? 31.938  -28.565  39.165  1.00 74.63  ? 250 PHE B CD1   1 
ATOM   5365  C  CD2   . PHE B  1 250 ? 30.662  -28.289  41.159  1.00 73.82  ? 250 PHE B CD2   1 
ATOM   5366  C  CE1   . PHE B  1 250 ? 31.846  -27.213  38.898  1.00 73.69  ? 250 PHE B CE1   1 
ATOM   5367  C  CE2   . PHE B  1 250 ? 30.562  -26.932  40.900  1.00 73.55  ? 250 PHE B CE2   1 
ATOM   5368  C  CZ    . PHE B  1 250 ? 31.158  -26.394  39.762  1.00 73.32  ? 250 PHE B CZ    1 
ATOM   5369  N  N     . THR B  1 251 ? 30.696  -33.614  40.658  1.00 78.05  ? 251 THR B N     1 
ATOM   5370  C  CA    . THR B  1 251 ? 30.967  -35.040  40.773  1.00 79.83  ? 251 THR B CA    1 
ATOM   5371  C  C     . THR B  1 251 ? 30.324  -35.769  39.598  1.00 81.00  ? 251 THR B C     1 
ATOM   5372  O  O     . THR B  1 251 ? 30.922  -36.696  39.033  1.00 82.88  ? 251 THR B O     1 
ATOM   5373  C  CB    . THR B  1 251 ? 30.438  -35.656  42.081  1.00 79.77  ? 251 THR B CB    1 
ATOM   5374  O  OG1   . THR B  1 251 ? 29.071  -35.290  42.274  1.00 77.98  ? 251 THR B OG1   1 
ATOM   5375  C  CG2   . THR B  1 251 ? 31.271  -35.228  43.270  1.00 79.39  ? 251 THR B CG2   1 
ATOM   5376  N  N     . ALA B  1 252 ? 29.115  -35.344  39.227  1.00 80.08  ? 252 ALA B N     1 
ATOM   5377  C  CA    . ALA B  1 252 ? 28.447  -35.885  38.046  1.00 80.82  ? 252 ALA B CA    1 
ATOM   5378  C  C     . ALA B  1 252 ? 29.344  -35.769  36.812  1.00 81.68  ? 252 ALA B C     1 
ATOM   5379  O  O     . ALA B  1 252 ? 29.508  -36.739  36.081  1.00 83.02  ? 252 ALA B O     1 
ATOM   5380  C  CB    . ALA B  1 252 ? 27.113  -35.197  37.813  1.00 79.43  ? 252 ALA B CB    1 
ATOM   5381  N  N     . ALA B  1 253 ? 29.936  -34.590  36.606  1.00 81.34  ? 253 ALA B N     1 
ATOM   5382  C  CA    . ALA B  1 253 ? 30.855  -34.337  35.484  1.00 82.50  ? 253 ALA B CA    1 
ATOM   5383  C  C     . ALA B  1 253 ? 31.989  -35.349  35.439  1.00 84.82  ? 253 ALA B C     1 
ATOM   5384  O  O     . ALA B  1 253 ? 32.369  -35.823  34.365  1.00 86.08  ? 253 ALA B O     1 
ATOM   5385  C  CB    . ALA B  1 253 ? 31.419  -32.935  35.562  1.00 81.31  ? 253 ALA B CB    1 
ATOM   5386  N  N     . SER B  1 254 ? 32.516  -35.672  36.616  1.00 85.71  ? 254 SER B N     1 
ATOM   5387  C  CA    . SER B  1 254 ? 33.563  -36.666  36.757  1.00 88.21  ? 254 SER B CA    1 
ATOM   5388  C  C     . SER B  1 254 ? 33.082  -38.033  36.276  1.00 90.00  ? 254 SER B C     1 
ATOM   5389  O  O     . SER B  1 254 ? 33.800  -38.727  35.549  1.00 91.94  ? 254 SER B O     1 
ATOM   5390  C  CB    . SER B  1 254 ? 34.035  -36.734  38.209  1.00 88.28  ? 254 SER B CB    1 
ATOM   5391  O  OG    . SER B  1 254 ? 34.529  -35.476  38.632  1.00 87.42  ? 254 SER B OG    1 
ATOM   5392  N  N     . ILE B  1 255 ? 31.865  -38.404  36.673  1.00 89.69  ? 255 ILE B N     1 
ATOM   5393  C  CA    . ILE B  1 255 ? 31.243  -39.658  36.237  1.00 91.42  ? 255 ILE B CA    1 
ATOM   5394  C  C     . ILE B  1 255 ? 31.106  -39.695  34.707  1.00 92.21  ? 255 ILE B C     1 
ATOM   5395  O  O     . ILE B  1 255 ? 31.460  -40.695  34.067  1.00 94.12  ? 255 ILE B O     1 
ATOM   5396  C  CB    . ILE B  1 255 ? 29.887  -39.905  36.978  1.00 90.64  ? 255 ILE B CB    1 
ATOM   5397  C  CG1   . ILE B  1 255 ? 30.149  -40.525  38.358  1.00 91.49  ? 255 ILE B CG1   1 
ATOM   5398  C  CG2   . ILE B  1 255 ? 28.947  -40.795  36.173  1.00 91.14  ? 255 ILE B CG2   1 
ATOM   5399  C  CD1   . ILE B  1 255 ? 29.322  -39.920  39.501  1.00 89.66  ? 255 ILE B CD1   1 
ATOM   5400  N  N     . GLY B  1 256 ? 30.622  -38.592  34.133  1.00 91.00  ? 256 GLY B N     1 
ATOM   5401  C  CA    . GLY B  1 256 ? 30.522  -38.443  32.684  1.00 91.69  ? 256 GLY B CA    1 
ATOM   5402  C  C     . GLY B  1 256 ? 31.881  -38.559  32.023  1.00 93.43  ? 256 GLY B C     1 
ATOM   5403  O  O     . GLY B  1 256 ? 32.035  -39.257  31.014  1.00 94.94  ? 256 GLY B O     1 
ATOM   5404  N  N     . GLU B  1 257 ? 32.873  -37.899  32.623  1.00 93.43  ? 257 GLU B N     1 
ATOM   5405  C  CA    . GLU B  1 257 ? 34.241  -37.835  32.085  1.00 95.04  ? 257 GLU B CA    1 
ATOM   5406  C  C     . GLU B  1 257 ? 34.928  -39.171  31.855  1.00 97.49  ? 257 GLU B C     1 
ATOM   5407  O  O     . GLU B  1 257 ? 35.758  -39.278  30.955  1.00 98.79  ? 257 GLU B O     1 
ATOM   5408  C  CB    . GLU B  1 257 ? 35.133  -36.977  32.976  1.00 94.37  ? 257 GLU B CB    1 
ATOM   5409  C  CG    . GLU B  1 257 ? 35.236  -35.545  32.526  1.00 93.51  ? 257 GLU B CG    1 
ATOM   5410  C  CD    . GLU B  1 257 ? 35.722  -34.633  33.627  1.00 93.49  ? 257 GLU B CD    1 
ATOM   5411  O  OE1   . GLU B  1 257 ? 35.798  -35.096  34.789  1.00 93.92  ? 257 GLU B OE1   1 
ATOM   5412  O  OE2   . GLU B  1 257 ? 36.018  -33.451  33.331  1.00 92.86  ? 257 GLU B OE2   1 
ATOM   5413  N  N     . TRP B  1 258 ? 34.604  -40.172  32.673  1.00 98.40  ? 258 TRP B N     1 
ATOM   5414  C  CA    . TRP B  1 258 ? 35.236  -41.491  32.552  1.00 101.16 ? 258 TRP B CA    1 
ATOM   5415  C  C     . TRP B  1 258 ? 35.017  -42.085  31.164  1.00 102.48 ? 258 TRP B C     1 
ATOM   5416  O  O     . TRP B  1 258 ? 35.899  -42.742  30.616  1.00 104.45 ? 258 TRP B O     1 
ATOM   5417  C  CB    . TRP B  1 258 ? 34.739  -42.472  33.621  1.00 101.67 ? 258 TRP B CB    1 
ATOM   5418  C  CG    . TRP B  1 258 ? 35.523  -43.739  33.593  1.00 104.55 ? 258 TRP B CG    1 
ATOM   5419  C  CD1   . TRP B  1 258 ? 36.670  -44.003  34.281  1.00 106.34 ? 258 TRP B CD1   1 
ATOM   5420  C  CD2   . TRP B  1 258 ? 35.248  -44.906  32.806  1.00 107.01 ? 258 TRP B CD2   1 
ATOM   5421  N  NE1   . TRP B  1 258 ? 37.122  -45.268  33.986  1.00 109.39 ? 258 TRP B NE1   1 
ATOM   5422  C  CE2   . TRP B  1 258 ? 36.267  -45.847  33.085  1.00 109.71 ? 258 TRP B CE2   1 
ATOM   5423  C  CE3   . TRP B  1 258 ? 34.236  -45.253  31.897  1.00 107.16 ? 258 TRP B CE3   1 
ATOM   5424  C  CZ2   . TRP B  1 258 ? 36.309  -47.112  32.484  1.00 111.73 ? 258 TRP B CZ2   1 
ATOM   5425  C  CZ3   . TRP B  1 258 ? 34.277  -46.518  31.299  1.00 109.35 ? 258 TRP B CZ3   1 
ATOM   5426  C  CH2   . TRP B  1 258 ? 35.308  -47.427  31.597  1.00 111.39 ? 258 TRP B CH2   1 
ATOM   5427  N  N     . PHE B  1 259 ? 33.828  -41.842  30.615  1.00 101.41 ? 259 PHE B N     1 
ATOM   5428  C  CA    . PHE B  1 259 ? 33.475  -42.261  29.265  1.00 102.38 ? 259 PHE B CA    1 
ATOM   5429  C  C     . PHE B  1 259 ? 34.214  -41.411  28.236  1.00 102.13 ? 259 PHE B C     1 
ATOM   5430  O  O     . PHE B  1 259 ? 34.622  -41.917  27.189  1.00 103.82 ? 259 PHE B O     1 
ATOM   5431  C  CB    . PHE B  1 259 ? 31.955  -42.190  29.077  1.00 101.32 ? 259 PHE B CB    1 
ATOM   5432  C  CG    . PHE B  1 259 ? 31.195  -43.111  30.000  1.00 102.45 ? 259 PHE B CG    1 
ATOM   5433  C  CD1   . PHE B  1 259 ? 30.780  -44.368  29.564  1.00 104.65 ? 259 PHE B CD1   1 
ATOM   5434  C  CD2   . PHE B  1 259 ? 30.916  -42.732  31.315  1.00 101.87 ? 259 PHE B CD2   1 
ATOM   5435  C  CE1   . PHE B  1 259 ? 30.088  -45.231  30.414  1.00 105.24 ? 259 PHE B CE1   1 
ATOM   5436  C  CE2   . PHE B  1 259 ? 30.226  -43.590  32.178  1.00 102.75 ? 259 PHE B CE2   1 
ATOM   5437  C  CZ    . PHE B  1 259 ? 29.813  -44.843  31.722  1.00 104.29 ? 259 PHE B CZ    1 
ATOM   5438  N  N     . ARG B  1 260 ? 34.412  -40.132  28.564  1.00 100.01 ? 260 ARG B N     1 
ATOM   5439  C  CA    . ARG B  1 260 ? 35.163  -39.196  27.721  1.00 99.55  ? 260 ARG B CA    1 
ATOM   5440  C  C     . ARG B  1 260 ? 36.650  -39.566  27.613  1.00 101.20 ? 260 ARG B C     1 
ATOM   5441  O  O     . ARG B  1 260 ? 37.191  -39.672  26.510  1.00 102.61 ? 260 ARG B O     1 
ATOM   5442  C  CB    . ARG B  1 260 ? 35.006  -37.771  28.247  1.00 97.26  ? 260 ARG B CB    1 
ATOM   5443  C  CG    . ARG B  1 260 ? 35.463  -36.702  27.276  1.00 97.61  ? 260 ARG B CG    1 
ATOM   5444  C  CD    . ARG B  1 260 ? 35.702  -35.373  27.984  1.00 97.26  ? 260 ARG B CD    1 
ATOM   5445  N  NE    . ARG B  1 260 ? 36.838  -35.433  28.905  1.00 98.02  ? 260 ARG B NE    1 
ATOM   5446  C  CZ    . ARG B  1 260 ? 37.154  -34.484  29.780  1.00 96.75  ? 260 ARG B CZ    1 
ATOM   5447  N  NH1   . ARG B  1 260 ? 36.423  -33.379  29.879  1.00 94.20  ? 260 ARG B NH1   1 
ATOM   5448  N  NH2   . ARG B  1 260 ? 38.206  -34.652  30.568  1.00 97.97  ? 260 ARG B NH2   1 
ATOM   5449  N  N     . ASP B  1 261 ? 37.298  -39.775  28.758  1.00 100.98 ? 261 ASP B N     1 
ATOM   5450  C  CA    . ASP B  1 261 ? 38.715  -40.140  28.799  1.00 102.55 ? 261 ASP B CA    1 
ATOM   5451  C  C     . ASP B  1 261 ? 38.974  -41.589  28.386  1.00 104.80 ? 261 ASP B C     1 
ATOM   5452  O  O     . ASP B  1 261 ? 40.123  -42.037  28.404  1.00 106.66 ? 261 ASP B O     1 
ATOM   5453  C  CB    . ASP B  1 261 ? 39.295  -39.907  30.200  1.00 102.27 ? 261 ASP B CB    1 
ATOM   5454  C  CG    . ASP B  1 261 ? 39.233  -38.459  30.634  1.00 99.98  ? 261 ASP B CG    1 
ATOM   5455  O  OD1   . ASP B  1 261 ? 39.187  -37.557  29.770  1.00 99.10  ? 261 ASP B OD1   1 
ATOM   5456  O  OD2   . ASP B  1 261 ? 39.238  -38.228  31.858  1.00 99.47  ? 261 ASP B OD2   1 
ATOM   5457  N  N     . ASN B  1 262 ? 37.910  -42.313  28.030  1.00 104.49 ? 262 ASN B N     1 
ATOM   5458  C  CA    . ASN B  1 262 ? 38.014  -43.717  27.603  1.00 106.66 ? 262 ASN B CA    1 
ATOM   5459  C  C     . ASN B  1 262 ? 37.461  -44.001  26.210  1.00 107.15 ? 262 ASN B C     1 
ATOM   5460  O  O     . ASN B  1 262 ? 37.037  -45.115  25.925  1.00 108.43 ? 262 ASN B O     1 
ATOM   5461  C  CB    . ASN B  1 262 ? 37.364  -44.655  28.626  1.00 106.70 ? 262 ASN B CB    1 
ATOM   5462  C  CG    . ASN B  1 262 ? 38.259  -44.929  29.813  1.00 107.32 ? 262 ASN B CG    1 
ATOM   5463  O  OD1   . ASN B  1 262 ? 39.285  -45.586  29.688  1.00 109.70 ? 262 ASN B OD1   1 
ATOM   5464  N  ND2   . ASN B  1 262 ? 37.873  -44.428  30.973  1.00 105.73 ? 262 ASN B ND2   1 
ATOM   5465  N  N     . GLY B  1 263 ? 37.469  -42.989  25.349  1.00 106.26 ? 263 GLY B N     1 
ATOM   5466  C  CA    . GLY B  1 263 ? 37.097  -43.167  23.947  1.00 107.26 ? 263 GLY B CA    1 
ATOM   5467  C  C     . GLY B  1 263 ? 35.614  -43.356  23.671  1.00 106.24 ? 263 GLY B C     1 
ATOM   5468  O  O     . GLY B  1 263 ? 35.219  -43.591  22.524  1.00 107.14 ? 263 GLY B O     1 
ATOM   5469  N  N     . LYS B  1 264 ? 34.795  -43.245  24.717  1.00 104.43 ? 264 LYS B N     1 
ATOM   5470  C  CA    . LYS B  1 264 ? 33.345  -43.416  24.604  1.00 103.27 ? 264 LYS B CA    1 
ATOM   5471  C  C     . LYS B  1 264 ? 32.619  -42.073  24.672  1.00 100.39 ? 264 LYS B C     1 
ATOM   5472  O  O     . LYS B  1 264 ? 33.221  -41.030  24.951  1.00 99.02  ? 264 LYS B O     1 
ATOM   5473  C  CB    . LYS B  1 264 ? 32.823  -44.337  25.712  1.00 103.57 ? 264 LYS B CB    1 
ATOM   5474  C  CG    . LYS B  1 264 ? 33.552  -45.660  25.843  1.00 106.63 ? 264 LYS B CG    1 
ATOM   5475  C  CD    . LYS B  1 264 ? 33.164  -46.358  27.131  1.00 107.81 ? 264 LYS B CD    1 
ATOM   5476  C  CE    . LYS B  1 264 ? 33.659  -47.792  27.145  1.00 112.03 ? 264 LYS B CE    1 
ATOM   5477  N  NZ    . LYS B  1 264 ? 32.889  -48.613  28.123  1.00 113.61 ? 264 LYS B NZ    1 
ATOM   5478  N  N     . HIS B  1 265 ? 31.315  -42.109  24.423  1.00 99.33  ? 265 HIS B N     1 
ATOM   5479  C  CA    . HIS B  1 265 ? 30.507  -40.899  24.483  1.00 96.69  ? 265 HIS B CA    1 
ATOM   5480  C  C     . HIS B  1 265 ? 29.536  -40.903  25.668  1.00 94.85  ? 265 HIS B C     1 
ATOM   5481  O  O     . HIS B  1 265 ? 29.203  -41.958  26.216  1.00 95.71  ? 265 HIS B O     1 
ATOM   5482  C  CB    . HIS B  1 265 ? 29.810  -40.661  23.141  1.00 96.96  ? 265 HIS B CB    1 
ATOM   5483  C  CG    . HIS B  1 265 ? 30.766  -40.434  22.009  1.00 98.16  ? 265 HIS B CG    1 
ATOM   5484  N  ND1   . HIS B  1 265 ? 31.030  -39.182  21.493  1.00 97.06  ? 265 HIS B ND1   1 
ATOM   5485  C  CD2   . HIS B  1 265 ? 31.543  -41.296  21.313  1.00 100.11 ? 265 HIS B CD2   1 
ATOM   5486  C  CE1   . HIS B  1 265 ? 31.915  -39.285  20.518  1.00 98.13  ? 265 HIS B CE1   1 
ATOM   5487  N  NE2   . HIS B  1 265 ? 32.243  -40.557  20.389  1.00 100.43 ? 265 HIS B NE2   1 
ATOM   5488  N  N     . ALA B  1 266 ? 29.118  -39.708  26.077  1.00 92.30  ? 266 ALA B N     1 
ATOM   5489  C  CA    . ALA B  1 266 ? 28.260  -39.539  27.245  1.00 90.25  ? 266 ALA B CA    1 
ATOM   5490  C  C     . ALA B  1 266 ? 27.510  -38.223  27.184  1.00 87.83  ? 266 ALA B C     1 
ATOM   5491  O  O     . ALA B  1 266 ? 28.022  -37.227  26.668  1.00 87.08  ? 266 ALA B O     1 
ATOM   5492  C  CB    . ALA B  1 266 ? 29.074  -39.627  28.534  1.00 90.17  ? 266 ALA B CB    1 
ATOM   5493  N  N     . LEU B  1 267 ? 26.288  -38.243  27.706  1.00 86.52  ? 267 LEU B N     1 
ATOM   5494  C  CA    . LEU B  1 267 ? 25.435  -37.066  27.782  1.00 84.44  ? 267 LEU B CA    1 
ATOM   5495  C  C     . LEU B  1 267 ? 25.116  -36.783  29.237  1.00 83.13  ? 267 LEU B C     1 
ATOM   5496  O  O     . LEU B  1 267 ? 24.664  -37.668  29.967  1.00 83.60  ? 267 LEU B O     1 
ATOM   5497  C  CB    . LEU B  1 267 ? 24.138  -37.285  27.008  1.00 84.66  ? 267 LEU B CB    1 
ATOM   5498  C  CG    . LEU B  1 267 ? 23.167  -36.110  26.964  1.00 82.67  ? 267 LEU B CG    1 
ATOM   5499  C  CD1   . LEU B  1 267 ? 23.544  -35.167  25.851  1.00 82.94  ? 267 LEU B CD1   1 
ATOM   5500  C  CD2   . LEU B  1 267 ? 21.766  -36.611  26.757  1.00 83.10  ? 267 LEU B CD2   1 
ATOM   5501  N  N     . ILE B  1 268 ? 25.361  -35.546  29.655  1.00 81.61  ? 268 ILE B N     1 
ATOM   5502  C  CA    . ILE B  1 268 ? 25.108  -35.135  31.035  1.00 80.18  ? 268 ILE B CA    1 
ATOM   5503  C  C     . ILE B  1 268 ? 24.062  -34.026  31.070  1.00 78.84  ? 268 ILE B C     1 
ATOM   5504  O  O     . ILE B  1 268 ? 24.233  -32.981  30.436  1.00 78.10  ? 268 ILE B O     1 
ATOM   5505  C  CB    . ILE B  1 268 ? 26.423  -34.757  31.794  1.00 79.66  ? 268 ILE B CB    1 
ATOM   5506  C  CG1   . ILE B  1 268 ? 26.156  -34.583  33.290  1.00 78.35  ? 268 ILE B CG1   1 
ATOM   5507  C  CG2   . ILE B  1 268 ? 27.083  -33.527  31.192  1.00 78.83  ? 268 ILE B CG2   1 
ATOM   5508  C  CD1   . ILE B  1 268 ? 27.333  -34.915  34.152  1.00 77.79  ? 268 ILE B CD1   1 
ATOM   5509  N  N     . VAL B  1 269 ? 22.967  -34.286  31.783  1.00 78.63  ? 269 VAL B N     1 
ATOM   5510  C  CA    . VAL B  1 269 ? 21.873  -33.327  31.897  1.00 77.71  ? 269 VAL B CA    1 
ATOM   5511  C  C     . VAL B  1 269 ? 21.852  -32.716  33.305  1.00 76.65  ? 269 VAL B C     1 
ATOM   5512  O  O     . VAL B  1 269 ? 21.715  -33.436  34.301  1.00 76.89  ? 269 VAL B O     1 
ATOM   5513  C  CB    . VAL B  1 269 ? 20.500  -33.964  31.544  1.00 78.41  ? 269 VAL B CB    1 
ATOM   5514  C  CG1   . VAL B  1 269 ? 19.444  -32.890  31.431  1.00 77.66  ? 269 VAL B CG1   1 
ATOM   5515  C  CG2   . VAL B  1 269 ? 20.577  -34.734  30.243  1.00 79.27  ? 269 VAL B CG2   1 
ATOM   5516  N  N     . TYR B  1 270 ? 22.002  -31.391  33.371  1.00 75.57  ? 270 TYR B N     1 
ATOM   5517  C  CA    . TYR B  1 270 ? 22.042  -30.653  34.645  1.00 74.59  ? 270 TYR B CA    1 
ATOM   5518  C  C     . TYR B  1 270 ? 20.687  -30.016  34.977  1.00 74.21  ? 270 TYR B C     1 
ATOM   5519  O  O     . TYR B  1 270 ? 20.339  -28.952  34.441  1.00 73.80  ? 270 TYR B O     1 
ATOM   5520  C  CB    . TYR B  1 270 ? 23.111  -29.558  34.604  1.00 73.73  ? 270 TYR B CB    1 
ATOM   5521  C  CG    . TYR B  1 270 ? 24.531  -30.036  34.392  1.00 73.97  ? 270 TYR B CG    1 
ATOM   5522  C  CD1   . TYR B  1 270 ? 25.251  -30.628  35.431  1.00 73.97  ? 270 TYR B CD1   1 
ATOM   5523  C  CD2   . TYR B  1 270 ? 25.168  -29.858  33.163  1.00 73.80  ? 270 TYR B CD2   1 
ATOM   5524  C  CE1   . TYR B  1 270 ? 26.560  -31.054  35.246  1.00 74.85  ? 270 TYR B CE1   1 
ATOM   5525  C  CE2   . TYR B  1 270 ? 26.475  -30.280  32.964  1.00 74.74  ? 270 TYR B CE2   1 
ATOM   5526  C  CZ    . TYR B  1 270 ? 27.168  -30.877  34.010  1.00 75.46  ? 270 TYR B CZ    1 
ATOM   5527  O  OH    . TYR B  1 270 ? 28.467  -31.301  33.823  1.00 76.42  ? 270 TYR B OH    1 
ATOM   5528  N  N     . ASP B  1 271 ? 19.937  -30.652  35.874  1.00 74.49  ? 271 ASP B N     1 
ATOM   5529  C  CA    . ASP B  1 271 ? 18.549  -30.267  36.119  1.00 74.34  ? 271 ASP B CA    1 
ATOM   5530  C  C     . ASP B  1 271 ? 18.250  -29.850  37.578  1.00 73.63  ? 271 ASP B C     1 
ATOM   5531  O  O     . ASP B  1 271 ? 18.072  -30.692  38.456  1.00 74.19  ? 271 ASP B O     1 
ATOM   5532  C  CB    . ASP B  1 271 ? 17.622  -31.398  35.663  1.00 75.62  ? 271 ASP B CB    1 
ATOM   5533  C  CG    . ASP B  1 271 ? 16.233  -30.909  35.288  1.00 76.32  ? 271 ASP B CG    1 
ATOM   5534  O  OD1   . ASP B  1 271 ? 15.972  -29.694  35.404  1.00 76.65  ? 271 ASP B OD1   1 
ATOM   5535  O  OD2   . ASP B  1 271 ? 15.397  -31.743  34.872  1.00 77.64  ? 271 ASP B OD2   1 
ATOM   5536  N  N     . ASP B  1 272 ? 18.231  -28.548  37.844  1.00 72.53  ? 272 ASP B N     1 
ATOM   5537  C  CA    . ASP B  1 272 ? 18.672  -27.545  36.886  1.00 71.93  ? 272 ASP B CA    1 
ATOM   5538  C  C     . ASP B  1 272 ? 19.821  -26.758  37.511  1.00 70.61  ? 272 ASP B C     1 
ATOM   5539  O  O     . ASP B  1 272 ? 20.195  -27.020  38.655  1.00 70.19  ? 272 ASP B O     1 
ATOM   5540  C  CB    . ASP B  1 272 ? 17.506  -26.649  36.435  1.00 72.04  ? 272 ASP B CB    1 
ATOM   5541  C  CG    . ASP B  1 272 ? 16.883  -25.847  37.574  1.00 72.33  ? 272 ASP B CG    1 
ATOM   5542  O  OD1   . ASP B  1 272 ? 17.591  -25.510  38.552  1.00 73.41  ? 272 ASP B OD1   1 
ATOM   5543  O  OD2   . ASP B  1 272 ? 15.675  -25.532  37.472  1.00 72.67  ? 272 ASP B OD2   1 
ATOM   5544  N  N     . LEU B  1 273 ? 20.383  -25.815  36.762  1.00 69.95  ? 273 LEU B N     1 
ATOM   5545  C  CA    . LEU B  1 273 ? 21.515  -25.026  37.241  1.00 69.11  ? 273 LEU B CA    1 
ATOM   5546  C  C     . LEU B  1 273 ? 21.093  -23.795  38.033  1.00 68.19  ? 273 LEU B C     1 
ATOM   5547  O  O     . LEU B  1 273 ? 21.921  -23.199  38.735  1.00 67.79  ? 273 LEU B O     1 
ATOM   5548  C  CB    . LEU B  1 273 ? 22.444  -24.620  36.090  1.00 69.25  ? 273 LEU B CB    1 
ATOM   5549  C  CG    . LEU B  1 273 ? 23.513  -25.604  35.606  1.00 69.58  ? 273 LEU B CG    1 
ATOM   5550  C  CD1   . LEU B  1 273 ? 24.535  -24.841  34.779  1.00 69.15  ? 273 LEU B CD1   1 
ATOM   5551  C  CD2   . LEU B  1 273 ? 24.202  -26.338  36.751  1.00 68.54  ? 273 LEU B CD2   1 
ATOM   5552  N  N     . SER B  1 274 ? 19.815  -23.422  37.917  1.00 67.82  ? 274 SER B N     1 
ATOM   5553  C  CA    . SER B  1 274 ? 19.255  -22.306  38.683  1.00 66.93  ? 274 SER B CA    1 
ATOM   5554  C  C     . SER B  1 274 ? 19.369  -22.646  40.163  1.00 66.62  ? 274 SER B C     1 
ATOM   5555  O  O     . SER B  1 274 ? 20.014  -21.931  40.938  1.00 65.99  ? 274 SER B O     1 
ATOM   5556  C  CB    . SER B  1 274 ? 17.785  -22.061  38.314  1.00 67.15  ? 274 SER B CB    1 
ATOM   5557  O  OG    . SER B  1 274 ? 17.614  -21.874  36.922  1.00 67.10  ? 274 SER B OG    1 
ATOM   5558  N  N     . LYS B  1 275 ? 18.761  -23.772  40.527  1.00 66.94  ? 275 LYS B N     1 
ATOM   5559  C  CA    . LYS B  1 275 ? 18.752  -24.253  41.892  1.00 66.64  ? 275 LYS B CA    1 
ATOM   5560  C  C     . LYS B  1 275 ? 20.170  -24.475  42.409  1.00 66.53  ? 275 LYS B C     1 
ATOM   5561  O  O     . LYS B  1 275 ? 20.453  -24.200  43.576  1.00 66.44  ? 275 LYS B O     1 
ATOM   5562  C  CB    . LYS B  1 275 ? 17.908  -25.524  42.003  1.00 67.39  ? 275 LYS B CB    1 
ATOM   5563  C  CG    . LYS B  1 275 ? 16.408  -25.263  41.983  1.00 66.72  ? 275 LYS B CG    1 
ATOM   5564  C  CD    . LYS B  1 275 ? 15.605  -26.557  41.929  1.00 66.20  ? 275 LYS B CD    1 
ATOM   5565  C  CE    . LYS B  1 275 ? 14.165  -26.295  41.536  1.00 65.30  ? 275 LYS B CE    1 
ATOM   5566  N  NZ    . LYS B  1 275 ? 14.098  -25.486  40.292  1.00 64.57  ? 275 LYS B NZ    1 
ATOM   5567  N  N     . GLN B  1 276 ? 21.065  -24.947  41.543  1.00 66.72  ? 276 GLN B N     1 
ATOM   5568  C  CA    . GLN B  1 276 ? 22.470  -25.057  41.927  1.00 66.68  ? 276 GLN B CA    1 
ATOM   5569  C  C     . GLN B  1 276 ? 23.020  -23.702  42.375  1.00 66.12  ? 276 GLN B C     1 
ATOM   5570  O  O     . GLN B  1 276 ? 23.637  -23.598  43.443  1.00 66.00  ? 276 GLN B O     1 
ATOM   5571  C  CB    . GLN B  1 276 ? 23.339  -25.614  40.805  1.00 66.88  ? 276 GLN B CB    1 
ATOM   5572  C  CG    . GLN B  1 276 ? 24.651  -26.174  41.344  1.00 67.24  ? 276 GLN B CG    1 
ATOM   5573  C  CD    . GLN B  1 276 ? 25.840  -25.846  40.472  1.00 67.51  ? 276 GLN B CD    1 
ATOM   5574  O  OE1   . GLN B  1 276 ? 25.732  -25.054  39.540  1.00 68.13  ? 276 GLN B OE1   1 
ATOM   5575  N  NE2   . GLN B  1 276 ? 26.985  -26.457  40.769  1.00 67.38  ? 276 GLN B NE2   1 
ATOM   5576  N  N     . ALA B  1 277 ? 22.778  -22.677  41.554  1.00 65.68  ? 277 ALA B N     1 
ATOM   5577  C  CA    . ALA B  1 277 ? 23.265  -21.328  41.811  1.00 64.90  ? 277 ALA B CA    1 
ATOM   5578  C  C     . ALA B  1 277 ? 22.716  -20.791  43.126  1.00 64.54  ? 277 ALA B C     1 
ATOM   5579  O  O     . ALA B  1 277 ? 23.459  -20.191  43.907  1.00 64.18  ? 277 ALA B O     1 
ATOM   5580  C  CB    . ALA B  1 277 ? 22.898  -20.408  40.662  1.00 64.73  ? 277 ALA B CB    1 
ATOM   5581  N  N     . VAL B  1 278 ? 21.423  -21.023  43.370  1.00 64.63  ? 278 VAL B N     1 
ATOM   5582  C  CA    . VAL B  1 278 ? 20.763  -20.544  44.586  1.00 64.28  ? 278 VAL B CA    1 
ATOM   5583  C  C     . VAL B  1 278 ? 21.388  -21.221  45.802  1.00 64.85  ? 278 VAL B C     1 
ATOM   5584  O  O     . VAL B  1 278 ? 21.663  -20.571  46.815  1.00 65.16  ? 278 VAL B O     1 
ATOM   5585  C  CB    . VAL B  1 278 ? 19.237  -20.749  44.547  1.00 64.12  ? 278 VAL B CB    1 
ATOM   5586  C  CG1   . VAL B  1 278 ? 18.583  -20.149  45.774  1.00 64.00  ? 278 VAL B CG1   1 
ATOM   5587  C  CG2   . VAL B  1 278 ? 18.662  -20.102  43.321  1.00 63.71  ? 278 VAL B CG2   1 
ATOM   5588  N  N     . ALA B  1 279 ? 21.646  -22.517  45.683  1.00 65.51  ? 279 ALA B N     1 
ATOM   5589  C  CA    . ALA B  1 279 ? 22.337  -23.251  46.727  1.00 66.15  ? 279 ALA B CA    1 
ATOM   5590  C  C     . ALA B  1 279 ? 23.752  -22.709  46.968  1.00 66.20  ? 279 ALA B C     1 
ATOM   5591  O  O     . ALA B  1 279 ? 24.184  -22.601  48.112  1.00 66.81  ? 279 ALA B O     1 
ATOM   5592  C  CB    . ALA B  1 279 ? 22.374  -24.743  46.390  1.00 66.94  ? 279 ALA B CB    1 
ATOM   5593  N  N     . TYR B  1 280 ? 24.467  -22.367  45.897  1.00 66.10  ? 280 TYR B N     1 
ATOM   5594  C  CA    . TYR B  1 280 ? 25.846  -21.886  46.009  1.00 65.91  ? 280 TYR B CA    1 
ATOM   5595  C  C     . TYR B  1 280 ? 25.894  -20.455  46.500  1.00 65.29  ? 280 TYR B C     1 
ATOM   5596  O  O     . TYR B  1 280 ? 26.912  -20.012  47.013  1.00 65.46  ? 280 TYR B O     1 
ATOM   5597  C  CB    . TYR B  1 280 ? 26.575  -21.994  44.670  1.00 66.35  ? 280 TYR B CB    1 
ATOM   5598  C  CG    . TYR B  1 280 ? 27.985  -21.450  44.700  1.00 66.70  ? 280 TYR B CG    1 
ATOM   5599  C  CD1   . TYR B  1 280 ? 28.959  -22.021  45.525  1.00 68.02  ? 280 TYR B CD1   1 
ATOM   5600  C  CD2   . TYR B  1 280 ? 28.346  -20.361  43.915  1.00 66.40  ? 280 TYR B CD2   1 
ATOM   5601  C  CE1   . TYR B  1 280 ? 30.253  -21.524  45.561  1.00 68.30  ? 280 TYR B CE1   1 
ATOM   5602  C  CE2   . TYR B  1 280 ? 29.641  -19.858  43.941  1.00 67.09  ? 280 TYR B CE2   1 
ATOM   5603  C  CZ    . TYR B  1 280 ? 30.586  -20.444  44.763  1.00 68.05  ? 280 TYR B CZ    1 
ATOM   5604  O  OH    . TYR B  1 280 ? 31.863  -19.949  44.788  1.00 69.22  ? 280 TYR B OH    1 
ATOM   5605  N  N     . ARG B  1 281 ? 24.792  -19.732  46.310  1.00 64.82  ? 281 ARG B N     1 
ATOM   5606  C  CA    . ARG B  1 281 ? 24.587  -18.422  46.924  1.00 64.31  ? 281 ARG B CA    1 
ATOM   5607  C  C     . ARG B  1 281 ? 24.358  -18.600  48.426  1.00 64.27  ? 281 ARG B C     1 
ATOM   5608  O  O     . ARG B  1 281 ? 24.915  -17.860  49.234  1.00 64.38  ? 281 ARG B O     1 
ATOM   5609  C  CB    . ARG B  1 281 ? 23.395  -17.713  46.279  1.00 64.03  ? 281 ARG B CB    1 
ATOM   5610  C  CG    . ARG B  1 281 ? 23.015  -16.386  46.914  1.00 64.15  ? 281 ARG B CG    1 
ATOM   5611  C  CD    . ARG B  1 281 ? 21.934  -15.664  46.107  1.00 64.37  ? 281 ARG B CD    1 
ATOM   5612  N  NE    . ARG B  1 281 ? 20.599  -16.235  46.286  1.00 64.36  ? 281 ARG B NE    1 
ATOM   5613  C  CZ    . ARG B  1 281 ? 19.520  -15.826  45.623  1.00 65.00  ? 281 ARG B CZ    1 
ATOM   5614  N  NH1   . ARG B  1 281 ? 19.614  -14.849  44.734  1.00 65.93  ? 281 ARG B NH1   1 
ATOM   5615  N  NH2   . ARG B  1 281 ? 18.344  -16.392  45.840  1.00 65.12  ? 281 ARG B NH2   1 
ATOM   5616  N  N     . GLN B  1 282 ? 23.547  -19.589  48.794  1.00 64.23  ? 282 GLN B N     1 
ATOM   5617  C  CA    . GLN B  1 282 ? 23.342  -19.917  50.197  1.00 64.31  ? 282 GLN B CA    1 
ATOM   5618  C  C     . GLN B  1 282 ? 24.670  -20.169  50.891  1.00 64.78  ? 282 GLN B C     1 
ATOM   5619  O  O     . GLN B  1 282 ? 24.958  -19.564  51.916  1.00 65.30  ? 282 GLN B O     1 
ATOM   5620  C  CB    . GLN B  1 282 ? 22.447  -21.133  50.348  1.00 64.45  ? 282 GLN B CB    1 
ATOM   5621  C  CG    . GLN B  1 282 ? 22.307  -21.567  51.772  1.00 64.50  ? 282 GLN B CG    1 
ATOM   5622  C  CD    . GLN B  1 282 ? 21.313  -22.671  51.928  1.00 65.62  ? 282 GLN B CD    1 
ATOM   5623  O  OE1   . GLN B  1 282 ? 20.228  -22.626  51.356  1.00 66.26  ? 282 GLN B OE1   1 
ATOM   5624  N  NE2   . GLN B  1 282 ? 21.670  -23.680  52.708  1.00 67.44  ? 282 GLN B NE2   1 
ATOM   5625  N  N     . LEU B  1 283 ? 25.465  -21.065  50.312  1.00 65.28  ? 283 LEU B N     1 
ATOM   5626  C  CA    . LEU B  1 283 ? 26.809  -21.418  50.782  1.00 65.71  ? 283 LEU B CA    1 
ATOM   5627  C  C     . LEU B  1 283 ? 27.685  -20.158  50.951  1.00 65.09  ? 283 LEU B C     1 
ATOM   5628  O  O     . LEU B  1 283 ? 28.284  -19.947  52.003  1.00 64.99  ? 283 LEU B O     1 
ATOM   5629  C  CB    . LEU B  1 283 ? 27.428  -22.415  49.775  1.00 66.41  ? 283 LEU B CB    1 
ATOM   5630  C  CG    . LEU B  1 283 ? 28.578  -23.397  50.053  1.00 68.03  ? 283 LEU B CG    1 
ATOM   5631  C  CD1   . LEU B  1 283 ? 28.778  -24.341  48.862  1.00 68.28  ? 283 LEU B CD1   1 
ATOM   5632  C  CD2   . LEU B  1 283 ? 29.893  -22.686  50.376  1.00 68.63  ? 283 LEU B CD2   1 
ATOM   5633  N  N     . SER B  1 284 ? 27.706  -19.317  49.918  1.00 64.55  ? 284 SER B N     1 
ATOM   5634  C  CA    . SER B  1 284 ? 28.583  -18.145  49.834  1.00 64.59  ? 284 SER B CA    1 
ATOM   5635  C  C     . SER B  1 284 ? 28.255  -17.099  50.864  1.00 64.22  ? 284 SER B C     1 
ATOM   5636  O  O     . SER B  1 284 ? 29.156  -16.572  51.526  1.00 64.81  ? 284 SER B O     1 
ATOM   5637  C  CB    . SER B  1 284 ? 28.475  -17.488  48.458  1.00 64.15  ? 284 SER B CB    1 
ATOM   5638  O  OG    . SER B  1 284 ? 28.927  -18.352  47.434  1.00 65.16  ? 284 SER B OG    1 
ATOM   5639  N  N     . LEU B  1 285 ? 26.963  -16.792  50.964  1.00 63.39  ? 285 LEU B N     1 
ATOM   5640  C  CA    . LEU B  1 285 ? 26.453  -15.761  51.857  1.00 62.79  ? 285 LEU B CA    1 
ATOM   5641  C  C     . LEU B  1 285 ? 26.653  -16.120  53.314  1.00 62.91  ? 285 LEU B C     1 
ATOM   5642  O  O     . LEU B  1 285 ? 27.050  -15.271  54.113  1.00 63.23  ? 285 LEU B O     1 
ATOM   5643  C  CB    . LEU B  1 285 ? 24.977  -15.478  51.573  1.00 62.44  ? 285 LEU B CB    1 
ATOM   5644  C  CG    . LEU B  1 285 ? 24.727  -14.585  50.356  1.00 62.41  ? 285 LEU B CG    1 
ATOM   5645  C  CD1   . LEU B  1 285 ? 23.242  -14.385  50.075  1.00 62.02  ? 285 LEU B CD1   1 
ATOM   5646  C  CD2   . LEU B  1 285 ? 25.412  -13.251  50.576  1.00 63.16  ? 285 LEU B CD2   1 
ATOM   5647  N  N     . LEU B  1 286 ? 26.395  -17.378  53.651  1.00 62.69  ? 286 LEU B N     1 
ATOM   5648  C  CA    . LEU B  1 286 ? 26.614  -17.858  55.001  1.00 63.04  ? 286 LEU B CA    1 
ATOM   5649  C  C     . LEU B  1 286 ? 28.109  -17.896  55.320  1.00 63.90  ? 286 LEU B C     1 
ATOM   5650  O  O     . LEU B  1 286 ? 28.497  -17.876  56.484  1.00 64.27  ? 286 LEU B O     1 
ATOM   5651  C  CB    . LEU B  1 286 ? 25.980  -19.230  55.187  1.00 63.13  ? 286 LEU B CB    1 
ATOM   5652  C  CG    . LEU B  1 286 ? 24.471  -19.343  54.981  1.00 61.97  ? 286 LEU B CG    1 
ATOM   5653  C  CD1   . LEU B  1 286 ? 24.088  -20.788  54.885  1.00 62.52  ? 286 LEU B CD1   1 
ATOM   5654  C  CD2   . LEU B  1 286 ? 23.704  -18.685  56.098  1.00 62.41  ? 286 LEU B CD2   1 
ATOM   5655  N  N     . LEU B  1 287 ? 28.936  -17.940  54.275  1.00 64.27  ? 287 LEU B N     1 
ATOM   5656  C  CA    . LEU B  1 287 ? 30.392  -17.826  54.413  1.00 65.38  ? 287 LEU B CA    1 
ATOM   5657  C  C     . LEU B  1 287 ? 30.881  -16.381  54.498  1.00 65.85  ? 287 LEU B C     1 
ATOM   5658  O  O     . LEU B  1 287 ? 32.080  -16.143  54.672  1.00 66.78  ? 287 LEU B O     1 
ATOM   5659  C  CB    . LEU B  1 287 ? 31.123  -18.527  53.260  1.00 65.42  ? 287 LEU B CB    1 
ATOM   5660  C  CG    . LEU B  1 287 ? 31.722  -19.922  53.481  1.00 65.99  ? 287 LEU B CG    1 
ATOM   5661  C  CD1   . LEU B  1 287 ? 32.382  -20.415  52.202  1.00 65.44  ? 287 LEU B CD1   1 
ATOM   5662  C  CD2   . LEU B  1 287 ? 32.713  -19.946  54.636  1.00 66.55  ? 287 LEU B CD2   1 
ATOM   5663  N  N     . ARG B  1 288 ? 29.968  -15.419  54.358  1.00 65.61  ? 288 ARG B N     1 
ATOM   5664  C  CA    . ARG B  1 288 ? 30.303  -13.998  54.502  1.00 65.83  ? 288 ARG B CA    1 
ATOM   5665  C  C     . ARG B  1 288 ? 30.857  -13.354  53.234  1.00 65.81  ? 288 ARG B C     1 
ATOM   5666  O  O     . ARG B  1 288 ? 31.254  -12.192  53.256  1.00 66.15  ? 288 ARG B O     1 
ATOM   5667  C  CB    . ARG B  1 288 ? 31.296  -13.794  55.651  1.00 66.84  ? 288 ARG B CB    1 
ATOM   5668  C  CG    . ARG B  1 288 ? 30.687  -13.864  57.019  1.00 67.21  ? 288 ARG B CG    1 
ATOM   5669  C  CD    . ARG B  1 288 ? 30.514  -12.476  57.526  1.00 67.85  ? 288 ARG B CD    1 
ATOM   5670  N  NE    . ARG B  1 288 ? 29.288  -12.363  58.293  1.00 69.31  ? 288 ARG B NE    1 
ATOM   5671  C  CZ    . ARG B  1 288 ? 28.632  -11.223  58.461  1.00 70.41  ? 288 ARG B CZ    1 
ATOM   5672  N  NH1   . ARG B  1 288 ? 29.085  -10.106  57.904  1.00 70.86  ? 288 ARG B NH1   1 
ATOM   5673  N  NH2   . ARG B  1 288 ? 27.514  -11.201  59.170  1.00 71.62  ? 288 ARG B NH2   1 
ATOM   5674  N  N     . ARG B  1 289 ? 30.883  -14.089  52.129  1.00 65.83  ? 289 ARG B N     1 
ATOM   5675  C  CA    . ARG B  1 289 ? 31.387  -13.524  50.880  1.00 66.14  ? 289 ARG B CA    1 
ATOM   5676  C  C     . ARG B  1 289 ? 30.399  -12.472  50.346  1.00 65.17  ? 289 ARG B C     1 
ATOM   5677  O  O     . ARG B  1 289 ? 29.204  -12.741  50.248  1.00 64.77  ? 289 ARG B O     1 
ATOM   5678  C  CB    . ARG B  1 289 ? 31.690  -14.626  49.844  1.00 66.58  ? 289 ARG B CB    1 
ATOM   5679  C  CG    . ARG B  1 289 ? 32.581  -15.770  50.360  1.00 69.29  ? 289 ARG B CG    1 
ATOM   5680  C  CD    . ARG B  1 289 ? 33.670  -16.177  49.352  1.00 73.99  ? 289 ARG B CD    1 
ATOM   5681  N  NE    . ARG B  1 289 ? 34.136  -17.570  49.513  1.00 78.41  ? 289 ARG B NE    1 
ATOM   5682  C  CZ    . ARG B  1 289 ? 33.652  -18.631  48.841  1.00 79.41  ? 289 ARG B CZ    1 
ATOM   5683  N  NH1   . ARG B  1 289 ? 32.671  -18.495  47.945  1.00 78.83  ? 289 ARG B NH1   1 
ATOM   5684  N  NH2   . ARG B  1 289 ? 34.145  -19.847  49.063  1.00 79.61  ? 289 ARG B NH2   1 
ATOM   5685  N  N     . PRO B  1 290 ? 30.896  -11.266  50.012  1.00 65.20  ? 290 PRO B N     1 
ATOM   5686  C  CA    . PRO B  1 290 ? 30.067  -10.144  49.558  1.00 64.72  ? 290 PRO B CA    1 
ATOM   5687  C  C     . PRO B  1 290 ? 28.960  -10.521  48.566  1.00 63.91  ? 290 PRO B C     1 
ATOM   5688  O  O     . PRO B  1 290 ? 29.237  -11.142  47.539  1.00 64.21  ? 290 PRO B O     1 
ATOM   5689  C  CB    . PRO B  1 290 ? 31.078  -9.217   48.865  1.00 65.17  ? 290 PRO B CB    1 
ATOM   5690  C  CG    . PRO B  1 290 ? 32.347  -9.472   49.548  1.00 65.94  ? 290 PRO B CG    1 
ATOM   5691  C  CD    . PRO B  1 290 ? 32.329  -10.933  49.955  1.00 66.14  ? 290 PRO B CD    1 
ATOM   5692  N  N     . PRO B  1 291 ? 27.706  -10.172  48.885  1.00 63.34  ? 291 PRO B N     1 
ATOM   5693  C  CA    . PRO B  1 291 ? 26.632  -10.220  47.893  1.00 62.91  ? 291 PRO B CA    1 
ATOM   5694  C  C     . PRO B  1 291 ? 26.840  -9.208   46.766  1.00 63.02  ? 291 PRO B C     1 
ATOM   5695  O  O     . PRO B  1 291 ? 27.086  -8.021   47.024  1.00 63.74  ? 291 PRO B O     1 
ATOM   5696  C  CB    . PRO B  1 291 ? 25.379  -9.849   48.708  1.00 62.72  ? 291 PRO B CB    1 
ATOM   5697  C  CG    . PRO B  1 291 ? 25.885  -9.284   49.999  1.00 62.91  ? 291 PRO B CG    1 
ATOM   5698  C  CD    . PRO B  1 291 ? 27.177  -9.985   50.247  1.00 63.32  ? 291 PRO B CD    1 
ATOM   5699  N  N     . GLY B  1 292 ? 26.737  -9.676   45.526  1.00 62.63  ? 292 GLY B N     1 
ATOM   5700  C  CA    . GLY B  1 292 ? 26.830  -8.789   44.362  1.00 62.45  ? 292 GLY B CA    1 
ATOM   5701  C  C     . GLY B  1 292 ? 25.465  -8.524   43.764  1.00 61.82  ? 292 GLY B C     1 
ATOM   5702  O  O     . GLY B  1 292 ? 24.524  -8.197   44.478  1.00 62.05  ? 292 GLY B O     1 
ATOM   5703  N  N     . ARG B  1 293 ? 25.368  -8.656   42.448  1.00 61.48  ? 293 ARG B N     1 
ATOM   5704  C  CA    . ARG B  1 293 ? 24.096  -8.624   41.743  1.00 61.20  ? 293 ARG B CA    1 
ATOM   5705  C  C     . ARG B  1 293 ? 23.182  -9.716   42.285  1.00 61.38  ? 293 ARG B C     1 
ATOM   5706  O  O     . ARG B  1 293 ? 23.630  -10.834  42.540  1.00 61.15  ? 293 ARG B O     1 
ATOM   5707  C  CB    . ARG B  1 293 ? 24.331  -8.819   40.246  1.00 61.10  ? 293 ARG B CB    1 
ATOM   5708  C  CG    . ARG B  1 293 ? 23.126  -8.603   39.385  1.00 60.01  ? 293 ARG B CG    1 
ATOM   5709  C  CD    . ARG B  1 293 ? 23.515  -8.549   37.941  1.00 58.70  ? 293 ARG B CD    1 
ATOM   5710  N  NE    . ARG B  1 293 ? 24.201  -7.312   37.578  1.00 58.84  ? 293 ARG B NE    1 
ATOM   5711  C  CZ    . ARG B  1 293 ? 23.623  -6.279   36.966  1.00 58.70  ? 293 ARG B CZ    1 
ATOM   5712  N  NH1   . ARG B  1 293 ? 22.332  -6.320   36.648  1.00 58.64  ? 293 ARG B NH1   1 
ATOM   5713  N  NH2   . ARG B  1 293 ? 24.337  -5.203   36.666  1.00 57.85  ? 293 ARG B NH2   1 
ATOM   5714  N  N     . GLU B  1 294 ? 21.906  -9.374   42.475  1.00 62.24  ? 294 GLU B N     1 
ATOM   5715  C  CA    . GLU B  1 294 ? 20.890  -10.287  43.020  1.00 62.63  ? 294 GLU B CA    1 
ATOM   5716  C  C     . GLU B  1 294 ? 21.433  -11.101  44.184  1.00 62.32  ? 294 GLU B C     1 
ATOM   5717  O  O     . GLU B  1 294 ? 21.098  -12.273  44.345  1.00 62.19  ? 294 GLU B O     1 
ATOM   5718  C  CB    . GLU B  1 294 ? 20.365  -11.222  41.935  1.00 62.97  ? 294 GLU B CB    1 
ATOM   5719  C  CG    . GLU B  1 294 ? 20.047  -10.527  40.631  1.00 64.62  ? 294 GLU B CG    1 
ATOM   5720  C  CD    . GLU B  1 294 ? 19.058  -11.302  39.795  1.00 66.75  ? 294 GLU B CD    1 
ATOM   5721  O  OE1   . GLU B  1 294 ? 18.340  -12.162  40.372  1.00 67.06  ? 294 GLU B OE1   1 
ATOM   5722  O  OE2   . GLU B  1 294 ? 18.995  -11.034  38.569  1.00 67.66  ? 294 GLU B OE2   1 
ATOM   5723  N  N     . ALA B  1 295 ? 22.288  -10.456  44.973  1.00 62.56  ? 295 ALA B N     1 
ATOM   5724  C  CA    . ALA B  1 295 ? 22.984  -11.066  46.108  1.00 62.95  ? 295 ALA B CA    1 
ATOM   5725  C  C     . ALA B  1 295 ? 23.752  -12.363  45.795  1.00 63.27  ? 295 ALA B C     1 
ATOM   5726  O  O     . ALA B  1 295 ? 24.001  -13.174  46.693  1.00 63.39  ? 295 ALA B O     1 
ATOM   5727  C  CB    . ALA B  1 295 ? 22.029  -11.265  47.278  1.00 62.97  ? 295 ALA B CB    1 
ATOM   5728  N  N     . TYR B  1 296 ? 24.129  -12.554  44.533  1.00 63.60  ? 296 TYR B N     1 
ATOM   5729  C  CA    . TYR B  1 296 ? 24.946  -13.698  44.157  1.00 64.02  ? 296 TYR B CA    1 
ATOM   5730  C  C     . TYR B  1 296 ? 26.415  -13.379  44.358  1.00 64.56  ? 296 TYR B C     1 
ATOM   5731  O  O     . TYR B  1 296 ? 26.833  -12.240  44.120  1.00 64.87  ? 296 TYR B O     1 
ATOM   5732  C  CB    . TYR B  1 296 ? 24.712  -14.082  42.707  1.00 64.20  ? 296 TYR B CB    1 
ATOM   5733  C  CG    . TYR B  1 296 ? 23.462  -14.886  42.493  1.00 64.41  ? 296 TYR B CG    1 
ATOM   5734  C  CD1   . TYR B  1 296 ? 23.432  -16.242  42.793  1.00 64.13  ? 296 TYR B CD1   1 
ATOM   5735  C  CD2   . TYR B  1 296 ? 22.310  -14.297  41.976  1.00 64.31  ? 296 TYR B CD2   1 
ATOM   5736  C  CE1   . TYR B  1 296 ? 22.291  -16.992  42.591  1.00 63.67  ? 296 TYR B CE1   1 
ATOM   5737  C  CE2   . TYR B  1 296 ? 21.166  -15.042  41.772  1.00 64.19  ? 296 TYR B CE2   1 
ATOM   5738  C  CZ    . TYR B  1 296 ? 21.166  -16.390  42.084  1.00 63.69  ? 296 TYR B CZ    1 
ATOM   5739  O  OH    . TYR B  1 296 ? 20.039  -17.145  41.893  1.00 64.27  ? 296 TYR B OH    1 
ATOM   5740  N  N     . PRO B  1 297 ? 27.206  -14.387  44.785  1.00 64.85  ? 297 PRO B N     1 
ATOM   5741  C  CA    . PRO B  1 297 ? 28.640  -14.224  45.024  1.00 65.13  ? 297 PRO B CA    1 
ATOM   5742  C  C     . PRO B  1 297 ? 29.329  -13.864  43.732  1.00 65.52  ? 297 PRO B C     1 
ATOM   5743  O  O     . PRO B  1 297 ? 28.784  -14.107  42.659  1.00 65.45  ? 297 PRO B O     1 
ATOM   5744  C  CB    . PRO B  1 297 ? 29.083  -15.615  45.457  1.00 65.58  ? 297 PRO B CB    1 
ATOM   5745  C  CG    . PRO B  1 297 ? 28.036  -16.540  44.914  1.00 65.40  ? 297 PRO B CG    1 
ATOM   5746  C  CD    . PRO B  1 297 ? 26.768  -15.779  44.997  1.00 64.84  ? 297 PRO B CD    1 
ATOM   5747  N  N     . GLY B  1 298 ? 30.521  -13.295  43.833  1.00 66.28  ? 298 GLY B N     1 
ATOM   5748  C  CA    . GLY B  1 298 ? 31.232  -12.798  42.657  1.00 66.88  ? 298 GLY B CA    1 
ATOM   5749  C  C     . GLY B  1 298 ? 31.517  -13.849  41.602  1.00 67.25  ? 298 GLY B C     1 
ATOM   5750  O  O     . GLY B  1 298 ? 31.445  -13.572  40.413  1.00 67.50  ? 298 GLY B O     1 
ATOM   5751  N  N     . ASP B  1 299 ? 31.818  -15.061  42.044  1.00 67.57  ? 299 ASP B N     1 
ATOM   5752  C  CA    . ASP B  1 299 ? 32.345  -16.088  41.170  1.00 68.29  ? 299 ASP B CA    1 
ATOM   5753  C  C     . ASP B  1 299 ? 31.280  -17.083  40.729  1.00 68.05  ? 299 ASP B C     1 
ATOM   5754  O  O     . ASP B  1 299 ? 31.588  -18.256  40.456  1.00 68.73  ? 299 ASP B O     1 
ATOM   5755  C  CB    . ASP B  1 299 ? 33.468  -16.821  41.898  1.00 69.34  ? 299 ASP B CB    1 
ATOM   5756  C  CG    . ASP B  1 299 ? 32.978  -17.573  43.126  1.00 69.47  ? 299 ASP B CG    1 
ATOM   5757  O  OD1   . ASP B  1 299 ? 32.020  -17.105  43.782  1.00 69.00  ? 299 ASP B OD1   1 
ATOM   5758  O  OD2   . ASP B  1 299 ? 33.560  -18.637  43.433  1.00 71.06  ? 299 ASP B OD2   1 
ATOM   5759  N  N     . VAL B  1 300 ? 30.031  -16.622  40.662  1.00 67.18  ? 300 VAL B N     1 
ATOM   5760  C  CA    . VAL B  1 300 ? 28.920  -17.493  40.272  1.00 66.77  ? 300 VAL B CA    1 
ATOM   5761  C  C     . VAL B  1 300 ? 28.948  -17.804  38.767  1.00 67.35  ? 300 VAL B C     1 
ATOM   5762  O  O     . VAL B  1 300 ? 28.493  -18.861  38.342  1.00 67.56  ? 300 VAL B O     1 
ATOM   5763  C  CB    . VAL B  1 300 ? 27.547  -16.942  40.746  1.00 66.06  ? 300 VAL B CB    1 
ATOM   5764  C  CG1   . VAL B  1 300 ? 27.111  -15.723  39.917  1.00 66.03  ? 300 VAL B CG1   1 
ATOM   5765  C  CG2   . VAL B  1 300 ? 26.485  -18.041  40.738  1.00 65.36  ? 300 VAL B CG2   1 
ATOM   5766  N  N     . PHE B  1 301 ? 29.492  -16.879  37.975  1.00 67.76  ? 301 PHE B N     1 
ATOM   5767  C  CA    . PHE B  1 301 ? 29.742  -17.120  36.555  1.00 68.31  ? 301 PHE B CA    1 
ATOM   5768  C  C     . PHE B  1 301 ? 30.760  -18.227  36.424  1.00 69.34  ? 301 PHE B C     1 
ATOM   5769  O  O     . PHE B  1 301 ? 30.569  -19.179  35.670  1.00 69.94  ? 301 PHE B O     1 
ATOM   5770  C  CB    . PHE B  1 301 ? 30.294  -15.872  35.878  1.00 68.38  ? 301 PHE B CB    1 
ATOM   5771  C  CG    . PHE B  1 301 ? 30.977  -16.150  34.574  1.00 69.16  ? 301 PHE B CG    1 
ATOM   5772  C  CD1   . PHE B  1 301 ? 30.235  -16.441  33.430  1.00 69.45  ? 301 PHE B CD1   1 
ATOM   5773  C  CD2   . PHE B  1 301 ? 32.367  -16.131  34.484  1.00 69.92  ? 301 PHE B CD2   1 
ATOM   5774  C  CE1   . PHE B  1 301 ? 30.871  -16.700  32.211  1.00 69.75  ? 301 PHE B CE1   1 
ATOM   5775  C  CE2   . PHE B  1 301 ? 33.010  -16.388  33.274  1.00 70.12  ? 301 PHE B CE2   1 
ATOM   5776  C  CZ    . PHE B  1 301 ? 32.258  -16.675  32.138  1.00 70.34  ? 301 PHE B CZ    1 
ATOM   5777  N  N     . TYR B  1 302 ? 31.854  -18.083  37.167  1.00 69.94  ? 302 TYR B N     1 
ATOM   5778  C  CA    . TYR B  1 302 ? 32.916  -19.077  37.185  1.00 70.83  ? 302 TYR B CA    1 
ATOM   5779  C  C     . TYR B  1 302 ? 32.421  -20.396  37.770  1.00 70.58  ? 302 TYR B C     1 
ATOM   5780  O  O     . TYR B  1 302 ? 32.897  -21.462  37.376  1.00 71.36  ? 302 TYR B O     1 
ATOM   5781  C  CB    . TYR B  1 302 ? 34.140  -18.542  37.935  1.00 71.41  ? 302 TYR B CB    1 
ATOM   5782  C  CG    . TYR B  1 302 ? 35.277  -19.532  38.103  1.00 72.88  ? 302 TYR B CG    1 
ATOM   5783  C  CD1   . TYR B  1 302 ? 35.954  -20.051  36.994  1.00 73.96  ? 302 TYR B CD1   1 
ATOM   5784  C  CD2   . TYR B  1 302 ? 35.682  -19.938  39.374  1.00 73.14  ? 302 TYR B CD2   1 
ATOM   5785  C  CE1   . TYR B  1 302 ? 36.999  -20.958  37.150  1.00 75.38  ? 302 TYR B CE1   1 
ATOM   5786  C  CE2   . TYR B  1 302 ? 36.719  -20.840  39.539  1.00 74.93  ? 302 TYR B CE2   1 
ATOM   5787  C  CZ    . TYR B  1 302 ? 37.376  -21.341  38.427  1.00 76.12  ? 302 TYR B CZ    1 
ATOM   5788  O  OH    . TYR B  1 302 ? 38.409  -22.231  38.603  1.00 78.75  ? 302 TYR B OH    1 
ATOM   5789  N  N     . LEU B  1 303 ? 31.454  -20.330  38.685  1.00 69.49  ? 303 LEU B N     1 
ATOM   5790  C  CA    . LEU B  1 303 ? 30.845  -21.553  39.192  1.00 69.52  ? 303 LEU B CA    1 
ATOM   5791  C  C     . LEU B  1 303 ? 30.360  -22.428  38.053  1.00 70.25  ? 303 LEU B C     1 
ATOM   5792  O  O     . LEU B  1 303 ? 30.675  -23.615  38.019  1.00 71.48  ? 303 LEU B O     1 
ATOM   5793  C  CB    . LEU B  1 303 ? 29.677  -21.293  40.138  1.00 68.38  ? 303 LEU B CB    1 
ATOM   5794  C  CG    . LEU B  1 303 ? 28.900  -22.580  40.461  1.00 67.32  ? 303 LEU B CG    1 
ATOM   5795  C  CD1   . LEU B  1 303 ? 29.716  -23.510  41.337  1.00 66.61  ? 303 LEU B CD1   1 
ATOM   5796  C  CD2   . LEU B  1 303 ? 27.568  -22.281  41.104  1.00 66.42  ? 303 LEU B CD2   1 
ATOM   5797  N  N     . HIS B  1 304 ? 29.594  -21.845  37.132  1.00 69.87  ? 304 HIS B N     1 
ATOM   5798  C  CA    . HIS B  1 304 ? 29.039  -22.607  36.023  1.00 70.32  ? 304 HIS B CA    1 
ATOM   5799  C  C     . HIS B  1 304 ? 30.033  -22.830  34.901  1.00 71.44  ? 304 HIS B C     1 
ATOM   5800  O  O     . HIS B  1 304 ? 30.087  -23.924  34.341  1.00 72.45  ? 304 HIS B O     1 
ATOM   5801  C  CB    . HIS B  1 304 ? 27.756  -21.976  35.500  1.00 69.72  ? 304 HIS B CB    1 
ATOM   5802  C  CG    . HIS B  1 304 ? 26.584  -22.172  36.408  1.00 69.59  ? 304 HIS B CG    1 
ATOM   5803  N  ND1   . HIS B  1 304 ? 25.372  -21.547  36.207  1.00 69.64  ? 304 HIS B ND1   1 
ATOM   5804  C  CD2   . HIS B  1 304 ? 26.446  -22.910  37.535  1.00 69.28  ? 304 HIS B CD2   1 
ATOM   5805  C  CE1   . HIS B  1 304 ? 24.532  -21.908  37.161  1.00 69.32  ? 304 HIS B CE1   1 
ATOM   5806  N  NE2   . HIS B  1 304 ? 25.159  -22.733  37.980  1.00 68.88  ? 304 HIS B NE2   1 
ATOM   5807  N  N     . SER B  1 305 ? 30.824  -21.806  34.587  1.00 71.63  ? 305 SER B N     1 
ATOM   5808  C  CA    . SER B  1 305 ? 31.847  -21.914  33.545  1.00 72.88  ? 305 SER B CA    1 
ATOM   5809  C  C     . SER B  1 305 ? 32.668  -23.187  33.704  1.00 73.92  ? 305 SER B C     1 
ATOM   5810  O  O     . SER B  1 305 ? 32.574  -24.080  32.871  1.00 75.10  ? 305 SER B O     1 
ATOM   5811  C  CB    . SER B  1 305 ? 32.767  -20.691  33.524  1.00 73.08  ? 305 SER B CB    1 
ATOM   5812  O  OG    . SER B  1 305 ? 33.717  -20.735  34.573  1.00 73.41  ? 305 SER B OG    1 
ATOM   5813  N  N     . ARG B  1 306 ? 33.433  -23.296  34.785  1.00 73.95  ? 306 ARG B N     1 
ATOM   5814  C  CA    . ARG B  1 306 ? 34.312  -24.453  34.964  1.00 75.30  ? 306 ARG B CA    1 
ATOM   5815  C  C     . ARG B  1 306 ? 33.588  -25.813  34.870  1.00 75.49  ? 306 ARG B C     1 
ATOM   5816  O  O     . ARG B  1 306 ? 34.169  -26.798  34.399  1.00 77.03  ? 306 ARG B O     1 
ATOM   5817  C  CB    . ARG B  1 306 ? 35.182  -24.325  36.226  1.00 75.62  ? 306 ARG B CB    1 
ATOM   5818  C  CG    . ARG B  1 306 ? 34.482  -24.526  37.560  1.00 75.29  ? 306 ARG B CG    1 
ATOM   5819  C  CD    . ARG B  1 306 ? 35.486  -24.360  38.707  1.00 76.74  ? 306 ARG B CD    1 
ATOM   5820  N  NE    . ARG B  1 306 ? 34.987  -24.922  39.959  1.00 77.11  ? 306 ARG B NE    1 
ATOM   5821  C  CZ    . ARG B  1 306 ? 34.135  -24.306  40.773  1.00 76.42  ? 306 ARG B CZ    1 
ATOM   5822  N  NH1   . ARG B  1 306 ? 33.683  -23.095  40.473  1.00 75.78  ? 306 ARG B NH1   1 
ATOM   5823  N  NH2   . ARG B  1 306 ? 33.731  -24.905  41.888  1.00 76.45  ? 306 ARG B NH2   1 
ATOM   5824  N  N     . LEU B  1 307 ? 32.322  -25.856  35.278  1.00 74.07  ? 307 LEU B N     1 
ATOM   5825  C  CA    . LEU B  1 307 ? 31.504  -27.051  35.083  1.00 74.10  ? 307 LEU B CA    1 
ATOM   5826  C  C     . LEU B  1 307 ? 31.244  -27.322  33.609  1.00 74.50  ? 307 LEU B C     1 
ATOM   5827  O  O     . LEU B  1 307 ? 31.527  -28.411  33.110  1.00 75.77  ? 307 LEU B O     1 
ATOM   5828  C  CB    . LEU B  1 307 ? 30.157  -26.927  35.797  1.00 72.95  ? 307 LEU B CB    1 
ATOM   5829  C  CG    . LEU B  1 307 ? 29.222  -28.097  35.485  1.00 73.06  ? 307 LEU B CG    1 
ATOM   5830  C  CD1   . LEU B  1 307 ? 29.667  -29.320  36.257  1.00 73.48  ? 307 LEU B CD1   1 
ATOM   5831  C  CD2   . LEU B  1 307 ? 27.788  -27.743  35.804  1.00 72.35  ? 307 LEU B CD2   1 
ATOM   5832  N  N     . LEU B  1 308 ? 30.694  -26.320  32.929  1.00 73.45  ? 308 LEU B N     1 
ATOM   5833  C  CA    . LEU B  1 308 ? 30.231  -26.465  31.557  1.00 73.73  ? 308 LEU B CA    1 
ATOM   5834  C  C     . LEU B  1 308 ? 31.351  -26.555  30.519  1.00 75.21  ? 308 LEU B C     1 
ATOM   5835  O  O     . LEU B  1 308 ? 31.124  -26.965  29.381  1.00 76.00  ? 308 LEU B O     1 
ATOM   5836  C  CB    . LEU B  1 308 ? 29.259  -25.345  31.214  1.00 72.37  ? 308 LEU B CB    1 
