data_3ONW
# 
_entry.id   3ONW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ONW         
RCSB  RCSB061352   
WWPDB D_1000061352 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2om2 'Structure of G-alpha-i1 and the RGS14 GoLoco motif' unspecified 
PDB 1kjy 'Structure of G-alpha-i1 and the RGS14 GoLoco motif' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ONW 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bosch, D.'        1 
'Kimple, A.J.'     2 
'Sammond, D.W.'    3 
'Miley, M.J.'      4 
'Machius, M.'      5 
'Kuhlman, B.'      6 
'Willard, F.S.'    7 
'Siderovski, D.P.' 8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Determinants of Affinity Enhancement between GoLoco Motifs and G-Protein {alpha} Subunit Mutants.' 
J.Biol.Chem. 286 3351 3358 2011 JBCHA3 US 0021-9258 0071 ? 21115486 10.1074/jbc.M110.190496 
1       'Structure-based protocol for identifying mutations that enhance protein-protein binding affinities'           J.Mol.Biol. 
371 1392 1404 2007 JMOBAK UK 0022-2836 0070 ? ?        ?                       
2       'Structural determinants for GoLoco-induced inhibition of nucleotide release by Galpha subunits'               Nature 416 
878  881  2002 NATUAS UK 0028-0836 0006 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bosch, D.E.'      1  
primary 'Kimple, A.J.'     2  
primary 'Sammond, D.W.'    3  
primary 'Muller, R.E.'     4  
primary 'Miley, M.J.'      5  
primary 'Machius, M.'      6  
primary 'Kuhlman, B.'      7  
primary 'Willard, F.S.'    8  
primary 'Siderovski, D.P.' 9  
1       'Sammond, D.W.'    10 
1       'Eletr, Z.M.'      11 
1       'Purbeck, C.'      12 
1       'Kimple, R.J.'     13 
1       'Siderovski, D.P.' 14 
1       'Kuhlman, B.'      15 
2       'Kimple, R.J.'     16 
2       'Kimple, M.E.'     17 
2       'Betts, L.'        18 
2       'Sondek, J.'       19 
2       'Siderovski, D.P.' 20 
# 
_cell.entry_id           3ONW 
_cell.length_a           70.392 
_cell.length_b           83.679 
_cell.length_c           190.148 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ONW 
_symmetry.space_group_name_H-M             'P 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                17 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(i) subunit alpha-1' 37416.637 2  3.6.5.1 Q147L ? ? 
2 polymer     syn 'Regulator of G-protein signaling 14'                     4093.621  2  ?       ?     ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                                443.201   2  ?       ?     ? ? 
4 non-polymer syn 'SULFATE ION'                                             96.063    3  ?       ?     ? ? 
5 water       nat water                                                     18.015    97 ?       ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Adenylate cyclase-inhibiting G alpha protein' 
2 RGS14                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNAGAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQ
LFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYLLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVE
THFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL
FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKN
NLKDCGLF
;
;SNAGAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQ
LFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYLLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVE
THFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL
FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKN
NLKDCGLF
;
A,B ? 
2 'polypeptide(L)' no no DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  LEU n 
1 12  LEU n 
1 13  LEU n 
1 14  GLY n 
1 15  ALA n 
1 16  GLY n 
1 17  GLU n 
1 18  SER n 
1 19  GLY n 
1 20  LYS n 
1 21  SER n 
1 22  THR n 
1 23  ILE n 
1 24  VAL n 
1 25  LYS n 
1 26  GLN n 
1 27  MET n 
1 28  LYS n 
1 29  ILE n 
1 30  ILE n 
1 31  HIS n 
1 32  GLU n 
1 33  ALA n 
1 34  GLY n 
1 35  TYR n 
1 36  SER n 
1 37  GLU n 
1 38  GLU n 
1 39  GLU n 
1 40  CYS n 
1 41  LYS n 
1 42  GLN n 
1 43  TYR n 
1 44  LYS n 
1 45  ALA n 
1 46  VAL n 
1 47  VAL n 
1 48  TYR n 
1 49  SER n 
1 50  ASN n 
1 51  THR n 
1 52  ILE n 
1 53  GLN n 
1 54  SER n 
1 55  ILE n 
1 56  ILE n 
1 57  ALA n 
1 58  ILE n 
1 59  ILE n 
1 60  ARG n 
1 61  ALA n 
1 62  MET n 
1 63  GLY n 
1 64  ARG n 
1 65  LEU n 
1 66  LYS n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  GLY n 
1 71  ASP n 
1 72  SER n 
1 73  ALA n 
1 74  ARG n 
1 75  ALA n 
1 76  ASP n 
1 77  ASP n 
1 78  ALA n 
1 79  ARG n 
1 80  GLN n 
1 81  LEU n 
1 82  PHE n 
1 83  VAL n 
1 84  LEU n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  ALA n 
1 89  GLU n 
1 90  GLU n 
1 91  GLY n 
1 92  PHE n 
1 93  MET n 
1 94  THR n 
1 95  ALA n 
1 96  GLU n 
1 97  LEU n 
1 98  ALA n 
1 99  GLY n 
1 100 VAL n 
1 101 ILE n 
1 102 LYS n 
1 103 ARG n 
1 104 LEU n 
1 105 TRP n 
1 106 LYS n 
1 107 ASP n 
1 108 SER n 
1 109 GLY n 
1 110 VAL n 
1 111 GLN n 
1 112 ALA n 
1 113 CYS n 
1 114 PHE n 
1 115 ASN n 
1 116 ARG n 
1 117 SER n 
1 118 ARG n 
1 119 GLU n 
1 120 TYR n 
1 121 LEU n 
1 122 LEU n 
1 123 ASN n 
1 124 ASP n 
1 125 SER n 
1 126 ALA n 
1 127 ALA n 
1 128 TYR n 
1 129 TYR n 
1 130 LEU n 
1 131 ASN n 
1 132 ASP n 
1 133 LEU n 
1 134 ASP n 
1 135 ARG n 
1 136 ILE n 
1 137 ALA n 
1 138 GLN n 
1 139 PRO n 
1 140 ASN n 
1 141 TYR n 
1 142 ILE n 
1 143 PRO n 
1 144 THR n 
1 145 GLN n 
1 146 GLN n 
1 147 ASP n 
1 148 VAL n 
1 149 LEU n 
1 150 ARG n 
1 151 THR n 
1 152 ARG n 
1 153 VAL n 
1 154 LYS n 
1 155 THR n 
1 156 THR n 
1 157 GLY n 
1 158 ILE n 
1 159 VAL n 
1 160 GLU n 
1 161 THR n 
1 162 HIS n 
1 163 PHE n 
1 164 THR n 
1 165 PHE n 
1 166 LYS n 
1 167 ASP n 
1 168 LEU n 
1 169 HIS n 
1 170 PHE n 
1 171 LYS n 
1 172 MET n 
1 173 PHE n 
1 174 ASP n 
1 175 VAL n 
1 176 GLY n 
1 177 GLY n 
1 178 GLN n 
1 179 ARG n 
1 180 SER n 
1 181 GLU n 
1 182 ARG n 
1 183 LYS n 
1 184 LYS n 
1 185 TRP n 
1 186 ILE n 
1 187 HIS n 
1 188 CYS n 
1 189 PHE n 
1 190 GLU n 
1 191 GLY n 
1 192 VAL n 
1 193 THR n 
1 194 ALA n 
1 195 ILE n 
1 196 ILE n 
1 197 PHE n 
1 198 CYS n 
1 199 VAL n 
1 200 ALA n 
1 201 LEU n 
1 202 SER n 
1 203 ASP n 
1 204 TYR n 
1 205 ASP n 
1 206 LEU n 
1 207 VAL n 
1 208 LEU n 
1 209 ALA n 
1 210 GLU n 
1 211 ASP n 
1 212 GLU n 
1 213 GLU n 
1 214 MET n 
1 215 ASN n 
1 216 ARG n 
1 217 MET n 
1 218 HIS n 
1 219 GLU n 
1 220 SER n 
1 221 MET n 
1 222 LYS n 
1 223 LEU n 
1 224 PHE n 
1 225 ASP n 
1 226 SER n 
1 227 ILE n 
1 228 CYS n 
1 229 ASN n 
1 230 ASN n 
1 231 LYS n 
1 232 TRP n 
1 233 PHE n 
1 234 THR n 
1 235 ASP n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 ILE n 
1 240 LEU n 
1 241 PHE n 
1 242 LEU n 
1 243 ASN n 
1 244 LYS n 
1 245 LYS n 
1 246 ASP n 
1 247 LEU n 
1 248 PHE n 
1 249 GLU n 
1 250 GLU n 
1 251 LYS n 
1 252 ILE n 
1 253 LYS n 
1 254 LYS n 
1 255 SER n 
1 256 PRO n 
1 257 LEU n 
1 258 THR n 
1 259 ILE n 
1 260 CYS n 
1 261 TYR n 
1 262 PRO n 
1 263 GLU n 
1 264 TYR n 
1 265 ALA n 
1 266 GLY n 
1 267 SER n 
1 268 ASN n 
1 269 THR n 
1 270 TYR n 
1 271 GLU n 
1 272 GLU n 
1 273 ALA n 
1 274 ALA n 
1 275 ALA n 
1 276 TYR n 
1 277 ILE n 
1 278 GLN n 
1 279 CYS n 
1 280 GLN n 
1 281 PHE n 
1 282 GLU n 
1 283 ASP n 
1 284 LEU n 
1 285 ASN n 
1 286 LYS n 
1 287 ARG n 
1 288 LYS n 
1 289 ASP n 
1 290 THR n 
1 291 LYS n 
1 292 GLU n 
1 293 ILE n 
1 294 TYR n 
1 295 THR n 
1 296 HIS n 
1 297 PHE n 
1 298 THR n 
1 299 CYS n 
1 300 ALA n 
1 301 THR n 
1 302 ASP n 
1 303 THR n 
1 304 LYS n 
1 305 ASN n 
1 306 VAL n 
1 307 GLN n 
1 308 PHE n 
1 309 VAL n 
1 310 PHE n 
1 311 ASP n 
1 312 ALA n 
1 313 VAL n 
1 314 THR n 
1 315 ASP n 
1 316 VAL n 
1 317 ILE n 
1 318 ILE n 
1 319 LYS n 
1 320 ASN n 
1 321 ASN n 
1 322 LEU n 
1 323 LYS n 
1 324 ASP n 
1 325 CYS n 
1 326 GLY n 
1 327 LEU n 
1 328 PHE n 
2 1   ASP n 
2 2   ILE n 
2 3   GLU n 
2 4   GLY n 
2 5   LEU n 
2 6   VAL n 
2 7   GLU n 
2 8   LEU n 
2 9   LEU n 
2 10  ASN n 
2 11  ARG n 
2 12  VAL n 
2 13  GLN n 
2 14  SER n 
2 15  SER n 
2 16  GLY n 
2 17  ALA n 
2 18  HIS n 
2 19  ASP n 
2 20  GLN n 
2 21  ARG n 
2 22  GLY n 
2 23  LEU n 
2 24  LEU n 
2 25  ARG n 
2 26  LYS n 
2 27  GLU n 
2 28  ASP n 
2 29  LEU n 
2 30  VAL n 
2 31  LEU n 
2 32  PRO n 
2 33  GLU n 
2 34  PHE n 
2 35  LEU n 
2 36  GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GNAI1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLICHis 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;The RGS14 GoLoco motif peptide was synthesized according to the human RGS14 sequence, identical to that used in PDB entries 1KJY and 2OM2.
;
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI1_HUMAN P63096 1 
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
31  ? 
2 UNP RGS14_HUMAN O43566 2 DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ 497 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ONW A 5 ? 328 ? P63096 31  ? 354 ? 31  354 
2 1 3ONW B 5 ? 328 ? P63096 31  ? 354 ? 31  354 
3 2 3ONW C 1 ? 36  ? O43566 497 ? 532 ? 496 531 
4 2 3ONW D 1 ? 36  ? O43566 497 ? 532 ? 496 531 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ONW SER A 1   ? UNP P63096 ?   ?   'EXPRESSION TAG'      27  1  
1 3ONW ASN A 2   ? UNP P63096 ?   ?   'EXPRESSION TAG'      28  2  
1 3ONW ALA A 3   ? UNP P63096 ?   ?   'EXPRESSION TAG'      29  3  
1 3ONW GLY A 4   ? UNP P63096 ?   ?   'EXPRESSION TAG'      30  4  
1 3ONW LEU A 121 ? UNP P63096 GLN 147 'ENGINEERED MUTATION' 147 5  
2 3ONW SER B 1   ? UNP P63096 ?   ?   'EXPRESSION TAG'      27  6  
2 3ONW ASN B 2   ? UNP P63096 ?   ?   'EXPRESSION TAG'      28  7  
2 3ONW ALA B 3   ? UNP P63096 ?   ?   'EXPRESSION TAG'      29  8  
2 3ONW GLY B 4   ? UNP P63096 ?   ?   'EXPRESSION TAG'      30  9  
2 3ONW LEU B 121 ? UNP P63096 GLN 147 'ENGINEERED MUTATION' 147 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'              ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3ONW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.37 
_exptl_crystal.density_percent_sol   63.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;Hanging drops were a 1:1 mixture of protein-peptide complex in buffer (10 mM Tris pH 7.5, 1 mM magnesium chloride, 5% (w/v) glycerol, 5 mM DTT) and well solution (1.9 M ammonium sulfate, 100 mM sodium acetate pH 5.0, 200 mM magnesium chloride, 10% (w/v) glycerol), VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2009-11-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3ONW 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             28.88 
_reflns.d_resolution_high            2.380 
_reflns.number_obs                   45328 
_reflns.number_all                   45328 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.3 
_reflns.B_iso_Wilson_estimate        59.4 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.38 
_reflns_shell.d_res_low              2.40 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.761 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        6.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ONW 
_refine.ls_number_reflns_obs                     43755 
_refine.ls_number_reflns_all                     43755 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             95.07 
_refine.ls_d_res_high                            2.38 
_refine.ls_percent_reflns_obs                    98.55 
_refine.ls_R_factor_obs                          0.22953 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22825 
_refine.ls_R_factor_R_free                       0.26539 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.4 
_refine.ls_number_reflns_R_free                  1528 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               62.254 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            -0.33 
_refine.aniso_B[3][3]                            0.35 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      '2OM2 chain A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.294 
_refine.pdbx_overall_ESU_R_Free                  0.234 
_refine.overall_SU_ML                            0.166 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             15.463 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3ONW 
_refine_analyze.Luzzati_coordinate_error_obs    0.290 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.231 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5643 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         71 
_refine_hist.number_atoms_solvent             97 
_refine_hist.number_atoms_total               5811 
_refine_hist.d_res_high                       2.38 
_refine_hist.d_res_low                        95.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 5811 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.086  1.968  ? 7841 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.150  5.000  ? 698  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.925 24.507 ? 284  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.856 15.000 ? 1065 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.807 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.074  0.200  ? 872  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4310 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.463  1.500  ? 3480 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.897  2.000  ? 5606 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.303  3.000  ? 2331 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.086  4.500  ? 2235 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.380 
_refine_ls_shell.d_res_low                        2.442 
_refine_ls_shell.number_reflns_R_work             3186 
_refine_ls_shell.R_factor_R_work                  0.300 
_refine_ls_shell.percent_reflns_obs               97.77 
_refine_ls_shell.R_factor_R_free                  0.280 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3ONW 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3ONW 
_struct.title                     'Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.' 
_struct.pdbx_descriptor           
'Guanine nucleotide-binding protein G(i) subunit alpha-1 (E.C.3.6.5.1), Regulator of G-protein signaling 14' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ONW 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;RGS14 GoLoco, Rosetta, protein design, affinity enhancement, Ras-like domain, all-helical domain, GoLoco motif, arginine finger, signaling protein, lipoprotein, transducer, guanine nucleotide dissociation inhibitor, GTP binding, nucleotide binding, ADP-ribosylation
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 19  ? GLU A 32  ? GLY A 45  GLU A 58  1 ? 14 
HELX_P HELX_P2  2  SER A 36  ? GLN A 42  ? SER A 62  GLN A 68  1 ? 7  
HELX_P HELX_P3  3  TYR A 43  ? LYS A 66  ? TYR A 69  LYS A 92  1 ? 24 
HELX_P HELX_P4  4  ALA A 73  ? ALA A 87  ? ALA A 99  ALA A 113 1 ? 15 
HELX_P HELX_P5  5  THR A 94  ? ASP A 107 ? THR A 120 ASP A 133 1 ? 14 
HELX_P HELX_P6  6  ASP A 107 ? ASN A 115 ? ASP A 133 ASN A 141 1 ? 9  
HELX_P HELX_P7  7  ARG A 116 ? TYR A 120 ? ARG A 142 TYR A 146 5 ? 5  
HELX_P HELX_P8  8  SER A 125 ? ASN A 131 ? SER A 151 ASN A 157 1 ? 7  
HELX_P HELX_P9  9  ASP A 132 ? GLN A 138 ? ASP A 158 GLN A 164 1 ? 7  
HELX_P HELX_P10 10 THR A 144 ? THR A 151 ? THR A 170 THR A 177 1 ? 8  
HELX_P HELX_P11 11 GLU A 181 ? GLU A 190 ? GLU A 207 GLU A 216 1 ? 10 
HELX_P HELX_P12 12 SER A 202 ? LEU A 206 ? SER A 228 LEU A 232 5 ? 5  
HELX_P HELX_P13 13 ASN A 215 ? ASN A 230 ? ASN A 241 ASN A 256 1 ? 16 
HELX_P HELX_P14 14 LYS A 231 ? THR A 234 ? LYS A 257 THR A 260 5 ? 4  
HELX_P HELX_P15 15 LYS A 244 ? LYS A 253 ? LYS A 270 LYS A 279 1 ? 10 
HELX_P HELX_P16 16 PRO A 256 ? CYS A 260 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P17 17 THR A 269 ? ASP A 283 ? THR A 295 ASP A 309 1 ? 15 
HELX_P HELX_P18 18 ASP A 302 ? ASN A 320 ? ASP A 328 ASN A 346 1 ? 19 
HELX_P HELX_P19 19 GLY B 19  ? GLU B 32  ? GLY B 45  GLU B 58  1 ? 14 
HELX_P HELX_P20 20 SER B 36  ? LEU B 65  ? SER B 62  LEU B 91  1 ? 30 
HELX_P HELX_P21 21 ALA B 73  ? ALA B 88  ? ALA B 99  ALA B 114 1 ? 16 
HELX_P HELX_P22 22 THR B 94  ? ASP B 107 ? THR B 120 ASP B 133 1 ? 14 
HELX_P HELX_P23 23 ASP B 107 ? ASN B 115 ? ASP B 133 ASN B 141 1 ? 9  
HELX_P HELX_P24 24 ARG B 116 ? TYR B 120 ? ARG B 142 TYR B 146 5 ? 5  
HELX_P HELX_P25 25 SER B 125 ? ASN B 131 ? SER B 151 ASN B 157 1 ? 7  
HELX_P HELX_P26 26 ASP B 132 ? ALA B 137 ? ASP B 158 ALA B 163 1 ? 6  
HELX_P HELX_P27 27 THR B 144 ? THR B 151 ? THR B 170 THR B 177 1 ? 8  
HELX_P HELX_P28 28 GLU B 181 ? GLY B 191 ? GLU B 207 GLY B 217 1 ? 11 
HELX_P HELX_P29 29 SER B 202 ? LEU B 206 ? SER B 228 LEU B 232 5 ? 5  
HELX_P HELX_P30 30 ASN B 215 ? ASN B 230 ? ASN B 241 ASN B 256 1 ? 16 
HELX_P HELX_P31 31 LYS B 231 ? THR B 234 ? LYS B 257 THR B 260 5 ? 4  
HELX_P HELX_P32 32 LYS B 244 ? ILE B 252 ? LYS B 270 ILE B 278 1 ? 9  
HELX_P HELX_P33 33 PRO B 256 ? CYS B 260 ? PRO B 282 CYS B 286 5 ? 5  
HELX_P HELX_P34 34 THR B 269 ? ASP B 283 ? THR B 295 ASP B 309 1 ? 15 
HELX_P HELX_P35 35 ASP B 302 ? LYS B 319 ? ASP B 328 LYS B 345 1 ? 18 
HELX_P HELX_P36 36 ILE C 2   ? SER C 15  ? ILE C 497 SER C 510 1 ? 14 
HELX_P HELX_P37 37 ARG C 25  ? VAL C 30  ? ARG C 520 VAL C 525 5 ? 6  
HELX_P HELX_P38 38 PRO C 32  ? GLN C 36  ? PRO C 527 GLN C 531 5 ? 5  
HELX_P HELX_P39 39 ASP D 1   ? SER D 15  ? ASP D 496 SER D 510 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 159 ? PHE A 165 ? VAL A 185 PHE A 191 
A 2 LEU A 168 ? ASP A 174 ? LEU A 194 ASP A 200 
A 3 GLU A 7   ? GLY A 14  ? GLU A 33  GLY A 40  
A 4 ALA A 194 ? ALA A 200 ? ALA A 220 ALA A 226 
A 5 SER A 237 ? ASN A 243 ? SER A 263 ASN A 269 
A 6 TYR A 294 ? PHE A 297 ? TYR A 320 PHE A 323 
B 1 VAL B 159 ? PHE B 165 ? VAL B 185 PHE B 191 
B 2 LEU B 168 ? ASP B 174 ? LEU B 194 ASP B 200 
B 3 GLU B 7   ? GLY B 14  ? GLU B 33  GLY B 40  
B 4 ALA B 194 ? ALA B 200 ? ALA B 220 ALA B 226 
B 5 SER B 237 ? ASN B 243 ? SER B 263 ASN B 269 
B 6 ILE B 293 ? PHE B 297 ? ILE B 319 PHE B 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 163 ? N PHE A 189 O PHE A 170 ? O PHE A 196 
A 2 3 O PHE A 173 ? O PHE A 199 N LEU A 10  ? N LEU A 36  
A 3 4 N LEU A 13  ? N LEU A 39  O ILE A 196 ? O ILE A 222 
A 4 5 N ILE A 195 ? N ILE A 221 O ILE A 239 ? O ILE A 265 
A 5 6 N LEU A 242 ? N LEU A 268 O HIS A 296 ? O HIS A 322 
B 1 2 N PHE B 163 ? N PHE B 189 O PHE B 170 ? O PHE B 196 
B 2 3 O PHE B 173 ? O PHE B 199 N LEU B 10  ? N LEU B 36  
B 3 4 N LEU B 13  ? N LEU B 39  O CYS B 198 ? O CYS B 224 
B 4 5 N ILE B 195 ? N ILE B 221 O ILE B 239 ? O ILE B 265 
B 5 6 N LEU B 242 ? N LEU B 268 O HIS B 296 ? O HIS B 322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE GDP A 401' 
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GDP B 401' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1'   
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 2'   
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 3'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 ALA A 15  ? ALA A 41  . ? 1_555 ? 
2  AC1 19 GLU A 17  ? GLU A 43  . ? 1_555 ? 
3  AC1 19 SER A 18  ? SER A 44  . ? 1_555 ? 
4  AC1 19 GLY A 19  ? GLY A 45  . ? 1_555 ? 
5  AC1 19 LYS A 20  ? LYS A 46  . ? 1_555 ? 
6  AC1 19 SER A 21  ? SER A 47  . ? 1_555 ? 
7  AC1 19 THR A 22  ? THR A 48  . ? 1_555 ? 
8  AC1 19 ASP A 124 ? ASP A 150 . ? 1_555 ? 
9  AC1 19 SER A 125 ? SER A 151 . ? 1_555 ? 
10 AC1 19 ARG A 150 ? ARG A 176 . ? 1_555 ? 
11 AC1 19 ARG A 152 ? ARG A 178 . ? 1_555 ? 
12 AC1 19 ASN A 243 ? ASN A 269 . ? 1_555 ? 
13 AC1 19 LYS A 244 ? LYS A 270 . ? 1_555 ? 
14 AC1 19 ASP A 246 ? ASP A 272 . ? 1_555 ? 
15 AC1 19 LEU A 247 ? LEU A 273 . ? 1_555 ? 
16 AC1 19 CYS A 299 ? CYS A 325 . ? 1_555 ? 
17 AC1 19 ALA A 300 ? ALA A 326 . ? 1_555 ? 
18 AC1 19 THR A 301 ? THR A 327 . ? 1_555 ? 
19 AC1 19 ARG C 21  ? ARG C 516 . ? 1_555 ? 
20 AC2 21 HOH K .   ? HOH B 23  . ? 1_555 ? 
21 AC2 21 ALA B 15  ? ALA B 41  . ? 1_555 ? 
22 AC2 21 GLU B 17  ? GLU B 43  . ? 1_555 ? 
23 AC2 21 SER B 18  ? SER B 44  . ? 1_555 ? 
24 AC2 21 GLY B 19  ? GLY B 45  . ? 1_555 ? 
25 AC2 21 LYS B 20  ? LYS B 46  . ? 1_555 ? 
26 AC2 21 SER B 21  ? SER B 47  . ? 1_555 ? 
27 AC2 21 THR B 22  ? THR B 48  . ? 1_555 ? 
28 AC2 21 ASP B 124 ? ASP B 150 . ? 1_555 ? 
29 AC2 21 SER B 125 ? SER B 151 . ? 1_555 ? 
30 AC2 21 ARG B 150 ? ARG B 176 . ? 1_555 ? 
31 AC2 21 ARG B 152 ? ARG B 178 . ? 1_555 ? 
32 AC2 21 ASN B 243 ? ASN B 269 . ? 1_555 ? 
33 AC2 21 LYS B 244 ? LYS B 270 . ? 1_555 ? 
34 AC2 21 ASP B 246 ? ASP B 272 . ? 1_555 ? 
35 AC2 21 LEU B 247 ? LEU B 273 . ? 1_555 ? 
36 AC2 21 CYS B 299 ? CYS B 325 . ? 1_555 ? 
37 AC2 21 ALA B 300 ? ALA B 326 . ? 1_555 ? 
38 AC2 21 THR B 301 ? THR B 327 . ? 1_555 ? 
39 AC2 21 HOH K .   ? HOH B 357 . ? 1_555 ? 
40 AC2 21 ARG D 21  ? ARG D 516 . ? 1_555 ? 
41 AC3 4  TYR B 128 ? TYR B 154 . ? 1_555 ? 
42 AC3 4  GLN B 146 ? GLN B 172 . ? 1_555 ? 
43 AC3 4  ARG B 150 ? ARG B 176 . ? 1_555 ? 
44 AC3 4  HOH K .   ? HOH B 365 . ? 1_555 ? 
45 AC4 3  ARG B 216 ? ARG B 242 . ? 1_555 ? 
46 AC4 3  SER D 15  ? SER D 510 . ? 1_555 ? 
47 AC4 3  GLY D 16  ? GLY D 511 . ? 1_555 ? 
48 AC5 2  SER A 267 ? SER A 293 . ? 1_555 ? 
49 AC5 2  ASN A 268 ? ASN A 294 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ONW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ONW 
_atom_sites.fract_transf_matrix[1][1]   0.014206 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011950 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005259 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 6   ? 18.001  8.044   7.526  1.00 84.97  ? 32  ARG A N     1 
ATOM   2    C CA    . ARG A 1 6   ? 16.574  8.457   7.696  1.00 85.19  ? 32  ARG A CA    1 
ATOM   3    C C     . ARG A 1 6   ? 16.337  9.233   8.998  1.00 83.80  ? 32  ARG A C     1 
ATOM   4    O O     . ARG A 1 6   ? 15.504  10.144  9.040  1.00 83.51  ? 32  ARG A O     1 
ATOM   5    C CB    . ARG A 1 6   ? 15.658  7.234   7.629  1.00 87.48  ? 32  ARG A CB    1 
ATOM   6    C CG    . ARG A 1 6   ? 14.165  7.546   7.596  1.00 88.88  ? 32  ARG A CG    1 
ATOM   7    C CD    . ARG A 1 6   ? 13.365  6.373   8.141  1.00 92.05  ? 32  ARG A CD    1 
ATOM   8    N NE    . ARG A 1 6   ? 13.852  5.973   9.465  1.00 92.53  ? 32  ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 6   ? 13.485  4.869   10.111 1.00 94.68  ? 32  ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 6   ? 12.610  4.023   9.570  1.00 97.18  ? 32  ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 6   ? 13.997  4.609   11.305 1.00 94.40  ? 32  ARG A NH2   1 
ATOM   12   N N     . GLU A 1 7   ? 17.058  8.868   10.057 1.00 82.97  ? 33  GLU A N     1 
ATOM   13   C CA    . GLU A 1 7   ? 16.962  9.588   11.330 1.00 81.27  ? 33  GLU A CA    1 
ATOM   14   C C     . GLU A 1 7   ? 17.988  10.711  11.381 1.00 78.50  ? 33  GLU A C     1 
ATOM   15   O O     . GLU A 1 7   ? 19.188  10.468  11.220 1.00 78.31  ? 33  GLU A O     1 
ATOM   16   C CB    . GLU A 1 7   ? 17.124  8.634   12.516 1.00 82.35  ? 33  GLU A CB    1 
ATOM   17   C CG    . GLU A 1 7   ? 15.878  7.779   12.806 1.00 85.18  ? 33  GLU A CG    1 
ATOM   18   C CD    . GLU A 1 7   ? 14.795  8.532   13.586 1.00 85.46  ? 33  GLU A CD    1 
ATOM   19   O OE1   . GLU A 1 7   ? 15.048  9.680   14.012 1.00 83.68  ? 33  GLU A OE1   1 
ATOM   20   O OE2   . GLU A 1 7   ? 13.691  7.970   13.775 1.00 86.84  ? 33  GLU A OE2   1 
ATOM   21   N N     . VAL A 1 8   ? 17.502  11.936  11.599 1.00 76.17  ? 34  VAL A N     1 
ATOM   22   C CA    . VAL A 1 8   ? 18.327  13.149  11.516 1.00 73.27  ? 34  VAL A CA    1 
ATOM   23   C C     . VAL A 1 8   ? 18.238  13.992  12.792 1.00 71.45  ? 34  VAL A C     1 
ATOM   24   O O     . VAL A 1 8   ? 17.172  14.526  13.127 1.00 71.58  ? 34  VAL A O     1 
ATOM   25   C CB    . VAL A 1 8   ? 17.934  14.023  10.291 1.00 72.81  ? 34  VAL A CB    1 
ATOM   26   C CG1   . VAL A 1 8   ? 18.736  15.321  10.272 1.00 71.36  ? 34  VAL A CG1   1 
ATOM   27   C CG2   . VAL A 1 8   ? 18.125  13.254  8.979  1.00 73.18  ? 34  VAL A CG2   1 
ATOM   28   N N     . LYS A 1 9   ? 19.365  14.110  13.491 1.00 69.34  ? 35  LYS A N     1 
ATOM   29   C CA    . LYS A 1 9   ? 19.434  14.861  14.739 1.00 67.40  ? 35  LYS A CA    1 
ATOM   30   C C     . LYS A 1 9   ? 19.968  16.256  14.440 1.00 65.14  ? 35  LYS A C     1 
ATOM   31   O O     . LYS A 1 9   ? 21.056  16.401  13.878 1.00 64.47  ? 35  LYS A O     1 
ATOM   32   C CB    . LYS A 1 9   ? 20.320  14.142  15.766 1.00 67.43  ? 35  LYS A CB    1 
ATOM   33   C CG    . LYS A 1 9   ? 20.176  14.648  17.199 1.00 66.89  ? 35  LYS A CG    1 
ATOM   34   C CD    . LYS A 1 9   ? 21.155  13.971  18.161 1.00 66.16  ? 35  LYS A CD    1 
ATOM   35   C CE    . LYS A 1 9   ? 20.960  14.476  19.585 1.00 65.85  ? 35  LYS A CE    1 
ATOM   36   N NZ    . LYS A 1 9   ? 21.754  13.720  20.602 1.00 66.41  ? 35  LYS A NZ    1 
ATOM   37   N N     . LEU A 1 10  ? 19.187  17.268  14.812 1.00 63.82  ? 36  LEU A N     1 
ATOM   38   C CA    . LEU A 1 10  ? 19.511  18.669  14.519 1.00 61.94  ? 36  LEU A CA    1 
ATOM   39   C C     . LEU A 1 10  ? 19.654  19.520  15.768 1.00 60.50  ? 36  LEU A C     1 
ATOM   40   O O     . LEU A 1 10  ? 18.740  19.609  16.584 1.00 61.02  ? 36  LEU A O     1 
ATOM   41   C CB    . LEU A 1 10  ? 18.441  19.298  13.619 1.00 62.14  ? 36  LEU A CB    1 
ATOM   42   C CG    . LEU A 1 10  ? 18.720  19.344  12.120 1.00 62.55  ? 36  LEU A CG    1 
ATOM   43   C CD1   . LEU A 1 10  ? 17.551  19.986  11.385 1.00 62.08  ? 36  LEU A CD1   1 
ATOM   44   C CD2   . LEU A 1 10  ? 19.987  20.126  11.870 1.00 62.03  ? 36  LEU A CD2   1 
ATOM   45   N N     . LEU A 1 11  ? 20.797  20.175  15.885 1.00 58.67  ? 37  LEU A N     1 
ATOM   46   C CA    . LEU A 1 11  ? 21.082  21.020  17.024 1.00 57.43  ? 37  LEU A CA    1 
ATOM   47   C C     . LEU A 1 11  ? 21.097  22.505  16.634 1.00 55.68  ? 37  LEU A C     1 
ATOM   48   O O     . LEU A 1 11  ? 21.934  22.937  15.844 1.00 54.96  ? 37  LEU A O     1 
ATOM   49   C CB    . LEU A 1 11  ? 22.421  20.585  17.625 1.00 57.56  ? 37  LEU A CB    1 
ATOM   50   C CG    . LEU A 1 11  ? 22.960  21.129  18.949 1.00 58.17  ? 37  LEU A CG    1 
ATOM   51   C CD1   . LEU A 1 11  ? 21.875  21.338  20.012 1.00 58.96  ? 37  LEU A CD1   1 
ATOM   52   C CD2   . LEU A 1 11  ? 24.057  20.186  19.449 1.00 60.30  ? 37  LEU A CD2   1 
ATOM   53   N N     . LEU A 1 12  ? 20.153  23.273  17.175 1.00 54.87  ? 38  LEU A N     1 
ATOM   54   C CA    . LEU A 1 12  ? 20.172  24.733  17.058 1.00 53.26  ? 38  LEU A CA    1 
ATOM   55   C C     . LEU A 1 12  ? 21.064  25.344  18.129 1.00 52.11  ? 38  LEU A C     1 
ATOM   56   O O     . LEU A 1 12  ? 20.796  25.178  19.318 1.00 53.11  ? 38  LEU A O     1 
ATOM   57   C CB    . LEU A 1 12  ? 18.763  25.303  17.217 1.00 53.64  ? 38  LEU A CB    1 
ATOM   58   C CG    . LEU A 1 12  ? 17.810  25.315  16.022 1.00 54.08  ? 38  LEU A CG    1 
ATOM   59   C CD1   . LEU A 1 12  ? 16.377  25.514  16.495 1.00 54.06  ? 38  LEU A CD1   1 
ATOM   60   C CD2   . LEU A 1 12  ? 18.199  26.419  15.045 1.00 54.20  ? 38  LEU A CD2   1 
ATOM   61   N N     . LEU A 1 13  ? 22.123  26.037  17.717 1.00 50.21  ? 39  LEU A N     1 
ATOM   62   C CA    . LEU A 1 13  ? 22.978  26.783  18.649 1.00 48.58  ? 39  LEU A CA    1 
ATOM   63   C C     . LEU A 1 13  ? 23.039  28.259  18.268 1.00 47.38  ? 39  LEU A C     1 
ATOM   64   O O     . LEU A 1 13  ? 22.704  28.626  17.142 1.00 47.21  ? 39  LEU A O     1 
ATOM   65   C CB    . LEU A 1 13  ? 24.393  26.192  18.702 1.00 48.50  ? 39  LEU A CB    1 
ATOM   66   C CG    . LEU A 1 13  ? 24.567  24.726  19.131 1.00 48.80  ? 39  LEU A CG    1 
ATOM   67   C CD1   . LEU A 1 13  ? 25.995  24.257  18.858 1.00 47.65  ? 39  LEU A CD1   1 
ATOM   68   C CD2   . LEU A 1 13  ? 24.195  24.503  20.595 1.00 46.83  ? 39  LEU A CD2   1 
ATOM   69   N N     . GLY A 1 14  ? 23.466  29.097  19.212 1.00 46.37  ? 40  GLY A N     1 
ATOM   70   C CA    . GLY A 1 14  ? 23.643  30.527  18.985 1.00 44.54  ? 40  GLY A CA    1 
ATOM   71   C C     . GLY A 1 14  ? 23.253  31.351  20.199 1.00 44.30  ? 40  GLY A C     1 
ATOM   72   O O     . GLY A 1 14  ? 22.553  30.856  21.086 1.00 44.77  ? 40  GLY A O     1 
ATOM   73   N N     . ALA A 1 15  ? 23.669  32.617  20.218 1.00 42.60  ? 41  ALA A N     1 
ATOM   74   C CA    . ALA A 1 15  ? 23.444  33.495  21.359 1.00 42.14  ? 41  ALA A CA    1 
ATOM   75   C C     . ALA A 1 15  ? 21.961  33.620  21.732 1.00 42.62  ? 41  ALA A C     1 
ATOM   76   O O     . ALA A 1 15  ? 21.085  33.347  20.901 1.00 42.25  ? 41  ALA A O     1 
ATOM   77   C CB    . ALA A 1 15  ? 24.043  34.865  21.092 1.00 40.94  ? 41  ALA A CB    1 
ATOM   78   N N     . GLY A 1 16  ? 21.678  34.016  22.984 1.00 42.65  ? 42  GLY A N     1 
ATOM   79   C CA    . GLY A 1 16  ? 20.309  34.342  23.372 1.00 42.70  ? 42  GLY A CA    1 
ATOM   80   C C     . GLY A 1 16  ? 19.793  35.403  22.408 1.00 42.52  ? 42  GLY A C     1 
ATOM   81   O O     . GLY A 1 16  ? 20.553  36.259  21.950 1.00 42.08  ? 42  GLY A O     1 
ATOM   82   N N     . GLU A 1 17  ? 18.510  35.344  22.085 1.00 42.94  ? 43  GLU A N     1 
ATOM   83   C CA    . GLU A 1 17  ? 17.892  36.320  21.183 1.00 42.75  ? 43  GLU A CA    1 
ATOM   84   C C     . GLU A 1 17  ? 18.326  36.190  19.700 1.00 42.36  ? 43  GLU A C     1 
ATOM   85   O O     . GLU A 1 17  ? 18.032  37.082  18.909 1.00 42.62  ? 43  GLU A O     1 
ATOM   86   C CB    . GLU A 1 17  ? 18.109  37.764  21.688 1.00 42.52  ? 43  GLU A CB    1 
ATOM   87   C CG    . GLU A 1 17  ? 17.571  38.094  23.110 1.00 43.02  ? 43  GLU A CG    1 
ATOM   88   C CD    . GLU A 1 17  ? 16.057  37.893  23.265 1.00 45.75  ? 43  GLU A CD    1 
ATOM   89   O OE1   . GLU A 1 17  ? 15.633  37.361  24.319 1.00 48.31  ? 43  GLU A OE1   1 
ATOM   90   O OE2   . GLU A 1 17  ? 15.284  38.253  22.347 1.00 44.61  ? 43  GLU A OE2   1 
ATOM   91   N N     . SER A 1 18  ? 18.999  35.096  19.321 1.00 42.05  ? 44  SER A N     1 
ATOM   92   C CA    . SER A 1 18  ? 19.525  34.955  17.955 1.00 41.51  ? 44  SER A CA    1 
ATOM   93   C C     . SER A 1 18  ? 18.488  34.474  16.938 1.00 42.24  ? 44  SER A C     1 
ATOM   94   O O     . SER A 1 18  ? 18.671  34.648  15.726 1.00 41.92  ? 44  SER A O     1 
ATOM   95   C CB    . SER A 1 18  ? 20.790  34.090  17.895 1.00 40.91  ? 44  SER A CB    1 
ATOM   96   O OG    . SER A 1 18  ? 20.511  32.734  18.196 1.00 42.87  ? 44  SER A OG    1 
ATOM   97   N N     . GLY A 1 19  ? 17.405  33.879  17.438 1.00 43.53  ? 45  GLY A N     1 
ATOM   98   C CA    . GLY A 1 19  ? 16.286  33.421  16.602 1.00 43.92  ? 45  GLY A CA    1 
ATOM   99   C C     . GLY A 1 19  ? 15.994  31.927  16.698 1.00 44.93  ? 45  GLY A C     1 
ATOM   100  O O     . GLY A 1 19  ? 15.211  31.389  15.895 1.00 45.97  ? 45  GLY A O     1 
ATOM   101  N N     . LYS A 1 20  ? 16.607  31.254  17.671 1.00 44.39  ? 46  LYS A N     1 
ATOM   102  C CA    . LYS A 1 20  ? 16.505  29.792  17.793 1.00 45.00  ? 46  LYS A CA    1 
ATOM   103  C C     . LYS A 1 20  ? 15.074  29.291  17.986 1.00 46.89  ? 46  LYS A C     1 
ATOM   104  O O     . LYS A 1 20  ? 14.596  28.447  17.221 1.00 47.40  ? 46  LYS A O     1 
ATOM   105  C CB    . LYS A 1 20  ? 17.410  29.263  18.906 1.00 44.72  ? 46  LYS A CB    1 
ATOM   106  C CG    . LYS A 1 20  ? 18.898  29.462  18.650 1.00 42.40  ? 46  LYS A CG    1 
ATOM   107  C CD    . LYS A 1 20  ? 19.767  28.863  19.765 1.00 41.88  ? 46  LYS A CD    1 
ATOM   108  C CE    . LYS A 1 20  ? 19.451  29.432  21.150 1.00 41.77  ? 46  LYS A CE    1 
ATOM   109  N NZ    . LYS A 1 20  ? 19.849  30.855  21.320 1.00 42.14  ? 46  LYS A NZ    1 
ATOM   110  N N     . SER A 1 21  ? 14.370  29.833  18.972 1.00 47.70  ? 47  SER A N     1 
ATOM   111  C CA    . SER A 1 21  ? 13.025  29.345  19.258 1.00 50.21  ? 47  SER A CA    1 
ATOM   112  C C     . SER A 1 21  ? 11.990  29.789  18.213 1.00 50.93  ? 47  SER A C     1 
ATOM   113  O O     . SER A 1 21  ? 10.943  29.154  18.056 1.00 52.68  ? 47  SER A O     1 
ATOM   114  C CB    . SER A 1 21  ? 12.594  29.718  20.682 1.00 50.74  ? 47  SER A CB    1 
ATOM   115  O OG    . SER A 1 21  ? 12.294  31.090  20.771 1.00 50.74  ? 47  SER A OG    1 
ATOM   116  N N     . THR A 1 22  ? 12.287  30.873  17.501 1.00 50.32  ? 48  THR A N     1 
ATOM   117  C CA    . THR A 1 22  ? 11.470  31.304  16.361 1.00 50.72  ? 48  THR A CA    1 
ATOM   118  C C     . THR A 1 22  ? 11.553  30.269  15.224 1.00 51.29  ? 48  THR A C     1 
ATOM   119  O O     . THR A 1 22  ? 10.541  29.928  14.620 1.00 52.40  ? 48  THR A O     1 
ATOM   120  C CB    . THR A 1 22  ? 11.905  32.703  15.867 1.00 49.78  ? 48  THR A CB    1 
ATOM   121  O OG1   . THR A 1 22  ? 11.792  33.644  16.945 1.00 49.24  ? 48  THR A OG1   1 
ATOM   122  C CG2   . THR A 1 22  ? 11.048  33.169  14.693 1.00 49.94  ? 48  THR A CG2   1 
ATOM   123  N N     . ILE A 1 23  ? 12.758  29.766  14.958 1.00 50.66  ? 49  ILE A N     1 
ATOM   124  C CA    . ILE A 1 23  ? 12.957  28.702  13.979 1.00 51.81  ? 49  ILE A CA    1 
ATOM   125  C C     . ILE A 1 23  ? 12.169  27.452  14.377 1.00 53.95  ? 49  ILE A C     1 
ATOM   126  O O     . ILE A 1 23  ? 11.495  26.847  13.546 1.00 55.38  ? 49  ILE A O     1 
ATOM   127  C CB    . ILE A 1 23  ? 14.455  28.335  13.810 1.00 50.65  ? 49  ILE A CB    1 
ATOM   128  C CG1   . ILE A 1 23  ? 15.247  29.498  13.192 1.00 49.59  ? 49  ILE A CG1   1 
ATOM   129  C CG2   . ILE A 1 23  ? 14.612  27.075  12.971 1.00 51.33  ? 49  ILE A CG2   1 
ATOM   130  C CD1   . ILE A 1 23  ? 14.674  30.029  11.869 1.00 49.39  ? 49  ILE A CD1   1 
ATOM   131  N N     . VAL A 1 24  ? 12.259  27.077  15.652 1.00 54.69  ? 50  VAL A N     1 
ATOM   132  C CA    . VAL A 1 24  ? 11.494  25.962  16.187 1.00 56.53  ? 50  VAL A CA    1 
ATOM   133  C C     . VAL A 1 24  ? 10.013  26.154  15.870 1.00 58.42  ? 50  VAL A C     1 
ATOM   134  O O     . VAL A 1 24  ? 9.370   25.248  15.346 1.00 59.86  ? 50  VAL A O     1 
ATOM   135  C CB    . VAL A 1 24  ? 11.728  25.781  17.718 1.00 56.78  ? 50  VAL A CB    1 
ATOM   136  C CG1   . VAL A 1 24  ? 10.694  24.846  18.331 1.00 58.39  ? 50  VAL A CG1   1 
ATOM   137  C CG2   . VAL A 1 24  ? 13.124  25.245  17.985 1.00 54.91  ? 50  VAL A CG2   1 
ATOM   138  N N     . LYS A 1 25  ? 9.486   27.345  16.150 1.00 58.95  ? 51  LYS A N     1 
ATOM   139  C CA    . LYS A 1 25  ? 8.076   27.646  15.871 1.00 60.91  ? 51  LYS A CA    1 
ATOM   140  C C     . LYS A 1 25  ? 7.764   27.568  14.375 1.00 61.43  ? 51  LYS A C     1 
ATOM   141  O O     . LYS A 1 25  ? 6.699   27.090  13.986 1.00 63.33  ? 51  LYS A O     1 
ATOM   142  C CB    . LYS A 1 25  ? 7.665   29.008  16.444 1.00 60.61  ? 51  LYS A CB    1 
ATOM   143  C CG    . LYS A 1 25  ? 7.601   29.045  17.977 1.00 61.73  ? 51  LYS A CG    1 
ATOM   144  C CD    . LYS A 1 25  ? 6.819   30.251  18.504 1.00 63.26  ? 51  LYS A CD    1 
ATOM   145  C CE    . LYS A 1 25  ? 7.729   31.440  18.828 1.00 61.57  ? 51  LYS A CE    1 
ATOM   146  N NZ    . LYS A 1 25  ? 6.972   32.507  19.558 1.00 62.80  ? 51  LYS A NZ    1 
ATOM   147  N N     . GLN A 1 26  ? 8.703   28.025  13.549 1.00 60.10  ? 52  GLN A N     1 
ATOM   148  C CA    . GLN A 1 26  ? 8.556   27.964  12.099 1.00 60.26  ? 52  GLN A CA    1 
ATOM   149  C C     . GLN A 1 26  ? 8.444   26.523  11.582 1.00 61.88  ? 52  GLN A C     1 
ATOM   150  O O     . GLN A 1 26  ? 7.644   26.241  10.691 1.00 62.91  ? 52  GLN A O     1 
ATOM   151  C CB    . GLN A 1 26  ? 9.714   28.696  11.412 1.00 58.30  ? 52  GLN A CB    1 
ATOM   152  C CG    . GLN A 1 26  ? 9.683   30.211  11.556 1.00 55.85  ? 52  GLN A CG    1 
ATOM   153  C CD    . GLN A 1 26  ? 8.570   30.886  10.761 1.00 55.59  ? 52  GLN A CD    1 
ATOM   154  O OE1   . GLN A 1 26  ? 7.560   30.270  10.431 1.00 55.98  ? 52  GLN A OE1   1 
ATOM   155  N NE2   . GLN A 1 26  ? 8.751   32.174  10.469 1.00 54.92  ? 52  GLN A NE2   1 
ATOM   156  N N     . MET A 1 27  ? 9.240   25.618  12.152 1.00 62.27  ? 53  MET A N     1 
ATOM   157  C CA    . MET A 1 27  ? 9.178   24.198  11.795 1.00 64.15  ? 53  MET A CA    1 
ATOM   158  C C     . MET A 1 27  ? 7.807   23.621  12.115 1.00 66.68  ? 53  MET A C     1 
ATOM   159  O O     . MET A 1 27  ? 7.332   22.730  11.420 1.00 68.13  ? 53  MET A O     1 
ATOM   160  C CB    . MET A 1 27  ? 10.256  23.386  12.516 1.00 63.23  ? 53  MET A CB    1 
ATOM   161  C CG    . MET A 1 27  ? 11.697  23.696  12.127 1.00 61.97  ? 53  MET A CG    1 
ATOM   162  S SD    . MET A 1 27  ? 12.141  23.445  10.387 1.00 62.57  ? 53  MET A SD    1 
ATOM   163  C CE    . MET A 1 27  ? 11.977  25.116  9.768  1.00 59.63  ? 53  MET A CE    1 
ATOM   164  N N     . LYS A 1 28  ? 7.176   24.135  13.168 1.00 67.95  ? 54  LYS A N     1 
ATOM   165  C CA    . LYS A 1 28  ? 5.823   23.714  13.538 1.00 70.94  ? 54  LYS A CA    1 
ATOM   166  C C     . LYS A 1 28  ? 4.795   24.218  12.518 1.00 72.22  ? 54  LYS A C     1 
ATOM   167  O O     . LYS A 1 28  ? 3.853   23.506  12.170 1.00 74.03  ? 54  LYS A O     1 
ATOM   168  C CB    . LYS A 1 28  ? 5.472   24.192  14.955 1.00 71.27  ? 54  LYS A CB    1 
ATOM   169  C CG    . LYS A 1 28  ? 4.227   23.543  15.566 1.00 75.44  ? 54  LYS A CG    1 
ATOM   170  C CD    . LYS A 1 28  ? 3.952   24.078  16.975 1.00 77.87  ? 54  LYS A CD    1 
ATOM   171  C CE    . LYS A 1 28  ? 2.761   23.376  17.627 1.00 81.89  ? 54  LYS A CE    1 
ATOM   172  N NZ    . LYS A 1 28  ? 2.427   23.989  18.950 1.00 83.14  ? 54  LYS A NZ    1 
ATOM   173  N N     . ILE A 1 29  ? 4.988   25.444  12.042 1.00 71.33  ? 55  ILE A N     1 
ATOM   174  C CA    . ILE A 1 29  ? 4.080   26.042  11.074 1.00 72.81  ? 55  ILE A CA    1 
ATOM   175  C C     . ILE A 1 29  ? 4.234   25.391  9.699  1.00 73.66  ? 55  ILE A C     1 
ATOM   176  O O     . ILE A 1 29  ? 3.241   25.093  9.038  1.00 75.71  ? 55  ILE A O     1 
ATOM   177  C CB    . ILE A 1 29  ? 4.285   27.577  10.994 1.00 71.53  ? 55  ILE A CB    1 
ATOM   178  C CG1   . ILE A 1 29  ? 3.786   28.238  12.285 1.00 71.74  ? 55  ILE A CG1   1 
ATOM   179  C CG2   . ILE A 1 29  ? 3.599   28.173  9.754  1.00 71.82  ? 55  ILE A CG2   1 
ATOM   180  C CD1   . ILE A 1 29  ? 4.292   29.642  12.491 1.00 69.60  ? 55  ILE A CD1   1 
ATOM   181  N N     . ILE A 1 30  ? 5.478   25.164  9.283  1.00 72.68  ? 56  ILE A N     1 
ATOM   182  C CA    . ILE A 1 30  ? 5.771   24.646  7.948  1.00 73.34  ? 56  ILE A CA    1 
ATOM   183  C C     . ILE A 1 30  ? 5.614   23.119  7.838  1.00 74.05  ? 56  ILE A C     1 
ATOM   184  O O     . ILE A 1 30  ? 5.023   22.629  6.876  1.00 74.74  ? 56  ILE A O     1 
ATOM   185  C CB    . ILE A 1 30  ? 7.187   25.080  7.473  1.00 72.77  ? 56  ILE A CB    1 
ATOM   186  C CG1   . ILE A 1 30  ? 7.292   26.609  7.415  1.00 73.16  ? 56  ILE A CG1   1 
ATOM   187  C CG2   . ILE A 1 30  ? 7.528   24.476  6.104  1.00 73.25  ? 56  ILE A CG2   1 
ATOM   188  C CD1   . ILE A 1 30  ? 8.712   27.139  7.556  1.00 71.42  ? 56  ILE A CD1   1 
ATOM   189  N N     . HIS A 1 31  ? 6.129   22.380  8.822  1.00 74.23  ? 57  HIS A N     1 
ATOM   190  C CA    . HIS A 1 31  ? 6.243   20.917  8.719  1.00 75.21  ? 57  HIS A CA    1 
ATOM   191  C C     . HIS A 1 31  ? 5.383   20.129  9.702  1.00 76.29  ? 57  HIS A C     1 
ATOM   192  O O     . HIS A 1 31  ? 5.411   18.897  9.705  1.00 77.08  ? 57  HIS A O     1 
ATOM   193  C CB    . HIS A 1 31  ? 7.705   20.478  8.848  1.00 74.68  ? 57  HIS A CB    1 
ATOM   194  C CG    . HIS A 1 31  ? 8.585   20.992  7.755  1.00 74.83  ? 57  HIS A CG    1 
ATOM   195  N ND1   . HIS A 1 31  ? 9.680   21.794  7.996  1.00 75.36  ? 57  HIS A ND1   1 
ATOM   196  C CD2   . HIS A 1 31  ? 8.521   20.835  6.413  1.00 75.71  ? 57  HIS A CD2   1 
ATOM   197  C CE1   . HIS A 1 31  ? 10.258  22.103  6.849  1.00 75.91  ? 57  HIS A CE1   1 
ATOM   198  N NE2   . HIS A 1 31  ? 9.575   21.531  5.873  1.00 76.38  ? 57  HIS A NE2   1 
ATOM   199  N N     . GLU A 1 32  ? 4.634   20.842  10.538 1.00 76.72  ? 58  GLU A N     1 
ATOM   200  C CA    . GLU A 1 32  ? 3.674   20.227  11.451 1.00 77.89  ? 58  GLU A CA    1 
ATOM   201  C C     . GLU A 1 32  ? 2.303   20.876  11.253 1.00 78.99  ? 58  GLU A C     1 
ATOM   202  O O     . GLU A 1 32  ? 2.035   21.450  10.189 1.00 78.87  ? 58  GLU A O     1 
ATOM   203  C CB    . GLU A 1 32  ? 4.157   20.331  12.901 1.00 77.44  ? 58  GLU A CB    1 
ATOM   204  C CG    . GLU A 1 32  ? 5.409   19.508  13.180 1.00 77.53  ? 58  GLU A CG    1 
ATOM   205  C CD    . GLU A 1 32  ? 6.061   19.831  14.513 1.00 77.25  ? 58  GLU A CD    1 
ATOM   206  O OE1   . GLU A 1 32  ? 5.404   19.664  15.560 1.00 78.48  ? 58  GLU A OE1   1 
ATOM   207  O OE2   . GLU A 1 32  ? 7.243   20.235  14.513 1.00 76.24  ? 58  GLU A OE2   1 
ATOM   208  N N     . ALA A 1 33  ? 1.443   20.790  12.267 1.00 80.40  ? 59  ALA A N     1 
ATOM   209  C CA    . ALA A 1 33  ? 0.063   21.267  12.142 1.00 82.28  ? 59  ALA A CA    1 
ATOM   210  C C     . ALA A 1 33  ? -0.075  22.787  12.253 1.00 82.01  ? 59  ALA A C     1 
ATOM   211  O O     . ALA A 1 33  ? -1.080  23.355  11.820 1.00 83.15  ? 59  ALA A O     1 
ATOM   212  C CB    . ALA A 1 33  ? -0.844  20.561  13.155 1.00 83.86  ? 59  ALA A CB    1 
ATOM   213  N N     . GLY A 1 34  ? 0.935   23.439  12.825 1.00 81.08  ? 60  GLY A N     1 
ATOM   214  C CA    . GLY A 1 34  ? 0.911   24.888  13.021 1.00 80.98  ? 60  GLY A CA    1 
ATOM   215  C C     . GLY A 1 34  ? 0.028   25.297  14.188 1.00 81.90  ? 60  GLY A C     1 
ATOM   216  O O     . GLY A 1 34  ? -0.034  24.601  15.209 1.00 82.10  ? 60  GLY A O     1 
ATOM   217  N N     . TYR A 1 35  ? -0.655  26.430  14.033 1.00 82.62  ? 61  TYR A N     1 
ATOM   218  C CA    . TYR A 1 35  ? -1.527  26.975  15.078 1.00 83.48  ? 61  TYR A CA    1 
ATOM   219  C C     . TYR A 1 35  ? -2.944  27.184  14.548 1.00 85.77  ? 61  TYR A C     1 
ATOM   220  O O     . TYR A 1 35  ? -3.148  27.930  13.586 1.00 86.31  ? 61  TYR A O     1 
ATOM   221  C CB    . TYR A 1 35  ? -0.969  28.303  15.636 1.00 82.17  ? 61  TYR A CB    1 
ATOM   222  C CG    . TYR A 1 35  ? 0.444   28.218  16.184 1.00 79.51  ? 61  TYR A CG    1 
ATOM   223  C CD1   . TYR A 1 35  ? 0.682   27.815  17.500 1.00 78.36  ? 61  TYR A CD1   1 
ATOM   224  C CD2   . TYR A 1 35  ? 1.543   28.545  15.386 1.00 77.70  ? 61  TYR A CD2   1 
ATOM   225  C CE1   . TYR A 1 35  ? 1.985   27.733  18.007 1.00 76.93  ? 61  TYR A CE1   1 
ATOM   226  C CE2   . TYR A 1 35  ? 2.847   28.467  15.881 1.00 76.27  ? 61  TYR A CE2   1 
ATOM   227  C CZ    . TYR A 1 35  ? 3.060   28.059  17.189 1.00 75.60  ? 61  TYR A CZ    1 
ATOM   228  O OH    . TYR A 1 35  ? 4.341   27.976  17.676 1.00 74.39  ? 61  TYR A OH    1 
ATOM   229  N N     . SER A 1 36  ? -3.911  26.512  15.172 1.00 87.73  ? 62  SER A N     1 
ATOM   230  C CA    . SER A 1 36  ? -5.333  26.723  14.880 1.00 90.37  ? 62  SER A CA    1 
ATOM   231  C C     . SER A 1 36  ? -5.795  28.022  15.537 1.00 90.81  ? 62  SER A C     1 
ATOM   232  O O     . SER A 1 36  ? -5.058  28.609  16.340 1.00 89.43  ? 62  SER A O     1 
ATOM   233  C CB    . SER A 1 36  ? -6.170  25.540  15.384 1.00 92.18  ? 62  SER A CB    1 
ATOM   234  O OG    . SER A 1 36  ? -5.988  25.320  16.775 1.00 91.83  ? 62  SER A OG    1 
ATOM   235  N N     . GLU A 1 37  ? -7.005  28.474  15.205 1.00 93.00  ? 63  GLU A N     1 
ATOM   236  C CA    . GLU A 1 37  ? -7.540  29.703  15.803 1.00 93.58  ? 63  GLU A CA    1 
ATOM   237  C C     . GLU A 1 37  ? -7.735  29.553  17.315 1.00 93.34  ? 63  GLU A C     1 
ATOM   238  O O     . GLU A 1 37  ? -7.529  30.506  18.069 1.00 92.70  ? 63  GLU A O     1 
ATOM   239  C CB    . GLU A 1 37  ? -8.842  30.139  15.123 1.00 96.20  ? 63  GLU A CB    1 
ATOM   240  C CG    . GLU A 1 37  ? -9.185  31.617  15.336 1.00 96.88  ? 63  GLU A CG    1 
ATOM   241  C CD    . GLU A 1 37  ? -10.526 32.025  14.728 1.00 100.37 ? 63  GLU A CD    1 
ATOM   242  O OE1   . GLU A 1 37  ? -10.765 31.732  13.536 1.00 101.72 ? 63  GLU A OE1   1 
ATOM   243  O OE2   . GLU A 1 37  ? -11.336 32.654  15.444 1.00 101.11 ? 63  GLU A OE2   1 
ATOM   244  N N     . GLU A 1 38  ? -8.104  28.348  17.746 1.00 94.17  ? 64  GLU A N     1 
ATOM   245  C CA    . GLU A 1 38  ? -8.318  28.042  19.164 1.00 94.27  ? 64  GLU A CA    1 
ATOM   246  C C     . GLU A 1 38  ? -7.026  28.142  19.975 1.00 91.73  ? 64  GLU A C     1 
ATOM   247  O O     . GLU A 1 38  ? -7.022  28.682  21.087 1.00 91.22  ? 64  GLU A O     1 
ATOM   248  C CB    . GLU A 1 38  ? -8.932  26.645  19.332 1.00 96.24  ? 64  GLU A CB    1 
ATOM   249  C CG    . GLU A 1 38  ? -10.212 26.397  18.523 1.00 99.53  ? 64  GLU A CG    1 
ATOM   250  C CD    . GLU A 1 38  ? -11.462 26.982  19.171 1.00 102.06 ? 64  GLU A CD    1 
ATOM   251  O OE1   . GLU A 1 38  ? -12.521 26.315  19.106 1.00 104.76 ? 64  GLU A OE1   1 
ATOM   252  O OE2   . GLU A 1 38  ? -11.395 28.098  19.740 1.00 100.91 ? 64  GLU A OE2   1 
ATOM   253  N N     . GLU A 1 39  ? -5.940  27.612  19.413 1.00 90.22  ? 65  GLU A N     1 
ATOM   254  C CA    . GLU A 1 39  ? -4.609  27.709  20.019 1.00 88.00  ? 65  GLU A CA    1 
ATOM   255  C C     . GLU A 1 39  ? -4.134  29.162  20.071 1.00 86.32  ? 65  GLU A C     1 
ATOM   256  O O     . GLU A 1 39  ? -3.580  29.604  21.079 1.00 85.29  ? 65  GLU A O     1 
ATOM   257  C CB    . GLU A 1 39  ? -3.601  26.858  19.244 1.00 87.29  ? 65  GLU A CB    1 
ATOM   258  C CG    . GLU A 1 39  ? -3.802  25.350  19.385 1.00 89.17  ? 65  GLU A CG    1 
ATOM   259  C CD    . GLU A 1 39  ? -3.032  24.562  18.341 1.00 89.46  ? 65  GLU A CD    1 
ATOM   260  O OE1   . GLU A 1 39  ? -3.239  24.806  17.132 1.00 89.82  ? 65  GLU A OE1   1 
ATOM   261  O OE2   . GLU A 1 39  ? -2.223  23.694  18.730 1.00 89.56  ? 65  GLU A OE2   1 
ATOM   262  N N     . CYS A 1 40  ? -4.368  29.892  18.979 1.00 86.12  ? 66  CYS A N     1 
ATOM   263  C CA    . CYS A 1 40  ? -4.015  31.305  18.870 1.00 85.08  ? 66  CYS A CA    1 
ATOM   264  C C     . CYS A 1 40  ? -4.648  32.155  19.974 1.00 85.36  ? 66  CYS A C     1 
ATOM   265  O O     . CYS A 1 40  ? -3.999  33.046  20.524 1.00 84.27  ? 66  CYS A O     1 
ATOM   266  C CB    . CYS A 1 40  ? -4.412  31.846  17.498 1.00 86.00  ? 66  CYS A CB    1 
ATOM   267  S SG    . CYS A 1 40  ? -3.291  31.392  16.163 1.00 84.67  ? 66  CYS A SG    1 
ATOM   268  N N     . LYS A 1 41  ? -5.908  31.862  20.296 1.00 86.74  ? 67  LYS A N     1 
ATOM   269  C CA    . LYS A 1 41  ? -6.640  32.558  21.355 1.00 87.08  ? 67  LYS A CA    1 
ATOM   270  C C     . LYS A 1 41  ? -5.910  32.457  22.701 1.00 85.42  ? 67  LYS A C     1 
ATOM   271  O O     . LYS A 1 41  ? -5.957  33.386  23.510 1.00 85.16  ? 67  LYS A O     1 
ATOM   272  C CB    . LYS A 1 41  ? -8.068  32.004  21.458 1.00 89.50  ? 67  LYS A CB    1 
ATOM   273  C CG    . LYS A 1 41  ? -9.061  32.899  22.196 1.00 91.15  ? 67  LYS A CG    1 
ATOM   274  C CD    . LYS A 1 41  ? -10.463 32.283  22.223 1.00 94.41  ? 67  LYS A CD    1 
ATOM   275  C CE    . LYS A 1 41  ? -11.447 33.156  23.008 1.00 96.05  ? 67  LYS A CE    1 
ATOM   276  N NZ    . LYS A 1 41  ? -12.858 32.653  22.949 1.00 99.06  ? 67  LYS A NZ    1 
ATOM   277  N N     . GLN A 1 42  ? -5.219  31.338  22.913 1.00 84.40  ? 68  GLN A N     1 
ATOM   278  C CA    . GLN A 1 42  ? -4.476  31.067  24.152 1.00 83.25  ? 68  GLN A CA    1 
ATOM   279  C C     . GLN A 1 42  ? -3.227  31.941  24.331 1.00 81.05  ? 68  GLN A C     1 
ATOM   280  O O     . GLN A 1 42  ? -2.714  32.080  25.447 1.00 80.56  ? 68  GLN A O     1 
ATOM   281  C CB    . GLN A 1 42  ? -4.069  29.586  24.221 1.00 83.76  ? 68  GLN A CB    1 
ATOM   282  C CG    . GLN A 1 42  ? -5.233  28.591  24.176 1.00 86.49  ? 68  GLN A CG    1 
ATOM   283  C CD    . GLN A 1 42  ? -6.089  28.625  25.436 1.00 89.03  ? 68  GLN A CD    1 
ATOM   284  O OE1   . GLN A 1 42  ? -5.570  28.671  26.558 1.00 88.97  ? 68  GLN A OE1   1 
ATOM   285  N NE2   . GLN A 1 42  ? -7.408  28.600  25.255 1.00 90.44  ? 68  GLN A NE2   1 
ATOM   286  N N     . TYR A 1 43  ? -2.737  32.515  23.235 1.00 79.61  ? 69  TYR A N     1 
ATOM   287  C CA    . TYR A 1 43  ? -1.531  33.348  23.274 1.00 77.61  ? 69  TYR A CA    1 
ATOM   288  C C     . TYR A 1 43  ? -1.835  34.825  23.568 1.00 77.10  ? 69  TYR A C     1 
ATOM   289  O O     . TYR A 1 43  ? -0.925  35.658  23.601 1.00 76.42  ? 69  TYR A O     1 
ATOM   290  C CB    . TYR A 1 43  ? -0.723  33.204  21.970 1.00 77.03  ? 69  TYR A CB    1 
ATOM   291  C CG    . TYR A 1 43  ? 0.082   31.920  21.869 1.00 76.75  ? 69  TYR A CG    1 
ATOM   292  C CD1   . TYR A 1 43  ? 1.363   31.826  22.419 1.00 76.15  ? 69  TYR A CD1   1 
ATOM   293  C CD2   . TYR A 1 43  ? -0.437  30.799  21.222 1.00 77.77  ? 69  TYR A CD2   1 
ATOM   294  C CE1   . TYR A 1 43  ? 2.107   30.639  22.328 1.00 76.44  ? 69  TYR A CE1   1 
ATOM   295  C CE2   . TYR A 1 43  ? 0.294   29.610  21.123 1.00 77.63  ? 69  TYR A CE2   1 
ATOM   296  C CZ    . TYR A 1 43  ? 1.562   29.534  21.675 1.00 77.15  ? 69  TYR A CZ    1 
ATOM   297  O OH    . TYR A 1 43  ? 2.273   28.357  21.575 1.00 76.01  ? 69  TYR A OH    1 
ATOM   298  N N     . LYS A 1 44  ? -3.111  35.136  23.796 1.00 77.20  ? 70  LYS A N     1 
ATOM   299  C CA    . LYS A 1 44  ? -3.567  36.519  23.971 1.00 76.70  ? 70  LYS A CA    1 
ATOM   300  C C     . LYS A 1 44  ? -2.926  37.200  25.181 1.00 75.20  ? 70  LYS A C     1 
ATOM   301  O O     . LYS A 1 44  ? -2.499  38.354  25.098 1.00 75.08  ? 70  LYS A O     1 
ATOM   302  C CB    . LYS A 1 44  ? -5.097  36.571  24.067 1.00 78.29  ? 70  LYS A CB    1 
ATOM   303  C CG    . LYS A 1 44  ? -5.702  37.932  23.785 1.00 79.42  ? 70  LYS A CG    1 
ATOM   304  C CD    . LYS A 1 44  ? -7.222  37.858  23.689 1.00 81.48  ? 70  LYS A CD    1 
ATOM   305  C CE    . LYS A 1 44  ? -7.828  39.245  23.566 1.00 82.54  ? 70  LYS A CE    1 
ATOM   306  N NZ    . LYS A 1 44  ? -9.301  39.188  23.376 1.00 84.64  ? 70  LYS A NZ    1 
ATOM   307  N N     . ALA A 1 45  ? -2.848  36.479  26.294 1.00 73.98  ? 71  ALA A N     1 
ATOM   308  C CA    . ALA A 1 45  ? -2.277  37.028  27.515 1.00 72.74  ? 71  ALA A CA    1 
ATOM   309  C C     . ALA A 1 45  ? -0.797  37.361  27.335 1.00 71.36  ? 71  ALA A C     1 
ATOM   310  O O     . ALA A 1 45  ? -0.355  38.456  27.689 1.00 71.16  ? 71  ALA A O     1 
ATOM   311  C CB    . ALA A 1 45  ? -2.488  36.073  28.680 1.00 72.84  ? 71  ALA A CB    1 
ATOM   312  N N     . VAL A 1 46  ? -0.046  36.424  26.759 1.00 61.29  ? 72  VAL A N     1 
ATOM   313  C CA    . VAL A 1 46  ? 1.389   36.607  26.539 1.00 59.28  ? 72  VAL A CA    1 
ATOM   314  C C     . VAL A 1 46  ? 1.678   37.732  25.533 1.00 56.88  ? 72  VAL A C     1 
ATOM   315  O O     . VAL A 1 46  ? 2.693   38.402  25.643 1.00 55.51  ? 72  VAL A O     1 
ATOM   316  C CB    . VAL A 1 46  ? 2.122   35.265  26.197 1.00 60.77  ? 72  VAL A CB    1 
ATOM   317  C CG1   . VAL A 1 46  ? 1.553   34.625  24.954 1.00 62.02  ? 72  VAL A CG1   1 
ATOM   318  C CG2   . VAL A 1 46  ? 3.636   35.465  26.055 1.00 59.51  ? 72  VAL A CG2   1 
ATOM   319  N N     . VAL A 1 47  ? 0.773   37.951  24.583 1.00 56.79  ? 73  VAL A N     1 
ATOM   320  C CA    . VAL A 1 47  ? 0.870   39.089  23.678 1.00 55.31  ? 73  VAL A CA    1 
ATOM   321  C C     . VAL A 1 47  ? 0.776   40.381  24.495 1.00 54.48  ? 73  VAL A C     1 
ATOM   322  O O     . VAL A 1 47  ? 1.599   41.289  24.339 1.00 53.15  ? 73  VAL A O     1 
ATOM   323  C CB    . VAL A 1 47  ? -0.221  39.041  22.574 1.00 56.78  ? 73  VAL A CB    1 
ATOM   324  C CG1   . VAL A 1 47  ? -0.366  40.388  21.858 1.00 55.75  ? 73  VAL A CG1   1 
ATOM   325  C CG2   . VAL A 1 47  ? 0.087   37.941  21.568 1.00 57.48  ? 73  VAL A CG2   1 
ATOM   326  N N     . TYR A 1 48  ? -0.202  40.439  25.392 1.00 55.36  ? 74  TYR A N     1 
ATOM   327  C CA    . TYR A 1 48  ? -0.379  41.605  26.242 1.00 55.06  ? 74  TYR A CA    1 
ATOM   328  C C     . TYR A 1 48  ? 0.812   41.830  27.181 1.00 54.01  ? 74  TYR A C     1 
ATOM   329  O O     . TYR A 1 48  ? 1.332   42.942  27.268 1.00 53.09  ? 74  TYR A O     1 
ATOM   330  C CB    . TYR A 1 48  ? -1.710  41.540  27.003 1.00 57.35  ? 74  TYR A CB    1 
ATOM   331  C CG    . TYR A 1 48  ? -2.943  41.721  26.121 1.00 59.15  ? 74  TYR A CG    1 
ATOM   332  C CD1   . TYR A 1 48  ? -2.836  42.285  24.848 1.00 59.71  ? 74  TYR A CD1   1 
ATOM   333  C CD2   . TYR A 1 48  ? -4.218  41.367  26.571 1.00 61.66  ? 74  TYR A CD2   1 
ATOM   334  C CE1   . TYR A 1 48  ? -3.953  42.467  24.037 1.00 61.42  ? 74  TYR A CE1   1 
ATOM   335  C CE2   . TYR A 1 48  ? -5.345  41.549  25.762 1.00 63.90  ? 74  TYR A CE2   1 
ATOM   336  C CZ    . TYR A 1 48  ? -5.199  42.107  24.494 1.00 63.40  ? 74  TYR A CZ    1 
ATOM   337  O OH    . TYR A 1 48  ? -6.279  42.306  23.660 1.00 65.58  ? 74  TYR A OH    1 
ATOM   338  N N     . SER A 1 49  ? 1.269   40.780  27.857 1.00 54.33  ? 75  SER A N     1 
ATOM   339  C CA    . SER A 1 49  ? 2.412   40.938  28.755 1.00 53.84  ? 75  SER A CA    1 
ATOM   340  C C     . SER A 1 49  ? 3.689   41.343  28.005 1.00 51.15  ? 75  SER A C     1 
ATOM   341  O O     . SER A 1 49  ? 4.412   42.246  28.446 1.00 50.08  ? 75  SER A O     1 
ATOM   342  C CB    . SER A 1 49  ? 2.639   39.675  29.576 1.00 55.94  ? 75  SER A CB    1 
ATOM   343  O OG    . SER A 1 49  ? 2.956   38.590  28.732 1.00 58.45  ? 75  SER A OG    1 
ATOM   344  N N     . ASN A 1 50  ? 3.954   40.688  26.871 1.00 50.21  ? 76  ASN A N     1 
ATOM   345  C CA    . ASN A 1 50  ? 5.094   41.047  26.013 1.00 48.31  ? 76  ASN A CA    1 
ATOM   346  C C     . ASN A 1 50  ? 5.057   42.532  25.652 1.00 47.13  ? 76  ASN A C     1 
ATOM   347  O O     . ASN A 1 50  ? 6.079   43.223  25.711 1.00 45.81  ? 76  ASN A O     1 
ATOM   348  C CB    . ASN A 1 50  ? 5.114   40.204  24.730 1.00 48.79  ? 76  ASN A CB    1 
ATOM   349  C CG    . ASN A 1 50  ? 5.578   38.765  24.958 1.00 48.94  ? 76  ASN A CG    1 
ATOM   350  O OD1   . ASN A 1 50  ? 5.422   37.926  24.081 1.00 48.73  ? 76  ASN A OD1   1 
ATOM   351  N ND2   . ASN A 1 50  ? 6.153   38.483  26.121 1.00 47.66  ? 76  ASN A ND2   1 
ATOM   352  N N     . THR A 1 51  ? 3.857   43.010  25.319 1.00 47.53  ? 77  THR A N     1 
ATOM   353  C CA    . THR A 1 51  ? 3.615   44.398  24.946 1.00 46.96  ? 77  THR A CA    1 
ATOM   354  C C     . THR A 1 51  ? 3.919   45.333  26.115 1.00 46.76  ? 77  THR A C     1 
ATOM   355  O O     . THR A 1 51  ? 4.521   46.398  25.937 1.00 46.02  ? 77  THR A O     1 
ATOM   356  C CB    . THR A 1 51  ? 2.146   44.603  24.454 1.00 48.35  ? 77  THR A CB    1 
ATOM   357  O OG1   . THR A 1 51  ? 1.881   43.725  23.347 1.00 48.63  ? 77  THR A OG1   1 
ATOM   358  C CG2   . THR A 1 51  ? 1.892   46.046  24.017 1.00 46.51  ? 77  THR A CG2   1 
ATOM   359  N N     . ILE A 1 52  ? 3.515   44.921  27.311 1.00 47.81  ? 78  ILE A N     1 
ATOM   360  C CA    . ILE A 1 52  ? 3.684   45.758  28.503 1.00 47.82  ? 78  ILE A CA    1 
ATOM   361  C C     . ILE A 1 52  ? 5.133   45.725  29.010 1.00 47.08  ? 78  ILE A C     1 
ATOM   362  O O     . ILE A 1 52  ? 5.696   46.769  29.367 1.00 46.90  ? 78  ILE A O     1 
ATOM   363  C CB    . ILE A 1 52  ? 2.685   45.378  29.616 1.00 49.48  ? 78  ILE A CB    1 
ATOM   364  C CG1   . ILE A 1 52  ? 1.255   45.643  29.136 1.00 50.82  ? 78  ILE A CG1   1 
ATOM   365  C CG2   . ILE A 1 52  ? 2.991   46.154  30.892 1.00 50.26  ? 78  ILE A CG2   1 
ATOM   366  C CD1   . ILE A 1 52  ? 0.145   45.043  30.019 1.00 52.64  ? 78  ILE A CD1   1 
ATOM   367  N N     . GLN A 1 53  ? 5.731   44.535  29.036 1.00 46.72  ? 79  GLN A N     1 
ATOM   368  C CA    . GLN A 1 53  ? 7.164   44.408  29.318 1.00 46.26  ? 79  GLN A CA    1 
ATOM   369  C C     . GLN A 1 53  ? 7.986   45.324  28.413 1.00 44.69  ? 79  GLN A C     1 
ATOM   370  O O     . GLN A 1 53  ? 8.937   45.949  28.876 1.00 45.12  ? 79  GLN A O     1 
ATOM   371  C CB    . GLN A 1 53  ? 7.634   42.953  29.163 1.00 47.11  ? 79  GLN A CB    1 
ATOM   372  C CG    . GLN A 1 53  ? 7.154   42.006  30.274 1.00 48.48  ? 79  GLN A CG    1 
ATOM   373  C CD    . GLN A 1 53  ? 7.099   40.537  29.841 1.00 50.02  ? 79  GLN A CD    1 
ATOM   374  O OE1   . GLN A 1 53  ? 7.169   40.213  28.649 1.00 46.98  ? 79  GLN A OE1   1 
ATOM   375  N NE2   . GLN A 1 53  ? 6.957   39.643  30.816 1.00 51.89  ? 79  GLN A NE2   1 
ATOM   376  N N     . SER A 1 54  ? 7.598   45.417  27.143 1.00 43.72  ? 80  SER A N     1 
ATOM   377  C CA    . SER A 1 54  ? 8.339   46.177  26.131 1.00 43.19  ? 80  SER A CA    1 
ATOM   378  C C     . SER A 1 54  ? 8.357   47.678  26.416 1.00 43.16  ? 80  SER A C     1 
ATOM   379  O O     . SER A 1 54  ? 9.426   48.304  26.437 1.00 42.96  ? 80  SER A O     1 
ATOM   380  C CB    . SER A 1 54  ? 7.758   45.916  24.734 1.00 43.45  ? 80  SER A CB    1 
ATOM   381  O OG    . SER A 1 54  ? 8.020   44.580  24.313 1.00 43.86  ? 80  SER A OG    1 
ATOM   382  N N     . ILE A 1 55  ? 7.176   48.252  26.644 1.00 43.50  ? 81  ILE A N     1 
ATOM   383  C CA    . ILE A 1 55  ? 7.068   49.665  26.968 1.00 43.59  ? 81  ILE A CA    1 
ATOM   384  C C     . ILE A 1 55  ? 7.670   49.964  28.362 1.00 43.71  ? 81  ILE A C     1 
ATOM   385  O O     . ILE A 1 55  ? 8.236   51.034  28.572 1.00 43.83  ? 81  ILE A O     1 
ATOM   386  C CB    . ILE A 1 55  ? 5.608   50.197  26.812 1.00 44.91  ? 81  ILE A CB    1 
ATOM   387  C CG1   . ILE A 1 55  ? 5.563   51.732  26.902 1.00 46.36  ? 81  ILE A CG1   1 
ATOM   388  C CG2   . ILE A 1 55  ? 4.659   49.567  27.839 1.00 45.01  ? 81  ILE A CG2   1 
ATOM   389  C CD1   . ILE A 1 55  ? 6.056   52.449  25.649 1.00 46.02  ? 81  ILE A CD1   1 
ATOM   390  N N     . ILE A 1 56  ? 7.576   49.009  29.289 1.00 43.80  ? 82  ILE A N     1 
ATOM   391  C CA    . ILE A 1 56  ? 8.202   49.147  30.601 1.00 44.34  ? 82  ILE A CA    1 
ATOM   392  C C     . ILE A 1 56  ? 9.728   49.161  30.464 1.00 44.03  ? 82  ILE A C     1 
ATOM   393  O O     . ILE A 1 56  ? 10.403  50.022  31.032 1.00 45.12  ? 82  ILE A O     1 
ATOM   394  C CB    . ILE A 1 56  ? 7.739   48.041  31.582 1.00 45.65  ? 82  ILE A CB    1 
ATOM   395  C CG1   . ILE A 1 56  ? 6.332   48.370  32.100 1.00 47.35  ? 82  ILE A CG1   1 
ATOM   396  C CG2   . ILE A 1 56  ? 8.726   47.878  32.759 1.00 45.52  ? 82  ILE A CG2   1 
ATOM   397  C CD1   . ILE A 1 56  ? 5.734   47.338  33.053 1.00 47.39  ? 82  ILE A CD1   1 
ATOM   398  N N     . ALA A 1 57  ? 10.271  48.223  29.700 1.00 43.17  ? 83  ALA A N     1 
ATOM   399  C CA    . ALA A 1 57  ? 11.704  48.197  29.460 1.00 43.15  ? 83  ALA A CA    1 
ATOM   400  C C     . ALA A 1 57  ? 12.209  49.563  28.965 1.00 42.65  ? 83  ALA A C     1 
ATOM   401  O O     . ALA A 1 57  ? 13.267  50.020  29.380 1.00 43.84  ? 83  ALA A O     1 
ATOM   402  C CB    . ALA A 1 57  ? 12.050  47.091  28.465 1.00 43.05  ? 83  ALA A CB    1 
ATOM   403  N N     . ILE A 1 58  ? 11.442  50.207  28.092 1.00 41.91  ? 84  ILE A N     1 
ATOM   404  C CA    . ILE A 1 58  ? 11.800  51.511  27.544 1.00 41.56  ? 84  ILE A CA    1 
ATOM   405  C C     . ILE A 1 58  ? 11.690  52.611  28.593 1.00 42.40  ? 84  ILE A C     1 
ATOM   406  O O     . ILE A 1 58  ? 12.572  53.464  28.680 1.00 42.80  ? 84  ILE A O     1 
ATOM   407  C CB    . ILE A 1 58  ? 10.941  51.876  26.309 1.00 41.58  ? 84  ILE A CB    1 
ATOM   408  C CG1   . ILE A 1 58  ? 11.115  50.837  25.194 1.00 41.24  ? 84  ILE A CG1   1 
ATOM   409  C CG2   . ILE A 1 58  ? 11.325  53.261  25.775 1.00 42.15  ? 84  ILE A CG2   1 
ATOM   410  C CD1   . ILE A 1 58  ? 10.051  50.925  24.062 1.00 41.76  ? 84  ILE A CD1   1 
ATOM   411  N N     . ILE A 1 59  ? 10.616  52.590  29.391 1.00 43.29  ? 85  ILE A N     1 
ATOM   412  C CA    . ILE A 1 59  ? 10.447  53.555  30.487 1.00 44.38  ? 85  ILE A CA    1 
ATOM   413  C C     . ILE A 1 59  ? 11.646  53.491  31.444 1.00 44.88  ? 85  ILE A C     1 
ATOM   414  O O     . ILE A 1 59  ? 12.181  54.530  31.833 1.00 45.85  ? 85  ILE A O     1 
ATOM   415  C CB    . ILE A 1 59  ? 9.112   53.344  31.281 1.00 46.03  ? 85  ILE A CB    1 
ATOM   416  C CG1   . ILE A 1 59  ? 7.865   53.357  30.364 1.00 46.38  ? 85  ILE A CG1   1 
ATOM   417  C CG2   . ILE A 1 59  ? 8.975   54.346  32.434 1.00 47.02  ? 85  ILE A CG2   1 
ATOM   418  C CD1   . ILE A 1 59  ? 7.652   54.610  29.539 1.00 48.78  ? 85  ILE A CD1   1 
ATOM   419  N N     . ARG A 1 60  ? 12.070  52.278  31.801 1.00 44.77  ? 86  ARG A N     1 
ATOM   420  C CA    . ARG A 1 60  ? 13.222  52.056  32.701 1.00 46.05  ? 86  ARG A CA    1 
ATOM   421  C C     . ARG A 1 60  ? 14.526  52.634  32.163 1.00 45.67  ? 86  ARG A C     1 
ATOM   422  O O     . ARG A 1 60  ? 15.303  53.228  32.914 1.00 47.11  ? 86  ARG A O     1 
ATOM   423  C CB    . ARG A 1 60  ? 13.436  50.554  32.973 1.00 46.14  ? 86  ARG A CB    1 
ATOM   424  C CG    . ARG A 1 60  ? 12.309  49.882  33.760 1.00 48.09  ? 86  ARG A CG    1 
ATOM   425  C CD    . ARG A 1 60  ? 12.823  48.719  34.612 1.00 49.40  ? 86  ARG A CD    1 
ATOM   426  N NE    . ARG A 1 60  ? 11.729  47.919  35.147 1.00 52.18  ? 86  ARG A NE    1 
ATOM   427  C CZ    . ARG A 1 60  ? 11.074  48.181  36.278 1.00 55.62  ? 86  ARG A CZ    1 
ATOM   428  N NH1   . ARG A 1 60  ? 11.399  49.234  37.027 1.00 57.48  ? 86  ARG A NH1   1 
ATOM   429  N NH2   . ARG A 1 60  ? 10.090  47.380  36.668 1.00 57.44  ? 86  ARG A NH2   1 
ATOM   430  N N     . ALA A 1 61  ? 14.772  52.418  30.870 1.00 44.37  ? 87  ALA A N     1 
ATOM   431  C CA    . ALA A 1 61  ? 15.953  52.958  30.198 1.00 44.36  ? 87  ALA A CA    1 
ATOM   432  C C     . ALA A 1 61  ? 15.930  54.492  30.190 1.00 44.66  ? 87  ALA A C     1 
ATOM   433  O O     . ALA A 1 61  ? 16.963  55.127  30.341 1.00 45.07  ? 87  ALA A O     1 
ATOM   434  C CB    . ALA A 1 61  ? 16.059  52.406  28.776 1.00 43.35  ? 87  ALA A CB    1 
ATOM   435  N N     . MET A 1 62  ? 14.749  55.089  30.039 1.00 44.75  ? 88  MET A N     1 
ATOM   436  C CA    . MET A 1 62  ? 14.648  56.552  30.107 1.00 46.16  ? 88  MET A CA    1 
ATOM   437  C C     . MET A 1 62  ? 15.175  57.077  31.447 1.00 47.43  ? 88  MET A C     1 
ATOM   438  O O     . MET A 1 62  ? 15.860  58.110  31.499 1.00 48.19  ? 88  MET A O     1 
ATOM   439  C CB    . MET A 1 62  ? 13.213  57.012  29.894 1.00 46.74  ? 88  MET A CB    1 
ATOM   440  C CG    . MET A 1 62  ? 12.713  56.861  28.477 1.00 46.39  ? 88  MET A CG    1 
ATOM   441  S SD    . MET A 1 62  ? 10.963  57.284  28.391 1.00 49.98  ? 88  MET A SD    1 
ATOM   442  C CE    . MET A 1 62  ? 11.037  59.067  28.423 1.00 49.26  ? 88  MET A CE    1 
ATOM   443  N N     . GLY A 1 63  ? 14.871  56.345  32.518 1.00 47.76  ? 89  GLY A N     1 
ATOM   444  C CA    . GLY A 1 63  ? 15.388  56.666  33.844 1.00 50.13  ? 89  GLY A CA    1 
ATOM   445  C C     . GLY A 1 63  ? 16.901  56.554  33.925 1.00 50.86  ? 89  GLY A C     1 
ATOM   446  O O     . GLY A 1 63  ? 17.580  57.472  34.389 1.00 51.92  ? 89  GLY A O     1 
ATOM   447  N N     . ARG A 1 64  ? 17.426  55.427  33.460 1.00 50.50  ? 90  ARG A N     1 
ATOM   448  C CA    . ARG A 1 64  ? 18.862  55.181  33.467 1.00 51.85  ? 90  ARG A CA    1 
ATOM   449  C C     . ARG A 1 64  ? 19.586  56.171  32.550 1.00 51.36  ? 90  ARG A C     1 
ATOM   450  O O     . ARG A 1 64  ? 20.648  56.678  32.900 1.00 52.47  ? 90  ARG A O     1 
ATOM   451  C CB    . ARG A 1 64  ? 19.158  53.752  33.015 1.00 52.03  ? 90  ARG A CB    1 
ATOM   452  C CG    . ARG A 1 64  ? 18.643  52.652  33.929 1.00 55.82  ? 90  ARG A CG    1 
ATOM   453  C CD    . ARG A 1 64  ? 18.988  51.267  33.337 1.00 62.02  ? 90  ARG A CD    1 
ATOM   454  N NE    . ARG A 1 64  ? 19.276  50.273  34.379 1.00 67.91  ? 90  ARG A NE    1 
ATOM   455  C CZ    . ARG A 1 64  ? 20.021  49.173  34.216 1.00 70.51  ? 90  ARG A CZ    1 
ATOM   456  N NH1   . ARG A 1 64  ? 20.583  48.887  33.044 1.00 69.90  ? 90  ARG A NH1   1 
ATOM   457  N NH2   . ARG A 1 64  ? 20.212  48.349  35.244 1.00 74.13  ? 90  ARG A NH2   1 
ATOM   458  N N     . LEU A 1 65  ? 18.990  56.460  31.396 1.00 49.81  ? 91  LEU A N     1 
ATOM   459  C CA    . LEU A 1 65  ? 19.640  57.261  30.358 1.00 50.09  ? 91  LEU A CA    1 
ATOM   460  C C     . LEU A 1 65  ? 19.407  58.753  30.500 1.00 51.07  ? 91  LEU A C     1 
ATOM   461  O O     . LEU A 1 65  ? 19.951  59.539  29.716 1.00 51.67  ? 91  LEU A O     1 
ATOM   462  C CB    . LEU A 1 65  ? 19.186  56.808  28.969 1.00 49.01  ? 91  LEU A CB    1 
ATOM   463  C CG    . LEU A 1 65  ? 19.684  55.439  28.502 1.00 48.71  ? 91  LEU A CG    1 
ATOM   464  C CD1   . LEU A 1 65  ? 19.000  55.048  27.196 1.00 47.24  ? 91  LEU A CD1   1 
ATOM   465  C CD2   . LEU A 1 65  ? 21.188  55.478  28.336 1.00 51.40  ? 91  LEU A CD2   1 
ATOM   466  N N     . LYS A 1 66  ? 18.618  59.124  31.511 1.00 51.73  ? 92  LYS A N     1 
ATOM   467  C CA    . LYS A 1 66  ? 18.148  60.500  31.740 1.00 53.48  ? 92  LYS A CA    1 
ATOM   468  C C     . LYS A 1 66  ? 17.572  61.172  30.478 1.00 53.32  ? 92  LYS A C     1 
ATOM   469  O O     . LYS A 1 66  ? 18.042  62.226  30.035 1.00 54.58  ? 92  LYS A O     1 
ATOM   470  C CB    . LYS A 1 66  ? 19.219  61.365  32.417 1.00 55.64  ? 92  LYS A CB    1 
ATOM   471  C CG    . LYS A 1 66  ? 18.659  62.574  33.206 1.00 59.51  ? 92  LYS A CG    1 
ATOM   472  C CD    . LYS A 1 66  ? 17.986  62.146  34.524 1.00 63.50  ? 92  LYS A CD    1 
ATOM   473  C CE    . LYS A 1 66  ? 17.161  63.281  35.161 1.00 68.05  ? 92  LYS A CE    1 
ATOM   474  N NZ    . LYS A 1 66  ? 17.991  64.453  35.599 1.00 71.68  ? 92  LYS A NZ    1 
ATOM   475  N N     . ILE A 1 67  ? 16.570  60.518  29.900 1.00 52.07  ? 93  ILE A N     1 
ATOM   476  C CA    . ILE A 1 67  ? 15.784  61.074  28.805 1.00 52.73  ? 93  ILE A CA    1 
ATOM   477  C C     . ILE A 1 67  ? 14.408  61.385  29.379 1.00 53.55  ? 93  ILE A C     1 
ATOM   478  O O     . ILE A 1 67  ? 13.769  60.518  29.988 1.00 52.34  ? 93  ILE A O     1 
ATOM   479  C CB    . ILE A 1 67  ? 15.616  60.069  27.647 1.00 51.65  ? 93  ILE A CB    1 
ATOM   480  C CG1   . ILE A 1 67  ? 16.982  59.589  27.149 1.00 51.72  ? 93  ILE A CG1   1 
ATOM   481  C CG2   . ILE A 1 67  ? 14.790  60.682  26.508 1.00 52.26  ? 93  ILE A CG2   1 
ATOM   482  C CD1   . ILE A 1 67  ? 16.930  58.353  26.261 1.00 50.07  ? 93  ILE A CD1   1 
ATOM   483  N N     . ASP A 1 68  ? 13.979  62.629  29.207 1.00 55.64  ? 94  ASP A N     1 
ATOM   484  C CA    . ASP A 1 68  ? 12.692  63.082  29.704 1.00 57.82  ? 94  ASP A CA    1 
ATOM   485  C C     . ASP A 1 68  ? 11.571  62.795  28.701 1.00 57.31  ? 94  ASP A C     1 
ATOM   486  O O     . ASP A 1 68  ? 11.819  62.636  27.504 1.00 56.68  ? 94  ASP A O     1 
ATOM   487  C CB    . ASP A 1 68  ? 12.750  64.585  30.029 1.00 61.31  ? 94  ASP A CB    1 
ATOM   488  C CG    . ASP A 1 68  ? 13.783  64.917  31.103 1.00 64.09  ? 94  ASP A CG    1 
ATOM   489  O OD1   . ASP A 1 68  ? 14.060  64.062  31.985 1.00 64.97  ? 94  ASP A OD1   1 
ATOM   490  O OD2   . ASP A 1 68  ? 14.324  66.043  31.060 1.00 68.44  ? 94  ASP A OD2   1 
ATOM   491  N N     . PHE A 1 69  ? 10.342  62.722  29.201 1.00 57.85  ? 95  PHE A N     1 
ATOM   492  C CA    . PHE A 1 69  ? 9.162   62.602  28.342 1.00 58.31  ? 95  PHE A CA    1 
ATOM   493  C C     . PHE A 1 69  ? 9.000   63.860  27.517 1.00 61.38  ? 95  PHE A C     1 
ATOM   494  O O     . PHE A 1 69  ? 9.294   64.947  27.998 1.00 63.76  ? 95  PHE A O     1 
ATOM   495  C CB    . PHE A 1 69  ? 7.914   62.412  29.192 1.00 59.03  ? 95  PHE A CB    1 
ATOM   496  C CG    . PHE A 1 69  ? 7.905   61.143  29.971 1.00 55.41  ? 95  PHE A CG    1 
ATOM   497  C CD1   . PHE A 1 69  ? 7.668   59.928  29.339 1.00 52.12  ? 95  PHE A CD1   1 
ATOM   498  C CD2   . PHE A 1 69  ? 8.136   61.158  31.335 1.00 54.06  ? 95  PHE A CD2   1 
ATOM   499  C CE1   . PHE A 1 69  ? 7.666   58.746  30.058 1.00 50.23  ? 95  PHE A CE1   1 
ATOM   500  C CE2   . PHE A 1 69  ? 8.136   59.980  32.062 1.00 52.45  ? 95  PHE A CE2   1 
ATOM   501  C CZ    . PHE A 1 69  ? 7.899   58.772  31.425 1.00 50.30  ? 95  PHE A CZ    1 
ATOM   502  N N     . GLY A 1 70  ? 8.540   63.718  26.279 1.00 66.15  ? 96  GLY A N     1 
ATOM   503  C CA    . GLY A 1 70  ? 8.240   64.878  25.433 1.00 68.54  ? 96  GLY A CA    1 
ATOM   504  C C     . GLY A 1 70  ? 7.243   65.822  26.093 1.00 69.05  ? 96  GLY A C     1 
ATOM   505  O O     . GLY A 1 70  ? 7.448   67.041  26.129 1.00 70.99  ? 96  GLY A O     1 
ATOM   506  N N     . ASP A 1 71  ? 6.161   65.244  26.618 1.00 67.82  ? 97  ASP A N     1 
ATOM   507  C CA    . ASP A 1 71  ? 5.154   65.974  27.386 1.00 68.60  ? 97  ASP A CA    1 
ATOM   508  C C     . ASP A 1 71  ? 5.157   65.445  28.817 1.00 67.74  ? 97  ASP A C     1 
ATOM   509  O O     . ASP A 1 71  ? 5.091   64.239  29.028 1.00 66.05  ? 97  ASP A O     1 
ATOM   510  C CB    . ASP A 1 71  ? 3.771   65.775  26.762 1.00 68.73  ? 97  ASP A CB    1 
ATOM   511  C CG    . ASP A 1 71  ? 3.731   66.120  25.266 1.00 71.46  ? 97  ASP A CG    1 
ATOM   512  O OD1   . ASP A 1 71  ? 4.701   65.805  24.532 1.00 72.85  ? 97  ASP A OD1   1 
ATOM   513  O OD2   . ASP A 1 71  ? 2.709   66.695  24.818 1.00 73.76  ? 97  ASP A OD2   1 
ATOM   514  N N     . SER A 1 72  ? 5.231   66.338  29.799 1.00 69.63  ? 98  SER A N     1 
ATOM   515  C CA    . SER A 1 72  ? 5.371   65.930  31.202 1.00 70.45  ? 98  SER A CA    1 
ATOM   516  C C     . SER A 1 72  ? 4.166   65.181  31.768 1.00 69.80  ? 98  SER A C     1 
ATOM   517  O O     . SER A 1 72  ? 4.273   64.499  32.794 1.00 70.10  ? 98  SER A O     1 
ATOM   518  C CB    . SER A 1 72  ? 5.720   67.125  32.091 1.00 73.58  ? 98  SER A CB    1 
ATOM   519  O OG    . SER A 1 72  ? 5.053   68.298  31.654 1.00 76.46  ? 98  SER A OG    1 
ATOM   520  N N     . ALA A 1 73  ? 3.025   65.303  31.098 1.00 70.01  ? 99  ALA A N     1 
ATOM   521  C CA    . ALA A 1 73  ? 1.825   64.564  31.472 1.00 69.78  ? 99  ALA A CA    1 
ATOM   522  C C     . ALA A 1 73  ? 2.024   63.045  31.363 1.00 67.64  ? 99  ALA A C     1 
ATOM   523  O O     . ALA A 1 73  ? 1.368   62.280  32.079 1.00 67.81  ? 99  ALA A O     1 
ATOM   524  C CB    . ALA A 1 73  ? 0.661   65.006  30.613 1.00 71.18  ? 99  ALA A CB    1 
ATOM   525  N N     . ARG A 1 74  ? 2.931   62.616  30.477 1.00 66.14  ? 100 ARG A N     1 
ATOM   526  C CA    . ARG A 1 74  ? 3.218   61.184  30.261 1.00 64.21  ? 100 ARG A CA    1 
ATOM   527  C C     . ARG A 1 74  ? 3.757   60.498  31.504 1.00 63.55  ? 100 ARG A C     1 
ATOM   528  O O     . ARG A 1 74  ? 3.615   59.280  31.657 1.00 62.31  ? 100 ARG A O     1 
ATOM   529  C CB    . ARG A 1 74  ? 4.199   60.973  29.104 1.00 63.75  ? 100 ARG A CB    1 
ATOM   530  C CG    . ARG A 1 74  ? 3.710   61.450  27.739 1.00 65.45  ? 100 ARG A CG    1 
ATOM   531  C CD    . ARG A 1 74  ? 2.429   60.753  27.306 1.00 67.71  ? 100 ARG A CD    1 
ATOM   532  N NE    . ARG A 1 74  ? 1.514   61.712  26.693 1.00 70.89  ? 100 ARG A NE    1 
ATOM   533  C CZ    . ARG A 1 74  ? 0.560   62.363  27.348 1.00 71.58  ? 100 ARG A CZ    1 
ATOM   534  N NH1   . ARG A 1 74  ? -0.208  63.220  26.700 1.00 74.16  ? 100 ARG A NH1   1 
ATOM   535  N NH2   . ARG A 1 74  ? 0.365   62.156  28.644 1.00 71.41  ? 100 ARG A NH2   1 