ATOM   5837  C  CG    . LEU B  1 308 ? 27.843  -25.592  31.696  1.00 70.77  ? 308 LEU B CG    1 
ATOM   5838  C  CD1   . LEU B  1 308 ? 27.025  -24.377  31.407  1.00 69.86  ? 308 LEU B CD1   1 
ATOM   5839  C  CD2   . LEU B  1 308 ? 27.264  -26.791  30.985  1.00 71.82  ? 308 LEU B CD2   1 
ATOM   5840  N  N     . GLU B  1 309 ? 32.556  -26.172  30.921  1.00 75.64  ? 309 GLU B N     1 
ATOM   5841  C  CA    . GLU B  1 309 ? 33.723  -26.293  30.065  1.00 77.29  ? 309 GLU B CA    1 
ATOM   5842  C  C     . GLU B  1 309 ? 34.220  -27.737  30.016  1.00 78.84  ? 309 GLU B C     1 
ATOM   5843  O  O     . GLU B  1 309 ? 34.901  -28.130  29.065  1.00 80.22  ? 309 GLU B O     1 
ATOM   5844  C  CB    . GLU B  1 309 ? 34.823  -25.355  30.552  1.00 77.26  ? 309 GLU B CB    1 
ATOM   5845  C  CG    . GLU B  1 309 ? 34.764  -23.974  29.929  1.00 77.09  ? 309 GLU B CG    1 
ATOM   5846  C  CD    . GLU B  1 309 ? 35.891  -23.742  28.950  1.00 78.66  ? 309 GLU B CD    1 
ATOM   5847  O  OE1   . GLU B  1 309 ? 37.052  -23.928  29.358  1.00 79.37  ? 309 GLU B OE1   1 
ATOM   5848  O  OE2   . GLU B  1 309 ? 35.630  -23.370  27.783  1.00 79.25  ? 309 GLU B OE2   1 
ATOM   5849  N  N     . ARG B  1 310 ? 33.863  -28.517  31.037  1.00 78.58  ? 310 ARG B N     1 
ATOM   5850  C  CA    . ARG B  1 310 ? 34.278  -29.908  31.139  1.00 80.22  ? 310 ARG B CA    1 
ATOM   5851  C  C     . ARG B  1 310 ? 33.652  -30.820  30.085  1.00 81.48  ? 310 ARG B C     1 
ATOM   5852  O  O     . ARG B  1 310 ? 34.122  -31.945  29.864  1.00 83.23  ? 310 ARG B O     1 
ATOM   5853  C  CB    . ARG B  1 310 ? 34.025  -30.436  32.546  1.00 79.62  ? 310 ARG B CB    1 
ATOM   5854  C  CG    . ARG B  1 310 ? 35.154  -30.094  33.488  1.00 80.39  ? 310 ARG B CG    1 
ATOM   5855  C  CD    . ARG B  1 310 ? 34.764  -30.229  34.934  1.00 80.11  ? 310 ARG B CD    1 
ATOM   5856  N  NE    . ARG B  1 310 ? 34.752  -31.614  35.389  1.00 81.36  ? 310 ARG B NE    1 
ATOM   5857  C  CZ    . ARG B  1 310 ? 34.656  -31.972  36.667  1.00 81.72  ? 310 ARG B CZ    1 
ATOM   5858  N  NH1   . ARG B  1 310 ? 34.570  -31.044  37.616  1.00 79.82  ? 310 ARG B NH1   1 
ATOM   5859  N  NH2   . ARG B  1 310 ? 34.651  -33.257  36.998  1.00 83.26  ? 310 ARG B NH2   1 
ATOM   5860  N  N     . ALA B  1 311 ? 32.606  -30.337  29.425  1.00 80.98  ? 311 ALA B N     1 
ATOM   5861  C  CA    . ALA B  1 311 ? 32.013  -31.078  28.319  1.00 82.21  ? 311 ALA B CA    1 
ATOM   5862  C  C     . ALA B  1 311 ? 32.633  -30.610  27.009  1.00 83.32  ? 311 ALA B C     1 
ATOM   5863  O  O     . ALA B  1 311 ? 32.529  -29.428  26.663  1.00 82.73  ? 311 ALA B O     1 
ATOM   5864  C  CB    . ALA B  1 311 ? 30.513  -30.892  28.304  1.00 81.21  ? 311 ALA B CB    1 
ATOM   5865  N  N     . ALA B  1 312 ? 33.289  -31.538  26.302  1.00 85.28  ? 312 ALA B N     1 
ATOM   5866  C  CA    . ALA B  1 312 ? 34.015  -31.258  25.048  1.00 86.61  ? 312 ALA B CA    1 
ATOM   5867  C  C     . ALA B  1 312 ? 34.200  -32.522  24.221  1.00 88.68  ? 312 ALA B C     1 
ATOM   5868  O  O     . ALA B  1 312 ? 34.267  -33.622  24.774  1.00 89.40  ? 312 ALA B O     1 
ATOM   5869  C  CB    . ALA B  1 312 ? 35.383  -30.648  25.351  1.00 86.91  ? 312 ALA B CB    1 
ATOM   5870  N  N     . LYS B  1 313 ? 34.292  -32.368  22.902  1.00 89.92  ? 313 LYS B N     1 
ATOM   5871  C  CA    . LYS B  1 313 ? 34.707  -33.474  22.031  1.00 92.43  ? 313 LYS B CA    1 
ATOM   5872  C  C     . LYS B  1 313 ? 36.236  -33.572  21.996  1.00 94.02  ? 313 LYS B C     1 
ATOM   5873  O  O     . LYS B  1 313 ? 36.909  -32.659  21.511  1.00 94.29  ? 313 LYS B O     1 
ATOM   5874  C  CB    . LYS B  1 313 ? 34.144  -33.312  20.611  1.00 93.05  ? 313 LYS B CB    1 
ATOM   5875  C  CG    . LYS B  1 313 ? 34.855  -34.144  19.529  1.00 96.19  ? 313 LYS B CG    1 
ATOM   5876  C  CD    . LYS B  1 313 ? 34.700  -35.652  19.747  1.00 99.06  ? 313 LYS B CD    1 
ATOM   5877  C  CE    . LYS B  1 313 ? 35.481  -36.450  18.709  1.00 102.40 ? 313 LYS B CE    1 
ATOM   5878  N  NZ    . LYS B  1 313 ? 35.050  -37.879  18.651  1.00 104.30 ? 313 LYS B NZ    1 
ATOM   5879  N  N     . LEU B  1 314 ? 36.780  -34.675  22.510  1.00 95.33  ? 314 LEU B N     1 
ATOM   5880  C  CA    . LEU B  1 314 ? 38.234  -34.866  22.531  1.00 97.11  ? 314 LEU B CA    1 
ATOM   5881  C  C     . LEU B  1 314 ? 38.804  -35.164  21.137  1.00 99.44  ? 314 LEU B C     1 
ATOM   5882  O  O     . LEU B  1 314 ? 38.068  -35.528  20.215  1.00 100.09 ? 314 LEU B O     1 
ATOM   5883  C  CB    . LEU B  1 314 ? 38.652  -35.945  23.541  1.00 97.90  ? 314 LEU B CB    1 
ATOM   5884  C  CG    . LEU B  1 314 ? 38.863  -35.547  25.010  1.00 96.27  ? 314 LEU B CG    1 
ATOM   5885  C  CD1   . LEU B  1 314 ? 38.894  -36.782  25.892  1.00 97.20  ? 314 LEU B CD1   1 
ATOM   5886  C  CD2   . LEU B  1 314 ? 40.140  -34.740  25.210  1.00 96.31  ? 314 LEU B CD2   1 
ATOM   5887  N  N     . SER B  1 315 ? 40.119  -35.000  20.999  1.00 100.88 ? 315 SER B N     1 
ATOM   5888  C  CA    . SER B  1 315 ? 40.790  -35.068  19.704  1.00 102.73 ? 315 SER B CA    1 
ATOM   5889  C  C     . SER B  1 315 ? 41.007  -36.490  19.241  1.00 104.94 ? 315 SER B C     1 
ATOM   5890  O  O     . SER B  1 315 ? 40.748  -37.444  19.976  1.00 105.02 ? 315 SER B O     1 
ATOM   5891  C  CB    . SER B  1 315 ? 42.139  -34.357  19.770  1.00 103.71 ? 315 SER B CB    1 
ATOM   5892  O  OG    . SER B  1 315 ? 43.044  -35.081  20.585  1.00 105.12 ? 315 SER B OG    1 
ATOM   5893  N  N     . GLU B  1 316 ? 41.493  -36.609  18.010  1.00 106.85 ? 316 GLU B N     1 
ATOM   5894  C  CA    . GLU B  1 316 ? 41.880  -37.881  17.431  1.00 109.44 ? 316 GLU B CA    1 
ATOM   5895  C  C     . GLU B  1 316 ? 42.939  -38.554  18.316  1.00 110.60 ? 316 GLU B C     1 
ATOM   5896  O  O     . GLU B  1 316 ? 42.804  -39.727  18.661  1.00 111.44 ? 316 GLU B O     1 
ATOM   5897  C  CB    . GLU B  1 316 ? 42.398  -37.649  16.009  1.00 111.58 ? 316 GLU B CB    1 
ATOM   5898  C  CG    . GLU B  1 316 ? 42.027  -38.735  14.997  1.00 114.21 ? 316 GLU B CG    1 
ATOM   5899  C  CD    . GLU B  1 316 ? 43.142  -39.746  14.759  1.00 118.60 ? 316 GLU B CD    1 
ATOM   5900  O  OE1   . GLU B  1 316 ? 44.338  -39.361  14.744  1.00 120.15 ? 316 GLU B OE1   1 
ATOM   5901  O  OE2   . GLU B  1 316 ? 42.815  -40.936  14.569  1.00 120.89 ? 316 GLU B OE2   1 
ATOM   5902  N  N     . LYS B  1 317 ? 43.961  -37.793  18.714  1.00 110.49 ? 317 LYS B N     1 
ATOM   5903  C  CA    . LYS B  1 317 ? 45.037  -38.303  19.571  1.00 111.81 ? 317 LYS B CA    1 
ATOM   5904  C  C     . LYS B  1 317 ? 44.568  -38.791  20.946  1.00 110.51 ? 317 LYS B C     1 
ATOM   5905  O  O     . LYS B  1 317 ? 45.180  -39.684  21.525  1.00 112.00 ? 317 LYS B O     1 
ATOM   5906  C  CB    . LYS B  1 317 ? 46.136  -37.249  19.752  1.00 111.99 ? 317 LYS B CB    1 
ATOM   5907  C  CG    . LYS B  1 317 ? 47.497  -37.849  20.112  1.00 114.98 ? 317 LYS B CG    1 
ATOM   5908  C  CD    . LYS B  1 317 ? 48.572  -36.802  20.400  1.00 115.41 ? 317 LYS B CD    1 
ATOM   5909  C  CE    . LYS B  1 317 ? 48.737  -36.551  21.894  1.00 114.09 ? 317 LYS B CE    1 
ATOM   5910  N  NZ    . LYS B  1 317 ? 50.083  -35.998  22.208  1.00 115.60 ? 317 LYS B NZ    1 
ATOM   5911  N  N     . GLU B  1 318 ? 43.488  -38.200  21.459  1.00 107.96 ? 318 GLU B N     1 
ATOM   5912  C  CA    . GLU B  1 318 ? 42.994  -38.492  22.817  1.00 106.59 ? 318 GLU B CA    1 
ATOM   5913  C  C     . GLU B  1 318 ? 41.827  -39.491  22.849  1.00 106.46 ? 318 GLU B C     1 
ATOM   5914  O  O     . GLU B  1 318 ? 41.020  -39.489  23.783  1.00 104.74 ? 318 GLU B O     1 
ATOM   5915  C  CB    . GLU B  1 318 ? 42.597  -37.198  23.541  1.00 103.62 ? 318 GLU B CB    1 
ATOM   5916  C  CG    . GLU B  1 318 ? 43.674  -36.116  23.583  1.00 103.59 ? 318 GLU B CG    1 
ATOM   5917  C  CD    . GLU B  1 318 ? 44.693  -36.302  24.696  1.00 104.11 ? 318 GLU B CD    1 
ATOM   5918  O  OE1   . GLU B  1 318 ? 44.310  -36.636  25.836  1.00 103.12 ? 318 GLU B OE1   1 
ATOM   5919  O  OE2   . GLU B  1 318 ? 45.890  -36.089  24.427  1.00 105.92 ? 318 GLU B OE2   1 
ATOM   5920  N  N     . GLY B  1 319 ? 41.740  -40.343  21.832  1.00 108.47 ? 319 GLY B N     1 
ATOM   5921  C  CA    . GLY B  1 319 ? 40.717  -41.382  21.796  1.00 108.82 ? 319 GLY B CA    1 
ATOM   5922  C  C     . GLY B  1 319 ? 39.344  -40.936  21.324  1.00 106.98 ? 319 GLY B C     1 
ATOM   5923  O  O     . GLY B  1 319 ? 38.419  -41.746  21.255  1.00 107.09 ? 319 GLY B O     1 
ATOM   5924  N  N     . SER B  1 320 ? 39.205  -39.651  21.006  1.00 105.49 ? 320 SER B N     1 
ATOM   5925  C  CA    . SER B  1 320 ? 37.958  -39.102  20.455  1.00 104.03 ? 320 SER B CA    1 
ATOM   5926  C  C     . SER B  1 320 ? 36.725  -39.234  21.372  1.00 102.29 ? 320 SER B C     1 
ATOM   5927  O  O     . SER B  1 320 ? 35.593  -39.036  20.917  1.00 101.30 ? 320 SER B O     1 
ATOM   5928  C  CB    . SER B  1 320 ? 37.670  -39.687  19.058  1.00 105.64 ? 320 SER B CB    1 
ATOM   5929  O  OG    . SER B  1 320 ? 38.361  -38.976  18.046  1.00 106.12 ? 320 SER B OG    1 
ATOM   5930  N  N     . GLY B  1 321 ? 36.949  -39.555  22.650  1.00 102.01 ? 321 GLY B N     1 
ATOM   5931  C  CA    . GLY B  1 321 ? 35.865  -39.647  23.639  1.00 100.46 ? 321 GLY B CA    1 
ATOM   5932  C  C     . GLY B  1 321 ? 35.231  -38.294  23.927  1.00 98.08  ? 321 GLY B C     1 
ATOM   5933  O  O     . GLY B  1 321 ? 35.920  -37.272  23.903  1.00 97.52  ? 321 GLY B O     1 
ATOM   5934  N  N     . SER B  1 322 ? 33.924  -38.266  24.193  1.00 96.71  ? 322 SER B N     1 
ATOM   5935  C  CA    . SER B  1 322 ? 33.240  -36.979  24.351  1.00 94.57  ? 322 SER B CA    1 
ATOM   5936  C  C     . SER B  1 322 ? 32.310  -36.881  25.557  1.00 92.89  ? 322 SER B C     1 
ATOM   5937  O  O     . SER B  1 322 ? 31.795  -37.884  26.047  1.00 93.43  ? 322 SER B O     1 
ATOM   5938  C  CB    . SER B  1 322 ? 32.496  -36.585  23.064  1.00 94.53  ? 322 SER B CB    1 
ATOM   5939  O  OG    . SER B  1 322 ? 31.124  -36.939  23.112  1.00 94.08  ? 322 SER B OG    1 
ATOM   5940  N  N     . LEU B  1 323 ? 32.126  -35.649  26.024  1.00 91.06  ? 323 LEU B N     1 
ATOM   5941  C  CA    . LEU B  1 323 ? 31.111  -35.300  27.012  1.00 89.38  ? 323 LEU B CA    1 
ATOM   5942  C  C     . LEU B  1 323 ? 30.250  -34.175  26.434  1.00 88.15  ? 323 LEU B C     1 
ATOM   5943  O  O     . LEU B  1 323 ? 30.769  -33.148  25.990  1.00 87.78  ? 323 LEU B O     1 
ATOM   5944  C  CB    . LEU B  1 323 ? 31.765  -34.862  28.328  1.00 88.61  ? 323 LEU B CB    1 
ATOM   5945  C  CG    . LEU B  1 323 ? 30.906  -34.633  29.577  1.00 86.90  ? 323 LEU B CG    1 
ATOM   5946  C  CD1   . LEU B  1 323 ? 30.195  -35.916  29.977  1.00 88.07  ? 323 LEU B CD1   1 
ATOM   5947  C  CD2   . LEU B  1 323 ? 31.765  -34.131  30.727  1.00 85.73  ? 323 LEU B CD2   1 
ATOM   5948  N  N     . THR B  1 324 ? 28.936  -34.386  26.439  1.00 87.66  ? 324 THR B N     1 
ATOM   5949  C  CA    . THR B  1 324 ? 27.976  -33.484  25.800  1.00 86.65  ? 324 THR B CA    1 
ATOM   5950  C  C     . THR B  1 324 ? 26.988  -32.997  26.843  1.00 84.67  ? 324 THR B C     1 
ATOM   5951  O  O     . THR B  1 324 ? 26.168  -33.786  27.316  1.00 85.02  ? 324 THR B O     1 
ATOM   5952  C  CB    . THR B  1 324 ? 27.170  -34.237  24.719  1.00 88.09  ? 324 THR B CB    1 
ATOM   5953  O  OG1   . THR B  1 324 ? 28.057  -34.972  23.853  1.00 90.39  ? 324 THR B OG1   1 
ATOM   5954  C  CG2   . THR B  1 324 ? 26.293  -33.272  23.915  1.00 87.58  ? 324 THR B CG2   1 
ATOM   5955  N  N     . ALA B  1 325 ? 27.040  -31.715  27.199  1.00 82.70  ? 325 ALA B N     1 
ATOM   5956  C  CA    . ALA B  1 325 ? 26.228  -31.230  28.321  1.00 80.74  ? 325 ALA B CA    1 
ATOM   5957  C  C     . ALA B  1 325 ? 24.919  -30.533  27.934  1.00 79.74  ? 325 ALA B C     1 
ATOM   5958  O  O     . ALA B  1 325 ? 24.878  -29.731  27.000  1.00 79.79  ? 325 ALA B O     1 
ATOM   5959  C  CB    . ALA B  1 325 ? 27.058  -30.347  29.242  1.00 79.71  ? 325 ALA B CB    1 
ATOM   5960  N  N     . LEU B  1 326 ? 23.855  -30.858  28.663  1.00 78.81  ? 326 LEU B N     1 
ATOM   5961  C  CA    . LEU B  1 326 ? 22.594  -30.129  28.571  1.00 77.85  ? 326 LEU B CA    1 
ATOM   5962  C  C     . LEU B  1 326 ? 22.208  -29.573  29.936  1.00 76.30  ? 326 LEU B C     1 
ATOM   5963  O  O     . LEU B  1 326 ? 21.584  -30.278  30.738  1.00 76.13  ? 326 LEU B O     1 
ATOM   5964  C  CB    . LEU B  1 326 ? 21.474  -31.024  28.051  1.00 78.99  ? 326 LEU B CB    1 
ATOM   5965  C  CG    . LEU B  1 326 ? 21.587  -31.556  26.626  1.00 80.78  ? 326 LEU B CG    1 
ATOM   5966  C  CD1   . LEU B  1 326 ? 20.659  -32.760  26.438  1.00 81.60  ? 326 LEU B CD1   1 
ATOM   5967  C  CD2   . LEU B  1 326 ? 21.289  -30.451  25.618  1.00 80.52  ? 326 LEU B CD2   1 
ATOM   5968  N  N     . PRO B  1 327 ? 22.609  -28.318  30.217  1.00 75.08  ? 327 PRO B N     1 
ATOM   5969  C  CA    . PRO B  1 327 ? 22.179  -27.612  31.420  1.00 73.89  ? 327 PRO B CA    1 
ATOM   5970  C  C     . PRO B  1 327 ? 20.781  -27.003  31.273  1.00 73.54  ? 327 PRO B C     1 
ATOM   5971  O  O     . PRO B  1 327 ? 20.408  -26.555  30.182  1.00 73.73  ? 327 PRO B O     1 
ATOM   5972  C  CB    . PRO B  1 327 ? 23.227  -26.510  31.566  1.00 73.31  ? 327 PRO B CB    1 
ATOM   5973  C  CG    . PRO B  1 327 ? 23.707  -26.269  30.188  1.00 73.87  ? 327 PRO B CG    1 
ATOM   5974  C  CD    . PRO B  1 327 ? 23.679  -27.591  29.511  1.00 75.06  ? 327 PRO B CD    1 
ATOM   5975  N  N     . VAL B  1 328 ? 20.027  -27.005  32.374  1.00 72.97  ? 328 VAL B N     1 
ATOM   5976  C  CA    . VAL B  1 328 ? 18.659  -26.485  32.414  1.00 72.80  ? 328 VAL B CA    1 
ATOM   5977  C  C     . VAL B  1 328 ? 18.606  -25.232  33.282  1.00 71.57  ? 328 VAL B C     1 
ATOM   5978  O  O     . VAL B  1 328 ? 19.124  -25.231  34.398  1.00 71.15  ? 328 VAL B O     1 
ATOM   5979  C  CB    . VAL B  1 328 ? 17.676  -27.516  33.000  1.00 73.42  ? 328 VAL B CB    1 
ATOM   5980  C  CG1   . VAL B  1 328 ? 16.238  -27.009  32.876  1.00 73.91  ? 328 VAL B CG1   1 
ATOM   5981  C  CG2   . VAL B  1 328 ? 17.836  -28.879  32.322  1.00 74.41  ? 328 VAL B CG2   1 
ATOM   5982  N  N     . ILE B  1 329 ? 17.983  -24.171  32.770  1.00 71.15  ? 329 ILE B N     1 
ATOM   5983  C  CA    . ILE B  1 329 ? 17.899  -22.889  33.479  1.00 69.83  ? 329 ILE B CA    1 
ATOM   5984  C  C     . ILE B  1 329 ? 16.461  -22.392  33.467  1.00 69.99  ? 329 ILE B C     1 
ATOM   5985  O  O     . ILE B  1 329 ? 15.815  -22.344  32.424  1.00 70.38  ? 329 ILE B O     1 
ATOM   5986  C  CB    . ILE B  1 329 ? 18.916  -21.842  32.903  1.00 69.36  ? 329 ILE B CB    1 
ATOM   5987  C  CG1   . ILE B  1 329 ? 20.310  -22.044  33.510  1.00 68.88  ? 329 ILE B CG1   1 
ATOM   5988  C  CG2   . ILE B  1 329 ? 18.466  -20.414  33.109  1.00 69.13  ? 329 ILE B CG2   1 
ATOM   5989  C  CD1   . ILE B  1 329 ? 20.455  -21.671  34.984  1.00 68.04  ? 329 ILE B CD1   1 
ATOM   5990  N  N     . GLU B  1 330 ? 15.964  -22.058  34.653  1.00 69.78  ? 330 GLU B N     1 
ATOM   5991  C  CA    . GLU B  1 330 ? 14.595  -21.592  34.828  1.00 70.50  ? 330 GLU B CA    1 
ATOM   5992  C  C     . GLU B  1 330 ? 14.549  -20.083  34.945  1.00 70.15  ? 330 GLU B C     1 
ATOM   5993  O  O     . GLU B  1 330 ? 15.071  -19.513  35.896  1.00 69.44  ? 330 GLU B O     1 
ATOM   5994  C  CB    . GLU B  1 330 ? 13.960  -22.218  36.071  1.00 70.64  ? 330 GLU B CB    1 
ATOM   5995  C  CG    . GLU B  1 330 ? 12.642  -21.561  36.481  1.00 71.82  ? 330 GLU B CG    1 
ATOM   5996  C  CD    . GLU B  1 330 ? 11.880  -22.333  37.546  1.00 73.83  ? 330 GLU B CD    1 
ATOM   5997  O  OE1   . GLU B  1 330 ? 11.915  -23.587  37.549  1.00 75.04  ? 330 GLU B OE1   1 
ATOM   5998  O  OE2   . GLU B  1 330 ? 11.219  -21.675  38.377  1.00 74.89  ? 330 GLU B OE2   1 
ATOM   5999  N  N     . THR B  1 331 ? 13.901  -19.446  33.980  1.00 71.05  ? 331 THR B N     1 
ATOM   6000  C  CA    . THR B  1 331 ? 13.756  -17.998  33.967  1.00 71.25  ? 331 THR B CA    1 
ATOM   6001  C  C     . THR B  1 331 ? 12.454  -17.580  34.637  1.00 71.93  ? 331 THR B C     1 
ATOM   6002  O  O     . THR B  1 331 ? 11.483  -18.340  34.645  1.00 72.84  ? 331 THR B O     1 
ATOM   6003  C  CB    . THR B  1 331 ? 13.753  -17.467  32.532  1.00 72.04  ? 331 THR B CB    1 
ATOM   6004  O  OG1   . THR B  1 331 ? 12.570  -17.913  31.855  1.00 72.98  ? 331 THR B OG1   1 
ATOM   6005  C  CG2   . THR B  1 331 ? 14.983  -17.954  31.786  1.00 71.67  ? 331 THR B CG2   1 
ATOM   6006  N  N     . GLN B  1 332 ? 12.437  -16.370  35.188  1.00 71.91  ? 332 GLN B N     1 
ATOM   6007  C  CA    . GLN B  1 332 ? 11.241  -15.818  35.826  1.00 73.00  ? 332 GLN B CA    1 
ATOM   6008  C  C     . GLN B  1 332 ? 10.501  -14.854  34.895  1.00 74.28  ? 332 GLN B C     1 
ATOM   6009  O  O     . GLN B  1 332 ? 11.110  -13.951  34.316  1.00 74.40  ? 332 GLN B O     1 
ATOM   6010  C  CB    . GLN B  1 332 ? 11.607  -15.114  37.132  1.00 72.20  ? 332 GLN B CB    1 
ATOM   6011  C  CG    . GLN B  1 332 ? 12.238  -16.022  38.175  1.00 72.02  ? 332 GLN B CG    1 
ATOM   6012  C  CD    . GLN B  1 332 ? 11.262  -17.028  38.763  1.00 73.24  ? 332 GLN B CD    1 
ATOM   6013  O  OE1   . GLN B  1 332 ? 10.148  -16.678  39.162  1.00 74.97  ? 332 GLN B OE1   1 
ATOM   6014  N  NE2   . GLN B  1 332 ? 11.684  -18.284  38.833  1.00 73.06  ? 332 GLN B NE2   1 
ATOM   6015  N  N     . GLY B  1 333 ? 9.194   -15.054  34.745  1.00 75.57  ? 333 GLY B N     1 
ATOM   6016  C  CA    . GLY B  1 333 ? 8.399   -14.261  33.811  1.00 77.29  ? 333 GLY B CA    1 
ATOM   6017  C  C     . GLY B  1 333 ? 8.961   -14.200  32.396  1.00 77.99  ? 333 GLY B C     1 
ATOM   6018  O  O     . GLY B  1 333 ? 8.684   -13.257  31.652  1.00 79.05  ? 333 GLY B O     1 
ATOM   6019  N  N     . GLY B  1 334 ? 9.743   -15.211  32.021  1.00 77.64  ? 334 GLY B N     1 
ATOM   6020  C  CA    . GLY B  1 334 ? 10.373  -15.263  30.707  1.00 78.17  ? 334 GLY B CA    1 
ATOM   6021  C  C     . GLY B  1 334 ? 11.299  -14.085  30.470  1.00 77.98  ? 334 GLY B C     1 
ATOM   6022  O  O     . GLY B  1 334 ? 11.267  -13.463  29.408  1.00 79.12  ? 334 GLY B O     1 
ATOM   6023  N  N     . ASP B  1 335 ? 12.111  -13.766  31.473  1.00 76.83  ? 335 ASP B N     1 
ATOM   6024  C  CA    . ASP B  1 335 ? 13.121  -12.725  31.352  1.00 76.34  ? 335 ASP B CA    1 
ATOM   6025  C  C     . ASP B  1 335 ? 14.481  -13.388  31.133  1.00 75.28  ? 335 ASP B C     1 
ATOM   6026  O  O     . ASP B  1 335 ? 15.068  -13.939  32.071  1.00 74.27  ? 335 ASP B O     1 
ATOM   6027  C  CB    . ASP B  1 335 ? 13.098  -11.830  32.602  1.00 76.01  ? 335 ASP B CB    1 
ATOM   6028  C  CG    . ASP B  1 335 ? 14.311  -10.907  32.709  1.00 75.91  ? 335 ASP B CG    1 
ATOM   6029  O  OD1   . ASP B  1 335 ? 14.716  -10.282  31.701  1.00 76.95  ? 335 ASP B OD1   1 
ATOM   6030  O  OD2   . ASP B  1 335 ? 14.850  -10.798  33.829  1.00 75.52  ? 335 ASP B OD2   1 
ATOM   6031  N  N     . VAL B  1 336 ? 14.950  -13.351  29.884  1.00 75.61  ? 336 VAL B N     1 
ATOM   6032  C  CA    . VAL B  1 336 ? 16.258  -13.922  29.497  1.00 75.19  ? 336 VAL B CA    1 
ATOM   6033  C  C     . VAL B  1 336 ? 17.441  -12.973  29.748  1.00 74.42  ? 336 VAL B C     1 
ATOM   6034  O  O     . VAL B  1 336 ? 18.603  -13.355  29.571  1.00 74.11  ? 336 VAL B O     1 
ATOM   6035  C  CB    . VAL B  1 336 ? 16.304  -14.417  27.999  1.00 76.28  ? 336 VAL B CB    1 
ATOM   6036  C  CG1   . VAL B  1 336 ? 15.853  -15.873  27.886  1.00 76.37  ? 336 VAL B CG1   1 
ATOM   6037  C  CG2   . VAL B  1 336 ? 15.511  -13.483  27.046  1.00 77.42  ? 336 VAL B CG2   1 
ATOM   6038  N  N     . SER B  1 337 ? 17.128  -11.744  30.153  1.00 74.09  ? 337 SER B N     1 
ATOM   6039  C  CA    . SER B  1 337 ? 18.130  -10.733  30.461  1.00 73.27  ? 337 SER B CA    1 
ATOM   6040  C  C     . SER B  1 337 ? 18.510  -10.742  31.935  1.00 71.80  ? 337 SER B C     1 
ATOM   6041  O  O     . SER B  1 337 ? 19.269  -9.888   32.379  1.00 71.66  ? 337 SER B O     1 
ATOM   6042  C  CB    . SER B  1 337 ? 17.621  -9.347   30.071  1.00 74.23  ? 337 SER B CB    1 
ATOM   6043  O  OG    . SER B  1 337 ? 17.407  -9.266   28.673  1.00 76.05  ? 337 SER B OG    1 
ATOM   6044  N  N     . ALA B  1 338 ? 17.979  -11.701  32.690  1.00 70.73  ? 338 ALA B N     1 
ATOM   6045  C  CA    . ALA B  1 338 ? 18.356  -11.892  34.089  1.00 69.25  ? 338 ALA B CA    1 
ATOM   6046  C  C     . ALA B  1 338 ? 19.836  -12.244  34.194  1.00 68.42  ? 338 ALA B C     1 
ATOM   6047  O  O     . ALA B  1 338 ? 20.455  -12.589  33.195  1.00 69.11  ? 338 ALA B O     1 
ATOM   6048  C  CB    . ALA B  1 338 ? 17.499  -12.973  34.713  1.00 69.21  ? 338 ALA B CB    1 
ATOM   6049  N  N     . TYR B  1 339 ? 20.397  -12.161  35.397  1.00 67.29  ? 339 TYR B N     1 
ATOM   6050  C  CA    . TYR B  1 339 ? 21.836  -12.375  35.627  1.00 66.60  ? 339 TYR B CA    1 
ATOM   6051  C  C     . TYR B  1 339 ? 22.334  -13.805  35.356  1.00 66.44  ? 339 TYR B C     1 
ATOM   6052  O  O     . TYR B  1 339 ? 23.283  -14.001  34.588  1.00 66.69  ? 339 TYR B O     1 
ATOM   6053  C  CB    . TYR B  1 339 ? 22.196  -11.957  37.053  1.00 66.06  ? 339 TYR B CB    1 
ATOM   6054  C  CG    . TYR B  1 339 ? 23.667  -12.005  37.399  1.00 66.01  ? 339 TYR B CG    1 
ATOM   6055  C  CD1   . TYR B  1 339 ? 24.630  -11.539  36.511  1.00 67.02  ? 339 TYR B CD1   1 
ATOM   6056  C  CD2   . TYR B  1 339 ? 24.092  -12.476  38.642  1.00 66.03  ? 339 TYR B CD2   1 
ATOM   6057  C  CE1   . TYR B  1 339 ? 25.986  -11.571  36.837  1.00 67.01  ? 339 TYR B CE1   1 
ATOM   6058  C  CE2   . TYR B  1 339 ? 25.442  -12.504  38.976  1.00 65.93  ? 339 TYR B CE2   1 
ATOM   6059  C  CZ    . TYR B  1 339 ? 26.374  -12.052  38.066  1.00 66.22  ? 339 TYR B CZ    1 
ATOM   6060  O  OH    . TYR B  1 339 ? 27.701  -12.086  38.367  1.00 67.00  ? 339 TYR B OH    1 
ATOM   6061  N  N     . ILE B  1 340 ? 21.703  -14.791  35.989  1.00 65.89  ? 340 ILE B N     1 
ATOM   6062  C  CA    . ILE B  1 340 ? 22.127  -16.184  35.842  1.00 65.61  ? 340 ILE B CA    1 
ATOM   6063  C  C     . ILE B  1 340 ? 21.837  -16.717  34.416  1.00 66.46  ? 340 ILE B C     1 
ATOM   6064  O  O     . ILE B  1 340 ? 22.702  -17.399  33.823  1.00 66.56  ? 340 ILE B O     1 
ATOM   6065  C  CB    . ILE B  1 340 ? 21.538  -17.111  36.969  1.00 65.18  ? 340 ILE B CB    1 
ATOM   6066  C  CG1   . ILE B  1 340 ? 21.748  -16.506  38.373  1.00 63.81  ? 340 ILE B CG1   1 
ATOM   6067  C  CG2   . ILE B  1 340 ? 22.085  -18.551  36.866  1.00 65.15  ? 340 ILE B CG2   1 
ATOM   6068  C  CD1   . ILE B  1 340 ? 23.167  -16.560  38.914  1.00 62.15  ? 340 ILE B CD1   1 
ATOM   6069  N  N     . PRO B  1 341 ? 20.629  -16.411  33.864  1.00 66.80  ? 341 PRO B N     1 
ATOM   6070  C  CA    . PRO B  1 341 ? 20.296  -16.753  32.468  1.00 67.39  ? 341 PRO B CA    1 
ATOM   6071  C  C     . PRO B  1 341 ? 21.324  -16.280  31.441  1.00 67.53  ? 341 PRO B C     1 
ATOM   6072  O  O     . PRO B  1 341 ? 21.836  -17.096  30.674  1.00 67.89  ? 341 PRO B O     1 
ATOM   6073  C  CB    . PRO B  1 341 ? 18.955  -16.053  32.259  1.00 67.56  ? 341 PRO B CB    1 
ATOM   6074  C  CG    . PRO B  1 341 ? 18.314  -16.184  33.588  1.00 67.34  ? 341 PRO B CG    1 
ATOM   6075  C  CD    . PRO B  1 341 ? 19.424  -15.955  34.586  1.00 66.53  ? 341 PRO B CD    1 
ATOM   6076  N  N     . THR B  1 342 ? 21.625  -14.982  31.445  1.00 67.17  ? 342 THR B N     1 
ATOM   6077  C  CA    . THR B  1 342 ? 22.634  -14.408  30.557  1.00 67.54  ? 342 THR B CA    1 
ATOM   6078  C  C     . THR B  1 342 ? 24.037  -15.020  30.797  1.00 67.45  ? 342 THR B C     1 
ATOM   6079  O  O     . THR B  1 342 ? 24.770  -15.309  29.843  1.00 67.79  ? 342 THR B O     1 
ATOM   6080  C  CB    . THR B  1 342 ? 22.675  -12.864  30.681  1.00 67.60  ? 342 THR B CB    1 
ATOM   6081  O  OG1   . THR B  1 342 ? 22.618  -12.495  32.061  1.00 66.97  ? 342 THR B OG1   1 
ATOM   6082  C  CG2   . THR B  1 342 ? 21.506  -12.225  29.967  1.00 67.73  ? 342 THR B CG2   1 
ATOM   6083  N  N     . ASN B  1 343 ? 24.394  -15.214  32.070  1.00 66.78  ? 343 ASN B N     1 
ATOM   6084  C  CA    . ASN B  1 343 ? 25.618  -15.924  32.456  1.00 66.64  ? 343 ASN B CA    1 
ATOM   6085  C  C     . ASN B  1 343 ? 25.769  -17.257  31.745  1.00 67.27  ? 343 ASN B C     1 
ATOM   6086  O  O     . ASN B  1 343 ? 26.792  -17.515  31.119  1.00 67.82  ? 343 ASN B O     1 
ATOM   6087  C  CB    . ASN B  1 343 ? 25.624  -16.208  33.958  1.00 65.89  ? 343 ASN B CB    1 
ATOM   6088  C  CG    . ASN B  1 343 ? 26.293  -15.133  34.764  1.00 65.13  ? 343 ASN B CG    1 
ATOM   6089  O  OD1   . ASN B  1 343 ? 26.551  -14.026  34.283  1.00 65.42  ? 343 ASN B OD1   1 
ATOM   6090  N  ND2   . ASN B  1 343 ? 26.573  -15.453  36.017  1.00 64.19  ? 343 ASN B ND2   1 
ATOM   6091  N  N     . VAL B  1 344 ? 24.749  -18.109  31.867  1.00 67.30  ? 344 VAL B N     1 
ATOM   6092  C  CA    . VAL B  1 344 ? 24.796  -19.469  31.311  1.00 67.80  ? 344 VAL B CA    1 
ATOM   6093  C  C     . VAL B  1 344 ? 24.685  -19.449  29.788  1.00 68.72  ? 344 VAL B C     1 
ATOM   6094  O  O     . VAL B  1 344 ? 25.280  -20.279  29.111  1.00 69.45  ? 344 VAL B O     1 
ATOM   6095  C  CB    . VAL B  1 344 ? 23.721  -20.385  31.942  1.00 67.49  ? 344 VAL B CB    1 
ATOM   6096  C  CG1   . VAL B  1 344 ? 23.747  -21.779  31.314  1.00 67.70  ? 344 VAL B CG1   1 
ATOM   6097  C  CG2   . VAL B  1 344 ? 23.932  -20.472  33.446  1.00 66.51  ? 344 VAL B CG2   1 
ATOM   6098  N  N     . ILE B  1 345 ? 23.931  -18.488  29.260  1.00 68.90  ? 345 ILE B N     1 
ATOM   6099  C  CA    . ILE B  1 345 ? 23.906  -18.228  27.826  1.00 69.93  ? 345 ILE B CA    1 
ATOM   6100  C  C     . ILE B  1 345 ? 25.308  -17.880  27.338  1.00 70.90  ? 345 ILE B C     1 
ATOM   6101  O  O     . ILE B  1 345 ? 25.714  -18.307  26.261  1.00 72.16  ? 345 ILE B O     1 
ATOM   6102  C  CB    . ILE B  1 345 ? 22.884  -17.122  27.446  1.00 69.89  ? 345 ILE B CB    1 
ATOM   6103  C  CG1   . ILE B  1 345 ? 21.452  -17.653  27.617  1.00 69.23  ? 345 ILE B CG1   1 
ATOM   6104  C  CG2   . ILE B  1 345 ? 23.122  -16.608  26.015  1.00 70.13  ? 345 ILE B CG2   1 
ATOM   6105  C  CD1   . ILE B  1 345 ? 20.357  -16.617  27.467  1.00 68.58  ? 345 ILE B CD1   1 
ATOM   6106  N  N     . SER B  1 346 ? 26.059  -17.140  28.149  1.00 70.80  ? 346 SER B N     1 
ATOM   6107  C  CA    . SER B  1 346 ? 27.424  -16.760  27.777  1.00 71.71  ? 346 SER B CA    1 
ATOM   6108  C  C     . SER B  1 346 ? 28.446  -17.888  27.892  1.00 72.19  ? 346 SER B C     1 
ATOM   6109  O  O     . SER B  1 346 ? 29.582  -17.721  27.469  1.00 73.18  ? 346 SER B O     1 
ATOM   6110  C  CB    . SER B  1 346 ? 27.894  -15.532  28.562  1.00 71.23  ? 346 SER B CB    1 
ATOM   6111  O  OG    . SER B  1 346 ? 28.286  -15.865  29.881  1.00 71.29  ? 346 SER B OG    1 
ATOM   6112  N  N     . ILE B  1 347 ? 28.045  -19.024  28.458  1.00 72.11  ? 347 ILE B N     1 
ATOM   6113  C  CA    . ILE B  1 347 ? 28.926  -20.186  28.567  1.00 72.80  ? 347 ILE B CA    1 
ATOM   6114  C  C     . ILE B  1 347 ? 28.601  -21.194  27.462  1.00 74.21  ? 347 ILE B C     1 
ATOM   6115  O  O     . ILE B  1 347 ? 29.465  -21.525  26.646  1.00 75.21  ? 347 ILE B O     1 
ATOM   6116  C  CB    . ILE B  1 347 ? 28.838  -20.858  29.965  1.00 71.90  ? 347 ILE B CB    1 
ATOM   6117  C  CG1   . ILE B  1 347 ? 29.174  -19.863  31.068  1.00 70.84  ? 347 ILE B CG1   1 
ATOM   6118  C  CG2   . ILE B  1 347 ? 29.798  -22.016  30.074  1.00 72.27  ? 347 ILE B CG2   1 
ATOM   6119  C  CD1   . ILE B  1 347 ? 28.520  -20.192  32.385  1.00 69.59  ? 347 ILE B CD1   1 
ATOM   6120  N  N     . THR B  1 348 ? 27.348  -21.651  27.434  1.00 74.56  ? 348 THR B N     1 
ATOM   6121  C  CA    . THR B  1 348 ? 26.884  -22.718  26.527  1.00 76.12  ? 348 THR B CA    1 
ATOM   6122  C  C     . THR B  1 348 ? 27.067  -22.397  25.041  1.00 77.69  ? 348 THR B C     1 
ATOM   6123  O  O     . THR B  1 348 ? 27.309  -21.248  24.669  1.00 77.84  ? 348 THR B O     1 
ATOM   6124  C  CB    . THR B  1 348 ? 25.390  -23.076  26.776  1.00 75.69  ? 348 THR B CB    1 
ATOM   6125  O  OG1   . THR B  1 348 ? 24.543  -21.967  26.419  1.00 75.40  ? 348 THR B OG1   1 
ATOM   6126  C  CG2   . THR B  1 348 ? 25.162  -23.456  28.231  1.00 74.67  ? 348 THR B CG2   1 
ATOM   6127  N  N     . ASP B  1 349 ? 26.932  -23.417  24.197  1.00 79.21  ? 349 ASP B N     1 
ATOM   6128  C  CA    . ASP B  1 349 ? 27.062  -23.254  22.742  1.00 80.88  ? 349 ASP B CA    1 
ATOM   6129  C  C     . ASP B  1 349 ? 25.729  -22.964  22.071  1.00 80.96  ? 349 ASP B C     1 
ATOM   6130  O  O     . ASP B  1 349 ? 25.540  -23.252  20.887  1.00 82.15  ? 349 ASP B O     1 
ATOM   6131  C  CB    . ASP B  1 349 ? 27.682  -24.508  22.122  1.00 82.31  ? 349 ASP B CB    1 
ATOM   6132  C  CG    . ASP B  1 349 ? 29.044  -24.805  22.680  1.00 83.41  ? 349 ASP B CG    1 
ATOM   6133  O  OD1   . ASP B  1 349 ? 29.887  -23.878  22.706  1.00 83.53  ? 349 ASP B OD1   1 
ATOM   6134  O  OD2   . ASP B  1 349 ? 29.268  -25.959  23.104  1.00 85.28  ? 349 ASP B OD2   1 
ATOM   6135  N  N     . GLY B  1 350 ? 24.801  -22.400  22.830  1.00 79.80  ? 350 GLY B N     1 
ATOM   6136  C  CA    . GLY B  1 350 ? 23.469  -22.178  22.316  1.00 80.13  ? 350 GLY B CA    1 
ATOM   6137  C  C     . GLY B  1 350 ? 22.404  -22.601  23.298  1.00 79.38  ? 350 GLY B C     1 
ATOM   6138  O  O     . GLY B  1 350 ? 22.683  -23.283  24.292  1.00 78.87  ? 350 GLY B O     1 
ATOM   6139  N  N     . GLN B  1 351 ? 21.177  -22.185  23.007  1.00 79.39  ? 351 GLN B N     1 
ATOM   6140  C  CA    . GLN B  1 351 ? 20.068  -22.358  23.920  1.00 78.64  ? 351 GLN B CA    1 
ATOM   6141  C  C     . GLN B  1 351 ? 18.842  -22.776  23.147  1.00 79.73  ? 351 GLN B C     1 
ATOM   6142  O  O     . GLN B  1 351 ? 18.521  -22.199  22.110  1.00 80.69  ? 351 GLN B O     1 
ATOM   6143  C  CB    . GLN B  1 351 ? 19.755  -21.058  24.671  1.00 77.50  ? 351 GLN B CB    1 
ATOM   6144  C  CG    . GLN B  1 351 ? 20.873  -20.027  24.689  1.00 77.07  ? 351 GLN B CG    1 
ATOM   6145  C  CD    . GLN B  1 351 ? 20.960  -19.218  23.399  1.00 77.94  ? 351 GLN B CD    1 
ATOM   6146  O  OE1   . GLN B  1 351 ? 19.939  -18.924  22.758  1.00 77.98  ? 351 GLN B OE1   1 
ATOM   6147  N  NE2   . GLN B  1 351 ? 22.187  -18.849  23.014  1.00 77.38  ? 351 GLN B NE2   1 
ATOM   6148  N  N     . ILE B  1 352 ? 18.165  -23.791  23.658  1.00 79.79  ? 352 ILE B N     1 
ATOM   6149  C  CA    . ILE B  1 352 ? 16.834  -24.126  23.205  1.00 80.70  ? 352 ILE B CA    1 
ATOM   6150  C  C     . ILE B  1 352 ? 15.903  -23.424  24.172  1.00 79.85  ? 352 ILE B C     1 
ATOM   6151  O  O     . ILE B  1 352 ? 15.813  -23.809  25.342  1.00 79.03  ? 352 ILE B O     1 
ATOM   6152  C  CB    . ILE B  1 352 ? 16.604  -25.643  23.254  1.00 81.58  ? 352 ILE B CB    1 
ATOM   6153  C  CG1   . ILE B  1 352 ? 17.577  -26.358  22.301  1.00 82.70  ? 352 ILE B CG1   1 
ATOM   6154  C  CG2   . ILE B  1 352 ? 15.141  -25.972  22.950  1.00 82.75  ? 352 ILE B CG2   1 
ATOM   6155  C  CD1   . ILE B  1 352 ? 17.653  -27.864  22.482  1.00 83.61  ? 352 ILE B CD1   1 
ATOM   6156  N  N     . PHE B  1 353 ? 15.240  -22.372  23.700  1.00 80.20  ? 353 PHE B N     1 
ATOM   6157  C  CA    . PHE B  1 353 ? 14.362  -21.595  24.568  1.00 79.68  ? 353 PHE B CA    1 
ATOM   6158  C  C     . PHE B  1 353 ? 12.909  -21.931  24.379  1.00 80.51  ? 353 PHE B C     1 
ATOM   6159  O  O     . PHE B  1 353 ? 12.386  -21.842  23.274  1.00 81.75  ? 353 PHE B O     1 
ATOM   6160  C  CB    . PHE B  1 353 ? 14.546  -20.089  24.396  1.00 79.61  ? 353 PHE B CB    1 
ATOM   6161  C  CG    . PHE B  1 353 ? 13.632  -19.275  25.277  1.00 80.12  ? 353 PHE B CG    1 
ATOM   6162  C  CD1   . PHE B  1 353 ? 13.871  -19.174  26.644  1.00 79.55  ? 353 PHE B CD1   1 
ATOM   6163  C  CD2   . PHE B  1 353 ? 12.519  -18.630  24.745  1.00 82.26  ? 353 PHE B CD2   1 
ATOM   6164  C  CE1   . PHE B  1 353 ? 13.028  -18.437  27.465  1.00 79.91  ? 353 PHE B CE1   1 
ATOM   6165  C  CE2   . PHE B  1 353 ? 11.666  -17.885  25.561  1.00 82.56  ? 353 PHE B CE2   1 
ATOM   6166  C  CZ    . PHE B  1 353 ? 11.923  -17.787  26.921  1.00 81.35  ? 353 PHE B CZ    1 
ATOM   6167  N  N     . LEU B  1 354 ? 12.258  -22.277  25.481  1.00 79.96  ? 354 LEU B N     1 
ATOM   6168  C  CA    . LEU B  1 354 ? 10.870  -22.682  25.452  1.00 81.06  ? 354 LEU B CA    1 
ATOM   6169  C  C     . LEU B  1 354 ? 9.985   -21.530  25.925  1.00 81.40  ? 354 LEU B C     1 
ATOM   6170  O  O     . LEU B  1 354 ? 10.154  -21.024  27.035  1.00 80.51  ? 354 LEU B O     1 
ATOM   6171  C  CB    . LEU B  1 354 ? 10.677  -23.950  26.293  1.00 80.60  ? 354 LEU B CB    1 
ATOM   6172  C  CG    . LEU B  1 354 ? 11.698  -25.080  26.062  1.00 79.74  ? 354 LEU B CG    1 
ATOM   6173  C  CD1   . LEU B  1 354 ? 11.498  -26.236  27.025  1.00 78.62  ? 354 LEU B CD1   1 
ATOM   6174  C  CD2   . LEU B  1 354 ? 11.676  -25.587  24.628  1.00 80.49  ? 354 LEU B CD2   1 
ATOM   6175  N  N     . GLU B  1 355 ? 9.080   -21.088  25.051  1.00 83.01  ? 355 GLU B N     1 
ATOM   6176  C  CA    . GLU B  1 355 ? 8.076   -20.085  25.392  1.00 83.76  ? 355 GLU B CA    1 
ATOM   6177  C  C     . GLU B  1 355 ? 6.991   -20.739  26.223  1.00 84.31  ? 355 GLU B C     1 
ATOM   6178  O  O     . GLU B  1 355 ? 6.565   -21.839  25.901  1.00 85.41  ? 355 GLU B O     1 
ATOM   6179  C  CB    . GLU B  1 355 ? 7.419   -19.533  24.131  1.00 85.35  ? 355 GLU B CB    1 
ATOM   6180  C  CG    . GLU B  1 355 ? 8.193   -18.455  23.413  1.00 85.89  ? 355 GLU B CG    1 
ATOM   6181  C  CD    . GLU B  1 355 ? 7.284   -17.550  22.596  1.00 88.61  ? 355 GLU B CD    1 
ATOM   6182  O  OE1   . GLU B  1 355 ? 7.615   -17.256  21.421  1.00 90.00  ? 355 GLU B OE1   1 
ATOM   6183  O  OE2   . GLU B  1 355 ? 6.232   -17.138  23.130  1.00 89.64  ? 355 GLU B OE2   1 
ATOM   6184  N  N     . ALA B  1 356 ? 6.534   -20.074  27.282  1.00 84.06  ? 356 ALA B N     1 
ATOM   6185  C  CA    . ALA B  1 356 ? 5.370   -20.565  28.028  1.00 84.92  ? 356 ALA B CA    1 
ATOM   6186  C  C     . ALA B  1 356 ? 4.109   -20.317  27.211  1.00 87.13  ? 356 ALA B C     1 
ATOM   6187  O  O     . ALA B  1 356 ? 3.179   -21.118  27.228  1.00 88.41  ? 356 ALA B O     1 
ATOM   6188  C  CB    . ALA B  1 356 ? 5.270   -19.902  29.390  1.00 83.90  ? 356 ALA B CB    1 
ATOM   6189  N  N     . GLU B  1 357 ? 4.106   -19.203  26.485  1.00 87.86  ? 357 GLU B N     1 
ATOM   6190  C  CA    . GLU B  1 357 ? 3.009   -18.815  25.605  1.00 90.14  ? 357 GLU B CA    1 
ATOM   6191  C  C     . GLU B  1 357 ? 2.638   -19.922  24.612  1.00 91.41  ? 357 GLU B C     1 
ATOM   6192  O  O     . GLU B  1 357 ? 1.463   -20.214  24.428  1.00 93.22  ? 357 GLU B O     1 
ATOM   6193  C  CB    . GLU B  1 357 ? 3.372   -17.503  24.883  1.00 90.51  ? 357 GLU B CB    1 
ATOM   6194  C  CG    . GLU B  1 357 ? 2.712   -17.264  23.511  1.00 93.42  ? 357 GLU B CG    1 
ATOM   6195  C  CD    . GLU B  1 357 ? 1.265   -16.811  23.606  1.00 96.27  ? 357 GLU B CD    1 
ATOM   6196  O  OE1   . GLU B  1 357 ? 0.869   -16.294  24.673  1.00 96.64  ? 357 GLU B OE1   1 
ATOM   6197  O  OE2   . GLU B  1 357 ? 0.524   -16.964  22.607  1.00 98.42  ? 357 GLU B OE2   1 
ATOM   6198  N  N     . LEU B  1 358 ? 3.638   -20.535  23.986  1.00 90.74  ? 358 LEU B N     1 
ATOM   6199  C  CA    . LEU B  1 358 ? 3.397   -21.565  22.977  1.00 91.99  ? 358 LEU B CA    1 
ATOM   6200  C  C     . LEU B  1 358 ? 3.051   -22.896  23.622  1.00 92.08  ? 358 LEU B C     1 
ATOM   6201  O  O     . LEU B  1 358 ? 2.307   -23.691  23.055  1.00 93.75  ? 358 LEU B O     1 
ATOM   6202  C  CB    . LEU B  1 358 ? 4.613   -21.737  22.060  1.00 91.45  ? 358 LEU B CB    1 
ATOM   6203  C  CG    . LEU B  1 358 ? 5.262   -20.508  21.409  1.00 91.25  ? 358 LEU B CG    1 
ATOM   6204  C  CD1   . LEU B  1 358 ? 6.483   -20.947  20.612  1.00 90.77  ? 358 LEU B CD1   1 
ATOM   6205  C  CD2   . LEU B  1 358 ? 4.295   -19.687  20.533  1.00 92.90  ? 358 LEU B CD2   1 
ATOM   6206  N  N     . PHE B  1 359 ? 3.602   -23.126  24.810  1.00 90.47  ? 359 PHE B N     1 
ATOM   6207  C  CA    . PHE B  1 359 ? 3.384   -24.358  25.566  1.00 90.59  ? 359 PHE B CA    1 
ATOM   6208  C  C     . PHE B  1 359 ? 1.949   -24.417  26.081  1.00 92.03  ? 359 PHE B C     1 
ATOM   6209  O  O     . PHE B  1 359 ? 1.320   -25.474  26.083  1.00 93.10  ? 359 PHE B O     1 
ATOM   6210  C  CB    . PHE B  1 359 ? 4.383   -24.426  26.732  1.00 88.53  ? 359 PHE B CB    1 
ATOM   6211  C  CG    . PHE B  1 359 ? 4.294   -25.684  27.554  1.00 88.41  ? 359 PHE B CG    1 
ATOM   6212  C  CD1   . PHE B  1 359 ? 5.121   -26.764  27.280  1.00 87.95  ? 359 PHE B CD1   1 
ATOM   6213  C  CD2   . PHE B  1 359 ? 3.401   -25.779  28.621  1.00 88.97  ? 359 PHE B CD2   1 
ATOM   6214  C  CE1   . PHE B  1 359 ? 5.047   -27.931  28.045  1.00 88.42  ? 359 PHE B CE1   1 
ATOM   6215  C  CE2   . PHE B  1 359 ? 3.320   -26.938  29.386  1.00 89.02  ? 359 PHE B CE2   1 
ATOM   6216  C  CZ    . PHE B  1 359 ? 4.149   -28.016  29.099  1.00 88.40  ? 359 PHE B CZ    1 
ATOM   6217  N  N     . TYR B  1 360 ? 1.454   -23.268  26.526  1.00 92.22  ? 360 TYR B N     1 
ATOM   6218  C  CA    . TYR B  1 360 ? 0.092   -23.127  27.014  1.00 94.01  ? 360 TYR B CA    1 
ATOM   6219  C  C     . TYR B  1 360 ? -0.888  -23.137  25.833  1.00 95.78  ? 360 TYR B C     1 
ATOM   6220  O  O     . TYR B  1 360 ? -2.063  -23.452  26.004  1.00 97.64  ? 360 TYR B O     1 
ATOM   6221  C  CB    . TYR B  1 360 ? -0.030  -21.839  27.853  1.00 93.84  ? 360 TYR B CB    1 
ATOM   6222  C  CG    . TYR B  1 360 ? -1.426  -21.528  28.384  1.00 97.96  ? 360 TYR B CG    1 
ATOM   6223  C  CD1   . TYR B  1 360 ? -1.799  -21.886  29.691  1.00 99.50  ? 360 TYR B CD1   1 
ATOM   6224  C  CD2   . TYR B  1 360 ? -2.371  -20.857  27.586  1.00 101.61 ? 360 TYR B CD2   1 
ATOM   6225  C  CE1   . TYR B  1 360 ? -3.083  -21.595  30.183  1.00 101.82 ? 360 TYR B CE1   1 
ATOM   6226  C  CE2   . TYR B  1 360 ? -3.654  -20.570  28.067  1.00 104.21 ? 360 TYR B CE2   1 
ATOM   6227  C  CZ    . TYR B  1 360 ? -3.997  -20.939  29.363  1.00 104.35 ? 360 TYR B CZ    1 
ATOM   6228  O  OH    . TYR B  1 360 ? -5.255  -20.656  29.838  1.00 107.23 ? 360 TYR B OH    1 
ATOM   6229  N  N     . LYS B  1 361 ? -0.395  -22.802  24.642  1.00 95.31  ? 361 LYS B N     1 
ATOM   6230  C  CA    . LYS B  1 361 ? -1.191  -22.877  23.414  1.00 97.01  ? 361 LYS B CA    1 
ATOM   6231  C  C     . LYS B  1 361 ? -1.153  -24.269  22.769  1.00 97.30  ? 361 LYS B C     1 
ATOM   6232  O  O     . LYS B  1 361 ? -1.632  -24.452  21.651  1.00 98.97  ? 361 LYS B O     1 
ATOM   6233  C  CB    . LYS B  1 361 ? -0.732  -21.825  22.399  1.00 97.19  ? 361 LYS B CB    1 
ATOM   6234  C  CG    . LYS B  1 361 ? -1.391  -20.464  22.535  1.00 98.36  ? 361 LYS B CG    1 
ATOM   6235  C  CD    . LYS B  1 361 ? -1.155  -19.631  21.272  1.00 100.17 ? 361 LYS B CD    1 
ATOM   6236  C  CE    . LYS B  1 361 ? -2.110  -18.437  21.183  1.00 102.47 ? 361 LYS B CE    1 
ATOM   6237  N  NZ    . LYS B  1 361 ? -2.195  -17.864  19.802  1.00 104.05 ? 361 LYS B NZ    1 
ATOM   6238  N  N     . GLY B  1 362 ? -0.566  -25.237  23.471  1.00 95.57  ? 362 GLY B N     1 
ATOM   6239  C  CA    . GLY B  1 362 ? -0.521  -26.630  23.018  1.00 95.78  ? 362 GLY B CA    1 
ATOM   6240  C  C     . GLY B  1 362 ? 0.598   -27.027  22.062  1.00 94.80  ? 362 GLY B C     1 
ATOM   6241  O  O     . GLY B  1 362 ? 0.630   -28.164  21.584  1.00 95.71  ? 362 GLY B O     1 
ATOM   6242  N  N     . ILE B  1 363 ? 1.515   -26.104  21.784  1.00 93.01  ? 363 ILE B N     1 
ATOM   6243  C  CA    . ILE B  1 363 ? 2.628   -26.358  20.864  1.00 92.09  ? 363 ILE B CA    1 
ATOM   6244  C  C     . ILE B  1 363 ? 3.854   -26.905  21.615  1.00 89.97  ? 363 ILE B C     1 
ATOM   6245  O  O     . ILE B  1 363 ? 4.676   -26.137  22.116  1.00 88.41  ? 363 ILE B O     1 
ATOM   6246  C  CB    . ILE B  1 363 ? 2.987   -25.083  20.060  1.00 91.90  ? 363 ILE B CB    1 
ATOM   6247  C  CG1   . ILE B  1 363 ? 1.747   -24.550  19.335  1.00 93.60  ? 363 ILE B CG1   1 
ATOM   6248  C  CG2   . ILE B  1 363 ? 4.131   -25.362  19.078  1.00 91.80  ? 363 ILE B CG2   1 
ATOM   6249  C  CD1   . ILE B  1 363 ? 1.889   -23.144  18.794  1.00 93.17  ? 363 ILE B CD1   1 
ATOM   6250  N  N     . ARG B  1 364 ? 3.967   -28.231  21.682  1.00 90.03  ? 364 ARG B N     1 
ATOM   6251  C  CA    . ARG B  1 364 ? 4.982   -28.907  22.498  1.00 88.29  ? 364 ARG B CA    1 
ATOM   6252  C  C     . ARG B  1 364 ? 5.869   -29.835  21.653  1.00 88.64  ? 364 ARG B C     1 
ATOM   6253  O  O     . ARG B  1 364 ? 5.357   -30.771  21.050  1.00 90.55  ? 364 ARG B O     1 
ATOM   6254  C  CB    . ARG B  1 364 ? 4.303   -29.711  23.612  1.00 88.32  ? 364 ARG B CB    1 
ATOM   6255  C  CG    . ARG B  1 364 ? 3.521   -28.872  24.604  1.00 88.21  ? 364 ARG B CG    1 
ATOM   6256  C  CD    . ARG B  1 364 ? 2.388   -29.661  25.267  1.00 90.50  ? 364 ARG B CD    1 
ATOM   6257  N  NE    . ARG B  1 364 ? 1.433   -28.753  25.912  1.00 91.53  ? 364 ARG B NE    1 
ATOM   6258  C  CZ    . ARG B  1 364 ? 1.138   -28.733  27.212  1.00 90.99  ? 364 ARG B CZ    1 
ATOM   6259  N  NH1   . ARG B  1 364 ? 1.691   -29.598  28.054  1.00 90.67  ? 364 ARG B NH1   1 
ATOM   6260  N  NH2   . ARG B  1 364 ? 0.263   -27.850  27.667  1.00 91.58  ? 364 ARG B NH2   1 
ATOM   6261  N  N     . PRO B  1 365 ? 7.204   -29.610  21.625  1.00 87.20  ? 365 PRO B N     1 
ATOM   6262  C  CA    . PRO B  1 365 ? 8.048   -28.658  22.367  1.00 85.18  ? 365 PRO B CA    1 
ATOM   6263  C  C     . PRO B  1 365 ? 7.709   -27.229  22.015  1.00 85.10  ? 365 PRO B C     1 
ATOM   6264  O  O     . PRO B  1 365 ? 7.249   -26.974  20.904  1.00 86.67  ? 365 PRO B O     1 
ATOM   6265  C  CB    . PRO B  1 365 ? 9.459   -28.974  21.868  1.00 84.49  ? 365 PRO B CB    1 
ATOM   6266  C  CG    . PRO B  1 365 ? 9.361   -30.334  21.275  1.00 86.24  ? 365 PRO B CG    1 
ATOM   6267  C  CD    . PRO B  1 365 ? 8.006   -30.400  20.678  1.00 87.73  ? 365 PRO B CD    1 
ATOM   6268  N  N     . ALA B  1 366 ? 7.933   -26.309  22.951  1.00 83.59  ? 366 ALA B N     1 
ATOM   6269  C  CA    . ALA B  1 366 ? 7.573   -24.905  22.747  1.00 83.61  ? 366 ALA B CA    1 
ATOM   6270  C  C     . ALA B  1 366 ? 8.737   -24.017  22.263  1.00 82.77  ? 366 ALA B C     1 
ATOM   6271  O  O     . ALA B  1 366 ? 8.706   -22.791  22.423  1.00 82.34  ? 366 ALA B O     1 
ATOM   6272  C  CB    . ALA B  1 366 ? 6.937   -24.344  24.001  1.00 82.82  ? 366 ALA B CB    1 
ATOM   6273  N  N     . ILE B  1 367 ? 9.740   -24.648  21.650  1.00 82.67  ? 367 ILE B N     1 
ATOM   6274  C  CA    . ILE B  1 367 ? 10.908  -23.959  21.100  1.00 82.09  ? 367 ILE B CA    1 
ATOM   6275  C  C     . ILE B  1 367 ? 10.577  -22.664  20.357  1.00 82.90  ? 367 ILE B C     1 
ATOM   6276  O  O     . ILE B  1 367 ? 9.991   -22.683  19.271  1.00 84.36  ? 367 ILE B O     1 
ATOM   6277  C  CB    . ILE B  1 367 ? 11.720  -24.865  20.140  1.00 82.75  ? 367 ILE B CB    1 
ATOM   6278  C  CG1   . ILE B  1 367 ? 12.203  -26.120  20.863  1.00 82.52  ? 367 ILE B CG1   1 
ATOM   6279  C  CG2   . ILE B  1 367 ? 12.904  -24.100  19.533  1.00 82.01  ? 367 ILE B CG2   1 
ATOM   6280  C  CD1   . ILE B  1 367 ? 12.921  -27.120  19.962  1.00 84.19  ? 367 ILE B CD1   1 
ATOM   6281  N  N     . ASN B  1 368 ? 10.961  -21.545  20.967  1.00 82.00  ? 368 ASN B N     1 
ATOM   6282  C  CA    . ASN B  1 368 ? 11.009  -20.257  20.292  1.00 82.44  ? 368 ASN B CA    1 
ATOM   6283  C  C     . ASN B  1 368 ? 12.176  -20.277  19.307  1.00 82.74  ? 368 ASN B C     1 
ATOM   6284  O  O     . ASN B  1 368 ? 13.339  -20.276  19.717  1.00 81.63  ? 368 ASN B O     1 
ATOM   6285  C  CB    . ASN B  1 368 ? 11.180  -19.131  21.320  1.00 80.99  ? 368 ASN B CB    1 
ATOM   6286  C  CG    . ASN B  1 368 ? 11.027  -17.743  20.717  1.00 81.58  ? 368 ASN B CG    1 
ATOM   6287  O  OD1   . ASN B  1 368 ? 11.170  -17.543  19.512  1.00 83.07  ? 368 ASN B OD1   1 
ATOM   6288  N  ND2   . ASN B  1 368 ? 10.745  -16.772  21.566  1.00 80.93  ? 368 ASN B ND2   1 
ATOM   6289  N  N     . VAL B  1 369 ? 11.855  -20.311  18.015  1.00 84.51  ? 369 VAL B N     1 
ATOM   6290  C  CA    . VAL B  1 369 ? 12.862  -20.363  16.944  1.00 85.26  ? 369 VAL B CA    1 
ATOM   6291  C  C     . VAL B  1 369 ? 13.661  -19.055  16.846  1.00 84.79  ? 369 VAL B C     1 
ATOM   6292  O  O     . VAL B  1 369 ? 14.830  -19.055  16.445  1.00 84.55  ? 369 VAL B O     1 
ATOM   6293  C  CB    . VAL B  1 369 ? 12.220  -20.748  15.574  1.00 87.36  ? 369 VAL B CB    1 
ATOM   6294  C  CG1   . VAL B  1 369 ? 13.234  -20.718  14.452  1.00 88.06  ? 369 VAL B CG1   1 
ATOM   6295  C  CG2   . VAL B  1 369 ? 11.607  -22.133  15.652  1.00 88.14  ? 369 VAL B CG2   1 
ATOM   6296  N  N     . GLY B  1 370 ? 13.026  -17.950  17.229  1.00 84.86  ? 370 GLY B N     1 
ATOM   6297  C  CA    . GLY B  1 370 ? 13.682  -16.648  17.270  1.00 84.46  ? 370 GLY B CA    1 
ATOM   6298  C  C     . GLY B  1 370 ? 14.778  -16.588  18.316  1.00 82.78  ? 370 GLY B C     1 
ATOM   6299  O  O     . GLY B  1 370 ? 15.838  -16.007  18.081  1.00 82.89  ? 370 GLY B O     1 
ATOM   6300  N  N     . LEU B  1 371 ? 14.527  -17.197  19.469  1.00 81.54  ? 371 LEU B N     1 
ATOM   6301  C  CA    . LEU B  1 371 ? 15.445  -17.105  20.592  1.00 79.86  ? 371 LEU B CA    1 
ATOM   6302  C  C     . LEU B  1 371 ? 16.222  -18.394  20.808  1.00 79.56  ? 371 LEU B C     1 
ATOM   6303  O  O     . LEU B  1 371 ? 16.856  -18.576  21.856  1.00 78.62  ? 371 LEU B O     1 
ATOM   6304  C  CB    . LEU B  1 371 ? 14.685  -16.739  21.863  1.00 78.90  ? 371 LEU B CB    1 
ATOM   6305  C  CG    . LEU B  1 371 ? 14.255  -15.300  22.152  1.00 78.78  ? 371 LEU B CG    1 
ATOM   6306  C  CD1   . LEU B  1 371 ? 13.805  -14.510  20.921  1.00 80.60  ? 371 LEU B CD1   1 
ATOM   6307  C  CD2   . LEU B  1 371 ? 13.151  -15.337  23.197  1.00 78.09  ? 371 LEU B CD2   1 
ATOM   6308  N  N     . SER B  1 372 ? 16.182  -19.288  19.825  1.00 80.70  ? 372 SER B N     1 
ATOM   6309  C  CA    . SER B  1 372 ? 16.953  -20.526  19.914  1.00 80.60  ? 372 SER B CA    1 
ATOM   6310  C  C     . SER B  1 372 ? 18.024  -20.656  18.836  1.00 81.52  ? 372 SER B C     1 
ATOM   6311  O  O     . SER B  1 372 ? 17.805  -20.335  17.666  1.00 82.68  ? 372 SER B O     1 
ATOM   6312  C  CB    . SER B  1 372 ? 16.044  -21.755  19.941  1.00 81.14  ? 372 SER B CB    1 
ATOM   6313  O  OG    . SER B  1 372 ? 15.285  -21.776  21.134  1.00 80.01  ? 372 SER B OG    1 
ATOM   6314  N  N     . VAL B  1 373 ? 19.191  -21.125  19.261  1.00 81.18  ? 373 VAL B N     1 
ATOM   6315  C  CA    . VAL B  1 373 ? 20.333  -21.287  18.380  1.00 82.33  ? 373 VAL B CA    1 
ATOM   6316  C  C     . VAL B  1 373 ? 21.178  -22.478  18.832  1.00 82.46  ? 373 VAL B C     1 
ATOM   6317  O  O     . VAL B  1 373 ? 21.340  -22.721  20.034  1.00 81.47  ? 373 VAL B O     1 
ATOM   6318  C  CB    . VAL B  1 373 ? 21.195  -19.983  18.323  1.00 81.84  ? 373 VAL B CB    1 
ATOM   6319  C  CG1   . VAL B  1 373 ? 22.017  -19.791  19.593  1.00 80.29  ? 373 VAL B CG1   1 
ATOM   6320  C  CG2   . VAL B  1 373 ? 22.097  -19.985  17.107  1.00 83.30  ? 373 VAL B CG2   1 
ATOM   6321  N  N     . SER B  1 374 ? 21.675  -23.240  17.862  1.00 83.91  ? 374 SER B N     1 
ATOM   6322  C  CA    . SER B  1 374 ? 22.804  -24.113  18.099  1.00 84.22  ? 374 SER B CA    1 
ATOM   6323  C  C     . SER B  1 374 ? 23.981  -23.465  17.398  1.00 85.04  ? 374 SER B C     1 
ATOM   6324  O  O     . SER B  1 374 ? 23.905  -23.135  16.215  1.00 85.98  ? 374 SER B O     1 
ATOM   6325  C  CB    . SER B  1 374 ? 22.554  -25.508  17.555  1.00 85.51  ? 374 SER B CB    1 
ATOM   6326  O  OG    . SER B  1 374 ? 23.693  -26.320  17.769  1.00 85.91  ? 374 SER B OG    1 
ATOM   6327  N  N     . ARG B  1 375 ? 25.061  -23.254  18.139  1.00 84.94  ? 375 ARG B N     1 
ATOM   6328  C  CA    . ARG B  1 375 ? 26.185  -22.467  17.631  1.00 86.03  ? 375 ARG B CA    1 
ATOM   6329  C  C     . ARG B  1 375 ? 27.172  -23.301  16.823  1.00 87.86  ? 375 ARG B C     1 
ATOM   6330  O  O     . ARG B  1 375 ? 28.045  -22.753  16.146  1.00 88.88  ? 375 ARG B O     1 
ATOM   6331  C  CB    . ARG B  1 375 ? 26.915  -21.740  18.771  1.00 84.65  ? 375 ARG B CB    1 
ATOM   6332  C  CG    . ARG B  1 375 ? 26.146  -20.589  19.395  1.00 83.34  ? 375 ARG B CG    1 
ATOM   6333  C  CD    . ARG B  1 375 ? 27.000  -19.930  20.451  1.00 83.05  ? 375 ARG B CD    1 
ATOM   6334  N  NE    . ARG B  1 375 ? 26.246  -19.005  21.292  1.00 82.57  ? 375 ARG B NE    1 
ATOM   6335  C  CZ    . ARG B  1 375 ? 26.794  -18.022  22.003  1.00 82.05  ? 375 ARG B CZ    1 
ATOM   6336  N  NH1   . ARG B  1 375 ? 28.105  -17.816  21.966  1.00 82.22  ? 375 ARG B NH1   1 
ATOM   6337  N  NH2   . ARG B  1 375 ? 26.025  -17.233  22.742  1.00 81.43  ? 375 ARG B NH2   1 
ATOM   6338  N  N     . VAL B  1 376 ? 27.036  -24.622  16.902  1.00 88.69  ? 376 VAL B N     1 
ATOM   6339  C  CA    . VAL B  1 376 ? 27.974  -25.534  16.255  1.00 90.61  ? 376 VAL B CA    1 
ATOM   6340  C  C     . VAL B  1 376 ? 27.227  -26.712  15.635  1.00 92.24  ? 376 VAL B C     1 
ATOM   6341  O  O     . VAL B  1 376 ? 27.833  -27.727  15.268  1.00 93.65  ? 376 VAL B O     1 
ATOM   6342  C  CB    . VAL B  1 376 ? 29.075  -26.044  17.243  1.00 90.17  ? 376 VAL B CB    1 
ATOM   6343  C  CG1   . VAL B  1 376 ? 30.068  -24.932  17.609  1.00 89.51  ? 376 VAL B CG1   1 
ATOM   6344  C  CG2   . VAL B  1 376 ? 28.463  -26.646  18.491  1.00 88.58  ? 376 VAL B CG2   1 
ATOM   6345  N  N     . GLY B  1 377 ? 25.910  -26.553  15.504  1.00 92.36  ? 377 GLY B N     1 
ATOM   6346  C  CA    . GLY B  1 377 ? 25.012  -27.635  15.095  1.00 93.71  ? 377 GLY B CA    1 
ATOM   6347  C  C     . GLY B  1 377 ? 25.003  -27.999  13.621  1.00 96.02  ? 377 GLY B C     1 
ATOM   6348  O  O     . GLY B  1 377 ? 24.960  -29.185  13.274  1.00 97.33  ? 377 GLY B O     1 
ATOM   6349  N  N     . SER B  1 378 ? 25.040  -26.988  12.751  1.00 96.71  ? 378 SER B N     1 
ATOM   6350  C  CA    . SER B  1 378 ? 24.991  -27.196  11.293  1.00 98.78  ? 378 SER B CA    1 
ATOM   6351  C  C     . SER B  1 378 ? 26.094  -28.129  10.813  1.00 100.01 ? 378 SER B C     1 
ATOM   6352  O  O     . SER B  1 378 ? 25.961  -28.732  9.754   1.00 101.95 ? 378 SER B O     1 
ATOM   6353  C  CB    . SER B  1 378 ? 25.098  -25.868  10.542  1.00 99.18  ? 378 SER B CB    1 
ATOM   6354  O  OG    . SER B  1 378 ? 24.784  -24.771  11.391  1.00 98.51  ? 378 SER B OG    1 
ATOM   6355  N  N     . ALA B  1 379 ? 27.173  -28.231  11.595  1.00 99.16  ? 379 ALA B N     1 
ATOM   6356  C  CA    . ALA B  1 379 ? 28.295  -29.142  11.323  1.00 100.20 ? 379 ALA B CA    1 
ATOM   6357  C  C     . ALA B  1 379 ? 28.149  -30.508  12.010  1.00 100.10 ? 379 ALA B C     1 
ATOM   6358  O  O     . ALA B  1 379 ? 28.802  -31.478  11.625  1.00 101.69 ? 379 ALA B O     1 
ATOM   6359  C  CB    . ALA B  1 379 ? 29.610  -28.492  11.710  1.00 99.69  ? 379 ALA B CB    1 
ATOM   6360  N  N     . ALA B  1 380 ? 27.291  -30.577  13.021  1.00 98.44  ? 380 ALA B N     1 
ATOM   6361  C  CA    . ALA B  1 380 ? 27.026  -31.827  13.726  1.00 98.47  ? 380 ALA B CA    1 
ATOM   6362  C  C     . ALA B  1 380 ? 25.804  -32.574  13.176  1.00 99.43  ? 380 ALA B C     1 
ATOM   6363  O  O     . ALA B  1 380 ? 25.741  -33.804  13.247  1.00 100.41 ? 380 ALA B O     1 
ATOM   6364  C  CB    . ALA B  1 380 ? 26.853  -31.562  15.200  1.00 96.62  ? 380 ALA B CB    1 
ATOM   6365  N  N     . GLN B  1 381 ? 24.848  -31.819  12.627  1.00 99.10  ? 381 GLN B N     1 
ATOM   6366  C  CA    . GLN B  1 381 ? 23.582  -32.349  12.103  1.00 99.69  ? 381 GLN B CA    1 
ATOM   6367  C  C     . GLN B  1 381 ? 23.781  -33.527  11.148  1.00 101.74 ? 381 GLN B C     1 
ATOM   6368  O  O     . GLN B  1 381 ? 24.749  -33.563  10.388  1.00 102.81 ? 381 GLN B O     1 
ATOM   6369  C  CB    . GLN B  1 381 ? 22.808  -31.225  11.395  1.00 99.71  ? 381 GLN B CB    1 
ATOM   6370  C  CG    . GLN B  1 381 ? 21.287  -31.424  11.315  1.00 99.92  ? 381 GLN B CG    1 
ATOM   6371  C  CD    . GLN B  1 381 ? 20.534  -30.201  10.785  1.00 99.51  ? 381 GLN B CD    1 
ATOM   6372  O  OE1   . GLN B  1 381 ? 21.029  -29.461  9.936   1.00 100.16 ? 381 GLN B OE1   1 
ATOM   6373  N  NE2   . GLN B  1 381 ? 19.322  -29.998  11.284  1.00 98.79  ? 381 GLN B NE2   1 
ATOM   6374  N  N     . VAL B  1 382 ? 22.866  -34.493  11.208  1.00 102.40 ? 382 VAL B N     1 
ATOM   6375  C  CA    . VAL B  1 382 ? 22.821  -35.590  10.238  1.00 104.64 ? 382 VAL B CA    1 
ATOM   6376  C  C     . VAL B  1 382 ? 22.626  -35.004  8.835   1.00 106.09 ? 382 VAL B C     1 
ATOM   6377  O  O     . VAL B  1 382 ? 21.634  -34.310  8.568   1.00 105.72 ? 382 VAL B O     1 
ATOM   6378  C  CB    . VAL B  1 382 ? 21.713  -36.618  10.585  1.00 105.04 ? 382 VAL B CB    1 
ATOM   6379  C  CG1   . VAL B  1 382 ? 21.407  -37.524  9.399   1.00 107.61 ? 382 VAL B CG1   1 
ATOM   6380  C  CG2   . VAL B  1 382 ? 22.118  -37.449  11.790  1.00 103.96 ? 382 VAL B CG2   1 
ATOM   6381  N  N     . LYS B  1 383 ? 23.585  -35.285  7.954   1.00 108.97 ? 383 LYS B N     1 
ATOM   6382  C  CA    . LYS B  1 383 ? 23.683  -34.624  6.648   1.00 110.31 ? 383 LYS B CA    1 
ATOM   6383  C  C     . LYS B  1 383 ? 22.407  -34.688  5.808   1.00 110.38 ? 383 LYS B C     1 
ATOM   6384  O  O     . LYS B  1 383 ? 22.141  -33.789  5.010   1.00 110.83 ? 383 LYS B O     1 
ATOM   6385  C  CB    . LYS B  1 383 ? 24.897  -35.136  5.865   1.00 112.42 ? 383 LYS B CB    1 
ATOM   6386  C  CG    . LYS B  1 383 ? 26.195  -35.032  6.662   1.00 113.36 ? 383 LYS B CG    1 
ATOM   6387  C  CD    . LYS B  1 383 ? 27.378  -34.611  5.802   1.00 116.07 ? 383 LYS B CD    1 
ATOM   6388  C  CE    . LYS B  1 383 ? 28.547  -34.133  6.663   1.00 115.76 ? 383 LYS B CE    1 
ATOM   6389  N  NZ    . LYS B  1 383 ? 29.550  -33.384  5.853   1.00 117.31 ? 383 LYS B NZ    1 
ATOM   6390  N  N     . ALA B  1 384 ? 21.620  -35.744  6.013   1.00 110.20 ? 384 ALA B N     1 
ATOM   6391  C  CA    . ALA B  1 384 ? 20.346  -35.932  5.318   1.00 110.53 ? 384 ALA B CA    1 
ATOM   6392  C  C     . ALA B  1 384 ? 19.265  -34.948  5.783   1.00 109.27 ? 384 ALA B C     1 
ATOM   6393  O  O     . ALA B  1 384 ? 18.493  -34.441  4.959   1.00 109.90 ? 384 ALA B O     1 
ATOM   6394  C  CB    . ALA B  1 384 ? 19.864  -37.360  5.483   1.00 110.83 ? 384 ALA B CB    1 
ATOM   6395  N  N     . LEU B  1 385 ? 19.212  -34.698  7.097   1.00 107.71 ? 385 LEU B N     1 
ATOM   6396  C  CA    . LEU B  1 385 ? 18.281  -33.733  7.692   1.00 106.19 ? 385 LEU B CA    1 
ATOM   6397  C  C     . LEU B  1 385 ? 18.528  -32.320  7.177   1.00 106.40 ? 385 LEU B C     1 
ATOM   6398  O  O     . LEU B  1 385 ? 17.598  -31.644  6.727   1.00 106.34 ? 385 LEU B O     1 
ATOM   6399  C  CB    . LEU B  1 385 ? 18.396  -33.742  9.220   1.00 104.79 ? 385 LEU B CB    1 
ATOM   6400  C  CG    . LEU B  1 385 ? 17.381  -34.502  10.076  1.00 104.01 ? 385 LEU B CG    1 
ATOM   6401  C  CD1   . LEU B  1 385 ? 17.865  -34.502  11.521  1.00 102.91 ? 385 LEU B CD1   1 
ATOM   6402  C  CD2   . LEU B  1 385 ? 15.975  -33.907  9.976   1.00 102.94 ? 385 LEU B CD2   1 
ATOM   6403  N  N     . LYS B  1 386 ? 19.786  -31.888  7.246   1.00 106.68 ? 386 LYS B N     1 
ATOM   6404  C  CA    . LYS B  1 386 ? 20.188  -30.547  6.822   1.00 107.31 ? 386 LYS B CA    1 
ATOM   6405  C  C     . LYS B  1 386 ? 19.664  -30.211  5.423   1.00 108.57 ? 386 LYS B C     1 
ATOM   6406  O  O     . LYS B  1 386 ? 19.205  -29.090  5.175   1.00 108.55 ? 386 LYS B O     1 
ATOM   6407  C  CB    . LYS B  1 386 ? 21.720  -30.409  6.880   1.00 108.16 ? 386 LYS B CB    1 
ATOM   6408  C  CG    . LYS B  1 386 ? 22.244  -28.981  6.740   1.00 108.32 ? 386 LYS B CG    1 
ATOM   6409  C  CD    . LYS B  1 386 ? 23.739  -28.902  6.992   1.00 109.06 ? 386 LYS B CD    1 
ATOM   6410  C  CE    . LYS B  1 386 ? 24.157  -27.449  7.178   1.00 110.63 ? 386 LYS B CE    1 
ATOM   6411  N  NZ    . LYS B  1 386 ? 25.616  -27.255  7.436   1.00 111.94 ? 386 LYS B NZ    1 
ATOM   6412  N  N     . GLN B  1 387 ? 19.724  -31.204  4.534   1.00 109.77 ? 387 GLN B N     1 
ATOM   6413  C  CA    . GLN B  1 387 ? 19.340  -31.065  3.127   1.00 111.45 ? 387 GLN B CA    1 
ATOM   6414  C  C     . GLN B  1 387 ? 17.847  -30.808  2.903   1.00 111.26 ? 387 GLN B C     1 
ATOM   6415  O  O     . GLN B  1 387 ? 17.479  -29.971  2.071   1.00 112.15 ? 387 GLN B O     1 
ATOM   6416  C  CB    . GLN B  1 387 ? 19.795  -32.295  2.339   1.00 112.92 ? 387 GLN B CB    1 
ATOM   6417  C  CG    . GLN B  1 387 ? 21.307  -32.356  2.143   1.00 114.41 ? 387 GLN B CG    1 
ATOM   6418  C  CD    . GLN B  1 387 ? 21.807  -33.699  1.629   1.00 116.12 ? 387 GLN B CD    1 
ATOM   6419  O  OE1   . GLN B  1 387 ? 21.140  -34.727  1.766   1.00 116.06 ? 387 GLN B OE1   1 
ATOM   6420  N  NE2   . GLN B  1 387 ? 23.000  -33.692  1.043   1.00 117.85 ? 387 GLN B NE2   1 
ATOM   6421  N  N     . VAL B  1 388 ? 17.001  -31.527  3.645   1.00 110.23 ? 388 VAL B N     1 
ATOM   6422  C  CA    . VAL B  1 388 ? 15.541  -31.371  3.543   1.00 110.19 ? 388 VAL B CA    1 
ATOM   6423  C  C     . VAL B  1 388 ? 14.991  -30.237  4.405   1.00 109.00 ? 388 VAL B C     1 
ATOM   6424  O  O     . VAL B  1 388 ? 13.875  -29.773  4.181   1.00 109.49 ? 388 VAL B O     1 
ATOM   6425  C  CB    . VAL B  1 388 ? 14.763  -32.682  3.871   1.00 109.91 ? 388 VAL B CB    1 
ATOM   6426  C  CG1   . VAL B  1 388 ? 15.128  -33.781  2.893   1.00 111.70 ? 388 VAL B CG1   1 
ATOM   6427  C  CG2   . VAL B  1 388 ? 15.002  -33.134  5.308   1.00 108.39 ? 388 VAL B CG2   1 
ATOM   6428  N  N     . ALA B  1 389 ? 15.774  -29.797  5.384   1.00 107.76 ? 389 ALA B N     1 
ATOM   6429  C  CA    . ALA B  1 389 ? 15.337  -28.750  6.290   1.00 106.74 ? 389 ALA B CA    1 
ATOM   6430  C  C     . ALA B  1 389 ? 15.582  -27.345  5.735   1.00 107.56 ? 389 ALA B C     1 
ATOM   6431  O  O     . ALA B  1 389 ? 15.294  -26.362  6.405   1.00 107.29 ? 389 ALA B O     1 
ATOM   6432  C  CB    . ALA B  1 389 ? 16.012  -28.919  7.636   1.00 105.42 ? 389 ALA B CB    1 
ATOM   6433  N  N     . GLY B  1 390 ? 16.104  -27.254  4.515   1.00 108.93 ? 390 GLY B N     1 
ATOM   6434  C  CA    . GLY B  1 390 ? 16.479  -25.971  3.902   1.00 109.99 ? 390 GLY B CA    1 
ATOM   6435  C  C     . GLY B  1 390 ? 15.710  -24.734  4.350   1.00 109.80 ? 390 GLY B C     1 
ATOM   6436  O  O     . GLY B  1 390 ? 14.508  -24.610  4.085   1.00 110.33 ? 390 GLY B O     1 
ATOM   6437  N  N     . SER B  1 391 ? 16.414  -23.828  5.032   1.00 109.30 ? 391 SER B N     1 
ATOM   6438  C  CA    . SER B  1 391 ? 15.856  -22.555  5.536   1.00 109.26 ? 391 SER B CA    1 
ATOM   6439  C  C     . SER B  1 391 ? 14.486  -22.668  6.220   1.00 108.43 ? 391 SER B C     1 
ATOM   6440  O  O     . SER B  1 391 ? 13.617  -21.816  6.023   1.00 109.30 ? 391 SER B O     1 
ATOM   6441  C  CB    . SER B  1 391 ? 15.829  -21.477  4.434   1.00 111.10 ? 391 SER B CB    1 
ATOM   6442  O  OG    . SER B  1 391 ? 16.911  -20.567  4.570   1.00 111.54 ? 391 SER B OG    1 
ATOM   6443  N  N     . LEU B  1 392 ? 14.308  -23.726  7.012   1.00 106.81 ? 392 LEU B N     1 
ATOM   6444  C  CA    . LEU B  1 392 ? 13.098  -23.914  7.817   1.00 105.81 ? 392 LEU B CA    1 
ATOM   6445  C  C     . LEU B  1 392 ? 13.250  -23.132  9.097   1.00 105.03 ? 392 LEU B C     1 
ATOM   6446  O  O     . LEU B  1 392 ? 12.314  -22.457  9.537   1.00 105.49 ? 392 LEU B O     1 
ATOM   6447  C  CB    . LEU B  1 392 ? 12.866  -25.393  8.139   1.00 104.86 ? 392 LEU B CB    1 
ATOM   6448  C  CG    . LEU B  1 392 ? 11.706  -25.782  9.058   1.00 103.78 ? 392 LEU B CG    1 
ATOM   6449  C  CD1   . LEU B  1 392 ? 10.358  -25.408  8.444   1.00 104.42 ? 392 LEU B CD1   1 
ATOM   6450  C  CD2   . LEU B  1 392 ? 11.774  -27.272  9.378   1.00 102.49 ? 392 LEU B CD2   1 
ATOM   6451  N  N     . LYS B  1 393 ? 14.440  -23.247  9.689   1.00 104.06 ? 393 LYS B N     1 
ATOM   6452  C  CA    . LYS B  1 393 ? 14.850  -22.423  10.818  1.00 103.45 ? 393 LYS B CA    1 
ATOM   6453  C  C     . LYS B  1 393 ? 14.575  -20.949  10.506  1.00 104.45 ? 393 LYS B C     1 
ATOM   6454  O  O     . LYS B  1 393 ? 13.793  -20.292  11.198  1.00 104.52 ? 393 LYS B O     1 
ATOM   6455  C  CB    . LYS B  1 393 ? 16.335  -22.665  11.126  1.00 103.06 ? 393 LYS B CB    1 
ATOM   6456  C  CG    . LYS B  1 393 ? 16.916  -21.837  12.268  1.00 102.76 ? 393 LYS B CG    1 
ATOM   6457  C  CD    . LYS B  1 393 ? 16.457  -22.324  13.637  1.00 101.09 ? 393 LYS B CD    1 
ATOM   6458  C  CE    . LYS B  1 393 ? 17.100  -21.504  14.746  1.00 101.58 ? 393 LYS B CE    1 
ATOM   6459  N  NZ    . LYS B  1 393 ? 16.814  -20.033  14.637  1.00 102.61 ? 393 LYS B NZ    1 
ATOM   6460  N  N     . LEU B  1 394 ? 15.184  -20.455  9.432   1.00 105.23 ? 394 LEU B N     1 
ATOM   6461  C  CA    . LEU B  1 394 ? 15.016  -19.065  9.030   1.00 106.58 ? 394 LEU B CA    1 
ATOM   6462  C  C     . LEU B  1 394 ? 13.583  -18.762  8.572   1.00 107.17 ? 394 LEU B C     1 
ATOM   6463  O  O     . LEU B  1 394 ? 13.122  -17.628  8.698   1.00 108.24 ? 394 LEU B O     1 
ATOM   6464  C  CB    . LEU B  1 394 ? 16.053  -18.673  7.963   1.00 107.78 ? 394 LEU B CB    1 
ATOM   6465  C  CG    . LEU B  1 394 ? 17.544  -18.869  8.329   1.00 107.72 ? 394 LEU B CG    1 
ATOM   6466  C  CD1   . LEU B  1 394 ? 18.419  -19.134  7.092   1.00 108.69 ? 394 LEU B CD1   1 
ATOM   6467  C  CD2   . LEU B  1 394 ? 18.119  -17.723  9.179   1.00 107.67 ? 394 LEU B CD2   1 
ATOM   6468  N  N     . PHE B  1 395 ? 12.878  -19.780  8.075   1.00 106.53 ? 395 PHE B N     1 
ATOM   6469  C  CA    . PHE B  1 395 ? 11.503  -19.600  7.601   1.00 107.20 ? 395 PHE B CA    1 
ATOM   6470  C  C     . PHE B  1 395 ? 10.509  -19.363  8.729   1.00 107.04 ? 395 PHE B C     1 
ATOM   6471  O  O     . PHE B  1 395 ? 9.727   -18.413  8.683   1.00 108.35 ? 395 PHE B O     1 
ATOM   6472  C  CB    . PHE B  1 395 ? 11.038  -20.785  6.746   1.00 106.92 ? 395 PHE B CB    1 
ATOM   6473  C  CG    . PHE B  1 395 ? 9.556   -20.788  6.466   1.00 107.14 ? 395 PHE B CG    1 
ATOM   6474  C  CD1   . PHE B  1 395 ? 8.990   -19.838  5.618   1.00 108.36 ? 395 PHE B CD1   1 
ATOM   6475  C  CD2   . PHE B  1 395 ? 8.726   -21.737  7.053   1.00 105.63 ? 395 PHE B CD2   1 
ATOM   6476  C  CE1   . PHE B  1 395 ? 7.621   -19.828  5.362   1.00 108.92 ? 395 PHE B CE1   1 
ATOM   6477  C  CE2   . PHE B  1 395 ? 7.358   -21.736  6.801   1.00 106.23 ? 395 PHE B CE2   1 
ATOM   6478  C  CZ    . PHE B  1 395 ? 6.806   -20.778  5.953   1.00 108.11 ? 395 PHE B CZ    1 
ATOM   6479  N  N     . LEU B  1 396 ? 10.530  -20.237  9.728   1.00 105.59 ? 396 LEU B N     1 
ATOM   6480  C  CA    . LEU B  1 396 ? 9.545   -20.185  10.803  1.00 105.56 ? 396 LEU B CA    1 
ATOM   6481  C  C     . LEU B  1 396 ? 9.537   -18.837  11.526  1.00 106.71 ? 396 LEU B C     1 
ATOM   6482  O  O     . LEU B  1 396 ? 8.475   -18.274  11.785  1.00 107.65 ? 396 LEU B O     1 
ATOM   6483  C  CB    . LEU B  1 396 ? 9.757   -21.342  11.782  1.00 103.79 ? 396 LEU B CB    1 
ATOM   6484  C  CG    . LEU B  1 396 ? 9.372   -22.738  11.281  1.00 102.56 ? 396 LEU B CG    1 
ATOM   6485  C  CD1   . LEU B  1 396 ? 10.057  -23.813  12.100  1.00 100.31 ? 396 LEU B CD1   1 
ATOM   6486  C  CD2   . LEU B  1 396 ? 7.865   -22.925  11.308  1.00 102.98 ? 396 LEU B CD2   1 
ATOM   6487  N  N     . ALA B  1 397 ? 10.724  -18.315  11.822  1.00 106.98 ? 397 ALA B N     1 
ATOM   6488  C  CA    . ALA B  1 397 ? 10.858  -16.999  12.449  1.00 108.63 ? 397 ALA B CA    1 
ATOM   6489  C  C     . ALA B  1 397 ? 10.272  -15.893  11.572  1.00 111.02 ? 397 ALA B C     1 
ATOM   6490  O  O     . ALA B  1 397 ? 9.799   -14.871  12.081  1.00 112.35 ? 397 ALA B O     1 
ATOM   6491  C  CB    . ALA B  1 397 ? 12.317  -16.704  12.771  1.00 108.23 ? 397 ALA B CB    1 
ATOM   6492  N  N     . GLN B  1 398 ? 10.314  -16.104  10.257  1.00 111.88 ? 398 GLN B N     1 
ATOM   6493  C  CA    . GLN B  1 398 ? 9.715   -15.175  9.302   1.00 114.36 ? 398 GLN B CA    1 
ATOM   6494  C  C     . GLN B  1 398 ? 8.195   -15.316  9.286   1.00 115.32 ? 398 GLN B C     1 
ATOM   6495  O  O     . GLN B  1 398 ? 7.483   -14.315  9.230   1.00 117.16 ? 398 GLN B O     1 
ATOM   6496  C  CB    . GLN B  1 398 ? 10.296  -15.378  7.898   1.00 114.85 ? 398 GLN B CB    1 
ATOM   6497  C  CG    . GLN B  1 398 ? 11.712  -14.836  7.721   1.00 115.60 ? 398 GLN B CG    1 
ATOM   6498  C  CD    . GLN B  1 398 ? 12.389  -15.341  6.455   1.00 116.65 ? 398 GLN B CD    1 
ATOM   6499  O  OE1   . GLN B  1 398 ? 11.915  -15.104  5.340   1.00 118.52 ? 398 GLN B OE1   1 
ATOM   6500  N  NE2   . GLN B  1 398 ? 13.514  -16.032  6.623   1.00 115.62 ? 398 GLN B NE2   1 
ATOM   6501  N  N     . TYR B  1 399 ? 7.709   -16.556  9.345   1.00 114.42 ? 399 TYR B N     1 
ATOM   6502  C  CA    . TYR B  1 399 ? 6.270   -16.828  9.367   1.00 115.62 ? 399 TYR B CA    1 
ATOM   6503  C  C     . TYR B  1 399 ? 5.603   -16.283  10.626  1.00 116.44 ? 399 TYR B C     1 
ATOM   6504  O  O     . TYR B  1 399 ? 4.583   -15.599  10.543  1.00 118.40 ? 399 TYR B O     1 
ATOM   6505  C  CB    . TYR B  1 399 ? 5.990   -18.329  9.188   1.00 114.26 ? 399 TYR B CB    1 
ATOM   6506  C  CG    . TYR B  1 399 ? 4.803   -18.881  9.972   1.00 114.30 ? 399 TYR B CG    1 
ATOM   6507  C  CD1   . TYR B  1 399 ? 3.492   -18.476  9.695   1.00 116.51 ? 399 TYR B CD1   1 
ATOM   6508  C  CD2   . TYR B  1 399 ? 4.996   -19.828  10.978  1.00 112.48 ? 399 TYR B CD2   1 
ATOM   6509  C  CE1   . TYR B  1 399 ? 2.407   -18.986  10.420  1.00 116.66 ? 399 TYR B CE1   1 
ATOM   6510  C  CE2   . TYR B  1 399 ? 3.920   -20.348  11.703  1.00 112.65 ? 399 TYR B CE2   1 
ATOM   6511  C  CZ    . TYR B  1 399 ? 2.631   -19.926  11.418  1.00 114.77 ? 399 TYR B CZ    1 
ATOM   6512  O  OH    . TYR B  1 399 ? 1.575   -20.448  12.134  1.00 115.08 ? 399 TYR B OH    1 
ATOM   6513  N  N     . ARG B  1 400 ? 6.186   -16.579  11.785  1.00 115.46 ? 400 ARG B N     1 
ATOM   6514  C  CA    . ARG B  1 400 ? 5.640   -16.116  13.059  1.00 116.47 ? 400 ARG B CA    1 
ATOM   6515  C  C     . ARG B  1 400 ? 5.631   -14.588  13.164  1.00 118.73 ? 400 ARG B C     1 
ATOM   6516  O  O     . ARG B  1 400 ? 4.796   -14.025  13.871  1.00 120.10 ? 400 ARG B O     1 
ATOM   6517  C  CB    . ARG B  1 400 ? 6.364   -16.777  14.240  1.00 114.62 ? 400 ARG B CB    1 
ATOM   6518  C  CG    . ARG B  1 400 ? 5.840   -18.187  14.571  1.00 114.07 ? 400 ARG B CG    1 
ATOM   6519  C  CD    . ARG B  1 400 ? 6.818   -18.994  15.415  1.00 113.94 ? 400 ARG B CD    1 
ATOM   6520  N  NE    . ARG B  1 400 ? 7.175   -18.293  16.651  1.00 116.65 ? 400 ARG B NE    1 
ATOM   6521  C  CZ    . ARG B  1 400 ? 8.321   -18.445  17.316  1.00 116.27 ? 400 ARG B CZ    1 
ATOM   6522  N  NH1   . ARG B  1 400 ? 9.257   -19.283  16.874  1.00 114.73 ? 400 ARG B NH1   1 
ATOM   6523  N  NH2   . ARG B  1 400 ? 8.532   -17.748  18.431  1.00 116.94 ? 400 ARG B NH2   1 
ATOM   6524  N  N     . GLU B  1 401 ? 6.541   -13.928  12.441  1.00 119.56 ? 401 GLU B N     1 
ATOM   6525  C  CA    . GLU B  1 401 ? 6.542   -12.463  12.314  1.00 122.20 ? 401 GLU B CA    1 
ATOM   6526  C  C     . GLU B  1 401 ? 5.423   -11.970  11.388  1.00 124.68 ? 401 GLU B C     1 
ATOM   6527  O  O     . GLU B  1 401 ? 4.759   -10.973  11.683  1.00 126.90 ? 401 GLU B O     1 
ATOM   6528  C  CB    . GLU B  1 401 ? 7.902   -11.945  11.823  1.00 122.05 ? 401 GLU B CB    1 
ATOM   6529  C  CG    . GLU B  1 401 ? 8.987   -11.871  12.900  1.00 121.35 ? 401 GLU B CG    1 
ATOM   6530  C  CD    . GLU B  1 401 ? 10.194  -11.045  12.469  1.00 122.37 ? 401 GLU B CD    1 
ATOM   6531  O  OE1   . GLU B  1 401 ? 11.299  -11.619  12.345  1.00 121.27 ? 401 GLU B OE1   1 
ATOM   6532  O  OE2   . GLU B  1 401 ? 10.037  -9.823   12.252  1.00 124.27 ? 401 GLU B OE2   1 
ATOM   6533  N  N     . VAL B  1 402 ? 5.228   -12.672  10.270  1.00 124.68 ? 402 VAL B N     1 
ATOM   6534  C  CA    . VAL B  1 402 ? 4.161   -12.370  9.310   1.00 127.07 ? 402 VAL B CA    1 
ATOM   6535  C  C     . VAL B  1 402 ? 2.789   -12.510  9.975   1.00 128.28 ? 402 VAL B C     1 
ATOM   6536  O  O     . VAL B  1 402 ? 1.922   -11.645  9.817   1.00 130.69 ? 402 VAL B O     1 
ATOM   6537  C  CB    . VAL B  1 402 ? 4.267   -13.279  8.044   1.00 126.42 ? 402 VAL B CB    1 
ATOM   6538  C  CG1   . VAL B  1 402 ? 2.973   -13.278  7.236   1.00 128.53 ? 402 VAL B CG1   1 
ATOM   6539  C  CG2   . VAL B  1 402 ? 5.432   -12.842  7.166   1.00 126.62 ? 402 VAL B CG2   1 
ATOM   6540  N  N     . ALA B  1 403 ? 2.625   -13.592  10.738  1.00 126.88 ? 403 ALA B N     1 
ATOM   6541  C  CA    . ALA B  1 403 ? 1.385   -13.899  11.454  1.00 128.13 ? 403 ALA B CA    1 
ATOM   6542  C  C     . ALA B  1 403 ? 1.091   -12.914  12.587  1.00 130.01 ? 403 ALA B C     1 
ATOM   6543  O  O     . ALA B  1 403 ? 0.012   -12.950  13.183  1.00 131.27 ? 403 ALA B O     1 
ATOM   6544  C  CB    . ALA B  1 403 ? 1.421   -15.330  11.983  1.00 125.61 ? 403 ALA B CB    1 
ATOM   6545  N  N     . ALA B  1 404 ? 2.058   -12.045  12.881  1.00 130.65 ? 404 ALA B N     1 
ATOM   6546  C  CA    . ALA B  1 404 ? 1.875   -10.968  13.848  1.00 132.99 ? 404 ALA B CA    1 
ATOM   6547  C  C     . ALA B  1 404 ? 1.186   -9.767   13.196  1.00 136.77 ? 404 ALA B C     1 
ATOM   6548  O  O     . ALA B  1 404 ? 0.247   -9.203   13.763  1.00 139.09 ? 404 ALA B O     1 
ATOM   6549  C  CB    . ALA B  1 404 ? 3.205   -10.564  14.455  1.00 131.81 ? 404 ALA B CB    1 
ATOM   6550  N  N     . PHE B  1 405 ? 1.649   -9.390   12.002  1.00 137.90 ? 405 PHE B N     1 
ATOM   6551  C  CA    . PHE B  1 405 ? 1.032   -8.316   11.208  1.00 141.72 ? 405 PHE B CA    1 
ATOM   6552  C  C     . PHE B  1 405 ? -0.299  -8.777   10.581  1.00 143.36 ? 405 PHE B C     1 
ATOM   6553  O  O     . PHE B  1 405 ? -1.017  -7.989   9.950   1.00 146.34 ? 405 PHE B O     1 
ATOM   6554  C  CB    . PHE B  1 405 ? 2.033   -7.805   10.151  1.00 141.92 ? 405 PHE B CB    1 
ATOM   6555  C  CG    . PHE B  1 405 ? 1.477   -6.757   9.207   1.00 145.71 ? 405 PHE B CG    1 
ATOM   6556  C  CD1   . PHE B  1 405 ? 1.233   -5.451   9.641   1.00 148.74 ? 405 PHE B CD1   1 
ATOM   6557  C  CD2   . PHE B  1 405 ? 1.230   -7.077   7.870   1.00 146.51 ? 405 PHE B CD2   1 
ATOM   6558  C  CE1   . PHE B  1 405 ? 0.731   -4.486   8.758   1.00 152.24 ? 405 PHE B CE1   1 
ATOM   6559  C  CE2   . PHE B  1 405 ? 0.727   -6.124   6.983   1.00 149.98 ? 405 PHE B CE2   1 
ATOM   6560  C  CZ    . PHE B  1 405 ? 0.478   -4.825   7.426   1.00 152.83 ? 405 PHE B CZ    1 
ATOM   6561  N  N     . ALA B  1 406 ? -0.630  -10.052  10.792  1.00 141.78 ? 406 ALA B N     1 
ATOM   6562  C  CA    . ALA B  1 406 ? -1.885  -10.645  10.324  1.00 143.27 ? 406 ALA B CA    1 
ATOM   6563  C  C     . ALA B  1 406 ? -3.087  -10.273  11.206  1.00 145.76 ? 406 ALA B C     1 
ATOM   6564  O  O     . ALA B  1 406 ? -4.121  -10.952  11.186  1.00 146.38 ? 406 ALA B O     1 
ATOM   6565  C  CB    . ALA B  1 406 ? -1.739  -12.161  10.227  1.00 140.47 ? 406 ALA B CB    1 
ATOM   6566  N  N     . GLN B  1 407 ? -2.947  -9.185   11.963  1.00 147.56 ? 407 GLN B N     1 
ATOM   6567  C  CA    . GLN B  1 407 ? -3.982  -8.720   12.889  1.00 150.31 ? 407 GLN B CA    1 
ATOM   6568  C  C     . GLN B  1 407 ? -5.313  -8.418   12.185  1.00 153.61 ? 407 GLN B C     1 
ATOM   6569  O  O     . GLN B  1 407 ? -6.385  -8.577   12.776  1.00 155.28 ? 407 GLN B O     1 
ATOM   6570  C  CB    . GLN B  1 407 ? -3.483  -7.502   13.684  1.00 151.76 ? 407 GLN B CB    1 
ATOM   6571  C  CG    . GLN B  1 407 ? -4.147  -7.312   15.053  1.00 153.81 ? 407 GLN B CG    1 
ATOM   6572  C  CD    . GLN B  1 407 ? -4.130  -8.574   15.917  1.00 152.15 ? 407 GLN B CD    1 
ATOM   6573  O  OE1   . GLN B  1 407 ? -5.151  -9.248   16.071  1.00 153.13 ? 407 GLN B OE1   1 
ATOM   6574  N  NE2   . GLN B  1 407 ? -2.966  -8.898   16.477  1.00 149.70 ? 407 GLN B NE2   1 
ATOM   6575  N  N     . PHE B  1 408 ? -5.229  -7.986   10.927  1.00 154.74 ? 408 PHE B N     1 
ATOM   6576  C  CA    . PHE B  1 408 ? -6.399  -7.853   10.054  1.00 157.59 ? 408 PHE B CA    1 
ATOM   6577  C  C     . PHE B  1 408 ? -6.435  -8.990   9.015   1.00 155.88 ? 408 PHE B C     1 
ATOM   6578  O  O     . PHE B  1 408 ? -5.387  -9.516   8.641   1.00 153.02 ? 408 PHE B O     1 
ATOM   6579  C  CB    . PHE B  1 408 ? -6.451  -6.463   9.384   1.00 160.94 ? 408 PHE B CB    1 
ATOM   6580  C  CG    . PHE B  1 408 ? -5.109  -5.782   9.252   1.00 159.87 ? 408 PHE B CG    1 
ATOM   6581  C  CD1   . PHE B  1 408 ? -4.749  -4.757   10.124  1.00 160.89 ? 408 PHE B CD1   1 
ATOM   6582  C  CD2   . PHE B  1 408 ? -4.213  -6.156   8.252   1.00 157.98 ? 408 PHE B CD2   1 
ATOM   6583  C  CE1   . PHE B  1 408 ? -3.517  -4.120   10.006  1.00 160.00 ? 408 PHE B CE1   1 
ATOM   6584  C  CE2   . PHE B  1 408 ? -2.978  -5.524   8.126   1.00 156.92 ? 408 PHE B CE2   1 
ATOM   6585  C  CZ    . PHE B  1 408 ? -2.631  -4.505   9.005   1.00 157.94 ? 408 PHE B CZ    1 
ATOM   6586  N  N     . GLY B  1 409 ? -7.623  -9.389   8.559   1.00 157.68 ? 409 GLY B N     1 
ATOM   6587  C  CA    . GLY B  1 409 ? -8.896  -8.800   8.971   1.00 161.16 ? 409 GLY B CA    1 
ATOM   6588  C  C     . GLY B  1 409 ? -9.608  -8.190   7.781   1.00 164.60 ? 409 GLY B C     1 
ATOM   6589  O  O     . GLY B  1 409 ? -10.060 -8.913   6.887   1.00 164.91 ? 409 GLY B O     1 
ATOM   6590  N  N     . SER B  1 410 ? -9.700  -6.860   7.768   1.00 167.35 ? 410 SER B N     1 
ATOM   6591  C  CA    . SER B  1 410 ? -10.278 -6.124   6.640   1.00 170.79 ? 410 SER B CA    1 
ATOM   6592  C  C     . SER B  1 410 ? -9.235  -5.903   5.537   1.00 169.46 ? 410 SER B C     1 
ATOM   6593  O  O     . SER B  1 410 ? -9.502  -5.235   4.532   1.00 172.40 ? 410 SER B O     1 
ATOM   6594  C  CB    . SER B  1 410 ? -10.876 -4.792   7.109   1.00 174.78 ? 410 SER B CB    1 
ATOM   6595  O  OG    . SER B  1 410 ? -9.866  -3.883   7.541   1.00 174.27 ? 410 SER B OG    1 
ATOM   6596  N  N     . ASP B  1 411 ? -8.054  -6.483   5.741   1.00 165.02 ? 411 ASP B N     1 
ATOM   6597  C  CA    . ASP B  1 411 ? -6.952  -6.401   4.794   1.00 163.29 ? 411 ASP B CA    1 
ATOM   6598  C  C     . ASP B  1 411 ? -6.323  -7.793   4.591   1.00 159.20 ? 411 ASP B C     1 
ATOM   6599  O  O     . ASP B  1 411 ? -5.145  -8.014   4.895   1.00 156.21 ? 411 ASP B O     1 
ATOM   6600  C  CB    . ASP B  1 411 ? -5.925  -5.371   5.290   1.00 162.85 ? 411 ASP B CB    1 
ATOM   6601  C  CG    . ASP B  1 411 ? -4.756  -5.187   4.336   1.00 161.71 ? 411 ASP B CG    1 
ATOM   6602  O  OD1   . ASP B  1 411 ? -4.983  -5.071   3.112   1.00 163.53 ? 411 ASP B OD1   1 
ATOM   6603  O  OD2   . ASP B  1 411 ? -3.603  -5.153   4.818   1.00 159.05 ? 411 ASP B OD2   1 
ATOM   6604  N  N     . LEU B  1 412 ? -7.122  -8.730   4.079   1.00 159.16 ? 412 LEU B N     1 
ATOM   6605  C  CA    . LEU B  1 412 ? -6.658  -10.101  3.851   1.00 155.55 ? 412 LEU B CA    1 
ATOM   6606  C  C     . LEU B  1 412 ? -5.811  -10.206  2.580   1.00 154.73 ? 412 LEU B C     1 
ATOM   6607  O  O     . LEU B  1 412 ? -6.315  -10.050  1.463   1.00 157.20 ? 412 LEU B O     1 
ATOM   6608  C  CB    . LEU B  1 412 ? -7.837  -11.089  3.827   1.00 156.30 ? 412 LEU B CB    1 
ATOM   6609  C  CG    . LEU B  1 412 ? -8.510  -11.429  5.167   1.00 155.69 ? 412 LEU B CG    1 
ATOM   6610  C  CD1   . LEU B  1 412 ? -9.926  -11.955  4.953   1.00 157.94 ? 412 LEU B CD1   1 
ATOM   6611  C  CD2   . LEU B  1 412 ? -7.681  -12.414  5.992   1.00 151.14 ? 412 LEU B CD2   1 
ATOM   6612  N  N     . ASP B  1 413 ? -4.519  -10.464  2.775   1.00 151.25 ? 413 ASP B N     1 
ATOM   6613  C  CA    . ASP B  1 413 ? -3.537  -10.518  1.690   1.00 150.24 ? 413 ASP B CA    1 
ATOM   6614  C  C     . ASP B  1 413 ? -3.627  -11.823  0.898   1.00 148.94 ? 413 ASP B C     1 
ATOM   6615  O  O     . ASP B  1 413 ? -4.044  -12.852  1.428   1.00 147.34 ? 413 ASP B O     1 
ATOM   6616  C  CB    . ASP B  1 413 ? -2.123  -10.314  2.263   1.00 147.57 ? 413 ASP B CB    1 
ATOM   6617  C  CG    . ASP B  1 413 ? -1.017  -10.539  1.234   1.00 146.70 ? 413 ASP B CG    1 
ATOM   6618  O  OD1   . ASP B  1 413 ? -1.163  -10.117  0.065   1.00 148.92 ? 413 ASP B OD1   1 
ATOM   6619  O  OD2   . ASP B  1 413 ? 0.011   -11.140  1.606   1.00 143.98 ? 413 ASP B OD2   1 
ATOM   6620  N  N     . ALA B  1 414 ? -3.240  -11.758  -0.375  1.00 149.66 ? 414 ALA B N     1 
ATOM   6621  C  CA    . ALA B  1 414 ? -3.176  -12.928  -1.248  1.00 148.72 ? 414 ALA B CA    1 
ATOM   6622  C  C     . ALA B  1 414 ? -1.752  -13.478  -1.345  1.00 145.52 ? 414 ALA B C     1 
ATOM   6623  O  O     . ALA B  1 414 ? -1.553  -14.689  -1.474  1.00 143.73 ? 414 ALA B O     1 
ATOM   6624  C  CB    . ALA B  1 414 ? -3.712  -12.582  -2.635  1.00 152.17 ? 414 ALA B CB    1 
ATOM   6625  N  N     . SER B  1 415 ? -0.774  -12.576  -1.273  1.00 144.95 ? 415 SER B N     1 
ATOM   6626  C  CA    . SER B  1 415 ? 0.650   -12.913  -1.395  1.00 142.42 ? 415 SER B CA    1 
ATOM   6627  C  C     . SER B  1 415 ? 1.186   -13.828  -0.279  1.00 138.71 ? 415 SER B C     1 
ATOM   6628  O  O     . SER B  1 415 ? 1.320   -15.042  -0.472  1.00 137.20 ? 415 SER B O     1 
ATOM   6629  C  CB    . SER B  1 415 ? 1.482   -11.624  -1.494  1.00 143.27 ? 415 SER B CB    1 
ATOM   6630  O  OG    . SER B  1 415 ? 2.845   -11.848  -1.169  1.00 140.78 ? 415 SER B OG    1 
ATOM   6631  N  N     . THR B  1 416 ? 1.487   -13.240  0.879   1.00 137.31 ? 416 THR B N     1 
ATOM   6632  C  CA    . THR B  1 416 ? 2.094   -13.974  1.994   1.00 133.93 ? 416 THR B CA    1 
ATOM   6633  C  C     . THR B  1 416 ? 1.088   -14.859  2.742   1.00 132.97 ? 416 THR B C     1 
ATOM   6634  O  O     . THR B  1 416 ? 1.426   -15.485  3.750   1.00 130.60 ? 416 THR B O     1 
ATOM   6635  C  CB    . THR B  1 416 ? 2.833   -13.029  2.994   1.00 133.20 ? 416 THR B CB    1 
ATOM   6636  O  OG1   . THR B  1 416 ? 1.902   -12.107  3.572   1.00 135.24 ? 416 THR B OG1   1 
ATOM   6637  C  CG2   . THR B  1 416 ? 3.961   -12.256  2.305   1.00 133.53 ? 416 THR B CG2   1 
ATOM   6638  N  N     . LYS B  1 417 ? -0.141  -14.924  2.236   1.00 134.85 ? 417 LYS B N     1 
ATOM   6639  C  CA    . LYS B  1 417 ? -1.163  -15.781  2.826   1.00 134.35 ? 417 LYS B CA    1 
ATOM   6640  C  C     . LYS B  1 417 ? -0.835  -17.263  2.648   1.00 132.26 ? 417 LYS B C     1 
ATOM   6641  O  O     . LYS B  1 417 ? -1.395  -18.111  3.344   1.00 131.36 ? 417 LYS B O     1 
ATOM   6642  C  CB    . LYS B  1 417 ? -2.540  -15.476  2.238   1.00 137.50 ? 417 LYS B CB    1 
ATOM   6643  C  CG    . LYS B  1 417 ? -3.682  -15.773  3.194   1.00 137.63 ? 417 LYS B CG    1 
ATOM   6644  C  CD    . LYS B  1 417 ? -5.019  -15.616  2.521   1.00 141.00 ? 417 LYS B CD    1 
ATOM   6645  C  CE    . LYS B  1 417 ? -6.140  -15.615  3.540   1.00 142.06 ? 417 LYS B CE    1 
ATOM   6646  N  NZ    . LYS B  1 417 ? -7.457  -15.374  2.888   1.00 145.70 ? 417 LYS B NZ    1 
ATOM   6647  N  N     . GLN B  1 418 ? 0.069   -17.570  1.720   1.00 131.68 ? 418 GLN B N     1 
ATOM   6648  C  CA    . GLN B  1 418 ? 0.456   -18.956  1.465   1.00 130.03 ? 418 GLN B CA    1 
ATOM   6649  C  C     . GLN B  1 418 ? 1.561   -19.425  2.406   1.00 126.77 ? 418 GLN B C     1 
ATOM   6650  O  O     . GLN B  1 418 ? 1.666   -20.619  2.705   1.00 125.20 ? 418 GLN B O     1 
ATOM   6651  C  CB    . GLN B  1 418 ? 0.875   -19.150  0.012   1.00 131.39 ? 418 GLN B CB    1 
ATOM   6652  C  CG    . GLN B  1 418 ? 0.895   -20.611  -0.423  1.00 131.38 ? 418 GLN B CG    1 
ATOM   6653  C  CD    . GLN B  1 418 ? 0.903   -20.775  -1.929  1.00 134.71 ? 418 GLN B CD    1 
ATOM   6654  O  OE1   . GLN B  1 418 ? 1.008   -19.796  -2.675  1.00 137.12 ? 418 GLN B OE1   1 
ATOM   6655  N  NE2   . GLN B  1 418 ? 0.791   -22.020  -2.388  1.00 134.98 ? 418 GLN B NE2   1 
ATOM   6656  N  N     . THR B  1 419 ? 2.383   -18.481  2.862   1.00 125.88 ? 419 THR B N     1 
ATOM   6657  C  CA    . THR B  1 419 ? 3.375   -18.756  3.903   1.00 123.01 ? 419 THR B CA    1 
ATOM   6658  C  C     . THR B  1 419 ? 2.676   -18.906  5.260   1.00 121.85 ? 419 THR B C     1 
ATOM   6659  O  O     . THR B  1 419 ? 3.214   -19.520  6.189   1.00 119.67 ? 419 THR B O     1 
ATOM   6660  C  CB    . THR B  1 419 ? 4.472   -17.660  3.969   1.00 123.02 ? 419 THR B CB    1 
ATOM   6661  O  OG1   . THR B  1 419 ? 3.889   -16.406  4.347   1.00 124.72 ? 419 THR B OG1   1 
ATOM   6662  C  CG2   . THR B  1 419 ? 5.178   -17.511  2.615   1.00 124.01 ? 419 THR B CG2   1 
ATOM   6663  N  N     . LEU B  1 420 ? 1.469   -18.346  5.348   1.00 123.31 ? 420 LEU B N     1 
ATOM   6664  C  CA    . LEU B  1 420 ? 0.608   -18.460  6.524   1.00 122.74 ? 420 LEU B CA    1 
ATOM   6665  C  C     . LEU B  1 420 ? -0.012  -19.855  6.630   1.00 121.70 ? 420 LEU B C     1 
ATOM   6666  O  O     . LEU B  1 420 ? -0.338  -20.319  7.725   1.00 120.60 ? 420 LEU B O     1 
ATOM   6667  C  CB    . LEU B  1 420 ? -0.494  -17.398  6.469   1.00 125.51 ? 420 LEU B CB    1 
ATOM   6668  C  CG    . LEU B  1 420 ? -1.009  -16.812  7.785   1.00 125.74 ? 420 LEU B CG    1 
ATOM   6669  C  CD1   . LEU B  1 420 ? 0.018   -15.861  8.395   1.00 124.67 ? 420 LEU B CD1   1 
ATOM   6670  C  CD2   . LEU B  1 420 ? -2.333  -16.099  7.562   1.00 128.66 ? 420 LEU B CD2   1 
ATOM   6671  N  N     . VAL B  1 421 ? -0.178  -20.510  5.482   1.00 122.14 ? 421 VAL B N     1 
ATOM   6672  C  CA    . VAL B  1 421 ? -0.647  -21.895  5.432   1.00 121.35 ? 421 VAL B CA    1 
ATOM   6673  C  C     . VAL B  1 421 ? 0.517   -22.844  5.732   1.00 118.65 ? 421 VAL B C     1 
ATOM   6674  O  O     . VAL B  1 421 ? 0.392   -23.726  6.584   1.00 117.28 ? 421 VAL B O     1 
ATOM   6675  C  CB    . VAL B  1 421 ? -1.295  -22.244  4.065   1.00 123.42 ? 421 VAL B CB    1 
ATOM   6676  C  CG1   . VAL B  1 421 ? -1.975  -23.610  4.123   1.00 123.10 ? 421 VAL B CG1   1 
ATOM   6677  C  CG2   . VAL B  1 421 ? -2.297  -21.178  3.659   1.00 126.07 ? 421 VAL B CG2   1 
ATOM   6678  N  N     . ARG B  1 422 ? 1.639   -22.646  5.031   1.00 117.99 ? 422 ARG B N     1 
ATOM   6679  C  CA    . ARG B  1 422 ? 2.877   -23.404  5.254   1.00 115.63 ? 422 ARG B CA    1 
ATOM   6680  C  C     . ARG B  1 422 ? 3.213   -23.425  6.722   1.00 113.59 ? 422 ARG B C     1 
ATOM   6681  O  O     . ARG B  1 422 ? 3.462   -24.482  7.304   1.00 111.88 ? 422 ARG B O     1 
ATOM   6682  C  CB    . ARG B  1 422 ? 4.047   -22.756  4.514   1.00 115.69 ? 422 ARG B CB    1 
ATOM   6683  C  CG    . ARG B  1 422 ? 4.206   -23.185  3.089   1.00 117.28 ? 422 ARG B CG    1 
ATOM   6684  C  CD    . ARG B  1 422 ? 5.008   -24.471  2.967   1.00 116.58 ? 422 ARG B CD    1 
ATOM   6685  N  NE    . ARG B  1 422 ? 4.786   -25.082  1.658   1.00 119.04 ? 422 ARG B NE    1 
ATOM   6686  C  CZ    . ARG B  1 422 ? 5.359   -24.678  0.523   1.00 120.67 ? 422 ARG B CZ    1 
ATOM   6687  N  NH1   . ARG B  1 422 ? 6.210   -23.657  0.520   1.00 120.70 ? 422 ARG B NH1   1 
ATOM   6688  N  NH2   . ARG B  1 422 ? 5.081   -25.294  -0.619  1.00 122.46 ? 422 ARG B NH2   1 
ATOM   6689  N  N     . GLY B  1 423 ? 3.216   -22.230  7.304   1.00 113.86 ? 423 GLY B N     1 
ATOM   6690  C  CA    . GLY B  1 423 ? 3.519   -22.044  8.703   1.00 112.56 ? 423 GLY B CA    1 
ATOM   6691  C  C     . GLY B  1 423 ? 2.694   -22.963  9.570   1.00 112.04 ? 423 GLY B C     1 
ATOM   6692  O  O     . GLY B  1 423 ? 3.243   -23.826  10.254  1.00 110.47 ? 423 GLY B O     1 
ATOM   6693  N  N     . GLU B  1 424 ? 1.375   -22.797  9.517   1.00 113.58 ? 424 GLU B N     1 
ATOM   6694  C  CA    . GLU B  1 424 ? 0.469   -23.605  10.329  1.00 113.41 ? 424 GLU B CA    1 
ATOM   6695  C  C     . GLU B  1 424 ? 0.616   -25.104  10.080  1.00 112.11 ? 424 GLU B C     1 
ATOM   6696  O  O     . GLU B  1 424 ? 0.443   -25.902  11.004  1.00 111.09 ? 424 GLU B O     1 
ATOM   6697  C  CB    . GLU B  1 424 ? -0.978  -23.136  10.164  1.00 115.93 ? 424 GLU B CB    1 
ATOM   6698  C  CG    . GLU B  1 424 ? -1.354  -22.040  11.159  1.00 117.30 ? 424 GLU B CG    1 
ATOM   6699  C  CD    . GLU B  1 424 ? -2.677  -21.370  10.844  1.00 120.77 ? 424 GLU B CD    1 
ATOM   6700  O  OE1   . GLU B  1 424 ? -3.739  -22.031  10.949  1.00 121.71 ? 424 GLU B OE1   1 
ATOM   6701  O  OE2   . GLU B  1 424 ? -2.645  -20.168  10.508  1.00 122.30 ? 424 GLU B OE2   1 
ATOM   6702  N  N     . ARG B  1 425 ? 0.963   -25.471  8.844   1.00 112.24 ? 425 ARG B N     1 
ATOM   6703  C  CA    . ARG B  1 425 ? 1.244   -26.864  8.484   1.00 111.33 ? 425 ARG B CA    1 
ATOM   6704  C  C     . ARG B  1 425 ? 2.547   -27.352  9.131   1.00 109.08 ? 425 ARG B C     1 
ATOM   6705  O  O     . ARG B  1 425 ? 2.581   -28.419  9.755   1.00 108.26 ? 425 ARG B O     1 
ATOM   6706  C  CB    . ARG B  1 425 ? 1.296   -27.049  6.956   1.00 112.59 ? 425 ARG B CB    1 
ATOM   6707  C  CG    . ARG B  1 425 ? -0.015  -26.765  6.190   1.00 115.14 ? 425 ARG B CG    1 
ATOM   6708  C  CD    . ARG B  1 425 ? -1.197  -27.579  6.728   1.00 115.83 ? 425 ARG B CD    1 
ATOM   6709  N  NE    . ARG B  1 425 ? -2.473  -27.296  6.065   1.00 117.96 ? 425 ARG B NE    1 
ATOM   6710  C  CZ    . ARG B  1 425 ? -3.228  -26.219  6.276   1.00 119.19 ? 425 ARG B CZ    1 
ATOM   6711  N  NH1   . ARG B  1 425 ? -2.843  -25.272  7.121   1.00 118.41 ? 425 ARG B NH1   1 
ATOM   6712  N  NH2   . ARG B  1 425 ? -4.372  -26.081  5.623   1.00 121.84 ? 425 ARG B NH2   1 
ATOM   6713  N  N     . LEU B  1 426 ? 3.610   -26.561  8.991   1.00 108.23 ? 426 LEU B N     1 
ATOM   6714  C  CA    . LEU B  1 426 ? 4.915   -26.886  9.581   1.00 106.08 ? 426 LEU B CA    1 
ATOM   6715  C  C     . LEU B  1 426 ? 4.918   -26.818  11.110  1.00 104.72 ? 426 LEU B C     1 
ATOM   6716  O  O     . LEU B  1 426 ? 5.571   -27.635  11.767  1.00 103.56 ? 426 LEU B O     1 
ATOM   6717  C  CB    . LEU B  1 426 ? 6.005   -25.989  8.995   1.00 106.06 ? 426 LEU B CB    1 
ATOM   6718  C  CG    . LEU B  1 426 ? 6.345   -26.353  7.549   1.00 106.98 ? 426 LEU B CG    1 
ATOM   6719  C  CD1   . LEU B  1 426 ? 6.806   -25.140  6.767   1.00 108.36 ? 426 LEU B CD1   1 
ATOM   6720  C  CD2   . LEU B  1 426 ? 7.378   -27.473  7.501   1.00 105.85 ? 426 LEU B CD2   1 
ATOM   6721  N  N     . THR B  1 427 ? 4.193   -25.842  11.664  1.00 104.94 ? 427 THR B N     1 
ATOM   6722  C  CA    . THR B  1 427 ? 3.931   -25.778  13.102  1.00 103.74 ? 427 THR B CA    1 
ATOM   6723  C  C     . THR B  1 427 ? 3.342   -27.110  13.549  1.00 103.03 ? 427 THR B C     1 
ATOM   6724  O  O     . THR B  1 427 ? 3.847   -27.727  14.489  1.00 101.87 ? 427 THR B O     1 
ATOM   6725  C  CB    . THR B  1 427 ? 2.958   -24.629  13.471  1.00 105.20 ? 427 THR B CB    1 
ATOM   6726  O  OG1   . THR B  1 427 ? 3.577   -23.366  13.201  1.00 105.44 ? 427 THR B OG1   1 
ATOM   6727  C  CG2   . THR B  1 427 ? 2.583   -24.685  14.945  1.00 104.70 ? 427 THR B CG2   1 
ATOM   6728  N  N     . GLN B  1 428 ? 2.292   -27.554  12.857  1.00 103.67 ? 428 GLN B N     1 
ATOM   6729  C  CA    . GLN B  1 428 ? 1.628   -28.809  13.189  1.00 103.23 ? 428 GLN B CA    1 
ATOM   6730  C  C     . GLN B  1 428 ? 2.571   -29.985  13.123  1.00 101.72 ? 428 GLN B C     1 
ATOM   6731  O  O     . GLN B  1 428 ? 2.510   -30.880  13.971  1.00 101.01 ? 428 GLN B O     1 
ATOM   6732  C  CB    . GLN B  1 428 ? 0.435   -29.071  12.272  1.00 104.92 ? 428 GLN B CB    1 
ATOM   6733  C  CG    . GLN B  1 428 ? -0.859  -28.443  12.746  1.00 106.33 ? 428 GLN B CG    1 
ATOM   6734  C  CD    . GLN B  1 428 ? -1.225  -28.812  14.171  1.00 105.48 ? 428 GLN B CD    1 
ATOM   6735  O  OE1   . GLN B  1 428 ? -1.620  -27.951  14.955  1.00 106.22 ? 428 GLN B OE1   1 
ATOM   6736  N  NE2   . GLN B  1 428 ? -1.096  -30.092  14.515  1.00 103.93 ? 428 GLN B NE2   1 
ATOM   6737  N  N     . LEU B  1 429 ? 3.443   -29.971  12.117  1.00 101.34 ? 429 LEU B N     1 
ATOM   6738  C  CA    . LEU B  1 429 ? 4.330   -31.094  11.847  1.00 100.44 ? 429 LEU B CA    1 
ATOM   6739  C  C     . LEU B  1 429 ? 5.378   -31.303  12.941  1.00 98.91  ? 429 LEU B C     1 
ATOM   6740  O  O     . LEU B  1 429 ? 5.710   -32.439  13.281  1.00 98.46  ? 429 LEU B O     1 
ATOM   6741  C  CB    . LEU B  1 429 ? 4.999   -30.936  10.479  1.00 100.76 ? 429 LEU B CB    1 
ATOM   6742  C  CG    . LEU B  1 429 ? 5.872   -32.109  10.009  1.00 100.55 ? 429 LEU B CG    1 
ATOM   6743  C  CD1   . LEU B  1 429 ? 5.128   -33.444  10.021  1.00 101.06 ? 429 LEU B CD1   1 
ATOM   6744  C  CD2   . LEU B  1 429 ? 6.436   -31.823  8.634   1.00 101.67 ? 429 LEU B CD2   1 
ATOM   6745  N  N     . LEU B  1 430 ? 5.879   -30.206  13.495  1.00 98.38  ? 430 LEU B N     1 
ATOM   6746  C  CA    . LEU B  1 430 ? 6.944   -30.261  14.486  1.00 97.03  ? 430 LEU B CA    1 
ATOM   6747  C  C     . LEU B  1 430 ? 6.463   -30.595  15.904  1.00 96.57  ? 430 LEU B C     1 
ATOM   6748  O  O     . LEU B  1 430 ? 7.248   -31.097  16.719  1.00 95.80  ? 430 LEU B O     1 
ATOM   6749  C  CB    . LEU B  1 430 ? 7.735   -28.956  14.461  1.00 97.05  ? 430 LEU B CB    1 
ATOM   6750  C  CG    . LEU B  1 430 ? 8.549   -28.760  13.179  1.00 97.41  ? 430 LEU B CG    1 
ATOM   6751  C  CD1   . LEU B  1 430 ? 8.780   -27.284  12.889  1.00 98.34  ? 430 LEU B CD1   1 
ATOM   6752  C  CD2   . LEU B  1 430 ? 9.863   -29.531  13.240  1.00 96.60  ? 430 LEU B CD2   1 
ATOM   6753  N  N     . LYS B  1 431 ? 5.186   -30.319  16.187  1.00 97.19  ? 431 LYS B N     1 
ATOM   6754  C  CA    . LYS B  1 431 ? 4.529   -30.759  17.426  1.00 96.86  ? 431 LYS B CA    1 
ATOM   6755  C  C     . LYS B  1 431 ? 4.836   -32.231  17.667  1.00 96.12  ? 431 LYS B C     1 
ATOM   6756  O  O     . LYS B  1 431 ? 4.858   -33.026  16.728  1.00 96.25  ? 431 LYS B O     1 
ATOM   6757  C  CB    . LYS B  1 431 ? 3.009   -30.586  17.345  1.00 98.15  ? 431 LYS B CB    1 
ATOM   6758  C  CG    . LYS B  1 431 ? 2.518   -29.165  17.155  1.00 99.09  ? 431 LYS B CG    1 
ATOM   6759  C  CD    . LYS B  1 431 ? 1.015   -29.064  17.402  1.00 100.73 ? 431 LYS B CD    1 
ATOM   6760  C  CE    . LYS B  1 431 ? 0.522   -27.622  17.314  1.00 102.03 ? 431 LYS B CE    1 
ATOM   6761  N  NZ    . LYS B  1 431 ? -0.897  -27.466  17.758  1.00 103.63 ? 431 LYS B NZ    1 
ATOM   6762  N  N     . GLN B  1 432 ? 5.076   -32.594  18.919  1.00 95.48  ? 432 GLN B N     1 
ATOM   6763  C  CA    . GLN B  1 432 ? 5.483   -33.949  19.231  1.00 95.01  ? 432 GLN B CA    1 
ATOM   6764  C  C     . GLN B  1 432 ? 4.902   -34.393  20.549  1.00 95.47  ? 432 GLN B C     1 
ATOM   6765  O  O     . GLN B  1 432 ? 4.932   -33.656  21.534  1.00 95.65  ? 432 GLN B O     1 
ATOM   6766  C  CB    . GLN B  1 432 ? 7.005   -34.042  19.275  1.00 93.97  ? 432 GLN B CB    1 
ATOM   6767  C  CG    . GLN B  1 432 ? 7.560   -35.417  18.968  1.00 93.79  ? 432 GLN B CG    1 
ATOM   6768  C  CD    . GLN B  1 432 ? 8.877   -35.359  18.215  1.00 93.56  ? 432 GLN B CD    1 
ATOM   6769  O  OE1   . GLN B  1 432 ? 9.305   -34.296  17.756  1.00 93.85  ? 432 GLN B OE1   1 
ATOM   6770  N  NE2   . GLN B  1 432 ? 9.523   -36.506  18.077  1.00 93.63  ? 432 GLN B NE2   1 
ATOM   6771  N  N     . ASN B  1 433 ? 4.349   -35.597  20.561  1.00 96.16  ? 433 ASN B N     1 
ATOM   6772  C  CA    . ASN B  1 433 ? 3.980   -36.218  21.813  1.00 96.63  ? 433 ASN B CA    1 
ATOM   6773  C  C     . ASN B  1 433 ? 5.230   -36.476  22.609  1.00 95.72  ? 433 ASN B C     1 
ATOM   6774  O  O     . ASN B  1 433 ? 6.266   -36.849  22.052  1.00 94.98  ? 433 ASN B O     1 
ATOM   6775  C  CB    . ASN B  1 433 ? 3.227   -37.522  21.580  1.00 97.52  ? 433 ASN B CB    1 
ATOM   6776  C  CG    . ASN B  1 433 ? 1.752   -37.387  21.851  1.00 99.40  ? 433 ASN B CG    1 
ATOM   6777  O  OD1   . ASN B  1 433 ? 1.344   -36.748  22.826  1.00 101.10 ? 433 ASN B OD1   1 
ATOM   6778  N  ND2   . ASN B  1 433 ? 0.937   -37.984  20.994  1.00 100.38 ? 433 ASN B ND2   1 
ATOM   6779  N  N     . GLN B  1 434 ? 5.145   -36.249  23.911  1.00 96.03  ? 434 GLN B N     1 
ATOM   6780  C  CA    . GLN B  1 434 ? 6.240   -36.615  24.782  1.00 95.68  ? 434 GLN B CA    1 
ATOM   6781  C  C     . GLN B  1 434 ? 6.414   -38.123  24.689  1.00 95.66  ? 434 GLN B C     1 
ATOM   6782  O  O     . GLN B  1 434 ? 5.435   -38.854  24.488  1.00 96.38  ? 434 GLN B O     1 