ATOM   536  N N     . ALA A 1 75  ? 4.373   61.284  32.387 1.00 64.72  ? 101 ALA A N     1 
ATOM   537  C CA    . ALA A 1 75  ? 4.945   60.758  33.617 1.00 65.18  ? 101 ALA A CA    1 
ATOM   538  C C     . ALA A 1 75  ? 3.862   60.118  34.465 1.00 65.37  ? 101 ALA A C     1 
ATOM   539  O O     . ALA A 1 75  ? 4.080   59.070  35.077 1.00 64.99  ? 101 ALA A O     1 
ATOM   540  C CB    . ALA A 1 75  ? 5.666   61.847  34.385 1.00 67.71  ? 101 ALA A CB    1 
ATOM   541  N N     . ASP A 1 76  ? 2.688   60.745  34.481 1.00 66.62  ? 102 ASP A N     1 
ATOM   542  C CA    . ASP A 1 76  ? 1.529   60.186  35.176 1.00 67.64  ? 102 ASP A CA    1 
ATOM   543  C C     . ASP A 1 76  ? 0.983   58.943  34.481 1.00 65.55  ? 102 ASP A C     1 
ATOM   544  O O     . ASP A 1 76  ? 0.686   57.952  35.143 1.00 65.33  ? 102 ASP A O     1 
ATOM   545  C CB    . ASP A 1 76  ? 0.447   61.248  35.374 1.00 70.80  ? 102 ASP A CB    1 
ATOM   546  C CG    . ASP A 1 76  ? 0.794   62.215  36.492 1.00 74.82  ? 102 ASP A CG    1 
ATOM   547  O OD1   . ASP A 1 76  ? 0.848   61.769  37.665 1.00 77.27  ? 102 ASP A OD1   1 
ATOM   548  O OD2   . ASP A 1 76  ? 1.023   63.411  36.197 1.00 77.32  ? 102 ASP A OD2   1 
ATOM   549  N N     . ASP A 1 77  ? 0.866   58.992  33.156 1.00 64.56  ? 103 ASP A N     1 
ATOM   550  C CA    . ASP A 1 77  ? 0.605   57.787  32.359 1.00 63.86  ? 103 ASP A CA    1 
ATOM   551  C C     . ASP A 1 77  ? 1.564   56.646  32.739 1.00 62.40  ? 103 ASP A C     1 
ATOM   552  O O     . ASP A 1 77  ? 1.129   55.525  33.011 1.00 62.05  ? 103 ASP A O     1 
ATOM   553  C CB    . ASP A 1 77  ? 0.757   58.088  30.867 1.00 63.65  ? 103 ASP A CB    1 
ATOM   554  C CG    . ASP A 1 77  ? -0.443  58.801  30.274 1.00 66.12  ? 103 ASP A CG    1 
ATOM   555  O OD1   . ASP A 1 77  ? -1.516  58.858  30.916 1.00 69.01  ? 103 ASP A OD1   1 
ATOM   556  O OD2   . ASP A 1 77  ? -0.310  59.295  29.133 1.00 67.08  ? 103 ASP A OD2   1 
ATOM   557  N N     . ALA A 1 78  ? 2.864   56.958  32.770 1.00 62.01  ? 104 ALA A N     1 
ATOM   558  C CA    . ALA A 1 78  ? 3.922   55.985  33.092 1.00 61.52  ? 104 ALA A CA    1 
ATOM   559  C C     . ALA A 1 78  ? 3.756   55.437  34.494 1.00 62.57  ? 104 ALA A C     1 
ATOM   560  O O     . ALA A 1 78  ? 3.864   54.232  34.711 1.00 62.61  ? 104 ALA A O     1 
ATOM   561  C CB    . ALA A 1 78  ? 5.303   56.608  32.923 1.00 61.60  ? 104 ALA A CB    1 
ATOM   562  N N     . ARG A 1 79  ? 3.478   56.325  35.441 1.00 64.26  ? 105 ARG A N     1 
ATOM   563  C CA    . ARG A 1 79  ? 3.159   55.929  36.808 1.00 66.28  ? 105 ARG A CA    1 
ATOM   564  C C     . ARG A 1 79  ? 1.938   54.999  36.830 1.00 66.38  ? 105 ARG A C     1 
ATOM   565  O O     . ARG A 1 79  ? 1.928   53.978  37.525 1.00 67.07  ? 105 ARG A O     1 
ATOM   566  C CB    . ARG A 1 79  ? 2.901   57.182  37.652 1.00 68.95  ? 105 ARG A CB    1 
ATOM   567  C CG    . ARG A 1 79  ? 3.249   57.044  39.120 1.00 72.24  ? 105 ARG A CG    1 
ATOM   568  C CD    . ARG A 1 79  ? 3.243   58.407  39.807 1.00 76.97  ? 105 ARG A CD    1 
ATOM   569  N NE    . ARG A 1 79  ? 4.505   59.133  39.637 1.00 77.65  ? 105 ARG A NE    1 
ATOM   570  C CZ    . ARG A 1 79  ? 4.709   60.135  38.782 1.00 76.87  ? 105 ARG A CZ    1 
ATOM   571  N NH1   . ARG A 1 79  ? 3.734   60.558  37.984 1.00 75.22  ? 105 ARG A NH1   1 
ATOM   572  N NH2   . ARG A 1 79  ? 5.904   60.717  38.726 1.00 77.66  ? 105 ARG A NH2   1 
ATOM   573  N N     . GLN A 1 80  ? 0.928   55.363  36.040 1.00 66.35  ? 106 GLN A N     1 
ATOM   574  C CA    . GLN A 1 80  ? -0.356  54.659  35.962 1.00 67.34  ? 106 GLN A CA    1 
ATOM   575  C C     . GLN A 1 80  ? -0.229  53.286  35.302 1.00 65.73  ? 106 GLN A C     1 
ATOM   576  O O     . GLN A 1 80  ? -0.936  52.338  35.665 1.00 66.98  ? 106 GLN A O     1 
ATOM   577  C CB    . GLN A 1 80  ? -1.341  55.519  35.166 1.00 68.71  ? 106 GLN A CB    1 
ATOM   578  C CG    . GLN A 1 80  ? -2.745  54.976  35.069 1.00 72.39  ? 106 GLN A CG    1 
ATOM   579  C CD    . GLN A 1 80  ? -3.698  55.601  36.065 1.00 76.24  ? 106 GLN A CD    1 
ATOM   580  O OE1   . GLN A 1 80  ? -4.886  55.301  36.058 1.00 79.69  ? 106 GLN A OE1   1 
ATOM   581  N NE2   . GLN A 1 80  ? -3.185  56.482  36.917 1.00 77.25  ? 106 GLN A NE2   1 
ATOM   582  N N     . LEU A 1 81  ? 0.669   53.196  34.324 1.00 63.27  ? 107 LEU A N     1 
ATOM   583  C CA    . LEU A 1 81  ? 0.928   51.958  33.605 1.00 61.97  ? 107 LEU A CA    1 
ATOM   584  C C     . LEU A 1 81  ? 1.219   50.804  34.560 1.00 62.06  ? 107 LEU A C     1 
ATOM   585  O O     . LEU A 1 81  ? 0.713   49.699  34.377 1.00 62.58  ? 107 LEU A O     1 
ATOM   586  C CB    . LEU A 1 81  ? 2.089   52.159  32.622 1.00 60.70  ? 107 LEU A CB    1 
ATOM   587  C CG    . LEU A 1 81  ? 2.714   50.962  31.893 1.00 59.92  ? 107 LEU A CG    1 
ATOM   588  C CD1   . LEU A 1 81  ? 1.730   50.325  30.940 1.00 60.49  ? 107 LEU A CD1   1 
ATOM   589  C CD2   . LEU A 1 81  ? 3.962   51.410  31.156 1.00 58.73  ? 107 LEU A CD2   1 
ATOM   590  N N     . PHE A 1 82  ? 2.015   51.075  35.589 1.00 61.89  ? 108 PHE A N     1 
ATOM   591  C CA    . PHE A 1 82  ? 2.402   50.055  36.561 1.00 62.67  ? 108 PHE A CA    1 
ATOM   592  C C     . PHE A 1 82  ? 1.244   49.636  37.464 1.00 64.82  ? 108 PHE A C     1 
ATOM   593  O O     . PHE A 1 82  ? 1.177   48.479  37.904 1.00 65.95  ? 108 PHE A O     1 
ATOM   594  C CB    . PHE A 1 82  ? 3.599   50.527  37.388 1.00 62.88  ? 108 PHE A CB    1 
ATOM   595  C CG    . PHE A 1 82  ? 4.867   50.660  36.589 1.00 61.57  ? 108 PHE A CG    1 
ATOM   596  C CD1   . PHE A 1 82  ? 5.758   49.595  36.486 1.00 61.85  ? 108 PHE A CD1   1 
ATOM   597  C CD2   . PHE A 1 82  ? 5.173   51.846  35.940 1.00 60.54  ? 108 PHE A CD2   1 
ATOM   598  C CE1   . PHE A 1 82  ? 6.932   49.711  35.745 1.00 61.45  ? 108 PHE A CE1   1 
ATOM   599  C CE2   . PHE A 1 82  ? 6.345   51.970  35.191 1.00 61.13  ? 108 PHE A CE2   1 
ATOM   600  C CZ    . PHE A 1 82  ? 7.226   50.899  35.094 1.00 60.79  ? 108 PHE A CZ    1 
ATOM   601  N N     . VAL A 1 83  ? 0.334   50.573  37.731 1.00 65.90  ? 109 VAL A N     1 
ATOM   602  C CA    . VAL A 1 83  ? -0.863  50.283  38.519 1.00 68.40  ? 109 VAL A CA    1 
ATOM   603  C C     . VAL A 1 83  ? -1.829  49.430  37.700 1.00 69.18  ? 109 VAL A C     1 
ATOM   604  O O     . VAL A 1 83  ? -2.244  48.355  38.142 1.00 70.74  ? 109 VAL A O     1 
ATOM   605  C CB    . VAL A 1 83  ? -1.570  51.579  39.008 1.00 70.55  ? 109 VAL A CB    1 
ATOM   606  C CG1   . VAL A 1 83  ? -2.823  51.239  39.812 1.00 74.17  ? 109 VAL A CG1   1 
ATOM   607  C CG2   . VAL A 1 83  ? -0.623  52.437  39.842 1.00 70.16  ? 109 VAL A CG2   1 
ATOM   608  N N     . LEU A 1 84  ? -2.164  49.911  36.504 1.00 65.62  ? 110 LEU A N     1 
ATOM   609  C CA    . LEU A 1 84  ? -3.108  49.236  35.603 1.00 65.14  ? 110 LEU A CA    1 
ATOM   610  C C     . LEU A 1 84  ? -2.670  47.848  35.130 1.00 64.94  ? 110 LEU A C     1 
ATOM   611  O O     . LEU A 1 84  ? -3.499  46.948  34.992 1.00 65.69  ? 110 LEU A O     1 
ATOM   612  C CB    . LEU A 1 84  ? -3.402  50.116  34.389 1.00 63.40  ? 110 LEU A CB    1 
ATOM   613  C CG    . LEU A 1 84  ? -4.128  51.437  34.648 1.00 63.92  ? 110 LEU A CG    1 
ATOM   614  C CD1   . LEU A 1 84  ? -4.315  52.194  33.353 1.00 62.31  ? 110 LEU A CD1   1 
ATOM   615  C CD2   . LEU A 1 84  ? -5.466  51.201  35.324 1.00 64.81  ? 110 LEU A CD2   1 
ATOM   616  N N     . ALA A 1 85  ? -1.374  47.687  34.868 1.00 64.32  ? 111 ALA A N     1 
ATOM   617  C CA    . ALA A 1 85  ? -0.813  46.395  34.485 1.00 64.51  ? 111 ALA A CA    1 
ATOM   618  C C     . ALA A 1 85  ? -0.898  45.441  35.659 1.00 67.20  ? 111 ALA A C     1 
ATOM   619  O O     . ALA A 1 85  ? -1.183  44.256  35.484 1.00 67.66  ? 111 ALA A O     1 
ATOM   620  C CB    . ALA A 1 85  ? 0.641   46.552  34.020 1.00 62.76  ? 111 ALA A CB    1 
ATOM   621  N N     . GLY A 1 86  ? -0.650  45.981  36.853 1.00 69.73  ? 112 GLY A N     1 
ATOM   622  C CA    . GLY A 1 86  ? -0.788  45.248  38.112 1.00 73.65  ? 112 GLY A CA    1 
ATOM   623  C C     . GLY A 1 86  ? -2.222  44.900  38.490 1.00 76.35  ? 112 GLY A C     1 
ATOM   624  O O     . GLY A 1 86  ? -2.452  43.896  39.173 1.00 78.59  ? 112 GLY A O     1 
ATOM   625  N N     . ALA A 1 87  ? -3.184  45.723  38.057 1.00 76.68  ? 113 ALA A N     1 
ATOM   626  C CA    . ALA A 1 87  ? -4.621  45.436  38.267 1.00 79.18  ? 113 ALA A CA    1 
ATOM   627  C C     . ALA A 1 87  ? -5.027  44.199  37.472 1.00 79.51  ? 113 ALA A C     1 
ATOM   628  O O     . ALA A 1 87  ? -6.079  43.596  37.729 1.00 81.45  ? 113 ALA A O     1 
ATOM   629  C CB    . ALA A 1 87  ? -5.496  46.635  37.888 1.00 78.42  ? 113 ALA A CB    1 
ATOM   630  N N     . ALA A 1 88  ? -4.185  43.860  36.493 1.00 77.99  ? 114 ALA A N     1 
ATOM   631  C CA    . ALA A 1 88  ? -4.151  42.545  35.848 1.00 78.44  ? 114 ALA A CA    1 
ATOM   632  C C     . ALA A 1 88  ? -5.288  42.274  34.874 1.00 78.28  ? 114 ALA A C     1 
ATOM   633  O O     . ALA A 1 88  ? -5.409  42.956  33.854 1.00 76.86  ? 114 ALA A O     1 
ATOM   634  C CB    . ALA A 1 88  ? -4.022  41.409  36.896 1.00 81.11  ? 114 ALA A CB    1 
ATOM   635  N N     . GLU A 1 89  ? -6.118  41.289  35.211 1.00 80.52  ? 115 GLU A N     1 
ATOM   636  C CA    . GLU A 1 89  ? -7.002  40.617  34.257 1.00 80.76  ? 115 GLU A CA    1 
ATOM   637  C C     . GLU A 1 89  ? -6.144  40.118  33.089 1.00 78.80  ? 115 GLU A C     1 
ATOM   638  O O     . GLU A 1 89  ? -6.151  40.676  31.981 1.00 76.75  ? 115 GLU A O     1 
ATOM   639  C CB    . GLU A 1 89  ? -8.172  41.507  33.811 1.00 80.59  ? 115 GLU A CB    1 
ATOM   640  C CG    . GLU A 1 89  ? -9.205  40.812  32.915 1.00 82.28  ? 115 GLU A CG    1 
ATOM   641  C CD    . GLU A 1 89  ? -10.031 39.740  33.617 1.00 86.75  ? 115 GLU A CD    1 
ATOM   642  O OE1   . GLU A 1 89  ? -10.492 39.964  34.761 1.00 89.05  ? 115 GLU A OE1   1 
ATOM   643  O OE2   . GLU A 1 89  ? -10.255 38.677  32.995 1.00 88.00  ? 115 GLU A OE2   1 
ATOM   644  N N     . GLU A 1 90  ? -5.371  39.078  33.396 1.00 79.30  ? 116 GLU A N     1 
ATOM   645  C CA    . GLU A 1 90  ? -4.540  38.378  32.439 1.00 77.84  ? 116 GLU A CA    1 
ATOM   646  C C     . GLU A 1 90  ? -5.407  37.978  31.253 1.00 76.99  ? 116 GLU A C     1 
ATOM   647  O O     . GLU A 1 90  ? -6.390  37.247  31.411 1.00 79.10  ? 116 GLU A O     1 
ATOM   648  C CB    . GLU A 1 90  ? -3.951  37.138  33.111 1.00 80.15  ? 116 GLU A CB    1 
ATOM   649  C CG    . GLU A 1 90  ? -2.648  36.646  32.528 1.00 80.35  ? 116 GLU A CG    1 
ATOM   650  C CD    . GLU A 1 90  ? -2.152  35.385  33.224 1.00 84.80  ? 116 GLU A CD    1 
ATOM   651  O OE1   . GLU A 1 90  ? -1.087  35.454  33.876 1.00 85.62  ? 116 GLU A OE1   1 
ATOM   652  O OE2   . GLU A 1 90  ? -2.830  34.333  33.129 1.00 86.39  ? 116 GLU A OE2   1 
ATOM   653  N N     . GLY A 1 91  ? -5.063  38.498  30.078 1.00 74.01  ? 117 GLY A N     1 
ATOM   654  C CA    . GLY A 1 91  ? -5.798  38.197  28.854 1.00 72.86  ? 117 GLY A CA    1 
ATOM   655  C C     . GLY A 1 91  ? -6.774  39.272  28.406 1.00 71.30  ? 117 GLY A C     1 
ATOM   656  O O     . GLY A 1 91  ? -7.497  39.085  27.421 1.00 71.62  ? 117 GLY A O     1 
ATOM   657  N N     . PHE A 1 92  ? -6.799  40.400  29.116 1.00 69.44  ? 118 PHE A N     1 
ATOM   658  C CA    . PHE A 1 92  ? -7.718  41.482  28.776 1.00 68.04  ? 118 PHE A CA    1 
ATOM   659  C C     . PHE A 1 92  ? -7.116  42.861  29.004 1.00 65.82  ? 118 PHE A C     1 
ATOM   660  O O     . PHE A 1 92  ? -6.535  43.137  30.058 1.00 65.58  ? 118 PHE A O     1 
ATOM   661  C CB    . PHE A 1 92  ? -9.050  41.333  29.539 1.00 70.00  ? 118 PHE A CB    1 
ATOM   662  C CG    . PHE A 1 92  ? -10.135 42.240  29.039 1.00 69.74  ? 118 PHE A CG    1 
ATOM   663  C CD1   . PHE A 1 92  ? -10.957 41.844  27.985 1.00 70.48  ? 118 PHE A CD1   1 
ATOM   664  C CD2   . PHE A 1 92  ? -10.332 43.500  29.613 1.00 69.12  ? 118 PHE A CD2   1 
ATOM   665  C CE1   . PHE A 1 92  ? -11.963 42.691  27.507 1.00 70.87  ? 118 PHE A CE1   1 
ATOM   666  C CE2   . PHE A 1 92  ? -11.326 44.356  29.142 1.00 68.47  ? 118 PHE A CE2   1 
ATOM   667  C CZ    . PHE A 1 92  ? -12.144 43.953  28.089 1.00 69.62  ? 118 PHE A CZ    1 
ATOM   668  N N     . MET A 1 93  ? -7.268  43.722  28.002 1.00 63.86  ? 119 MET A N     1 
ATOM   669  C CA    . MET A 1 93  ? -6.779  45.093  28.075 1.00 61.83  ? 119 MET A CA    1 
ATOM   670  C C     . MET A 1 93  ? -7.952  46.067  28.159 1.00 61.41  ? 119 MET A C     1 
ATOM   671  O O     . MET A 1 93  ? -8.796  46.115  27.261 1.00 61.43  ? 119 MET A O     1 
ATOM   672  C CB    . MET A 1 93  ? -5.892  45.422  26.867 1.00 60.50  ? 119 MET A CB    1 
ATOM   673  C CG    . MET A 1 93  ? -5.187  46.776  26.957 1.00 60.10  ? 119 MET A CG    1 
ATOM   674  S SD    . MET A 1 93  ? -3.898  47.013  25.707 1.00 62.01  ? 119 MET A SD    1 
ATOM   675  C CE    . MET A 1 93  ? -2.680  45.804  26.225 1.00 59.81  ? 119 MET A CE    1 
ATOM   676  N N     . THR A 1 94  ? -7.994  46.842  29.238 1.00 60.88  ? 120 THR A N     1 
ATOM   677  C CA    . THR A 1 94  ? -9.038  47.855  29.417 1.00 60.99  ? 120 THR A CA    1 
ATOM   678  C C     . THR A 1 94  ? -8.785  49.051  28.512 1.00 59.83  ? 120 THR A C     1 
ATOM   679  O O     . THR A 1 94  ? -7.673  49.239  28.016 1.00 58.61  ? 120 THR A O     1 
ATOM   680  C CB    . THR A 1 94  ? -9.136  48.355  30.871 1.00 61.78  ? 120 THR A CB    1 
ATOM   681  O OG1   . THR A 1 94  ? -7.955  49.095  31.208 1.00 60.92  ? 120 THR A OG1   1 
ATOM   682  C CG2   . THR A 1 94  ? -9.329  47.195  31.841 1.00 62.91  ? 120 THR A CG2   1 
ATOM   683  N N     . ALA A 1 95  ? -9.827  49.853  28.302 1.00 60.34  ? 121 ALA A N     1 
ATOM   684  C CA    . ALA A 1 95  ? -9.719  51.109  27.559 1.00 59.56  ? 121 ALA A CA    1 
ATOM   685  C C     . ALA A 1 95  ? -8.668  52.036  28.154 1.00 58.67  ? 121 ALA A C     1 
ATOM   686  O O     . ALA A 1 95  ? -7.969  52.738  27.428 1.00 57.73  ? 121 ALA A O     1 
ATOM   687  C CB    . ALA A 1 95  ? -11.065 51.813  27.519 1.00 61.04  ? 121 ALA A CB    1 
ATOM   688  N N     . GLU A 1 96  ? -8.567  52.055  29.477 1.00 59.17  ? 122 GLU A N     1 
ATOM   689  C CA    . GLU A 1 96  ? -7.624  52.965  30.116 1.00 59.00  ? 122 GLU A CA    1 
ATOM   690  C C     . GLU A 1 96  ? -6.173  52.508  29.950 1.00 56.84  ? 122 GLU A C     1 
ATOM   691  O O     . GLU A 1 96  ? -5.315  53.328  29.668 1.00 56.27  ? 122 GLU A O     1 
ATOM   692  C CB    . GLU A 1 96  ? -7.968  53.223  31.583 1.00 60.50  ? 122 GLU A CB    1 
ATOM   693  C CG    . GLU A 1 96  ? -7.440  54.577  32.068 1.00 62.90  ? 122 GLU A CG    1 
ATOM   694  C CD    . GLU A 1 96  ? -7.642  54.811  33.552 1.00 67.28  ? 122 GLU A CD    1 
ATOM   695  O OE1   . GLU A 1 96  ? -8.323  54.001  34.207 1.00 70.15  ? 122 GLU A OE1   1 
ATOM   696  O OE2   . GLU A 1 96  ? -7.120  55.818  34.070 1.00 69.91  ? 122 GLU A OE2   1 
ATOM   697  N N     . LEU A 1 97  ? -5.910  51.208  30.096 1.00 56.15  ? 123 LEU A N     1 
ATOM   698  C CA    . LEU A 1 97  ? -4.560  50.664  29.839 1.00 54.50  ? 123 LEU A CA    1 
ATOM   699  C C     . LEU A 1 97  ? -4.145  50.883  28.382 1.00 52.84  ? 123 LEU A C     1 
ATOM   700  O O     . LEU A 1 97  ? -3.065  51.393  28.120 1.00 51.97  ? 123 LEU A O     1 
ATOM   701  C CB    . LEU A 1 97  ? -4.450  49.179  30.229 1.00 54.61  ? 123 LEU A CB    1 
ATOM   702  C CG    . LEU A 1 97  ? -3.047  48.543  30.175 1.00 53.70  ? 123 LEU A CG    1 
ATOM   703  C CD1   . LEU A 1 97  ? -2.033  49.296  31.021 1.00 53.16  ? 123 LEU A CD1   1 
ATOM   704  C CD2   . LEU A 1 97  ? -3.100  47.081  30.594 1.00 55.43  ? 123 LEU A CD2   1 
ATOM   705  N N     . ALA A 1 98  ? -5.020  50.530  27.446 1.00 52.52  ? 124 ALA A N     1 
ATOM   706  C CA    . ALA A 1 98  ? -4.782  50.815  26.037 1.00 52.10  ? 124 ALA A CA    1 
ATOM   707  C C     . ALA A 1 98  ? -4.366  52.272  25.831 1.00 52.36  ? 124 ALA A C     1 
ATOM   708  O O     . ALA A 1 98  ? -3.327  52.548  25.211 1.00 51.84  ? 124 ALA A O     1 
ATOM   709  C CB    . ALA A 1 98  ? -6.016  50.485  25.208 1.00 52.58  ? 124 ALA A CB    1 
ATOM   710  N N     . GLY A 1 99  ? -5.169  53.194  26.371 1.00 53.43  ? 125 GLY A N     1 
ATOM   711  C CA    . GLY A 1 99  ? -4.910  54.629  26.266 1.00 54.06  ? 125 GLY A CA    1 
ATOM   712  C C     . GLY A 1 99  ? -3.540  55.007  26.789 1.00 53.93  ? 125 GLY A C     1 
ATOM   713  O O     . GLY A 1 99  ? -2.788  55.720  26.124 1.00 54.06  ? 125 GLY A O     1 
ATOM   714  N N     . VAL A 1 100 ? -3.211  54.516  27.978 1.00 53.97  ? 126 VAL A N     1 
ATOM   715  C CA    . VAL A 1 100 ? -1.944  54.845  28.616 1.00 54.28  ? 126 VAL A CA    1 
ATOM   716  C C     . VAL A 1 100 ? -0.773  54.411  27.747 1.00 52.95  ? 126 VAL A C     1 
ATOM   717  O O     . VAL A 1 100 ? 0.146   55.185  27.526 1.00 53.29  ? 126 VAL A O     1 
ATOM   718  C CB    . VAL A 1 100 ? -1.833  54.245  30.043 1.00 54.84  ? 126 VAL A CB    1 
ATOM   719  C CG1   . VAL A 1 100 ? -0.365  54.171  30.490 1.00 53.80  ? 126 VAL A CG1   1 
ATOM   720  C CG2   . VAL A 1 100 ? -2.671  55.064  31.031 1.00 55.49  ? 126 VAL A CG2   1 
ATOM   721  N N     . ILE A 1 101 ? -0.841  53.191  27.226 1.00 52.35  ? 127 ILE A N     1 
ATOM   722  C CA    . ILE A 1 101 ? 0.225   52.640  26.392 1.00 51.41  ? 127 ILE A CA    1 
ATOM   723  C C     . ILE A 1 101 ? 0.347   53.373  25.049 1.00 51.97  ? 127 ILE A C     1 
ATOM   724  O O     . ILE A 1 101 ? 1.463   53.669  24.607 1.00 51.75  ? 127 ILE A O     1 
ATOM   725  C CB    . ILE A 1 101 ? 0.067   51.104  26.182 1.00 50.51  ? 127 ILE A CB    1 
ATOM   726  C CG1   . ILE A 1 101 ? 0.078   50.388  27.534 1.00 50.57  ? 127 ILE A CG1   1 
ATOM   727  C CG2   . ILE A 1 101 ? 1.185   50.568  25.276 1.00 49.84  ? 127 ILE A CG2   1 
ATOM   728  C CD1   . ILE A 1 101 ? -0.096  48.883  27.477 1.00 50.10  ? 127 ILE A CD1   1 
ATOM   729  N N     . LYS A 1 102 ? -0.785  53.652  24.399 1.00 53.05  ? 128 LYS A N     1 
ATOM   730  C CA    . LYS A 1 102 ? -0.763  54.408  23.136 1.00 54.21  ? 128 LYS A CA    1 
ATOM   731  C C     . LYS A 1 102 ? -0.099  55.773  23.271 1.00 54.88  ? 128 LYS A C     1 
ATOM   732  O O     . LYS A 1 102 ? 0.673   56.164  22.402 1.00 55.52  ? 128 LYS A O     1 
ATOM   733  C CB    . LYS A 1 102 ? -2.163  54.573  22.525 1.00 55.43  ? 128 LYS A CB    1 
ATOM   734  C CG    . LYS A 1 102 ? -2.637  53.377  21.699 1.00 55.35  ? 128 LYS A CG    1 
ATOM   735  C CD    . LYS A 1 102 ? -4.035  53.615  21.138 1.00 57.69  ? 128 LYS A CD    1 
ATOM   736  C CE    . LYS A 1 102 ? -4.615  52.337  20.534 1.00 58.17  ? 128 LYS A CE    1 
ATOM   737  N NZ    . LYS A 1 102 ? -5.839  52.619  19.711 1.00 60.28  ? 128 LYS A NZ    1 
ATOM   738  N N     . ARG A 1 103 ? -0.403  56.495  24.347 1.00 55.59  ? 129 ARG A N     1 
ATOM   739  C CA    . ARG A 1 103 ? 0.152   57.831  24.542 1.00 56.49  ? 129 ARG A CA    1 
ATOM   740  C C     . ARG A 1 103 ? 1.635   57.781  24.942 1.00 55.69  ? 129 ARG A C     1 
ATOM   741  O O     . ARG A 1 103 ? 2.388   58.700  24.630 1.00 56.24  ? 129 ARG A O     1 
ATOM   742  C CB    . ARG A 1 103 ? -0.647  58.618  25.574 1.00 57.61  ? 129 ARG A CB    1 
ATOM   743  C CG    . ARG A 1 103 ? -2.078  58.957  25.145 1.00 59.95  ? 129 ARG A CG    1 
ATOM   744  C CD    . ARG A 1 103 ? -2.722  59.955  26.106 1.00 60.56  ? 129 ARG A CD    1 
ATOM   745  N NE    . ARG A 1 103 ? -2.745  59.473  27.489 1.00 60.36  ? 129 ARG A NE    1 
ATOM   746  C CZ    . ARG A 1 103 ? -3.704  58.707  28.011 1.00 60.84  ? 129 ARG A CZ    1 
ATOM   747  N NH1   . ARG A 1 103 ? -4.742  58.328  27.274 1.00 60.75  ? 129 ARG A NH1   1 
ATOM   748  N NH2   . ARG A 1 103 ? -3.633  58.333  29.285 1.00 60.66  ? 129 ARG A NH2   1 
ATOM   749  N N     . LEU A 1 104 ? 2.036   56.721  25.640 1.00 54.22  ? 130 LEU A N     1 
ATOM   750  C CA    . LEU A 1 104 ? 3.444   56.505  25.946 1.00 53.85  ? 130 LEU A CA    1 
ATOM   751  C C     . LEU A 1 104 ? 4.216   56.187  24.670 1.00 53.15  ? 130 LEU A C     1 
ATOM   752  O O     . LEU A 1 104 ? 5.139   56.912  24.308 1.00 53.49  ? 130 LEU A O     1 
ATOM   753  C CB    . LEU A 1 104 ? 3.635   55.417  27.014 1.00 52.71  ? 130 LEU A CB    1 
ATOM   754  C CG    . LEU A 1 104 ? 3.261   55.857  28.433 1.00 53.14  ? 130 LEU A CG    1 
ATOM   755  C CD1   . LEU A 1 104 ? 3.246   54.681  29.382 1.00 51.44  ? 130 LEU A CD1   1 
ATOM   756  C CD2   . LEU A 1 104 ? 4.183   56.964  28.948 1.00 53.41  ? 130 LEU A CD2   1 
ATOM   757  N N     . TRP A 1 105 ? 3.800   55.143  23.963 1.00 52.70  ? 131 TRP A N     1 
ATOM   758  C CA    . TRP A 1 105 ? 4.463   54.759  22.720 1.00 52.48  ? 131 TRP A CA    1 
ATOM   759  C C     . TRP A 1 105 ? 4.595   55.928  21.739 1.00 54.28  ? 131 TRP A C     1 
ATOM   760  O O     . TRP A 1 105 ? 5.576   56.007  20.996 1.00 54.96  ? 131 TRP A O     1 
ATOM   761  C CB    . TRP A 1 105 ? 3.760   53.554  22.080 1.00 51.90  ? 131 TRP A CB    1 
ATOM   762  C CG    . TRP A 1 105 ? 4.365   53.075  20.784 1.00 50.29  ? 131 TRP A CG    1 
ATOM   763  C CD1   . TRP A 1 105 ? 3.744   53.014  19.561 1.00 50.19  ? 131 TRP A CD1   1 
ATOM   764  C CD2   . TRP A 1 105 ? 5.705   52.597  20.581 1.00 47.73  ? 131 TRP A CD2   1 
ATOM   765  N NE1   . TRP A 1 105 ? 4.617   52.526  18.612 1.00 50.98  ? 131 TRP A NE1   1 
ATOM   766  C CE2   . TRP A 1 105 ? 5.825   52.259  19.213 1.00 48.36  ? 131 TRP A CE2   1 
ATOM   767  C CE3   . TRP A 1 105 ? 6.816   52.416  21.427 1.00 46.11  ? 131 TRP A CE3   1 
ATOM   768  C CZ2   . TRP A 1 105 ? 7.009   51.753  18.667 1.00 46.82  ? 131 TRP A CZ2   1 
ATOM   769  C CZ3   . TRP A 1 105 ? 7.994   51.914  20.888 1.00 43.85  ? 131 TRP A CZ3   1 
ATOM   770  C CH2   . TRP A 1 105 ? 8.081   51.587  19.518 1.00 46.82  ? 131 TRP A CH2   1 
ATOM   771  N N     . LYS A 1 106 ? 3.628   56.841  21.765 1.00 55.98  ? 132 LYS A N     1 
ATOM   772  C CA    . LYS A 1 106 ? 3.618   58.021  20.889 1.00 57.68  ? 132 LYS A CA    1 
ATOM   773  C C     . LYS A 1 106 ? 4.470   59.195  21.392 1.00 57.80  ? 132 LYS A C     1 
ATOM   774  O O     . LYS A 1 106 ? 4.784   60.108  20.621 1.00 59.06  ? 132 LYS A O     1 
ATOM   775  C CB    . LYS A 1 106 ? 2.174   58.500  20.701 1.00 59.79  ? 132 LYS A CB    1 
ATOM   776  C CG    . LYS A 1 106 ? 1.943   59.471  19.534 1.00 64.46  ? 132 LYS A CG    1 
ATOM   777  C CD    . LYS A 1 106 ? 1.671   58.727  18.223 1.00 67.99  ? 132 LYS A CD    1 
ATOM   778  C CE    . LYS A 1 106 ? 1.035   59.658  17.189 1.00 72.23  ? 132 LYS A CE    1 
ATOM   779  N NZ    . LYS A 1 106 ? 0.348   58.900  16.093 1.00 73.53  ? 132 LYS A NZ    1 
ATOM   780  N N     . ASP A 1 107 ? 4.816   59.193  22.679 1.00 56.42  ? 133 ASP A N     1 
ATOM   781  C CA    . ASP A 1 107 ? 5.573   60.302  23.267 1.00 57.10  ? 133 ASP A CA    1 
ATOM   782  C C     . ASP A 1 107 ? 6.947   60.430  22.596 1.00 56.55  ? 133 ASP A C     1 
ATOM   783  O O     . ASP A 1 107 ? 7.589   59.415  22.287 1.00 54.91  ? 133 ASP A O     1 
ATOM   784  C CB    . ASP A 1 107 ? 5.727   60.109  24.775 1.00 56.46  ? 133 ASP A CB    1 
ATOM   785  C CG    . ASP A 1 107 ? 6.599   61.173  25.413 1.00 58.80  ? 133 ASP A CG    1 
ATOM   786  O OD1   . ASP A 1 107 ? 6.107   62.312  25.603 1.00 62.55  ? 133 ASP A OD1   1 
ATOM   787  O OD2   . ASP A 1 107 ? 7.777   60.880  25.722 1.00 58.20  ? 133 ASP A OD2   1 
ATOM   788  N N     . SER A 1 108 ? 7.385   61.668  22.370 1.00 57.78  ? 134 SER A N     1 
ATOM   789  C CA    . SER A 1 108 ? 8.624   61.940  21.638 1.00 57.81  ? 134 SER A CA    1 
ATOM   790  C C     . SER A 1 108 ? 9.896   61.549  22.401 1.00 56.25  ? 134 SER A C     1 
ATOM   791  O O     . SER A 1 108 ? 10.913  61.248  21.783 1.00 56.34  ? 134 SER A O     1 
ATOM   792  C CB    . SER A 1 108 ? 8.693   63.400  21.188 1.00 60.57  ? 134 SER A CB    1 
ATOM   793  O OG    . SER A 1 108 ? 8.739   64.263  22.303 1.00 61.50  ? 134 SER A OG    1 
ATOM   794  N N     . GLY A 1 109 ? 9.840   61.556  23.731 1.00 55.48  ? 135 GLY A N     1 
ATOM   795  C CA    . GLY A 1 109 ? 10.950  61.073  24.551 1.00 53.90  ? 135 GLY A CA    1 
ATOM   796  C C     . GLY A 1 109 ? 11.047  59.548  24.547 1.00 51.55  ? 135 GLY A C     1 
ATOM   797  O O     . GLY A 1 109 ? 12.129  58.986  24.368 1.00 49.90  ? 135 GLY A O     1 
ATOM   798  N N     . VAL A 1 110 ? 9.902   58.889  24.741 1.00 50.68  ? 136 VAL A N     1 
ATOM   799  C CA    . VAL A 1 110 ? 9.795   57.435  24.677 1.00 48.58  ? 136 VAL A CA    1 
ATOM   800  C C     . VAL A 1 110 ? 10.343  56.962  23.332 1.00 48.09  ? 136 VAL A C     1 
ATOM   801  O O     . VAL A 1 110 ? 11.108  56.001  23.269 1.00 46.93  ? 136 VAL A O     1 
ATOM   802  C CB    . VAL A 1 110 ? 8.313   56.968  24.897 1.00 48.63  ? 136 VAL A CB    1 
ATOM   803  C CG1   . VAL A 1 110 ? 8.132   55.494  24.579 1.00 46.13  ? 136 VAL A CG1   1 
ATOM   804  C CG2   . VAL A 1 110 ? 7.870   57.251  26.335 1.00 48.70  ? 136 VAL A CG2   1 
ATOM   805  N N     . GLN A 1 111 ? 9.971   57.662  22.262 1.00 49.21  ? 137 GLN A N     1 
ATOM   806  C CA    . GLN A 1 111 ? 10.518  57.387  20.930 1.00 49.08  ? 137 GLN A CA    1 
ATOM   807  C C     . GLN A 1 111 ? 12.031  57.629  20.866 1.00 48.74  ? 137 GLN A C     1 
ATOM   808  O O     . GLN A 1 111 ? 12.767  56.804  20.320 1.00 48.46  ? 137 GLN A O     1 
ATOM   809  C CB    . GLN A 1 111 ? 9.776   58.181  19.845 1.00 50.83  ? 137 GLN A CB    1 
ATOM   810  C CG    . GLN A 1 111 ? 8.406   57.579  19.479 1.00 51.05  ? 137 GLN A CG    1 
ATOM   811  C CD    . GLN A 1 111 ? 8.504   56.117  19.031 1.00 49.70  ? 137 GLN A CD    1 
ATOM   812  O OE1   . GLN A 1 111 ? 9.203   55.794  18.079 1.00 50.81  ? 137 GLN A OE1   1 
ATOM   813  N NE2   . GLN A 1 111 ? 7.788   55.239  19.715 1.00 48.16  ? 137 GLN A NE2   1 
ATOM   814  N N     . ALA A 1 112 ? 12.497  58.736  21.442 1.00 48.96  ? 138 ALA A N     1 
ATOM   815  C CA    . ALA A 1 112 ? 13.931  59.010  21.485 1.00 48.45  ? 138 ALA A CA    1 
ATOM   816  C C     . ALA A 1 112 ? 14.681  57.846  22.154 1.00 46.08  ? 138 ALA A C     1 
ATOM   817  O O     . ALA A 1 112 ? 15.724  57.421  21.673 1.00 45.80  ? 138 ALA A O     1 
ATOM   818  C CB    . ALA A 1 112 ? 14.214  60.322  22.202 1.00 49.56  ? 138 ALA A CB    1 
ATOM   819  N N     . CYS A 1 113 ? 14.121  57.323  23.241 1.00 44.94  ? 139 CYS A N     1 
ATOM   820  C CA    . CYS A 1 113 ? 14.727  56.224  23.987 1.00 43.03  ? 139 CYS A CA    1 
ATOM   821  C C     . CYS A 1 113 ? 14.698  54.910  23.216 1.00 41.85  ? 139 CYS A C     1 
ATOM   822  O O     . CYS A 1 113 ? 15.660  54.141  23.244 1.00 41.32  ? 139 CYS A O     1 
ATOM   823  C CB    . CYS A 1 113 ? 14.048  56.049  25.341 1.00 42.61  ? 139 CYS A CB    1 
ATOM   824  S SG    . CYS A 1 113 ? 14.887  54.839  26.393 1.00 41.04  ? 139 CYS A SG    1 
ATOM   825  N N     . PHE A 1 114 ? 13.585  54.665  22.542 1.00 41.68  ? 140 PHE A N     1 
ATOM   826  C CA    . PHE A 1 114 ? 13.424  53.505  21.692 1.00 41.43  ? 140 PHE A CA    1 
ATOM   827  C C     . PHE A 1 114 ? 14.472  53.465  20.579 1.00 41.90  ? 140 PHE A C     1 
ATOM   828  O O     . PHE A 1 114 ? 15.016  52.406  20.279 1.00 41.84  ? 140 PHE A O     1 
ATOM   829  C CB    . PHE A 1 114 ? 12.017  53.503  21.073 1.00 41.90  ? 140 PHE A CB    1 
ATOM   830  C CG    . PHE A 1 114 ? 11.817  52.447  20.036 1.00 40.56  ? 140 PHE A CG    1 
ATOM   831  C CD1   . PHE A 1 114 ? 11.658  51.118  20.407 1.00 39.74  ? 140 PHE A CD1   1 
ATOM   832  C CD2   . PHE A 1 114 ? 11.784  52.783  18.677 1.00 42.06  ? 140 PHE A CD2   1 
ATOM   833  C CE1   . PHE A 1 114 ? 11.462  50.117  19.432 1.00 40.92  ? 140 PHE A CE1   1 
ATOM   834  C CE2   . PHE A 1 114 ? 11.604  51.804  17.694 1.00 41.88  ? 140 PHE A CE2   1 
ATOM   835  C CZ    . PHE A 1 114 ? 11.448  50.464  18.067 1.00 41.30  ? 140 PHE A CZ    1 
ATOM   836  N N     . ASN A 1 115 ? 14.724  54.611  19.959 1.00 43.00  ? 141 ASN A N     1 
ATOM   837  C CA    . ASN A 1 115 ? 15.755  54.728  18.941 1.00 44.04  ? 141 ASN A CA    1 
ATOM   838  C C     . ASN A 1 115 ? 17.163  54.573  19.492 1.00 43.14  ? 141 ASN A C     1 
ATOM   839  O O     . ASN A 1 115 ? 18.094  54.364  18.737 1.00 43.56  ? 141 ASN A O     1 
ATOM   840  C CB    . ASN A 1 115 ? 15.636  56.058  18.192 1.00 45.76  ? 141 ASN A CB    1 
ATOM   841  C CG    . ASN A 1 115 ? 14.415  56.112  17.326 1.00 47.55  ? 141 ASN A CG    1 
ATOM   842  O OD1   . ASN A 1 115 ? 13.947  55.080  16.833 1.00 49.03  ? 141 ASN A OD1   1 
ATOM   843  N ND2   . ASN A 1 115 ? 13.870  57.309  17.143 1.00 49.73  ? 141 ASN A ND2   1 
ATOM   844  N N     . ARG A 1 116 ? 17.311  54.675  20.807 1.00 42.35  ? 142 ARG A N     1 
ATOM   845  C CA    . ARG A 1 116 ? 18.602  54.403  21.429 1.00 41.41  ? 142 ARG A CA    1 
ATOM   846  C C     . ARG A 1 116 ? 18.703  52.991  22.017 1.00 40.02  ? 142 ARG A C     1 
ATOM   847  O O     . ARG A 1 116 ? 19.556  52.727  22.850 1.00 39.80  ? 142 ARG A O     1 
ATOM   848  C CB    . ARG A 1 116 ? 18.928  55.493  22.463 1.00 42.00  ? 142 ARG A CB    1 
ATOM   849  C CG    . ARG A 1 116 ? 19.190  56.870  21.794 1.00 41.78  ? 142 ARG A CG    1 
ATOM   850  C CD    . ARG A 1 116 ? 19.292  58.006  22.785 1.00 40.93  ? 142 ARG A CD    1 
ATOM   851  N NE    . ARG A 1 116 ? 20.316  57.746  23.787 1.00 41.49  ? 142 ARG A NE    1 
ATOM   852  C CZ    . ARG A 1 116 ? 20.602  58.534  24.828 1.00 42.94  ? 142 ARG A CZ    1 
ATOM   853  N NH1   . ARG A 1 116 ? 19.950  59.671  25.023 1.00 42.99  ? 142 ARG A NH1   1 
ATOM   854  N NH2   . ARG A 1 116 ? 21.565  58.179  25.676 1.00 41.02  ? 142 ARG A NH2   1 
ATOM   855  N N     . SER A 1 117 ? 17.851  52.075  21.555 1.00 40.16  ? 143 SER A N     1 
ATOM   856  C CA    . SER A 1 117 ? 17.820  50.689  22.098 1.00 39.38  ? 143 SER A CA    1 
ATOM   857  C C     . SER A 1 117 ? 19.155  49.957  22.096 1.00 38.39  ? 143 SER A C     1 
ATOM   858  O O     . SER A 1 117 ? 19.379  49.077  22.934 1.00 39.13  ? 143 SER A O     1 
ATOM   859  C CB    . SER A 1 117 ? 16.747  49.823  21.422 1.00 39.71  ? 143 SER A CB    1 
ATOM   860  O OG    . SER A 1 117 ? 16.845  49.862  20.005 1.00 40.25  ? 143 SER A OG    1 
ATOM   861  N N     . ARG A 1 118 ? 20.066  50.320  21.205 1.00 37.95  ? 144 ARG A N     1 
ATOM   862  C CA    . ARG A 1 118 ? 21.399  49.675  21.243 1.00 37.25  ? 144 ARG A CA    1 
ATOM   863  C C     . ARG A 1 118 ? 22.167  49.908  22.560 1.00 36.81  ? 144 ARG A C     1 
ATOM   864  O O     . ARG A 1 118 ? 23.146  49.230  22.829 1.00 37.13  ? 144 ARG A O     1 
ATOM   865  C CB    . ARG A 1 118 ? 22.245  50.094  20.038 1.00 37.16  ? 144 ARG A CB    1 
ATOM   866  C CG    . ARG A 1 118 ? 23.011  51.402  20.215 1.00 36.20  ? 144 ARG A CG    1 
ATOM   867  C CD    . ARG A 1 118 ? 23.570  51.836  18.882 1.00 35.63  ? 144 ARG A CD    1 
ATOM   868  N NE    . ARG A 1 118 ? 24.455  52.984  18.967 1.00 35.51  ? 144 ARG A NE    1 
ATOM   869  C CZ    . ARG A 1 118 ? 25.749  52.934  19.264 1.00 35.14  ? 144 ARG A CZ    1 
ATOM   870  N NH1   . ARG A 1 118 ? 26.350  51.782  19.536 1.00 32.90  ? 144 ARG A NH1   1 
ATOM   871  N NH2   . ARG A 1 118 ? 26.448  54.055  19.278 1.00 36.70  ? 144 ARG A NH2   1 
ATOM   872  N N     . GLU A 1 119 ? 21.719  50.857  23.377 1.00 36.91  ? 145 GLU A N     1 
ATOM   873  C CA    . GLU A 1 119 ? 22.355  51.136  24.672 1.00 36.90  ? 145 GLU A CA    1 
ATOM   874  C C     . GLU A 1 119 ? 21.830  50.277  25.819 1.00 37.12  ? 145 GLU A C     1 
ATOM   875  O O     . GLU A 1 119 ? 22.409  50.241  26.900 1.00 37.58  ? 145 GLU A O     1 
ATOM   876  C CB    . GLU A 1 119 ? 22.216  52.621  25.019 1.00 37.70  ? 145 GLU A CB    1 
ATOM   877  C CG    . GLU A 1 119 ? 22.712  53.558  23.896 1.00 37.63  ? 145 GLU A CG    1 
ATOM   878  C CD    . GLU A 1 119 ? 22.750  55.022  24.292 1.00 38.74  ? 145 GLU A CD    1 
ATOM   879  O OE1   . GLU A 1 119 ? 23.113  55.323  25.443 1.00 39.63  ? 145 GLU A OE1   1 
ATOM   880  O OE2   . GLU A 1 119 ? 22.425  55.880  23.443 1.00 39.80  ? 145 GLU A OE2   1 
ATOM   881  N N     . TYR A 1 120 ? 20.723  49.586  25.592 1.00 37.12  ? 146 TYR A N     1 
ATOM   882  C CA    . TYR A 1 120 ? 20.147  48.729  26.630 1.00 37.60  ? 146 TYR A CA    1 
ATOM   883  C C     . TYR A 1 120 ? 19.617  47.475  25.935 1.00 38.05  ? 146 TYR A C     1 
ATOM   884  O O     . TYR A 1 120 ? 19.886  47.269  24.742 1.00 38.62  ? 146 TYR A O     1 
ATOM   885  C CB    . TYR A 1 120 ? 19.077  49.477  27.449 1.00 37.13  ? 146 TYR A CB    1 
ATOM   886  C CG    . TYR A 1 120 ? 17.955  50.103  26.642 1.00 36.55  ? 146 TYR A CG    1 
ATOM   887  C CD1   . TYR A 1 120 ? 18.125  51.353  26.020 1.00 36.71  ? 146 TYR A CD1   1 
ATOM   888  C CD2   . TYR A 1 120 ? 16.723  49.470  26.517 1.00 33.17  ? 146 TYR A CD2   1 
ATOM   889  C CE1   . TYR A 1 120 ? 17.109  51.935  25.289 1.00 34.92  ? 146 TYR A CE1   1 
ATOM   890  C CE2   . TYR A 1 120 ? 15.695  50.046  25.784 1.00 33.88  ? 146 TYR A CE2   1 
ATOM   891  C CZ    . TYR A 1 120 ? 15.898  51.280  25.175 1.00 35.74  ? 146 TYR A CZ    1 
ATOM   892  O OH    . TYR A 1 120 ? 14.891  51.868  24.433 1.00 36.96  ? 146 TYR A OH    1 
ATOM   893  N N     . LEU A 1 121 ? 18.871  46.644  26.643 1.00 38.83  ? 147 LEU A N     1 
ATOM   894  C CA    . LEU A 1 121 ? 18.376  45.402  26.060 1.00 40.04  ? 147 LEU A CA    1 
ATOM   895  C C     . LEU A 1 121 ? 16.878  45.454  25.777 1.00 39.84  ? 147 LEU A C     1 
ATOM   896  O O     . LEU A 1 121 ? 16.077  45.246  26.663 1.00 41.78  ? 147 LEU A O     1 
ATOM   897  C CB    . LEU A 1 121 ? 18.715  44.217  26.975 1.00 41.09  ? 147 LEU A CB    1 
ATOM   898  C CG    . LEU A 1 121 ? 20.189  44.004  27.362 1.00 43.67  ? 147 LEU A CG    1 
ATOM   899  C CD1   . LEU A 1 121 ? 20.311  42.975  28.491 1.00 47.03  ? 147 LEU A CD1   1 
ATOM   900  C CD2   . LEU A 1 121 ? 21.052  43.594  26.162 1.00 43.98  ? 147 LEU A CD2   1 
ATOM   901  N N     . LEU A 1 122 ? 16.500  45.734  24.539 1.00 39.31  ? 148 LEU A N     1 
ATOM   902  C CA    . LEU A 1 122 ? 15.084  45.735  24.141 1.00 38.36  ? 148 LEU A CA    1 
ATOM   903  C C     . LEU A 1 122 ? 14.801  44.577  23.178 1.00 38.98  ? 148 LEU A C     1 
ATOM   904  O O     . LEU A 1 122 ? 15.469  44.448  22.151 1.00 38.49  ? 148 LEU A O     1 
ATOM   905  C CB    . LEU A 1 122 ? 14.718  47.064  23.470 1.00 37.03  ? 148 LEU A CB    1 
ATOM   906  C CG    . LEU A 1 122 ? 13.242  47.281  23.094 1.00 36.79  ? 148 LEU A CG    1 
ATOM   907  C CD1   . LEU A 1 122 ? 12.286  47.228  24.303 1.00 33.65  ? 148 LEU A CD1   1 
ATOM   908  C CD2   . LEU A 1 122 ? 13.098  48.621  22.368 1.00 34.99  ? 148 LEU A CD2   1 
ATOM   909  N N     . ASN A 1 123 ? 13.818  43.745  23.509 1.00 39.65  ? 149 ASN A N     1 
ATOM   910  C CA    . ASN A 1 123 ? 13.488  42.587  22.683 1.00 40.90  ? 149 ASN A CA    1 
ATOM   911  C C     . ASN A 1 123 ? 12.996  43.007  21.294 1.00 41.01  ? 149 ASN A C     1 
ATOM   912  O O     . ASN A 1 123 ? 12.429  44.089  21.136 1.00 41.42  ? 149 ASN A O     1 
ATOM   913  C CB    . ASN A 1 123 ? 12.480  41.675  23.384 1.00 41.50  ? 149 ASN A CB    1 
ATOM   914  C CG    . ASN A 1 123 ? 11.062  42.210  23.336 1.00 42.10  ? 149 ASN A CG    1 
ATOM   915  O OD1   . ASN A 1 123 ? 10.294  41.894  22.419 1.00 44.80  ? 149 ASN A OD1   1 
ATOM   916  N ND2   . ASN A 1 123 ? 10.707  43.035  24.313 1.00 41.93  ? 149 ASN A ND2   1 
ATOM   917  N N     . ASP A 1 124 ? 13.220  42.168  20.286 1.00 41.44  ? 150 ASP A N     1 
ATOM   918  C CA    . ASP A 1 124 ? 12.812  42.546  18.919 1.00 41.90  ? 150 ASP A CA    1 
ATOM   919  C C     . ASP A 1 124 ? 11.331  42.365  18.576 1.00 42.80  ? 150 ASP A C     1 
ATOM   920  O O     . ASP A 1 124 ? 10.938  42.529  17.438 1.00 43.89  ? 150 ASP A O     1 
ATOM   921  C CB    . ASP A 1 124 ? 13.729  41.921  17.867 1.00 41.88  ? 150 ASP A CB    1 
ATOM   922  C CG    . ASP A 1 124 ? 15.104  42.574  17.846 1.00 41.02  ? 150 ASP A CG    1 
ATOM   923  O OD1   . ASP A 1 124 ? 15.154  43.824  17.857 1.00 39.74  ? 150 ASP A OD1   1 
ATOM   924  O OD2   . ASP A 1 124 ? 16.131  41.852  17.822 1.00 39.65  ? 150 ASP A OD2   1 
ATOM   925  N N     . SER A 1 125 ? 10.505  42.033  19.555 1.00 43.63  ? 151 SER A N     1 
ATOM   926  C CA    . SER A 1 125 ? 9.071   41.943  19.296 1.00 45.02  ? 151 SER A CA    1 
ATOM   927  C C     . SER A 1 125 ? 8.361   43.216  19.737 1.00 44.75  ? 151 SER A C     1 
ATOM   928  O O     . SER A 1 125 ? 7.162   43.388  19.465 1.00 45.89  ? 151 SER A O     1 
ATOM   929  C CB    . SER A 1 125 ? 8.470   40.703  19.959 1.00 45.98  ? 151 SER A CB    1 
ATOM   930  O OG    . SER A 1 125 ? 8.973   39.520  19.348 1.00 47.22  ? 151 SER A OG    1 
ATOM   931  N N     . ALA A 1 126 ? 9.118   44.120  20.367 1.00 43.87  ? 152 ALA A N     1 
ATOM   932  C CA    . ALA A 1 126 ? 8.590   45.368  20.928 1.00 43.84  ? 152 ALA A CA    1 
ATOM   933  C C     . ALA A 1 126 ? 7.942   46.282  19.898 1.00 44.47  ? 152 ALA A C     1 
ATOM   934  O O     . ALA A 1 126 ? 6.797   46.697  20.066 1.00 45.18  ? 152 ALA A O     1 
ATOM   935  C CB    . ALA A 1 126 ? 9.677   46.115  21.706 1.00 42.52  ? 152 ALA A CB    1 
ATOM   936  N N     . ALA A 1 127 ? 8.670   46.604  18.839 1.00 45.28  ? 153 ALA A N     1 
ATOM   937  C CA    . ALA A 1 127 ? 8.123   47.454  17.774 1.00 47.10  ? 153 ALA A CA    1 
ATOM   938  C C     . ALA A 1 127 ? 6.909   46.799  17.128 1.00 48.72  ? 153 ALA A C     1 
ATOM   939  O O     . ALA A 1 127 ? 5.932   47.474  16.826 1.00 50.07  ? 153 ALA A O     1 
ATOM   940  C CB    . ALA A 1 127 ? 9.176   47.746  16.717 1.00 47.45  ? 153 ALA A CB    1 
ATOM   941  N N     . TYR A 1 128 ? 6.983   45.484  16.934 1.00 49.52  ? 154 TYR A N     1 
ATOM   942  C CA    . TYR A 1 128 ? 5.945   44.732  16.255 1.00 51.21  ? 154 TYR A CA    1 
ATOM   943  C C     . TYR A 1 128 ? 4.601   44.880  16.951 1.00 51.48  ? 154 TYR A C     1 
ATOM   944  O O     . TYR A 1 128 ? 3.601   45.181  16.306 1.00 52.84  ? 154 TYR A O     1 
ATOM   945  C CB    . TYR A 1 128 ? 6.335   43.251  16.135 1.00 51.90  ? 154 TYR A CB    1 
ATOM   946  C CG    . TYR A 1 128 ? 5.233   42.377  15.570 1.00 53.51  ? 154 TYR A CG    1 
ATOM   947  C CD1   . TYR A 1 128 ? 5.131   42.148  14.196 1.00 54.95  ? 154 TYR A CD1   1 
ATOM   948  C CD2   . TYR A 1 128 ? 4.282   41.791  16.413 1.00 54.08  ? 154 TYR A CD2   1 
ATOM   949  C CE1   . TYR A 1 128 ? 4.109   41.344  13.672 1.00 57.23  ? 154 TYR A CE1   1 
ATOM   950  C CE2   . TYR A 1 128 ? 3.250   40.998  15.904 1.00 55.47  ? 154 TYR A CE2   1 
ATOM   951  C CZ    . TYR A 1 128 ? 3.175   40.776  14.537 1.00 57.92  ? 154 TYR A CZ    1 
ATOM   952  O OH    . TYR A 1 128 ? 2.162   39.991  14.040 1.00 59.96  ? 154 TYR A OH    1 
ATOM   953  N N     . TYR A 1 129 ? 4.585   44.673  18.265 1.00 50.70  ? 155 TYR A N     1 
ATOM   954  C CA    . TYR A 1 129 ? 3.348   44.761  19.045 1.00 50.78  ? 155 TYR A CA    1 
ATOM   955  C C     . TYR A 1 129 ? 2.873   46.191  19.250 1.00 50.71  ? 155 TYR A C     1 
ATOM   956  O O     . TYR A 1 129 ? 1.698   46.500  19.005 1.00 52.16  ? 155 TYR A O     1 
ATOM   957  C CB    . TYR A 1 129 ? 3.502   44.066  20.398 1.00 49.97  ? 155 TYR A CB    1 
ATOM   958  C CG    . TYR A 1 129 ? 3.554   42.563  20.306 1.00 50.88  ? 155 TYR A CG    1 
ATOM   959  C CD1   . TYR A 1 129 ? 2.587   41.859  19.597 1.00 52.28  ? 155 TYR A CD1   1 
ATOM   960  C CD2   . TYR A 1 129 ? 4.567   41.840  20.932 1.00 50.42  ? 155 TYR A CD2   1 
ATOM   961  C CE1   . TYR A 1 129 ? 2.628   40.475  19.507 1.00 53.57  ? 155 TYR A CE1   1 
ATOM   962  C CE2   . TYR A 1 129 ? 4.612   40.451  20.852 1.00 51.06  ? 155 TYR A CE2   1 
ATOM   963  C CZ    . TYR A 1 129 ? 3.640   39.781  20.136 1.00 52.78  ? 155 TYR A CZ    1 
ATOM   964  O OH    . TYR A 1 129 ? 3.663   38.413  20.045 1.00 54.86  ? 155 TYR A OH    1 
ATOM   965  N N     . LEU A 1 130 ? 3.780   47.057  19.690 1.00 55.81  ? 156 LEU A N     1 
ATOM   966  C CA    . LEU A 1 130 ? 3.462   48.462  19.955 1.00 55.89  ? 156 LEU A CA    1 
ATOM   967  C C     . LEU A 1 130 ? 3.021   49.242  18.708 1.00 56.84  ? 156 LEU A C     1 
ATOM   968  O O     . LEU A 1 130 ? 2.239   50.177  18.816 1.00 57.21  ? 156 LEU A O     1 
ATOM   969  C CB    . LEU A 1 130 ? 4.635   49.164  20.665 1.00 54.91  ? 156 LEU A CB    1 
ATOM   970  C CG    . LEU A 1 130 ? 4.961   48.659  22.080 1.00 53.71  ? 156 LEU A CG    1 
ATOM   971  C CD1   . LEU A 1 130 ? 6.335   49.141  22.575 1.00 49.96  ? 156 LEU A CD1   1 
ATOM   972  C CD2   . LEU A 1 130 ? 3.864   49.016  23.078 1.00 50.67  ? 156 LEU A CD2   1 
ATOM   973  N N     . ASN A 1 131 ? 3.514   48.863  17.530 1.00 57.92  ? 157 ASN A N     1 
ATOM   974  C CA    . ASN A 1 131 ? 3.036   49.480  16.282 1.00 59.40  ? 157 ASN A CA    1 
ATOM   975  C C     . ASN A 1 131 ? 1.682   48.929  15.811 1.00 60.77  ? 157 ASN A C     1 
ATOM   976  O O     . ASN A 1 131 ? 1.032   49.512  14.936 1.00 61.88  ? 157 ASN A O     1 
ATOM   977  C CB    . ASN A 1 131 ? 4.086   49.390  15.166 1.00 59.32  ? 157 ASN A CB    1 
ATOM   978  C CG    . ASN A 1 131 ? 5.145   50.478  15.272 1.00 59.01  ? 157 ASN A CG    1 
ATOM   979  O OD1   . ASN A 1 131 ? 4.879   51.575  15.760 1.00 58.42  ? 157 ASN A OD1   1 
ATOM   980  N ND2   . ASN A 1 131 ? 6.352   50.179  14.807 1.00 58.49  ? 157 ASN A ND2   1 
ATOM   981  N N     . ASP A 1 132 ? 1.264   47.812  16.405 1.00 61.22  ? 158 ASP A N     1 
ATOM   982  C CA    . ASP A 1 132 ? -0.008  47.165  16.077 1.00 62.52  ? 158 ASP A CA    1 
ATOM   983  C C     . ASP A 1 132 ? -1.036  47.344  17.201 1.00 63.02  ? 158 ASP A C     1 
ATOM   984  O O     . ASP A 1 132 ? -1.929  46.512  17.352 1.00 63.71  ? 158 ASP A O     1 
ATOM   985  C CB    . ASP A 1 132 ? 0.211   45.661  15.860 1.00 62.41  ? 158 ASP A CB    1 
ATOM   986  C CG    . ASP A 1 132 ? 0.781   45.323  14.499 1.00 63.08  ? 158 ASP A CG    1 
ATOM   987  O OD1   . ASP A 1 132 ? 1.327   46.207  13.804 1.00 63.56  ? 158 ASP A OD1   1 
ATOM   988  O OD2   . ASP A 1 132 ? 0.684   44.137  14.124 1.00 63.93  ? 158 ASP A OD2   1 
ATOM   989  N N     . LEU A 1 133 ? -0.913  48.413  17.988 1.00 63.00  ? 159 LEU A N     1 
ATOM   990  C CA    . LEU A 1 133 ? -1.776  48.617  19.168 1.00 63.55  ? 159 LEU A CA    1 
ATOM   991  C C     . LEU A 1 133 ? -3.273  48.751  18.864 1.00 65.14  ? 159 LEU A C     1 
ATOM   992  O O     . LEU A 1 133 ? -4.108  48.276  19.644 1.00 65.71  ? 159 LEU A O     1 
ATOM   993  C CB    . LEU A 1 133 ? -1.302  49.824  19.986 1.00 62.78  ? 159 LEU A CB    1 
ATOM   994  C CG    . LEU A 1 133 ? -0.064  49.639  20.869 1.00 62.17  ? 159 LEU A CG    1 
ATOM   995  C CD1   . LEU A 1 133 ? 0.480   50.989  21.328 1.00 61.17  ? 159 LEU A CD1   1 
ATOM   996  C CD2   . LEU A 1 133 ? -0.359  48.733  22.070 1.00 62.47  ? 159 LEU A CD2   1 
ATOM   997  N N     . ASP A 1 134 ? -3.607  49.408  17.749 1.00 66.22  ? 160 ASP A N     1 
ATOM   998  C CA    . ASP A 1 134 ? -5.007  49.562  17.330 1.00 68.17  ? 160 ASP A CA    1 
ATOM   999  C C     . ASP A 1 134 ? -5.684  48.200  17.209 1.00 68.96  ? 160 ASP A C     1 
ATOM   1000 O O     . ASP A 1 134 ? -6.730  47.965  17.824 1.00 69.81  ? 160 ASP A O     1 
ATOM   1001 C CB    . ASP A 1 134 ? -5.125  50.343  16.010 1.00 69.04  ? 160 ASP A CB    1 
ATOM   1002 C CG    . ASP A 1 134 ? -4.940  51.863  16.188 1.00 70.37  ? 160 ASP A CG    1 
ATOM   1003 O OD1   . ASP A 1 134 ? -5.218  52.412  17.288 1.00 70.56  ? 160 ASP A OD1   1 
ATOM   1004 O OD2   . ASP A 1 134 ? -4.521  52.517  15.205 1.00 71.40  ? 160 ASP A OD2   1 
ATOM   1005 N N     . ARG A 1 135 ? -5.059  47.300  16.450 1.00 68.74  ? 161 ARG A N     1 
ATOM   1006 C CA    . ARG A 1 135 ? -5.580  45.946  16.251 1.00 69.68  ? 161 ARG A CA    1 
ATOM   1007 C C     . ARG A 1 135 ? -5.591  45.141  17.553 1.00 69.29  ? 161 ARG A C     1 
ATOM   1008 O O     . ARG A 1 135 ? -6.547  44.420  17.838 1.00 70.39  ? 161 ARG A O     1 
ATOM   1009 C CB    . ARG A 1 135 ? -4.774  45.220  15.158 1.00 69.49  ? 161 ARG A CB    1 
ATOM   1010 C CG    . ARG A 1 135 ? -5.153  43.747  14.917 1.00 70.48  ? 161 ARG A CG    1 
ATOM   1011 C CD    . ARG A 1 135 ? -4.345  43.110  13.776 1.00 71.34  ? 161 ARG A CD    1 
ATOM   1012 N NE    . ARG A 1 135 ? -2.905  43.056  14.055 1.00 70.48  ? 161 ARG A NE    1 
ATOM   1013 C CZ    . ARG A 1 135 ? -2.256  41.992  14.532 1.00 69.94  ? 161 ARG A CZ    1 
ATOM   1014 N NH1   . ARG A 1 135 ? -2.899  40.861  14.793 1.00 69.74  ? 161 ARG A NH1   1 
ATOM   1015 N NH2   . ARG A 1 135 ? -0.948  42.059  14.741 1.00 69.05  ? 161 ARG A NH2   1 
ATOM   1016 N N     . ILE A 1 136 ? -4.531  45.293  18.342 1.00 68.08  ? 162 ILE A N     1 
ATOM   1017 C CA    . ILE A 1 136 ? -4.262  44.431  19.499 1.00 67.71  ? 162 ILE A CA    1 
ATOM   1018 C C     . ILE A 1 136 ? -5.116  44.739  20.725 1.00 68.24  ? 162 ILE A C     1 
ATOM   1019 O O     . ILE A 1 136 ? -5.541  43.824  21.433 1.00 68.62  ? 162 ILE A O     1 
ATOM   1020 C CB    . ILE A 1 136 ? -2.745  44.455  19.850 1.00 66.43  ? 162 ILE A CB    1 
ATOM   1021 C CG1   . ILE A 1 136 ? -2.011  43.395  19.037 1.00 66.68  ? 162 ILE A CG1   1 
ATOM   1022 C CG2   . ILE A 1 136 ? -2.482  44.256  21.343 1.00 65.78  ? 162 ILE A CG2   1 
ATOM   1023 C CD1   . ILE A 1 136 ? -0.510  43.642  18.934 1.00 67.22  ? 162 ILE A CD1   1 
ATOM   1024 N N     . ALA A 1 137 ? -5.361  46.025  20.967 1.00 68.50  ? 163 ALA A N     1 
ATOM   1025 C CA    . ALA A 1 137 ? -6.016  46.474  22.199 1.00 69.34  ? 163 ALA A CA    1 
ATOM   1026 C C     . ALA A 1 137 ? -7.526  46.185  22.265 1.00 71.32  ? 163 ALA A C     1 
ATOM   1027 O O     . ALA A 1 137 ? -8.114  46.180  23.354 1.00 72.24  ? 163 ALA A O     1 
ATOM   1028 C CB    . ALA A 1 137 ? -5.735  47.951  22.433 1.00 68.69  ? 163 ALA A CB    1 
ATOM   1029 N N     . GLN A 1 138 ? -8.141  45.930  21.111 1.00 72.45  ? 164 GLN A N     1 
ATOM   1030 C CA    . GLN A 1 138 ? -9.581  45.637  21.031 1.00 74.89  ? 164 GLN A CA    1 
ATOM   1031 C C     . GLN A 1 138 ? -9.978  44.383  21.823 1.00 75.76  ? 164 GLN A C     1 
ATOM   1032 O O     . GLN A 1 138 ? -9.262  43.375  21.791 1.00 75.07  ? 164 GLN A O     1 
ATOM   1033 C CB    . GLN A 1 138 ? -10.020 45.487  19.573 1.00 75.80  ? 164 GLN A CB    1 
ATOM   1034 C CG    . GLN A 1 138 ? -10.062 46.783  18.788 1.00 76.49  ? 164 GLN A CG    1 
ATOM   1035 C CD    . GLN A 1 138 ? -9.956  46.558  17.291 1.00 78.87  ? 164 GLN A CD    1 
ATOM   1036 O OE1   . GLN A 1 138 ? -10.185 45.448  16.794 1.00 80.43  ? 164 GLN A OE1   1 
ATOM   1037 N NE2   . GLN A 1 138 ? -9.605  47.613  16.559 1.00 79.11  ? 164 GLN A NE2   1 
ATOM   1038 N N     . PRO A 1 139 ? -11.124 44.441  22.536 1.00 77.30  ? 165 PRO A N     1 
ATOM   1039 C CA    . PRO A 1 139 ? -11.619 43.301  23.326 1.00 78.39  ? 165 PRO A CA    1 
ATOM   1040 C C     . PRO A 1 139 ? -12.040 42.088  22.482 1.00 79.37  ? 165 PRO A C     1 
ATOM   1041 O O     . PRO A 1 139 ? -12.292 41.014  23.030 1.00 80.17  ? 165 PRO A O     1 
ATOM   1042 C CB    . PRO A 1 139 ? -12.826 43.888  24.076 1.00 80.12  ? 165 PRO A CB    1 
ATOM   1043 C CG    . PRO A 1 139 ? -13.247 45.071  23.266 1.00 80.33  ? 165 PRO A CG    1 
ATOM   1044 C CD    . PRO A 1 139 ? -11.976 45.633  22.701 1.00 78.31  ? 165 PRO A CD    1 
ATOM   1045 N N     . ASN A 1 140 ? -12.101 42.269  21.164 1.00 79.28  ? 166 ASN A N     1 
ATOM   1046 C CA    . ASN A 1 140 ? -12.436 41.200  20.220 1.00 80.34  ? 166 ASN A CA    1 
ATOM   1047 C C     . ASN A 1 140 ? -11.211 40.657  19.468 1.00 78.31  ? 166 ASN A C     1 
ATOM   1048 O O     . ASN A 1 140 ? -11.322 39.730  18.658 1.00 78.93  ? 166 ASN A O     1 
ATOM   1049 C CB    . ASN A 1 140 ? -13.498 41.694  19.227 1.00 82.43  ? 166 ASN A CB    1 
ATOM   1050 C CG    . ASN A 1 140 ? -13.168 43.073  18.646 1.00 82.50  ? 166 ASN A CG    1 
ATOM   1051 O OD1   . ASN A 1 140 ? -12.944 44.041  19.383 1.00 82.38  ? 166 ASN A OD1   1 
ATOM   1052 N ND2   . ASN A 1 140 ? -13.151 43.167  17.320 1.00 83.49  ? 166 ASN A ND2   1 
ATOM   1053 N N     . TYR A 1 141 ? -10.048 41.241  19.751 1.00 75.84  ? 167 TYR A N     1 
ATOM   1054 C CA    . TYR A 1 141 ? -8.775  40.848  19.145 1.00 73.64  ? 167 TYR A CA    1 
ATOM   1055 C C     . TYR A 1 141 ? -8.513  39.344  19.222 1.00 73.73  ? 167 TYR A C     1 
ATOM   1056 O O     . TYR A 1 141 ? -8.659  38.729  20.283 1.00 73.89  ? 167 TYR A O     1 
ATOM   1057 C CB    . TYR A 1 141 ? -7.628  41.642  19.798 1.00 71.76  ? 167 TYR A CB    1 
ATOM   1058 C CG    . TYR A 1 141 ? -6.236  41.062  19.643 1.00 69.03  ? 167 TYR A CG    1 
ATOM   1059 C CD1   . TYR A 1 141 ? -5.566  41.114  18.422 1.00 67.61  ? 167 TYR A CD1   1 
ATOM   1060 C CD2   . TYR A 1 141 ? -5.581  40.484  20.730 1.00 67.77  ? 167 TYR A CD2   1 
ATOM   1061 C CE1   . TYR A 1 141 ? -4.284  40.586  18.284 1.00 66.58  ? 167 TYR A CE1   1 
ATOM   1062 C CE2   . TYR A 1 141 ? -4.300  39.955  20.604 1.00 66.02  ? 167 TYR A CE2   1 
ATOM   1063 C CZ    . TYR A 1 141 ? -3.657  40.010  19.380 1.00 65.79  ? 167 TYR A CZ    1 
ATOM   1064 O OH    . TYR A 1 141 ? -2.388  39.491  19.245 1.00 64.89  ? 167 TYR A OH    1 
ATOM   1065 N N     . ILE A 1 142 ? -8.145  38.767  18.077 1.00 73.57  ? 168 ILE A N     1 
ATOM   1066 C CA    . ILE A 1 142 ? -7.702  37.374  17.986 1.00 73.44  ? 168 ILE A CA    1 
ATOM   1067 C C     . ILE A 1 142 ? -6.280  37.375  17.420 1.00 71.69  ? 168 ILE A C     1 
ATOM   1068 O O     . ILE A 1 142 ? -6.050  37.915  16.335 1.00 71.71  ? 168 ILE A O     1 
ATOM   1069 C CB    . ILE A 1 142 ? -8.637  36.520  17.082 1.00 75.30  ? 168 ILE A CB    1 
ATOM   1070 C CG1   . ILE A 1 142 ? -10.077 36.532  17.617 1.00 77.36  ? 168 ILE A CG1   1 
ATOM   1071 C CG2   . ILE A 1 142 ? -8.112  35.076  16.953 1.00 74.90  ? 168 ILE A CG2   1 
ATOM   1072 C CD1   . ILE A 1 142 ? -11.137 36.107  16.599 1.00 79.41  ? 168 ILE A CD1   1 
ATOM   1073 N N     . PRO A 1 143 ? -5.314  36.801  18.162 1.00 70.57  ? 169 PRO A N     1 
ATOM   1074 C CA    . PRO A 1 143 ? -3.934  36.760  17.673 1.00 69.12  ? 169 PRO A CA    1 
ATOM   1075 C C     . PRO A 1 143 ? -3.786  35.979  16.366 1.00 69.41  ? 169 PRO A C     1 
ATOM   1076 O O     . PRO A 1 143 ? -4.161  34.815  16.302 1.00 70.33  ? 169 PRO A O     1 
ATOM   1077 C CB    . PRO A 1 143 ? -3.185  36.053  18.808 1.00 68.40  ? 169 PRO A CB    1 
ATOM   1078 C CG    . PRO A 1 143 ? -3.985  36.329  20.010 1.00 69.03  ? 169 PRO A CG    1 
ATOM   1079 C CD    . PRO A 1 143 ? -5.412  36.306  19.547 1.00 70.82  ? 169 PRO A CD    1 
ATOM   1080 N N     . THR A 1 144 ? -3.254  36.633  15.336 1.00 69.08  ? 170 THR A N     1 
ATOM   1081 C CA    . THR A 1 144 ? -2.911  35.973  14.076 1.00 69.39  ? 170 THR A CA    1 
ATOM   1082 C C     . THR A 1 144 ? -1.748  35.010  14.299 1.00 68.95  ? 170 THR A C     1 
ATOM   1083 O O     . THR A 1 144 ? -1.137  34.997  15.373 1.00 68.52  ? 170 THR A O     1 
ATOM   1084 C CB    . THR A 1 144 ? -2.502  36.993  12.977 1.00 69.26  ? 170 THR A CB    1 
ATOM   1085 O OG1   . THR A 1 144 ? -1.267  37.638  13.339 1.00 67.04  ? 170 THR A OG1   1 
ATOM   1086 C CG2   . THR A 1 144 ? -3.601  38.038  12.754 1.00 69.08  ? 170 THR A CG2   1 
ATOM   1087 N N     . GLN A 1 145 ? -1.439  34.209  13.287 1.00 69.30  ? 171 GLN A N     1 
ATOM   1088 C CA    . GLN A 1 145 ? -0.301  33.296  13.354 1.00 68.84  ? 171 GLN A CA    1 
ATOM   1089 C C     . GLN A 1 145 ? 1.027   34.046  13.552 1.00 67.25  ? 171 GLN A C     1 
ATOM   1090 O O     . GLN A 1 145 ? 1.896   33.585  14.293 1.00 66.92  ? 171 GLN A O     1 
ATOM   1091 C CB    . GLN A 1 145 ? -0.251  32.425  12.096 1.00 69.72  ? 171 GLN A CB    1 
ATOM   1092 C CG    . GLN A 1 145 ? 0.401   31.070  12.307 1.00 70.74  ? 171 GLN A CG    1 
ATOM   1093 C CD    . GLN A 1 145 ? 0.098   30.090  11.180 1.00 73.31  ? 171 GLN A CD    1 
ATOM   1094 O OE1   . GLN A 1 145 ? -0.532  29.052  11.397 1.00 74.89  ? 171 GLN A OE1   1 
ATOM   1095 N NE2   . GLN A 1 145 ? 0.546   30.419  9.970  1.00 73.35  ? 171 GLN A NE2   1 
ATOM   1096 N N     . GLN A 1 146 ? 1.171   35.198  12.898 1.00 66.63  ? 172 GLN A N     1 
ATOM   1097 C CA    . GLN A 1 146 ? 2.359   36.045  13.040 1.00 65.45  ? 172 GLN A CA    1 
ATOM   1098 C C     . GLN A 1 146 ? 2.522   36.591  14.469 1.00 64.25  ? 172 GLN A C     1 
ATOM   1099 O O     . GLN A 1 146 ? 3.628   36.588  15.015 1.00 63.28  ? 172 GLN A O     1 
ATOM   1100 C CB    . GLN A 1 146 ? 2.331   37.189  12.022 1.00 65.84  ? 172 GLN A CB    1 
ATOM   1101 C CG    . GLN A 1 146 ? 3.641   37.981  11.920 1.00 67.01  ? 172 GLN A CG    1 
ATOM   1102 C CD    . GLN A 1 146 ? 4.765   37.230  11.206 1.00 68.97  ? 172 GLN A CD    1 
ATOM   1103 O OE1   . GLN A 1 146 ? 4.522   36.320  10.402 1.00 70.09  ? 172 GLN A OE1   1 
ATOM   1104 N NE2   . GLN A 1 146 ? 6.005   37.622  11.491 1.00 68.37  ? 172 GLN A NE2   1 
ATOM   1105 N N     . ASP A 1 147 ? 1.418   37.045  15.068 1.00 63.88  ? 173 ASP A N     1 
ATOM   1106 C CA    . ASP A 1 147 ? 1.400   37.443  16.477 1.00 62.74  ? 173 ASP A CA    1 
ATOM   1107 C C     . ASP A 1 147 ? 1.965   36.335  17.363 1.00 62.34  ? 173 ASP A C     1 
ATOM   1108 O O     . ASP A 1 147 ? 2.797   36.593  18.239 1.00 61.87  ? 173 ASP A O     1 
ATOM   1109 C CB    . ASP A 1 147 ? -0.025  37.760  16.947 1.00 63.49  ? 173 ASP A CB    1 
ATOM   1110 C CG    . ASP A 1 147 ? -0.622  38.979  16.272 1.00 63.22  ? 173 ASP A CG    1 
ATOM   1111 O OD1   . ASP A 1 147 ? 0.092   39.726  15.571 1.00 60.98  ? 173 ASP A OD1   1 
ATOM   1112 O OD2   . ASP A 1 147 ? -1.837  39.184  16.452 1.00 65.12  ? 173 ASP A OD2   1 
ATOM   1113 N N     . VAL A 1 148 ? 1.508   35.107  17.123 1.00 62.35  ? 174 VAL A N     1 
ATOM   1114 C CA    . VAL A 1 148 ? 1.909   33.944  17.911 1.00 62.19  ? 174 VAL A CA    1 
ATOM   1115 C C     . VAL A 1 148 ? 3.397   33.659  17.729 1.00 61.22  ? 174 VAL A C     1 
ATOM   1116 O O     . VAL A 1 148 ? 4.102   33.331  18.688 1.00 60.96  ? 174 VAL A O     1 
ATOM   1117 C CB    . VAL A 1 148 ? 1.074   32.692  17.532 1.00 63.18  ? 174 VAL A CB    1 
ATOM   1118 C CG1   . VAL A 1 148 ? 1.646   31.438  18.175 1.00 63.89  ? 174 VAL A CG1   1 
ATOM   1119 C CG2   . VAL A 1 148 ? -0.375  32.877  17.947 1.00 64.16  ? 174 VAL A CG2   1 
ATOM   1120 N N     . LEU A 1 149 ? 3.855   33.793  16.488 1.00 60.71  ? 175 LEU A N     1 
ATOM   1121 C CA    . LEU A 1 149 ? 5.247   33.597  16.119 1.00 60.05  ? 175 LEU A CA    1 
ATOM   1122 C C     . LEU A 1 149 ? 6.111   34.616  16.866 1.00 59.17  ? 175 LEU A C     1 
ATOM   1123 O O     . LEU A 1 149 ? 7.200   34.302  17.345 1.00 59.19  ? 175 LEU A O     1 
ATOM   1124 C CB    . LEU A 1 149 ? 5.371   33.760  14.602 1.00 60.50  ? 175 LEU A CB    1 
ATOM   1125 C CG    . LEU A 1 149 ? 6.576   33.345  13.743 1.00 61.30  ? 175 LEU A CG    1 
ATOM   1126 C CD1   . LEU A 1 149 ? 7.148   31.973  14.096 1.00 61.82  ? 175 LEU A CD1   1 
ATOM   1127 C CD2   . LEU A 1 149 ? 6.127   33.368  12.301 1.00 61.40  ? 175 LEU A CD2   1 
ATOM   1128 N N     . ARG A 1 150 ? 5.582   35.827  17.004 1.00 58.24  ? 176 ARG A N     1 
ATOM   1129 C CA    . ARG A 1 150 ? 6.246   36.897  17.728 1.00 57.09  ? 176 ARG A CA    1 
ATOM   1130 C C     . ARG A 1 150 ? 6.290   36.761  19.257 1.00 56.91  ? 176 ARG A C     1 
ATOM   1131 O O     . ARG A 1 150 ? 7.081   37.450  19.907 1.00 56.55  ? 176 ARG A O     1 
ATOM   1132 C CB    . ARG A 1 150 ? 5.633   38.242  17.335 1.00 56.82  ? 176 ARG A CB    1 
ATOM   1133 C CG    . ARG A 1 150 ? 5.985   38.678  15.930 1.00 56.34  ? 176 ARG A CG    1 
ATOM   1134 C CD    . ARG A 1 150 ? 7.464   38.908  15.835 1.00 56.02  ? 176 ARG A CD    1 
ATOM   1135 N NE    . ARG A 1 150 ? 7.828   39.785  14.732 1.00 55.43  ? 176 ARG A NE    1 
ATOM   1136 C CZ    . ARG A 1 150 ? 8.994   40.415  14.651 1.00 55.11  ? 176 ARG A CZ    1 
ATOM   1137 N NH1   . ARG A 1 150 ? 9.909   40.269  15.612 1.00 53.17  ? 176 ARG A NH1   1 
ATOM   1138 N NH2   . ARG A 1 150 ? 9.242   41.194  13.609 1.00 56.00  ? 176 ARG A NH2   1 
ATOM   1139 N N     . THR A 1 151 ? 5.466   35.884  19.832 1.00 57.12  ? 177 THR A N     1 
ATOM   1140 C CA    . THR A 1 151 ? 5.400   35.763  21.299 1.00 57.29  ? 177 THR A CA    1 
ATOM   1141 C C     . THR A 1 151 ? 6.722   35.328  21.942 1.00 57.27  ? 177 THR A C     1 
ATOM   1142 O O     . THR A 1 151 ? 7.533   34.638  21.327 1.00 56.44  ? 177 THR A O     1 
ATOM   1143 C CB    . THR A 1 151 ? 4.254   34.847  21.780 1.00 58.06  ? 177 THR A CB    1 
ATOM   1144 O OG1   . THR A 1 151 ? 4.488   33.494  21.363 1.00 58.54  ? 177 THR A OG1   1 
ATOM   1145 C CG2   . THR A 1 151 ? 2.915   35.331  21.239 1.00 58.83  ? 177 THR A CG2   1 
ATOM   1146 N N     . ARG A 1 152 ? 6.922   35.759  23.183 1.00 57.86  ? 178 ARG A N     1 
ATOM   1147 C CA    . ARG A 1 152 ? 8.115   35.420  23.951 1.00 59.09  ? 178 ARG A CA    1 
ATOM   1148 C C     . ARG A 1 152 ? 7.704   34.758  25.262 1.00 61.20  ? 178 ARG A C     1 
ATOM   1149 O O     . ARG A 1 152 ? 7.157   35.402  26.159 1.00 61.62  ? 178 ARG A O     1 
ATOM   1150 C CB    . ARG A 1 152 ? 8.975   36.664  24.212 1.00 58.00  ? 178 ARG A CB    1 
ATOM   1151 C CG    . ARG A 1 152 ? 9.429   37.382  22.941 1.00 56.20  ? 178 ARG A CG    1 
ATOM   1152 C CD    . ARG A 1 152 ? 9.938   38.801  23.199 1.00 51.93  ? 178 ARG A CD    1 
ATOM   1153 N NE    . ARG A 1 152 ? 10.992  38.826  24.206 1.00 50.50  ? 178 ARG A NE    1 
ATOM   1154 C CZ    . ARG A 1 152 ? 12.262  38.500  23.988 1.00 50.26  ? 178 ARG A CZ    1 
ATOM   1155 N NH1   . ARG A 1 152 ? 13.129  38.556  24.985 1.00 48.97  ? 178 ARG A NH1   1 
ATOM   1156 N NH2   . ARG A 1 152 ? 12.673  38.131  22.778 1.00 50.19  ? 178 ARG A NH2   1 
ATOM   1157 N N     . VAL A 1 153 ? 7.949   33.459  25.354 1.00 63.48  ? 179 VAL A N     1 
ATOM   1158 C CA    . VAL A 1 153 ? 7.667   32.712  26.568 1.00 66.32  ? 179 VAL A CA    1 
ATOM   1159 C C     . VAL A 1 153 ? 8.967   32.308  27.247 1.00 68.45  ? 179 VAL A C     1 
ATOM   1160 O O     . VAL A 1 153 ? 10.020  32.254  26.603 1.00 68.33  ? 179 VAL A O     1 
ATOM   1161 C CB    . VAL A 1 153 ? 6.786   31.461  26.296 1.00 66.94  ? 179 VAL A CB    1 
ATOM   1162 C CG1   . VAL A 1 153 ? 5.368   31.875  25.905 1.00 66.32  ? 179 VAL A CG1   1 
ATOM   1163 C CG2   . VAL A 1 153 ? 7.411   30.548  25.227 1.00 66.45  ? 179 VAL A CG2   1 
ATOM   1164 N N     . LYS A 1 154 ? 8.892   32.068  28.553 1.00 71.46  ? 180 LYS A N     1 
ATOM   1165 C CA    . LYS A 1 154 ? 9.973   31.417  29.291 1.00 74.55  ? 180 LYS A CA    1 
ATOM   1166 C C     . LYS A 1 154 ? 9.873   29.918  29.029 1.00 76.22  ? 180 LYS A C     1 
ATOM   1167 O O     . LYS A 1 154 ? 8.780   29.414  28.743 1.00 76.50  ? 180 LYS A O     1 
ATOM   1168 C CB    . LYS A 1 154 ? 9.826   31.678  30.791 1.00 75.87  ? 180 LYS A CB    1 
ATOM   1169 C CG    . LYS A 1 154 ? 10.373  33.012  31.281 1.00 76.66  ? 180 LYS A CG    1 
ATOM   1170 C CD    . LYS A 1 154 ? 10.180  33.131  32.790 1.00 79.29  ? 180 LYS A CD    1 
ATOM   1171 C CE    . LYS A 1 154 ? 11.279  33.962  33.435 1.00 80.84  ? 180 LYS A CE    1 
ATOM   1172 N NZ    . LYS A 1 154 ? 11.421  33.618  34.885 1.00 83.04  ? 180 LYS A NZ    1 
ATOM   1173 N N     . THR A 1 155 ? 10.991  29.199  29.124 1.00 78.18  ? 181 THR A N     1 
ATOM   1174 C CA    . THR A 1 155 ? 10.953  27.740  28.930 1.00 80.08  ? 181 THR A CA    1 
ATOM   1175 C C     . THR A 1 155 ? 11.726  26.942  29.988 1.00 82.35  ? 181 THR A C     1 
ATOM   1176 O O     . THR A 1 155 ? 12.610  27.475  30.667 1.00 83.09  ? 181 THR A O     1 
ATOM   1177 C CB    . THR A 1 155 ? 11.415  27.329  27.508 1.00 79.22  ? 181 THR A CB    1 
ATOM   1178 O OG1   . THR A 1 155 ? 11.070  28.358  26.574 1.00 78.42  ? 181 THR A OG1   1 
ATOM   1179 C CG2   . THR A 1 155 ? 10.743  26.027  27.081 1.00 79.60  ? 181 THR A CG2   1 
ATOM   1180 N N     . THR A 1 156 ? 11.359  25.666  30.116 1.00 84.05  ? 182 THR A N     1 
ATOM   1181 C CA    . THR A 1 156 ? 12.032  24.708  30.992 1.00 86.47  ? 182 THR A CA    1 
ATOM   1182 C C     . THR A 1 156 ? 13.035  23.881  30.182 1.00 86.83  ? 182 THR A C     1 
ATOM   1183 O O     . THR A 1 156 ? 12.666  22.886  29.544 1.00 87.05  ? 182 THR A O     1 
ATOM   1184 C CB    . THR A 1 156 ? 11.010  23.758  31.693 1.00 87.98  ? 182 THR A CB    1 
ATOM   1185 O OG1   . THR A 1 156 ? 9.992   24.530  32.345 1.00 87.96  ? 182 THR A OG1   1 
ATOM   1186 C CG2   . THR A 1 156 ? 11.700  22.852  32.724 1.00 90.05  ? 182 THR A CG2   1 
ATOM   1187 N N     . GLY A 1 157 ? 14.296  24.315  30.200 1.00 87.15  ? 183 GLY A N     1 
ATOM   1188 C CA    . GLY A 1 157 ? 15.401  23.574  29.584 1.00 87.59  ? 183 GLY A CA    1 
ATOM   1189 C C     . GLY A 1 157 ? 15.275  23.296  28.094 1.00 86.15  ? 183 GLY A C     1 
ATOM   1190 O O     . GLY A 1 157 ? 14.746  24.118  27.341 1.00 84.49  ? 183 GLY A O     1 
ATOM   1191 N N     . ILE A 1 158 ? 15.758  22.123  27.685 1.00 86.84  ? 184 ILE A N     1 
ATOM   1192 C CA    . ILE A 1 158 ? 15.806  21.719  26.275 1.00 85.77  ? 184 ILE A CA    1 
ATOM   1193 C C     . ILE A 1 158 ? 14.420  21.709  25.624 1.00 84.48  ? 184 ILE A C     1 
ATOM   1194 O O     . ILE A 1 158 ? 13.434  21.308  26.240 1.00 85.12  ? 184 ILE A O     1 
ATOM   1195 C CB    . ILE A 1 158 ? 16.493  20.327  26.084 1.00 87.01  ? 184 ILE A CB    1 
ATOM   1196 C CG1   . ILE A 1 158 ? 17.790  20.215  26.900 1.00 88.97  ? 184 ILE A CG1   1 
ATOM   1197 C CG2   . ILE A 1 158 ? 16.802  20.059  24.621 1.00 85.87  ? 184 ILE A CG2   1 
ATOM   1198 C CD1   . ILE A 1 158 ? 17.661  19.411  28.194 1.00 91.66  ? 184 ILE A CD1   1 
ATOM   1199 N N     . VAL A 1 159 ? 14.358  22.181  24.383 1.00 83.02  ? 185 VAL A N     1 
ATOM   1200 C CA    . VAL A 1 159 ? 13.151  22.090  23.573 1.00 82.03  ? 185 VAL A CA    1 
ATOM   1201 C C     . VAL A 1 159 ? 13.417  21.158  22.399 1.00 82.11  ? 185 VAL A C     1 
ATOM   1202 O O     . VAL A 1 159 ? 14.498  21.184  21.807 1.00 82.00  ? 185 VAL A O     1 
ATOM   1203 C CB    . VAL A 1 159 ? 12.713  23.463  23.037 1.00 80.50  ? 185 VAL A CB    1 
ATOM   1204 C CG1   . VAL A 1 159 ? 11.421  23.343  22.225 1.00 79.75  ? 185 VAL A CG1   1 
ATOM   1205 C CG2   . VAL A 1 159 ? 12.531  24.447  24.178 1.00 80.55  ? 185 VAL A CG2   1 
ATOM   1206 N N     . GLU A 1 160 ? 12.429  20.329  22.077 1.00 82.43  ? 186 GLU A N     1 
ATOM   1207 C CA    . GLU A 1 160 ? 12.515  19.437  20.933 1.00 82.59  ? 186 GLU A CA    1 
ATOM   1208 C C     . GLU A 1 160 ? 11.187  19.391  20.193 1.00 81.95  ? 186 GLU A C     1 
ATOM   1209 O O     . GLU A 1 160 ? 10.145  19.094  20.785 1.00 82.76  ? 186 GLU A O     1 
ATOM   1210 C CB    . GLU A 1 160 ? 12.924  18.026  21.381 1.00 84.31  ? 186 GLU A CB    1 
ATOM   1211 C CG    . GLU A 1 160 ? 13.177  17.034  20.235 1.00 85.54  ? 186 GLU A CG    1 
ATOM   1212 C CD    . GLU A 1 160 ? 13.193  15.570  20.690 1.00 89.03  ? 186 GLU A CD    1 
ATOM   1213 O OE1   . GLU A 1 160 ? 13.329  15.308  21.909 1.00 90.84  ? 186 GLU A OE1   1 
ATOM   1214 O OE2   . GLU A 1 160 ? 13.072  14.675  19.821 1.00 89.75  ? 186 GLU A OE2   1 
ATOM   1215 N N     . THR A 1 161 ? 11.222  19.709  18.904 1.00 80.83  ? 187 THR A N     1 
ATOM   1216 C CA    . THR A 1 161 ? 10.117  19.354  18.021 1.00 80.46  ? 187 THR A CA    1 
ATOM   1217 C C     . THR A 1 161 ? 10.577  18.299  17.035 1.00 80.66  ? 187 THR A C     1 
ATOM   1218 O O     . THR A 1 161 ? 11.735  18.292  16.597 1.00 80.25  ? 187 THR A O     1 
ATOM   1219 C CB    . THR A 1 161 ? 9.528   20.546  17.247 1.00 79.34  ? 187 THR A CB    1 
ATOM   1220 O OG1   . THR A 1 161 ? 10.579  21.252  16.575 1.00 78.39  ? 187 THR A OG1   1 
ATOM   1221 C CG2   . THR A 1 161 ? 8.768   21.479  18.186 1.00 79.29  ? 187 THR A CG2   1 
ATOM   1222 N N     . HIS A 1 162 ? 9.658   17.401  16.709 1.00 81.25  ? 188 HIS A N     1 
ATOM   1223 C CA    . HIS A 1 162 ? 9.902   16.356  15.728 1.00 81.61  ? 188 HIS A CA    1 
ATOM   1224 C C     . HIS A 1 162 ? 8.931   16.519  14.567 1.00 80.84  ? 188 HIS A C     1 
ATOM   1225 O O     . HIS A 1 162 ? 7.779   16.912  14.756 1.00 80.82  ? 188 HIS A O     1 
ATOM   1226 C CB    . HIS A 1 162 ? 9.800   14.958  16.365 1.00 83.20  ? 188 HIS A CB    1 
ATOM   1227 C CG    . HIS A 1 162 ? 8.745   14.845  17.424 1.00 85.05  ? 188 HIS A CG    1 
ATOM   1228 N ND1   . HIS A 1 162 ? 9.013   15.030  18.763 1.00 86.87  ? 188 HIS A ND1   1 
ATOM   1229 C CD2   . HIS A 1 162 ? 7.420   14.571  17.341 1.00 86.69  ? 188 HIS A CD2   1 
ATOM   1230 C CE1   . HIS A 1 162 ? 7.901   14.874  19.461 1.00 88.12  ? 188 HIS A CE1   1 
ATOM   1231 N NE2   . HIS A 1 162 ? 6.919   14.597  18.621 1.00 88.32  ? 188 HIS A NE2   1 
ATOM   1232 N N     . PHE A 1 163 ? 9.420   16.246  13.363 1.00 80.39  ? 189 PHE A N     1 
ATOM   1233 C CA    . PHE A 1 163 ? 8.603   16.300  12.157 1.00 80.00  ? 189 PHE A CA    1 
ATOM   1234 C C     . PHE A 1 163 ? 9.246   15.478  11.053 1.00 80.28  ? 189 PHE A C     1 
ATOM   1235 O O     . PHE A 1 163 ? 10.458  15.239  11.063 1.00 80.17  ? 189 PHE A O     1 
ATOM   1236 C CB    . PHE A 1 163 ? 8.391   17.747  11.686 1.00 79.00  ? 189 PHE A CB    1 
ATOM   1237 C CG    . PHE A 1 163 ? 9.667   18.487  11.379 1.00 77.65  ? 189 PHE A CG    1 
ATOM   1238 C CD1   . PHE A 1 163 ? 10.255  18.400  10.119 1.00 77.19  ? 189 PHE A CD1   1 
ATOM   1239 C CD2   . PHE A 1 163 ? 10.276  19.278  12.351 1.00 76.59  ? 189 PHE A CD2   1 
ATOM   1240 C CE1   . PHE A 1 163 ? 11.433  19.084  9.832  1.00 77.01  ? 189 PHE A CE1   1 
ATOM   1241 C CE2   . PHE A 1 163 ? 11.452  19.964  12.076 1.00 76.23  ? 189 PHE A CE2   1 
ATOM   1242 C CZ    . PHE A 1 163 ? 12.033  19.869  10.810 1.00 76.28  ? 189 PHE A CZ    1 
ATOM   1243 N N     . THR A 1 164 ? 8.422   15.053  10.104 1.00 80.78  ? 190 THR A N     1 
ATOM   1244 C CA    . THR A 1 164 ? 8.897   14.334  8.933  1.00 81.14  ? 190 THR A CA    1 
ATOM   1245 C C     . THR A 1 164 ? 8.856   15.267  7.727  1.00 80.54  ? 190 THR A C     1 
ATOM   1246 O O     . THR A 1 164 ? 7.875   15.985  7.513  1.00 80.48  ? 190 THR A O     1 
ATOM   1247 C CB    . THR A 1 164 ? 8.061   13.058  8.670  1.00 82.35  ? 190 THR A CB    1 
ATOM   1248 O OG1   . THR A 1 164 ? 7.957   12.296  9.880  1.00 82.93  ? 190 THR A OG1   1 
ATOM   1249 C CG2   . THR A 1 164 ? 8.703   12.194  7.578  1.00 82.80  ? 190 THR A CG2   1 
ATOM   1250 N N     . PHE A 1 165 ? 9.940   15.259  6.959  1.00 80.21  ? 191 PHE A N     1 
ATOM   1251 C CA    . PHE A 1 165 ? 10.061  16.076  5.763  1.00 80.05  ? 191 PHE A CA    1 
ATOM   1252 C C     . PHE A 1 165 ? 10.945  15.334  4.786  1.00 80.65  ? 191 PHE A C     1 
ATOM   1253 O O     . PHE A 1 165 ? 11.987  14.792  5.173  1.00 80.68  ? 191 PHE A O     1 
ATOM   1254 C CB    . PHE A 1 165 ? 10.666  17.442  6.106  1.00 79.23  ? 191 PHE A CB    1 
ATOM   1255 C CG    . PHE A 1 165 ? 10.794  18.375  4.928  1.00 79.12  ? 191 PHE A CG    1 
ATOM   1256 C CD1   . PHE A 1 165 ? 9.686   18.698  4.146  1.00 79.36  ? 191 PHE A CD1   1 
ATOM   1257 C CD2   . PHE A 1 165 ? 12.023  18.958  4.621  1.00 79.01  ? 191 PHE A CD2   1 
ATOM   1258 C CE1   . PHE A 1 165 ? 9.805   19.574  3.064  1.00 79.35  ? 191 PHE A CE1   1 
ATOM   1259 C CE2   . PHE A 1 165 ? 12.155  19.837  3.544  1.00 78.72  ? 191 PHE A CE2   1 
ATOM   1260 C CZ    . PHE A 1 165 ? 11.041  20.144  2.763  1.00 79.21  ? 191 PHE A CZ    1 
ATOM   1261 N N     . LYS A 1 166 ? 10.514  15.296  3.527  1.00 81.16  ? 192 LYS A N     1 
ATOM   1262 C CA    . LYS A 1 166 ? 11.210  14.553  2.473  1.00 81.85  ? 192 LYS A CA    1 
ATOM   1263 C C     . LYS A 1 166 ? 11.689  13.177  2.960  1.00 82.21  ? 192 LYS A C     1 
ATOM   1264 O O     . LYS A 1 166 ? 12.847  12.792  2.759  1.00 82.36  ? 192 LYS A O     1 
ATOM   1265 C CB    . LYS A 1 166 ? 12.354  15.390  1.887  1.00 81.62  ? 192 LYS A CB    1 
ATOM   1266 C CG    . LYS A 1 166 ? 11.878  16.591  1.076  1.00 81.95  ? 192 LYS A CG    1 
ATOM   1267 C CD    . LYS A 1 166 ? 13.044  17.408  0.522  1.00 82.93  ? 192 LYS A CD    1 
ATOM   1268 C CE    . LYS A 1 166 ? 12.546  18.598  -0.292 1.00 83.40  ? 192 LYS A CE    1 
ATOM   1269 N NZ    . LYS A 1 166 ? 13.657  19.424  -0.846 1.00 83.96  ? 192 LYS A NZ    1 
ATOM   1270 N N     . ASP A 1 167 ? 10.775  12.458  3.615  1.00 82.49  ? 193 ASP A N     1 
ATOM   1271 C CA    . ASP A 1 167 ? 11.012  11.106  4.154  1.00 83.16  ? 193 ASP A CA    1 
ATOM   1272 C C     . ASP A 1 167 ? 12.157  10.999  5.180  1.00 82.68  ? 193 ASP A C     1 
ATOM   1273 O O     . ASP A 1 167 ? 12.797  9.949   5.297  1.00 83.46  ? 193 ASP A O     1 
ATOM   1274 C CB    . ASP A 1 167 ? 11.191  10.079  3.016  1.00 84.24  ? 193 ASP A CB    1 
ATOM   1275 C CG    . ASP A 1 167 ? 9.965   9.974   2.118  1.00 85.23  ? 193 ASP A CG    1 
ATOM   1276 O OD1   . ASP A 1 167 ? 10.032  10.468  0.973  1.00 85.89  ? 193 ASP A OD1   1 
ATOM   1277 O OD2   . ASP A 1 167 ? 8.936   9.409   2.555  1.00 85.84  ? 193 ASP A OD2   1 
ATOM   1278 N N     . LEU A 1 168 ? 12.404  12.077  5.926  1.00 83.43  ? 194 LEU A N     1 
ATOM   1279 C CA    . LEU A 1 168 ? 13.401  12.050  7.003  1.00 81.69  ? 194 LEU A CA    1 
ATOM   1280 C C     . LEU A 1 168 ? 12.759  12.336  8.361  1.00 80.54  ? 194 LEU A C     1 
ATOM   1281 O O     . LEU A 1 168 ? 11.836  13.141  8.461  1.00 80.18  ? 194 LEU A O     1 
ATOM   1282 C CB    . LEU A 1 168 ? 14.546  13.035  6.727  1.00 80.47  ? 194 LEU A CB    1 
ATOM   1283 C CG    . LEU A 1 168 ? 15.379  12.917  5.439  1.00 81.38  ? 194 LEU A CG    1 
ATOM   1284 C CD1   . LEU A 1 168 ? 16.322  14.107  5.301  1.00 79.77  ? 194 LEU A CD1   1 
ATOM   1285 C CD2   . LEU A 1 168 ? 16.165  11.611  5.361  1.00 81.70  ? 194 LEU A CD2   1 
ATOM   1286 N N     . HIS A 1 169 ? 13.231  11.657  9.401  1.00 80.10  ? 195 HIS A N     1 
ATOM   1287 C CA    . HIS A 1 169 ? 12.755  11.928  10.752 1.00 79.27  ? 195 HIS A CA    1 
ATOM   1288 C C     . HIS A 1 169 ? 13.674  12.969  11.394 1.00 77.06  ? 195 HIS A C     1 
ATOM   1289 O O     . HIS A 1 169 ? 14.788  12.650  11.819 1.00 76.69  ? 195 HIS A O     1 
ATOM   1290 C CB    . HIS A 1 169 ? 12.724  10.648  11.598 1.00 80.59  ? 195 HIS A CB    1 
ATOM   1291 C CG    . HIS A 1 169 ? 11.600  9.714   11.265 1.00 83.39  ? 195 HIS A CG    1 
ATOM   1292 N ND1   . HIS A 1 169 ? 10.311  9.906   11.719 1.00 85.22  ? 195 HIS A ND1   1 
ATOM   1293 C CD2   . HIS A 1 169 ? 11.577  8.562   10.551 1.00 85.90  ? 195 HIS A CD2   1 
ATOM   1294 C CE1   . HIS A 1 169 ? 9.540   8.923   11.286 1.00 87.12  ? 195 HIS A CE1   1 
ATOM   1295 N NE2   . HIS A 1 169 ? 10.284  8.093   10.576 1.00 87.77  ? 195 HIS A NE2   1 
ATOM   1296 N N     . PHE A 1 170 ? 13.216  14.218  11.441 1.00 75.48  ? 196 PHE A N     1 
ATOM   1297 C CA    . PHE A 1 170 ? 13.984  15.291  12.072 1.00 73.29  ? 196 PHE A CA    1 
ATOM   1298 C C     . PHE A 1 170 ? 13.715  15.362  13.564 1.00 72.61  ? 196 PHE A C     1 
ATOM   1299 O O     . PHE A 1 170 ? 12.558  15.361  13.998 1.00 72.97  ? 196 PHE A O     1 
ATOM   1300 C CB    . PHE A 1 170 ? 13.651  16.648  11.449 1.00 72.51  ? 196 PHE A CB    1 
ATOM   1301 C CG    . PHE A 1 170 ? 14.291  16.882  10.113 1.00 72.34  ? 196 PHE A CG    1 
ATOM   1302 C CD1   . PHE A 1 170 ? 15.581  17.386  10.028 1.00 71.15  ? 196 PHE A CD1   1 
ATOM   1303 C CD2   . PHE A 1 170 ? 13.599  16.610  8.939  1.00 73.27  ? 196 PHE A CD2   1 
ATOM   1304 C CE1   . PHE A 1 170 ? 16.182  17.611  8.792  1.00 71.66  ? 196 PHE A CE1   1 
ATOM   1305 C CE2   . PHE A 1 170 ? 14.190  16.833  7.695  1.00 73.87  ? 196 PHE A CE2   1 
ATOM   1306 C CZ    . PHE A 1 170 ? 15.483  17.334  7.623  1.00 73.11  ? 196 PHE A CZ    1 
ATOM   1307 N N     . LYS A 1 171 ? 14.789  15.420  14.342 1.00 71.47  ? 197 LYS A N     1 
ATOM   1308 C CA    . LYS A 1 171 ? 14.699  15.798  15.752 1.00 70.76  ? 197 LYS A CA    1 
ATOM   1309 C C     . LYS A 1 171 ? 15.499  17.086  15.966 1.00 68.90  ? 197 LYS A C     1 
ATOM   1310 O O     . LYS A 1 171 ? 16.735  17.084  15.923 1.00 68.44  ? 197 LYS A O     1 
ATOM   1311 C CB    . LYS A 1 171 ? 15.174  14.658  16.661 1.00 71.79  ? 197 LYS A CB    1 
ATOM   1312 C CG    . LYS A 1 171 ? 14.240  13.449  16.634 1.00 73.94  ? 197 LYS A CG    1 
ATOM   1313 C CD    . LYS A 1 171 ? 14.920  12.167  17.072 1.00 75.71  ? 197 LYS A CD    1 
ATOM   1314 C CE    . LYS A 1 171 ? 13.966  10.987  16.890 1.00 78.99  ? 197 LYS A CE    1 
ATOM   1315 N NZ    . LYS A 1 171 ? 14.448  9.737   17.541 1.00 80.42  ? 197 LYS A NZ    1 
ATOM   1316 N N     . MET A 1 172 ? 14.781  18.188  16.158 1.00 67.64  ? 198 MET A N     1 
ATOM   1317 C CA    . MET A 1 172 ? 15.405  19.501  16.296 1.00 65.99  ? 198 MET A CA    1 
ATOM   1318 C C     . MET A 1 172 ? 15.486  19.933  17.754 1.00 65.33  ? 198 MET A C     1 
ATOM   1319 O O     . MET A 1 172 ? 14.467  20.217  18.390 1.00 65.41  ? 198 MET A O     1 
ATOM   1320 C CB    . MET A 1 172 ? 14.660  20.549  15.462 1.00 65.60  ? 198 MET A CB    1 
ATOM   1321 C CG    . MET A 1 172 ? 15.328  21.916  15.448 1.00 65.29  ? 198 MET A CG    1 
ATOM   1322 S SD    . MET A 1 172 ? 14.578  23.086  14.300 1.00 64.54  ? 198 MET A SD    1 
ATOM   1323 C CE    . MET A 1 172 ? 15.317  22.553  12.765 1.00 65.49  ? 198 MET A CE    1 
ATOM   1324 N N     . PHE A 1 173 ? 16.710  19.990  18.269 1.00 64.43  ? 199 PHE A N     1 
ATOM   1325 C CA    . PHE A 1 173 ? 16.950  20.388  19.650 1.00 64.09  ? 199 PHE A CA    1 
ATOM   1326 C C     . PHE A 1 173 ? 17.450  21.820  19.740 1.00 62.88  ? 199 PHE A C     1 
ATOM   1327 O O     . PHE A 1 173 ? 18.420  22.196  19.079 1.00 62.36  ? 199 PHE A O     1 
ATOM   1328 C CB    . PHE A 1 173 ? 17.976  19.470  20.313 1.00 64.54  ? 199 PHE A CB    1 
ATOM   1329 C CG    . PHE A 1 173 ? 17.515  18.055  20.487 1.00 66.03  ? 199 PHE A CG    1 
ATOM   1330 C CD1   . PHE A 1 173 ? 16.919  17.648  21.679 1.00 67.32  ? 199 PHE A CD1   1 
ATOM   1331 C CD2   . PHE A 1 173 ? 17.703  17.116  19.471 1.00 66.12  ? 199 PHE A CD2   1 
ATOM   1332 C CE1   . PHE A 1 173 ? 16.502  16.326  21.852 1.00 68.43  ? 199 PHE A CE1   1 
ATOM   1333 C CE2   . PHE A 1 173 ? 17.290  15.795  19.635 1.00 67.20  ? 199 PHE A CE2   1 
ATOM   1334 C CZ    . PHE A 1 173 ? 16.690  15.399  20.825 1.00 68.15  ? 199 PHE A CZ    1 
ATOM   1335 N N     . ASP A 1 174 ? 16.776  22.603  20.574 1.00 62.64  ? 200 ASP A N     1 
ATOM   1336 C CA    . ASP A 1 174 ? 17.228  23.930  20.973 1.00 61.82  ? 200 ASP A CA    1 
ATOM   1337 C C     . ASP A 1 174 ? 17.496  23.911  22.474 1.00 62.46  ? 200 ASP A C     1 
ATOM   1338 O O     . ASP A 1 174 ? 16.564  23.885  23.275 1.00 62.78  ? 200 ASP A O     1 
ATOM   1339 C CB    . ASP A 1 174 ? 16.160  24.972  20.614 1.00 61.51  ? 200 ASP A CB    1 
ATOM   1340 C CG    . ASP A 1 174 ? 16.453  26.361  21.181 1.00 60.09  ? 200 ASP A CG    1 
ATOM   1341 O OD1   . ASP A 1 174 ? 17.627  26.682  21.485 1.00 58.59  ? 200 ASP A OD1   1 
ATOM   1342 O OD2   . ASP A 1 174 ? 15.485  27.135  21.315 1.00 58.59  ? 200 ASP A OD2   1 
ATOM   1343 N N     . VAL A 1 175 ? 18.773  23.920  22.842 1.00 62.85  ? 201 VAL A N     1 
ATOM   1344 C CA    . VAL A 1 175 ? 19.188  23.902  24.248 1.00 64.45  ? 201 VAL A CA    1 
ATOM   1345 C C     . VAL A 1 175 ? 18.808  25.188  24.984 1.00 65.31  ? 201 VAL A C     1 
ATOM   1346 O O     . VAL A 1 175 ? 18.441  25.154  26.158 1.00 66.56  ? 201 VAL A O     1 
ATOM   1347 C CB    . VAL A 1 175 ? 20.703  23.593  24.394 1.00 64.62  ? 201 VAL A CB    1 
ATOM   1348 C CG1   . VAL A 1 175 ? 21.120  23.564  25.856 1.00 65.86  ? 201 VAL A CG1   1 
ATOM   1349 C CG2   . VAL A 1 175 ? 21.037  22.253  23.743 1.00 64.68  ? 201 VAL A CG2   1 
ATOM   1350 N N     . GLY A 1 176 ? 18.888  26.317  24.287 1.00 65.50  ? 202 GLY A N     1 
ATOM   1351 C CA    . GLY A 1 176 ? 18.391  27.589  24.807 1.00 66.68  ? 202 GLY A CA    1 
ATOM   1352 C C     . GLY A 1 176 ? 19.339  28.246  25.782 1.00 68.24  ? 202 GLY A C     1 
ATOM   1353 O O     . GLY A 1 176 ? 20.506  27.866  25.874 1.00 68.25  ? 202 GLY A O     1 
ATOM   1354 N N     . GLY A 1 177 ? 18.826  29.230  26.516 1.00 69.91  ? 203 GLY A N     1 
ATOM   1355 C CA    . GLY A 1 177 ? 19.643  30.034  27.422 1.00 72.37  ? 203 GLY A CA    1 
ATOM   1356 C C     . GLY A 1 177 ? 19.849  29.454  28.811 1.00 74.94  ? 203 GLY A C     1 
ATOM   1357 O O     . GLY A 1 177 ? 20.547  30.049  29.639 1.00 76.05  ? 203 GLY A O     1 
ATOM   1358 N N     . GLN A 1 178 ? 19.241  28.295  29.062 1.00 76.01  ? 204 GLN A N     1 
ATOM   1359 C CA    . GLN A 1 178 ? 19.334  27.611  30.348 1.00 78.62  ? 204 GLN A CA    1 
ATOM   1360 C C     . GLN A 1 178 ? 20.703  26.937  30.487 1.00 78.98  ? 204 GLN A C     1 
ATOM   1361 O O     . GLN A 1 178 ? 21.126  26.188  29.599 1.00 77.87  ? 204 GLN A O     1 
ATOM   1362 C CB    . GLN A 1 178 ? 18.195  26.589  30.486 1.00 79.23  ? 204 GLN A CB    1 
ATOM   1363 C CG    . GLN A 1 178 ? 16.777  27.200  30.618 1.00 81.23  ? 204 GLN A CG    1 
ATOM   1364 C CD    . GLN A 1 178 ? 16.249  27.867  29.331 1.00 81.62  ? 204 GLN A CD    1 
ATOM   1365 O OE1   . GLN A 1 178 ? 16.620  27.491  28.211 1.00 81.29  ? 204 GLN A OE1   1 
ATOM   1366 N NE2   . GLN A 1 178 ? 15.370  28.855  29.498 1.00 82.53  ? 204 GLN A NE2   1 
ATOM   1367 N N     . ARG A 1 179 ? 21.394  27.226  31.591 1.00 80.85  ? 205 ARG A N     1 
ATOM   1368 C CA    . ARG A 1 179 ? 22.756  26.727  31.824 1.00 81.66  ? 205 ARG A CA    1 
ATOM   1369 C C     . ARG A 1 179 ? 22.774  25.202  31.985 1.00 81.82  ? 205 ARG A C     1 
ATOM   1370 O O     . ARG A 1 179 ? 21.991  24.644  32.757 1.00 83.00  ? 205 ARG A O     1 
ATOM   1371 C CB    . ARG A 1 179 ? 23.384  27.402  33.055 1.00 83.72  ? 205 ARG A CB    1 
ATOM   1372 C CG    . ARG A 1 179 ? 24.906  27.249  33.142 1.00 85.08  ? 205 ARG A CG    1 
ATOM   1373 C CD    . ARG A 1 179 ? 25.431  27.352  34.574 1.00 88.98  ? 205 ARG A CD    1 
ATOM   1374 N NE    . ARG A 1 179 ? 26.818  26.887  34.686 1.00 90.69  ? 205 ARG A NE    1 
ATOM   1375 C CZ    . ARG A 1 179 ? 27.188  25.618  34.880 1.00 91.35  ? 205 ARG A CZ    1 
ATOM   1376 N NH1   . ARG A 1 179 ? 26.281  24.650  34.992 1.00 91.02  ? 205 ARG A NH1   1 
ATOM   1377 N NH2   . ARG A 1 179 ? 28.477  25.312  34.964 1.00 91.71  ? 205 ARG A NH2   1 
ATOM   1378 N N     . SER A 1 180 ? 23.666  24.541  31.251 1.00 80.90  ? 206 SER A N     1 
ATOM   1379 C CA    . SER A 1 180 ? 23.746  23.082  31.267 1.00 81.01  ? 206 SER A CA    1 
ATOM   1380 C C     . SER A 1 180 ? 25.144  22.563  31.550 1.00 81.43  ? 206 SER A C     1 
ATOM   1381 O O     . SER A 1 180 ? 26.136  23.113  31.063 1.00 80.72  ? 206 SER A O     1 
ATOM   1382 C CB    . SER A 1 180 ? 23.231  22.503  29.955 1.00 79.53  ? 206 SER A CB    1 
ATOM   1383 O OG    . SER A 1 180 ? 21.831  22.680  29.859 1.00 80.06  ? 206 SER A OG    1 
ATOM   1384 N N     . GLU A 1 181 ? 25.200  21.495  32.344 1.00 82.66  ? 207 GLU A N     1 
ATOM   1385 C CA    . GLU A 1 181 ? 26.457  20.841  32.718 1.00 83.23  ? 207 GLU A CA    1 
ATOM   1386 C C     . GLU A 1 181 ? 27.124  20.165  31.517 1.00 81.59  ? 207 GLU A C     1 
ATOM   1387 O O     . GLU A 1 181 ? 26.464  19.870  30.511 1.00 79.81  ? 207 GLU A O     1 
ATOM   1388 C CB    . GLU A 1 181 ? 26.218  19.817  33.834 1.00 85.17  ? 207 GLU A CB    1 
ATOM   1389 C CG    . GLU A 1 181 ? 25.884  20.422  35.202 1.00 87.88  ? 207 GLU A CG    1 
ATOM   1390 C CD    . GLU A 1 181 ? 25.886  19.385  36.317 1.00 91.14  ? 207 GLU A CD    1 
ATOM   1391 O OE1   . GLU A 1 181 ? 25.250  18.320  36.147 1.00 91.49  ? 207 GLU A OE1   1 
ATOM   1392 O OE2   . GLU A 1 181 ? 26.523  19.633  37.365 1.00 93.09  ? 207 GLU A OE2   1 
ATOM   1393 N N     . ARG A 1 182 ? 28.432  19.924  31.643 1.00 81.81  ? 208 ARG A N     1 
ATOM   1394 C CA    . ARG A 1 182 ? 29.251  19.306  30.594 1.00 80.71  ? 208 ARG A CA    1 
ATOM   1395 C C     . ARG A 1 182 ? 28.642  18.015  30.033 1.00 80.07  ? 208 ARG A C     1 
ATOM   1396 O O     . ARG A 1 182 ? 28.770  17.730  28.844 1.00 78.80  ? 208 ARG A O     1 
ATOM   1397 C CB    . ARG A 1 182 ? 30.667  19.059  31.127 1.00 81.96  ? 208 ARG A CB    1 
ATOM   1398 C CG    . ARG A 1 182 ? 31.616  18.321  30.185 1.00 82.19  ? 208 ARG A CG    1 
ATOM   1399 C CD    . ARG A 1 182 ? 32.943  18.010  30.881 1.00 85.29  ? 208 ARG A CD    1 
ATOM   1400 N NE    . ARG A 1 182 ? 33.793  17.113  30.095 1.00 86.15  ? 208 ARG A NE    1 
ATOM   1401 C CZ    . ARG A 1 182 ? 34.685  17.512  29.189 1.00 86.67  ? 208 ARG A CZ    1 
ATOM   1402 N NH1   . ARG A 1 182 ? 34.860  18.806  28.938 1.00 87.06  ? 208 ARG A NH1   1 
ATOM   1403 N NH2   . ARG A 1 182 ? 35.405  16.615  28.523 1.00 86.59  ? 208 ARG A NH2   1 
ATOM   1404 N N     . LYS A 1 183 ? 27.966  17.256  30.891 1.00 81.03  ? 209 LYS A N     1 
ATOM   1405 C CA    . LYS A 1 183 ? 27.396  15.966  30.511 1.00 80.90  ? 209 LYS A CA    1 
ATOM   1406 C C     . LYS A 1 183 ? 26.171  16.109  29.597 1.00 79.37  ? 209 LYS A C     1 
ATOM   1407 O O     . LYS A 1 183 ? 26.042  15.364  28.617 1.00 78.51  ? 209 LYS A O     1 
ATOM   1408 C CB    . LYS A 1 183 ? 27.063  15.132  31.761 1.00 82.95  ? 209 LYS A CB    1 
ATOM   1409 C CG    . LYS A 1 183 ? 27.063  13.613  31.544 1.00 84.06  ? 209 LYS A CG    1 
ATOM   1410 C CD    . LYS A 1 183 ? 28.444  13.056  31.143 1.00 84.66  ? 209 LYS A CD    1 
ATOM   1411 C CE    . LYS A 1 183 ? 29.428  13.010  32.312 1.00 86.99  ? 209 LYS A CE    1 
ATOM   1412 N NZ    . LYS A 1 183 ? 29.028  12.039  33.372 1.00 89.06  ? 209 LYS A NZ    1 
ATOM   1413 N N     . LYS A 1 184 ? 25.286  17.056  29.917 1.00 78.74  ? 210 LYS A N     1 
ATOM   1414 C CA    . LYS A 1 184 ? 24.105  17.335  29.087 1.00 77.57  ? 210 LYS A CA    1 
ATOM   1415 C C     . LYS A 1 184 ? 24.485  17.775  27.668 1.00 75.43  ? 210 LYS A C     1 
ATOM   1416 O O     . LYS A 1 184 ? 23.847  17.366  26.696 1.00 74.76  ? 210 LYS A O     1 
ATOM   1417 C CB    . LYS A 1 184 ? 23.181  18.366  29.753 1.00 78.12  ? 210 LYS A CB    1 
ATOM   1418 C CG    . LYS A 1 184 ? 22.215  17.758  30.776 1.00 80.85  ? 210 LYS A CG    1 
ATOM   1419 C CD    . LYS A 1 184 ? 21.643  18.803  31.740 1.00 82.59  ? 210 LYS A CD    1 
ATOM   1420 C CE    . LYS A 1 184 ? 20.925  18.128  32.909 1.00 84.95  ? 210 LYS A CE    1 
ATOM   1421 N NZ    . LYS A 1 184 ? 20.458  19.095  33.942 1.00 85.94  ? 210 LYS A NZ    1 
ATOM   1422 N N     . TRP A 1 185 ? 25.534  18.590  27.565 1.00 74.40  ? 211 TRP A N     1 
ATOM   1423 C CA    . TRP A 1 185 ? 26.086  19.008  26.276 1.00 72.73  ? 211 TRP A CA    1 
ATOM   1424 C C     . TRP A 1 185 ? 26.669  17.836  25.478 1.00 72.09  ? 211 TRP A C     1 
ATOM   1425 O O     . TRP A 1 185 ? 26.403  17.699  24.282 1.00 71.13  ? 211 TRP A O     1 
ATOM   1426 C CB    . TRP A 1 185 ? 27.140  20.105  26.463 1.00 72.62  ? 211 TRP A CB    1 
ATOM   1427 C CG    . TRP A 1 185 ? 26.555  21.465  26.701 1.00 72.77  ? 211 TRP A CG    1 
ATOM   1428 C CD1   . TRP A 1 185 ? 26.642  22.206  27.844 1.00 73.65  ? 211 TRP A CD1   1 
ATOM   1429 C CD2   . TRP A 1 185 ? 25.790  22.248  25.774 1.00 71.70  ? 211 TRP A CD2   1 
ATOM   1430 N NE1   . TRP A 1 185 ? 25.981  23.402  27.686 1.00 73.12  ? 211 TRP A NE1   1 
ATOM   1431 C CE2   . TRP A 1 185 ? 25.450  23.453  26.425 1.00 71.96  ? 211 TRP A CE2   1 
ATOM   1432 C CE3   . TRP A 1 185 ? 25.361  22.048  24.455 1.00 70.69  ? 211 TRP A CE3   1 
ATOM   1433 C CZ2   . TRP A 1 185 ? 24.701  24.454  25.804 1.00 71.69  ? 211 TRP A CZ2   1 
ATOM   1434 C CZ3   . TRP A 1 185 ? 24.614  23.042  23.838 1.00 70.10  ? 211 TRP A CZ3   1 
ATOM   1435 C CH2   . TRP A 1 185 ? 24.296  24.232  24.510 1.00 70.82  ? 211 TRP A CH2   1 
ATOM   1436 N N     . ILE A 1 186 ? 27.454  16.996  26.146 1.00 72.40  ? 212 ILE A N     1 
ATOM   1437 C CA    . ILE A 1 186 ? 28.030  15.811  25.515 1.00 72.06  ? 212 ILE A CA    1 
ATOM   1438 C C     . ILE A 1 186 ? 26.930  14.915  24.942 1.00 71.65  ? 212 ILE A C     1 
ATOM   1439 O O     . ILE A 1 186 ? 27.056  14.415  23.824 1.00 71.08  ? 212 ILE A O     1 
ATOM   1440 C CB    . ILE A 1 186 ? 28.955  15.029  26.495 1.00 73.45  ? 212 ILE A CB    1 
ATOM   1441 C CG1   . ILE A 1 186 ? 30.189  15.868  26.870 1.00 73.52  ? 212 ILE A CG1   1 
ATOM   1442 C CG2   . ILE A 1 186 ? 29.369  13.665  25.919 1.00 73.51  ? 212 ILE A CG2   1 
ATOM   1443 C CD1   . ILE A 1 186 ? 31.028  16.346  25.692 1.00 72.36  ? 212 ILE A CD1   1 
ATOM   1444 N N     . HIS A 1 187 ? 25.849  14.741  25.702 1.00 71.99  ? 213 HIS A N     1 
ATOM   1445 C CA    . HIS A 1 187 ? 24.695  13.967  25.243 1.00 72.01  ? 213 HIS A CA    1 
ATOM   1446 C C     . HIS A 1 187 ? 24.060  14.619  24.018 1.00 70.57  ? 213 HIS A C     1 
ATOM   1447 O O     . HIS A 1 187 ? 23.720  13.935  23.054 1.00 70.73  ? 213 HIS A O     1 
ATOM   1448 C CB    . HIS A 1 187 ? 23.650  13.794  26.356 1.00 73.10  ? 213 HIS A CB    1 
ATOM   1449 C CG    . HIS A 1 187 ? 24.120  12.975  27.523 1.00 75.13  ? 213 HIS A CG    1 
ATOM   1450 N ND1   . HIS A 1 187 ? 25.001  11.921  27.397 1.00 75.94  ? 213 HIS A ND1   1 
ATOM   1451 C CD2   . HIS A 1 187 ? 23.802  13.040  28.840 1.00 76.79  ? 213 HIS A CD2   1 
ATOM   1452 C CE1   . HIS A 1 187 ? 25.220  11.386  28.585 1.00 77.29  ? 213 HIS A CE1   1 
ATOM   1453 N NE2   . HIS A 1 187 ? 24.504  12.046  29.478 1.00 77.48  ? 213 HIS A NE2   1 
ATOM   1454 N N     . CYS A 1 188 ? 23.925  15.944  24.057 1.00 69.48  ? 214 CYS A N     1 
ATOM   1455 C CA    . CYS A 1 188 ? 23.380  16.704  22.934 1.00 68.09  ? 214 CYS A CA    1 
ATOM   1456 C C     . CYS A 1 188 ? 24.218  16.542  21.680 1.00 66.56  ? 214 CYS A C     1 
ATOM   1457 O O     . CYS A 1 188 ? 23.677  16.283  20.609 1.00 66.55  ? 214 CYS A O     1 
ATOM   1458 C CB    . CYS A 1 188 ? 23.246  18.184  23.290 1.00 67.69  ? 214 CYS A CB    1 
ATOM   1459 S SG    . CYS A 1 188 ? 21.798  18.510  24.293 1.00 71.24  ? 214 CYS A SG    1 
ATOM   1460 N N     . PHE A 1 189 ? 25.533  16.686  21.821 1.00 65.56  ? 215 PHE A N     1 
ATOM   1461 C CA    . PHE A 1 189 ? 26.450  16.547  20.696 1.00 64.44  ? 215 PHE A CA    1 
ATOM   1462 C C     . PHE A 1 189 ? 26.483  15.133  20.133 1.00 64.69  ? 215 PHE A C     1 
ATOM   1463 O O     . PHE A 1 189 ? 26.801  14.946  18.965 1.00 64.23  ? 215 PHE A O     1 
ATOM   1464 C CB    . PHE A 1 189 ? 27.866  16.965  21.085 1.00 64.54  ? 215 PHE A CB    1 
ATOM   1465 C CG    . PHE A 1 189 ? 27.982  18.396  21.511 1.00 64.28  ? 215 PHE A CG    1 
ATOM   1466 C CD1   . PHE A 1 189 ? 28.826  18.750  22.553 1.00 64.70  ? 215 PHE A CD1   1 
ATOM   1467 C CD2   . PHE A 1 189 ? 27.244  19.389  20.878 1.00 63.31  ? 215 PHE A CD2   1 
ATOM   1468 C CE1   . PHE A 1 189 ? 28.934  20.071  22.957 1.00 64.79  ? 215 PHE A CE1   1 
ATOM   1469 C CE2   . PHE A 1 189 ? 27.344  20.706  21.276 1.00 63.77  ? 215 PHE A CE2   1 
ATOM   1470 C CZ    . PHE A 1 189 ? 28.190  21.049  22.317 1.00 64.30  ? 215 PHE A CZ    1 
ATOM   1471 N N     . GLU A 1 190 ? 26.167  14.141  20.966 1.00 65.10  ? 216 GLU A N     1 
ATOM   1472 C CA    . GLU A 1 190 ? 26.226  12.753  20.535 1.00 65.63  ? 216 GLU A CA    1 
ATOM   1473 C C     . GLU A 1 190 ? 25.146  12.438  19.510 1.00 65.06  ? 216 GLU A C     1 
ATOM   1474 O O     . GLU A 1 190 ? 23.956  12.656  19.755 1.00 64.71  ? 216 GLU A O     1 
ATOM   1475 C CB    . GLU A 1 190 ? 26.155  11.804  21.729 1.00 66.95  ? 216 GLU A CB    1 
ATOM   1476 C CG    . GLU A 1 190 ? 27.520  11.492  22.318 1.00 68.31  ? 216 GLU A CG    1 
ATOM   1477 C CD    . GLU A 1 190 ? 27.454  10.947  23.726 1.00 70.18  ? 216 GLU A CD    1 
ATOM   1478 O OE1   . GLU A 1 190 ? 26.340  10.829  24.281 1.00 71.35  ? 216 GLU A OE1   1 
ATOM   1479 O OE2   . GLU A 1 190 ? 28.530  10.636  24.280 1.00 71.71  ? 216 GLU A OE2   1 
ATOM   1480 N N     . GLY A 1 191 ? 25.592  11.965  18.350 1.00 70.72  ? 217 GLY A N     1 
ATOM   1481 C CA    . GLY A 1 191 ? 24.711  11.515  17.284 1.00 69.82  ? 217 GLY A CA    1 
ATOM   1482 C C     . GLY A 1 191 ? 24.135  12.624  16.435 1.00 67.08  ? 217 GLY A C     1 
ATOM   1483 O O     . GLY A 1 191 ? 23.114  12.428  15.791 1.00 67.23  ? 217 GLY A O     1 
ATOM   1484 N N     . VAL A 1 192 ? 24.792  13.781  16.423 1.00 64.98  ? 218 VAL A N     1 
ATOM   1485 C CA    . VAL A 1 192 ? 24.279  14.944  15.712 1.00 62.48  ? 218 VAL A CA    1 
ATOM   1486 C C     . VAL A 1 192 ? 24.630  14.921  14.216 1.00 61.77  ? 218 VAL A C     1 
ATOM   1487 O O     . VAL A 1 192 ? 25.808  14.824  13.839 1.00 62.07  ? 218 VAL A O     1 
ATOM   1488 C CB    . VAL A 1 192 ? 24.717  16.278  16.394 1.00 61.03  ? 218 VAL A CB    1 
ATOM   1489 C CG1   . VAL A 1 192 ? 26.217  16.516  16.258 1.00 61.05  ? 218 VAL A CG1   1 
ATOM   1490 C CG2   . VAL A 1 192 ? 23.938  17.445  15.830 1.00 58.47  ? 218 VAL A CG2   1 
ATOM   1491 N N     . THR A 1 193 ? 23.596  14.999  13.380 1.00 61.05  ? 219 THR A N     1 
ATOM   1492 C CA    . THR A 1 193 ? 23.757  15.117  11.929 1.00 61.08  ? 219 THR A CA    1 
ATOM   1493 C C     . THR A 1 193 ? 24.221  16.527  11.536 1.00 59.03  ? 219 THR A C     1 
ATOM   1494 O O     . THR A 1 193 ? 25.252  16.691  10.886 1.00 59.45  ? 219 THR A O     1 
ATOM   1495 C CB    . THR A 1 193 ? 22.423  14.840  11.194 1.00 61.85  ? 219 THR A CB    1 
ATOM   1496 O OG1   . THR A 1 193 ? 21.847  13.632  11.689 1.00 65.38  ? 219 THR A OG1   1 
ATOM   1497 C CG2   . THR A 1 193 ? 22.639  14.717  9.695  1.00 62.91  ? 219 THR A CG2   1 
ATOM   1498 N N     . ALA A 1 194 ? 23.445  17.538  11.924 1.00 57.04  ? 220 ALA A N     1 
ATOM   1499 C CA    . ALA A 1 194 ? 23.742  18.914  11.544 1.00 54.91  ? 220 ALA A CA    1 
ATOM   1500 C C     . ALA A 1 194 ? 23.581  19.896  12.693 1.00 52.95  ? 220 ALA A C     1 
ATOM   1501 O O     . ALA A 1 194 ? 22.747  19.713  13.581 1.00 53.57  ? 220 ALA A O     1 
ATOM   1502 C CB    . ALA A 1 194 ? 22.877  19.344  10.356 1.00 55.06  ? 220 ALA A CB    1 
ATOM   1503 N N     . ILE A 1 195 ? 24.400  20.935  12.653 1.00 50.92  ? 221 ILE A N     1 
ATOM   1504 C CA    . ILE A 1 195 ? 24.309  22.047  13.577 1.00 48.86  ? 221 ILE A CA    1 
ATOM   1505 C C     . ILE A 1 195 ? 23.901  23.295  12.787 1.00 47.65  ? 221 ILE A C     1 
ATOM   1506 O O     . ILE A 1 195 ? 24.509  23.620  11.763 1.00 47.37  ? 221 ILE A O     1 
ATOM   1507 C CB    . ILE A 1 195 ? 25.662  22.270  14.311 1.00 48.59  ? 221 ILE A CB    1 
ATOM   1508 C CG1   . ILE A 1 195 ? 25.894  21.158  15.351 1.00 49.64  ? 221 ILE A CG1   1 
ATOM   1509 C CG2   . ILE A 1 195 ? 25.716  23.645  14.970 1.00 46.24  ? 221 ILE A CG2   1 
ATOM   1510 C CD1   . ILE A 1 195 ? 27.344  20.995  15.770 1.00 48.14  ? 221 ILE A CD1   1 
ATOM   1511 N N     . ILE A 1 196 ? 22.845  23.959  13.252 1.00 46.50  ? 222 ILE A N     1 
ATOM   1512 C CA    . ILE A 1 196 ? 22.482  25.265  12.754 1.00 44.94  ? 222 ILE A CA    1 
ATOM   1513 C C     . ILE A 1 196 ? 22.893  26.312  13.789 1.00 43.79  ? 222 ILE A C     1 
ATOM   1514 O O     . ILE A 1 196 ? 22.395  26.306  14.916 1.00 43.78  ? 222 ILE A O     1 
ATOM   1515 C CB    . ILE A 1 196 ? 20.975  25.393  12.459 1.00 45.56  ? 222 ILE A CB    1 
ATOM   1516 C CG1   . ILE A 1 196 ? 20.496  24.241  11.574 1.00 46.64  ? 222 ILE A CG1   1 
ATOM   1517 C CG2   . ILE A 1 196 ? 20.688  26.734  11.803 1.00 43.34  ? 222 ILE A CG2   1 
ATOM   1518 C CD1   . ILE A 1 196 ? 19.055  24.392  11.096 1.00 47.91  ? 222 ILE A CD1   1 
ATOM   1519 N N     . PHE A 1 197 ? 23.795  27.202  13.380 1.00 42.51  ? 223 PHE A N     1 
ATOM   1520 C CA    . PHE A 1 197 ? 24.290  28.275  14.220 1.00 41.20  ? 223 PHE A CA    1 
ATOM   1521 C C     . PHE A 1 197 ? 23.635  29.591  13.820 1.00 40.68  ? 223 PHE A C     1 
ATOM   1522 O O     . PHE A 1 197 ? 23.861  30.093  12.711 1.00 40.17  ? 223 PHE A O     1 
ATOM   1523 C CB    . PHE A 1 197 ? 25.812  28.400  14.124 1.00 41.00  ? 223 PHE A CB    1 
ATOM   1524 C CG    . PHE A 1 197 ? 26.406  29.300  15.178 1.00 41.05  ? 223 PHE A CG    1 
ATOM   1525 C CD1   . PHE A 1 197 ? 26.612  28.831  16.473 1.00 42.24  ? 223 PHE A CD1   1 
ATOM   1526 C CD2   . PHE A 1 197 ? 26.727  30.615  14.893 1.00 39.53  ? 223 PHE A CD2   1 
ATOM   1527 C CE1   . PHE A 1 197 ? 27.141  29.663  17.458 1.00 40.51  ? 223 PHE A CE1   1 
ATOM   1528 C CE2   . PHE A 1 197 ? 27.266  31.448  15.874 1.00 39.85  ? 223 PHE A CE2   1 
ATOM   1529 C CZ    . PHE A 1 197 ? 27.467  30.966  17.160 1.00 39.31  ? 223 PHE A CZ    1 
ATOM   1530 N N     . CYS A 1 198 ? 22.811  30.124  14.729 1.00 40.11  ? 224 CYS A N     1 
ATOM   1531 C CA    . CYS A 1 198 ? 22.103  31.375  14.524 1.00 39.22  ? 224 CYS A CA    1 
ATOM   1532 C C     . CYS A 1 198 ? 22.874  32.574  15.041 1.00 37.59  ? 224 CYS A C     1 
ATOM   1533 O O     . CYS A 1 198 ? 23.419  32.543  16.139 1.00 37.78  ? 224 CYS A O     1 
ATOM   1534 C CB    . CYS A 1 198 ? 20.736  31.321  15.182 1.00 39.96  ? 224 CYS A CB    1 
ATOM   1535 S SG    . CYS A 1 198 ? 19.742  29.986  14.547 1.00 44.03  ? 224 CYS A SG    1 
ATOM   1536 N N     . VAL A 1 199 ? 22.898  33.626  14.230 1.00 36.26  ? 225 VAL A N     1 
ATOM   1537 C CA    . VAL A 1 199 ? 23.587  34.855  14.531 1.00 34.88  ? 225 VAL A CA    1 
ATOM   1538 C C     . VAL A 1 199 ? 22.608  35.993  14.305 1.00 35.37  ? 225 VAL A C     1 
ATOM   1539 O O     . VAL A 1 199 ? 22.003  36.077  13.247 1.00 35.77  ? 225 VAL A O     1 
ATOM   1540 C CB    . VAL A 1 199 ? 24.793  35.080  13.590 1.00 35.13  ? 225 VAL A CB    1 
ATOM   1541 C CG1   . VAL A 1 199 ? 25.446  36.448  13.846 1.00 34.29  ? 225 VAL A CG1   1 
ATOM   1542 C CG2   . VAL A 1 199 ? 25.813  33.969  13.732 1.00 33.32  ? 225 VAL A CG2   1 
ATOM   1543 N N     . ALA A 1 200 ? 22.441  36.867  15.296 1.00 35.15  ? 226 ALA A N     1 
ATOM   1544 C CA    . ALA A 1 200 ? 21.653  38.069  15.086 1.00 35.59  ? 226 ALA A CA    1 
ATOM   1545 C C     . ALA A 1 200 ? 22.553  39.106  14.432 1.00 35.06  ? 226 ALA A C     1 
ATOM   1546 O O     . ALA A 1 200 ? 23.392  39.695  15.114 1.00 35.05  ? 226 ALA A O     1 
ATOM   1547 C CB    . ALA A 1 200 ? 21.110  38.590  16.409 1.00 35.79  ? 226 ALA A CB    1 
ATOM   1548 N N     . LEU A 1 201 ? 22.396  39.315  13.120 1.00 35.25  ? 227 LEU A N     1 
ATOM   1549 C CA    . LEU A 1 201 ? 23.188  40.324  12.398 1.00 34.81  ? 227 LEU A CA    1 
ATOM   1550 C C     . LEU A 1 201 ? 23.092  41.693  13.036 1.00 34.11  ? 227 LEU A C     1 
ATOM   1551 O O     . LEU A 1 201 ? 24.090  42.413  13.131 1.00 33.19  ? 227 LEU A O     1 
ATOM   1552 C CB    . LEU A 1 201 ? 22.762  40.442  10.914 1.00 35.89  ? 227 LEU A CB    1 
ATOM   1553 C CG    . LEU A 1 201 ? 23.193  39.300  9.987  1.00 36.23  ? 227 LEU A CG    1 
ATOM   1554 C CD1   . LEU A 1 201 ? 22.402  39.342  8.671  1.00 34.90  ? 227 LEU A CD1   1 
ATOM   1555 C CD2   . LEU A 1 201 ? 24.683  39.347  9.735  1.00 34.83  ? 227 LEU A CD2   1 
ATOM   1556 N N     . SER A 1 202 ? 21.871  42.045  13.438 1.00 34.53  ? 228 SER A N     1 
ATOM   1557 C CA    . SER A 1 202 ? 21.562  43.341  14.024 1.00 35.02  ? 228 SER A CA    1 
ATOM   1558 C C     . SER A 1 202 ? 22.205  43.572  15.401 1.00 33.97  ? 228 SER A C     1 
ATOM   1559 O O     . SER A 1 202 ? 22.090  44.652  15.959 1.00 34.16  ? 228 SER A O     1 
ATOM   1560 C CB    . SER A 1 202 ? 20.046  43.517  14.122 1.00 36.27  ? 228 SER A CB    1 
ATOM   1561 O OG    . SER A 1 202 ? 19.479  42.334  14.670 1.00 38.77  ? 228 SER A OG    1 
ATOM   1562 N N     . ASP A 1 203 ? 22.891  42.575  15.947 1.00 33.45  ? 229 ASP A N     1 
ATOM   1563 C CA    . ASP A 1 203 ? 23.602  42.762  17.225 1.00 32.80  ? 229 ASP A CA    1 
ATOM   1564 C C     . ASP A 1 203 ? 24.914  43.525  17.053 1.00 31.72  ? 229 ASP A C     1 
ATOM   1565 O O     . ASP A 1 203 ? 25.578  43.826  18.039 1.00 31.53  ? 229 ASP A O     1 
ATOM   1566 C CB    . ASP A 1 203 ? 23.884  41.405  17.914 1.00 32.60  ? 229 ASP A CB    1 
ATOM   1567 C CG    . ASP A 1 203 ? 22.679  40.863  18.660 1.00 34.62  ? 229 ASP A CG    1 
ATOM   1568 O OD1   . ASP A 1 203 ? 21.556  41.416  18.528 1.00 36.03  ? 229 ASP A OD1   1 
ATOM   1569 O OD2   . ASP A 1 203 ? 22.847  39.867  19.395 1.00 39.17  ? 229 ASP A OD2   1 
ATOM   1570 N N     . TYR A 1 204 ? 25.295  43.832  15.810 1.00 31.43  ? 230 TYR A N     1 
ATOM   1571 C CA    . TYR A 1 204 ? 26.593  44.476  15.545 1.00 30.87  ? 230 TYR A CA    1 
ATOM   1572 C C     . TYR A 1 204 ? 26.798  45.824  16.257 1.00 31.00  ? 230 TYR A C     1 
ATOM   1573 O O     . TYR A 1 204 ? 27.928  46.231  16.510 1.00 31.12  ? 230 TYR A O     1 
ATOM   1574 C CB    . TYR A 1 204 ? 26.844  44.637  14.037 1.00 31.07  ? 230 TYR A CB    1 
ATOM   1575 C CG    . TYR A 1 204 ? 26.143  45.818  13.422 1.00 31.32  ? 230 TYR A CG    1 
ATOM   1576 C CD1   . TYR A 1 204 ? 26.755  47.065  13.376 1.00 31.12  ? 230 TYR A CD1   1 
ATOM   1577 C CD2   . TYR A 1 204 ? 24.862  45.693  12.892 1.00 32.22  ? 230 TYR A CD2   1 
ATOM   1578 C CE1   . TYR A 1 204 ? 26.108  48.151  12.827 1.00 33.71  ? 230 TYR A CE1   1 
ATOM   1579 C CE2   . TYR A 1 204 ? 24.207  46.771  12.321 1.00 33.14  ? 230 TYR A CE2   1 
ATOM   1580 C CZ    . TYR A 1 204 ? 24.830  47.999  12.295 1.00 35.97  ? 230 TYR A CZ    1 
ATOM   1581 O OH    . TYR A 1 204 ? 24.178  49.086  11.745 1.00 39.12  ? 230 TYR A OH    1 
ATOM   1582 N N     . ASP A 1 205 ? 25.720  46.518  16.580 1.00 31.31  ? 231 ASP A N     1 
ATOM   1583 C CA    . ASP A 1 205 ? 25.864  47.862  17.133 1.00 32.66  ? 231 ASP A CA    1 
ATOM   1584 C C     . ASP A 1 205 ? 25.550  47.954  18.641 1.00 33.18  ? 231 ASP A C     1 
ATOM   1585 O O     . ASP A 1 205 ? 25.434  49.057  19.180 1.00 33.06  ? 231 ASP A O     1 
ATOM   1586 C CB    . ASP A 1 205 ? 24.985  48.854  16.350 1.00 32.60  ? 231 ASP A CB    1 
ATOM   1587 C CG    . ASP A 1 205 ? 23.507  48.675  16.636 1.00 34.29  ? 231 ASP A CG    1 
ATOM   1588 O OD1   . ASP A 1 205 ? 23.097  47.657  17.252 1.00 31.34  ? 231 ASP A OD1   1 
ATOM   1589 O OD2   . ASP A 1 205 ? 22.736  49.571  16.234 1.00 40.39  ? 231 ASP A OD2   1 
ATOM   1590 N N     . LEU A 1 206 ? 25.398  46.805  19.302 1.00 33.99  ? 232 LEU A N     1 
ATOM   1591 C CA    . LEU A 1 206 ? 25.073  46.782  20.731 1.00 35.74  ? 232 LEU A CA    1 
ATOM   1592 C C     . LEU A 1 206 ? 26.247  47.276  21.550 1.00 36.87  ? 232 LEU A C     1 
ATOM   1593 O O     . LEU A 1 206 ? 27.405  46.934  21.264 1.00 37.04  ? 232 LEU A O     1 
ATOM   1594 C CB    . LEU A 1 206 ? 24.727  45.378  21.196 1.00 36.16  ? 232 LEU A CB    1 
ATOM   1595 C CG    . LEU A 1 206 ? 23.373  44.801  20.784 1.00 38.41  ? 232 LEU A CG    1 
ATOM   1596 C CD1   . LEU A 1 206 ? 23.341  43.317  21.147 1.00 39.39  ? 232 LEU A CD1   1 
ATOM   1597 C CD2   . LEU A 1 206 ? 22.209  45.538  21.445 1.00 38.63  ? 232 LEU A CD2   1 
ATOM   1598 N N     . VAL A 1 207 ? 25.944  48.087  22.557 1.00 37.99  ? 233 VAL A N     1 
ATOM   1599 C CA    . VAL A 1 207 ? 26.953  48.601  23.462 1.00 39.78  ? 233 VAL A CA    1 
ATOM   1600 C C     . VAL A 1 207 ? 27.558  47.429  24.233 1.00 41.14  ? 233 VAL A C     1 
ATOM   1601 O O     . VAL A 1 207 ? 26.875  46.472  24.566 1.00 41.77  ? 233 VAL A O     1 
ATOM   1602 C CB    . VAL A 1 207 ? 26.349  49.690  24.404 1.00 41.04  ? 233 VAL A CB    1 
ATOM   1603 C CG1   . VAL A 1 207 ? 27.318  50.104  25.518 1.00 43.99  ? 233 VAL A CG1   1 
ATOM   1604 C CG2   . VAL A 1 207 ? 25.989  50.911  23.599 1.00 40.15  ? 233 VAL A CG2   1 
ATOM   1605 N N     . LEU A 1 208 ? 28.857  47.503  24.467 1.00 42.80  ? 234 LEU A N     1 
ATOM   1606 C CA    . LEU A 1 208 ? 29.565  46.567  25.331 1.00 45.70  ? 234 LEU A CA    1 
ATOM   1607 C C     . LEU A 1 208 ? 28.964  46.578  26.720 1.00 48.61  ? 234 LEU A C     1 
ATOM   1608 O O     . LEU A 1 208 ? 28.779  47.653  27.307 1.00 50.09  ? 234 LEU A O     1 
ATOM   1609 C CB    . LEU A 1 208 ? 31.017  47.029  25.433 1.00 46.58  ? 234 LEU A CB    1 
ATOM   1610 C CG    . LEU A 1 208 ? 32.179  46.058  25.513 1.00 48.89  ? 234 LEU A CG    1 
ATOM   1611 C CD1   . LEU A 1 208 ? 32.064  44.972  24.415 1.00 47.35  ? 234 LEU A CD1   1 
ATOM   1612 C CD2   . LEU A 1 208 ? 33.465  46.847  25.366 1.00 47.79  ? 234 LEU A CD2   1 
ATOM   1613 N N     . ALA A 1 209 ? 28.649  45.400  27.255 1.00 50.71  ? 235 ALA A N     1 
ATOM   1614 C CA    . ALA A 1 209 ? 28.323  45.286  28.687 1.00 54.38  ? 235 ALA A CA    1 
ATOM   1615 C C     . ALA A 1 209 ? 29.551  45.583  29.574 1.00 56.93  ? 235 ALA A C     1 
ATOM   1616 O O     . ALA A 1 209 ? 30.695  45.585  29.100 1.00 56.22  ? 235 ALA A O     1 
ATOM   1617 C CB    . ALA A 1 209 ? 27.748  43.907  29.007 1.00 55.68  ? 235 ALA A CB    1 
ATOM   1618 N N     . GLU A 1 210 ? 29.310  45.816  30.862 1.00 60.57  ? 236 GLU A N     1 
ATOM   1619 C CA    . GLU A 1 210 ? 30.370  46.265  31.769 1.00 63.85  ? 236 GLU A CA    1 
ATOM   1620 C C     . GLU A 1 210 ? 31.491  45.228  31.985 1.00 65.69  ? 236 GLU A C     1 
ATOM   1621 O O     . GLU A 1 210 ? 32.657  45.595  32.144 1.00 66.94  ? 236 GLU A O     1 
ATOM   1622 C CB    . GLU A 1 210 ? 29.777  46.728  33.110 1.00 67.33  ? 236 GLU A CB    1 
ATOM   1623 C CG    . GLU A 1 210 ? 30.757  47.504  34.018 1.00 70.90  ? 236 GLU A CG    1 
ATOM   1624 C CD    . GLU A 1 210 ? 30.993  48.963  33.587 1.00 70.06  ? 236 GLU A CD    1 
ATOM   1625 O OE1   . GLU A 1 210 ? 30.063  49.607  33.034 1.00 68.70  ? 236 GLU A OE1   1 
ATOM   1626 O OE2   . GLU A 1 210 ? 32.116  49.467  33.814 1.00 69.84  ? 236 GLU A OE2   1 
ATOM   1627 N N     . ASP A 1 211 ? 31.138  43.947  31.982 1.00 66.21  ? 237 ASP A N     1 
ATOM   1628 C CA    . ASP A 1 211 ? 32.106  42.882  32.260 1.00 69.13  ? 237 ASP A CA    1 
ATOM   1629 C C     . ASP A 1 211 ? 32.661  42.229  30.983 1.00 65.99  ? 237 ASP A C     1 
ATOM   1630 O O     . ASP A 1 211 ? 33.414  41.254  31.046 1.00 67.55  ? 237 ASP A O     1 
ATOM   1631 C CB    . ASP A 1 211 ? 31.466  41.819  33.170 1.00 72.71  ? 237 ASP A CB    1 
ATOM   1632 C CG    . ASP A 1 211 ? 30.246  41.134  32.524 1.00 71.92  ? 237 ASP A CG    1 
ATOM   1633 O OD1   . ASP A 1 211 ? 29.772  40.119  33.088 1.00 76.37  ? 237 ASP A OD1   1 
ATOM   1634 O OD2   . ASP A 1 211 ? 29.758  41.607  31.470 1.00 68.55  ? 237 ASP A OD2   1 
ATOM   1635 N N     . GLU A 1 212 ? 32.287  42.798  29.840 1.00 64.97  ? 238 GLU A N     1 
ATOM   1636 C CA    . GLU A 1 212 ? 32.488  42.205  28.522 1.00 61.86  ? 238 GLU A CA    1 
ATOM   1637 C C     . GLU A 1 212 ? 33.784  42.752  27.943 1.00 61.63  ? 238 GLU A C     1 
ATOM   1638 O O     . GLU A 1 212 ? 33.996  43.962  27.912 1.00 62.31  ? 238 GLU A O     1 
ATOM   1639 C CB    . GLU A 1 212 ? 31.308  42.609  27.624 1.00 59.21  ? 238 GLU A CB    1 
ATOM   1640 C CG    . GLU A 1 212 ? 30.702  41.509  26.762 1.00 58.33  ? 238 GLU A CG    1 
ATOM   1641 C CD    . GLU A 1 212 ? 29.749  42.034  25.653 1.00 57.06  ? 238 GLU A CD    1 
ATOM   1642 O OE1   . GLU A 1 212 ? 29.774  41.455  24.546 1.00 53.97  ? 238 GLU A OE1   1 
ATOM   1643 O OE2   . GLU A 1 212 ? 28.975  43.003  25.880 1.00 57.55  ? 238 GLU A OE2   1 
ATOM   1644 N N     . GLU A 1 213 ? 34.661  41.865  27.502 1.00 61.23  ? 239 GLU A N     1 
ATOM   1645 C CA    . GLU A 1 213 ? 35.883  42.297  26.824 1.00 61.71  ? 239 GLU A CA    1 
ATOM   1646 C C     . GLU A 1 213 ? 35.658  42.462  25.312 1.00 57.97  ? 239 GLU A C     1 
ATOM   1647 O O     . GLU A 1 213 ? 36.074  43.456  24.723 1.00 58.40  ? 239 GLU A O     1 
ATOM   1648 C CB    . GLU A 1 213 ? 37.070  41.376  27.159 1.00 64.18  ? 239 GLU A CB    1 
ATOM   1649 C CG    . GLU A 1 213 ? 37.539  41.553  28.628 1.00 70.37  ? 239 GLU A CG    1 
ATOM   1650 C CD    . GLU A 1 213 ? 38.995  41.178  28.877 1.00 76.18  ? 239 GLU A CD    1 
ATOM   1651 O OE1   . GLU A 1 213 ? 39.604  40.481  28.034 1.00 77.59  ? 239 GLU A OE1   1 
ATOM   1652 O OE2   . GLU A 1 213 ? 39.535  41.572  29.938 1.00 80.63  ? 239 GLU A OE2   1 
ATOM   1653 N N     . MET A 1 214 ? 34.966  41.516  24.697 1.00 54.49  ? 240 MET A N     1 
ATOM   1654 C CA    . MET A 1 214 ? 34.647  41.635  23.279 1.00 51.21  ? 240 MET A CA    1 
ATOM   1655 C C     . MET A 1 214 ? 33.137  41.792  23.055 1.00 48.24  ? 240 MET A C     1 
ATOM   1656 O O     . MET A 1 214 ? 32.341  41.393  23.902 1.00 48.13  ? 240 MET A O     1 
ATOM   1657 C CB    . MET A 1 214 ? 35.214  40.451  22.495 1.00 50.84  ? 240 MET A CB    1 
ATOM   1658 C CG    . MET A 1 214 ? 34.636  39.113  22.861 1.00 51.36  ? 240 MET A CG    1 
ATOM   1659 S SD    . MET A 1 214 ? 35.310  37.765  21.869 1.00 55.32  ? 240 MET A SD    1 
ATOM   1660 C CE    . MET A 1 214 ? 37.059  37.850  22.240 1.00 55.05  ? 240 MET A CE    1 
ATOM   1661 N N     . ASN A 1 215 ? 32.746  42.379  21.926 1.00 45.11  ? 241 ASN A N     1 
ATOM   1662 C CA    . ASN A 1 215 ? 31.332  42.632  21.675 1.00 42.65  ? 241 ASN A CA    1 
ATOM   1663 C C     . ASN A 1 215 ? 30.552  41.357  21.342 1.00 41.39  ? 241 ASN A C     1 
ATOM   1664 O O     . ASN A 1 215 ? 31.156  40.317  21.049 1.00 40.88  ? 241 ASN A O     1 
ATOM   1665 C CB    . ASN A 1 215 ? 31.146  43.741  20.621 1.00 41.55  ? 241 ASN A CB    1 
ATOM   1666 C CG    . ASN A 1 215 ? 31.793  43.409  19.260 1.00 39.07  ? 241 ASN A CG    1 
ATOM   1667 O OD1   . ASN A 1 215 ? 31.671  42.299  18.743 1.00 36.38  ? 241 ASN A OD1   1 
ATOM   1668 N ND2   . ASN A 1 215 ? 32.452  44.396  18.673 1.00 36.35  ? 241 ASN A ND2   1 
ATOM   1669 N N     . ARG A 1 216 ? 29.220  41.438  21.386 1.00 40.65  ? 242 ARG A N     1 
ATOM   1670 C CA    . ARG A 1 216 ? 28.362  40.260  21.178 1.00 40.63  ? 242 ARG A CA    1 
ATOM   1671 C C     . ARG A 1 216 ? 28.683  39.486  19.887 1.00 39.44  ? 242 ARG A C     1 
ATOM   1672 O O     . ARG A 1 216 ? 28.730  38.241  19.889 1.00 39.96  ? 242 ARG A O     1 
ATOM   1673 C CB    . ARG A 1 216 ? 26.876  40.647  21.200 1.00 40.04  ? 242 ARG A CB    1 
ATOM   1674 C CG    . ARG A 1 216 ? 26.352  41.089  22.556 1.00 45.70  ? 242 ARG A CG    1 
ATOM   1675 C CD    . ARG A 1 216 ? 26.005  39.917  23.495 1.00 52.70  ? 242 ARG A CD    1 
ATOM   1676 N NE    . ARG A 1 216 ? 25.631  40.417  24.826 1.00 58.72  ? 242 ARG A NE    1 
ATOM   1677 C CZ    . ARG A 1 216 ? 26.272  40.137  25.964 1.00 63.19  ? 242 ARG A CZ    1 
ATOM   1678 N NH1   . ARG A 1 216 ? 27.324  39.318  25.979 1.00 65.14  ? 242 ARG A NH1   1 
ATOM   1679 N NH2   . ARG A 1 216 ? 25.849  40.670  27.107 1.00 66.44  ? 242 ARG A NH2   1 
ATOM   1680 N N     . MET A 1 217 ? 28.904  40.215  18.795 1.00 37.99  ? 243 MET A N     1 
ATOM   1681 C CA    . MET A 1 217 ? 29.223  39.581  17.533 1.00 37.50  ? 243 MET A CA    1 
ATOM   1682 C C     . MET A 1 217 ? 30.531  38.806  17.626 1.00 38.42  ? 243 MET A C     1 
ATOM   1683 O O     . MET A 1 217 ? 30.600  37.670  17.174 1.00 38.57  ? 243 MET A O     1 
ATOM   1684 C CB    . MET A 1 217 ? 29.295  40.602  16.397 1.00 37.33  ? 243 MET A CB    1 
ATOM   1685 C CG    . MET A 1 217 ? 29.497  39.969  15.027 1.00 37.86  ? 243 MET A CG    1 
ATOM   1686 S SD    . MET A 1 217 ? 27.918  39.421  14.384 1.00 39.98  ? 243 MET A SD    1 
ATOM   1687 C CE    . MET A 1 217 ? 27.284  40.987  13.807 1.00 37.56  ? 243 MET A CE    1 
ATOM   1688 N N     . HIS A 1 218 ? 31.570  39.405  18.208 1.00 39.15  ? 244 HIS A N     1 
ATOM   1689 C CA    . HIS A 1 218 ? 32.833  38.678  18.348 1.00 40.41  ? 244 HIS A CA    1 
ATOM   1690 C C     . HIS A 1 218 ? 32.775  37.450  19.270 1.00 41.56  ? 244 HIS A C     1 
ATOM   1691 O O     . HIS A 1 218 ? 33.560  36.511  19.099 1.00 42.29  ? 244 HIS A O     1 
ATOM   1692 C CB    . HIS A 1 218 ? 33.975  39.622  18.736 1.00 41.64  ? 244 HIS A CB    1 
ATOM   1693 C CG    . HIS A 1 218 ? 34.445  40.462  17.596 1.00 40.74  ? 244 HIS A CG    1 
ATOM   1694 N ND1   . HIS A 1 218 ? 33.682  41.478  17.062 1.00 37.76  ? 244 HIS A ND1   1 
ATOM   1695 C CD2   . HIS A 1 218 ? 35.578  40.414  16.858 1.00 42.21  ? 244 HIS A CD2   1 
ATOM   1696 C CE1   . HIS A 1 218 ? 34.331  42.029  16.052 1.00 39.23  ? 244 HIS A CE1   1 
ATOM   1697 N NE2   . HIS A 1 218 ? 35.485  41.402  15.905 1.00 41.24  ? 244 HIS A NE2   1 
ATOM   1698 N N     . GLU A 1 219 ? 31.851  37.453  20.228 1.00 42.01  ? 245 GLU A N     1 
ATOM   1699 C CA    . GLU A 1 219 ? 31.654  36.295  21.106 1.00 44.03  ? 245 GLU A CA    1 
ATOM   1700 C C     . GLU A 1 219 ? 30.987  35.182  20.319 1.00 43.49  ? 245 GLU A C     1 
ATOM   1701 O O     . GLU A 1 219 ? 31.331  33.996  20.440 1.00 44.28  ? 245 GLU A O     1 
ATOM   1702 C CB    . GLU A 1 219 ? 30.770  36.666  22.288 1.00 45.00  ? 245 GLU A CB    1 
ATOM   1703 C CG    . GLU A 1 219 ? 31.456  37.557  23.310 1.00 47.87  ? 245 GLU A CG    1 
ATOM   1704 C CD    . GLU A 1 219 ? 30.519  37.988  24.403 1.00 51.43  ? 245 GLU A CD    1 
ATOM   1705 O OE1   . GLU A 1 219 ? 31.027  38.449  25.450 1.00 55.86  ? 245 GLU A OE1   1 
ATOM   1706 O OE2   . GLU A 1 219 ? 29.279  37.863  24.225 1.00 50.45  ? 245 GLU A OE2   1 
ATOM   1707 N N     . SER A 1 220 ? 30.022  35.590  19.502 1.00 42.11  ? 246 SER A N     1 
ATOM   1708 C CA    . SER A 1 220 ? 29.361  34.691  18.592 1.00 41.13  ? 246 SER A CA    1 
ATOM   1709 C C     . SER A 1 220 ? 30.366  34.058  17.628 1.00 40.62  ? 246 SER A C     1 
ATOM   1710 O O     . SER A 1 220 ? 30.318  32.848  17.390 1.00 41.42  ? 246 SER A O     1 
ATOM   1711 C CB    . SER A 1 220 ? 28.271  35.440  17.847 1.00 39.84  ? 246 SER A CB    1 
ATOM   1712 O OG    . SER A 1 220 ? 27.233  34.559  17.527 1.00 41.70  ? 246 SER A OG    1 
ATOM   1713 N N     . MET A 1 221 ? 31.294  34.860  17.115 1.00 40.00  ? 247 MET A N     1 
ATOM   1714 C CA    . MET A 1 221 ? 32.375  34.360  16.251 1.00 40.61  ? 247 MET A CA    1 
ATOM   1715 C C     . MET A 1 221 ? 33.301  33.387  16.980 1.00 42.88  ? 247 MET A C     1 
ATOM   1716 O O     . MET A 1 221 ? 33.721  32.378  16.410 1.00 43.62  ? 247 MET A O     1 
ATOM   1717 C CB    . MET A 1 221 ? 33.212  35.517  15.697 1.00 40.15  ? 247 MET A CB    1 
ATOM   1718 C CG    . MET A 1 221 ? 32.493  36.373  14.657 1.00 38.63  ? 247 MET A CG    1 
ATOM   1719 S SD    . MET A 1 221 ? 33.256  37.982  14.352 1.00 39.43  ? 247 MET A SD    1 
ATOM   1720 C CE    . MET A 1 221 ? 34.891  37.489  13.768 1.00 35.65  ? 247 MET A CE    1 
ATOM   1721 N N     . LYS A 1 222 ? 33.632  33.701  18.232 1.00 44.24  ? 248 LYS A N     1 
ATOM   1722 C CA    . LYS A 1 222 ? 34.518  32.854  19.033 1.00 46.57  ? 248 LYS A CA    1 
ATOM   1723 C C     . LYS A 1 222 ? 33.888  31.466  19.200 1.00 46.56  ? 248 LYS A C     1 
ATOM   1724 O O     . LYS A 1 222 ? 34.527  30.440  18.959 1.00 47.24  ? 248 LYS A O     1 
ATOM   1725 C CB    . LYS A 1 222 ? 34.801  33.521  20.390 1.00 47.71  ? 248 LYS A CB    1 
ATOM   1726 C CG    . LYS A 1 222 ? 35.947  32.920  21.194 1.00 52.13  ? 248 LYS A CG    1 
ATOM   1727 C CD    . LYS A 1 222 ? 36.007  33.568  22.593 1.00 57.79  ? 248 LYS A CD    1 
ATOM   1728 C CE    . LYS A 1 222 ? 37.011  32.889  23.526 1.00 62.47  ? 248 LYS A CE    1 
ATOM   1729 N NZ    . LYS A 1 222 ? 38.386  33.460  23.364 1.00 66.40  ? 248 LYS A NZ    1 
ATOM   1730 N N     . LEU A 1 223 ? 32.619  31.455  19.587 1.00 45.88  ? 249 LEU A N     1 
ATOM   1731 C CA    . LEU A 1 223 ? 31.838  30.228  19.683 1.00 46.47  ? 249 LEU A CA    1 
ATOM   1732 C C     . LEU A 1 223 ? 31.799  29.436  18.359 1.00 46.36  ? 249 LEU A C     1 
ATOM   1733 O O     . LEU A 1 223 ? 32.004  28.225  18.358 1.00 47.97  ? 249 LEU A O     1 
ATOM   1734 C CB    . LEU A 1 223 ? 30.420  30.563  20.153 1.00 45.23  ? 249 LEU A CB    1 
ATOM   1735 C CG    . LEU A 1 223 ? 29.437  29.407  20.273 1.00 47.09  ? 249 LEU A CG    1 
ATOM   1736 C CD1   . LEU A 1 223 ? 29.923  28.399  21.327 1.00 50.17  ? 249 LEU A CD1   1 
ATOM   1737 C CD2   . LEU A 1 223 ? 28.033  29.914  20.598 1.00 46.60  ? 249 LEU A CD2   1 
ATOM   1738 N N     . PHE A 1 224 ? 31.531  30.125  17.249 1.00 45.05  ? 250 PHE A N     1 
ATOM   1739 C CA    . PHE A 1 224 ? 31.428  29.491  15.936 1.00 44.90  ? 250 PHE A CA    1 
ATOM   1740 C C     . PHE A 1 224 ? 32.759  28.906  15.457 1.00 46.16  ? 250 PHE A C     1 
ATOM   1741 O O     . PHE A 1 224 ? 32.798  27.802  14.895 1.00 46.30  ? 250 PHE A O     1 
ATOM   1742 C CB    . PHE A 1 224 ? 30.856  30.471  14.896 1.00 43.45  ? 250 PHE A CB    1 
ATOM   1743 C CG    . PHE A 1 224 ? 30.738  29.882  13.510 1.00 44.16  ? 250 PHE A CG    1 
ATOM   1744 C CD1   . PHE A 1 224 ? 29.678  29.040  13.185 1.00 43.84  ? 250 PHE A CD1   1 
ATOM   1745 C CD2   . PHE A 1 224 ? 31.707  30.142  12.542 1.00 43.32  ? 250 PHE A CD2   1 
ATOM   1746 C CE1   . PHE A 1 224 ? 29.579  28.480  11.918 1.00 43.72  ? 250 PHE A CE1   1 
ATOM   1747 C CE2   . PHE A 1 224 ? 31.604  29.593  11.271 1.00 43.42  ? 250 PHE A CE2   1 
ATOM   1748 C CZ    . PHE A 1 224 ? 30.538  28.764  10.961 1.00 43.36  ? 250 PHE A CZ    1 
ATOM   1749 N N     . ASP A 1 225 ? 33.842  29.646  15.675 1.00 46.50  ? 251 ASP A N     1 
ATOM   1750 C CA    . ASP A 1 225 ? 35.199  29.133  15.442 1.00 48.49  ? 251 ASP A CA    1 
ATOM   1751 C C     . ASP A 1 225 ? 35.411  27.797  16.172 1.00 50.10  ? 251 ASP A C     1 
ATOM   1752 O O     . ASP A 1 225 ? 35.914  26.819  15.588 1.00 50.52  ? 251 ASP A O     1 
ATOM   1753 C CB    . ASP A 1 225 ? 36.220  30.173  15.920 1.00 49.40  ? 251 ASP A CB    1 
ATOM   1754 C CG    . ASP A 1 225 ? 37.674  29.783  15.648 1.00 52.77  ? 251 ASP A CG    1 
ATOM   1755 O OD1   . ASP A 1 225 ? 37.959  28.696  15.105 1.00 56.24  ? 251 ASP A OD1   1 
ATOM   1756 O OD2   . ASP A 1 225 ? 38.557  30.591  15.997 1.00 55.98  ? 251 ASP A OD2   1 
ATOM   1757 N N     . SER A 1 226 ? 35.005  27.766  17.440 1.00 50.67  ? 252 SER A N     1 
ATOM   1758 C CA    . SER A 1 226 ? 35.179  26.590  18.293 1.00 52.93  ? 252 SER A CA    1 
ATOM   1759 C C     . SER A 1 226 ? 34.350  25.403  17.806 1.00 53.30  ? 252 SER A C     1 
ATOM   1760 O O     . SER A 1 226 ? 34.881  24.305  17.661 1.00 54.65  ? 252 SER A O     1 
ATOM   1761 C CB    . SER A 1 226 ? 34.861  26.924  19.754 1.00 53.50  ? 252 SER A CB    1 
ATOM   1762 O OG    . SER A 1 226 ? 35.028  25.778  20.570 1.00 55.65  ? 252 SER A OG    1 
ATOM   1763 N N     . ILE A 1 227 ? 33.066  25.632  17.532 1.00 52.46  ? 253 ILE A N     1 
ATOM   1764 C CA    . ILE A 1 227 ? 32.181  24.591  16.999 1.00 53.58  ? 253 ILE A CA    1 
ATOM   1765 C C     . ILE A 1 227 ? 32.676  24.072  15.654 1.00 54.57  ? 253 ILE A C     1 
ATOM   1766 O O     . ILE A 1 227 ? 32.849  22.873  15.448 1.00 56.25  ? 253 ILE A O     1 
ATOM   1767 C CB    . ILE A 1 227 ? 30.742  25.116  16.796 1.00 51.94  ? 253 ILE A CB    1 
ATOM   1768 C CG1   . ILE A 1 227 ? 30.119  25.528  18.128 1.00 52.16  ? 253 ILE A CG1   1 
ATOM   1769 C CG2   . ILE A 1 227 ? 29.877  24.057  16.115 1.00 53.09  ? 253 ILE A CG2   1 
ATOM   1770 C CD1   . ILE A 1 227 ? 28.905  26.407  17.976 1.00 51.52  ? 253 ILE A CD1   1 
ATOM   1771 N N     . CYS A 1 228 ? 32.899  25.002  14.739 1.00 54.12  ? 254 CYS A N     1 
ATOM   1772 C CA    . CYS A 1 228 ? 33.201  24.681  13.359 1.00 55.25  ? 254 CYS A CA    1 
ATOM   1773 C C     . CYS A 1 228 ? 34.555  23.975  13.189 1.00 56.56  ? 254 CYS A C     1 
ATOM   1774 O O     . CYS A 1 228 ? 34.708  23.111  12.325 1.00 57.48  ? 254 CYS A O     1 
ATOM   1775 C CB    . CYS A 1 228 ? 33.085  25.963  12.531 1.00 53.87  ? 254 CYS A CB    1 
ATOM   1776 S SG    . CYS A 1 228 ? 33.921  25.956  11.009 1.00 59.28  ? 254 CYS A SG    1 
ATOM   1777 N N     . ASN A 1 229 ? 35.526  24.312  14.030 1.00 57.24  ? 255 ASN A N     1 
ATOM   1778 C CA    . ASN A 1 229 ? 36.842  23.654  13.953 1.00 59.07  ? 255 ASN A CA    1 
ATOM   1779 C C     . ASN A 1 229 ? 37.062  22.459  14.879 1.00 60.89  ? 255 ASN A C     1 
ATOM   1780 O O     . ASN A 1 229 ? 38.106  21.813  14.805 1.00 62.68  ? 255 ASN A O     1 
ATOM   1781 C CB    . ASN A 1 229 ? 37.965  24.673  14.129 1.00 59.12  ? 255 ASN A CB    1 
ATOM   1782 C CG    . ASN A 1 229 ? 37.961  25.719  13.035 1.00 58.13  ? 255 ASN A CG    1 
ATOM   1783 O OD1   . ASN A 1 229 ? 37.925  25.389  11.848 1.00 59.75  ? 255 ASN A OD1   1 
ATOM   1784 N ND2   . ASN A 1 229 ? 37.980  26.984  13.425 1.00 55.58  ? 255 ASN A ND2   1 
ATOM   1785 N N     . ASN A 1 230 ? 36.088  22.156  15.736 1.00 60.98  ? 256 ASN A N     1 
ATOM   1786 C CA    . ASN A 1 230 ? 36.209  21.004  16.639 1.00 63.54  ? 256 ASN A CA    1 
ATOM   1787 C C     . ASN A 1 230 ? 36.160  19.677  15.885 1.00 65.31  ? 256 ASN A C     1 
ATOM   1788 O O     . ASN A 1 230 ? 35.160  19.356  15.240 1.00 64.72  ? 256 ASN A O     1 
ATOM   1789 C CB    . ASN A 1 230 ? 35.150  21.026  17.747 1.00 63.10  ? 256 ASN A CB    1 
ATOM   1790 C CG    . ASN A 1 230 ? 35.488  20.076  18.896 1.00 65.38  ? 256 ASN A CG    1 
ATOM   1791 O OD1   . ASN A 1 230 ? 35.624  18.869  18.705 1.00 67.56  ? 256 ASN A OD1   1 
ATOM   1792 N ND2   . ASN A 1 230 ? 35.633  20.626  20.089 1.00 65.02  ? 256 ASN A ND2   1 
ATOM   1793 N N     . LYS A 1 231 ? 37.238  18.905  15.991 1.00 68.10  ? 257 LYS A N     1 
ATOM   1794 C CA    . LYS A 1 231 ? 37.382  17.679  15.204 1.00 70.47  ? 257 LYS A CA    1 
ATOM   1795 C C     . LYS A 1 231 ? 36.249  16.672  15.430 1.00 71.35  ? 257 LYS A C     1 
ATOM   1796 O O     . LYS A 1 231 ? 35.991  15.834  14.570 1.00 72.57  ? 257 LYS A O     1 
ATOM   1797 C CB    . LYS A 1 231 ? 38.757  17.027  15.413 1.00 73.03  ? 257 LYS A CB    1 
ATOM   1798 C CG    . LYS A 1 231 ? 39.264  16.301  14.162 1.00 75.04  ? 257 LYS A CG    1 
ATOM   1799 C CD    . LYS A 1 231 ? 40.546  15.513  14.384 1.00 78.49  ? 257 LYS A CD    1 
ATOM   1800 C CE    . LYS A 1 231 ? 40.812  14.618  13.182 1.00 80.06  ? 257 LYS A CE    1 
ATOM   1801 N NZ    . LYS A 1 231 ? 41.960  13.708  13.396 1.00 83.55  ? 257 LYS A NZ    1 
ATOM   1802 N N     . TRP A 1 232 ? 35.561  16.768  16.565 1.00 71.21  ? 258 TRP A N     1 
ATOM   1803 C CA    . TRP A 1 232 ? 34.409  15.911  16.829 1.00 72.39  ? 258 TRP A CA    1 
ATOM   1804 C C     . TRP A 1 232 ? 33.281  16.095  15.805 1.00 70.92  ? 258 TRP A C     1 
ATOM   1805 O O     . TRP A 1 232 ? 32.429  15.224  15.646 1.00 71.97  ? 258 TRP A O     1 
ATOM   1806 C CB    . TRP A 1 232 ? 33.887  16.139  18.254 1.00 72.95  ? 258 TRP A CB    1 
ATOM   1807 C CG    . TRP A 1 232 ? 33.473  14.868  18.972 1.00 76.64  ? 258 TRP A CG    1 
ATOM   1808 C CD1   . TRP A 1 232 ? 33.924  13.602  18.722 1.00 79.14  ? 258 TRP A CD1   1 
ATOM   1809 C CD2   . TRP A 1 232 ? 32.566  14.757  20.082 1.00 77.86  ? 258 TRP A CD2   1 
ATOM   1810 N NE1   . TRP A 1 232 ? 33.337  12.709  19.586 1.00 82.30  ? 258 TRP A NE1   1 
ATOM   1811 C CE2   . TRP A 1 232 ? 32.502  13.390  20.432 1.00 80.90  ? 258 TRP A CE2   1 
ATOM   1812 C CE3   . TRP A 1 232 ? 31.790  15.677  20.802 1.00 77.18  ? 258 TRP A CE3   1 
ATOM   1813 C CZ2   . TRP A 1 232 ? 31.694  12.918  21.471 1.00 82.85  ? 258 TRP A CZ2   1 
ATOM   1814 C CZ3   . TRP A 1 232 ? 30.989  15.206  21.838 1.00 78.31  ? 258 TRP A CZ3   1 
ATOM   1815 C CH2   . TRP A 1 232 ? 30.950  13.840  22.161 1.00 81.87  ? 258 TRP A CH2   1 
ATOM   1816 N N     . PHE A 1 233 ? 33.283  17.224  15.102 1.00 69.06  ? 259 PHE A N     1 
ATOM   1817 C CA    . PHE A 1 233 ? 32.203  17.523  14.164 1.00 67.86  ? 259 PHE A CA    1 
ATOM   1818 C C     . PHE A 1 233 ? 32.576  17.343  12.684 1.00 68.24  ? 259 PHE A C     1 
ATOM   1819 O O     . PHE A 1 233 ? 31.893  17.862  11.808 1.00 67.13  ? 259 PHE A O     1 
ATOM   1820 C CB    . PHE A 1 233 ? 31.626  18.917  14.445 1.00 65.51  ? 259 PHE A CB    1 
ATOM   1821 C CG    . PHE A 1 233 ? 31.150  19.102  15.866 1.00 65.66  ? 259 PHE A CG    1 
ATOM   1822 C CD1   . PHE A 1 233 ? 30.331  18.147  16.475 1.00 67.17  ? 259 PHE A CD1   1 
ATOM   1823 C CD2   . PHE A 1 233 ? 31.514  20.233  16.592 1.00 63.14  ? 259 PHE A CD2   1 
ATOM   1824 C CE1   . PHE A 1 233 ? 29.893  18.316  17.789 1.00 67.71  ? 259 PHE A CE1   1 
ATOM   1825 C CE2   . PHE A 1 233 ? 31.079  20.412  17.898 1.00 63.77  ? 259 PHE A CE2   1 
ATOM   1826 C CZ    . PHE A 1 233 ? 30.267  19.455  18.501 1.00 66.19  ? 259 PHE A CZ    1 
ATOM   1827 N N     . THR A 1 234 ? 33.645  16.592  12.421 1.00 70.38  ? 260 THR A N     1 
ATOM   1828 C CA    . THR A 1 234 ? 34.117  16.292  11.056 1.00 71.61  ? 260 THR A CA    1 
ATOM   1829 C C     . THR A 1 234 ? 32.997  16.002  10.044 1.00 71.73  ? 260 THR A C     1 
ATOM   1830 O O     . THR A 1 234 ? 32.966  16.604  8.966  1.00 71.48  ? 260 THR A O     1 
ATOM   1831 C CB    . THR A 1 234 ? 35.178  15.153  11.073 1.00 74.57  ? 260 THR A CB    1 
ATOM   1832 O OG1   . THR A 1 234 ? 36.415  15.682  11.557 1.00 75.10  ? 260 THR A OG1   1 
ATOM   1833 C CG2   . THR A 1 234 ? 35.411  14.536  9.672  1.00 76.59  ? 260 THR A CG2   1 
ATOM   1834 N N     . ASP A 1 235 ? 32.085  15.096  10.396 1.00 72.83  ? 261 ASP A N     1 
ATOM   1835 C CA    . ASP A 1 235 ? 30.998  14.690  9.496  1.00 73.58  ? 261 ASP A CA    1 
ATOM   1836 C C     . ASP A 1 235 ? 29.663  15.369  9.810  1.00 71.42  ? 261 ASP A C     1 
ATOM   1837 O O     . ASP A 1 235 ? 28.622  15.009  9.245  1.00 72.51  ? 261 ASP A O     1 
ATOM   1838 C CB    . ASP A 1 235 ? 30.820  13.164  9.508  1.00 77.16  ? 261 ASP A CB    1 
ATOM   1839 C CG    . ASP A 1 235 ? 31.687  12.452  8.469  1.00 80.20  ? 261 ASP A CG    1 
ATOM   1840 O OD1   . ASP A 1 235 ? 32.327  13.127  7.627  1.00 80.29  ? 261 ASP A OD1   1 
ATOM   1841 O OD2   . ASP A 1 235 ? 31.715  11.200  8.497  1.00 84.07  ? 261 ASP A OD2   1 
ATOM   1842 N N     . THR A 1 236 ? 29.699  16.343  10.713 1.00 68.37  ? 262 THR A N     1 
ATOM   1843 C CA    . THR A 1 236 ? 28.515  17.110  11.066 1.00 65.65  ? 262 THR A CA    1 
ATOM   1844 C C     . THR A 1 236 ? 28.364  18.263  10.081 1.00 63.11  ? 262 THR A C     1 
ATOM   1845 O O     . THR A 1 236 ? 29.332  18.963  9.788  1.00 61.62  ? 262 THR A O     1 
ATOM   1846 C CB    . THR A 1 236 ? 28.607  17.624  12.520 1.00 64.77  ? 262 THR A CB    1 
ATOM   1847 O OG1   . THR A 1 236 ? 28.849  16.513  13.396 1.00 66.26  ? 262 THR A OG1   1 
ATOM   1848 C CG2   . THR A 1 236 ? 27.320  18.318  12.946 1.00 62.80  ? 262 THR A CG2   1 
ATOM   1849 N N     . SER A 1 237 ? 27.159  18.429  9.543  1.00 62.27  ? 263 SER A N     1 
ATOM   1850 C CA    . SER A 1 237 ? 26.877  19.531  8.630  1.00 60.35  ? 263 SER A CA    1 
ATOM   1851 C C     . SER A 1 237 ? 26.735  20.822  9.439  1.00 57.34  ? 263 SER A C     1 
ATOM   1852 O O     . SER A 1 237 ? 25.853  20.937  10.289 1.00 57.03  ? 263 SER A O     1 
ATOM   1853 C CB    . SER A 1 237 ? 25.608  19.260  7.814  1.00 61.59  ? 263 SER A CB    1 
ATOM   1854 O OG    . SER A 1 237 ? 25.780  18.171  6.907  1.00 65.22  ? 263 SER A OG    1 
ATOM   1855 N N     . ILE A 1 238 ? 27.626  21.775  9.193  1.00 54.95  ? 264 ILE A N     1 
ATOM   1856 C CA    . ILE A 1 238 ? 27.551  23.065  9.858  1.00 51.94  ? 264 ILE A CA    1 
ATOM   1857 C C     . ILE A 1 238 ? 26.798  24.087  9.006  1.00 50.37  ? 264 ILE A C     1 
ATOM   1858 O O     . ILE A 1 238 ? 27.253  24.499  7.930  1.00 49.93  ? 264 ILE A O     1 
ATOM   1859 C CB    . ILE A 1 238 ? 28.947  23.612  10.226 1.00 51.44  ? 264 ILE A CB    1 
ATOM   1860 C CG1   . ILE A 1 238 ? 29.795  22.529  10.912 1.00 52.69  ? 264 ILE A CG1   1 
ATOM   1861 C CG2   . ILE A 1 238 ? 28.807  24.869  11.088 1.00 49.52  ? 264 ILE A CG2   1 
ATOM   1862 C CD1   . ILE A 1 238 ? 29.313  22.124  12.312 1.00 52.29  ? 264 ILE A CD1   1 
ATOM   1863 N N     . ILE A 1 239 ? 25.644  24.492  9.518  1.00 48.77  ? 265 ILE A N     1 
ATOM   1864 C CA    . ILE A 1 239 ? 24.794  25.465  8.873  1.00 46.97  ? 265 ILE A CA    1 
ATOM   1865 C C     . ILE A 1 239 ? 24.808  26.756  9.691  1.00 45.24  ? 265 ILE A C     1 
ATOM   1866 O O     . ILE A 1 239 ? 24.639  26.727  10.912 1.00 44.56  ? 265 ILE A O     1 
ATOM   1867 C CB    . ILE A 1 239 ? 23.385  24.898  8.716  1.00 48.04  ? 265 ILE A CB    1 
ATOM   1868 C CG1   . ILE A 1 239 ? 23.454  23.637  7.840  1.00 50.33  ? 265 ILE A CG1   1 
ATOM   1869 C CG2   . ILE A 1 239 ? 22.460  25.909  8.083  1.00 46.73  ? 265 ILE A CG2   1 
ATOM   1870 C CD1   . ILE A 1 239 ? 22.688  22.471  8.377  1.00 51.25  ? 265 ILE A CD1   1 
ATOM   1871 N N     . LEU A 1 240 ? 25.044  27.875  8.999  1.00 43.69  ? 266 LEU A N     1 
ATOM   1872 C CA    . LEU A 1 240 ? 25.158  29.189  9.608  1.00 41.41  ? 266 LEU A CA    1 
ATOM   1873 C C     . LEU A 1 240 ? 24.005  30.047  9.110  1.00 41.19  ? 266 LEU A C     1 
ATOM   1874 O O     . LEU A 1 240 ? 23.856  30.262  7.893  1.00 42.02  ? 266 LEU A O     1 
ATOM   1875 C CB    . LEU A 1 240 ? 26.493  29.828  9.226  1.00 40.51  ? 266 LEU A CB    1 
ATOM   1876 C CG    . LEU A 1 240 ? 26.775  31.258  9.698  1.00 38.58  ? 266 LEU A CG    1 
ATOM   1877 C CD1   . LEU A 1 240 ? 26.877  31.358  11.246 1.00 34.88  ? 266 LEU A CD1   1 
ATOM   1878 C CD2   . LEU A 1 240 ? 28.043  31.770  9.023  1.00 36.22  ? 266 LEU A CD2   1 
ATOM   1879 N N     . PHE A 1 241 ? 23.167  30.488  10.045 1.00 39.90  ? 267 PHE A N     1 
ATOM   1880 C CA    . PHE A 1 241 ? 22.051  31.363  9.740  1.00 39.22  ? 267 PHE A CA    1 
ATOM   1881 C C     . PHE A 1 241 ? 22.452  32.737  10.177 1.00 37.53  ? 267 PHE A C     1 
ATOM   1882 O O     . PHE A 1 241 ? 22.653  32.978  11.372 1.00 36.53  ? 267 PHE A O     1 
ATOM   1883 C CB    . PHE A 1 241 ? 20.785  30.960  10.495 1.00 39.84  ? 267 PHE A CB    1 
ATOM   1884 C CG    . PHE A 1 241 ? 19.996  29.856  9.844  1.00 42.92  ? 267 PHE A CG    1 
ATOM   1885 C CD1   . PHE A 1 241 ? 20.506  29.134  8.762  1.00 43.72  ? 267 PHE A CD1   1 
ATOM   1886 C CD2   . PHE A 1 241 ? 18.743  29.509  10.345 1.00 44.77  ? 267 PHE A CD2   1 
ATOM   1887 C CE1   . PHE A 1 241 ? 19.763  28.103  8.184  1.00 45.64  ? 267 PHE A CE1   1 
ATOM   1888 C CE2   . PHE A 1 241 ? 17.993  28.473  9.769  1.00 46.73  ? 267 PHE A CE2   1 
ATOM   1889 C CZ    . PHE A 1 241 ? 18.501  27.777  8.688  1.00 47.05  ? 267 PHE A CZ    1 
ATOM   1890 N N     . LEU A 1 242 ? 22.588  33.635  9.208  1.00 37.18  ? 268 LEU A N     1 
ATOM   1891 C CA    . LEU A 1 242 ? 22.882  35.032  9.503  1.00 35.75  ? 268 LEU A CA    1 
ATOM   1892 C C     . LEU A 1 242 ? 21.532  35.711  9.494  1.00 35.78  ? 268 LEU A C     1 
ATOM   1893 O O     . LEU A 1 242 ? 20.985  36.063  8.435  1.00 36.57  ? 268 LEU A O     1 
ATOM   1894 C CB    . LEU A 1 242 ? 23.845  35.626  8.464  1.00 35.63  ? 268 LEU A CB    1 
ATOM   1895 C CG    . LEU A 1 242 ? 25.264  35.035  8.490  1.00 35.62  ? 268 LEU A CG    1 
ATOM   1896 C CD1   . LEU A 1 242 ? 26.109  35.598  7.377  1.00 34.98  ? 268 LEU A CD1   1 
ATOM   1897 C CD2   . LEU A 1 242 ? 25.962  35.271  9.833  1.00 36.12  ? 268 LEU A CD2   1 
ATOM   1898 N N     . ASN A 1 243 ? 20.995  35.858  10.697 1.00 35.06  ? 269 ASN A N     1 
ATOM   1899 C CA    . ASN A 1 243 ? 19.575  36.103  10.910 1.00 35.44  ? 269 ASN A CA    1 
ATOM   1900 C C     . ASN A 1 243 ? 19.306  37.571  11.202 1.00 34.55  ? 269 ASN A C     1 
ATOM   1901 O O     . ASN A 1 243 ? 20.245  38.348  11.360 1.00 33.24  ? 269 ASN A O     1 
ATOM   1902 C CB    . ASN A 1 243 ? 19.080  35.217  12.049 1.00 35.64  ? 269 ASN A CB    1 
ATOM   1903 C CG    . ASN A 1 243 ? 17.575  35.219  12.180 1.00 38.34  ? 269 ASN A CG    1 
ATOM   1904 O OD1   . ASN A 1 243 ? 16.843  35.116  11.185 1.00 38.62  ? 269 ASN A OD1   1 
ATOM   1905 N ND2   . ASN A 1 243 ? 17.094  35.344  13.421 1.00 37.33  ? 269 ASN A ND2   1 
ATOM   1906 N N     . LYS A 1 244 ? 18.032  37.944  11.260 1.00 34.92  ? 270 LYS A N     1 
ATOM   1907 C CA    . LYS A 1 244 ? 17.635  39.341  11.472 1.00 35.51  ? 270 LYS A CA    1 
ATOM   1908 C C     . LYS A 1 244 ? 18.199  40.280  10.392 1.00 35.31  ? 270 LYS A C     1 
ATOM   1909 O O     . LYS A 1 244 ? 18.550  41.440  10.678 1.00 34.65  ? 270 LYS A O     1 
ATOM   1910 C CB    . LYS A 1 244 ? 18.005  39.834  12.886 1.00 34.72  ? 270 LYS A CB    1 
ATOM   1911 C CG    . LYS A 1 244 ? 17.257  39.128  14.035 1.00 36.05  ? 270 LYS A CG    1 
ATOM   1912 C CD    . LYS A 1 244 ? 17.543  39.769  15.413 1.00 35.96  ? 270 LYS A CD    1 
ATOM   1913 C CE    . LYS A 1 244 ? 16.846  38.988  16.537 1.00 39.04  ? 270 LYS A CE    1 
ATOM   1914 N NZ    . LYS A 1 244 ? 17.125  39.548  17.906 1.00 39.38  ? 270 LYS A NZ    1 
ATOM   1915 N N     . LYS A 1 245 ? 18.260  39.776  9.157  1.00 35.69  ? 271 LYS A N     1 
ATOM   1916 C CA    . LYS A 1 245 ? 18.781  40.551  8.023  1.00 36.35  ? 271 LYS A CA    1 
ATOM   1917 C C     . LYS A 1 245 ? 17.910  41.761  7.720  1.00 37.00  ? 271 LYS A C     1 
ATOM   1918 O O     . LYS A 1 245 ? 18.422  42.788  7.270  1.00 37.09  ? 271 LYS A O     1 
ATOM   1919 C CB    . LYS A 1 245 ? 18.931  39.680  6.762  1.00 37.44  ? 271 LYS A CB    1 
ATOM   1920 C CG    . LYS A 1 245 ? 17.610  39.178  6.174  1.00 37.85  ? 271 LYS A CG    1 
ATOM   1921 C CD    . LYS A 1 245 ? 17.862  38.249  5.021  1.00 40.79  ? 271 LYS A CD    1 
ATOM   1922 C CE    . LYS A 1 245 ? 16.558  37.787  4.391  1.00 44.56  ? 271 LYS A CE    1 
ATOM   1923 N NZ    . LYS A 1 245 ? 16.866  37.017  3.147  1.00 49.25  ? 271 LYS A NZ    1 
ATOM   1924 N N     . ASP A 1 246 ? 16.602  41.634  7.974  1.00 37.87  ? 272 ASP A N     1 
ATOM   1925 C CA    . ASP A 1 246 ? 15.663  42.755  7.834  1.00 38.85  ? 272 ASP A CA    1 
ATOM   1926 C C     . ASP A 1 246 ? 16.040  43.881  8.794  1.00 38.09  ? 272 ASP A C     1 
ATOM   1927 O O     . ASP A 1 246 ? 16.068  45.044  8.400  1.00 39.09  ? 272 ASP A O     1 
ATOM   1928 C CB    . ASP A 1 246 ? 14.195  42.306  8.052  1.00 40.10  ? 272 ASP A CB    1 
ATOM   1929 C CG    . ASP A 1 246 ? 13.948  41.693  9.446  1.00 40.96  ? 272 ASP A CG    1 
ATOM   1930 O OD1   . ASP A 1 246 ? 14.827  40.962  9.965  1.00 39.48  ? 272 ASP A OD1   1 
ATOM   1931 O OD2   . ASP A 1 246 ? 12.861  41.941  10.023 1.00 42.41  ? 272 ASP A OD2   1 
ATOM   1932 N N     . LEU A 1 247 ? 16.368  43.532  10.041 1.00 37.08  ? 273 LEU A N     1 
ATOM   1933 C CA    . LEU A 1 247 ? 16.716  44.538  11.049 1.00 36.07  ? 273 LEU A CA    1 
ATOM   1934 C C     . LEU A 1 247 ? 18.095  45.105  10.773 1.00 35.00  ? 273 LEU A C     1 
ATOM   1935 O O     . LEU A 1 247 ? 18.340  46.295  10.982 1.00 35.33  ? 273 LEU A O     1 
ATOM   1936 C CB    . LEU A 1 247 ? 16.641  43.948  12.473 1.00 36.25  ? 273 LEU A CB    1 
ATOM   1937 C CG    . LEU A 1 247 ? 15.245  43.587  13.013 1.00 36.95  ? 273 LEU A CG    1 
ATOM   1938 C CD1   . LEU A 1 247 ? 15.369  42.999  14.405 1.00 36.46  ? 273 LEU A CD1   1 
ATOM   1939 C CD2   . LEU A 1 247 ? 14.287  44.815  13.009 1.00 34.24  ? 273 LEU A CD2   1 
ATOM   1940 N N     . PHE A 1 248 ? 18.991  44.254  10.293 1.00 38.07  ? 274 PHE A N     1 
ATOM   1941 C CA    . PHE A 1 248 ? 20.316  44.696  9.871  1.00 36.64  ? 274 PHE A CA    1 
ATOM   1942 C C     . PHE A 1 248 ? 20.218  45.743  8.737  1.00 38.34  ? 274 PHE A C     1 
ATOM   1943 O O     . PHE A 1 248 ? 20.928  46.755  8.769  1.00 38.14  ? 274 PHE A O     1 
ATOM   1944 C CB    . PHE A 1 248 ? 21.132  43.490  9.431  1.00 34.48  ? 274 PHE A CB    1 
ATOM   1945 C CG    . PHE A 1 248 ? 22.543  43.803  9.036  1.00 33.55  ? 274 PHE A CG    1 
ATOM   1946 C CD1   . PHE A 1 248 ? 23.519  44.031  10.003 1.00 30.72  ? 274 PHE A CD1   1 
ATOM   1947 C CD2   . PHE A 1 248 ? 22.909  43.815  7.691  1.00 34.42  ? 274 PHE A CD2   1 
ATOM   1948 C CE1   . PHE A 1 248 ? 24.811  44.311  9.653  1.00 29.81  ? 274 PHE A CE1   1 
ATOM   1949 C CE2   . PHE A 1 248 ? 24.224  44.093  7.313  1.00 33.45  ? 274 PHE A CE2   1 
ATOM   1950 C CZ    . PHE A 1 248 ? 25.178  44.326  8.291  1.00 33.83  ? 274 PHE A CZ    1 
ATOM   1951 N N     . GLU A 1 249 ? 19.318  45.512  7.773  1.00 39.97  ? 275 GLU A N     1 
ATOM   1952 C CA    . GLU A 1 249 ? 19.171  46.404  6.618  1.00 42.88  ? 275 GLU A CA    1 
ATOM   1953 C C     . GLU A 1 249 ? 18.649  47.770  7.032  1.00 44.88  ? 275 GLU A C     1 
ATOM   1954 O O     . GLU A 1 249 ? 19.072  48.788  6.507  1.00 45.33  ? 275 GLU A O     1 
ATOM   1955 C CB    . GLU A 1 249 ? 18.239  45.798  5.554  1.00 44.92  ? 275 GLU A CB    1 
ATOM   1956 C CG    . GLU A 1 249 ? 18.118  46.670  4.295  1.00 50.16  ? 275 GLU A CG    1 
ATOM   1957 C CD    . GLU A 1 249 ? 17.168  46.101  3.263  1.00 57.76  ? 275 GLU A CD    1 
ATOM   1958 O OE1   . GLU A 1 249 ? 16.884  44.873  3.311  1.00 59.95  ? 275 GLU A OE1   1 
ATOM   1959 O OE2   . GLU A 1 249 ? 16.707  46.878  2.398  1.00 61.50  ? 275 GLU A OE2   1 
ATOM   1960 N N     . GLU A 1 250 ? 17.718  47.771  7.977  1.00 46.71  ? 276 GLU A N     1 
ATOM   1961 C CA    . GLU A 1 250 ? 17.200  49.002  8.544  1.00 50.18  ? 276 GLU A CA    1 
ATOM   1962 C C     . GLU A 1 250 ? 18.243  49.790  9.344  1.00 49.16  ? 276 GLU A C     1 
ATOM   1963 O O     . GLU A 1 250 ? 18.237  51.004  9.291  1.00 52.14  ? 276 GLU A O     1 
ATOM   1964 C CB    . GLU A 1 250 ? 15.942  48.728  9.374  1.00 52.07  ? 276 GLU A CB    1 
ATOM   1965 C CG    . GLU A 1 250 ? 14.749  48.297  8.534  1.00 57.33  ? 276 GLU A CG    1 
ATOM   1966 C CD    . GLU A 1 250 ? 14.302  49.374  7.532  1.00 64.85  ? 276 GLU A CD    1 
ATOM   1967 O OE1   . GLU A 1 250 ? 13.827  50.456  7.966  1.00 69.23  ? 276 GLU A OE1   1 
ATOM   1968 O OE2   . GLU A 1 250 ? 14.421  49.136  6.305  1.00 66.91  ? 276 GLU A OE2   1 
ATOM   1969 N N     . LYS A 1 251 ? 19.136  49.102  10.049 1.00 46.62  ? 277 LYS A N     1 
ATOM   1970 C CA    . LYS A 1 251 ? 20.150  49.736  10.917 1.00 46.91  ? 277 LYS A CA    1 
ATOM   1971 C C     . LYS A 1 251 ? 21.382  50.253  10.163 1.00 46.19  ? 277 LYS A C     1 
ATOM   1972 O O     . LYS A 1 251 ? 21.959  51.280  10.539 1.00 46.83  ? 277 LYS A O     1 
ATOM   1973 C CB    . LYS A 1 251 ? 20.682  48.735  11.979 1.00 44.43  ? 277 LYS A CB    1 
ATOM   1974 C CG    . LYS A 1 251 ? 19.877  48.595  13.269 1.00 47.41  ? 277 LYS A CG    1 
ATOM   1975 C CD    . LYS A 1 251 ? 20.623  47.671  14.258 1.00 47.62  ? 277 LYS A CD    1 
ATOM   1976 C CE    . LYS A 1 251 ? 19.725  47.129  15.349 1.00 48.77  ? 277 LYS A CE    1 
ATOM   1977 N NZ    . LYS A 1 251 ? 20.529  46.728  16.557 1.00 49.34  ? 277 LYS A NZ    1 
ATOM   1978 N N     . ILE A 1 252 ? 21.818  49.503  9.154  1.00 45.09  ? 278 ILE A N     1 
ATOM   1979 C CA    . ILE A 1 252 ? 23.129  49.727  8.532  1.00 45.80  ? 278 ILE A CA    1 
ATOM   1980 C C     . ILE A 1 252 ? 23.320  51.154  7.983  1.00 49.47  ? 278 ILE A C     1 
ATOM   1981 O O     . ILE A 1 252 ? 24.433  51.677  7.960  1.00 50.34  ? 278 ILE A O     1 
ATOM   1982 C CB    . ILE A 1 252 ? 23.450  48.650  7.460  1.00 44.68  ? 278 ILE A CB    1 
ATOM   1983 C CG1   . ILE A 1 252 ? 24.954  48.608  7.187  1.00 43.92  ? 278 ILE A CG1   1 
ATOM   1984 C CG2   . ILE A 1 252 ? 22.574  48.829  6.168  1.00 45.52  ? 278 ILE A CG2   1 
ATOM   1985 C CD1   . ILE A 1 252 ? 25.771  48.078  8.364  1.00 42.60  ? 278 ILE A CD1   1 
ATOM   1986 N N     . LYS A 1 253 ? 22.211  51.776  7.598  1.00 52.92  ? 279 LYS A N     1 
ATOM   1987 C CA    . LYS A 1 253 ? 22.148  53.179  7.205  1.00 57.42  ? 279 LYS A CA    1 
ATOM   1988 C C     . LYS A 1 253 ? 22.601  54.162  8.293  1.00 58.20  ? 279 LYS A C     1 
ATOM   1989 O O     . LYS A 1 253 ? 23.282  55.144  8.000  1.00 60.64  ? 279 LYS A O     1 
ATOM   1990 C CB    . LYS A 1 253 ? 20.705  53.540  6.820  1.00 60.67  ? 279 LYS A CB    1 
ATOM   1991 C CG    . LYS A 1 253 ? 19.761  52.337  6.555  1.00 60.98  ? 279 LYS A CG    1 
ATOM   1992 C CD    . LYS A 1 253 ? 18.384  52.857  6.059  1.00 68.05  ? 279 LYS A CD    1 
ATOM   1993 C CE    . LYS A 1 253 ? 17.424  51.721  5.721  1.00 68.45  ? 279 LYS A CE    1 
ATOM   1994 N NZ    . LYS A 1 253 ? 16.075  52.243  5.359  1.00 73.43  ? 279 LYS A NZ    1 
ATOM   1995 N N     . LYS A 1 254 ? 22.199  53.915  9.537  1.00 56.94  ? 280 LYS A N     1 
ATOM   1996 C CA    . LYS A 1 254 ? 22.373  54.906  10.612 1.00 57.96  ? 280 LYS A CA    1 
ATOM   1997 C C     . LYS A 1 254 ? 23.471  54.549  11.625 1.00 54.43  ? 280 LYS A C     1 
ATOM   1998 O O     . LYS A 1 254 ? 23.986  55.435  12.306 1.00 56.15  ? 280 LYS A O     1 
ATOM   1999 C CB    . LYS A 1 254 ? 21.032  55.172  11.320 1.00 60.65  ? 280 LYS A CB    1 
ATOM   2000 C CG    . LYS A 1 254 ? 20.414  53.929  11.983 1.00 60.66  ? 280 LYS A CG    1 
ATOM   2001 C CD    . LYS A 1 254 ? 18.888  53.959  11.984 1.00 66.02  ? 280 LYS A CD    1 
ATOM   2002 C CE    . LYS A 1 254 ? 18.327  52.646  12.537 1.00 66.02  ? 280 LYS A CE    1 
ATOM   2003 N NZ    . LYS A 1 254 ? 16.929  52.367  12.061 1.00 69.23  ? 280 LYS A NZ    1 
ATOM   2004 N N     . SER A 1 255 ? 23.814  53.261  11.711 1.00 49.58  ? 281 SER A N     1 
ATOM   2005 C CA    . SER A 1 255 ? 24.854  52.760  12.612 1.00 46.14  ? 281 SER A CA    1 
ATOM   2006 C C     . SER A 1 255 ? 25.958  52.076  11.826 1.00 42.91  ? 281 SER A C     1 
ATOM   2007 O O     . SER A 1 255 ? 25.751  51.003  11.273 1.00 41.35  ? 281 SER A O     1 
ATOM   2008 C CB    . SER A 1 255 ? 24.280  51.751  13.611 1.00 44.73  ? 281 SER A CB    1 
ATOM   2009 O OG    . SER A 1 255 ? 23.423  52.367  14.534 1.00 48.25  ? 281 SER A OG    1 
ATOM   2010 N N     . PRO A 1 256 ? 27.148  52.674  11.798 1.00 42.59  ? 282 PRO A N     1 
ATOM   2011 C CA    . PRO A 1 256 ? 28.195  52.092  10.976 1.00 40.91  ? 282 PRO A CA    1 
ATOM   2012 C C     . PRO A 1 256 ? 28.659  50.756  11.525 1.00 38.83  ? 282 PRO A C     1 
ATOM   2013 O O     . PRO A 1 256 ? 28.653  50.531  12.746 1.00 38.65  ? 282 PRO A O     1 
ATOM   2014 C CB    . PRO A 1 256 ? 29.315  53.125  11.046 1.00 42.58  ? 282 PRO A CB    1 
ATOM   2015 C CG    . PRO A 1 256 ? 29.057  53.883  12.278 1.00 44.31  ? 282 PRO A CG    1 
ATOM   2016 C CD    . PRO A 1 256 ? 27.584  53.907  12.476 1.00 44.51  ? 282 PRO A CD    1 
ATOM   2017 N N     . LEU A 1 257 ? 29.056  49.872  10.620 1.00 37.17  ? 283 LEU A N     1 
ATOM   2018 C CA    . LEU A 1 257 ? 29.537  48.567  11.003 1.00 35.01  ? 283 LEU A CA    1 
ATOM   2019 C C     . LEU A 1 257 ? 30.855  48.703  11.773 1.00 35.47  ? 283 LEU A C     1 
ATOM   2020 O O     . LEU A 1 257 ? 31.241  47.785  12.477 1.00 33.43  ? 283 LEU A O     1 
ATOM   2021 C CB    . LEU A 1 257 ? 29.704  47.653  9.776  1.00 33.80  ? 283 LEU A CB    1 
ATOM   2022 C CG    . LEU A 1 257 ? 30.065  46.184  10.075 1.00 33.24  ? 283 LEU A CG    1 
ATOM   2023 C CD1   . LEU A 1 257 ? 28.963  45.437  10.854 1.00 29.28  ? 283 LEU A CD1   1 
ATOM   2024 C CD2   . LEU A 1 257 ? 30.450  45.433  8.793  1.00 31.87  ? 283 LEU A CD2   1 
ATOM   2025 N N     . THR A 1 258 ? 31.514  49.864  11.654 1.00 37.72  ? 284 THR A N     1 
ATOM   2026 C CA    . THR A 1 258 ? 32.764  50.107  12.388 1.00 39.58  ? 284 THR A CA    1 
ATOM   2027 C C     . THR A 1 258 ? 32.581  50.083  13.921 1.00 39.11  ? 284 THR A C     1 
ATOM   2028 O O     . THR A 1 258 ? 33.571  49.985  14.639 1.00 40.22  ? 284 THR A O     1 
ATOM   2029 C CB    . THR A 1 258 ? 33.452  51.420  11.994 1.00 41.47  ? 284 THR A CB    1 
ATOM   2030 O OG1   . THR A 1 258 ? 32.463  52.432  11.848 1.00 43.67  ? 284 THR A OG1   1 
ATOM   2031 C CG2   . THR A 1 258 ? 34.220  51.274  10.680 1.00 44.17  ? 284 THR A CG2   1 
ATOM   2032 N N     . ILE A 1 259 ? 31.338  50.187  14.399 1.00 37.76  ? 285 ILE A N     1 
ATOM   2033 C CA    . ILE A 1 259 ? 31.026  49.954  15.806 1.00 38.53  ? 285 ILE A CA    1 
ATOM   2034 C C     . ILE A 1 259 ? 31.476  48.546  16.242 1.00 37.50  ? 285 ILE A C     1 
ATOM   2035 O O     . ILE A 1 259 ? 32.046  48.370  17.313 1.00 38.22  ? 285 ILE A O     1 
ATOM   2036 C CB    . ILE A 1 259 ? 29.503  50.106  16.125 1.00 38.36  ? 285 ILE A CB    1 
ATOM   2037 C CG1   . ILE A 1 259 ? 29.048  51.576  16.039 1.00 39.20  ? 285 ILE A CG1   1 
ATOM   2038 C CG2   . ILE A 1 259 ? 29.206  49.626  17.550 1.00 39.38  ? 285 ILE A CG2   1 
ATOM   2039 C CD1   . ILE A 1 259 ? 27.527  51.715  15.903 1.00 38.08  ? 285 ILE A CD1   1 
ATOM   2040 N N     . CYS A 1 260 ? 31.209  47.566  15.389 1.00 35.97  ? 286 CYS A N     1 
ATOM   2041 C CA    . CYS A 1 260 ? 31.503  46.173  15.645 1.00 35.52  ? 286 CYS A CA    1 
ATOM   2042 C C     . CYS A 1 260 ? 32.891  45.764  15.138 1.00 36.55  ? 286 CYS A C     1 
ATOM   2043 O O     . CYS A 1 260 ? 33.588  44.966  15.787 1.00 36.94  ? 286 CYS A O     1 
ATOM   2044 C CB    . CYS A 1 260 ? 30.448  45.327  14.977 1.00 33.45  ? 286 CYS A CB    1 
ATOM   2045 S SG    . CYS A 1 260 ? 30.517  43.610  15.377 1.00 34.55  ? 286 CYS A SG    1 
ATOM   2046 N N     . TYR A 1 261 ? 33.278  46.297  13.977 1.00 36.74  ? 287 TYR A N     1 
ATOM   2047 C CA    . TYR A 1 261 ? 34.541  45.944  13.336 1.00 37.94  ? 287 TYR A CA    1 
ATOM   2048 C C     . TYR A 1 261 ? 35.283  47.212  12.997 1.00 40.66  ? 287 TYR A C     1 
ATOM   2049 O O     . TYR A 1 261 ? 35.137  47.718  11.887 1.00 41.74  ? 287 TYR A O     1 
ATOM   2050 C CB    . TYR A 1 261 ? 34.316  45.163  12.042 1.00 36.56  ? 287 TYR A CB    1 
ATOM   2051 C CG    . TYR A 1 261 ? 33.603  43.839  12.186 1.00 34.14  ? 287 TYR A CG    1 
ATOM   2052 C CD1   . TYR A 1 261 ? 34.309  42.676  12.442 1.00 32.78  ? 287 TYR A CD1   1 
ATOM   2053 C CD2   . TYR A 1 261 ? 32.215  43.754  12.051 1.00 32.42  ? 287 TYR A CD2   1 
ATOM   2054 C CE1   . TYR A 1 261 ? 33.660  41.442  12.566 1.00 31.74  ? 287 TYR A CE1   1 
ATOM   2055 C CE2   . TYR A 1 261 ? 31.554  42.533  12.168 1.00 29.07  ? 287 TYR A CE2   1 
ATOM   2056 C CZ    . TYR A 1 261 ? 32.288  41.391  12.427 1.00 30.95  ? 287 TYR A CZ    1 
ATOM   2057 O OH    . TYR A 1 261 ? 31.655  40.177  12.537 1.00 33.37  ? 287 TYR A OH    1 
ATOM   2058 N N     . PRO A 1 262 ? 36.102  47.728  13.938 1.00 42.82  ? 288 PRO A N     1 
ATOM   2059 C CA    . PRO A 1 262 ? 36.735  49.031  13.718 1.00 45.29  ? 288 PRO A CA    1 
ATOM   2060 C C     . PRO A 1 262 ? 37.549  49.079  12.420 1.00 47.25  ? 288 PRO A C     1 
ATOM   2061 O O     . PRO A 1 262 ? 37.813  50.166  11.894 1.00 49.29  ? 288 PRO A O     1 
ATOM   2062 C CB    . PRO A 1 262 ? 37.672  49.195  14.932 1.00 47.20  ? 288 PRO A CB    1 
ATOM   2063 C CG    . PRO A 1 262 ? 37.212  48.180  15.943 1.00 45.85  ? 288 PRO A CG    1 
ATOM   2064 C CD    . PRO A 1 262 ? 36.547  47.078  15.188 1.00 42.81  ? 288 PRO A CD    1 
ATOM   2065 N N     . GLU A 1 263 ? 37.952  47.918  11.917 1.00 47.42  ? 289 GLU A N     1 
ATOM   2066 C CA    . GLU A 1 263 ? 38.810  47.871  10.719 1.00 50.29  ? 289 GLU A CA    1 
ATOM   2067 C C     . GLU A 1 263 ? 38.040  47.851  9.372  1.00 49.31  ? 289 GLU A C     1 
ATOM   2068 O O     . GLU A 1 263 ? 38.654  47.957  8.308  1.00 51.52  ? 289 GLU A O     1 
ATOM   2069 C CB    . GLU A 1 263 ? 39.853  46.739  10.825 1.00 51.59  ? 289 GLU A CB    1 
ATOM   2070 C CG    . GLU A 1 263 ? 39.331  45.297  10.623 1.00 52.45  ? 289 GLU A CG    1 
ATOM   2071 C CD    . GLU A 1 263 ? 38.428  44.732  11.752 1.00 52.44  ? 289 GLU A CD    1 