ATOM   6783  C  CB    . GLN B  1 434 ? 5.964   -36.189  26.217  1.00 96.25  ? 434 GLN B CB    1 
ATOM   6784  C  CG    . GLN B  1 434 ? 7.176   -35.555  26.833  1.00 96.83  ? 434 GLN B CG    1 
ATOM   6785  C  CD    . GLN B  1 434 ? 7.252   -35.729  28.326  1.00 98.66  ? 434 GLN B CD    1 
ATOM   6786  O  OE1   . GLN B  1 434 ? 6.398   -35.237  29.072  1.00 99.82  ? 434 GLN B OE1   1 
ATOM   6787  N  NE2   . GLN B  1 434 ? 8.305   -36.407  28.780  1.00 98.81  ? 434 GLN B NE2   1 
ATOM   6788  N  N     . TYR B  1 435 ? 7.658   -38.582  24.814  1.00 94.95  ? 435 TYR B N     1 
ATOM   6789  C  CA    . TYR B  1 435 ? 7.996   -40.011  24.720  1.00 95.06  ? 435 TYR B CA    1 
ATOM   6790  C  C     . TYR B  1 435 ? 7.768   -40.617  23.317  1.00 95.01  ? 435 TYR B C     1 
ATOM   6791  O  O     . TYR B  1 435 ? 7.614   -41.832  23.185  1.00 95.66  ? 435 TYR B O     1 
ATOM   6792  C  CB    . TYR B  1 435 ? 7.244   -40.850  25.774  1.00 95.99  ? 435 TYR B CB    1 
ATOM   6793  C  CG    . TYR B  1 435 ? 6.978   -40.180  27.115  1.00 96.34  ? 435 TYR B CG    1 
ATOM   6794  C  CD1   . TYR B  1 435 ? 7.921   -40.229  28.139  1.00 96.81  ? 435 TYR B CD1   1 
ATOM   6795  C  CD2   . TYR B  1 435 ? 5.763   -39.533  27.371  1.00 96.51  ? 435 TYR B CD2   1 
ATOM   6796  C  CE1   . TYR B  1 435 ? 7.674   -39.627  29.377  1.00 97.02  ? 435 TYR B CE1   1 
ATOM   6797  C  CE2   . TYR B  1 435 ? 5.510   -38.928  28.595  1.00 96.85  ? 435 TYR B CE2   1 
ATOM   6798  C  CZ    . TYR B  1 435 ? 6.467   -38.982  29.593  1.00 97.01  ? 435 TYR B CZ    1 
ATOM   6799  O  OH    . TYR B  1 435 ? 6.225   -38.390  30.807  1.00 97.19  ? 435 TYR B OH    1 
ATOM   6800  N  N     . SER B  1 436 ? 7.747   -39.779  22.281  1.00 94.34  ? 436 SER B N     1 
ATOM   6801  C  CA    . SER B  1 436 ? 7.675   -40.261  20.898  1.00 94.28  ? 436 SER B CA    1 
ATOM   6802  C  C     . SER B  1 436 ? 8.910   -39.870  20.089  1.00 93.51  ? 436 SER B C     1 
ATOM   6803  O  O     . SER B  1 436 ? 8.777   -39.246  19.035  1.00 93.42  ? 436 SER B O     1 
ATOM   6804  C  CB    . SER B  1 436 ? 6.420   -39.737  20.197  1.00 94.72  ? 436 SER B CB    1 
ATOM   6805  O  OG    . SER B  1 436 ? 5.256   -40.322  20.740  1.00 95.75  ? 436 SER B OG    1 
ATOM   6806  N  N     . PRO B  1 437 ? 10.116  -40.236  20.570  1.00 93.13  ? 437 PRO B N     1 
ATOM   6807  C  CA    . PRO B  1 437 ? 11.266  -39.850  19.776  1.00 92.97  ? 437 PRO B CA    1 
ATOM   6808  C  C     . PRO B  1 437 ? 11.387  -40.740  18.540  1.00 94.04  ? 437 PRO B C     1 
ATOM   6809  O  O     . PRO B  1 437 ? 11.598  -41.951  18.661  1.00 94.76  ? 437 PRO B O     1 
ATOM   6810  C  CB    . PRO B  1 437 ? 12.443  -40.033  20.740  1.00 92.60  ? 437 PRO B CB    1 
ATOM   6811  C  CG    . PRO B  1 437 ? 11.994  -40.999  21.751  1.00 92.94  ? 437 PRO B CG    1 
ATOM   6812  C  CD    . PRO B  1 437 ? 10.496  -41.068  21.728  1.00 93.28  ? 437 PRO B CD    1 
ATOM   6813  N  N     . LEU B  1 438 ? 11.216  -40.135  17.364  1.00 94.47  ? 438 LEU B N     1 
ATOM   6814  C  CA    . LEU B  1 438 ? 11.281  -40.852  16.091  1.00 95.78  ? 438 LEU B CA    1 
ATOM   6815  C  C     . LEU B  1 438 ? 12.722  -40.993  15.640  1.00 96.26  ? 438 LEU B C     1 
ATOM   6816  O  O     . LEU B  1 438 ? 13.572  -40.182  16.000  1.00 95.56  ? 438 LEU B O     1 
ATOM   6817  C  CB    . LEU B  1 438 ? 10.489  -40.118  15.005  1.00 96.03  ? 438 LEU B CB    1 
ATOM   6818  C  CG    . LEU B  1 438 ? 9.162   -39.428  15.338  1.00 96.11  ? 438 LEU B CG    1 
ATOM   6819  C  CD1   . LEU B  1 438 ? 8.748   -38.569  14.161  1.00 96.83  ? 438 LEU B CD1   1 
ATOM   6820  C  CD2   . LEU B  1 438 ? 8.049   -40.413  15.715  1.00 97.04  ? 438 LEU B CD2   1 
ATOM   6821  N  N     . ALA B  1 439 ? 12.992  -42.025  14.847  1.00 97.91  ? 439 ALA B N     1 
ATOM   6822  C  CA    . ALA B  1 439 ? 14.320  -42.232  14.284  1.00 99.11  ? 439 ALA B CA    1 
ATOM   6823  C  C     . ALA B  1 439 ? 14.617  -41.167  13.239  1.00 99.51  ? 439 ALA B C     1 
ATOM   6824  O  O     . ALA B  1 439 ? 13.698  -40.595  12.646  1.00 99.49  ? 439 ALA B O     1 
ATOM   6825  C  CB    . ALA B  1 439 ? 14.428  -43.610  13.679  1.00 100.66 ? 439 ALA B CB    1 
ATOM   6826  N  N     . THR B  1 440 ? 15.901  -40.902  13.020  1.00 100.35 ? 440 THR B N     1 
ATOM   6827  C  CA    . THR B  1 440 ? 16.326  -39.874  12.070  1.00 101.26 ? 440 THR B CA    1 
ATOM   6828  C  C     . THR B  1 440 ? 15.777  -40.139  10.644  1.00 103.23 ? 440 THR B C     1 
ATOM   6829  O  O     . THR B  1 440 ? 15.433  -39.200  9.911   1.00 103.27 ? 440 THR B O     1 
ATOM   6830  C  CB    . THR B  1 440 ? 17.870  -39.700  12.072  1.00 101.55 ? 440 THR B CB    1 
ATOM   6831  O  OG1   . THR B  1 440 ? 18.387  -39.899  13.398  1.00 100.57 ? 440 THR B OG1   1 
ATOM   6832  C  CG2   . THR B  1 440 ? 18.256  -38.311  11.591  1.00 100.94 ? 440 THR B CG2   1 
ATOM   6833  N  N     . GLU B  1 441 ? 15.672  -41.419  10.277  1.00 105.23 ? 441 GLU B N     1 
ATOM   6834  C  CA    . GLU B  1 441 ? 15.074  -41.827  8.998   1.00 107.31 ? 441 GLU B CA    1 
ATOM   6835  C  C     . GLU B  1 441 ? 13.559  -41.593  8.941   1.00 107.49 ? 441 GLU B C     1 
ATOM   6836  O  O     . GLU B  1 441 ? 13.009  -41.364  7.868   1.00 108.49 ? 441 GLU B O     1 
ATOM   6837  C  CB    . GLU B  1 441 ? 15.406  -43.292  8.657   1.00 108.94 ? 441 GLU B CB    1 
ATOM   6838  C  CG    . GLU B  1 441 ? 14.711  -44.347  9.518   1.00 108.94 ? 441 GLU B CG    1 
ATOM   6839  C  CD    . GLU B  1 441 ? 15.624  -44.984  10.547  1.00 108.85 ? 441 GLU B CD    1 
ATOM   6840  O  OE1   . GLU B  1 441 ? 16.441  -44.271  11.167  1.00 108.18 ? 441 GLU B OE1   1 
ATOM   6841  O  OE2   . GLU B  1 441 ? 15.518  -46.210  10.743  1.00 110.21 ? 441 GLU B OE2   1 
ATOM   6842  N  N     . GLU B  1 442 ? 12.897  -41.668  10.095  1.00 107.01 ? 442 GLU B N     1 
ATOM   6843  C  CA    . GLU B  1 442 ? 11.461  -41.396  10.192  1.00 107.40 ? 442 GLU B CA    1 
ATOM   6844  C  C     . GLU B  1 442 ? 11.200  -39.891  10.195  1.00 106.44 ? 442 GLU B C     1 
ATOM   6845  O  O     . GLU B  1 442 ? 10.057  -39.449  10.060  1.00 106.58 ? 442 GLU B O     1 
ATOM   6846  C  CB    . GLU B  1 442 ? 10.874  -42.023  11.462  1.00 107.10 ? 442 GLU B CB    1 
ATOM   6847  C  CG    . GLU B  1 442 ? 11.002  -43.546  11.564  1.00 109.38 ? 442 GLU B CG    1 
ATOM   6848  C  CD    . GLU B  1 442 ? 10.586  -44.070  12.936  1.00 110.40 ? 442 GLU B CD    1 
ATOM   6849  O  OE1   . GLU B  1 442 ? 11.424  -44.704  13.619  1.00 110.56 ? 442 GLU B OE1   1 
ATOM   6850  O  OE2   . GLU B  1 442 ? 9.422   -43.836  13.340  1.00 111.10 ? 442 GLU B OE2   1 
ATOM   6851  N  N     . GLN B  1 443 ? 12.268  -39.115  10.348  1.00 105.70 ? 443 GLN B N     1 
ATOM   6852  C  CA    . GLN B  1 443 ? 12.165  -37.665  10.407  1.00 105.10 ? 443 GLN B CA    1 
ATOM   6853  C  C     . GLN B  1 443 ? 12.194  -36.993  9.031   1.00 105.99 ? 443 GLN B C     1 
ATOM   6854  O  O     . GLN B  1 443 ? 11.285  -36.216  8.698   1.00 106.20 ? 443 GLN B O     1 
ATOM   6855  C  CB    . GLN B  1 443 ? 13.275  -37.087  11.280  1.00 104.23 ? 443 GLN B CB    1 
ATOM   6856  C  CG    . GLN B  1 443 ? 13.148  -37.385  12.766  1.00 103.58 ? 443 GLN B CG    1 
ATOM   6857  C  CD    . GLN B  1 443 ? 14.164  -36.610  13.587  1.00 102.93 ? 443 GLN B CD    1 
ATOM   6858  O  OE1   . GLN B  1 443 ? 14.480  -35.461  13.270  1.00 102.84 ? 443 GLN B OE1   1 
ATOM   6859  N  NE2   . GLN B  1 443 ? 14.687  -37.236  14.642  1.00 102.14 ? 443 GLN B NE2   1 
ATOM   6860  N  N     . VAL B  1 444 ? 13.227  -37.288  8.238   1.00 106.61 ? 444 VAL B N     1 
ATOM   6861  C  CA    . VAL B  1 444 ? 13.445  -36.566  6.968   1.00 107.40 ? 444 VAL B CA    1 
ATOM   6862  C  C     . VAL B  1 444 ? 12.273  -36.642  5.962   1.00 108.40 ? 444 VAL B C     1 
ATOM   6863  O  O     . VAL B  1 444 ? 12.018  -35.656  5.271   1.00 108.92 ? 444 VAL B O     1 
ATOM   6864  C  CB    . VAL B  1 444 ? 14.871  -36.813  6.293   1.00 108.37 ? 444 VAL B CB    1 
ATOM   6865  C  CG1   . VAL B  1 444 ? 15.904  -37.307  7.308   1.00 107.58 ? 444 VAL B CG1   1 
ATOM   6866  C  CG2   . VAL B  1 444 ? 14.799  -37.750  5.092   1.00 110.17 ? 444 VAL B CG2   1 
ATOM   6867  N  N     . PRO B  1 445 ? 11.559  -37.800  5.888   1.00 108.82 ? 445 PRO B N     1 
ATOM   6868  C  CA    . PRO B  1 445 ? 10.376  -37.883  5.029   1.00 109.92 ? 445 PRO B CA    1 
ATOM   6869  C  C     . PRO B  1 445 ? 9.296   -36.891  5.440   1.00 109.09 ? 445 PRO B C     1 
ATOM   6870  O  O     . PRO B  1 445 ? 8.700   -36.236  4.579   1.00 110.16 ? 445 PRO B O     1 
ATOM   6871  C  CB    . PRO B  1 445 ? 9.874   -39.311  5.260   1.00 110.45 ? 445 PRO B CB    1 
ATOM   6872  C  CG    . PRO B  1 445 ? 11.059  -40.057  5.656   1.00 110.19 ? 445 PRO B CG    1 
ATOM   6873  C  CD    . PRO B  1 445 ? 11.847  -39.113  6.497   1.00 108.66 ? 445 PRO B CD    1 
ATOM   6874  N  N     . LEU B  1 446 ? 9.054   -36.784  6.745   1.00 107.24 ? 446 LEU B N     1 
ATOM   6875  C  CA    . LEU B  1 446 ? 8.055   -35.866  7.258   1.00 106.44 ? 446 LEU B CA    1 
ATOM   6876  C  C     . LEU B  1 446 ? 8.431   -34.424  6.921   1.00 106.14 ? 446 LEU B C     1 
ATOM   6877  O  O     . LEU B  1 446 ? 7.614   -33.680  6.371   1.00 107.05 ? 446 LEU B O     1 
ATOM   6878  C  CB    . LEU B  1 446 ? 7.865   -36.066  8.761   1.00 105.01 ? 446 LEU B CB    1 
ATOM   6879  C  CG    . LEU B  1 446 ? 7.296   -37.429  9.174   1.00 105.31 ? 446 LEU B CG    1 
ATOM   6880  C  CD1   . LEU B  1 446 ? 7.510   -37.680  10.658  1.00 104.30 ? 446 LEU B CD1   1 
ATOM   6881  C  CD2   . LEU B  1 446 ? 5.818   -37.552  8.817   1.00 106.27 ? 446 LEU B CD2   1 
ATOM   6882  N  N     . ILE B  1 447 ? 9.679   -34.054  7.207   1.00 104.96 ? 447 ILE B N     1 
ATOM   6883  C  CA    . ILE B  1 447 ? 10.168  -32.696  6.950   1.00 104.66 ? 447 ILE B CA    1 
ATOM   6884  C  C     . ILE B  1 447 ? 10.189  -32.348  5.453   1.00 106.08 ? 447 ILE B C     1 
ATOM   6885  O  O     . ILE B  1 447 ? 9.874   -31.216  5.072   1.00 106.46 ? 447 ILE B O     1 
ATOM   6886  C  CB    . ILE B  1 447 ? 11.538  -32.448  7.641   1.00 103.58 ? 447 ILE B CB    1 
ATOM   6887  C  CG1   . ILE B  1 447 ? 11.342  -32.461  9.164   1.00 102.28 ? 447 ILE B CG1   1 
ATOM   6888  C  CG2   . ILE B  1 447 ? 12.174  -31.127  7.178   1.00 103.71 ? 447 ILE B CG2   1 
ATOM   6889  C  CD1   . ILE B  1 447 ? 12.613  -32.354  9.980   1.00 101.87 ? 447 ILE B CD1   1 
ATOM   6890  N  N     . TYR B  1 448 ? 10.540  -33.333  4.623   1.00 106.94 ? 448 TYR B N     1 
ATOM   6891  C  CA    . TYR B  1 448 ? 10.503  -33.212  3.157   1.00 108.59 ? 448 TYR B CA    1 
ATOM   6892  C  C     . TYR B  1 448 ? 9.097   -32.882  2.667   1.00 109.56 ? 448 TYR B C     1 
ATOM   6893  O  O     . TYR B  1 448 ? 8.927   -32.091  1.736   1.00 110.68 ? 448 TYR B O     1 
ATOM   6894  C  CB    . TYR B  1 448 ? 10.983  -34.513  2.496   1.00 109.64 ? 448 TYR B CB    1 
ATOM   6895  C  CG    . TYR B  1 448 ? 11.125  -34.445  0.986   1.00 112.24 ? 448 TYR B CG    1 
ATOM   6896  C  CD1   . TYR B  1 448 ? 12.374  -34.242  0.389   1.00 113.23 ? 448 TYR B CD1   1 
ATOM   6897  C  CD2   . TYR B  1 448 ? 10.014  -34.594  0.148   1.00 114.48 ? 448 TYR B CD2   1 
ATOM   6898  C  CE1   . TYR B  1 448 ? 12.511  -34.180  -1.001  1.00 115.40 ? 448 TYR B CE1   1 
ATOM   6899  C  CE2   . TYR B  1 448 ? 10.138  -34.530  -1.244  1.00 116.79 ? 448 TYR B CE2   1 
ATOM   6900  C  CZ    . TYR B  1 448 ? 11.388  -34.323  -1.807  1.00 117.34 ? 448 TYR B CZ    1 
ATOM   6901  O  OH    . TYR B  1 448 ? 11.513  -34.256  -3.172  1.00 119.92 ? 448 TYR B OH    1 
ATOM   6902  N  N     . ALA B  1 449 ? 8.100   -33.501  3.301   1.00 109.19 ? 449 ALA B N     1 
ATOM   6903  C  CA    . ALA B  1 449 ? 6.687   -33.276  2.984   1.00 110.12 ? 449 ALA B CA    1 
ATOM   6904  C  C     . ALA B  1 449 ? 6.225   -31.886  3.420   1.00 109.56 ? 449 ALA B C     1 
ATOM   6905  O  O     . ALA B  1 449 ? 5.332   -31.300  2.802   1.00 111.10 ? 449 ALA B O     1 
ATOM   6906  C  CB    . ALA B  1 449 ? 5.819   -34.354  3.623   1.00 109.91 ? 449 ALA B CB    1 
ATOM   6907  N  N     . GLY B  1 450 ? 6.839   -31.366  4.480   1.00 107.52 ? 450 GLY B N     1 
ATOM   6908  C  CA    . GLY B  1 450 ? 6.519   -30.034  4.974   1.00 107.05 ? 450 GLY B CA    1 
ATOM   6909  C  C     . GLY B  1 450 ? 7.185   -28.919  4.192   1.00 107.52 ? 450 GLY B C     1 
ATOM   6910  O  O     . GLY B  1 450 ? 6.511   -28.084  3.580   1.00 108.88 ? 450 GLY B O     1 
ATOM   6911  N  N     . VAL B  1 451 ? 8.514   -28.908  4.223   1.00 106.51 ? 451 VAL B N     1 
ATOM   6912  C  CA    . VAL B  1 451 ? 9.307   -27.882  3.554   1.00 106.92 ? 451 VAL B CA    1 
ATOM   6913  C  C     . VAL B  1 451 ? 8.853   -27.664  2.111   1.00 108.99 ? 451 VAL B C     1 
ATOM   6914  O  O     . VAL B  1 451 ? 8.406   -26.571  1.769   1.00 110.02 ? 451 VAL B O     1 
ATOM   6915  C  CB    . VAL B  1 451 ? 10.823  -28.198  3.627   1.00 106.12 ? 451 VAL B CB    1 
ATOM   6916  C  CG1   . VAL B  1 451 ? 11.614  -27.348  2.631   1.00 107.16 ? 451 VAL B CG1   1 
ATOM   6917  C  CG2   . VAL B  1 451 ? 11.339  -27.994  5.053   1.00 104.19 ? 451 VAL B CG2   1 
ATOM   6918  N  N     . ASN B  1 452 ? 8.935   -28.716  1.293   1.00 109.81 ? 452 ASN B N     1 
ATOM   6919  C  CA    . ASN B  1 452 ? 8.620   -28.647  -0.142  1.00 112.03 ? 452 ASN B CA    1 
ATOM   6920  C  C     . ASN B  1 452 ? 7.160   -28.342  -0.468  1.00 113.42 ? 452 ASN B C     1 
ATOM   6921  O  O     . ASN B  1 452 ? 6.858   -27.824  -1.547  1.00 115.27 ? 452 ASN B O     1 
ATOM   6922  C  CB    . ASN B  1 452 ? 9.069   -29.921  -0.853  1.00 112.84 ? 452 ASN B CB    1 
ATOM   6923  C  CG    . ASN B  1 452 ? 10.572  -30.108  -0.814  1.00 112.16 ? 452 ASN B CG    1 
ATOM   6924  O  OD1   . ASN B  1 452 ? 11.334  -29.187  -1.110  1.00 112.30 ? 452 ASN B OD1   1 
ATOM   6925  N  ND2   . ASN B  1 452 ? 11.007  -31.304  -0.449  1.00 111.76 ? 452 ASN B ND2   1 
ATOM   6926  N  N     . GLY B  1 453 ? 6.265   -28.689  0.459   1.00 112.65 ? 453 GLY B N     1 
ATOM   6927  C  CA    . GLY B  1 453 ? 4.879   -28.217  0.424   1.00 113.96 ? 453 GLY B CA    1 
ATOM   6928  C  C     . GLY B  1 453 ? 3.795   -29.212  0.068   1.00 115.27 ? 453 GLY B C     1 
ATOM   6929  O  O     . GLY B  1 453 ? 2.675   -28.819  -0.270  1.00 116.84 ? 453 GLY B O     1 
ATOM   6930  N  N     . HIS B  1 454 ? 4.122   -30.497  0.159   1.00 114.85 ? 454 HIS B N     1 
ATOM   6931  C  CA    . HIS B  1 454 ? 3.166   -31.565  -0.118  1.00 116.24 ? 454 HIS B CA    1 
ATOM   6932  C  C     . HIS B  1 454 ? 2.145   -31.663  1.015   1.00 115.79 ? 454 HIS B C     1 
ATOM   6933  O  O     . HIS B  1 454 ? 1.447   -32.671  1.149   1.00 116.36 ? 454 HIS B O     1 
ATOM   6934  C  CB    . HIS B  1 454 ? 3.891   -32.904  -0.307  1.00 115.77 ? 454 HIS B CB    1 
ATOM   6935  C  CG    . HIS B  1 454 ? 4.938   -32.884  -1.377  1.00 116.16 ? 454 HIS B CG    1 
ATOM   6936  N  ND1   . HIS B  1 454 ? 4.866   -33.674  -2.503  1.00 117.88 ? 454 HIS B ND1   1 
ATOM   6937  C  CD2   . HIS B  1 454 ? 6.085   -32.173  -1.492  1.00 115.10 ? 454 HIS B CD2   1 
ATOM   6938  C  CE1   . HIS B  1 454 ? 5.922   -33.451  -3.265  1.00 118.29 ? 454 HIS B CE1   1 
ATOM   6939  N  NE2   . HIS B  1 454 ? 6.677   -32.543  -2.674  1.00 116.33 ? 454 HIS B NE2   1 
ATOM   6940  N  N     . LEU B  1 455 ? 2.061   -30.600  1.815   1.00 115.12 ? 455 LEU B N     1 
ATOM   6941  C  CA    . LEU B  1 455 ? 1.168   -30.544  2.968   1.00 114.93 ? 455 LEU B CA    1 
ATOM   6942  C  C     . LEU B  1 455 ? 0.210   -29.349  2.953   1.00 116.55 ? 455 LEU B C     1 
ATOM   6943  O  O     . LEU B  1 455 ? -0.696  -29.271  3.787   1.00 116.65 ? 455 LEU B O     1 
ATOM   6944  C  CB    . LEU B  1 455 ? 1.980   -30.541  4.269   1.00 112.42 ? 455 LEU B CB    1 
ATOM   6945  C  CG    . LEU B  1 455 ? 2.450   -31.880  4.838   1.00 111.05 ? 455 LEU B CG    1 
ATOM   6946  C  CD1   . LEU B  1 455 ? 3.477   -31.633  5.916   1.00 109.22 ? 455 LEU B CD1   1 
ATOM   6947  C  CD2   . LEU B  1 455 ? 1.287   -32.676  5.401   1.00 111.39 ? 455 LEU B CD2   1 
ATOM   6948  N  N     . ASP B  1 456 ? 0.410   -28.429  2.008   1.00 118.17 ? 456 ASP B N     1 
ATOM   6949  C  CA    . ASP B  1 456 ? -0.407  -27.210  1.908   1.00 120.14 ? 456 ASP B CA    1 
ATOM   6950  C  C     . ASP B  1 456 ? -1.889  -27.483  1.610   1.00 122.66 ? 456 ASP B C     1 
ATOM   6951  O  O     . ASP B  1 456 ? -2.741  -26.607  1.803   1.00 124.01 ? 456 ASP B O     1 
ATOM   6952  C  CB    . ASP B  1 456 ? 0.184   -26.243  0.869   1.00 121.26 ? 456 ASP B CB    1 
ATOM   6953  C  CG    . ASP B  1 456 ? 1.387   -25.461  1.402   1.00 119.76 ? 456 ASP B CG    1 
ATOM   6954  O  OD1   . ASP B  1 456 ? 2.250   -26.068  2.079   1.00 117.96 ? 456 ASP B OD1   1 
ATOM   6955  O  OD2   . ASP B  1 456 ? 1.474   -24.238  1.136   1.00 120.42 ? 456 ASP B OD2   1 
ATOM   6956  N  N     . GLY B  1 457 ? -2.184  -28.698  1.149   1.00 123.58 ? 457 GLY B N     1 
ATOM   6957  C  CA    . GLY B  1 457 ? -3.554  -29.122  0.870   1.00 126.04 ? 457 GLY B CA    1 
ATOM   6958  C  C     . GLY B  1 457 ? -4.216  -29.782  2.064   1.00 125.29 ? 457 GLY B C     1 
ATOM   6959  O  O     . GLY B  1 457 ? -5.373  -29.492  2.374   1.00 126.79 ? 457 GLY B O     1 
ATOM   6960  N  N     . ILE B  1 458 ? -3.471  -30.659  2.737   1.00 123.21 ? 458 ILE B N     1 
ATOM   6961  C  CA    . ILE B  1 458 ? -3.976  -31.448  3.872   1.00 122.58 ? 458 ILE B CA    1 
ATOM   6962  C  C     . ILE B  1 458 ? -4.489  -30.588  5.031   1.00 122.23 ? 458 ILE B C     1 
ATOM   6963  O  O     . ILE B  1 458 ? -3.882  -29.573  5.381   1.00 121.17 ? 458 ILE B O     1 
ATOM   6964  C  CB    . ILE B  1 458 ? -2.912  -32.469  4.375   1.00 120.25 ? 458 ILE B CB    1 
ATOM   6965  C  CG1   . ILE B  1 458 ? -2.432  -33.338  3.205   1.00 121.12 ? 458 ILE B CG1   1 
ATOM   6966  C  CG2   . ILE B  1 458 ? -3.466  -33.337  5.521   1.00 119.51 ? 458 ILE B CG2   1 
ATOM   6967  C  CD1   . ILE B  1 458 ? -1.283  -34.267  3.521   1.00 119.24 ? 458 ILE B CD1   1 
ATOM   6968  N  N     . GLU B  1 459 ? -5.613  -31.009  5.610   1.00 123.45 ? 459 GLU B N     1 
ATOM   6969  C  CA    . GLU B  1 459 ? -6.255  -30.298  6.717   1.00 123.73 ? 459 GLU B CA    1 
ATOM   6970  C  C     . GLU B  1 459 ? -5.397  -30.294  7.972   1.00 120.99 ? 459 GLU B C     1 
ATOM   6971  O  O     . GLU B  1 459 ? -4.627  -31.226  8.214   1.00 119.33 ? 459 GLU B O     1 
ATOM   6972  C  CB    . GLU B  1 459 ? -7.610  -30.923  7.034   1.00 125.68 ? 459 GLU B CB    1 
ATOM   6973  C  CG    . GLU B  1 459 ? -8.596  -30.862  5.892   1.00 129.27 ? 459 GLU B CG    1 
ATOM   6974  C  CD    . GLU B  1 459 ? -9.819  -31.709  6.147   1.00 131.95 ? 459 GLU B CD    1 
ATOM   6975  O  OE1   . GLU B  1 459 ? -10.599 -31.369  7.065   1.00 133.15 ? 459 GLU B OE1   1 
ATOM   6976  O  OE2   . GLU B  1 459 ? -10.001 -32.713  5.422   1.00 133.04 ? 459 GLU B OE2   1 
ATOM   6977  N  N     . LEU B  1 460 ? -5.557  -29.250  8.778   1.00 120.81 ? 460 LEU B N     1 
ATOM   6978  C  CA    . LEU B  1 460 ? -4.717  -29.047  9.952   1.00 118.44 ? 460 LEU B CA    1 
ATOM   6979  C  C     . LEU B  1 460 ? -5.033  -30.038  11.076  1.00 117.63 ? 460 LEU B C     1 
ATOM   6980  O  O     . LEU B  1 460 ? -4.203  -30.275  11.949  1.00 115.69 ? 460 LEU B O     1 
ATOM   6981  C  CB    . LEU B  1 460 ? -4.844  -27.595  10.441  1.00 118.99 ? 460 LEU B CB    1 
ATOM   6982  C  CG    . LEU B  1 460 ? -3.589  -26.839  10.896  1.00 116.73 ? 460 LEU B CG    1 
ATOM   6983  C  CD1   . LEU B  1 460 ? -2.444  -27.032  9.922   1.00 115.38 ? 460 LEU B CD1   1 
ATOM   6984  C  CD2   . LEU B  1 460 ? -3.889  -25.355  11.066  1.00 117.67 ? 460 LEU B CD2   1 
ATOM   6985  N  N     . SER B  1 461 ? -6.224  -30.632  11.033  1.00 119.35 ? 461 SER B N     1 
ATOM   6986  C  CA    . SER B  1 461 ? -6.677  -31.543  12.087  1.00 118.99 ? 461 SER B CA    1 
ATOM   6987  C  C     . SER B  1 461 ? -6.296  -33.001  11.828  1.00 118.20 ? 461 SER B C     1 
ATOM   6988  O  O     . SER B  1 461 ? -6.710  -33.896  12.568  1.00 118.25 ? 461 SER B O     1 
ATOM   6989  C  CB    . SER B  1 461 ? -8.194  -31.423  12.278  1.00 121.53 ? 461 SER B CB    1 
ATOM   6990  O  OG    . SER B  1 461 ? -8.897  -31.921  11.154  1.00 123.12 ? 461 SER B OG    1 
ATOM   6991  N  N     . ARG B  1 462 ? -5.507  -33.232  10.781  1.00 117.72 ? 462 ARG B N     1 
ATOM   6992  C  CA    . ARG B  1 462 ? -5.189  -34.588  10.323  1.00 117.52 ? 462 ARG B CA    1 
ATOM   6993  C  C     . ARG B  1 462 ? -3.728  -34.729  9.884   1.00 115.71 ? 462 ARG B C     1 
ATOM   6994  O  O     . ARG B  1 462 ? -3.398  -35.600  9.068   1.00 115.97 ? 462 ARG B O     1 
ATOM   6995  C  CB    . ARG B  1 462 ? -6.136  -35.001  9.185   1.00 120.09 ? 462 ARG B CB    1 
ATOM   6996  C  CG    . ARG B  1 462 ? -7.551  -35.396  9.643   1.00 122.11 ? 462 ARG B CG    1 
ATOM   6997  C  CD    . ARG B  1 462 ? -8.596  -35.328  8.520   1.00 123.99 ? 462 ARG B CD    1 
ATOM   6998  N  NE    . ARG B  1 462 ? -8.337  -36.281  7.442   1.00 123.72 ? 462 ARG B NE    1 
ATOM   6999  C  CZ    . ARG B  1 462 ? -7.859  -35.951  6.246   1.00 123.99 ? 462 ARG B CZ    1 
ATOM   7000  N  NH1   . ARG B  1 462 ? -7.590  -34.683  5.957   1.00 123.71 ? 462 ARG B NH1   1 
ATOM   7001  N  NH2   . ARG B  1 462 ? -7.655  -36.891  5.334   1.00 124.81 ? 462 ARG B NH2   1 
ATOM   7002  N  N     . ILE B  1 463 ? -2.867  -33.869  10.432  1.00 114.01 ? 463 ILE B N     1 
ATOM   7003  C  CA    . ILE B  1 463 ? -1.431  -33.908  10.156  1.00 112.32 ? 463 ILE B CA    1 
ATOM   7004  C  C     . ILE B  1 463 ? -0.753  -34.956  11.037  1.00 110.79 ? 463 ILE B C     1 
ATOM   7005  O  O     . ILE B  1 463 ? 0.199   -35.613  10.613  1.00 110.00 ? 463 ILE B O     1 
ATOM   7006  C  CB    . ILE B  1 463 ? -0.747  -32.536  10.395  1.00 111.45 ? 463 ILE B CB    1 
ATOM   7007  C  CG1   . ILE B  1 463 ? -1.678  -31.365  10.031  1.00 113.24 ? 463 ILE B CG1   1 
ATOM   7008  C  CG2   . ILE B  1 463 ? 0.613   -32.473  9.669   1.00 110.39 ? 463 ILE B CG2   1 
ATOM   7009  C  CD1   . ILE B  1 463 ? -1.619  -30.908  8.580   1.00 114.94 ? 463 ILE B CD1   1 
ATOM   7010  N  N     . GLY B  1 464 ? -1.246  -35.091  12.267  1.00 110.60 ? 464 GLY B N     1 
ATOM   7011  C  CA    . GLY B  1 464 ? -0.793  -36.138  13.182  1.00 109.77 ? 464 GLY B CA    1 
ATOM   7012  C  C     . GLY B  1 464 ? -1.141  -37.504  12.622  1.00 111.03 ? 464 GLY B C     1 
ATOM   7013  O  O     . GLY B  1 464 ? -0.368  -38.457  12.751  1.00 110.32 ? 464 GLY B O     1 
ATOM   7014  N  N     . GLU B  1 465 ? -2.315  -37.585  11.995  1.00 113.21 ? 465 GLU B N     1 
ATOM   7015  C  CA    . GLU B  1 465 ? -2.742  -38.770  11.253  1.00 114.74 ? 465 GLU B CA    1 
ATOM   7016  C  C     . GLU B  1 465 ? -1.812  -38.995  10.071  1.00 114.58 ? 465 GLU B C     1 
ATOM   7017  O  O     . GLU B  1 465 ? -1.230  -40.070  9.942   1.00 114.21 ? 465 GLU B O     1 
ATOM   7018  C  CB    . GLU B  1 465 ? -4.185  -38.613  10.763  1.00 117.13 ? 465 GLU B CB    1 
ATOM   7019  C  CG    . GLU B  1 465 ? -4.790  -39.896  10.210  1.00 119.11 ? 465 GLU B CG    1 
ATOM   7020  C  CD    . GLU B  1 465 ? -5.991  -39.648  9.323   1.00 121.95 ? 465 GLU B CD    1 
ATOM   7021  O  OE1   . GLU B  1 465 ? -6.678  -38.622  9.522   1.00 122.61 ? 465 GLU B OE1   1 
ATOM   7022  O  OE2   . GLU B  1 465 ? -6.248  -40.485  8.427   1.00 123.55 ? 465 GLU B OE2   1 
ATOM   7023  N  N     . PHE B  1 466 ? -1.665  -37.970  9.230   1.00 114.98 ? 466 PHE B N     1 
ATOM   7024  C  CA    . PHE B  1 466 ? -0.747  -38.015  8.095   1.00 115.36 ? 466 PHE B CA    1 
ATOM   7025  C  C     . PHE B  1 466 ? 0.617   -38.561  8.499   1.00 113.87 ? 466 PHE B C     1 
ATOM   7026  O  O     . PHE B  1 466 ? 1.252   -39.270  7.725   1.00 114.47 ? 466 PHE B O     1 
ATOM   7027  C  CB    . PHE B  1 466 ? -0.595  -36.636  7.434   1.00 115.46 ? 466 PHE B CB    1 
ATOM   7028  C  CG    . PHE B  1 466 ? 0.479   -36.584  6.372   1.00 115.64 ? 466 PHE B CG    1 
ATOM   7029  C  CD1   . PHE B  1 466 ? 1.747   -36.090  6.668   1.00 114.15 ? 466 PHE B CD1   1 
ATOM   7030  C  CD2   . PHE B  1 466 ? 0.229   -37.049  5.082   1.00 118.06 ? 466 PHE B CD2   1 
ATOM   7031  C  CE1   . PHE B  1 466 ? 2.749   -36.051  5.690   1.00 114.61 ? 466 PHE B CE1   1 
ATOM   7032  C  CE2   . PHE B  1 466 ? 1.224   -37.012  4.096   1.00 118.30 ? 466 PHE B CE2   1 
ATOM   7033  C  CZ    . PHE B  1 466 ? 2.485   -36.513  4.402   1.00 116.39 ? 466 PHE B CZ    1 
ATOM   7034  N  N     . GLU B  1 467 ? 1.056   -38.234  9.712   1.00 112.47 ? 467 GLU B N     1 
ATOM   7035  C  CA    . GLU B  1 467 ? 2.352   -38.688  10.210  1.00 111.26 ? 467 GLU B CA    1 
ATOM   7036  C  C     . GLU B  1 467 ? 2.418   -40.207  10.410  1.00 111.66 ? 467 GLU B C     1 
ATOM   7037  O  O     . GLU B  1 467 ? 3.293   -40.861  9.846   1.00 111.86 ? 467 GLU B O     1 
ATOM   7038  C  CB    . GLU B  1 467 ? 2.735   -37.947  11.493  1.00 109.74 ? 467 GLU B CB    1 
ATOM   7039  C  CG    . GLU B  1 467 ? 4.084   -38.356  12.065  1.00 109.10 ? 467 GLU B CG    1 
ATOM   7040  C  CD    . GLU B  1 467 ? 4.666   -37.327  13.014  1.00 108.89 ? 467 GLU B CD    1 
ATOM   7041  O  OE1   . GLU B  1 467 ? 4.079   -36.230  13.166  1.00 109.34 ? 467 GLU B OE1   1 
ATOM   7042  O  OE2   . GLU B  1 467 ? 5.724   -37.618  13.610  1.00 108.59 ? 467 GLU B OE2   1 
ATOM   7043  N  N     . SER B  1 468 ? 1.505   -40.762  11.205  1.00 112.06 ? 468 SER B N     1 
ATOM   7044  C  CA    . SER B  1 468 ? 1.472   -42.207  11.433  1.00 112.79 ? 468 SER B CA    1 
ATOM   7045  C  C     . SER B  1 468 ? 1.088   -42.956  10.152  1.00 114.94 ? 468 SER B C     1 
ATOM   7046  O  O     . SER B  1 468 ? 1.638   -44.022  9.857   1.00 115.52 ? 468 SER B O     1 
ATOM   7047  C  CB    . SER B  1 468 ? 0.518   -42.556  12.575  1.00 112.94 ? 468 SER B CB    1 
ATOM   7048  O  OG    . SER B  1 468 ? -0.758  -41.979  12.360  1.00 114.31 ? 468 SER B OG    1 
ATOM   7049  N  N     . SER B  1 469 ? 0.157   -42.382  9.390   1.00 116.33 ? 469 SER B N     1 
ATOM   7050  C  CA    . SER B  1 469 ? -0.270  -42.945  8.108   1.00 118.51 ? 469 SER B CA    1 
ATOM   7051  C  C     . SER B  1 469 ? 0.867   -43.004  7.092   1.00 118.61 ? 469 SER B C     1 
ATOM   7052  O  O     . SER B  1 469 ? 0.938   -43.940  6.300   1.00 120.30 ? 469 SER B O     1 
ATOM   7053  C  CB    . SER B  1 469 ? -1.442  -42.149  7.524   1.00 119.94 ? 469 SER B CB    1 
ATOM   7054  O  OG    . SER B  1 469 ? -2.628  -42.333  8.279   1.00 120.72 ? 469 SER B OG    1 
ATOM   7055  N  N     . PHE B  1 470 ? 1.745   -42.005  7.114   1.00 117.18 ? 470 PHE B N     1 
ATOM   7056  C  CA    . PHE B  1 470 ? 2.846   -41.924  6.155   1.00 117.57 ? 470 PHE B CA    1 
ATOM   7057  C  C     . PHE B  1 470 ? 4.063   -42.756  6.572   1.00 116.96 ? 470 PHE B C     1 
ATOM   7058  O  O     . PHE B  1 470 ? 4.830   -43.196  5.714   1.00 117.99 ? 470 PHE B O     1 
ATOM   7059  C  CB    . PHE B  1 470 ? 3.224   -40.459  5.873   1.00 116.62 ? 470 PHE B CB    1 
ATOM   7060  C  CG    . PHE B  1 470 ? 4.167   -40.271  4.704   1.00 117.45 ? 470 PHE B CG    1 
ATOM   7061  C  CD1   . PHE B  1 470 ? 4.127   -41.120  3.593   1.00 119.78 ? 470 PHE B CD1   1 
ATOM   7062  C  CD2   . PHE B  1 470 ? 5.079   -39.220  4.702   1.00 116.02 ? 470 PHE B CD2   1 
ATOM   7063  C  CE1   . PHE B  1 470 ? 5.001   -40.940  2.518   1.00 120.19 ? 470 PHE B CE1   1 
ATOM   7064  C  CE2   . PHE B  1 470 ? 5.952   -39.030  3.629   1.00 116.60 ? 470 PHE B CE2   1 
ATOM   7065  C  CZ    . PHE B  1 470 ? 5.910   -39.891  2.535   1.00 118.56 ? 470 PHE B CZ    1 
ATOM   7066  N  N     . LEU B  1 471 ? 4.235   -42.983  7.874   1.00 115.81 ? 471 LEU B N     1 
ATOM   7067  C  CA    . LEU B  1 471 ? 5.316   -43.857  8.359   1.00 115.55 ? 471 LEU B CA    1 
ATOM   7068  C  C     . LEU B  1 471 ? 5.022   -45.331  8.052   1.00 117.58 ? 471 LEU B C     1 
ATOM   7069  O  O     . LEU B  1 471 ? 5.830   -45.996  7.392   1.00 118.70 ? 471 LEU B O     1 
ATOM   7070  C  CB    . LEU B  1 471 ? 5.614   -43.637  9.852   1.00 113.66 ? 471 LEU B CB    1 
ATOM   7071  C  CG    . LEU B  1 471 ? 6.261   -42.311  10.292  1.00 111.77 ? 471 LEU B CG    1 
ATOM   7072  C  CD1   . LEU B  1 471 ? 6.442   -42.287  11.804  1.00 109.97 ? 471 LEU B CD1   1 
ATOM   7073  C  CD2   . LEU B  1 471 ? 7.588   -42.027  9.582   1.00 111.22 ? 471 LEU B CD2   1 
ATOM   7074  N  N     . SER B  1 472 ? 3.864   -45.825  8.507   1.00 118.39 ? 472 SER B N     1 
ATOM   7075  C  CA    . SER B  1 472 ? 3.372   -47.169  8.144   1.00 120.41 ? 472 SER B CA    1 
ATOM   7076  C  C     . SER B  1 472 ? 3.496   -47.461  6.648   1.00 122.40 ? 472 SER B C     1 
ATOM   7077  O  O     . SER B  1 472 ? 4.007   -48.511  6.268   1.00 123.71 ? 472 SER B O     1 
ATOM   7078  C  CB    . SER B  1 472 ? 1.919   -47.375  8.595   1.00 121.16 ? 472 SER B CB    1 
ATOM   7079  O  OG    . SER B  1 472 ? 1.856   -48.009  9.860   1.00 120.42 ? 472 SER B OG    1 
ATOM   7080  N  N     . TYR B  1 473 ? 3.039   -46.521  5.818   1.00 122.92 ? 473 TYR B N     1 
ATOM   7081  C  CA    . TYR B  1 473 ? 3.109   -46.638  4.357   1.00 125.22 ? 473 TYR B CA    1 
ATOM   7082  C  C     . TYR B  1 473 ? 4.535   -46.824  3.849   1.00 125.22 ? 473 TYR B C     1 
ATOM   7083  O  O     . TYR B  1 473 ? 4.784   -47.654  2.965   1.00 127.34 ? 473 TYR B O     1 
ATOM   7084  C  CB    . TYR B  1 473 ? 2.478   -45.416  3.672   1.00 125.52 ? 473 TYR B CB    1 
ATOM   7085  C  CG    . TYR B  1 473 ? 2.819   -45.297  2.195   1.00 127.63 ? 473 TYR B CG    1 
ATOM   7086  C  CD1   . TYR B  1 473 ? 2.173   -46.089  1.240   1.00 130.38 ? 473 TYR B CD1   1 
ATOM   7087  C  CD2   . TYR B  1 473 ? 3.795   -44.400  1.754   1.00 126.70 ? 473 TYR B CD2   1 
ATOM   7088  C  CE1   . TYR B  1 473 ? 2.485   -45.987  -0.114  1.00 132.01 ? 473 TYR B CE1   1 
ATOM   7089  C  CE2   . TYR B  1 473 ? 4.115   -44.295  0.400   1.00 128.55 ? 473 TYR B CE2   1 
ATOM   7090  C  CZ    . TYR B  1 473 ? 3.455   -45.089  -0.525  1.00 131.15 ? 473 TYR B CZ    1 
ATOM   7091  O  OH    . TYR B  1 473 ? 3.768   -44.981  -1.859  1.00 133.17 ? 473 TYR B OH    1 
ATOM   7092  N  N     . LEU B  1 474 ? 5.458   -46.031  4.391   1.00 122.98 ? 474 LEU B N     1 
ATOM   7093  C  CA    . LEU B  1 474 ? 6.856   -46.114  3.989   1.00 122.95 ? 474 LEU B CA    1 
ATOM   7094  C  C     . LEU B  1 474 ? 7.520   -47.367  4.549   1.00 123.14 ? 474 LEU B C     1 
ATOM   7095  O  O     . LEU B  1 474 ? 8.248   -48.054  3.827   1.00 124.85 ? 474 LEU B O     1 
ATOM   7096  C  CB    . LEU B  1 474 ? 7.629   -44.851  4.388   1.00 120.89 ? 474 LEU B CB    1 
ATOM   7097  C  CG    . LEU B  1 474 ? 7.480   -43.608  3.499   1.00 121.18 ? 474 LEU B CG    1 
ATOM   7098  C  CD1   . LEU B  1 474 ? 8.150   -42.411  4.157   1.00 118.98 ? 474 LEU B CD1   1 
ATOM   7099  C  CD2   . LEU B  1 474 ? 8.044   -43.832  2.095   1.00 123.29 ? 474 LEU B CD2   1 
ATOM   7100  N  N     . LYS B  1 475 ? 7.246   -47.670  5.819   1.00 121.58 ? 475 LYS B N     1 
ATOM   7101  C  CA    . LYS B  1 475 ? 7.799   -48.855  6.494   1.00 121.75 ? 475 LYS B CA    1 
ATOM   7102  C  C     . LYS B  1 475 ? 7.522   -50.166  5.738   1.00 124.56 ? 475 LYS B C     1 
ATOM   7103  O  O     . LYS B  1 475 ? 8.398   -51.032  5.632   1.00 125.56 ? 475 LYS B O     1 
ATOM   7104  C  CB    . LYS B  1 475 ? 7.298   -48.942  7.945   1.00 120.16 ? 475 LYS B CB    1 
ATOM   7105  C  CG    . LYS B  1 475 ? 7.965   -47.954  8.907   1.00 116.92 ? 475 LYS B CG    1 
ATOM   7106  C  CD    . LYS B  1 475 ? 7.277   -47.927  10.270  1.00 114.32 ? 475 LYS B CD    1 
ATOM   7107  C  CE    . LYS B  1 475 ? 7.915   -46.900  11.195  1.00 111.18 ? 475 LYS B CE    1 
ATOM   7108  N  NZ    . LYS B  1 475 ? 7.424   -47.029  12.589  1.00 109.49 ? 475 LYS B NZ    1 
ATOM   7109  N  N     . SER B  1 476 ? 6.307   -50.296  5.210   1.00 125.93 ? 476 SER B N     1 
ATOM   7110  C  CA    . SER B  1 476 ? 5.924   -51.463  4.423   1.00 128.77 ? 476 SER B CA    1 
ATOM   7111  C  C     . SER B  1 476 ? 6.398   -51.346  2.974   1.00 130.67 ? 476 SER B C     1 
ATOM   7112  O  O     . SER B  1 476 ? 7.073   -52.243  2.474   1.00 132.65 ? 476 SER B O     1 
ATOM   7113  C  CB    . SER B  1 476 ? 4.409   -51.693  4.482   1.00 129.73 ? 476 SER B CB    1 
ATOM   7114  O  OG    . SER B  1 476 ? 3.701   -50.710  3.745   1.00 129.69 ? 476 SER B OG    1 
ATOM   7115  N  N     . ASN B  1 477 ? 6.062   -50.235  2.314   1.00 130.29 ? 477 ASN B N     1 
ATOM   7116  C  CA    . ASN B  1 477 ? 6.346   -50.058  0.881   1.00 132.29 ? 477 ASN B CA    1 
ATOM   7117  C  C     . ASN B  1 477 ? 7.800   -49.745  0.534   1.00 131.74 ? 477 ASN B C     1 
ATOM   7118  O  O     . ASN B  1 477 ? 8.501   -50.580  -0.041  1.00 133.68 ? 477 ASN B O     1 
ATOM   7119  C  CB    . ASN B  1 477 ? 5.418   -49.007  0.265   1.00 132.45 ? 477 ASN B CB    1 
ATOM   7120  C  CG    . ASN B  1 477 ? 3.968   -49.436  0.274   1.00 134.15 ? 477 ASN B CG    1 
ATOM   7121  O  OD1   . ASN B  1 477 ? 3.475   -49.993  1.257   1.00 133.84 ? 477 ASN B OD1   1 
ATOM   7122  N  ND2   . ASN B  1 477 ? 3.273   -49.178  -0.825  1.00 136.61 ? 477 ASN B ND2   1 
ATOM   7123  N  N     . HIS B  1 478 ? 8.240   -48.540  0.882   1.00 129.19 ? 478 HIS B N     1 
ATOM   7124  C  CA    . HIS B  1 478 ? 9.565   -48.063  0.506   1.00 128.73 ? 478 HIS B CA    1 
ATOM   7125  C  C     . HIS B  1 478 ? 10.566  -48.198  1.651   1.00 126.61 ? 478 HIS B C     1 
ATOM   7126  O  O     . HIS B  1 478 ? 11.225  -47.225  2.028   1.00 124.75 ? 478 HIS B O     1 
ATOM   7127  C  CB    . HIS B  1 478 ? 9.488   -46.611  0.026   1.00 127.83 ? 478 HIS B CB    1 
ATOM   7128  C  CG    . HIS B  1 478 ? 8.473   -46.384  -1.051  1.00 130.25 ? 478 HIS B CG    1 
ATOM   7129  N  ND1   . HIS B  1 478 ? 8.763   -46.527  -2.392  1.00 133.15 ? 478 HIS B ND1   1 
ATOM   7130  C  CD2   . HIS B  1 478 ? 7.168   -46.028  -0.984  1.00 130.47 ? 478 HIS B CD2   1 
ATOM   7131  C  CE1   . HIS B  1 478 ? 7.682   -46.264  -3.104  1.00 134.44 ? 478 HIS B CE1   1 
ATOM   7132  N  NE2   . HIS B  1 478 ? 6.700   -45.959  -2.275  1.00 132.91 ? 478 HIS B NE2   1 
ATOM   7133  N  N     . ASN B  1 479 ? 10.680  -49.412  2.192   1.00 127.05 ? 479 ASN B N     1 
ATOM   7134  C  CA    . ASN B  1 479 ? 11.636  -49.709  3.266   1.00 125.39 ? 479 ASN B CA    1 
ATOM   7135  C  C     . ASN B  1 479 ? 13.089  -49.568  2.800   1.00 125.86 ? 479 ASN B C     1 
ATOM   7136  O  O     . ASN B  1 479 ? 13.985  -49.274  3.596   1.00 124.33 ? 479 ASN B O     1 
ATOM   7137  C  CB    . ASN B  1 479 ? 11.390  -51.111  3.834   1.00 126.48 ? 479 ASN B CB    1 
ATOM   7138  C  CG    . ASN B  1 479 ? 12.059  -51.324  5.181   1.00 124.53 ? 479 ASN B CG    1 
ATOM   7139  O  OD1   . ASN B  1 479 ? 11.612  -50.801  6.201   1.00 121.97 ? 479 ASN B OD1   1 
ATOM   7140  N  ND2   . ASN B  1 479 ? 13.129  -52.106  5.191   1.00 125.67 ? 479 ASN B ND2   1 
ATOM   7141  N  N     . GLU B  1 480 ? 13.301  -49.774  1.501   1.00 128.11 ? 480 GLU B N     1 
ATOM   7142  C  CA    . GLU B  1 480 ? 14.605  -49.592  0.855   1.00 128.90 ? 480 GLU B CA    1 
ATOM   7143  C  C     . GLU B  1 480 ? 15.181  -48.181  1.019   1.00 126.51 ? 480 GLU B C     1 
ATOM   7144  O  O     . GLU B  1 480 ? 16.402  -48.022  1.089   1.00 126.50 ? 480 GLU B O     1 
ATOM   7145  C  CB    . GLU B  1 480 ? 14.548  -49.974  -0.636  1.00 132.10 ? 480 GLU B CB    1 
ATOM   7146  C  CG    . GLU B  1 480 ? 13.170  -49.854  -1.293  1.00 132.90 ? 480 GLU B CG    1 
ATOM   7147  C  CD    . GLU B  1 480 ? 12.286  -51.064  -1.023  1.00 134.56 ? 480 GLU B CD    1 
ATOM   7148  O  OE1   . GLU B  1 480 ? 11.048  -50.927  -1.107  1.00 134.74 ? 480 GLU B OE1   1 
ATOM   7149  O  OE2   . GLU B  1 480 ? 12.828  -52.149  -0.721  1.00 136.14 ? 480 GLU B OE2   1 
ATOM   7150  N  N     . LEU B  1 481 ? 14.308  -47.171  1.071   1.00 124.55 ? 481 LEU B N     1 
ATOM   7151  C  CA    . LEU B  1 481 ? 14.742  -45.785  1.276   1.00 122.24 ? 481 LEU B CA    1 
ATOM   7152  C  C     . LEU B  1 481 ? 15.085  -45.563  2.735   1.00 119.49 ? 481 LEU B C     1 
ATOM   7153  O  O     . LEU B  1 481 ? 16.138  -45.007  3.050   1.00 118.61 ? 481 LEU B O     1 
ATOM   7154  C  CB    . LEU B  1 481 ? 13.672  -44.768  0.863   1.00 121.52 ? 481 LEU B CB    1 
ATOM   7155  C  CG    . LEU B  1 481 ? 12.843  -44.852  -0.419  1.00 123.93 ? 481 LEU B CG    1 
ATOM   7156  C  CD1   . LEU B  1 481 ? 12.278  -43.468  -0.699  1.00 122.85 ? 481 LEU B CD1   1 
ATOM   7157  C  CD2   . LEU B  1 481 ? 13.633  -45.364  -1.625  1.00 127.15 ? 481 LEU B CD2   1 
ATOM   7158  N  N     . LEU B  1 482 ? 14.186  -46.007  3.615   1.00 118.18 ? 482 LEU B N     1 
ATOM   7159  C  CA    . LEU B  1 482 ? 14.327  -45.818  5.059   1.00 115.68 ? 482 LEU B CA    1 
ATOM   7160  C  C     . LEU B  1 482 ? 15.591  -46.481  5.599   1.00 115.90 ? 482 LEU B C     1 
ATOM   7161  O  O     . LEU B  1 482 ? 16.142  -46.043  6.614   1.00 114.43 ? 482 LEU B O     1 
ATOM   7162  C  CB    . LEU B  1 482 ? 13.094  -46.341  5.816   1.00 115.06 ? 482 LEU B CB    1 
ATOM   7163  C  CG    . LEU B  1 482 ? 11.655  -45.968  5.418   1.00 114.88 ? 482 LEU B CG    1 
ATOM   7164  C  CD1   . LEU B  1 482 ? 10.681  -46.508  6.461   1.00 113.51 ? 482 LEU B CD1   1 
ATOM   7165  C  CD2   . LEU B  1 482 ? 11.441  -44.463  5.210   1.00 112.99 ? 482 LEU B CD2   1 
ATOM   7166  N  N     . THR B  1 483 ? 16.041  -47.532  4.918   1.00 117.93 ? 483 THR B N     1 
ATOM   7167  C  CA    . THR B  1 483 ? 17.280  -48.217  5.272   1.00 118.66 ? 483 THR B CA    1 
ATOM   7168  C  C     . THR B  1 483 ? 18.499  -47.515  4.662   1.00 119.10 ? 483 THR B C     1 
ATOM   7169  O  O     . THR B  1 483 ? 19.597  -47.565  5.222   1.00 119.04 ? 483 THR B O     1 
ATOM   7170  C  CB    . THR B  1 483 ? 17.221  -49.709  4.875   1.00 121.28 ? 483 THR B CB    1 
ATOM   7171  O  OG1   . THR B  1 483 ? 16.283  -50.377  5.725   1.00 120.60 ? 483 THR B OG1   1 
ATOM   7172  C  CG2   . THR B  1 483 ? 18.582  -50.393  5.013   1.00 122.82 ? 483 THR B CG2   1 
ATOM   7173  N  N     . GLU B  1 484 ? 18.296  -46.846  3.528   1.00 119.65 ? 484 GLU B N     1 
ATOM   7174  C  CA    . GLU B  1 484 ? 19.383  -46.130  2.860   1.00 120.18 ? 484 GLU B CA    1 
ATOM   7175  C  C     . GLU B  1 484 ? 19.681  -44.795  3.543   1.00 117.54 ? 484 GLU B C     1 
ATOM   7176  O  O     . GLU B  1 484 ? 20.840  -44.397  3.650   1.00 117.58 ? 484 GLU B O     1 
ATOM   7177  C  CB    . GLU B  1 484 ? 19.089  -45.937  1.367   1.00 122.21 ? 484 GLU B CB    1 
ATOM   7178  C  CG    . GLU B  1 484 ? 20.335  -46.030  0.480   1.00 124.59 ? 484 GLU B CG    1 
ATOM   7179  C  CD    . GLU B  1 484 ? 20.065  -45.670  -0.970  1.00 126.64 ? 484 GLU B CD    1 
ATOM   7180  O  OE1   . GLU B  1 484 ? 20.681  -44.700  -1.460  1.00 126.65 ? 484 GLU B OE1   1 
ATOM   7181  O  OE2   . GLU B  1 484 ? 19.239  -46.349  -1.617  1.00 128.54 ? 484 GLU B OE2   1 
ATOM   7182  N  N     . ILE B  1 485 ? 18.636  -44.114  4.012   1.00 115.43 ? 485 ILE B N     1 
ATOM   7183  C  CA    . ILE B  1 485 ? 18.804  -42.895  4.810   1.00 113.00 ? 485 ILE B CA    1 
ATOM   7184  C  C     . ILE B  1 485 ? 19.575  -43.199  6.095   1.00 112.00 ? 485 ILE B C     1 
ATOM   7185  O  O     . ILE B  1 485 ? 20.522  -42.487  6.427   1.00 111.53 ? 485 ILE B O     1 
ATOM   7186  C  CB    . ILE B  1 485 ? 17.453  -42.215  5.154   1.00 111.25 ? 485 ILE B CB    1 
ATOM   7187  C  CG1   . ILE B  1 485 ? 16.701  -41.818  3.879   1.00 112.30 ? 485 ILE B CG1   1 
ATOM   7188  C  CG2   . ILE B  1 485 ? 17.677  -40.980  6.025   1.00 109.15 ? 485 ILE B CG2   1 
ATOM   7189  C  CD1   . ILE B  1 485 ? 15.228  -41.490  4.099   1.00 110.95 ? 485 ILE B CD1   1 
ATOM   7190  N  N     . ARG B  1 486 ? 19.177  -44.265  6.793   1.00 111.98 ? 486 ARG B N     1 
ATOM   7191  C  CA    . ARG B  1 486 ? 19.809  -44.682  8.056   1.00 111.40 ? 486 ARG B CA    1 
ATOM   7192  C  C     . ARG B  1 486 ? 21.292  -45.025  7.913   1.00 112.84 ? 486 ARG B C     1 
ATOM   7193  O  O     . ARG B  1 486 ? 22.083  -44.765  8.823   1.00 112.15 ? 486 ARG B O     1 
ATOM   7194  C  CB    . ARG B  1 486 ? 19.071  -45.884  8.661   1.00 111.71 ? 486 ARG B CB    1 
ATOM   7195  C  CG    . ARG B  1 486 ? 19.442  -46.209  10.122  1.00 111.15 ? 486 ARG B CG    1 
ATOM   7196  C  CD    . ARG B  1 486 ? 19.243  -47.689  10.476  1.00 113.11 ? 486 ARG B CD    1 
ATOM   7197  N  NE    . ARG B  1 486 ? 17.947  -48.206  10.033  1.00 114.16 ? 486 ARG B NE    1 
ATOM   7198  C  CZ    . ARG B  1 486 ? 17.765  -48.959  8.948   1.00 116.62 ? 486 ARG B CZ    1 
ATOM   7199  N  NH1   . ARG B  1 486 ? 18.801  -49.304  8.190   1.00 118.55 ? 486 ARG B NH1   1 
ATOM   7200  N  NH2   . ARG B  1 486 ? 16.545  -49.372  8.623   1.00 116.85 ? 486 ARG B NH2   1 
ATOM   7201  N  N     . GLU B  1 487 ? 21.660  -45.606  6.774   1.00 115.05 ? 487 GLU B N     1 
ATOM   7202  C  CA    . GLU B  1 487 ? 23.010  -46.119  6.582   1.00 117.01 ? 487 GLU B CA    1 
ATOM   7203  C  C     . GLU B  1 487 ? 23.925  -45.189  5.778   1.00 117.80 ? 487 GLU B C     1 
ATOM   7204  O  O     . GLU B  1 487 ? 25.124  -45.126  6.049   1.00 118.50 ? 487 GLU B O     1 
ATOM   7205  C  CB    . GLU B  1 487 ? 22.966  -47.533  5.993   1.00 119.59 ? 487 GLU B CB    1 
ATOM   7206  C  CG    . GLU B  1 487 ? 22.521  -48.599  7.006   1.00 119.28 ? 487 GLU B CG    1 
ATOM   7207  C  CD    . GLU B  1 487 ? 22.256  -49.972  6.388   1.00 121.69 ? 487 GLU B CD    1 
ATOM   7208  O  OE1   . GLU B  1 487 ? 22.801  -50.278  5.299   1.00 123.54 ? 487 GLU B OE1   1 
ATOM   7209  O  OE2   . GLU B  1 487 ? 21.501  -50.752  7.011   1.00 121.34 ? 487 GLU B OE2   1 
ATOM   7210  N  N     . LYS B  1 488 ? 23.365  -44.471  4.803   1.00 117.93 ? 488 LYS B N     1 
ATOM   7211  C  CA    . LYS B  1 488 ? 24.115  -43.436  4.072   1.00 118.75 ? 488 LYS B CA    1 
ATOM   7212  C  C     . LYS B  1 488 ? 24.338  -42.177  4.914   1.00 116.64 ? 488 LYS B C     1 
ATOM   7213  O  O     . LYS B  1 488 ? 25.457  -41.661  4.991   1.00 117.20 ? 488 LYS B O     1 
ATOM   7214  C  CB    . LYS B  1 488 ? 23.432  -43.064  2.747   1.00 119.58 ? 488 LYS B CB    1 
ATOM   7215  C  CG    . LYS B  1 488 ? 24.243  -43.418  1.505   1.00 123.17 ? 488 LYS B CG    1 
ATOM   7216  C  CD    . LYS B  1 488 ? 23.573  -42.917  0.220   1.00 124.47 ? 488 LYS B CD    1 
ATOM   7217  C  CE    . LYS B  1 488 ? 24.599  -42.609  -0.882  1.00 126.83 ? 488 LYS B CE    1 
ATOM   7218  N  NZ    . LYS B  1 488 ? 25.440  -43.777  -1.273  1.00 129.14 ? 488 LYS B NZ    1 
ATOM   7219  N  N     . GLY B  1 489 ? 23.268  -41.691  5.541   1.00 114.48 ? 489 GLY B N     1 
ATOM   7220  C  CA    . GLY B  1 489 ? 23.302  -40.435  6.278   1.00 112.44 ? 489 GLY B CA    1 
ATOM   7221  C  C     . GLY B  1 489 ? 23.064  -39.243  5.370   1.00 112.49 ? 489 GLY B C     1 
ATOM   7222  O  O     . GLY B  1 489 ? 22.835  -38.137  5.848   1.00 111.05 ? 489 GLY B O     1 
ATOM   7223  N  N     . GLU B  1 490 ? 23.127  -39.473  4.059   1.00 114.51 ? 490 GLU B N     1 
ATOM   7224  C  CA    . GLU B  1 490 ? 22.924  -38.427  3.054   1.00 115.07 ? 490 GLU B CA    1 
ATOM   7225  C  C     . GLU B  1 490 ? 21.625  -38.665  2.288   1.00 115.32 ? 490 GLU B C     1 
ATOM   7226  O  O     . GLU B  1 490 ? 20.850  -39.575  2.605   1.00 114.97 ? 490 GLU B O     1 
ATOM   7227  C  CB    . GLU B  1 490 ? 24.086  -38.395  2.045   1.00 117.56 ? 490 GLU B CB    1 
ATOM   7228  C  CG    . GLU B  1 490 ? 25.495  -38.320  2.629   1.00 118.76 ? 490 GLU B CG    1 
ATOM   7229  C  CD    . GLU B  1 490 ? 26.559  -38.079  1.562   1.00 121.93 ? 490 GLU B CD    1 
ATOM   7230  O  OE1   . GLU B  1 490 ? 26.747  -36.911  1.149   1.00 122.16 ? 490 GLU B OE1   1 
ATOM   7231  O  OE2   . GLU B  1 490 ? 27.216  -39.058  1.144   1.00 124.22 ? 490 GLU B OE2   1 
ATOM   7232  N  N     . LEU B  1 491 ? 21.399  -37.832  1.277   1.00 116.06 ? 491 LEU B N     1 
ATOM   7233  C  CA    . LEU B  1 491 ? 20.369  -38.080  0.280   1.00 117.15 ? 491 LEU B CA    1 
ATOM   7234  C  C     . LEU B  1 491 ? 20.910  -37.806  -1.121  1.00 119.61 ? 491 LEU B C     1 
ATOM   7235  O  O     . LEU B  1 491 ? 21.090  -36.648  -1.508  1.00 119.63 ? 491 LEU B O     1 
ATOM   7236  C  CB    . LEU B  1 491 ? 19.123  -37.230  0.548   1.00 115.46 ? 491 LEU B CB    1 
ATOM   7237  C  CG    . LEU B  1 491 ? 18.206  -37.618  1.709   1.00 113.46 ? 491 LEU B CG    1 
ATOM   7238  C  CD1   . LEU B  1 491 ? 17.125  -36.573  1.851   1.00 112.50 ? 491 LEU B CD1   1 
ATOM   7239  C  CD2   . LEU B  1 491 ? 17.588  -39.001  1.526   1.00 114.36 ? 491 LEU B CD2   1 
ATOM   7240  N  N     . SER B  1 492 ? 21.184  -38.876  -1.867  1.00 121.87 ? 492 SER B N     1 
ATOM   7241  C  CA    . SER B  1 492 ? 21.549  -38.757  -3.277  1.00 124.67 ? 492 SER B CA    1 
ATOM   7242  C  C     . SER B  1 492 ? 20.325  -38.304  -4.079  1.00 125.18 ? 492 SER B C     1 
ATOM   7243  O  O     . SER B  1 492 ? 19.190  -38.537  -3.657  1.00 123.95 ? 492 SER B O     1 
ATOM   7244  C  CB    . SER B  1 492 ? 22.108  -40.085  -3.812  1.00 127.25 ? 492 SER B CB    1 
ATOM   7245  O  OG    . SER B  1 492 ? 21.183  -41.151  -3.672  1.00 127.18 ? 492 SER B OG    1 
ATOM   7246  N  N     . LYS B  1 493 ? 20.554  -37.646  -5.219  1.00 127.15 ? 493 LYS B N     1 
ATOM   7247  C  CA    . LYS B  1 493 ? 19.458  -37.139  -6.062  1.00 127.99 ? 493 LYS B CA    1 
ATOM   7248  C  C     . LYS B  1 493 ? 18.532  -38.274  -6.518  1.00 129.60 ? 493 LYS B C     1 
ATOM   7249  O  O     . LYS B  1 493 ? 17.325  -38.066  -6.692  1.00 129.31 ? 493 LYS B O     1 
ATOM   7250  C  CB    . LYS B  1 493 ? 19.991  -36.334  -7.260  1.00 130.11 ? 493 LYS B CB    1 
ATOM   7251  C  CG    . LYS B  1 493 ? 21.074  -35.316  -6.896  1.00 129.23 ? 493 LYS B CG    1 
ATOM   7252  C  CD    . LYS B  1 493 ? 21.057  -34.060  -7.769  1.00 129.88 ? 493 LYS B CD    1 
ATOM   7253  C  CE    . LYS B  1 493 ? 22.053  -33.024  -7.232  1.00 128.49 ? 493 LYS B CE    1 
ATOM   7254  N  NZ    . LYS B  1 493 ? 21.799  -31.640  -7.724  1.00 128.29 ? 493 LYS B NZ    1 
ATOM   7255  N  N     . GLU B  1 494 ? 19.112  -39.467  -6.687  1.00 131.45 ? 494 GLU B N     1 