ATOM   2072 O OE1   . GLU A 1 263 ? 38.093  45.442  12.743 1.00 49.52  ? 289 GLU A OE1   1 
ATOM   2073 O OE2   . GLU A 1 263 ? 38.045  43.539  11.614 1.00 53.21  ? 289 GLU A OE2   1 
ATOM   2074 N N     . TYR A 1 264 ? 36.706  47.743  9.429  1.00 46.45  ? 290 TYR A N     1 
ATOM   2075 C CA    . TYR A 1 264 ? 35.861  47.769  8.235  1.00 45.83  ? 290 TYR A CA    1 
ATOM   2076 C C     . TYR A 1 264 ? 36.077  49.016  7.386  1.00 48.24  ? 290 TYR A C     1 
ATOM   2077 O O     . TYR A 1 264 ? 35.877  50.128  7.858  1.00 49.44  ? 290 TYR A O     1 
ATOM   2078 C CB    . TYR A 1 264 ? 34.385  47.651  8.617  1.00 43.55  ? 290 TYR A CB    1 
ATOM   2079 C CG    . TYR A 1 264 ? 33.440  47.597  7.431  1.00 43.96  ? 290 TYR A CG    1 
ATOM   2080 C CD1   . TYR A 1 264 ? 33.449  46.499  6.559  1.00 44.68  ? 290 TYR A CD1   1 
ATOM   2081 C CD2   . TYR A 1 264 ? 32.553  48.641  7.170  1.00 44.97  ? 290 TYR A CD2   1 
ATOM   2082 C CE1   . TYR A 1 264 ? 32.602  46.434  5.470  1.00 44.12  ? 290 TYR A CE1   1 
ATOM   2083 C CE2   . TYR A 1 264 ? 31.692  48.591  6.071  1.00 46.01  ? 290 TYR A CE2   1 
ATOM   2084 C CZ    . TYR A 1 264 ? 31.727  47.469  5.232  1.00 46.31  ? 290 TYR A CZ    1 
ATOM   2085 O OH    . TYR A 1 264 ? 30.897  47.381  4.152  1.00 47.35  ? 290 TYR A OH    1 
ATOM   2086 N N     . ALA A 1 265 ? 36.493  48.839  6.135  1.00 50.17  ? 291 ALA A N     1 
ATOM   2087 C CA    . ALA A 1 265 ? 36.709  49.998  5.249  1.00 53.14  ? 291 ALA A CA    1 
ATOM   2088 C C     . ALA A 1 265 ? 35.690  50.124  4.114  1.00 53.07  ? 291 ALA A C     1 
ATOM   2089 O O     . ALA A 1 265 ? 35.772  51.037  3.314  1.00 56.12  ? 291 ALA A O     1 
ATOM   2090 C CB    . ALA A 1 265 ? 38.153  50.029  4.704  1.00 56.17  ? 291 ALA A CB    1 
ATOM   2091 N N     . GLY A 1 266 ? 34.722  49.216  4.062  1.00 50.92  ? 292 GLY A N     1 
ATOM   2092 C CA    . GLY A 1 266 ? 33.710  49.232  3.007  1.00 51.45  ? 292 GLY A CA    1 
ATOM   2093 C C     . GLY A 1 266 ? 32.638  50.285  3.215  1.00 51.68  ? 292 GLY A C     1 
ATOM   2094 O O     . GLY A 1 266 ? 32.700  51.074  4.160  1.00 51.18  ? 292 GLY A O     1 
ATOM   2095 N N     . SER A 1 267 ? 31.652  50.301  2.325  1.00 52.73  ? 293 SER A N     1 
ATOM   2096 C CA    . SER A 1 267 ? 30.538  51.222  2.458  1.00 54.04  ? 293 SER A CA    1 
ATOM   2097 C C     . SER A 1 267 ? 29.501  50.661  3.427  1.00 51.16  ? 293 SER A C     1 
ATOM   2098 O O     . SER A 1 267 ? 29.498  49.478  3.750  1.00 48.35  ? 293 SER A O     1 
ATOM   2099 C CB    . SER A 1 267 ? 29.891  51.498  1.096  1.00 57.10  ? 293 SER A CB    1 
ATOM   2100 O OG    . SER A 1 267 ? 28.927  50.501  0.798  1.00 57.17  ? 293 SER A OG    1 
ATOM   2101 N N     . ASN A 1 268 ? 28.601  51.514  3.881  1.00 52.63  ? 294 ASN A N     1 
ATOM   2102 C CA    . ASN A 1 268 ? 27.526  51.041  4.734  1.00 51.52  ? 294 ASN A CA    1 
ATOM   2103 C C     . ASN A 1 268 ? 26.244  50.713  3.962  1.00 52.32  ? 294 ASN A C     1 
ATOM   2104 O O     . ASN A 1 268 ? 25.144  51.042  4.413  1.00 53.75  ? 294 ASN A O     1 
ATOM   2105 C CB    . ASN A 1 268 ? 27.305  52.013  5.909  1.00 52.14  ? 294 ASN A CB    1 
ATOM   2106 C CG    . ASN A 1 268 ? 28.419  51.896  6.972  1.00 52.09  ? 294 ASN A CG    1 
ATOM   2107 O OD1   . ASN A 1 268 ? 28.617  50.831  7.591  1.00 49.61  ? 294 ASN A OD1   1 
ATOM   2108 N ND2   . ASN A 1 268 ? 29.152  52.979  7.171  1.00 53.78  ? 294 ASN A ND2   1 
ATOM   2109 N N     . THR A 1 269 ? 26.400  50.090  2.784  1.00 51.95  ? 295 THR A N     1 
ATOM   2110 C CA    . THR A 1 269 ? 25.282  49.456  2.087  1.00 50.66  ? 295 THR A CA    1 
ATOM   2111 C C     . THR A 1 269 ? 25.020  48.110  2.750  1.00 46.16  ? 295 THR A C     1 
ATOM   2112 O O     . THR A 1 269 ? 25.953  47.452  3.230  1.00 44.14  ? 295 THR A O     1 
ATOM   2113 C CB    . THR A 1 269 ? 25.551  49.192  0.550  1.00 53.36  ? 295 THR A CB    1 
ATOM   2114 O OG1   . THR A 1 269 ? 26.694  48.336  0.364  1.00 51.51  ? 295 THR A OG1   1 
ATOM   2115 C CG2   . THR A 1 269 ? 25.745  50.469  -0.218 1.00 57.15  ? 295 THR A CG2   1 
ATOM   2116 N N     . TYR A 1 270 ? 23.760  47.689  2.751  1.00 44.33  ? 296 TYR A N     1 
ATOM   2117 C CA    . TYR A 1 270 ? 23.411  46.357  3.200  1.00 40.59  ? 296 TYR A CA    1 
ATOM   2118 C C     . TYR A 1 270 ? 24.364  45.320  2.594  1.00 39.40  ? 296 TYR A C     1 
ATOM   2119 O O     . TYR A 1 270 ? 24.966  44.523  3.317  1.00 37.43  ? 296 TYR A O     1 
ATOM   2120 C CB    . TYR A 1 270 ? 21.940  46.014  2.871  1.00 41.07  ? 296 TYR A CB    1 
ATOM   2121 C CG    . TYR A 1 270 ? 21.628  44.538  3.083  1.00 40.07  ? 296 TYR A CG    1 
ATOM   2122 C CD1   . TYR A 1 270 ? 21.502  44.004  4.372  1.00 36.86  ? 296 TYR A CD1   1 
ATOM   2123 C CD2   . TYR A 1 270 ? 21.489  43.670  1.995  1.00 40.70  ? 296 TYR A CD2   1 
ATOM   2124 C CE1   . TYR A 1 270 ? 21.229  42.651  4.570  1.00 36.15  ? 296 TYR A CE1   1 
ATOM   2125 C CE2   . TYR A 1 270 ? 21.220  42.323  2.172  1.00 38.94  ? 296 TYR A CE2   1 
ATOM   2126 C CZ    . TYR A 1 270 ? 21.096  41.807  3.468  1.00 38.98  ? 296 TYR A CZ    1 
ATOM   2127 O OH    . TYR A 1 270 ? 20.838  40.453  3.646  1.00 36.25  ? 296 TYR A OH    1 
ATOM   2128 N N     . GLU A 1 271 ? 24.492  45.347  1.266  1.00 40.72  ? 297 GLU A N     1 
ATOM   2129 C CA    . GLU A 1 271 ? 25.271  44.369  0.502  1.00 40.31  ? 297 GLU A CA    1 
ATOM   2130 C C     . GLU A 1 271 ? 26.718  44.174  0.981  1.00 38.91  ? 297 GLU A C     1 
ATOM   2131 O O     . GLU A 1 271 ? 27.118  43.063  1.298  1.00 37.29  ? 297 GLU A O     1 
ATOM   2132 C CB    . GLU A 1 271 ? 25.250  44.737  -0.991 1.00 43.99  ? 297 GLU A CB    1 
ATOM   2133 C CG    . GLU A 1 271 ? 23.940  44.420  -1.725 1.00 45.50  ? 297 GLU A CG    1 
ATOM   2134 C CD    . GLU A 1 271 ? 22.743  45.287  -1.318 1.00 46.61  ? 297 GLU A CD    1 
ATOM   2135 O OE1   . GLU A 1 271 ? 22.923  46.346  -0.664 1.00 44.69  ? 297 GLU A OE1   1 
ATOM   2136 O OE2   . GLU A 1 271 ? 21.603  44.906  -1.686 1.00 48.17  ? 297 GLU A OE2   1 
ATOM   2137 N N     . GLU A 1 272 ? 27.500  45.247  1.016  1.00 40.32  ? 298 GLU A N     1 
ATOM   2138 C CA    . GLU A 1 272 ? 28.908  45.159  1.404  1.00 40.94  ? 298 GLU A CA    1 
ATOM   2139 C C     . GLU A 1 272 ? 29.136  44.803  2.877  1.00 38.66  ? 298 GLU A C     1 
ATOM   2140 O O     . GLU A 1 272 ? 30.133  44.150  3.195  1.00 38.69  ? 298 GLU A O     1 
ATOM   2141 C CB    . GLU A 1 272 ? 29.662  46.438  1.064  1.00 42.71  ? 298 GLU A CB    1 
ATOM   2142 C CG    . GLU A 1 272 ? 29.987  46.518  -0.413 1.00 49.10  ? 298 GLU A CG    1 
ATOM   2143 C CD    . GLU A 1 272 ? 31.036  47.532  -0.747 1.00 53.49  ? 298 GLU A CD    1 
ATOM   2144 O OE1   . GLU A 1 272 ? 31.667  48.104  0.174  1.00 53.69  ? 298 GLU A OE1   1 
ATOM   2145 O OE2   . GLU A 1 272 ? 31.237  47.745  -1.959 1.00 58.68  ? 298 GLU A OE2   1 
ATOM   2146 N N     . ALA A 1 273 ? 28.228  45.235  3.751  1.00 37.17  ? 299 ALA A N     1 
ATOM   2147 C CA    . ALA A 1 273 ? 28.397  45.057  5.192  1.00 35.35  ? 299 ALA A CA    1 
ATOM   2148 C C     . ALA A 1 273 ? 27.967  43.667  5.572  1.00 33.89  ? 299 ALA A C     1 
ATOM   2149 O O     . ALA A 1 273 ? 28.615  43.031  6.391  1.00 33.31  ? 299 ALA A O     1 
ATOM   2150 C CB    . ALA A 1 273 ? 27.632  46.129  5.988  1.00 35.05  ? 299 ALA A CB    1 
ATOM   2151 N N     . ALA A 1 274 ? 26.904  43.174  4.940  1.00 34.35  ? 300 ALA A N     1 
ATOM   2152 C CA    . ALA A 1 274 ? 26.482  41.781  5.115  1.00 33.76  ? 300 ALA A CA    1 
ATOM   2153 C C     . ALA A 1 274 ? 27.513  40.766  4.597  1.00 34.26  ? 300 ALA A C     1 
ATOM   2154 O O     . ALA A 1 274 ? 27.756  39.726  5.226  1.00 34.06  ? 300 ALA A O     1 
ATOM   2155 C CB    . ALA A 1 274 ? 25.142  41.549  4.440  1.00 34.55  ? 300 ALA A CB    1 
ATOM   2156 N N     . ALA A 1 275 ? 28.089  41.056  3.436  1.00 35.13  ? 301 ALA A N     1 
ATOM   2157 C CA    . ALA A 1 275 ? 29.125  40.207  2.856  1.00 36.09  ? 301 ALA A CA    1 
ATOM   2158 C C     . ALA A 1 275 ? 30.306  40.168  3.795  1.00 35.08  ? 301 ALA A C     1 
ATOM   2159 O O     . ALA A 1 275 ? 30.852  39.109  4.032  1.00 35.46  ? 301 ALA A O     1 
ATOM   2160 C CB    . ALA A 1 275 ? 29.590  40.757  1.464  1.00 37.77  ? 301 ALA A CB    1 
ATOM   2161 N N     . TYR A 1 276 ? 30.707  41.339  4.292  1.00 34.50  ? 302 TYR A N     1 
ATOM   2162 C CA    . TYR A 1 276 ? 31.808  41.451  5.240  1.00 35.21  ? 302 TYR A CA    1 
ATOM   2163 C C     . TYR A 1 276 ? 31.608  40.533  6.461  1.00 34.03  ? 302 TYR A C     1 
ATOM   2164 O O     . TYR A 1 276 ? 32.519  39.831  6.846  1.00 35.07  ? 302 TYR A O     1 
ATOM   2165 C CB    . TYR A 1 276 ? 32.004  42.909  5.698  1.00 35.00  ? 302 TYR A CB    1 
ATOM   2166 C CG    . TYR A 1 276 ? 33.294  43.097  6.463  1.00 35.16  ? 302 TYR A CG    1 
ATOM   2167 C CD1   . TYR A 1 276 ? 34.529  43.121  5.801  1.00 36.88  ? 302 TYR A CD1   1 
ATOM   2168 C CD2   . TYR A 1 276 ? 33.290  43.211  7.863  1.00 33.53  ? 302 TYR A CD2   1 
ATOM   2169 C CE1   . TYR A 1 276 ? 35.732  43.262  6.519  1.00 37.65  ? 302 TYR A CE1   1 
ATOM   2170 C CE2   . TYR A 1 276 ? 34.475  43.379  8.584  1.00 33.21  ? 302 TYR A CE2   1 
ATOM   2171 C CZ    . TYR A 1 276 ? 35.681  43.399  7.918  1.00 37.37  ? 302 TYR A CZ    1 
ATOM   2172 O OH    . TYR A 1 276 ? 36.835  43.568  8.651  1.00 41.80  ? 302 TYR A OH    1 
ATOM   2173 N N     . ILE A 1 277 ? 30.404  40.510  7.024  1.00 33.17  ? 303 ILE A N     1 
ATOM   2174 C CA    . ILE A 1 277 ? 30.129  39.672  8.180  1.00 33.58  ? 303 ILE A CA    1 
ATOM   2175 C C     . ILE A 1 277 ? 30.195  38.195  7.777  1.00 35.07  ? 303 ILE A C     1 
ATOM   2176 O O     . ILE A 1 277 ? 30.749  37.355  8.521  1.00 36.11  ? 303 ILE A O     1 
ATOM   2177 C CB    . ILE A 1 277 ? 28.773  40.028  8.855  1.00 32.45  ? 303 ILE A CB    1 
ATOM   2178 C CG1   . ILE A 1 277 ? 28.816  41.468  9.364  1.00 30.88  ? 303 ILE A CG1   1 
ATOM   2179 C CG2   . ILE A 1 277 ? 28.494  39.072  10.008 1.00 33.17  ? 303 ILE A CG2   1 
ATOM   2180 C CD1   . ILE A 1 277 ? 27.530  41.940  10.006 1.00 31.43  ? 303 ILE A CD1   1 
ATOM   2181 N N     . GLN A 1 278 ? 29.676  37.881  6.591  1.00 35.41  ? 304 GLN A N     1 
ATOM   2182 C CA    . GLN A 1 278 ? 29.751  36.509  6.091  1.00 36.34  ? 304 GLN A CA    1 
ATOM   2183 C C     . GLN A 1 278 ? 31.201  36.008  6.029  1.00 37.88  ? 304 GLN A C     1 
ATOM   2184 O O     . GLN A 1 278 ? 31.506  34.890  6.457  1.00 38.66  ? 304 GLN A O     1 
ATOM   2185 C CB    . GLN A 1 278 ? 29.037  36.349  4.740  1.00 36.90  ? 304 GLN A CB    1 
ATOM   2186 C CG    . GLN A 1 278 ? 28.862  34.889  4.344  1.00 37.90  ? 304 GLN A CG    1 
ATOM   2187 C CD    . GLN A 1 278 ? 28.379  34.662  2.907  1.00 39.12  ? 304 GLN A CD    1 
ATOM   2188 O OE1   . GLN A 1 278 ? 27.862  35.570  2.240  1.00 39.10  ? 304 GLN A OE1   1 
ATOM   2189 N NE2   . GLN A 1 278 ? 28.535  33.431  2.437  1.00 36.73  ? 304 GLN A NE2   1 
ATOM   2190 N N     . CYS A 1 279 ? 32.098  36.844  5.527  1.00 39.17  ? 305 CYS A N     1 
ATOM   2191 C CA    . CYS A 1 279 ? 33.525  36.493  5.477  1.00 42.02  ? 305 CYS A CA    1 
ATOM   2192 C C     . CYS A 1 279 ? 34.156  36.338  6.858  1.00 41.65  ? 305 CYS A C     1 
ATOM   2193 O O     . CYS A 1 279 ? 34.897  35.388  7.099  1.00 43.89  ? 305 CYS A O     1 
ATOM   2194 C CB    . CYS A 1 279 ? 34.305  37.504  4.648  1.00 43.39  ? 305 CYS A CB    1 
ATOM   2195 S SG    . CYS A 1 279 ? 34.000  37.280  2.888  1.00 50.94  ? 305 CYS A SG    1 
ATOM   2196 N N     . GLN A 1 280 ? 33.839  37.252  7.771  1.00 39.81  ? 306 GLN A N     1 
ATOM   2197 C CA    . GLN A 1 280 ? 34.363  37.183  9.128  1.00 40.14  ? 306 GLN A CA    1 
ATOM   2198 C C     . GLN A 1 280 ? 34.086  35.815  9.765  1.00 40.27  ? 306 GLN A C     1 
ATOM   2199 O O     . GLN A 1 280 ? 34.977  35.204  10.359 1.00 42.42  ? 306 GLN A O     1 
ATOM   2200 C CB    . GLN A 1 280 ? 33.791  38.324  9.958  1.00 38.65  ? 306 GLN A CB    1 
ATOM   2201 C CG    . GLN A 1 280 ? 34.344  39.685  9.573  1.00 39.64  ? 306 GLN A CG    1 
ATOM   2202 C CD    . GLN A 1 280 ? 35.823  39.819  9.915  1.00 46.23  ? 306 GLN A CD    1 
ATOM   2203 O OE1   . GLN A 1 280 ? 36.278  39.367  10.976 1.00 48.90  ? 306 GLN A OE1   1 
ATOM   2204 N NE2   . GLN A 1 280 ? 36.581  40.441  9.019  1.00 48.03  ? 306 GLN A NE2   1 
ATOM   2205 N N     . PHE A 1 281 ? 32.872  35.319  9.570  1.00 38.77  ? 307 PHE A N     1 
ATOM   2206 C CA    . PHE A 1 281 ? 32.484  34.000  10.028 1.00 39.81  ? 307 PHE A CA    1 
ATOM   2207 C C     . PHE A 1 281 ? 33.113  32.854  9.246  1.00 42.64  ? 307 PHE A C     1 
ATOM   2208 O O     . PHE A 1 281 ? 33.758  31.977  9.838  1.00 45.07  ? 307 PHE A O     1 
ATOM   2209 C CB    . PHE A 1 281 ? 30.960  33.878  10.061 1.00 38.30  ? 307 PHE A CB    1 
ATOM   2210 C CG    . PHE A 1 281 ? 30.335  34.489  11.287 1.00 37.66  ? 307 PHE A CG    1 
ATOM   2211 C CD1   . PHE A 1 281 ? 30.032  35.845  11.329 1.00 36.30  ? 307 PHE A CD1   1 
ATOM   2212 C CD2   . PHE A 1 281 ? 30.069  33.707  12.414 1.00 39.27  ? 307 PHE A CD2   1 
ATOM   2213 C CE1   . PHE A 1 281 ? 29.454  36.417  12.465 1.00 35.22  ? 307 PHE A CE1   1 
ATOM   2214 C CE2   . PHE A 1 281 ? 29.495  34.273  13.558 1.00 39.09  ? 307 PHE A CE2   1 
ATOM   2215 C CZ    . PHE A 1 281 ? 29.194  35.631  13.582 1.00 36.57  ? 307 PHE A CZ    1 
ATOM   2216 N N     . GLU A 1 282 ? 32.954  32.843  7.923  1.00 42.68  ? 308 GLU A N     1 
ATOM   2217 C CA    . GLU A 1 282 ? 33.481  31.717  7.132  1.00 45.13  ? 308 GLU A CA    1 
ATOM   2218 C C     . GLU A 1 282 ? 35.012  31.623  7.182  1.00 47.35  ? 308 GLU A C     1 
ATOM   2219 O O     . GLU A 1 282 ? 35.575  30.535  7.064  1.00 50.24  ? 308 GLU A O     1 
ATOM   2220 C CB    . GLU A 1 282 ? 32.970  31.756  5.688  1.00 45.10  ? 308 GLU A CB    1 
ATOM   2221 C CG    . GLU A 1 282 ? 31.434  31.675  5.586  1.00 44.51  ? 308 GLU A CG    1 
ATOM   2222 C CD    . GLU A 1 282 ? 30.907  31.591  4.150  1.00 46.21  ? 308 GLU A CD    1 
ATOM   2223 O OE1   . GLU A 1 282 ? 31.709  31.706  3.191  1.00 49.78  ? 308 GLU A OE1   1 
ATOM   2224 O OE2   . GLU A 1 282 ? 29.681  31.402  3.977  1.00 44.16  ? 308 GLU A OE2   1 
ATOM   2225 N N     . ASP A 1 283 ? 35.682  32.754  7.379  1.00 46.62  ? 309 ASP A N     1 
ATOM   2226 C CA    . ASP A 1 283 ? 37.151  32.756  7.488  1.00 50.04  ? 309 ASP A CA    1 
ATOM   2227 C C     . ASP A 1 283 ? 37.705  32.093  8.755  1.00 50.65  ? 309 ASP A C     1 
ATOM   2228 O O     . ASP A 1 283 ? 38.890  31.758  8.799  1.00 54.53  ? 309 ASP A O     1 
ATOM   2229 C CB    . ASP A 1 283 ? 37.735  34.169  7.327  1.00 49.96  ? 309 ASP A CB    1 
ATOM   2230 C CG    . ASP A 1 283 ? 37.703  34.665  5.870  1.00 53.63  ? 309 ASP A CG    1 
ATOM   2231 O OD1   . ASP A 1 283 ? 37.318  33.899  4.951  1.00 56.79  ? 309 ASP A OD1   1 
ATOM   2232 O OD2   . ASP A 1 283 ? 38.066  35.839  5.644  1.00 57.55  ? 309 ASP A OD2   1 
ATOM   2233 N N     . LEU A 1 284 ? 36.857  31.885  9.761  1.00 58.54  ? 310 LEU A N     1 
ATOM   2234 C CA    . LEU A 1 284 ? 37.250  31.131  10.956 1.00 58.56  ? 310 LEU A CA    1 
ATOM   2235 C C     . LEU A 1 284 ? 37.466  29.633  10.692 1.00 60.34  ? 310 LEU A C     1 
ATOM   2236 O O     . LEU A 1 284 ? 38.121  28.952  11.476 1.00 61.78  ? 310 LEU A O     1 
ATOM   2237 C CB    . LEU A 1 284 ? 36.247  31.337  12.093 1.00 56.07  ? 310 LEU A CB    1 
ATOM   2238 C CG    . LEU A 1 284 ? 36.059  32.800  12.517 1.00 53.00  ? 310 LEU A CG    1 
ATOM   2239 C CD1   . LEU A 1 284 ? 34.772  32.980  13.293 1.00 47.12  ? 310 LEU A CD1   1 
ATOM   2240 C CD2   . LEU A 1 284 ? 37.279  33.353  13.266 1.00 51.27  ? 310 LEU A CD2   1 
ATOM   2241 N N     . ASN A 1 285 ? 36.913  29.131  9.595  1.00 60.47  ? 311 ASN A N     1 
ATOM   2242 C CA    . ASN A 1 285 ? 37.116  27.744  9.177  1.00 63.14  ? 311 ASN A CA    1 
ATOM   2243 C C     . ASN A 1 285 ? 38.585  27.505  8.840  1.00 66.75  ? 311 ASN A C     1 
ATOM   2244 O O     . ASN A 1 285 ? 39.138  28.135  7.936  1.00 67.42  ? 311 ASN A O     1 
ATOM   2245 C CB    . ASN A 1 285 ? 36.219  27.424  7.977  1.00 62.47  ? 311 ASN A CB    1 
ATOM   2246 C CG    . ASN A 1 285 ? 36.259  25.952  7.558  1.00 63.62  ? 311 ASN A CG    1 
ATOM   2247 O OD1   . ASN A 1 285 ? 37.102  25.164  8.003  1.00 64.71  ? 311 ASN A OD1   1 
ATOM   2248 N ND2   . ASN A 1 285 ? 35.342  25.587  6.673  1.00 62.37  ? 311 ASN A ND2   1 
ATOM   2249 N N     . LYS A 1 286 ? 39.215  26.604  9.590  1.00 69.95  ? 312 LYS A N     1 
ATOM   2250 C CA    . LYS A 1 286 ? 40.634  26.331  9.429  1.00 74.47  ? 312 LYS A CA    1 
ATOM   2251 C C     . LYS A 1 286 ? 40.877  25.124  8.536  1.00 77.11  ? 312 LYS A C     1 
ATOM   2252 O O     . LYS A 1 286 ? 42.007  24.886  8.106  1.00 80.14  ? 312 LYS A O     1 
ATOM   2253 C CB    . LYS A 1 286 ? 41.306  26.160  10.791 1.00 76.62  ? 312 LYS A CB    1 
ATOM   2254 C CG    . LYS A 1 286 ? 41.287  27.435  11.631 1.00 76.33  ? 312 LYS A CG    1 
ATOM   2255 C CD    . LYS A 1 286 ? 42.145  27.316  12.875 1.00 80.93  ? 312 LYS A CD    1 
ATOM   2256 C CE    . LYS A 1 286 ? 42.090  28.600  13.689 1.00 80.90  ? 312 LYS A CE    1 
ATOM   2257 N NZ    . LYS A 1 286 ? 42.903  28.477  14.928 1.00 86.00  ? 312 LYS A NZ    1 
ATOM   2258 N N     . ARG A 1 287 ? 39.809  24.379  8.252  1.00 77.01  ? 313 ARG A N     1 
ATOM   2259 C CA    . ARG A 1 287 ? 39.873  23.207  7.368  1.00 79.85  ? 313 ARG A CA    1 
ATOM   2260 C C     . ARG A 1 287 ? 39.037  23.457  6.107  1.00 79.03  ? 313 ARG A C     1 
ATOM   2261 O O     . ARG A 1 287 ? 38.119  22.695  5.796  1.00 78.59  ? 313 ARG A O     1 
ATOM   2262 C CB    . ARG A 1 287 ? 39.389  21.939  8.096  1.00 80.62  ? 313 ARG A CB    1 
ATOM   2263 C CG    . ARG A 1 287 ? 40.153  21.562  9.370  1.00 84.12  ? 313 ARG A CG    1 
ATOM   2264 C CD    . ARG A 1 287 ? 41.467  20.845  9.066  1.00 90.96  ? 313 ARG A CD    1 
ATOM   2265 N NE    . ARG A 1 287 ? 42.326  20.710  10.247 1.00 95.56  ? 313 ARG A NE    1 
ATOM   2266 C CZ    . ARG A 1 287 ? 43.061  21.693  10.774 1.00 97.26  ? 313 ARG A CZ    1 
ATOM   2267 N NH1   . ARG A 1 287 ? 43.051  22.912  10.245 1.00 95.47  ? 313 ARG A NH1   1 
ATOM   2268 N NH2   . ARG A 1 287 ? 43.807  21.457  11.845 1.00 101.21 ? 313 ARG A NH2   1 
ATOM   2269 N N     . LYS A 1 288 ? 39.374  24.536  5.398  1.00 79.82  ? 314 LYS A N     1 
ATOM   2270 C CA    . LYS A 1 288 ? 38.659  25.007  4.196  1.00 79.97  ? 314 LYS A CA    1 
ATOM   2271 C C     . LYS A 1 288 ? 38.516  23.971  3.082  1.00 82.39  ? 314 LYS A C     1 
ATOM   2272 O O     . LYS A 1 288 ? 37.495  23.937  2.388  1.00 82.30  ? 314 LYS A O     1 
ATOM   2273 C CB    . LYS A 1 288 ? 39.372  26.229  3.609  1.00 81.04  ? 314 LYS A CB    1 
ATOM   2274 C CG    . LYS A 1 288 ? 39.158  27.509  4.357  1.00 78.83  ? 314 LYS A CG    1 
ATOM   2275 C CD    . LYS A 1 288 ? 37.946  28.262  3.843  1.00 77.00  ? 314 LYS A CD    1 
ATOM   2276 C CE    . LYS A 1 288 ? 37.794  29.598  4.574  1.00 74.56  ? 314 LYS A CE    1 
ATOM   2277 N NZ    . LYS A 1 288 ? 39.103  30.316  4.667  1.00 75.76  ? 314 LYS A NZ    1 
ATOM   2278 N N     . ASP A 1 289 ? 39.547  23.151  2.899  1.00 85.11  ? 315 ASP A N     1 
ATOM   2279 C CA    . ASP A 1 289 ? 39.559  22.158  1.828  1.00 87.74  ? 315 ASP A CA    1 
ATOM   2280 C C     . ASP A 1 289 ? 38.657  20.963  2.135  1.00 86.86  ? 315 ASP A C     1 
ATOM   2281 O O     . ASP A 1 289 ? 38.103  20.349  1.218  1.00 88.35  ? 315 ASP A O     1 
ATOM   2282 C CB    . ASP A 1 289 ? 40.994  21.700  1.536  1.00 91.15  ? 315 ASP A CB    1 
ATOM   2283 C CG    . ASP A 1 289 ? 41.928  22.863  1.187  1.00 93.39  ? 315 ASP A CG    1 
ATOM   2284 O OD1   . ASP A 1 289 ? 41.442  23.983  0.900  1.00 93.25  ? 315 ASP A OD1   1 
ATOM   2285 O OD2   . ASP A 1 289 ? 43.158  22.659  1.199  1.00 96.72  ? 315 ASP A OD2   1 
ATOM   2286 N N     . THR A 1 290 ? 38.508  20.649  3.423  1.00 84.95  ? 316 THR A N     1 
ATOM   2287 C CA    . THR A 1 290 ? 37.718  19.495  3.870  1.00 84.27  ? 316 THR A CA    1 
ATOM   2288 C C     . THR A 1 290 ? 36.289  19.886  4.222  1.00 81.33  ? 316 THR A C     1 
ATOM   2289 O O     . THR A 1 290 ? 35.337  19.186  3.868  1.00 82.04  ? 316 THR A O     1 
ATOM   2290 C CB    . THR A 1 290 ? 38.379  18.804  5.093  1.00 85.21  ? 316 THR A CB    1 
ATOM   2291 O OG1   . THR A 1 290 ? 39.527  18.063  4.661  1.00 88.23  ? 316 THR A OG1   1 
ATOM   2292 C CG2   . THR A 1 290 ? 37.402  17.852  5.796  1.00 85.19  ? 316 THR A CG2   1 
ATOM   2293 N N     . LYS A 1 291 ? 36.159  21.019  4.906  1.00 78.23  ? 317 LYS A N     1 
ATOM   2294 C CA    . LYS A 1 291 ? 34.922  21.416  5.551  1.00 75.30  ? 317 LYS A CA    1 
ATOM   2295 C C     . LYS A 1 291 ? 34.251  22.581  4.821  1.00 73.45  ? 317 LYS A C     1 
ATOM   2296 O O     . LYS A 1 291 ? 34.899  23.574  4.485  1.00 73.15  ? 317 LYS A O     1 
ATOM   2297 C CB    . LYS A 1 291 ? 35.231  21.806  7.002  1.00 74.25  ? 317 LYS A CB    1 
ATOM   2298 C CG    . LYS A 1 291 ? 34.032  21.909  7.923  1.00 73.07  ? 317 LYS A CG    1 
ATOM   2299 C CD    . LYS A 1 291 ? 33.568  20.546  8.376  1.00 74.72  ? 317 LYS A CD    1 
ATOM   2300 C CE    . LYS A 1 291 ? 32.381  20.666  9.306  1.00 73.86  ? 317 LYS A CE    1 
ATOM   2301 N NZ    . LYS A 1 291 ? 31.802  19.320  9.555  1.00 76.89  ? 317 LYS A NZ    1 
ATOM   2302 N N     . GLU A 1 292 ? 32.949  22.455  4.585  1.00 72.39  ? 318 GLU A N     1 
ATOM   2303 C CA    . GLU A 1 292 ? 32.175  23.523  3.971  1.00 70.97  ? 318 GLU A CA    1 
ATOM   2304 C C     . GLU A 1 292 ? 31.107  24.035  4.934  1.00 68.33  ? 318 GLU A C     1 
ATOM   2305 O O     . GLU A 1 292 ? 30.315  23.247  5.455  1.00 68.87  ? 318 GLU A O     1 
ATOM   2306 C CB    . GLU A 1 292 ? 31.534  23.031  2.672  1.00 73.68  ? 318 GLU A CB    1 
ATOM   2307 C CG    . GLU A 1 292 ? 31.003  24.141  1.771  1.00 74.86  ? 318 GLU A CG    1 
ATOM   2308 C CD    . GLU A 1 292 ? 30.853  23.693  0.330  1.00 79.74  ? 318 GLU A CD    1 
ATOM   2309 O OE1   . GLU A 1 292 ? 31.747  22.972  -0.168 1.00 82.33  ? 318 GLU A OE1   1 
ATOM   2310 O OE2   . GLU A 1 292 ? 29.841  24.057  -0.307 1.00 81.79  ? 318 GLU A OE2   1 
ATOM   2311 N N     . ILE A 1 293 ? 31.116  25.348  5.187  1.00 65.36  ? 319 ILE A N     1 
ATOM   2312 C CA    . ILE A 1 293 ? 30.031  26.017  5.900  1.00 62.75  ? 319 ILE A CA    1 
ATOM   2313 C C     . ILE A 1 293 ? 28.885  26.247  4.923  1.00 63.51  ? 319 ILE A C     1 
ATOM   2314 O O     . ILE A 1 293 ? 29.112  26.628  3.783  1.00 64.72  ? 319 ILE A O     1 
ATOM   2315 C CB    . ILE A 1 293 ? 30.451  27.412  6.478  1.00 60.63  ? 319 ILE A CB    1 
ATOM   2316 C CG1   . ILE A 1 293 ? 31.830  27.374  7.153  1.00 60.04  ? 319 ILE A CG1   1 
ATOM   2317 C CG2   . ILE A 1 293 ? 29.369  27.975  7.414  1.00 58.00  ? 319 ILE A CG2   1 
ATOM   2318 C CD1   . ILE A 1 293 ? 31.913  26.530  8.402  1.00 60.78  ? 319 ILE A CD1   1 
ATOM   2319 N N     . TYR A 1 294 ? 27.659  26.028  5.377  1.00 63.31  ? 320 TYR A N     1 
ATOM   2320 C CA    . TYR A 1 294 ? 26.477  26.317  4.582  1.00 64.43  ? 320 TYR A CA    1 
ATOM   2321 C C     . TYR A 1 294 ? 25.764  27.540  5.151  1.00 62.86  ? 320 TYR A C     1 
ATOM   2322 O O     . TYR A 1 294 ? 25.040  27.455  6.143  1.00 62.55  ? 320 TYR A O     1 
ATOM   2323 C CB    . TYR A 1 294 ? 25.567  25.091  4.530  1.00 67.01  ? 320 TYR A CB    1 
ATOM   2324 C CG    . TYR A 1 294 ? 26.275  23.864  3.972  1.00 68.75  ? 320 TYR A CG    1 
ATOM   2325 C CD1   . TYR A 1 294 ? 26.332  23.631  2.596  1.00 71.47  ? 320 TYR A CD1   1 
ATOM   2326 C CD2   . TYR A 1 294 ? 26.903  22.951  4.822  1.00 67.93  ? 320 TYR A CD2   1 
ATOM   2327 C CE1   . TYR A 1 294 ? 26.991  22.509  2.078  1.00 73.67  ? 320 TYR A CE1   1 
ATOM   2328 C CE2   . TYR A 1 294 ? 27.564  21.834  4.322  1.00 70.54  ? 320 TYR A CE2   1 
ATOM   2329 C CZ    . TYR A 1 294 ? 27.601  21.614  2.950  1.00 72.98  ? 320 TYR A CZ    1 
ATOM   2330 O OH    . TYR A 1 294 ? 28.254  20.509  2.460  1.00 75.16  ? 320 TYR A OH    1 
ATOM   2331 N N     . THR A 1 295 ? 25.987  28.684  4.512  1.00 45.49  ? 321 THR A N     1 
ATOM   2332 C CA    . THR A 1 295 ? 25.507  29.958  5.011  1.00 43.66  ? 321 THR A CA    1 
ATOM   2333 C C     . THR A 1 295 ? 24.257  30.466  4.297  1.00 43.26  ? 321 THR A C     1 
ATOM   2334 O O     . THR A 1 295 ? 24.196  30.468  3.078  1.00 43.59  ? 321 THR A O     1 
ATOM   2335 C CB    . THR A 1 295 ? 26.603  31.000  4.909  1.00 43.73  ? 321 THR A CB    1 
ATOM   2336 O OG1   . THR A 1 295 ? 27.752  30.547  5.632  1.00 43.57  ? 321 THR A OG1   1 
ATOM   2337 C CG2   . THR A 1 295 ? 26.137  32.342  5.461  1.00 42.46  ? 321 THR A CG2   1 
ATOM   2338 N N     . HIS A 1 296 ? 23.274  30.905  5.086  1.00 42.43  ? 322 HIS A N     1 
ATOM   2339 C CA    . HIS A 1 296 ? 22.087  31.566  4.592  1.00 41.87  ? 322 HIS A CA    1 
ATOM   2340 C C     . HIS A 1 296 ? 21.832  32.837  5.379  1.00 41.44  ? 322 HIS A C     1 
ATOM   2341 O O     . HIS A 1 296 ? 22.124  32.905  6.589  1.00 41.58  ? 322 HIS A O     1 
ATOM   2342 C CB    . HIS A 1 296 ? 20.880  30.655  4.708  1.00 42.47  ? 322 HIS A CB    1 
ATOM   2343 C CG    . HIS A 1 296 ? 21.043  29.362  3.978  1.00 45.06  ? 322 HIS A CG    1 
ATOM   2344 N ND1   . HIS A 1 296 ? 20.617  29.185  2.679  1.00 45.58  ? 322 HIS A ND1   1 
ATOM   2345 C CD2   . HIS A 1 296 ? 21.621  28.195  4.352  1.00 45.87  ? 322 HIS A CD2   1 
ATOM   2346 C CE1   . HIS A 1 296 ? 20.909  27.956  2.290  1.00 46.44  ? 322 HIS A CE1   1 
ATOM   2347 N NE2   . HIS A 1 296 ? 21.522  27.336  3.284  1.00 47.60  ? 322 HIS A NE2   1 
ATOM   2348 N N     . PHE A 1 297 ? 21.324  33.847  4.675  1.00 40.25  ? 323 PHE A N     1 
ATOM   2349 C CA    . PHE A 1 297 ? 20.863  35.070  5.285  1.00 39.76  ? 323 PHE A CA    1 
ATOM   2350 C C     . PHE A 1 297 ? 19.379  34.885  5.483  1.00 40.23  ? 323 PHE A C     1 
ATOM   2351 O O     . PHE A 1 297 ? 18.677  34.511  4.541  1.00 41.22  ? 323 PHE A O     1 
ATOM   2352 C CB    . PHE A 1 297 ? 21.147  36.272  4.381  1.00 39.43  ? 323 PHE A CB    1 
ATOM   2353 C CG    . PHE A 1 297 ? 22.554  36.747  4.465  1.00 37.69  ? 323 PHE A CG    1 
ATOM   2354 C CD1   . PHE A 1 297 ? 23.549  36.158  3.687  1.00 36.00  ? 323 PHE A CD1   1 
ATOM   2355 C CD2   . PHE A 1 297 ? 22.899  37.762  5.353  1.00 34.79  ? 323 PHE A CD2   1 
ATOM   2356 C CE1   . PHE A 1 297 ? 24.854  36.582  3.778  1.00 35.40  ? 323 PHE A CE1   1 
ATOM   2357 C CE2   . PHE A 1 297 ? 24.206  38.182  5.457  1.00 34.69  ? 323 PHE A CE2   1 
ATOM   2358 C CZ    . PHE A 1 297 ? 25.188  37.588  4.670  1.00 35.44  ? 323 PHE A CZ    1 
ATOM   2359 N N     . THR A 1 298 ? 18.902  35.129  6.700  1.00 39.89  ? 324 THR A N     1 
ATOM   2360 C CA    . THR A 1 298 ? 17.553  34.718  7.077  1.00 40.57  ? 324 THR A CA    1 
ATOM   2361 C C     . THR A 1 298 ? 16.813  35.800  7.827  1.00 41.41  ? 324 THR A C     1 
ATOM   2362 O O     . THR A 1 298 ? 17.407  36.688  8.418  1.00 41.23  ? 324 THR A O     1 
ATOM   2363 C CB    . THR A 1 298 ? 17.549  33.423  7.969  1.00 40.22  ? 324 THR A CB    1 
ATOM   2364 O OG1   . THR A 1 298 ? 18.138  33.707  9.240  1.00 40.37  ? 324 THR A OG1   1 
ATOM   2365 C CG2   . THR A 1 298 ? 18.330  32.281  7.320  1.00 40.58  ? 324 THR A CG2   1 
ATOM   2366 N N     . CYS A 1 299 ? 15.497  35.721  7.764  1.00 43.70  ? 325 CYS A N     1 
ATOM   2367 C CA    . CYS A 1 299 ? 14.617  36.480  8.630  1.00 45.97  ? 325 CYS A CA    1 
ATOM   2368 C C     . CYS A 1 299 ? 13.758  35.384  9.232  1.00 46.98  ? 325 CYS A C     1 
ATOM   2369 O O     . CYS A 1 299 ? 12.909  34.822  8.550  1.00 47.74  ? 325 CYS A O     1 
ATOM   2370 C CB    . CYS A 1 299 ? 13.758  37.460  7.832  1.00 46.81  ? 325 CYS A CB    1 
ATOM   2371 S SG    . CYS A 1 299 ? 12.608  38.396  8.858  1.00 48.69  ? 325 CYS A SG    1 
ATOM   2372 N N     . ALA A 1 300 ? 14.025  35.050  10.490 1.00 47.82  ? 326 ALA A N     1 
ATOM   2373 C CA    . ALA A 1 300 ? 13.443  33.866  11.115 1.00 48.79  ? 326 ALA A CA    1 
ATOM   2374 C C     . ALA A 1 300 ? 11.954  34.053  11.320 1.00 50.55  ? 326 ALA A C     1 
ATOM   2375 O O     . ALA A 1 300 ? 11.210  33.080  11.399 1.00 51.25  ? 326 ALA A O     1 
ATOM   2376 C CB    . ALA A 1 300 ? 14.133  33.567  12.454 1.00 49.09  ? 326 ALA A CB    1 
ATOM   2377 N N     . THR A 1 301 ? 11.529  35.309  11.382 1.00 51.59  ? 327 THR A N     1 
ATOM   2378 C CA    . THR A 1 301 ? 10.125  35.648  11.584 1.00 53.94  ? 327 THR A CA    1 
ATOM   2379 C C     . THR A 1 301 ? 9.353   35.636  10.276 1.00 55.63  ? 327 THR A C     1 
ATOM   2380 O O     . THR A 1 301 ? 8.127   35.804  10.263 1.00 57.34  ? 327 THR A O     1 
ATOM   2381 C CB    . THR A 1 301 ? 9.968   37.022  12.273 1.00 54.93  ? 327 THR A CB    1 
ATOM   2382 O OG1   . THR A 1 301 ? 10.808  37.982  11.619 1.00 53.92  ? 327 THR A OG1   1 
ATOM   2383 C CG2   . THR A 1 301 ? 10.372  36.928  13.741 1.00 53.79  ? 327 THR A CG2   1 
ATOM   2384 N N     . ASP A 1 302 ? 10.072  35.421  9.178  1.00 55.67  ? 328 ASP A N     1 
ATOM   2385 C CA    . ASP A 1 302 ? 9.462   35.338  7.857  1.00 57.65  ? 328 ASP A CA    1 
ATOM   2386 C C     . ASP A 1 302 ? 9.299   33.876  7.428  1.00 57.66  ? 328 ASP A C     1 
ATOM   2387 O O     . ASP A 1 302 ? 10.256  33.227  7.008  1.00 56.92  ? 328 ASP A O     1 
ATOM   2388 C CB    . ASP A 1 302 ? 10.299  36.130  6.846  1.00 57.40  ? 328 ASP A CB    1 
ATOM   2389 C CG    . ASP A 1 302 ? 9.682   36.168  5.451  1.00 59.63  ? 328 ASP A CG    1 
ATOM   2390 O OD1   . ASP A 1 302 ? 8.633   35.540  5.205  1.00 62.34  ? 328 ASP A OD1   1 
ATOM   2391 O OD2   . ASP A 1 302 ? 10.276  36.831  4.582  1.00 62.18  ? 328 ASP A OD2   1 
ATOM   2392 N N     . THR A 1 303 ? 8.073   33.378  7.527  1.00 59.46  ? 329 THR A N     1 
ATOM   2393 C CA    . THR A 1 303 ? 7.762   31.972  7.279  1.00 60.10  ? 329 THR A CA    1 
ATOM   2394 C C     . THR A 1 303 ? 8.185   31.473  5.888  1.00 60.17  ? 329 THR A C     1 
ATOM   2395 O O     . THR A 1 303 ? 8.792   30.406  5.774  1.00 59.75  ? 329 THR A O     1 
ATOM   2396 C CB    . THR A 1 303 ? 6.270   31.692  7.559  1.00 61.95  ? 329 THR A CB    1 
ATOM   2397 O OG1   . THR A 1 303 ? 6.013   31.918  8.950  1.00 62.12  ? 329 THR A OG1   1 
ATOM   2398 C CG2   . THR A 1 303 ? 5.895   30.249  7.208  1.00 62.64  ? 329 THR A CG2   1 
ATOM   2399 N N     . LYS A 1 304 ? 7.886   32.249  4.846  1.00 61.14  ? 330 LYS A N     1 
ATOM   2400 C CA    . LYS A 1 304 ? 8.314   31.911  3.490  1.00 61.14  ? 330 LYS A CA    1 
ATOM   2401 C C     . LYS A 1 304 ? 9.821   31.707  3.409  1.00 58.93  ? 330 LYS A C     1 
ATOM   2402 O O     . LYS A 1 304 ? 10.296  30.696  2.870  1.00 58.60  ? 330 LYS A O     1 
ATOM   2403 C CB    . LYS A 1 304 ? 7.899   32.999  2.499  1.00 62.88  ? 330 LYS A CB    1 
ATOM   2404 C CG    . LYS A 1 304 ? 8.521   32.799  1.114  1.00 65.15  ? 330 LYS A CG    1 
ATOM   2405 C CD    . LYS A 1 304 ? 8.387   34.025  0.208  1.00 69.83  ? 330 LYS A CD    1 
ATOM   2406 C CE    . LYS A 1 304 ? 8.853   33.696  -1.214 1.00 71.44  ? 330 LYS A CE    1 
ATOM   2407 N NZ    . LYS A 1 304 ? 7.883   32.812  -1.947 1.00 74.19  ? 330 LYS A NZ    1 
ATOM   2408 N N     . ASN A 1 305 ? 10.568  32.670  3.950  1.00 57.32  ? 331 ASN A N     1 
ATOM   2409 C CA    . ASN A 1 305 ? 12.023  32.624  3.914  1.00 55.11  ? 331 ASN A CA    1 
ATOM   2410 C C     . ASN A 1 305 ? 12.563  31.392  4.630  1.00 54.36  ? 331 ASN A C     1 
ATOM   2411 O O     . ASN A 1 305 ? 13.458  30.716  4.115  1.00 53.92  ? 331 ASN A O     1 
ATOM   2412 C CB    . ASN A 1 305 ? 12.631  33.905  4.499  1.00 54.37  ? 331 ASN A CB    1 
ATOM   2413 C CG    . ASN A 1 305 ? 14.145  33.865  4.537  1.00 53.10  ? 331 ASN A CG    1 
ATOM   2414 O OD1   . ASN A 1 305 ? 14.748  33.863  5.610  1.00 52.26  ? 331 ASN A OD1   1 
ATOM   2415 N ND2   . ASN A 1 305 ? 14.770  33.795  3.363  1.00 52.64  ? 331 ASN A ND2   1 
ATOM   2416 N N     . VAL A 1 306 ? 12.012  31.089  5.802  1.00 54.04  ? 332 VAL A N     1 
ATOM   2417 C CA    . VAL A 1 306 ? 12.466  29.926  6.555  1.00 53.66  ? 332 VAL A CA    1 
ATOM   2418 C C     . VAL A 1 306 ? 12.208  28.652  5.761  1.00 54.94  ? 332 VAL A C     1 
ATOM   2419 O O     . VAL A 1 306 ? 13.074  27.769  5.690  1.00 54.52  ? 332 VAL A O     1 
ATOM   2420 C CB    . VAL A 1 306 ? 11.830  29.859  7.965  1.00 54.03  ? 332 VAL A CB    1 
ATOM   2421 C CG1   . VAL A 1 306 ? 12.269  28.604  8.701  1.00 52.65  ? 332 VAL A CG1   1 
ATOM   2422 C CG2   . VAL A 1 306 ? 12.222  31.088  8.766  1.00 52.48  ? 332 VAL A CG2   1 
ATOM   2423 N N     . GLN A 1 307 ? 11.030  28.582  5.139  1.00 56.68  ? 333 GLN A N     1 
ATOM   2424 C CA    . GLN A 1 307 ? 10.652  27.445  4.308  1.00 58.24  ? 333 GLN A CA    1 
ATOM   2425 C C     . GLN A 1 307 ? 11.642  27.235  3.161  1.00 57.79  ? 333 GLN A C     1 
ATOM   2426 O O     . GLN A 1 307 ? 12.110  26.120  2.937  1.00 57.94  ? 333 GLN A O     1 
ATOM   2427 C CB    . GLN A 1 307 ? 9.227   27.627  3.764  1.00 59.95  ? 333 GLN A CB    1 
ATOM   2428 C CG    . GLN A 1 307 ? 8.704   26.455  2.945  1.00 61.67  ? 333 GLN A CG    1 
ATOM   2429 C CD    . GLN A 1 307 ? 7.352   26.751  2.320  1.00 66.02  ? 333 GLN A CD    1 
ATOM   2430 O OE1   . GLN A 1 307 ? 6.591   27.587  2.816  1.00 68.38  ? 333 GLN A OE1   1 
ATOM   2431 N NE2   . GLN A 1 307 ? 7.048   26.071  1.225  1.00 66.23  ? 333 GLN A NE2   1 
ATOM   2432 N N     . PHE A 1 308 ? 11.955  28.310  2.446  1.00 57.70  ? 334 PHE A N     1 
ATOM   2433 C CA    . PHE A 1 308 ? 12.931  28.251  1.369  1.00 57.77  ? 334 PHE A CA    1 
ATOM   2434 C C     . PHE A 1 308 ? 14.305  27.806  1.873  1.00 57.01  ? 334 PHE A C     1 
ATOM   2435 O O     . PHE A 1 308 ? 14.929  26.906  1.299  1.00 57.39  ? 334 PHE A O     1 
ATOM   2436 C CB    . PHE A 1 308 ? 13.056  29.606  0.668  1.00 57.97  ? 334 PHE A CB    1 
ATOM   2437 C CG    . PHE A 1 308 ? 14.031  29.596  -0.476 1.00 59.15  ? 334 PHE A CG    1 
ATOM   2438 C CD1   . PHE A 1 308 ? 13.636  29.157  -1.741 1.00 59.62  ? 334 PHE A CD1   1 
ATOM   2439 C CD2   . PHE A 1 308 ? 15.355  29.992  -0.284 1.00 58.54  ? 334 PHE A CD2   1 
ATOM   2440 C CE1   . PHE A 1 308 ? 14.541  29.129  -2.796 1.00 60.79  ? 334 PHE A CE1   1 
ATOM   2441 C CE2   . PHE A 1 308 ? 16.273  29.956  -1.350 1.00 58.98  ? 334 PHE A CE2   1 
ATOM   2442 C CZ    . PHE A 1 308 ? 15.865  29.534  -2.594 1.00 59.15  ? 334 PHE A CZ    1 
ATOM   2443 N N     . VAL A 1 309 ? 14.768  28.441  2.946  1.00 55.93  ? 335 VAL A N     1 
ATOM   2444 C CA    . VAL A 1 309 ? 16.090  28.152  3.496  1.00 55.25  ? 335 VAL A CA    1 
ATOM   2445 C C     . VAL A 1 309 ? 16.165  26.732  4.050  1.00 55.91  ? 335 VAL A C     1 
ATOM   2446 O O     . VAL A 1 309 ? 17.141  26.018  3.804  1.00 56.01  ? 335 VAL A O     1 
ATOM   2447 C CB    . VAL A 1 309 ? 16.500  29.183  4.573  1.00 54.13  ? 335 VAL A CB    1 
ATOM   2448 C CG1   . VAL A 1 309 ? 17.755  28.724  5.298  1.00 53.85  ? 335 VAL A CG1   1 
ATOM   2449 C CG2   . VAL A 1 309 ? 16.726  30.547  3.937  1.00 53.58  ? 335 VAL A CG2   1 
ATOM   2450 N N     . PHE A 1 310 ? 15.134  26.317  4.784  1.00 56.77  ? 336 PHE A N     1 
ATOM   2451 C CA    . PHE A 1 310 ? 15.121  24.957  5.319  1.00 58.34  ? 336 PHE A CA    1 
ATOM   2452 C C     . PHE A 1 310 ? 15.034  23.898  4.220  1.00 59.59  ? 336 PHE A C     1 
ATOM   2453 O O     . PHE A 1 310 ? 15.540  22.786  4.388  1.00 60.22  ? 336 PHE A O     1 
ATOM   2454 C CB    . PHE A 1 310 ? 14.032  24.733  6.379  1.00 58.54  ? 336 PHE A CB    1 
ATOM   2455 C CG    . PHE A 1 310 ? 14.312  23.552  7.258  1.00 59.83  ? 336 PHE A CG    1 
ATOM   2456 C CD1   . PHE A 1 310 ? 15.233  23.650  8.298  1.00 60.35  ? 336 PHE A CD1   1 
ATOM   2457 C CD2   . PHE A 1 310 ? 13.706  22.322  7.014  1.00 61.22  ? 336 PHE A CD2   1 
ATOM   2458 C CE1   . PHE A 1 310 ? 15.523  22.540  9.109  1.00 62.51  ? 336 PHE A CE1   1 
ATOM   2459 C CE2   . PHE A 1 310 ? 13.987  21.205  7.812  1.00 63.17  ? 336 PHE A CE2   1 
ATOM   2460 C CZ    . PHE A 1 310 ? 14.899  21.310  8.860  1.00 62.64  ? 336 PHE A CZ    1 
ATOM   2461 N N     . ASP A 1 311 ? 14.404  24.245  3.101  1.00 60.33  ? 337 ASP A N     1 
ATOM   2462 C CA    . ASP A 1 311 ? 14.391  23.353  1.949  1.00 62.64  ? 337 ASP A CA    1 
ATOM   2463 C C     . ASP A 1 311 ? 15.811  23.109  1.418  1.00 62.73  ? 337 ASP A C     1 
ATOM   2464 O O     . ASP A 1 311 ? 16.198  21.964  1.179  1.00 63.84  ? 337 ASP A O     1 
ATOM   2465 C CB    . ASP A 1 311 ? 13.481  23.884  0.837  1.00 63.41  ? 337 ASP A CB    1 
ATOM   2466 C CG    . ASP A 1 311 ? 13.423  22.953  -0.356 1.00 66.60  ? 337 ASP A CG    1 
ATOM   2467 O OD1   . ASP A 1 311 ? 12.640  21.976  -0.314 1.00 70.25  ? 337 ASP A OD1   1 
ATOM   2468 O OD2   . ASP A 1 311 ? 14.164  23.194  -1.340 1.00 68.70  ? 337 ASP A OD2   1 
ATOM   2469 N N     . ALA A 1 312 ? 16.581  24.181  1.241  1.00 61.95  ? 338 ALA A N     1 
ATOM   2470 C CA    . ALA A 1 312 ? 17.963  24.061  0.778  1.00 62.60  ? 338 ALA A CA    1 
ATOM   2471 C C     . ALA A 1 312 ? 18.832  23.283  1.769  1.00 63.21  ? 338 ALA A C     1 
ATOM   2472 O O     . ALA A 1 312 ? 19.676  22.485  1.361  1.00 64.61  ? 338 ALA A O     1 
ATOM   2473 C CB    . ALA A 1 312 ? 18.560  25.430  0.496  1.00 61.70  ? 338 ALA A CB    1 
ATOM   2474 N N     . VAL A 1 313 ? 18.611  23.510  3.063  1.00 62.57  ? 339 VAL A N     1 
ATOM   2475 C CA    . VAL A 1 313 ? 19.338  22.800  4.115  1.00 63.05  ? 339 VAL A CA    1 
ATOM   2476 C C     . VAL A 1 313 ? 19.053  21.294  4.078  1.00 65.01  ? 339 VAL A C     1 
ATOM   2477 O O     . VAL A 1 313 ? 19.969  20.480  4.241  1.00 66.22  ? 339 VAL A O     1 
ATOM   2478 C CB    . VAL A 1 313 ? 19.027  23.383  5.524  1.00 61.92  ? 339 VAL A CB    1 
ATOM   2479 C CG1   . VAL A 1 313 ? 19.622  22.518  6.621  1.00 62.12  ? 339 VAL A CG1   1 
ATOM   2480 C CG2   . VAL A 1 313 ? 19.549  24.801  5.639  1.00 60.12  ? 339 VAL A CG2   1 
ATOM   2481 N N     . THR A 1 314 ? 17.788  20.934  3.867  1.00 65.61  ? 340 THR A N     1 
ATOM   2482 C CA    . THR A 1 314 ? 17.379  19.527  3.781  1.00 67.68  ? 340 THR A CA    1 
ATOM   2483 C C     . THR A 1 314 ? 18.043  18.802  2.601  1.00 69.59  ? 340 THR A C     1 
ATOM   2484 O O     . THR A 1 314 ? 18.501  17.661  2.741  1.00 71.19  ? 340 THR A O     1 
ATOM   2485 C CB    . THR A 1 314 ? 15.836  19.384  3.739  1.00 67.79  ? 340 THR A CB    1 
ATOM   2486 O OG1   . THR A 1 314 ? 15.284  19.883  4.965  1.00 66.75  ? 340 THR A OG1   1 
ATOM   2487 C CG2   . THR A 1 314 ? 15.417  17.927  3.571  1.00 68.97  ? 340 THR A CG2   1 
ATOM   2488 N N     . ASP A 1 315 ? 18.113  19.477  1.457  1.00 69.81  ? 341 ASP A N     1 
ATOM   2489 C CA    . ASP A 1 315 ? 18.819  18.951  0.290  1.00 72.01  ? 341 ASP A CA    1 
ATOM   2490 C C     . ASP A 1 315 ? 20.308  18.750  0.569  1.00 72.94  ? 341 ASP A C     1 
ATOM   2491 O O     . ASP A 1 315 ? 20.928  17.835  0.028  1.00 75.27  ? 341 ASP A O     1 
ATOM   2492 C CB    . ASP A 1 315 ? 18.611  19.856  -0.930 1.00 71.44  ? 341 ASP A CB    1 
ATOM   2493 C CG    . ASP A 1 315 ? 17.215  19.725  -1.524 1.00 72.57  ? 341 ASP A CG    1 
ATOM   2494 O OD1   . ASP A 1 315 ? 16.388  18.959  -0.979 1.00 73.56  ? 341 ASP A OD1   1 
ATOM   2495 O OD2   . ASP A 1 315 ? 16.940  20.386  -2.544 1.00 73.63  ? 341 ASP A OD2   1 
ATOM   2496 N N     . VAL A 1 316 ? 20.869  19.597  1.423  1.00 71.80  ? 342 VAL A N     1 
ATOM   2497 C CA    . VAL A 1 316 ? 22.266  19.472  1.836  1.00 72.87  ? 342 VAL A CA    1 
ATOM   2498 C C     . VAL A 1 316 ? 22.489  18.222  2.700  1.00 74.55  ? 342 VAL A C     1 
ATOM   2499 O O     . VAL A 1 316 ? 23.437  17.465  2.475  1.00 76.48  ? 342 VAL A O     1 
ATOM   2500 C CB    . VAL A 1 316 ? 22.748  20.762  2.561  1.00 71.22  ? 342 VAL A CB    1 
ATOM   2501 C CG1   . VAL A 1 316 ? 23.975  20.501  3.439  1.00 72.06  ? 342 VAL A CG1   1 
ATOM   2502 C CG2   . VAL A 1 316 ? 23.025  21.860  1.541  1.00 70.20  ? 342 VAL A CG2   1 
ATOM   2503 N N     . ILE A 1 317 ? 21.608  18.010  3.673  1.00 74.26  ? 343 ILE A N     1 
ATOM   2504 C CA    . ILE A 1 317 ? 21.713  16.868  4.575  1.00 76.20  ? 343 ILE A CA    1 
ATOM   2505 C C     . ILE A 1 317 ? 21.527  15.547  3.820  1.00 78.98  ? 343 ILE A C     1 
ATOM   2506 O O     . ILE A 1 317 ? 22.233  14.575  4.097  1.00 81.10  ? 343 ILE A O     1 
ATOM   2507 C CB    . ILE A 1 317 ? 20.731  16.988  5.764  1.00 75.17  ? 343 ILE A CB    1 
ATOM   2508 C CG1   . ILE A 1 317 ? 21.147  18.158  6.668  1.00 73.42  ? 343 ILE A CG1   1 
ATOM   2509 C CG2   . ILE A 1 317 ? 20.675  15.683  6.565  1.00 76.85  ? 343 ILE A CG2   1 
ATOM   2510 C CD1   . ILE A 1 317 ? 20.063  18.654  7.602  1.00 71.57  ? 343 ILE A CD1   1 
ATOM   2511 N N     . ILE A 1 318 ? 20.593  15.526  2.865  1.00 79.26  ? 344 ILE A N     1 
ATOM   2512 C CA    . ILE A 1 318 ? 20.389  14.359  2.010  1.00 81.98  ? 344 ILE A CA    1 
ATOM   2513 C C     . ILE A 1 318 ? 21.666  14.031  1.244  1.00 84.32  ? 344 ILE A C     1 
ATOM   2514 O O     . ILE A 1 318 ? 22.198  12.920  1.369  1.00 86.79  ? 344 ILE A O     1 
ATOM   2515 C CB    . ILE A 1 318 ? 19.212  14.536  1.008  1.00 81.49  ? 344 ILE A CB    1 
ATOM   2516 C CG1   . ILE A 1 318 ? 17.877  14.643  1.748  1.00 80.28  ? 344 ILE A CG1   1 
ATOM   2517 C CG2   . ILE A 1 318 ? 19.157  13.356  0.027  1.00 83.86  ? 344 ILE A CG2   1 
ATOM   2518 C CD1   . ILE A 1 318 ? 16.718  15.089  0.872  1.00 79.37  ? 344 ILE A CD1   1 
ATOM   2519 N N     . LYS A 1 319 ? 22.160  15.003  0.476  1.00 83.98  ? 345 LYS A N     1 
ATOM   2520 C CA    . LYS A 1 319 ? 23.330  14.800  -0.382 1.00 86.57  ? 345 LYS A CA    1 
ATOM   2521 C C     . LYS A 1 319 ? 24.542  14.308  0.399  1.00 88.54  ? 345 LYS A C     1 
ATOM   2522 O O     . LYS A 1 319 ? 25.325  13.509  -0.111 1.00 91.37  ? 345 LYS A O     1 
ATOM   2523 C CB    . LYS A 1 319 ? 23.679  16.069  -1.163 1.00 85.26  ? 345 LYS A CB    1 
ATOM   2524 C CG    . LYS A 1 319 ? 22.787  16.317  -2.369 1.00 85.54  ? 345 LYS A CG    1 
ATOM   2525 C CD    . LYS A 1 319 ? 23.221  17.563  -3.125 1.00 85.69  ? 345 LYS A CD    1 
ATOM   2526 C CE    . LYS A 1 319 ? 22.142  18.042  -4.086 1.00 85.75  ? 345 LYS A CE    1 
ATOM   2527 N NZ    . LYS A 1 319 ? 22.476  19.377  -4.668 1.00 85.43  ? 345 LYS A NZ    1 
ATOM   2528 N N     . ASN A 1 320 ? 24.680  14.777  1.638  1.00 87.56  ? 346 ASN A N     1 
ATOM   2529 C CA    . ASN A 1 320 ? 25.754  14.330  2.521  1.00 89.47  ? 346 ASN A CA    1 
ATOM   2530 C C     . ASN A 1 320 ? 25.534  12.916  3.070  1.00 91.72  ? 346 ASN A C     1 
ATOM   2531 O O     . ASN A 1 320 ? 25.313  12.725  4.271  1.00 91.49  ? 346 ASN A O     1 
ATOM   2532 C CB    . ASN A 1 320 ? 25.972  15.344  3.650  1.00 87.49  ? 346 ASN A CB    1 
ATOM   2533 C CG    . ASN A 1 320 ? 26.448  16.699  3.137  1.00 86.84  ? 346 ASN A CG    1 
ATOM   2534 O OD1   . ASN A 1 320 ? 26.881  16.825  1.987  1.00 88.66  ? 346 ASN A OD1   1 
ATOM   2535 N ND2   . ASN A 1 320 ? 26.367  17.721  3.990  1.00 85.48  ? 346 ASN A ND2   1 
ATOM   2536 N N     . ASN A 1 321 ? 25.586  11.935  2.169  1.00 94.24  ? 347 ASN A N     1 
ATOM   2537 C CA    . ASN A 1 321 ? 25.502  10.511  2.513  1.00 96.95  ? 347 ASN A CA    1 
ATOM   2538 C C     . ASN A 1 321 ? 26.535  9.699   1.746  1.00 100.45 ? 347 ASN A C     1 
ATOM   2539 O O     . ASN A 1 321 ? 26.841  10.002  0.593  1.00 100.78 ? 347 ASN A O     1 
ATOM   2540 C CB    . ASN A 1 321 ? 24.099  9.955   2.242  1.00 96.62  ? 347 ASN A CB    1 
ATOM   2541 C CG    . ASN A 1 321 ? 23.165  10.092  3.444  1.00 95.11  ? 347 ASN A CG    1 
ATOM   2542 O OD1   . ASN A 1 321 ? 22.768  11.199  3.831  1.00 91.79  ? 347 ASN A OD1   1 
ATOM   2543 N ND2   . ASN A 1 321 ? 22.795  8.956   4.027  1.00 96.40  ? 347 ASN A ND2   1 
ATOM   2544 N N     . ARG B 1 6   ? 67.994  63.636  37.518 1.00 87.23  ? 32  ARG B N     1 
ATOM   2545 C CA    . ARG B 1 6   ? 68.027  65.129  37.575 1.00 87.75  ? 32  ARG B CA    1 
ATOM   2546 C C     . ARG B 1 6   ? 67.190  65.772  36.464 1.00 85.40  ? 32  ARG B C     1 
ATOM   2547 O O     . ARG B 1 6   ? 66.543  66.799  36.681 1.00 84.98  ? 32  ARG B O     1 
ATOM   2548 C CB    . ARG B 1 6   ? 69.469  65.631  37.527 1.00 91.04  ? 32  ARG B CB    1 
ATOM   2549 C CG    . ARG B 1 6   ? 69.618  67.142  37.612 1.00 93.05  ? 32  ARG B CG    1 
ATOM   2550 C CD    . ARG B 1 6   ? 71.047  67.548  37.331 1.00 98.27  ? 32  ARG B CD    1 
ATOM   2551 N NE    . ARG B 1 6   ? 71.516  67.047  36.039 1.00 99.07  ? 32  ARG B NE    1 
ATOM   2552 C CZ    . ARG B 1 6   ? 72.795  66.839  35.738 1.00 102.36 ? 32  ARG B CZ    1 
ATOM   2553 N NH1   . ARG B 1 6   ? 73.741  67.077  36.639 1.00 104.91 ? 32  ARG B NH1   1 
ATOM   2554 N NH2   . ARG B 1 6   ? 73.130  66.382  34.538 1.00 103.13 ? 32  ARG B NH2   1 
ATOM   2555 N N     . GLU B 1 7   ? 67.218  65.177  35.276 1.00 84.17  ? 33  GLU B N     1 
ATOM   2556 C CA    . GLU B 1 7   ? 66.311  65.566  34.200 1.00 81.61  ? 33  GLU B CA    1 
ATOM   2557 C C     . GLU B 1 7   ? 65.067  64.679  34.316 1.00 78.24  ? 33  GLU B C     1 
ATOM   2558 O O     . GLU B 1 7   ? 65.185  63.450  34.358 1.00 78.27  ? 33  GLU B O     1 
ATOM   2559 C CB    . GLU B 1 7   ? 66.991  65.375  32.843 1.00 82.87  ? 33  GLU B CB    1 
ATOM   2560 C CG    . GLU B 1 7   ? 66.669  66.441  31.805 1.00 83.50  ? 33  GLU B CG    1 
ATOM   2561 C CD    . GLU B 1 7   ? 67.597  66.372  30.599 1.00 86.27  ? 33  GLU B CD    1 
ATOM   2562 O OE1   . GLU B 1 7   ? 67.369  65.521  29.708 1.00 85.31  ? 33  GLU B OE1   1 
ATOM   2563 O OE2   . GLU B 1 7   ? 68.555  67.176  30.542 1.00 88.94  ? 33  GLU B OE2   1 
ATOM   2564 N N     . VAL B 1 8   ? 63.886  65.293  34.397 1.00 75.04  ? 34  VAL B N     1 
ATOM   2565 C CA    . VAL B 1 8   ? 62.642  64.535  34.582 1.00 71.55  ? 34  VAL B CA    1 
ATOM   2566 C C     . VAL B 1 8   ? 61.692  64.725  33.402 1.00 69.04  ? 34  VAL B C     1 
ATOM   2567 O O     . VAL B 1 8   ? 61.284  65.848  33.085 1.00 68.38  ? 34  VAL B O     1 
ATOM   2568 C CB    . VAL B 1 8   ? 61.911  64.900  35.901 1.00 70.76  ? 34  VAL B CB    1 
ATOM   2569 C CG1   . VAL B 1 8   ? 60.646  64.072  36.047 1.00 68.53  ? 34  VAL B CG1   1 
ATOM   2570 C CG2   . VAL B 1 8   ? 62.813  64.682  37.107 1.00 72.91  ? 34  VAL B CG2   1 
ATOM   2571 N N     . LYS B 1 9   ? 61.333  63.621  32.759 1.00 67.01  ? 35  LYS B N     1 
ATOM   2572 C CA    . LYS B 1 9   ? 60.554  63.705  31.535 1.00 64.94  ? 35  LYS B CA    1 
ATOM   2573 C C     . LYS B 1 9   ? 59.154  63.095  31.670 1.00 61.62  ? 35  LYS B C     1 
ATOM   2574 O O     . LYS B 1 9   ? 58.991  61.914  31.991 1.00 60.78  ? 35  LYS B O     1 
ATOM   2575 C CB    . LYS B 1 9   ? 61.358  63.150  30.348 1.00 66.40  ? 35  LYS B CB    1 
ATOM   2576 C CG    . LYS B 1 9   ? 62.520  64.075  29.931 1.00 69.82  ? 35  LYS B CG    1 
ATOM   2577 C CD    . LYS B 1 9   ? 63.443  63.476  28.853 1.00 73.04  ? 35  LYS B CD    1 
ATOM   2578 C CE    . LYS B 1 9   ? 64.582  62.636  29.458 1.00 75.81  ? 35  LYS B CE    1 
ATOM   2579 N NZ    . LYS B 1 9   ? 65.489  62.054  28.418 1.00 76.68  ? 35  LYS B NZ    1 
ATOM   2580 N N     . LEU B 1 10  ? 58.148  63.925  31.433 1.00 59.38  ? 36  LEU B N     1 
ATOM   2581 C CA    . LEU B 1 10  ? 56.758  63.541  31.651 1.00 56.35  ? 36  LEU B CA    1 
ATOM   2582 C C     . LEU B 1 10  ? 55.982  63.537  30.345 1.00 54.71  ? 36  LEU B C     1 
ATOM   2583 O O     . LEU B 1 10  ? 56.034  64.501  29.584 1.00 55.66  ? 36  LEU B O     1 
ATOM   2584 C CB    . LEU B 1 10  ? 56.088  64.487  32.660 1.00 55.68  ? 36  LEU B CB    1 
ATOM   2585 C CG    . LEU B 1 10  ? 56.758  64.683  34.033 1.00 56.96  ? 36  LEU B CG    1 
ATOM   2586 C CD1   . LEU B 1 10  ? 56.086  65.784  34.833 1.00 56.23  ? 36  LEU B CD1   1 
ATOM   2587 C CD2   . LEU B 1 10  ? 56.775  63.406  34.842 1.00 56.41  ? 36  LEU B CD2   1 
ATOM   2588 N N     . LEU B 1 11  ? 55.272  62.445  30.092 1.00 52.23  ? 37  LEU B N     1 
ATOM   2589 C CA    . LEU B 1 11  ? 54.334  62.388  28.986 1.00 50.58  ? 37  LEU B CA    1 
ATOM   2590 C C     . LEU B 1 11  ? 52.892  62.470  29.473 1.00 48.30  ? 37  LEU B C     1 
ATOM   2591 O O     . LEU B 1 11  ? 52.470  61.640  30.253 1.00 47.16  ? 37  LEU B O     1 
ATOM   2592 C CB    . LEU B 1 11  ? 54.530  61.097  28.190 1.00 50.72  ? 37  LEU B CB    1 
ATOM   2593 C CG    . LEU B 1 11  ? 53.573  60.815  27.030 1.00 49.87  ? 37  LEU B CG    1 
ATOM   2594 C CD1   . LEU B 1 11  ? 53.636  61.913  25.954 1.00 49.48  ? 37  LEU B CD1   1 
ATOM   2595 C CD2   . LEU B 1 11  ? 53.871  59.443  26.457 1.00 48.62  ? 37  LEU B CD2   1 
ATOM   2596 N N     . LEU B 1 12  ? 52.157  63.480  29.008 1.00 47.75  ? 38  LEU B N     1 
ATOM   2597 C CA    . LEU B 1 12  ? 50.712  63.582  29.211 1.00 46.06  ? 38  LEU B CA    1 
ATOM   2598 C C     . LEU B 1 12  ? 49.988  62.741  28.182 1.00 45.24  ? 38  LEU B C     1 
ATOM   2599 O O     . LEU B 1 12  ? 50.287  62.823  26.990 1.00 46.50  ? 38  LEU B O     1 
ATOM   2600 C CB    . LEU B 1 12  ? 50.240  65.031  29.078 1.00 46.50  ? 38  LEU B CB    1 
ATOM   2601 C CG    . LEU B 1 12  ? 50.683  66.024  30.151 1.00 47.22  ? 38  LEU B CG    1 
ATOM   2602 C CD1   . LEU B 1 12  ? 50.646  67.418  29.592 1.00 48.45  ? 38  LEU B CD1   1 
ATOM   2603 C CD2   . LEU B 1 12  ? 49.786  65.938  31.359 1.00 48.17  ? 38  LEU B CD2   1 
ATOM   2604 N N     . LEU B 1 13  ? 49.053  61.922  28.651 1.00 42.91  ? 39  LEU B N     1 
ATOM   2605 C CA    . LEU B 1 13  ? 48.171  61.169  27.783 1.00 41.70  ? 39  LEU B CA    1 
ATOM   2606 C C     . LEU B 1 13  ? 46.731  61.335  28.270 1.00 40.50  ? 39  LEU B C     1 
ATOM   2607 O O     . LEU B 1 13  ? 46.513  61.609  29.449 1.00 39.47  ? 39  LEU B O     1 
ATOM   2608 C CB    . LEU B 1 13  ? 48.544  59.682  27.787 1.00 41.42  ? 39  LEU B CB    1 
ATOM   2609 C CG    . LEU B 1 13  ? 49.903  59.210  27.229 1.00 43.94  ? 39  LEU B CG    1 
ATOM   2610 C CD1   . LEU B 1 13  ? 50.034  57.710  27.444 1.00 44.34  ? 39  LEU B CD1   1 
ATOM   2611 C CD2   . LEU B 1 13  ? 50.091  59.536  25.755 1.00 42.75  ? 39  LEU B CD2   1 
ATOM   2612 N N     . GLY B 1 14  ? 45.766  61.159  27.359 1.00 39.67  ? 40  GLY B N     1 
ATOM   2613 C CA    . GLY B 1 14  ? 44.356  61.112  27.694 1.00 37.82  ? 40  GLY B CA    1 
ATOM   2614 C C     . GLY B 1 14  ? 43.525  61.499  26.489 1.00 38.62  ? 40  GLY B C     1 
ATOM   2615 O O     . GLY B 1 14  ? 44.066  62.002  25.484 1.00 40.14  ? 40  GLY B O     1 
ATOM   2616 N N     . ALA B 1 15  ? 42.213  61.290  26.581 1.00 36.89  ? 41  ALA B N     1 
ATOM   2617 C CA    . ALA B 1 15  ? 41.306  61.639  25.501 1.00 37.39  ? 41  ALA B CA    1 
ATOM   2618 C C     . ALA B 1 15  ? 41.454  63.107  25.129 1.00 38.30  ? 41  ALA B C     1 
ATOM   2619 O O     . ALA B 1 15  ? 41.935  63.913  25.941 1.00 38.00  ? 41  ALA B O     1 
ATOM   2620 C CB    . ALA B 1 15  ? 39.857  61.358  25.916 1.00 36.36  ? 41  ALA B CB    1 
ATOM   2621 N N     . GLY B 1 16  ? 41.037  63.462  23.913 1.00 39.17  ? 42  GLY B N     1 
ATOM   2622 C CA    . GLY B 1 16  ? 40.860  64.871  23.568 1.00 40.41  ? 42  GLY B CA    1 
ATOM   2623 C C     . GLY B 1 16  ? 39.957  65.512  24.624 1.00 40.30  ? 42  GLY B C     1 
ATOM   2624 O O     . GLY B 1 16  ? 39.024  64.859  25.135 1.00 38.67  ? 42  GLY B O     1 
ATOM   2625 N N     . GLU B 1 17  ? 40.269  66.762  24.986 1.00 40.87  ? 43  GLU B N     1 
ATOM   2626 C CA    . GLU B 1 17  ? 39.465  67.559  25.930 1.00 40.68  ? 43  GLU B CA    1 
ATOM   2627 C C     . GLU B 1 17  ? 39.589  67.121  27.393 1.00 39.46  ? 43  GLU B C     1 
ATOM   2628 O O     . GLU B 1 17  ? 38.779  67.503  28.223 1.00 39.72  ? 43  GLU B O     1 
ATOM   2629 C CB    . GLU B 1 17  ? 37.974  67.586  25.518 1.00 40.62  ? 43  GLU B CB    1 
ATOM   2630 C CG    . GLU B 1 17  ? 37.715  67.885  24.047 1.00 42.60  ? 43  GLU B CG    1 
ATOM   2631 C CD    . GLU B 1 17  ? 38.087  69.298  23.655 1.00 45.17  ? 43  GLU B CD    1 
ATOM   2632 O OE1   . GLU B 1 17  ? 38.556  69.496  22.504 1.00 50.35  ? 43  GLU B OE1   1 
ATOM   2633 O OE2   . GLU B 1 17  ? 37.933  70.210  24.495 1.00 42.94  ? 43  GLU B OE2   1 
ATOM   2634 N N     . SER B 1 18  ? 40.594  66.316  27.708 1.00 39.40  ? 44  SER B N     1 
ATOM   2635 C CA    . SER B 1 18  ? 40.771  65.821  29.065 1.00 38.03  ? 44  SER B CA    1 
ATOM   2636 C C     . SER B 1 18  ? 41.561  66.797  29.931 1.00 38.56  ? 44  SER B C     1 
ATOM   2637 O O     . SER B 1 18  ? 41.523  66.692  31.157 1.00 38.16  ? 44  SER B O     1 
ATOM   2638 C CB    . SER B 1 18  ? 41.417  64.422  29.076 1.00 37.44  ? 44  SER B CB    1 
ATOM   2639 O OG    . SER B 1 18  ? 42.718  64.427  28.483 1.00 38.51  ? 44  SER B OG    1 
ATOM   2640 N N     . GLY B 1 19  ? 42.281  67.732  29.312 1.00 39.63  ? 45  GLY B N     1 
ATOM   2641 C CA    . GLY B 1 19  ? 42.989  68.759  30.083 1.00 40.23  ? 45  GLY B CA    1 
ATOM   2642 C C     . GLY B 1 19  ? 44.492  68.894  29.900 1.00 41.14  ? 45  GLY B C     1 
ATOM   2643 O O     . GLY B 1 19  ? 45.117  69.756  30.516 1.00 41.64  ? 45  GLY B O     1 
ATOM   2644 N N     . LYS B 1 20  ? 45.065  68.059  29.041 1.00 41.53  ? 46  LYS B N     1 
ATOM   2645 C CA    . LYS B 1 20  ? 46.513  68.062  28.763 1.00 42.62  ? 46  LYS B CA    1 
ATOM   2646 C C     . LYS B 1 20  ? 47.097  69.441  28.416 1.00 44.51  ? 46  LYS B C     1 
ATOM   2647 O O     . LYS B 1 20  ? 48.074  69.868  29.046 1.00 45.29  ? 46  LYS B O     1 
ATOM   2648 C CB    . LYS B 1 20  ? 46.853  67.046  27.667 1.00 42.43  ? 46  LYS B CB    1 
ATOM   2649 C CG    . LYS B 1 20  ? 46.243  65.664  27.901 1.00 39.71  ? 46  LYS B CG    1 
ATOM   2650 C CD    . LYS B 1 20  ? 46.638  64.685  26.804 1.00 40.09  ? 46  LYS B CD    1 
ATOM   2651 C CE    . LYS B 1 20  ? 45.953  64.995  25.469 1.00 39.04  ? 46  LYS B CE    1 
ATOM   2652 N NZ    . LYS B 1 20  ? 44.511  64.606  25.509 1.00 38.24  ? 46  LYS B NZ    1 
ATOM   2653 N N     . SER B 1 21  ? 46.506  70.138  27.439 1.00 45.44  ? 47  SER B N     1 
ATOM   2654 C CA    . SER B 1 21  ? 47.014  71.457  27.026 1.00 47.64  ? 47  SER B CA    1 
ATOM   2655 C C     . SER B 1 21  ? 46.969  72.435  28.167 1.00 47.54  ? 47  SER B C     1 
ATOM   2656 O O     . SER B 1 21  ? 47.842  73.273  28.308 1.00 49.44  ? 47  SER B O     1 
ATOM   2657 C CB    . SER B 1 21  ? 46.194  72.056  25.877 1.00 48.67  ? 47  SER B CB    1 
ATOM   2658 O OG    . SER B 1 21  ? 46.261  71.238  24.735 1.00 51.04  ? 47  SER B OG    1 
ATOM   2659 N N     . THR B 1 22  ? 45.908  72.350  28.953 1.00 46.54  ? 48  THR B N     1 
ATOM   2660 C CA    . THR B 1 22  ? 45.715  73.245  30.070 1.00 46.63  ? 48  THR B CA    1 
ATOM   2661 C C     . THR B 1 22  ? 46.807  73.017  31.095 1.00 46.71  ? 48  THR B C     1 
ATOM   2662 O O     . THR B 1 22  ? 47.303  73.978  31.675 1.00 48.11  ? 48  THR B O     1 
ATOM   2663 C CB    . THR B 1 22  ? 44.313  73.059  30.702 1.00 45.22  ? 48  THR B CB    1 
ATOM   2664 O OG1   . THR B 1 22  ? 43.320  73.262  29.691 1.00 45.07  ? 48  THR B OG1   1 
ATOM   2665 C CG2   . THR B 1 22  ? 44.078  74.071  31.813 1.00 45.09  ? 48  THR B CG2   1 
ATOM   2666 N N     . ILE B 1 23  ? 47.170  71.753  31.317 1.00 46.02  ? 49  ILE B N     1 
ATOM   2667 C CA    . ILE B 1 23  ? 48.206  71.402  32.293 1.00 46.76  ? 49  ILE B CA    1 
ATOM   2668 C C     . ILE B 1 23  ? 49.540  72.011  31.870 1.00 49.32  ? 49  ILE B C     1 
ATOM   2669 O O     . ILE B 1 23  ? 50.221  72.654  32.669 1.00 50.96  ? 49  ILE B O     1 
ATOM   2670 C CB    . ILE B 1 23  ? 48.335  69.858  32.489 1.00 45.48  ? 49  ILE B CB    1 
ATOM   2671 C CG1   . ILE B 1 23  ? 47.107  69.290  33.216 1.00 42.66  ? 49  ILE B CG1   1 
ATOM   2672 C CG2   . ILE B 1 23  ? 49.629  69.493  33.247 1.00 45.83  ? 49  ILE B CG2   1 
ATOM   2673 C CD1   . ILE B 1 23  ? 46.905  69.835  34.621 1.00 41.52  ? 49  ILE B CD1   1 
ATOM   2674 N N     . VAL B 1 24  ? 49.885  71.837  30.597 1.00 50.70  ? 50  VAL B N     1 
ATOM   2675 C CA    . VAL B 1 24  ? 51.103  72.414  30.036 1.00 53.14  ? 50  VAL B CA    1 
ATOM   2676 C C     . VAL B 1 24  ? 51.165  73.923  30.291 1.00 55.46  ? 50  VAL B C     1 
ATOM   2677 O O     . VAL B 1 24  ? 52.179  74.437  30.781 1.00 56.53  ? 50  VAL B O     1 
ATOM   2678 C CB    . VAL B 1 24  ? 51.216  72.107  28.525 1.00 53.71  ? 50  VAL B CB    1 
ATOM   2679 C CG1   . VAL B 1 24  ? 52.321  72.939  27.872 1.00 55.90  ? 50  VAL B CG1   1 
ATOM   2680 C CG2   . VAL B 1 24  ? 51.456  70.613  28.307 1.00 51.94  ? 50  VAL B CG2   1 
ATOM   2681 N N     . LYS B 1 25  ? 50.071  74.622  29.982 1.00 56.22  ? 51  LYS B N     1 
ATOM   2682 C CA    . LYS B 1 25  ? 50.020  76.081  30.132 1.00 58.69  ? 51  LYS B CA    1 
ATOM   2683 C C     . LYS B 1 25  ? 50.144  76.495  31.596 1.00 59.16  ? 51  LYS B C     1 
ATOM   2684 O O     . LYS B 1 25  ? 50.751  77.526  31.907 1.00 60.60  ? 51  LYS B O     1 
ATOM   2685 C CB    . LYS B 1 25  ? 48.732  76.661  29.543 1.00 58.68  ? 51  LYS B CB    1 
ATOM   2686 C CG    . LYS B 1 25  ? 48.582  76.485  28.037 1.00 59.65  ? 51  LYS B CG    1 
ATOM   2687 C CD    . LYS B 1 25  ? 47.717  77.584  27.458 1.00 61.17  ? 51  LYS B CD    1 
ATOM   2688 C CE    . LYS B 1 25  ? 46.849  77.081  26.319 1.00 62.05  ? 51  LYS B CE    1 
ATOM   2689 N NZ    . LYS B 1 25  ? 45.441  76.910  26.768 1.00 60.51  ? 51  LYS B NZ    1 
ATOM   2690 N N     . GLN B 1 26  ? 49.573  75.686  32.488 1.00 57.81  ? 52  GLN B N     1 
ATOM   2691 C CA    . GLN B 1 26  ? 49.684  75.945  33.911 1.00 58.56  ? 52  GLN B CA    1 
ATOM   2692 C C     . GLN B 1 26  ? 51.129  75.823  34.398 1.00 60.48  ? 52  GLN B C     1 
ATOM   2693 O O     . GLN B 1 26  ? 51.550  76.596  35.259 1.00 62.12  ? 52  GLN B O     1 
ATOM   2694 C CB    . GLN B 1 26  ? 48.753  75.038  34.707 1.00 56.68  ? 52  GLN B CB    1 
ATOM   2695 C CG    . GLN B 1 26  ? 47.276  75.395  34.560 1.00 55.53  ? 52  GLN B CG    1 
ATOM   2696 C CD    . GLN B 1 26  ? 46.854  76.569  35.430 1.00 56.13  ? 52  GLN B CD    1 
ATOM   2697 O OE1   . GLN B 1 26  ? 47.661  77.440  35.763 1.00 57.34  ? 52  GLN B OE1   1 
ATOM   2698 N NE2   . GLN B 1 26  ? 45.583  76.589  35.812 1.00 54.28  ? 52  GLN B NE2   1 
ATOM   2699 N N     . MET B 1 27  ? 51.890  74.877  33.841 1.00 60.75  ? 53  MET B N     1 
ATOM   2700 C CA    . MET B 1 27  ? 53.334  74.783  34.125 1.00 62.79  ? 53  MET B CA    1 
ATOM   2701 C C     . MET B 1 27  ? 54.077  76.080  33.799 1.00 65.30  ? 53  MET B C     1 
ATOM   2702 O O     . MET B 1 27  ? 54.980  76.492  34.531 1.00 66.80  ? 53  MET B O     1 
ATOM   2703 C CB    . MET B 1 27  ? 53.983  73.610  33.377 1.00 62.49  ? 53  MET B CB    1 
ATOM   2704 C CG    . MET B 1 27  ? 53.472  72.224  33.768 1.00 61.02  ? 53  MET B CG    1 
ATOM   2705 S SD    . MET B 1 27  ? 53.574  71.873  35.532 1.00 62.96  ? 53  MET B SD    1 
ATOM   2706 C CE    . MET B 1 27  ? 51.889  72.147  36.076 1.00 59.31  ? 53  MET B CE    1 
ATOM   2707 N N     . LYS B 1 28  ? 53.689  76.713  32.696 1.00 66.31  ? 54  LYS B N     1 
ATOM   2708 C CA    . LYS B 1 28  ? 54.251  78.000  32.287 1.00 69.08  ? 54  LYS B CA    1 
ATOM   2709 C C     . LYS B 1 28  ? 53.866  79.108  33.279 1.00 69.95  ? 54  LYS B C     1 
ATOM   2710 O O     . LYS B 1 28  ? 54.655  80.004  33.558 1.00 72.13  ? 54  LYS B O     1 
ATOM   2711 C CB    . LYS B 1 28  ? 53.803  78.340  30.855 1.00 69.64  ? 54  LYS B CB    1 
ATOM   2712 C CG    . LYS B 1 28  ? 54.454  79.590  30.257 1.00 73.99  ? 54  LYS B CG    1 
ATOM   2713 C CD    . LYS B 1 28  ? 54.204  79.742  28.750 1.00 76.14  ? 54  LYS B CD    1 
ATOM   2714 C CE    . LYS B 1 28  ? 54.897  81.000  28.221 1.00 80.90  ? 54  LYS B CE    1 
ATOM   2715 N NZ    . LYS B 1 28  ? 54.698  81.215  26.757 1.00 83.11  ? 54  LYS B NZ    1 
ATOM   2716 N N     . ILE B 1 29  ? 52.655  79.030  33.820 1.00 68.62  ? 55  ILE B N     1 
ATOM   2717 C CA    . ILE B 1 29  ? 52.163  80.037  34.763 1.00 69.63  ? 55  ILE B CA    1 
ATOM   2718 C C     . ILE B 1 29  ? 52.765  79.857  36.157 1.00 70.21  ? 55  ILE B C     1 
ATOM   2719 O O     . ILE B 1 29  ? 53.200  80.822  36.781 1.00 72.19  ? 55  ILE B O     1 
ATOM   2720 C CB    . ILE B 1 29  ? 50.610  80.048  34.844 1.00 67.81  ? 55  ILE B CB    1 
ATOM   2721 C CG1   . ILE B 1 29  ? 50.007  80.468  33.503 1.00 68.02  ? 55  ILE B CG1   1 
ATOM   2722 C CG2   . ILE B 1 29  ? 50.120  80.977  35.962 1.00 68.38  ? 55  ILE B CG2   1 
ATOM   2723 C CD1   . ILE B 1 29  ? 48.531  80.092  33.329 1.00 66.00  ? 55  ILE B CD1   1 
ATOM   2724 N N     . ILE B 1 30  ? 52.780  78.622  36.645 1.00 68.90  ? 56  ILE B N     1 
ATOM   2725 C CA    . ILE B 1 30  ? 53.264  78.356  37.994 1.00 69.63  ? 56  ILE B CA    1 
ATOM   2726 C C     . ILE B 1 30  ? 54.790  78.430  38.085 1.00 72.01  ? 56  ILE B C     1 
ATOM   2727 O O     . ILE B 1 30  ? 55.327  79.107  38.964 1.00 73.85  ? 56  ILE B O     1 
ATOM   2728 C CB    . ILE B 1 30  ? 52.750  77.004  38.538 1.00 67.27  ? 56  ILE B CB    1 
ATOM   2729 C CG1   . ILE B 1 30  ? 51.217  76.997  38.567 1.00 65.63  ? 56  ILE B CG1   1 
ATOM   2730 C CG2   . ILE B 1 30  ? 53.301  76.741  39.940 1.00 67.95  ? 56  ILE B CG2   1 
ATOM   2731 C CD1   . ILE B 1 30  ? 50.591  75.614  38.566 1.00 61.94  ? 56  ILE B CD1   1 
ATOM   2732 N N     . HIS B 1 31  ? 55.477  77.754  37.168 1.00 78.89  ? 57  HIS B N     1 
ATOM   2733 C CA    . HIS B 1 31  ? 56.911  77.524  37.308 1.00 79.76  ? 57  HIS B CA    1 
ATOM   2734 C C     . HIS B 1 31  ? 57.798  78.330  36.361 1.00 80.66  ? 57  HIS B C     1 
ATOM   2735 O O     . HIS B 1 31  ? 59.019  78.355  36.519 1.00 81.36  ? 57  HIS B O     1 
ATOM   2736 C CB    . HIS B 1 31  ? 57.215  76.028  37.212 1.00 79.28  ? 57  HIS B CB    1 
ATOM   2737 C CG    . HIS B 1 31  ? 56.634  75.229  38.336 1.00 79.04  ? 57  HIS B CG    1 
ATOM   2738 N ND1   . HIS B 1 31  ? 55.626  74.309  38.153 1.00 78.94  ? 57  HIS B ND1   1 
ATOM   2739 C CD2   . HIS B 1 31  ? 56.899  75.237  39.663 1.00 79.80  ? 57  HIS B CD2   1 
ATOM   2740 C CE1   . HIS B 1 31  ? 55.304  73.772  39.318 1.00 79.09  ? 57  HIS B CE1   1 
ATOM   2741 N NE2   . HIS B 1 31  ? 56.062  74.319  40.251 1.00 79.77  ? 57  HIS B NE2   1 
ATOM   2742 N N     . GLU B 1 32  ? 57.187  78.995  35.388 1.00 81.11  ? 58  GLU B N     1 
ATOM   2743 C CA    . GLU B 1 32  ? 57.928  79.849  34.466 1.00 82.08  ? 58  GLU B CA    1 
ATOM   2744 C C     . GLU B 1 32  ? 57.474  81.295  34.594 1.00 83.14  ? 58  GLU B C     1 
ATOM   2745 O O     . GLU B 1 32  ? 57.004  81.716  35.656 1.00 83.26  ? 58  GLU B O     1 
ATOM   2746 C CB    . GLU B 1 32  ? 57.777  79.363  33.022 1.00 81.59  ? 58  GLU B CB    1 
ATOM   2747 C CG    . GLU B 1 32  ? 58.307  77.962  32.771 1.00 81.09  ? 58  GLU B CG    1 
ATOM   2748 C CD    . GLU B 1 32  ? 57.752  77.355  31.498 1.00 80.92  ? 58  GLU B CD    1 
ATOM   2749 O OE1   . GLU B 1 32  ? 57.572  78.098  30.510 1.00 81.45  ? 58  GLU B OE1   1 
ATOM   2750 O OE2   . GLU B 1 32  ? 57.487  76.135  31.486 1.00 80.10  ? 58  GLU B OE2   1 
ATOM   2751 N N     . ALA B 1 33  ? 57.600  82.038  33.498 1.00 84.32  ? 59  ALA B N     1 
ATOM   2752 C CA    . ALA B 1 33  ? 57.395  83.485  33.497 1.00 86.00  ? 59  ALA B CA    1 
ATOM   2753 C C     . ALA B 1 33  ? 55.932  83.914  33.311 1.00 86.06  ? 59  ALA B C     1 
ATOM   2754 O O     . ALA B 1 33  ? 55.645  85.100  33.123 1.00 86.98  ? 59  ALA B O     1 
ATOM   2755 C CB    . ALA B 1 33  ? 58.296  84.135  32.435 1.00 86.91  ? 59  ALA B CB    1 
ATOM   2756 N N     . GLY B 1 34  ? 55.012  82.956  33.384 1.00 85.61  ? 60  GLY B N     1 
ATOM   2757 C CA    . GLY B 1 34  ? 53.600  83.222  33.119 1.00 85.66  ? 60  GLY B CA    1 
ATOM   2758 C C     . GLY B 1 34  ? 53.402  83.810  31.731 1.00 86.27  ? 60  GLY B C     1 
ATOM   2759 O O     . GLY B 1 34  ? 54.030  83.374  30.756 1.00 86.11  ? 60  GLY B O     1 
ATOM   2760 N N     . TYR B 1 35  ? 52.531  84.810  31.649 1.00 87.01  ? 61  TYR B N     1 
ATOM   2761 C CA    . TYR B 1 35  ? 52.274  85.508  30.392 1.00 87.72  ? 61  TYR B CA    1 
ATOM   2762 C C     . TYR B 1 35  ? 52.398  87.019  30.574 1.00 89.28  ? 61  TYR B C     1 
ATOM   2763 O O     . TYR B 1 35  ? 51.801  87.598  31.487 1.00 89.68  ? 61  TYR B O     1 
ATOM   2764 C CB    . TYR B 1 35  ? 50.897  85.135  29.824 1.00 86.71  ? 61  TYR B CB    1 
ATOM   2765 C CG    . TYR B 1 35  ? 50.786  83.700  29.347 1.00 85.29  ? 61  TYR B CG    1 
ATOM   2766 C CD1   . TYR B 1 35  ? 51.261  83.322  28.087 1.00 84.79  ? 61  TYR B CD1   1 
ATOM   2767 C CD2   . TYR B 1 35  ? 50.197  82.723  30.148 1.00 84.17  ? 61  TYR B CD2   1 
ATOM   2768 C CE1   . TYR B 1 35  ? 51.160  82.001  27.642 1.00 83.54  ? 61  TYR B CE1   1 
ATOM   2769 C CE2   . TYR B 1 35  ? 50.091  81.398  29.714 1.00 82.97  ? 61  TYR B CE2   1 
ATOM   2770 C CZ    . TYR B 1 35  ? 50.575  81.043  28.461 1.00 83.12  ? 61  TYR B CZ    1 
ATOM   2771 O OH    . TYR B 1 35  ? 50.469  79.733  28.032 1.00 82.31  ? 61  TYR B OH    1 
ATOM   2772 N N     . SER B 1 36  ? 53.187  87.642  29.702 1.00 90.52  ? 62  SER B N     1 
ATOM   2773 C CA    . SER B 1 36  ? 53.368  89.096  29.696 1.00 92.33  ? 62  SER B CA    1 
ATOM   2774 C C     . SER B 1 36  ? 52.125  89.800  29.144 1.00 92.67  ? 62  SER B C     1 
ATOM   2775 O O     . SER B 1 36  ? 51.164  89.142  28.741 1.00 91.57  ? 62  SER B O     1 
ATOM   2776 C CB    . SER B 1 36  ? 54.606  89.469  28.873 1.00 93.39  ? 62  SER B CB    1 
ATOM   2777 O OG    . SER B 1 36  ? 54.494  88.994  27.540 1.00 92.80  ? 62  SER B OG    1 
ATOM   2778 N N     . GLU B 1 37  ? 52.149  91.133  29.129 1.00 94.40  ? 63  GLU B N     1 
ATOM   2779 C CA    . GLU B 1 37  ? 51.059  91.929  28.559 1.00 94.98  ? 63  GLU B CA    1 
ATOM   2780 C C     . GLU B 1 37  ? 50.918  91.674  27.049 1.00 94.66  ? 63  GLU B C     1 
ATOM   2781 O O     . GLU B 1 37  ? 49.807  91.468  26.550 1.00 93.91  ? 63  GLU B O     1 
ATOM   2782 C CB    . GLU B 1 37  ? 51.270  93.425  28.854 1.00 97.01  ? 63  GLU B CB    1 
ATOM   2783 C CG    . GLU B 1 37  ? 49.991  94.277  28.794 1.00 98.16  ? 63  GLU B CG    1 
ATOM   2784 C CD    . GLU B 1 37  ? 50.201  95.750  29.180 1.00 101.31 ? 63  GLU B CD    1 
ATOM   2785 O OE1   . GLU B 1 37  ? 51.322  96.286  29.002 1.00 103.02 ? 63  GLU B OE1   1 
ATOM   2786 O OE2   . GLU B 1 37  ? 49.229  96.379  29.657 1.00 101.51 ? 63  GLU B OE2   1 
ATOM   2787 N N     . GLU B 1 38  ? 52.049  91.663  26.342 1.00 95.28  ? 64  GLU B N     1 
ATOM   2788 C CA    . GLU B 1 38  ? 52.071  91.514  24.877 1.00 95.40  ? 64  GLU B CA    1 
ATOM   2789 C C     . GLU B 1 38  ? 51.805  90.096  24.379 1.00 93.58  ? 64  GLU B C     1 
ATOM   2790 O O     . GLU B 1 38  ? 51.222  89.919  23.308 1.00 93.54  ? 64  GLU B O     1 
ATOM   2791 C CB    . GLU B 1 38  ? 53.376  92.057  24.265 1.00 97.06  ? 64  GLU B CB    1 
ATOM   2792 C CG    . GLU B 1 38  ? 54.662  91.633  24.971 1.00 97.77  ? 64  GLU B CG    1 
ATOM   2793 C CD    . GLU B 1 38  ? 55.113  92.633  26.029 1.00 100.00 ? 64  GLU B CD    1 
ATOM   2794 O OE1   . GLU B 1 38  ? 54.375  92.839  27.020 1.00 99.55  ? 64  GLU B OE1   1 
ATOM   2795 O OE2   . GLU B 1 38  ? 56.212  93.212  25.868 1.00 101.78 ? 64  GLU B OE2   1 
ATOM   2796 N N     . GLU B 1 39  ? 52.244  89.094  25.139 1.00 92.27  ? 65  GLU B N     1 
ATOM   2797 C CA    . GLU B 1 39  ? 51.953  87.697  24.807 1.00 90.57  ? 65  GLU B CA    1 
ATOM   2798 C C     . GLU B 1 39  ? 50.448  87.457  24.778 1.00 89.00  ? 65  GLU B C     1 
ATOM   2799 O O     . GLU B 1 39  ? 49.941  86.801  23.873 1.00 88.42  ? 65  GLU B O     1 
ATOM   2800 C CB    . GLU B 1 39  ? 52.616  86.743  25.801 1.00 90.04  ? 65  GLU B CB    1 
ATOM   2801 C CG    . GLU B 1 39  ? 54.087  86.468  25.534 1.00 91.30  ? 65  GLU B CG    1 
ATOM   2802 C CD    . GLU B 1 39  ? 54.736  85.649  26.641 1.00 91.45  ? 65  GLU B CD    1 
ATOM   2803 O OE1   . GLU B 1 39  ? 54.393  85.863  27.826 1.00 91.63  ? 65  GLU B OE1   1 
ATOM   2804 O OE2   . GLU B 1 39  ? 55.593  84.793  26.327 1.00 91.27  ? 65  GLU B OE2   1 
ATOM   2805 N N     . CYS B 1 40  ? 49.749  88.003  25.772 1.00 88.29  ? 66  CYS B N     1 
ATOM   2806 C CA    . CYS B 1 40  ? 48.293  87.959  25.838 1.00 87.08  ? 66  CYS B CA    1 
ATOM   2807 C C     . CYS B 1 40  ? 47.630  88.538  24.582 1.00 87.30  ? 66  CYS B C     1 
ATOM   2808 O O     . CYS B 1 40  ? 46.602  88.028  24.133 1.00 86.32  ? 66  CYS B O     1 
ATOM   2809 C CB    . CYS B 1 40  ? 47.796  88.710  27.075 1.00 87.45  ? 66  CYS B CB    1 
ATOM   2810 S SG    . CYS B 1 40  ? 48.259  87.989  28.675 1.00 87.24  ? 66  CYS B SG    1 
ATOM   2811 N N     . LYS B 1 41  ? 48.227  89.592  24.018 1.00 88.39  ? 67  LYS B N     1 
ATOM   2812 C CA    . LYS B 1 41  ? 47.686  90.262  22.827 1.00 88.74  ? 67  LYS B CA    1 
ATOM   2813 C C     . LYS B 1 41  ? 47.651  89.354  21.599 1.00 87.81  ? 67  LYS B C     1 
ATOM   2814 O O     . LYS B 1 41  ? 46.825  89.552  20.704 1.00 87.94  ? 67  LYS B O     1 
ATOM   2815 C CB    . LYS B 1 41  ? 48.469  91.543  22.501 1.00 90.87  ? 67  LYS B CB    1 
ATOM   2816 C CG    . LYS B 1 41  ? 48.194  92.735  23.418 1.00 92.35  ? 67  LYS B CG    1 
ATOM   2817 C CD    . LYS B 1 41  ? 49.094  93.919  23.045 1.00 95.83  ? 67  LYS B CD    1 
ATOM   2818 C CE    . LYS B 1 41  ? 49.099  95.009  24.115 1.00 97.63  ? 67  LYS B CE    1 
ATOM   2819 N NZ    . LYS B 1 41  ? 49.782  94.574  25.368 1.00 97.46  ? 67  LYS B NZ    1 
ATOM   2820 N N     . GLN B 1 42  ? 48.550  88.373  21.554 1.00 86.85  ? 68  GLN B N     1 
ATOM   2821 C CA    . GLN B 1 42  ? 48.567  87.379  20.474 1.00 86.12  ? 68  GLN B CA    1 
ATOM   2822 C C     . GLN B 1 42  ? 47.327  86.482  20.511 1.00 84.02  ? 68  GLN B C     1 
ATOM   2823 O O     . GLN B 1 42  ? 46.829  86.055  19.467 1.00 83.94  ? 68  GLN B O     1 
ATOM   2824 C CB    . GLN B 1 42  ? 49.835  86.515  20.540 1.00 86.35  ? 68  GLN B CB    1 
ATOM   2825 C CG    . GLN B 1 42  ? 51.136  87.248  20.187 1.00 89.07  ? 68  GLN B CG    1 
ATOM   2826 C CD    . GLN B 1 42  ? 52.377  86.362  20.290 1.00 90.75  ? 68  GLN B CD    1 
ATOM   2827 O OE1   . GLN B 1 42  ? 52.399  85.371  21.033 1.00 90.59  ? 68  GLN B OE1   1 
ATOM   2828 N NE2   . GLN B 1 42  ? 53.421  86.724  19.547 1.00 92.20  ? 68  GLN B NE2   1 
ATOM   2829 N N     . TYR B 1 43  ? 46.834  86.211  21.721 1.00 82.17  ? 69  TYR B N     1 
ATOM   2830 C CA    . TYR B 1 43  ? 45.699  85.303  21.927 1.00 80.05  ? 69  TYR B CA    1 
ATOM   2831 C C     . TYR B 1 43  ? 44.340  85.960  21.679 1.00 79.26  ? 69  TYR B C     1 
ATOM   2832 O O     . TYR B 1 43  ? 43.325  85.266  21.558 1.00 78.32  ? 69  TYR B O     1 
ATOM   2833 C CB    . TYR B 1 43  ? 45.744  84.684  23.330 1.00 79.16  ? 69  TYR B CB    1 
ATOM   2834 C CG    . TYR B 1 43  ? 46.923  83.768  23.550 1.00 79.20  ? 69  TYR B CG    1 
ATOM   2835 C CD1   . TYR B 1 43  ? 46.883  82.434  23.138 1.00 79.05  ? 69  TYR B CD1   1 
ATOM   2836 C CD2   . TYR B 1 43  ? 48.082  84.232  24.166 1.00 79.84  ? 69  TYR B CD2   1 
ATOM   2837 C CE1   . TYR B 1 43  ? 47.973  81.585  23.337 1.00 79.01  ? 69  TYR B CE1   1 
ATOM   2838 C CE2   . TYR B 1 43  ? 49.175  83.394  24.369 1.00 79.81  ? 69  TYR B CE2   1 
ATOM   2839 C CZ    . TYR B 1 43  ? 49.113  82.075  23.953 1.00 79.55  ? 69  TYR B CZ    1 