ATOM   7256  C  CA    . GLU B  1 494 ? 18.374  -40.702  -6.982  1.00 133.12 ? 494 GLU B CA    1 
ATOM   7257  C  C     . GLU B  1 494 ? 17.473  -41.144  -5.831  1.00 130.90 ? 494 GLU B C     1 
ATOM   7258  O  O     . GLU B  1 494 ? 16.421  -41.744  -6.058  1.00 131.65 ? 494 GLU B O     1 
ATOM   7259  C  CB    . GLU B  1 494 ? 19.331  -41.853  -7.316  1.00 135.51 ? 494 GLU B CB    1 
ATOM   7260  C  CG    . GLU B  1 494 ? 19.854  -41.875  -8.748  1.00 139.04 ? 494 GLU B CG    1 
ATOM   7261  C  CD    . GLU B  1 494 ? 21.342  -41.570  -8.852  1.00 139.77 ? 494 GLU B CD    1 
ATOM   7262  O  OE1   . GLU B  1 494 ? 21.979  -41.236  -7.828  1.00 137.56 ? 494 GLU B OE1   1 
ATOM   7263  O  OE2   . GLU B  1 494 ? 21.881  -41.678  -9.972  1.00 142.74 ? 494 GLU B OE2   1 
ATOM   7264  N  N     . LEU B  1 495 ? 17.907  -40.875  -4.601  1.00 128.54 ? 495 LEU B N     1 
ATOM   7265  C  CA    . LEU B  1 495 ? 17.127  -41.202  -3.406  1.00 126.46 ? 495 LEU B CA    1 
ATOM   7266  C  C     . LEU B  1 495 ? 16.196  -40.047  -3.038  1.00 124.62 ? 495 LEU B C     1 
ATOM   7267  O  O     . LEU B  1 495 ? 15.191  -40.240  -2.350  1.00 123.15 ? 495 LEU B O     1 
ATOM   7268  C  CB    . LEU B  1 495 ? 18.060  -41.543  -2.237  1.00 124.89 ? 495 LEU B CB    1 
ATOM   7269  C  CG    . LEU B  1 495 ? 17.509  -42.279  -1.009  1.00 123.20 ? 495 LEU B CG    1 
ATOM   7270  C  CD1   . LEU B  1 495 ? 16.983  -43.668  -1.357  1.00 125.27 ? 495 LEU B CD1   1 
ATOM   7271  C  CD2   . LEU B  1 495 ? 18.592  -42.376  0.050   1.00 122.14 ? 495 LEU B CD2   1 
ATOM   7272  N  N     . LEU B  1 496 ? 16.545  -38.853  -3.515  1.00 125.06 ? 496 LEU B N     1 
ATOM   7273  C  CA    . LEU B  1 496 ? 15.755  -37.642  -3.301  1.00 124.05 ? 496 LEU B CA    1 
ATOM   7274  C  C     . LEU B  1 496 ? 14.517  -37.650  -4.202  1.00 125.97 ? 496 LEU B C     1 
ATOM   7275  O  O     . LEU B  1 496 ? 13.404  -37.358  -3.750  1.00 124.90 ? 496 LEU B O     1 
ATOM   7276  C  CB    . LEU B  1 496 ? 16.610  -36.389  -3.559  1.00 123.83 ? 496 LEU B CB    1 
ATOM   7277  C  CG    . LEU B  1 496 ? 16.221  -35.075  -2.869  1.00 121.44 ? 496 LEU B CG    1 
ATOM   7278  C  CD1   . LEU B  1 496 ? 16.774  -34.999  -1.448  1.00 118.30 ? 496 LEU B CD1   1 
ATOM   7279  C  CD2   . LEU B  1 496 ? 16.700  -33.891  -3.692  1.00 122.24 ? 496 LEU B CD2   1 
ATOM   7280  N  N     . ALA B  1 497 ? 14.717  -37.992  -5.472  1.00 129.18 ? 497 ALA B N     1 
ATOM   7281  C  CA    . ALA B  1 497 ? 13.608  -38.174  -6.399  1.00 131.70 ? 497 ALA B CA    1 
ATOM   7282  C  C     . ALA B  1 497 ? 12.781  -39.431  -6.066  1.00 132.39 ? 497 ALA B C     1 
ATOM   7283  O  O     . ALA B  1 497 ? 11.596  -39.509  -6.413  1.00 133.45 ? 497 ALA B O     1 
ATOM   7284  C  CB    . ALA B  1 497 ? 14.119  -38.221  -7.828  1.00 134.82 ? 497 ALA B CB    1 
ATOM   7285  N  N     . SER B  1 498 ? 13.408  -40.403  -5.395  1.00 132.19 ? 498 SER B N     1 
ATOM   7286  C  CA    . SER B  1 498 ? 12.734  -41.630  -4.939  1.00 132.66 ? 498 SER B CA    1 
ATOM   7287  C  C     . SER B  1 498 ? 11.754  -41.306  -3.813  1.00 130.36 ? 498 SER B C     1 
ATOM   7288  O  O     . SER B  1 498 ? 10.613  -41.775  -3.808  1.00 130.81 ? 498 SER B O     1 
ATOM   7289  C  CB    . SER B  1 498 ? 13.763  -42.669  -4.470  1.00 132.77 ? 498 SER B CB    1 
ATOM   7290  O  OG    . SER B  1 498 ? 13.227  -43.983  -4.478  1.00 134.33 ? 498 SER B OG    1 
ATOM   7291  N  N     . LEU B  1 499 ? 12.225  -40.496  -2.867  1.00 128.23 ? 499 LEU B N     1 
ATOM   7292  C  CA    . LEU B  1 499 ? 11.400  -39.935  -1.801  1.00 126.30 ? 499 LEU B CA    1 
ATOM   7293  C  C     . LEU B  1 499 ? 10.279  -39.057  -2.381  1.00 127.03 ? 499 LEU B C     1 
ATOM   7294  O  O     . LEU B  1 499 ? 9.105   -39.260  -2.062  1.00 126.97 ? 499 LEU B O     1 
ATOM   7295  C  CB    . LEU B  1 499 ? 12.284  -39.134  -0.832  1.00 124.07 ? 499 LEU B CB    1 
ATOM   7296  C  CG    . LEU B  1 499 ? 11.841  -38.884  0.617   1.00 121.93 ? 499 LEU B CG    1 
ATOM   7297  C  CD1   . LEU B  1 499 ? 11.819  -40.172  1.444   1.00 121.80 ? 499 LEU B CD1   1 
ATOM   7298  C  CD2   . LEU B  1 499 ? 12.750  -37.847  1.273   1.00 120.35 ? 499 LEU B CD2   1 
ATOM   7299  N  N     . LYS B  1 500 ? 10.651  -38.102  -3.238  1.00 128.04 ? 500 LYS B N     1 
ATOM   7300  C  CA    . LYS B  1 500 ? 9.705   -37.247  -3.970  1.00 129.33 ? 500 LYS B CA    1 
ATOM   7301  C  C     . LYS B  1 500 ? 8.489   -38.027  -4.493  1.00 131.30 ? 500 LYS B C     1 
ATOM   7302  O  O     . LYS B  1 500 ? 7.349   -37.687  -4.165  1.00 131.05 ? 500 LYS B O     1 
ATOM   7303  C  CB    . LYS B  1 500 ? 10.422  -36.544  -5.132  1.00 131.07 ? 500 LYS B CB    1 
ATOM   7304  C  CG    . LYS B  1 500 ? 9.738   -35.289  -5.683  1.00 131.88 ? 500 LYS B CG    1 
ATOM   7305  C  CD    . LYS B  1 500 ? 10.600  -34.660  -6.782  1.00 133.71 ? 500 LYS B CD    1 
ATOM   7306  C  CE    . LYS B  1 500 ? 10.349  -33.166  -6.944  1.00 133.29 ? 500 LYS B CE    1 
ATOM   7307  N  NZ    . LYS B  1 500 ? 9.083   -32.876  -7.664  1.00 134.77 ? 500 LYS B NZ    1 
ATOM   7308  N  N     . SER B  1 501 ? 8.739   -39.071  -5.288  1.00 133.44 ? 501 SER B N     1 
ATOM   7309  C  CA    . SER B  1 501 ? 7.670   -39.899  -5.861  1.00 135.67 ? 501 SER B CA    1 
ATOM   7310  C  C     . SER B  1 501 ? 6.768   -40.486  -4.777  1.00 134.20 ? 501 SER B C     1 
ATOM   7311  O  O     . SER B  1 501 ? 5.553   -40.277  -4.792  1.00 134.74 ? 501 SER B O     1 
ATOM   7312  C  CB    . SER B  1 501 ? 8.246   -41.017  -6.741  1.00 138.30 ? 501 SER B CB    1 
ATOM   7313  O  OG    . SER B  1 501 ? 7.213   -41.749  -7.391  1.00 140.89 ? 501 SER B OG    1 
ATOM   7314  N  N     . ALA B  1 502 ? 7.377   -41.195  -3.830  1.00 132.41 ? 502 ALA B N     1 
ATOM   7315  C  CA    . ALA B  1 502 ? 6.649   -41.798  -2.720  1.00 131.06 ? 502 ALA B CA    1 
ATOM   7316  C  C     . ALA B  1 502 ? 5.849   -40.780  -1.899  1.00 129.15 ? 502 ALA B C     1 
ATOM   7317  O  O     . ALA B  1 502 ? 4.913   -41.159  -1.195  1.00 128.89 ? 502 ALA B O     1 
ATOM   7318  C  CB    . ALA B  1 502 ? 7.601   -42.580  -1.827  1.00 129.57 ? 502 ALA B CB    1 
ATOM   7319  N  N     . THR B  1 503 ? 6.212   -39.498  -1.993  1.00 128.14 ? 503 THR B N     1 
ATOM   7320  C  CA    . THR B  1 503 ? 5.492   -38.431  -1.277  1.00 126.56 ? 503 THR B CA    1 
ATOM   7321  C  C     . THR B  1 503 ? 4.194   -38.047  -2.001  1.00 128.47 ? 503 THR B C     1 
ATOM   7322  O  O     . THR B  1 503 ? 3.125   -38.013  -1.384  1.00 128.11 ? 503 THR B O     1 
ATOM   7323  C  CB    . THR B  1 503 ? 6.364   -37.153  -1.039  1.00 124.98 ? 503 THR B CB    1 
ATOM   7324  O  OG1   . THR B  1 503 ? 7.696   -37.519  -0.659  1.00 123.68 ? 503 THR B OG1   1 
ATOM   7325  C  CG2   . THR B  1 503 ? 5.757   -36.274  0.053   1.00 122.94 ? 503 THR B CG2   1 
ATOM   7326  N  N     . GLU B  1 504 ? 4.299   -37.762  -3.302  1.00 130.45 ? 504 GLU B N     1 
ATOM   7327  C  CA    . GLU B  1 504 ? 3.146   -37.398  -4.129  1.00 132.70 ? 504 GLU B CA    1 
ATOM   7328  C  C     . GLU B  1 504 ? 2.225   -38.599  -4.280  1.00 134.43 ? 504 GLU B C     1 
ATOM   7329  O  O     . GLU B  1 504 ? 1.006   -38.452  -4.398  1.00 135.75 ? 504 GLU B O     1 
ATOM   7330  C  CB    . GLU B  1 504 ? 3.592   -36.946  -5.518  1.00 134.86 ? 504 GLU B CB    1 
ATOM   7331  C  CG    . GLU B  1 504 ? 4.824   -36.063  -5.548  1.00 133.73 ? 504 GLU B CG    1 
ATOM   7332  C  CD    . GLU B  1 504 ? 5.620   -36.205  -6.841  1.00 136.33 ? 504 GLU B CD    1 
ATOM   7333  O  OE1   . GLU B  1 504 ? 5.516   -37.257  -7.514  1.00 138.09 ? 504 GLU B OE1   1 
ATOM   7334  O  OE2   . GLU B  1 504 ? 6.366   -35.262  -7.180  1.00 136.72 ? 504 GLU B OE2   1 
ATOM   7335  N  N     . SER B  1 505 ? 2.837   -39.782  -4.292  1.00 134.63 ? 505 SER B N     1 
ATOM   7336  C  CA    . SER B  1 505 ? 2.131   -41.058  -4.313  1.00 136.17 ? 505 SER B CA    1 
ATOM   7337  C  C     . SER B  1 505 ? 1.213   -41.210  -3.093  1.00 134.72 ? 505 SER B C     1 
ATOM   7338  O  O     . SER B  1 505 ? 0.056   -41.597  -3.233  1.00 136.52 ? 505 SER B O     1 
ATOM   7339  C  CB    . SER B  1 505 ? 3.144   -42.207  -4.409  1.00 136.39 ? 505 SER B CB    1 
ATOM   7340  O  OG    . SER B  1 505 ? 2.655   -43.408  -3.845  1.00 136.89 ? 505 SER B OG    1 
ATOM   7341  N  N     . PHE B  1 506 ? 1.725   -40.885  -1.908  1.00 131.79 ? 506 PHE B N     1 
ATOM   7342  C  CA    . PHE B  1 506 ? 0.925   -40.942  -0.682  1.00 130.41 ? 506 PHE B CA    1 
ATOM   7343  C  C     . PHE B  1 506 ? -0.059  -39.770  -0.560  1.00 130.47 ? 506 PHE B C     1 
ATOM   7344  O  O     . PHE B  1 506 ? -1.115  -39.909  0.056   1.00 130.70 ? 506 PHE B O     1 
ATOM   7345  C  CB    . PHE B  1 506 ? 1.821   -41.038  0.563   1.00 127.51 ? 506 PHE B CB    1 
ATOM   7346  C  CG    . PHE B  1 506 ? 1.062   -41.294  1.836   1.00 126.42 ? 506 PHE B CG    1 
ATOM   7347  C  CD1   . PHE B  1 506 ? 0.621   -42.577  2.153   1.00 127.23 ? 506 PHE B CD1   1 
ATOM   7348  C  CD2   . PHE B  1 506 ? 0.774   -40.249  2.712   1.00 124.85 ? 506 PHE B CD2   1 
ATOM   7349  C  CE1   . PHE B  1 506 ? -0.091  -42.815  3.325   1.00 126.48 ? 506 PHE B CE1   1 
ATOM   7350  C  CE2   . PHE B  1 506 ? 0.061   -40.475  3.888   1.00 124.01 ? 506 PHE B CE2   1 
ATOM   7351  C  CZ    . PHE B  1 506 ? -0.372  -41.760  4.194   1.00 124.95 ? 506 PHE B CZ    1 
ATOM   7352  N  N     . VAL B  1 507 ? 0.292   -38.623  -1.141  1.00 130.48 ? 507 VAL B N     1 
ATOM   7353  C  CA    . VAL B  1 507 ? -0.581  -37.440  -1.148  1.00 130.93 ? 507 VAL B CA    1 
ATOM   7354  C  C     . VAL B  1 507 ? -1.883  -37.709  -1.918  1.00 133.89 ? 507 VAL B C     1 
ATOM   7355  O  O     . VAL B  1 507 ? -2.972  -37.359  -1.451  1.00 134.43 ? 507 VAL B O     1 
ATOM   7356  C  CB    . VAL B  1 507 ? 0.153   -36.180  -1.709  1.00 130.72 ? 507 VAL B CB    1 
ATOM   7357  C  CG1   . VAL B  1 507 ? -0.835  -35.063  -2.069  1.00 132.28 ? 507 VAL B CG1   1 
ATOM   7358  C  CG2   . VAL B  1 507 ? 1.194   -35.668  -0.712  1.00 127.76 ? 507 VAL B CG2   1 
ATOM   7359  N  N     . ALA B  1 508 ? -1.759  -38.344  -3.084  1.00 136.01 ? 508 ALA B N     1 
ATOM   7360  C  CA    . ALA B  1 508 ? -2.909  -38.745  -3.898  1.00 139.12 ? 508 ALA B CA    1 
ATOM   7361  C  C     . ALA B  1 508 ? -3.879  -39.663  -3.143  1.00 139.40 ? 508 ALA B C     1 
ATOM   7362  O  O     . ALA B  1 508 ? -5.035  -39.818  -3.540  1.00 141.89 ? 508 ALA B O     1 
ATOM   7363  C  CB    . ALA B  1 508 ? -2.436  -39.414  -5.185  1.00 141.41 ? 508 ALA B CB    1 
ATOM   7364  N  N     . THR B  1 509 ? -3.399  -40.260  -2.053  1.00 137.02 ? 509 THR B N     1 
ATOM   7365  C  CA    . THR B  1 509 ? -4.198  -41.175  -1.239  1.00 137.20 ? 509 THR B CA    1 
ATOM   7366  C  C     . THR B  1 509 ? -4.213  -40.807  0.256   1.00 134.46 ? 509 THR B C     1 
ATOM   7367  O  O     . THR B  1 509 ? -3.355  -41.249  1.028   1.00 132.35 ? 509 THR B O     1 
ATOM   7368  C  CB    . THR B  1 509 ? -3.770  -42.667  -1.449  1.00 137.96 ? 509 THR B CB    1 
ATOM   7369  O  OG1   . THR B  1 509 ? -4.478  -43.510  -0.533  1.00 138.04 ? 509 THR B OG1   1 
ATOM   7370  C  CG2   . THR B  1 509 ? -2.265  -42.867  -1.250  1.00 135.61 ? 509 THR B CG2   1 
ATOM   7371  N  N     . PHE B  1 510 ? -5.192  -39.995  0.654   1.00 134.74 ? 510 PHE B N     1 
ATOM   7372  C  CA    . PHE B  1 510 ? -5.385  -39.664  2.065   1.00 132.69 ? 510 PHE B CA    1 
ATOM   7373  C  C     . PHE B  1 510 ? -6.810  -39.200  2.351   1.00 134.21 ? 510 PHE B C     1 
ATOM   7374  O  O     . PHE B  1 510 ? -7.325  -38.302  1.690   1.00 135.67 ? 510 PHE B O     1 
ATOM   7375  C  CB    . PHE B  1 510 ? -4.360  -38.617  2.532   1.00 130.11 ? 510 PHE B CB    1 
ATOM   7376  C  CG    . PHE B  1 510 ? -4.236  -38.508  4.033   1.00 128.17 ? 510 PHE B CG    1 
ATOM   7377  C  CD1   . PHE B  1 510 ? -3.860  -39.609  4.801   1.00 127.45 ? 510 PHE B CD1   1 
ATOM   7378  C  CD2   . PHE B  1 510 ? -4.484  -37.300  4.676   1.00 127.60 ? 510 PHE B CD2   1 
ATOM   7379  C  CE1   . PHE B  1 510 ? -3.748  -39.513  6.187   1.00 125.73 ? 510 PHE B CE1   1 
ATOM   7380  C  CE2   . PHE B  1 510 ? -4.371  -37.191  6.062   1.00 126.24 ? 510 PHE B CE2   1 
ATOM   7381  C  CZ    . PHE B  1 510 ? -4.004  -38.300  6.818   1.00 125.18 ? 510 PHE B CZ    1 
ATOM   7382  N  N     . ASN C  1 26  ? 64.284  6.649    67.438  1.00 112.53 ? 26  ASN C N     1 
ATOM   7383  C  CA    . ASN C  1 26  ? 63.500  7.910    67.318  1.00 109.36 ? 26  ASN C CA    1 
ATOM   7384  C  C     . ASN C  1 26  ? 62.480  7.804    66.201  1.00 103.51 ? 26  ASN C C     1 
ATOM   7385  O  O     . ASN C  1 26  ? 62.834  7.656    65.029  1.00 101.64 ? 26  ASN C O     1 
ATOM   7386  C  CB    . ASN C  1 26  ? 64.432  9.116    67.103  1.00 111.37 ? 26  ASN C CB    1 
ATOM   7387  C  CG    . ASN C  1 26  ? 63.685  10.400   66.703  1.00 108.76 ? 26  ASN C CG    1 
ATOM   7388  O  OD1   . ASN C  1 26  ? 62.506  10.597   67.027  1.00 106.47 ? 26  ASN C OD1   1 
ATOM   7389  N  ND2   . ASN C  1 26  ? 64.392  11.287   66.004  1.00 110.16 ? 26  ASN C ND2   1 
ATOM   7390  N  N     . LEU C  1 27  ? 61.211  7.899    66.583  1.00 101.07 ? 27  LEU C N     1 
ATOM   7391  C  CA    . LEU C  1 27  ? 60.106  7.697    65.659  1.00 95.90  ? 27  LEU C CA    1 
ATOM   7392  C  C     . LEU C  1 27  ? 59.241  8.943    65.475  1.00 93.35  ? 27  LEU C C     1 
ATOM   7393  O  O     . LEU C  1 27  ? 58.150  8.864    64.923  1.00 90.31  ? 27  LEU C O     1 
ATOM   7394  C  CB    . LEU C  1 27  ? 59.266  6.507    66.112  1.00 95.65  ? 27  LEU C CB    1 
ATOM   7395  C  CG    . LEU C  1 27  ? 60.010  5.173    66.045  1.00 97.20  ? 27  LEU C CG    1 
ATOM   7396  C  CD1   . LEU C  1 27  ? 59.303  4.113    66.874  1.00 98.64  ? 27  LEU C CD1   1 
ATOM   7397  C  CD2   . LEU C  1 27  ? 60.192  4.726    64.603  1.00 93.20  ? 27  LEU C CD2   1 
ATOM   7398  N  N     . ASN C  1 28  ? 59.746  10.091   65.918  1.00 95.13  ? 28  ASN C N     1 
ATOM   7399  C  CA    . ASN C  1 28  ? 59.066  11.372   65.730  1.00 93.39  ? 28  ASN C CA    1 
ATOM   7400  C  C     . ASN C  1 28  ? 58.988  11.820   64.270  1.00 90.46  ? 28  ASN C C     1 
ATOM   7401  O  O     . ASN C  1 28  ? 57.947  12.300   63.807  1.00 87.93  ? 28  ASN C O     1 
ATOM   7402  C  CB    . ASN C  1 28  ? 59.765  12.463   66.544  1.00 96.78  ? 28  ASN C CB    1 
ATOM   7403  C  CG    . ASN C  1 28  ? 59.586  12.290   68.035  1.00 99.71  ? 28  ASN C CG    1 
ATOM   7404  O  OD1   . ASN C  1 28  ? 58.795  11.466   68.495  1.00 98.83  ? 28  ASN C OD1   1 
ATOM   7405  N  ND2   . ASN C  1 28  ? 60.327  13.077   68.804  1.00 103.38 ? 28  ASN C ND2   1 
ATOM   7406  N  N     . GLU C  1 29  ? 60.100  11.669   63.556  1.00 91.42  ? 29  GLU C N     1 
ATOM   7407  C  CA    . GLU C  1 29  ? 60.232  12.179   62.190  1.00 89.69  ? 29  GLU C CA    1 
ATOM   7408  C  C     . GLU C  1 29  ? 60.147  11.063   61.158  1.00 87.52  ? 29  GLU C C     1 
ATOM   7409  O  O     . GLU C  1 29  ? 59.926  11.313   59.973  1.00 85.68  ? 29  GLU C O     1 
ATOM   7410  C  CB    . GLU C  1 29  ? 61.558  12.937   62.040  1.00 92.85  ? 29  GLU C CB    1 
ATOM   7411  C  CG    . GLU C  1 29  ? 61.693  14.135   62.963  1.00 95.56  ? 29  GLU C CG    1 
ATOM   7412  C  CD    . GLU C  1 29  ? 60.589  15.148   62.741  1.00 94.71  ? 29  GLU C CD    1 
ATOM   7413  O  OE1   . GLU C  1 29  ? 60.447  15.617   61.588  1.00 94.02  ? 29  GLU C OE1   1 
ATOM   7414  O  OE2   . GLU C  1 29  ? 59.859  15.467   63.710  1.00 95.17  ? 29  GLU C OE2   1 
ATOM   7415  N  N     . THR C  1 30  ? 60.332  9.833    61.624  1.00 88.20  ? 30  THR C N     1 
ATOM   7416  C  CA    . THR C  1 30  ? 60.404  8.671    60.753  1.00 87.10  ? 30  THR C CA    1 
ATOM   7417  C  C     . THR C  1 30  ? 59.570  7.545    61.320  1.00 86.24  ? 30  THR C C     1 
ATOM   7418  O  O     . THR C  1 30  ? 59.515  7.355    62.538  1.00 88.16  ? 30  THR C O     1 
ATOM   7419  C  CB    . THR C  1 30  ? 61.862  8.143    60.569  1.00 90.13  ? 30  THR C CB    1 
ATOM   7420  O  OG1   . THR C  1 30  ? 62.395  7.723    61.833  1.00 93.45  ? 30  THR C OG1   1 
ATOM   7421  C  CG2   . THR C  1 30  ? 62.775  9.204    59.958  1.00 91.68  ? 30  THR C CG2   1 
ATOM   7422  N  N     . GLY C  1 31  ? 58.934  6.799    60.425  1.00 83.77  ? 31  GLY C N     1 
ATOM   7423  C  CA    . GLY C  1 31  ? 58.210  5.600    60.803  1.00 83.56  ? 31  GLY C CA    1 
ATOM   7424  C  C     . GLY C  1 31  ? 58.601  4.449    59.908  1.00 83.50  ? 31  GLY C C     1 
ATOM   7425  O  O     . GLY C  1 31  ? 58.994  4.668    58.769  1.00 82.79  ? 31  GLY C O     1 
ATOM   7426  N  N     . ARG C  1 32  ? 58.519  3.227    60.430  1.00 84.97  ? 32  ARG C N     1 
ATOM   7427  C  CA    . ARG C  1 32  ? 58.750  2.026    59.631  1.00 85.11  ? 32  ARG C CA    1 
ATOM   7428  C  C     . ARG C  1 32  ? 57.404  1.564    59.090  1.00 82.19  ? 32  ARG C C     1 
ATOM   7429  O  O     . ARG C  1 32  ? 56.362  1.979    59.602  1.00 81.04  ? 32  ARG C O     1 
ATOM   7430  C  CB    . ARG C  1 32  ? 59.391  0.918    60.470  1.00 88.99  ? 32  ARG C CB    1 
ATOM   7431  C  CG    . ARG C  1 32  ? 58.403  0.222    61.399  1.00 91.18  ? 32  ARG C CG    1 
ATOM   7432  C  CD    . ARG C  1 32  ? 59.005  -0.975   62.091  1.00 98.07  ? 32  ARG C CD    1 
ATOM   7433  N  NE    . ARG C  1 32  ? 58.123  -1.438   63.161  1.00 101.85 ? 32  ARG C NE    1 
ATOM   7434  C  CZ    . ARG C  1 32  ? 58.536  -2.055   64.268  1.00 108.07 ? 32  ARG C CZ    1 
ATOM   7435  N  NH1   . ARG C  1 32  ? 59.833  -2.294   64.470  1.00 111.76 ? 32  ARG C NH1   1 
ATOM   7436  N  NH2   . ARG C  1 32  ? 57.647  -2.429   65.185  1.00 110.18 ? 32  ARG C NH2   1 
ATOM   7437  N  N     . VAL C  1 33  ? 57.424  0.700    58.073  1.00 81.27  ? 33  VAL C N     1 
ATOM   7438  C  CA    . VAL C  1 33  ? 56.190  0.233    57.421  1.00 78.77  ? 33  VAL C CA    1 
ATOM   7439  C  C     . VAL C  1 33  ? 55.599  -1.020   58.086  1.00 79.90  ? 33  VAL C C     1 
ATOM   7440  O  O     . VAL C  1 33  ? 56.227  -2.078   58.117  1.00 81.88  ? 33  VAL C O     1 
ATOM   7441  C  CB    . VAL C  1 33  ? 56.402  -0.003   55.896  1.00 77.82  ? 33  VAL C CB    1 
ATOM   7442  C  CG1   . VAL C  1 33  ? 55.101  -0.460   55.219  1.00 76.22  ? 33  VAL C CG1   1 
ATOM   7443  C  CG2   . VAL C  1 33  ? 56.943  1.256    55.223  1.00 76.56  ? 33  VAL C CG2   1 
ATOM   7444  N  N     . LEU C  1 34  ? 54.386  -0.891   58.611  1.00 78.83  ? 34  LEU C N     1 
ATOM   7445  C  CA    . LEU C  1 34  ? 53.693  -2.027   59.222  1.00 80.66  ? 34  LEU C CA    1 
ATOM   7446  C  C     . LEU C  1 34  ? 53.061  -3.020   58.224  1.00 80.10  ? 34  LEU C C     1 
ATOM   7447  O  O     . LEU C  1 34  ? 53.202  -4.234   58.401  1.00 82.60  ? 34  LEU C O     1 
ATOM   7448  C  CB    . LEU C  1 34  ? 52.662  -1.548   60.252  1.00 81.00  ? 34  LEU C CB    1 
ATOM   7449  C  CG    . LEU C  1 34  ? 53.085  -1.601   61.723  1.00 84.18  ? 34  LEU C CG    1 
ATOM   7450  C  CD1   . LEU C  1 34  ? 52.077  -0.878   62.586  1.00 84.84  ? 34  LEU C CD1   1 
ATOM   7451  C  CD2   . LEU C  1 34  ? 53.244  -3.043   62.199  1.00 87.89  ? 34  LEU C CD2   1 
ATOM   7452  N  N     . ALA C  1 35  ? 52.359  -2.505   57.205  1.00 77.26  ? 35  ALA C N     1 
ATOM   7453  C  CA    . ALA C  1 35  ? 51.783  -3.319   56.117  1.00 76.57  ? 35  ALA C CA    1 
ATOM   7454  C  C     . ALA C  1 35  ? 51.421  -2.457   54.906  1.00 74.04  ? 35  ALA C C     1 
ATOM   7455  O  O     . ALA C  1 35  ? 50.993  -1.313   55.072  1.00 72.47  ? 35  ALA C O     1 
ATOM   7456  C  CB    . ALA C  1 35  ? 50.569  -4.069   56.599  1.00 77.95  ? 35  ALA C CB    1 
ATOM   7457  N  N     . VAL C  1 36  ? 51.583  -3.010   53.698  1.00 74.02  ? 36  VAL C N     1 
ATOM   7458  C  CA    . VAL C  1 36  ? 51.326  -2.264   52.444  1.00 72.44  ? 36  VAL C CA    1 
ATOM   7459  C  C     . VAL C  1 36  ? 50.590  -3.055   51.354  1.00 72.97  ? 36  VAL C C     1 
ATOM   7460  O  O     . VAL C  1 36  ? 51.013  -4.141   50.948  1.00 74.31  ? 36  VAL C O     1 
ATOM   7461  C  CB    . VAL C  1 36  ? 52.624  -1.565   51.867  1.00 72.33  ? 36  VAL C CB    1 
ATOM   7462  C  CG1   . VAL C  1 36  ? 53.737  -2.578   51.504  1.00 73.81  ? 36  VAL C CG1   1 
ATOM   7463  C  CG2   . VAL C  1 36  ? 52.285  -0.655   50.678  1.00 71.16  ? 36  VAL C CG2   1 
ATOM   7464  N  N     . GLY C  1 37  ? 49.483  -2.482   50.888  1.00 72.44  ? 37  GLY C N     1 
ATOM   7465  C  CA    . GLY C  1 37  ? 48.640  -3.089   49.859  1.00 73.36  ? 37  GLY C CA    1 
ATOM   7466  C  C     . GLY C  1 37  ? 47.603  -2.133   49.290  1.00 72.85  ? 37  GLY C C     1 
ATOM   7467  O  O     . GLY C  1 37  ? 46.951  -1.382   50.036  1.00 72.01  ? 37  GLY C O     1 
ATOM   7468  N  N     . ASP C  1 38  ? 47.469  -2.169   47.961  1.00 73.60  ? 38  ASP C N     1 
ATOM   7469  C  CA    . ASP C  1 38  ? 46.464  -1.407   47.201  1.00 74.03  ? 38  ASP C CA    1 
ATOM   7470  C  C     . ASP C  1 38  ? 46.562  0.106    47.389  1.00 73.03  ? 38  ASP C C     1 
ATOM   7471  O  O     . ASP C  1 38  ? 45.551  0.779    47.624  1.00 73.27  ? 38  ASP C O     1 
ATOM   7472  C  CB    . ASP C  1 38  ? 45.044  -1.889   47.523  1.00 75.04  ? 38  ASP C CB    1 
ATOM   7473  C  CG    . ASP C  1 38  ? 44.864  -3.368   47.296  1.00 76.26  ? 38  ASP C CG    1 
ATOM   7474  O  OD1   . ASP C  1 38  ? 44.733  -3.776   46.129  1.00 77.62  ? 38  ASP C OD1   1 
ATOM   7475  O  OD2   . ASP C  1 38  ? 44.833  -4.125   48.285  1.00 76.01  ? 38  ASP C OD2   1 
ATOM   7476  N  N     . GLY C  1 39  ? 47.781  0.635    47.283  1.00 72.44  ? 39  GLY C N     1 
ATOM   7477  C  CA    . GLY C  1 39  ? 48.011  2.084    47.353  1.00 71.89  ? 39  GLY C CA    1 
ATOM   7478  C  C     . GLY C  1 39  ? 47.760  2.666    48.730  1.00 70.56  ? 39  GLY C C     1 
ATOM   7479  O  O     . GLY C  1 39  ? 47.585  3.879    48.887  1.00 70.39  ? 39  GLY C O     1 
ATOM   7480  N  N     . ILE C  1 40  ? 47.730  1.780    49.720  1.00 70.09  ? 40  ILE C N     1 
ATOM   7481  C  CA    . ILE C  1 40  ? 47.585  2.147    51.113  1.00 69.32  ? 40  ILE C CA    1 
ATOM   7482  C  C     . ILE C  1 40  ? 48.778  1.559    51.851  1.00 69.26  ? 40  ILE C C     1 
ATOM   7483  O  O     . ILE C  1 40  ? 49.235  0.461    51.530  1.00 70.35  ? 40  ILE C O     1 
ATOM   7484  C  CB    . ILE C  1 40  ? 46.270  1.575    51.703  1.00 70.18  ? 40  ILE C CB    1 
ATOM   7485  C  CG1   . ILE C  1 40  ? 45.040  2.092    50.933  1.00 70.41  ? 40  ILE C CG1   1 
ATOM   7486  C  CG2   . ILE C  1 40  ? 46.162  1.861    53.210  1.00 70.27  ? 40  ILE C CG2   1 
ATOM   7487  C  CD1   . ILE C  1 40  ? 44.786  3.592    51.023  1.00 68.43  ? 40  ILE C CD1   1 
ATOM   7488  N  N     . ALA C  1 41  ? 49.297  2.295    52.826  1.00 68.62  ? 41  ALA C N     1 
ATOM   7489  C  CA    . ALA C  1 41  ? 50.394  1.797    53.642  1.00 68.83  ? 41  ALA C CA    1 
ATOM   7490  C  C     . ALA C  1 41  ? 50.155  2.104    55.119  1.00 69.31  ? 41  ALA C C     1 
ATOM   7491  O  O     . ALA C  1 41  ? 49.843  3.243    55.495  1.00 68.65  ? 41  ALA C O     1 
ATOM   7492  C  CB    . ALA C  1 41  ? 51.715  2.374    53.169  1.00 68.43  ? 41  ALA C CB    1 
ATOM   7493  N  N     . ARG C  1 42  ? 50.280  1.072    55.948  1.00 70.79  ? 42  ARG C N     1 
ATOM   7494  C  CA    . ARG C  1 42  ? 50.237  1.241    57.387  1.00 72.19  ? 42  ARG C CA    1 
ATOM   7495  C  C     . ARG C  1 42  ? 51.653  1.435    57.918  1.00 73.13  ? 42  ARG C C     1 
ATOM   7496  O  O     . ARG C  1 42  ? 52.517  0.571    57.768  1.00 74.26  ? 42  ARG C O     1 
ATOM   7497  C  CB    . ARG C  1 42  ? 49.537  0.063    58.051  1.00 74.18  ? 42  ARG C CB    1 
ATOM   7498  C  CG    . ARG C  1 42  ? 48.008  0.181    58.048  1.00 75.08  ? 42  ARG C CG    1 
ATOM   7499  C  CD    . ARG C  1 42  ? 47.351  -1.166   58.347  1.00 79.05  ? 42  ARG C CD    1 
ATOM   7500  N  NE    . ARG C  1 42  ? 47.908  -1.764   59.562  1.00 82.76  ? 42  ARG C NE    1 
ATOM   7501  C  CZ    . ARG C  1 42  ? 48.152  -3.062   59.738  1.00 85.29  ? 42  ARG C CZ    1 
ATOM   7502  N  NH1   . ARG C  1 42  ? 47.891  -3.944   58.773  1.00 85.34  ? 42  ARG C NH1   1 
ATOM   7503  N  NH2   . ARG C  1 42  ? 48.669  -3.478   60.890  1.00 87.82  ? 42  ARG C NH2   1 
ATOM   7504  N  N     . VAL C  1 43  ? 51.888  2.605    58.503  1.00 73.09  ? 43  VAL C N     1 
ATOM   7505  C  CA    . VAL C  1 43  ? 53.206  2.983    58.990  1.00 74.33  ? 43  VAL C CA    1 
ATOM   7506  C  C     . VAL C  1 43  ? 53.141  3.148    60.503  1.00 76.24  ? 43  VAL C C     1 
ATOM   7507  O  O     . VAL C  1 43  ? 52.151  3.656    61.032  1.00 75.88  ? 43  VAL C O     1 
ATOM   7508  C  CB    . VAL C  1 43  ? 53.718  4.285    58.300  1.00 73.21  ? 43  VAL C CB    1 
ATOM   7509  C  CG1   . VAL C  1 43  ? 55.127  4.659    58.768  1.00 74.77  ? 43  VAL C CG1   1 
ATOM   7510  C  CG2   . VAL C  1 43  ? 53.716  4.122    56.784  1.00 72.24  ? 43  VAL C CG2   1 
ATOM   7511  N  N     . PHE C  1 44  ? 54.192  2.685    61.180  1.00 78.65  ? 44  PHE C N     1 
ATOM   7512  C  CA    . PHE C  1 44  ? 54.347  2.817    62.627  1.00 81.30  ? 44  PHE C CA    1 
ATOM   7513  C  C     . PHE C  1 44  ? 55.351  3.926    62.945  1.00 81.90  ? 44  PHE C C     1 
ATOM   7514  O  O     . PHE C  1 44  ? 56.436  3.965    62.368  1.00 82.06  ? 44  PHE C O     1 
ATOM   7515  C  CB    . PHE C  1 44  ? 54.824  1.491    63.220  1.00 84.59  ? 44  PHE C CB    1 
ATOM   7516  C  CG    . PHE C  1 44  ? 54.938  1.495    64.715  1.00 88.40  ? 44  PHE C CG    1 
ATOM   7517  C  CD1   . PHE C  1 44  ? 53.859  1.126    65.503  1.00 90.13  ? 44  PHE C CD1   1 
ATOM   7518  C  CD2   . PHE C  1 44  ? 56.133  1.846    65.335  1.00 91.41  ? 44  PHE C CD2   1 
ATOM   7519  C  CE1   . PHE C  1 44  ? 53.959  1.122    66.888  1.00 94.58  ? 44  PHE C CE1   1 
ATOM   7520  C  CE2   . PHE C  1 44  ? 56.242  1.848    66.716  1.00 95.48  ? 44  PHE C CE2   1 
ATOM   7521  C  CZ    . PHE C  1 44  ? 55.152  1.485    67.495  1.00 97.15  ? 44  PHE C CZ    1 
ATOM   7522  N  N     . GLY C  1 45  ? 54.987  4.809    63.874  1.00 82.74  ? 45  GLY C N     1 
ATOM   7523  C  CA    . GLY C  1 45  ? 55.817  5.955    64.243  1.00 83.46  ? 45  GLY C CA    1 
ATOM   7524  C  C     . GLY C  1 45  ? 55.273  7.254    63.686  1.00 80.89  ? 45  GLY C C     1 
ATOM   7525  O  O     . GLY C  1 45  ? 54.083  7.542    63.831  1.00 80.00  ? 45  GLY C O     1 
ATOM   7526  N  N     . LEU C  1 46  ? 56.153  8.028    63.048  1.00 80.41  ? 46  LEU C N     1 
ATOM   7527  C  CA    . LEU C  1 46  ? 55.841  9.362    62.488  1.00 78.74  ? 46  LEU C CA    1 
ATOM   7528  C  C     . LEU C  1 46  ? 55.083  10.295   63.452  1.00 79.14  ? 46  LEU C C     1 
ATOM   7529  O  O     . LEU C  1 46  ? 54.231  11.067   63.031  1.00 77.46  ? 46  LEU C O     1 
ATOM   7530  C  CB    . LEU C  1 46  ? 55.099  9.235    61.140  1.00 75.97  ? 46  LEU C CB    1 
ATOM   7531  C  CG    . LEU C  1 46  ? 55.868  8.786    59.885  1.00 75.45  ? 46  LEU C CG    1 
ATOM   7532  C  CD1   . LEU C  1 46  ? 54.916  8.516    58.717  1.00 72.48  ? 46  LEU C CD1   1 
ATOM   7533  C  CD2   . LEU C  1 46  ? 56.962  9.790    59.477  1.00 76.62  ? 46  LEU C CD2   1 
ATOM   7534  N  N     . ASN C  1 47  ? 55.431  10.232   64.735  1.00 81.74  ? 47  ASN C N     1 
ATOM   7535  C  CA    . ASN C  1 47  ? 54.634  10.825   65.821  1.00 83.03  ? 47  ASN C CA    1 
ATOM   7536  C  C     . ASN C  1 47  ? 54.249  12.303   65.688  1.00 82.39  ? 47  ASN C C     1 
ATOM   7537  O  O     . ASN C  1 47  ? 53.093  12.670   65.943  1.00 82.16  ? 47  ASN C O     1 
ATOM   7538  C  CB    . ASN C  1 47  ? 55.300  10.565   67.178  1.00 86.98  ? 47  ASN C CB    1 
ATOM   7539  C  CG    . ASN C  1 47  ? 55.564  9.084    67.433  1.00 88.47  ? 47  ASN C CG    1 
ATOM   7540  O  OD1   . ASN C  1 47  ? 54.893  8.205    66.881  1.00 86.80  ? 47  ASN C OD1   1 
ATOM   7541  N  ND2   . ASN C  1 47  ? 56.552  8.806    68.276  1.00 92.43  ? 47  ASN C ND2   1 
ATOM   7542  N  N     . ASN C  1 48  ? 55.208  13.136   65.288  1.00 82.60  ? 48  ASN C N     1 
ATOM   7543  C  CA    . ASN C  1 48  ? 54.973  14.573   65.097  1.00 82.44  ? 48  ASN C CA    1 
ATOM   7544  C  C     . ASN C  1 48  ? 54.436  14.959   63.716  1.00 79.33  ? 48  ASN C C     1 
ATOM   7545  O  O     . ASN C  1 48  ? 54.485  16.135   63.340  1.00 79.83  ? 48  ASN C O     1 
ATOM   7546  C  CB    . ASN C  1 48  ? 56.251  15.366   65.361  1.00 85.40  ? 48  ASN C CB    1 
ATOM   7547  C  CG    . ASN C  1 48  ? 56.718  15.260   66.788  1.00 89.85  ? 48  ASN C CG    1 
ATOM   7548  O  OD1   . ASN C  1 48  ? 55.931  15.421   67.727  1.00 92.71  ? 48  ASN C OD1   1 
ATOM   7549  N  ND2   . ASN C  1 48  ? 58.015  14.999   66.966  1.00 92.01  ? 48  ASN C ND2   1 
ATOM   7550  N  N     . ILE C  1 49  ? 53.936  13.975   62.968  1.00 76.36  ? 49  ILE C N     1 
ATOM   7551  C  CA    . ILE C  1 49  ? 53.363  14.214   61.651  1.00 73.60  ? 49  ILE C CA    1 
ATOM   7552  C  C     . ILE C  1 49  ? 52.019  14.917   61.800  1.00 73.09  ? 49  ILE C C     1 
ATOM   7553  O  O     . ILE C  1 49  ? 51.318  14.737   62.806  1.00 73.59  ? 49  ILE C O     1 
ATOM   7554  C  CB    . ILE C  1 49  ? 53.231  12.897   60.837  1.00 71.69  ? 49  ILE C CB    1 
ATOM   7555  C  CG1   . ILE C  1 49  ? 53.214  13.177   59.337  1.00 70.60  ? 49  ILE C CG1   1 
ATOM   7556  C  CG2   . ILE C  1 49  ? 51.999  12.084   61.251  1.00 71.41  ? 49  ILE C CG2   1 
ATOM   7557  C  CD1   . ILE C  1 49  ? 53.405  11.933   58.477  1.00 69.30  ? 49  ILE C CD1   1 
ATOM   7558  N  N     . GLN C  1 50  ? 51.692  15.735   60.802  1.00 72.43  ? 50  GLN C N     1 
ATOM   7559  C  CA    . GLN C  1 50  ? 50.442  16.480   60.752  1.00 72.52  ? 50  GLN C CA    1 
ATOM   7560  C  C     . GLN C  1 50  ? 49.444  15.713   59.910  1.00 71.09  ? 50  GLN C C     1 
ATOM   7561  O  O     . GLN C  1 50  ? 49.833  14.945   59.032  1.00 69.91  ? 50  GLN C O     1 
ATOM   7562  C  CB    . GLN C  1 50  ? 50.648  17.845   60.103  1.00 73.48  ? 50  GLN C CB    1 
ATOM   7563  C  CG    . GLN C  1 50  ? 51.766  18.676   60.677  1.00 75.44  ? 50  GLN C CG    1 
ATOM   7564  C  CD    . GLN C  1 50  ? 52.096  19.866   59.797  1.00 77.01  ? 50  GLN C CD    1 
ATOM   7565  O  OE1   . GLN C  1 50  ? 52.957  19.781   58.917  1.00 76.99  ? 50  GLN C OE1   1 
ATOM   7566  N  NE2   . GLN C  1 50  ? 51.400  20.982   60.017  1.00 78.28  ? 50  GLN C NE2   1 
ATOM   7567  N  N     . ALA C  1 51  ? 48.159  15.926   60.176  1.00 71.73  ? 51  ALA C N     1 
ATOM   7568  C  CA    . ALA C  1 51  ? 47.116  15.381   59.338  1.00 71.15  ? 51  ALA C CA    1 
ATOM   7569  C  C     . ALA C  1 51  ? 47.275  15.965   57.936  1.00 71.64  ? 51  ALA C C     1 
ATOM   7570  O  O     . ALA C  1 51  ? 47.303  17.186   57.765  1.00 73.05  ? 51  ALA C O     1 
ATOM   7571  C  CB    . ALA C  1 51  ? 45.768  15.720   59.910  1.00 72.33  ? 51  ALA C CB    1 
ATOM   7572  N  N     . GLU C  1 52  ? 47.404  15.078   56.949  1.00 71.08  ? 52  GLU C N     1 
ATOM   7573  C  CA    . GLU C  1 52  ? 47.523  15.440   55.524  1.00 72.38  ? 52  GLU C CA    1 
ATOM   7574  C  C     . GLU C  1 52  ? 48.899  15.981   55.171  1.00 73.37  ? 52  GLU C C     1 
ATOM   7575  O  O     . GLU C  1 52  ? 49.033  16.935   54.402  1.00 75.22  ? 52  GLU C O     1 
ATOM   7576  C  CB    . GLU C  1 52  ? 46.414  16.400   55.068  1.00 74.20  ? 52  GLU C CB    1 
ATOM   7577  C  CG    . GLU C  1 52  ? 45.004  15.837   55.219  1.00 75.11  ? 52  GLU C CG    1 
ATOM   7578  C  CD    . GLU C  1 52  ? 43.931  16.904   55.125  1.00 78.24  ? 52  GLU C CD    1 
ATOM   7579  O  OE1   . GLU C  1 52  ? 44.171  17.941   54.465  1.00 80.33  ? 52  GLU C OE1   1 
ATOM   7580  O  OE2   . GLU C  1 52  ? 42.846  16.695   55.708  1.00 78.95  ? 52  GLU C OE2   1 
ATOM   7581  N  N     . GLU C  1 53  ? 49.922  15.359   55.739  1.00 73.10  ? 53  GLU C N     1 
ATOM   7582  C  CA    . GLU C  1 53  ? 51.296  15.711   55.435  1.00 74.51  ? 53  GLU C CA    1 
ATOM   7583  C  C     . GLU C  1 53  ? 51.835  14.758   54.361  1.00 74.22  ? 53  GLU C C     1 
ATOM   7584  O  O     . GLU C  1 53  ? 51.527  13.556   54.380  1.00 73.03  ? 53  GLU C O     1 
ATOM   7585  C  CB    . GLU C  1 53  ? 52.145  15.627   56.708  1.00 74.74  ? 53  GLU C CB    1 
ATOM   7586  C  CG    . GLU C  1 53  ? 53.458  16.395   56.652  1.00 77.22  ? 53  GLU C CG    1 
ATOM   7587  C  CD    . GLU C  1 53  ? 54.318  16.195   57.883  1.00 78.69  ? 53  GLU C CD    1 
ATOM   7588  O  OE1   . GLU C  1 53  ? 53.832  16.424   59.008  1.00 79.74  ? 53  GLU C OE1   1 
ATOM   7589  O  OE2   . GLU C  1 53  ? 55.493  15.812   57.729  1.00 80.37  ? 53  GLU C OE2   1 
ATOM   7590  N  N     . LEU C  1 54  ? 52.622  15.298   53.424  1.00 75.92  ? 54  LEU C N     1 
ATOM   7591  C  CA    . LEU C  1 54  ? 53.394  14.495   52.464  1.00 75.97  ? 54  LEU C CA    1 
ATOM   7592  C  C     . LEU C  1 54  ? 54.400  13.598   53.174  1.00 75.27  ? 54  LEU C C     1 
ATOM   7593  O  O     . LEU C  1 54  ? 54.866  13.928   54.265  1.00 75.74  ? 54  LEU C O     1 
ATOM   7594  C  CB    . LEU C  1 54  ? 54.145  15.408   51.488  1.00 78.73  ? 54  LEU C CB    1 
ATOM   7595  C  CG    . LEU C  1 54  ? 53.682  15.555   50.032  1.00 80.68  ? 54  LEU C CG    1 
ATOM   7596  C  CD1   . LEU C  1 54  ? 52.166  15.454   49.881  1.00 79.53  ? 54  LEU C CD1   1 
ATOM   7597  C  CD2   . LEU C  1 54  ? 54.216  16.856   49.405  1.00 85.30  ? 54  LEU C CD2   1 
ATOM   7598  N  N     . VAL C  1 55  ? 54.733  12.465   52.562  1.00 74.66  ? 55  VAL C N     1 
ATOM   7599  C  CA    . VAL C  1 55  ? 55.835  11.636   53.058  1.00 75.12  ? 55  VAL C CA    1 
ATOM   7600  C  C     . VAL C  1 55  ? 56.695  11.094   51.922  1.00 76.62  ? 55  VAL C C     1 
ATOM   7601  O  O     . VAL C  1 55  ? 56.199  10.886   50.813  1.00 76.78  ? 55  VAL C O     1 
ATOM   7602  C  CB    . VAL C  1 55  ? 55.359  10.448   53.934  1.00 73.36  ? 55  VAL C CB    1 
ATOM   7603  C  CG1   . VAL C  1 55  ? 54.675  10.932   55.212  1.00 72.72  ? 55  VAL C CG1   1 
ATOM   7604  C  CG2   . VAL C  1 55  ? 54.471  9.499    53.144  1.00 72.15  ? 55  VAL C CG2   1 
ATOM   7605  N  N     . GLU C  1 56  ? 57.981  10.881   52.195  1.00 78.47  ? 56  GLU C N     1 
ATOM   7606  C  CA    . GLU C  1 56  ? 58.839  10.121   51.282  1.00 80.22  ? 56  GLU C CA    1 
ATOM   7607  C  C     . GLU C  1 56  ? 59.097  8.724    51.828  1.00 79.47  ? 56  GLU C C     1 
ATOM   7608  O  O     . GLU C  1 56  ? 59.385  8.554    53.017  1.00 79.60  ? 56  GLU C O     1 
ATOM   7609  C  CB    . GLU C  1 56  ? 60.171  10.828   51.016  1.00 83.50  ? 56  GLU C CB    1 
ATOM   7610  C  CG    . GLU C  1 56  ? 60.176  11.684   49.761  1.00 86.46  ? 56  GLU C CG    1 
ATOM   7611  C  CD    . GLU C  1 56  ? 61.556  12.227   49.422  1.00 92.01  ? 56  GLU C CD    1 
ATOM   7612  O  OE1   . GLU C  1 56  ? 62.401  11.437   48.935  1.00 94.21  ? 56  GLU C OE1   1 
ATOM   7613  O  OE2   . GLU C  1 56  ? 61.791  13.444   49.632  1.00 94.24  ? 56  GLU C OE2   1 
ATOM   7614  N  N     . PHE C  1 57  ? 58.970  7.728    50.957  1.00 79.02  ? 57  PHE C N     1 
ATOM   7615  C  CA    . PHE C  1 57  ? 59.400  6.374    51.278  1.00 79.12  ? 57  PHE C CA    1 
ATOM   7616  C  C     . PHE C  1 57  ? 60.854  6.215    50.854  1.00 81.85  ? 57  PHE C C     1 
ATOM   7617  O  O     . PHE C  1 57  ? 61.326  6.946    49.979  1.00 83.55  ? 57  PHE C O     1 
ATOM   7618  C  CB    . PHE C  1 57  ? 58.499  5.350    50.595  1.00 77.79  ? 57  PHE C CB    1 
ATOM   7619  C  CG    . PHE C  1 57  ? 57.125  5.277    51.192  1.00 76.37  ? 57  PHE C CG    1 
ATOM   7620  C  CD1   . PHE C  1 57  ? 56.172  6.269    50.919  1.00 76.36  ? 57  PHE C CD1   1 
ATOM   7621  C  CD2   . PHE C  1 57  ? 56.780  4.226    52.048  1.00 76.17  ? 57  PHE C CD2   1 
ATOM   7622  C  CE1   . PHE C  1 57  ? 54.890  6.214    51.489  1.00 75.07  ? 57  PHE C CE1   1 
ATOM   7623  C  CE2   . PHE C  1 57  ? 55.508  4.155    52.625  1.00 75.10  ? 57  PHE C CE2   1 
ATOM   7624  C  CZ    . PHE C  1 57  ? 54.558  5.154    52.348  1.00 74.54  ? 57  PHE C CZ    1 
ATOM   7625  N  N     . SER C  1 58  ? 61.562  5.275    51.482  1.00 82.62  ? 58  SER C N     1 
ATOM   7626  C  CA    . SER C  1 58  ? 62.992  5.065    51.217  1.00 85.66  ? 58  SER C CA    1 
ATOM   7627  C  C     . SER C  1 58  ? 63.267  4.823    49.736  1.00 86.54  ? 58  SER C C     1 
ATOM   7628  O  O     . SER C  1 58  ? 64.335  5.166    49.234  1.00 89.70  ? 58  SER C O     1 
ATOM   7629  C  CB    . SER C  1 58  ? 63.525  3.890    52.037  1.00 87.03  ? 58  SER C CB    1 
ATOM   7630  O  OG    . SER C  1 58  ? 62.920  2.681    51.613  1.00 86.11  ? 58  SER C OG    1 
ATOM   7631  N  N     . SER C  1 59  ? 62.287  4.235    49.055  1.00 84.12  ? 59  SER C N     1 
ATOM   7632  C  CA    . SER C  1 59  ? 62.350  3.946    47.624  1.00 84.97  ? 59  SER C CA    1 
ATOM   7633  C  C     . SER C  1 59  ? 62.133  5.159    46.710  1.00 85.55  ? 59  SER C C     1 
ATOM   7634  O  O     . SER C  1 59  ? 62.470  5.107    45.531  1.00 87.62  ? 59  SER C O     1 
ATOM   7635  C  CB    . SER C  1 59  ? 61.327  2.868    47.275  1.00 83.02  ? 59  SER C CB    1 
ATOM   7636  O  OG    . SER C  1 59  ? 60.028  3.242    47.702  1.00 79.58  ? 59  SER C OG    1 
ATOM   7637  N  N     . GLY C  1 60  ? 61.557  6.237    47.238  1.00 84.03  ? 60  GLY C N     1 
ATOM   7638  C  CA    . GLY C  1 60  ? 61.362  7.465    46.457  1.00 85.29  ? 60  GLY C CA    1 
ATOM   7639  C  C     . GLY C  1 60  ? 59.917  7.827    46.152  1.00 83.04  ? 60  GLY C C     1 
ATOM   7640  O  O     . GLY C  1 60  ? 59.623  8.951    45.734  1.00 84.04  ? 60  GLY C O     1 
ATOM   7641  N  N     . VAL C  1 61  ? 59.017  6.873    46.346  1.00 80.49  ? 61  VAL C N     1 
ATOM   7642  C  CA    . VAL C  1 61  ? 57.592  7.111    46.179  1.00 78.84  ? 61  VAL C CA    1 
ATOM   7643  C  C     . VAL C  1 61  ? 57.111  8.116    47.241  1.00 77.58  ? 61  VAL C C     1 
ATOM   7644  O  O     . VAL C  1 61  ? 57.689  8.208    48.331  1.00 77.50  ? 61  VAL C O     1 
ATOM   7645  C  CB    . VAL C  1 61  ? 56.800  5.766    46.220  1.00 76.95  ? 61  VAL C CB    1 
ATOM   7646  C  CG1   . VAL C  1 61  ? 57.098  4.984    47.485  1.00 75.50  ? 61  VAL C CG1   1 
ATOM   7647  C  CG2   . VAL C  1 61  ? 55.309  5.990    46.083  1.00 75.87  ? 61  VAL C CG2   1 
ATOM   7648  N  N     . LYS C  1 62  ? 56.085  8.894    46.912  1.00 77.30  ? 62  LYS C N     1 
ATOM   7649  C  CA    . LYS C  1 62  ? 55.497  9.818    47.877  1.00 76.25  ? 62  LYS C CA    1 
ATOM   7650  C  C     . LYS C  1 62  ? 54.147  9.317    48.384  1.00 74.06  ? 62  LYS C C     1 
ATOM   7651  O  O     . LYS C  1 62  ? 53.578  8.376    47.821  1.00 73.82  ? 62  LYS C O     1 
ATOM   7652  C  CB    . LYS C  1 62  ? 55.387  11.223   47.286  1.00 78.34  ? 62  LYS C CB    1 
ATOM   7653  C  CG    . LYS C  1 62  ? 56.539  12.113   47.684  1.00 80.93  ? 62  LYS C CG    1 
ATOM   7654  C  CD    . LYS C  1 62  ? 57.165  12.840   46.502  1.00 85.84  ? 62  LYS C CD    1 
ATOM   7655  C  CE    . LYS C  1 62  ? 58.681  12.587   46.528  1.00 89.37  ? 62  LYS C CE    1 
ATOM   7656  N  NZ    . LYS C  1 62  ? 59.533  13.616   45.856  1.00 94.43  ? 62  LYS C NZ    1 
ATOM   7657  N  N     . GLY C  1 63  ? 53.654  9.936    49.459  1.00 73.06  ? 63  GLY C N     1 
ATOM   7658  C  CA    . GLY C  1 63  ? 52.352  9.596    50.045  1.00 71.20  ? 63  GLY C CA    1 
ATOM   7659  C  C     . GLY C  1 63  ? 51.745  10.722   50.866  1.00 71.06  ? 63  GLY C C     1 
ATOM   7660  O  O     . GLY C  1 63  ? 52.360  11.771   51.058  1.00 72.20  ? 63  GLY C O     1 
ATOM   7661  N  N     . MET C  1 64  ? 50.534  10.496   51.361  1.00 70.16  ? 64  MET C N     1 
ATOM   7662  C  CA    . MET C  1 64  ? 49.814  11.486   52.163  1.00 70.28  ? 64  MET C CA    1 
ATOM   7663  C  C     . MET C  1 64  ? 49.224  10.812   53.401  1.00 69.06  ? 64  MET C C     1 
ATOM   7664  O  O     . MET C  1 64  ? 48.454  9.855    53.291  1.00 68.47  ? 64  MET C O     1 
ATOM   7665  C  CB    . MET C  1 64  ? 48.721  12.134   51.309  1.00 71.54  ? 64  MET C CB    1 
ATOM   7666  C  CG    . MET C  1 64  ? 47.845  13.191   51.966  1.00 72.47  ? 64  MET C CG    1 
ATOM   7667  S  SD    . MET C  1 64  ? 46.832  13.922   50.653  1.00 76.54  ? 64  MET C SD    1 
ATOM   7668  C  CE    . MET C  1 64  ? 45.665  14.912   51.586  1.00 78.55  ? 64  MET C CE    1 
ATOM   7669  N  N     . ALA C  1 65  ? 49.610  11.307   54.575  1.00 68.96  ? 65  ALA C N     1 
ATOM   7670  C  CA    . ALA C  1 65  ? 49.088  10.801   55.840  1.00 68.49  ? 65  ALA C CA    1 
ATOM   7671  C  C     . ALA C  1 65  ? 47.669  11.296   56.051  1.00 68.81  ? 65  ALA C C     1 
ATOM   7672  O  O     . ALA C  1 65  ? 47.464  12.437   56.457  1.00 69.99  ? 65  ALA C O     1 
ATOM   7673  C  CB    . ALA C  1 65  ? 49.972  11.242   56.982  1.00 69.11  ? 65  ALA C CB    1 
ATOM   7674  N  N     . LEU C  1 66  ? 46.691  10.445   55.773  1.00 68.19  ? 66  LEU C N     1 
ATOM   7675  C  CA    . LEU C  1 66  ? 45.306  10.851   55.897  1.00 68.96  ? 66  LEU C CA    1 
ATOM   7676  C  C     . LEU C  1 66  ? 44.653  10.371   57.189  1.00 69.69  ? 66  LEU C C     1 
ATOM   7677  O  O     . LEU C  1 66  ? 43.662  10.952   57.633  1.00 71.27  ? 66  LEU C O     1 
ATOM   7678  C  CB    . LEU C  1 66  ? 44.494  10.402   54.682  1.00 69.37  ? 66  LEU C CB    1 
ATOM   7679  C  CG    . LEU C  1 66  ? 44.447  11.301   53.445  1.00 69.97  ? 66  LEU C CG    1 
ATOM   7680  C  CD1   . LEU C  1 66  ? 43.828  10.549   52.276  1.00 70.15  ? 66  LEU C CD1   1 
ATOM   7681  C  CD2   . LEU C  1 66  ? 43.649  12.558   53.725  1.00 72.60  ? 66  LEU C CD2   1 
ATOM   7682  N  N     . ILE C  1 67  ? 45.194  9.322    57.801  1.00 69.17  ? 67  ILE C N     1 
ATOM   7683  C  CA    . ILE C  1 67  ? 44.634  8.838    59.069  1.00 70.43  ? 67  ILE C CA    1 
ATOM   7684  C  C     . ILE C  1 67  ? 45.692  8.754    60.172  1.00 70.54  ? 67  ILE C C     1 
ATOM   7685  O  O     . ILE C  1 67  ? 46.703  8.095    60.001  1.00 69.80  ? 67  ILE C O     1 
ATOM   7686  C  CB    . ILE C  1 67  ? 43.860  7.486    58.904  1.00 71.04  ? 67  ILE C CB    1 
ATOM   7687  C  CG1   . ILE C  1 67  ? 42.636  7.672    58.001  1.00 71.56  ? 67  ILE C CG1   1 
ATOM   7688  C  CG2   . ILE C  1 67  ? 43.405  6.945    60.259  1.00 73.18  ? 67  ILE C CG2   1 
ATOM   7689  C  CD1   . ILE C  1 67  ? 41.730  6.438    57.889  1.00 73.40  ? 67  ILE C CD1   1 
ATOM   7690  N  N     . LEU C  1 68  ? 45.450  9.439    61.289  1.00 71.97  ? 68  LEU C N     1 
ATOM   7691  C  CA    . LEU C  1 68  ? 46.326  9.367    62.455  1.00 73.18  ? 68  LEU C CA    1 
ATOM   7692  C  C     . LEU C  1 68  ? 45.612  8.649    63.593  1.00 75.86  ? 68  LEU C C     1 
ATOM   7693  O  O     . LEU C  1 68  ? 44.689  9.196    64.176  1.00 77.74  ? 68  LEU C O     1 
ATOM   7694  C  CB    . LEU C  1 68  ? 46.752  10.769   62.927  1.00 73.56  ? 68  LEU C CB    1 
ATOM   7695  C  CG    . LEU C  1 68  ? 47.080  11.940   61.991  1.00 71.82  ? 68  LEU C CG    1 
ATOM   7696  C  CD1   . LEU C  1 68  ? 47.696  13.055   62.800  1.00 72.76  ? 68  LEU C CD1   1 
ATOM   7697  C  CD2   . LEU C  1 68  ? 48.017  11.561   60.866  1.00 69.87  ? 68  LEU C CD2   1 
ATOM   7698  N  N     . GLU C  1 69  ? 46.031  7.429    63.905  1.00 76.95  ? 69  GLU C N     1 
ATOM   7699  C  CA    . GLU C  1 69  ? 45.454  6.678    65.024  1.00 80.56  ? 69  GLU C CA    1 
ATOM   7700  C  C     . GLU C  1 69  ? 46.497  6.481    66.126  1.00 82.55  ? 69  GLU C C     1 
ATOM   7701  O  O     . GLU C  1 69  ? 47.689  6.705    65.886  1.00 81.38  ? 69  GLU C O     1 
ATOM   7702  C  CB    . GLU C  1 69  ? 44.960  5.312    64.553  1.00 81.17  ? 69  GLU C CB    1 
ATOM   7703  C  CG    . GLU C  1 69  ? 43.704  5.321    63.717  1.00 82.33  ? 69  GLU C CG    1 
ATOM   7704  C  CD    . GLU C  1 69  ? 43.524  4.006    62.976  1.00 85.13  ? 69  GLU C CD    1 
ATOM   7705  O  OE1   . GLU C  1 69  ? 42.647  3.209    63.384  1.00 89.87  ? 69  GLU C OE1   1 
ATOM   7706  O  OE2   . GLU C  1 69  ? 44.273  3.751    62.003  1.00 83.36  ? 69  GLU C OE2   1 
ATOM   7707  N  N     . PRO C  1 70  ? 46.063  6.045    67.331  1.00 86.09  ? 70  PRO C N     1 
ATOM   7708  C  CA    . PRO C  1 70  ? 46.994  5.795    68.430  1.00 89.02  ? 70  PRO C CA    1 
ATOM   7709  C  C     . PRO C  1 70  ? 48.228  4.956    68.063  1.00 88.44  ? 70  PRO C C     1 
ATOM   7710  O  O     . PRO C  1 70  ? 49.334  5.301    68.473  1.00 89.60  ? 70  PRO C O     1 
ATOM   7711  C  CB    . PRO C  1 70  ? 46.126  5.060    69.453  1.00 93.16  ? 70  PRO C CB    1 
ATOM   7712  C  CG    . PRO C  1 70  ? 44.797  5.645    69.263  1.00 92.66  ? 70  PRO C CG    1 
ATOM   7713  C  CD    . PRO C  1 70  ? 44.667  5.883    67.779  1.00 88.41  ? 70  PRO C CD    1 
ATOM   7714  N  N     . GLY C  1 71  ? 48.056  3.886    67.296  1.00 87.19  ? 71  GLY C N     1 
ATOM   7715  C  CA    . GLY C  1 71  ? 49.177  2.991    67.017  1.00 87.32  ? 71  GLY C CA    1 
ATOM   7716  C  C     . GLY C  1 71  ? 49.931  3.192    65.710  1.00 83.60  ? 71  GLY C C     1 
ATOM   7717  O  O     . GLY C  1 71  ? 51.082  2.777    65.585  1.00 84.16  ? 71  GLY C O     1 
ATOM   7718  N  N     . GLN C  1 72  ? 49.291  3.827    64.732  1.00 80.33  ? 72  GLN C N     1 
ATOM   7719  C  CA    . GLN C  1 72  ? 49.786  3.806    63.353  1.00 77.15  ? 72  GLN C CA    1 
ATOM   7720  C  C     . GLN C  1 72  ? 49.253  4.979    62.539  1.00 74.22  ? 72  GLN C C     1 
ATOM   7721  O  O     . GLN C  1 72  ? 48.410  5.741    63.013  1.00 74.75  ? 72  GLN C O     1 
ATOM   7722  C  CB    . GLN C  1 72  ? 49.358  2.500    62.682  1.00 77.11  ? 72  GLN C CB    1 
ATOM   7723  C  CG    . GLN C  1 72  ? 47.845  2.345    62.636  1.00 78.06  ? 72  GLN C CG    1 
ATOM   7724  C  CD    . GLN C  1 72  ? 47.387  0.960    62.245  1.00 79.94  ? 72  GLN C CD    1 
ATOM   7725  O  OE1   . GLN C  1 72  ? 48.037  0.276    61.456  1.00 79.59  ? 72  GLN C OE1   1 
ATOM   7726  N  NE2   . GLN C  1 72  ? 46.242  0.545    62.783  1.00 82.34  ? 72  GLN C NE2   1 
ATOM   7727  N  N     . VAL C  1 73  ? 49.743  5.112    61.310  1.00 71.52  ? 73  VAL C N     1 
ATOM   7728  C  CA    . VAL C  1 73  ? 49.272  6.152    60.407  1.00 69.16  ? 73  VAL C CA    1 
ATOM   7729  C  C     . VAL C  1 73  ? 48.861  5.556    59.054  1.00 67.99  ? 73  VAL C C     1 
ATOM   7730  O  O     . VAL C  1 73  ? 49.628  4.824    58.425  1.00 68.00  ? 73  VAL C O     1 
ATOM   7731  C  CB    . VAL C  1 73  ? 50.320  7.285    60.245  1.00 68.33  ? 73  VAL C CB    1 
ATOM   7732  C  CG1   . VAL C  1 73  ? 49.957  8.223    59.111  1.00 66.17  ? 73  VAL C CG1   1 
ATOM   7733  C  CG2   . VAL C  1 73  ? 50.442  8.060    61.527  1.00 69.40  ? 73  VAL C CG2   1 
ATOM   7734  N  N     . GLY C  1 74  ? 47.638  5.860    58.629  1.00 67.51  ? 74  GLY C N     1 
ATOM   7735  C  CA    . GLY C  1 74  ? 47.195  5.546    57.279  1.00 66.55  ? 74  GLY C CA    1 
ATOM   7736  C  C     . GLY C  1 74  ? 47.818  6.480    56.255  1.00 65.45  ? 74  GLY C C     1 
ATOM   7737  O  O     . GLY C  1 74  ? 47.681  7.704    56.347  1.00 65.34  ? 74  GLY C O     1 
ATOM   7738  N  N     . ILE C  1 75  ? 48.519  5.906    55.282  1.00 65.07  ? 75  ILE C N     1 
ATOM   7739  C  CA    . ILE C  1 75  ? 49.082  6.698    54.195  1.00 64.97  ? 75  ILE C CA    1 
ATOM   7740  C  C     . ILE C  1 75  ? 48.655  6.195    52.822  1.00 65.10  ? 75  ILE C C     1 
ATOM   7741  O  O     . ILE C  1 75  ? 48.910  5.044    52.457  1.00 65.18  ? 75  ILE C O     1 
ATOM   7742  C  CB    . ILE C  1 75  ? 50.633  6.827    54.290  1.00 65.20  ? 75  ILE C CB    1 
ATOM   7743  C  CG1   . ILE C  1 75  ? 51.018  7.672    55.510  1.00 65.57  ? 75  ILE C CG1   1 
ATOM   7744  C  CG2   . ILE C  1 75  ? 51.206  7.457    53.019  1.00 65.60  ? 75  ILE C CG2   1 
ATOM   7745  C  CD1   . ILE C  1 75  ? 52.486  7.878    55.705  1.00 65.94  ? 75  ILE C CD1   1 
ATOM   7746  N  N     . VAL C  1 76  ? 47.986  7.067    52.074  1.00 65.65  ? 76  VAL C N     1 
ATOM   7747  C  CA    . VAL C  1 76  ? 47.714  6.816    50.658  1.00 66.41  ? 76  VAL C CA    1 
ATOM   7748  C  C     . VAL C  1 76  ? 48.998  7.040    49.838  1.00 66.72  ? 76  VAL C C     1 
ATOM   7749  O  O     . VAL C  1 76  ? 49.725  8.013    50.051  1.00 66.96  ? 76  VAL C O     1 
ATOM   7750  C  CB    . VAL C  1 76  ? 46.513  7.660    50.118  1.00 67.46  ? 76  VAL C CB    1 
ATOM   7751  C  CG1   . VAL C  1 76  ? 45.214  7.188    50.728  1.00 67.85  ? 76  VAL C CG1   1 
ATOM   7752  C  CG2   . VAL C  1 76  ? 46.696  9.143    50.397  1.00 67.63  ? 76  VAL C CG2   1 
ATOM   7753  N  N     . LEU C  1 77  ? 49.294  6.128    48.924  1.00 67.09  ? 77  LEU C N     1 
ATOM   7754  C  CA    . LEU C  1 77  ? 50.491  6.270    48.117  1.00 67.97  ? 77  LEU C CA    1 
ATOM   7755  C  C     . LEU C  1 77  ? 50.211  7.129    46.893  1.00 70.25  ? 77  LEU C C     1 
ATOM   7756  O  O     . LEU C  1 77  ? 49.089  7.144    46.376  1.00 71.04  ? 77  LEU C O     1 
ATOM   7757  C  CB    . LEU C  1 77  ? 51.035  4.900    47.716  1.00 67.96  ? 77  LEU C CB    1 
ATOM   7758  C  CG    . LEU C  1 77  ? 51.275  3.869    48.826  1.00 66.03  ? 77  LEU C CG    1 
ATOM   7759  C  CD1   . LEU C  1 77  ? 51.700  2.552    48.238  1.00 65.34  ? 77  LEU C CD1   1 
ATOM   7760  C  CD2   . LEU C  1 77  ? 52.306  4.340    49.834  1.00 65.04  ? 77  LEU C CD2   1 
ATOM   7761  N  N     . PHE C  1 78  ? 51.225  7.866    46.451  1.00 72.11  ? 78  PHE C N     1 
ATOM   7762  C  CA    . PHE C  1 78  ? 51.121  8.629    45.206  1.00 75.53  ? 78  PHE C CA    1 
ATOM   7763  C  C     . PHE C  1 78  ? 51.780  7.879    44.047  1.00 77.78  ? 78  PHE C C     1 
ATOM   7764  O  O     . PHE C  1 78  ? 51.788  8.361    42.909  1.00 80.95  ? 78  PHE C O     1 
ATOM   7765  C  CB    . PHE C  1 78  ? 51.722  10.035   45.338  1.00 76.72  ? 78  PHE C CB    1 
ATOM   7766  C  CG    . PHE C  1 78  ? 50.897  10.990   46.163  1.00 76.42  ? 78  PHE C CG    1 
ATOM   7767  C  CD1   . PHE C  1 78  ? 49.509  10.866   46.244  1.00 76.90  ? 78  PHE C CD1   1 
ATOM   7768  C  CD2   . PHE C  1 78  ? 51.508  12.039   46.833  1.00 76.38  ? 78  PHE C CD2   1 
ATOM   7769  C  CE1   . PHE C  1 78  ? 48.748  11.769   47.003  1.00 76.37  ? 78  PHE C CE1   1 
ATOM   7770  C  CE2   . PHE C  1 78  ? 50.757  12.935   47.589  1.00 76.57  ? 78  PHE C CE2   1 
ATOM   7771  C  CZ    . PHE C  1 78  ? 49.372  12.800   47.670  1.00 76.06  ? 78  PHE C CZ    1 
ATOM   7772  N  N     . GLY C  1 79  ? 52.329  6.702    44.341  1.00 76.86  ? 79  GLY C N     1 
ATOM   7773  C  CA    . GLY C  1 79  ? 52.940  5.867    43.319  1.00 79.02  ? 79  GLY C CA    1 
ATOM   7774  C  C     . GLY C  1 79  ? 52.849  4.385    43.623  1.00 78.22  ? 79  GLY C C     1 
ATOM   7775  O  O     . GLY C  1 79  ? 52.319  3.982    44.660  1.00 76.04  ? 79  GLY C O     1 
ATOM   7776  N  N     . SER C  1 80  ? 53.398  3.583    42.709  1.00 80.51  ? 80  SER C N     1 
ATOM   7777  C  CA    . SER C  1 80  ? 53.353  2.114    42.738  1.00 80.35  ? 80  SER C CA    1 
ATOM   7778  C  C     . SER C  1 80  ? 53.800  1.475    44.060  1.00 78.39  ? 80  SER C C     1 
ATOM   7779  O  O     . SER C  1 80  ? 54.879  1.779    44.570  1.00 78.60  ? 80  SER C O     1 
ATOM   7780  C  CB    . SER C  1 80  ? 54.202  1.571    41.587  1.00 83.14  ? 80  SER C CB    1 
ATOM   7781  O  OG    . SER C  1 80  ? 54.114  0.162    41.515  1.00 83.93  ? 80  SER C OG    1 
ATOM   7782  N  N     . ASP C  1 81  ? 52.972  0.579    44.599  1.00 77.31  ? 81  ASP C N     1 
ATOM   7783  C  CA    . ASP C  1 81  ? 53.312  -0.132   45.839  1.00 76.11  ? 81  ASP C CA    1 
ATOM   7784  C  C     . ASP C  1 81  ? 54.135  -1.392   45.639  1.00 77.55  ? 81  ASP C C     1 
ATOM   7785  O  O     . ASP C  1 81  ? 54.314  -2.161   46.579  1.00 77.69  ? 81  ASP C O     1 
ATOM   7786  C  CB    . ASP C  1 81  ? 52.090  -0.409   46.742  1.00 74.76  ? 81  ASP C CB    1 
ATOM   7787  C  CG    . ASP C  1 81  ? 50.878  -0.903   45.983  1.00 75.36  ? 81  ASP C CG    1 
ATOM   7788  O  OD1   . ASP C  1 81  ? 51.006  -1.873   45.207  1.00 78.05  ? 81  ASP C OD1   1 
ATOM   7789  O  OD2   . ASP C  1 81  ? 49.789  -0.328   46.184  1.00 73.64  ? 81  ASP C OD2   1 
ATOM   7790  N  N     . ARG C  1 82  ? 54.643  -1.609   44.428  1.00 79.37  ? 82  ARG C N     1 
ATOM   7791  C  CA    . ARG C  1 82  ? 55.723  -2.573   44.256  1.00 81.16  ? 82  ARG C CA    1 
ATOM   7792  C  C     . ARG C  1 82  ? 56.947  -1.987   44.944  1.00 81.15  ? 82  ARG C C     1 
ATOM   7793  O  O     . ARG C  1 82  ? 57.794  -2.713   45.455  1.00 82.31  ? 82  ARG C O     1 
ATOM   7794  C  CB    . ARG C  1 82  ? 56.014  -2.848   42.780  1.00 83.87  ? 82  ARG C CB    1 
ATOM   7795  C  CG    . ARG C  1 82  ? 57.268  -3.695   42.540  1.00 86.72  ? 82  ARG C CG    1 
ATOM   7796  C  CD    . ARG C  1 82  ? 57.097  -4.631   41.335  1.00 90.13  ? 82  ARG C CD    1 
ATOM   7797  N  NE    . ARG C  1 82  ? 58.388  -4.934   40.724  1.00 93.75  ? 82  ARG C NE    1 
ATOM   7798  C  CZ    . ARG C  1 82  ? 59.178  -5.938   41.090  1.00 95.99  ? 82  ARG C CZ    1 
ATOM   7799  N  NH1   . ARG C  1 82  ? 58.803  -6.759   42.065  1.00 95.00  ? 82  ARG C NH1   1 
ATOM   7800  N  NH2   . ARG C  1 82  ? 60.344  -6.121   40.477  1.00 99.69  ? 82  ARG C NH2   1 
ATOM   7801  N  N     . LEU C  1 83  ? 56.999  -0.659   44.984  1.00 80.18  ? 83  LEU C N     1 
ATOM   7802  C  CA    . LEU C  1 83  ? 58.130  0.070    45.535  1.00 80.47  ? 83  LEU C CA    1 
ATOM   7803  C  C     . LEU C  1 83  ? 58.112  0.213    47.063  1.00 78.63  ? 83  LEU C C     1 
ATOM   7804  O  O     . LEU C  1 83  ? 59.087  0.689    47.652  1.00 79.58  ? 83  LEU C O     1 
ATOM   7805  C  CB    . LEU C  1 83  ? 58.255  1.434    44.850  1.00 81.17  ? 83  LEU C CB    1 
ATOM   7806  C  CG    . LEU C  1 83  ? 58.633  1.358    43.368  1.00 83.98  ? 83  LEU C CG    1 
ATOM   7807  C  CD1   . LEU C  1 83  ? 58.259  2.638    42.635  1.00 84.87  ? 83  LEU C CD1   1 
ATOM   7808  C  CD2   . LEU C  1 83  ? 60.113  1.025    43.198  1.00 86.51  ? 83  LEU C CD2   1 
ATOM   7809  N  N     . VAL C  1 84  ? 57.026  -0.205   47.710  1.00 76.35  ? 84  VAL C N     1 
ATOM   7810  C  CA    . VAL C  1 84  ? 57.007  -0.250   49.177  1.00 75.14  ? 84  VAL C CA    1 
ATOM   7811  C  C     . VAL C  1 84  ? 57.051  -1.705   49.668  1.00 75.84  ? 84  VAL C C     1 
ATOM   7812  O  O     . VAL C  1 84  ? 56.484  -2.604   49.028  1.00 76.07  ? 84  VAL C O     1 
ATOM   7813  C  CB    . VAL C  1 84  ? 55.817  0.571    49.789  1.00 73.07  ? 84  VAL C CB    1 
ATOM   7814  C  CG1   . VAL C  1 84  ? 55.933  0.698    51.318  1.00 72.42  ? 84  VAL C CG1   1 
ATOM   7815  C  CG2   . VAL C  1 84  ? 55.766  1.962    49.183  1.00 72.51  ? 84  VAL C CG2   1 
ATOM   7816  N  N     . LYS C  1 85  ? 57.771  -1.922   50.772  1.00 76.39  ? 85  LYS C N     1 
ATOM   7817  C  CA    . LYS C  1 85  ? 57.870  -3.224   51.442  1.00 77.80  ? 85  LYS C CA    1 
ATOM   7818  C  C     . LYS C  1 85  ? 57.733  -3.010   52.942  1.00 77.91  ? 85  LYS C C     1 
ATOM   7819  O  O     . LYS C  1 85  ? 57.874  -1.893   53.415  1.00 77.01  ? 85  LYS C O     1 
ATOM   7820  C  CB    . LYS C  1 85  ? 59.220  -3.893   51.150  1.00 80.59  ? 85  LYS C CB    1 
ATOM   7821  C  CG    . LYS C  1 85  ? 59.427  -4.355   49.714  1.00 80.44  ? 85  LYS C CG    1 
ATOM   7822  C  CD    . LYS C  1 85  ? 60.728  -5.113   49.539  1.00 81.62  ? 85  LYS C CD    1 
ATOM   7823  C  CE    . LYS C  1 85  ? 61.056  -5.262   48.061  1.00 82.44  ? 85  LYS C CE    1 
ATOM   7824  N  NZ    . LYS C  1 85  ? 62.346  -5.962   47.826  1.00 85.94  ? 85  LYS C NZ    1 
ATOM   7825  N  N     . GLU C  1 86  ? 57.467  -4.078   53.688  1.00 79.75  ? 86  GLU C N     1 
ATOM   7826  C  CA    . GLU C  1 86  ? 57.351  -3.997   55.147  1.00 81.06  ? 86  GLU C CA    1 
ATOM   7827  C  C     . GLU C  1 86  ? 58.731  -3.829   55.756  1.00 83.82  ? 86  GLU C C     1 
ATOM   7828  O  O     . GLU C  1 86  ? 59.679  -4.460   55.309  1.00 86.21  ? 86  GLU C O     1 
ATOM   7829  C  CB    . GLU C  1 86  ? 56.681  -5.255   55.705  1.00 82.85  ? 86  GLU C CB    1 
ATOM   7830  C  CG    . GLU C  1 86  ? 56.644  -5.369   57.226  1.00 84.97  ? 86  GLU C CG    1 
ATOM   7831  C  CD    . GLU C  1 86  ? 56.688  -6.815   57.697  1.00 89.77  ? 86  GLU C CD    1 
ATOM   7832  O  OE1   . GLU C  1 86  ? 56.202  -7.706   56.965  1.00 90.75  ? 86  GLU C OE1   1 
ATOM   7833  O  OE2   . GLU C  1 86  ? 57.213  -7.072   58.800  1.00 93.03  ? 86  GLU C OE2   1 
ATOM   7834  N  N     . GLY C  1 87  ? 58.839  -2.976   56.772  1.00 84.33  ? 87  GLY C N     1 
ATOM   7835  C  CA    . GLY C  1 87  ? 60.113  -2.717   57.436  1.00 87.37  ? 87  GLY C CA    1 
ATOM   7836  C  C     . GLY C  1 87  ? 60.852  -1.528   56.856  1.00 86.88  ? 87  GLY C C     1 
ATOM   7837  O  O     . GLY C  1 87  ? 61.829  -1.065   57.435  1.00 89.26  ? 87  GLY C O     1 
ATOM   7838  N  N     . GLU C  1 88  ? 60.386  -1.036   55.709  1.00 84.58  ? 88  GLU C N     1 
ATOM   7839  C  CA    . GLU C  1 88  ? 60.938  0.162    55.077  1.00 84.56  ? 88  GLU C CA    1 
ATOM   7840  C  C     . GLU C  1 88  ? 60.746  1.434    55.903  1.00 83.89  ? 88  GLU C C     1 
ATOM   7841  O  O     . GLU C  1 88  ? 59.855  1.522    56.749  1.00 82.92  ? 88  GLU C O     1 
ATOM   7842  C  CB    . GLU C  1 88  ? 60.299  0.384    53.718  1.00 82.35  ? 88  GLU C CB    1 
ATOM   7843  C  CG    . GLU C  1 88  ? 60.929  -0.361   52.577  1.00 85.60  ? 88  GLU C CG    1 
ATOM   7844  C  CD    . GLU C  1 88  ? 60.331  0.065    51.244  1.00 86.81  ? 88  GLU C CD    1 
ATOM   7845  O  OE1   . GLU C  1 88  ? 60.164  -0.810   50.360  1.00 88.45  ? 88  GLU C OE1   1 
ATOM   7846  O  OE2   . GLU C  1 88  ? 60.020  1.277    51.087  1.00 85.89  ? 88  GLU C OE2   1 
ATOM   7847  N  N     . LEU C  1 89  ? 61.568  2.433    55.605  1.00 84.92  ? 89  LEU C N     1 
ATOM   7848  C  CA    . LEU C  1 89  ? 61.625  3.666    56.370  1.00 85.15  ? 89  LEU C CA    1 
ATOM   7849  C  C     . LEU C  1 89  ? 60.862  4.818    55.688  1.00 82.83  ? 89  LEU C C     1 
ATOM   7850  O  O     . LEU C  1 89  ? 61.213  5.240    54.581  1.00 83.29  ? 89  LEU C O     1 
ATOM   7851  C  CB    . LEU C  1 89  ? 63.098  4.025    56.591  1.00 88.69  ? 89  LEU C CB    1 
ATOM   7852  C  CG    . LEU C  1 89  ? 63.497  5.180    57.505  1.00 90.16  ? 89  LEU C CG    1 
ATOM   7853  C  CD1   . LEU C  1 89  ? 64.783  4.833    58.255  1.00 94.32  ? 89  LEU C CD1   1 
ATOM   7854  C  CD2   . LEU C  1 89  ? 63.644  6.472    56.700  1.00 89.62  ? 89  LEU C CD2   1 
ATOM   7855  N  N     . VAL C  1 90  ? 59.823  5.317    56.359  1.00 81.05  ? 90  VAL C N     1 
ATOM   7856  C  CA    . VAL C  1 90  ? 59.015  6.452    55.881  1.00 79.01  ? 90  VAL C CA    1 
ATOM   7857  C  C     . VAL C  1 90  ? 59.404  7.718    56.641  1.00 80.09  ? 90  VAL C C     1 
ATOM   7858  O  O     . VAL C  1 90  ? 59.646  7.680    57.849  1.00 81.41  ? 90  VAL C O     1 
ATOM   7859  C  CB    . VAL C  1 90  ? 57.490  6.203    56.063  1.00 76.77  ? 90  VAL C CB    1 
ATOM   7860  C  CG1   . VAL C  1 90  ? 56.666  7.309    55.415  1.00 75.09  ? 90  VAL C CG1   1 
ATOM   7861  C  CG2   . VAL C  1 90  ? 57.091  4.850    55.495  1.00 76.39  ? 90  VAL C CG2   1 
ATOM   7862  N  N     . LYS C  1 91  ? 59.427  8.835    55.920  1.00 79.84  ? 91  LYS C N     1 
ATOM   7863  C  CA    . LYS C  1 91  ? 60.013  10.084   56.385  1.00 81.48  ? 91  LYS C CA    1 
ATOM   7864  C  C     . LYS C  1 91  ? 58.979  11.211   56.330  1.00 79.74  ? 91  LYS C C     1 
ATOM   7865  O  O     . LYS C  1 91  ? 58.265  11.342   55.339  1.00 78.49  ? 91  LYS C O     1 
ATOM   7866  C  CB    . LYS C  1 91  ? 61.205  10.430   55.472  1.00 83.96  ? 91  LYS C CB    1 
ATOM   7867  C  CG    . LYS C  1 91  ? 62.135  11.499   55.998  1.00 87.81  ? 91  LYS C CG    1 
ATOM   7868  C  CD    . LYS C  1 91  ? 62.575  12.497   54.919  1.00 90.99  ? 91  LYS C CD    1 
ATOM   7869  C  CE    . LYS C  1 91  ? 63.109  13.785   55.589  1.00 94.76  ? 91  LYS C CE    1 
ATOM   7870  N  NZ    . LYS C  1 91  ? 63.520  14.880   54.660  1.00 97.17  ? 91  LYS C NZ    1 
ATOM   7871  N  N     . ARG C  1 92  ? 58.897  12.023   57.383  1.00 80.24  ? 92  ARG C N     1 
ATOM   7872  C  CA    . ARG C  1 92  ? 58.125  13.276   57.335  1.00 79.38  ? 92  ARG C CA    1 
ATOM   7873  C  C     . ARG C  1 92  ? 58.696  14.225   56.297  1.00 80.64  ? 92  ARG C C     1 
ATOM   7874  O  O     . ARG C  1 92  ? 59.887  14.201   56.000  1.00 82.69  ? 92  ARG C O     1 
ATOM   7875  C  CB    . ARG C  1 92  ? 58.188  14.016   58.666  1.00 80.93  ? 92  ARG C CB    1 
ATOM   7876  C  CG    . ARG C  1 92  ? 57.256  13.544   59.749  1.00 79.91  ? 92  ARG C CG    1 
ATOM   7877  C  CD    . ARG C  1 92  ? 57.208  14.606   60.845  1.00 81.91  ? 92  ARG C CD    1 
ATOM   7878  N  NE    . ARG C  1 92  ? 56.416  15.760   60.418  1.00 81.25  ? 92  ARG C NE    1 
ATOM   7879  C  CZ    . ARG C  1 92  ? 56.368  16.924   61.053  1.00 82.20  ? 92  ARG C CZ    1 
ATOM   7880  N  NH1   . ARG C  1 92  ? 57.080  17.116   62.154  1.00 84.60  ? 92  ARG C NH1   1 
ATOM   7881  N  NH2   . ARG C  1 92  ? 55.603  17.898   60.580  1.00 81.50  ? 92  ARG C NH2   1 
ATOM   7882  N  N     . THR C  1 93  ? 57.842  15.080   55.766  1.00 79.85  ? 93  THR C N     1 
ATOM   7883  C  CA    . THR C  1 93  ? 58.291  16.180   54.948  1.00 82.06  ? 93  THR C CA    1 
ATOM   7884  C  C     . THR C  1 93  ? 58.223  17.432   55.799  1.00 83.80  ? 93  THR C C     1 
ATOM   7885  O  O     . THR C  1 93  ? 58.973  18.382   55.579  1.00 86.86  ? 93  THR C O     1 
ATOM   7886  C  CB    . THR C  1 93  ? 57.384  16.364   53.728  1.00 81.18  ? 93  THR C CB    1 
ATOM   7887  O  OG1   . THR C  1 93  ? 57.195  15.102   53.091  1.00 79.41  ? 93  THR C OG1   1 
ATOM   7888  C  CG2   . THR C  1 93  ? 58.007  17.321   52.731  1.00 84.40  ? 93  THR C CG2   1 
ATOM   7889  N  N     . GLY C  1 94  ? 57.323  17.416   56.779  1.00 82.35  ? 94  GLY C N     1 
ATOM   7890  C  CA    . GLY C  1 94  ? 56.932  18.619   57.493  1.00 83.94  ? 94  GLY C CA    1 
ATOM   7891  C  C     . GLY C  1 94  ? 55.932  19.439   56.693  1.00 84.23  ? 94  GLY C C     1 
ATOM   7892  O  O     . GLY C  1 94  ? 55.450  20.467   57.169  1.00 85.66  ? 94  GLY C O     1 
ATOM   7893  N  N     . ASN C  1 95  ? 55.606  18.979   55.484  1.00 83.48  ? 95  ASN C N     1 
ATOM   7894  C  CA    . ASN C  1 95  ? 54.792  19.757   54.542  1.00 84.65  ? 95  ASN C CA    1 
ATOM   7895  C  C     . ASN C  1 95  ? 53.361  19.259   54.339  1.00 82.57  ? 95  ASN C C     1 
ATOM   7896  O  O     . ASN C  1 95  ? 53.141  18.104   53.956  1.00 80.77  ? 95  ASN C O     1 
ATOM   7897  C  CB    . ASN C  1 95  ? 55.483  19.837   53.172  1.00 86.56  ? 95  ASN C CB    1 
ATOM   7898  C  CG    . ASN C  1 95  ? 56.655  20.798   53.158  1.00 90.23  ? 95  ASN C CG    1 
ATOM   7899  O  OD1   . ASN C  1 95  ? 57.586  20.643   52.370  1.00 92.44  ? 95  ASN C OD1   1 
ATOM   7900  N  ND2   . ASN C  1 95  ? 56.613  21.800   54.025  1.00 92.04  ? 95  ASN C ND2   1 
ATOM   7901  N  N     . ILE C  1 96  ? 52.391  20.140   54.579  1.00 83.28  ? 96  ILE C N     1 
ATOM   7902  C  CA    . ILE C  1 96  ? 51.014  19.886   54.157  1.00 82.12  ? 96  ILE C CA    1 
ATOM   7903  C  C     . ILE C  1 96  ? 51.013  19.959   52.636  1.00 83.38  ? 96  ILE C C     1 
ATOM   7904  O  O     . ILE C  1 96  ? 51.721  20.783   52.054  1.00 86.14  ? 96  ILE C O     1 
ATOM   7905  C  CB    . ILE C  1 96  ? 50.015  20.931   54.740  1.00 83.57  ? 96  ILE C CB    1 
ATOM   7906  C  CG1   . ILE C  1 96  ? 50.184  21.086   56.260  1.00 83.53  ? 96  ILE C CG1   1 
ATOM   7907  C  CG2   . ILE C  1 96  ? 48.572  20.580   54.385  1.00 82.60  ? 96  ILE C CG2   1 
ATOM   7908  C  CD1   . ILE C  1 96  ? 49.724  19.881   57.097  1.00 81.24  ? 96  ILE C CD1   1 
ATOM   7909  N  N     . VAL C  1 97  ? 50.232  19.090   52.003  1.00 81.96  ? 97  VAL C N     1 
ATOM   7910  C  CA    . VAL C  1 97  ? 50.168  18.994   50.543  1.00 83.54  ? 97  VAL C CA    1 
ATOM   7911  C  C     . VAL C  1 97  ? 50.022  20.365   49.874  1.00 87.61  ? 97  VAL C C     1 
ATOM   7912  O  O     . VAL C  1 97  ? 49.159  21.156   50.262  1.00 88.94  ? 97  VAL C O     1 
ATOM   7913  C  CB    . VAL C  1 97  ? 49.008  18.089   50.094  1.00 82.14  ? 97  VAL C CB    1 
ATOM   7914  C  CG1   . VAL C  1 97  ? 49.180  17.701   48.637  1.00 83.64  ? 97  VAL C CG1   1 
ATOM   7915  C  CG2   . VAL C  1 97  ? 48.932  16.850   50.968  1.00 78.67  ? 97  VAL C CG2   1 
ATOM   7916  N  N     . ASP C  1 98  ? 50.869  20.638   48.876  1.00 72.98  ? 98  ASP C N     1 
ATOM   7917  C  CA    . ASP C  1 98  ? 50.903  21.943   48.207  1.00 72.94  ? 98  ASP C CA    1 
ATOM   7918  C  C     . ASP C  1 98  ? 51.416  21.856   46.772  1.00 72.80  ? 98  ASP C C     1 
ATOM   7919  O  O     . ASP C  1 98  ? 51.922  20.820   46.356  1.00 72.77  ? 98  ASP C O     1 
ATOM   7920  C  CB    . ASP C  1 98  ? 51.738  22.941   49.025  1.00 74.44  ? 98  ASP C CB    1 
ATOM   7921  C  CG    . ASP C  1 98  ? 53.221  22.596   49.059  1.00 76.16  ? 98  ASP C CG    1 
ATOM   7922  O  OD1   . ASP C  1 98  ? 53.582  21.394   49.093  1.00 77.13  ? 98  ASP C OD1   1 
ATOM   7923  O  OD2   . ASP C  1 98  ? 54.030  23.544   49.064  1.00 77.61  ? 98  ASP C OD2   1 
ATOM   7924  N  N     . VAL C  1 99  ? 51.287  22.956   46.032  1.00 72.97  ? 99  VAL C N     1 
ATOM   7925  C  CA    . VAL C  1 99  ? 51.659  23.025   44.611  1.00 73.23  ? 99  VAL C CA    1 
ATOM   7926  C  C     . VAL C  1 99  ? 52.366  24.314   44.210  1.00 74.19  ? 99  VAL C C     1 
ATOM   7927  O  O     . VAL C  1 99  ? 52.156  25.356   44.829  1.00 74.48  ? 99  VAL C O     1 
ATOM   7928  C  CB    . VAL C  1 99  ? 50.425  22.924   43.698  1.00 72.27  ? 99  VAL C CB    1 
ATOM   7929  C  CG1   . VAL C  1 99  ? 50.134  21.478   43.378  1.00 72.30  ? 99  VAL C CG1   1 
ATOM   7930  C  CG2   . VAL C  1 99  ? 49.214  23.638   44.320  1.00 71.40  ? 99  VAL C CG2   1 
ATOM   7931  N  N     . PRO C  1 100 ? 53.198  24.249   43.157  1.00 74.97  ? 100 PRO C N     1 
ATOM   7932  C  CA    . PRO C  1 100 ? 53.721  25.483   42.563  1.00 75.98  ? 100 PRO C CA    1 
ATOM   7933  C  C     . PRO C  1 100 ? 52.608  26.266   41.866  1.00 75.35  ? 100 PRO C C     1 
ATOM   7934  O  O     . PRO C  1 100 ? 51.766  25.675   41.173  1.00 74.47  ? 100 PRO C O     1 
ATOM   7935  C  CB    . PRO C  1 100 ? 54.759  24.987   41.549  1.00 76.94  ? 100 PRO C CB    1 
ATOM   7936  C  CG    . PRO C  1 100 ? 54.415  23.548   41.304  1.00 76.47  ? 100 PRO C CG    1 
ATOM   7937  C  CD    . PRO C  1 100 ? 53.803  23.040   42.569  1.00 75.26  ? 100 PRO C CD    1 
ATOM   7938  N  N     . VAL C  1 101 ? 52.595  27.583   42.083  1.00 75.76  ? 101 VAL C N     1 
ATOM   7939  C  CA    . VAL C  1 101 ? 51.563  28.471   41.529  1.00 75.02  ? 101 VAL C CA    1 
ATOM   7940  C  C     . VAL C  1 101 ? 52.194  29.735   40.943  1.00 76.21  ? 101 VAL C C     1 
ATOM   7941  O  O     . VAL C  1 101 ? 53.346  30.034   41.231  1.00 77.29  ? 101 VAL C O     1 
ATOM   7942  C  CB    . VAL C  1 101 ? 50.471  28.847   42.582  1.00 74.08  ? 101 VAL C CB    1 
ATOM   7943  C  CG1   . VAL C  1 101 ? 49.686  27.613   43.037  1.00 72.28  ? 101 VAL C CG1   1 
ATOM   7944  C  CG2   . VAL C  1 101 ? 51.081  29.578   43.762  1.00 74.69  ? 101 VAL C CG2   1 
ATOM   7945  N  N     . GLY C  1 102 ? 51.435  30.457   40.120  1.00 76.14  ? 102 GLY C N     1 
ATOM   7946  C  CA    . GLY C  1 102 ? 51.901  31.693   39.493  1.00 77.76  ? 102 GLY C CA    1 
ATOM   7947  C  C     . GLY C  1 102 ? 51.708  31.738   37.981  1.00 78.52  ? 102 GLY C C     1 
ATOM   7948  O  O     . GLY C  1 102 ? 51.209  30.774   37.389  1.00 77.75  ? 102 GLY C O     1 
ATOM   7949  N  N     . PRO C  1 103 ? 52.116  32.855   37.333  1.00 80.10  ? 103 PRO C N     1 
ATOM   7950  C  CA    . PRO C  1 103 ? 51.907  32.965   35.888  1.00 80.86  ? 103 PRO C CA    1 
ATOM   7951  C  C     . PRO C  1 103 ? 52.886  32.104   35.085  1.00 81.61  ? 103 PRO C C     1 
ATOM   7952  O  O     . PRO C  1 103 ? 52.680  31.896   33.885  1.00 82.28  ? 103 PRO C O     1 
ATOM   7953  C  CB    . PRO C  1 103 ? 52.110  34.459   35.605  1.00 82.32  ? 103 PRO C CB    1 
ATOM   7954  C  CG    . PRO C  1 103 ? 52.943  34.963   36.712  1.00 82.83  ? 103 PRO C CG    1 
ATOM   7955  C  CD    . PRO C  1 103 ? 52.872  34.003   37.870  1.00 81.37  ? 103 PRO C CD    1 
ATOM   7956  N  N     . GLY C  1 104 ? 53.924  31.596   35.751  1.00 81.61  ? 104 GLY C N     1 
ATOM   7957  C  CA    . GLY C  1 104 ? 54.872  30.670   35.130  1.00 82.06  ? 104 GLY C CA    1 
ATOM   7958  C  C     . GLY C  1 104 ? 54.254  29.364   34.644  1.00 80.73  ? 104 GLY C C     1 
ATOM   7959  O  O     . GLY C  1 104 ? 54.789  28.719   33.742  1.00 81.66  ? 104 GLY C O     1 
ATOM   7960  N  N     . LEU C  1 105 ? 53.125  28.976   35.234  1.00 78.70  ? 105 LEU C N     1 
ATOM   7961  C  CA    . LEU C  1 105 ? 52.472  27.726   34.874  1.00 77.33  ? 105 LEU C CA    1 
ATOM   7962  C  C     . LEU C  1 105 ? 51.820  27.740   33.495  1.00 77.74  ? 105 LEU C C     1 
ATOM   7963  O  O     . LEU C  1 105 ? 51.662  26.689   32.875  1.00 77.53  ? 105 LEU C O     1 
ATOM   7964  C  CB    . LEU C  1 105 ? 51.449  27.332   35.930  1.00 75.46  ? 105 LEU C CB    1 
ATOM   7965  C  CG    . LEU C  1 105 ? 51.998  26.443   37.040  1.00 74.81  ? 105 LEU C CG    1 
ATOM   7966  C  CD1   . LEU C  1 105 ? 52.570  27.271   38.182  1.00 75.08  ? 105 LEU C CD1   1 
ATOM   7967  C  CD2   . LEU C  1 105 ? 50.903  25.543   37.541  1.00 73.29  ? 105 LEU C CD2   1 
ATOM   7968  N  N     . LEU C  1 106 ? 51.454  28.929   33.020  1.00 78.40  ? 106 LEU C N     1 
ATOM   7969  C  CA    . LEU C  1 106 ? 50.745  29.091   31.746  1.00 78.89  ? 106 LEU C CA    1 
ATOM   7970  C  C     . LEU C  1 106 ? 51.446  28.412   30.576  1.00 80.14  ? 106 LEU C C     1 
ATOM   7971  O  O     . LEU C  1 106 ? 52.660  28.534   30.420  1.00 81.60  ? 106 LEU C O     1 
ATOM   7972  C  CB    . LEU C  1 106 ? 50.524  30.574   31.438  1.00 79.73  ? 106 LEU C CB    1 
ATOM   7973  C  CG    . LEU C  1 106 ? 49.509  31.280   32.341  1.00 78.78  ? 106 LEU C CG    1 
ATOM   7974  C  CD1   . LEU C  1 106 ? 49.656  32.790   32.230  1.00 79.76  ? 106 LEU C CD1   1 
ATOM   7975  C  CD2   . LEU C  1 106 ? 48.065  30.836   32.047  1.00 77.50  ? 106 LEU C CD2   1 
ATOM   7976  N  N     . GLY C  1 107 ? 50.678  27.690   29.764  1.00 79.83  ? 107 GLY C N     1 
ATOM   7977  C  CA    . GLY C  1 107 ? 51.222  27.012   28.596  1.00 80.96  ? 107 GLY C CA    1 
ATOM   7978  C  C     . GLY C  1 107 ? 51.743  25.622   28.898  1.00 80.39  ? 107 GLY C C     1 
ATOM   7979  O  O     . GLY C  1 107 ? 51.805  24.781   28.005  1.00 81.30  ? 107 GLY C O     1 
ATOM   7980  N  N     . ARG C  1 108 ? 52.112  25.378   30.155  1.00 79.22  ? 108 ARG C N     1 
ATOM   7981  C  CA    . ARG C  1 108 ? 52.649  24.079   30.595  1.00 78.68  ? 108 ARG C CA    1 
ATOM   7982  C  C     . ARG C  1 108 ? 51.554  23.027   30.868  1.00 77.03  ? 108 ARG C C     1 
ATOM   7983  O  O     . ARG C  1 108 ? 50.371  23.357   30.991  1.00 76.28  ? 108 ARG C O     1 
ATOM   7984  C  CB    . ARG C  1 108 ? 53.520  24.253   31.852  1.00 78.25  ? 108 ARG C CB    1 
ATOM   7985  C  CG    . ARG C  1 108 ? 54.591  25.346   31.769  1.00 80.37  ? 108 ARG C CG    1 
ATOM   7986  C  CD    . ARG C  1 108 ? 55.635  25.056   30.689  1.00 83.31  ? 108 ARG C CD    1 
ATOM   7987  N  NE    . ARG C  1 108 ? 56.118  23.676   30.742  1.00 83.12  ? 108 ARG C NE    1 
ATOM   7988  C  CZ    . ARG C  1 108 ? 57.110  23.254   31.519  1.00 83.14  ? 108 ARG C CZ    1 
ATOM   7989  N  NH1   . ARG C  1 108 ? 57.748  24.099   32.316  1.00 83.73  ? 108 ARG C NH1   1 
ATOM   7990  N  NH2   . ARG C  1 108 ? 57.468  21.982   31.499  1.00 83.04  ? 108 ARG C NH2   1 
ATOM   7991  N  N     . VAL C  1 109 ? 51.957  21.761   30.958  1.00 76.49  ? 109 VAL C N     1 
ATOM   7992  C  CA    . VAL C  1 109 ? 51.066  20.686   31.394  1.00 74.69  ? 109 VAL C CA    1 
ATOM   7993  C  C     . VAL C  1 109 ? 51.654  20.060   32.659  1.00 73.65  ? 109 VAL C C     1 
ATOM   7994  O  O     . VAL C  1 109 ? 52.847  19.754   32.702  1.00 74.48  ? 109 VAL C O     1 
ATOM   7995  C  CB    . VAL C  1 109 ? 50.899  19.602   30.308  1.00 75.43  ? 109 VAL C CB    1 
ATOM   7996  C  CG1   . VAL C  1 109 ? 49.770  18.652   30.671  1.00 73.75  ? 109 VAL C CG1   1 
ATOM   7997  C  CG2   . VAL C  1 109 ? 50.640  20.232   28.946  1.00 77.03  ? 109 VAL C CG2   1 
ATOM   7998  N  N     . VAL C  1 110 ? 50.835  19.882   33.693  1.00 71.81  ? 110 VAL C N     1 
ATOM   7999  C  CA    . VAL C  1 110 ? 51.347  19.348   34.957  1.00 71.00  ? 110 VAL C CA    1 
ATOM   8000  C  C     . VAL C  1 110 ? 50.485  18.265   35.573  1.00 69.66  ? 110 VAL C C     1 
ATOM   8001  O  O     . VAL C  1 110 ? 49.277  18.221   35.356  1.00 68.58  ? 110 VAL C O     1 
ATOM   8002  C  CB    . VAL C  1 110 ? 51.614  20.455   36.034  1.00 70.70  ? 110 VAL C CB    1 
ATOM   8003  C  CG1   . VAL C  1 110 ? 52.751  21.379   35.606  1.00 72.35  ? 110 VAL C CG1   1 
ATOM   8004  C  CG2   . VAL C  1 110 ? 50.353  21.235   36.372  1.00 69.38  ? 110 VAL C CG2   1 
ATOM   8005  N  N     . ASP C  1 111 ? 51.127  17.403   36.357  1.00 69.72  ? 111 ASP C N     1 
ATOM   8006  C  CA    . ASP C  1 111 ? 50.419  16.406   37.140  1.00 69.14  ? 111 ASP C CA    1 
ATOM   8007  C  C     . ASP C  1 111 ? 49.736  17.002   38.383  1.00 68.40  ? 111 ASP C C     1 
ATOM   8008  O  O     . ASP C  1 111 ? 49.797  18.215   38.617  1.00 68.41  ? 111 ASP C O     1 
ATOM   8009  C  CB    . ASP C  1 111 ? 51.330  15.210   37.479  1.00 69.83  ? 111 ASP C CB    1 
ATOM   8010  C  CG    . ASP C  1 111 ? 52.361  15.506   38.570  1.00 70.16  ? 111 ASP C CG    1 
ATOM   8011  O  OD1   . ASP C  1 111 ? 52.293  16.536   39.269  1.00 69.95  ? 111 ASP C OD1   1 
ATOM   8012  O  OD2   . ASP C  1 111 ? 53.256  14.659   38.740  1.00 71.58  ? 111 ASP C OD2   1 
ATOM   8013  N  N     . ALA C  1 112 ? 49.088  16.145   39.172  1.00 67.88  ? 112 ALA C N     1 
ATOM   8014  C  CA    . ALA C  1 112 ? 48.292  16.586   40.321  1.00 66.96  ? 112 ALA C CA    1 
ATOM   8015  C  C     . ALA C  1 112 ? 49.104  17.347   41.350  1.00 67.28  ? 112 ALA C C     1 
ATOM   8016  O  O     . ALA C  1 112 ? 48.550  18.149   42.102  1.00 67.18  ? 112 ALA C O     1 
ATOM   8017  C  CB    . ALA C  1 112 ? 47.612  15.407   40.977  1.00 66.42  ? 112 ALA C CB    1 
ATOM   8018  N  N     . LEU C  1 113 ? 50.409  17.090   41.385  1.00 67.99  ? 113 LEU C N     1 
ATOM   8019  C  CA    . LEU C  1 113 ? 51.286  17.744   42.342  1.00 68.34  ? 113 LEU C CA    1 
ATOM   8020  C  C     . LEU C  1 113 ? 52.064  18.902   41.747  1.00 69.45  ? 113 LEU C C     1 
ATOM   8021  O  O     . LEU C  1 113 ? 52.938  19.455   42.404  1.00 70.47  ? 113 LEU C O     1 
ATOM   8022  C  CB    . LEU C  1 113 ? 52.235  16.732   42.976  1.00 68.73  ? 113 LEU C CB    1 
ATOM   8023  C  CG    . LEU C  1 113 ? 51.593  15.861   44.049  1.00 67.47  ? 113 LEU C CG    1 
ATOM   8024  C  CD1   . LEU C  1 113 ? 52.592  14.864   44.591  1.00 67.77  ? 113 LEU C CD1   1 
ATOM   8025  C  CD2   . LEU C  1 113 ? 51.031  16.721   45.164  1.00 66.85  ? 113 LEU C CD2   1 
ATOM   8026  N  N     . GLY C  1 114 ? 51.740  19.282   40.514  1.00 69.72  ? 114 GLY C N     1 
ATOM   8027  C  CA    . GLY C  1 114 ? 52.397  20.414   39.856  1.00 70.99  ? 114 GLY C CA    1 
ATOM   8028  C  C     . GLY C  1 114 ? 53.720  20.106   39.161  1.00 72.63  ? 114 GLY C C     1 
ATOM   8029  O  O     . GLY C  1 114 ? 54.394  21.014   38.652  1.00 73.79  ? 114 GLY C O     1 
ATOM   8030  N  N     . ASN C  1 115 ? 54.100  18.831   39.143  1.00 72.89  ? 115 ASN C N     1 
ATOM   8031  C  CA    . ASN C  1 115 ? 55.280  18.387   38.412  1.00 74.39  ? 115 ASN C CA    1 
ATOM   8032  C  C     . ASN C  1 115 ? 55.046  18.535   36.911  1.00 75.06  ? 115 ASN C C     1 
ATOM   8033  O  O     . ASN C  1 115 ? 53.937  18.293   36.447  1.00 74.31  ? 115 ASN C O     1 
ATOM   8034  C  CB    . ASN C  1 115 ? 55.584  16.931   38.755  1.00 74.36  ? 115 ASN C CB    1 
ATOM   8035  C  CG    . ASN C  1 115 ? 55.901  16.734   40.215  1.00 73.81  ? 115 ASN C CG    1 
ATOM   8036  O  OD1   . ASN C  1 115 ? 56.925  17.206   40.699  1.00 74.92  ? 115 ASN C OD1   1 
ATOM   8037  N  ND2   . ASN C  1 115 ? 55.024  16.038   40.927  1.00 72.05  ? 115 ASN C ND2   1 
ATOM   8038  N  N     . PRO C  1 116 ? 56.083  18.926   36.143  1.00 76.76  ? 116 PRO C N     1 
ATOM   8039  C  CA    . PRO C  1 116 ? 55.860  19.090   34.711  1.00 77.47  ? 116 PRO C CA    1 
ATOM   8040  C  C     . PRO C  1 116 ? 55.827  17.740   33.999  1.00 77.78  ? 116 PRO C C     1 
ATOM   8041  O  O     . PRO C  1 116 ? 56.628  16.855   34.304  1.00 78.28  ? 116 PRO C O     1 
ATOM   8042  C  CB    . PRO C  1 116 ? 57.063  19.922   34.251  1.00 79.17  ? 116 PRO C CB    1 
ATOM   8043  C  CG    . PRO C  1 116 ? 58.036  19.946   35.405  1.00 79.64  ? 116 PRO C CG    1 
ATOM   8044  C  CD    . PRO C  1 116 ? 57.509  19.056   36.488  1.00 78.33  ? 116 PRO C CD    1 
ATOM   8045  N  N     . ILE C  1 117 ? 54.882  17.586   33.077  1.00 77.63  ? 117 ILE C N     1 
ATOM   8046  C  CA    . ILE C  1 117 ? 54.690  16.324   32.361  1.00 78.03  ? 117 ILE C CA    1 
ATOM   8047  C  C     . ILE C  1 117 ? 54.668  16.507   30.840  1.00 79.52  ? 117 ILE C C     1 
ATOM   8048  O  O     . ILE C  1 117 ? 54.556  15.526   30.097  1.00 80.34  ? 117 ILE C O     1 
ATOM   8049  C  CB    . ILE C  1 117 ? 53.393  15.585   32.792  1.00 76.29  ? 117 ILE C CB    1 
ATOM   8050  C  CG1   . ILE C  1 117 ? 52.161  16.445   32.503  1.00 75.53  ? 117 ILE C CG1   1 
ATOM   8051  C  CG2   . ILE C  1 117 ? 53.458  15.157   34.262  1.00 75.25  ? 117 ILE C CG2   1 
ATOM   8052  C  CD1   . ILE C  1 117 ? 50.977  15.656   32.004  1.00 75.57  ? 117 ILE C CD1   1 
ATOM   8053  N  N     . ASP C  1 118 ? 54.763  17.754   30.381  1.00 80.08  ? 118 ASP C N     1 
ATOM   8054  C  CA    . ASP C  1 118 ? 54.868  18.037   28.951  1.00 81.67  ? 118 ASP C CA    1 
ATOM   8055  C  C     . ASP C  1 118 ? 56.321  17.949   28.474  1.00 83.65  ? 118 ASP C C     1 
ATOM   8056  O  O     . ASP C  1 118 ? 56.628  18.314   27.339  1.00 85.20  ? 118 ASP C O     1 
ATOM   8057  C  CB    . ASP C  1 118 ? 54.270  19.410   28.618  1.00 81.79  ? 118 ASP C CB    1 
ATOM   8058  C  CG    . ASP C  1 118 ? 54.951  20.559   29.364  1.00 81.80  ? 118 ASP C CG    1 
ATOM   8059  O  OD1   . ASP C  1 118 ? 55.817  20.298   30.230  1.00 81.04  ? 118 ASP C OD1   1 
ATOM   8060  O  OD2   . ASP C  1 118 ? 54.608  21.731   29.080  1.00 81.87  ? 118 ASP C OD2   1 
ATOM   8061  N  N     . GLY C  1 119 ? 57.196  17.470   29.361  1.00 83.47  ? 119 GLY C N     1 
ATOM   8062  C  CA    . GLY C  1 119 ? 58.624  17.351   29.102  1.00 85.27  ? 119 GLY C CA    1 
ATOM   8063  C  C     . GLY C  1 119 ? 59.277  18.611   28.562  1.00 86.79  ? 119 GLY C C     1 
ATOM   8064  O  O     . GLY C  1 119 ? 60.018  18.560   27.575  1.00 89.05  ? 119 GLY C O     1 
ATOM   8065  N  N     . LYS C  1 120 ? 59.003  19.742   29.203  1.00 85.92  ? 120 LYS C N     1 
ATOM   8066  C  CA    . LYS C  1 120 ? 59.611  21.015   28.815  1.00 87.48  ? 120 LYS C CA    1 
ATOM   8067  C  C     . LYS C  1 120 ? 60.448  21.652   29.937  1.00 87.94  ? 120 LYS C C     1 
ATOM   8068  O  O     . LYS C  1 120 ? 60.833  22.823   29.842  1.00 88.81  ? 120 LYS C O     1 
ATOM   8069  C  CB    . LYS C  1 120 ? 58.547  21.996   28.305  1.00 86.81  ? 120 LYS C CB    1 
ATOM   8070  C  CG    . LYS C  1 120 ? 57.788  21.505   27.093  1.00 86.16  ? 120 LYS C CG    1 
ATOM   8071  C  CD    . LYS C  1 120 ? 56.894  22.580   26.533  1.00 84.75  ? 120 LYS C CD    1 
ATOM   8072  C  CE    . LYS C  1 120 ? 56.011  22.012   25.449  1.00 84.54  ? 120 LYS C CE    1 
ATOM   8073  N  NZ    . LYS C  1 120 ? 55.017  22.997   24.965  1.00 84.24  ? 120 LYS C NZ    1 
ATOM   8074  N  N     . GLY C  1 121 ? 60.724  20.878   30.989  1.00 87.46  ? 121 GLY C N     1 
ATOM   8075  C  CA    . GLY C  1 121 ? 61.576  21.330   32.093  1.00 88.34  ? 121 GLY C CA    1 
ATOM   8076  C  C     . GLY C  1 121 ? 60.816  21.971   33.240  1.00 87.07  ? 121 GLY C C     1 
ATOM   8077  O  O     . GLY C  1 121 ? 59.589  21.849   33.310  1.00 85.64  ? 121 GLY C O     1 
ATOM   8078  N  N     . PRO C  1 122 ? 61.540  22.675   34.140  1.00 87.87  ? 122 PRO C N     1 
ATOM   8079  C  CA    . PRO C  1 122 ? 61.023  23.245   35.413  1.00 86.71  ? 122 PRO C CA    1 
ATOM   8080  C  C     . PRO C  1 122 ? 59.884  24.280   35.270  1.00 85.83  ? 122 PRO C C     1 
ATOM   8081  O  O     . PRO C  1 122 ? 59.784  24.940   34.236  1.00 86.78  ? 122 PRO C O     1 
ATOM   8082  C  CB    . PRO C  1 122 ? 62.267  23.919   36.021  1.00 88.19  ? 122 PRO C CB    1 
ATOM   8083  C  CG    . PRO C  1 122 ? 63.429  23.290   35.330  1.00 89.83  ? 122 PRO C CG    1 
ATOM   8084  C  CD    . PRO C  1 122 ? 62.970  22.980   33.950  1.00 89.76  ? 122 PRO C CD    1 
ATOM   8085  N  N     . ILE C  1 123 ? 59.046  24.423   36.300  1.00 84.33  ? 123 ILE C N     1 
ATOM   8086  C  CA    . ILE C  1 123 ? 58.027  25.489   36.326  1.00 83.80  ? 123 ILE C CA    1 
ATOM   8087  C  C     . ILE C  1 123 ? 58.516  26.752   37.052  1.00 84.74  ? 123 ILE C C     1 
ATOM   8088  O  O     . ILE C  1 123 ? 59.273  26.665   38.018  1.00 85.35  ? 123 ILE C O     1 
ATOM   8089  C  CB    . ILE C  1 123 ? 56.702  25.028   36.994  1.00 81.72  ? 123 ILE C CB    1 
ATOM   8090  C  CG1   . ILE C  1 123 ? 56.197  23.704   36.402  1.00 81.31  ? 123 ILE C CG1   1 
ATOM   8091  C  CG2   . ILE C  1 123 ? 55.637  26.121   36.884  1.00 80.97  ? 123 ILE C CG2   1 
ATOM   8092  C  CD1   . ILE C  1 123 ? 55.788  23.769   34.922  1.00 81.92  ? 123 ILE C CD1   1 
ATOM   8093  N  N     . ASP C  1 124 ? 58.070  27.921   36.592  1.00 85.23  ? 124 ASP C N     1 
ATOM   8094  C  CA    . ASP C  1 124 ? 58.364  29.193   37.271  1.00 85.96  ? 124 ASP C CA    1 
ATOM   8095  C  C     . ASP C  1 124 ? 57.328  29.612   38.314  1.00 84.27  ? 124 ASP C C     1 
ATOM   8096  O  O     . ASP C  1 124 ? 56.401  30.386   38.027  1.00 83.85  ? 124 ASP C O     1 
ATOM   8097  C  CB    . ASP C  1 124 ? 58.589  30.314   36.262  1.00 87.65  ? 124 ASP C CB    1 
ATOM   8098  C  CG    . ASP C  1 124 ? 60.039  30.465   35.905  1.00 90.94  ? 124 ASP C CG    1 
ATOM   8099  O  OD1   . ASP C  1 124 ? 60.871  29.844   36.607  1.00 91.96  ? 124 ASP C OD1   1 
ATOM   8100  O  OD2   . ASP C  1 124 ? 60.351  31.197   34.936  1.00 94.28  ? 124 ASP C OD2   1 
ATOM   8101  N  N     . ALA C  1 125 ? 57.515  29.107   39.531  1.00 83.31  ? 125 ALA C N     1 
ATOM   8102  C  CA    . ALA C  1 125 ? 56.577  29.328   40.617  1.00 81.82  ? 125 ALA C CA    1 
ATOM   8103  C  C     . ALA C  1 125 ? 56.794  30.678   41.277  1.00 82.63  ? 125 ALA C C     1 
ATOM   8104  O  O     . ALA C  1 125 ? 57.886  30.959   41.776  1.00 84.28  ? 125 ALA C O     1 
ATOM   8105  C  CB    . ALA C  1 125 ? 56.699  28.216   41.643  1.00 81.20  ? 125 ALA C CB    1 
ATOM   8106  N  N     . ALA C  1 126 ? 55.757  31.512   41.275  1.00 81.69  ? 126 ALA C N     1 
ATOM   8107  C  CA    . ALA C  1 126 ? 55.776  32.750   42.039  1.00 82.14  ? 126 ALA C CA    1 
ATOM   8108  C  C     . ALA C  1 126 ? 55.500  32.450   43.510  1.00 81.42  ? 126 ALA C C     1 
ATOM   8109  O  O     . ALA C  1 126 ? 55.615  33.325   44.360  1.00 82.42  ? 126 ALA C O     1 
ATOM   8110  C  CB    . ALA C  1 126 ? 54.766  33.730   41.488  1.00 81.86  ? 126 ALA C CB    1 
ATOM   8111  N  N     . GLY C  1 127 ? 55.144  31.204   43.801  1.00 80.19  ? 127 GLY C N     1 
ATOM   8112  C  CA    . GLY C  1 127 ? 54.903  30.760   45.168  1.00 79.79  ? 127 GLY C CA    1 
ATOM   8113  C  C     . GLY C  1 127 ? 54.393  29.332   45.259  1.00 78.54  ? 127 GLY C C     1 
ATOM   8114  O  O     . GLY C  1 127 ? 54.476  28.559   44.294  1.00 77.97  ? 127 GLY C O     1 
ATOM   8115  N  N     . ARG C  1 128 ? 53.860  28.990   46.430  1.00 78.06  ? 128 ARG C N     1 
ATOM   8116  C  CA    . ARG C  1 128 ? 53.350  27.650   46.701  1.00 77.05  ? 128 ARG C CA    1 
ATOM   8117  C  C     . ARG C  1 128 ? 52.067  27.704   47.534  1.00 76.32  ? 128 ARG C C     1 
ATOM   8118  O  O     . ARG C  1 128 ? 52.119  27.815   48.765  1.00 77.30  ? 128 ARG C O     1 
ATOM   8119  C  CB    . ARG C  1 128 ? 54.409  26.800   47.427  1.00 77.73  ? 128 ARG C CB    1 
ATOM   8120  C  CG    . ARG C  1 128 ? 55.604  26.385   46.582  1.00 77.76  ? 128 ARG C CG    1 
ATOM   8121  C  CD    . ARG C  1 128 ? 56.403  25.269   47.246  1.00 76.97  ? 128 ARG C CD    1 
ATOM   8122  N  NE    . ARG C  1 128 ? 55.688  23.994   47.252  1.00 74.96  ? 128 ARG C NE    1 
ATOM   8123  C  CZ    . ARG C  1 128 ? 55.623  23.160   46.219  1.00 74.16  ? 128 ARG C CZ    1 
ATOM   8124  N  NH1   . ARG C  1 128 ? 56.225  23.452   45.077  1.00 75.31  ? 128 ARG C NH1   1 
ATOM   8125  N  NH2   . ARG C  1 128 ? 54.947  22.030   46.322  1.00 73.21  ? 128 ARG C NH2   1 
ATOM   8126  N  N     . SER C  1 129 ? 50.919  27.627   46.870  1.00 75.00  ? 129 SER C N     1 
ATOM   8127  C  CA    . SER C  1 129 ? 49.647  27.530   47.578  1.00 74.05  ? 129 SER C CA    1 
ATOM   8128  C  C     . SER C  1 129 ? 49.448  26.109   48.092  1.00 73.19  ? 129 SER C C     1 
ATOM   8129  O  O     . SER C  1 129 ? 49.973  25.166   47.515  1.00 73.12  ? 129 SER C O     1 
ATOM   8130  C  CB    . SER C  1 129 ? 48.487  27.911   46.654  1.00 73.42  ? 129 SER C CB    1 
ATOM   8131  O  OG    . SER C  1 129 ? 48.475  29.300   46.362  1.00 74.62  ? 129 SER C OG    1 
ATOM   8132  N  N     . ARG C  1 130 ? 48.686  25.961   49.173  1.00 72.85  ? 130 ARG C N     1 
ATOM   8133  C  CA    . ARG C  1 130 ? 48.266  24.642   49.672  1.00 72.13  ? 130 ARG C CA    1 
ATOM   8134  C  C     . ARG C  1 130 ? 47.265  23.945   48.762  1.00 70.70  ? 130 ARG C C     1 
ATOM   8135  O  O     . ARG C  1 130 ? 46.628  24.585   47.924  1.00 70.67  ? 130 ARG C O     1 
ATOM   8136  C  CB    . ARG C  1 130 ? 47.623  24.773   51.047  1.00 72.48  ? 130 ARG C CB    1 
ATOM   8137  C  CG    . ARG C  1 130 ? 48.471  24.240   52.162  1.00 74.20  ? 130 ARG C CG    1 
ATOM   8138  C  CD    . ARG C  1 130 ? 47.750  24.373   53.465  1.00 75.89  ? 130 ARG C CD    1 
ATOM   8139  N  NE    . ARG C  1 130 ? 48.692  24.374   54.572  1.00 78.61  ? 130 ARG C NE    1 
ATOM   8140  C  CZ    . ARG C  1 130 ? 48.377  24.695   55.822  1.00 80.67  ? 130 ARG C CZ    1 
ATOM   8141  N  NH1   . ARG C  1 130 ? 47.136  25.048   56.141  1.00 80.49  ? 130 ARG C NH1   1 
ATOM   8142  N  NH2   . ARG C  1 130 ? 49.312  24.664   56.759  1.00 83.26  ? 130 ARG C NH2   1 
ATOM   8143  N  N     . ALA C  1 131 ? 47.105  22.636   48.952  1.00 69.82  ? 131 ALA C N     1 
ATOM   8144  C  CA    . ALA C  1 131 ? 46.114  21.866   48.199  1.00 68.23  ? 131 ALA C CA    1 
ATOM   8145  C  C     . ALA C  1 131 ? 44.710  22.230   48.653  1.00 67.30  ? 131 ALA C C     1 
ATOM   8146  O  O     . ALA C  1 131 ? 43.821  22.431   47.827  1.00 66.62  ? 131 ALA C O     1 
ATOM   8147  C  CB    . ALA C  1 131 ? 46.356  20.374   48.349  1.00 68.16  ? 131 ALA C CB    1 
ATOM   8148  N  N     . GLN C  1 132 ? 44.528  22.328   49.968  1.00 67.17  ? 132 GLN C N     1 
ATOM   8149  C  CA    . GLN C  1 132 ? 43.239  22.685   50.539  1.00 66.52  ? 132 GLN C CA    1 
ATOM   8150  C  C     . GLN C  1 132 ? 43.250  24.086   51.141  1.00 66.73  ? 132 GLN C C     1 
ATOM   8151  O  O     . GLN C  1 132 ? 43.644  24.267   52.283  1.00 67.53  ? 132 GLN C O     1 
ATOM   8152  C  CB    . GLN C  1 132 ? 42.822  21.657   51.592  1.00 66.73  ? 132 GLN C CB    1 
ATOM   8153  C  CG    . GLN C  1 132 ? 42.553  20.253   51.042  1.00 66.76  ? 132 GLN C CG    1 
ATOM   8154  C  CD    . GLN C  1 132 ? 41.188  20.100   50.379  1.00 66.34  ? 132 GLN C CD    1 
ATOM   8155  O  OE1   . GLN C  1 132 ? 40.317  20.969   50.491  1.00 66.44  ? 132 GLN C OE1   1 
ATOM   8156  N  NE2   . GLN C  1 132 ? 40.995  18.978   49.690  1.00 65.68  ? 132 GLN C NE2   1 
ATOM   8157  N  N     . VAL C  1 133 ? 42.823  25.070   50.356  1.00 66.25  ? 133 VAL C N     1 
ATOM   8158  C  CA    . VAL C  1 133 ? 42.615  26.446   50.822  1.00 66.67  ? 133 VAL C CA    1 
ATOM   8159  C  C     . VAL C  1 133 ? 41.142  26.671   51.190  1.00 66.31  ? 133 VAL C C     1 
ATOM   8160  O  O     . VAL C  1 133 ? 40.247  26.068   50.593  1.00 65.68  ? 133 VAL C O     1 
ATOM   8161  C  CB    . VAL C  1 133 ? 43.002  27.476   49.732  1.00 66.78  ? 133 VAL C CB    1 
ATOM   8162  C  CG1   . VAL C  1 133 ? 42.860  28.882   50.253  1.00 67.55  ? 133 VAL C CG1   1 
ATOM   8163  C  CG2   . VAL C  1 133 ? 44.437  27.256   49.247  1.00 67.69  ? 133 VAL C CG2   1 
ATOM   8164  N  N     . LYS C  1 134 ? 40.889  27.536   52.168  1.00 66.84  ? 134 LYS C N     1 
ATOM   8165  C  CA    . LYS C  1 134 ? 39.528  27.981   52.458  1.00 66.58  ? 134 LYS C CA    1 
ATOM   8166  C  C     . LYS C  1 134 ? 38.920  28.766   51.298  1.00 65.95  ? 134 LYS C C     1 
ATOM   8167  O  O     . LYS C  1 134 ? 39.642  29.322   50.462  1.00 66.37  ? 134 LYS C O     1 
ATOM   8168  C  CB    . LYS C  1 134 ? 39.516  28.833   53.704  1.00 67.68  ? 134 LYS C CB    1 
ATOM   8169  C  CG    . LYS C  1 134 ? 39.264  28.034   54.942  1.00 69.44  ? 134 LYS C CG    1 
ATOM   8170  C  CD    . LYS C  1 134 ? 39.683  28.811   56.183  1.00 73.11  ? 134 LYS C CD    1 
ATOM   8171  C  CE    . LYS C  1 134 ? 39.133  28.163   57.444  1.00 74.91  ? 134 LYS C CE    1 
ATOM   8172  N  NZ    . LYS C  1 134 ? 40.204  28.071   58.467  1.00 76.73  ? 134 LYS C NZ    1 
ATOM   8173  N  N     . ALA C  1 135 ? 37.593  28.784   51.227  1.00 65.05  ? 135 ALA C N     1 
ATOM   8174  C  CA    . ALA C  1 135 ? 36.908  29.600   50.242  1.00 64.50  ? 135 ALA C CA    1 
ATOM   8175  C  C     . ALA C  1 135 ? 36.820  31.005   50.827  1.00 65.43  ? 135 ALA C C     1 
ATOM   8176  O  O     . ALA C  1 135 ? 37.045  31.169   52.022  1.00 65.95  ? 135 ALA C O     1 
ATOM   8177  C  CB    . ALA C  1 135 ? 35.556  29.044   49.959  1.00 63.88  ? 135 ALA C CB    1 
ATOM   8178  N  N     . PRO C  1 136 ? 36.551  32.033   49.992  1.00 65.68  ? 136 PRO C N     1 
ATOM   8179  C  CA    . PRO C  1 136 ? 36.386  33.338   50.608  1.00 66.69  ? 136 PRO C CA    1 
ATOM   8180  C  C     . PRO C  1 136 ? 35.039  33.403   51.305  1.00 67.05  ? 136 PRO C C     1 
ATOM   8181  O  O     . PRO C  1 136 ? 34.044  32.871   50.789  1.00 66.37  ? 136 PRO C O     1 
ATOM   8182  C  CB    . PRO C  1 136 ? 36.448  34.307   49.418  1.00 66.89  ? 136 PRO C CB    1 
ATOM   8183  C  CG    . PRO C  1 136 ? 37.150  33.564   48.361  1.00 65.98  ? 136 PRO C CG    1 
ATOM   8184  C  CD    . PRO C  1 136 ? 36.663  32.154   48.529  1.00 65.52  ? 136 PRO C CD    1 
ATOM   8185  N  N     . GLY C  1 137 ? 35.035  34.031   52.481  1.00 67.94  ? 137 GLY C N     1 
ATOM   8186  C  CA    . GLY C  1 137 ? 33.870  34.081   53.338  1.00 68.36  ? 137 GLY C CA    1 
ATOM   8187  C  C     . GLY C  1 137 ? 32.806  35.001   52.795  1.00 68.98  ? 137 GLY C C     1 
ATOM   8188  O  O     . GLY C  1 137 ? 32.843  35.405   51.629  1.00 68.41  ? 137 GLY C O     1 
ATOM   8189  N  N     . ILE C  1 138 ? 31.860  35.336   53.666  1.00 70.27  ? 138 ILE C N     1 
ATOM   8190  C  CA    . ILE C  1 138 ? 30.723  36.185   53.333  1.00 71.21  ? 138 ILE C CA    1 
ATOM   8191  C  C     . ILE C  1 138 ? 31.182  37.588   52.942  1.00 71.95  ? 138 ILE C C     1 
ATOM   8192  O  O     . ILE C  1 138 ? 30.614  38.186   52.028  1.00 72.52  ? 138 ILE C O     1 
ATOM   8193  C  CB    . ILE C  1 138 ? 29.692  36.233   54.502  1.00 72.44  ? 138 ILE C CB    1 
ATOM   8194  C  CG1   . ILE C  1 138 ? 28.913  34.912   54.603  1.00 72.58  ? 138 ILE C CG1   1 
ATOM   8195  C  CG2   . ILE C  1 138 ? 28.703  37.369   54.322  1.00 73.74  ? 138 ILE C CG2   1 
ATOM   8196  C  CD1   . ILE C  1 138 ? 29.688  33.734   55.264  1.00 73.42  ? 138 ILE C CD1   1 
ATOM   8197  N  N     . LEU C  1 139 ? 32.230  38.086   53.601  1.00 72.15  ? 139 LEU C N     1 
ATOM   8198  C  CA    . LEU C  1 139 ? 32.722  39.450   53.370  1.00 72.80  ? 139 LEU C CA    1 
ATOM   8199  C  C     . LEU C  1 139 ? 33.490  39.756   52.048  1.00 72.28  ? 139 LEU C C     1 
ATOM   8200  O  O     . LEU C  1 139 ? 32.977  40.514   51.227  1.00 72.80  ? 139 LEU C O     1 