ATOM   2840 O OH    . TYR B 1 43  ? 50.193  81.248  24.152 1.00 80.20  ? 69  TYR B OH    1 
ATOM   2841 N N     . LYS B 1 44  ? 44.330  87.292  21.605 1.00 79.17  ? 70  LYS B N     1 
ATOM   2842 C CA    . LYS B 1 44  ? 43.121  88.058  21.310 1.00 78.36  ? 70  LYS B CA    1 
ATOM   2843 C C     . LYS B 1 44  ? 42.363  87.442  20.135 1.00 77.30  ? 70  LYS B C     1 
ATOM   2844 O O     . LYS B 1 44  ? 41.162  87.191  20.231 1.00 76.56  ? 70  LYS B O     1 
ATOM   2845 C CB    . LYS B 1 44  ? 43.481  89.522  21.024 1.00 79.89  ? 70  LYS B CB    1 
ATOM   2846 C CG    . LYS B 1 44  ? 42.305  90.488  21.025 1.00 80.36  ? 70  LYS B CG    1 
ATOM   2847 C CD    . LYS B 1 44  ? 42.767  91.932  21.231 1.00 82.50  ? 70  LYS B CD    1 
ATOM   2848 C CE    . LYS B 1 44  ? 41.612  92.914  21.095 1.00 83.09  ? 70  LYS B CE    1 
ATOM   2849 N NZ    . LYS B 1 44  ? 41.968  94.279  21.573 1.00 84.82  ? 70  LYS B NZ    1 
ATOM   2850 N N     . ALA B 1 45  ? 43.083  87.171  19.048 1.00 77.01  ? 71  ALA B N     1 
ATOM   2851 C CA    . ALA B 1 45  ? 42.505  86.586  17.836 1.00 76.11  ? 71  ALA B CA    1 
ATOM   2852 C C     . ALA B 1 45  ? 41.838  85.221  18.059 1.00 74.21  ? 71  ALA B C     1 
ATOM   2853 O O     . ALA B 1 45  ? 40.770  84.946  17.500 1.00 74.04  ? 71  ALA B O     1 
ATOM   2854 C CB    . ALA B 1 45  ? 43.566  86.491  16.741 1.00 77.27  ? 71  ALA B CB    1 
ATOM   2855 N N     . VAL B 1 46  ? 42.463  84.368  18.869 1.00 72.55  ? 72  VAL B N     1 
ATOM   2856 C CA    . VAL B 1 46  ? 41.909  83.033  19.121 1.00 70.53  ? 72  VAL B CA    1 
ATOM   2857 C C     . VAL B 1 46  ? 40.748  83.064  20.134 1.00 68.70  ? 72  VAL B C     1 
ATOM   2858 O O     . VAL B 1 46  ? 39.819  82.264  20.038 1.00 67.62  ? 72  VAL B O     1 
ATOM   2859 C CB    . VAL B 1 46  ? 43.018  81.963  19.436 1.00 70.42  ? 72  VAL B CB    1 
ATOM   2860 C CG1   . VAL B 1 46  ? 43.619  82.148  20.816 1.00 69.78  ? 72  VAL B CG1   1 
ATOM   2861 C CG2   . VAL B 1 46  ? 42.471  80.560  19.274 1.00 70.45  ? 72  VAL B CG2   1 
ATOM   2862 N N     . VAL B 1 47  ? 40.787  84.016  21.067 1.00 68.00  ? 73  VAL B N     1 
ATOM   2863 C CA    . VAL B 1 47  ? 39.664  84.257  21.980 1.00 66.96  ? 73  VAL B CA    1 
ATOM   2864 C C     . VAL B 1 47  ? 38.390  84.516  21.173 1.00 66.94  ? 73  VAL B C     1 
ATOM   2865 O O     . VAL B 1 47  ? 37.329  83.959  21.473 1.00 65.94  ? 73  VAL B O     1 
ATOM   2866 C CB    . VAL B 1 47  ? 39.944  85.436  22.959 1.00 67.48  ? 73  VAL B CB    1 
ATOM   2867 C CG1   . VAL B 1 47  ? 38.669  85.910  23.646 1.00 66.64  ? 73  VAL B CG1   1 
ATOM   2868 C CG2   . VAL B 1 47  ? 40.982  85.042  24.001 1.00 66.78  ? 73  VAL B CG2   1 
ATOM   2869 N N     . TYR B 1 48  ? 38.518  85.336  20.129 1.00 67.69  ? 74  TYR B N     1 
ATOM   2870 C CA    . TYR B 1 48  ? 37.393  85.666  19.260 1.00 67.69  ? 74  TYR B CA    1 
ATOM   2871 C C     . TYR B 1 48  ? 36.975  84.478  18.415 1.00 67.58  ? 74  TYR B C     1 
ATOM   2872 O O     . TYR B 1 48  ? 35.780  84.194  18.280 1.00 67.35  ? 74  TYR B O     1 
ATOM   2873 C CB    . TYR B 1 48  ? 37.704  86.889  18.387 1.00 68.75  ? 74  TYR B CB    1 
ATOM   2874 C CG    . TYR B 1 48  ? 37.809  88.185  19.170 1.00 68.06  ? 74  TYR B CG    1 
ATOM   2875 C CD1   . TYR B 1 48  ? 37.113  88.356  20.367 1.00 66.13  ? 74  TYR B CD1   1 
ATOM   2876 C CD2   . TYR B 1 48  ? 38.587  89.246  18.704 1.00 68.34  ? 74  TYR B CD2   1 
ATOM   2877 C CE1   . TYR B 1 48  ? 37.195  89.535  21.088 1.00 66.61  ? 74  TYR B CE1   1 
ATOM   2878 C CE2   . TYR B 1 48  ? 38.677  90.440  19.424 1.00 68.30  ? 74  TYR B CE2   1 
ATOM   2879 C CZ    . TYR B 1 48  ? 37.974  90.575  20.612 1.00 67.66  ? 74  TYR B CZ    1 
ATOM   2880 O OH    . TYR B 1 48  ? 38.053  91.735  21.341 1.00 67.50  ? 74  TYR B OH    1 
ATOM   2881 N N     . SER B 1 49  ? 37.958  83.771  17.871 1.00 68.10  ? 75  SER B N     1 
ATOM   2882 C CA    . SER B 1 49  ? 37.681  82.553  17.119 1.00 68.47  ? 75  SER B CA    1 
ATOM   2883 C C     . SER B 1 49  ? 36.998  81.456  17.952 1.00 67.84  ? 75  SER B C     1 
ATOM   2884 O O     . SER B 1 49  ? 36.063  80.814  17.474 1.00 67.54  ? 75  SER B O     1 
ATOM   2885 C CB    . SER B 1 49  ? 38.951  82.015  16.475 1.00 69.10  ? 75  SER B CB    1 
ATOM   2886 O OG    . SER B 1 49  ? 38.623  80.946  15.608 1.00 70.11  ? 75  SER B OG    1 
ATOM   2887 N N     . ASN B 1 50  ? 37.452  81.248  19.191 1.00 50.50  ? 76  ASN B N     1 
ATOM   2888 C CA    . ASN B 1 50  ? 36.840  80.229  20.064 1.00 50.05  ? 76  ASN B CA    1 
ATOM   2889 C C     . ASN B 1 50  ? 35.414  80.611  20.429 1.00 49.32  ? 76  ASN B C     1 
ATOM   2890 O O     . ASN B 1 50  ? 34.532  79.749  20.495 1.00 48.92  ? 76  ASN B O     1 
ATOM   2891 C CB    . ASN B 1 50  ? 37.652  80.013  21.341 1.00 50.17  ? 76  ASN B CB    1 
ATOM   2892 C CG    . ASN B 1 50  ? 39.031  79.450  21.078 1.00 52.08  ? 76  ASN B CG    1 
ATOM   2893 O OD1   . ASN B 1 50  ? 39.918  79.559  21.927 1.00 54.19  ? 76  ASN B OD1   1 
ATOM   2894 N ND2   . ASN B 1 50  ? 39.227  78.846  19.906 1.00 52.62  ? 76  ASN B ND2   1 
ATOM   2895 N N     . THR B 1 51  ? 35.195  81.913  20.639 1.00 49.47  ? 77  THR B N     1 
ATOM   2896 C CA    . THR B 1 51  ? 33.881  82.451  20.975 1.00 49.17  ? 77  THR B CA    1 
ATOM   2897 C C     . THR B 1 51  ? 32.888  82.264  19.826 1.00 50.01  ? 77  THR B C     1 
ATOM   2898 O O     . THR B 1 51  ? 31.714  81.949  20.049 1.00 50.21  ? 77  THR B O     1 
ATOM   2899 C CB    . THR B 1 51  ? 33.983  83.946  21.321 1.00 50.02  ? 77  THR B CB    1 
ATOM   2900 O OG1   . THR B 1 51  ? 34.985  84.132  22.324 1.00 50.62  ? 77  THR B OG1   1 
ATOM   2901 C CG2   . THR B 1 51  ? 32.647  84.491  21.840 1.00 50.31  ? 77  THR B CG2   1 
ATOM   2902 N N     . ILE B 1 52  ? 33.362  82.462  18.600 1.00 51.29  ? 78  ILE B N     1 
ATOM   2903 C CA    . ILE B 1 52  ? 32.519  82.309  17.414 1.00 52.96  ? 78  ILE B CA    1 
ATOM   2904 C C     . ILE B 1 52  ? 32.267  80.826  17.125 1.00 53.26  ? 78  ILE B C     1 
ATOM   2905 O O     . ILE B 1 52  ? 31.129  80.417  16.832 1.00 53.89  ? 78  ILE B O     1 
ATOM   2906 C CB    . ILE B 1 52  ? 33.112  83.070  16.202 1.00 55.30  ? 78  ILE B CB    1 
ATOM   2907 C CG1   . ILE B 1 52  ? 33.125  84.572  16.506 1.00 55.56  ? 78  ILE B CG1   1 
ATOM   2908 C CG2   . ILE B 1 52  ? 32.318  82.779  14.929 1.00 58.04  ? 78  ILE B CG2   1 
ATOM   2909 C CD1   . ILE B 1 52  ? 34.021  85.405  15.607 1.00 57.50  ? 78  ILE B CD1   1 
ATOM   2910 N N     . GLN B 1 53  ? 33.318  80.017  17.249 1.00 53.41  ? 79  GLN B N     1 
ATOM   2911 C CA    . GLN B 1 53  ? 33.188  78.567  17.092 1.00 54.17  ? 79  GLN B CA    1 
ATOM   2912 C C     . GLN B 1 53  ? 32.170  78.030  18.086 1.00 52.62  ? 79  GLN B C     1 
ATOM   2913 O O     . GLN B 1 53  ? 31.374  77.150  17.746 1.00 53.83  ? 79  GLN B O     1 
ATOM   2914 C CB    . GLN B 1 53  ? 34.538  77.862  17.281 1.00 55.11  ? 79  GLN B CB    1 
ATOM   2915 C CG    . GLN B 1 53  ? 35.546  78.101  16.151 1.00 58.54  ? 79  GLN B CG    1 
ATOM   2916 C CD    . GLN B 1 53  ? 37.003  77.961  16.600 1.00 60.15  ? 79  GLN B CD    1 
ATOM   2917 O OE1   . GLN B 1 53  ? 37.296  77.853  17.796 1.00 57.10  ? 79  GLN B OE1   1 
ATOM   2918 N NE2   . GLN B 1 53  ? 37.924  77.978  15.635 1.00 62.49  ? 79  GLN B NE2   1 
ATOM   2919 N N     . SER B 1 54  ? 32.175  78.577  19.305 1.00 50.55  ? 80  SER B N     1 
ATOM   2920 C CA    . SER B 1 54  ? 31.336  78.036  20.370 1.00 49.32  ? 80  SER B CA    1 
ATOM   2921 C C     . SER B 1 54  ? 29.868  78.272  20.083 1.00 49.39  ? 80  SER B C     1 
ATOM   2922 O O     . SER B 1 54  ? 29.059  77.355  20.215 1.00 49.51  ? 80  SER B O     1 
ATOM   2923 C CB    . SER B 1 54  ? 31.713  78.617  21.737 1.00 48.83  ? 80  SER B CB    1 
ATOM   2924 O OG    . SER B 1 54  ? 33.040  78.274  22.085 1.00 47.61  ? 80  SER B OG    1 
ATOM   2925 N N     . ILE B 1 55  ? 29.521  79.497  19.690 1.00 49.85  ? 81  ILE B N     1 
ATOM   2926 C CA    . ILE B 1 55  ? 28.117  79.811  19.393 1.00 50.49  ? 81  ILE B CA    1 
ATOM   2927 C C     . ILE B 1 55  ? 27.648  79.083  18.127 1.00 52.41  ? 81  ILE B C     1 
ATOM   2928 O O     . ILE B 1 55  ? 26.519  78.584  18.081 1.00 53.07  ? 81  ILE B O     1 
ATOM   2929 C CB    . ILE B 1 55  ? 27.812  81.345  19.362 1.00 51.17  ? 81  ILE B CB    1 
ATOM   2930 C CG1   . ILE B 1 55  ? 26.304  81.612  19.299 1.00 52.39  ? 81  ILE B CG1   1 
ATOM   2931 C CG2   . ILE B 1 55  ? 28.498  82.037  18.187 1.00 52.55  ? 81  ILE B CG2   1 
ATOM   2932 C CD1   . ILE B 1 55  ? 25.504  81.081  20.469 1.00 51.34  ? 81  ILE B CD1   1 
ATOM   2933 N N     . ILE B 1 56  ? 28.522  78.994  17.124 1.00 53.75  ? 82  ILE B N     1 
ATOM   2934 C CA    . ILE B 1 56  ? 28.215  78.207  15.931 1.00 56.95  ? 82  ILE B CA    1 
ATOM   2935 C C     . ILE B 1 56  ? 27.871  76.760  16.318 1.00 56.81  ? 82  ILE B C     1 
ATOM   2936 O O     . ILE B 1 56  ? 26.822  76.232  15.914 1.00 58.56  ? 82  ILE B O     1 
ATOM   2937 C CB    . ILE B 1 56  ? 29.354  78.262  14.875 1.00 59.05  ? 82  ILE B CB    1 
ATOM   2938 C CG1   . ILE B 1 56  ? 29.286  79.589  14.104 1.00 61.11  ? 82  ILE B CG1   1 
ATOM   2939 C CG2   . ILE B 1 56  ? 29.252  77.089  13.910 1.00 61.74  ? 82  ILE B CG2   1 
ATOM   2940 C CD1   . ILE B 1 56  ? 30.512  79.887  13.277 1.00 62.90  ? 82  ILE B CD1   1 
ATOM   2941 N N     . ALA B 1 57  ? 28.735  76.142  17.123 1.00 55.01  ? 83  ALA B N     1 
ATOM   2942 C CA    . ALA B 1 57  ? 28.522  74.770  17.570 1.00 55.02  ? 83  ALA B CA    1 
ATOM   2943 C C     . ALA B 1 57  ? 27.133  74.588  18.170 1.00 54.43  ? 83  ALA B C     1 
ATOM   2944 O O     . ALA B 1 57  ? 26.462  73.612  17.874 1.00 55.97  ? 83  ALA B O     1 
ATOM   2945 C CB    . ALA B 1 57  ? 29.602  74.350  18.557 1.00 53.32  ? 83  ALA B CB    1 
ATOM   2946 N N     . ILE B 1 58  ? 26.701  75.533  18.999 1.00 53.08  ? 84  ILE B N     1 
ATOM   2947 C CA    . ILE B 1 58  ? 25.365  75.467  19.600 1.00 53.54  ? 84  ILE B CA    1 
ATOM   2948 C C     . ILE B 1 58  ? 24.232  75.587  18.556 1.00 56.31  ? 84  ILE B C     1 
ATOM   2949 O O     . ILE B 1 58  ? 23.272  74.812  18.575 1.00 57.62  ? 84  ILE B O     1 
ATOM   2950 C CB    . ILE B 1 58  ? 25.192  76.515  20.733 1.00 52.03  ? 84  ILE B CB    1 
ATOM   2951 C CG1   . ILE B 1 58  ? 26.206  76.249  21.857 1.00 50.87  ? 84  ILE B CG1   1 
ATOM   2952 C CG2   . ILE B 1 58  ? 23.785  76.465  21.288 1.00 51.83  ? 84  ILE B CG2   1 
ATOM   2953 C CD1   . ILE B 1 58  ? 26.412  77.430  22.812 1.00 49.85  ? 84  ILE B CD1   1 
ATOM   2954 N N     . ILE B 1 59  ? 24.356  76.545  17.647 1.00 58.22  ? 85  ILE B N     1 
ATOM   2955 C CA    . ILE B 1 59  ? 23.362  76.755  16.588 1.00 62.13  ? 85  ILE B CA    1 
ATOM   2956 C C     . ILE B 1 59  ? 23.302  75.539  15.660 1.00 64.93  ? 85  ILE B C     1 
ATOM   2957 O O     . ILE B 1 59  ? 22.220  75.031  15.342 1.00 66.99  ? 85  ILE B O     1 
ATOM   2958 C CB    . ILE B 1 59  ? 23.667  78.051  15.800 1.00 63.71  ? 85  ILE B CB    1 
ATOM   2959 C CG1   . ILE B 1 59  ? 23.380  79.271  16.685 1.00 62.79  ? 85  ILE B CG1   1 
ATOM   2960 C CG2   . ILE B 1 59  ? 22.876  78.109  14.485 1.00 68.42  ? 85  ILE B CG2   1 
ATOM   2961 C CD1   . ILE B 1 59  ? 24.130  80.523  16.289 1.00 64.14  ? 85  ILE B CD1   1 
ATOM   2962 N N     . ARG B 1 60  ? 24.481  75.069  15.260 1.00 65.64  ? 86  ARG B N     1 
ATOM   2963 C CA    . ARG B 1 60  ? 24.632  73.868  14.444 1.00 69.08  ? 86  ARG B CA    1 
ATOM   2964 C C     . ARG B 1 60  ? 23.997  72.648  15.125 1.00 68.66  ? 86  ARG B C     1 
ATOM   2965 O O     . ARG B 1 60  ? 23.587  71.705  14.457 1.00 71.92  ? 86  ARG B O     1 
ATOM   2966 C CB    . ARG B 1 60  ? 26.119  73.637  14.177 1.00 69.25  ? 86  ARG B CB    1 
ATOM   2967 C CG    . ARG B 1 60  ? 26.446  72.685  13.066 1.00 74.53  ? 86  ARG B CG    1 
ATOM   2968 C CD    . ARG B 1 60  ? 27.889  72.859  12.642 1.00 77.02  ? 86  ARG B CD    1 
ATOM   2969 N NE    . ARG B 1 60  ? 28.024  73.807  11.539 1.00 82.26  ? 86  ARG B NE    1 
ATOM   2970 C CZ    . ARG B 1 60  ? 29.184  74.276  11.083 1.00 84.30  ? 86  ARG B CZ    1 
ATOM   2971 N NH1   . ARG B 1 60  ? 30.333  73.899  11.640 1.00 83.03  ? 86  ARG B NH1   1 
ATOM   2972 N NH2   . ARG B 1 60  ? 29.194  75.130  10.068 1.00 87.37  ? 86  ARG B NH2   1 
ATOM   2973 N N     . ALA B 1 61  ? 23.904  72.690  16.454 1.00 65.57  ? 87  ALA B N     1 
ATOM   2974 C CA    . ALA B 1 61  ? 23.295  71.612  17.234 1.00 65.30  ? 87  ALA B CA    1 
ATOM   2975 C C     . ALA B 1 61  ? 21.781  71.771  17.395 1.00 66.10  ? 87  ALA B C     1 
ATOM   2976 O O     . ALA B 1 61  ? 21.071  70.784  17.585 1.00 67.15  ? 87  ALA B O     1 
ATOM   2977 C CB    . ALA B 1 61  ? 23.968  71.502  18.593 1.00 62.20  ? 87  ALA B CB    1 
ATOM   2978 N N     . MET B 1 62  ? 21.294  73.010  17.337 1.00 66.20  ? 88  MET B N     1 
ATOM   2979 C CA    . MET B 1 62  ? 19.848  73.278  17.350 1.00 68.16  ? 88  MET B CA    1 
ATOM   2980 C C     . MET B 1 62  ? 19.165  72.632  16.148 1.00 72.23  ? 88  MET B C     1 
ATOM   2981 O O     . MET B 1 62  ? 18.023  72.191  16.241 1.00 73.66  ? 88  MET B O     1 
ATOM   2982 C CB    . MET B 1 62  ? 19.557  74.785  17.339 1.00 68.20  ? 88  MET B CB    1 
ATOM   2983 C CG    . MET B 1 62  ? 19.906  75.514  18.626 1.00 65.75  ? 88  MET B CG    1 
ATOM   2984 S SD    . MET B 1 62  ? 19.623  77.297  18.535 1.00 67.88  ? 88  MET B SD    1 
ATOM   2985 C CE    . MET B 1 62  ? 17.907  77.389  19.041 1.00 69.27  ? 88  MET B CE    1 
ATOM   2986 N N     . GLY B 1 63  ? 19.874  72.604  15.021 1.00 74.74  ? 89  GLY B N     1 
ATOM   2987 C CA    . GLY B 1 63  ? 19.405  71.944  13.808 1.00 80.05  ? 89  GLY B CA    1 
ATOM   2988 C C     . GLY B 1 63  ? 19.293  70.441  13.971 1.00 81.23  ? 89  GLY B C     1 
ATOM   2989 O O     . GLY B 1 63  ? 18.257  69.855  13.649 1.00 84.15  ? 89  GLY B O     1 
ATOM   2990 N N     . ARG B 1 64  ? 20.356  69.821  14.480 1.00 79.27  ? 90  ARG B N     1 
ATOM   2991 C CA    . ARG B 1 64  ? 20.388  68.373  14.674 1.00 80.97  ? 90  ARG B CA    1 
ATOM   2992 C C     . ARG B 1 64  ? 19.390  67.899  15.727 1.00 79.52  ? 90  ARG B C     1 
ATOM   2993 O O     . ARG B 1 64  ? 18.771  66.844  15.568 1.00 82.20  ? 90  ARG B O     1 
ATOM   2994 C CB    . ARG B 1 64  ? 21.808  67.901  14.997 1.00 79.80  ? 90  ARG B CB    1 
ATOM   2995 C CG    . ARG B 1 64  ? 22.593  67.480  13.761 1.00 85.09  ? 90  ARG B CG    1 
ATOM   2996 C CD    . ARG B 1 64  ? 24.054  67.908  13.814 1.00 85.19  ? 90  ARG B CD    1 
ATOM   2997 N NE    . ARG B 1 64  ? 24.787  67.424  12.643 1.00 91.15  ? 90  ARG B NE    1 
ATOM   2998 C CZ    . ARG B 1 64  ? 25.872  67.999  12.124 1.00 92.69  ? 90  ARG B CZ    1 
ATOM   2999 N NH1   . ARG B 1 64  ? 26.376  69.109  12.656 1.00 88.42  ? 90  ARG B NH1   1 
ATOM   3000 N NH2   . ARG B 1 64  ? 26.450  67.461  11.053 1.00 98.45  ? 90  ARG B NH2   1 
ATOM   3001 N N     . LEU B 1 65  ? 19.222  68.689  16.785 1.00 77.68  ? 91  LEU B N     1 
ATOM   3002 C CA    . LEU B 1 65  ? 18.268  68.366  17.844 1.00 78.41  ? 91  LEU B CA    1 
ATOM   3003 C C     . LEU B 1 65  ? 16.889  68.944  17.553 1.00 79.50  ? 91  LEU B C     1 
ATOM   3004 O O     . LEU B 1 65  ? 15.955  68.770  18.341 1.00 80.08  ? 91  LEU B O     1 
ATOM   3005 C CB    . LEU B 1 65  ? 18.783  68.851  19.201 1.00 77.02  ? 91  LEU B CB    1 
ATOM   3006 C CG    . LEU B 1 65  ? 20.073  68.214  19.730 1.00 76.42  ? 91  LEU B CG    1 
ATOM   3007 C CD1   . LEU B 1 65  ? 20.528  68.915  21.002 1.00 74.55  ? 91  LEU B CD1   1 
ATOM   3008 C CD2   . LEU B 1 65  ? 19.916  66.706  19.964 1.00 77.19  ? 91  LEU B CD2   1 
ATOM   3009 N N     . LYS B 1 66  ? 16.777  69.605  16.401 1.00 80.22  ? 92  LYS B N     1 
ATOM   3010 C CA    . LYS B 1 66  ? 15.581  70.356  15.984 1.00 81.67  ? 92  LYS B CA    1 
ATOM   3011 C C     . LYS B 1 66  ? 14.866  71.094  17.119 1.00 81.80  ? 92  LYS B C     1 
ATOM   3012 O O     . LYS B 1 66  ? 13.739  70.768  17.492 1.00 83.15  ? 92  LYS B O     1 
ATOM   3013 C CB    . LYS B 1 66  ? 14.625  69.500  15.145 1.00 83.65  ? 92  LYS B CB    1 
ATOM   3014 C CG    . LYS B 1 66  ? 14.957  69.528  13.649 1.00 84.49  ? 92  LYS B CG    1 
ATOM   3015 C CD    . LYS B 1 66  ? 13.728  69.305  12.770 1.00 87.41  ? 92  LYS B CD    1 
ATOM   3016 C CE    . LYS B 1 66  ? 12.847  70.548  12.689 1.00 87.31  ? 92  LYS B CE    1 
ATOM   3017 N NZ    . LYS B 1 66  ? 11.584  70.267  11.954 1.00 89.48  ? 92  LYS B NZ    1 
ATOM   3018 N N     . ILE B 1 67  ? 15.574  72.069  17.680 1.00 80.84  ? 93  ILE B N     1 
ATOM   3019 C CA    . ILE B 1 67  ? 15.004  73.036  18.605 1.00 81.03  ? 93  ILE B CA    1 
ATOM   3020 C C     . ILE B 1 67  ? 15.006  74.356  17.850 1.00 81.08  ? 93  ILE B C     1 
ATOM   3021 O O     . ILE B 1 67  ? 16.034  74.761  17.292 1.00 80.07  ? 93  ILE B O     1 
ATOM   3022 C CB    . ILE B 1 67  ? 15.847  73.170  19.901 1.00 79.92  ? 93  ILE B CB    1 
ATOM   3023 C CG1   . ILE B 1 67  ? 15.875  71.844  20.673 1.00 80.59  ? 93  ILE B CG1   1 
ATOM   3024 C CG2   . ILE B 1 67  ? 15.317  74.297  20.793 1.00 79.54  ? 93  ILE B CG2   1 
ATOM   3025 C CD1   . ILE B 1 67  ? 17.064  71.691  21.602 1.00 78.85  ? 93  ILE B CD1   1 
ATOM   3026 N N     . ASP B 1 68  ? 13.846  75.003  17.794 1.00 82.54  ? 94  ASP B N     1 
ATOM   3027 C CA    . ASP B 1 68  ? 13.753  76.339  17.207 1.00 82.83  ? 94  ASP B CA    1 
ATOM   3028 C C     . ASP B 1 68  ? 14.047  77.420  18.244 1.00 81.76  ? 94  ASP B C     1 
ATOM   3029 O O     . ASP B 1 68  ? 14.004  77.180  19.457 1.00 81.25  ? 94  ASP B O     1 
ATOM   3030 C CB    . ASP B 1 68  ? 12.400  76.573  16.498 1.00 84.85  ? 94  ASP B CB    1 
ATOM   3031 C CG    . ASP B 1 68  ? 11.235  75.866  17.180 1.00 86.67  ? 94  ASP B CG    1 
ATOM   3032 O OD1   . ASP B 1 68  ? 10.984  76.120  18.379 1.00 87.39  ? 94  ASP B OD1   1 
ATOM   3033 O OD2   . ASP B 1 68  ? 10.557  75.062  16.506 1.00 88.67  ? 94  ASP B OD2   1 
ATOM   3034 N N     . PHE B 1 69  ? 14.365  78.608  17.746 1.00 81.57  ? 95  PHE B N     1 
ATOM   3035 C CA    . PHE B 1 69  ? 14.672  79.754  18.587 1.00 80.93  ? 95  PHE B CA    1 
ATOM   3036 C C     . PHE B 1 69  ? 13.481  80.176  19.440 1.00 82.16  ? 95  PHE B C     1 
ATOM   3037 O O     . PHE B 1 69  ? 12.327  79.878  19.108 1.00 83.59  ? 95  PHE B O     1 
ATOM   3038 C CB    . PHE B 1 69  ? 15.119  80.923  17.716 1.00 80.74  ? 95  PHE B CB    1 
ATOM   3039 C CG    . PHE B 1 69  ? 16.320  80.622  16.869 1.00 79.81  ? 95  PHE B CG    1 
ATOM   3040 C CD1   . PHE B 1 69  ? 17.605  80.701  17.407 1.00 77.85  ? 95  PHE B CD1   1 
ATOM   3041 C CD2   . PHE B 1 69  ? 16.171  80.261  15.533 1.00 79.87  ? 95  PHE B CD2   1 
ATOM   3042 C CE1   . PHE B 1 69  ? 18.723  80.428  16.624 1.00 77.24  ? 95  PHE B CE1   1 
ATOM   3043 C CE2   . PHE B 1 69  ? 17.281  79.983  14.741 1.00 79.05  ? 95  PHE B CE2   1 
ATOM   3044 C CZ    . PHE B 1 69  ? 18.560  80.070  15.286 1.00 78.12  ? 95  PHE B CZ    1 
ATOM   3045 N N     . GLY B 1 70  ? 13.773  80.859  20.546 1.00 81.68  ? 96  GLY B N     1 
ATOM   3046 C CA    . GLY B 1 70  ? 12.742  81.486  21.365 1.00 83.09  ? 96  GLY B CA    1 
ATOM   3047 C C     . GLY B 1 70  ? 11.952  82.485  20.538 1.00 84.54  ? 96  GLY B C     1 
ATOM   3048 O O     . GLY B 1 70  ? 10.721  82.428  20.496 1.00 86.13  ? 96  GLY B O     1 
ATOM   3049 N N     . ASP B 1 71  ? 12.672  83.380  19.863 1.00 84.08  ? 97  ASP B N     1 
ATOM   3050 C CA    . ASP B 1 71  ? 12.067  84.372  18.978 1.00 85.51  ? 97  ASP B CA    1 
ATOM   3051 C C     . ASP B 1 71  ? 12.549  84.232  17.531 1.00 85.23  ? 97  ASP B C     1 
ATOM   3052 O O     . ASP B 1 71  ? 13.733  84.017  17.278 1.00 83.87  ? 97  ASP B O     1 
ATOM   3053 C CB    . ASP B 1 71  ? 12.333  85.790  19.497 1.00 85.78  ? 97  ASP B CB    1 
ATOM   3054 C CG    . ASP B 1 71  ? 11.527  86.843  18.754 1.00 88.39  ? 97  ASP B CG    1 
ATOM   3055 O OD1   . ASP B 1 71  ? 10.510  87.311  19.311 1.00 90.44  ? 97  ASP B OD1   1 
ATOM   3056 O OD2   . ASP B 1 71  ? 11.896  87.190  17.606 1.00 89.57  ? 97  ASP B OD2   1 
ATOM   3057 N N     . SER B 1 72  ? 11.613  84.398  16.597 1.00 86.72  ? 98  SER B N     1 
ATOM   3058 C CA    . SER B 1 72  ? 11.829  84.187  15.160 1.00 87.04  ? 98  SER B CA    1 
ATOM   3059 C C     . SER B 1 72  ? 12.919  85.049  14.527 1.00 86.38  ? 98  SER B C     1 
ATOM   3060 O O     . SER B 1 72  ? 13.479  84.684  13.490 1.00 86.37  ? 98  SER B O     1 
ATOM   3061 C CB    . SER B 1 72  ? 10.517  84.414  14.399 1.00 89.28  ? 98  SER B CB    1 
ATOM   3062 O OG    . SER B 1 72  ? 9.444   83.735  15.025 1.00 90.13  ? 98  SER B OG    1 
ATOM   3063 N N     . ALA B 1 73  ? 13.197  86.197  15.138 1.00 86.02  ? 99  ALA B N     1 
ATOM   3064 C CA    . ALA B 1 73  ? 14.168  87.150  14.599 1.00 85.75  ? 99  ALA B CA    1 
ATOM   3065 C C     . ALA B 1 73  ? 15.612  86.652  14.697 1.00 83.86  ? 99  ALA B C     1 
ATOM   3066 O O     . ALA B 1 73  ? 16.470  87.071  13.914 1.00 83.83  ? 99  ALA B O     1 
ATOM   3067 C CB    . ALA B 1 73  ? 14.014  88.508  15.283 1.00 86.35  ? 99  ALA B CB    1 
ATOM   3068 N N     . ARG B 1 74  ? 15.868  85.753  15.653 1.00 82.41  ? 100 ARG B N     1 
ATOM   3069 C CA    . ARG B 1 74  ? 17.209  85.186  15.879 1.00 80.79  ? 100 ARG B CA    1 
ATOM   3070 C C     . ARG B 1 74  ? 17.690  84.356  14.695 1.00 80.97  ? 100 ARG B C     1 
ATOM   3071 O O     . ARG B 1 74  ? 18.895  84.178  14.502 1.00 80.03  ? 100 ARG B O     1 
ATOM   3072 C CB    . ARG B 1 74  ? 17.249  84.336  17.156 1.00 79.45  ? 100 ARG B CB    1 
ATOM   3073 C CG    . ARG B 1 74  ? 16.772  85.040  18.413 1.00 79.52  ? 100 ARG B CG    1 
ATOM   3074 C CD    . ARG B 1 74  ? 17.588  86.287  18.722 1.00 79.39  ? 100 ARG B CD    1 
ATOM   3075 N NE    . ARG B 1 74  ? 16.712  87.417  19.025 1.00 81.11  ? 100 ARG B NE    1 
ATOM   3076 C CZ    . ARG B 1 74  ? 16.454  88.422  18.190 1.00 81.87  ? 100 ARG B CZ    1 
ATOM   3077 N NH1   . ARG B 1 74  ? 15.641  89.396  18.565 1.00 83.04  ? 100 ARG B NH1   1 
ATOM   3078 N NH2   . ARG B 1 74  ? 17.013  88.465  16.986 1.00 81.68  ? 100 ARG B NH2   1 
ATOM   3079 N N     . ALA B 1 75  ? 16.736  83.855  13.912 1.00 82.33  ? 101 ALA B N     1 
ATOM   3080 C CA    . ALA B 1 75  ? 17.029  83.093  12.707 1.00 83.10  ? 101 ALA B CA    1 
ATOM   3081 C C     . ALA B 1 75  ? 17.808  83.933  11.699 1.00 84.09  ? 101 ALA B C     1 
ATOM   3082 O O     . ALA B 1 75  ? 18.708  83.426  11.026 1.00 83.97  ? 101 ALA B O     1 
ATOM   3083 C CB    . ALA B 1 75  ? 15.746  82.563  12.092 1.00 84.46  ? 101 ALA B CB    1 
ATOM   3084 N N     . ASP B 1 76  ? 17.465  85.218  11.607 1.00 85.41  ? 102 ASP B N     1 
ATOM   3085 C CA    . ASP B 1 76  ? 18.185  86.150  10.740 1.00 86.66  ? 102 ASP B CA    1 
ATOM   3086 C C     . ASP B 1 76  ? 19.541  86.520  11.341 1.00 85.42  ? 102 ASP B C     1 
ATOM   3087 O O     . ASP B 1 76  ? 20.518  86.692  10.606 1.00 85.82  ? 102 ASP B O     1 
ATOM   3088 C CB    . ASP B 1 76  ? 17.348  87.406  10.465 1.00 88.54  ? 102 ASP B CB    1 
ATOM   3089 C CG    . ASP B 1 76  ? 17.875  88.217  9.286  1.00 90.79  ? 102 ASP B CG    1 
ATOM   3090 O OD1   . ASP B 1 76  ? 17.225  88.196  8.215  1.00 93.63  ? 102 ASP B OD1   1 
ATOM   3091 O OD2   . ASP B 1 76  ? 18.934  88.871  9.421  1.00 90.31  ? 102 ASP B OD2   1 
ATOM   3092 N N     . ASP B 1 77  ? 19.589  86.650  12.670 1.00 84.16  ? 103 ASP B N     1 
ATOM   3093 C CA    . ASP B 1 77  ? 20.850  86.848  13.399 1.00 82.96  ? 103 ASP B CA    1 
ATOM   3094 C C     . ASP B 1 77  ? 21.834  85.718  13.088 1.00 81.93  ? 103 ASP B C     1 
ATOM   3095 O O     . ASP B 1 77  ? 22.985  85.971  12.721 1.00 81.72  ? 103 ASP B O     1 
ATOM   3096 C CB    . ASP B 1 77  ? 20.611  86.915  14.919 1.00 81.96  ? 103 ASP B CB    1 
ATOM   3097 C CG    . ASP B 1 77  ? 19.976  88.224  15.369 1.00 82.94  ? 103 ASP B CG    1 
ATOM   3098 O OD1   . ASP B 1 77  ? 19.953  89.194  14.583 1.00 85.19  ? 103 ASP B OD1   1 
ATOM   3099 O OD2   . ASP B 1 77  ? 19.506  88.283  16.527 1.00 82.38  ? 103 ASP B OD2   1 
ATOM   3100 N N     . ALA B 1 78  ? 21.364  84.478  13.225 1.00 81.42  ? 104 ALA B N     1 
ATOM   3101 C CA    . ALA B 1 78  ? 22.175  83.293  12.950 1.00 81.07  ? 104 ALA B CA    1 
ATOM   3102 C C     . ALA B 1 78  ? 22.827  83.363  11.570 1.00 82.58  ? 104 ALA B C     1 
ATOM   3103 O O     . ALA B 1 78  ? 24.021  83.095  11.435 1.00 82.16  ? 104 ALA B O     1 
ATOM   3104 C CB    . ALA B 1 78  ? 21.338  82.032  13.088 1.00 80.75  ? 104 ALA B CB    1 
ATOM   3105 N N     . ARG B 1 79  ? 22.039  83.743  10.559 1.00 84.60  ? 105 ARG B N     1 
ATOM   3106 C CA    . ARG B 1 79  ? 22.533  83.915  9.189  1.00 86.42  ? 105 ARG B CA    1 
ATOM   3107 C C     . ARG B 1 79  ? 23.581  85.015  9.130  1.00 86.81  ? 105 ARG B C     1 
ATOM   3108 O O     . ARG B 1 79  ? 24.664  84.828  8.570  1.00 87.28  ? 105 ARG B O     1 
ATOM   3109 C CB    . ARG B 1 79  ? 21.381  84.246  8.231  1.00 88.41  ? 105 ARG B CB    1 
ATOM   3110 C CG    . ARG B 1 79  ? 20.356  83.137  8.094  1.00 89.11  ? 105 ARG B CG    1 
ATOM   3111 C CD    . ARG B 1 79  ? 19.203  83.502  7.174  1.00 91.61  ? 105 ARG B CD    1 
ATOM   3112 N NE    . ARG B 1 79  ? 18.186  82.453  7.217  1.00 92.84  ? 105 ARG B NE    1 
ATOM   3113 C CZ    . ARG B 1 79  ? 17.059  82.514  7.927  1.00 93.47  ? 105 ARG B CZ    1 
ATOM   3114 N NH1   . ARG B 1 79  ? 16.767  83.594  8.644  1.00 93.49  ? 105 ARG B NH1   1 
ATOM   3115 N NH2   . ARG B 1 79  ? 16.207  81.495  7.906  1.00 93.83  ? 105 ARG B NH2   1 
ATOM   3116 N N     . GLN B 1 80  ? 23.244  86.158  9.722  1.00 86.96  ? 106 GLN B N     1 
ATOM   3117 C CA    . GLN B 1 80  ? 24.132  87.316  9.785  1.00 87.57  ? 106 GLN B CA    1 
ATOM   3118 C C     . GLN B 1 80  ? 25.428  86.993  10.537 1.00 86.05  ? 106 GLN B C     1 
ATOM   3119 O O     . GLN B 1 80  ? 26.488  87.542  10.214 1.00 86.59  ? 106 GLN B O     1 
ATOM   3120 C CB    . GLN B 1 80  ? 23.395  88.509  10.418 1.00 87.98  ? 106 GLN B CB    1 
ATOM   3121 C CG    . GLN B 1 80  ? 24.208  89.805  10.554 1.00 89.19  ? 106 GLN B CG    1 
ATOM   3122 C CD    . GLN B 1 80  ? 24.307  90.621  9.264  1.00 92.20  ? 106 GLN B CD    1 
ATOM   3123 O OE1   . GLN B 1 80  ? 24.148  90.097  8.157  1.00 93.51  ? 106 GLN B OE1   1 
ATOM   3124 N NE2   . GLN B 1 80  ? 24.584  91.918  9.410  1.00 92.63  ? 106 GLN B NE2   1 
ATOM   3125 N N     . LEU B 1 81  ? 25.340  86.098  11.525 1.00 84.23  ? 107 LEU B N     1 
ATOM   3126 C CA    . LEU B 1 81  ? 26.517  85.666  12.281 1.00 82.85  ? 107 LEU B CA    1 
ATOM   3127 C C     . LEU B 1 81  ? 27.591  85.085  11.366 1.00 83.52  ? 107 LEU B C     1 
ATOM   3128 O O     . LEU B 1 81  ? 28.740  85.528  11.406 1.00 83.56  ? 107 LEU B O     1 
ATOM   3129 C CB    . LEU B 1 81  ? 26.145  84.661  13.382 1.00 81.27  ? 107 LEU B CB    1 
ATOM   3130 C CG    . LEU B 1 81  ? 27.301  83.916  14.070 1.00 79.53  ? 107 LEU B CG    1 
ATOM   3131 C CD1   . LEU B 1 81  ? 28.107  84.821  14.987 1.00 78.41  ? 107 LEU B CD1   1 
ATOM   3132 C CD2   . LEU B 1 81  ? 26.777  82.728  14.832 1.00 78.65  ? 107 LEU B CD2   1 
ATOM   3133 N N     . PHE B 1 82  ? 27.207  84.110  10.543 1.00 84.22  ? 108 PHE B N     1 
ATOM   3134 C CA    . PHE B 1 82  ? 28.125  83.489  9.578  1.00 85.55  ? 108 PHE B CA    1 
ATOM   3135 C C     . PHE B 1 82  ? 28.721  84.506  8.599  1.00 87.55  ? 108 PHE B C     1 
ATOM   3136 O O     . PHE B 1 82  ? 29.932  84.493  8.340  1.00 88.08  ? 108 PHE B O     1 
ATOM   3137 C CB    . PHE B 1 82  ? 27.428  82.359  8.811  1.00 86.12  ? 108 PHE B CB    1 
ATOM   3138 C CG    . PHE B 1 82  ? 27.181  81.125  9.636  1.00 85.06  ? 108 PHE B CG    1 
ATOM   3139 C CD1   . PHE B 1 82  ? 28.149  80.125  9.725  1.00 85.04  ? 108 PHE B CD1   1 
ATOM   3140 C CD2   . PHE B 1 82  ? 25.979  80.955  10.320 1.00 84.68  ? 108 PHE B CD2   1 
ATOM   3141 C CE1   . PHE B 1 82  ? 27.925  78.976  10.487 1.00 83.78  ? 108 PHE B CE1   1 
ATOM   3142 C CE2   . PHE B 1 82  ? 25.743  79.810  11.088 1.00 83.84  ? 108 PHE B CE2   1 
ATOM   3143 C CZ    . PHE B 1 82  ? 26.719  78.819  11.170 1.00 83.36  ? 108 PHE B CZ    1 
ATOM   3144 N N     . VAL B 1 83  ? 27.865  85.384  8.074  1.00 88.91  ? 109 VAL B N     1 
ATOM   3145 C CA    . VAL B 1 83  ? 28.279  86.440  7.147  1.00 91.19  ? 109 VAL B CA    1 
ATOM   3146 C C     . VAL B 1 83  ? 29.281  87.388  7.810  1.00 91.07  ? 109 VAL B C     1 
ATOM   3147 O O     . VAL B 1 83  ? 30.320  87.708  7.223  1.00 92.48  ? 109 VAL B O     1 
ATOM   3148 C CB    . VAL B 1 83  ? 27.052  87.222  6.571  1.00 92.66  ? 109 VAL B CB    1 
ATOM   3149 C CG1   . VAL B 1 83  ? 27.484  88.496  5.847  1.00 94.78  ? 109 VAL B CG1   1 
ATOM   3150 C CG2   . VAL B 1 83  ? 26.246  86.334  5.631  1.00 93.51  ? 109 VAL B CG2   1 
ATOM   3151 N N     . LEU B 1 84  ? 28.972  87.814  9.034  1.00 89.66  ? 110 LEU B N     1 
ATOM   3152 C CA    . LEU B 1 84  ? 29.840  88.729  9.780  1.00 89.60  ? 110 LEU B CA    1 
ATOM   3153 C C     . LEU B 1 84  ? 31.142  88.094  10.264 1.00 88.73  ? 110 LEU B C     1 
ATOM   3154 O O     . LEU B 1 84  ? 32.159  88.786  10.402 1.00 89.41  ? 110 LEU B O     1 
ATOM   3155 C CB    . LEU B 1 84  ? 29.094  89.335  10.966 1.00 88.42  ? 110 LEU B CB    1 
ATOM   3156 C CG    . LEU B 1 84  ? 28.228  90.559  10.671 1.00 90.34  ? 110 LEU B CG    1 
ATOM   3157 C CD1   . LEU B 1 84  ? 27.508  91.000  11.939 1.00 89.22  ? 110 LEU B CD1   1 
ATOM   3158 C CD2   . LEU B 1 84  ? 29.066  91.702  10.086 1.00 92.27  ? 110 LEU B CD2   1 
ATOM   3159 N N     . ALA B 1 85  ? 31.097  86.788  10.523 1.00 87.28  ? 111 ALA B N     1 
ATOM   3160 C CA    . ALA B 1 85  ? 32.258  86.046  11.008 1.00 86.54  ? 111 ALA B CA    1 
ATOM   3161 C C     . ALA B 1 85  ? 33.370  85.996  9.963  1.00 88.29  ? 111 ALA B C     1 
ATOM   3162 O O     . ALA B 1 85  ? 34.500  86.419  10.232 1.00 88.57  ? 111 ALA B O     1 
ATOM   3163 C CB    . ALA B 1 85  ? 31.856  84.635  11.433 1.00 85.00  ? 111 ALA B CB    1 
ATOM   3164 N N     . GLY B 1 86  ? 33.030  85.494  8.774  1.00 89.58  ? 112 GLY B N     1 
ATOM   3165 C CA    . GLY B 1 86  ? 33.981  85.358  7.669  1.00 91.61  ? 112 GLY B CA    1 
ATOM   3166 C C     . GLY B 1 86  ? 34.534  86.672  7.149  1.00 93.53  ? 112 GLY B C     1 
ATOM   3167 O O     . GLY B 1 86  ? 35.601  86.697  6.533  1.00 95.17  ? 112 GLY B O     1 
ATOM   3168 N N     . ALA B 1 87  ? 33.807  87.760  7.404  1.00 93.60  ? 113 ALA B N     1 
ATOM   3169 C CA    . ALA B 1 87  ? 34.207  89.099  6.964  1.00 95.63  ? 113 ALA B CA    1 
ATOM   3170 C C     . ALA B 1 87  ? 35.075  89.826  7.991  1.00 95.00  ? 113 ALA B C     1 
ATOM   3171 O O     . ALA B 1 87  ? 35.863  90.705  7.626  1.00 97.02  ? 113 ALA B O     1 
ATOM   3172 C CB    . ALA B 1 87  ? 32.978  89.937  6.618  1.00 96.44  ? 113 ALA B CB    1 
ATOM   3173 N N     . ALA B 1 88  ? 34.929  89.457  9.265  1.00 92.31  ? 114 ALA B N     1 
ATOM   3174 C CA    . ALA B 1 88  ? 35.649  90.106  10.364 1.00 91.40  ? 114 ALA B CA    1 
ATOM   3175 C C     . ALA B 1 88  ? 37.164  90.081  10.176 1.00 92.39  ? 114 ALA B C     1 
ATOM   3176 O O     . ALA B 1 88  ? 37.713  89.148  9.591  1.00 92.77  ? 114 ALA B O     1 
ATOM   3177 C CB    . ALA B 1 88  ? 35.269  89.471  11.696 1.00 88.77  ? 114 ALA B CB    1 
ATOM   3178 N N     . GLU B 1 89  ? 37.830  91.126  10.659 1.00 93.01  ? 115 GLU B N     1 
ATOM   3179 C CA    . GLU B 1 89  ? 39.286  91.173  10.679 1.00 93.92  ? 115 GLU B CA    1 
ATOM   3180 C C     . GLU B 1 89  ? 39.797  90.303  11.827 1.00 91.67  ? 115 GLU B C     1 
ATOM   3181 O O     . GLU B 1 89  ? 39.284  90.373  12.955 1.00 89.73  ? 115 GLU B O     1 
ATOM   3182 C CB    . GLU B 1 89  ? 39.781  92.618  10.825 1.00 95.72  ? 115 GLU B CB    1 
ATOM   3183 C CG    . GLU B 1 89  ? 41.302  92.780  10.809 1.00 97.52  ? 115 GLU B CG    1 
ATOM   3184 C CD    . GLU B 1 89  ? 41.740  94.239  10.839 1.00 100.24 ? 115 GLU B CD    1 
ATOM   3185 O OE1   . GLU B 1 89  ? 41.412  94.989  9.883  1.00 102.71 ? 115 GLU B OE1   1 
ATOM   3186 O OE2   . GLU B 1 89  ? 42.426  94.636  11.814 1.00 100.11 ? 115 GLU B OE2   1 
ATOM   3187 N N     . GLU B 1 90  ? 40.800  89.480  11.528 1.00 91.82  ? 116 GLU B N     1 
ATOM   3188 C CA    . GLU B 1 90  ? 41.417  88.609  12.518 1.00 89.85  ? 116 GLU B CA    1 
ATOM   3189 C C     . GLU B 1 90  ? 42.079  89.451  13.615 1.00 89.27  ? 116 GLU B C     1 
ATOM   3190 O O     . GLU B 1 90  ? 43.054  90.164  13.365 1.00 91.24  ? 116 GLU B O     1 
ATOM   3191 C CB    . GLU B 1 90  ? 42.431  87.687  11.839 1.00 91.13  ? 116 GLU B CB    1 
ATOM   3192 C CG    . GLU B 1 90  ? 42.947  86.558  12.709 1.00 89.86  ? 116 GLU B CG    1 
ATOM   3193 C CD    . GLU B 1 90  ? 44.279  86.014  12.223 1.00 92.25  ? 116 GLU B CD    1 
ATOM   3194 O OE1   . GLU B 1 90  ? 44.313  85.378  11.145 1.00 93.38  ? 116 GLU B OE1   1 
ATOM   3195 O OE2   . GLU B 1 90  ? 45.293  86.223  12.928 1.00 92.88  ? 116 GLU B OE2   1 
ATOM   3196 N N     . GLY B 1 91  ? 41.520  89.377  14.821 1.00 86.67  ? 117 GLY B N     1 
ATOM   3197 C CA    . GLY B 1 91  ? 42.027  90.127  15.971 1.00 85.86  ? 117 GLY B CA    1 
ATOM   3198 C C     . GLY B 1 91  ? 41.091  91.216  16.472 1.00 85.13  ? 117 GLY B C     1 
ATOM   3199 O O     . GLY B 1 91  ? 41.375  91.870  17.478 1.00 84.59  ? 117 GLY B O     1 
ATOM   3200 N N     . PHE B 1 92  ? 39.975  91.409  15.769 1.00 85.01  ? 118 PHE B N     1 
ATOM   3201 C CA    . PHE B 1 92  ? 39.046  92.498  16.067 1.00 85.02  ? 118 PHE B CA    1 
ATOM   3202 C C     . PHE B 1 92  ? 37.586  92.088  15.907 1.00 83.40  ? 118 PHE B C     1 
ATOM   3203 O O     . PHE B 1 92  ? 37.176  91.577  14.857 1.00 83.72  ? 118 PHE B O     1 
ATOM   3204 C CB    . PHE B 1 92  ? 39.336  93.723  15.174 1.00 88.02  ? 118 PHE B CB    1 
ATOM   3205 C CG    . PHE B 1 92  ? 40.612  94.457  15.524 1.00 90.31  ? 118 PHE B CG    1 
ATOM   3206 C CD1   . PHE B 1 92  ? 40.579  95.573  16.361 1.00 91.56  ? 118 PHE B CD1   1 
ATOM   3207 C CD2   . PHE B 1 92  ? 41.844  94.039  15.009 1.00 92.16  ? 118 PHE B CD2   1 
ATOM   3208 C CE1   . PHE B 1 92  ? 41.759  96.263  16.688 1.00 93.94  ? 118 PHE B CE1   1 
ATOM   3209 C CE2   . PHE B 1 92  ? 43.029  94.716  15.330 1.00 94.65  ? 118 PHE B CE2   1 
ATOM   3210 C CZ    . PHE B 1 92  ? 42.986  95.833  16.170 1.00 95.17  ? 118 PHE B CZ    1 
ATOM   3211 N N     . MET B 1 93  ? 36.803  92.326  16.955 1.00 81.54  ? 119 MET B N     1 
ATOM   3212 C CA    . MET B 1 93  ? 35.357  92.180  16.872 1.00 80.30  ? 119 MET B CA    1 
ATOM   3213 C C     . MET B 1 93  ? 34.703  93.558  16.775 1.00 81.29  ? 119 MET B C     1 
ATOM   3214 O O     . MET B 1 93  ? 34.951  94.436  17.608 1.00 81.30  ? 119 MET B O     1 
ATOM   3215 C CB    . MET B 1 93  ? 34.818  91.410  18.079 1.00 78.26  ? 119 MET B CB    1 
ATOM   3216 C CG    . MET B 1 93  ? 33.379  90.946  17.923 1.00 77.58  ? 119 MET B CG    1 
ATOM   3217 S SD    . MET B 1 93  ? 32.856  89.875  19.271 1.00 77.20  ? 119 MET B SD    1 
ATOM   3218 C CE    . MET B 1 93  ? 33.715  88.352  18.860 1.00 74.96  ? 119 MET B CE    1 
ATOM   3219 N N     . THR B 1 94  ? 33.872  93.735  15.749 1.00 73.83  ? 120 THR B N     1 
ATOM   3220 C CA    . THR B 1 94  ? 33.130  94.987  15.550 1.00 74.42  ? 120 THR B CA    1 
ATOM   3221 C C     . THR B 1 94  ? 31.988  95.083  16.561 1.00 72.98  ? 120 THR B C     1 
ATOM   3222 O O     . THR B 1 94  ? 31.568  94.070  17.137 1.00 71.19  ? 120 THR B O     1 
ATOM   3223 C CB    . THR B 1 94  ? 32.562  95.122  14.108 1.00 75.41  ? 120 THR B CB    1 
ATOM   3224 O OG1   . THR B 1 94  ? 31.439  94.248  13.940 1.00 74.48  ? 120 THR B OG1   1 
ATOM   3225 C CG2   . THR B 1 94  ? 33.624  94.803  13.061 1.00 76.30  ? 120 THR B CG2   1 
ATOM   3226 N N     . ALA B 1 95  ? 31.500  96.303  16.785 1.00 73.35  ? 121 ALA B N     1 
ATOM   3227 C CA    . ALA B 1 95  ? 30.369  96.528  17.680 1.00 72.39  ? 121 ALA B CA    1 
ATOM   3228 C C     . ALA B 1 95  ? 29.148  95.745  17.209 1.00 71.26  ? 121 ALA B C     1 
ATOM   3229 O O     . ALA B 1 95  ? 28.328  95.324  18.021 1.00 70.01  ? 121 ALA B O     1 
ATOM   3230 C CB    . ALA B 1 95  ? 30.046  98.019  17.776 1.00 73.90  ? 121 ALA B CB    1 
ATOM   3231 N N     . GLU B 1 96  ? 29.058  95.547  15.892 1.00 71.73  ? 122 GLU B N     1 
ATOM   3232 C CA    . GLU B 1 96  ? 27.919  94.896  15.256 1.00 71.47  ? 122 GLU B CA    1 
ATOM   3233 C C     . GLU B 1 96  ? 27.857  93.398  15.540 1.00 69.57  ? 122 GLU B C     1 
ATOM   3234 O O     . GLU B 1 96  ? 26.807  92.890  15.930 1.00 69.12  ? 122 GLU B O     1 
ATOM   3235 C CB    . GLU B 1 96  ? 27.937  95.145  13.748 1.00 73.19  ? 122 GLU B CB    1 
ATOM   3236 C CG    . GLU B 1 96  ? 26.610  94.843  13.048 1.00 75.19  ? 122 GLU B CG    1 
ATOM   3237 C CD    . GLU B 1 96  ? 26.699  95.022  11.545 1.00 79.26  ? 122 GLU B CD    1 
ATOM   3238 O OE1   . GLU B 1 96  ? 27.615  94.432  10.930 1.00 80.10  ? 122 GLU B OE1   1 
ATOM   3239 O OE2   . GLU B 1 96  ? 25.862  95.758  10.974 1.00 81.78  ? 122 GLU B OE2   1 
ATOM   3240 N N     . LEU B 1 97  ? 28.976  92.702  15.339 1.00 68.65  ? 123 LEU B N     1 
ATOM   3241 C CA    . LEU B 1 97  ? 29.049  91.252  15.556 1.00 66.78  ? 123 LEU B CA    1 
ATOM   3242 C C     . LEU B 1 97  ? 28.887  90.889  17.031 1.00 64.88  ? 123 LEU B C     1 
ATOM   3243 O O     . LEU B 1 97  ? 28.276  89.867  17.362 1.00 63.92  ? 123 LEU B O     1 
ATOM   3244 C CB    . LEU B 1 97  ? 30.359  90.675  14.990 1.00 66.99  ? 123 LEU B CB    1 
ATOM   3245 C CG    . LEU B 1 97  ? 30.652  89.171  15.103 1.00 65.45  ? 123 LEU B CG    1 
ATOM   3246 C CD1   . LEU B 1 97  ? 29.478  88.313  14.634 1.00 65.30  ? 123 LEU B CD1   1 
ATOM   3247 C CD2   . LEU B 1 97  ? 31.910  88.814  14.336 1.00 65.63  ? 123 LEU B CD2   1 
ATOM   3248 N N     . ALA B 1 98  ? 29.422  91.732  17.910 1.00 64.46  ? 124 ALA B N     1 
ATOM   3249 C CA    . ALA B 1 98  ? 29.224  91.564  19.353 1.00 63.06  ? 124 ALA B CA    1 
ATOM   3250 C C     . ALA B 1 98  ? 27.736  91.488  19.685 1.00 62.75  ? 124 ALA B C     1 
ATOM   3251 O O     . ALA B 1 98  ? 27.314  90.687  20.524 1.00 61.46  ? 124 ALA B O     1 
ATOM   3252 C CB    . ALA B 1 98  ? 29.883  92.699  20.114 1.00 63.70  ? 124 ALA B CB    1 
ATOM   3253 N N     . GLY B 1 99  ? 26.945  92.324  19.013 1.00 63.70  ? 125 GLY B N     1 
ATOM   3254 C CA    . GLY B 1 99  ? 25.500  92.329  19.202 1.00 64.04  ? 125 GLY B CA    1 
ATOM   3255 C C     . GLY B 1 99  ? 24.822  91.052  18.737 1.00 63.51  ? 125 GLY B C     1 
ATOM   3256 O O     . GLY B 1 99  ? 23.955  90.514  19.430 1.00 63.27  ? 125 GLY B O     1 
ATOM   3257 N N     . VAL B 1 100 ? 25.217  90.571  17.561 1.00 63.60  ? 126 VAL B N     1 
ATOM   3258 C CA    . VAL B 1 100 ? 24.615  89.381  16.965 1.00 63.71  ? 126 VAL B CA    1 
ATOM   3259 C C     . VAL B 1 100 ? 24.885  88.146  17.840 1.00 62.31  ? 126 VAL B C     1 
ATOM   3260 O O     . VAL B 1 100 ? 23.958  87.401  18.182 1.00 62.16  ? 126 VAL B O     1 
ATOM   3261 C CB    . VAL B 1 100 ? 25.111  89.171  15.511 1.00 64.63  ? 126 VAL B CB    1 
ATOM   3262 C CG1   . VAL B 1 100 ? 24.541  87.896  14.918 1.00 64.49  ? 126 VAL B CG1   1 
ATOM   3263 C CG2   . VAL B 1 100 ? 24.734  90.371  14.647 1.00 66.60  ? 126 VAL B CG2   1 
ATOM   3264 N N     . ILE B 1 101 ? 26.148  87.952  18.223 1.00 61.40  ? 127 ILE B N     1 
ATOM   3265 C CA    . ILE B 1 101 ? 26.506  86.889  19.158 1.00 60.25  ? 127 ILE B CA    1 
ATOM   3266 C C     . ILE B 1 101 ? 25.727  87.037  20.461 1.00 60.26  ? 127 ILE B C     1 
ATOM   3267 O O     . ILE B 1 101 ? 25.213  86.050  20.995 1.00 59.99  ? 127 ILE B O     1 
ATOM   3268 C CB    . ILE B 1 101 ? 28.021  86.838  19.443 1.00 59.60  ? 127 ILE B CB    1 
ATOM   3269 C CG1   . ILE B 1 101 ? 28.798  86.622  18.143 1.00 59.64  ? 127 ILE B CG1   1 
ATOM   3270 C CG2   . ILE B 1 101 ? 28.343  85.704  20.412 1.00 58.24  ? 127 ILE B CG2   1 
ATOM   3271 C CD1   . ILE B 1 101 ? 30.260  86.970  18.239 1.00 58.22  ? 127 ILE B CD1   1 
ATOM   3272 N N     . LYS B 1 102 ? 25.614  88.271  20.947 1.00 61.14  ? 128 LYS B N     1 
ATOM   3273 C CA    . LYS B 1 102 ? 24.936  88.540  22.215 1.00 61.62  ? 128 LYS B CA    1 
ATOM   3274 C C     . LYS B 1 102 ? 23.454  88.178  22.180 1.00 62.10  ? 128 LYS B C     1 
ATOM   3275 O O     . LYS B 1 102 ? 22.966  87.480  23.072 1.00 61.66  ? 128 LYS B O     1 
ATOM   3276 C CB    . LYS B 1 102 ? 25.120  89.999  22.635 1.00 62.93  ? 128 LYS B CB    1 
ATOM   3277 C CG    . LYS B 1 102 ? 24.477  90.344  23.980 1.00 65.16  ? 128 LYS B CG    1 
ATOM   3278 C CD    . LYS B 1 102 ? 25.275  89.801  25.163 1.00 66.01  ? 128 LYS B CD    1 
ATOM   3279 C CE    . LYS B 1 102 ? 26.319  90.807  25.640 1.00 67.90  ? 128 LYS B CE    1 
ATOM   3280 N NZ    . LYS B 1 102 ? 25.716  92.013  26.295 1.00 70.09  ? 128 LYS B NZ    1 
ATOM   3281 N N     . ARG B 1 103 ? 22.749  88.655  21.151 1.00 62.96  ? 129 ARG B N     1 
ATOM   3282 C CA    . ARG B 1 103 ? 21.336  88.336  20.969 1.00 63.74  ? 129 ARG B CA    1 
ATOM   3283 C C     . ARG B 1 103 ? 21.131  86.821  20.831 1.00 62.64  ? 129 ARG B C     1 
ATOM   3284 O O     . ARG B 1 103 ? 20.211  86.261  21.421 1.00 63.15  ? 129 ARG B O     1 
ATOM   3285 C CB    . ARG B 1 103 ? 20.736  89.097  19.771 1.00 65.44  ? 129 ARG B CB    1 
ATOM   3286 C CG    . ARG B 1 103 ? 20.643  90.627  19.974 1.00 67.40  ? 129 ARG B CG    1 
ATOM   3287 C CD    . ARG B 1 103 ? 19.785  91.325  18.904 1.00 70.22  ? 129 ARG B CD    1 
ATOM   3288 N NE    . ARG B 1 103 ? 20.299  91.127  17.547 1.00 71.24  ? 129 ARG B NE    1 
ATOM   3289 C CZ    . ARG B 1 103 ? 21.076  91.984  16.888 1.00 71.20  ? 129 ARG B CZ    1 
ATOM   3290 N NH1   . ARG B 1 103 ? 21.447  93.134  17.439 1.00 71.92  ? 129 ARG B NH1   1 
ATOM   3291 N NH2   . ARG B 1 103 ? 21.482  91.688  15.664 1.00 71.50  ? 129 ARG B NH2   1 
ATOM   3292 N N     . LEU B 1 104 ? 21.994  86.163  20.066 1.00 61.29  ? 130 LEU B N     1 
ATOM   3293 C CA    . LEU B 1 104 ? 21.945  84.705  19.944 1.00 60.54  ? 130 LEU B CA    1 
ATOM   3294 C C     . LEU B 1 104 ? 22.093  84.019  21.305 1.00 59.15  ? 130 LEU B C     1 
ATOM   3295 O O     . LEU B 1 104 ? 21.241  83.232  21.708 1.00 59.39  ? 130 LEU B O     1 
ATOM   3296 C CB    . LEU B 1 104 ? 23.004  84.196  18.952 1.00 59.83  ? 130 LEU B CB    1 
ATOM   3297 C CG    . LEU B 1 104 ? 22.716  84.487  17.469 1.00 61.40  ? 130 LEU B CG    1 
ATOM   3298 C CD1   . LEU B 1 104 ? 23.964  84.393  16.598 1.00 60.78  ? 130 LEU B CD1   1 
ATOM   3299 C CD2   . LEU B 1 104 ? 21.602  83.605  16.916 1.00 61.59  ? 130 LEU B CD2   1 
ATOM   3300 N N     . TRP B 1 105 ? 23.155  84.362  22.024 1.00 57.81  ? 131 TRP B N     1 
ATOM   3301 C CA    . TRP B 1 105 ? 23.472  83.738  23.301 1.00 56.52  ? 131 TRP B CA    1 
ATOM   3302 C C     . TRP B 1 105 ? 22.398  83.950  24.368 1.00 58.08  ? 131 TRP B C     1 
ATOM   3303 O O     . TRP B 1 105 ? 22.228  83.113  25.254 1.00 57.81  ? 131 TRP B O     1 
ATOM   3304 C CB    . TRP B 1 105 ? 24.841  84.229  23.780 1.00 55.27  ? 131 TRP B CB    1 
ATOM   3305 C CG    . TRP B 1 105 ? 25.266  83.744  25.126 1.00 52.67  ? 131 TRP B CG    1 
ATOM   3306 C CD1   . TRP B 1 105 ? 25.526  84.518  26.220 1.00 51.88  ? 131 TRP B CD1   1 
ATOM   3307 C CD2   . TRP B 1 105 ? 25.493  82.388  25.527 1.00 49.75  ? 131 TRP B CD2   1 
ATOM   3308 N NE1   . TRP B 1 105 ? 25.897  83.733  27.274 1.00 51.36  ? 131 TRP B NE1   1 
ATOM   3309 C CE2   . TRP B 1 105 ? 25.889  82.419  26.879 1.00 50.25  ? 131 TRP B CE2   1 
ATOM   3310 C CE3   . TRP B 1 105 ? 25.397  81.148  24.877 1.00 50.39  ? 131 TRP B CE3   1 
ATOM   3311 C CZ2   . TRP B 1 105 ? 26.186  81.259  27.603 1.00 48.79  ? 131 TRP B CZ2   1 
ATOM   3312 C CZ3   . TRP B 1 105 ? 25.694  79.992  25.591 1.00 49.46  ? 131 TRP B CZ3   1 
ATOM   3313 C CH2   . TRP B 1 105 ? 26.082  80.057  26.944 1.00 49.62  ? 131 TRP B CH2   1 
ATOM   3314 N N     . LYS B 1 106 ? 21.670  85.058  24.266 1.00 60.05  ? 132 LYS B N     1 
ATOM   3315 C CA    . LYS B 1 106 ? 20.628  85.403  25.228 1.00 62.19  ? 132 LYS B CA    1 
ATOM   3316 C C     . LYS B 1 106 ? 19.279  84.712  24.929 1.00 63.59  ? 132 LYS B C     1 
ATOM   3317 O O     . LYS B 1 106 ? 18.421  84.589  25.816 1.00 64.86  ? 132 LYS B O     1 
ATOM   3318 C CB    . LYS B 1 106 ? 20.466  86.926  25.268 1.00 63.67  ? 132 LYS B CB    1 
ATOM   3319 C CG    . LYS B 1 106 ? 19.872  87.477  26.560 1.00 66.75  ? 132 LYS B CG    1 
ATOM   3320 C CD    . LYS B 1 106 ? 19.861  89.021  26.591 1.00 69.62  ? 132 LYS B CD    1 
ATOM   3321 C CE    . LYS B 1 106 ? 21.126  89.600  27.233 1.00 69.43  ? 132 LYS B CE    1 
ATOM   3322 N NZ    . LYS B 1 106 ? 21.021  91.087  27.420 1.00 72.32  ? 132 LYS B NZ    1 
ATOM   3323 N N     . ASP B 1 107 ? 19.103  84.266  23.684 1.00 63.66  ? 133 ASP B N     1 
ATOM   3324 C CA    . ASP B 1 107 ? 17.867  83.610  23.229 1.00 64.99  ? 133 ASP B CA    1 
ATOM   3325 C C     . ASP B 1 107 ? 17.593  82.299  23.978 1.00 64.78  ? 133 ASP B C     1 
ATOM   3326 O O     . ASP B 1 107 ? 18.502  81.483  24.165 1.00 63.09  ? 133 ASP B O     1 
ATOM   3327 C CB    . ASP B 1 107 ? 17.939  83.335  21.724 1.00 65.01  ? 133 ASP B CB    1 
ATOM   3328 C CG    . ASP B 1 107 ? 16.706  82.625  21.204 1.00 67.40  ? 133 ASP B CG    1 
ATOM   3329 O OD1   . ASP B 1 107 ? 15.688  83.312  20.949 1.00 69.31  ? 133 ASP B OD1   1 
ATOM   3330 O OD2   . ASP B 1 107 ? 16.753  81.380  21.056 1.00 66.87  ? 133 ASP B OD2   1 
ATOM   3331 N N     . SER B 1 108 ? 16.333  82.102  24.367 1.00 66.60  ? 134 SER B N     1 
ATOM   3332 C CA    . SER B 1 108 ? 15.917  81.003  25.236 1.00 66.72  ? 134 SER B CA    1 
ATOM   3333 C C     . SER B 1 108 ? 16.094  79.629  24.589 1.00 66.18  ? 134 SER B C     1 
ATOM   3334 O O     . SER B 1 108 ? 16.396  78.650  25.282 1.00 65.31  ? 134 SER B O     1 
ATOM   3335 C CB    . SER B 1 108 ? 14.461  81.195  25.682 1.00 69.85  ? 134 SER B CB    1 
ATOM   3336 O OG    . SER B 1 108 ? 13.561  81.077  24.589 1.00 71.72  ? 134 SER B OG    1 
ATOM   3337 N N     . GLY B 1 109 ? 15.897  79.563  23.271 1.00 66.59  ? 135 GLY B N     1 
ATOM   3338 C CA    . GLY B 1 109 ? 16.172  78.354  22.500 1.00 66.11  ? 135 GLY B CA    1 
ATOM   3339 C C     . GLY B 1 109 ? 17.650  77.983  22.555 1.00 63.44  ? 135 GLY B C     1 
ATOM   3340 O O     . GLY B 1 109 ? 18.012  76.880  22.977 1.00 62.53  ? 135 GLY B O     1 
ATOM   3341 N N     . VAL B 1 110 ? 18.502  78.917  22.139 1.00 62.21  ? 136 VAL B N     1 
ATOM   3342 C CA    . VAL B 1 110 ? 19.948  78.741  22.186 1.00 59.79  ? 136 VAL B CA    1 
ATOM   3343 C C     . VAL B 1 110 ? 20.378  78.249  23.570 1.00 58.81  ? 136 VAL B C     1 
ATOM   3344 O O     . VAL B 1 110 ? 21.165  77.318  23.676 1.00 57.90  ? 136 VAL B O     1 
ATOM   3345 C CB    . VAL B 1 110 ? 20.684  80.045  21.790 1.00 59.21  ? 136 VAL B CB    1 
ATOM   3346 C CG1   . VAL B 1 110 ? 22.196  79.910  21.953 1.00 56.69  ? 136 VAL B CG1   1 
ATOM   3347 C CG2   . VAL B 1 110 ? 20.336  80.426  20.356 1.00 59.82  ? 136 VAL B CG2   1 
ATOM   3348 N N     . GLN B 1 111 ? 19.824  78.851  24.620 1.00 59.56  ? 137 GLN B N     1 
ATOM   3349 C CA    . GLN B 1 111 ? 20.091  78.436  25.999 1.00 58.63  ? 137 GLN B CA    1 
ATOM   3350 C C     . GLN B 1 111 ? 19.585  77.026  26.315 1.00 58.85  ? 137 GLN B C     1 
ATOM   3351 O O     . GLN B 1 111 ? 20.247  76.264  27.027 1.00 58.33  ? 137 GLN B O     1 
ATOM   3352 C CB    . GLN B 1 111 ? 19.487  79.447  26.982 1.00 60.02  ? 137 GLN B CB    1 
ATOM   3353 C CG    . GLN B 1 111 ? 20.323  80.703  27.169 1.00 59.08  ? 137 GLN B CG    1 
ATOM   3354 C CD    . GLN B 1 111 ? 21.738  80.394  27.646 1.00 57.69  ? 137 GLN B CD    1 
ATOM   3355 O OE1   . GLN B 1 111 ? 21.932  79.685  28.636 1.00 58.04  ? 137 GLN B OE1   1 
ATOM   3356 N NE2   . GLN B 1 111 ? 22.732  80.919  26.937 1.00 55.47  ? 137 GLN B NE2   1 
ATOM   3357 N N     . ALA B 1 112 ? 18.415  76.673  25.794 1.00 60.14  ? 138 ALA B N     1 
ATOM   3358 C CA    . ALA B 1 112 ? 17.875  75.328  26.000 1.00 60.27  ? 138 ALA B CA    1 
ATOM   3359 C C     . ALA B 1 112 ? 18.766  74.283  25.318 1.00 58.47  ? 138 ALA B C     1 
ATOM   3360 O O     . ALA B 1 112 ? 18.883  73.153  25.787 1.00 58.00  ? 138 ALA B O     1 
ATOM   3361 C CB    . ALA B 1 112 ? 16.444  75.239  25.477 1.00 63.01  ? 138 ALA B CB    1 
ATOM   3362 N N     . CYS B 1 113 ? 19.371  74.681  24.201 1.00 57.36  ? 139 CYS B N     1 
ATOM   3363 C CA    . CYS B 1 113 ? 20.329  73.854  23.490 1.00 55.89  ? 139 CYS B CA    1 
ATOM   3364 C C     . CYS B 1 113 ? 21.662  73.783  24.232 1.00 53.28  ? 139 CYS B C     1 
ATOM   3365 O O     . CYS B 1 113 ? 22.277  72.714  24.311 1.00 52.83  ? 139 CYS B O     1 
ATOM   3366 C CB    . CYS B 1 113 ? 20.558  74.385  22.079 1.00 56.39  ? 139 CYS B CB    1 
ATOM   3367 S SG    . CYS B 1 113 ? 21.584  73.275  21.100 1.00 56.55  ? 139 CYS B SG    1 
ATOM   3368 N N     . PHE B 1 114 ? 22.102  74.921  24.770 1.00 51.63  ? 140 PHE B N     1 
ATOM   3369 C CA    . PHE B 1 114 ? 23.306  74.963  25.575 1.00 49.33  ? 140 PHE B CA    1 
ATOM   3370 C C     . PHE B 1 114 ? 23.212  73.991  26.734 1.00 49.16  ? 140 PHE B C     1 
ATOM   3371 O O     . PHE B 1 114 ? 24.173  73.309  27.043 1.00 47.91  ? 140 PHE B O     1 
ATOM   3372 C CB    . PHE B 1 114 ? 23.581  76.371  26.122 1.00 48.80  ? 140 PHE B CB    1 
ATOM   3373 C CG    . PHE B 1 114 ? 24.718  76.416  27.121 1.00 45.17  ? 140 PHE B CG    1 
ATOM   3374 C CD1   . PHE B 1 114 ? 26.018  76.114  26.724 1.00 41.29  ? 140 PHE B CD1   1 
ATOM   3375 C CD2   . PHE B 1 114 ? 24.479  76.733  28.460 1.00 43.59  ? 140 PHE B CD2   1 
ATOM   3376 C CE1   . PHE B 1 114 ? 27.079  76.146  27.646 1.00 39.65  ? 140 PHE B CE1   1 
ATOM   3377 C CE2   . PHE B 1 114 ? 25.524  76.771  29.399 1.00 40.64  ? 140 PHE B CE2   1 
ATOM   3378 C CZ    . PHE B 1 114 ? 26.826  76.483  28.995 1.00 39.91  ? 140 PHE B CZ    1 
ATOM   3379 N N     . ASN B 1 115 ? 22.054  73.961  27.382 1.00 50.73  ? 141 ASN B N     1 
ATOM   3380 C CA    . ASN B 1 115 ? 21.821  73.102  28.534 1.00 51.37  ? 141 ASN B CA    1 
ATOM   3381 C C     . ASN B 1 115 ? 21.604  71.622  28.187 1.00 51.39  ? 141 ASN B C     1 
ATOM   3382 O O     . ASN B 1 115 ? 21.504  70.778  29.079 1.00 51.49  ? 141 ASN B O     1 
ATOM   3383 C CB    . ASN B 1 115 ? 20.651  73.652  29.373 1.00 53.45  ? 141 ASN B CB    1 
ATOM   3384 C CG    . ASN B 1 115 ? 21.063  74.828  30.240 1.00 54.67  ? 141 ASN B CG    1 
ATOM   3385 O OD1   . ASN B 1 115 ? 22.127  74.810  30.879 1.00 55.14  ? 141 ASN B OD1   1 
ATOM   3386 N ND2   . ASN B 1 115 ? 20.223  75.857  30.275 1.00 56.41  ? 141 ASN B ND2   1 
ATOM   3387 N N     . ARG B 1 116 ? 21.527  71.319  26.895 1.00 51.36  ? 142 ARG B N     1 
ATOM   3388 C CA    . ARG B 1 116 ? 21.485  69.940  26.430 1.00 51.14  ? 142 ARG B CA    1 
ATOM   3389 C C     . ARG B 1 116 ? 22.782  69.550  25.694 1.00 49.41  ? 142 ARG B C     1 
ATOM   3390 O O     . ARG B 1 116 ? 22.806  68.635  24.852 1.00 49.96  ? 142 ARG B O     1 
ATOM   3391 C CB    . ARG B 1 116 ? 20.248  69.720  25.569 1.00 53.14  ? 142 ARG B CB    1 
ATOM   3392 C CG    . ARG B 1 116 ? 18.949  69.698  26.380 1.00 55.40  ? 142 ARG B CG    1 
ATOM   3393 C CD    . ARG B 1 116 ? 17.738  69.692  25.470 1.00 57.99  ? 142 ARG B CD    1 
ATOM   3394 N NE    . ARG B 1 116 ? 17.805  68.603  24.497 1.00 59.80  ? 142 ARG B NE    1 
ATOM   3395 C CZ    . ARG B 1 116 ? 16.880  68.353  23.578 1.00 62.05  ? 142 ARG B CZ    1 
ATOM   3396 N NH1   . ARG B 1 116 ? 15.800  69.110  23.497 1.00 65.46  ? 142 ARG B NH1   1 
ATOM   3397 N NH2   . ARG B 1 116 ? 17.033  67.336  22.742 1.00 63.12  ? 142 ARG B NH2   1 
ATOM   3398 N N     . SER B 1 117 ? 23.863  70.236  26.049 1.00 47.31  ? 143 SER B N     1 
ATOM   3399 C CA    . SER B 1 117 ? 25.196  69.983  25.484 1.00 45.81  ? 143 SER B CA    1 
ATOM   3400 C C     . SER B 1 117 ? 25.731  68.552  25.655 1.00 45.13  ? 143 SER B C     1 
ATOM   3401 O O     . SER B 1 117 ? 26.636  68.154  24.933 1.00 44.96  ? 143 SER B O     1 
ATOM   3402 C CB    . SER B 1 117 ? 26.203  70.979  26.056 1.00 44.43  ? 143 SER B CB    1 
ATOM   3403 O OG    . SER B 1 117 ? 26.459  70.698  27.417 1.00 44.11  ? 143 SER B OG    1 
ATOM   3404 N N     . ARG B 1 118 ? 25.194  67.786  26.603 1.00 45.06  ? 144 ARG B N     1 
ATOM   3405 C CA    . ARG B 1 118 ? 25.619  66.385  26.803 1.00 44.98  ? 144 ARG B CA    1 
ATOM   3406 C C     . ARG B 1 118 ? 25.211  65.486  25.624 1.00 46.54  ? 144 ARG B C     1 
ATOM   3407 O O     . ARG B 1 118 ? 25.693  64.361  25.487 1.00 46.61  ? 144 ARG B O     1 
ATOM   3408 C CB    . ARG B 1 118 ? 25.057  65.827  28.116 1.00 45.06  ? 144 ARG B CB    1 
ATOM   3409 C CG    . ARG B 1 118 ? 23.533  65.975  28.264 1.00 46.71  ? 144 ARG B CG    1 
ATOM   3410 C CD    . ARG B 1 118 ? 23.038  65.312  29.538 1.00 48.28  ? 144 ARG B CD    1 
ATOM   3411 N NE    . ARG B 1 118 ? 23.330  63.890  29.463 1.00 51.34  ? 144 ARG B NE    1 
ATOM   3412 C CZ    . ARG B 1 118 ? 22.447  62.938  29.189 1.00 51.46  ? 144 ARG B CZ    1 
ATOM   3413 N NH1   . ARG B 1 118 ? 21.168  63.230  29.014 1.00 53.08  ? 144 ARG B NH1   1 
ATOM   3414 N NH2   . ARG B 1 118 ? 22.856  61.687  29.110 1.00 50.56  ? 144 ARG B NH2   1 
ATOM   3415 N N     . GLU B 1 119 ? 24.322  66.001  24.779 1.00 48.31  ? 145 GLU B N     1 
ATOM   3416 C CA    . GLU B 1 119 ? 23.857  65.310  23.586 1.00 50.35  ? 145 GLU B CA    1 
ATOM   3417 C C     . GLU B 1 119 ? 24.725  65.626  22.368 1.00 50.45  ? 145 GLU B C     1 
ATOM   3418 O O     . GLU B 1 119 ? 24.563  65.006  21.316 1.00 52.63  ? 145 GLU B O     1 
ATOM   3419 C CB    . GLU B 1 119 ? 22.395  65.665  23.295 1.00 52.14  ? 145 GLU B CB    1 
ATOM   3420 C CG    . GLU B 1 119 ? 21.434  65.324  24.430 1.00 54.10  ? 145 GLU B CG    1 
ATOM   3421 C CD    . GLU B 1 119 ? 20.009  65.757  24.146 1.00 59.33  ? 145 GLU B CD    1 
ATOM   3422 O OE1   . GLU B 1 119 ? 19.519  65.507  23.021 1.00 62.55  ? 145 GLU B OE1   1 
ATOM   3423 O OE2   . GLU B 1 119 ? 19.373  66.356  25.046 1.00 60.80  ? 145 GLU B OE2   1 
ATOM   3424 N N     . TYR B 1 120 ? 25.635  66.588  22.501 1.00 48.64  ? 146 TYR B N     1 
ATOM   3425 C CA    . TYR B 1 120 ? 26.586  66.883  21.430 1.00 48.70  ? 146 TYR B CA    1 
ATOM   3426 C C     . TYR B 1 120 ? 27.967  67.175  22.016 1.00 47.41  ? 146 TYR B C     1 
ATOM   3427 O O     . TYR B 1 120 ? 28.246  66.789  23.152 1.00 46.55  ? 146 TYR B O     1 
ATOM   3428 C CB    . TYR B 1 120 ? 26.066  67.977  20.467 1.00 49.37  ? 146 TYR B CB    1 
ATOM   3429 C CG    . TYR B 1 120 ? 25.663  69.296  21.117 1.00 47.86  ? 146 TYR B CG    1 
ATOM   3430 C CD1   . TYR B 1 120 ? 24.431  69.442  21.753 1.00 46.87  ? 146 TYR B CD1   1 
ATOM   3431 C CD2   . TYR B 1 120 ? 26.507  70.402  21.064 1.00 45.83  ? 146 TYR B CD2   1 
ATOM   3432 C CE1   . TYR B 1 120 ? 24.061  70.646  22.333 1.00 46.75  ? 146 TYR B CE1   1 
ATOM   3433 C CE2   . TYR B 1 120 ? 26.149  71.607  21.643 1.00 45.30  ? 146 TYR B CE2   1 
ATOM   3434 C CZ    . TYR B 1 120 ? 24.929  71.718  22.279 1.00 46.24  ? 146 TYR B CZ    1 
ATOM   3435 O OH    . TYR B 1 120 ? 24.584  72.906  22.861 1.00 47.42  ? 146 TYR B OH    1 
ATOM   3436 N N     . LEU B 1 121 ? 28.842  67.818  21.249 1.00 48.06  ? 147 LEU B N     1 
ATOM   3437 C CA    . LEU B 1 121 ? 30.204  68.089  21.723 1.00 47.34  ? 147 LEU B CA    1 
ATOM   3438 C C     . LEU B 1 121 ? 30.483  69.577  21.798 1.00 46.41  ? 147 LEU B C     1 
ATOM   3439 O O     . LEU B 1 121 ? 30.708  70.226  20.788 1.00 48.26  ? 147 LEU B O     1 
ATOM   3440 C CB    . LEU B 1 121 ? 31.222  67.413  20.813 1.00 48.68  ? 147 LEU B CB    1 
ATOM   3441 C CG    . LEU B 1 121 ? 30.983  65.930  20.518 1.00 51.49  ? 147 LEU B CG    1 
ATOM   3442 C CD1   . LEU B 1 121 ? 31.827  65.493  19.327 1.00 54.33  ? 147 LEU B CD1   1 
ATOM   3443 C CD2   . LEU B 1 121 ? 31.247  65.057  21.755 1.00 51.53  ? 147 LEU B CD2   1 
ATOM   3444 N N     . LEU B 1 122 ? 30.442  70.131  22.999 1.00 44.54  ? 148 LEU B N     1 
ATOM   3445 C CA    . LEU B 1 122 ? 30.639  71.556  23.162 1.00 42.97  ? 148 LEU B CA    1 
ATOM   3446 C C     . LEU B 1 122 ? 31.841  71.736  24.058 1.00 42.33  ? 148 LEU B C     1 
ATOM   3447 O O     . LEU B 1 122 ? 31.889  71.183  25.157 1.00 41.53  ? 148 LEU B O     1 
ATOM   3448 C CB    . LEU B 1 122 ? 29.399  72.213  23.775 1.00 42.53  ? 148 LEU B CB    1 
ATOM   3449 C CG    . LEU B 1 122 ? 29.414  73.751  23.946 1.00 42.62  ? 148 LEU B CG    1 
ATOM   3450 C CD1   . LEU B 1 122 ? 29.519  74.507  22.603 1.00 40.87  ? 148 LEU B CD1   1 
ATOM   3451 C CD2   . LEU B 1 122 ? 28.198  74.220  24.714 1.00 40.62  ? 148 LEU B CD2   1 
ATOM   3452 N N     . ASN B 1 123 ? 32.824  72.482  23.568 1.00 42.37  ? 149 ASN B N     1 
ATOM   3453 C CA    . ASN B 1 123 ? 34.039  72.747  24.314 1.00 42.02  ? 149 ASN B CA    1 
ATOM   3454 C C     . ASN B 1 123 ? 33.717  73.441  25.640 1.00 41.49  ? 149 ASN B C     1 
ATOM   3455 O O     . ASN B 1 123 ? 32.740  74.185  25.728 1.00 41.26  ? 149 ASN B O     1 
ATOM   3456 C CB    . ASN B 1 123 ? 35.013  73.578  23.478 1.00 42.80  ? 149 ASN B CB    1 
ATOM   3457 C CG    . ASN B 1 123 ? 34.635  75.035  23.428 1.00 42.95  ? 149 ASN B CG    1 
ATOM   3458 O OD1   . ASN B 1 123 ? 35.072  75.822  24.257 1.00 42.76  ? 149 ASN B OD1   1 
ATOM   3459 N ND2   . ASN B 1 123 ? 33.782  75.397  22.479 1.00 44.85  ? 149 ASN B ND2   1 
ATOM   3460 N N     . ASP B 1 124 ? 34.538  73.181  26.658 1.00 41.27  ? 150 ASP B N     1 
ATOM   3461 C CA    . ASP B 1 124 ? 34.295  73.668  28.015 1.00 40.97  ? 150 ASP B CA    1 
ATOM   3462 C C     . ASP B 1 124 ? 34.788  75.090  28.279 1.00 42.09  ? 150 ASP B C     1 
ATOM   3463 O O     . ASP B 1 124 ? 34.813  75.548  29.424 1.00 42.32  ? 150 ASP B O     1 
ATOM   3464 C CB    . ASP B 1 124 ? 34.856  72.682  29.035 1.00 40.48  ? 150 ASP B CB    1 
ATOM   3465 C CG    . ASP B 1 124 ? 33.914  71.517  29.286 1.00 40.08  ? 150 ASP B CG    1 
ATOM   3466 O OD1   . ASP B 1 124 ? 32.684  71.769  29.361 1.00 39.16  ? 150 ASP B OD1   1 
ATOM   3467 O OD2   . ASP B 1 124 ? 34.395  70.365  29.419 1.00 37.60  ? 150 ASP B OD2   1 
ATOM   3468 N N     . SER B 1 125 ? 35.169  75.787  27.210 1.00 42.91  ? 151 SER B N     1 
ATOM   3469 C CA    . SER B 1 125 ? 35.463  77.217  27.274 1.00 44.18  ? 151 SER B CA    1 
ATOM   3470 C C     . SER B 1 125 ? 34.301  78.045  26.719 1.00 44.16  ? 151 SER B C     1 
ATOM   3471 O O     . SER B 1 125 ? 34.378  79.273  26.693 1.00 45.58  ? 151 SER B O     1 
ATOM   3472 C CB    . SER B 1 125 ? 36.745  77.551  26.493 1.00 45.24  ? 151 SER B CB    1 
ATOM   3473 O OG    . SER B 1 125 ? 37.911  77.052  27.129 1.00 45.73  ? 151 SER B OG    1 
ATOM   3474 N N     . ALA B 1 126 ? 33.228  77.382  26.292 1.00 43.63  ? 152 ALA B N     1 
ATOM   3475 C CA    . ALA B 1 126 ? 32.112  78.054  25.601 1.00 44.20  ? 152 ALA B CA    1 
ATOM   3476 C C     . ALA B 1 126 ? 31.389  79.100  26.444 1.00 44.92  ? 152 ALA B C     1 
ATOM   3477 O O     . ALA B 1 126 ? 31.282  80.258  26.031 1.00 45.39  ? 152 ALA B O     1 
ATOM   3478 C CB    . ALA B 1 126 ? 31.127  77.046  25.058 1.00 43.66  ? 152 ALA B CB    1 
ATOM   3479 N N     . ALA B 1 127 ? 30.898  78.705  27.619 1.00 45.05  ? 153 ALA B N     1 
ATOM   3480 C CA    . ALA B 1 127 ? 30.192  79.658  28.486 1.00 46.12  ? 153 ALA B CA    1 
ATOM   3481 C C     . ALA B 1 127 ? 31.150  80.718  29.027 1.00 47.06  ? 153 ALA B C     1 
ATOM   3482 O O     . ALA B 1 127 ? 30.757  81.873  29.236 1.00 48.15  ? 153 ALA B O     1 
ATOM   3483 C CB    . ALA B 1 127 ? 29.491  78.946  29.620 1.00 46.15  ? 153 ALA B CB    1 
ATOM   3484 N N     . TYR B 1 128 ? 32.406  80.331  29.226 1.00 46.90  ? 154 TYR B N     1 
ATOM   3485 C CA    . TYR B 1 128 ? 33.412  81.251  29.746 1.00 48.68  ? 154 TYR B CA    1 
ATOM   3486 C C     . TYR B 1 128 ? 33.561  82.512  28.883 1.00 49.57  ? 154 TYR B C     1 
ATOM   3487 O O     . TYR B 1 128 ? 33.599  83.617  29.408 1.00 50.80  ? 154 TYR B O     1 
ATOM   3488 C CB    . TYR B 1 128 ? 34.765  80.550  29.923 1.00 48.67  ? 154 TYR B CB    1 
ATOM   3489 C CG    . TYR B 1 128 ? 35.867  81.483  30.371 1.00 50.95  ? 154 TYR B CG    1 
ATOM   3490 C CD1   . TYR B 1 128 ? 36.154  81.661  31.734 1.00 52.76  ? 154 TYR B CD1   1 
ATOM   3491 C CD2   . TYR B 1 128 ? 36.618  82.200  29.436 1.00 51.67  ? 154 TYR B CD2   1 
ATOM   3492 C CE1   . TYR B 1 128 ? 37.162  82.533  32.148 1.00 54.34  ? 154 TYR B CE1   1 
ATOM   3493 C CE2   . TYR B 1 128 ? 37.626  83.078  29.839 1.00 53.69  ? 154 TYR B CE2   1 
ATOM   3494 C CZ    . TYR B 1 128 ? 37.893  83.240  31.187 1.00 55.47  ? 154 TYR B CZ    1 
ATOM   3495 O OH    . TYR B 1 128 ? 38.897  84.100  31.568 1.00 57.57  ? 154 TYR B OH    1 
ATOM   3496 N N     . TYR B 1 129 ? 33.652  82.349  27.568 1.00 49.60  ? 155 TYR B N     1 
ATOM   3497 C CA    . TYR B 1 129 ? 33.759  83.506  26.677 1.00 50.97  ? 155 TYR B CA    1 
ATOM   3498 C C     . TYR B 1 129 ? 32.412  84.172  26.406 1.00 51.37  ? 155 TYR B C     1 
ATOM   3499 O O     . TYR B 1 129 ? 32.311  85.413  26.404 1.00 52.60  ? 155 TYR B O     1 
ATOM   3500 C CB    . TYR B 1 129 ? 34.460  83.143  25.365 1.00 51.04  ? 155 TYR B CB    1 
ATOM   3501 C CG    . TYR B 1 129 ? 35.924  82.766  25.542 1.00 52.25  ? 155 TYR B CG    1 
ATOM   3502 C CD1   . TYR B 1 129 ? 36.814  83.630  26.179 1.00 54.76  ? 155 TYR B CD1   1 
ATOM   3503 C CD2   . TYR B 1 129 ? 36.418  81.553  25.061 1.00 52.08  ? 155 TYR B CD2   1 
ATOM   3504 C CE1   . TYR B 1 129 ? 38.164  83.292  26.343 1.00 56.38  ? 155 TYR B CE1   1 
ATOM   3505 C CE2   . TYR B 1 129 ? 37.768  81.204  25.221 1.00 52.94  ? 155 TYR B CE2   1 
ATOM   3506 C CZ    . TYR B 1 129 ? 38.628  82.079  25.862 1.00 55.35  ? 155 TYR B CZ    1 
ATOM   3507 O OH    . TYR B 1 129 ? 39.955  81.761  26.023 1.00 56.32  ? 155 TYR B OH    1 
ATOM   3508 N N     . LEU B 1 130 ? 31.378  83.361  26.207 1.00 50.67  ? 156 LEU B N     1 
ATOM   3509 C CA    . LEU B 1 130 ? 30.077  83.894  25.800 1.00 51.49  ? 156 LEU B CA    1 
ATOM   3510 C C     . LEU B 1 130 ? 29.413  84.738  26.873 1.00 53.08  ? 156 LEU B C     1 
ATOM   3511 O O     . LEU B 1 130 ? 28.685  85.669  26.551 1.00 54.81  ? 156 LEU B O     1 
ATOM   3512 C CB    . LEU B 1 130 ? 29.137  82.788  25.311 1.00 50.30  ? 156 LEU B CB    1 
ATOM   3513 C CG    . LEU B 1 130 ? 29.455  82.216  23.926 1.00 49.13  ? 156 LEU B CG    1 
ATOM   3514 C CD1   . LEU B 1 130 ? 28.849  80.845  23.748 1.00 47.85  ? 156 LEU B CD1   1 
ATOM   3515 C CD2   . LEU B 1 130 ? 28.977  83.143  22.823 1.00 49.55  ? 156 LEU B CD2   1 
ATOM   3516 N N     . ASN B 1 131 ? 29.666  84.425  28.140 1.00 53.77  ? 157 ASN B N     1 
ATOM   3517 C CA    . ASN B 1 131 ? 29.117  85.211  29.245 1.00 55.38  ? 157 ASN B CA    1 
ATOM   3518 C C     . ASN B 1 131 ? 29.889  86.509  29.508 1.00 57.15  ? 157 ASN B C     1 
ATOM   3519 O O     . ASN B 1 131 ? 29.441  87.354  30.288 1.00 58.67  ? 157 ASN B O     1 
ATOM   3520 C CB    . ASN B 1 131 ? 29.053  84.366  30.523 1.00 55.54  ? 157 ASN B CB    1 
ATOM   3521 C CG    . ASN B 1 131 ? 27.846  83.441  30.563 1.00 55.05  ? 157 ASN B CG    1 
ATOM   3522 O OD1   . ASN B 1 131 ? 26.783  83.745  30.021 1.00 55.43  ? 157 ASN B OD1   1 
ATOM   3523 N ND2   . ASN B 1 131 ? 28.005  82.310  31.224 1.00 55.45  ? 157 ASN B ND2   1 
ATOM   3524 N N     . ASP B 1 132 ? 31.040  86.654  28.854 1.00 57.47  ? 158 ASP B N     1 
ATOM   3525 C CA    . ASP B 1 132 ? 31.933  87.797  29.025 1.00 59.42  ? 158 ASP B CA    1 
ATOM   3526 C C     . ASP B 1 132 ? 32.023  88.655  27.754 1.00 60.09  ? 158 ASP B C     1 
ATOM   3527 O O     . ASP B 1 132 ? 33.015  89.362  27.547 1.00 61.31  ? 158 ASP B O     1 
ATOM   3528 C CB    . ASP B 1 132 ? 33.350  87.314  29.362 1.00 59.99  ? 158 ASP B CB    1 
ATOM   3529 C CG    . ASP B 1 132 ? 33.492  86.756  30.782 1.00 61.02  ? 158 ASP B CG    1 
ATOM   3530 O OD1   . ASP B 1 132 ? 32.512  86.735  31.567 1.00 61.60  ? 158 ASP B OD1   1 
ATOM   3531 O OD2   . ASP B 1 132 ? 34.627  86.332  31.104 1.00 61.26  ? 158 ASP B OD2   1 
ATOM   3532 N N     . LEU B 1 133 ? 31.004  88.595  26.905 1.00 65.36  ? 159 LEU B N     1 
ATOM   3533 C CA    . LEU B 1 133 ? 31.022  89.335  25.645 1.00 66.64  ? 159 LEU B CA    1 
ATOM   3534 C C     . LEU B 1 133 ? 31.325  90.829  25.807 1.00 67.80  ? 159 LEU B C     1 
ATOM   3535 O O     . LEU B 1 133 ? 32.179  91.370  25.098 1.00 68.38  ? 159 LEU B O     1 
ATOM   3536 C CB    . LEU B 1 133 ? 29.711  89.133  24.890 1.00 67.06  ? 159 LEU B CB    1 
ATOM   3537 C CG    . LEU B 1 133 ? 29.699  87.931  23.956 1.00 67.39  ? 159 LEU B CG    1 
ATOM   3538 C CD1   . LEU B 1 133 ? 28.266  87.499  23.674 1.00 69.41  ? 159 LEU B CD1   1 
ATOM   3539 C CD2   . LEU B 1 133 ? 30.453  88.235  22.654 1.00 68.41  ? 159 LEU B CD2   1 
ATOM   3540 N N     . ASP B 1 134 ? 30.640  91.483  26.746 1.00 68.22  ? 160 ASP B N     1 
ATOM   3541 C CA    . ASP B 1 134 ? 30.862  92.907  27.020 1.00 69.51  ? 160 ASP B CA    1 
ATOM   3542 C C     . ASP B 1 134 ? 32.341  93.264  27.159 1.00 69.97  ? 160 ASP B C     1 
ATOM   3543 O O     . ASP B 1 134 ? 32.793  94.261  26.597 1.00 71.31  ? 160 ASP B O     1 
ATOM   3544 C CB    . ASP B 1 134 ? 30.111  93.344  28.277 1.00 69.32  ? 160 ASP B CB    1 
ATOM   3545 C CG    . ASP B 1 134 ? 28.614  93.420  28.069 1.00 69.80  ? 160 ASP B CG    1 
ATOM   3546 O OD1   . ASP B 1 134 ? 28.135  93.167  26.937 1.00 69.53  ? 160 ASP B OD1   1 
ATOM   3547 O OD2   . ASP B 1 134 ? 27.909  93.740  29.052 1.00 70.03  ? 160 ASP B OD2   1 
ATOM   3548 N N     . ARG B 1 135 ? 33.084  92.439  27.894 1.00 69.39  ? 161 ARG B N     1 
ATOM   3549 C CA    . ARG B 1 135 ? 34.489  92.710  28.183 1.00 69.94  ? 161 ARG B CA    1 
ATOM   3550 C C     . ARG B 1 135 ? 35.404  92.362  27.009 1.00 70.27  ? 161 ARG B C     1 
ATOM   3551 O O     . ARG B 1 135 ? 36.291  93.150  26.658 1.00 71.55  ? 161 ARG B O     1 
ATOM   3552 C CB    . ARG B 1 135 ? 34.926  91.984  29.465 1.00 69.28  ? 161 ARG B CB    1 
ATOM   3553 C CG    . ARG B 1 135 ? 36.416  92.070  29.781 1.00 69.91  ? 161 ARG B CG    1 
ATOM   3554 C CD    . ARG B 1 135 ? 36.752  91.425  31.125 1.00 70.28  ? 161 ARG B CD    1 
ATOM   3555 N NE    . ARG B 1 135 ? 36.542  89.975  31.128 1.00 69.25  ? 161 ARG B NE    1 
ATOM   3556 C CZ    . ARG B 1 135 ? 37.457  89.073  30.775 1.00 68.83  ? 161 ARG B CZ    1 
ATOM   3557 N NH1   . ARG B 1 135 ? 38.667  89.452  30.376 1.00 69.38  ? 161 ARG B NH1   1 
ATOM   3558 N NH2   . ARG B 1 135 ? 37.159  87.782  30.821 1.00 67.93  ? 161 ARG B NH2   1 
ATOM   3559 N N     . ILE B 1 136 ? 35.190  91.202  26.393 1.00 69.24  ? 162 ILE B N     1 
ATOM   3560 C CA    . ILE B 1 136 ? 36.102  90.746  25.346 1.00 69.64  ? 162 ILE B CA    1 
ATOM   3561 C C     . ILE B 1 136 ? 35.889  91.447  23.999 1.00 70.94  ? 162 ILE B C     1 
ATOM   3562 O O     . ILE B 1 136 ? 36.845  91.674  23.267 1.00 71.54  ? 162 ILE B O     1 
ATOM   3563 C CB    . ILE B 1 136 ? 36.138  89.192  25.196 1.00 68.49  ? 162 ILE B CB    1 
ATOM   3564 C CG1   . ILE B 1 136 ? 34.838  88.648  24.596 1.00 67.70  ? 162 ILE B CG1   1 
ATOM   3565 C CG2   . ILE B 1 136 ? 36.440  88.530  26.541 1.00 67.84  ? 162 ILE B CG2   1 
ATOM   3566 C CD1   . ILE B 1 136 ? 34.996  87.275  23.979 1.00 67.54  ? 162 ILE B CD1   1 
ATOM   3567 N N     . ALA B 1 137 ? 34.644  91.809  23.699 1.00 71.82  ? 163 ALA B N     1 
ATOM   3568 C CA    . ALA B 1 137 ? 34.283  92.387  22.397 1.00 73.67  ? 163 ALA B CA    1 
ATOM   3569 C C     . ALA B 1 137 ? 34.800  93.811  22.128 1.00 75.78  ? 163 ALA B C     1 
ATOM   3570 O O     . ALA B 1 137 ? 34.825  94.259  20.978 1.00 77.26  ? 163 ALA B O     1 
ATOM   3571 C CB    . ALA B 1 137 ? 32.776  92.324  22.195 1.00 73.47  ? 163 ALA B CB    1 
ATOM   3572 N N     . GLN B 1 138 ? 35.204  94.515  23.182 1.00 76.60  ? 164 GLN B N     1 
ATOM   3573 C CA    . GLN B 1 138 ? 35.686  95.898  23.078 1.00 78.77  ? 164 GLN B CA    1 
ATOM   3574 C C     . GLN B 1 138 ? 37.028  96.022  22.346 1.00 80.03  ? 164 GLN B C     1 
ATOM   3575 O O     . GLN B 1 138 ? 37.698  95.015  22.093 1.00 79.36  ? 164 GLN B O     1 
ATOM   3576 C CB    . GLN B 1 138 ? 35.809  96.512  24.472 1.00 78.95  ? 164 GLN B CB    1 
ATOM   3577 C CG    . GLN B 1 138 ? 34.483  96.848  25.134 1.00 79.74  ? 164 GLN B CG    1 
ATOM   3578 C CD    . GLN B 1 138 ? 34.636  97.123  26.624 1.00 81.44  ? 164 GLN B CD    1 
ATOM   3579 O OE1   . GLN B 1 138 ? 35.677  97.612  27.078 1.00 83.64  ? 164 GLN B OE1   1 
ATOM   3580 N NE2   . GLN B 1 138 ? 33.598  96.808  27.394 1.00 80.01  ? 164 GLN B NE2   1 
ATOM   3581 N N     . PRO B 1 139 ? 37.419  97.261  21.987 1.00 82.29  ? 165 PRO B N     1 
ATOM   3582 C CA    . PRO B 1 139 ? 38.741  97.491  21.401 1.00 83.88  ? 165 PRO B CA    1 
ATOM   3583 C C     . PRO B 1 139 ? 39.850  97.629  22.455 1.00 84.39  ? 165 PRO B C     1 
ATOM   3584 O O     . PRO B 1 139 ? 40.993  97.260  22.184 1.00 84.91  ? 165 PRO B O     1 
ATOM   3585 C CB    . PRO B 1 139 ? 38.568  98.814  20.631 1.00 86.37  ? 165 PRO B CB    1 
ATOM   3586 C CG    . PRO B 1 139 ? 37.102  99.190  20.756 1.00 85.87  ? 165 PRO B CG    1 
ATOM   3587 C CD    . PRO B 1 139 ? 36.597  98.485  21.963 1.00 83.51  ? 165 PRO B CD    1 
ATOM   3588 N N     . ASN B 1 140 ? 39.512  98.161  23.635 1.00 84.52  ? 166 ASN B N     1 
ATOM   3589 C CA    . ASN B 1 140 ? 40.462  98.320  24.750 1.00 85.19  ? 166 ASN B CA    1 
ATOM   3590 C C     . ASN B 1 140 ? 40.799  96.975  25.454 1.00 83.12  ? 166 ASN B C     1 
ATOM   3591 O O     . ASN B 1 140 ? 41.468  96.958  26.497 1.00 83.34  ? 166 ASN B O     1 
ATOM   3592 C CB    . ASN B 1 140 ? 39.929  99.347  25.781 1.00 86.00  ? 166 ASN B CB    1 
ATOM   3593 C CG    . ASN B 1 140 ? 39.841  100.801 25.232 1.00 89.84  ? 166 ASN B CG    1 
ATOM   3594 O OD1   . ASN B 1 140 ? 40.411  101.144 24.186 1.00 92.48  ? 166 ASN B OD1   1 
ATOM   3595 N ND2   . ASN B 1 140 ? 39.128  101.661 25.969 1.00 90.26  ? 166 ASN B ND2   1 
ATOM   3596 N N     . TYR B 1 141 ? 40.351  95.860  24.867 1.00 81.13  ? 167 TYR B N     1 
ATOM   3597 C CA    . TYR B 1 141 ? 40.417  94.527  25.504 1.00 78.90  ? 167 TYR B CA    1 
ATOM   3598 C C     . TYR B 1 141 ? 41.794  93.847  25.522 1.00 78.98  ? 167 TYR B C     1 
ATOM   3599 O O     . TYR B 1 141 ? 42.365  93.519  24.473 1.00 79.09  ? 167 TYR B O     1 
ATOM   3600 C CB    . TYR B 1 141 ? 39.359  93.576  24.904 1.00 77.13  ? 167 TYR B CB    1 
ATOM   3601 C CG    . TYR B 1 141 ? 39.577  92.095  25.210 1.00 75.16  ? 167 TYR B CG    1 
ATOM   3602 C CD1   . TYR B 1 141 ? 39.375  91.587  26.498 1.00 73.96  ? 167 TYR B CD1   1 
ATOM   3603 C CD2   . TYR B 1 141 ? 39.978  91.206  24.210 1.00 73.77  ? 167 TYR B CD2   1 
ATOM   3604 C CE1   . TYR B 1 141 ? 39.569  90.242  26.782 1.00 72.22  ? 167 TYR B CE1   1 
ATOM   3605 C CE2   . TYR B 1 141 ? 40.178  89.850  24.485 1.00 72.11  ? 167 TYR B CE2   1 
ATOM   3606 C CZ    . TYR B 1 141 ? 39.972  89.373  25.774 1.00 71.71  ? 167 TYR B CZ    1 
ATOM   3607 O OH    . TYR B 1 141 ? 40.168  88.031  26.068 1.00 69.18  ? 167 TYR B OH    1 
ATOM   3608 N N     . ILE B 1 142 ? 42.296  93.626  26.735 1.00 78.69  ? 168 ILE B N     1 
ATOM   3609 C CA    . ILE B 1 142 ? 43.458  92.772  26.961 1.00 78.65  ? 168 ILE B CA    1 
ATOM   3610 C C     . ILE B 1 142 ? 42.989  91.461  27.600 1.00 76.25  ? 168 ILE B C     1 
ATOM   3611 O O     . ILE B 1 142 ? 42.235  91.488  28.579 1.00 75.64  ? 168 ILE B O     1 
ATOM   3612 C CB    . ILE B 1 142 ? 44.505  93.423  27.900 1.00 80.59  ? 168 ILE B CB    1 
ATOM   3613 C CG1   . ILE B 1 142 ? 44.625  94.932  27.654 1.00 82.90  ? 168 ILE B CG1   1 
ATOM   3614 C CG2   . ILE B 1 142 ? 45.863  92.724  27.741 1.00 81.75  ? 168 ILE B CG2   1 
ATOM   3615 C CD1   . ILE B 1 142 ? 45.357  95.686  28.766 1.00 85.00  ? 168 ILE B CD1   1 
ATOM   3616 N N     . PRO B 1 143 ? 43.406  90.311  27.033 1.00 75.07  ? 169 PRO B N     1 
ATOM   3617 C CA    . PRO B 1 143 ? 43.170  89.003  27.665 1.00 73.41  ? 169 PRO B CA    1 
ATOM   3618 C C     . PRO B 1 143 ? 43.951  88.835  28.970 1.00 74.06  ? 169 PRO B C     1 
ATOM   3619 O O     . PRO B 1 143 ? 45.169  89.013  28.986 1.00 75.70  ? 169 PRO B O     1 
ATOM   3620 C CB    . PRO B 1 143 ? 43.681  88.011  26.615 1.00 72.73  ? 169 PRO B CB    1 
ATOM   3621 C CG    . PRO B 1 143 ? 43.561  88.734  25.320 1.00 73.10  ? 169 PRO B CG    1 
ATOM   3622 C CD    . PRO B 1 143 ? 43.882  90.165  25.644 1.00 75.36  ? 169 PRO B CD    1 
ATOM   3623 N N     . THR B 1 144 ? 43.250  88.504  30.052 1.00 73.13  ? 170 THR B N     1 
ATOM   3624 C CA    . THR B 1 144 ? 43.883  88.210  31.345 1.00 73.72  ? 170 THR B CA    1 
ATOM   3625 C C     . THR B 1 144 ? 44.644  86.875  31.297 1.00 73.48  ? 170 THR B C     1 
ATOM   3626 O O     . THR B 1 144 ? 44.706  86.221  30.249 1.00 72.46  ? 170 THR B O     1 
ATOM   3627 C CB    . THR B 1 144 ? 42.835  88.134  32.485 1.00 73.15  ? 170 THR B CB    1 
ATOM   3628 O OG1   . THR B 1 144 ? 41.884  87.096  32.195 1.00 71.25  ? 170 THR B OG1   1 
ATOM   3629 C CG2   . THR B 1 144 ? 42.101  89.465  32.657 1.00 73.20  ? 170 THR B CG2   1 
ATOM   3630 N N     . GLN B 1 145 ? 45.217  86.479  32.436 1.00 74.28  ? 171 GLN B N     1 
ATOM   3631 C CA    . GLN B 1 145 ? 45.878  85.176  32.575 1.00 73.99  ? 171 GLN B CA    1 
ATOM   3632 C C     . GLN B 1 145 ? 44.879  84.054  32.340 1.00 71.44  ? 171 GLN B C     1 
ATOM   3633 O O     . GLN B 1 145 ? 45.144  83.104  31.590 1.00 70.77  ? 171 GLN B O     1 
ATOM   3634 C CB    . GLN B 1 145 ? 46.481  85.031  33.970 1.00 75.65  ? 171 GLN B CB    1 
ATOM   3635 C CG    . GLN B 1 145 ? 47.781  85.780  34.168 1.00 79.45  ? 171 GLN B CG    1 
ATOM   3636 C CD    . GLN B 1 145 ? 49.006  84.928  33.869 1.00 81.68  ? 171 GLN B CD    1 
ATOM   3637 O OE1   . GLN B 1 145 ? 49.090  83.763  34.277 1.00 81.35  ? 171 GLN B OE1   1 
ATOM   3638 N NE2   . GLN B 1 145 ? 49.974  85.516  33.170 1.00 83.32  ? 171 GLN B NE2   1 
ATOM   3639 N N     . GLN B 1 146 ? 43.722  84.187  32.980 1.00 69.99  ? 172 GLN B N     1 
ATOM   3640 C CA    . GLN B 1 146 ? 42.677  83.186  32.900 1.00 67.86  ? 172 GLN B CA    1 
ATOM   3641 C C     . GLN B 1 146 ? 42.140  83.022  31.480 1.00 66.00  ? 172 GLN B C     1 
ATOM   3642 O O     . GLN B 1 146 ? 41.880  81.900  31.052 1.00 65.20  ? 172 GLN B O     1 
ATOM   3643 C CB    . GLN B 1 146 ? 41.551  83.504  33.888 1.00 67.76  ? 172 GLN B CB    1 
ATOM   3644 C CG    . GLN B 1 146 ? 40.690  82.292  34.252 1.00 67.38  ? 172 GLN B CG    1 
ATOM   3645 C CD    . GLN B 1 146 ? 41.497  81.154  34.870 1.00 68.73  ? 172 GLN B CD    1 
ATOM   3646 O OE1   . GLN B 1 146 ? 42.558  81.373  35.469 1.00 70.98  ? 172 GLN B OE1   1 
ATOM   3647 N NE2   . GLN B 1 146 ? 40.995  79.935  34.730 1.00 66.65  ? 172 GLN B NE2   1 
ATOM   3648 N N     . ASP B 1 147 ? 42.000  84.135  30.755 1.00 65.41  ? 173 ASP B N     1 
ATOM   3649 C CA    . ASP B 1 147 ? 41.521  84.120  29.367 1.00 63.87  ? 173 ASP B CA    1 
ATOM   3650 C C     . ASP B 1 147 ? 42.429  83.275  28.471 1.00 63.02  ? 173 ASP B C     1 
ATOM   3651 O O     . ASP B 1 147 ? 41.942  82.464  27.683 1.00 61.79  ? 173 ASP B O     1 
ATOM   3652 C CB    . ASP B 1 147 ? 41.401  85.546  28.790 1.00 64.67  ? 173 ASP B CB    1 
ATOM   3653 C CG    . ASP B 1 147 ? 40.333  86.396  29.489 1.00 65.37  ? 173 ASP B CG    1 
ATOM   3654 O OD1   . ASP B 1 147 ? 39.317  85.847  29.954 1.00 65.04  ? 173 ASP B OD1   1 
ATOM   3655 O OD2   . ASP B 1 147 ? 40.502  87.638  29.559 1.00 68.44  ? 173 ASP B OD2   1 
ATOM   3656 N N     . VAL B 1 148 ? 43.742  83.481  28.601 1.00 63.52  ? 174 VAL B N     1 
ATOM   3657 C CA    . VAL B 1 148 ? 44.759  82.747  27.837 1.00 63.10  ? 174 VAL B CA    1 
ATOM   3658 C C     . VAL B 1 148 ? 44.762  81.242  28.159 1.00 62.02  ? 174 VAL B C     1 
ATOM   3659 O O     . VAL B 1 148 ? 44.854  80.416  27.251 1.00 60.97  ? 174 VAL B O     1 
ATOM   3660 C CB    . VAL B 1 148 ? 46.173  83.357  28.049 1.00 65.15  ? 174 VAL B CB    1 
ATOM   3661 C CG1   . VAL B 1 148 ? 47.266  82.449  27.484 1.00 65.27  ? 174 VAL B CG1   1 
ATOM   3662 C CG2   . VAL B 1 148 ? 46.257  84.751  27.422 1.00 65.93  ? 174 VAL B CG2   1 
ATOM   3663 N N     . LEU B 1 149 ? 44.660  80.899  29.445 1.00 61.86  ? 175 LEU B N     1 
ATOM   3664 C CA    . LEU B 1 149 ? 44.478  79.507  29.875 1.00 61.12  ? 175 LEU B CA    1 
ATOM   3665 C C     . LEU B 1 149 ? 43.343  78.836  29.131 1.00 59.13  ? 175 LEU B C     1 
ATOM   3666 O O     . LEU B 1 149 ? 43.451  77.682  28.716 1.00 58.39  ? 175 LEU B O     1 
ATOM   3667 C CB    . LEU B 1 149 ? 44.142  79.437  31.365 1.00 61.79  ? 175 LEU B CB    1 
ATOM   3668 C CG    . LEU B 1 149 ? 45.177  78.913  32.346 1.00 63.89  ? 175 LEU B CG    1 
ATOM   3669 C CD1   . LEU B 1 149 ? 44.622  79.030  33.754 1.00 65.35  ? 175 LEU B CD1   1 
ATOM   3670 C CD2   . LEU B 1 149 ? 45.562  77.483  32.028 1.00 62.99  ? 175 LEU B CD2   1 
ATOM   3671 N N     . ARG B 1 150 ? 42.254  79.587  28.989 1.00 58.32  ? 176 ARG B N     1 
ATOM   3672 C CA    . ARG B 1 150 ? 41.001  79.110  28.431 1.00 57.05  ? 176 ARG B CA    1 
ATOM   3673 C C     . ARG B 1 150 ? 40.982  78.962  26.912 1.00 56.85  ? 176 ARG B C     1 
ATOM   3674 O O     . ARG B 1 150 ? 40.103  78.288  26.376 1.00 55.88  ? 176 ARG B O     1 
ATOM   3675 C CB    . ARG B 1 150 ? 39.862  80.019  28.887 1.00 56.93  ? 176 ARG B CB    1 
ATOM   3676 C CG    . ARG B 1 150 ? 39.413  79.779  30.317 1.00 56.78  ? 176 ARG B CG    1 
ATOM   3677 C CD    . ARG B 1 150 ? 38.778  78.398  30.429 1.00 55.25  ? 176 ARG B CD    1 
ATOM   3678 N NE    . ARG B 1 150 ? 38.090  78.211  31.695 1.00 54.76  ? 176 ARG B NE    1 
ATOM   3679 C CZ    . ARG B 1 150 ? 37.367  77.138  32.003 1.00 55.18  ? 176 ARG B CZ    1 
ATOM   3680 N NH1   . ARG B 1 150 ? 37.232  76.137  31.135 1.00 53.20  ? 176 ARG B NH1   1 
ATOM   3681 N NH2   . ARG B 1 150 ? 36.776  77.068  33.188 1.00 56.78  ? 176 ARG B NH2   1 
ATOM   3682 N N     . THR B 1 151 ? 41.944  79.578  26.224 1.00 58.08  ? 177 THR B N     1 
ATOM   3683 C CA    . THR B 1 151 ? 42.002  79.515  24.756 1.00 58.71  ? 177 THR B CA    1 
ATOM   3684 C C     . THR B 1 151 ? 42.301  78.102  24.275 1.00 58.66  ? 177 THR B C     1 
ATOM   3685 O O     . THR B 1 151 ? 42.936  77.317  24.976 1.00 58.47  ? 177 THR B O     1 
ATOM   3686 C CB    . THR B 1 151 ? 43.071  80.447  24.162 1.00 59.89  ? 177 THR B CB    1 
ATOM   3687 O OG1   . THR B 1 151 ? 44.366  80.066  24.642 1.00 61.08  ? 177 THR B OG1   1 
ATOM   3688 C CG2   . THR B 1 151 ? 42.803  81.906  24.519 1.00 60.98  ? 177 THR B CG2   1 
ATOM   3689 N N     . ARG B 1 152 ? 41.839  77.798  23.069 1.00 59.07  ? 178 ARG B N     1 
ATOM   3690 C CA    . ARG B 1 152 ? 42.004  76.484  22.472 1.00 59.23  ? 178 ARG B CA    1 
ATOM   3691 C C     . ARG B 1 152 ? 42.642  76.662  21.104 1.00 60.67  ? 178 ARG B C     1 
ATOM   3692 O O     . ARG B 1 152 ? 42.004  77.150  20.162 1.00 61.05  ? 178 ARG B O     1 
ATOM   3693 C CB    . ARG B 1 152 ? 40.648  75.780  22.336 1.00 58.19  ? 178 ARG B CB    1 
ATOM   3694 C CG    . ARG B 1 152 ? 39.828  75.691  23.622 1.00 56.86  ? 178 ARG B CG    1 
ATOM   3695 C CD    . ARG B 1 152 ? 38.326  75.470  23.351 1.00 53.16  ? 178 ARG B CD    1 
ATOM   3696 N NE    . ARG B 1 152 ? 38.112  74.343  22.455 1.00 51.80  ? 178 ARG B NE    1 
ATOM   3697 C CZ    . ARG B 1 152 ? 38.203  73.063  22.815 1.00 52.74  ? 178 ARG B CZ    1 
ATOM   3698 N NH1   . ARG B 1 152 ? 38.484  72.738  24.071 1.00 51.13  ? 178 ARG B NH1   1 
ATOM   3699 N NH2   . ARG B 1 152 ? 38.004  72.101  21.920 1.00 51.30  ? 178 ARG B NH2   1 
ATOM   3700 N N     . VAL B 1 153 ? 43.910  76.290  21.006 1.00 77.05  ? 179 VAL B N     1 
ATOM   3701 C CA    . VAL B 1 153 ? 44.626  76.319  19.735 1.00 79.84  ? 179 VAL B CA    1 
ATOM   3702 C C     . VAL B 1 153 ? 44.763  74.914  19.175 1.00 79.87  ? 179 VAL B C     1 
ATOM   3703 O O     . VAL B 1 153 ? 44.663  73.930  19.918 1.00 78.07  ? 179 VAL B O     1 
ATOM   3704 C CB    . VAL B 1 153 ? 46.034  76.947  19.877 1.00 80.36  ? 179 VAL B CB    1 
ATOM   3705 C CG1   . VAL B 1 153 ? 45.932  78.448  20.104 1.00 82.58  ? 179 VAL B CG1   1 
ATOM   3706 C CG2   . VAL B 1 153 ? 46.829  76.286  21.004 1.00 77.91  ? 179 VAL B CG2   1 
ATOM   3707 N N     . LYS B 1 154 ? 44.981  74.821  17.867 1.00 82.98  ? 180 LYS B N     1 
ATOM   3708 C CA    . LYS B 1 154 ? 45.377  73.556  17.253 1.00 83.95  ? 180 LYS B CA    1 
ATOM   3709 C C     . LYS B 1 154 ? 46.809  73.236  17.671 1.00 83.86  ? 180 LYS B C     1 
ATOM   3710 O O     . LYS B 1 154 ? 47.621  74.149  17.870 1.00 84.55  ? 180 LYS B O     1 
ATOM   3711 C CB    . LYS B 1 154 ? 45.285  73.634  15.727 1.00 86.77  ? 180 LYS B CB    1 
ATOM   3712 C CG    . LYS B 1 154 ? 43.979  73.117  15.134 1.00 87.92  ? 180 LYS B CG    1 
ATOM   3713 C CD    . LYS B 1 154 ? 44.022  73.144  13.604 1.00 91.68  ? 180 LYS B CD    1 
ATOM   3714 C CE    . LYS B 1 154 ? 42.821  72.428  12.977 1.00 92.72  ? 180 LYS B CE    1 
ATOM   3715 N NZ    . LYS B 1 154 ? 41.566  73.231  13.038 1.00 93.52  ? 180 LYS B NZ    1 
ATOM   3716 N N     . THR B 1 155 ? 47.106  71.945  17.821 1.00 83.68  ? 181 THR B N     1 
ATOM   3717 C CA    . THR B 1 155 ? 48.472  71.488  18.098 1.00 84.15  ? 181 THR B CA    1 
ATOM   3718 C C     . THR B 1 155 ? 49.216  71.214  16.792 1.00 86.98  ? 181 THR B C     1 
ATOM   3719 O O     . THR B 1 155 ? 48.692  70.541  15.899 1.00 88.22  ? 181 THR B O     1 
ATOM   3720 C CB    . THR B 1 155 ? 48.497  70.205  18.962 1.00 82.27  ? 181 THR B CB    1 
ATOM   3721 O OG1   . THR B 1 155 ? 47.577  69.243  18.427 1.00 82.87  ? 181 THR B OG1   1 
ATOM   3722 C CG2   . THR B 1 155 ? 48.137  70.516  20.425 1.00 80.58  ? 181 THR B CG2   1 
ATOM   3723 N N     . THR B 1 156 ? 50.432  71.746  16.678 1.00 88.66  ? 182 THR B N     1 
ATOM   3724 C CA    . THR B 1 156 ? 51.279  71.461  15.518 1.00 91.78  ? 182 THR B CA    1 
ATOM   3725 C C     . THR B 1 156 ? 52.347  70.427  15.898 1.00 91.31  ? 182 THR B C     1 
ATOM   3726 O O     . THR B 1 156 ? 53.485  70.776  16.232 1.00 91.90  ? 182 THR B O     1 
ATOM   3727 C CB    . THR B 1 156 ? 51.909  72.749  14.883 1.00 94.81  ? 182 THR B CB    1 
ATOM   3728 O OG1   . THR B 1 156 ? 52.847  73.345  15.790 1.00 94.52  ? 182 THR B OG1   1 
ATOM   3729 C CG2   . THR B 1 156 ? 50.830  73.774  14.508 1.00 95.76  ? 182 THR B CG2   1 
ATOM   3730 N N     . GLY B 1 157 ? 51.952  69.154  15.869 1.00 90.58  ? 183 GLY B N     1 
ATOM   3731 C CA    . GLY B 1 157 ? 52.856  68.043  16.165 1.00 90.42  ? 183 GLY B CA    1 
ATOM   3732 C C     . GLY B 1 157 ? 52.878  67.640  17.628 1.00 87.47  ? 183 GLY B C     1 
ATOM   3733 O O     . GLY B 1 157 ? 51.899  67.092  18.151 1.00 85.70  ? 183 GLY B O     1 
ATOM   3734 N N     . ILE B 1 158 ? 54.011  67.907  18.278 1.00 86.99  ? 184 ILE B N     1 
ATOM   3735 C CA    . ILE B 1 158 ? 54.221  67.576  19.685 1.00 84.41  ? 184 ILE B CA    1 
ATOM   3736 C C     . ILE B 1 158 ? 54.592  68.851  20.440 1.00 83.39  ? 184 ILE B C     1 
ATOM   3737 O O     . ILE B 1 158 ? 55.481  69.586  20.021 1.00 84.96  ? 184 ILE B O     1 
ATOM   3738 C CB    . ILE B 1 158 ? 55.319  66.482  19.857 1.00 85.34  ? 184 ILE B CB    1 
ATOM   3739 C CG1   . ILE B 1 158 ? 54.877  65.166  19.192 1.00 86.54  ? 184 ILE B CG1   1 
ATOM   3740 C CG2   . ILE B 1 158 ? 55.658  66.266  21.336 1.00 82.99  ? 184 ILE B CG2   1 
ATOM   3741 C CD1   . ILE B 1 158 ? 55.963  64.090  19.093 1.00 87.83  ? 184 ILE B CD1   1 
ATOM   3742 N N     . VAL B 1 159 ? 53.896  69.108  21.544 1.00 81.03  ? 185 VAL B N     1 
ATOM   3743 C CA    . VAL B 1 159 ? 54.139  70.297  22.364 1.00 80.27  ? 185 VAL B CA    1 
ATOM   3744 C C     . VAL B 1 159 ? 55.031  69.949  23.552 1.00 79.29  ? 185 VAL B C     1 
ATOM   3745 O O     . VAL B 1 159 ? 54.878  68.889  24.164 1.00 78.27  ? 185 VAL B O     1 
ATOM   3746 C CB    . VAL B 1 159 ? 52.814  70.925  22.874 1.00 78.95  ? 185 VAL B CB    1 
ATOM   3747 C CG1   . VAL B 1 159 ? 53.075  72.211  23.659 1.00 78.56  ? 185 VAL B CG1   1 
ATOM   3748 C CG2   . VAL B 1 159 ? 51.871  71.202  21.713 1.00 80.29  ? 185 VAL B CG2   1 
ATOM   3749 N N     . GLU B 1 160 ? 55.967  70.845  23.858 1.00 79.95  ? 186 GLU B N     1 
ATOM   3750 C CA    . GLU B 1 160 ? 56.844  70.701  25.007 1.00 79.21  ? 186 GLU B CA    1 
ATOM   3751 C C     . GLU B 1 160 ? 56.866  71.987  25.819 1.00 78.56  ? 186 GLU B C     1 
ATOM   3752 O O     . GLU B 1 160 ? 56.630  73.070  25.295 1.00 79.93  ? 186 GLU B O     1 
ATOM   3753 C CB    . GLU B 1 160 ? 58.272  70.346  24.569 1.00 81.52  ? 186 GLU B CB    1 
ATOM   3754 C CG    . GLU B 1 160 ? 59.254  70.171  25.742 1.00 82.39  ? 186 GLU B CG    1 
ATOM   3755 C CD    . GLU B 1 160 ? 60.722  70.243  25.342 1.00 86.86  ? 186 GLU B CD    1 
ATOM   3756 O OE1   . GLU B 1 160 ? 61.037  70.038  24.146 1.00 90.31  ? 186 GLU B OE1   1 
ATOM   3757 O OE2   . GLU B 1 160 ? 61.565  70.499  26.235 1.00 87.33  ? 186 GLU B OE2   1 
ATOM   3758 N N     . THR B 1 161 ? 57.138  71.849  27.109 1.00 76.87  ? 187 THR B N     1 
ATOM   3759 C CA    . THR B 1 161 ? 57.455  72.973  27.962 1.00 76.66  ? 187 THR B CA    1 
ATOM   3760 C C     . THR B 1 161 ? 58.573  72.528  28.897 1.00 76.45  ? 187 THR B C     1 
ATOM   3761 O O     . THR B 1 161 ? 58.643  71.360  29.279 1.00 75.44  ? 187 THR B O     1 
ATOM   3762 C CB    . THR B 1 161 ? 56.219  73.485  28.738 1.00 75.47  ? 187 THR B CB    1 
ATOM   3763 O OG1   . THR B 1 161 ? 56.565  74.654  29.493 1.00 76.02  ? 187 THR B OG1   1 
ATOM   3764 C CG2   . THR B 1 161 ? 55.649  72.407  29.676 1.00 73.83  ? 187 THR B CG2   1 
ATOM   3765 N N     . HIS B 1 162 ? 59.469  73.446  29.233 1.00 77.78  ? 188 HIS B N     1 
ATOM   3766 C CA    . HIS B 1 162 ? 60.582  73.115  30.107 1.00 78.07  ? 188 HIS B CA    1 
ATOM   3767 C C     . HIS B 1 162 ? 60.672  74.083  31.274 1.00 77.72  ? 188 HIS B C     1 
ATOM   3768 O O     . HIS B 1 162 ? 60.511  75.294  31.107 1.00 78.97  ? 188 HIS B O     1 
ATOM   3769 C CB    . HIS B 1 162 ? 61.901  73.019  29.326 1.00 80.78  ? 188 HIS B CB    1 
ATOM   3770 C CG    . HIS B 1 162 ? 62.232  74.236  28.515 1.00 84.51  ? 188 HIS B CG    1 
ATOM   3771 N ND1   . HIS B 1 162 ? 63.171  75.165  28.915 1.00 87.49  ? 188 HIS B ND1   1 
ATOM   3772 C CD2   . HIS B 1 162 ? 61.768  74.665  27.315 1.00 87.10  ? 188 HIS B CD2   1 
ATOM   3773 C CE1   . HIS B 1 162 ? 63.264  76.116  28.002 1.00 90.60  ? 188 HIS B CE1   1 
ATOM   3774 N NE2   . HIS B 1 162 ? 62.423  75.837  27.021 1.00 90.03  ? 188 HIS B NE2   1 
ATOM   3775 N N     . PHE B 1 163 ? 60.900  73.539  32.463 1.00 76.26  ? 189 PHE B N     1 
ATOM   3776 C CA    . PHE B 1 163 ? 60.976  74.356  33.668 1.00 76.22  ? 189 PHE B CA    1 
ATOM   3777 C C     . PHE B 1 163 ? 61.796  73.693  34.765 1.00 76.01  ? 189 PHE B C     1 
ATOM   3778 O O     . PHE B 1 163 ? 61.973  72.473  34.777 1.00 75.29  ? 189 PHE B O     1 
ATOM   3779 C CB    . PHE B 1 163 ? 59.569  74.719  34.187 1.00 75.09  ? 189 PHE B CB    1 
ATOM   3780 C CG    . PHE B 1 163 ? 58.745  73.534  34.628 1.00 72.55  ? 189 PHE B CG    1 
ATOM   3781 C CD1   . PHE B 1 163 ? 58.693  73.169  35.968 1.00 71.57  ? 189 PHE B CD1   1 
ATOM   3782 C CD2   . PHE B 1 163 ? 58.007  72.797  33.705 1.00 71.30  ? 189 PHE B CD2   1 
ATOM   3783 C CE1   . PHE B 1 163 ? 57.928  72.084  36.385 1.00 70.33  ? 189 PHE B CE1   1 
ATOM   3784 C CE2   . PHE B 1 163 ? 57.243  71.706  34.111 1.00 70.08  ? 189 PHE B CE2   1 
ATOM   3785 C CZ    . PHE B 1 163 ? 57.202  71.352  35.456 1.00 69.48  ? 189 PHE B CZ    1 
ATOM   3786 N N     . THR B 1 164 ? 62.291  74.516  35.683 1.00 76.94  ? 190 THR B N     1 
ATOM   3787 C CA    . THR B 1 164 ? 63.039  74.037  36.832 1.00 77.12  ? 190 THR B CA    1 
ATOM   3788 C C     . THR B 1 164 ? 62.182  74.152  38.094 1.00 76.10  ? 190 THR B C     1 
ATOM   3789 O O     . THR B 1 164 ? 61.507  75.165  38.313 1.00 76.35  ? 190 THR B O     1 
ATOM   3790 C CB    . THR B 1 164 ? 64.358  74.815  36.984 1.00 79.40  ? 190 THR B CB    1 
ATOM   3791 O OG1   . THR B 1 164 ? 65.049  74.808  35.727 1.00 81.02  ? 190 THR B OG1   1 
ATOM   3792 C CG2   . THR B 1 164 ? 65.250  74.190  38.062 1.00 79.67  ? 190 THR B CG2   1 
ATOM   3793 N N     . PHE B 1 165 ? 62.205  73.100  38.906 1.00 75.21  ? 191 PHE B N     1 
ATOM   3794 C CA    . PHE B 1 165 ? 61.400  73.035  40.117 1.00 74.81  ? 191 PHE B CA    1 
ATOM   3795 C C     . PHE B 1 165 ? 62.017  72.031  41.084 1.00 75.19  ? 191 PHE B C     1 
ATOM   3796 O O     . PHE B 1 165 ? 62.317  70.902  40.700 1.00 74.82  ? 191 PHE B O     1 
ATOM   3797 C CB    . PHE B 1 165 ? 59.950  72.660  39.761 1.00 73.46  ? 191 PHE B CB    1 
ATOM   3798 C CG    . PHE B 1 165 ? 59.033  72.531  40.945 1.00 72.94  ? 191 PHE B CG    1 
ATOM   3799 C CD1   . PHE B 1 165 ? 58.838  73.594  41.818 1.00 73.68  ? 191 PHE B CD1   1 
ATOM   3800 C CD2   . PHE B 1 165 ? 58.339  71.343  41.169 1.00 72.54  ? 191 PHE B CD2   1 
ATOM   3801 C CE1   . PHE B 1 165 ? 57.972  73.472  42.913 1.00 74.57  ? 191 PHE B CE1   1 
ATOM   3802 C CE2   . PHE B 1 165 ? 57.474  71.209  42.252 1.00 72.60  ? 191 PHE B CE2   1 
ATOM   3803 C CZ    . PHE B 1 165 ? 57.290  72.276  43.128 1.00 74.00  ? 191 PHE B CZ    1 
ATOM   3804 N N     . LYS B 1 166 ? 62.208  72.459  42.332 1.00 76.45  ? 192 LYS B N     1 
ATOM   3805 C CA    . LYS B 1 166 ? 62.866  71.655  43.368 1.00 77.60  ? 192 LYS B CA    1 
ATOM   3806 C C     . LYS B 1 166 ? 64.146  70.979  42.858 1.00 78.34  ? 192 LYS B C     1 
ATOM   3807 O O     . LYS B 1 166 ? 64.309  69.759  42.978 1.00 78.68  ? 192 LYS B O     1 
ATOM   3808 C CB    . LYS B 1 166 ? 61.894  70.634  43.982 1.00 77.27  ? 192 LYS B CB    1 
ATOM   3809 C CG    . LYS B 1 166 ? 60.904  71.239  44.975 1.00 78.72  ? 192 LYS B CG    1 
ATOM   3810 C CD    . LYS B 1 166 ? 60.015  70.184  45.645 1.00 80.28  ? 192 LYS B CD    1 
ATOM   3811 C CE    . LYS B 1 166 ? 59.016  70.842  46.615 1.00 82.17  ? 192 LYS B CE    1 
ATOM   3812 N NZ    . LYS B 1 166 ? 58.034  69.890  47.221 1.00 82.41  ? 192 LYS B NZ    1 
ATOM   3813 N N     . ASP B 1 167 ? 65.038  71.789  42.280 1.00 79.15  ? 193 ASP B N     1 
ATOM   3814 C CA    . ASP B 1 167 ? 66.334  71.340  41.725 1.00 80.49  ? 193 ASP B CA    1 
ATOM   3815 C C     . ASP B 1 167 ? 66.211  70.544  40.426 1.00 79.66  ? 193 ASP B C     1 
ATOM   3816 O O     . ASP B 1 167 ? 67.171  70.459  39.655 1.00 81.05  ? 193 ASP B O     1 
ATOM   3817 C CB    . ASP B 1 167 ? 67.169  70.541  42.751 1.00 81.77  ? 193 ASP B CB    1 
ATOM   3818 C CG    . ASP B 1 167 ? 67.581  71.369  43.966 1.00 83.58  ? 193 ASP B CG    1 
ATOM   3819 O OD1   . ASP B 1 167 ? 67.079  72.506  44.125 1.00 83.46  ? 193 ASP B OD1   1 
ATOM   3820 O OD2   . ASP B 1 167 ? 68.412  70.872  44.770 1.00 85.49  ? 193 ASP B OD2   1 
ATOM   3821 N N     . LEU B 1 168 ? 65.038  69.963  40.190 1.00 77.83  ? 194 LEU B N     1 
ATOM   3822 C CA    . LEU B 1 168 ? 64.822  69.086  39.035 1.00 77.12  ? 194 LEU B CA    1 
ATOM   3823 C C     . LEU B 1 168 ? 64.517  69.869  37.771 1.00 76.57  ? 194 LEU B C     1 
ATOM   3824 O O     . LEU B 1 168 ? 63.857  70.911  37.814 1.00 75.87  ? 194 LEU B O     1 
ATOM   3825 C CB    . LEU B 1 168 ? 63.694  68.089  39.305 1.00 76.16  ? 194 LEU B CB    1 
ATOM   3826 C CG    . LEU B 1 168 ? 63.696  67.323  40.628 1.00 76.59  ? 194 LEU B CG    1 
ATOM   3827 C CD1   . LEU B 1 168 ? 62.404  66.542  40.767 1.00 75.97  ? 194 LEU B CD1   1 
ATOM   3828 C CD2   . LEU B 1 168 ? 64.901  66.401  40.740 1.00 78.35  ? 194 LEU B CD2   1 
ATOM   3829 N N     . HIS B 1 169 ? 65.013  69.357  36.649 1.00 77.15  ? 195 HIS B N     1 
ATOM   3830 C CA    . HIS B 1 169 ? 64.814  69.979  35.350 1.00 77.20  ? 195 HIS B CA    1 
ATOM   3831 C C     . HIS B 1 169 ? 63.720  69.213  34.619 1.00 75.63  ? 195 HIS B C     1 
ATOM   3832 O O     . HIS B 1 169 ? 63.966  68.141  34.059 1.00 76.28  ? 195 HIS B O     1 
ATOM   3833 C CB    . HIS B 1 169 ? 66.118  69.970  34.543 1.00 79.77  ? 195 HIS B CB    1 
ATOM   3834 C CG    . HIS B 1 169 ? 67.169  70.910  35.063 1.00 82.40  ? 195 HIS B CG    1 
ATOM   3835 N ND1   . HIS B 1 169 ? 67.908  70.652  36.200 1.00 83.65  ? 195 HIS B ND1   1 
ATOM   3836 C CD2   . HIS B 1 169 ? 67.620  72.096  34.586 1.00 84.71  ? 195 HIS B CD2   1 
ATOM   3837 C CE1   . HIS B 1 169 ? 68.756  71.644  36.408 1.00 85.63  ? 195 HIS B CE1   1 
ATOM   3838 N NE2   . HIS B 1 169 ? 68.601  72.534  35.444 1.00 86.34  ? 195 HIS B NE2   1 
ATOM   3839 N N     . PHE B 1 170 ? 62.509  69.765  34.637 1.00 77.36  ? 196 PHE B N     1 
ATOM   3840 C CA    . PHE B 1 170 ? 61.343  69.099  34.051 1.00 74.23  ? 196 PHE B CA    1 
ATOM   3841 C C     . PHE B 1 170 ? 61.178  69.361  32.564 1.00 73.58  ? 196 PHE B C     1 
ATOM   3842 O O     . PHE B 1 170 ? 61.326  70.496  32.097 1.00 74.59  ? 196 PHE B O     1 
ATOM   3843 C CB    . PHE B 1 170 ? 60.060  69.527  34.763 1.00 72.95  ? 196 PHE B CB    1 
ATOM   3844 C CG    . PHE B 1 170 ? 59.883  68.922  36.118 1.00 72.27  ? 196 PHE B CG    1 
ATOM   3845 C CD1   . PHE B 1 170 ? 60.268  69.617  37.257 1.00 73.90  ? 196 PHE B CD1   1 
ATOM   3846 C CD2   . PHE B 1 170 ? 59.326  67.658  36.260 1.00 70.09  ? 196 PHE B CD2   1 
ATOM   3847 C CE1   . PHE B 1 170 ? 60.098  69.062  38.522 1.00 73.76  ? 196 PHE B CE1   1 
ATOM   3848 C CE2   . PHE B 1 170 ? 59.151  67.094  37.517 1.00 70.31  ? 196 PHE B CE2   1 
ATOM   3849 C CZ    . PHE B 1 170 ? 59.538  67.798  38.653 1.00 71.65  ? 196 PHE B CZ    1 
ATOM   3850 N N     . LYS B 1 171 ? 60.862  68.297  31.834 1.00 71.90  ? 197 LYS B N     1 
ATOM   3851 C CA    . LYS B 1 171 ? 60.410  68.401  30.451 1.00 71.21  ? 197 LYS B CA    1 
ATOM   3852 C C     . LYS B 1 171 ? 59.086  67.651  30.260 1.00 68.54  ? 197 LYS B C     1 
ATOM   3853 O O     . LYS B 1 171 ? 59.023  66.431  30.406 1.00 67.57  ? 197 LYS B O     1 
ATOM   3854 C CB    . LYS B 1 171 ? 61.499  67.929  29.483 1.00 72.60  ? 197 LYS B CB    1 
ATOM   3855 C CG    . LYS B 1 171 ? 62.554  69.008  29.219 1.00 76.02  ? 197 LYS B CG    1 
ATOM   3856 C CD    . LYS B 1 171 ? 63.830  68.476  28.578 1.00 78.54  ? 197 LYS B CD    1 
ATOM   3857 C CE    . LYS B 1 171 ? 64.916  69.555  28.607 1.00 82.58  ? 197 LYS B CE    1 
ATOM   3858 N NZ    . LYS B 1 171 ? 66.193  69.122  27.975 1.00 85.63  ? 197 LYS B NZ    1 
ATOM   3859 N N     . MET B 1 172 ? 58.031  68.399  29.945 1.00 67.39  ? 198 MET B N     1 
ATOM   3860 C CA    . MET B 1 172 ? 56.685  67.841  29.819 1.00 65.33  ? 198 MET B CA    1 
ATOM   3861 C C     . MET B 1 172 ? 56.201  67.833  28.363 1.00 64.98  ? 198 MET B C     1 
ATOM   3862 O O     . MET B 1 172 ? 56.119  68.885  27.728 1.00 65.76  ? 198 MET B O     1 
ATOM   3863 C CB    . MET B 1 172 ? 55.723  68.629  30.705 1.00 64.86  ? 198 MET B CB    1 
ATOM   3864 C CG    . MET B 1 172 ? 54.321  68.072  30.765 1.00 63.53  ? 198 MET B CG    1 
ATOM   3865 S SD    . MET B 1 172 ? 53.298  69.049  31.864 1.00 64.05  ? 198 MET B SD    1 
ATOM   3866 C CE    . MET B 1 172 ? 53.598  68.263  33.434 1.00 63.14  ? 198 MET B CE    1 
ATOM   3867 N N     . PHE B 1 173 ? 55.891  66.645  27.844 1.00 63.83  ? 199 PHE B N     1 
ATOM   3868 C CA    . PHE B 1 173 ? 55.447  66.486  26.455 1.00 63.88  ? 199 PHE B CA    1 
ATOM   3869 C C     . PHE B 1 173 ? 53.952  66.164  26.333 1.00 62.35  ? 199 PHE B C     1 
ATOM   3870 O O     . PHE B 1 173 ? 53.367  65.530  27.207 1.00 61.28  ? 199 PHE B O     1 
ATOM   3871 C CB    . PHE B 1 173 ? 56.263  65.404  25.741 1.00 64.30  ? 199 PHE B CB    1 
ATOM   3872 C CG    . PHE B 1 173 ? 57.744  65.633  25.786 1.00 67.98  ? 199 PHE B CG    1 
ATOM   3873 C CD1   . PHE B 1 173 ? 58.344  66.612  24.984 1.00 70.69  ? 199 PHE B CD1   1 
ATOM   3874 C CD2   . PHE B 1 173 ? 58.551  64.868  26.625 1.00 69.21  ? 199 PHE B CD2   1 
ATOM   3875 C CE1   . PHE B 1 173 ? 59.735  66.824  25.023 1.00 72.88  ? 199 PHE B CE1   1 
ATOM   3876 C CE2   . PHE B 1 173 ? 59.939  65.074  26.672 1.00 71.37  ? 199 PHE B CE2   1 
ATOM   3877 C CZ    . PHE B 1 173 ? 60.529  66.054  25.870 1.00 73.06  ? 199 PHE B CZ    1 
ATOM   3878 N N     . ASP B 1 174 ? 53.352  66.601  25.231 1.00 62.19  ? 200 ASP B N     1 
ATOM   3879 C CA    . ASP B 1 174 ? 51.956  66.326  24.936 1.00 61.10  ? 200 ASP B CA    1 
ATOM   3880 C C     . ASP B 1 174 ? 51.822  66.115  23.441 1.00 62.04  ? 200 ASP B C     1 
ATOM   3881 O O     . ASP B 1 174 ? 51.968  67.054  22.667 1.00 62.83  ? 200 ASP B O     1 
ATOM   3882 C CB    . ASP B 1 174 ? 51.062  67.484  25.417 1.00 60.52  ? 200 ASP B CB    1 
ATOM   3883 C CG    . ASP B 1 174 ? 49.604  67.338  24.983 1.00 58.50  ? 200 ASP B CG    1 
ATOM   3884 O OD1   . ASP B 1 174 ? 49.176  66.227  24.615 1.00 56.44  ? 200 ASP B OD1   1 
ATOM   3885 O OD2   . ASP B 1 174 ? 48.881  68.351  25.008 1.00 55.28  ? 200 ASP B OD2   1 
ATOM   3886 N N     . VAL B 1 175 ? 51.554  64.873  23.048 1.00 62.39  ? 201 VAL B N     1 
ATOM   3887 C CA    . VAL B 1 175 ? 51.319  64.517  21.641 1.00 64.00  ? 201 VAL B CA    1 
ATOM   3888 C C     . VAL B 1 175 ? 50.020  65.133  21.102 1.00 64.68  ? 201 VAL B C     1 
ATOM   3889 O O     . VAL B 1 175 ? 49.941  65.508  19.932 1.00 65.80  ? 201 VAL B O     1 
ATOM   3890 C CB    . VAL B 1 175 ? 51.293  62.976  21.451 1.00 63.82  ? 201 VAL B CB    1 
ATOM   3891 C CG1   . VAL B 1 175 ? 51.023  62.602  19.989 1.00 65.33  ? 201 VAL B CG1   1 
ATOM   3892 C CG2   . VAL B 1 175 ? 52.601  62.362  21.920 1.00 63.80  ? 201 VAL B CG2   1 
ATOM   3893 N N     . GLY B 1 176 ? 49.009  65.230  21.966 1.00 64.77  ? 202 GLY B N     1 
ATOM   3894 C CA    . GLY B 1 176 ? 47.728  65.857  21.623 1.00 65.88  ? 202 GLY B CA    1 
ATOM   3895 C C     . GLY B 1 176 ? 46.935  65.070  20.600 1.00 67.38  ? 202 GLY B C     1 
ATOM   3896 O O     . GLY B 1 176 ? 47.065  63.850  20.511 1.00 67.36  ? 202 GLY B O     1 
ATOM   3897 N N     . GLY B 1 177 ? 46.131  65.777  19.810 1.00 69.03  ? 203 GLY B N     1 
ATOM   3898 C CA    . GLY B 1 177 ? 45.191  65.141  18.889 1.00 71.23  ? 203 GLY B CA    1 
ATOM   3899 C C     . GLY B 1 177 ? 45.733  64.782  17.515 1.00 73.28  ? 203 GLY B C     1 
ATOM   3900 O O     . GLY B 1 177 ? 45.005  64.234  16.681 1.00 74.52  ? 203 GLY B O     1 
ATOM   3901 N N     . GLN B 1 178 ? 47.007  65.084  17.272 1.00 73.83  ? 204 GLN B N     1 
ATOM   3902 C CA    . GLN B 1 178 ? 47.627  64.749  16.001 1.00 75.78  ? 204 GLN B CA    1 
ATOM   3903 C C     . GLN B 1 178 ? 48.013  63.266  15.970 1.00 75.55  ? 204 GLN B C     1 
ATOM   3904 O O     . GLN B 1 178 ? 48.786  62.802  16.815 1.00 74.36  ? 204 GLN B O     1 
ATOM   3905 C CB    . GLN B 1 178 ? 48.839  65.647  15.741 1.00 76.32  ? 204 GLN B CB    1 
ATOM   3906 C CG    . GLN B 1 178 ? 49.168  65.811  14.260 1.00 79.76  ? 204 GLN B CG    1 
ATOM   3907 C CD    . GLN B 1 178 ? 50.323  66.762  14.018 1.00 82.11  ? 204 GLN B CD    1 
ATOM   3908 O OE1   . GLN B 1 178 ? 50.187  67.980  14.161 1.00 83.18  ? 204 GLN B OE1   1 
ATOM   3909 N NE2   . GLN B 1 178 ? 51.468  66.209  13.641 1.00 83.24  ? 204 GLN B NE2   1 
ATOM   3910 N N     . ARG B 1 179 ? 47.456  62.533  15.006 1.00 76.84  ? 205 ARG B N     1 
ATOM   3911 C CA    . ARG B 1 179 ? 47.780  61.116  14.820 1.00 77.34  ? 205 ARG B CA    1 
ATOM   3912 C C     . ARG B 1 179 ? 49.271  60.905  14.504 1.00 77.19  ? 205 ARG B C     1 
ATOM   3913 O O     . ARG B 1 179 ? 49.875  61.667  13.743 1.00 78.02  ? 205 ARG B O     1 
ATOM   3914 C CB    . ARG B 1 179 ? 46.896  60.479  13.735 1.00 79.57  ? 205 ARG B CB    1 
ATOM   3915 C CG    . ARG B 1 179 ? 45.409  60.372  14.109 1.00 81.24  ? 205 ARG B CG    1 
ATOM   3916 C CD    . ARG B 1 179 ? 44.679  59.312  13.283 1.00 85.15  ? 205 ARG B CD    1 
ATOM   3917 N NE    . ARG B 1 179 ? 43.230  59.306  13.529 1.00 87.99  ? 205 ARG B NE    1 
ATOM   3918 C CZ    . ARG B 1 179 ? 42.539  58.303  14.080 1.00 88.56  ? 205 ARG B CZ    1 
ATOM   3919 N NH1   . ARG B 1 179 ? 43.147  57.182  14.460 1.00 88.02  ? 205 ARG B NH1   1 
ATOM   3920 N NH2   . ARG B 1 179 ? 41.224  58.416  14.244 1.00 89.25  ? 205 ARG B NH2   1 
ATOM   3921 N N     . SER B 1 180 ? 49.848  59.869  15.110 1.00 76.02  ? 206 SER B N     1 
ATOM   3922 C CA    . SER B 1 180 ? 51.272  59.570  14.993 1.00 75.53  ? 206 SER B CA    1 
ATOM   3923 C C     . SER B 1 180 ? 51.492  58.076  14.784 1.00 75.70  ? 206 SER B C     1 
ATOM   3924 O O     . SER B 1 180 ? 50.743  57.247  15.307 1.00 74.97  ? 206 SER B O     1 
ATOM   3925 C CB    . SER B 1 180 ? 52.008  60.031  16.250 1.00 73.91  ? 206 SER B CB    1 
ATOM   3926 O OG    . SER B 1 180 ? 51.695  61.377  16.555 1.00 73.79  ? 206 SER B OG    1 
ATOM   3927 N N     . GLU B 1 181 ? 52.530  57.731  14.029 1.00 76.55  ? 207 GLU B N     1 
ATOM   3928 C CA    . GLU B 1 181 ? 52.789  56.327  13.714 1.00 77.25  ? 207 GLU B CA    1 
ATOM   3929 C C     . GLU B 1 181 ? 53.649  55.628  14.769 1.00 75.80  ? 207 GLU B C     1 
ATOM   3930 O O     . GLU B 1 181 ? 54.242  56.275  15.636 1.00 74.38  ? 207 GLU B O     1 
ATOM   3931 C CB    . GLU B 1 181 ? 53.347  56.166  12.291 1.00 79.68  ? 207 GLU B CB    1 
ATOM   3932 C CG    . GLU B 1 181 ? 52.258  56.253  11.210 1.00 82.25  ? 207 GLU B CG    1 
ATOM   3933 C CD    . GLU B 1 181 ? 52.739  55.880  9.813  1.00 86.85  ? 207 GLU B CD    1 
ATOM   3934 O OE1   . GLU B 1 181 ? 53.614  54.991  9.681  1.00 88.39  ? 207 GLU B OE1   1 
ATOM   3935 O OE2   . GLU B 1 181 ? 52.224  56.473  8.839  1.00 88.67  ? 207 GLU B OE2   1 
ATOM   3936 N N     . ARG B 1 182 ? 53.688  54.300  14.682 1.00 76.12  ? 208 ARG B N     1 
ATOM   3937 C CA    . ARG B 1 182 ? 54.286  53.436  15.693 1.00 75.26  ? 208 ARG B CA    1 
ATOM   3938 C C     . ARG B 1 182 ? 55.621  53.951  16.222 1.00 74.53  ? 208 ARG B C     1 
ATOM   3939 O O     . ARG B 1 182 ? 55.795  54.127  17.436 1.00 73.18  ? 208 ARG B O     1 
ATOM   3940 C CB    . ARG B 1 182 ? 54.449  52.018  15.137 1.00 76.97  ? 208 ARG B CB    1 
ATOM   3941 C CG    . ARG B 1 182 ? 54.895  50.996  16.163 1.00 77.86  ? 208 ARG B CG    1 
ATOM   3942 C CD    . ARG B 1 182 ? 55.437  49.724  15.516 1.00 81.48  ? 208 ARG B CD    1 
ATOM   3943 N NE    . ARG B 1 182 ? 55.814  48.744  16.536 1.00 82.96  ? 208 ARG B NE    1 
ATOM   3944 C CZ    . ARG B 1 182 ? 55.168  47.602  16.772 1.00 85.08  ? 208 ARG B CZ    1 
ATOM   3945 N NH1   . ARG B 1 182 ? 54.108  47.263  16.045 1.00 86.90  ? 208 ARG B NH1   1 
ATOM   3946 N NH2   . ARG B 1 182 ? 55.591  46.786  17.731 1.00 85.74  ? 208 ARG B NH2   1 
ATOM   3947 N N     . LYS B 1 183 ? 56.549  54.213  15.308 1.00 75.45  ? 209 LYS B N     1 
ATOM   3948 C CA    . LYS B 1 183 ? 57.914  54.563  15.680 1.00 75.26  ? 209 LYS B CA    1 
ATOM   3949 C C     . LYS B 1 183 ? 57.999  55.873  16.458 1.00 73.49  ? 209 LYS B C     1 
ATOM   3950 O O     . LYS B 1 183 ? 58.822  55.996  17.360 1.00 72.94  ? 209 LYS B O     1 
ATOM   3951 C CB    . LYS B 1 183 ? 58.838  54.587  14.453 1.00 77.61  ? 209 LYS B CB    1 
ATOM   3952 C CG    . LYS B 1 183 ? 59.054  53.219  13.786 1.00 79.79  ? 209 LYS B CG    1 
ATOM   3953 C CD    . LYS B 1 183 ? 60.058  52.346  14.544 1.00 81.22  ? 209 LYS B CD    1 
ATOM   3954 C CE    . LYS B 1 183 ? 60.664  51.288  13.617 1.00 84.12  ? 209 LYS B CE    1 
ATOM   3955 N NZ    . LYS B 1 183 ? 61.884  50.637  14.185 1.00 84.68  ? 209 LYS B NZ    1 
ATOM   3956 N N     . LYS B 1 184 ? 57.153  56.839  16.120 1.00 72.61  ? 210 LYS B N     1 
ATOM   3957 C CA    . LYS B 1 184 ? 57.112  58.086  16.871 1.00 71.64  ? 210 LYS B CA    1 
ATOM   3958 C C     . LYS B 1 184 ? 56.613  57.863  18.313 1.00 69.33  ? 210 LYS B C     1 
ATOM   3959 O O     . LYS B 1 184 ? 57.088  58.515  19.244 1.00 68.53  ? 210 LYS B O     1 
ATOM   3960 C CB    . LYS B 1 184 ? 56.261  59.132  16.153 1.00 72.25  ? 210 LYS B CB    1 
ATOM   3961 C CG    . LYS B 1 184 ? 56.453  60.554  16.686 1.00 73.85  ? 210 LYS B CG    1 
ATOM   3962 C CD    . LYS B 1 184 ? 56.358  61.583  15.563 1.00 78.44  ? 210 LYS B CD    1 
ATOM   3963 C CE    . LYS B 1 184 ? 57.296  62.772  15.805 1.00 80.51  ? 210 LYS B CE    1 
ATOM   3964 N NZ    . LYS B 1 184 ? 57.493  63.598  14.569 1.00 83.50  ? 210 LYS B NZ    1 
ATOM   3965 N N     . TRP B 1 185 ? 55.673  56.933  18.483 1.00 68.10  ? 211 TRP B N     1 
ATOM   3966 C CA    . TRP B 1 185 ? 55.165  56.577  19.807 1.00 66.36  ? 211 TRP B CA    1 
ATOM   3967 C C     . TRP B 1 185 ? 56.213  55.837  20.630 1.00 66.05  ? 211 TRP B C     1 
ATOM   3968 O O     . TRP B 1 185 ? 56.332  56.083  21.828 1.00 64.81  ? 211 TRP B O     1 
ATOM   3969 C CB    . TRP B 1 185 ? 53.880  55.741  19.720 1.00 66.01  ? 211 TRP B CB    1 
ATOM   3970 C CG    . TRP B 1 185 ? 52.632  56.553  19.540 1.00 65.12  ? 211 TRP B CG    1 
ATOM   3971 C CD1   . TRP B 1 185 ? 51.815  56.571  18.445 1.00 65.23  ? 211 TRP B CD1   1 
ATOM   3972 C CD2   . TRP B 1 185 ? 52.051  57.462  20.489 1.00 64.09  ? 211 TRP B CD2   1 
ATOM   3973 N NE1   . TRP B 1 185 ? 50.763  57.431  18.650 1.00 64.32  ? 211 TRP B NE1   1 
ATOM   3974 C CE2   . TRP B 1 185 ? 50.882  57.994  19.894 1.00 63.66  ? 211 TRP B CE2   1 
ATOM   3975 C CE3   . TRP B 1 185 ? 52.404  57.880  21.785 1.00 62.71  ? 211 TRP B CE3   1 
ATOM   3976 C CZ2   . TRP B 1 185 ? 50.061  58.925  20.549 1.00 62.80  ? 211 TRP B CZ2   1 
ATOM   3977 C CZ3   . TRP B 1 185 ? 51.583  58.804  22.437 1.00 61.82  ? 211 TRP B CZ3   1 
ATOM   3978 C CH2   . TRP B 1 185 ? 50.425  59.314  21.815 1.00 61.33  ? 211 TRP B CH2   1 
ATOM   3979 N N     . ILE B 1 186 ? 56.962  54.945  19.975 1.00 66.86  ? 212 ILE B N     1 
ATOM   3980 C CA    . ILE B 1 186 ? 58.014  54.168  20.626 1.00 66.89  ? 212 ILE B CA    1 
ATOM   3981 C C     . ILE B 1 186 ? 59.026  55.111  21.265 1.00 66.79  ? 212 ILE B C     1 
ATOM   3982 O O     . ILE B 1 186 ? 59.389  54.947  22.434 1.00 66.07  ? 212 ILE B O     1 
ATOM   3983 C CB    . ILE B 1 186 ? 58.761  53.224  19.629 1.00 68.69  ? 212 ILE B CB    1 
ATOM   3984 C CG1   . ILE B 1 186 ? 57.826  52.159  19.029 1.00 69.22  ? 212 ILE B CG1   1 
ATOM   3985 C CG2   . ILE B 1 186 ? 59.997  52.584  20.289 1.00 68.71  ? 212 ILE B CG2   1 
ATOM   3986 C CD1   . ILE B 1 186 ? 57.389  51.046  19.984 1.00 69.24  ? 212 ILE B CD1   1 
ATOM   3987 N N     . HIS B 1 187 ? 59.464  56.102  20.490 1.00 67.39  ? 213 HIS B N     1 
ATOM   3988 C CA    . HIS B 1 187 ? 60.497  57.033  20.931 1.00 67.87  ? 213 HIS B CA    1 
ATOM   3989 C C     . HIS B 1 187 ? 59.979  57.956  22.025 1.00 66.00  ? 213 HIS B C     1 
ATOM   3990 O O     . HIS B 1 187 ? 60.753  58.430  22.859 1.00 66.26  ? 213 HIS B O     1 
ATOM   3991 C CB    . HIS B 1 187 ? 61.059  57.836  19.756 1.00 69.54  ? 213 HIS B CB    1 
ATOM   3992 C CG    . HIS B 1 187 ? 61.756  56.995  18.727 1.00 73.32  ? 213 HIS B CG    1 
ATOM   3993 N ND1   . HIS B 1 187 ? 62.469  55.857  19.048 1.00 75.03  ? 213 HIS B ND1   1 
ATOM   3994 C CD2   . HIS B 1 187 ? 61.863  57.137  17.383 1.00 76.00  ? 213 HIS B CD2   1 
ATOM   3995 C CE1   . HIS B 1 187 ? 62.975  55.330  17.947 1.00 77.51  ? 213 HIS B CE1   1 
ATOM   3996 N NE2   . HIS B 1 187 ? 62.623  56.088  16.922 1.00 78.19  ? 213 HIS B NE2   1 
ATOM   3997 N N     . CYS B 1 188 ? 58.671  58.195  22.012 1.00 64.22  ? 214 CYS B N     1 
ATOM   3998 C CA    . CYS B 1 188 ? 57.999  58.952  23.062 1.00 62.88  ? 214 CYS B CA    1 
ATOM   3999 C C     . CYS B 1 188 ? 58.005  58.244  24.403 1.00 60.89  ? 214 CYS B C     1 
ATOM   4000 O O     . CYS B 1 188 ? 58.346  58.837  25.416 1.00 60.51  ? 214 CYS B O     1 
ATOM   4001 C CB    . CYS B 1 188 ? 56.562  59.271  22.667 1.00 62.29  ? 214 CYS B CB    1 
ATOM   4002 S SG    . CYS B 1 188 ? 56.347  61.012  22.376 1.00 67.06  ? 214 CYS B SG    1 
ATOM   4003 N N     . PHE B 1 189 ? 57.628  56.974  24.394 1.00 59.90  ? 215 PHE B N     1 
ATOM   4004 C CA    . PHE B 1 189 ? 57.573  56.194  25.607 1.00 59.34  ? 215 PHE B CA    1 
ATOM   4005 C C     . PHE B 1 189 ? 58.969  55.897  26.164 1.00 60.21  ? 215 PHE B C     1 
ATOM   4006 O O     . PHE B 1 189 ? 59.166  55.893  27.375 1.00 60.36  ? 215 PHE B O     1 
ATOM   4007 C CB    . PHE B 1 189 ? 56.757  54.920  25.380 1.00 59.37  ? 215 PHE B CB    1 
ATOM   4008 C CG    . PHE B 1 189 ? 55.272  55.172  25.156 1.00 58.70  ? 215 PHE B CG    1 
ATOM   4009 C CD1   . PHE B 1 189 ? 54.642  54.724  24.004 1.00 58.59  ? 215 PHE B CD1   1 
ATOM   4010 C CD2   . PHE B 1 189 ? 54.513  55.857  26.106 1.00 58.43  ? 215 PHE B CD2   1 
ATOM   4011 C CE1   . PHE B 1 189 ? 53.277  54.950  23.788 1.00 58.84  ? 215 PHE B CE1   1 
ATOM   4012 C CE2   . PHE B 1 189 ? 53.138  56.081  25.910 1.00 58.94  ? 215 PHE B CE2   1 
ATOM   4013 C CZ    . PHE B 1 189 ? 52.524  55.632  24.744 1.00 59.33  ? 215 PHE B CZ    1 
ATOM   4014 N N     . GLU B 1 190 ? 59.939  55.684  25.280 1.00 61.19  ? 216 GLU B N     1 
ATOM   4015 C CA    . GLU B 1 190 ? 61.321  55.453  25.700 1.00 62.30  ? 216 GLU B CA    1 
ATOM   4016 C C     . GLU B 1 190 ? 61.937  56.679  26.377 1.00 62.84  ? 216 GLU B C     1 
ATOM   4017 O O     . GLU B 1 190 ? 62.807  56.537  27.229 1.00 63.83  ? 216 GLU B O     1 
ATOM   4018 C CB    . GLU B 1 190 ? 62.179  55.000  24.517 1.00 63.35  ? 216 GLU B CB    1 
ATOM   4019 C CG    . GLU B 1 190 ? 61.839  53.601  24.027 1.00 62.14  ? 216 GLU B CG    1 
ATOM   4020 C CD    . GLU B 1 190 ? 62.530  53.218  22.731 1.00 61.29  ? 216 GLU B CD    1 
ATOM   4021 O OE1   . GLU B 1 190 ? 63.008  54.106  21.996 1.00 59.97  ? 216 GLU B OE1   1 
ATOM   4022 O OE2   . GLU B 1 190 ? 62.581  52.006  22.445 1.00 62.32  ? 216 GLU B OE2   1 
ATOM   4023 N N     . GLY B 1 191 ? 61.449  57.869  26.019 1.00 62.69  ? 217 GLY B N     1 
ATOM   4024 C CA    . GLY B 1 191 ? 61.993  59.132  26.517 1.00 63.08  ? 217 GLY B CA    1 
ATOM   4025 C C     . GLY B 1 191 ? 61.444  59.706  27.815 1.00 62.30  ? 217 GLY B C     1 
ATOM   4026 O O     . GLY B 1 191 ? 61.858  60.784  28.220 1.00 63.36  ? 217 GLY B O     1 
ATOM   4027 N N     . VAL B 1 192 ? 60.528  59.007  28.484 1.00 60.94  ? 218 VAL B N     1 
ATOM   4028 C CA    . VAL B 1 192 ? 59.864  59.570  29.675 1.00 59.44  ? 218 VAL B CA    1 
ATOM   4029 C C     . VAL B 1 192 ? 60.058  58.768  30.973 1.00 59.09  ? 218 VAL B C     1 
ATOM   4030 O O     . VAL B 1 192 ? 60.233  57.543  30.934 1.00 59.46  ? 218 VAL B O     1 
ATOM   4031 C CB    . VAL B 1 192 ? 58.341  59.782  29.436 1.00 58.41  ? 218 VAL B CB    1 
ATOM   4032 C CG1   . VAL B 1 192 ? 58.102  60.704  28.238 1.00 58.43  ? 218 VAL B CG1   1 
ATOM   4033 C CG2   . VAL B 1 192 ? 57.621  58.446  29.258 1.00 57.91  ? 218 VAL B CG2   1 
ATOM   4034 N N     . THR B 1 193 ? 60.001  59.476  32.107 1.00 57.92  ? 219 THR B N     1 
ATOM   4035 C CA    . THR B 1 193 ? 60.077  58.891  33.451 1.00 57.27  ? 219 THR B CA    1 
ATOM   4036 C C     . THR B 1 193 ? 58.696  58.564  34.037 1.00 55.32  ? 219 THR B C     1 
ATOM   4037 O O     . THR B 1 193 ? 58.551  57.640  34.846 1.00 54.96  ? 219 THR B O     1 
ATOM   4038 C CB    . THR B 1 193 ? 60.787  59.851  34.433 1.00 58.39  ? 219 THR B CB    1 
ATOM   4039 O OG1   . THR B 1 193 ? 62.010  60.326  33.848 1.00 60.90  ? 219 THR B OG1   1 
ATOM   4040 C CG2   . THR B 1 193 ? 61.102  59.144  35.740 1.00 59.98  ? 219 THR B CG2   1 
ATOM   4041 N N     . ALA B 1 194 ? 57.686  59.341  33.650 1.00 48.02  ? 220 ALA B N     1 
ATOM   4042 C CA    . ALA B 1 194 ? 56.339  59.111  34.139 1.00 46.27  ? 220 ALA B CA    1 
ATOM   4043 C C     . ALA B 1 194 ? 55.294  59.510  33.118 1.00 44.86  ? 220 ALA B C     1 
ATOM   4044 O O     . ALA B 1 194 ? 55.505  60.420  32.307 1.00 44.81  ? 220 ALA B O     1 
ATOM   4045 C CB    . ALA B 1 194 ? 56.107  59.850  35.465 1.00 45.91  ? 220 ALA B CB    1 
ATOM   4046 N N     . ILE B 1 195 ? 54.165  58.817  33.172 1.00 43.23  ? 221 ILE B N     1 
ATOM   4047 C CA    . ILE B 1 195 ? 53.012  59.183  32.378 1.00 41.79  ? 221 ILE B CA    1 
ATOM   4048 C C     . ILE B 1 195 ? 51.984  59.776  33.306 1.00 40.88  ? 221 ILE B C     1 
ATOM   4049 O O     . ILE B 1 195 ? 51.673  59.193  34.358 1.00 40.70  ? 221 ILE B O     1 
ATOM   4050 C CB    . ILE B 1 195 ? 52.410  57.966  31.642 1.00 42.03  ? 221 ILE B CB    1 
ATOM   4051 C CG1   . ILE B 1 195 ? 53.389  57.449  30.575 1.00 42.28  ? 221 ILE B CG1   1 
ATOM   4052 C CG2   . ILE B 1 195 ? 51.034  58.304  31.027 1.00 40.78  ? 221 ILE B CG2   1 
ATOM   4053 C CD1   . ILE B 1 195 ? 53.125  56.002  30.172 1.00 41.95  ? 221 ILE B CD1   1 
ATOM   4054 N N     . ILE B 1 196 ? 51.489  60.953  32.928 1.00 39.84  ? 222 ILE B N     1 
ATOM   4055 C CA    . ILE B 1 196 ? 50.353  61.539  33.576 1.00 39.23  ? 222 ILE B CA    1 
ATOM   4056 C C     . ILE B 1 196 ? 49.149  61.291  32.656 1.00 39.01  ? 222 ILE B C     1 
ATOM   4057 O O     . ILE B 1 196 ? 49.041  61.881  31.569 1.00 39.43  ? 222 ILE B O     1 
ATOM   4058 C CB    . ILE B 1 196 ? 50.532  63.052  33.827 1.00 39.48  ? 222 ILE B CB    1 
ATOM   4059 C CG1   . ILE B 1 196 ? 51.753  63.330  34.699 1.00 39.73  ? 222 ILE B CG1   1 
ATOM   4060 C CG2   . ILE B 1 196 ? 49.299  63.621  34.493 1.00 37.91  ? 222 ILE B CG2   1 
ATOM   4061 C CD1   . ILE B 1 196 ? 52.009  64.832  34.896 1.00 40.50  ? 222 ILE B CD1   1 
ATOM   4062 N N     . PHE B 1 197 ? 48.265  60.405  33.094 1.00 37.90  ? 223 PHE B N     1 
ATOM   4063 C CA    . PHE B 1 197 ? 47.068  60.073  32.343 1.00 36.94  ? 223 PHE B CA    1 
ATOM   4064 C C     . PHE B 1 197 ? 45.934  60.964  32.807 1.00 36.04  ? 223 PHE B C     1 
ATOM   4065 O O     . PHE B 1 197 ? 45.587  60.955  33.990 1.00 35.91  ? 223 PHE B O     1 
ATOM   4066 C CB    . PHE B 1 197 ? 46.704  58.592  32.527 1.00 36.94  ? 223 PHE B CB    1 
ATOM   4067 C CG    . PHE B 1 197 ? 45.713  58.088  31.514 1.00 37.51  ? 223 PHE B CG    1 
ATOM   4068 C CD1   . PHE B 1 197 ? 46.142  57.655  30.270 1.00 37.74  ? 223 PHE B CD1   1 
ATOM   4069 C CD2   . PHE B 1 197 ? 44.348  58.059  31.800 1.00 36.51  ? 223 PHE B CD2   1 
ATOM   4070 C CE1   . PHE B 1 197 ? 45.229  57.211  29.310 1.00 37.86  ? 223 PHE B CE1   1 
ATOM   4071 C CE2   . PHE B 1 197 ? 43.432  57.603  30.854 1.00 37.42  ? 223 PHE B CE2   1 
ATOM   4072 C CZ    . PHE B 1 197 ? 43.882  57.181  29.598 1.00 37.81  ? 223 PHE B CZ    1 
ATOM   4073 N N     . CYS B 1 198 ? 45.376  61.735  31.877 1.00 35.28  ? 224 CYS B N     1 
ATOM   4074 C CA    . CYS B 1 198 ? 44.286  62.641  32.163 1.00 35.66  ? 224 CYS B CA    1 
ATOM   4075 C C     . CYS B 1 198 ? 42.920  62.095  31.757 1.00 35.00  ? 224 CYS B C     1 
ATOM   4076 O O     . CYS B 1 198 ? 42.757  61.538  30.668 1.00 35.42  ? 224 CYS B O     1 
ATOM   4077 C CB    . CYS B 1 198 ? 44.507  64.001  31.483 1.00 36.57  ? 224 CYS B CB    1 
ATOM   4078 S SG    . CYS B 1 198 ? 46.016  64.831  31.982 1.00 38.87  ? 224 CYS B SG    1 
ATOM   4079 N N     . VAL B 1 199 ? 41.948  62.327  32.633 1.00 34.01  ? 225 VAL B N     1 
ATOM   4080 C CA    . VAL B 1 199 ? 40.566  61.919  32.473 1.00 33.60  ? 225 VAL B CA    1 
ATOM   4081 C C     . VAL B 1 199 ? 39.664  63.087  32.837 1.00 33.88  ? 225 VAL B C     1 
ATOM   4082 O O     . VAL B 1 199 ? 39.771  63.643  33.936 1.00 34.92  ? 225 VAL B O     1 
ATOM   4083 C CB    . VAL B 1 199 ? 40.213  60.742  33.430 1.00 33.71  ? 225 VAL B CB    1 
ATOM   4084 C CG1   . VAL B 1 199 ? 38.701  60.416  33.387 1.00 33.03  ? 225 VAL B CG1   1 
ATOM   4085 C CG2   . VAL B 1 199 ? 41.055  59.504  33.114 1.00 32.81  ? 225 VAL B CG2   1 
ATOM   4086 N N     . ALA B 1 200 ? 38.785  63.470  31.924 1.00 33.81  ? 226 ALA B N     1 
ATOM   4087 C CA    . ALA B 1 200 ? 37.723  64.424  32.234 1.00 34.37  ? 226 ALA B CA    1 
ATOM   4088 C C     . ALA B 1 200 ? 36.587  63.716  32.994 1.00 34.31  ? 226 ALA B C     1 
ATOM   4089 O O     . ALA B 1 200 ? 35.792  62.982  32.374 1.00 34.74  ? 226 ALA B O     1 
ATOM   4090 C CB    . ALA B 1 200 ? 37.188  65.033  30.950 1.00 34.68  ? 226 ALA B CB    1 
ATOM   4091 N N     . LEU B 1 201 ? 36.509  63.923  34.311 1.00 33.66  ? 227 LEU B N     1 
ATOM   4092 C CA    . LEU B 1 201 ? 35.441  63.324  35.131 1.00 33.55  ? 227 LEU B CA    1 
ATOM   4093 C C     . LEU B 1 201 ? 34.052  63.634  34.592 1.00 33.21  ? 227 LEU B C     1 
ATOM   4094 O O     . LEU B 1 201 ? 33.162  62.798  34.636 1.00 33.09  ? 227 LEU B O     1 
ATOM   4095 C CB    . LEU B 1 201 ? 35.521  63.794  36.596 1.00 34.04  ? 227 LEU B CB    1 
ATOM   4096 C CG    . LEU B 1 201 ? 36.696  63.244  37.413 1.00 35.48  ? 227 LEU B CG    1 
ATOM   4097 C CD1   . LEU B 1 201 ? 36.866  64.010  38.727 1.00 35.66  ? 227 LEU B CD1   1 
ATOM   4098 C CD2   . LEU B 1 201 ? 36.543  61.743  37.662 1.00 33.88  ? 227 LEU B CD2   1 
ATOM   4099 N N     . SER B 1 202 ? 33.866  64.849  34.105 1.00 33.55  ? 228 SER B N     1 
ATOM   4100 C CA    . SER B 1 202 ? 32.564  65.294  33.662 1.00 34.30  ? 228 SER B CA    1 
ATOM   4101 C C     . SER B 1 202 ? 32.078  64.682  32.321 1.00 34.53  ? 228 SER B C     1 
ATOM   4102 O O     . SER B 1 202 ? 30.939  64.901  31.931 1.00 35.17  ? 228 SER B O     1 
ATOM   4103 C CB    . SER B 1 202 ? 32.577  66.820  33.585 1.00 35.24  ? 228 SER B CB    1 
ATOM   4104 O OG    . SER B 1 202 ? 33.746  67.265  32.911 1.00 37.38  ? 228 SER B OG    1 
ATOM   4105 N N     . ASP B 1 203 ? 32.941  63.952  31.608 1.00 34.68  ? 229 ASP B N     1 
ATOM   4106 C CA    . ASP B 1 203 ? 32.549  63.243  30.375 1.00 35.43  ? 229 ASP B CA    1 
ATOM   4107 C C     . ASP B 1 203 ? 31.585  62.080  30.663 1.00 35.04  ? 229 ASP B C     1 
ATOM   4108 O O     . ASP B 1 203 ? 31.010  61.523  29.747 1.00 35.27  ? 229 ASP B O     1 
ATOM   4109 C CB    . ASP B 1 203 ? 33.784  62.690  29.616 1.00 35.11  ? 229 ASP B CB    1 
ATOM   4110 C CG    . ASP B 1 203 ? 34.495  63.749  28.771 1.00 37.83  ? 229 ASP B CG    1 
ATOM   4111 O OD1   . ASP B 1 203 ? 34.157  64.951  28.885 1.00 40.74  ? 229 ASP B OD1   1 
ATOM   4112 O OD2   . ASP B 1 203 ? 35.408  63.382  27.989 1.00 40.24  ? 229 ASP B OD2   1 
ATOM   4113 N N     . TYR B 1 204 ? 31.418  61.725  31.937 1.00 34.59  ? 230 TYR B N     1 
ATOM   4114 C CA    . TYR B 1 204 ? 30.541  60.617  32.336 1.00 34.31  ? 230 TYR B CA    1 
ATOM   4115 C C     . TYR B 1 204 ? 29.099  60.709  31.815 1.00 35.06  ? 230 TYR B C     1 
ATOM   4116 O O     . TYR B 1 204 ? 28.440  59.666  31.649 1.00 35.34  ? 230 TYR B O     1 
ATOM   4117 C CB    . TYR B 1 204 ? 30.536  60.443  33.863 1.00 33.96  ? 230 TYR B CB    1 
ATOM   4118 C CG    . TYR B 1 204 ? 29.537  61.303  34.592 1.00 34.14  ? 230 TYR B CG    1 
ATOM   4119 C CD1   . TYR B 1 204 ? 29.858  62.601  34.997 1.00 33.18  ? 230 TYR B CD1   1 
ATOM   4120 C CD2   . TYR B 1 204 ? 28.258  60.822  34.872 1.00 34.97  ? 230 TYR B CD2   1 
ATOM   4121 C CE1   . TYR B 1 204 ? 28.918  63.399  35.644 1.00 33.41  ? 230 TYR B CE1   1 
ATOM   4122 C CE2   . TYR B 1 204 ? 27.328  61.598  35.527 1.00 34.52  ? 230 TYR B CE2   1 
ATOM   4123 C CZ    . TYR B 1 204 ? 27.663  62.885  35.915 1.00 34.25  ? 230 TYR B CZ    1 
ATOM   4124 O OH    . TYR B 1 204 ? 26.725  63.642  36.567 1.00 34.94  ? 230 TYR B OH    1 
ATOM   4125 N N     . ASP B 1 205 ? 28.599  61.916  31.549 1.00 34.83  ? 231 ASP B N     1 
ATOM   4126 C CA    . ASP B 1 205 ? 27.181  62.031  31.169 1.00 35.79  ? 231 ASP B CA    1 
ATOM   4127 C C     . ASP B 1 205 ? 26.996  62.241  29.680 1.00 36.36  ? 231 ASP B C     1 
ATOM   4128 O O     . ASP B 1 205 ? 25.886  62.494  29.213 1.00 36.47  ? 231 ASP B O     1 
ATOM   4129 C CB    . ASP B 1 205 ? 26.489  63.150  31.943 1.00 36.18  ? 231 ASP B CB    1 
ATOM   4130 C CG    . ASP B 1 205 ? 26.945  64.530  31.503 1.00 38.26  ? 231 ASP B CG    1 
ATOM   4131 O OD1   . ASP B 1 205 ? 28.051  64.655  30.923 1.00 35.90  ? 231 ASP B OD1   1 
ATOM   4132 O OD2   . ASP B 1 205 ? 26.192  65.496  31.746 1.00 42.82  ? 231 ASP B OD2   1 
ATOM   4133 N N     . LEU B 1 206 ? 28.095  62.166  28.939 1.00 36.65  ? 232 LEU B N     1 
ATOM   4134 C CA    . LEU B 1 206 ? 28.034  62.394  27.505 1.00 38.27  ? 232 LEU B CA    1 
ATOM   4135 C C     . LEU B 1 206 ? 27.325  61.221  26.847 1.00 38.84  ? 232 LEU B C     1 
ATOM   4136 O O     . LEU B 1 206 ? 27.530  60.057  27.214 1.00 37.98  ? 232 LEU B O     1 
ATOM   4137 C CB    . LEU B 1 206 ? 29.418  62.571  26.889 1.00 37.94  ? 232 LEU B CB    1 
ATOM   4138 C CG    . LEU B 1 206 ? 30.164  63.825  27.330 1.00 39.59  ? 232 LEU B CG    1 
ATOM   4139 C CD1   . LEU B 1 206 ? 31.554  63.910  26.641 1.00 37.12  ? 232 LEU B CD1   1 
ATOM   4140 C CD2   . LEU B 1 206 ? 29.323  65.065  27.077 1.00 39.58  ? 232 LEU B CD2   1 
ATOM   4141 N N     . VAL B 1 207 ? 26.472  61.557  25.898 1.00 39.84  ? 233 VAL B N     1 
ATOM   4142 C CA    . VAL B 1 207 ? 25.756  60.577  25.154 1.00 41.20  ? 233 VAL B CA    1 
ATOM   4143 C C     . VAL B 1 207 ? 26.721  59.882  24.214 1.00 42.48  ? 233 VAL B C     1 
ATOM   4144 O O     . VAL B 1 207 ? 27.593  60.510  23.581 1.00 43.61  ? 233 VAL B O     1 
ATOM   4145 C CB    . VAL B 1 207 ? 24.617  61.236  24.366 1.00 42.94  ? 233 VAL B CB    1 
ATOM   4146 C CG1   . VAL B 1 207 ? 24.292  60.442  23.110 1.00 44.80  ? 233 VAL B CG1   1 
ATOM   4147 C CG2   . VAL B 1 207 ? 23.399  61.425  25.258 1.00 40.30  ? 233 VAL B CG2   1 
ATOM   4148 N N     . LEU B 1 208 ? 26.561  58.572  24.161 1.00 42.82  ? 234 LEU B N     1 
ATOM   4149 C CA    . LEU B 1 208 ? 27.221  57.703  23.197 1.00 44.12  ? 234 LEU B CA    1 
ATOM   4150 C C     . LEU B 1 208 ? 27.184  58.272  21.753 1.00 45.72  ? 234 LEU B C     1 
ATOM   4151 O O     . LEU B 1 208 ? 26.114  58.515  21.211 1.00 46.79  ? 234 LEU B O     1 
ATOM   4152 C CB    . LEU B 1 208 ? 26.518  56.330  23.264 1.00 43.84  ? 234 LEU B CB    1 
ATOM   4153 C CG    . LEU B 1 208 ? 27.123  55.141  22.531 1.00 46.14  ? 234 LEU B CG    1 
ATOM   4154 C CD1   . LEU B 1 208 ? 28.448  54.732  23.151 1.00 44.27  ? 234 LEU B CD1   1 
ATOM   4155 C CD2   . LEU B 1 208 ? 26.135  53.996  22.584 1.00 47.02  ? 234 LEU B CD2   1 
ATOM   4156 N N     . ALA B 1 209 ? 28.351  58.479  21.148 1.00 46.39  ? 235 ALA B N     1 
ATOM   4157 C CA    . ALA B 1 209 ? 28.440  58.835  19.722 1.00 49.32  ? 235 ALA B CA    1 
ATOM   4158 C C     . ALA B 1 209 ? 27.940  57.690  18.819 1.00 51.54  ? 235 ALA B C     1 
ATOM   4159 O O     . ALA B 1 209 ? 28.077  56.513  19.159 1.00 51.29  ? 235 ALA B O     1 
ATOM   4160 C CB    . ALA B 1 209 ? 29.883  59.202  19.350 1.00 49.45  ? 235 ALA B CB    1 
ATOM   4161 N N     . GLU B 1 210 ? 27.388  58.055  17.669 1.00 54.27  ? 236 GLU B N     1 
ATOM   4162 C CA    . GLU B 1 210 ? 26.751  57.119  16.746 1.00 57.08  ? 236 GLU B CA    1 
ATOM   4163 C C     . GLU B 1 210 ? 27.667  56.000  16.241 1.00 57.47  ? 236 GLU B C     1 
ATOM   4164 O O     . GLU B 1 210 ? 27.186  54.996  15.717 1.00 58.44  ? 236 GLU B O     1 
ATOM   4165 C CB    . GLU B 1 210 ? 26.167  57.872  15.548 1.00 60.05  ? 236 GLU B CB    1 
ATOM   4166 C CG    . GLU B 1 210 ? 25.125  58.921  15.922 1.00 63.79  ? 236 GLU B CG    1 
ATOM   4167 C CD    . GLU B 1 210 ? 23.781  58.326  16.332 1.00 66.86  ? 236 GLU B CD    1 
ATOM   4168 O OE1   . GLU B 1 210 ? 22.995  57.983  15.415 1.00 71.28  ? 236 GLU B OE1   1 
ATOM   4169 O OE2   . GLU B 1 210 ? 23.507  58.230  17.558 1.00 63.65  ? 236 GLU B OE2   1 
ATOM   4170 N N     . ASP B 1 211 ? 28.974  56.169  16.413 1.00 56.31  ? 237 ASP B N     1 
ATOM   4171 C CA    . ASP B 1 211 ? 29.930  55.271  15.786 1.00 57.41  ? 237 ASP B CA    1 
ATOM   4172 C C     . ASP B 1 211 ? 30.785  54.539  16.816 1.00 54.43  ? 237 ASP B C     1 
ATOM   4173 O O     . ASP B 1 211 ? 31.802  53.943  16.468 1.00 54.71  ? 237 ASP B O     1 
ATOM   4174 C CB    . ASP B 1 211 ? 30.816  56.048  14.801 1.00 59.74  ? 237 ASP B CB    1 
ATOM   4175 C CG    . ASP B 1 211 ? 31.953  56.788  15.498 1.00 59.72  ? 237 ASP B CG    1 
ATOM   4176 O OD1   . ASP B 1 211 ? 31.756  57.269  16.641 1.00 57.60  ? 237 ASP B OD1   1 
ATOM   4177 O OD2   . ASP B 1 211 ? 33.048  56.880  14.904 1.00 62.97  ? 237 ASP B OD2   1 
ATOM   4178 N N     . GLU B 1 212 ? 30.356  54.568  18.075 1.00 51.26  ? 238 GLU B N     1 
ATOM   4179 C CA    . GLU B 1 212 ? 31.105  53.924  19.149 1.00 49.20  ? 238 GLU B CA    1 
ATOM   4180 C C     . GLU B 1 212 ? 30.356  52.766  19.795 1.00 47.21  ? 238 GLU B C     1 
ATOM   4181 O O     . GLU B 1 212 ? 29.130  52.762  19.833 1.00 47.05  ? 238 GLU B O     1 
ATOM   4182 C CB    . GLU B 1 212 ? 31.499  54.973  20.198 1.00 48.23  ? 238 GLU B CB    1 
ATOM   4183 C CG    . GLU B 1 212 ? 32.833  55.676  19.875 1.00 52.75  ? 238 GLU B CG    1 
ATOM   4184 C CD    . GLU B 1 212 ? 34.031  54.731  19.981 1.00 57.95  ? 238 GLU B CD    1 
ATOM   4185 O OE1   . GLU B 1 212 ? 33.979  53.766  20.802 1.00 58.11  ? 238 GLU B OE1   1 
ATOM   4186 O OE2   . GLU B 1 212 ? 35.019  54.945  19.231 1.00 61.60  ? 238 GLU B OE2   1 
ATOM   4187 N N     . GLU B 1 213 ? 31.099  51.782  20.291 1.00 46.10  ? 239 GLU B N     1 
ATOM   4188 C CA    . GLU B 1 213 ? 30.514  50.643  21.018 1.00 45.43  ? 239 GLU B CA    1 
ATOM   4189 C C     . GLU B 1 213 ? 30.524  50.828  22.523 1.00 42.57  ? 239 GLU B C     1 
ATOM   4190 O O     . GLU B 1 213 ? 29.982  49.989  23.264 1.00 42.90  ? 239 GLU B O     1 
ATOM   4191 C CB    . GLU B 1 213 ? 31.217  49.324  20.664 1.00 47.00  ? 239 GLU B CB    1 
ATOM   4192 C CG    . GLU B 1 213 ? 32.636  49.201  21.187 1.00 47.78  ? 239 GLU B CG    1 
ATOM   4193 C CD    . GLU B 1 213 ? 33.198  47.794  21.084 1.00 50.70  ? 239 GLU B CD    1 
ATOM   4194 O OE1   . GLU B 1 213 ? 34.373  47.599  21.465 1.00 53.14  ? 239 GLU B OE1   1 
ATOM   4195 O OE2   . GLU B 1 213 ? 32.489  46.882  20.614 1.00 53.42  ? 239 GLU B OE2   1 
ATOM   4196 N N     . MET B 1 214 ? 31.150  51.909  22.985 1.00 40.47  ? 240 MET B N     1 
ATOM   4197 C CA    . MET B 1 214 ? 31.231  52.196  24.417 1.00 37.76  ? 240 MET B CA    1 
ATOM   4198 C C     . MET B 1 214 ? 31.300  53.709  24.632 1.00 36.81  ? 240 MET B C     1 
ATOM   4199 O O     . MET B 1 214 ? 31.702  54.441  23.735 1.00 37.35  ? 240 MET B O     1 
ATOM   4200 C CB    . MET B 1 214 ? 32.438  51.479  25.025 1.00 37.22  ? 240 MET B CB    1 
ATOM   4201 C CG    . MET B 1 214 ? 33.772  52.146  24.736 1.00 37.38  ? 240 MET B CG    1 
ATOM   4202 S SD    . MET B 1 214 ? 35.159  51.212  25.378 1.00 42.31  ? 240 MET B SD    1 
ATOM   4203 C CE    . MET B 1 214 ? 35.313  49.893  24.167 1.00 41.40  ? 240 MET B CE    1 
ATOM   4204 N N     . ASN B 1 215 ? 30.882  54.191  25.794 1.00 35.36  ? 241 ASN B N     1 
ATOM   4205 C CA    . ASN B 1 215 ? 30.954  55.638  26.041 1.00 35.79  ? 241 ASN B CA    1 
ATOM   4206 C C     . ASN B 1 215 ? 32.399  56.123  26.273 1.00 35.85  ? 241 ASN B C     1 
ATOM   4207 O O     . ASN B 1 215 ? 33.315  55.301  26.478 1.00 34.89  ? 241 ASN B O     1 
ATOM   4208 C CB    . ASN B 1 215 ? 30.019  56.084  27.177 1.00 33.76  ? 241 ASN B CB    1 
ATOM   4209 C CG    . ASN B 1 215 ? 30.348  55.427  28.498 1.00 34.11  ? 241 ASN B CG    1 
ATOM   4210 O OD1   . ASN B 1 215 ? 31.516  55.317  28.900 1.00 33.51  ? 241 ASN B OD1   1 
ATOM   4211 N ND2   . ASN B 1 215 ? 29.310  54.985  29.198 1.00 35.50  ? 241 ASN B ND2   1 
ATOM   4212 N N     . ARG B 1 216 ? 32.574  57.447  26.216 1.00 36.39  ? 242 ARG B N     1 
ATOM   4213 C CA    . ARG B 1 216 ? 33.891  58.090  26.229 1.00 37.34  ? 242 ARG B CA    1 
ATOM   4214 C C     . ARG B 1 216 ? 34.712  57.728  27.440 1.00 36.49  ? 242 ARG B C     1 
ATOM   4215 O O     . ARG B 1 216 ? 35.900  57.465  27.323 1.00 37.28  ? 242 ARG B O     1 
ATOM   4216 C CB    . ARG B 1 216 ? 33.754  59.605  26.088 1.00 38.05  ? 242 ARG B CB    1 
ATOM   4217 C CG    . ARG B 1 216 ? 33.668  59.997  24.604 1.00 42.72  ? 242 ARG B CG    1 
ATOM   4218 C CD    . ARG B 1 216 ? 33.334  61.451  24.341 1.00 48.34  ? 242 ARG B CD    1 
ATOM   4219 N NE    . ARG B 1 216 ? 33.015  61.644  22.917 1.00 54.58  ? 242 ARG B NE    1 
ATOM   4220 C CZ    . ARG B 1 216 ? 31.778  61.616  22.415 1.00 56.51  ? 242 ARG B CZ    1 
ATOM   4221 N NH1   . ARG B 1 216 ? 30.730  61.418  23.214 1.00 58.62  ? 242 ARG B NH1   1 
ATOM   4222 N NH2   . ARG B 1 216 ? 31.579  61.795  21.122 1.00 57.26  ? 242 ARG B NH2   1 
ATOM   4223 N N     . MET B 1 217 ? 34.064  57.673  28.596 1.00 35.58  ? 243 MET B N     1 
ATOM   4224 C CA    . MET B 1 217 ? 34.719  57.249  29.795 1.00 34.91  ? 243 MET B CA    1 
ATOM   4225 C C     . MET B 1 217 ? 35.275  55.828  29.696 1.00 35.21  ? 243 MET B C     1 
ATOM   4226 O O     . MET B 1 217 ? 36.383  55.551  30.204 1.00 35.80  ? 243 MET B O     1 
ATOM   4227 C CB    . MET B 1 217 ? 33.755  57.358  30.969 1.00 34.49  ? 243 MET B CB    1 
ATOM   4228 C CG    . MET B 1 217 ? 34.410  57.047  32.294 1.00 35.31  ? 243 MET B CG    1 
ATOM   4229 S SD    . MET B 1 217 ? 35.401  58.451  32.817 1.00 39.75  ? 243 MET B SD    1 
ATOM   4230 C CE    . MET B 1 217 ? 34.145  59.510  33.513 1.00 36.08  ? 243 MET B CE    1 
ATOM   4231 N N     . HIS B 1 218 ? 34.505  54.921  29.093 1.00 34.88  ? 244 HIS B N     1 
ATOM   4232 C CA    . HIS B 1 218 ? 34.975  53.546  28.879 1.00 35.69  ? 244 HIS B CA    1 
ATOM   4233 C C     . HIS B 1 218 ? 36.125  53.458  27.863 1.00 36.53  ? 244 HIS B C     1 
ATOM   4234 O O     . HIS B 1 218 ? 37.010  52.638  28.034 1.00 37.48  ? 244 HIS B O     1 
ATOM   4235 C CB    . HIS B 1 218 ? 33.812  52.595  28.531 1.00 36.29  ? 244 HIS B CB    1 
ATOM   4236 C CG    . HIS B 1 218 ? 33.021  52.185  29.729 1.00 36.04  ? 244 HIS B CG    1 
ATOM   4237 N ND1   . HIS B 1 218 ? 32.059  52.998  30.296 1.00 35.96  ? 244 HIS B ND1   1 
ATOM   4238 C CD2   . HIS B 1 218 ? 33.110  51.093  30.524 1.00 34.97  ? 244 HIS B CD2   1 
ATOM   4239 C CE1   . HIS B 1 218 ? 31.579  52.415  31.380 1.00 34.39  ? 244 HIS B CE1   1 
ATOM   4240 N NE2   . HIS B 1 218 ? 32.194  51.256  31.535 1.00 36.01  ? 244 HIS B NE2   1 
ATOM   4241 N N     . GLU B 1 219 ? 36.115  54.300  26.829 1.00 37.05  ? 245 GLU B N     1 
ATOM   4242 C CA    . GLU B 1 219 ? 37.257  54.424  25.913 1.00 39.40  ? 245 GLU B CA    1 
ATOM   4243 C C     . GLU B 1 219 ? 38.530  54.764  26.688 1.00 38.80  ? 245 GLU B C     1 
ATOM   4244 O O     . GLU B 1 219 ? 39.568  54.114  26.525 1.00 38.78  ? 245 GLU B O     1 
ATOM   4245 C CB    . GLU B 1 219 ? 36.992  55.492  24.852 1.00 40.11  ? 245 GLU B CB    1 
ATOM   4246 C CG    . GLU B 1 219 ? 36.206  54.953  23.649 1.00 48.29  ? 245 GLU B CG    1 
ATOM   4247 C CD    . GLU B 1 219 ? 36.048  55.983  22.548 1.00 56.77  ? 245 GLU B CD    1 
ATOM   4248 O OE1   . GLU B 1 219 ? 35.273  56.953  22.740 1.00 60.21  ? 245 GLU B OE1   1 
ATOM   4249 O OE2   . GLU B 1 219 ? 36.693  55.823  21.486 1.00 60.38  ? 245 GLU B OE2   1 
ATOM   4250 N N     . SER B 1 220 ? 38.411  55.757  27.574 1.00 37.73  ? 246 SER B N     1 
ATOM   4251 C CA    . SER B 1 220 ? 39.514  56.206  28.384 1.00 37.64  ? 246 SER B CA    1 
ATOM   4252 C C     . SER B 1 220 ? 39.962  55.094  29.349 1.00 37.21  ? 246 SER B C     1 
ATOM   4253 O O     . SER B 1 220 ? 41.144  54.868  29.511 1.00 37.39  ? 246 SER B O     1 
ATOM   4254 C CB    . SER B 1 220 ? 39.116  57.505  29.101 1.00 36.84  ? 246 SER B CB    1 
ATOM   4255 O OG    . SER B 1 220 ? 40.111  57.882  30.028 1.00 40.51  ? 246 SER B OG    1 
ATOM   4256 N N     . MET B 1 221 ? 39.022  54.366  29.945 1.00 37.24  ? 247 MET B N     1 
ATOM   4257 C CA    . MET B 1 221 ? 39.375  53.175  30.747 1.00 37.86  ? 247 MET B CA    1 
ATOM   4258 C C     . MET B 1 221 ? 40.131  52.099  29.960 1.00 39.25  ? 247 MET B C     1 
ATOM   4259 O O     . MET B 1 221 ? 41.103  51.509  30.460 1.00 39.82  ? 247 MET B O     1 
ATOM   4260 C CB    . MET B 1 221 ? 38.133  52.541  31.373 1.00 37.22  ? 247 MET B CB    1 
ATOM   4261 C CG    . MET B 1 221 ? 37.583  53.286  32.566 1.00 37.14  ? 247 MET B CG    1 
ATOM   4262 S SD    . MET B 1 221 ? 35.870  52.815  32.930 1.00 39.54  ? 247 MET B SD    1 
ATOM   4263 C CE    . MET B 1 221 ? 36.097  51.077  33.339 1.00 32.73  ? 247 MET B CE    1 
ATOM   4264 N N     . LYS B 1 222 ? 39.671  51.825  28.745 1.00 40.10  ? 248 LYS B N     1 
ATOM   4265 C CA    . LYS B 1 222 ? 40.334  50.844  27.890 1.00 42.02  ? 248 LYS B CA    1 
ATOM   4266 C C     . LYS B 1 222 ? 41.794  51.241  27.611 1.00 42.05  ? 248 LYS B C     1 
ATOM   4267 O O     . LYS B 1 222 ? 42.689  50.407  27.671 1.00 43.32  ? 248 LYS B O     1 
ATOM   4268 C CB    . LYS B 1 222 ? 39.556  50.660  26.586 1.00 42.91  ? 248 LYS B CB    1 
ATOM   4269 C CG    . LYS B 1 222 ? 40.134  49.583  25.675 1.00 47.46  ? 248 LYS B CG    1 
ATOM   4270 C CD    . LYS B 1 222 ? 39.290  49.393  24.431 1.00 52.01  ? 248 LYS B CD    1 
ATOM   4271 C CE    . LYS B 1 222 ? 39.716  48.145  23.642 1.00 55.04  ? 248 LYS B CE    1 
ATOM   4272 N NZ    . LYS B 1 222 ? 38.488  47.597  22.978 1.00 56.62  ? 248 LYS B NZ    1 
ATOM   4273 N N     . LEU B 1 223 ? 42.028  52.522  27.339 1.00 41.40  ? 249 LEU B N     1 
ATOM   4274 C CA    . LEU B 1 223 ? 43.365  53.012  27.087 1.00 41.77  ? 249 LEU B CA    1 
ATOM   4275 C C     . LEU B 1 223 ? 44.229  52.911  28.335 1.00 41.69  ? 249 LEU B C     1 
ATOM   4276 O O     . LEU B 1 223 ? 45.395  52.518  28.249 1.00 42.53  ? 249 LEU B O     1 
ATOM   4277 C CB    . LEU B 1 223 ? 43.325  54.457  26.583 1.00 41.57  ? 249 LEU B CB    1 
ATOM   4278 C CG    . LEU B 1 223 ? 44.675  55.133  26.314 1.00 41.85  ? 249 LEU B CG    1 
ATOM   4279 C CD1   . LEU B 1 223 ? 45.484  54.290  25.349 1.00 44.41  ? 249 LEU B CD1   1 
ATOM   4280 C CD2   . LEU B 1 223 ? 44.464  56.543  25.767 1.00 41.95  ? 249 LEU B CD2   1 
ATOM   4281 N N     . PHE B 1 224 ? 43.653  53.267  29.484 1.00 40.79  ? 250 PHE B N     1 
ATOM   4282 C CA    . PHE B 1 224 ? 44.355  53.198  30.758 1.00 40.62  ? 250 PHE B CA    1 
ATOM   4283 C C     . PHE B 1 224 ? 44.709  51.773  31.129 1.00 42.01  ? 250 PHE B C     1 
ATOM   4284 O O     . PHE B 1 224 ? 45.806  51.520  31.622 1.00 42.28  ? 250 PHE B O     1 
ATOM   4285 C CB    . PHE B 1 224 ? 43.536  53.850  31.880 1.00 39.26  ? 250 PHE B CB    1 
ATOM   4286 C CG    . PHE B 1 224 ? 44.251  53.897  33.204 1.00 38.29  ? 250 PHE B CG    1 
ATOM   4287 C CD1   . PHE B 1 224 ? 45.303  54.781  33.412 1.00 37.42  ? 250 PHE B CD1   1 
ATOM   4288 C CD2   . PHE B 1 224 ? 43.869  53.062  34.245 1.00 40.26  ? 250 PHE B CD2   1 
ATOM   4289 C CE1   . PHE B 1 224 ? 45.971  54.834  34.629 1.00 37.92  ? 250 PHE B CE1   1 
ATOM   4290 C CE2   . PHE B 1 224 ? 44.519  53.123  35.496 1.00 40.39  ? 250 PHE B CE2   1 
ATOM   4291 C CZ    . PHE B 1 224 ? 45.574  54.018  35.682 1.00 38.70  ? 250 PHE B CZ    1 
ATOM   4292 N N     . ASP B 1 225 ? 43.783  50.849  30.893 1.00 43.20  ? 251 ASP B N     1 
ATOM   4293 C CA    . ASP B 1 225 ? 44.017  49.410  31.136 1.00 45.60  ? 251 ASP B CA    1 
ATOM   4294 C C     . ASP B 1 225 ? 45.198  48.875  30.312 1.00 46.94  ? 251 ASP B C     1 
ATOM   4295 O O     . ASP B 1 225 ? 45.996  48.064  30.783 1.00 47.81  ? 251 ASP B O     1 
ATOM   4296 C CB    . ASP B 1 225 ? 42.748  48.608  30.789 1.00 46.48  ? 251 ASP B CB    1 
ATOM   4297 C CG    . ASP B 1 225 ? 42.885  47.103  31.072 1.00 50.09  ? 251 ASP B CG    1 
ATOM   4298 O OD1   . ASP B 1 225 ? 43.834  46.672  31.757 1.00 52.71  ? 251 ASP B OD1   1 
ATOM   4299 O OD2   . ASP B 1 225 ? 42.014  46.337  30.614 1.00 53.48  ? 251 ASP B OD2   1 
ATOM   4300 N N     . SER B 1 226 ? 45.296  49.339  29.077 1.00 47.19  ? 252 SER B N     1 
ATOM   4301 C CA    . SER B 1 226 ? 46.348  48.897  28.189 1.00 49.23  ? 252 SER B CA    1 
ATOM   4302 C C     . SER B 1 226 ? 47.709  49.435  28.640 1.00 49.14  ? 252 SER B C     1 
ATOM   4303 O O     . SER B 1 226 ? 48.656  48.674  28.771 1.00 50.73  ? 252 SER B O     1 
ATOM   4304 C CB    . SER B 1 226 ? 46.024  49.315  26.761 1.00 49.43  ? 252 SER B CB    1 
ATOM   4305 O OG    . SER B 1 226 ? 46.889  48.670  25.860 1.00 53.13  ? 252 SER B OG    1 
ATOM   4306 N N     . ILE B 1 227 ? 47.789  50.734  28.910 1.00 48.20  ? 253 ILE B N     1 
ATOM   4307 C CA    . ILE B 1 227 ? 49.025  51.382  29.360 1.00 48.45  ? 253 ILE B CA    1 
ATOM   4308 C C     . ILE B 1 227 ? 49.501  50.867  30.714 1.00 49.54  ? 253 ILE B C     1 
ATOM   4309 O O     . ILE B 1 227 ? 50.677  50.560  30.901 1.00 50.89  ? 253 ILE B O     1 
ATOM   4310 C CB    . ILE B 1 227 ? 48.840  52.914  29.450 1.00 47.09  ? 253 ILE B CB    1 
ATOM   4311 C CG1   . ILE B 1 227 ? 48.635  53.496  28.054 1.00 47.23  ? 253 ILE B CG1   1 
ATOM   4312 C CG2   . ILE B 1 227 ? 50.023  53.574  30.164 1.00 45.97  ? 253 ILE B CG2   1 
ATOM   4313 C CD1   . ILE B 1 227 ? 48.031  54.858  28.063 1.00 47.42  ? 253 ILE B CD1   1 
ATOM   4314 N N     . CYS B 1 228 ? 48.577  50.769  31.656 1.00 49.44  ? 254 CYS B N     1 
ATOM   4315 C CA    . CYS B 1 228 ? 48.905  50.385  33.010 1.00 50.89  ? 254 CYS B CA    1 
ATOM   4316 C C     . CYS B 1 228 ? 49.351  48.926  33.113 1.00 52.03  ? 254 CYS B C     1 
ATOM   4317 O O     . CYS B 1 228 ? 50.230  48.600  33.922 1.00 53.57  ? 254 CYS B O     1 
ATOM   4318 C CB    . CYS B 1 228 ? 47.712  50.685  33.924 1.00 50.59  ? 254 CYS B CB    1 
ATOM   4319 S SG    . CYS B 1 228 ? 47.888  50.060  35.553 1.00 58.47  ? 254 CYS B SG    1 
ATOM   4320 N N     . ASN B 1 229 ? 48.776  48.050  32.286 1.00 51.84  ? 255 ASN B N     1 
ATOM   4321 C CA    . ASN B 1 229 ? 49.104  46.611  32.344 1.00 52.44  ? 255 ASN B CA    1 
ATOM   4322 C C     . ASN B 1 229 ? 50.154  46.108  31.358 1.00 53.53  ? 255 ASN B C     1 
ATOM   4323 O O     . ASN B 1 229 ? 50.506  44.918  31.377 1.00 54.95  ? 255 ASN B O     1 
ATOM   4324 C CB    . ASN B 1 229 ? 47.843  45.759  32.205 1.00 52.44  ? 255 ASN B CB    1 
ATOM   4325 C CG    . ASN B 1 229 ? 46.939  45.881  33.403 1.00 52.01  ? 255 ASN B CG    1 
ATOM   4326 O OD1   . ASN B 1 229 ? 47.314  45.497  34.512 1.00 53.82  ? 255 ASN B OD1   1 
ATOM   4327 N ND2   . ASN B 1 229 ? 45.752  46.442  33.199 1.00 45.89  ? 255 ASN B ND2   1 
ATOM   4328 N N     . ASN B 1 230 ? 50.649  46.977  30.486 1.00 52.26  ? 256 ASN B N     1 
ATOM   4329 C CA    . ASN B 1 230 ? 51.675  46.517  29.570 1.00 53.59  ? 256 ASN B CA    1 
ATOM   4330 C C     . ASN B 1 230 ? 53.028  46.447  30.289 1.00 54.51  ? 256 ASN B C     1 
ATOM   4331 O O     . ASN B 1 230 ? 53.513  47.432  30.848 1.00 53.10  ? 256 ASN B O     1 
ATOM   4332 C CB    . ASN B 1 230 ? 51.729  47.353  28.289 1.00 52.98  ? 256 ASN B CB    1 
ATOM   4333 C CG    . ASN B 1 230 ? 52.552  46.689  27.193 1.00 54.72  ? 256 ASN B CG    1 
ATOM   4334 O OD1   . ASN B 1 230 ? 53.715  46.348  27.397 1.00 55.17  ? 256 ASN B OD1   1 
ATOM   4335 N ND2   . ASN B 1 230 ? 51.950  46.508  26.024 1.00 54.47  ? 256 ASN B ND2   1 
ATOM   4336 N N     . LYS B 1 231 ? 53.601  45.251  30.279 1.00 56.87  ? 257 LYS B N     1 
ATOM   4337 C CA    . LYS B 1 231 ? 54.863  44.963  30.936 1.00 59.02  ? 257 LYS B CA    1 
ATOM   4338 C C     . LYS B 1 231 ? 55.977  45.898  30.457 1.00 58.64  ? 257 LYS B C     1 
ATOM   4339 O O     . LYS B 1 231 ? 56.894  46.211  31.211 1.00 58.99  ? 257 LYS B O     1 
ATOM   4340 C CB    . LYS B 1 231 ? 55.240  43.504  30.683 1.00 61.72  ? 257 LYS B CB    1 
ATOM   4341 C CG    . LYS B 1 231 ? 56.268  42.958  31.639 1.00 65.49  ? 257 LYS B CG    1 
ATOM   4342 C CD    . LYS B 1 231 ? 56.256  41.441  31.630 1.00 70.75  ? 257 LYS B CD    1 
ATOM   4343 C CE    . LYS B 1 231 ? 57.575  40.906  32.125 1.00 73.49  ? 257 LYS B CE    1 
ATOM   4344 N NZ    . LYS B 1 231 ? 57.599  39.422  32.083 1.00 78.48  ? 257 LYS B NZ    1 
ATOM   4345 N N     . TRP B 1 232 ? 55.867  46.348  29.207 1.00 58.13  ? 258 TRP B N     1 
ATOM   4346 C CA    . TRP B 1 232 ? 56.795  47.300  28.600 1.00 57.95  ? 258 TRP B CA    1 
ATOM   4347 C C     . TRP B 1 232 ? 56.894  48.608  29.387 1.00 56.45  ? 258 TRP B C     1 
ATOM   4348 O O     . TRP B 1 232 ? 57.922  49.293  29.332 1.00 56.57  ? 258 TRP B O     1 
ATOM   4349 C CB    . TRP B 1 232 ? 56.365  47.571  27.154 1.00 57.93  ? 258 TRP B CB    1 
ATOM   4350 C CG    . TRP B 1 232 ? 57.407  48.185  26.266 1.00 59.44  ? 258 TRP B CG    1 
ATOM   4351 C CD1   . TRP B 1 232 ? 58.671  47.708  26.015 1.00 61.17  ? 258 TRP B CD1   1 
ATOM   4352 C CD2   . TRP B 1 232 ? 57.261  49.369  25.474 1.00 58.71  ? 258 TRP B CD2   1 
ATOM   4353 N NE1   . TRP B 1 232 ? 59.319  48.537  25.135 1.00 61.90  ? 258 TRP B NE1   1 
ATOM   4354 C CE2   . TRP B 1 232 ? 58.479  49.562  24.783 1.00 60.26  ? 258 TRP B CE2   1 
ATOM   4355 C CE3   . TRP B 1 232 ? 56.219  50.292  25.286 1.00 58.02  ? 258 TRP B CE3   1 
ATOM   4356 C CZ2   . TRP B 1 232 ? 58.690  50.641  23.919 1.00 60.76  ? 258 TRP B CZ2   1 
ATOM   4357 C CZ3   . TRP B 1 232 ? 56.427  51.367  24.429 1.00 59.11  ? 258 TRP B CZ3   1 
ATOM   4358 C CH2   . TRP B 1 232 ? 57.662  51.530  23.752 1.00 60.49  ? 258 TRP B CH2   1 
ATOM   4359 N N     . PHE B 1 233 ? 55.832  48.927  30.132 1.00 55.22  ? 259 PHE B N     1 
ATOM   4360 C CA    . PHE B 1 233 ? 55.740  50.154  30.925 1.00 53.97  ? 259 PHE B CA    1 
ATOM   4361 C C     . PHE B 1 233 ? 56.081  49.963  32.409 1.00 54.44  ? 259 PHE B C     1 
ATOM   4362 O O     . PHE B 1 233 ? 56.004  50.912  33.187 1.00 53.38  ? 259 PHE B O     1 
ATOM   4363 C CB    . PHE B 1 233 ? 54.335  50.770  30.801 1.00 52.53  ? 259 PHE B CB    1 
ATOM   4364 C CG    . PHE B 1 233 ? 54.042  51.360  29.452 1.00 52.49  ? 259 PHE B CG    1 
ATOM   4365 C CD1   . PHE B 1 233 ? 54.793  52.419  28.963 1.00 53.51  ? 259 PHE B CD1   1 
ATOM   4366 C CD2   . PHE B 1 233 ? 53.004  50.867  28.677 1.00 52.45  ? 259 PHE B CD2   1 
ATOM   4367 C CE1   . PHE B 1 233 ? 54.514  52.972  27.719 1.00 53.68  ? 259 PHE B CE1   1 
ATOM   4368 C CE2   . PHE B 1 233 ? 52.726  51.409  27.428 1.00 52.59  ? 259 PHE B CE2   1 
ATOM   4369 C CZ    . PHE B 1 233 ? 53.483  52.463  26.949 1.00 52.84  ? 259 PHE B CZ    1 
ATOM   4370 N N     . THR B 1 234 ? 56.448  48.742  32.790 1.00 56.06  ? 260 THR B N     1 
ATOM   4371 C CA    . THR B 1 234 ? 56.807  48.403  34.174 1.00 57.66  ? 260 THR B CA    1 
ATOM   4372 C C     . THR B 1 234 ? 57.690  49.429  34.900 1.00 57.82  ? 260 THR B C     1 
ATOM   4373 O O     . THR B 1 234 ? 57.473  49.716  36.076 1.00 58.01  ? 260 THR B O     1 
ATOM   4374 C CB    . THR B 1 234 ? 57.478  47.004  34.215 1.00 60.31  ? 260 THR B CB    1 
ATOM   4375 O OG1   . THR B 1 234 ? 56.506  46.019  33.852 1.00 60.73  ? 260 THR B OG1   1 