ATOM   8201  C  CB    . LEU C  1 139 ? 33.502  39.940   54.585  1.00 73.84  ? 139 LEU C CB    1 
ATOM   8202  C  CG    . LEU C  1 139 ? 33.262  41.403   54.919  1.00 74.88  ? 139 LEU C CG    1 
ATOM   8203  C  CD1   . LEU C  1 139 ? 32.020  41.513   55.770  1.00 75.49  ? 139 LEU C CD1   1 
ATOM   8204  C  CD2   . LEU C  1 139 ? 34.463  41.956   55.645  1.00 75.85  ? 139 LEU C CD2   1 
ATOM   8205  N  N     . PRO C  1 140 ? 34.704  39.185   51.840  1.00 71.46  ? 140 PRO C N     1 
ATOM   8206  C  CA    . PRO C  1 140 ? 35.568  39.573   50.711  1.00 71.47  ? 140 PRO C CA    1 
ATOM   8207  C  C     . PRO C  1 140 ? 35.033  39.224   49.319  1.00 71.06  ? 140 PRO C C     1 
ATOM   8208  O  O     . PRO C  1 140 ? 35.718  38.546   48.549  1.00 70.25  ? 140 PRO C O     1 
ATOM   8209  C  CB    . PRO C  1 140 ? 36.846  38.773   50.977  1.00 70.67  ? 140 PRO C CB    1 
ATOM   8210  C  CG    . PRO C  1 140 ? 36.383  37.584   51.704  1.00 69.64  ? 140 PRO C CG    1 
ATOM   8211  C  CD    . PRO C  1 140 ? 35.338  38.114   52.630  1.00 70.87  ? 140 PRO C CD    1 
ATOM   8212  N  N     . ARG C  1 141 ? 33.836  39.706   48.990  1.00 72.02  ? 141 ARG C N     1 
ATOM   8213  C  CA    . ARG C  1 141 ? 33.113  39.252   47.802  1.00 71.88  ? 141 ARG C CA    1 
ATOM   8214  C  C     . ARG C  1 141 ? 32.256  40.333   47.180  1.00 73.25  ? 141 ARG C C     1 
ATOM   8215  O  O     . ARG C  1 141 ? 31.829  41.256   47.859  1.00 74.77  ? 141 ARG C O     1 
ATOM   8216  C  CB    . ARG C  1 141 ? 32.221  38.068   48.153  1.00 71.00  ? 141 ARG C CB    1 
ATOM   8217  C  CG    . ARG C  1 141 ? 32.901  36.720   48.106  1.00 70.16  ? 141 ARG C CG    1 
ATOM   8218  C  CD    . ARG C  1 141 ? 31.925  35.665   48.553  1.00 70.86  ? 141 ARG C CD    1 
ATOM   8219  N  NE    . ARG C  1 141 ? 32.542  34.354   48.682  1.00 70.27  ? 141 ARG C NE    1 
ATOM   8220  C  CZ    . ARG C  1 141 ? 32.532  33.431   47.729  1.00 69.63  ? 141 ARG C CZ    1 
ATOM   8221  N  NH1   . ARG C  1 141 ? 31.933  33.684   46.568  1.00 70.24  ? 141 ARG C NH1   1 
ATOM   8222  N  NH2   . ARG C  1 141 ? 33.131  32.262   47.938  1.00 68.16  ? 141 ARG C NH2   1 
ATOM   8223  N  N     . ARG C  1 142 ? 31.985  40.184   45.890  1.00 73.47  ? 142 ARG C N     1 
ATOM   8224  C  CA    . ARG C  1 142 ? 31.267  41.172   45.096  1.00 75.26  ? 142 ARG C CA    1 
ATOM   8225  C  C     . ARG C  1 142 ? 30.305  40.413   44.193  1.00 74.94  ? 142 ARG C C     1 
ATOM   8226  O  O     . ARG C  1 142 ? 30.646  39.350   43.685  1.00 73.87  ? 142 ARG C O     1 
ATOM   8227  C  CB    . ARG C  1 142 ? 32.289  41.971   44.272  1.00 76.22  ? 142 ARG C CB    1 
ATOM   8228  C  CG    . ARG C  1 142 ? 31.757  43.082   43.377  1.00 78.81  ? 142 ARG C CG    1 
ATOM   8229  C  CD    . ARG C  1 142 ? 32.939  43.863   42.803  1.00 82.31  ? 142 ARG C CD    1 
ATOM   8230  N  NE    . ARG C  1 142 ? 32.565  45.179   42.274  1.00 87.04  ? 142 ARG C NE    1 
ATOM   8231  C  CZ    . ARG C  1 142 ? 32.183  46.226   43.012  1.00 89.71  ? 142 ARG C CZ    1 
ATOM   8232  N  NH1   . ARG C  1 142 ? 32.098  46.143   44.338  1.00 90.54  ? 142 ARG C NH1   1 
ATOM   8233  N  NH2   . ARG C  1 142 ? 31.868  47.369   42.416  1.00 91.80  ? 142 ARG C NH2   1 
ATOM   8234  N  N     . SER C  1 143 ? 29.105  40.943   43.991  1.00 76.29  ? 143 SER C N     1 
ATOM   8235  C  CA    . SER C  1 143 ? 28.109  40.270   43.153  1.00 76.69  ? 143 SER C CA    1 
ATOM   8236  C  C     . SER C  1 143 ? 28.613  39.993   41.736  1.00 76.84  ? 143 SER C C     1 
ATOM   8237  O  O     . SER C  1 143 ? 29.376  40.781   41.178  1.00 77.76  ? 143 SER C O     1 
ATOM   8238  C  CB    . SER C  1 143 ? 26.822  41.083   43.102  1.00 78.17  ? 143 SER C CB    1 
ATOM   8239  O  OG    . SER C  1 143 ? 26.130  40.995   44.334  1.00 78.92  ? 143 SER C OG    1 
ATOM   8240  N  N     . VAL C  1 144 ? 28.188  38.872   41.160  1.00 76.43  ? 144 VAL C N     1 
ATOM   8241  C  CA    . VAL C  1 144 ? 28.652  38.469   39.832  1.00 76.57  ? 144 VAL C CA    1 
ATOM   8242  C  C     . VAL C  1 144 ? 27.965  39.326   38.763  1.00 78.60  ? 144 VAL C C     1 
ATOM   8243  O  O     . VAL C  1 144 ? 26.743  39.292   38.632  1.00 79.40  ? 144 VAL C O     1 
ATOM   8244  C  CB    . VAL C  1 144 ? 28.419  36.949   39.585  1.00 75.23  ? 144 VAL C CB    1 
ATOM   8245  C  CG1   . VAL C  1 144 ? 28.918  36.541   38.216  1.00 75.28  ? 144 VAL C CG1   1 
ATOM   8246  C  CG2   . VAL C  1 144 ? 29.100  36.110   40.658  1.00 73.21  ? 144 VAL C CG2   1 
ATOM   8247  N  N     . HIS C  1 145 ? 28.751  40.102   38.015  1.00 79.83  ? 145 HIS C N     1 
ATOM   8248  C  CA    . HIS C  1 145 ? 28.192  41.045   37.035  1.00 82.19  ? 145 HIS C CA    1 
ATOM   8249  C  C     . HIS C  1 145 ? 28.909  41.075   35.680  1.00 83.00  ? 145 HIS C C     1 
ATOM   8250  O  O     . HIS C  1 145 ? 28.375  41.617   34.708  1.00 84.77  ? 145 HIS C O     1 
ATOM   8251  C  CB    . HIS C  1 145 ? 28.126  42.457   37.622  1.00 83.55  ? 145 HIS C CB    1 
ATOM   8252  C  CG    . HIS C  1 145 ? 29.468  43.044   37.941  1.00 84.41  ? 145 HIS C CG    1 
ATOM   8253  N  ND1   . HIS C  1 145 ? 30.329  42.476   38.857  1.00 83.80  ? 145 HIS C ND1   1 
ATOM   8254  C  CD2   . HIS C  1 145 ? 30.091  44.153   37.476  1.00 86.16  ? 145 HIS C CD2   1 
ATOM   8255  C  CE1   . HIS C  1 145 ? 31.428  43.205   38.936  1.00 84.36  ? 145 HIS C CE1   1 
ATOM   8256  N  NE2   . HIS C  1 145 ? 31.310  44.227   38.107  1.00 85.92  ? 145 HIS C NE2   1 
ATOM   8257  N  N     . GLU C  1 146 ? 30.107  40.500   35.616  1.00 82.10  ? 146 GLU C N     1 
ATOM   8258  C  CA    . GLU C  1 146 ? 30.904  40.518   34.390  1.00 82.83  ? 146 GLU C CA    1 
ATOM   8259  C  C     . GLU C  1 146 ? 30.710  39.226   33.608  1.00 82.11  ? 146 GLU C C     1 
ATOM   8260  O  O     . GLU C  1 146 ? 30.898  38.145   34.158  1.00 80.50  ? 146 GLU C O     1 
ATOM   8261  C  CB    . GLU C  1 146 ? 32.386  40.703   34.715  1.00 82.51  ? 146 GLU C CB    1 
ATOM   8262  C  CG    . GLU C  1 146 ? 32.705  41.881   35.617  1.00 83.50  ? 146 GLU C CG    1 
ATOM   8263  C  CD    . GLU C  1 146 ? 33.695  41.508   36.692  1.00 83.04  ? 146 GLU C CD    1 
ATOM   8264  O  OE1   . GLU C  1 146 ? 33.427  40.543   37.445  1.00 82.50  ? 146 GLU C OE1   1 
ATOM   8265  O  OE2   . GLU C  1 146 ? 34.739  42.177   36.788  1.00 84.10  ? 146 GLU C OE2   1 
ATOM   8266  N  N     . PRO C  1 147 ? 30.336  39.335   32.319  1.00 83.57  ? 147 PRO C N     1 
ATOM   8267  C  CA    . PRO C  1 147 ? 30.127  38.170   31.453  1.00 83.26  ? 147 PRO C CA    1 
ATOM   8268  C  C     . PRO C  1 147 ? 31.398  37.388   31.123  1.00 82.32  ? 147 PRO C C     1 
ATOM   8269  O  O     . PRO C  1 147 ? 32.424  37.972   30.780  1.00 82.64  ? 147 PRO C O     1 
ATOM   8270  C  CB    . PRO C  1 147 ? 29.549  38.783   30.168  1.00 85.57  ? 147 PRO C CB    1 
ATOM   8271  C  CG    . PRO C  1 147 ? 29.036  40.134   30.568  1.00 86.71  ? 147 PRO C CG    1 
ATOM   8272  C  CD    . PRO C  1 147 ? 29.972  40.592   31.637  1.00 85.76  ? 147 PRO C CD    1 
ATOM   8273  N  N     . VAL C  1 148 ? 31.316  36.069   31.265  1.00 81.25  ? 148 VAL C N     1 
ATOM   8274  C  CA    . VAL C  1 148 ? 32.287  35.155   30.673  1.00 81.16  ? 148 VAL C CA    1 
ATOM   8275  C  C     . VAL C  1 148 ? 31.615  34.667   29.397  1.00 82.76  ? 148 VAL C C     1 
ATOM   8276  O  O     . VAL C  1 148 ? 30.628  33.925   29.461  1.00 82.73  ? 148 VAL C O     1 
ATOM   8277  C  CB    . VAL C  1 148 ? 32.605  33.948   31.592  1.00 78.80  ? 148 VAL C CB    1 
ATOM   8278  C  CG1   . VAL C  1 148 ? 33.474  32.935   30.869  1.00 78.40  ? 148 VAL C CG1   1 
ATOM   8279  C  CG2   . VAL C  1 148 ? 33.291  34.402   32.854  1.00 78.09  ? 148 VAL C CG2   1 
ATOM   8280  N  N     . GLN C  1 149 ? 32.122  35.107   28.246  1.00 84.57  ? 149 GLN C N     1 
ATOM   8281  C  CA    . GLN C  1 149 ? 31.466  34.832   26.961  1.00 86.33  ? 149 GLN C CA    1 
ATOM   8282  C  C     . GLN C  1 149 ? 31.897  33.485   26.385  1.00 86.01  ? 149 GLN C C     1 
ATOM   8283  O  O     . GLN C  1 149 ? 33.094  33.215   26.250  1.00 85.85  ? 149 GLN C O     1 
ATOM   8284  C  CB    . GLN C  1 149 ? 31.734  35.961   25.958  1.00 88.62  ? 149 GLN C CB    1 
ATOM   8285  C  CG    . GLN C  1 149 ? 31.101  37.294   26.348  1.00 89.54  ? 149 GLN C CG    1 
ATOM   8286  C  CD    . GLN C  1 149 ? 31.619  38.468   25.534  1.00 91.09  ? 149 GLN C CD    1 
ATOM   8287  O  OE1   . GLN C  1 149 ? 31.657  38.420   24.306  1.00 92.76  ? 149 GLN C OE1   1 
ATOM   8288  N  NE2   . GLN C  1 149 ? 32.013  39.535   26.220  1.00 90.65  ? 149 GLN C NE2   1 
ATOM   8289  N  N     . THR C  1 150 ? 30.925  32.642   26.048  1.00 86.06  ? 150 THR C N     1 
ATOM   8290  C  CA    . THR C  1 150 ? 31.233  31.308   25.537  1.00 85.67  ? 150 THR C CA    1 
ATOM   8291  C  C     . THR C  1 150 ? 31.332  31.266   24.015  1.00 88.02  ? 150 THR C C     1 
ATOM   8292  O  O     . THR C  1 150 ? 32.069  30.447   23.461  1.00 88.23  ? 150 THR C O     1 
ATOM   8293  C  CB    . THR C  1 150 ? 30.217  30.259   26.012  1.00 84.53  ? 150 THR C CB    1 
ATOM   8294  O  OG1   . THR C  1 150 ? 28.906  30.654   25.607  1.00 85.87  ? 150 THR C OG1   1 
ATOM   8295  C  CG2   . THR C  1 150 ? 30.259  30.118   27.525  1.00 82.33  ? 150 THR C CG2   1 
ATOM   8296  N  N     . GLY C  1 151 ? 30.596  32.153   23.347  1.00 90.09  ? 151 GLY C N     1 
ATOM   8297  C  CA    . GLY C  1 151 ? 30.536  32.173   21.881  1.00 92.55  ? 151 GLY C CA    1 
ATOM   8298  C  C     . GLY C  1 151 ? 29.430  31.271   21.368  1.00 93.17  ? 151 GLY C C     1 
ATOM   8299  O  O     . GLY C  1 151 ? 29.022  31.358   20.209  1.00 95.53  ? 151 GLY C O     1 
ATOM   8300  N  N     . LEU C  1 152 ? 28.947  30.401   22.250  1.00 91.16  ? 152 LEU C N     1 
ATOM   8301  C  CA    . LEU C  1 152 ? 27.831  29.525   21.956  1.00 91.59  ? 152 LEU C CA    1 
ATOM   8302  C  C     . LEU C  1 152 ? 26.543  30.323   22.040  1.00 92.59  ? 152 LEU C C     1 
ATOM   8303  O  O     . LEU C  1 152 ? 26.077  30.657   23.132  1.00 90.91  ? 152 LEU C O     1 
ATOM   8304  C  CB    . LEU C  1 152 ? 27.794  28.345   22.934  1.00 89.40  ? 152 LEU C CB    1 
ATOM   8305  C  CG    . LEU C  1 152 ? 29.126  27.688   23.319  1.00 88.10  ? 152 LEU C CG    1 
ATOM   8306  C  CD1   . LEU C  1 152 ? 28.937  26.730   24.477  1.00 86.27  ? 152 LEU C CD1   1 
ATOM   8307  C  CD2   . LEU C  1 152 ? 29.761  26.974   22.141  1.00 90.04  ? 152 LEU C CD2   1 
ATOM   8308  N  N     . LYS C  1 153 ? 25.988  30.636   20.872  1.00 95.36  ? 153 LYS C N     1 
ATOM   8309  C  CA    . LYS C  1 153 ? 24.723  31.360   20.748  1.00 97.15  ? 153 LYS C CA    1 
ATOM   8310  C  C     . LYS C  1 153 ? 23.684  30.938   21.788  1.00 95.97  ? 153 LYS C C     1 
ATOM   8311  O  O     . LYS C  1 153 ? 22.987  31.785   22.350  1.00 96.14  ? 153 LYS C O     1 
ATOM   8312  C  CB    . LYS C  1 153 ? 24.131  31.145   19.358  1.00 100.01 ? 153 LYS C CB    1 
ATOM   8313  C  CG    . LYS C  1 153 ? 24.864  31.832   18.229  1.00 102.16 ? 153 LYS C CG    1 
ATOM   8314  C  CD    . LYS C  1 153 ? 24.228  31.483   16.888  1.00 105.05 ? 153 LYS C CD    1 
ATOM   8315  C  CE    . LYS C  1 153 ? 24.534  30.042   16.497  1.00 104.86 ? 153 LYS C CE    1 
ATOM   8316  N  NZ    . LYS C  1 153 ? 23.905  29.661   15.210  1.00 107.74 ? 153 LYS C NZ    1 
ATOM   8317  N  N     . ALA C  1 154 ? 23.591  29.628   22.029  1.00 94.99  ? 154 ALA C N     1 
ATOM   8318  C  CA    . ALA C  1 154 ? 22.577  29.048   22.910  1.00 94.17  ? 154 ALA C CA    1 
ATOM   8319  C  C     . ALA C  1 154 ? 22.849  29.311   24.395  1.00 92.00  ? 154 ALA C C     1 
ATOM   8320  O  O     . ALA C  1 154 ? 21.924  29.601   25.160  1.00 91.91  ? 154 ALA C O     1 
ATOM   8321  C  CB    . ALA C  1 154 ? 22.444  27.562   22.647  1.00 93.66  ? 154 ALA C CB    1 
ATOM   8322  N  N     . VAL C  1 155 ? 24.115  29.211   24.796  1.00 90.60  ? 155 VAL C N     1 
ATOM   8323  C  CA    . VAL C  1 155 ? 24.505  29.454   26.188  1.00 88.47  ? 155 VAL C CA    1 
ATOM   8324  C  C     . VAL C  1 155 ? 24.381  30.933   26.564  1.00 89.04  ? 155 VAL C C     1 
ATOM   8325  O  O     . VAL C  1 155 ? 23.749  31.277   27.561  1.00 88.26  ? 155 VAL C O     1 
ATOM   8326  C  CB    . VAL C  1 155 ? 25.932  28.907   26.492  1.00 86.71  ? 155 VAL C CB    1 
ATOM   8327  C  CG1   . VAL C  1 155 ? 26.510  29.520   27.768  1.00 85.09  ? 155 VAL C CG1   1 
ATOM   8328  C  CG2   . VAL C  1 155 ? 25.896  27.405   26.608  1.00 85.53  ? 155 VAL C CG2   1 
ATOM   8329  N  N     . ASP C  1 156 ? 24.963  31.803   25.749  1.00 90.49  ? 156 ASP C N     1 
ATOM   8330  C  CA    . ASP C  1 156 ? 25.036  33.213   26.092  1.00 91.16  ? 156 ASP C CA    1 
ATOM   8331  C  C     . ASP C  1 156 ? 23.703  33.950   25.937  1.00 93.02  ? 156 ASP C C     1 
ATOM   8332  O  O     . ASP C  1 156 ? 23.568  35.095   26.382  1.00 93.68  ? 156 ASP C O     1 
ATOM   8333  C  CB    . ASP C  1 156 ? 26.182  33.883   25.333  1.00 92.07  ? 156 ASP C CB    1 
ATOM   8334  C  CG    . ASP C  1 156 ? 27.553  33.424   25.832  1.00 90.58  ? 156 ASP C CG    1 
ATOM   8335  O  OD1   . ASP C  1 156 ? 27.614  32.764   26.899  1.00 88.10  ? 156 ASP C OD1   1 
ATOM   8336  O  OD2   . ASP C  1 156 ? 28.569  33.721   25.160  1.00 91.69  ? 156 ASP C OD2   1 
ATOM   8337  N  N     . ALA C  1 157 ? 22.716  33.278   25.342  1.00 94.02  ? 157 ALA C N     1 
ATOM   8338  C  CA    . ALA C  1 157 ? 21.360  33.816   25.239  1.00 95.57  ? 157 ALA C CA    1 
ATOM   8339  C  C     . ALA C  1 157 ? 20.457  33.307   26.364  1.00 94.27  ? 157 ALA C C     1 
ATOM   8340  O  O     . ALA C  1 157 ? 19.627  34.059   26.887  1.00 94.87  ? 157 ALA C O     1 
ATOM   8341  C  CB    . ALA C  1 157 ? 20.754  33.481   23.886  1.00 97.98  ? 157 ALA C CB    1 
ATOM   8342  N  N     . LEU C  1 158 ? 20.641  32.038   26.738  1.00 92.51  ? 158 LEU C N     1 
ATOM   8343  C  CA    . LEU C  1 158 ? 19.715  31.326   27.632  1.00 91.30  ? 158 LEU C CA    1 
ATOM   8344  C  C     . LEU C  1 158 ? 20.307  30.928   28.986  1.00 88.57  ? 158 LEU C C     1 
ATOM   8345  O  O     . LEU C  1 158 ? 19.601  30.917   29.993  1.00 87.97  ? 158 LEU C O     1 
ATOM   8346  C  CB    . LEU C  1 158 ? 19.141  30.095   26.923  1.00 91.90  ? 158 LEU C CB    1 
ATOM   8347  C  CG    . LEU C  1 158 ? 18.615  30.317   25.499  1.00 94.27  ? 158 LEU C CG    1 
ATOM   8348  C  CD1   . LEU C  1 158 ? 18.233  28.994   24.861  1.00 94.97  ? 158 LEU C CD1   1 
ATOM   8349  C  CD2   . LEU C  1 158 ? 17.445  31.284   25.476  1.00 95.58  ? 158 LEU C CD2   1 
ATOM   8350  N  N     . VAL C  1 159 ? 21.593  30.595   29.008  1.00 87.15  ? 159 VAL C N     1 
ATOM   8351  C  CA    . VAL C  1 159 ? 22.289  30.292   30.267  1.00 84.96  ? 159 VAL C CA    1 
ATOM   8352  C  C     . VAL C  1 159 ? 23.649  31.021   30.393  1.00 84.27  ? 159 VAL C C     1 
ATOM   8353  O  O     . VAL C  1 159 ? 24.705  30.382   30.360  1.00 83.06  ? 159 VAL C O     1 
ATOM   8354  C  CB    . VAL C  1 159 ? 22.454  28.758   30.494  1.00 83.60  ? 159 VAL C CB    1 
ATOM   8355  C  CG1   . VAL C  1 159 ? 21.106  28.097   30.718  1.00 84.00  ? 159 VAL C CG1   1 
ATOM   8356  C  CG2   . VAL C  1 159 ? 23.182  28.097   29.331  1.00 84.21  ? 159 VAL C CG2   1 
ATOM   8357  N  N     . PRO C  1 160 ? 23.619  32.366   30.559  1.00 85.08  ? 160 PRO C N     1 
ATOM   8358  C  CA    . PRO C  1 160 ? 24.827  33.203   30.501  1.00 84.92  ? 160 PRO C CA    1 
ATOM   8359  C  C     . PRO C  1 160 ? 25.722  33.127   31.742  1.00 82.89  ? 160 PRO C C     1 
ATOM   8360  O  O     . PRO C  1 160 ? 25.285  33.477   32.845  1.00 82.50  ? 160 PRO C O     1 
ATOM   8361  C  CB    . PRO C  1 160 ? 24.265  34.628   30.335  1.00 86.78  ? 160 PRO C CB    1 
ATOM   8362  C  CG    . PRO C  1 160 ? 22.767  34.479   30.172  1.00 87.74  ? 160 PRO C CG    1 
ATOM   8363  C  CD    . PRO C  1 160 ? 22.423  33.186   30.820  1.00 86.39  ? 160 PRO C CD    1 
ATOM   8364  N  N     . ILE C  1 161 ? 26.974  32.709   31.540  1.00 81.86  ? 161 ILE C N     1 
ATOM   8365  C  CA    . ILE C  1 161 ? 27.920  32.439   32.631  1.00 79.87  ? 161 ILE C CA    1 
ATOM   8366  C  C     . ILE C  1 161 ? 28.762  33.660   33.016  1.00 80.00  ? 161 ILE C C     1 
ATOM   8367  O  O     . ILE C  1 161 ? 29.516  34.183   32.193  1.00 80.79  ? 161 ILE C O     1 
ATOM   8368  C  CB    . ILE C  1 161 ? 28.862  31.266   32.274  1.00 78.89  ? 161 ILE C CB    1 
ATOM   8369  C  CG1   . ILE C  1 161 ? 28.052  30.010   31.934  1.00 78.65  ? 161 ILE C CG1   1 
ATOM   8370  C  CG2   . ILE C  1 161 ? 29.856  31.001   33.415  1.00 77.33  ? 161 ILE C CG2   1 
ATOM   8371  C  CD1   . ILE C  1 161 ? 28.851  28.929   31.222  1.00 77.73  ? 161 ILE C CD1   1 
ATOM   8372  N  N     . GLY C  1 162 ? 28.639  34.087   34.276  1.00 79.17  ? 162 GLY C N     1 
ATOM   8373  C  CA    . GLY C  1 162 ? 29.356  35.257   34.797  1.00 79.23  ? 162 GLY C CA    1 
ATOM   8374  C  C     . GLY C  1 162 ? 30.689  34.990   35.482  1.00 77.77  ? 162 GLY C C     1 
ATOM   8375  O  O     . GLY C  1 162 ? 31.078  33.838   35.671  1.00 76.69  ? 162 GLY C O     1 
ATOM   8376  N  N     . ARG C  1 163 ? 31.386  36.066   35.852  1.00 77.96  ? 163 ARG C N     1 
ATOM   8377  C  CA    . ARG C  1 163 ? 32.699  35.977   36.482  1.00 76.97  ? 163 ARG C CA    1 
ATOM   8378  C  C     . ARG C  1 163 ? 32.606  35.764   37.979  1.00 75.69  ? 163 ARG C C     1 
ATOM   8379  O  O     . ARG C  1 163 ? 32.119  36.626   38.714  1.00 76.36  ? 163 ARG C O     1 
ATOM   8380  C  CB    . ARG C  1 163 ? 33.533  37.211   36.173  1.00 78.24  ? 163 ARG C CB    1 
ATOM   8381  C  CG    . ARG C  1 163 ? 34.508  36.978   35.047  1.00 79.77  ? 163 ARG C CG    1 
ATOM   8382  C  CD    . ARG C  1 163 ? 34.594  38.179   34.136  1.00 83.47  ? 163 ARG C CD    1 
ATOM   8383  N  NE    . ARG C  1 163 ? 34.828  37.778   32.751  1.00 85.76  ? 163 ARG C NE    1 
ATOM   8384  C  CZ    . ARG C  1 163 ? 35.938  38.046   32.068  1.00 87.89  ? 163 ARG C CZ    1 
ATOM   8385  N  NH1   . ARG C  1 163 ? 36.926  38.736   32.639  1.00 87.97  ? 163 ARG C NH1   1 
ATOM   8386  N  NH2   . ARG C  1 163 ? 36.054  37.637   30.805  1.00 89.15  ? 163 ARG C NH2   1 
ATOM   8387  N  N     . GLY C  1 164 ? 33.098  34.612   38.422  1.00 74.02  ? 164 GLY C N     1 
ATOM   8388  C  CA    . GLY C  1 164 ? 32.945  34.184   39.804  1.00 72.43  ? 164 GLY C CA    1 
ATOM   8389  C  C     . GLY C  1 164 ? 31.859  33.139   39.952  1.00 71.41  ? 164 GLY C C     1 
ATOM   8390  O  O     . GLY C  1 164 ? 31.586  32.690   41.061  1.00 70.85  ? 164 GLY C O     1 
ATOM   8391  N  N     . GLN C  1 165 ? 31.254  32.748   38.828  1.00 71.36  ? 165 GLN C N     1 
ATOM   8392  C  CA    . GLN C  1 165 ? 30.138  31.795   38.793  1.00 70.50  ? 165 GLN C CA    1 
ATOM   8393  C  C     . GLN C  1 165 ? 30.602  30.335   38.845  1.00 69.34  ? 165 GLN C C     1 
ATOM   8394  O  O     . GLN C  1 165 ? 31.763  30.023   38.543  1.00 68.80  ? 165 GLN C O     1 
ATOM   8395  C  CB    . GLN C  1 165 ? 29.282  32.037   37.539  1.00 71.40  ? 165 GLN C CB    1 
ATOM   8396  C  CG    . GLN C  1 165 ? 27.886  31.429   37.580  1.00 70.85  ? 165 GLN C CG    1 
ATOM   8397  C  CD    . GLN C  1 165 ? 26.969  31.915   36.459  1.00 71.96  ? 165 GLN C CD    1 
ATOM   8398  O  OE1   . GLN C  1 165 ? 27.063  33.054   35.995  1.00 73.05  ? 165 GLN C OE1   1 
ATOM   8399  N  NE2   . GLN C  1 165 ? 26.056  31.051   36.040  1.00 71.99  ? 165 GLN C NE2   1 
ATOM   8400  N  N     . ARG C  1 166 ? 29.689  29.456   39.264  1.00 68.91  ? 166 ARG C N     1 
ATOM   8401  C  CA    . ARG C  1 166 ? 29.851  28.005   39.142  1.00 67.82  ? 166 ARG C CA    1 
ATOM   8402  C  C     . ARG C  1 166 ? 28.695  27.476   38.296  1.00 68.68  ? 166 ARG C C     1 
ATOM   8403  O  O     . ARG C  1 166 ? 27.540  27.472   38.745  1.00 68.98  ? 166 ARG C O     1 
ATOM   8404  C  CB    . ARG C  1 166 ? 29.843  27.325   40.510  1.00 66.67  ? 166 ARG C CB    1 
ATOM   8405  C  CG    . ARG C  1 166 ? 31.042  27.618   41.396  1.00 65.04  ? 166 ARG C CG    1 
ATOM   8406  C  CD    . ARG C  1 166 ? 30.796  28.751   42.380  1.00 63.64  ? 166 ARG C CD    1 
ATOM   8407  N  NE    . ARG C  1 166 ? 29.454  28.756   42.963  1.00 63.43  ? 166 ARG C NE    1 
ATOM   8408  C  CZ    . ARG C  1 166 ? 29.056  28.027   44.009  1.00 63.55  ? 166 ARG C CZ    1 
ATOM   8409  N  NH1   . ARG C  1 166 ? 29.885  27.185   44.621  1.00 62.66  ? 166 ARG C NH1   1 
ATOM   8410  N  NH2   . ARG C  1 166 ? 27.806  28.132   44.449  1.00 64.24  ? 166 ARG C NH2   1 
ATOM   8411  N  N     . GLU C  1 167 ? 29.004  27.061   37.066  1.00 69.15  ? 167 GLU C N     1 
ATOM   8412  C  CA    . GLU C  1 167 ? 27.987  26.579   36.127  1.00 70.08  ? 167 GLU C CA    1 
ATOM   8413  C  C     . GLU C  1 167 ? 28.263  25.136   35.732  1.00 69.60  ? 167 GLU C C     1 
ATOM   8414  O  O     . GLU C  1 167 ? 29.281  24.838   35.113  1.00 69.49  ? 167 GLU C O     1 
ATOM   8415  C  CB    . GLU C  1 167 ? 27.904  27.487   34.898  1.00 71.21  ? 167 GLU C CB    1 
ATOM   8416  C  CG    . GLU C  1 167 ? 26.755  27.174   33.956  1.00 73.63  ? 167 GLU C CG    1 
ATOM   8417  C  CD    . GLU C  1 167 ? 25.360  27.411   34.551  1.00 76.24  ? 167 GLU C CD    1 
ATOM   8418  O  OE1   . GLU C  1 167 ? 25.239  27.982   35.662  1.00 76.81  ? 167 GLU C OE1   1 
ATOM   8419  O  OE2   . GLU C  1 167 ? 24.368  27.019   33.891  1.00 77.40  ? 167 GLU C OE2   1 
ATOM   8420  N  N     . LEU C  1 168 ? 27.356  24.245   36.117  1.00 69.65  ? 168 LEU C N     1 
ATOM   8421  C  CA    . LEU C  1 168 ? 27.536  22.815   35.900  1.00 69.47  ? 168 LEU C CA    1 
ATOM   8422  C  C     . LEU C  1 168 ? 27.238  22.420   34.460  1.00 70.94  ? 168 LEU C C     1 
ATOM   8423  O  O     . LEU C  1 168 ? 26.202  22.805   33.908  1.00 72.27  ? 168 LEU C O     1 
ATOM   8424  C  CB    . LEU C  1 168 ? 26.646  22.007   36.858  1.00 68.93  ? 168 LEU C CB    1 
ATOM   8425  C  CG    . LEU C  1 168 ? 26.679  20.470   36.799  1.00 68.05  ? 168 LEU C CG    1 
ATOM   8426  C  CD1   . LEU C  1 168 ? 28.093  19.896   36.955  1.00 65.94  ? 168 LEU C CD1   1 
ATOM   8427  C  CD2   . LEU C  1 168 ? 25.752  19.890   37.849  1.00 67.29  ? 168 LEU C CD2   1 
ATOM   8428  N  N     . ILE C  1 169 ? 28.152  21.662   33.857  1.00 70.83  ? 169 ILE C N     1 
ATOM   8429  C  CA    . ILE C  1 169 ? 27.871  21.003   32.591  1.00 72.05  ? 169 ILE C CA    1 
ATOM   8430  C  C     . ILE C  1 169 ? 27.545  19.552   32.916  1.00 71.68  ? 169 ILE C C     1 
ATOM   8431  O  O     . ILE C  1 169 ? 28.369  18.837   33.485  1.00 70.89  ? 169 ILE C O     1 
ATOM   8432  C  CB    . ILE C  1 169 ? 29.058  21.070   31.616  1.00 72.43  ? 169 ILE C CB    1 
ATOM   8433  C  CG1   . ILE C  1 169 ? 29.502  22.521   31.395  1.00 72.94  ? 169 ILE C CG1   1 
ATOM   8434  C  CG2   . ILE C  1 169 ? 28.676  20.421   30.284  1.00 74.20  ? 169 ILE C CG2   1 
ATOM   8435  C  CD1   . ILE C  1 169 ? 30.754  22.672   30.533  1.00 72.85  ? 169 ILE C CD1   1 
ATOM   8436  N  N     . ILE C  1 170 ? 26.343  19.118   32.561  1.00 72.58  ? 170 ILE C N     1 
ATOM   8437  C  CA    . ILE C  1 170 ? 25.872  17.802   32.975  1.00 72.43  ? 170 ILE C CA    1 
ATOM   8438  C  C     . ILE C  1 170 ? 25.174  17.060   31.830  1.00 74.19  ? 170 ILE C C     1 
ATOM   8439  O  O     . ILE C  1 170 ? 24.603  17.680   30.929  1.00 75.71  ? 170 ILE C O     1 
ATOM   8440  C  CB    . ILE C  1 170 ? 24.964  17.933   34.227  1.00 71.87  ? 170 ILE C CB    1 
ATOM   8441  C  CG1   . ILE C  1 170 ? 24.579  16.565   34.795  1.00 71.27  ? 170 ILE C CG1   1 
ATOM   8442  C  CG2   . ILE C  1 170 ? 23.743  18.794   33.920  1.00 73.27  ? 170 ILE C CG2   1 
ATOM   8443  C  CD1   . ILE C  1 170 ? 24.070  16.609   36.219  1.00 69.60  ? 170 ILE C CD1   1 
ATOM   8444  N  N     . GLY C  1 171 ? 25.240  15.732   31.861  1.00 74.37  ? 171 GLY C N     1 
ATOM   8445  C  CA    . GLY C  1 171 ? 24.623  14.898   30.826  1.00 76.43  ? 171 GLY C CA    1 
ATOM   8446  C  C     . GLY C  1 171 ? 25.252  13.519   30.721  1.00 76.46  ? 171 GLY C C     1 
ATOM   8447  O  O     . GLY C  1 171 ? 26.172  13.190   31.471  1.00 75.13  ? 171 GLY C O     1 
ATOM   8448  N  N     . ASP C  1 172 ? 24.742  12.710   29.796  1.00 78.17  ? 172 ASP C N     1 
ATOM   8449  C  CA    . ASP C  1 172 ? 25.281  11.373   29.545  1.00 78.73  ? 172 ASP C CA    1 
ATOM   8450  C  C     . ASP C  1 172 ? 26.626  11.404   28.819  1.00 79.00  ? 172 ASP C C     1 
ATOM   8451  O  O     . ASP C  1 172 ? 27.035  12.446   28.300  1.00 79.39  ? 172 ASP C O     1 
ATOM   8452  C  CB    . ASP C  1 172 ? 24.285  10.558   28.724  1.00 80.63  ? 172 ASP C CB    1 
ATOM   8453  C  CG    . ASP C  1 172 ? 23.125  10.053   29.547  1.00 81.06  ? 172 ASP C CG    1 
ATOM   8454  O  OD1   . ASP C  1 172 ? 23.064  10.373   30.755  1.00 79.62  ? 172 ASP C OD1   1 
ATOM   8455  O  OD2   . ASP C  1 172 ? 22.277  9.327    28.980  1.00 83.24  ? 172 ASP C OD2   1 
ATOM   8456  N  N     . ARG C  1 173 ? 27.312  10.262   28.784  1.00 79.08  ? 173 ARG C N     1 
ATOM   8457  C  CA    . ARG C  1 173 ? 28.547  10.140   28.017  1.00 79.79  ? 173 ARG C CA    1 
ATOM   8458  C  C     . ARG C  1 173 ? 28.284  10.526   26.560  1.00 81.62  ? 173 ARG C C     1 
ATOM   8459  O  O     . ARG C  1 173 ? 27.241  10.183   25.997  1.00 83.17  ? 173 ARG C O     1 
ATOM   8460  C  CB    . ARG C  1 173 ? 29.142  8.725    28.116  1.00 79.85  ? 173 ARG C CB    1 
ATOM   8461  C  CG    . ARG C  1 173 ? 28.151  7.611    27.812  1.00 82.67  ? 173 ARG C CG    1 
ATOM   8462  C  CD    . ARG C  1 173 ? 28.799  6.236    27.666  1.00 85.26  ? 173 ARG C CD    1 
ATOM   8463  N  NE    . ARG C  1 173 ? 27.847  5.294    27.068  1.00 88.10  ? 173 ARG C NE    1 
ATOM   8464  C  CZ    . ARG C  1 173 ? 27.774  5.007    25.766  1.00 90.72  ? 173 ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C  1 173 ? 28.618  5.565    24.899  1.00 90.97  ? 173 ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C  1 173 ? 26.861  4.144    25.328  1.00 92.29  ? 173 ARG C NH2   1 
ATOM   8467  N  N     . GLN C  1 174 ? 29.221  11.277   25.984  1.00 81.72  ? 174 GLN C N     1 
ATOM   8468  C  CA    . GLN C  1 174 ? 29.207  11.655   24.570  1.00 83.43  ? 174 GLN C CA    1 
ATOM   8469  C  C     . GLN C  1 174 ? 28.031  12.552   24.157  1.00 84.30  ? 174 GLN C C     1 
ATOM   8470  O  O     . GLN C  1 174 ? 27.424  12.358   23.103  1.00 86.36  ? 174 GLN C O     1 
ATOM   8471  C  CB    . GLN C  1 174 ? 29.308  10.412   23.694  1.00 84.99  ? 174 GLN C CB    1 
ATOM   8472  C  CG    . GLN C  1 174 ? 30.670  9.750    23.709  1.00 85.50  ? 174 GLN C CG    1 
ATOM   8473  C  CD    . GLN C  1 174 ? 31.668  10.455   22.800  1.00 88.16  ? 174 GLN C CD    1 
ATOM   8474  O  OE1   . GLN C  1 174 ? 32.853  10.565   23.126  1.00 87.81  ? 174 GLN C OE1   1 
ATOM   8475  N  NE2   . GLN C  1 174 ? 31.193  10.935   21.652  1.00 90.46  ? 174 GLN C NE2   1 
ATOM   8476  N  N     . THR C  1 175 ? 27.731  13.545   24.987  1.00 82.90  ? 175 THR C N     1 
ATOM   8477  C  CA    . THR C  1 175 ? 26.658  14.499   24.696  1.00 83.58  ? 175 THR C CA    1 
ATOM   8478  C  C     . THR C  1 175 ? 27.162  15.948   24.536  1.00 83.32  ? 175 THR C C     1 
ATOM   8479  O  O     . THR C  1 175 ? 26.370  16.898   24.468  1.00 83.84  ? 175 THR C O     1 
ATOM   8480  C  CB    . THR C  1 175 ? 25.534  14.422   25.753  1.00 82.83  ? 175 THR C CB    1 
ATOM   8481  O  OG1   . THR C  1 175 ? 26.104  14.468   27.071  1.00 80.98  ? 175 THR C OG1   1 
ATOM   8482  C  CG2   . THR C  1 175 ? 24.726  13.139   25.582  1.00 83.22  ? 175 THR C CG2   1 
ATOM   8483  N  N     . GLY C  1 176 ? 28.480  16.107   24.467  1.00 82.40  ? 176 GLY C N     1 
ATOM   8484  C  CA    . GLY C  1 176 ? 29.081  17.402   24.179  1.00 82.49  ? 176 GLY C CA    1 
ATOM   8485  C  C     . GLY C  1 176 ? 29.431  18.185   25.425  1.00 80.52  ? 176 GLY C C     1 
ATOM   8486  O  O     . GLY C  1 176 ? 29.353  19.418   25.430  1.00 80.96  ? 176 GLY C O     1 
ATOM   8487  N  N     . LYS C  1 177 ? 29.821  17.472   26.481  1.00 78.48  ? 177 LYS C N     1 
ATOM   8488  C  CA    . LYS C  1 177 ? 30.148  18.101   27.762  1.00 76.21  ? 177 LYS C CA    1 
ATOM   8489  C  C     . LYS C  1 177 ? 31.474  18.865   27.716  1.00 75.66  ? 177 LYS C C     1 
ATOM   8490  O  O     . LYS C  1 177 ? 31.509  20.049   28.055  1.00 75.48  ? 177 LYS C O     1 
ATOM   8491  C  CB    . LYS C  1 177 ? 30.131  17.080   28.904  1.00 74.57  ? 177 LYS C CB    1 
ATOM   8492  C  CG    . LYS C  1 177 ? 28.774  16.449   29.149  1.00 74.47  ? 177 LYS C CG    1 
ATOM   8493  C  CD    . LYS C  1 177 ? 28.714  15.709   30.475  1.00 72.95  ? 177 LYS C CD    1 
ATOM   8494  C  CE    . LYS C  1 177 ? 29.584  14.458   30.496  1.00 73.12  ? 177 LYS C CE    1 
ATOM   8495  N  NZ    . LYS C  1 177 ? 29.197  13.435   29.475  1.00 74.13  ? 177 LYS C NZ    1 
ATOM   8496  N  N     . THR C  1 178 ? 32.556  18.205   27.294  1.00 75.43  ? 178 THR C N     1 
ATOM   8497  C  CA    . THR C  1 178 ? 33.844  18.894   27.154  1.00 75.11  ? 178 THR C CA    1 
ATOM   8498  C  C     . THR C  1 178 ? 33.766  19.880   26.005  1.00 77.24  ? 178 THR C C     1 
ATOM   8499  O  O     . THR C  1 178 ? 34.391  20.941   26.047  1.00 77.33  ? 178 THR C O     1 
ATOM   8500  C  CB    . THR C  1 178 ? 35.030  17.940   26.915  1.00 74.91  ? 178 THR C CB    1 
ATOM   8501  O  OG1   . THR C  1 178 ? 34.983  16.872   27.860  1.00 72.38  ? 178 THR C OG1   1 
ATOM   8502  C  CG2   . THR C  1 178 ? 36.352  18.679   27.091  1.00 73.79  ? 178 THR C CG2   1 
ATOM   8503  N  N     . ALA C  1 179 ? 32.979  19.519   24.992  1.00 79.10  ? 179 ALA C N     1 
ATOM   8504  C  CA    . ALA C  1 179 ? 32.786  20.342   23.801  1.00 81.25  ? 179 ALA C CA    1 
ATOM   8505  C  C     . ALA C  1 179 ? 32.288  21.737   24.157  1.00 81.29  ? 179 ALA C C     1 
ATOM   8506  O  O     . ALA C  1 179 ? 32.706  22.719   23.546  1.00 82.61  ? 179 ALA C O     1 
ATOM   8507  C  CB    . ALA C  1 179 ? 31.826  19.660   22.831  1.00 82.86  ? 179 ALA C CB    1 
ATOM   8508  N  N     . VAL C  1 180 ? 31.406  21.824   25.147  1.00 80.11  ? 180 VAL C N     1 
ATOM   8509  C  CA    . VAL C  1 180 ? 30.846  23.109   25.543  1.00 80.43  ? 180 VAL C CA    1 
ATOM   8510  C  C     . VAL C  1 180 ? 31.887  23.963   26.244  1.00 79.54  ? 180 VAL C C     1 
ATOM   8511  O  O     . VAL C  1 180 ? 32.021  25.142   25.933  1.00 80.48  ? 180 VAL C O     1 
ATOM   8512  C  CB    . VAL C  1 180 ? 29.572  22.952   26.416  1.00 79.84  ? 180 VAL C CB    1 
ATOM   8513  C  CG1   . VAL C  1 180 ? 29.334  24.193   27.280  1.00 79.24  ? 180 VAL C CG1   1 
ATOM   8514  C  CG2   . VAL C  1 180 ? 28.346  22.647   25.539  1.00 81.32  ? 180 VAL C CG2   1 
ATOM   8515  N  N     . ALA C  1 181 ? 32.624  23.359   27.176  1.00 78.21  ? 181 ALA C N     1 
ATOM   8516  C  CA    . ALA C  1 181 ? 33.661  24.063   27.939  1.00 77.55  ? 181 ALA C CA    1 
ATOM   8517  C  C     . ALA C  1 181 ? 34.890  24.382   27.086  1.00 78.78  ? 181 ALA C C     1 
ATOM   8518  O  O     . ALA C  1 181 ? 35.568  25.387   27.320  1.00 79.02  ? 181 ALA C O     1 
ATOM   8519  C  CB    . ALA C  1 181 ? 34.061  23.262   29.179  1.00 75.59  ? 181 ALA C CB    1 
ATOM   8520  N  N     . LEU C  1 182 ? 35.165  23.524   26.103  1.00 79.88  ? 182 LEU C N     1 
ATOM   8521  C  CA    . LEU C  1 182 ? 36.303  23.698   25.209  1.00 81.41  ? 182 LEU C CA    1 
ATOM   8522  C  C     . LEU C  1 182 ? 36.117  24.900   24.302  1.00 83.53  ? 182 LEU C C     1 
ATOM   8523  O  O     . LEU C  1 182 ? 37.079  25.605   23.993  1.00 84.53  ? 182 LEU C O     1 
ATOM   8524  C  CB    . LEU C  1 182 ? 36.505  22.452   24.351  1.00 82.29  ? 182 LEU C CB    1 
ATOM   8525  C  CG    . LEU C  1 182 ? 37.599  22.501   23.281  1.00 84.45  ? 182 LEU C CG    1 
ATOM   8526  C  CD1   . LEU C  1 182 ? 38.982  22.231   23.870  1.00 83.59  ? 182 LEU C CD1   1 
ATOM   8527  C  CD2   . LEU C  1 182 ? 37.279  21.512   22.177  1.00 86.71  ? 182 LEU C CD2   1 
ATOM   8528  N  N     . ASP C  1 183 ? 34.879  25.120   23.870  1.00 84.63  ? 183 ASP C N     1 
ATOM   8529  C  CA    . ASP C  1 183 ? 34.559  26.215   22.964  1.00 86.89  ? 183 ASP C CA    1 
ATOM   8530  C  C     . ASP C  1 183 ? 34.581  27.568   23.679  1.00 86.35  ? 183 ASP C C     1 
ATOM   8531  O  O     . ASP C  1 183 ? 34.756  28.609   23.037  1.00 88.05  ? 183 ASP C O     1 
ATOM   8532  C  CB    . ASP C  1 183 ? 33.219  25.960   22.262  1.00 88.49  ? 183 ASP C CB    1 
ATOM   8533  C  CG    . ASP C  1 183 ? 33.349  25.008   21.055  1.00 91.24  ? 183 ASP C CG    1 
ATOM   8534  O  OD1   . ASP C  1 183 ? 33.711  23.820   21.239  1.00 90.86  ? 183 ASP C OD1   1 
ATOM   8535  O  OD2   . ASP C  1 183 ? 33.079  25.455   19.913  1.00 94.71  ? 183 ASP C OD2   1 
ATOM   8536  N  N     . THR C  1 184 ? 34.422  27.541   25.004  1.00 84.07  ? 184 THR C N     1 
ATOM   8537  C  CA    . THR C  1 184 ? 34.591  28.728   25.839  1.00 83.36  ? 184 THR C CA    1 
ATOM   8538  C  C     . THR C  1 184 ? 36.066  29.105   25.947  1.00 83.37  ? 184 THR C C     1 
ATOM   8539  O  O     . THR C  1 184 ? 36.430  30.273   25.770  1.00 84.67  ? 184 THR C O     1 
ATOM   8540  C  CB    . THR C  1 184 ? 34.054  28.507   27.250  1.00 81.22  ? 184 THR C CB    1 
ATOM   8541  O  OG1   . THR C  1 184 ? 32.718  28.013   27.173  1.00 81.76  ? 184 THR C OG1   1 
ATOM   8542  C  CG2   . THR C  1 184 ? 34.050  29.809   28.032  1.00 81.11  ? 184 THR C CG2   1 
ATOM   8543  N  N     . ILE C  1 185 ? 36.909  28.119   26.252  1.00 82.07  ? 185 ILE C N     1 
ATOM   8544  C  CA    . ILE C  1 185 ? 38.348  28.352   26.339  1.00 81.67  ? 185 ILE C CA    1 
ATOM   8545  C  C     . ILE C  1 185 ? 38.844  28.944   25.020  1.00 83.92  ? 185 ILE C C     1 
ATOM   8546  O  O     . ILE C  1 185 ? 39.438  30.025   25.010  1.00 84.58  ? 185 ILE C O     1 
ATOM   8547  C  CB    . ILE C  1 185 ? 39.125  27.074   26.754  1.00 80.33  ? 185 ILE C CB    1 
ATOM   8548  C  CG1   . ILE C  1 185 ? 38.740  26.676   28.186  1.00 77.20  ? 185 ILE C CG1   1 
ATOM   8549  C  CG2   . ILE C  1 185 ? 40.638  27.288   26.606  1.00 80.68  ? 185 ILE C CG2   1 
ATOM   8550  C  CD1   . ILE C  1 185 ? 39.343  25.392   28.665  1.00 75.09  ? 185 ILE C CD1   1 
ATOM   8551  N  N     . LEU C  1 186 ? 38.554  28.259   23.916  1.00 85.22  ? 186 LEU C N     1 
ATOM   8552  C  CA    . LEU C  1 186 ? 38.917  28.755   22.586  1.00 87.84  ? 186 LEU C CA    1 
ATOM   8553  C  C     . LEU C  1 186 ? 38.519  30.215   22.417  1.00 88.99  ? 186 LEU C C     1 
ATOM   8554  O  O     . LEU C  1 186 ? 39.362  31.048   22.084  1.00 90.10  ? 186 LEU C O     1 
ATOM   8555  C  CB    . LEU C  1 186 ? 38.277  27.916   21.467  1.00 89.17  ? 186 LEU C CB    1 
ATOM   8556  C  CG    . LEU C  1 186 ? 38.732  26.485   21.182  1.00 88.85  ? 186 LEU C CG    1 
ATOM   8557  C  CD1   . LEU C  1 186 ? 38.283  26.092   19.788  1.00 91.12  ? 186 LEU C CD1   1 
ATOM   8558  C  CD2   . LEU C  1 186 ? 40.236  26.332   21.316  1.00 88.82  ? 186 LEU C CD2   1 
ATOM   8559  N  N     . ASN C  1 187 ? 37.241  30.506   22.671  1.00 88.71  ? 187 ASN C N     1 
ATOM   8560  C  CA    . ASN C  1 187 ? 36.661  31.827   22.423  1.00 90.15  ? 187 ASN C CA    1 
ATOM   8561  C  C     . ASN C  1 187 ? 37.410  32.981   23.087  1.00 89.87  ? 187 ASN C C     1 
ATOM   8562  O  O     . ASN C  1 187 ? 37.631  34.011   22.452  1.00 91.87  ? 187 ASN C O     1 
ATOM   8563  C  CB    . ASN C  1 187 ? 35.176  31.869   22.822  1.00 89.75  ? 187 ASN C CB    1 
ATOM   8564  C  CG    . ASN C  1 187 ? 34.465  33.133   22.324  1.00 91.82  ? 187 ASN C CG    1 
ATOM   8565  O  OD1   . ASN C  1 187 ? 34.714  33.601   21.211  1.00 94.35  ? 187 ASN C OD1   1 
ATOM   8566  N  ND2   . ASN C  1 187 ? 33.575  33.682   23.149  1.00 90.55  ? 187 ASN C ND2   1 
ATOM   8567  N  N     . GLN C  1 188 ? 37.809  32.801   24.347  1.00 87.62  ? 188 GLN C N     1 
ATOM   8568  C  CA    . GLN C  1 188 ? 38.467  33.864   25.122  1.00 87.20  ? 188 GLN C CA    1 
ATOM   8569  C  C     . GLN C  1 188 ? 39.691  34.458   24.413  1.00 88.57  ? 188 GLN C C     1 
ATOM   8570  O  O     . GLN C  1 188 ? 40.195  35.505   24.813  1.00 89.04  ? 188 GLN C O     1 
ATOM   8571  C  CB    . GLN C  1 188 ? 38.852  33.383   26.537  1.00 85.05  ? 188 GLN C CB    1 
ATOM   8572  C  CG    . GLN C  1 188 ? 37.704  32.853   27.418  1.00 83.64  ? 188 GLN C CG    1 
ATOM   8573  C  CD    . GLN C  1 188 ? 36.531  33.826   27.584  1.00 84.79  ? 188 GLN C CD    1 
ATOM   8574  O  OE1   . GLN C  1 188 ? 36.700  35.012   27.909  1.00 85.01  ? 188 GLN C OE1   1 
ATOM   8575  N  NE2   . GLN C  1 188 ? 35.327  33.309   27.380  1.00 84.63  ? 188 GLN C NE2   1 
ATOM   8576  N  N     . LYS C  1 189 ? 40.153  33.783   23.362  1.00 89.38  ? 189 LYS C N     1 
ATOM   8577  C  CA    . LYS C  1 189 ? 41.252  34.254   22.524  1.00 91.07  ? 189 LYS C CA    1 
ATOM   8578  C  C     . LYS C  1 189 ? 41.067  35.722   22.146  1.00 92.83  ? 189 LYS C C     1 
ATOM   8579  O  O     . LYS C  1 189 ? 42.035  36.484   22.131  1.00 93.83  ? 189 LYS C O     1 
ATOM   8580  C  CB    . LYS C  1 189 ? 41.360  33.389   21.260  1.00 92.59  ? 189 LYS C CB    1 
ATOM   8581  C  CG    . LYS C  1 189 ? 42.753  33.275   20.668  1.00 93.60  ? 189 LYS C CG    1 
ATOM   8582  C  CD    . LYS C  1 189 ? 42.690  32.787   19.227  1.00 95.92  ? 189 LYS C CD    1 
ATOM   8583  C  CE    . LYS C  1 189 ? 44.059  32.888   18.555  1.00 98.36  ? 189 LYS C CE    1 
ATOM   8584  N  NZ    . LYS C  1 189 ? 44.004  32.894   17.056  1.00 100.86 ? 189 LYS C NZ    1 
ATOM   8585  N  N     . ARG C  1 190 ? 39.823  36.113   21.865  1.00 93.31  ? 190 ARG C N     1 
ATOM   8586  C  CA    . ARG C  1 190 ? 39.481  37.495   21.495  1.00 95.31  ? 190 ARG C CA    1 
ATOM   8587  C  C     . ARG C  1 190 ? 40.085  38.541   22.425  1.00 94.93  ? 190 ARG C C     1 
ATOM   8588  O  O     . ARG C  1 190 ? 40.547  39.575   21.962  1.00 96.92  ? 190 ARG C O     1 
ATOM   8589  C  CB    . ARG C  1 190 ? 37.964  37.699   21.451  1.00 95.46  ? 190 ARG C CB    1 
ATOM   8590  C  CG    . ARG C  1 190 ? 37.227  36.834   20.449  1.00 96.34  ? 190 ARG C CG    1 
ATOM   8591  C  CD    . ARG C  1 190 ? 35.729  37.085   20.507  1.00 96.05  ? 190 ARG C CD    1 
ATOM   8592  N  NE    . ARG C  1 190 ? 34.988  35.929   20.018  1.00 96.20  ? 190 ARG C NE    1 
ATOM   8593  C  CZ    . ARG C  1 190 ? 34.856  35.601   18.736  1.00 98.76  ? 190 ARG C CZ    1 
ATOM   8594  N  NH1   . ARG C  1 190 ? 35.411  36.340   17.787  1.00 101.73 ? 190 ARG C NH1   1 
ATOM   8595  N  NH2   . ARG C  1 190 ? 34.165  34.524   18.401  1.00 99.09  ? 190 ARG C NH2   1 
ATOM   8596  N  N     . TRP C  1 191 ? 40.077  38.262   23.730  1.00 92.76  ? 191 TRP C N     1 
ATOM   8597  C  CA    . TRP C  1 191 ? 40.552  39.207   24.752  1.00 92.29  ? 191 TRP C CA    1 
ATOM   8598  C  C     . TRP C  1 191 ? 41.939  38.878   25.300  1.00 91.86  ? 191 TRP C C     1 
ATOM   8599  O  O     . TRP C  1 191 ? 42.647  39.763   25.791  1.00 92.30  ? 191 TRP C O     1 
ATOM   8600  C  CB    . TRP C  1 191 ? 39.544  39.299   25.900  1.00 90.13  ? 191 TRP C CB    1 
ATOM   8601  C  CG    . TRP C  1 191 ? 38.182  39.630   25.422  1.00 90.25  ? 191 TRP C CG    1 
ATOM   8602  C  CD1   . TRP C  1 191 ? 37.693  40.868   25.135  1.00 91.29  ? 191 TRP C CD1   1 
ATOM   8603  C  CD2   . TRP C  1 191 ? 37.129  38.706   25.142  1.00 89.38  ? 191 TRP C CD2   1 
ATOM   8604  N  NE1   . TRP C  1 191 ? 36.394  40.777   24.703  1.00 91.56  ? 191 TRP C NE1   1 
ATOM   8605  C  CE2   . TRP C  1 191 ? 36.021  39.459   24.700  1.00 90.52  ? 191 TRP C CE2   1 
ATOM   8606  C  CE3   . TRP C  1 191 ? 37.009  37.311   25.232  1.00 87.64  ? 191 TRP C CE3   1 
ATOM   8607  C  CZ2   . TRP C  1 191 ? 34.808  38.866   24.344  1.00 90.69  ? 191 TRP C CZ2   1 
ATOM   8608  C  CZ3   . TRP C  1 191 ? 35.801  36.722   24.878  1.00 87.60  ? 191 TRP C CZ3   1 
ATOM   8609  C  CH2   . TRP C  1 191 ? 34.717  37.500   24.437  1.00 89.14  ? 191 TRP C CH2   1 
ATOM   8610  N  N     . ASN C  1 192 ? 42.313  37.603   25.212  1.00 91.37  ? 192 ASN C N     1 
ATOM   8611  C  CA    . ASN C  1 192 ? 43.595  37.116   25.718  1.00 91.00  ? 192 ASN C CA    1 
ATOM   8612  C  C     . ASN C  1 192 ? 44.801  37.532   24.883  1.00 93.49  ? 192 ASN C C     1 
ATOM   8613  O  O     . ASN C  1 192 ? 45.931  37.515   25.374  1.00 93.22  ? 192 ASN C O     1 
ATOM   8614  C  CB    . ASN C  1 192 ? 43.554  35.599   25.895  1.00 89.18  ? 192 ASN C CB    1 
ATOM   8615  C  CG    . ASN C  1 192 ? 42.679  35.175   27.062  1.00 86.95  ? 192 ASN C CG    1 
ATOM   8616  O  OD1   . ASN C  1 192 ? 42.540  35.902   28.048  1.00 86.20  ? 192 ASN C OD1   1 
ATOM   8617  N  ND2   . ASN C  1 192 ? 42.083  33.995   26.956  1.00 85.77  ? 192 ASN C ND2   1 
ATOM   8618  N  N     . ASN C  1 193 ? 44.555  37.908   23.630  1.00 96.35  ? 193 ASN C N     1 
ATOM   8619  C  CA    . ASN C  1 193 ? 45.605  38.452   22.768  1.00 99.46  ? 193 ASN C CA    1 
ATOM   8620  C  C     . ASN C  1 193 ? 45.805  39.962   22.928  1.00 101.18 ? 193 ASN C C     1 
ATOM   8621  O  O     . ASN C  1 193 ? 46.882  40.484   22.634  1.00 102.74 ? 193 ASN C O     1 
ATOM   8622  C  CB    . ASN C  1 193 ? 45.363  38.074   21.302  1.00 101.62 ? 193 ASN C CB    1 
ATOM   8623  C  CG    . ASN C  1 193 ? 46.038  36.760   20.918  1.00 101.76 ? 193 ASN C CG    1 
ATOM   8624  O  OD1   . ASN C  1 193 ? 47.267  36.658   20.933  1.00 102.84 ? 193 ASN C OD1   1 
ATOM   8625  N  ND2   . ASN C  1 193 ? 45.237  35.754   20.565  1.00 101.05 ? 193 ASN C ND2   1 
ATOM   8626  N  N     . GLY C  1 194 ? 44.769  40.650   23.407  1.00 101.15 ? 194 GLY C N     1 
ATOM   8627  C  CA    . GLY C  1 194 ? 44.843  42.082   23.703  1.00 102.87 ? 194 GLY C CA    1 
ATOM   8628  C  C     . GLY C  1 194 ? 45.681  42.406   24.929  1.00 102.08 ? 194 GLY C C     1 
ATOM   8629  O  O     . GLY C  1 194 ? 46.009  41.524   25.728  1.00 100.08 ? 194 GLY C O     1 
ATOM   8630  N  N     . SER C  1 195 ? 46.030  43.682   25.072  1.00 103.94 ? 195 SER C N     1 
ATOM   8631  C  CA    . SER C  1 195 ? 46.819  44.156   26.211  1.00 103.66 ? 195 SER C CA    1 
ATOM   8632  C  C     . SER C  1 195 ? 45.986  44.227   27.495  1.00 101.53 ? 195 SER C C     1 
ATOM   8633  O  O     . SER C  1 195 ? 46.451  43.808   28.562  1.00 99.90  ? 195 SER C O     1 
ATOM   8634  C  CB    . SER C  1 195 ? 47.449  45.520   25.893  1.00 106.38 ? 195 SER C CB    1 
ATOM   8635  O  OG    . SER C  1 195 ? 47.586  46.324   27.057  1.00 106.49 ? 195 SER C OG    1 
ATOM   8636  N  N     . ASP C  1 196 ? 44.764  44.756   27.373  1.00 101.75 ? 196 ASP C N     1 
ATOM   8637  C  CA    . ASP C  1 196 ? 43.812  44.899   28.492  1.00 99.84  ? 196 ASP C CA    1 
ATOM   8638  C  C     . ASP C  1 196 ? 43.783  43.671   29.410  1.00 96.85  ? 196 ASP C C     1 
ATOM   8639  O  O     . ASP C  1 196 ? 43.290  42.601   29.030  1.00 95.86  ? 196 ASP C O     1 
ATOM   8640  C  CB    . ASP C  1 196 ? 42.403  45.204   27.960  1.00 100.45 ? 196 ASP C CB    1 
ATOM   8641  C  CG    . ASP C  1 196 ? 41.486  45.783   29.022  1.00 99.18  ? 196 ASP C CG    1 
ATOM   8642  O  OD1   . ASP C  1 196 ? 41.539  45.323   30.185  1.00 96.83  ? 196 ASP C OD1   1 
ATOM   8643  O  OD2   . ASP C  1 196 ? 40.705  46.700   28.685  1.00 100.11 ? 196 ASP C OD2   1 
ATOM   8644  N  N     . GLU C  1 197 ? 44.308  43.853   30.619  1.00 95.44  ? 197 GLU C N     1 
ATOM   8645  C  CA    . GLU C  1 197 ? 44.586  42.750   31.533  1.00 92.91  ? 197 GLU C CA    1 
ATOM   8646  C  C     . GLU C  1 197 ? 43.368  42.338   32.357  1.00 90.70  ? 197 GLU C C     1 
ATOM   8647  O  O     . GLU C  1 197 ? 43.352  41.259   32.952  1.00 88.77  ? 197 GLU C O     1 
ATOM   8648  C  CB    . GLU C  1 197 ? 45.790  43.095   32.430  1.00 93.12  ? 197 GLU C CB    1 
ATOM   8649  C  CG    . GLU C  1 197 ? 46.169  42.041   33.489  1.00 91.57  ? 197 GLU C CG    1 
ATOM   8650  C  CD    . GLU C  1 197 ? 46.762  40.757   32.912  1.00 91.43  ? 197 GLU C CD    1 
ATOM   8651  O  OE1   . GLU C  1 197 ? 47.357  39.988   33.693  1.00 90.36  ? 197 GLU C OE1   1 
ATOM   8652  O  OE2   . GLU C  1 197 ? 46.645  40.505   31.692  1.00 92.37  ? 197 GLU C OE2   1 
ATOM   8653  N  N     . SER C  1 198 ? 42.347  43.193   32.367  1.00 90.90  ? 198 SER C N     1 
ATOM   8654  C  CA    . SER C  1 198 ? 41.128  42.942   33.131  1.00 89.08  ? 198 SER C CA    1 
ATOM   8655  C  C     . SER C  1 198 ? 39.965  42.467   32.253  1.00 88.76  ? 198 SER C C     1 
ATOM   8656  O  O     . SER C  1 198 ? 38.879  42.188   32.751  1.00 87.76  ? 198 SER C O     1 
ATOM   8657  C  CB    . SER C  1 198 ? 40.731  44.195   33.899  1.00 89.80  ? 198 SER C CB    1 
ATOM   8658  O  OG    . SER C  1 198 ? 40.500  45.256   32.993  1.00 92.17  ? 198 SER C OG    1 
ATOM   8659  N  N     . LYS C  1 199 ? 40.189  42.385   30.948  1.00 89.79  ? 199 LYS C N     1 
ATOM   8660  C  CA    . LYS C  1 199 ? 39.219  41.760   30.057  1.00 89.73  ? 199 LYS C CA    1 
ATOM   8661  C  C     . LYS C  1 199 ? 39.612  40.302   29.795  1.00 88.25  ? 199 LYS C C     1 
ATOM   8662  O  O     . LYS C  1 199 ? 38.764  39.481   29.422  1.00 87.68  ? 199 LYS C O     1 
ATOM   8663  C  CB    . LYS C  1 199 ? 39.077  42.543   28.746  1.00 92.25  ? 199 LYS C CB    1 
ATOM   8664  C  CG    . LYS C  1 199 ? 38.222  43.804   28.842  1.00 93.82  ? 199 LYS C CG    1 
ATOM   8665  C  CD    . LYS C  1 199 ? 38.284  44.582   27.529  1.00 97.99  ? 199 LYS C CD    1 
ATOM   8666  C  CE    . LYS C  1 199 ? 37.638  45.970   27.632  1.00 100.87 ? 199 LYS C CE    1 
ATOM   8667  N  NZ    . LYS C  1 199 ? 36.166  45.981   27.338  1.00 101.86 ? 199 LYS C NZ    1 
ATOM   8668  N  N     . LYS C  1 200 ? 40.891  39.991   30.018  1.00 87.51  ? 200 LYS C N     1 
ATOM   8669  C  CA    . LYS C  1 200 ? 41.439  38.644   29.831  1.00 86.26  ? 200 LYS C CA    1 
ATOM   8670  C  C     . LYS C  1 200 ? 40.765  37.579   30.708  1.00 84.02  ? 200 LYS C C     1 
ATOM   8671  O  O     . LYS C  1 200 ? 40.089  37.898   31.691  1.00 83.30  ? 200 LYS C O     1 
ATOM   8672  C  CB    . LYS C  1 200 ? 42.954  38.641   30.076  1.00 86.28  ? 200 LYS C CB    1 
ATOM   8673  C  CG    . LYS C  1 200 ? 43.767  39.265   28.954  1.00 88.64  ? 200 LYS C CG    1 
ATOM   8674  C  CD    . LYS C  1 200 ? 45.282  39.125   29.162  1.00 89.51  ? 200 LYS C CD    1 
ATOM   8675  C  CE    . LYS C  1 200 ? 45.814  37.753   28.722  1.00 89.37  ? 200 LYS C CE    1 
ATOM   8676  N  NZ    . LYS C  1 200 ? 47.217  37.792   28.181  1.00 90.38  ? 200 LYS C NZ    1 
ATOM   8677  N  N     . LEU C  1 201 ? 40.944  36.315   30.328  1.00 83.13  ? 201 LEU C N     1 
ATOM   8678  C  CA    . LEU C  1 201 ? 40.520  35.178   31.142  1.00 80.97  ? 201 LEU C CA    1 
ATOM   8679  C  C     . LEU C  1 201 ? 41.528  34.034   30.965  1.00 80.43  ? 201 LEU C C     1 
ATOM   8680  O  O     . LEU C  1 201 ? 41.687  33.488   29.865  1.00 81.41  ? 201 LEU C O     1 
ATOM   8681  C  CB    . LEU C  1 201 ? 39.093  34.741   30.773  1.00 80.70  ? 201 LEU C CB    1 
ATOM   8682  C  CG    . LEU C  1 201 ? 38.270  33.943   31.797  1.00 78.81  ? 201 LEU C CG    1 
ATOM   8683  C  CD1   . LEU C  1 201 ? 37.752  34.837   32.910  1.00 79.02  ? 201 LEU C CD1   1 
ATOM   8684  C  CD2   . LEU C  1 201 ? 37.101  33.249   31.134  1.00 78.11  ? 201 LEU C CD2   1 
ATOM   8685  N  N     . TYR C  1 202 ? 42.230  33.697   32.040  1.00 79.00  ? 202 TYR C N     1 
ATOM   8686  C  CA    . TYR C  1 202 ? 43.238  32.649   31.981  1.00 78.56  ? 202 TYR C CA    1 
ATOM   8687  C  C     . TYR C  1 202 ? 42.573  31.315   32.255  1.00 77.05  ? 202 TYR C C     1 
ATOM   8688  O  O     . TYR C  1 202 ? 41.681  31.236   33.098  1.00 76.20  ? 202 TYR C O     1 
ATOM   8689  C  CB    . TYR C  1 202 ? 44.357  32.930   32.980  1.00 78.25  ? 202 TYR C CB    1 
ATOM   8690  C  CG    . TYR C  1 202 ? 45.063  34.240   32.703  1.00 80.65  ? 202 TYR C CG    1 
ATOM   8691  C  CD1   . TYR C  1 202 ? 46.211  34.283   31.905  1.00 82.47  ? 202 TYR C CD1   1 
ATOM   8692  C  CD2   . TYR C  1 202 ? 44.573  35.444   33.220  1.00 81.33  ? 202 TYR C CD2   1 
ATOM   8693  C  CE1   . TYR C  1 202 ? 46.860  35.489   31.640  1.00 83.98  ? 202 TYR C CE1   1 
ATOM   8694  C  CE2   . TYR C  1 202 ? 45.213  36.653   32.961  1.00 83.03  ? 202 TYR C CE2   1 
ATOM   8695  C  CZ    . TYR C  1 202 ? 46.355  36.667   32.170  1.00 84.48  ? 202 TYR C CZ    1 
ATOM   8696  O  OH    . TYR C  1 202 ? 46.992  37.860   31.911  1.00 86.56  ? 202 TYR C OH    1 
ATOM   8697  N  N     . CYS C  1 203 ? 42.998  30.274   31.541  1.00 76.92  ? 203 CYS C N     1 
ATOM   8698  C  CA    . CYS C  1 203 ? 42.314  28.980   31.587  1.00 75.61  ? 203 CYS C CA    1 
ATOM   8699  C  C     . CYS C  1 203 ? 43.095  27.869   32.270  1.00 74.08  ? 203 CYS C C     1 
ATOM   8700  O  O     . CYS C  1 203 ? 44.284  27.698   32.034  1.00 74.63  ? 203 CYS C O     1 
ATOM   8701  C  CB    . CYS C  1 203 ? 41.927  28.536   30.176  1.00 76.91  ? 203 CYS C CB    1 
ATOM   8702  S  SG    . CYS C  1 203 ? 40.626  29.539   29.413  1.00 79.19  ? 203 CYS C SG    1 
ATOM   8703  N  N     . VAL C  1 204 ? 42.404  27.118   33.119  1.00 72.25  ? 204 VAL C N     1 
ATOM   8704  C  CA    . VAL C  1 204 ? 42.948  25.904   33.714  1.00 71.05  ? 204 VAL C CA    1 
ATOM   8705  C  C     . VAL C  1 204 ? 42.012  24.755   33.375  1.00 70.42  ? 204 VAL C C     1 
ATOM   8706  O  O     . VAL C  1 204 ? 40.822  24.801   33.703  1.00 69.91  ? 204 VAL C O     1 
ATOM   8707  C  CB    . VAL C  1 204 ? 43.090  26.019   35.246  1.00 70.01  ? 204 VAL C CB    1 
ATOM   8708  C  CG1   . VAL C  1 204 ? 43.481  24.670   35.866  1.00 68.75  ? 204 VAL C CG1   1 
ATOM   8709  C  CG2   . VAL C  1 204 ? 44.108  27.094   35.605  1.00 71.05  ? 204 VAL C CG2   1 
ATOM   8710  N  N     . TYR C  1 205 ? 42.540  23.739   32.697  1.00 70.53  ? 205 TYR C N     1 
ATOM   8711  C  CA    . TYR C  1 205 ? 41.761  22.545   32.402  1.00 69.84  ? 205 TYR C CA    1 
ATOM   8712  C  C     . TYR C  1 205 ? 42.257  21.424   33.289  1.00 68.77  ? 205 TYR C C     1 
ATOM   8713  O  O     . TYR C  1 205 ? 43.450  21.109   33.294  1.00 69.19  ? 205 TYR C O     1 
ATOM   8714  C  CB    . TYR C  1 205 ? 41.844  22.161   30.923  1.00 71.05  ? 205 TYR C CB    1 
ATOM   8715  C  CG    . TYR C  1 205 ? 40.975  20.974   30.546  1.00 70.96  ? 205 TYR C CG    1 
ATOM   8716  C  CD1   . TYR C  1 205 ? 41.527  19.691   30.394  1.00 70.82  ? 205 TYR C CD1   1 
ATOM   8717  C  CD2   . TYR C  1 205 ? 39.599  21.126   30.342  1.00 70.68  ? 205 TYR C CD2   1 
ATOM   8718  C  CE1   . TYR C  1 205 ? 40.728  18.593   30.043  1.00 70.36  ? 205 TYR C CE1   1 
ATOM   8719  C  CE2   . TYR C  1 205 ? 38.794  20.035   29.990  1.00 70.61  ? 205 TYR C CE2   1 
ATOM   8720  C  CZ    . TYR C  1 205 ? 39.363  18.774   29.843  1.00 70.41  ? 205 TYR C CZ    1 
ATOM   8721  O  OH    . TYR C  1 205 ? 38.565  17.702   29.501  1.00 70.21  ? 205 TYR C OH    1 
ATOM   8722  N  N     . VAL C  1 206 ? 41.335  20.853   34.059  1.00 67.55  ? 206 VAL C N     1 
ATOM   8723  C  CA    . VAL C  1 206 ? 41.631  19.748   34.952  1.00 66.63  ? 206 VAL C CA    1 
ATOM   8724  C  C     . VAL C  1 206 ? 41.049  18.489   34.345  1.00 66.87  ? 206 VAL C C     1 
ATOM   8725  O  O     . VAL C  1 206 ? 39.832  18.410   34.133  1.00 67.02  ? 206 VAL C O     1 
ATOM   8726  C  CB    . VAL C  1 206 ? 41.000  19.953   36.335  1.00 65.50  ? 206 VAL C CB    1 
ATOM   8727  C  CG1   . VAL C  1 206 ? 41.624  18.999   37.351  1.00 65.07  ? 206 VAL C CG1   1 
ATOM   8728  C  CG2   . VAL C  1 206 ? 41.153  21.392   36.775  1.00 65.44  ? 206 VAL C CG2   1 
ATOM   8729  N  N     . ALA C  1 207 ? 41.908  17.517   34.042  1.00 67.17  ? 207 ALA C N     1 
ATOM   8730  C  CA    . ALA C  1 207 ? 41.437  16.223   33.551  1.00 67.47  ? 207 ALA C CA    1 
ATOM   8731  C  C     . ALA C  1 207 ? 41.625  15.171   34.633  1.00 66.70  ? 207 ALA C C     1 
ATOM   8732  O  O     . ALA C  1 207 ? 42.756  14.861   35.030  1.00 66.76  ? 207 ALA C O     1 
ATOM   8733  C  CB    . ALA C  1 207 ? 42.136  15.827   32.256  1.00 68.67  ? 207 ALA C CB    1 
ATOM   8734  N  N     . VAL C  1 208 ? 40.498  14.664   35.129  1.00 66.11  ? 208 VAL C N     1 
ATOM   8735  C  CA    . VAL C  1 208 ? 40.480  13.681   36.207  1.00 65.43  ? 208 VAL C CA    1 
ATOM   8736  C  C     . VAL C  1 208 ? 39.934  12.396   35.633  1.00 65.76  ? 208 VAL C C     1 
ATOM   8737  O  O     . VAL C  1 208 ? 38.806  12.376   35.146  1.00 66.36  ? 208 VAL C O     1 
ATOM   8738  C  CB    . VAL C  1 208 ? 39.573  14.120   37.389  1.00 64.50  ? 208 VAL C CB    1 
ATOM   8739  C  CG1   . VAL C  1 208 ? 39.578  13.072   38.479  1.00 64.00  ? 208 VAL C CG1   1 
ATOM   8740  C  CG2   . VAL C  1 208 ? 40.031  15.447   37.964  1.00 64.55  ? 208 VAL C CG2   1 
ATOM   8741  N  N     . GLY C  1 209 ? 40.735  11.336   35.666  1.00 65.83  ? 209 GLY C N     1 
ATOM   8742  C  CA    . GLY C  1 209 ? 40.287  10.015   35.213  1.00 66.17  ? 209 GLY C CA    1 
ATOM   8743  C  C     . GLY C  1 209 ? 40.284  9.727    33.719  1.00 67.16  ? 209 GLY C C     1 
ATOM   8744  O  O     . GLY C  1 209 ? 39.912  8.629    33.304  1.00 67.44  ? 209 GLY C O     1 
ATOM   8745  N  N     . GLN C  1 210 ? 40.694  10.701   32.910  1.00 67.77  ? 210 GLN C N     1 
ATOM   8746  C  CA    . GLN C  1 210 ? 40.740  10.532   31.460  1.00 69.19  ? 210 GLN C CA    1 
ATOM   8747  C  C     . GLN C  1 210 ? 41.957  9.705    31.053  1.00 70.30  ? 210 GLN C C     1 
ATOM   8748  O  O     . GLN C  1 210 ? 42.958  9.675    31.768  1.00 69.73  ? 210 GLN C O     1 
ATOM   8749  C  CB    . GLN C  1 210 ? 40.799  11.887   30.765  1.00 69.49  ? 210 GLN C CB    1 
ATOM   8750  C  CG    . GLN C  1 210 ? 39.644  12.809   31.057  1.00 68.80  ? 210 GLN C CG    1 
ATOM   8751  C  CD    . GLN C  1 210 ? 39.640  14.008   30.139  1.00 70.19  ? 210 GLN C CD    1 
ATOM   8752  O  OE1   . GLN C  1 210 ? 40.438  14.087   29.204  1.00 71.38  ? 210 GLN C OE1   1 
ATOM   8753  N  NE2   . GLN C  1 210 ? 38.737  14.949   30.392  1.00 70.22  ? 210 GLN C NE2   1 
ATOM   8754  N  N     . LYS C  1 211 ? 41.865  9.025    29.911  1.00 71.89  ? 211 LYS C N     1 
ATOM   8755  C  CA    . LYS C  1 211 ? 43.015  8.318    29.360  1.00 73.30  ? 211 LYS C CA    1 
ATOM   8756  C  C     . LYS C  1 211 ? 43.948  9.353    28.769  1.00 74.26  ? 211 LYS C C     1 
ATOM   8757  O  O     . LYS C  1 211 ? 43.503  10.411   28.320  1.00 74.43  ? 211 LYS C O     1 
ATOM   8758  C  CB    . LYS C  1 211 ? 42.597  7.298    28.295  1.00 74.78  ? 211 LYS C CB    1 
ATOM   8759  C  CG    . LYS C  1 211 ? 42.088  7.923    27.019  1.00 76.31  ? 211 LYS C CG    1 
ATOM   8760  C  CD    . LYS C  1 211 ? 41.601  6.905    26.001  1.00 78.50  ? 211 LYS C CD    1 
ATOM   8761  C  CE    . LYS C  1 211 ? 41.316  7.610    24.670  1.00 79.92  ? 211 LYS C CE    1 
ATOM   8762  N  NZ    . LYS C  1 211 ? 40.125  7.070    23.974  1.00 80.90  ? 211 LYS C NZ    1 
ATOM   8763  N  N     . ARG C  1 212 ? 45.240  9.045    28.767  1.00 75.27  ? 212 ARG C N     1 
ATOM   8764  C  CA    . ARG C  1 212 ? 46.260  10.006   28.350  1.00 76.13  ? 212 ARG C CA    1 
ATOM   8765  C  C     . ARG C  1 212 ? 46.163  10.392   26.874  1.00 78.04  ? 212 ARG C C     1 
ATOM   8766  O  O     . ARG C  1 212 ? 46.446  11.539   26.518  1.00 78.61  ? 212 ARG C O     1 
ATOM   8767  C  CB    . ARG C  1 212 ? 47.657  9.498    28.699  1.00 76.45  ? 212 ARG C CB    1 
ATOM   8768  C  CG    . ARG C  1 212 ? 47.978  9.589    30.170  1.00 74.63  ? 212 ARG C CG    1 
ATOM   8769  C  CD    . ARG C  1 212 ? 49.155  8.715    30.513  1.00 75.65  ? 212 ARG C CD    1 
ATOM   8770  N  NE    . ARG C  1 212 ? 49.630  8.969    31.868  1.00 75.31  ? 212 ARG C NE    1 
ATOM   8771  C  CZ    . ARG C  1 212 ? 50.648  8.334    32.444  1.00 75.93  ? 212 ARG C CZ    1 
ATOM   8772  N  NH1   . ARG C  1 212 ? 51.315  7.388    31.795  1.00 77.37  ? 212 ARG C NH1   1 
ATOM   8773  N  NH2   . ARG C  1 212 ? 50.997  8.642    33.683  1.00 75.30  ? 212 ARG C NH2   1 
ATOM   8774  N  N     . SER C  1 213 ? 45.742  9.450    26.029  1.00 79.23  ? 213 SER C N     1 
ATOM   8775  C  CA    . SER C  1 213 ? 45.589  9.720    24.595  1.00 81.35  ? 213 SER C CA    1 
ATOM   8776  C  C     . SER C  1 213 ? 44.554  10.805   24.275  1.00 81.38  ? 213 SER C C     1 
ATOM   8777  O  O     . SER C  1 213 ? 44.572  11.373   23.179  1.00 82.99  ? 213 SER C O     1 
ATOM   8778  C  CB    . SER C  1 213 ? 45.307  8.438    23.793  1.00 82.75  ? 213 SER C CB    1 
ATOM   8779  O  OG    . SER C  1 213 ? 44.564  7.493    24.536  1.00 81.79  ? 213 SER C OG    1 
ATOM   8780  N  N     . THR C  1 214 ? 43.662  11.089   25.227  1.00 79.91  ? 214 THR C N     1 
ATOM   8781  C  CA    . THR C  1 214 ? 42.668  12.156   25.061  1.00 79.92  ? 214 THR C CA    1 
ATOM   8782  C  C     . THR C  1 214 ? 43.272  13.514   25.440  1.00 79.60  ? 214 THR C C     1 
ATOM   8783  O  O     . THR C  1 214 ? 43.207  14.458   24.650  1.00 80.84  ? 214 THR C O     1 
ATOM   8784  C  CB    . THR C  1 214 ? 41.351  11.902   25.860  1.00 78.40  ? 214 THR C CB    1 
ATOM   8785  O  OG1   . THR C  1 214 ? 41.069  10.503   25.922  1.00 78.58  ? 214 THR C OG1   1 
ATOM   8786  C  CG2   . THR C  1 214 ? 40.181  12.579   25.194  1.00 79.15  ? 214 THR C CG2   1 
ATOM   8787  N  N     . VAL C  1 215 ? 43.865  13.598   26.636  1.00 78.28  ? 215 VAL C N     1 
ATOM   8788  C  CA    . VAL C  1 215 ? 44.497  14.833   27.137  1.00 77.89  ? 215 VAL C CA    1 
ATOM   8789  C  C     . VAL C  1 215 ? 45.528  15.387   26.151  1.00 79.92  ? 215 VAL C C     1 
ATOM   8790  O  O     . VAL C  1 215 ? 45.527  16.582   25.842  1.00 80.53  ? 215 VAL C O     1 
ATOM   8791  C  CB    . VAL C  1 215 ? 45.178  14.621   28.516  1.00 76.38  ? 215 VAL C CB    1 
ATOM   8792  C  CG1   . VAL C  1 215 ? 45.764  15.935   29.039  1.00 75.18  ? 215 VAL C CG1   1 
ATOM   8793  C  CG2   . VAL C  1 215 ? 44.188  14.023   29.520  1.00 74.80  ? 215 VAL C CG2   1 
ATOM   8794  N  N     . ALA C  1 216 ? 46.399  14.505   25.666  1.00 81.08  ? 216 ALA C N     1 
ATOM   8795  C  CA    . ALA C  1 216 ? 47.386  14.853   24.661  1.00 83.20  ? 216 ALA C CA    1 
ATOM   8796  C  C     . ALA C  1 216 ? 46.693  15.423   23.437  1.00 85.05  ? 216 ALA C C     1 
ATOM   8797  O  O     . ALA C  1 216 ? 47.058  16.497   22.956  1.00 86.12  ? 216 ALA C O     1 
ATOM   8798  C  CB    . ALA C  1 216 ? 48.204  13.635   24.289  1.00 84.16  ? 216 ALA C CB    1 
ATOM   8799  N  N     . GLN C  1 217 ? 45.674  14.707   22.959  1.00 85.79  ? 217 GLN C N     1 
ATOM   8800  C  CA    . GLN C  1 217 ? 44.894  15.119   21.788  1.00 87.84  ? 217 GLN C CA    1 
ATOM   8801  C  C     . GLN C  1 217 ? 44.097  16.406   22.051  1.00 87.25  ? 217 GLN C C     1 
ATOM   8802  O  O     . GLN C  1 217 ? 43.791  17.144   21.119  1.00 88.97  ? 217 GLN C O     1 
ATOM   8803  C  CB    . GLN C  1 217 ? 44.001  13.964   21.293  1.00 88.41  ? 217 GLN C CB    1 
ATOM   8804  C  CG    . GLN C  1 217 ? 43.067  14.275   20.106  1.00 91.19  ? 217 GLN C CG    1 
ATOM   8805  C  CD    . GLN C  1 217 ? 43.795  14.609   18.804  1.00 94.95  ? 217 GLN C CD    1 
ATOM   8806  O  OE1   . GLN C  1 217 ? 44.282  13.717   18.095  1.00 97.59  ? 217 GLN C OE1   1 
ATOM   8807  N  NE2   . GLN C  1 217 ? 43.840  15.899   18.467  1.00 95.04  ? 217 GLN C NE2   1 
ATOM   8808  N  N     . LEU C  1 218 ? 43.784  16.693   23.311  1.00 85.24  ? 218 LEU C N     1 
ATOM   8809  C  CA    . LEU C  1 218 ? 43.151  17.963   23.622  1.00 84.83  ? 218 LEU C CA    1 
ATOM   8810  C  C     . LEU C  1 218 ? 44.150  19.113   23.664  1.00 85.37  ? 218 LEU C C     1 
ATOM   8811  O  O     . LEU C  1 218 ? 43.831  20.196   23.175  1.00 86.43  ? 218 LEU C O     1 
ATOM   8812  C  CB    . LEU C  1 218 ? 42.313  17.909   24.904  1.00 82.74  ? 218 LEU C CB    1 
ATOM   8813  C  CG    . LEU C  1 218 ? 41.395  19.138   25.039  1.00 82.86  ? 218 LEU C CG    1 
ATOM   8814  C  CD1   . LEU C  1 218 ? 39.933  18.784   25.317  1.00 81.81  ? 218 LEU C CD1   1 
ATOM   8815  C  CD2   . LEU C  1 218 ? 41.937  20.123   26.072  1.00 82.18  ? 218 LEU C CD2   1 
ATOM   8816  N  N     . VAL C  1 219 ? 45.342  18.895   24.231  1.00 85.01  ? 219 VAL C N     1 
ATOM   8817  C  CA    . VAL C  1 219 ? 46.342  19.979   24.301  1.00 85.75  ? 219 VAL C CA    1 
ATOM   8818  C  C     . VAL C  1 219 ? 46.751  20.420   22.904  1.00 88.27  ? 219 VAL C C     1 
ATOM   8819  O  O     . VAL C  1 219 ? 47.036  21.596   22.672  1.00 89.04  ? 219 VAL C O     1 
ATOM   8820  C  CB    . VAL C  1 219 ? 47.618  19.654   25.157  1.00 85.03  ? 219 VAL C CB    1 
ATOM   8821  C  CG1   . VAL C  1 219 ? 47.252  19.088   26.519  1.00 82.78  ? 219 VAL C CG1   1 
ATOM   8822  C  CG2   . VAL C  1 219 ? 48.581  18.737   24.419  1.00 87.09  ? 219 VAL C CG2   1 
ATOM   8823  N  N     . GLN C  1 220 ? 46.756  19.457   21.985  1.00 89.71  ? 220 GLN C N     1 
ATOM   8824  C  CA    . GLN C  1 220 ? 47.077  19.692   20.588  1.00 92.62  ? 220 GLN C CA    1 
ATOM   8825  C  C     . GLN C  1 220 ? 46.001  20.548   19.926  1.00 93.13  ? 220 GLN C C     1 
ATOM   8826  O  O     . GLN C  1 220 ? 46.326  21.459   19.169  1.00 95.07  ? 220 GLN C O     1 
ATOM   8827  C  CB    . GLN C  1 220 ? 47.239  18.358   19.858  1.00 94.03  ? 220 GLN C CB    1 
ATOM   8828  C  CG    . GLN C  1 220 ? 47.554  18.473   18.376  1.00 98.66  ? 220 GLN C CG    1 
ATOM   8829  C  CD    . GLN C  1 220 ? 46.770  17.464   17.541  1.00 102.39 ? 220 GLN C CD    1 
ATOM   8830  O  OE1   . GLN C  1 220 ? 47.089  16.267   17.517  1.00 103.48 ? 220 GLN C OE1   1 
ATOM   8831  N  NE2   . GLN C  1 220 ? 45.735  17.944   16.852  1.00 104.07 ? 220 GLN C NE2   1 
ATOM   8832  N  N     . THR C  1 221 ? 44.734  20.260   20.222  1.00 91.67  ? 221 THR C N     1 
ATOM   8833  C  CA    . THR C  1 221 ? 43.617  21.051   19.707  1.00 92.37  ? 221 THR C CA    1 
ATOM   8834  C  C     . THR C  1 221 ? 43.741  22.500   20.144  1.00 92.04  ? 221 THR C C     1 
ATOM   8835  O  O     . THR C  1 221 ? 43.546  23.410   19.336  1.00 93.98  ? 221 THR C O     1 
ATOM   8836  C  CB    . THR C  1 221 ? 42.249  20.515   20.178  1.00 91.04  ? 221 THR C CB    1 
ATOM   8837  O  OG1   . THR C  1 221 ? 42.110  19.146   19.789  1.00 91.96  ? 221 THR C OG1   1 
ATOM   8838  C  CG2   . THR C  1 221 ? 41.098  21.333   19.570  1.00 92.05  ? 221 THR C CG2   1 
ATOM   8839  N  N     . LEU C  1 222 ? 44.062  22.708   21.420  1.00 89.85  ? 222 LEU C N     1 
ATOM   8840  C  CA    . LEU C  1 222 ? 44.252  24.050   21.960  1.00 89.40  ? 222 LEU C CA    1 
ATOM   8841  C  C     . LEU C  1 222 ? 45.448  24.740   21.300  1.00 91.27  ? 222 LEU C C     1 
ATOM   8842  O  O     . LEU C  1 222 ? 45.358  25.908   20.929  1.00 92.40  ? 222 LEU C O     1 
ATOM   8843  C  CB    . LEU C  1 222 ? 44.398  24.023   23.488  1.00 87.07  ? 222 LEU C CB    1 
ATOM   8844  C  CG    . LEU C  1 222 ? 43.207  23.634   24.389  1.00 85.18  ? 222 LEU C CG    1 
ATOM   8845  C  CD1   . LEU C  1 222 ? 43.622  23.581   25.854  1.00 82.51  ? 222 LEU C CD1   1 
ATOM   8846  C  CD2   . LEU C  1 222 ? 42.008  24.571   24.232  1.00 85.77  ? 222 LEU C CD2   1 
ATOM   8847  N  N     . GLU C  1 223 ? 46.551  24.012   21.129  1.00 91.79  ? 223 GLU C N     1 
ATOM   8848  C  CA    . GLU C  1 223 ? 47.710  24.538   20.398  1.00 93.96  ? 223 GLU C CA    1 
ATOM   8849  C  C     . GLU C  1 223 ? 47.366  24.957   18.972  1.00 96.46  ? 223 GLU C C     1 
ATOM   8850  O  O     . GLU C  1 223 ? 47.804  26.019   18.523  1.00 98.33  ? 223 GLU C O     1 
ATOM   8851  C  CB    . GLU C  1 223 ? 48.887  23.559   20.407  1.00 94.29  ? 223 GLU C CB    1 
ATOM   8852  C  CG    . GLU C  1 223 ? 50.102  24.069   21.181  1.00 94.75  ? 223 GLU C CG    1 
ATOM   8853  C  CD    . GLU C  1 223 ? 50.922  22.939   21.780  1.00 95.70  ? 223 GLU C CD    1 
ATOM   8854  O  OE1   . GLU C  1 223 ? 51.672  22.275   21.037  1.00 98.19  ? 223 GLU C OE1   1 
ATOM   8855  O  OE2   . GLU C  1 223 ? 50.815  22.708   23.002  1.00 94.73  ? 223 GLU C OE2   1 
ATOM   8856  N  N     . GLN C  1 224 ? 46.583  24.131   18.272  1.00 96.71  ? 224 GLN C N     1 
ATOM   8857  C  CA    . GLN C  1 224 ? 46.099  24.470   16.931  1.00 99.00  ? 224 GLN C CA    1 
ATOM   8858  C  C     . GLN C  1 224 ? 45.399  25.824   16.904  1.00 99.03  ? 224 GLN C C     1 
ATOM   8859  O  O     . GLN C  1 224 ? 45.717  26.674   16.062  1.00 101.45 ? 224 GLN C O     1 
ATOM   8860  C  CB    . GLN C  1 224 ? 45.166  23.393   16.371  1.00 99.39  ? 224 GLN C CB    1 
ATOM   8861  C  CG    . GLN C  1 224 ? 45.811  22.495   15.325  1.00 102.31 ? 224 GLN C CG    1 
ATOM   8862  C  CD    . GLN C  1 224 ? 46.436  21.257   15.931  1.00 101.85 ? 224 GLN C CD    1 
ATOM   8863  O  OE1   . GLN C  1 224 ? 45.756  20.464   16.578  1.00 100.42 ? 224 GLN C OE1   1 
ATOM   8864  N  NE2   . GLN C  1 224 ? 47.733  21.080   15.715  1.00 103.69 ? 224 GLN C NE2   1 
ATOM   8865  N  N     . HIS C  1 225 ? 44.466  26.025   17.836  1.00 96.27  ? 225 HIS C N     1 
ATOM   8866  C  CA    . HIS C  1 225 ? 43.732  27.283   17.939  1.00 96.03  ? 225 HIS C CA    1 
ATOM   8867  C  C     . HIS C  1 225 ? 44.506  28.364   18.701  1.00 94.98  ? 225 HIS C C     1 
ATOM   8868  O  O     . HIS C  1 225 ? 43.935  29.397   19.065  1.00 94.52  ? 225 HIS C O     1 
ATOM   8869  C  CB    . HIS C  1 225 ? 42.361  27.050   18.574  1.00 94.37  ? 225 HIS C CB    1 
ATOM   8870  C  CG    . HIS C  1 225 ? 41.410  26.283   17.703  1.00 96.39  ? 225 HIS C CG    1 
ATOM   8871  N  ND1   . HIS C  1 225 ? 40.322  26.869   17.089  1.00 98.47  ? 225 HIS C ND1   1 
ATOM   8872  C  CD2   . HIS C  1 225 ? 41.383  24.977   17.345  1.00 97.24  ? 225 HIS C CD2   1 
ATOM   8873  C  CE1   . HIS C  1 225 ? 39.667  25.958   16.391  1.00 99.37  ? 225 HIS C CE1   1 
ATOM   8874  N  NE2   . HIS C  1 225 ? 40.291  24.802   16.528  1.00 98.73  ? 225 HIS C NE2   1 
ATOM   8875  N  N     . ASP C  1 226 ? 45.804  28.126   18.916  1.00 94.49  ? 226 ASP C N     1 
ATOM   8876  C  CA    . ASP C  1 226 ? 46.682  29.044   19.644  1.00 93.80  ? 226 ASP C CA    1 
ATOM   8877  C  C     . ASP C  1 226 ? 46.008  29.534   20.935  1.00 91.24  ? 226 ASP C C     1 
ATOM   8878  O  O     . ASP C  1 226 ? 45.798  30.729   21.147  1.00 91.52  ? 226 ASP C O     1 
ATOM   8879  C  CB    . ASP C  1 226 ? 47.128  30.203   18.737  1.00 96.52  ? 226 ASP C CB    1 
ATOM   8880  C  CG    . ASP C  1 226 ? 47.992  31.224   19.466  1.00 96.63  ? 226 ASP C CG    1 
ATOM   8881  O  OD1   . ASP C  1 226 ? 48.905  30.822   20.215  1.00 96.27  ? 226 ASP C OD1   1 
ATOM   8882  O  OD2   . ASP C  1 226 ? 47.751  32.436   19.303  1.00 97.80  ? 226 ASP C OD2   1 
ATOM   8883  N  N     . ALA C  1 227 ? 45.653  28.575   21.782  1.00 88.90  ? 227 ALA C N     1 
ATOM   8884  C  CA    . ALA C  1 227 ? 44.949  28.836   23.034  1.00 86.46  ? 227 ALA C CA    1 
ATOM   8885  C  C     . ALA C  1 227 ? 45.636  28.158   24.222  1.00 84.44  ? 227 ALA C C     1 
ATOM   8886  O  O     . ALA C  1 227 ? 45.196  28.301   25.359  1.00 82.75  ? 227 ALA C O     1 
ATOM   8887  C  CB    . ALA C  1 227 ? 43.494  28.391   22.924  1.00 85.76  ? 227 ALA C CB    1 
ATOM   8888  N  N     . MET C  1 228 ? 46.713  27.423   23.948  1.00 84.95  ? 228 MET C N     1 
ATOM   8889  C  CA    . MET C  1 228 ? 47.546  26.808   24.982  1.00 83.41  ? 228 MET C CA    1 
ATOM   8890  C  C     . MET C  1 228 ? 48.340  27.869   25.765  1.00 83.21  ? 228 MET C C     1 
ATOM   8891  O  O     . MET C  1 228 ? 48.535  27.747   26.980  1.00 81.46  ? 228 MET C O     1 
ATOM   8892  C  CB    . MET C  1 228 ? 48.478  25.762   24.353  1.00 84.30  ? 228 MET C CB    1 
ATOM   8893  C  CG    . MET C  1 228 ? 49.275  24.894   25.334  1.00 83.60  ? 228 MET C CG    1 
ATOM   8894  S  SD    . MET C  1 228 ? 48.324  24.038   26.624  1.00 82.67  ? 228 MET C SD    1 
ATOM   8895  C  CE    . MET C  1 228 ? 47.107  23.178   25.651  1.00 83.55  ? 228 MET C CE    1 
ATOM   8896  N  N     . LYS C  1 229 ? 48.773  28.920   25.069  1.00 84.99  ? 229 LYS C N     1 
ATOM   8897  C  CA    . LYS C  1 229 ? 49.556  29.997   25.695  1.00 85.00  ? 229 LYS C CA    1 
ATOM   8898  C  C     . LYS C  1 229 ? 48.896  30.615   26.932  1.00 82.94  ? 229 LYS C C     1 
ATOM   8899  O  O     . LYS C  1 229 ? 49.594  31.007   27.868  1.00 82.40  ? 229 LYS C O     1 
ATOM   8900  C  CB    . LYS C  1 229 ? 49.940  31.080   24.677  1.00 87.42  ? 229 LYS C CB    1 
ATOM   8901  C  CG    . LYS C  1 229 ? 48.776  31.793   24.016  1.00 88.26  ? 229 LYS C CG    1 
ATOM   8902  C  CD    . LYS C  1 229 ? 49.293  32.743   22.969  1.00 91.92  ? 229 LYS C CD    1 
ATOM   8903  C  CE    . LYS C  1 229 ? 48.273  33.787   22.589  1.00 93.09  ? 229 LYS C CE    1 
ATOM   8904  N  NZ    . LYS C  1 229 ? 48.958  34.868   21.831  1.00 96.71  ? 229 LYS C NZ    1 
ATOM   8905  N  N     . TYR C  1 230 ? 47.567  30.696   26.936  1.00 81.81  ? 230 TYR C N     1 
ATOM   8906  C  CA    . TYR C  1 230 ? 46.852  31.209   28.105  1.00 80.19  ? 230 TYR C CA    1 
ATOM   8907  C  C     . TYR C  1 230 ? 46.190  30.116   28.950  1.00 78.24  ? 230 TYR C C     1 
ATOM   8908  O  O     . TYR C  1 230 ? 45.309  30.394   29.768  1.00 77.03  ? 230 TYR C O     1 
ATOM   8909  C  CB    . TYR C  1 230 ? 45.859  32.322   27.728  1.00 80.77  ? 230 TYR C CB    1 
ATOM   8910  C  CG    . TYR C  1 230 ? 44.760  31.963   26.743  1.00 80.90  ? 230 TYR C CG    1 
ATOM   8911  C  CD1   . TYR C  1 230 ? 43.608  31.297   27.161  1.00 79.59  ? 230 TYR C CD1   1 
ATOM   8912  C  CD2   . TYR C  1 230 ? 44.847  32.338   25.405  1.00 82.47  ? 230 TYR C CD2   1 
ATOM   8913  C  CE1   . TYR C  1 230 ? 42.582  30.982   26.263  1.00 79.46  ? 230 TYR C CE1   1 
ATOM   8914  C  CE2   . TYR C  1 230 ? 43.824  32.037   24.502  1.00 82.99  ? 230 TYR C CE2   1 
ATOM   8915  C  CZ    . TYR C  1 230 ? 42.696  31.358   24.940  1.00 81.30  ? 230 TYR C CZ    1 
ATOM   8916  O  OH    . TYR C  1 230 ? 41.682  31.050   24.059  1.00 81.68  ? 230 TYR C OH    1 
ATOM   8917  N  N     . SER C  1 231 ? 46.649  28.877   28.763  1.00 78.06  ? 231 SER C N     1 
ATOM   8918  C  CA    . SER C  1 231 ? 46.027  27.712   29.390  1.00 76.33  ? 231 SER C CA    1 
ATOM   8919  C  C     . SER C  1 231 ? 46.983  26.840   30.196  1.00 75.48  ? 231 SER C C     1 
ATOM   8920  O  O     . SER C  1 231 ? 48.111  26.572   29.786  1.00 76.37  ? 231 SER C O     1 
ATOM   8921  C  CB    . SER C  1 231 ? 45.309  26.859   28.343  1.00 76.78  ? 231 SER C CB    1 
ATOM   8922  O  OG    . SER C  1 231 ? 44.201  27.559   27.802  1.00 77.46  ? 231 SER C OG    1 
ATOM   8923  N  N     . ILE C  1 232 ? 46.500  26.405   31.353  1.00 73.89  ? 232 ILE C N     1 
ATOM   8924  C  CA    . ILE C  1 232 ? 47.221  25.488   32.213  1.00 73.08  ? 232 ILE C CA    1 
ATOM   8925  C  C     . ILE C  1 232 ? 46.445  24.180   32.241  1.00 72.34  ? 232 ILE C C     1 
ATOM   8926  O  O     . ILE C  1 232 ? 45.229  24.175   32.445  1.00 71.72  ? 232 ILE C O     1 
ATOM   8927  C  CB    . ILE C  1 232 ? 47.381  26.058   33.634  1.00 72.06  ? 232 ILE C CB    1 
ATOM   8928  C  CG1   . ILE C  1 232 ? 47.983  27.464   33.563  1.00 73.34  ? 232 ILE C CG1   1 
ATOM   8929  C  CG2   . ILE C  1 232 ? 48.267  25.153   34.473  1.00 71.19  ? 232 ILE C CG2   1 
ATOM   8930  C  CD1   . ILE C  1 232 ? 47.848  28.266   34.825  1.00 73.00  ? 232 ILE C CD1   1 
ATOM   8931  N  N     . ILE C  1 233 ? 47.153  23.075   32.013  1.00 72.71  ? 233 ILE C N     1 
ATOM   8932  C  CA    . ILE C  1 233 ? 46.548  21.741   31.998  1.00 71.84  ? 233 ILE C CA    1 
ATOM   8933  C  C     . ILE C  1 233 ? 47.023  20.937   33.200  1.00 70.83  ? 233 ILE C C     1 
ATOM   8934  O  O     . ILE C  1 233 ? 48.176  20.502   33.254  1.00 71.52  ? 233 ILE C O     1 
ATOM   8935  C  CB    . ILE C  1 233 ? 46.901  20.957   30.709  1.00 73.01  ? 233 ILE C CB    1 
ATOM   8936  C  CG1   . ILE C  1 233 ? 46.755  21.832   29.445  1.00 74.81  ? 233 ILE C CG1   1 
ATOM   8937  C  CG2   . ILE C  1 233 ? 46.113  19.652   30.635  1.00 72.28  ? 233 ILE C CG2   1 
ATOM   8938  C  CD1   . ILE C  1 233 ? 45.413  22.545   29.274  1.00 74.83  ? 233 ILE C CD1   1 
ATOM   8939  N  N     . VAL C  1 234 ? 46.139  20.767   34.174  1.00 69.34  ? 234 VAL C N     1 
ATOM   8940  C  CA    . VAL C  1 234 ? 46.420  19.889   35.284  1.00 68.53  ? 234 VAL C CA    1 
ATOM   8941  C  C     . VAL C  1 234 ? 45.726  18.583   34.951  1.00 68.56  ? 234 VAL C C     1 
ATOM   8942  O  O     . VAL C  1 234 ? 44.562  18.592   34.554  1.00 68.77  ? 234 VAL C O     1 
ATOM   8943  C  CB    . VAL C  1 234 ? 45.897  20.458   36.598  1.00 67.49  ? 234 VAL C CB    1 
ATOM   8944  C  CG1   . VAL C  1 234 ? 46.192  19.498   37.738  1.00 66.73  ? 234 VAL C CG1   1 
ATOM   8945  C  CG2   . VAL C  1 234 ? 46.525  21.823   36.864  1.00 67.59  ? 234 VAL C CG2   1 
ATOM   8946  N  N     . ALA C  1 235 ? 46.440  17.466   35.087  1.00 68.76  ? 235 ALA C N     1 
ATOM   8947  C  CA    . ALA C  1 235 ? 45.898  16.156   34.714  1.00 68.51  ? 235 ALA C CA    1 
ATOM   8948  C  C     . ALA C  1 235 ? 46.191  15.065   35.747  1.00 68.05  ? 235 ALA C C     1 
ATOM   8949  O  O     . ALA C  1 235 ? 47.314  14.954   36.264  1.00 68.56  ? 235 ALA C O     1 
ATOM   8950  C  CB    . ALA C  1 235 ? 46.420  15.746   33.347  1.00 69.53  ? 235 ALA C CB    1 
ATOM   8951  N  N     . ALA C  1 236 ? 45.179  14.265   36.057  1.00 67.24  ? 236 ALA C N     1 
ATOM   8952  C  CA    . ALA C  1 236 ? 45.389  13.079   36.876  1.00 67.01  ? 236 ALA C CA    1 
ATOM   8953  C  C     . ALA C  1 236 ? 44.712  11.955   36.160  1.00 67.25  ? 236 ALA C C     1 
ATOM   8954  O  O     . ALA C  1 236 ? 43.539  11.673   36.432  1.00 67.05  ? 236 ALA C O     1 
ATOM   8955  C  CB    . ALA C  1 236 ? 44.789  13.251   38.236  1.00 65.91  ? 236 ALA C CB    1 
ATOM   8956  N  N     . THR C  1 237 ? 45.445  11.317   35.248  1.00 68.01  ? 237 THR C N     1 
ATOM   8957  C  CA    . THR C  1 237 ? 44.834  10.390   34.285  1.00 68.49  ? 237 THR C CA    1 
ATOM   8958  C  C     . THR C  1 237 ? 44.486  8.986    34.830  1.00 68.03  ? 237 THR C C     1 
ATOM   8959  O  O     . THR C  1 237 ? 44.758  8.672    35.988  1.00 67.54  ? 237 THR C O     1 
ATOM   8960  C  CB    . THR C  1 237 ? 45.612  10.362   32.935  1.00 70.03  ? 237 THR C CB    1 
ATOM   8961  O  OG1   . THR C  1 237 ? 47.015  10.162   33.163  1.00 70.88  ? 237 THR C OG1   1 
ATOM   8962  C  CG2   . THR C  1 237 ? 45.406  11.682   32.188  1.00 70.18  ? 237 THR C CG2   1 
ATOM   8963  N  N     . ALA C  1 238 ? 43.862  8.164    33.990  1.00 68.33  ? 238 ALA C N     1 
ATOM   8964  C  CA    . ALA C  1 238 ? 43.281  6.874    34.396  1.00 68.11  ? 238 ALA C CA    1 
ATOM   8965  C  C     . ALA C  1 238 ? 44.186  5.936    35.208  1.00 68.17  ? 238 ALA C C     1 
ATOM   8966  O  O     . ALA C  1 238 ? 43.746  5.326    36.186  1.00 67.40  ? 238 ALA C O     1 
ATOM   8967  C  CB    . ALA C  1 238 ? 42.736  6.144    33.167  1.00 69.11  ? 238 ALA C CB    1 
ATOM   8968  N  N     . SER C  1 239 ? 45.442  5.822    34.792  1.00 69.20  ? 239 SER C N     1 
ATOM   8969  C  CA    . SER C  1 239 ? 46.396  4.889    35.400  1.00 69.85  ? 239 SER C CA    1 
ATOM   8970  C  C     . SER C  1 239 ? 46.899  5.335    36.769  1.00 69.42  ? 239 SER C C     1 
ATOM   8971  O  O     . SER C  1 239 ? 47.499  4.549    37.502  1.00 70.03  ? 239 SER C O     1 
ATOM   8972  C  CB    . SER C  1 239 ? 47.586  4.685    34.465  1.00 70.97  ? 239 SER C CB    1 
ATOM   8973  O  OG    . SER C  1 239 ? 47.868  5.885    33.766  1.00 70.88  ? 239 SER C OG    1 
ATOM   8974  N  N     . GLU C  1 240 ? 46.643  6.592    37.113  1.00 68.73  ? 240 GLU C N     1 
ATOM   8975  C  CA    . GLU C  1 240 ? 47.256  7.204    38.279  1.00 68.56  ? 240 GLU C CA    1 
ATOM   8976  C  C     . GLU C  1 240 ? 46.621  6.741    39.575  1.00 67.91  ? 240 GLU C C     1 
ATOM   8977  O  O     . GLU C  1 240 ? 45.427  6.429    39.609  1.00 67.54  ? 240 GLU C O     1 
ATOM   8978  C  CB    . GLU C  1 240 ? 47.187  8.724    38.176  1.00 68.17  ? 240 GLU C CB    1 
ATOM   8979  C  CG    . GLU C  1 240 ? 47.637  9.254    36.834  1.00 70.00  ? 240 GLU C CG    1 
ATOM   8980  C  CD    . GLU C  1 240 ? 48.661  10.353   36.948  1.00 72.23  ? 240 GLU C CD    1 
ATOM   8981  O  OE1   . GLU C  1 240 ? 49.207  10.549   38.057  1.00 73.14  ? 240 GLU C OE1   1 
ATOM   8982  O  OE2   . GLU C  1 240 ? 48.931  11.011   35.920  1.00 73.90  ? 240 GLU C OE2   1 
ATOM   8983  N  N     . ALA C  1 241 ? 47.427  6.701    40.638  1.00 67.98  ? 241 ALA C N     1 
ATOM   8984  C  CA    . ALA C  1 241 ? 46.931  6.363    41.976  1.00 67.31  ? 241 ALA C CA    1 
ATOM   8985  C  C     . ALA C  1 241 ? 45.754  7.256    42.322  1.00 66.04  ? 241 ALA C C     1 
ATOM   8986  O  O     . ALA C  1 241 ? 45.731  8.434    41.957  1.00 65.50  ? 241 ALA C O     1 
ATOM   8987  C  CB    . ALA C  1 241 ? 48.034  6.510    43.014  1.00 67.87  ? 241 ALA C CB    1 
ATOM   8988  N  N     . ALA C  1 242 ? 44.779  6.694    43.026  1.00 65.58  ? 242 ALA C N     1 
ATOM   8989  C  CA    . ALA C  1 242 ? 43.535  7.408    43.320  1.00 64.62  ? 242 ALA C CA    1 
ATOM   8990  C  C     . ALA C  1 242 ? 43.731  8.791    43.962  1.00 64.20  ? 242 ALA C C     1 
ATOM   8991  O  O     . ALA C  1 242 ? 43.095  9.757    43.525  1.00 63.59  ? 242 ALA C O     1 
ATOM   8992  C  CB    . ALA C  1 242 ? 42.587  6.539    44.145  1.00 64.47  ? 242 ALA C CB    1 
ATOM   8993  N  N     . PRO C  1 243 ? 44.624  8.902    44.975  1.00 64.62  ? 243 PRO C N     1 
ATOM   8994  C  CA    . PRO C  1 243 ? 44.814  10.190   45.637  1.00 64.50  ? 243 PRO C CA    1 
ATOM   8995  C  C     . PRO C  1 243 ? 45.236  11.305   44.681  1.00 64.59  ? 243 PRO C C     1 
ATOM   8996  O  O     . PRO C  1 243 ? 44.992  12.483   44.973  1.00 64.42  ? 243 PRO C O     1 
ATOM   8997  C  CB    . PRO C  1 243 ? 45.938  9.903    46.631  1.00 65.16  ? 243 PRO C CB    1 
ATOM   8998  C  CG    . PRO C  1 243 ? 45.888  8.469    46.857  1.00 65.45  ? 243 PRO C CG    1 
ATOM   8999  C  CD    . PRO C  1 243 ? 45.493  7.870    45.570  1.00 65.36  ? 243 PRO C CD    1 
ATOM   9000  N  N     . LEU C  1 244 ? 45.858  10.935   43.560  1.00 64.98  ? 244 LEU C N     1 
ATOM   9001  C  CA    . LEU C  1 244 ? 46.272  11.903   42.545  1.00 65.18  ? 244 LEU C CA    1 
ATOM   9002  C  C     . LEU C  1 244 ? 45.095  12.408   41.714  1.00 64.95  ? 244 LEU C C     1 
ATOM   9003  O  O     . LEU C  1 244 ? 45.096  13.544   41.255  1.00 65.08  ? 244 LEU C O     1 
ATOM   9004  C  CB    . LEU C  1 244 ? 47.383  11.343   41.656  1.00 65.79  ? 244 LEU C CB    1 
ATOM   9005  C  CG    . LEU C  1 244 ? 48.731  11.150   42.365  1.00 66.39  ? 244 LEU C CG    1 
ATOM   9006  C  CD1   . LEU C  1 244 ? 49.767  10.554   41.433  1.00 67.45  ? 244 LEU C CD1   1 
ATOM   9007  C  CD2   . LEU C  1 244 ? 49.236  12.456   42.946  1.00 66.34  ? 244 LEU C CD2   1 
ATOM   9008  N  N     . GLN C  1 245 ? 44.081  11.570   41.544  1.00 64.95  ? 245 GLN C N     1 
ATOM   9009  C  CA    . GLN C  1 245 ? 42.842  11.998   40.904  1.00 64.86  ? 245 GLN C CA    1 
ATOM   9010  C  C     . GLN C  1 245 ? 41.961  12.744   41.898  1.00 64.85  ? 245 GLN C C     1 
ATOM   9011  O  O     . GLN C  1 245 ? 41.249  13.689   41.540  1.00 64.45  ? 245 GLN C O     1 
ATOM   9012  C  CB    . GLN C  1 245 ? 42.096  10.797   40.358  1.00 64.77  ? 245 GLN C CB    1 
ATOM   9013  C  CG    . GLN C  1 245 ? 42.985  9.858    39.613  1.00 64.58  ? 245 GLN C CG    1 
ATOM   9014  C  CD    . GLN C  1 245 ? 42.215  8.917    38.768  1.00 63.08  ? 245 GLN C CD    1 
ATOM   9015  O  OE1   . GLN C  1 245 ? 41.202  9.284    38.185  1.00 62.33  ? 245 GLN C OE1   1 
ATOM   9016  N  NE2   . GLN C  1 245 ? 42.686  7.688    38.683  1.00 63.63  ? 245 GLN C NE2   1 
ATOM   9017  N  N     . TYR C  1 246 ? 42.018  12.288   43.147  1.00 65.46  ? 246 TYR C N     1 
ATOM   9018  C  CA    . TYR C  1 246 ? 41.355  12.926   44.266  1.00 65.83  ? 246 TYR C CA    1 
ATOM   9019  C  C     . TYR C  1 246 ? 41.842  14.370   44.446  1.00 65.99  ? 246 TYR C C     1 
ATOM   9020  O  O     . TYR C  1 246 ? 41.043  15.287   44.651  1.00 65.78  ? 246 TYR C O     1 
ATOM   9021  C  CB    . TYR C  1 246 ? 41.614  12.094   45.527  1.00 66.36  ? 246 TYR C CB    1 
ATOM   9022  C  CG    . TYR C  1 246 ? 41.334  12.813   46.823  1.00 68.34  ? 246 TYR C CG    1 
ATOM   9023  C  CD1   . TYR C  1 246 ? 40.066  13.315   47.098  1.00 69.49  ? 246 TYR C CD1   1 
ATOM   9024  C  CD2   . TYR C  1 246 ? 42.335  12.984   47.783  1.00 70.81  ? 246 TYR C CD2   1 
ATOM   9025  C  CE1   . TYR C  1 246 ? 39.797  13.983   48.281  1.00 71.20  ? 246 TYR C CE1   1 
ATOM   9026  C  CE2   . TYR C  1 246 ? 42.074  13.647   48.984  1.00 72.17  ? 246 TYR C CE2   1 
ATOM   9027  C  CZ    . TYR C  1 246 ? 40.795  14.147   49.218  1.00 72.88  ? 246 TYR C CZ    1 
ATOM   9028  O  OH    . TYR C  1 246 ? 40.488  14.810   50.386  1.00 75.26  ? 246 TYR C OH    1 
ATOM   9029  N  N     . LEU C  1 247 ? 43.155  14.561   44.335  1.00 66.64  ? 247 LEU C N     1 
ATOM   9030  C  CA    . LEU C  1 247 ? 43.812  15.831   44.648  1.00 66.83  ? 247 LEU C CA    1 
ATOM   9031  C  C     . LEU C  1 247 ? 43.781  16.846   43.498  1.00 66.77  ? 247 LEU C C     1 
ATOM   9032  O  O     . LEU C  1 247 ? 43.766  18.062   43.727  1.00 66.79  ? 247 LEU C O     1 
ATOM   9033  C  CB    . LEU C  1 247 ? 45.258  15.547   45.026  1.00 67.27  ? 247 LEU C CB    1 
ATOM   9034  C  CG    . LEU C  1 247 ? 45.779  16.137   46.321  1.00 68.14  ? 247 LEU C CG    1 
ATOM   9035  C  CD1   . LEU C  1 247 ? 45.046  15.553   47.517  1.00 68.35  ? 247 LEU C CD1   1 
ATOM   9036  C  CD2   . LEU C  1 247 ? 47.254  15.817   46.402  1.00 70.13  ? 247 LEU C CD2   1 
ATOM   9037  N  N     . ALA C  1 248 ? 43.764  16.330   42.270  1.00 66.61  ? 248 ALA C N     1 
ATOM   9038  C  CA    . ALA C  1 248 ? 43.892  17.139   41.056  1.00 66.77  ? 248 ALA C CA    1 
ATOM   9039  C  C     . ALA C  1 248 ? 42.951  18.341   40.878  1.00 66.52  ? 248 ALA C C     1 
ATOM   9040  O  O     . ALA C  1 248 ? 43.391  19.366   40.381  1.00 66.88  ? 248 ALA C O     1 
ATOM   9041  C  CB    . ALA C  1 248 ? 43.836  16.262   39.842  1.00 67.13  ? 248 ALA C CB    1 
ATOM   9042  N  N     . PRO C  1 249 ? 41.656  18.222   41.246  1.00 66.09  ? 249 PRO C N     1 
ATOM   9043  C  CA    . PRO C  1 249 ? 40.865  19.438   41.128  1.00 66.15  ? 249 PRO C CA    1 
ATOM   9044  C  C     . PRO C  1 249 ? 41.212  20.448   42.221  1.00 66.44  ? 249 PRO C C     1 
ATOM   9045  O  O     . PRO C  1 249 ? 40.996  21.646   42.037  1.00 66.82  ? 249 PRO C O     1 
ATOM   9046  C  CB    . PRO C  1 249 ? 39.423  18.948   41.319  1.00 65.64  ? 249 PRO C CB    1 
ATOM   9047  C  CG    . PRO C  1 249 ? 39.464  17.482   41.219  1.00 65.23  ? 249 PRO C CG    1 
ATOM   9048  C  CD    . PRO C  1 249 ? 40.821  17.085   41.672  1.00 65.91  ? 249 PRO C CD    1 
ATOM   9049  N  N     . PHE C  1 250 ? 41.751  19.967   43.343  1.00 66.54  ? 250 PHE C N     1 
ATOM   9050  C  CA    . PHE C  1 250 ? 42.000  20.825   44.507  1.00 66.80  ? 250 PHE C CA    1 
ATOM   9051  C  C     . PHE C  1 250 ? 43.248  21.692   44.346  1.00 67.39  ? 250 PHE C C     1 
ATOM   9052  O  O     . PHE C  1 250 ? 43.212  22.900   44.611  1.00 67.69  ? 250 PHE C O     1 
ATOM   9053  C  CB    . PHE C  1 250 ? 42.061  20.001   45.805  1.00 66.73  ? 250 PHE C CB    1 
ATOM   9054  C  CG    . PHE C  1 250 ? 40.714  19.576   46.315  1.00 66.20  ? 250 PHE C CG    1 
ATOM   9055  C  CD1   . PHE C  1 250 ? 39.827  20.510   46.834  1.00 66.50  ? 250 PHE C CD1   1 
ATOM   9056  C  CD2   . PHE C  1 250 ? 40.329  18.243   46.278  1.00 66.49  ? 250 PHE C CD2   1 
ATOM   9057  C  CE1   . PHE C  1 250 ? 38.574  20.124   47.307  1.00 66.31  ? 250 PHE C CE1   1 
ATOM   9058  C  CE2   . PHE C  1 250 ? 39.073  17.848   46.753  1.00 66.16  ? 250 PHE C CE2   1 
ATOM   9059  C  CZ    . PHE C  1 250 ? 38.200  18.790   47.266  1.00 65.78  ? 250 PHE C CZ    1 
ATOM   9060  N  N     . THR C  1 251 ? 44.340  21.067   43.910  1.00 67.56  ? 251 THR C N     1 
ATOM   9061  C  CA    . THR C  1 251 ? 45.593  21.776   43.643  1.00 68.06  ? 251 THR C CA    1 
ATOM   9062  C  C     . THR C  1 251 ? 45.502  22.644   42.376  1.00 68.39  ? 251 THR C C     1 
ATOM   9063  O  O     . THR C  1 251 ? 46.180  23.673   42.268  1.00 68.85  ? 251 THR C O     1 
ATOM   9064  C  CB    . THR C  1 251 ? 46.783  20.801   43.549  1.00 68.32  ? 251 THR C CB    1 
ATOM   9065  O  OG1   . THR C  1 251 ? 46.482  19.756   42.617  1.00 67.53  ? 251 THR C OG1   1 
ATOM   9066  C  CG2   . THR C  1 251 ? 47.064  20.187   44.901  1.00 68.32  ? 251 THR C CG2   1 
ATOM   9067  N  N     . ALA C  1 252 ? 44.658  22.226   41.429  1.00 68.04  ? 252 ALA C N     1 
ATOM   9068  C  CA    . ALA C  1 252 ? 44.364  23.024   40.236  1.00 68.53  ? 252 ALA C CA    1 
ATOM   9069  C  C     . ALA C  1 252 ? 43.601  24.296   40.599  1.00 68.56  ? 252 ALA C C     1 
ATOM   9070  O  O     . ALA C  1 252 ? 43.858  25.364   40.037  1.00 69.27  ? 252 ALA C O     1 
ATOM   9071  C  CB    . ALA C  1 252 ? 43.597  22.213   39.211  1.00 68.20  ? 252 ALA C CB    1 
ATOM   9072  N  N     . ALA C  1 253 ? 42.663  24.178   41.536  1.00 68.01  ? 253 ALA C N     1 
ATOM   9073  C  CA    . ALA C  1 253 ? 42.017  25.349   42.119  1.00 68.18  ? 253 ALA C CA    1 
ATOM   9074  C  C     . ALA C  1 253 ? 43.098  26.327   42.595  1.00 68.92  ? 253 ALA C C     1 
ATOM   9075  O  O     . ALA C  1 253 ? 43.191  27.451   42.093  1.00 69.69  ? 253 ALA C O     1 
ATOM   9076  C  CB    . ALA C  1 253 ? 41.097  24.946   43.260  1.00 67.52  ? 253 ALA C CB    1 
ATOM   9077  N  N     . SER C  1 254 ? 43.940  25.876   43.526  1.00 68.83  ? 254 SER C N     1 
ATOM   9078  C  CA    . SER C  1 254 ? 45.062  26.682   44.031  1.00 69.46  ? 254 SER C CA    1 
ATOM   9079  C  C     . SER C  1 254 ? 45.868  27.382   42.912  1.00 70.41  ? 254 SER C C     1 
ATOM   9080  O  O     . SER C  1 254 ? 46.187  28.575   43.021  1.00 71.02  ? 254 SER C O     1 
ATOM   9081  C  CB    . SER C  1 254 ? 45.977  25.825   44.914  1.00 69.25  ? 254 SER C CB    1 
ATOM   9082  O  OG    . SER C  1 254 ? 45.232  25.184   45.926  1.00 67.62  ? 254 SER C OG    1 
ATOM   9083  N  N     . ILE C  1 255 ? 46.180  26.630   41.850  1.00 70.44  ? 255 ILE C N     1 
ATOM   9084  C  CA    . ILE C  1 255 ? 46.851  27.161   40.655  1.00 71.38  ? 255 ILE C CA    1 
ATOM   9085  C  C     . ILE C  1 255 ? 46.044  28.322   40.062  1.00 71.83  ? 255 ILE C C     1 
ATOM   9086  O  O     . ILE C  1 255 ? 46.596  29.405   39.768  1.00 72.77  ? 255 ILE C O     1 
ATOM   9087  C  CB    . ILE C  1 255 ? 47.078  26.045   39.578  1.00 71.23  ? 255 ILE C CB    1 
ATOM   9088  C  CG1   . ILE C  1 255 ? 48.154  25.058   40.042  1.00 71.13  ? 255 ILE C CG1   1 
ATOM   9089  C  CG2   . ILE C  1 255 ? 47.448  26.649   38.219  1.00 71.80  ? 255 ILE C CG2   1 
ATOM   9090  C  CD1   . ILE C  1 255 ? 48.190  23.763   39.260  1.00 70.26  ? 255 ILE C CD1   1 
ATOM   9091  N  N     . GLY C  1 256 ? 44.739  28.081   39.910  1.00 70.85  ? 256 GLY C N     1 
ATOM   9092  C  CA    . GLY C  1 256 ? 43.816  29.054   39.348  1.00 71.02  ? 256 GLY C CA    1 
ATOM   9093  C  C     . GLY C  1 256 ? 43.545  30.202   40.291  1.00 71.11  ? 256 GLY C C     1 
ATOM   9094  O  O     . GLY C  1 256 ? 43.295  31.318   39.841  1.00 71.94  ? 256 GLY C O     1 
ATOM   9095  N  N     . GLU C  1 257 ? 43.609  29.926   41.595  1.00 70.54  ? 257 GLU C N     1 
ATOM   9096  C  CA    . GLU C  1 257 ? 43.339  30.927   42.639  1.00 71.08  ? 257 GLU C CA    1 
ATOM   9097  C  C     . GLU C  1 257 ? 44.323  32.109   42.648  1.00 72.28  ? 257 GLU C C     1 
ATOM   9098  O  O     . GLU C  1 257 ? 43.953  33.232   43.017  1.00 72.54  ? 257 GLU C O     1 
ATOM   9099  C  CB    . GLU C  1 257 ? 43.284  30.266   44.019  1.00 70.44  ? 257 GLU C CB    1 
ATOM   9100  C  CG    . GLU C  1 257 ? 41.891  29.809   44.437  1.00 70.25  ? 257 GLU C CG    1 
ATOM   9101  C  CD    . GLU C  1 257 ? 41.885  29.051   45.760  1.00 71.26  ? 257 GLU C CD    1 
ATOM   9102  O  OE1   . GLU C  1 257 ? 42.963  28.564   46.182  1.00 71.68  ? 257 GLU C OE1   1 
ATOM   9103  O  OE2   . GLU C  1 257 ? 40.798  28.941   46.380  1.00 71.84  ? 257 GLU C OE2   1 
ATOM   9104  N  N     . TRP C  1 258 ? 45.562  31.843   42.230  1.00 72.89  ? 258 TRP C N     1 
ATOM   9105  C  CA    . TRP C  1 258 ? 46.590  32.869   42.087  1.00 74.19  ? 258 TRP C CA    1 
ATOM   9106  C  C     . TRP C  1 258 ? 46.098  34.036   41.236  1.00 74.98  ? 258 TRP C C     1 
ATOM   9107  O  O     . TRP C  1 258 ? 46.315  35.202   41.581  1.00 76.15  ? 258 TRP C O     1 
ATOM   9108  C  CB    . TRP C  1 258 ? 47.871  32.293   41.480  1.00 74.61  ? 258 TRP C CB    1 
ATOM   9109  C  CG    . TRP C  1 258 ? 48.957  33.306   41.434  1.00 76.67  ? 258 TRP C CG    1 
ATOM   9110  C  CD1   . TRP C  1 258 ? 49.909  33.531   42.385  1.00 77.82  ? 258 TRP C CD1   1 
ATOM   9111  C  CD2   . TRP C  1 258 ? 49.187  34.270   40.398  1.00 79.15  ? 258 TRP C CD2   1 
ATOM   9112  N  NE1   . TRP C  1 258 ? 50.732  34.570   42.002  1.00 79.94  ? 258 TRP C NE1   1 
ATOM   9113  C  CE2   . TRP C  1 258 ? 50.311  35.042   40.787  1.00 80.67  ? 258 TRP C CE2   1 
ATOM   9114  C  CE3   . TRP C  1 258 ? 48.558  34.552   39.174  1.00 79.51  ? 258 TRP C CE3   1 
ATOM   9115  C  CZ2   . TRP C  1 258 ? 50.817  36.079   39.997  1.00 82.23  ? 258 TRP C CZ2   1 
ATOM   9116  C  CZ3   . TRP C  1 258 ? 49.059  35.585   38.390  1.00 81.49  ? 258 TRP C CZ3   1 
ATOM   9117  C  CH2   . TRP C  1 258 ? 50.179  36.338   38.807  1.00 83.03  ? 258 TRP C CH2   1 
ATOM   9118  N  N     . PHE C  1 259 ? 45.445  33.719   40.123  1.00 74.53  ? 259 PHE C N     1 
ATOM   9119  C  CA    . PHE C  1 259 ? 44.905  34.745   39.248  1.00 75.19  ? 259 PHE C CA    1 
ATOM   9120  C  C     . PHE C  1 259 ? 43.850  35.568   39.965  1.00 74.93  ? 259 PHE C C     1 
ATOM   9121  O  O     . PHE C  1 259 ? 43.908  36.794   39.936  1.00 76.08  ? 259 PHE C O     1 
ATOM   9122  C  CB    . PHE C  1 259 ? 44.373  34.129   37.958  1.00 75.08  ? 259 PHE C CB    1 
ATOM   9123  C  CG    . PHE C  1 259 ? 45.442  33.512   37.123  1.00 76.11  ? 259 PHE C CG    1 
ATOM   9124  C  CD1   . PHE C  1 259 ? 46.177  34.286   36.230  1.00 78.40  ? 259 PHE C CD1   1 
ATOM   9125  C  CD2   . PHE C  1 259 ? 45.753  32.165   37.255  1.00 75.95  ? 259 PHE C CD2   1 
ATOM   9126  C  CE1   . PHE C  1 259 ? 47.193  33.723   35.456  1.00 79.09  ? 259 PHE C CE1   1 
ATOM   9127  C  CE2   . PHE C  1 259 ? 46.770  31.590   36.485  1.00 76.84  ? 259 PHE C CE2   1 
ATOM   9128  C  CZ    . PHE C  1 259 ? 47.488  32.372   35.582  1.00 78.19  ? 259 PHE C CZ    1 
ATOM   9129  N  N     . ARG C  1 260 ? 42.920  34.892   40.636  1.00 73.49  ? 260 ARG C N     1 
ATOM   9130  C  CA    . ARG C  1 260 ? 41.862  35.552   41.391  1.00 73.39  ? 260 ARG C CA    1 
ATOM   9131  C  C     . ARG C  1 260 ? 42.456  36.467   42.481  1.00 74.06  ? 260 ARG C C     1 
ATOM   9132  O  O     . ARG C  1 260 ? 41.977  37.593   42.710  1.00 74.70  ? 260 ARG C O     1 
ATOM   9133  C  CB    . ARG C  1 260 ? 40.934  34.490   41.990  1.00 72.19  ? 260 ARG C CB    1 
ATOM   9134  C  CG    . ARG C  1 260 ? 39.761  35.014   42.817  1.00 72.45  ? 260 ARG C CG    1 
ATOM   9135  C  CD    . ARG C  1 260 ? 39.219  33.945   43.789  1.00 71.93  ? 260 ARG C CD    1 
ATOM   9136  N  NE    . ARG C  1 260 ? 40.196  33.517   44.804  1.00 71.84  ? 260 ARG C NE    1 
ATOM   9137  C  CZ    . ARG C  1 260 ? 39.945  32.662   45.799  1.00 70.99  ? 260 ARG C CZ    1 
ATOM   9138  N  NH1   . ARG C  1 260 ? 38.745  32.125   45.952  1.00 70.96  ? 260 ARG C NH1   1 
ATOM   9139  N  NH2   . ARG C  1 260 ? 40.898  32.339   46.655  1.00 70.46  ? 260 ARG C NH2   1 
ATOM   9140  N  N     . ASP C  1 261 ? 43.525  35.985   43.115  1.00 73.73  ? 261 ASP C N     1 
ATOM   9141  C  CA    . ASP C  1 261 ? 44.135  36.664   44.254  1.00 74.27  ? 261 ASP C CA    1 
ATOM   9142  C  C     . ASP C  1 261 ? 45.000  37.852   43.871  1.00 75.63  ? 261 ASP C C     1 
ATOM   9143  O  O     . ASP C  1 261 ? 45.495  38.552   44.757  1.00 76.73  ? 261 ASP C O     1 
ATOM   9144  C  CB    . ASP C  1 261 ? 44.969  35.680   45.083  1.00 73.94  ? 261 ASP C CB    1 
ATOM   9145  C  CG    . ASP C  1 261 ? 44.119  34.661   45.843  1.00 73.22  ? 261 ASP C CG    1 
ATOM   9146  O  OD1   . ASP C  1 261 ? 42.886  34.582   45.619  1.00 72.78  ? 261 ASP C OD