ATOM   4376 C CG2   . THR B 1 234 ? 58.044  46.670  35.603 1.00 62.30  ? 260 THR B CG2   1 
ATOM   4377 N N     . ASP B 1 235 ? 58.678  49.986  34.204 1.00 58.19  ? 261 ASP B N     1 
ATOM   4378 C CA    . ASP B 1 235 ? 59.585  50.958  34.821 1.00 58.52  ? 261 ASP B CA    1 
ATOM   4379 C C     . ASP B 1 235 ? 59.117  52.401  34.739 1.00 56.58  ? 261 ASP B C     1 
ATOM   4380 O O     . ASP B 1 235 ? 59.750  53.290  35.304 1.00 57.04  ? 261 ASP B O     1 
ATOM   4381 C CB    . ASP B 1 235 ? 60.987  50.835  34.223 1.00 60.05  ? 261 ASP B CB    1 
ATOM   4382 C CG    . ASP B 1 235 ? 61.693  49.576  34.663 1.00 63.06  ? 261 ASP B CG    1 
ATOM   4383 O OD1   . ASP B 1 235 ? 62.524  49.071  33.876 1.00 66.14  ? 261 ASP B OD1   1 
ATOM   4384 O OD2   . ASP B 1 235 ? 61.422  49.091  35.790 1.00 64.01  ? 261 ASP B OD2   1 
ATOM   4385 N N     . THR B 1 236 ? 58.019  52.633  34.029 1.00 54.76  ? 262 THR B N     1 
ATOM   4386 C CA    . THR B 1 236 ? 57.469  53.969  33.874 1.00 52.79  ? 262 THR B CA    1 
ATOM   4387 C C     . THR B 1 236 ? 56.421  54.192  34.950 1.00 51.87  ? 262 THR B C     1 
ATOM   4388 O O     . THR B 1 236 ? 55.545  53.343  35.157 1.00 51.81  ? 262 THR B O     1 
ATOM   4389 C CB    . THR B 1 236 ? 56.826  54.131  32.485 1.00 52.36  ? 262 THR B CB    1 
ATOM   4390 O OG1   . THR B 1 236 ? 57.726  53.630  31.478 1.00 53.72  ? 262 THR B OG1   1 
ATOM   4391 C CG2   . THR B 1 236 ? 56.482  55.586  32.202 1.00 50.18  ? 262 THR B CG2   1 
ATOM   4392 N N     . SER B 1 237 ? 56.521  55.322  35.650 1.00 50.85  ? 263 SER B N     1 
ATOM   4393 C CA    . SER B 1 237 ? 55.541  55.675  36.668 1.00 49.62  ? 263 SER B CA    1 
ATOM   4394 C C     . SER B 1 237 ? 54.269  56.179  36.006 1.00 47.35  ? 263 SER B C     1 
ATOM   4395 O O     . SER B 1 237 ? 54.336  56.909  35.008 1.00 46.73  ? 263 SER B O     1 
ATOM   4396 C CB    . SER B 1 237 ? 56.100  56.746  37.607 1.00 50.41  ? 263 SER B CB    1 
ATOM   4397 O OG    . SER B 1 237 ? 57.073  56.191  38.473 1.00 53.39  ? 263 SER B OG    1 
ATOM   4398 N N     . ILE B 1 238 ? 53.125  55.787  36.571 1.00 46.17  ? 264 ILE B N     1 
ATOM   4399 C CA    . ILE B 1 238 ? 51.796  56.175  36.082 1.00 43.70  ? 264 ILE B CA    1 
ATOM   4400 C C     . ILE B 1 238 ? 51.081  57.063  37.105 1.00 42.68  ? 264 ILE B C     1 
ATOM   4401 O O     . ILE B 1 238 ? 50.789  56.640  38.223 1.00 42.47  ? 264 ILE B O     1 
ATOM   4402 C CB    . ILE B 1 238 ? 50.881  54.942  35.815 1.00 43.90  ? 264 ILE B CB    1 
ATOM   4403 C CG1   . ILE B 1 238 ? 51.548  53.916  34.895 1.00 45.46  ? 264 ILE B CG1   1 
ATOM   4404 C CG2   . ILE B 1 238 ? 49.499  55.381  35.286 1.00 43.03  ? 264 ILE B CG2   1 
ATOM   4405 C CD1   . ILE B 1 238 ? 51.989  54.460  33.533 1.00 47.80  ? 264 ILE B CD1   1 
ATOM   4406 N N     . ILE B 1 239 ? 50.788  58.289  36.687 1.00 41.03  ? 265 ILE B N     1 
ATOM   4407 C CA    . ILE B 1 239 ? 50.065  59.245  37.486 1.00 39.51  ? 265 ILE B CA    1 
ATOM   4408 C C     . ILE B 1 239 ? 48.709  59.445  36.806 1.00 38.55  ? 265 ILE B C     1 
ATOM   4409 O O     . ILE B 1 239 ? 48.629  59.526  35.585 1.00 38.34  ? 265 ILE B O     1 
ATOM   4410 C CB    . ILE B 1 239 ? 50.877  60.540  37.599 1.00 39.86  ? 265 ILE B CB    1 
ATOM   4411 C CG1   . ILE B 1 239 ? 52.183  60.257  38.377 1.00 41.40  ? 265 ILE B CG1   1 
ATOM   4412 C CG2   . ILE B 1 239 ? 50.088  61.632  38.300 1.00 39.69  ? 265 ILE B CG2   1 
ATOM   4413 C CD1   . ILE B 1 239 ? 53.382  61.027  37.882 1.00 39.32  ? 265 ILE B CD1   1 
ATOM   4414 N N     . LEU B 1 240 ? 47.648  59.477  37.603 1.00 37.98  ? 266 LEU B N     1 
ATOM   4415 C CA    . LEU B 1 240 ? 46.301  59.578  37.106 1.00 36.78  ? 266 LEU B CA    1 
ATOM   4416 C C     . LEU B 1 240 ? 45.684  60.872  37.625 1.00 36.91  ? 266 LEU B C     1 
ATOM   4417 O O     . LEU B 1 240 ? 45.541  61.037  38.837 1.00 38.08  ? 266 LEU B O     1 
ATOM   4418 C CB    . LEU B 1 240 ? 45.502  58.360  37.573 1.00 36.37  ? 266 LEU B CB    1 
ATOM   4419 C CG    . LEU B 1 240 ? 43.998  58.331  37.262 1.00 34.74  ? 266 LEU B CG    1 
ATOM   4420 C CD1   . LEU B 1 240 ? 43.691  58.386  35.783 1.00 31.41  ? 266 LEU B CD1   1 
ATOM   4421 C CD2   . LEU B 1 240 ? 43.386  57.096  37.872 1.00 34.88  ? 266 LEU B CD2   1 
ATOM   4422 N N     . PHE B 1 241 ? 45.382  61.803  36.716 1.00 36.26  ? 267 PHE B N     1 
ATOM   4423 C CA    . PHE B 1 241 ? 44.674  63.026  37.055 1.00 36.69  ? 267 PHE B CA    1 
ATOM   4424 C C     . PHE B 1 241 ? 43.211  62.856  36.674 1.00 36.24  ? 267 PHE B C     1 
ATOM   4425 O O     . PHE B 1 241 ? 42.860  62.779  35.491 1.00 35.11  ? 267 PHE B O     1 
ATOM   4426 C CB    . PHE B 1 241 ? 45.202  64.231  36.275 1.00 37.37  ? 267 PHE B CB    1 
ATOM   4427 C CG    . PHE B 1 241 ? 46.488  64.798  36.785 1.00 39.56  ? 267 PHE B CG    1 
ATOM   4428 C CD1   . PHE B 1 241 ? 47.202  64.185  37.821 1.00 40.00  ? 267 PHE B CD1   1 
ATOM   4429 C CD2   . PHE B 1 241 ? 47.013  65.953  36.190 1.00 40.73  ? 267 PHE B CD2   1 
ATOM   4430 C CE1   . PHE B 1 241 ? 48.408  64.718  38.264 1.00 40.08  ? 267 PHE B CE1   1 
ATOM   4431 C CE2   . PHE B 1 241 ? 48.229  66.490  36.624 1.00 41.97  ? 267 PHE B CE2   1 
ATOM   4432 C CZ    . PHE B 1 241 ? 48.929  65.866  37.657 1.00 41.44  ? 267 PHE B CZ    1 
ATOM   4433 N N     . LEU B 1 242 ? 42.357  62.803  37.680 1.00 32.83  ? 268 LEU B N     1 
ATOM   4434 C CA    . LEU B 1 242 ? 40.926  62.779  37.441 1.00 31.53  ? 268 LEU B CA    1 
ATOM   4435 C C     . LEU B 1 242 ? 40.496  64.234  37.457 1.00 32.07  ? 268 LEU B C     1 
ATOM   4436 O O     . LEU B 1 242 ? 40.285  64.848  38.520 1.00 33.45  ? 268 LEU B O     1 
ATOM   4437 C CB    . LEU B 1 242 ? 40.223  61.932  38.487 1.00 30.98  ? 268 LEU B CB    1 
ATOM   4438 C CG    . LEU B 1 242 ? 40.586  60.434  38.432 1.00 32.36  ? 268 LEU B CG    1 
ATOM   4439 C CD1   . LEU B 1 242 ? 39.982  59.683  39.626 1.00 32.66  ? 268 LEU B CD1   1 
ATOM   4440 C CD2   . LEU B 1 242 ? 40.133  59.743  37.151 1.00 31.55  ? 268 LEU B CD2   1 
ATOM   4441 N N     . ASN B 1 243 ? 40.384  64.778  36.250 1.00 31.46  ? 269 ASN B N     1 
ATOM   4442 C CA    . ASN B 1 243 ? 40.340  66.204  36.036 1.00 31.50  ? 269 ASN B CA    1 
ATOM   4443 C C     . ASN B 1 243 ? 38.911  66.684  35.813 1.00 30.50  ? 269 ASN B C     1 
ATOM   4444 O O     . ASN B 1 243 ? 38.007  65.869  35.700 1.00 28.49  ? 269 ASN B O     1 
ATOM   4445 C CB    . ASN B 1 243 ? 41.249  66.569  34.851 1.00 32.10  ? 269 ASN B CB    1 
ATOM   4446 C CG    . ASN B 1 243 ? 41.327  68.052  34.616 1.00 33.23  ? 269 ASN B CG    1 
ATOM   4447 O OD1   . ASN B 1 243 ? 41.594  68.839  35.543 1.00 33.86  ? 269 ASN B OD1   1 
ATOM   4448 N ND2   . ASN B 1 243 ? 41.098  68.457  33.372 1.00 30.69  ? 269 ASN B ND2   1 
ATOM   4449 N N     . LYS B 1 244 ? 38.723  68.006  35.769 1.00 31.03  ? 270 LYS B N     1 
ATOM   4450 C CA    . LYS B 1 244 ? 37.390  68.613  35.668 1.00 32.21  ? 270 LYS B CA    1 
ATOM   4451 C C     . LYS B 1 244 ? 36.504  68.254  36.855 1.00 31.86  ? 270 LYS B C     1 
ATOM   4452 O O     . LYS B 1 244 ? 35.281  68.073  36.703 1.00 32.31  ? 270 LYS B O     1 
ATOM   4453 C CB    . LYS B 1 244 ? 36.700  68.274  34.333 1.00 31.69  ? 270 LYS B CB    1 
ATOM   4454 C CG    . LYS B 1 244 ? 37.496  68.778  33.134 1.00 33.83  ? 270 LYS B CG    1 
ATOM   4455 C CD    . LYS B 1 244 ? 36.724  68.677  31.834 1.00 37.02  ? 270 LYS B CD    1 
ATOM   4456 C CE    . LYS B 1 244 ? 37.450  69.397  30.681 1.00 36.23  ? 270 LYS B CE    1 
ATOM   4457 N NZ    . LYS B 1 244 ? 36.714  69.207  29.376 1.00 36.35  ? 270 LYS B NZ    1 
ATOM   4458 N N     . LYS B 1 245 ? 37.117  68.171  38.032 1.00 31.79  ? 271 LYS B N     1 
ATOM   4459 C CA    . LYS B 1 245 ? 36.371  67.855  39.259 1.00 32.93  ? 271 LYS B CA    1 
ATOM   4460 C C     . LYS B 1 245 ? 35.330  68.919  39.590 1.00 33.71  ? 271 LYS B C     1 
ATOM   4461 O O     . LYS B 1 245 ? 34.304  68.590  40.180 1.00 34.44  ? 271 LYS B O     1 
ATOM   4462 C CB    . LYS B 1 245 ? 37.317  67.641  40.462 1.00 33.67  ? 271 LYS B CB    1 
ATOM   4463 C CG    . LYS B 1 245 ? 37.976  68.922  41.000 1.00 34.81  ? 271 LYS B CG    1 
ATOM   4464 C CD    . LYS B 1 245 ? 39.159  68.567  41.866 1.00 36.23  ? 271 LYS B CD    1 
ATOM   4465 C CE    . LYS B 1 245 ? 39.817  69.817  42.411 1.00 39.92  ? 271 LYS B CE    1 
ATOM   4466 N NZ    . LYS B 1 245 ? 39.360  70.047  43.797 1.00 44.30  ? 271 LYS B NZ    1 
ATOM   4467 N N     . ASP B 1 246 ? 35.593  70.172  39.189 1.00 34.55  ? 272 ASP B N     1 
ATOM   4468 C CA    . ASP B 1 246 ? 34.650  71.289  39.376 1.00 36.53  ? 272 ASP B CA    1 
ATOM   4469 C C     . ASP B 1 246 ? 33.373  71.060  38.570 1.00 36.47  ? 272 ASP B C     1 
ATOM   4470 O O     . ASP B 1 246 ? 32.273  71.157  39.114 1.00 37.47  ? 272 ASP B O     1 
ATOM   4471 C CB    . ASP B 1 246 ? 35.281  72.657  39.006 1.00 37.73  ? 272 ASP B CB    1 
ATOM   4472 C CG    . ASP B 1 246 ? 35.782  72.709  37.547 1.00 40.34  ? 272 ASP B CG    1 
ATOM   4473 O OD1   . ASP B 1 246 ? 36.206  71.647  37.011 1.00 40.55  ? 272 ASP B OD1   1 
ATOM   4474 O OD2   . ASP B 1 246 ? 35.749  73.803  36.930 1.00 41.44  ? 272 ASP B OD2   1 
ATOM   4475 N N     . LEU B 1 247 ? 33.514  70.743  37.276 1.00 35.73  ? 273 LEU B N     1 
ATOM   4476 C CA    . LEU B 1 247 ? 32.350  70.449  36.445 1.00 35.53  ? 273 LEU B CA    1 
ATOM   4477 C C     . LEU B 1 247 ? 31.669  69.171  36.923 1.00 34.84  ? 273 LEU B C     1 
ATOM   4478 O O     . LEU B 1 247 ? 30.446  69.056  36.890 1.00 35.63  ? 273 LEU B O     1 
ATOM   4479 C CB    . LEU B 1 247 ? 32.725  70.349  34.961 1.00 34.90  ? 273 LEU B CB    1 
ATOM   4480 C CG    . LEU B 1 247 ? 33.381  71.579  34.328 1.00 36.25  ? 273 LEU B CG    1 
ATOM   4481 C CD1   . LEU B 1 247 ? 33.755  71.271  32.879 1.00 35.32  ? 273 LEU B CD1   1 
ATOM   4482 C CD2   . LEU B 1 247 ? 32.493  72.833  34.410 1.00 35.51  ? 273 LEU B CD2   1 
ATOM   4483 N N     . PHE B 1 248 ? 32.461  68.206  37.365 1.00 33.99  ? 274 PHE B N     1 
ATOM   4484 C CA    . PHE B 1 248 ? 31.885  66.944  37.839 1.00 34.09  ? 274 PHE B CA    1 
ATOM   4485 C C     . PHE B 1 248 ? 30.972  67.199  39.053 1.00 35.80  ? 274 PHE B C     1 
ATOM   4486 O O     . PHE B 1 248 ? 29.861  66.671  39.131 1.00 36.10  ? 274 PHE B O     1 
ATOM   4487 C CB    . PHE B 1 248 ? 32.975  65.926  38.184 1.00 32.15  ? 274 PHE B CB    1 
ATOM   4488 C CG    . PHE B 1 248 ? 32.439  64.621  38.707 1.00 32.47  ? 274 PHE B CG    1 
ATOM   4489 C CD1   . PHE B 1 248 ? 31.940  63.664  37.839 1.00 31.10  ? 274 PHE B CD1   1 
ATOM   4490 C CD2   . PHE B 1 248 ? 32.422  64.354  40.081 1.00 33.90  ? 274 PHE B CD2   1 
ATOM   4491 C CE1   . PHE B 1 248 ? 31.425  62.471  38.315 1.00 31.65  ? 274 PHE B CE1   1 
ATOM   4492 C CE2   . PHE B 1 248 ? 31.919  63.154  40.572 1.00 32.30  ? 274 PHE B CE2   1 
ATOM   4493 C CZ    . PHE B 1 248 ? 31.416  62.215  39.688 1.00 33.99  ? 274 PHE B CZ    1 
ATOM   4494 N N     . GLU B 1 249 ? 31.447  68.021  39.981 1.00 37.27  ? 275 GLU B N     1 
ATOM   4495 C CA    . GLU B 1 249 ? 30.653  68.397  41.136 1.00 39.93  ? 275 GLU B CA    1 
ATOM   4496 C C     . GLU B 1 249 ? 29.319  69.060  40.786 1.00 41.10  ? 275 GLU B C     1 
ATOM   4497 O O     . GLU B 1 249 ? 28.323  68.799  41.458 1.00 42.85  ? 275 GLU B O     1 
ATOM   4498 C CB    . GLU B 1 249 ? 31.452  69.302  42.064 1.00 41.77  ? 275 GLU B CB    1 
ATOM   4499 C CG    . GLU B 1 249 ? 30.964  69.215  43.487 1.00 46.28  ? 275 GLU B CG    1 
ATOM   4500 C CD    . GLU B 1 249 ? 31.463  70.335  44.354 1.00 52.19  ? 275 GLU B CD    1 
ATOM   4501 O OE1   . GLU B 1 249 ? 32.646  70.735  44.218 1.00 52.93  ? 275 GLU B OE1   1 
ATOM   4502 O OE2   . GLU B 1 249 ? 30.665  70.798  45.191 1.00 56.45  ? 275 GLU B OE2   1 
ATOM   4503 N N     . GLU B 1 250 ? 29.297  69.915  39.762 1.00 40.90  ? 276 GLU B N     1 
ATOM   4504 C CA    . GLU B 1 250 ? 28.046  70.554  39.312 1.00 42.72  ? 276 GLU B CA    1 
ATOM   4505 C C     . GLU B 1 250 ? 27.104  69.540  38.689 1.00 42.09  ? 276 GLU B C     1 
ATOM   4506 O O     . GLU B 1 250 ? 25.896  69.563  38.951 1.00 43.60  ? 276 GLU B O     1 
ATOM   4507 C CB    . GLU B 1 250 ? 28.303  71.682  38.288 1.00 43.34  ? 276 GLU B CB    1 
ATOM   4508 C CG    . GLU B 1 250 ? 29.058  72.906  38.817 1.00 47.75  ? 276 GLU B CG    1 
ATOM   4509 C CD    . GLU B 1 250 ? 29.853  73.686  37.729 1.00 52.93  ? 276 GLU B CD    1 
ATOM   4510 O OE1   . GLU B 1 250 ? 29.503  73.656  36.513 1.00 54.75  ? 276 GLU B OE1   1 
ATOM   4511 O OE2   . GLU B 1 250 ? 30.841  74.357  38.107 1.00 55.76  ? 276 GLU B OE2   1 
ATOM   4512 N N     . LYS B 1 251 ? 27.653  68.662  37.850 1.00 40.10  ? 277 LYS B N     1 
ATOM   4513 C CA    . LYS B 1 251 ? 26.837  67.723  37.062 1.00 40.39  ? 277 LYS B CA    1 
ATOM   4514 C C     . LYS B 1 251 ? 26.205  66.624  37.899 1.00 40.28  ? 277 LYS B C     1 
ATOM   4515 O O     . LYS B 1 251 ? 25.057  66.254  37.667 1.00 41.88  ? 277 LYS B O     1 
ATOM   4516 C CB    . LYS B 1 251 ? 27.664  67.070  35.954 1.00 39.07  ? 277 LYS B CB    1 
ATOM   4517 C CG    . LYS B 1 251 ? 27.984  67.991  34.803 1.00 40.39  ? 277 LYS B CG    1 
ATOM   4518 C CD    . LYS B 1 251 ? 28.516  67.180  33.631 1.00 43.06  ? 277 LYS B CD    1 
ATOM   4519 C CE    . LYS B 1 251 ? 28.916  68.066  32.464 1.00 44.50  ? 277 LYS B CE    1 
ATOM   4520 N NZ    . LYS B 1 251 ? 29.121  67.220  31.244 1.00 47.22  ? 277 LYS B NZ    1 
ATOM   4521 N N     . ILE B 1 252 ? 26.959  66.116  38.871 1.00 38.74  ? 278 ILE B N     1 
ATOM   4522 C CA    . ILE B 1 252 ? 26.534  64.980  39.677 1.00 39.22  ? 278 ILE B CA    1 
ATOM   4523 C C     . ILE B 1 252 ? 25.233  65.226  40.455 1.00 42.57  ? 278 ILE B C     1 
ATOM   4524 O O     . ILE B 1 252 ? 24.571  64.270  40.838 1.00 43.75  ? 278 ILE B O     1 
ATOM   4525 C CB    . ILE B 1 252 ? 27.661  64.493  40.620 1.00 37.85  ? 278 ILE B CB    1 
ATOM   4526 C CG1   . ILE B 1 252 ? 27.410  63.050  41.079 1.00 39.52  ? 278 ILE B CG1   1 
ATOM   4527 C CG2   . ILE B 1 252 ? 27.841  65.442  41.816 1.00 38.63  ? 278 ILE B CG2   1 
ATOM   4528 C CD1   . ILE B 1 252 ? 27.208  62.015  39.921 1.00 39.86  ? 278 ILE B CD1   1 
ATOM   4529 N N     . LYS B 1 253 ? 24.877  66.499  40.654 1.00 44.10  ? 279 LYS B N     1 
ATOM   4530 C CA    . LYS B 1 253 ? 23.617  66.879  41.289 1.00 48.17  ? 279 LYS B CA    1 
ATOM   4531 C C     . LYS B 1 253 ? 22.435  66.667  40.353 1.00 50.11  ? 279 LYS B C     1 
ATOM   4532 O O     . LYS B 1 253 ? 21.332  66.384  40.811 1.00 52.51  ? 279 LYS B O     1 
ATOM   4533 C CB    . LYS B 1 253 ? 23.665  68.344  41.763 1.00 49.27  ? 279 LYS B CB    1 
ATOM   4534 C CG    . LYS B 1 253 ? 24.959  68.683  42.520 1.00 49.70  ? 279 LYS B CG    1 
ATOM   4535 C CD    . LYS B 1 253 ? 24.812  69.862  43.480 1.00 55.43  ? 279 LYS B CD    1 
ATOM   4536 C CE    . LYS B 1 253 ? 25.367  71.166  42.935 1.00 56.21  ? 279 LYS B CE    1 
ATOM   4537 N NZ    . LYS B 1 253 ? 26.861  71.126  42.860 1.00 58.25  ? 279 LYS B NZ    1 
ATOM   4538 N N     . LYS B 1 254 ? 22.664  66.793  39.044 1.00 49.72  ? 280 LYS B N     1 
ATOM   4539 C CA    . LYS B 1 254 ? 21.573  66.658  38.059 1.00 52.45  ? 280 LYS B CA    1 
ATOM   4540 C C     . LYS B 1 254 ? 21.587  65.331  37.302 1.00 51.12  ? 280 LYS B C     1 
ATOM   4541 O O     . LYS B 1 254 ? 20.538  64.798  36.942 1.00 53.31  ? 280 LYS B O     1 
ATOM   4542 C CB    . LYS B 1 254 ? 21.597  67.808  37.034 1.00 53.49  ? 280 LYS B CB    1 
ATOM   4543 C CG    . LYS B 1 254 ? 20.452  67.688  35.986 1.00 58.83  ? 280 LYS B CG    1 
ATOM   4544 C CD    . LYS B 1 254 ? 20.298  68.900  35.052 1.00 62.68  ? 280 LYS B CD    1 
ATOM   4545 C CE    . LYS B 1 254 ? 19.144  68.684  34.072 1.00 67.21  ? 280 LYS B CE    1 
ATOM   4546 N NZ    . LYS B 1 254 ? 17.831  68.451  34.757 1.00 70.44  ? 280 LYS B NZ    1 
ATOM   4547 N N     . SER B 1 255 ? 22.781  64.822  37.033 1.00 47.60  ? 281 SER B N     1 
ATOM   4548 C CA    . SER B 1 255 ? 22.927  63.674  36.157 1.00 46.50  ? 281 SER B CA    1 
ATOM   4549 C C     . SER B 1 255 ? 23.462  62.473  36.919 1.00 44.46  ? 281 SER B C     1 
ATOM   4550 O O     . SER B 1 255 ? 24.574  62.505  37.440 1.00 42.56  ? 281 SER B O     1 
ATOM   4551 C CB    . SER B 1 255 ? 23.831  64.023  34.966 1.00 45.00  ? 281 SER B CB    1 
ATOM   4552 O OG    . SER B 1 255 ? 23.346  65.177  34.298 1.00 47.24  ? 281 SER B OG    1 
ATOM   4553 N N     . PRO B 1 256 ? 22.664  61.410  36.996 1.00 45.33  ? 282 PRO B N     1 
ATOM   4554 C CA    . PRO B 1 256 ? 23.092  60.258  37.759 1.00 44.72  ? 282 PRO B CA    1 
ATOM   4555 C C     . PRO B 1 256 ? 24.233  59.536  37.057 1.00 42.27  ? 282 PRO B C     1 
ATOM   4556 O O     . PRO B 1 256 ? 24.250  59.457  35.826 1.00 42.18  ? 282 PRO B O     1 
ATOM   4557 C CB    . PRO B 1 256 ? 21.837  59.379  37.806 1.00 47.50  ? 282 PRO B CB    1 
ATOM   4558 C CG    . PRO B 1 256 ? 21.016  59.816  36.671 1.00 49.20  ? 282 PRO B CG    1 
ATOM   4559 C CD    . PRO B 1 256 ? 21.302  61.253  36.457 1.00 48.58  ? 282 PRO B CD    1 
ATOM   4560 N N     . LEU B 1 257 ? 25.157  59.016  37.850 1.00 40.23  ? 283 LEU B N     1 
ATOM   4561 C CA    . LEU B 1 257 ? 26.311  58.315  37.355 1.00 39.12  ? 283 LEU B CA    1 
ATOM   4562 C C     . LEU B 1 257 ? 25.952  57.060  36.537 1.00 40.65  ? 283 LEU B C     1 
ATOM   4563 O O     . LEU B 1 257 ? 26.787  56.550  35.787 1.00 38.98  ? 283 LEU B O     1 
ATOM   4564 C CB    . LEU B 1 257 ? 27.235  57.966  38.515 1.00 38.33  ? 283 LEU B CB    1 
ATOM   4565 C CG    . LEU B 1 257 ? 28.629  57.459  38.146 1.00 37.81  ? 283 LEU B CG    1 
ATOM   4566 C CD1   . LEU B 1 257 ? 29.419  58.470  37.296 1.00 36.31  ? 283 LEU B CD1   1 
ATOM   4567 C CD2   . LEU B 1 257 ? 29.387  57.060  39.401 1.00 36.83  ? 283 LEU B CD2   1 
ATOM   4568 N N     . THR B 1 258 ? 24.697  56.615  36.659 1.00 43.26  ? 284 THR B N     1 
ATOM   4569 C CA    . THR B 1 258 ? 24.209  55.430  35.989 1.00 45.61  ? 284 THR B CA    1 
ATOM   4570 C C     . THR B 1 258 ? 24.160  55.648  34.489 1.00 45.53  ? 284 THR B C     1 
ATOM   4571 O O     . THR B 1 258 ? 24.102  54.689  33.727 1.00 46.96  ? 284 THR B O     1 
ATOM   4572 C CB    . THR B 1 258 ? 22.794  54.997  36.498 1.00 49.63  ? 284 THR B CB    1 
ATOM   4573 O OG1   . THR B 1 258 ? 21.860  56.090  36.370 1.00 51.55  ? 284 THR B OG1   1 
ATOM   4574 C CG2   . THR B 1 258 ? 22.858  54.501  37.949 1.00 48.96  ? 284 THR B CG2   1 
ATOM   4575 N N     . ILE B 1 259 ? 24.171  56.910  34.068 1.00 44.51  ? 285 ILE B N     1 
ATOM   4576 C CA    . ILE B 1 259 ? 24.308  57.237  32.651 1.00 44.76  ? 285 ILE B CA    1 
ATOM   4577 C C     . ILE B 1 259 ? 25.584  56.603  32.076 1.00 43.36  ? 285 ILE B C     1 
ATOM   4578 O O     . ILE B 1 259 ? 25.586  56.131  30.946 1.00 44.86  ? 285 ILE B O     1 
ATOM   4579 C CB    . ILE B 1 259 ? 24.360  58.772  32.412 1.00 43.80  ? 285 ILE B CB    1 
ATOM   4580 C CG1   . ILE B 1 259 ? 23.025  59.436  32.781 1.00 45.71  ? 285 ILE B CG1   1 
ATOM   4581 C CG2   . ILE B 1 259 ? 24.712  59.084  30.939 1.00 43.05  ? 285 ILE B CG2   1 
ATOM   4582 C CD1   . ILE B 1 259 ? 22.992  60.969  32.570 1.00 44.39  ? 285 ILE B CD1   1 
ATOM   4583 N N     . CYS B 1 260 ? 26.656  56.616  32.869 1.00 41.63  ? 286 CYS B N     1 
ATOM   4584 C CA    . CYS B 1 260 ? 27.967  56.103  32.490 1.00 40.45  ? 286 CYS B CA    1 
ATOM   4585 C C     . CYS B 1 260 ? 28.179  54.645  32.931 1.00 42.05  ? 286 CYS B C     1 
ATOM   4586 O O     . CYS B 1 260 ? 28.665  53.817  32.152 1.00 42.80  ? 286 CYS B O     1 
ATOM   4587 C CB    . CYS B 1 260 ? 29.051  56.974  33.100 1.00 37.87  ? 286 CYS B CB    1 
ATOM   4588 S SG    . CYS B 1 260 ? 30.719  56.637  32.492 1.00 35.95  ? 286 CYS B SG    1 
ATOM   4589 N N     . TYR B 1 261 ? 27.828  54.346  34.182 1.00 42.44  ? 287 TYR B N     1 
ATOM   4590 C CA    . TYR B 1 261 ? 27.977  53.008  34.728 1.00 43.56  ? 287 TYR B CA    1 
ATOM   4591 C C     . TYR B 1 261 ? 26.602  52.499  35.141 1.00 47.04  ? 287 TYR B C     1 
ATOM   4592 O O     . TYR B 1 261 ? 26.160  52.751  36.268 1.00 47.41  ? 287 TYR B O     1 
ATOM   4593 C CB    . TYR B 1 261 ? 28.910  53.016  35.926 1.00 41.87  ? 287 TYR B CB    1 
ATOM   4594 C CG    . TYR B 1 261 ? 30.306  53.521  35.639 1.00 38.73  ? 287 TYR B CG    1 
ATOM   4595 C CD1   . TYR B 1 261 ? 31.288  52.661  35.143 1.00 36.08  ? 287 TYR B CD1   1 
ATOM   4596 C CD2   . TYR B 1 261 ? 30.660  54.854  35.898 1.00 36.09  ? 287 TYR B CD2   1 
ATOM   4597 C CE1   . TYR B 1 261 ? 32.576  53.102  34.882 1.00 33.59  ? 287 TYR B CE1   1 
ATOM   4598 C CE2   . TYR B 1 261 ? 31.963  55.313  35.636 1.00 34.62  ? 287 TYR B CE2   1 
ATOM   4599 C CZ    . TYR B 1 261 ? 32.905  54.422  35.125 1.00 34.24  ? 287 TYR B CZ    1 
ATOM   4600 O OH    . TYR B 1 261 ? 34.181  54.847  34.867 1.00 33.26  ? 287 TYR B OH    1 
ATOM   4601 N N     . PRO B 1 262 ? 25.917  51.777  34.227 1.00 49.59  ? 288 PRO B N     1 
ATOM   4602 C CA    . PRO B 1 262 ? 24.524  51.375  34.463 1.00 53.10  ? 288 PRO B CA    1 
ATOM   4603 C C     . PRO B 1 262 ? 24.360  50.496  35.704 1.00 55.30  ? 288 PRO B C     1 
ATOM   4604 O O     . PRO B 1 262 ? 23.260  50.399  36.241 1.00 57.88  ? 288 PRO B O     1 
ATOM   4605 C CB    . PRO B 1 262 ? 24.139  50.594  33.194 1.00 55.17  ? 288 PRO B CB    1 
ATOM   4606 C CG    . PRO B 1 262 ? 25.245  50.844  32.193 1.00 52.95  ? 288 PRO B CG    1 
ATOM   4607 C CD    . PRO B 1 262 ? 26.460  51.233  32.969 1.00 49.86  ? 288 PRO B CD    1 
ATOM   4608 N N     . GLU B 1 263 ? 25.448  49.884  36.160 1.00 55.25  ? 289 GLU B N     1 
ATOM   4609 C CA    . GLU B 1 263 ? 25.416  48.999  37.328 1.00 58.05  ? 289 GLU B CA    1 
ATOM   4610 C C     . GLU B 1 263 ? 25.708  49.730  38.641 1.00 56.96  ? 289 GLU B C     1 
ATOM   4611 O O     . GLU B 1 263 ? 25.663  49.116  39.710 1.00 59.22  ? 289 GLU B O     1 
ATOM   4612 C CB    . GLU B 1 263 ? 26.395  47.827  37.148 1.00 58.94  ? 289 GLU B CB    1 
ATOM   4613 C CG    . GLU B 1 263 ? 27.884  48.157  37.421 1.00 58.26  ? 289 GLU B CG    1 
ATOM   4614 C CD    . GLU B 1 263 ? 28.566  49.035  36.351 1.00 58.08  ? 289 GLU B CD    1 
ATOM   4615 O OE1   . GLU B 1 263 ? 27.906  49.516  35.403 1.00 58.39  ? 289 GLU B OE1   1 
ATOM   4616 O OE2   . GLU B 1 263 ? 29.794  49.245  36.467 1.00 58.93  ? 289 GLU B OE2   1 
ATOM   4617 N N     . TYR B 1 264 ? 26.014  51.027  38.563 1.00 53.78  ? 290 TYR B N     1 
ATOM   4618 C CA    . TYR B 1 264 ? 26.317  51.803  39.762 1.00 52.97  ? 290 TYR B CA    1 
ATOM   4619 C C     . TYR B 1 264 ? 25.092  51.941  40.662 1.00 55.85  ? 290 TYR B C     1 
ATOM   4620 O O     . TYR B 1 264 ? 24.036  52.405  40.220 1.00 56.83  ? 290 TYR B O     1 
ATOM   4621 C CB    . TYR B 1 264 ? 26.850  53.184  39.394 1.00 49.53  ? 290 TYR B CB    1 
ATOM   4622 C CG    . TYR B 1 264 ? 27.128  54.089  40.583 1.00 47.94  ? 290 TYR B CG    1 
ATOM   4623 C CD1   . TYR B 1 264 ? 28.157  53.793  41.477 1.00 46.89  ? 290 TYR B CD1   1 
ATOM   4624 C CD2   . TYR B 1 264 ? 26.367  55.248  40.805 1.00 47.15  ? 290 TYR B CD2   1 
ATOM   4625 C CE1   . TYR B 1 264 ? 28.425  54.628  42.563 1.00 46.78  ? 290 TYR B CE1   1 
ATOM   4626 C CE2   . TYR B 1 264 ? 26.631  56.091  41.884 1.00 46.15  ? 290 TYR B CE2   1 
ATOM   4627 C CZ    . TYR B 1 264 ? 27.662  55.772  42.754 1.00 45.72  ? 290 TYR B CZ    1 
ATOM   4628 O OH    . TYR B 1 264 ? 27.929  56.582  43.827 1.00 46.49  ? 290 TYR B OH    1 
ATOM   4629 N N     . ALA B 1 265 ? 25.244  51.550  41.924 1.00 57.72  ? 291 ALA B N     1 
ATOM   4630 C CA    . ALA B 1 265 ? 24.099  51.476  42.844 1.00 61.50  ? 291 ALA B CA    1 
ATOM   4631 C C     . ALA B 1 265 ? 24.250  52.435  44.028 1.00 61.72  ? 291 ALA B C     1 
ATOM   4632 O O     . ALA B 1 265 ? 23.467  52.394  44.974 1.00 64.84  ? 291 ALA B O     1 
ATOM   4633 C CB    . ALA B 1 265 ? 23.907  50.039  43.337 1.00 64.47  ? 291 ALA B CB    1 
ATOM   4634 N N     . GLY B 1 266 ? 25.267  53.302  43.956 1.00 59.15  ? 292 GLY B N     1 
ATOM   4635 C CA    . GLY B 1 266 ? 25.541  54.292  45.004 1.00 59.06  ? 292 GLY B CA    1 
ATOM   4636 C C     . GLY B 1 266 ? 24.817  55.603  44.776 1.00 58.56  ? 292 GLY B C     1 
ATOM   4637 O O     . GLY B 1 266 ? 23.992  55.732  43.867 1.00 58.82  ? 292 GLY B O     1 
ATOM   4638 N N     . SER B 1 267 ? 25.106  56.582  45.634 1.00 58.37  ? 293 SER B N     1 
ATOM   4639 C CA    . SER B 1 267 ? 24.326  57.813  45.653 1.00 58.57  ? 293 SER B CA    1 
ATOM   4640 C C     . SER B 1 267 ? 24.989  58.790  44.721 1.00 54.45  ? 293 SER B C     1 
ATOM   4641 O O     . SER B 1 267 ? 26.163  58.640  44.393 1.00 52.71  ? 293 SER B O     1 
ATOM   4642 C CB    . SER B 1 267 ? 24.219  58.382  47.074 1.00 61.04  ? 293 SER B CB    1 
ATOM   4643 O OG    . SER B 1 267 ? 25.491  58.858  47.512 1.00 61.91  ? 293 SER B OG    1 
ATOM   4644 N N     . ASN B 1 268 ? 24.230  59.782  44.277 1.00 53.76  ? 294 ASN B N     1 
ATOM   4645 C CA    . ASN B 1 268 ? 24.746  60.774  43.362 1.00 50.14  ? 294 ASN B CA    1 
ATOM   4646 C C     . ASN B 1 268 ? 25.280  61.988  44.114 1.00 49.40  ? 294 ASN B C     1 
ATOM   4647 O O     . ASN B 1 268 ? 24.771  63.102  43.970 1.00 49.60  ? 294 ASN B O     1 
ATOM   4648 C CB    . ASN B 1 268 ? 23.684  61.137  42.327 1.00 50.55  ? 294 ASN B CB    1 
ATOM   4649 C CG    . ASN B 1 268 ? 23.395  59.981  41.368 1.00 51.82  ? 294 ASN B CG    1 
ATOM   4650 O OD1   . ASN B 1 268 ? 24.296  59.466  40.684 1.00 49.28  ? 294 ASN B OD1   1 
ATOM   4651 N ND2   . ASN B 1 268 ? 22.137  59.565  41.319 1.00 54.34  ? 294 ASN B ND2   1 
ATOM   4652 N N     . THR B 1 269 ? 26.298  61.740  44.940 1.00 48.09  ? 295 THR B N     1 
ATOM   4653 C CA    . THR B 1 269 ? 27.021  62.797  45.634 1.00 47.30  ? 295 THR B CA    1 
ATOM   4654 C C     . THR B 1 269 ? 28.442  62.846  45.097 1.00 44.12  ? 295 THR B C     1 
ATOM   4655 O O     . THR B 1 269 ? 28.982  61.833  44.656 1.00 43.34  ? 295 THR B O     1 
ATOM   4656 C CB    . THR B 1 269 ? 27.098  62.549  47.156 1.00 49.94  ? 295 THR B CB    1 
ATOM   4657 O OG1   . THR B 1 269 ? 27.843  61.352  47.407 1.00 49.30  ? 295 THR B OG1   1 
ATOM   4658 C CG2   . THR B 1 269 ? 25.705  62.432  47.769 1.00 53.46  ? 295 THR B CG2   1 
ATOM   4659 N N     . TYR B 1 270 ? 29.057  64.016  45.172 1.00 42.77  ? 296 TYR B N     1 
ATOM   4660 C CA    . TYR B 1 270 ? 30.416  64.203  44.697 1.00 40.17  ? 296 TYR B CA    1 
ATOM   4661 C C     . TYR B 1 270 ? 31.388  63.129  45.182 1.00 39.94  ? 296 TYR B C     1 
ATOM   4662 O O     . TYR B 1 270 ? 32.075  62.508  44.379 1.00 38.43  ? 296 TYR B O     1 
ATOM   4663 C CB    . TYR B 1 270 ? 30.936  65.596  45.070 1.00 40.14  ? 296 TYR B CB    1 
ATOM   4664 C CG    . TYR B 1 270 ? 32.387  65.774  44.695 1.00 38.14  ? 296 TYR B CG    1 
ATOM   4665 C CD1   . TYR B 1 270 ? 32.767  65.878  43.360 1.00 35.87  ? 296 TYR B CD1   1 
ATOM   4666 C CD2   . TYR B 1 270 ? 33.380  65.794  45.669 1.00 37.43  ? 296 TYR B CD2   1 
ATOM   4667 C CE1   . TYR B 1 270 ? 34.110  66.027  42.998 1.00 34.45  ? 296 TYR B CE1   1 
ATOM   4668 C CE2   . TYR B 1 270 ? 34.715  65.948  45.329 1.00 36.24  ? 296 TYR B CE2   1 
ATOM   4669 C CZ    . TYR B 1 270 ? 35.077  66.064  43.989 1.00 35.33  ? 296 TYR B CZ    1 
ATOM   4670 O OH    . TYR B 1 270 ? 36.402  66.199  43.638 1.00 33.78  ? 296 TYR B OH    1 
ATOM   4671 N N     . GLU B 1 271 ? 31.437  62.919  46.496 1.00 42.14  ? 297 GLU B N     1 
ATOM   4672 C CA    . GLU B 1 271 ? 32.421  62.030  47.120 1.00 42.55  ? 297 GLU B CA    1 
ATOM   4673 C C     . GLU B 1 271 ? 32.258  60.561  46.727 1.00 42.61  ? 297 GLU B C     1 
ATOM   4674 O O     . GLU B 1 271 ? 33.221  59.896  46.382 1.00 42.39  ? 297 GLU B O     1 
ATOM   4675 C CB    . GLU B 1 271 ? 32.367  62.150  48.646 1.00 45.16  ? 297 GLU B CB    1 
ATOM   4676 C CG    . GLU B 1 271 ? 32.884  63.467  49.219 1.00 45.15  ? 297 GLU B CG    1 
ATOM   4677 C CD    . GLU B 1 271 ? 31.850  64.581  49.214 1.00 42.38  ? 297 GLU B CD    1 
ATOM   4678 O OE1   . GLU B 1 271 ? 30.750  64.376  48.660 1.00 40.35  ? 297 GLU B OE1   1 
ATOM   4679 O OE2   . GLU B 1 271 ? 32.147  65.667  49.760 1.00 40.83  ? 297 GLU B OE2   1 
ATOM   4680 N N     . GLU B 1 272 ? 31.047  60.039  46.815 1.00 44.41  ? 298 GLU B N     1 
ATOM   4681 C CA    . GLU B 1 272 ? 30.842  58.647  46.482 1.00 45.48  ? 298 GLU B CA    1 
ATOM   4682 C C     . GLU B 1 272 ? 31.069  58.386  44.977 1.00 42.60  ? 298 GLU B C     1 
ATOM   4683 O O     . GLU B 1 272 ? 31.790  57.462  44.617 1.00 42.58  ? 298 GLU B O     1 
ATOM   4684 C CB    . GLU B 1 272 ? 29.464  58.168  46.933 1.00 48.07  ? 298 GLU B CB    1 
ATOM   4685 C CG    . GLU B 1 272 ? 29.452  56.703  47.301 1.00 51.12  ? 298 GLU B CG    1 
ATOM   4686 C CD    . GLU B 1 272 ? 28.059  56.136  47.414 1.00 55.55  ? 298 GLU B CD    1 
ATOM   4687 O OE1   . GLU B 1 272 ? 27.155  56.820  47.940 1.00 57.09  ? 298 GLU B OE1   1 
ATOM   4688 O OE2   . GLU B 1 272 ? 27.873  54.988  46.971 1.00 57.94  ? 298 GLU B OE2   1 
ATOM   4689 N N     . ALA B 1 273 ? 30.482  59.214  44.119 1.00 40.89  ? 299 ALA B N     1 
ATOM   4690 C CA    . ALA B 1 273 ? 30.569  59.003  42.670 1.00 38.65  ? 299 ALA B CA    1 
ATOM   4691 C C     . ALA B 1 273 ? 32.016  59.187  42.185 1.00 37.36  ? 299 ALA B C     1 
ATOM   4692 O O     . ALA B 1 273 ? 32.504  58.403  41.372 1.00 36.44  ? 299 ALA B O     1 
ATOM   4693 C CB    . ALA B 1 273 ? 29.618  59.926  41.943 1.00 37.29  ? 299 ALA B CB    1 
ATOM   4694 N N     . ALA B 1 274 ? 32.708  60.190  42.723 1.00 37.16  ? 300 ALA B N     1 
ATOM   4695 C CA    . ALA B 1 274 ? 34.103  60.423  42.358 1.00 36.82  ? 300 ALA B CA    1 
ATOM   4696 C C     . ALA B 1 274 ? 35.001  59.251  42.734 1.00 37.57  ? 300 ALA B C     1 
ATOM   4697 O O     . ALA B 1 274 ? 35.860  58.854  41.957 1.00 37.29  ? 300 ALA B O     1 
ATOM   4698 C CB    . ALA B 1 274 ? 34.626  61.729  42.983 1.00 37.39  ? 300 ALA B CB    1 
ATOM   4699 N N     . ALA B 1 275 ? 34.798  58.714  43.935 1.00 39.09  ? 301 ALA B N     1 
ATOM   4700 C CA    . ALA B 1 275 ? 35.508  57.528  44.405 1.00 40.03  ? 301 ALA B CA    1 
ATOM   4701 C C     . ALA B 1 275 ? 35.218  56.301  43.560 1.00 39.30  ? 301 ALA B C     1 
ATOM   4702 O O     . ALA B 1 275 ? 36.100  55.488  43.355 1.00 40.25  ? 301 ALA B O     1 
ATOM   4703 C CB    . ALA B 1 275 ? 35.127  57.228  45.852 1.00 42.72  ? 301 ALA B CB    1 
ATOM   4704 N N     . TYR B 1 276 ? 33.968  56.139  43.138 1.00 38.44  ? 302 TYR B N     1 
ATOM   4705 C CA    . TYR B 1 276 ? 33.598  55.061  42.246 1.00 38.60  ? 302 TYR B CA    1 
ATOM   4706 C C     . TYR B 1 276 ? 34.343  55.129  40.890 1.00 37.40  ? 302 TYR B C     1 
ATOM   4707 O O     . TYR B 1 276 ? 34.787  54.102  40.401 1.00 38.36  ? 302 TYR B O     1 
ATOM   4708 C CB    . TYR B 1 276 ? 32.090  55.056  42.020 1.00 38.78  ? 302 TYR B CB    1 
ATOM   4709 C CG    . TYR B 1 276 ? 31.587  53.790  41.357 1.00 38.97  ? 302 TYR B CG    1 
ATOM   4710 C CD1   . TYR B 1 276 ? 31.410  52.600  42.090 1.00 40.59  ? 302 TYR B CD1   1 
ATOM   4711 C CD2   . TYR B 1 276 ? 31.277  53.782  40.001 1.00 35.49  ? 302 TYR B CD2   1 
ATOM   4712 C CE1   . TYR B 1 276 ? 30.943  51.428  41.458 1.00 41.42  ? 302 TYR B CE1   1 
ATOM   4713 C CE2   . TYR B 1 276 ? 30.811  52.638  39.377 1.00 36.54  ? 302 TYR B CE2   1 
ATOM   4714 C CZ    . TYR B 1 276 ? 30.654  51.469  40.099 1.00 39.59  ? 302 TYR B CZ    1 
ATOM   4715 O OH    . TYR B 1 276 ? 30.185  50.366  39.430 1.00 42.96  ? 302 TYR B OH    1 
ATOM   4716 N N     . ILE B 1 277 ? 34.482  56.323  40.306 1.00 35.78  ? 303 ILE B N     1 
ATOM   4717 C CA    . ILE B 1 277 ? 35.217  56.479  39.061 1.00 35.54  ? 303 ILE B CA    1 
ATOM   4718 C C     . ILE B 1 277 ? 36.714  56.186  39.293 1.00 37.15  ? 303 ILE B C     1 
ATOM   4719 O O     . ILE B 1 277 ? 37.346  55.484  38.499 1.00 37.61  ? 303 ILE B O     1 
ATOM   4720 C CB    . ILE B 1 277 ? 34.994  57.876  38.414 1.00 34.37  ? 303 ILE B CB    1 
ATOM   4721 C CG1   . ILE B 1 277 ? 33.512  58.053  38.056 1.00 33.26  ? 303 ILE B CG1   1 
ATOM   4722 C CG2   . ILE B 1 277 ? 35.916  58.068  37.175 1.00 31.54  ? 303 ILE B CG2   1 
ATOM   4723 C CD1   . ILE B 1 277 ? 33.122  59.478  37.620 1.00 30.03  ? 303 ILE B CD1   1 
ATOM   4724 N N     . GLN B 1 278 ? 37.263  56.665  40.406 1.00 38.39  ? 304 GLN B N     1 
ATOM   4725 C CA    . GLN B 1 278 ? 38.644  56.329  40.758 1.00 40.11  ? 304 GLN B CA    1 
ATOM   4726 C C     . GLN B 1 278 ? 38.867  54.822  40.801 1.00 42.49  ? 304 GLN B C     1 
ATOM   4727 O O     . GLN B 1 278 ? 39.850  54.319  40.234 1.00 44.02  ? 304 GLN B O     1 
ATOM   4728 C CB    . GLN B 1 278 ? 39.071  56.976  42.081 1.00 40.93  ? 304 GLN B CB    1 
ATOM   4729 C CG    . GLN B 1 278 ? 40.470  56.571  42.540 1.00 41.78  ? 304 GLN B CG    1 
ATOM   4730 C CD    . GLN B 1 278 ? 40.879  57.207  43.841 1.00 43.65  ? 304 GLN B CD    1 
ATOM   4731 O OE1   . GLN B 1 278 ? 40.117  57.958  44.444 1.00 43.65  ? 304 GLN B OE1   1 
ATOM   4732 N NE2   . GLN B 1 278 ? 42.098  56.921  44.282 1.00 45.67  ? 304 GLN B NE2   1 
ATOM   4733 N N     . CYS B 1 279 ? 37.956  54.110  41.463 1.00 43.96  ? 305 CYS B N     1 
ATOM   4734 C CA    . CYS B 1 279 ? 37.982  52.654  41.531 1.00 46.30  ? 305 CYS B CA    1 
ATOM   4735 C C     . CYS B 1 279 ? 37.900  51.958  40.181 1.00 45.04  ? 305 CYS B C     1 
ATOM   4736 O O     . CYS B 1 279 ? 38.612  50.987  39.955 1.00 46.57  ? 305 CYS B O     1 
ATOM   4737 C CB    . CYS B 1 279 ? 36.826  52.146  42.388 1.00 48.21  ? 305 CYS B CB    1 
ATOM   4738 S SG    . CYS B 1 279 ? 37.260  52.040  44.095 1.00 57.15  ? 305 CYS B SG    1 
ATOM   4739 N N     . GLN B 1 280 ? 37.002  52.420  39.313 1.00 42.78  ? 306 GLN B N     1 
ATOM   4740 C CA    . GLN B 1 280 ? 36.853  51.832  37.986 1.00 42.69  ? 306 GLN B CA    1 
ATOM   4741 C C     . GLN B 1 280 ? 38.172  51.876  37.220 1.00 42.09  ? 306 GLN B C     1 
ATOM   4742 O O     . GLN B 1 280 ? 38.520  50.930  36.533 1.00 43.03  ? 306 GLN B O     1 
ATOM   4743 C CB    . GLN B 1 280 ? 35.739  52.523  37.206 1.00 41.74  ? 306 GLN B CB    1 
ATOM   4744 C CG    . GLN B 1 280 ? 34.353  52.269  37.781 1.00 44.13  ? 306 GLN B CG    1 
ATOM   4745 C CD    . GLN B 1 280 ? 34.041  50.797  37.834 1.00 51.41  ? 306 GLN B CD    1 
ATOM   4746 O OE1   . GLN B 1 280 ? 33.964  50.129  36.796 1.00 55.86  ? 306 GLN B OE1   1 
ATOM   4747 N NE2   . GLN B 1 280 ? 33.881  50.270  39.039 1.00 53.79  ? 306 GLN B NE2   1 
ATOM   4748 N N     . PHE B 1 281 ? 38.924  52.957  37.394 1.00 40.83  ? 307 PHE B N     1 
ATOM   4749 C CA    . PHE B 1 281 ? 40.235  53.082  36.772 1.00 41.16  ? 307 PHE B CA    1 
ATOM   4750 C C     . PHE B 1 281 ? 41.304  52.241  37.471 1.00 43.63  ? 307 PHE B C     1 
ATOM   4751 O O     . PHE B 1 281 ? 42.026  51.483  36.822 1.00 45.05  ? 307 PHE B O     1 
ATOM   4752 C CB    . PHE B 1 281 ? 40.646  54.562  36.664 1.00 39.09  ? 307 PHE B CB    1 
ATOM   4753 C CG    . PHE B 1 281 ? 40.043  55.259  35.486 1.00 35.80  ? 307 PHE B CG    1 
ATOM   4754 C CD1   . PHE B 1 281 ? 38.768  55.801  35.557 1.00 33.93  ? 307 PHE B CD1   1 
ATOM   4755 C CD2   . PHE B 1 281 ? 40.756  55.356  34.273 1.00 34.94  ? 307 PHE B CD2   1 
ATOM   4756 C CE1   . PHE B 1 281 ? 38.197  56.447  34.431 1.00 32.17  ? 307 PHE B CE1   1 
ATOM   4757 C CE2   . PHE B 1 281 ? 40.205  55.979  33.154 1.00 31.82  ? 307 PHE B CE2   1 
ATOM   4758 C CZ    . PHE B 1 281 ? 38.924  56.522  33.228 1.00 32.47  ? 307 PHE B CZ    1 
ATOM   4759 N N     . GLU B 1 282 ? 41.400  52.358  38.791 1.00 45.08  ? 308 GLU B N     1 
ATOM   4760 C CA    . GLU B 1 282 ? 42.475  51.678  39.534 1.00 47.75  ? 308 GLU B CA    1 
ATOM   4761 C C     . GLU B 1 282 ? 42.339  50.159  39.558 1.00 49.90  ? 308 GLU B C     1 
ATOM   4762 O O     . GLU B 1 282 ? 43.340  49.451  39.648 1.00 51.89  ? 308 GLU B O     1 
ATOM   4763 C CB    . GLU B 1 282 ? 42.580  52.211  40.963 1.00 48.79  ? 308 GLU B CB    1 
ATOM   4764 C CG    . GLU B 1 282 ? 42.933  53.700  41.059 1.00 48.72  ? 308 GLU B CG    1 
ATOM   4765 C CD    . GLU B 1 282 ? 43.251  54.139  42.489 1.00 52.85  ? 308 GLU B CD    1 
ATOM   4766 O OE1   . GLU B 1 282 ? 42.905  53.409  43.453 1.00 54.33  ? 308 GLU B OE1   1 
ATOM   4767 O OE2   . GLU B 1 282 ? 43.852  55.222  42.648 1.00 52.75  ? 308 GLU B OE2   1 
ATOM   4768 N N     . ASP B 1 283 ? 41.108  49.658  39.480 1.00 49.67  ? 309 ASP B N     1 
ATOM   4769 C CA    . ASP B 1 283 ? 40.870  48.212  39.503 1.00 52.53  ? 309 ASP B CA    1 
ATOM   4770 C C     . ASP B 1 283 ? 41.304  47.540  38.211 1.00 52.59  ? 309 ASP B C     1 
ATOM   4771 O O     . ASP B 1 283 ? 41.390  46.324  38.146 1.00 54.93  ? 309 ASP B O     1 
ATOM   4772 C CB    . ASP B 1 283 ? 39.391  47.898  39.745 1.00 53.37  ? 309 ASP B CB    1 
ATOM   4773 C CG    . ASP B 1 283 ? 38.966  48.103  41.193 1.00 56.69  ? 309 ASP B CG    1 
ATOM   4774 O OD1   . ASP B 1 283 ? 39.805  48.498  42.048 1.00 58.65  ? 309 ASP B OD1   1 
ATOM   4775 O OD2   . ASP B 1 283 ? 37.768  47.858  41.470 1.00 60.22  ? 309 ASP B OD2   1 
ATOM   4776 N N     . LEU B 1 284 ? 41.545  48.334  37.174 1.00 50.17  ? 310 LEU B N     1 
ATOM   4777 C CA    . LEU B 1 284 ? 42.042  47.802  35.916 1.00 50.73  ? 310 LEU B CA    1 
ATOM   4778 C C     . LEU B 1 284 ? 43.484  47.288  36.047 1.00 53.25  ? 310 LEU B C     1 
ATOM   4779 O O     . LEU B 1 284 ? 43.873  46.355  35.346 1.00 54.86  ? 310 LEU B O     1 
ATOM   4780 C CB    . LEU B 1 284 ? 41.924  48.856  34.817 1.00 48.11  ? 310 LEU B CB    1 
ATOM   4781 C CG    . LEU B 1 284 ? 40.489  49.182  34.416 1.00 45.40  ? 310 LEU B CG    1 
ATOM   4782 C CD1   . LEU B 1 284 ? 40.461  50.464  33.613 1.00 42.60  ? 310 LEU B CD1   1 
ATOM   4783 C CD2   . LEU B 1 284 ? 39.823  48.008  33.663 1.00 45.10  ? 310 LEU B CD2   1 
ATOM   4784 N N     . ASN B 1 285 ? 44.248  47.889  36.963 1.00 53.97  ? 311 ASN B N     1 
ATOM   4785 C CA    . ASN B 1 285 ? 45.619  47.458  37.292 1.00 58.10  ? 311 ASN B CA    1 
ATOM   4786 C C     . ASN B 1 285 ? 45.682  46.010  37.783 1.00 62.00  ? 311 ASN B C     1 
ATOM   4787 O O     . ASN B 1 285 ? 45.174  45.684  38.851 1.00 62.95  ? 311 ASN B O     1 
ATOM   4788 C CB    . ASN B 1 285 ? 46.229  48.413  38.327 1.00 57.83  ? 311 ASN B CB    1 
ATOM   4789 C CG    . ASN B 1 285 ? 47.688  48.110  38.649 1.00 61.95  ? 311 ASN B CG    1 
ATOM   4790 O OD1   . ASN B 1 285 ? 48.338  47.279  38.013 1.00 65.77  ? 311 ASN B OD1   1 
ATOM   4791 N ND2   . ASN B 1 285 ? 48.208  48.796  39.660 1.00 63.08  ? 311 ASN B ND2   1 
ATOM   4792 N N     . LYS B 1 286 ? 46.311  45.147  36.994 1.00 72.00  ? 312 LYS B N     1 
ATOM   4793 C CA    . LYS B 1 286 ? 46.388  43.725  37.318 1.00 73.66  ? 312 LYS B CA    1 
ATOM   4794 C C     . LYS B 1 286 ? 47.643  43.359  38.118 1.00 74.86  ? 312 LYS B C     1 
ATOM   4795 O O     . LYS B 1 286 ? 47.793  42.214  38.552 1.00 76.17  ? 312 LYS B O     1 
ATOM   4796 C CB    . LYS B 1 286 ? 46.263  42.865  36.050 1.00 74.21  ? 312 LYS B CB    1 
ATOM   4797 C CG    . LYS B 1 286 ? 44.898  42.964  35.354 1.00 75.06  ? 312 LYS B CG    1 
ATOM   4798 C CD    . LYS B 1 286 ? 44.694  41.855  34.316 1.00 77.61  ? 312 LYS B CD    1 
ATOM   4799 C CE    . LYS B 1 286 ? 45.144  42.259  32.914 1.00 78.48  ? 312 LYS B CE    1 
ATOM   4800 N NZ    . LYS B 1 286 ? 44.042  42.892  32.140 1.00 79.49  ? 312 LYS B NZ    1 
ATOM   4801 N N     . ARG B 1 287 ? 48.529  44.333  38.324 1.00 75.39  ? 313 ARG B N     1 
ATOM   4802 C CA    . ARG B 1 287 ? 49.745  44.119  39.124 1.00 77.17  ? 313 ARG B CA    1 
ATOM   4803 C C     . ARG B 1 287 ? 49.820  45.039  40.354 1.00 77.53  ? 313 ARG B C     1 
ATOM   4804 O O     . ARG B 1 287 ? 50.844  45.683  40.610 1.00 77.73  ? 313 ARG B O     1 
ATOM   4805 C CB    . ARG B 1 287 ? 50.999  44.225  38.245 1.00 77.53  ? 313 ARG B CB    1 
ATOM   4806 C CG    . ARG B 1 287 ? 51.474  42.877  37.719 1.00 80.51  ? 313 ARG B CG    1 
ATOM   4807 C CD    . ARG B 1 287 ? 52.674  43.001  36.783 1.00 83.89  ? 313 ARG B CD    1 
ATOM   4808 N NE    . ARG B 1 287 ? 52.258  43.130  35.386 1.00 84.49  ? 313 ARG B NE    1 
ATOM   4809 C CZ    . ARG B 1 287 ? 52.148  44.282  34.726 1.00 83.82  ? 313 ARG B CZ    1 
ATOM   4810 N NH1   . ARG B 1 287 ? 52.437  45.439  35.314 1.00 82.53  ? 313 ARG B NH1   1 
ATOM   4811 N NH2   . ARG B 1 287 ? 51.754  44.270  33.461 1.00 84.14  ? 313 ARG B NH2   1 
ATOM   4812 N N     . LYS B 1 288 ? 48.723  45.050  41.118 1.00 78.22  ? 314 LYS B N     1 
ATOM   4813 C CA    . LYS B 1 288 ? 48.497  45.937  42.273 1.00 79.05  ? 314 LYS B CA    1 
ATOM   4814 C C     . LYS B 1 288 ? 49.665  46.113  43.244 1.00 80.49  ? 314 LYS B C     1 
ATOM   4815 O O     . LYS B 1 288 ? 49.998  47.240  43.623 1.00 80.54  ? 314 LYS B O     1 
ATOM   4816 C CB    . LYS B 1 288 ? 47.275  45.456  43.068 1.00 80.54  ? 314 LYS B CB    1 
ATOM   4817 C CG    . LYS B 1 288 ? 45.945  45.618  42.358 1.00 79.88  ? 314 LYS B CG    1 
ATOM   4818 C CD    . LYS B 1 288 ? 45.233  46.895  42.776 1.00 80.19  ? 314 LYS B CD    1 
ATOM   4819 C CE    . LYS B 1 288 ? 43.927  47.062  42.015 1.00 80.52  ? 314 LYS B CE    1 
ATOM   4820 N NZ    . LYS B 1 288 ? 43.121  45.800  41.964 1.00 80.71  ? 314 LYS B NZ    1 
ATOM   4821 N N     . ASP B 1 289 ? 50.266  45.003  43.662 1.00 82.16  ? 315 ASP B N     1 
ATOM   4822 C CA    . ASP B 1 289 ? 51.319  45.045  44.682 1.00 84.30  ? 315 ASP B CA    1 
ATOM   4823 C C     . ASP B 1 289 ? 52.742  45.056  44.100 1.00 83.99  ? 315 ASP B C     1 
ATOM   4824 O O     . ASP B 1 289 ? 53.721  44.799  44.811 1.00 86.56  ? 315 ASP B O     1 
ATOM   4825 C CB    . ASP B 1 289 ? 51.123  43.942  45.745 1.00 87.63  ? 315 ASP B CB    1 
ATOM   4826 C CG    . ASP B 1 289 ? 50.866  42.558  45.144 1.00 88.58  ? 315 ASP B CG    1 
ATOM   4827 O OD1   . ASP B 1 289 ? 50.129  42.448  44.136 1.00 86.53  ? 315 ASP B OD1   1 
ATOM   4828 O OD2   . ASP B 1 289 ? 51.392  41.570  45.709 1.00 92.33  ? 315 ASP B OD2   1 
ATOM   4829 N N     . THR B 1 290 ? 52.844  45.376  42.811 1.00 81.20  ? 316 THR B N     1 
ATOM   4830 C CA    . THR B 1 290 ? 54.139  45.600  42.163 1.00 80.76  ? 316 THR B CA    1 
ATOM   4831 C C     . THR B 1 290 ? 54.194  46.979  41.494 1.00 78.22  ? 316 THR B C     1 
ATOM   4832 O O     . THR B 1 290 ? 55.226  47.653  41.533 1.00 78.59  ? 316 THR B O     1 
ATOM   4833 C CB    . THR B 1 290 ? 54.495  44.480  41.154 1.00 81.54  ? 316 THR B CB    1 
ATOM   4834 O OG1   . THR B 1 290 ? 53.321  44.061  40.448 1.00 79.85  ? 316 THR B OG1   1 
ATOM   4835 C CG2   . THR B 1 290 ? 55.088  43.276  41.881 1.00 84.89  ? 316 THR B CG2   1 
ATOM   4836 N N     . LYS B 1 291 ? 53.069  47.389  40.904 1.00 75.66  ? 317 LYS B N     1 
ATOM   4837 C CA    . LYS B 1 291 ? 52.937  48.690  40.254 1.00 73.50  ? 317 LYS B CA    1 
ATOM   4838 C C     . LYS B 1 291 ? 51.874  49.533  40.962 1.00 72.48  ? 317 LYS B C     1 
ATOM   4839 O O     . LYS B 1 291 ? 50.739  49.088  41.133 1.00 72.55  ? 317 LYS B O     1 
ATOM   4840 C CB    . LYS B 1 291 ? 52.559  48.502  38.781 1.00 72.93  ? 317 LYS B CB    1 
ATOM   4841 C CG    . LYS B 1 291 ? 52.489  49.798  37.983 1.00 72.58  ? 317 LYS B CG    1 
ATOM   4842 C CD    . LYS B 1 291 ? 52.544  49.524  36.495 1.00 72.74  ? 317 LYS B CD    1 
ATOM   4843 C CE    . LYS B 1 291 ? 53.162  50.686  35.743 1.00 73.26  ? 317 LYS B CE    1 
ATOM   4844 N NZ    . LYS B 1 291 ? 54.551  50.972  36.202 1.00 73.83  ? 317 LYS B NZ    1 
ATOM   4845 N N     . GLU B 1 292 ? 52.234  50.749  41.362 1.00 75.22  ? 318 GLU B N     1 
ATOM   4846 C CA    . GLU B 1 292 ? 51.275  51.634  42.035 1.00 71.99  ? 318 GLU B CA    1 
ATOM   4847 C C     . GLU B 1 292 ? 50.804  52.806  41.150 1.00 66.80  ? 318 GLU B C     1 
ATOM   4848 O O     . GLU B 1 292 ? 51.592  53.392  40.413 1.00 65.48  ? 318 GLU B O     1 
ATOM   4849 C CB    . GLU B 1 292 ? 51.811  52.106  43.404 1.00 73.28  ? 318 GLU B CB    1 
ATOM   4850 C CG    . GLU B 1 292 ? 53.090  52.955  43.381 1.00 74.45  ? 318 GLU B CG    1 
ATOM   4851 C CD    . GLU B 1 292 ? 54.403  52.155  43.456 1.00 80.52  ? 318 GLU B CD    1 
ATOM   4852 O OE1   . GLU B 1 292 ? 54.536  51.260  44.327 1.00 84.37  ? 318 GLU B OE1   1 
ATOM   4853 O OE2   . GLU B 1 292 ? 55.324  52.447  42.651 1.00 81.07  ? 318 GLU B OE2   1 
ATOM   4854 N N     . ILE B 1 293 ? 49.508  53.108  41.201 1.00 63.65  ? 319 ILE B N     1 
ATOM   4855 C CA    . ILE B 1 293 ? 48.957  54.267  40.502 1.00 58.85  ? 319 ILE B CA    1 
ATOM   4856 C C     . ILE B 1 293 ? 48.849  55.434  41.479 1.00 57.04  ? 319 ILE B C     1 
ATOM   4857 O O     . ILE B 1 293 ? 48.327  55.268  42.573 1.00 57.94  ? 319 ILE B O     1 
ATOM   4858 C CB    . ILE B 1 293 ? 47.532  54.014  39.924 1.00 57.76  ? 319 ILE B CB    1 
ATOM   4859 C CG1   . ILE B 1 293 ? 47.412  52.658  39.209 1.00 59.67  ? 319 ILE B CG1   1 
ATOM   4860 C CG2   . ILE B 1 293 ? 47.100  55.176  39.028 1.00 52.94  ? 319 ILE B CG2   1 
ATOM   4861 C CD1   . ILE B 1 293 ? 48.248  52.513  37.957 1.00 61.21  ? 319 ILE B CD1   1 
ATOM   4862 N N     . TYR B 1 294 ? 49.323  56.607  41.070 1.00 54.28  ? 320 TYR B N     1 
ATOM   4863 C CA    . TYR B 1 294 ? 49.224  57.817  41.877 1.00 52.60  ? 320 TYR B CA    1 
ATOM   4864 C C     . TYR B 1 294 ? 48.082  58.685  41.352 1.00 49.45  ? 320 TYR B C     1 
ATOM   4865 O O     . TYR B 1 294 ? 48.205  59.330  40.307 1.00 48.21  ? 320 TYR B O     1 
ATOM   4866 C CB    . TYR B 1 294 ? 50.554  58.586  41.863 1.00 52.79  ? 320 TYR B CB    1 
ATOM   4867 C CG    . TYR B 1 294 ? 51.766  57.741  42.235 1.00 57.45  ? 320 TYR B CG    1 
ATOM   4868 C CD1   . TYR B 1 294 ? 52.132  57.549  43.574 1.00 60.67  ? 320 TYR B CD1   1 
ATOM   4869 C CD2   . TYR B 1 294 ? 52.548  57.128  41.246 1.00 59.62  ? 320 TYR B CD2   1 
ATOM   4870 C CE1   . TYR B 1 294 ? 53.246  56.759  43.921 1.00 64.61  ? 320 TYR B CE1   1 
ATOM   4871 C CE2   . TYR B 1 294 ? 53.671  56.346  41.579 1.00 63.12  ? 320 TYR B CE2   1 
ATOM   4872 C CZ    . TYR B 1 294 ? 54.013  56.169  42.917 1.00 65.79  ? 320 TYR B CZ    1 
ATOM   4873 O OH    . TYR B 1 294 ? 55.114  55.398  43.249 1.00 69.61  ? 320 TYR B OH    1 
ATOM   4874 N N     . THR B 1 295 ? 46.966  58.686  42.072 1.00 48.27  ? 321 THR B N     1 
ATOM   4875 C CA    . THR B 1 295 ? 45.770  59.378  41.625 1.00 45.42  ? 321 THR B CA    1 
ATOM   4876 C C     . THR B 1 295 ? 45.624  60.733  42.297 1.00 44.62  ? 321 THR B C     1 
ATOM   4877 O O     . THR B 1 295 ? 45.876  60.877  43.487 1.00 45.90  ? 321 THR B O     1 
ATOM   4878 C CB    . THR B 1 295 ? 44.520  58.546  41.861 1.00 45.49  ? 321 THR B CB    1 
ATOM   4879 O OG1   . THR B 1 295 ? 44.708  57.250  41.298 1.00 47.33  ? 321 THR B OG1   1 
ATOM   4880 C CG2   . THR B 1 295 ? 43.313  59.191  41.198 1.00 44.09  ? 321 THR B CG2   1 
ATOM   4881 N N     . HIS B 1 296 ? 45.250  61.727  41.502 1.00 42.40  ? 322 HIS B N     1 
ATOM   4882 C CA    . HIS B 1 296 ? 44.954  63.055  41.992 1.00 41.75  ? 322 HIS B CA    1 
ATOM   4883 C C     . HIS B 1 296 ? 43.671  63.524  41.332 1.00 39.86  ? 322 HIS B C     1 
ATOM   4884 O O     . HIS B 1 296 ? 43.438  63.258  40.140 1.00 39.15  ? 322 HIS B O     1 
ATOM   4885 C CB    . HIS B 1 296 ? 46.096  64.018  41.677 1.00 42.27  ? 322 HIS B CB    1 
ATOM   4886 C CG    . HIS B 1 296 ? 47.400  63.635  42.313 1.00 45.56  ? 322 HIS B CG    1 
ATOM   4887 N ND1   . HIS B 1 296 ? 47.897  64.269  43.432 1.00 48.09  ? 322 HIS B ND1   1 
ATOM   4888 C CD2   . HIS B 1 296 ? 48.288  62.658  42.009 1.00 46.68  ? 322 HIS B CD2   1 
ATOM   4889 C CE1   . HIS B 1 296 ? 49.037  63.700  43.786 1.00 49.11  ? 322 HIS B CE1   1 
ATOM   4890 N NE2   . HIS B 1 296 ? 49.295  62.720  42.939 1.00 48.40  ? 322 HIS B NE2   1 
ATOM   4891 N N     . PHE B 1 297 ? 42.829  64.182  42.117 1.00 38.78  ? 323 PHE B N     1 
ATOM   4892 C CA    . PHE B 1 297 ? 41.651  64.839  41.598 1.00 37.03  ? 323 PHE B CA    1 
ATOM   4893 C C     . PHE B 1 297 ? 42.033  66.269  41.297 1.00 36.76  ? 323 PHE B C     1 
ATOM   4894 O O     . PHE B 1 297 ? 42.606  66.953  42.151 1.00 37.67  ? 323 PHE B O     1 
ATOM   4895 C CB    . PHE B 1 297 ? 40.485  64.770  42.606 1.00 37.75  ? 323 PHE B CB    1 
ATOM   4896 C CG    . PHE B 1 297 ? 39.864  63.410  42.694 1.00 36.64  ? 323 PHE B CG    1 
ATOM   4897 C CD1   . PHE B 1 297 ? 40.442  62.417  43.472 1.00 38.08  ? 323 PHE B CD1   1 
ATOM   4898 C CD2   . PHE B 1 297 ? 38.723  63.118  41.996 1.00 34.89  ? 323 PHE B CD2   1 
ATOM   4899 C CE1   . PHE B 1 297 ? 39.893  61.154  43.533 1.00 38.19  ? 323 PHE B CE1   1 
ATOM   4900 C CE2   . PHE B 1 297 ? 38.167  61.843  42.052 1.00 36.38  ? 323 PHE B CE2   1 
ATOM   4901 C CZ    . PHE B 1 297 ? 38.750  60.867  42.824 1.00 35.52  ? 323 PHE B CZ    1 
ATOM   4902 N N     . THR B 1 298 ? 41.727  66.717  40.081 1.00 35.33  ? 324 THR B N     1 
ATOM   4903 C CA    . THR B 1 298 ? 42.194  68.026  39.627 1.00 35.21  ? 324 THR B CA    1 
ATOM   4904 C C     . THR B 1 298 ? 41.125  68.882  38.973 1.00 35.44  ? 324 THR B C     1 
ATOM   4905 O O     . THR B 1 298 ? 40.124  68.386  38.456 1.00 34.60  ? 324 THR B O     1 
ATOM   4906 C CB    . THR B 1 298 ? 43.420  67.903  38.651 1.00 34.66  ? 324 THR B CB    1 
ATOM   4907 O OG1   . THR B 1 298 ? 43.026  67.235  37.460 1.00 33.96  ? 324 THR B OG1   1 
ATOM   4908 C CG2   . THR B 1 298 ? 44.555  67.113  39.280 1.00 35.07  ? 324 THR B CG2   1 
ATOM   4909 N N     . CYS B 1 299 ? 41.343  70.183  39.044 1.00 37.53  ? 325 CYS B N     1 
ATOM   4910 C CA    . CYS B 1 299 ? 40.698  71.140  38.173 1.00 39.36  ? 325 CYS B CA    1 
ATOM   4911 C C     . CYS B 1 299 ? 41.846  71.837  37.425 1.00 40.60  ? 325 CYS B C     1 
ATOM   4912 O O     . CYS B 1 299 ? 42.463  72.761  37.950 1.00 41.84  ? 325 CYS B O     1 
ATOM   4913 C CB    . CYS B 1 299 ? 39.897  72.166  38.978 1.00 40.41  ? 325 CYS B CB    1 
ATOM   4914 S SG    . CYS B 1 299 ? 39.177  73.477  37.945 1.00 43.30  ? 325 CYS B SG    1 
ATOM   4915 N N     . ALA B 1 300 ? 42.133  71.371  36.212 1.00 40.86  ? 326 ALA B N     1 
ATOM   4916 C CA    . ALA B 1 300 ? 43.274  71.882  35.428 1.00 42.65  ? 326 ALA B CA    1 
ATOM   4917 C C     . ALA B 1 300 ? 43.225  73.394  35.208 1.00 44.88  ? 326 ALA B C     1 
ATOM   4918 O O     . ALA B 1 300 ? 44.262  74.038  35.044 1.00 46.54  ? 326 ALA B O     1 
ATOM   4919 C CB    . ALA B 1 300 ? 43.372  71.149  34.094 1.00 42.24  ? 326 ALA B CB    1 
ATOM   4920 N N     . THR B 1 301 ? 42.028  73.967  35.239 1.00 45.39  ? 327 THR B N     1 
ATOM   4921 C CA    . THR B 1 301 ? 41.885  75.413  35.036 1.00 48.51  ? 327 THR B CA    1 
ATOM   4922 C C     . THR B 1 301 ? 42.117  76.248  36.314 1.00 50.78  ? 327 THR B C     1 
ATOM   4923 O O     . THR B 1 301 ? 42.029  77.473  36.297 1.00 53.79  ? 327 THR B O     1 
ATOM   4924 C CB    . THR B 1 301 ? 40.536  75.730  34.361 1.00 48.73  ? 327 THR B CB    1 
ATOM   4925 O OG1   . THR B 1 301 ? 39.506  74.944  34.975 1.00 46.40  ? 327 THR B OG1   1 
ATOM   4926 C CG2   . THR B 1 301 ? 40.585  75.342  32.874 1.00 47.81  ? 327 THR B CG2   1 
ATOM   4927 N N     . ASP B 1 302 ? 42.460  75.583  37.409 1.00 50.53  ? 328 ASP B N     1 
ATOM   4928 C CA    . ASP B 1 302 ? 42.682  76.245  38.694 1.00 52.79  ? 328 ASP B CA    1 
ATOM   4929 C C     . ASP B 1 302 ? 44.162  76.188  39.048 1.00 53.95  ? 328 ASP B C     1 
ATOM   4930 O O     . ASP B 1 302 ? 44.669  75.150  39.495 1.00 52.88  ? 328 ASP B O     1 
ATOM   4931 C CB    . ASP B 1 302 ? 41.871  75.530  39.771 1.00 52.10  ? 328 ASP B CB    1 
ATOM   4932 C CG    . ASP B 1 302 ? 41.948  76.197  41.118 1.00 54.85  ? 328 ASP B CG    1 
ATOM   4933 O OD1   . ASP B 1 302 ? 43.004  76.730  41.507 1.00 58.88  ? 328 ASP B OD1   1 
ATOM   4934 O OD2   . ASP B 1 302 ? 40.927  76.157  41.815 1.00 57.99  ? 328 ASP B OD2   1 
ATOM   4935 N N     . THR B 1 303 ? 44.841  77.311  38.855 1.00 56.43  ? 329 THR B N     1 
ATOM   4936 C CA    . THR B 1 303 ? 46.278  77.426  39.083 1.00 58.11  ? 329 THR B CA    1 
ATOM   4937 C C     . THR B 1 303 ? 46.706  76.989  40.486 1.00 58.53  ? 329 THR B C     1 
ATOM   4938 O O     . THR B 1 303 ? 47.658  76.221  40.630 1.00 57.90  ? 329 THR B O     1 
ATOM   4939 C CB    . THR B 1 303 ? 46.753  78.866  38.789 1.00 61.39  ? 329 THR B CB    1 
ATOM   4940 O OG1   . THR B 1 303 ? 46.400  79.196  37.442 1.00 61.87  ? 329 THR B OG1   1 
ATOM   4941 C CG2   . THR B 1 303 ? 48.255  79.003  38.959 1.00 61.97  ? 329 THR B CG2   1 
ATOM   4942 N N     . LYS B 1 304 ? 45.991  77.460  41.506 1.00 60.22  ? 330 LYS B N     1 
ATOM   4943 C CA    . LYS B 1 304 ? 46.244  77.043  42.889 1.00 61.15  ? 330 LYS B CA    1 
ATOM   4944 C C     . LYS B 1 304 ? 46.168  75.522  43.034 1.00 58.20  ? 330 LYS B C     1 
ATOM   4945 O O     . LYS B 1 304 ? 47.072  74.905  43.593 1.00 58.68  ? 330 LYS B O     1 
ATOM   4946 C CB    . LYS B 1 304 ? 45.275  77.740  43.858 1.00 63.41  ? 330 LYS B CB    1 
ATOM   4947 C CG    . LYS B 1 304 ? 45.439  77.311  45.319 1.00 65.78  ? 330 LYS B CG    1 
ATOM   4948 C CD    . LYS B 1 304 ? 45.291  78.482  46.296 1.00 70.58  ? 330 LYS B CD    1 
ATOM   4949 C CE    . LYS B 1 304 ? 45.766  78.080  47.694 1.00 73.33  ? 330 LYS B CE    1 
ATOM   4950 N NZ    . LYS B 1 304 ? 46.231  79.240  48.550 1.00 77.87  ? 330 LYS B NZ    1 
ATOM   4951 N N     . ASN B 1 305 ? 45.112  74.919  42.496 1.00 55.70  ? 331 ASN B N     1 
ATOM   4952 C CA    . ASN B 1 305 ? 44.954  73.461  42.552 1.00 53.39  ? 331 ASN B CA    1 
ATOM   4953 C C     . ASN B 1 305 ? 46.080  72.695  41.860 1.00 52.23  ? 331 ASN B C     1 
ATOM   4954 O O     . ASN B 1 305 ? 46.571  71.695  42.385 1.00 52.28  ? 331 ASN B O     1 
ATOM   4955 C CB    . ASN B 1 305 ? 43.594  73.018  41.991 1.00 50.79  ? 331 ASN B CB    1 
ATOM   4956 C CG    . ASN B 1 305 ? 43.338  71.543  42.202 1.00 49.91  ? 331 ASN B CG    1 
ATOM   4957 O OD1   . ASN B 1 305 ? 43.116  70.786  41.249 1.00 47.31  ? 331 ASN B OD1   1 
ATOM   4958 N ND2   . ASN B 1 305 ? 43.384  71.115  43.458 1.00 51.94  ? 331 ASN B ND2   1 
ATOM   4959 N N     . VAL B 1 306 ? 46.487  73.166  40.687 1.00 52.25  ? 332 VAL B N     1 
ATOM   4960 C CA    . VAL B 1 306 ? 47.472  72.451  39.885 1.00 51.61  ? 332 VAL B CA    1 
ATOM   4961 C C     . VAL B 1 306 ? 48.848  72.600  40.514 1.00 53.44  ? 332 VAL B C     1 
ATOM   4962 O O     . VAL B 1 306 ? 49.653  71.678  40.470 1.00 52.84  ? 332 VAL B O     1 
ATOM   4963 C CB    . VAL B 1 306 ? 47.449  72.908  38.400 1.00 51.58  ? 332 VAL B CB    1 
ATOM   4964 C CG1   . VAL B 1 306 ? 48.656  72.380  37.644 1.00 51.39  ? 332 VAL B CG1   1 
ATOM   4965 C CG2   . VAL B 1 306 ? 46.167  72.439  37.732 1.00 48.93  ? 332 VAL B CG2   1 
ATOM   4966 N N     . GLN B 1 307 ? 49.094  73.755  41.125 1.00 56.19  ? 333 GLN B N     1 
ATOM   4967 C CA    . GLN B 1 307 ? 50.298  73.975  41.917 1.00 58.59  ? 333 GLN B CA    1 
ATOM   4968 C C     . GLN B 1 307 ? 50.392  72.972  43.071 1.00 58.44  ? 333 GLN B C     1 
ATOM   4969 O O     . GLN B 1 307 ? 51.422  72.327  43.258 1.00 58.85  ? 333 GLN B O     1 
ATOM   4970 C CB    . GLN B 1 307 ? 50.324  75.411  42.445 1.00 61.62  ? 333 GLN B CB    1 
ATOM   4971 C CG    . GLN B 1 307 ? 51.594  75.779  43.196 1.00 64.91  ? 333 GLN B CG    1 
ATOM   4972 C CD    . GLN B 1 307 ? 51.723  77.267  43.441 1.00 69.08  ? 333 GLN B CD    1 
ATOM   4973 O OE1   . GLN B 1 307 ? 50.924  78.064  42.954 1.00 71.37  ? 333 GLN B OE1   1 
ATOM   4974 N NE2   . GLN B 1 307 ? 52.740  77.651  44.194 1.00 72.08  ? 333 GLN B NE2   1 
ATOM   4975 N N     . PHE B 1 308 ? 49.312  72.839  43.836 1.00 58.55  ? 334 PHE B N     1 
ATOM   4976 C CA    . PHE B 1 308 ? 49.267  71.886  44.944 1.00 59.02  ? 334 PHE B CA    1 
ATOM   4977 C C     . PHE B 1 308 ? 49.464  70.443  44.472 1.00 56.99  ? 334 PHE B C     1 
ATOM   4978 O O     . PHE B 1 308 ? 50.267  69.688  45.033 1.00 57.64  ? 334 PHE B O     1 
ATOM   4979 C CB    . PHE B 1 308 ? 47.947  72.013  45.712 1.00 59.82  ? 334 PHE B CB    1 
ATOM   4980 C CG    . PHE B 1 308 ? 47.813  71.027  46.838 1.00 61.28  ? 334 PHE B CG    1 
ATOM   4981 C CD1   . PHE B 1 308 ? 48.352  71.305  48.085 1.00 64.63  ? 334 PHE B CD1   1 
ATOM   4982 C CD2   . PHE B 1 308 ? 47.164  69.815  46.644 1.00 60.63  ? 334 PHE B CD2   1 
ATOM   4983 C CE1   . PHE B 1 308 ? 48.244  70.389  49.120 1.00 66.66  ? 334 PHE B CE1   1 
ATOM   4984 C CE2   . PHE B 1 308 ? 47.060  68.891  47.681 1.00 62.54  ? 334 PHE B CE2   1 
ATOM   4985 C CZ    . PHE B 1 308 ? 47.596  69.183  48.918 1.00 63.80  ? 334 PHE B CZ    1 
ATOM   4986 N N     . VAL B 1 309 ? 48.730  70.063  43.435 1.00 54.77  ? 335 VAL B N     1 
ATOM   4987 C CA    . VAL B 1 309 ? 48.805  68.698  42.918 1.00 53.14  ? 335 VAL B CA    1 
ATOM   4988 C C     . VAL B 1 309 ? 50.195  68.395  42.356 1.00 53.54  ? 335 VAL B C     1 
ATOM   4989 O O     . VAL B 1 309 ? 50.773  67.331  42.630 1.00 53.56  ? 335 VAL B O     1 
ATOM   4990 C CB    . VAL B 1 309 ? 47.698  68.441  41.869 1.00 51.06  ? 335 VAL B CB    1 
ATOM   4991 C CG1   . VAL B 1 309 ? 47.990  67.177  41.052 1.00 50.11  ? 335 VAL B CG1   1 
ATOM   4992 C CG2   . VAL B 1 309 ? 46.342  68.357  42.554 1.00 50.32  ? 335 VAL B CG2   1 
ATOM   4993 N N     . PHE B 1 310 ? 50.744  69.335  41.594 1.00 54.06  ? 336 PHE B N     1 
ATOM   4994 C CA    . PHE B 1 310 ? 52.039  69.095  40.977 1.00 55.41  ? 336 PHE B CA    1 
ATOM   4995 C C     . PHE B 1 310 ? 53.177  69.033  41.995 1.00 57.68  ? 336 PHE B C     1 
ATOM   4996 O O     . PHE B 1 310 ? 54.151  68.305  41.804 1.00 58.32  ? 336 PHE B O     1 
ATOM   4997 C CB    . PHE B 1 310 ? 52.353  70.102  39.876 1.00 55.56  ? 336 PHE B CB    1 
ATOM   4998 C CG    . PHE B 1 310 ? 53.354  69.594  38.901 1.00 57.00  ? 336 PHE B CG    1 
ATOM   4999 C CD1   . PHE B 1 310 ? 52.976  68.697  37.909 1.00 56.09  ? 336 PHE B CD1   1 
ATOM   5000 C CD2   . PHE B 1 310 ? 54.691  69.961  39.001 1.00 60.93  ? 336 PHE B CD2   1 
ATOM   5001 C CE1   . PHE B 1 310 ? 53.901  68.200  37.011 1.00 56.78  ? 336 PHE B CE1   1 
ATOM   5002 C CE2   . PHE B 1 310 ? 55.632  69.459  38.100 1.00 62.38  ? 336 PHE B CE2   1 
ATOM   5003 C CZ    . PHE B 1 310 ? 55.225  68.579  37.099 1.00 59.38  ? 336 PHE B CZ    1 
ATOM   5004 N N     . ASP B 1 311 ? 53.048  69.791  43.077 1.00 59.37  ? 337 ASP B N     1 
ATOM   5005 C CA    . ASP B 1 311 ? 54.018  69.715  44.159 1.00 61.94  ? 337 ASP B CA    1 
ATOM   5006 C C     . ASP B 1 311 ? 53.995  68.314  44.793 1.00 61.47  ? 337 ASP B C     1 
ATOM   5007 O O     . ASP B 1 311 ? 55.048  67.763  45.119 1.00 63.11  ? 337 ASP B O     1 
ATOM   5008 C CB    . ASP B 1 311 ? 53.765  70.828  45.186 1.00 64.19  ? 337 ASP B CB    1 
ATOM   5009 C CG    . ASP B 1 311 ? 54.598  70.676  46.432 1.00 68.39  ? 337 ASP B CG    1 
ATOM   5010 O OD1   . ASP B 1 311 ? 54.341  69.730  47.207 1.00 70.55  ? 337 ASP B OD1   1 
ATOM   5011 O OD2   . ASP B 1 311 ? 55.506  71.507  46.655 1.00 74.07  ? 337 ASP B OD2   1 
ATOM   5012 N N     . ALA B 1 312 ? 52.802  67.739  44.952 1.00 59.61  ? 338 ALA B N     1 
ATOM   5013 C CA    . ALA B 1 312 ? 52.665  66.385  45.496 1.00 59.14  ? 338 ALA B CA    1 
ATOM   5014 C C     . ALA B 1 312 ? 53.204  65.333  44.525 1.00 58.30  ? 338 ALA B C     1 
ATOM   5015 O O     . ALA B 1 312 ? 53.873  64.388  44.941 1.00 59.57  ? 338 ALA B O     1 
ATOM   5016 C CB    . ALA B 1 312 ? 51.220  66.092  45.859 1.00 57.83  ? 338 ALA B CB    1 
ATOM   5017 N N     . VAL B 1 313 ? 52.908  65.505  43.235 1.00 56.39  ? 339 VAL B N     1 
ATOM   5018 C CA    . VAL B 1 313 ? 53.427  64.627  42.184 1.00 55.59  ? 339 VAL B CA    1 
ATOM   5019 C C     . VAL B 1 313 ? 54.959  64.633  42.195 1.00 57.86  ? 339 VAL B C     1 
ATOM   5020 O O     . VAL B 1 313 ? 55.590  63.576  42.154 1.00 58.61  ? 339 VAL B O     1 
ATOM   5021 C CB    . VAL B 1 313 ? 52.852  65.028  40.792 1.00 53.72  ? 339 VAL B CB    1 
ATOM   5022 C CG1   . VAL B 1 313 ? 53.732  64.531  39.638 1.00 53.91  ? 339 VAL B CG1   1 
ATOM   5023 C CG2   . VAL B 1 313 ? 51.426  64.529  40.649 1.00 51.00  ? 339 VAL B CG2   1 
ATOM   5024 N N     . THR B 1 314 ? 55.539  65.829  42.277 1.00 59.40  ? 340 THR B N     1 
ATOM   5025 C CA    . THR B 1 314 ? 56.988  66.008  42.339 1.00 62.50  ? 340 THR B CA    1 
ATOM   5026 C C     . THR B 1 314 ? 57.635  65.295  43.540 1.00 65.36  ? 340 THR B C     1 
ATOM   5027 O O     . THR B 1 314 ? 58.656  64.624  43.375 1.00 66.71  ? 340 THR B O     1 
ATOM   5028 C CB    . THR B 1 314 ? 57.369  67.506  42.305 1.00 63.12  ? 340 THR B CB    1 
ATOM   5029 O OG1   . THR B 1 314 ? 57.024  68.048  41.027 1.00 61.90  ? 340 THR B OG1   1 
ATOM   5030 C CG2   . THR B 1 314 ? 58.858  67.702  42.522 1.00 65.73  ? 340 THR B CG2   1 
ATOM   5031 N N     . ASP B 1 315 ? 57.035  65.423  44.726 1.00 67.10  ? 341 ASP B N     1 
ATOM   5032 C CA    . ASP B 1 315 ? 57.548  64.766  45.939 1.00 70.79  ? 341 ASP B CA    1 
ATOM   5033 C C     . ASP B 1 315 ? 57.720  63.270  45.739 1.00 71.91  ? 341 ASP B C     1 
ATOM   5034 O O     . ASP B 1 315 ? 58.738  62.696  46.138 1.00 74.50  ? 341 ASP B O     1 
ATOM   5035 C CB    . ASP B 1 315 ? 56.641  65.019  47.154 1.00 71.43  ? 341 ASP B CB    1 
ATOM   5036 C CG    . ASP B 1 315 ? 56.877  66.380  47.796 1.00 73.64  ? 341 ASP B CG    1 
ATOM   5037 O OD1   . ASP B 1 315 ? 57.959  66.976  47.584 1.00 76.64  ? 341 ASP B OD1   1 
ATOM   5038 O OD2   . ASP B 1 315 ? 55.981  66.853  48.525 1.00 73.87  ? 341 ASP B OD2   1 
ATOM   5039 N N     . VAL B 1 316 ? 56.723  62.656  45.113 1.00 70.89  ? 342 VAL B N     1 
ATOM   5040 C CA    . VAL B 1 316 ? 56.718  61.224  44.848 1.00 72.44  ? 342 VAL B CA    1 
ATOM   5041 C C     . VAL B 1 316 ? 57.818  60.829  43.861 1.00 73.64  ? 342 VAL B C     1 
ATOM   5042 O O     . VAL B 1 316 ? 58.538  59.851  44.088 1.00 75.95  ? 342 VAL B O     1 
ATOM   5043 C CB    . VAL B 1 316 ? 55.339  60.761  44.320 1.00 70.43  ? 342 VAL B CB    1 
ATOM   5044 C CG1   . VAL B 1 316 ? 55.396  59.315  43.866 1.00 71.28  ? 342 VAL B CG1   1 
ATOM   5045 C CG2   . VAL B 1 316 ? 54.271  60.948  45.394 1.00 70.59  ? 342 VAL B CG2   1 
ATOM   5046 N N     . ILE B 1 317 ? 57.946  61.593  42.776 1.00 72.81  ? 343 ILE B N     1 
ATOM   5047 C CA    . ILE B 1 317 ? 58.970  61.334  41.765 1.00 74.19  ? 343 ILE B CA    1 
ATOM   5048 C C     . ILE B 1 317 ? 60.360  61.383  42.403 1.00 77.17  ? 343 ILE B C     1 
ATOM   5049 O O     . ILE B 1 317 ? 61.212  60.549  42.102 1.00 78.85  ? 343 ILE B O     1 
ATOM   5050 C CB    . ILE B 1 317 ? 58.870  62.319  40.570 1.00 72.59  ? 343 ILE B CB    1 
ATOM   5051 C CG1   . ILE B 1 317 ? 57.563  62.093  39.805 1.00 70.50  ? 343 ILE B CG1   1 
ATOM   5052 C CG2   . ILE B 1 317 ? 60.064  62.155  39.628 1.00 73.92  ? 343 ILE B CG2   1 
ATOM   5053 C CD1   . ILE B 1 317 ? 57.268  63.132  38.731 1.00 69.49  ? 343 ILE B CD1   1 
ATOM   5054 N N     . ILE B 1 318 ? 60.558  62.349  43.300 1.00 78.44  ? 344 ILE B N     1 
ATOM   5055 C CA    . ILE B 1 318 ? 61.811  62.512  44.042 1.00 81.64  ? 344 ILE B CA    1 
ATOM   5056 C C     . ILE B 1 318 ? 62.184  61.249  44.831 1.00 84.61  ? 344 ILE B C     1 
ATOM   5057 O O     . ILE B 1 318 ? 63.324  60.777  44.754 1.00 86.89  ? 344 ILE B O     1 
ATOM   5058 C CB    . ILE B 1 318 ? 61.768  63.768  44.971 1.00 82.11  ? 344 ILE B CB    1 
ATOM   5059 C CG1   . ILE B 1 318 ? 61.867  65.050  44.139 1.00 80.87  ? 344 ILE B CG1   1 
ATOM   5060 C CG2   . ILE B 1 318 ? 62.889  63.732  46.030 1.00 85.05  ? 344 ILE B CG2   1 
ATOM   5061 C CD1   . ILE B 1 318 ? 61.669  66.348  44.926 1.00 81.86  ? 344 ILE B CD1   1 
ATOM   5062 N N     . LYS B 1 319 ? 61.225  60.692  45.570 1.00 85.16  ? 345 LYS B N     1 
ATOM   5063 C CA    . LYS B 1 319 ? 61.500  59.495  46.375 1.00 88.61  ? 345 LYS B CA    1 
ATOM   5064 C C     . LYS B 1 319 ? 61.360  58.180  45.598 1.00 88.97  ? 345 LYS B C     1 
ATOM   5065 O O     . LYS B 1 319 ? 61.412  57.104  46.188 1.00 91.48  ? 345 LYS B O     1 
ATOM   5066 C CB    . LYS B 1 319 ? 60.689  59.484  47.688 1.00 89.46  ? 345 LYS B CB    1 
ATOM   5067 C CG    . LYS B 1 319 ? 59.174  59.372  47.531 1.00 87.91  ? 345 LYS B CG    1 
ATOM   5068 C CD    . LYS B 1 319 ? 58.439  59.765  48.813 1.00 89.46  ? 345 LYS B CD    1 
ATOM   5069 C CE    . LYS B 1 319 ? 58.670  61.233  49.174 1.00 89.79  ? 345 LYS B CE    1 
ATOM   5070 N NZ    . LYS B 1 319 ? 57.617  61.770  50.084 1.00 90.33  ? 345 LYS B NZ    1 
ATOM   5071 N N     . ASN B 1 320 ? 61.197  58.268  44.279 1.00 87.33  ? 346 ASN B N     1 
ATOM   5072 C CA    . ASN B 1 320 ? 61.238  57.077  43.426 1.00 88.27  ? 346 ASN B CA    1 
ATOM   5073 C C     . ASN B 1 320 ? 62.601  56.856  42.760 1.00 90.44  ? 346 ASN B C     1 
ATOM   5074 O O     . ASN B 1 320 ? 62.718  56.135  41.763 1.00 90.93  ? 346 ASN B O     1 
ATOM   5075 C CB    . ASN B 1 320 ? 60.088  57.070  42.411 1.00 85.27  ? 346 ASN B CB    1 
ATOM   5076 C CG    . ASN B 1 320 ? 58.794  56.540  43.007 1.00 84.66  ? 346 ASN B CG    1 
ATOM   5077 O OD1   . ASN B 1 320 ? 58.756  56.136  44.172 1.00 85.93  ? 346 ASN B OD1   1 
ATOM   5078 N ND2   . ASN B 1 320 ? 57.725  56.539  42.211 1.00 81.88  ? 346 ASN B ND2   1 
ATOM   5079 N N     . ASN B 1 321 ? 63.624  57.488  43.331 1.00 92.32  ? 347 ASN B N     1 
ATOM   5080 C CA    . ASN B 1 321 ? 65.023  57.229  42.980 1.00 95.16  ? 347 ASN B CA    1 
ATOM   5081 C C     . ASN B 1 321 ? 65.735  56.545  44.140 1.00 98.81  ? 347 ASN B C     1 
ATOM   5082 O O     . ASN B 1 321 ? 66.501  55.590  43.946 1.00 101.59 ? 347 ASN B O     1 
ATOM   5083 C CB    . ASN B 1 321 ? 65.747  58.530  42.612 1.00 94.54  ? 347 ASN B CB    1 
ATOM   5084 C CG    . ASN B 1 321 ? 65.186  59.183  41.353 1.00 91.92  ? 347 ASN B CG    1 
ATOM   5085 O OD1   . ASN B 1 321 ? 63.996  59.508  41.277 1.00 87.97  ? 347 ASN B OD1   1 
ATOM   5086 N ND2   . ASN B 1 321 ? 66.050  59.383  40.359 1.00 92.73  ? 347 ASN B ND2   1 
ATOM   5087 N N     . LEU B 1 322 ? 65.462  57.046  45.346 1.00 99.18  ? 348 LEU B N     1 
ATOM   5088 C CA    . LEU B 1 322 ? 66.010  56.497  46.586 1.00 102.82 ? 348 LEU B CA    1 
ATOM   5089 C C     . LEU B 1 322 ? 65.604  55.037  46.784 1.00 104.80 ? 348 LEU B C     1 
ATOM   5090 O O     . LEU B 1 322 ? 64.452  54.664  46.551 1.00 103.07 ? 348 LEU B O     1 
ATOM   5091 C CB    . LEU B 1 322 ? 65.563  57.336  47.794 1.00 102.66 ? 348 LEU B CB    1 
ATOM   5092 C CG    . LEU B 1 322 ? 66.099  58.765  47.968 1.00 102.31 ? 348 LEU B CG    1 
ATOM   5093 C CD1   . LEU B 1 322 ? 65.157  59.789  47.355 1.00 98.21  ? 348 LEU B CD1   1 
ATOM   5094 C CD2   . LEU B 1 322 ? 66.340  59.088  49.446 1.00 105.21 ? 348 LEU B CD2   1 
ATOM   5095 N N     . ILE C 2 2   ? 35.572  19.570  24.160 1.00 86.72  ? 497 ILE C N     1 
ATOM   5096 C CA    . ILE C 2 2   ? 36.448  20.410  25.034 1.00 87.04  ? 497 ILE C CA    1 
ATOM   5097 C C     . ILE C 2 2   ? 35.611  21.193  26.055 1.00 86.61  ? 497 ILE C C     1 
ATOM   5098 O O     . ILE C 2 2   ? 34.489  21.607  25.760 1.00 85.05  ? 497 ILE C O     1 
ATOM   5099 C CB    . ILE C 2 2   ? 37.395  21.351  24.192 1.00 85.89  ? 497 ILE C CB    1 
ATOM   5100 C CG1   . ILE C 2 2   ? 38.420  22.085  25.076 1.00 87.24  ? 497 ILE C CG1   1 
ATOM   5101 C CG2   . ILE C 2 2   ? 36.601  22.345  23.348 1.00 83.73  ? 497 ILE C CG2   1 
ATOM   5102 C CD1   . ILE C 2 2   ? 39.690  21.309  25.370 1.00 89.35  ? 497 ILE C CD1   1 
ATOM   5103 N N     . GLU C 2 3   ? 36.159  21.359  27.260 1.00 88.45  ? 498 GLU C N     1 
ATOM   5104 C CA    . GLU C 2 3   ? 35.530  22.168  28.318 1.00 88.61  ? 498 GLU C CA    1 
ATOM   5105 C C     . GLU C 2 3   ? 35.468  23.652  27.951 1.00 86.31  ? 498 GLU C C     1 
ATOM   5106 O O     . GLU C 2 3   ? 34.599  24.379  28.440 1.00 86.13  ? 498 GLU C O     1 
ATOM   5107 C CB    . GLU C 2 3   ? 36.232  21.979  29.678 1.00 92.12  ? 498 GLU C CB    1 
ATOM   5108 C CG    . GLU C 2 3   ? 37.751  21.740  29.615 1.00 94.62  ? 498 GLU C CG    1 
ATOM   5109 C CD    . GLU C 2 3   ? 38.143  20.275  29.858 1.00 98.26  ? 498 GLU C CD    1 
ATOM   5110 O OE1   . GLU C 2 3   ? 37.243  19.395  29.896 1.00 99.27  ? 498 GLU C OE1   1 
ATOM   5111 O OE2   . GLU C 2 3   ? 39.358  20.002  30.021 1.00 99.79  ? 498 GLU C OE2   1 
ATOM   5112 N N     . GLY C 2 4   ? 36.392  24.088  27.092 1.00 84.96  ? 499 GLY C N     1 
ATOM   5113 C CA    . GLY C 2 4   ? 36.393  25.446  26.553 1.00 83.00  ? 499 GLY C CA    1 
ATOM   5114 C C     . GLY C 2 4   ? 35.117  25.773  25.797 1.00 80.07  ? 499 GLY C C     1 
ATOM   5115 O O     . GLY C 2 4   ? 34.608  26.894  25.892 1.00 79.91  ? 499 GLY C O     1 
ATOM   5116 N N     . LEU C 2 5   ? 34.599  24.789  25.058 1.00 78.23  ? 500 LEU C N     1 
ATOM   5117 C CA    . LEU C 2 5   ? 33.363  24.934  24.278 1.00 76.00  ? 500 LEU C CA    1 
ATOM   5118 C C     . LEU C 2 5   ? 32.129  25.092  25.166 1.00 75.57  ? 500 LEU C C     1 
ATOM   5119 O O     . LEU C 2 5   ? 31.206  25.833  24.823 1.00 74.63  ? 500 LEU C O     1 
ATOM   5120 C CB    . LEU C 2 5   ? 33.181  23.752  23.314 1.00 75.63  ? 500 LEU C CB    1 
ATOM   5121 C CG    . LEU C 2 5   ? 31.924  23.695  22.429 1.00 75.05  ? 500 LEU C CG    1 
ATOM   5122 C CD1   . LEU C 2 5   ? 31.870  24.856  21.424 1.00 73.20  ? 500 LEU C CD1   1 
ATOM   5123 C CD2   . LEU C 2 5   ? 31.802  22.352  21.708 1.00 74.88  ? 500 LEU C CD2   1 
ATOM   5124 N N     . VAL C 2 6   ? 32.126  24.398  26.303 1.00 76.57  ? 501 VAL C N     1 
ATOM   5125 C CA    . VAL C 2 6   ? 31.025  24.454  27.266 1.00 76.67  ? 501 VAL C CA    1 
ATOM   5126 C C     . VAL C 2 6   ? 30.955  25.831  27.949 1.00 76.51  ? 501 VAL C C     1 
ATOM   5127 O O     . VAL C 2 6   ? 29.864  26.392  28.116 1.00 75.93  ? 501 VAL C O     1 
ATOM   5128 C CB    . VAL C 2 6   ? 31.123  23.285  28.293 1.00 79.48  ? 501 VAL C CB    1 
ATOM   5129 C CG1   . VAL C 2 6   ? 30.158  23.474  29.460 1.00 80.89  ? 501 VAL C CG1   1 
ATOM   5130 C CG2   . VAL C 2 6   ? 30.867  21.945  27.600 1.00 79.69  ? 501 VAL C CG2   1 
ATOM   5131 N N     . GLU C 2 7   ? 32.119  26.375  28.315 1.00 77.25  ? 502 GLU C N     1 
ATOM   5132 C CA    . GLU C 2 7   ? 32.224  27.737  28.869 1.00 77.85  ? 502 GLU C CA    1 
ATOM   5133 C C     . GLU C 2 7   ? 31.601  28.745  27.902 1.00 75.41  ? 502 GLU C C     1 
ATOM   5134 O O     . GLU C 2 7   ? 30.691  29.497  28.266 1.00 75.59  ? 502 GLU C O     1 
ATOM   5135 C CB    . GLU C 2 7   ? 33.692  28.119  29.133 1.00 80.15  ? 502 GLU C CB    1 
ATOM   5136 C CG    . GLU C 2 7   ? 34.444  27.230  30.137 1.00 83.83  ? 502 GLU C CG    1 
ATOM   5137 C CD    . GLU C 2 7   ? 34.498  27.801  31.555 1.00 88.32  ? 502 GLU C CD    1 
ATOM   5138 O OE1   . GLU C 2 7   ? 33.561  28.528  31.960 1.00 89.38  ? 502 GLU C OE1   1 
ATOM   5139 O OE2   . GLU C 2 7   ? 35.481  27.506  32.271 1.00 90.67  ? 502 GLU C OE2   1 
ATOM   5140 N N     . LEU C 2 8   ? 32.089  28.741  26.664 1.00 73.29  ? 503 LEU C N     1 
ATOM   5141 C CA    . LEU C 2 8   ? 31.547  29.608  25.618 1.00 71.34  ? 503 LEU C CA    1 
ATOM   5142 C C     . LEU C 2 8   ? 30.046  29.437  25.444 1.00 68.88  ? 503 LEU C C     1 
ATOM   5143 O O     . LEU C 2 8   ? 29.315  30.416  25.467 1.00 68.86  ? 503 LEU C O     1 
ATOM   5144 C CB    . LEU C 2 8   ? 32.267  29.379  24.290 1.00 70.99  ? 503 LEU C CB    1 
ATOM   5145 C CG    . LEU C 2 8   ? 33.602  30.105  24.153 1.00 73.30  ? 503 LEU C CG    1 
ATOM   5146 C CD1   . LEU C 2 8   ? 34.487  29.436  23.103 1.00 73.68  ? 503 LEU C CD1   1 
ATOM   5147 C CD2   . LEU C 2 8   ? 33.357  31.568  23.827 1.00 75.31  ? 503 LEU C CD2   1 
ATOM   5148 N N     . LEU C 2 9   ? 29.595  28.194  25.297 1.00 67.03  ? 504 LEU C N     1 
ATOM   5149 C CA    . LEU C 2 9   ? 28.176  27.907  25.078 1.00 65.61  ? 504 LEU C CA    1 
ATOM   5150 C C     . LEU C 2 9   ? 27.287  28.472  26.178 1.00 65.68  ? 504 LEU C C     1 
ATOM   5151 O O     . LEU C 2 9   ? 26.329  29.187  25.897 1.00 64.65  ? 504 LEU C O     1 
ATOM   5152 C CB    . LEU C 2 9   ? 27.938  26.405  24.924 1.00 65.38  ? 504 LEU C CB    1 
ATOM   5153 C CG    . LEU C 2 9   ? 28.228  25.791  23.556 1.00 65.07  ? 504 LEU C CG    1 
ATOM   5154 C CD1   . LEU C 2 9   ? 28.349  24.290  23.685 1.00 65.57  ? 504 LEU C CD1   1 
ATOM   5155 C CD2   . LEU C 2 9   ? 27.148  26.152  22.549 1.00 63.80  ? 504 LEU C CD2   1 
ATOM   5156 N N     . ASN C 2 10  ? 27.627  28.155  27.428 1.00 67.03  ? 505 ASN C N     1 
ATOM   5157 C CA    . ASN C 2 10  ? 26.879  28.640  28.589 1.00 67.81  ? 505 ASN C CA    1 
ATOM   5158 C C     . ASN C 2 10  ? 26.859  30.155  28.697 1.00 67.87  ? 505 ASN C C     1 
ATOM   5159 O O     . ASN C 2 10  ? 25.806  30.741  28.958 1.00 68.19  ? 505 ASN C O     1 
ATOM   5160 C CB    . ASN C 2 10  ? 27.399  28.002  29.881 1.00 70.16  ? 505 ASN C CB    1 
ATOM   5161 C CG    . ASN C 2 10  ? 26.946  26.557  30.041 1.00 70.98  ? 505 ASN C CG    1 
ATOM   5162 O OD1   . ASN C 2 10  ? 25.823  26.197  29.668 1.00 70.74  ? 505 ASN C OD1   1 
ATOM   5163 N ND2   . ASN C 2 10  ? 27.814  25.725  30.604 1.00 72.26  ? 505 ASN C ND2   1 
ATOM   5164 N N     . ARG C 2 11  ? 28.008  30.787  28.474 1.00 68.14  ? 506 ARG C N     1 
ATOM   5165 C CA    . ARG C 2 11  ? 28.080  32.252  28.423 1.00 69.18  ? 506 ARG C CA    1 
ATOM   5166 C C     . ARG C 2 11  ? 27.279  32.856  27.253 1.00 67.32  ? 506 ARG C C     1 
ATOM   5167 O O     . ARG C 2 11  ? 26.443  33.748  27.456 1.00 68.21  ? 506 ARG C O     1 
ATOM   5168 C CB    . ARG C 2 11  ? 29.544  32.718  28.384 1.00 71.43  ? 506 ARG C CB    1 
ATOM   5169 C CG    . ARG C 2 11  ? 29.730  34.233  28.391 1.00 75.44  ? 506 ARG C CG    1 
ATOM   5170 C CD    . ARG C 2 11  ? 31.142  34.620  28.840 1.00 82.10  ? 506 ARG C CD    1 
ATOM   5171 N NE    . ARG C 2 11  ? 32.117  34.598  27.747 1.00 84.41  ? 506 ARG C NE    1 
ATOM   5172 C CZ    . ARG C 2 11  ? 33.050  33.663  27.572 1.00 85.53  ? 506 ARG C CZ    1 
ATOM   5173 N NH1   . ARG C 2 11  ? 33.159  32.638  28.416 1.00 85.84  ? 506 ARG C NH1   1 
ATOM   5174 N NH2   . ARG C 2 11  ? 33.886  33.756  26.543 1.00 86.08  ? 506 ARG C NH2   1 
ATOM   5175 N N     . VAL C 2 12  ? 27.524  32.363  26.040 1.00 83.03  ? 507 VAL C N     1 
ATOM   5176 C CA    . VAL C 2 12  ? 26.984  32.983  24.820 1.00 80.72  ? 507 VAL C CA    1 
ATOM   5177 C C     . VAL C 2 12  ? 25.475  32.744  24.593 1.00 78.37  ? 507 VAL C C     1 
ATOM   5178 O O     . VAL C 2 12  ? 24.744  33.633  24.163 1.00 77.80  ? 507 VAL C O     1 
ATOM   5179 C CB    . VAL C 2 12  ? 27.830  32.598  23.578 1.00 81.37  ? 507 VAL C CB    1 
ATOM   5180 C CG1   . VAL C 2 12  ? 27.195  33.106  22.274 1.00 81.55  ? 507 VAL C CG1   1 
ATOM   5181 C CG2   . VAL C 2 12  ? 29.242  33.157  23.730 1.00 84.85  ? 507 VAL C CG2   1 
ATOM   5182 N N     . GLN C 2 13  ? 25.014  31.551  25.019 1.00 77.93  ? 508 GLN C N     1 
ATOM   5183 C CA    . GLN C 2 13  ? 23.601  31.204  24.875 1.00 78.18  ? 508 GLN C CA    1 
ATOM   5184 C C     . GLN C 2 13  ? 22.695  31.788  25.962 1.00 80.01  ? 508 GLN C C     1 
ATOM   5185 O O     . GLN C 2 13  ? 21.484  31.886  25.761 1.00 80.81  ? 508 GLN C O     1 
ATOM   5186 C CB    . GLN C 2 13  ? 23.403  29.691  24.764 1.00 78.82  ? 508 GLN C CB    1 
ATOM   5187 C CG    . GLN C 2 13  ? 24.107  29.075  23.559 1.00 77.30  ? 508 GLN C CG    1 
ATOM   5188 C CD    . GLN C 2 13  ? 23.246  28.090  22.788 1.00 77.92  ? 508 GLN C CD    1 
ATOM   5189 O OE1   . GLN C 2 13  ? 23.592  27.699  21.681 1.00 77.90  ? 508 GLN C OE1   1 
ATOM   5190 N NE2   . GLN C 2 13  ? 22.120  27.695  23.364 1.00 80.48  ? 508 GLN C NE2   1 
ATOM   5191 N N     . SER C 2 14  ? 23.264  32.184  27.101 1.00 82.03  ? 509 SER C N     1 
ATOM   5192 C CA    . SER C 2 14  ? 22.450  32.780  28.168 1.00 85.52  ? 509 SER C CA    1 
ATOM   5193 C C     . SER C 2 14  ? 22.052  34.233  27.888 1.00 84.91  ? 509 SER C C     1 
ATOM   5194 O O     . SER C 2 14  ? 21.008  34.689  28.361 1.00 86.30  ? 509 SER C O     1 
ATOM   5195 C CB    . SER C 2 14  ? 23.147  32.678  29.531 1.00 89.47  ? 509 SER C CB    1 
ATOM   5196 O OG    . SER C 2 14  ? 24.095  33.717  29.719 1.00 90.37  ? 509 SER C OG    1 
ATOM   5197 N N     . SER C 2 15  ? 22.881  34.934  27.110 1.00 84.14  ? 510 SER C N     1 
ATOM   5198 C CA    . SER C 2 15  ? 22.803  36.400  26.939 1.00 84.99  ? 510 SER C CA    1 
ATOM   5199 C C     . SER C 2 15  ? 21.488  36.945  26.358 1.00 84.14  ? 510 SER C C     1 
ATOM   5200 O O     . SER C 2 15  ? 20.693  36.201  25.787 1.00 83.56  ? 510 SER C O     1 
ATOM   5201 C CB    . SER C 2 15  ? 24.002  36.910  26.127 1.00 85.51  ? 510 SER C CB    1 
ATOM   5202 O OG    . SER C 2 15  ? 24.092  36.262  24.867 1.00 84.71  ? 510 SER C OG    1 
ATOM   5203 N N     . GLY C 2 16  ? 21.257  38.245  26.538 1.00 85.28  ? 511 GLY C N     1 
ATOM   5204 C CA    . GLY C 2 16  ? 20.078  38.903  25.986 1.00 85.22  ? 511 GLY C CA    1 
ATOM   5205 C C     . GLY C 2 16  ? 19.031  39.355  26.992 1.00 86.82  ? 511 GLY C C     1 
ATOM   5206 O O     . GLY C 2 16  ? 19.335  39.616  28.162 1.00 88.84  ? 511 GLY C O     1 
ATOM   5207 N N     . ALA C 2 17  ? 17.785  39.421  26.524 1.00 87.13  ? 512 ALA C N     1 
ATOM   5208 C CA    . ALA C 2 17  ? 16.714  40.122  27.221 1.00 88.89  ? 512 ALA C CA    1 
ATOM   5209 C C     . ALA C 2 17  ? 15.744  39.249  28.041 1.00 92.30  ? 512 ALA C C     1 
ATOM   5210 O O     . ALA C 2 17  ? 14.726  38.755  27.522 1.00 94.11  ? 512 ALA C O     1 
ATOM   5211 C CB    . ALA C 2 17  ? 15.942  41.001  26.225 1.00 88.30  ? 512 ALA C CB    1 
ATOM   5212 N N     . HIS C 2 18  ? 16.054  39.077  29.327 1.00 94.97  ? 513 HIS C N     1 
ATOM   5213 C CA    . HIS C 2 18  ? 15.091  38.517  30.282 1.00 99.87  ? 513 HIS C CA    1 
ATOM   5214 C C     . HIS C 2 18  ? 14.192  39.653  30.783 1.00 101.27 ? 513 HIS C C     1 
ATOM   5215 O O     . HIS C 2 18  ? 14.297  40.783  30.293 1.00 98.11  ? 513 HIS C O     1 
ATOM   5216 C CB    . HIS C 2 18  ? 15.800  37.797  31.436 1.00 103.95 ? 513 HIS C CB    1 
ATOM   5217 C CG    . HIS C 2 18  ? 16.949  36.937  30.999 1.00 102.20 ? 513 HIS C CG    1 
ATOM   5218 N ND1   . HIS C 2 18  ? 18.181  36.970  31.619 1.00 103.37 ? 513 HIS C ND1   1 
ATOM   5219 C CD2   . HIS C 2 18  ? 17.058  36.032  29.997 1.00 100.23 ? 513 HIS C CD2   1 
ATOM   5220 C CE1   . HIS C 2 18  ? 18.996  36.116  31.023 1.00 101.84 ? 513 HIS C CE1   1 
ATOM   5221 N NE2   . HIS C 2 18  ? 18.339  35.535  30.034 1.00 99.26  ? 513 HIS C NE2   1 
ATOM   5222 N N     . ASP C 2 19  ? 13.309  39.358  31.741 1.00 73.82  ? 514 ASP C N     1 
ATOM   5223 C CA    . ASP C 2 19  ? 12.294  40.317  32.224 1.00 71.98  ? 514 ASP C CA    1 
ATOM   5224 C C     . ASP C 2 19  ? 11.337  40.772  31.098 1.00 67.08  ? 514 ASP C C     1 
ATOM   5225 O O     . ASP C 2 19  ? 10.395  41.537  31.336 1.00 66.61  ? 514 ASP C O     1 
ATOM   5226 C CB    . ASP C 2 19  ? 12.941  41.528  32.932 1.00 76.69  ? 514 ASP C CB    1 
ATOM   5227 C CG    . ASP C 2 19  ? 13.631  41.153  34.244 1.00 83.89  ? 514 ASP C CG    1 
ATOM   5228 O OD1   . ASP C 2 19  ? 14.864  41.350  34.347 1.00 89.82  ? 514 ASP C OD1   1 
ATOM   5229 O OD2   . ASP C 2 19  ? 12.946  40.667  35.178 1.00 85.73  ? 514 ASP C OD2   1 
ATOM   5230 N N     . GLN C 2 20  ? 11.584  40.281  29.885 1.00 63.85  ? 515 GLN C N     1 
ATOM   5231 C CA    . GLN C 2 20  ? 10.763  40.589  28.727 1.00 60.68  ? 515 GLN C CA    1 
ATOM   5232 C C     . GLN C 2 20  ? 10.216  39.313  28.094 1.00 59.95  ? 515 GLN C C     1 
ATOM   5233 O O     . GLN C 2 20  ? 9.915   39.283  26.902 1.00 59.48  ? 515 GLN C O     1 
ATOM   5234 C CB    . GLN C 2 20  ? 11.572  41.404  27.702 1.00 60.57  ? 515 GLN C CB    1 
ATOM   5235 C CG    . GLN C 2 20  ? 11.993  42.780  28.207 1.00 60.35  ? 515 GLN C CG    1 
ATOM   5236 C CD    . GLN C 2 20  ? 12.941  43.496  27.272 1.00 58.95  ? 515 GLN C CD    1 
ATOM   5237 O OE1   . GLN C 2 20  ? 12.617  43.765  26.112 1.00 56.56  ? 515 GLN C OE1   1 
ATOM   5238 N NE2   . GLN C 2 20  ? 14.113  43.841  27.782 1.00 60.07  ? 515 GLN C NE2   1 
ATOM   5239 N N     . ARG C 2 21  ? 10.091  38.266  28.901 1.00 61.37  ? 516 ARG C N     1 
ATOM   5240 C CA    . ARG C 2 21  ? 9.563   36.981  28.453 1.00 63.27  ? 516 ARG C CA    1 
ATOM   5241 C C     . ARG C 2 21  ? 8.434   36.499  29.348 1.00 64.57  ? 516 ARG C C     1 
ATOM   5242 O O     . ARG C 2 21  ? 8.462   36.711  30.563 1.00 64.46  ? 516 ARG C O     1 
ATOM   5243 C CB    . ARG C 2 21  ? 10.665  35.918  28.424 1.00 65.89  ? 516 ARG C CB    1 
ATOM   5244 C CG    . ARG C 2 21  ? 11.590  36.032  27.228 1.00 66.56  ? 516 ARG C CG    1 
ATOM   5245 C CD    . ARG C 2 21  ? 12.402  34.760  27.035 1.00 70.79  ? 516 ARG C CD    1 
ATOM   5246 N NE    . ARG C 2 21  ? 13.297  34.863  25.891 1.00 70.45  ? 516 ARG C NE    1 
ATOM   5247 C CZ    . ARG C 2 21  ? 12.941  34.636  24.626 1.00 71.26  ? 516 ARG C CZ    1 
ATOM   5248 N NH1   . ARG C 2 21  ? 11.693  34.288  24.330 1.00 72.24  ? 516 ARG C NH1   1 
ATOM   5249 N NH2   . ARG C 2 21  ? 13.839  34.760  23.652 1.00 69.42  ? 516 ARG C NH2   1 
ATOM   5250 N N     . GLY C 2 22  ? 7.451   35.838  28.740 1.00 66.66  ? 517 GLY C N     1 
ATOM   5251 C CA    . GLY C 2 22  ? 6.368   35.194  29.488 1.00 69.54  ? 517 GLY C CA    1 
ATOM   5252 C C     . GLY C 2 22  ? 5.341   36.160  30.055 1.00 68.26  ? 517 GLY C C     1 
ATOM   5253 O O     . GLY C 2 22  ? 5.332   37.351  29.717 1.00 66.49  ? 517 GLY C O     1 
ATOM   5254 N N     . LEU C 2 23  ? 4.474   35.642  30.919 1.00 70.15  ? 518 LEU C N     1 
ATOM   5255 C CA    . LEU C 2 23  ? 3.394   36.435  31.523 1.00 69.87  ? 518 LEU C CA    1 
ATOM   5256 C C     . LEU C 2 23  ? 3.947   37.430  32.530 1.00 68.04  ? 518 LEU C C     1 
ATOM   5257 O O     . LEU C 2 23  ? 5.029   37.221  33.080 1.00 68.13  ? 518 LEU C O     1 
ATOM   5258 C CB    . LEU C 2 23  ? 2.366   35.517  32.205 1.00 72.05  ? 518 LEU C CB    1 
ATOM   5259 C CG    . LEU C 2 23  ? 1.805   34.363  31.370 1.00 76.94  ? 518 LEU C CG    1 
ATOM   5260 C CD1   . LEU C 2 23  ? 1.043   33.357  32.239 1.00 81.00  ? 518 LEU C CD1   1 
ATOM   5261 C CD2   . LEU C 2 23  ? 0.934   34.888  30.233 1.00 78.84  ? 518 LEU C CD2   1 
ATOM   5262 N N     . LEU C 2 24  ? 3.200   38.507  32.765 1.00 68.40  ? 519 LEU C N     1 
ATOM   5263 C CA    . LEU C 2 24  ? 3.600   39.527  33.732 1.00 69.01  ? 519 LEU C CA    1 
ATOM   5264 C C     . LEU C 2 24  ? 3.776   38.978  35.142 1.00 70.19  ? 519 LEU C C     1 
ATOM   5265 O O     . LEU C 2 24  ? 2.964   38.191  35.628 1.00 70.55  ? 519 LEU C O     1 
ATOM   5266 C CB    . LEU C 2 24  ? 2.609   40.685  33.754 1.00 70.06  ? 519 LEU C CB    1 
ATOM   5267 C CG    . LEU C 2 24  ? 2.746   41.741  32.664 1.00 72.07  ? 519 LEU C CG    1 
ATOM   5268 C CD1   . LEU C 2 24  ? 1.608   42.743  32.792 1.00 76.05  ? 519 LEU C CD1   1 
ATOM   5269 C CD2   . LEU C 2 24  ? 4.104   42.444  32.722 1.00 72.00  ? 519 LEU C CD2   1 
ATOM   5270 N N     . ARG C 2 25  ? 4.856   39.406  35.781 1.00 72.28  ? 520 ARG C N     1 
ATOM   5271 C CA    . ARG C 2 25  ? 5.207   38.967  37.117 1.00 75.35  ? 520 ARG C CA    1 
ATOM   5272 C C     . ARG C 2 25  ? 5.415   40.186  38.013 1.00 77.85  ? 520 ARG C C     1 
ATOM   5273 O O     . ARG C 2 25  ? 5.730   41.280  37.527 1.00 78.56  ? 520 ARG C O     1 
ATOM   5274 C CB    . ARG C 2 25  ? 6.463   38.090  37.065 1.00 77.98  ? 520 ARG C CB    1 
ATOM   5275 C CG    . ARG C 2 25  ? 6.207   36.654  36.570 1.00 80.09  ? 520 ARG C CG    1 
ATOM   5276 C CD    . ARG C 2 25  ? 7.459   35.984  35.978 1.00 85.22  ? 520 ARG C CD    1 
ATOM   5277 N NE    . ARG C 2 25  ? 8.663   36.203  36.784 1.00 91.09  ? 520 ARG C NE    1 
ATOM   5278 C CZ    . ARG C 2 25  ? 9.756   36.847  36.367 1.00 92.86  ? 520 ARG C CZ    1 
ATOM   5279 N NH1   . ARG C 2 25  ? 9.833   37.337  35.131 1.00 88.65  ? 520 ARG C NH1   1 
ATOM   5280 N NH2   . ARG C 2 25  ? 10.786  36.990  37.192 1.00 98.84  ? 520 ARG C NH2   1 
ATOM   5281 N N     . LYS C 2 26  ? 5.232   39.984  39.317 1.00 90.70  ? 521 LYS C N     1 
ATOM   5282 C CA    . LYS C 2 26  ? 5.269   41.058  40.315 1.00 89.47  ? 521 LYS C CA    1 
ATOM   5283 C C     . LYS C 2 26  ? 6.541   41.907  40.260 1.00 87.89  ? 521 LYS C C     1 
ATOM   5284 O O     . LYS C 2 26  ? 6.496   43.125  40.461 1.00 86.75  ? 521 LYS C O     1 
ATOM   5285 C CB    . LYS C 2 26  ? 5.065   40.475  41.723 1.00 90.59  ? 521 LYS C CB    1 
ATOM   5286 C CG    . LYS C 2 26  ? 6.168   39.509  42.202 1.00 91.65  ? 521 LYS C CG    1 
ATOM   5287 C CD    . LYS C 2 26  ? 5.652   38.463  43.201 1.00 94.41  ? 521 LYS C CD    1 
ATOM   5288 C CE    . LYS C 2 26  ? 5.071   39.079  44.480 1.00 95.12  ? 521 LYS C CE    1 
ATOM   5289 N NZ    . LYS C 2 26  ? 6.087   39.799  45.307 1.00 94.28  ? 521 LYS C NZ    1 
ATOM   5290 N N     . GLU C 2 27  ? 7.666   41.254  39.979 1.00 87.93  ? 522 GLU C N     1 
ATOM   5291 C CA    . GLU C 2 27  ? 8.968   41.915  39.959 1.00 86.84  ? 522 GLU C CA    1 
ATOM   5292 C C     . GLU C 2 27  ? 9.090   42.880  38.783 1.00 85.71  ? 522 GLU C C     1 
ATOM   5293 O O     . GLU C 2 27  ? 9.700   43.942  38.907 1.00 85.13  ? 522 GLU C O     1 
ATOM   5294 C CB    . GLU C 2 27  ? 10.089  40.876  39.923 1.00 87.75  ? 522 GLU C CB    1 
ATOM   5295 C CG    . GLU C 2 27  ? 11.399  41.357  40.541 1.00 87.98  ? 522 GLU C CG    1 
ATOM   5296 C CD    . GLU C 2 27  ? 12.277  40.215  41.042 1.00 89.45  ? 522 GLU C CD    1 
ATOM   5297 O OE1   . GLU C 2 27  ? 12.112  39.068  40.570 1.00 90.66  ? 522 GLU C OE1   1 
ATOM   5298 O OE2   . GLU C 2 27  ? 13.137  40.471  41.912 1.00 89.32  ? 522 GLU C OE2   1 
ATOM   5299 N N     . ASP C 2 28  ? 8.493   42.507  37.652 1.00 85.53  ? 523 ASP C N     1 
ATOM   5300 C CA    . ASP C 2 28  ? 8.507   43.329  36.445 1.00 84.37  ? 523 ASP C CA    1 
ATOM   5301 C C     . ASP C 2 28  ? 7.770   44.651  36.656 1.00 82.75  ? 523 ASP C C     1 
ATOM   5302 O O     . ASP C 2 28  ? 7.938   45.593  35.875 1.00 82.10  ? 523 ASP C O     1 
ATOM   5303 C CB    . ASP C 2 28  ? 7.879   42.575  35.257 1.00 85.43  ? 523 ASP C CB    1 
ATOM   5304 C CG    . ASP C 2 28  ? 8.667   41.326  34.846 1.00 86.96  ? 523 ASP C CG    1 
ATOM   5305 O OD1   . ASP C 2 28  ? 9.735   41.032  35.438 1.00 87.06  ? 523 ASP C OD1   1 
ATOM   5306 O OD2   . ASP C 2 28  ? 8.203   40.633  33.913 1.00 87.38  ? 523 ASP C OD2   1 
ATOM   5307 N N     . LEU C 2 29  ? 6.966   44.722  37.717 1.00 81.90  ? 524 LEU C N     1 
ATOM   5308 C CA    . LEU C 2 29  ? 6.073   45.864  37.913 1.00 80.64  ? 524 LEU C CA    1 
ATOM   5309 C C     . LEU C 2 29  ? 6.469   46.795  39.063 1.00 79.73  ? 524 LEU C C     1 
ATOM   5310 O O     . LEU C 2 29  ? 5.679   47.641  39.476 1.00 79.84  ? 524 LEU C O     1 
ATOM   5311 C CB    . LEU C 2 29  ? 4.611   45.403  38.036 1.00 81.12  ? 524 LEU C CB    1 
ATOM   5312 C CG    . LEU C 2 29  ? 4.035   44.547  36.893 1.00 81.80  ? 524 LEU C CG    1 
ATOM   5313 C CD1   . LEU C 2 29  ? 2.637   44.043  37.221 1.00 82.60  ? 524 LEU C CD1   1 
ATOM   5314 C CD2   . LEU C 2 29  ? 4.019   45.288  35.564 1.00 81.05  ? 524 LEU C CD2   1 
ATOM   5315 N N     . VAL C 2 30  ? 7.696   46.660  39.559 1.00 79.14  ? 525 VAL C N     1 
ATOM   5316 C CA    . VAL C 2 30  ? 8.212   47.594  40.571 1.00 78.37  ? 525 VAL C CA    1 
ATOM   5317 C C     . VAL C 2 30  ? 8.557   48.950  39.938 1.00 77.32  ? 525 VAL C C     1 
ATOM   5318 O O     . VAL C 2 30  ? 9.364   49.029  39.006 1.00 77.33  ? 525 VAL C O     1 
ATOM   5319 C CB    . VAL C 2 30  ? 9.406   47.002  41.383 1.00 78.81  ? 525 VAL C CB    1 
ATOM   5320 C CG1   . VAL C 2 30  ? 10.530  46.515  40.465 1.00 79.13  ? 525 VAL C CG1   1 
ATOM   5321 C CG2   . VAL C 2 30  ? 9.935   48.016  42.401 1.00 79.14  ? 525 VAL C CG2   1 
ATOM   5322 N N     . LEU C 2 31  ? 7.921   50.002  40.448 1.00 76.43  ? 526 LEU C N     1 
ATOM   5323 C CA    . LEU C 2 31  ? 8.055   51.359  39.922 1.00 75.42  ? 526 LEU C CA    1 
ATOM   5324 C C     . LEU C 2 31  ? 9.514   51.804  39.827 1.00 75.36  ? 526 LEU C C     1 
ATOM   5325 O O     . LEU C 2 31  ? 10.287  51.576  40.755 1.00 75.83  ? 526 LEU C O     1 
ATOM   5326 C CB    . LEU C 2 31  ? 7.258   52.339  40.790 1.00 75.82  ? 526 LEU C CB    1 
ATOM   5327 C CG    . LEU C 2 31  ? 6.895   53.721  40.231 1.00 75.49  ? 526 LEU C CG    1 
ATOM   5328 C CD1   . LEU C 2 31  ? 5.841   53.618  39.143 1.00 73.95  ? 526 LEU C CD1   1 
ATOM   5329 C CD2   . LEU C 2 31  ? 6.410   54.641  41.344 1.00 76.43  ? 526 LEU C CD2   1 
ATOM   5330 N N     . PRO C 2 32  ? 9.898   52.423  38.690 1.00 74.84  ? 527 PRO C N     1 
ATOM   5331 C CA    . PRO C 2 32  ? 11.240  52.993  38.540 1.00 75.26  ? 527 PRO C CA    1 
ATOM   5332 C C     . PRO C 2 32  ? 11.450  54.166  39.493 1.00 75.70  ? 527 PRO C C     1 
ATOM   5333 O O     . PRO C 2 32  ? 10.529  54.958  39.711 1.00 75.63  ? 527 PRO C O     1 
ATOM   5334 C CB    . PRO C 2 32  ? 11.257  53.492  37.089 1.00 75.24  ? 527 PRO C CB    1 
ATOM   5335 C CG    . PRO C 2 32  ? 10.135  52.778  36.414 1.00 74.64  ? 527 PRO C CG    1 
ATOM   5336 C CD    . PRO C 2 32  ? 9.097   52.593  37.466 1.00 74.15  ? 527 PRO C CD    1 
ATOM   5337 N N     . GLU C 2 33  ? 12.660  54.267  40.039 1.00 76.21  ? 528 GLU C N     1 
ATOM   5338 C CA    . GLU C 2 33  ? 12.996  55.268  41.048 1.00 77.16  ? 528 GLU C CA    1 
ATOM   5339 C C     . GLU C 2 33  ? 12.769  56.694  40.571 1.00 77.51  ? 528 GLU C C     1 
ATOM   5340 O O     . GLU C 2 33  ? 12.374  57.547  41.359 1.00 78.77  ? 528 GLU C O     1 
ATOM   5341 C CB    . GLU C 2 33  ? 14.444  55.087  41.524 1.00 78.53  ? 528 GLU C CB    1 
ATOM   5342 C CG    . GLU C 2 33  ? 14.704  55.568  42.955 1.00 80.90  ? 528 GLU C CG    1 
ATOM   5343 C CD    . GLU C 2 33  ? 15.818  54.790  43.649 1.00 83.16  ? 528 GLU C CD    1 
ATOM   5344 O OE1   . GLU C 2 33  ? 17.010  55.013  43.327 1.00 84.02  ? 528 GLU C OE1   1 
ATOM   5345 O OE2   . GLU C 2 33  ? 15.496  53.958  44.529 1.00 83.52  ? 528 GLU C OE2   1 
ATOM   5346 N N     . PHE C 2 34  ? 12.999  56.955  39.287 1.00 76.70  ? 529 PHE C N     1 
ATOM   5347 C CA    . PHE C 2 34  ? 12.841  58.308  38.757 1.00 77.01  ? 529 PHE C CA    1 
ATOM   5348 C C     . PHE C 2 34  ? 11.371  58.743  38.669 1.00 76.29  ? 529 PHE C C     1 
ATOM   5349 O O     . PHE C 2 34  ? 11.068  59.923  38.468 1.00 77.16  ? 529 PHE C O     1 
ATOM   5350 C CB    . PHE C 2 34  ? 13.558  58.455  37.407 1.00 77.32  ? 529 PHE C CB    1 
ATOM   5351 C CG    . PHE C 2 34  ? 12.739  58.029  36.210 1.00 74.60  ? 529 PHE C CG    1 
ATOM   5352 C CD1   . PHE C 2 34  ? 12.558  56.681  35.910 1.00 71.84  ? 529 PHE C CD1   1 
ATOM   5353 C CD2   . PHE C 2 34  ? 12.180  58.983  35.363 1.00 73.59  ? 529 PHE C CD2   1 
ATOM   5354 C CE1   . PHE C 2 34  ? 11.822  56.290  34.797 1.00 70.14  ? 529 PHE C CE1   1 
ATOM   5355 C CE2   . PHE C 2 34  ? 11.434  58.601  34.248 1.00 72.22  ? 529 PHE C CE2   1 
ATOM   5356 C CZ    . PHE C 2 34  ? 11.257  57.249  33.965 1.00 70.53  ? 529 PHE C CZ    1 
ATOM   5357 N N     . LEU C 2 35  ? 10.464  57.785  38.819 1.00 74.62  ? 530 LEU C N     1 
ATOM   5358 C CA    . LEU C 2 35  ? 9.040   58.079  38.778 1.00 74.01  ? 530 LEU C CA    1 
ATOM   5359 C C     . LEU C 2 35  ? 8.450   58.289  40.179 1.00 74.86  ? 530 LEU C C     1 
ATOM   5360 O O     . LEU C 2 35  ? 7.283   58.664  40.319 1.00 74.70  ? 530 LEU C O     1 
ATOM   5361 C CB    . LEU C 2 35  ? 8.283   56.995  37.995 1.00 72.10  ? 530 LEU C CB    1 
ATOM   5362 C CG    . LEU C 2 35  ? 8.446   57.051  36.467 1.00 71.35  ? 530 LEU C CG    1 
ATOM   5363 C CD1   . LEU C 2 35  ? 7.795   55.853  35.780 1.00 68.93  ? 530 LEU C CD1   1 
ATOM   5364 C CD2   . LEU C 2 35  ? 7.904   58.358  35.894 1.00 70.67  ? 530 LEU C CD2   1 
ATOM   5365 N N     . GLN C 2 36  ? 9.268   58.072  41.209 1.00 75.89  ? 531 GLN C N     1 
ATOM   5366 C CA    . GLN C 2 36  ? 8.828   58.246  42.599 1.00 77.27  ? 531 GLN C CA    1 
ATOM   5367 C C     . GLN C 2 36  ? 8.904   59.697  43.063 1.00 79.10  ? 531 GLN C C     1 
ATOM   5368 O O     . GLN C 2 36  ? 8.550   60.614  42.323 1.00 79.51  ? 531 GLN C O     1 
ATOM   5369 C CB    . GLN C 2 36  ? 9.644   57.363  43.536 1.00 77.43  ? 531 GLN C CB    1 
ATOM   5370 C CG    . GLN C 2 36  ? 9.466   55.878  43.296 1.00 76.53  ? 531 GLN C CG    1 
ATOM   5371 C CD    . GLN C 2 36  ? 10.587  55.065  43.899 1.00 78.50  ? 531 GLN C CD    1 
ATOM   5372 O OE1   . GLN C 2 36  ? 11.438  55.591  44.626 1.00 80.03  ? 531 GLN C OE1   1 
ATOM   5373 N NE2   . GLN C 2 36  ? 10.602  53.770  43.597 1.00 78.40  ? 531 GLN C NE2   1 
ATOM   5374 N N     . ASP D 2 1   ? 49.097  44.572  23.000 1.00 89.93  ? 496 ASP D N     1 
ATOM   5375 C CA    . ASP D 2 1   ? 50.228  44.684  22.026 1.00 91.76  ? 496 ASP D CA    1 
ATOM   5376 C C     . ASP D 2 1   ? 50.507  46.152  21.701 1.00 88.89  ? 496 ASP D C     1 
ATOM   5377 O O     . ASP D 2 1   ? 49.677  47.027  21.993 1.00 86.07  ? 496 ASP D O     1 
ATOM   5378 C CB    . ASP D 2 1   ? 49.921  43.907  20.738 1.00 94.47  ? 496 ASP D CB    1 
ATOM   5379 C CG    . ASP D 2 1   ? 49.605  42.437  20.992 1.00 99.45  ? 496 ASP D CG    1 
ATOM   5380 O OD1   . ASP D 2 1   ? 50.010  41.594  20.161 1.00 103.84 ? 496 ASP D OD1   1 
ATOM   5381 O OD2   . ASP D 2 1   ? 48.945  42.120  22.009 1.00 98.66  ? 496 ASP D OD2   1 
ATOM   5382 N N     . ILE D 2 2   ? 51.668  46.413  21.100 1.00 90.58  ? 497 ILE D N     1 
ATOM   5383 C CA    . ILE D 2 2   ? 52.053  47.770  20.713 1.00 89.34  ? 497 ILE D CA    1 
ATOM   5384 C C     . ILE D 2 2   ? 51.244  48.219  19.498 1.00 87.00  ? 497 ILE D C     1 
ATOM   5385 O O     . ILE D 2 2   ? 50.842  49.381  19.408 1.00 85.41  ? 497 ILE D O     1 
ATOM   5386 C CB    . ILE D 2 2   ? 53.586  47.896  20.439 1.00 94.06  ? 497 ILE D CB    1 
ATOM   5387 C CG1   . ILE D 2 2   ? 54.415  47.366  21.625 1.00 97.48  ? 497 ILE D CG1   1 
ATOM   5388 C CG2   . ILE D 2 2   ? 53.974  49.338  20.089 1.00 94.06  ? 497 ILE D CG2   1 
ATOM   5389 C CD1   . ILE D 2 2   ? 54.121  48.020  22.987 1.00 94.87  ? 497 ILE D CD1   1 
ATOM   5390 N N     . GLU D 2 3   ? 51.005  47.285  18.578 1.00 87.80  ? 498 GLU D N     1 
ATOM   5391 C CA    . GLU D 2 3   ? 50.146  47.514  17.411 1.00 86.04  ? 498 GLU D CA    1 
ATOM   5392 C C     . GLU D 2 3   ? 48.803  48.154  17.811 1.00 82.43  ? 498 GLU D C     1 
ATOM   5393 O O     . GLU D 2 3   ? 48.464  49.242  17.334 1.00 80.59  ? 498 GLU D O     1 
ATOM   5394 C CB    . GLU D 2 3   ? 49.900  46.199  16.650 1.00 89.00  ? 498 GLU D CB    1 
ATOM   5395 C CG    . GLU D 2 3   ? 51.137  45.595  15.948 1.00 95.02  ? 498 GLU D CG    1 
ATOM   5396 C CD    . GLU D 2 3   ? 52.050  44.780  16.876 1.00 100.43 ? 498 GLU D CD    1 
ATOM   5397 O OE1   . GLU D 2 3   ? 51.695  44.587  18.062 1.00 100.59 ? 498 GLU D OE1   1 
ATOM   5398 O OE2   . GLU D 2 3   ? 53.126  44.332  16.416 1.00 104.70 ? 498 GLU D OE2   1 
ATOM   5399 N N     . GLY D 2 4   ? 48.069  47.475  18.698 1.00 82.09  ? 499 GLY D N     1 
ATOM   5400 C CA    . GLY D 2 4   ? 46.737  47.906  19.148 1.00 80.52  ? 499 GLY D CA    1 
ATOM   5401 C C     . GLY D 2 4   ? 46.751  49.186  19.965 1.00 78.88  ? 499 GLY D C     1 
ATOM   5402 O O     . GLY D 2 4   ? 45.867  50.036  19.812 1.00 79.10  ? 499 GLY D O     1 
ATOM   5403 N N     . LEU D 2 5   ? 47.762  49.320  20.828 1.00 78.18  ? 500 LEU D N     1 
ATOM   5404 C CA    . LEU D 2 5   ? 47.941  50.498  21.676 1.00 77.63  ? 500 LEU D CA    1 
ATOM   5405 C C     . LEU D 2 5   ? 48.046  51.780  20.857 1.00 78.23  ? 500 LEU D C     1 
ATOM   5406 O O     . LEU D 2 5   ? 47.458  52.799  21.213 1.00 79.41  ? 500 LEU D O     1 
ATOM   5407 C CB    . LEU D 2 5   ? 49.180  50.339  22.573 1.00 78.35  ? 500 LEU D CB    1 
ATOM   5408 C CG    . LEU D 2 5   ? 49.563  51.489  23.520 1.00 79.10  ? 500 LEU D CG    1 
ATOM   5409 C CD1   . LEU D 2 5   ? 48.546  51.643  24.631 1.00 78.65  ? 500 LEU D CD1   1 
ATOM   5410 C CD2   . LEU D 2 5   ? 50.944  51.289  24.113 1.00 80.48  ? 500 LEU D CD2   1 
ATOM   5411 N N     . VAL D 2 6   ? 48.787  51.714  19.754 1.00 78.37  ? 501 VAL D N     1 
ATOM   5412 C CA    . VAL D 2 6   ? 49.052  52.885  18.919 1.00 79.45  ? 501 VAL D CA    1 
ATOM   5413 C C     . VAL D 2 6   ? 47.770  53.401  18.271 1.00 79.03  ? 501 VAL D C     1 
ATOM   5414 O O     . VAL D 2 6   ? 47.554  54.606  18.194 1.00 81.10  ? 501 VAL D O     1 
ATOM   5415 C CB    . VAL D 2 6   ? 50.175  52.602  17.876 1.00 80.42  ? 501 VAL D CB    1 
ATOM   5416 C CG1   . VAL D 2 6   ? 50.312  53.738  16.852 1.00 81.53  ? 501 VAL D CG1   1 
ATOM   5417 C CG2   . VAL D 2 6   ? 51.496  52.390  18.590 1.00 83.02  ? 501 VAL D CG2   1 
ATOM   5418 N N     . GLU D 2 7   ? 46.907  52.494  17.832 1.00 59.56  ? 502 GLU D N     1 
ATOM   5419 C CA    . GLU D 2 7   ? 45.647  52.916  17.237 1.00 61.27  ? 502 GLU D CA    1 
ATOM   5420 C C     . GLU D 2 7   ? 44.654  53.397  18.305 1.00 57.50  ? 502 GLU D C     1 
ATOM   5421 O O     . GLU D 2 7   ? 44.004  54.434  18.131 1.00 56.73  ? 502 GLU D O     1 
ATOM   5422 C CB    . GLU D 2 7   ? 45.074  51.846  16.295 1.00 67.25  ? 502 GLU D CB    1 
ATOM   5423 C CG    . GLU D 2 7   ? 45.506  52.073  14.818 1.00 74.46  ? 502 GLU D CG    1 
ATOM   5424 C CD    . GLU D 2 7   ? 45.142  50.935  13.872 1.00 84.16  ? 502 GLU D CD    1 
ATOM   5425 O OE1   . GLU D 2 7   ? 45.050  49.777  14.330 1.00 86.80  ? 502 GLU D OE1   1 
ATOM   5426 O OE2   . GLU D 2 7   ? 44.965  51.198  12.655 1.00 90.91  ? 502 GLU D OE2   1 
ATOM   5427 N N     . LEU D 2 8   ? 44.580  52.670  19.417 1.00 55.74  ? 503 LEU D N     1 
ATOM   5428 C CA    . LEU D 2 8   ? 43.781  53.078  20.571 1.00 53.64  ? 503 LEU D CA    1 
ATOM   5429 C C     . LEU D 2 8   ? 44.137  54.498  21.001 1.00 51.25  ? 503 LEU D C     1 
ATOM   5430 O O     . LEU D 2 8   ? 43.253  55.350  21.106 1.00 50.88  ? 503 LEU D O     1 
ATOM   5431 C CB    . LEU D 2 8   ? 43.961  52.084  21.719 1.00 53.98  ? 503 LEU D CB    1 
ATOM   5432 C CG    . LEU D 2 8   ? 43.121  52.159  22.997 1.00 54.21  ? 503 LEU D CG    1 
ATOM   5433 C CD1   . LEU D 2 8   ? 41.626  52.084  22.702 1.00 58.42  ? 503 LEU D CD1   1 
ATOM   5434 C CD2   . LEU D 2 8   ? 43.513  51.031  23.914 1.00 55.03  ? 503 LEU D CD2   1 
ATOM   5435 N N     . LEU D 2 9   ? 45.432  54.757  21.197 1.00 50.52  ? 504 LEU D N     1 
ATOM   5436 C CA    . LEU D 2 9   ? 45.934  56.097  21.489 1.00 49.77  ? 504 LEU D CA    1 
ATOM   5437 C C     . LEU D 2 9   ? 45.509  57.143  20.462 1.00 50.97  ? 504 LEU D C     1 
ATOM   5438 O O     . LEU D 2 9   ? 45.035  58.221  20.833 1.00 50.42  ? 504 LEU D O     1 
ATOM   5439 C CB    . LEU D 2 9   ? 47.457  56.085  21.596 1.00 50.51  ? 504 LEU D CB    1 
ATOM   5440 C CG    . LEU D 2 9   ? 48.084  55.686  22.940 1.00 50.90  ? 504 LEU D CG    1 
ATOM   5441 C CD1   . LEU D 2 9   ? 49.503  55.219  22.712 1.00 52.60  ? 504 LEU D CD1   1 
ATOM   5442 C CD2   . LEU D 2 9   ? 48.060  56.832  23.936 1.00 49.74  ? 504 LEU D CD2   1 
ATOM   5443 N N     . ASN D 2 10  ? 45.687  56.829  19.177 1.00 53.44  ? 505 ASN D N     1 
ATOM   5444 C CA    . ASN D 2 10  ? 45.360  57.766  18.101 1.00 56.03  ? 505 ASN D CA    1 
ATOM   5445 C C     . ASN D 2 10  ? 43.870  58.138  18.074 1.00 55.78  ? 505 ASN D C     1 
ATOM   5446 O O     . ASN D 2 10  ? 43.517  59.310  17.948 1.00 56.05  ? 505 ASN D O     1 
ATOM   5447 C CB    . ASN D 2 10  ? 45.810  57.207  16.741 1.00 60.21  ? 505 ASN D CB    1 
ATOM   5448 C CG    . ASN D 2 10  ? 47.318  57.312  16.526 1.00 62.86  ? 505 ASN D CG    1 
ATOM   5449 O OD1   . ASN D 2 10  ? 48.026  58.003  17.265 1.00 61.81  ? 505 ASN D OD1   1 
ATOM   5450 N ND2   . ASN D 2 10  ? 47.812  56.632  15.493 1.00 68.04  ? 505 ASN D ND2   1 
ATOM   5451 N N     . ARG D 2 11  ? 43.024  57.121  18.209 1.00 56.40  ? 506 ARG D N     1 
ATOM   5452 C CA    . ARG D 2 11  ? 41.568  57.238  18.287 1.00 57.84  ? 506 ARG D CA    1 
ATOM   5453 C C     . ARG D 2 11  ? 41.100  58.058  19.511 1.00 55.47  ? 506 ARG D C     1 
ATOM   5454 O O     . ARG D 2 11  ? 40.365  59.032  19.369 1.00 56.30  ? 506 ARG D O     1 
ATOM   5455 C CB    . ARG D 2 11  ? 41.004  55.819  18.375 1.00 60.13  ? 506 ARG D CB    1 
ATOM   5456 C CG    . ARG D 2 11  ? 39.560  55.626  17.963 1.00 65.29  ? 506 ARG D CG    1 
ATOM   5457 C CD    . ARG D 2 11  ? 39.319  54.164  17.546 1.00 71.51  ? 506 ARG D CD    1 
ATOM   5458 N NE    . ARG D 2 11  ? 39.907  53.205  18.491 1.00 71.72  ? 506 ARG D NE    1 
ATOM   5459 C CZ    . ARG D 2 11  ? 39.998  51.887  18.290 1.00 76.50  ? 506 ARG D CZ    1 
ATOM   5460 N NH1   . ARG D 2 11  ? 39.535  51.335  17.174 1.00 81.82  ? 506 ARG D NH1   1 
ATOM   5461 N NH2   . ARG D 2 11  ? 40.559  51.111  19.213 1.00 75.26  ? 506 ARG D NH2   1 
ATOM   5462 N N     . VAL D 2 12  ? 41.528  57.659  20.708 1.00 53.53  ? 507 VAL D N     1 
ATOM   5463 C CA    . VAL D 2 12  ? 41.076  58.304  21.950 1.00 52.54  ? 507 VAL D CA    1 
ATOM   5464 C C     . VAL D 2 12  ? 41.575  59.757  22.059 1.00 51.81  ? 507 VAL D C     1 
ATOM   5465 O O     . VAL D 2 12  ? 40.829  60.659  22.453 1.00 51.76  ? 507 VAL D O     1 
ATOM   5466 C CB    . VAL D 2 12  ? 41.475  57.464  23.185 1.00 52.63  ? 507 VAL D CB    1 
ATOM   5467 C CG1   . VAL D 2 12  ? 41.219  58.219  24.495 1.00 54.60  ? 507 VAL D CG1   1 
ATOM   5468 C CG2   . VAL D 2 12  ? 40.717  56.136  23.188 1.00 54.45  ? 507 VAL D CG2   1 
ATOM   5469 N N     . GLN D 2 13  ? 42.819  59.982  21.655 1.00 51.38  ? 508 GLN D N     1 
ATOM   5470 C CA    . GLN D 2 13  ? 43.447  61.282  21.822 1.00 52.32  ? 508 GLN D CA    1 
ATOM   5471 C C     . GLN D 2 13  ? 42.934  62.344  20.833 1.00 53.26  ? 508 GLN D C     1 
ATOM   5472 O O     . GLN D 2 13  ? 43.132  63.531  21.048 1.00 54.82  ? 508 GLN D O     1 
ATOM   5473 C CB    . GLN D 2 13  ? 44.980  61.135  21.804 1.00 53.13  ? 508 GLN D CB    1 
ATOM   5474 C CG    . GLN D 2 13  ? 45.681  62.108  22.727 1.00 57.20  ? 508 GLN D CG    1 
ATOM   5475 C CD    . GLN D 2 13  ? 46.875  61.530  23.475 1.00 58.92  ? 508 GLN D CD    1 
ATOM   5476 O OE1   . GLN D 2 13  ? 46.740  60.667  24.346 1.00 58.70  ? 508 GLN D OE1   1 
ATOM   5477 N NE2   . GLN D 2 13  ? 48.048  62.050  23.170 1.00 62.98  ? 508 GLN D NE2   1 
ATOM   5478 N N     . SER D 2 14  ? 42.256  61.928  19.766 1.00 53.86  ? 509 SER D N     1 
ATOM   5479 C CA    . SER D 2 14  ? 41.676  62.894  18.824 1.00 56.03  ? 509 SER D CA    1 
ATOM   5480 C C     . SER D 2 14  ? 40.162  63.095  18.972 1.00 56.10  ? 509 SER D C     1 
ATOM   5481 O O     . SER D 2 14  ? 39.578  63.949  18.301 1.00 58.15  ? 509 SER D O     1 
ATOM   5482 C CB    . SER D 2 14  ? 42.040  62.549  17.374 1.00 58.49  ? 509 SER D CB    1 
ATOM   5483 O OG    . SER D 2 14  ? 41.775  61.185  17.104 1.00 59.55  ? 509 SER D OG    1 
ATOM   5484 N N     . SER D 2 15  ? 39.535  62.319  19.852 1.00 55.08  ? 510 SER D N     1 
ATOM   5485 C CA    . SER D 2 15  ? 38.104  62.459  20.138 1.00 56.23  ? 510 SER D CA    1 
ATOM   5486 C C     . SER D 2 15  ? 37.792  63.810  20.810 1.00 57.14  ? 510 SER D C     1 
ATOM   5487 O O     . SER D 2 15  ? 38.699  64.556  21.169 1.00 56.73  ? 510 SER D O     1 
ATOM   5488 C CB    . SER D 2 15  ? 37.616  61.289  21.006 1.00 56.01  ? 510 SER D CB    1 
ATOM   5489 O OG    . SER D 2 15  ? 38.120  61.370  22.335 1.00 54.94  ? 510 SER D OG    1 
ATOM   5490 N N     . GLY D 2 16  ? 36.506  64.115  20.968 1.00 59.26  ? 511 GLY D N     1 
ATOM   5491 C CA    . GLY D 2 16  ? 36.073  65.325  21.668 1.00 61.76  ? 511 GLY D CA    1 
ATOM   5492 C C     . GLY D 2 16  ? 35.762  66.504  20.756 1.00 63.69  ? 511 GLY D C     1 
ATOM   5493 O O     . GLY D 2 16  ? 36.065  66.477  19.554 1.00 63.70  ? 511 GLY D O     1 
ATOM   5494 N N     . ALA D 2 17  ? 35.156  67.537  21.337 1.00 65.98  ? 512 ALA D N     1 
ATOM   5495 C CA    . ALA D 2 17  ? 34.745  68.726  20.597 1.00 68.50  ? 512 ALA D CA    1 
ATOM   5496 C C     . ALA D 2 17  ? 35.741  69.125  19.500 1.00 68.53  ? 512 ALA D C     1 
ATOM   5497 O O     . ALA D 2 17  ? 36.948  69.247  19.754 1.00 68.14  ? 512 ALA D O     1 
ATOM   5498 C CB    . ALA D 2 17  ? 34.506  69.888  21.559 1.00 71.31  ? 512 ALA D CB    1 
ATOM   5499 N N     . HIS D 2 18  ? 35.236  69.295  18.279 1.00 77.25  ? 513 HIS D N     1 
ATOM   5500 C CA    . HIS D 2 18  ? 36.066  69.817  17.190 1.00 77.79  ? 513 HIS D CA    1 
ATOM   5501 C C     . HIS D 2 18  ? 35.366  70.856  16.297 1.00 77.37  ? 513 HIS D C     1 
ATOM   5502 O O     . HIS D 2 18  ? 34.178  71.144  16.478 1.00 77.54  ? 513 HIS D O     1 
ATOM   5503 C CB    . HIS D 2 18  ? 36.737  68.698  16.389 1.00 82.99  ? 513 HIS D CB    1 
ATOM   5504 C CG    . HIS D 2 18  ? 38.168  68.995  16.047 1.00 83.62  ? 513 HIS D CG    1 
ATOM   5505 N ND1   . HIS D 2 18  ? 38.853  68.334  15.049 1.00 89.51  ? 513 HIS D ND1   1 
ATOM   5506 C CD2   . HIS D 2 18  ? 39.037  69.896  16.567 1.00 79.75  ? 513 HIS D CD2   1 
ATOM   5507 C CE1   . HIS D 2 18  ? 40.085  68.807  14.978 1.00 88.98  ? 513 HIS D CE1   1 
ATOM   5508 N NE2   . HIS D 2 18  ? 40.220  69.759  15.886 1.00 83.51  ? 513 HIS D NE2   1 
ATOM   5509 N N     . ASP D 2 19  ? 36.122  71.418  15.350 1.00 77.36  ? 514 ASP D N     1 
ATOM   5510 C CA    . ASP D 2 19  ? 35.752  72.672  14.673 1.00 75.97  ? 514 ASP D CA    1 
ATOM   5511 C C     . ASP D 2 19  ? 35.649  73.766  15.737 1.00 70.63  ? 514 ASP D C     1 
ATOM   5512 O O     . ASP D 2 19  ? 34.996  74.795  15.535 1.00 70.15  ? 514 ASP D O     1 
ATOM   5513 C CB    . ASP D 2 19  ? 34.419  72.545  13.925 1.00 80.13  ? 514 ASP D CB    1 
ATOM   5514 C CG    . ASP D 2 19  ? 34.370  71.342  13.009 1.00 86.76  ? 514 ASP D CG    1 
ATOM   5515 O OD1   . ASP D 2 19  ? 35.070  71.353  11.974 1.00 89.86  ? 514 ASP D OD1   1 
ATOM   5516 O OD2   . ASP D 2 19  ? 33.615  70.395  13.323 1.00 90.12  ? 514 ASP D OD2   1 
ATOM   5517 N N     . GLN D 2 20  ? 36.283  73.509  16.879 1.00 66.98  ? 515 GLN D N     1 
ATOM   5518 C CA    . GLN D 2 20  ? 36.218  74.391  18.030 1.00 62.92  ? 515 GLN D CA    1 
ATOM   5519 C C     . GLN D 2 20  ? 37.631  74.676  18.542 1.00 61.87  ? 515 GLN D C     1 
ATOM   5520 O O     . GLN D 2 20  ? 37.822  74.993  19.716 1.00 60.06  ? 515 GLN D O     1 
ATOM   5521 C CB    . GLN D 2 20  ? 35.306  73.803  19.131 1.00 61.99  ? 515 GLN D CB    1 
ATOM   5522 C CG    . GLN D 2 20  ? 33.840  73.606  18.701 1.00 60.82  ? 515 GLN D CG    1 
ATOM   5523 C CD    . GLN D 2 20  ? 32.977  72.902  19.735 1.00 57.72  ? 515 GLN D CD    1 
ATOM   5524 O OE1   . GLN D 2 20  ? 32.913  73.303  20.894 1.00 54.19  ? 515 GLN D OE1   1 
ATOM   5525 N NE2   . GLN D 2 20  ? 32.286  71.859  19.307 1.00 59.98  ? 515 GLN D NE2   1 
ATOM   5526 N N     . ARG D 2 21  ? 38.615  74.567  17.646 1.00 63.71  ? 516 ARG D N     1 
ATOM   5527 C CA    . ARG D 2 21  ? 40.006  74.915  17.966 1.00 64.29  ? 516 ARG D CA    1 
ATOM   5528 C C     . ARG D 2 21  ? 40.637  75.832  16.928 1.00 65.98  ? 516 ARG D C     1 
ATOM   5529 O O     . ARG D 2 21  ? 40.287  75.785  15.752 1.00 67.70  ? 516 ARG D O     1 
ATOM   5530 C CB    . ARG D 2 21  ? 40.877  73.670  18.138 1.00 65.72  ? 516 ARG D CB    1 
ATOM   5531 C CG    . ARG D 2 21  ? 40.742  73.002  19.493 1.00 65.17  ? 516 ARG D CG    1 
ATOM   5532 C CD    . ARG D 2 21  ? 41.895  72.039  19.781 1.00 65.83  ? 516 ARG D CD    1 
ATOM   5533 N NE    . ARG D 2 21  ? 41.576  71.214  20.932 1.00 65.22  ? 516 ARG D NE    1 
ATOM   5534 C CZ    . ARG D 2 21  ? 41.816  71.544  22.202 1.00 64.97  ? 516 ARG D CZ    1 
ATOM   5535 N NH1   . ARG D 2 21  ? 42.414  72.691  22.511 1.00 63.97  ? 516 ARG D NH1   1 
ATOM   5536 N NH2   . ARG D 2 21  ? 41.450  70.715  23.173 1.00 64.29  ? 516 ARG D NH2   1 
ATOM   5537 N N     . GLY D 2 22  ? 41.565  76.667  17.386 1.00 66.73  ? 517 GLY D N     1 
ATOM   5538 C CA    . GLY D 2 22  ? 42.366  77.509  16.511 1.00 69.61  ? 517 GLY D CA    1 
ATOM   5539 C C     . GLY D 2 22  ? 41.632  78.696  15.920 1.00 70.54  ? 517 GLY D C     1 
ATOM   5540 O O     . GLY D 2 22  ? 40.483  78.981  16.274 1.00 68.82  ? 517 GLY D O     1 
ATOM   5541 N N     . LEU D 2 23  ? 42.319  79.388  15.011 1.00 73.82  ? 518 LEU D N     1 
ATOM   5542 C CA    . LEU D 2 23  ? 41.764  80.540  14.302 1.00 75.73  ? 518 LEU D CA    1 
ATOM   5543 C C     . LEU D 2 23  ? 40.674  80.104  13.332 1.00 77.32  ? 518 LEU D C     1 
ATOM   5544 O O     . LEU D 2 23  ? 40.693  78.983  12.818 1.00 78.69  ? 518 LEU D O     1 
ATOM   5545 C CB    . LEU D 2 23  ? 42.873  81.313  13.576 1.00 78.21  ? 518 LEU D CB    1 
ATOM   5546 C CG    . LEU D 2 23  ? 44.021  81.821  14.463 1.00 79.73  ? 518 LEU D CG    1 
ATOM   5547 C CD1   . LEU D 2 23  ? 45.199  82.325  13.633 1.00 83.34  ? 518 LEU D CD1   1 
ATOM   5548 C CD2   . LEU D 2 23  ? 43.542  82.896  15.443 1.00 79.87  ? 518 LEU D CD2   1 
ATOM   5549 N N     . LEU D 2 24  ? 39.722  81.002  13.101 1.00 78.82  ? 519 LEU D N     1 
ATOM   5550 C CA    . LEU D 2 24  ? 38.535  80.712  12.300 1.00 81.57  ? 519 LEU D CA    1 
ATOM   5551 C C     . LEU D 2 24  ? 38.869  80.258  10.879 1.00 85.75  ? 519 LEU D C     1 
ATOM   5552 O O     . LEU D 2 24  ? 39.831  80.740  10.270 1.00 87.11  ? 519 LEU D O     1 
ATOM   5553 C CB    . LEU D 2 24  ? 37.624  81.938  12.269 1.00 82.31  ? 519 LEU D CB    1 
ATOM   5554 C CG    . LEU D 2 24  ? 36.115  81.707  12.224 1.00 83.53  ? 519 LEU D CG    1 
ATOM   5555 C CD1   . LEU D 2 24  ? 35.633  81.074  13.518 1.00 81.29  ? 519 LEU D CD1   1 
ATOM   5556 C CD2   . LEU D 2 24  ? 35.398  83.028  11.967 1.00 85.50  ? 519 LEU D CD2   1 
ATOM   5557 N N     . ARG D 2 25  ? 38.072  79.318  10.372 1.00 94.40  ? 520 ARG D N     1 
ATOM   5558 C CA    . ARG D 2 25  ? 38.271  78.743  9.040  1.00 94.81  ? 520 ARG D CA    1 
ATOM   5559 C C     . ARG D 2 25  ? 36.972  78.672  8.238  1.00 93.80  ? 520 ARG D C     1 
ATOM   5560 O O     . ARG D 2 25  ? 35.884  78.502  8.801  1.00 92.88  ? 520 ARG D O     1 
ATOM   5561 C CB    . ARG D 2 25  ? 38.918  77.352  9.130  1.00 96.15  ? 520 ARG D CB    1 
ATOM   5562 C CG    . ARG D 2 25  ? 40.421  77.393  9.374  1.00 98.93  ? 520 ARG D CG    1 
ATOM   5563 C CD    . ARG D 2 25  ? 41.038  76.009  9.497  1.00 101.72 ? 520 ARG D CD    1 
ATOM   5564 N NE    . ARG D 2 25  ? 42.477  76.104  9.758  1.00 105.16 ? 520 ARG D NE    1 
ATOM   5565 C CZ    . ARG D 2 25  ? 43.296  75.066  9.933  1.00 108.46 ? 520 ARG D CZ    1 
ATOM   5566 N NH1   . ARG D 2 25  ? 42.836  73.822  9.877  1.00 109.61 ? 520 ARG D NH1   1 
ATOM   5567 N NH2   . ARG D 2 25  ? 44.587  75.275  10.166 1.00 110.97 ? 520 ARG D NH2   1 
ATOM   5568 N N     . LYS D 2 26  ? 37.113  78.803  6.919  1.00 94.91  ? 521 LYS D N     1 
ATOM   5569 C CA    . LYS D 2 26  ? 36.011  78.698  5.954  1.00 95.09  ? 521 LYS D CA    1 
ATOM   5570 C C     . LYS D 2 26  ? 35.153  77.441  6.133  1.00 95.23  ? 521 LYS D C     1 
ATOM   5571 O O     . LYS D 2 26  ? 33.955  77.450  5.833  1.00 94.56  ? 521 LYS D O     1 
ATOM   5572 C CB    . LYS D 2 26  ? 36.573  78.741  4.530  1.00 97.01  ? 521 LYS D CB    1 
ATOM   5573 C CG    . LYS D 2 26  ? 37.890  77.981  4.371  1.00 98.99  ? 521 LYS D CG    1 
ATOM   5574 C CD    . LYS D 2 26  ? 38.322  77.873  2.922  1.00 101.84 ? 521 LYS D CD    1 
ATOM   5575 C CE    . LYS D 2 26  ? 39.628  77.108  2.817  1.00 104.06 ? 521 LYS D CE    1 
ATOM   5576 N NZ    . LYS D 2 26  ? 39.952  76.781  1.407  1.00 108.11 ? 521 LYS D NZ    1 
ATOM   5577 N N     . GLU D 2 27  ? 35.779  76.367  6.615  1.00 97.01  ? 522 GLU D N     1 
ATOM   5578 C CA    . GLU D 2 27  ? 35.100  75.094  6.867  1.00 98.24  ? 522 GLU D CA    1 
ATOM   5579 C C     . GLU D 2 27  ? 34.154  75.179  8.067  1.00 97.54  ? 522 GLU D C     1 
ATOM   5580 O O     . GLU D 2 27  ? 33.055  74.611  8.041  1.00 97.44  ? 522 GLU D O     1 
ATOM   5581 C CB    . GLU D 2 27  ? 36.126  73.976  7.072  1.00 100.63 ? 522 GLU D CB    1 
ATOM   5582 C CG    . GLU D 2 27  ? 36.905  73.607  5.810  1.00 103.24 ? 522 GLU D CG    1 
ATOM   5583 C CD    . GLU D 2 27  ? 38.246  72.951  6.104  1.00 106.11 ? 522 GLU D CD    1 
ATOM   5584 O OE1   . GLU D 2 27  ? 38.325  72.130  7.044  1.00 107.40 ? 522 GLU D OE1   1 
ATOM   5585 O OE2   . GLU D 2 27  ? 39.223  73.258  5.387  1.00 107.64 ? 522 GLU D OE2   1 
ATOM   5586 N N     . ASP D 2 28  ? 34.586  75.897  9.107  1.00 97.89  ? 523 ASP D N     1 
ATOM   5587 C CA    . ASP D 2 28  ? 33.757  76.148  10.292 1.00 98.29  ? 523 ASP D CA    1 
ATOM   5588 C C     . ASP D 2 28  ? 32.471  76.894  9.934  1.00 96.87  ? 523 ASP D C     1 
ATOM   5589 O O     . ASP D 2 28  ? 31.442  76.714  10.589 1.00 97.05  ? 523 ASP D O     1 
ATOM   5590 C CB    . ASP D 2 28  ? 34.526  76.968  11.343 1.00 99.55  ? 523 ASP D CB    1 
ATOM   5591 C CG    . ASP D 2 28  ? 35.727  76.227  11.924 1.00 102.02 ? 523 ASP D CG    1 
ATOM   5592 O OD1   . ASP D 2 28  ? 35.648  74.994  12.118 1.00 103.46 ? 523 ASP D OD1   1 
ATOM   5593 O OD2   . ASP D 2 28  ? 36.749  76.894  12.204 1.00 102.69 ? 523 ASP D OD2   1 
ATOM   5594 N N     . LEU D 2 29  ? 32.541  77.714  8.884  1.00 96.19  ? 524 LEU D N     1 
ATOM   5595 C CA    . LEU D 2 29  ? 31.488  78.671  8.551  1.00 95.59  ? 524 LEU D CA    1 
ATOM   5596 C C     . LEU D 2 29  ? 30.442  78.172  7.546  1.00 95.47  ? 524 LEU D C     1 
ATOM   5597 O O     . LEU D 2 29  ? 29.638  78.962  7.049  1.00 95.32  ? 524 LEU D O     1 
ATOM   5598 C CB    . LEU D 2 29  ? 32.113  79.984  8.060  1.00 95.83  ? 524 LEU D CB    1 
ATOM   5599 C CG    . LEU D 2 29  ? 33.147  80.641  8.979  1.00 96.89  ? 524 LEU D CG    1 
ATOM   5600 C CD1   . LEU D 2 29  ? 33.884  81.748  8.252  1.00 97.89  ? 524 LEU D CD1   1 
ATOM   5601 C CD2   . LEU D 2 29  ? 32.510  81.165  10.259 1.00 97.55  ? 524 LEU D CD2   1 
ATOM   5602 N N     . VAL D 2 30  ? 30.445  76.871  7.260  1.00 96.36  ? 525 VAL D N     1 
ATOM   5603 C CA    . VAL D 2 30  ? 29.442  76.274  6.370  1.00 97.14  ? 525 VAL D CA    1 
ATOM   5604 C C     . VAL D 2 30  ? 28.052  76.373  7.010  1.00 96.67  ? 525 VAL D C     1 
ATOM   5605 O O     . VAL D 2 30  ? 27.805  75.806  8.078  1.00 97.06  ? 525 VAL D O     1 
ATOM   5606 C CB    . VAL D 2 30  ? 29.790  74.802  5.988  1.00 98.93  ? 525 VAL D CB    1 
ATOM   5607 C CG1   . VAL D 2 30  ? 28.674  74.166  5.165  1.00 100.42 ? 525 VAL D CG1   1 
ATOM   5608 C CG2   . VAL D 2 30  ? 31.106  74.740  5.218  1.00 100.17 ? 525 VAL D CG2   1 
ATOM   5609 N N     . LEU D 2 31  ? 27.161  77.107  6.347  1.00 96.60  ? 526 LEU D N     1 
ATOM   5610 C CA    . LEU D 2 31  ? 25.833  77.413  6.872  1.00 96.54  ? 526 LEU D CA    1 
ATOM   5611 C C     . LEU D 2 31  ? 24.977  76.150  7.014  1.00 97.59  ? 526 LEU D C     1 
ATOM   5612 O O     . LEU D 2 31  ? 24.962  75.314  6.110  1.00 98.80  ? 526 LEU D O     1 
ATOM   5613 C CB    . LEU D 2 31  ? 25.142  78.444  5.971  1.00 96.92  ? 526 LEU D CB    1 
ATOM   5614 C CG    . LEU D 2 31  ? 24.132  79.406  6.607  1.00 96.88  ? 526 LEU D CG    1 
ATOM   5615 C CD1   . LEU D 2 31  ? 24.299  80.806  6.031  1.00 97.69  ? 526 LEU D CD1   1 
ATOM   5616 C CD2   . LEU D 2 31  ? 22.690  78.913  6.461  1.00 97.31  ? 526 LEU D CD2   1 
ATOM   5617 N N     . PRO D 2 32  ? 24.269  76.005  8.156  1.00 97.94  ? 527 PRO D N     1 
ATOM   5618 C CA    . PRO D 2 32  ? 23.444  74.818  8.427  1.00 99.59  ? 527 PRO D CA    1 
ATOM   5619 C C     . PRO D 2 32  ? 22.198  74.742  7.541  1.00 100.52 ? 527 PRO D C     1 
ATOM   5620 O O     . PRO D 2 32  ? 22.014  75.586  6.662  1.00 100.20 ? 527 PRO D O     1 
ATOM   5621 C CB    . PRO D 2 32  ? 23.030  74.998  9.898  1.00 100.07 ? 527 PRO D CB    1 
ATOM   5622 C CG    . PRO D 2 32  ? 23.893  76.086  10.437 1.00 99.16  ? 527 PRO D CG    1 
ATOM   5623 C CD    . PRO D 2 32  ? 24.226  76.957  9.279  1.00 97.63  ? 527 PRO D CD    1 
ATOM   5624 N N     . GLU D 2 33  ? 21.356  73.735  7.777  1.00 102.47 ? 528 GLU D N     1 
ATOM   5625 C CA    . GLU D 2 33  ? 20.087  73.597  7.064  1.00 103.89 ? 528 GLU D CA    1 
ATOM   5626 C C     . GLU D 2 33  ? 18.991  74.452  7.714  1.00 103.60 ? 528 GLU D C     1 
ATOM   5627 O O     . GLU D 2 33  ? 18.091  73.944  8.396  1.00 104.90 ? 528 GLU D O     1 
ATOM   5628 C CB    . GLU D 2 33  ? 19.674  72.125  6.944  1.00 106.72 ? 528 GLU D CB    1 
ATOM   5629 C CG    . GLU D 2 33  ? 20.607  71.289  6.064  1.00 108.54 ? 528 GLU D CG    1 
ATOM   5630 C CD    . GLU D 2 33  ? 19.887  70.178  5.304  1.00 113.02 ? 528 GLU D CD    1 
ATOM   5631 O OE1   . GLU D 2 33  ? 20.492  69.100  5.108  1.00 115.72 ? 528 GLU D OE1   1 
ATOM   5632 O OE2   . GLU D 2 33  ? 18.722  70.380  4.893  1.00 113.90 ? 528 GLU D OE2   1 
ATOM   5633 N N     . PHE D 2 34  ? 19.102  75.763  7.495  1.00 102.44 ? 529 PHE D N     1 
ATOM   5634 C CA    . PHE D 2 34  ? 18.133  76.756  7.959  1.00 102.76 ? 529 PHE D CA    1 
ATOM   5635 C C     . PHE D 2 34  ? 17.938  77.848  6.909  1.00 102.72 ? 529 PHE D C     1 
ATOM   5636 O O     . PHE D 2 34  ? 18.907  78.371  6.355  1.00 101.81 ? 529 PHE D O     1 
ATOM   5637 C CB    . PHE D 2 34  ? 18.587  77.388  9.276  1.00 102.39 ? 529 PHE D CB    1 
ATOM   5638 C CG    . PHE D 2 34  ? 18.373  76.512  10.485 1.00 104.40 ? 529 PHE D CG    1 
ATOM   5639 C CD1   . PHE D 2 34  ? 17.088  76.287  10.982 1.00 106.59 ? 529 PHE D CD1   1 
ATOM   5640 C CD2   . PHE D 2 34  ? 19.458  75.930  11.141 1.00 104.58 ? 529 PHE D CD2   1 
ATOM   5641 C CE1   . PHE D 2 34  ? 16.888  75.486  12.105 1.00 108.80 ? 529 PHE D CE1   1 
ATOM   5642 C CE2   . PHE D 2 34  ? 19.268  75.131  12.262 1.00 106.77 ? 529 PHE D CE2   1 
ATOM   5643 C CZ    . PHE D 2 34  ? 17.979  74.909  12.746 1.00 109.11 ? 529 PHE D CZ    1 
HETATM 5644 P PB    . GDP E 3 .   ? 16.326  32.795  20.904 1.00 45.31  ? 401 GDP A PB    1 
HETATM 5645 O O1B   . GDP E 3 .   ? 15.325  31.694  21.080 1.00 44.87  ? 401 GDP A O1B   1 
HETATM 5646 O O2B   . GDP E 3 .   ? 16.585  33.501  22.212 1.00 44.60  ? 401 GDP A O2B   1 
HETATM 5647 O O3B   . GDP E 3 .   ? 17.634  32.239  20.384 1.00 44.38  ? 401 GDP A O3B   1 
HETATM 5648 O O3A   . GDP E 3 .   ? 15.756  33.883  19.861 1.00 45.53  ? 401 GDP A O3A   1 
HETATM 5649 P PA    . GDP E 3 .   ? 14.183  34.072  19.646 1.00 45.69  ? 401 GDP A PA    1 
HETATM 5650 O O1A   . GDP E 3 .   ? 13.441  33.989  20.948 1.00 49.27  ? 401 GDP A O1A   1 
HETATM 5651 O O2A   . GDP E 3 .   ? 13.632  33.050  18.697 1.00 49.78  ? 401 GDP A O2A   1 
HETATM 5652 O "O5'" . GDP E 3 .   ? 14.063  35.539  19.002 1.00 46.30  ? 401 GDP A "O5'" 1 
HETATM 5653 C "C5'" . GDP E 3 .   ? 14.431  36.714  19.716 1.00 45.00  ? 401 GDP A "C5'" 1 
HETATM 5654 C "C4'" . GDP E 3 .   ? 13.516  37.893  19.376 1.00 43.99  ? 401 GDP A "C4'" 1 
HETATM 5655 O "O4'" . GDP E 3 .   ? 13.851  38.381  18.088 1.00 44.00  ? 401 GDP A "O4'" 1 
HETATM 5656 C "C3'" . GDP E 3 .   ? 12.029  37.579  19.313 1.00 45.36  ? 401 GDP A "C3'" 1 
HETATM 5657 O "O3'" . GDP E 3 .   ? 11.342  38.759  19.778 1.00 44.96  ? 401 GDP A "O3'" 1 
HETATM 5658 C "C2'" . GDP E 3 .   ? 11.742  37.326  17.832 1.00 45.41  ? 401 GDP A "C2'" 1 
HETATM 5659 O "O2'" . GDP E 3 .   ? 10.430  37.745  17.427 1.00 46.88  ? 401 GDP A "O2'" 1 
HETATM 5660 C "C1'" . GDP E 3 .   ? 12.757  38.218  17.171 1.00 43.85  ? 401 GDP A "C1'" 1 
HETATM 5661 N N9    . GDP E 3 .   ? 13.351  37.716  15.914 1.00 44.24  ? 401 GDP A N9    1 
HETATM 5662 C C8    . GDP E 3 .   ? 13.985  36.545  15.704 1.00 44.68  ? 401 GDP A C8    1 
HETATM 5663 N N7    . GDP E 3 .   ? 14.454  36.476  14.426 1.00 45.71  ? 401 GDP A N7    1 
HETATM 5664 C C5    . GDP E 3 .   ? 14.119  37.641  13.816 1.00 44.70  ? 401 GDP A C5    1 
HETATM 5665 C C6    . GDP E 3 .   ? 14.296  38.238  12.476 1.00 45.55  ? 401 GDP A C6    1 
HETATM 5666 O O6    . GDP E 3 .   ? 14.906  37.613  11.572 1.00 48.93  ? 401 GDP A O6    1 
HETATM 5667 N N1    . GDP E 3 .   ? 13.819  39.475  12.268 1.00 45.02  ? 401 GDP A N1    1 
HETATM 5668 C C2    . GDP E 3 .   ? 13.171  40.180  13.217 1.00 42.62  ? 401 GDP A C2    1 
HETATM 5669 N N2    . GDP E 3 .   ? 12.702  41.407  12.904 1.00 41.93  ? 401 GDP A N2    1 
HETATM 5670 N N3    . GDP E 3 .   ? 12.969  39.698  14.463 1.00 40.95  ? 401 GDP A N3    1 
HETATM 5671 C C4    . GDP E 3 .   ? 13.420  38.462  14.808 1.00 43.26  ? 401 GDP A C4    1 
HETATM 5672 S S     . SO4 F 4 .   ? 28.970  55.245  3.931  1.00 121.14 ? 3   SO4 A S     1 
HETATM 5673 O O1    . SO4 F 4 .   ? 29.162  54.357  2.785  1.00 120.68 ? 3   SO4 A O1    1 
HETATM 5674 O O2    . SO4 F 4 .   ? 27.557  55.608  4.036  1.00 121.08 ? 3   SO4 A O2    1 
HETATM 5675 O O3    . SO4 F 4 .   ? 29.384  54.571  5.156  1.00 120.79 ? 3   SO4 A O3    1 
HETATM 5676 O O4    . SO4 F 4 .   ? 29.777  56.453  3.757  1.00 121.06 ? 3   SO4 A O4    1 
HETATM 5677 P PB    . GDP G 3 .   ? 43.190  68.506  25.708 1.00 46.77  ? 401 GDP B PB    1 
HETATM 5678 O O1B   . GDP G 3 .   ? 44.483  69.217  25.427 1.00 47.82  ? 401 GDP B O1B   1 
HETATM 5679 O O2B   . GDP G 3 .   ? 42.431  68.359  24.430 1.00 46.38  ? 401 GDP B O2B   1 
HETATM 5680 O O3B   . GDP G 3 .   ? 43.472  67.149  26.313 1.00 47.99  ? 401 GDP B O3B   1 
HETATM 5681 O O3A   . GDP G 3 .   ? 42.298  69.306  26.779 1.00 45.85  ? 401 GDP B O3A   1 
HETATM 5682 P PA    . GDP G 3 .   ? 42.316  70.910  26.933 1.00 43.89  ? 401 GDP B PA    1 
HETATM 5683 O O1A   . GDP G 3 .   ? 42.376  71.589  25.619 1.00 46.69  ? 401 GDP B O1A   1 
HETATM 5684 O O2A   . GDP G 3 .   ? 43.463  71.326  27.834 1.00 47.11  ? 401 GDP B O2A   1 
HETATM 5685 O "O5'" . GDP G 3 .   ? 40.909  71.210  27.656 1.00 47.77  ? 401 GDP B "O5'" 1 
HETATM 5686 C "C5'" . GDP G 3 .   ? 39.663  71.034  26.985 1.00 45.88  ? 401 GDP B "C5'" 1 
HETATM 5687 C "C4'" . GDP G 3 .   ? 38.692  72.116  27.425 1.00 46.07  ? 401 GDP B "C4'" 1 
HETATM 5688 O "O4'" . GDP G 3 .   ? 38.351  71.900  28.785 1.00 45.40  ? 401 GDP B "O4'" 1 
HETATM 5689 C "C3'" . GDP G 3 .   ? 39.313  73.502  27.346 1.00 47.17  ? 401 GDP B "C3'" 1 
HETATM 5690 O "O3'" . GDP G 3 .   ? 38.281  74.395  26.916 1.00 49.22  ? 401 GDP B "O3'" 1 
HETATM 5691 C "C2'" . GDP G 3 .   ? 39.718  73.851  28.765 1.00 46.75  ? 401 GDP B "C2'" 1 
HETATM 5692 O "O2'" . GDP G 3 .   ? 39.502  75.239  29.002 1.00 49.25  ? 401 GDP B "O2'" 1 
HETATM 5693 C "C1'" . GDP G 3 .   ? 38.726  73.031  29.568 1.00 45.49  ? 401 GDP B "C1'" 1 
HETATM 5694 N N9    . GDP G 3 .   ? 39.212  72.441  30.815 1.00 43.45  ? 401 GDP B N9    1 
HETATM 5695 C C8    . GDP G 3 .   ? 40.297  71.657  31.002 1.00 42.79  ? 401 GDP B C8    1 
HETATM 5696 N N7    . GDP G 3 .   ? 40.356  71.258  32.299 1.00 42.70  ? 401 GDP B N7    1 
HETATM 5697 C C5    . GDP G 3 .   ? 39.303  71.798  32.939 1.00 41.47  ? 401 GDP B C5    1 
HETATM 5698 C C6    . GDP G 3 .   ? 38.781  71.800  34.304 1.00 45.51  ? 401 GDP B C6    1 
HETATM 5699 O O6    . GDP G 3 .   ? 39.357  71.151  35.206 1.00 49.88  ? 401 GDP B O6    1 
HETATM 5700 N N1    . GDP G 3 .   ? 37.642  72.482  34.539 1.00 47.33  ? 401 GDP B N1    1 
HETATM 5701 C C2    . GDP G 3 .   ? 36.994  73.179  33.583 1.00 44.16  ? 401 GDP B C2    1 
HETATM 5702 N N2    . GDP G 3 .   ? 35.863  73.840  33.912 1.00 47.10  ? 401 GDP B N2    1 
HETATM 5703 N N3    . GDP G 3 .   ? 37.419  73.222  32.303 1.00 41.16  ? 401 GDP B N3    1 
HETATM 5704 C C4    . GDP G 3 .   ? 38.542  72.561  31.948 1.00 41.86  ? 401 GDP B C4    1 
HETATM 5705 S S     . SO4 H 4 .   ? 37.375  79.921  35.157 1.00 85.23  ? 1   SO4 B S     1 
HETATM 5706 O O1    . SO4 H 4 .   ? 38.275  79.733  34.022 1.00 84.16  ? 1   SO4 B O1    1 
HETATM 5707 O O2    . SO4 H 4 .   ? 36.117  79.210  34.931 1.00 85.46  ? 1   SO4 B O2    1 
HETATM 5708 O O3    . SO4 H 4 .   ? 38.027  79.419  36.364 1.00 86.55  ? 1   SO4 B O3    1 
HETATM 5709 O O4    . SO4 H 4 .   ? 37.066  81.335  35.361 1.00 85.82  ? 1   SO4 B O4    1 
HETATM 5710 S S     . SO4 I 4 .   ? 34.244  61.502  19.572 1.00 100.08 ? 2   SO4 B S     1 
HETATM 5711 O O1    . SO4 I 4 .   ? 35.343  61.354  18.618 1.00 100.01 ? 2   SO4 B O1    1 
HETATM 5712 O O2    . SO4 I 4 .   ? 32.969  61.418  18.859 1.00 100.02 ? 2   SO4 B O2    1 
HETATM 5713 O O3    . SO4 I 4 .   ? 34.322  60.438  20.578 1.00 100.48 ? 2   SO4 B O3    1 
HETATM 5714 O O4    . SO4 I 4 .   ? 34.337  62.798  20.239 1.00 99.88  ? 2   SO4 B O4    1 
HETATM 5715 O O     . HOH J 5 .   ? 24.762  33.898  18.010 1.00 31.88  ? 2   HOH A O     1 
HETATM 5716 O O     . HOH J 5 .   ? 28.306  43.178  18.645 1.00 31.17  ? 4   HOH A O     1 
HETATM 5717 O O     . HOH J 5 .   ? 18.686  46.414  22.476 1.00 38.09  ? 5   HOH A O     1 
HETATM 5718 O O     . HOH J 5 .   ? 18.647  47.165  19.587 1.00 44.72  ? 7   HOH A O     1 
HETATM 5719 O O     . HOH J 5 .   ? 19.548  39.797  19.010 1.00 40.91  ? 9   HOH A O     1 
HETATM 5720 O O     . HOH J 5 .   ? 21.026  33.418  1.752  1.00 36.48  ? 10  HOH A O     1 
HETATM 5721 O O     . HOH J 5 .   ? 28.255  44.020  22.173 1.00 39.66  ? 14  HOH A O     1 
HETATM 5722 O O     . HOH J 5 .   ? 19.886  52.273  18.663 1.00 39.01  ? 18  HOH A O     1 
HETATM 5723 O O     . HOH J 5 .   ? -6.420  46.008  31.143 1.00 56.76  ? 22  HOH A O     1 
HETATM 5724 O O     . HOH J 5 .   ? 12.735  63.511  25.495 1.00 61.38  ? 25  HOH A O     1 
HETATM 5725 O O     . HOH J 5 .   ? 14.911  50.380  18.322 1.00 49.40  ? 26  HOH A O     1 
HETATM 5726 O O     . HOH J 5 .   ? 15.393  40.430  20.555 1.00 39.78  ? 355 HOH A O     1 
HETATM 5727 O O     . HOH J 5 .   ? 29.041  45.732  19.066 1.00 35.05  ? 356 HOH A O     1 
HETATM 5728 O O     . HOH J 5 .   ? 20.394  43.798  18.679 1.00 42.80  ? 357 HOH A O     1 
HETATM 5729 O O     . HOH J 5 .   ? 15.338  48.730  30.295 1.00 43.90  ? 358 HOH A O     1 
HETATM 5730 O O     . HOH J 5 .   ? 35.154  42.779  20.164 1.00 37.99  ? 359 HOH A O     1 
HETATM 5731 O O     . HOH J 5 .   ? 17.539  33.697  2.266  1.00 52.76  ? 360 HOH A O     1 
HETATM 5732 O O     . HOH J 5 .   ? 21.502  37.639  19.659 1.00 41.02  ? 361 HOH A O     1 
HETATM 5733 O O     . HOH J 5 .   ? 17.714  41.527  20.650 1.00 40.01  ? 362 HOH A O     1 
HETATM 5734 O O     . HOH J 5 .   ? 8.946   51.337  14.979 1.00 56.64  ? 363 HOH A O     1 
HETATM 5735 O O     . HOH J 5 .   ? 37.209  40.891  13.687 1.00 43.90  ? 364 HOH A O     1 
HETATM 5736 O O     . HOH J 5 .   ? 11.257  50.564  14.360 1.00 59.33  ? 365 HOH A O     1 
HETATM 5737 O O     . HOH J 5 .   ? 20.889  35.756  0.407  1.00 48.48  ? 366 HOH A O     1 
HETATM 5738 O O     . HOH J 5 .   ? 37.184  46.163  4.649  1.00 51.36  ? 367 HOH A O     1 
HETATM 5739 O O     . HOH J 5 .   ? 3.888   45.866  13.864 1.00 58.94  ? 368 HOH A O     1 
HETATM 5740 O O     . HOH J 5 .   ? 32.425  43.556  2.156  1.00 48.52  ? 369 HOH A O     1 
HETATM 5741 O O     . HOH J 5 .   ? 37.710  24.098  17.929 1.00 59.83  ? 370 HOH A O     1 
HETATM 5742 O O     . HOH J 5 .   ? 20.731  51.111  16.362 1.00 51.40  ? 371 HOH A O     1 
HETATM 5743 O O     . HOH J 5 .   ? 31.068  51.453  8.539  1.00 56.91  ? 372 HOH A O     1 
HETATM 5744 O O     . HOH J 5 .   ? 32.741  54.674  10.345 1.00 51.97  ? 373 HOH A O     1 
HETATM 5745 O O     . HOH J 5 .   ? 36.084  36.689  17.992 1.00 52.09  ? 374 HOH A O     1 
HETATM 5746 O O     . HOH J 5 .   ? 29.514  20.954  7.242  1.00 61.45  ? 375 HOH A O     1 
HETATM 5747 O O     . HOH J 5 .   ? 22.918  55.796  20.781 1.00 58.50  ? 376 HOH A O     1 
HETATM 5748 O O     . HOH J 5 .   ? 14.211  50.947  37.001 1.00 64.94  ? 377 HOH A O     1 
HETATM 5749 O O     . HOH J 5 .   ? 14.680  53.220  35.585 1.00 50.12  ? 378 HOH A O     1 
HETATM 5750 O O     . HOH J 5 .   ? 33.884  41.336  2.084  1.00 44.86  ? 379 HOH A O     1 
HETATM 5751 O O     . HOH J 5 .   ? 34.113  47.787  31.974 1.00 58.66  ? 380 HOH A O     1 
HETATM 5752 O O     . HOH J 5 .   ? 38.459  33.087  16.775 1.00 53.64  ? 381 HOH A O     1 
HETATM 5753 O O     . HOH J 5 .   ? 6.895   40.282  11.572 1.00 58.70  ? 382 HOH A O     1 
HETATM 5754 O O     . HOH J 5 .   ? 19.493  31.227  1.097  1.00 51.30  ? 383 HOH A O     1 
HETATM 5755 O O     . HOH J 5 .   ? 24.375  54.218  27.192 1.00 49.69  ? 384 HOH A O     1 
HETATM 5756 O O     . HOH J 5 .   ? 11.780  46.038  18.767 1.00 52.94  ? 385 HOH A O     1 
HETATM 5757 O O     . HOH J 5 .   ? 9.502   35.464  19.845 1.00 54.55  ? 386 HOH A O     1 
HETATM 5758 O O     . HOH J 5 .   ? 14.432  61.230  33.128 1.00 65.03  ? 387 HOH A O     1 
HETATM 5759 O O     . HOH J 5 .   ? 16.694  42.301  4.335  1.00 56.23  ? 388 HOH A O     1 
HETATM 5760 O O     . HOH J 5 .   ? -1.601  65.430  26.590 1.00 60.69  ? 389 HOH A O     1 
HETATM 5761 O O     . HOH J 5 .   ? 23.617  36.458  17.786 1.00 45.88  ? 390 HOH A O     1 
HETATM 5762 O O     . HOH J 5 .   ? 7.781   16.229  2.249  1.00 67.18  ? 391 HOH A O     1 
HETATM 5763 O O     . HOH J 5 .   ? 16.547  47.957  12.873 1.00 52.90  ? 392 HOH A O     1 
HETATM 5764 O O     . HOH J 5 .   ? 10.221  64.217  31.769 1.00 68.40  ? 393 HOH A O     1 
HETATM 5765 O O     . HOH J 5 .   ? 32.958  14.744  30.457 1.00 67.07  ? 394 HOH A O     1 
HETATM 5766 O O     . HOH J 5 .   ? 37.227  29.896  19.679 1.00 63.54  ? 395 HOH A O     1 
HETATM 5767 O O     . HOH K 5 .   ? 24.605  54.237  16.128 1.00 44.69  ? 6   HOH B O     1 
HETATM 5768 O O     . HOH K 5 .   ? 38.737  62.059  29.302 1.00 36.17  ? 8   HOH B O     1 
HETATM 5769 O O     . HOH K 5 .   ? 22.195  59.297  28.111 1.00 52.12  ? 11  HOH B O     1 
HETATM 5770 O O     . HOH K 5 .   ? 37.992  64.164  27.777 1.00 46.90  ? 13  HOH B O     1 
HETATM 5771 O O     . HOH K 5 .   ? 28.655  68.902  28.289 1.00 39.39  ? 16  HOH B O     1 
HETATM 5772 O O     . HOH K 5 .   ? 31.270  58.895  29.017 1.00 30.70  ? 17  HOH B O     1 
HETATM 5773 O O     . HOH K 5 .   ? 53.656  53.905  39.044 1.00 51.47  ? 19  HOH B O     1 
HETATM 5774 O O     . HOH K 5 .   ? 28.504  58.629  29.094 1.00 39.19  ? 20  HOH B O     1 
HETATM 5775 O O     . HOH K 5 .   ? 31.996  68.385  48.706 1.00 53.35  ? 21  HOH B O     1 
HETATM 5776 O O     . HOH K 5 .   ? 46.441  68.188  23.993 1.00 47.22  ? 23  HOH B O     1 
HETATM 5777 O O     . HOH K 5 .   ? 28.866  66.157  48.587 1.00 43.04  ? 24  HOH B O     1 
HETATM 5778 O O     . HOH K 5 .   ? 41.128  60.390  29.111 1.00 31.13  ? 355 HOH B O     1 
HETATM 5779 O O     . HOH K 5 .   ? 35.826  66.897  28.267 1.00 42.58  ? 356 HOH B O     1 
HETATM 5780 O O     . HOH K 5 .   ? 34.308  75.241  32.044 1.00 42.87  ? 357 HOH B O     1 
HETATM 5781 O O     . HOH K 5 .   ? 29.317  68.400  25.163 1.00 36.93  ? 358 HOH B O     1 
HETATM 5782 O O     . HOH K 5 .   ? 35.911  70.582  26.400 1.00 40.16  ? 359 HOH B O     1 
HETATM 5783 O O     . HOH K 5 .   ? 27.831  50.092  42.782 1.00 54.69  ? 360 HOH B O     1 
HETATM 5784 O O     . HOH K 5 .   ? 34.518  68.293  26.663 1.00 34.93  ? 361 HOH B O     1 
HETATM 5785 O O     . HOH K 5 .   ? 32.884  77.382  29.727 1.00 55.97  ? 362 HOH B O     1 
HETATM 5786 O O     . HOH K 5 .   ? 30.404  58.979  25.714 1.00 46.19  ? 363 HOH B O     1 
HETATM 5787 O O     . HOH K 5 .   ? 46.209  65.366  45.280 1.00 53.94  ? 364 HOH B O     1 
HETATM 5788 O O     . HOH K 5 .   ? 39.049  77.096  36.823 1.00 62.85  ? 365 HOH B O     1 
HETATM 5789 O O     . HOH K 5 .   ? 30.743  75.888  28.631 1.00 45.11  ? 366 HOH B O     1 
HETATM 5790 O O     . HOH K 5 .   ? 30.157  52.394  27.727 1.00 39.53  ? 367 HOH B O     1 
HETATM 5791 O O     . HOH K 5 .   ? 43.950  64.847  44.706 1.00 49.92  ? 368 HOH B O     1 
HETATM 5792 O O     . HOH K 5 .   ? 24.847  56.547  19.574 1.00 53.98  ? 369 HOH B O     1 
HETATM 5793 O O     . HOH K 5 .   ? 28.081  67.671  44.538 1.00 51.54  ? 370 HOH B O     1 
HETATM 5794 O O     . HOH K 5 .   ? 43.969  53.912  45.648 1.00 59.80  ? 371 HOH B O     1 
HETATM 5795 O O     . HOH K 5 .   ? 32.157  68.470  27.397 1.00 50.11  ? 372 HOH B O     1 
HETATM 5796 O O     . HOH K 5 .   ? 27.697  63.976  23.433 1.00 50.02  ? 373 HOH B O     1 
HETATM 5797 O O     . HOH K 5 .   ? 55.693  52.667  40.005 1.00 69.49  ? 374 HOH B O     1 
HETATM 5798 O O     . HOH K 5 .   ? 43.343  72.913  45.598 1.00 70.11  ? 375 HOH B O     1 
HETATM 5799 O O     . HOH K 5 .   ? 21.264  60.343  44.668 1.00 72.25  ? 376 HOH B O     1 
HETATM 5800 O O     . HOH K 5 .   ? 40.297  79.442  38.554 1.00 82.46  ? 377 HOH B O     1 
HETATM 5801 O O     . HOH K 5 .   ? 64.427  74.780  41.576 1.00 75.22  ? 378 HOH B O     1 
HETATM 5802 O O     . HOH K 5 .   ? 36.986  48.669  36.160 1.00 46.06  ? 379 HOH B O     1 
HETATM 5803 O O     . HOH K 5 .   ? 59.041  51.160  31.235 1.00 51.31  ? 380 HOH B O     1 
HETATM 5804 O O     . HOH K 5 .   ? 34.755  64.441  25.449 1.00 51.34  ? 381 HOH B O     1 
HETATM 5805 O O     . HOH K 5 .   ? 32.087  57.205  22.766 1.00 47.34  ? 382 HOH B O     1 
HETATM 5806 O O     . HOH K 5 .   ? 49.478  55.908  12.677 1.00 66.54  ? 383 HOH B O     1 
HETATM 5807 O O     . HOH L 5 .   ? 19.531  30.990  24.122 1.00 48.03  ? 12  HOH C O     1 
HETATM 5808 O O     . HOH L 5 .   ? 4.614   37.182  40.290 1.00 77.16  ? 97  HOH C O     1 
HETATM 5809 O O     . HOH M 5 .   ? 49.571  63.611  24.512 1.00 52.30  ? 88  HOH D O     1 
HETATM 5810 O O     . HOH M 5 .   ? 34.171  67.098  24.178 1.00 69.69  ? 89  HOH D O     1 
HETATM 5811 O O     . HOH M 5 .   ? 35.887  65.340  17.045 1.00 68.66  ? 131 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ARG A 6   ? 1.3232 0.7398 1.1654 -0.0031 -0.1485 -0.0998 32  ARG A N     
2    C CA    . ARG A 6   ? 1.3071 0.7446 1.1849 -0.0257 -0.1514 -0.0993 32  ARG A CA    
3    C C     . ARG A 6   ? 1.2686 0.7399 1.1752 -0.0359 -0.1347 -0.0898 32  ARG A C     
4    O O     . ARG A 6   ? 1.2432 0.7473 1.1822 -0.0458 -0.1322 -0.0895 32  ARG A O     
5    C CB    . ARG A 6   ? 1.3485 0.7520 1.2233 -0.0433 -0.1640 -0.1017 32  ARG A CB    
6    C CG    . ARG A 6   ? 1.3462 0.7700 1.2606 -0.0660 -0.1697 -0.1029 32  ARG A CG    
7    C CD    . ARG A 6   ? 1.3942 0.7905 1.3128 -0.0877 -0.1739 -0.1003 32  ARG A CD    
8    N NE    . ARG A 6   ? 1.4065 0.7938 1.3154 -0.0904 -0.1577 -0.0903 32  ARG A NE    
9    C CZ    . ARG A 6   ? 1.4469 0.8027 1.3478 -0.1059 -0.1575 -0.0862 32  ARG A CZ    
10   N NH1   . ARG A 6   ? 1.4853 0.8169 1.3900 -0.1214 -0.1729 -0.0910 32  ARG A NH1   
11   N NH2   . ARG A 6   ? 1.4508 0.7972 1.3387 -0.1061 -0.1429 -0.0771 32  ARG A NH2   
12   N N     . GLU A 7   ? 1.2660 0.7271 1.1591 -0.0328 -0.1242 -0.0822 33  GLU A N     
13   C CA    . GLU A 7   ? 1.2293 0.7165 1.1418 -0.0403 -0.1082 -0.0730 33  GLU A CA    
14   C C     . GLU A 7   ? 1.1851 0.7002 1.0972 -0.0226 -0.1001 -0.0712 33  GLU A C     
15   O O     . GLU A 7   ? 1.1947 0.6975 1.0832 -0.0046 -0.1007 -0.0716 33  GLU A O     
16   C CB    . GLU A 7   ? 1.2583 0.7164 1.1542 -0.0477 -0.1021 -0.0653 33  GLU A CB    
17   C CG    . GLU A 7   ? 1.2970 0.7362 1.2033 -0.0718 -0.1045 -0.0642 33  GLU A CG    
18   C CD    . GLU A 7   ? 1.2777 0.7483 1.2209 -0.0906 -0.0916 -0.0588 33  GLU A CD    
19   O OE1   . GLU A 7   ? 1.2402 0.7432 1.1961 -0.0845 -0.0807 -0.0554 33  GLU A OE1   
20   O OE2   . GLU A 7   ? 1.2923 0.7547 1.2524 -0.1116 -0.0919 -0.0579 33  GLU A OE2   
21   N N     . VAL A 8   ? 1.1339 0.6865 1.0737 -0.0277 -0.0926 -0.0692 34  VAL A N     
22   C CA    . VAL A 8   ? 1.0864 0.6679 1.0293 -0.0131 -0.0861 -0.0681 34  VAL A CA    
23   C C     . VAL A 8   ? 1.0507 0.6551 1.0088 -0.0195 -0.0720 -0.0595 34  VAL A C     
24   O O     . VAL A 8   ? 1.0377 0.6611 1.0209 -0.0335 -0.0670 -0.0581 34  VAL A O     
25   C CB    . VAL A 8   ? 1.0689 0.6721 1.0251 -0.0092 -0.0927 -0.0756 34  VAL A CB    
26   C CG1   . VAL A 8   ? 1.0397 0.6720 0.9996 0.0036  -0.0847 -0.0736 34  VAL A CG1   
27   C CG2   . VAL A 8   ? 1.0898 0.6663 1.0243 -0.0004 -0.1066 -0.0844 34  VAL A CG2   
28   N N     . LYS A 9   ? 1.0299 0.6318 0.9727 -0.0085 -0.0662 -0.0541 35  LYS A N     
29   C CA    . LYS A 9   ? 0.9980 0.6150 0.9476 -0.0127 -0.0543 -0.0459 35  LYS A CA    
30   C C     . LYS A 9   ? 0.9549 0.6049 0.9153 -0.0022 -0.0512 -0.0464 35  LYS A C     
31   O O     . LYS A 9   ? 0.9489 0.6011 0.8993 0.0135  -0.0548 -0.0486 35  LYS A O     
32   C CB    . LYS A 9   ? 1.0153 0.6062 0.9402 -0.0078 -0.0523 -0.0395 35  LYS A CB    
33   C CG    . LYS A 9   ? 1.0072 0.6018 0.9324 -0.0155 -0.0409 -0.0306 35  LYS A CG    
34   C CD    . LYS A 9   ? 1.0170 0.5828 0.9140 -0.0085 -0.0419 -0.0246 35  LYS A CD    
35   C CE    . LYS A 9   ? 1.0153 0.5795 0.9071 -0.0164 -0.0310 -0.0160 35  LYS A CE    
36   N NZ    . LYS A 9   ? 1.0444 0.5739 0.9051 -0.0114 -0.0335 -0.0099 35  LYS A NZ    
37   N N     . LEU A 10  ? 0.9228 0.5978 0.9040 -0.0111 -0.0439 -0.0444 36  LEU A N     
38   C CA    . LEU A 10  ? 0.8853 0.5907 0.8773 -0.0034 -0.0411 -0.0450 36  LEU A CA    
39   C C     . LEU A 10  ? 0.8625 0.5795 0.8565 -0.0059 -0.0305 -0.0373 36  LEU A C     
40   O O     . LEU A 10  ? 0.8658 0.5838 0.8687 -0.0186 -0.0225 -0.0336 36  LEU A O     
41   C CB    . LEU A 10  ? 0.8738 0.5993 0.8879 -0.0090 -0.0444 -0.0511 36  LEU A CB    
42   C CG    . LEU A 10  ? 0.8802 0.6064 0.8897 0.0013  -0.0549 -0.0592 36  LEU A CG    
43   C CD1   . LEU A 10  ? 0.8613 0.6050 0.8921 -0.0052 -0.0598 -0.0648 36  LEU A CD1   
44   C CD2   . LEU A 10  ? 0.8734 0.6108 0.8727 0.0166  -0.0524 -0.0581 36  LEU A CD2   
45   N N     . LEU A 11  ? 0.8390 0.5647 0.8253 0.0060  -0.0304 -0.0349 37  LEU A N     
46   C CA    . LEU A 11  ? 0.8213 0.5550 0.8056 0.0052  -0.0229 -0.0280 37  LEU A CA    
47   C C     . LEU A 11  ? 0.7846 0.5481 0.7826 0.0089  -0.0207 -0.0293 37  LEU A C     
48   O O     . LEU A 11  ? 0.7720 0.5462 0.7698 0.0197  -0.0252 -0.0319 37  LEU A O     
49   C CB    . LEU A 11  ? 0.8349 0.5524 0.7996 0.0152  -0.0264 -0.0236 37  LEU A CB    
50   C CG    . LEU A 11  ? 0.8473 0.5614 0.8013 0.0157  -0.0226 -0.0159 37  LEU A CG    
51   C CD1   . LEU A 11  ? 0.8602 0.5678 0.8122 0.0019  -0.0122 -0.0113 37  LEU A CD1   
52   C CD2   . LEU A 11  ? 0.8892 0.5785 0.8234 0.0241  -0.0296 -0.0129 37  LEU A CD2   
53   N N     . LEU A 12  ? 0.7666 0.5422 0.7758 0.0000  -0.0130 -0.0274 38  LEU A N     
54   C CA    . LEU A 12  ? 0.7352 0.5350 0.7534 0.0031  -0.0103 -0.0274 38  LEU A CA    
55   C C     . LEU A 12  ? 0.7261 0.5232 0.7305 0.0070  -0.0072 -0.0205 38  LEU A C     
56   O O     . LEU A 12  ? 0.7465 0.5299 0.7413 0.0009  -0.0007 -0.0150 38  LEU A O     
57   C CB    . LEU A 12  ? 0.7294 0.5426 0.7660 -0.0067 -0.0034 -0.0285 38  LEU A CB    
58   C CG    . LEU A 12  ? 0.7239 0.5501 0.7808 -0.0092 -0.0089 -0.0362 38  LEU A CG    
59   C CD1   . LEU A 12  ? 0.7133 0.5490 0.7915 -0.0208 -0.0010 -0.0361 38  LEU A CD1   
60   C CD2   . LEU A 12  ? 0.7185 0.5627 0.7780 0.0002  -0.0144 -0.0402 38  LEU A CD2   
61   N N     . LEU A 13  ? 0.6989 0.5072 0.7015 0.0169  -0.0118 -0.0206 39  LEU A N     
62   C CA    . LEU A 13  ? 0.6816 0.4899 0.6741 0.0202  -0.0113 -0.0145 39  LEU A CA    
63   C C     . LEU A 13  ? 0.6562 0.4868 0.6570 0.0226  -0.0102 -0.0154 39  LEU A C     
64   O O     . LEU A 13  ? 0.6454 0.4906 0.6576 0.0244  -0.0114 -0.0207 39  LEU A O     
65   C CB    . LEU A 13  ? 0.6868 0.4858 0.6702 0.0295  -0.0188 -0.0126 39  LEU A CB    
66   C CG    . LEU A 13  ? 0.7035 0.4763 0.6742 0.0296  -0.0218 -0.0113 39  LEU A CG    
67   C CD1   . LEU A 13  ? 0.6908 0.4609 0.6587 0.0419  -0.0302 -0.0111 39  LEU A CD1   
68   C CD2   . LEU A 13  ? 0.6916 0.4425 0.6452 0.0222  -0.0177 -0.0050 39  LEU A CD2   
69   N N     . GLY A 14  ? 0.6466 0.4764 0.6386 0.0226  -0.0090 -0.0101 40  GLY A N     
70   C CA    . GLY A 14  ? 0.6164 0.4634 0.6126 0.0246  -0.0089 -0.0100 40  GLY A CA    
71   C C     . GLY A 14  ? 0.6191 0.4596 0.6043 0.0200  -0.0037 -0.0052 40  GLY A C     
72   O O     . GLY A 14  ? 0.6330 0.4581 0.6097 0.0143  0.0024  -0.0029 40  GLY A O     
73   N N     . ALA A 15  ? 0.5949 0.4451 0.5784 0.0223  -0.0055 -0.0039 41  ALA A N     
74   C CA    . ALA A 15  ? 0.5970 0.4381 0.5658 0.0195  -0.0019 0.0004  41  ALA A CA    
75   C C     . ALA A 15  ? 0.6032 0.4425 0.5734 0.0139  0.0095  -0.0008 41  ALA A C     
76   O O     . ALA A 15  ? 0.5884 0.4403 0.5765 0.0122  0.0128  -0.0059 41  ALA A O     
77   C CB    . ALA A 15  ? 0.5779 0.4306 0.5467 0.0224  -0.0064 0.0010  41  ALA A CB    
78   N N     . GLY A 16  ? 0.6153 0.4381 0.5668 0.0112  0.0156  0.0037  42  GLY A N     
79   C CA    . GLY A 16  ? 0.6147 0.4383 0.5693 0.0070  0.0288  0.0027  42  GLY A CA    
80   C C     . GLY A 16  ? 0.5985 0.4461 0.5709 0.0098  0.0285  -0.0023 42  GLY A C     
81   O O     . GLY A 16  ? 0.5913 0.4462 0.5612 0.0142  0.0203  -0.0026 42  GLY A O     
82   N N     . GLU A 17  ? 0.5935 0.4529 0.5848 0.0070  0.0368  -0.0062 43  GLU A N     
83   C CA    . GLU A 17  ? 0.5786 0.4589 0.5867 0.0104  0.0354  -0.0115 43  GLU A CA    
84   C C     . GLU A 17  ? 0.5642 0.4593 0.5859 0.0138  0.0237  -0.0166 43  GLU A C     
85   O O     . GLU A 17  ? 0.5605 0.4689 0.5900 0.0177  0.0202  -0.0206 43  GLU A O     
86   C CB    . GLU A 17  ? 0.5825 0.4592 0.5738 0.0146  0.0362  -0.0093 43  GLU A CB    
87   C CG    . GLU A 17  ? 0.6003 0.4600 0.5740 0.0130  0.0491  -0.0050 43  GLU A CG    
88   C CD    . GLU A 17  ? 0.6251 0.4941 0.6188 0.0102  0.0634  -0.0077 43  GLU A CD    
89   O OE1   . GLU A 17  ? 0.6659 0.5194 0.6502 0.0058  0.0761  -0.0038 43  GLU A OE1   
90   O OE2   . GLU A 17  ? 0.5948 0.4858 0.6141 0.0123  0.0620  -0.0135 43  GLU A OE2   
91   N N     . SER A 18  ? 0.5617 0.4522 0.5838 0.0132  0.0181  -0.0166 44  SER A N     
92   C CA    . SER A 18  ? 0.5491 0.4494 0.5787 0.0175  0.0085  -0.0211 44  SER A CA    
93   C C     . SER A 18  ? 0.5483 0.4587 0.5979 0.0162  0.0065  -0.0280 44  SER A C     
94   O O     . SER A 18  ? 0.5406 0.4582 0.5939 0.0207  -0.0009 -0.0326 44  SER A O     
95   C CB    . SER A 18  ? 0.5474 0.4385 0.5684 0.0196  0.0029  -0.0187 44  SER A CB    
96   O OG    . SER A 18  ? 0.5752 0.4553 0.5981 0.0156  0.0047  -0.0185 44  SER A OG    
97   N N     . GLY A 19  ? 0.5607 0.4704 0.6226 0.0098  0.0131  -0.0285 45  GLY A N     
98   C CA    . GLY A 19  ? 0.5545 0.4744 0.6396 0.0070  0.0103  -0.0350 45  GLY A CA    
99   C C     . GLY A 19  ? 0.5683 0.4786 0.6603 0.0000  0.0109  -0.0353 45  GLY A C     
100  O O     . GLY A 19  ? 0.5733 0.4895 0.6837 -0.0028 0.0054  -0.0410 45  GLY A O     
101  N N     . LYS A 20  ? 0.5724 0.4657 0.6484 -0.0027 0.0162  -0.0294 46  LYS A N     
102  C CA    . LYS A 20  ? 0.5846 0.4637 0.6614 -0.0089 0.0161  -0.0290 46  LYS A CA    
103  C C     . LYS A 20  ? 0.5992 0.4830 0.6992 -0.0191 0.0229  -0.0308 46  LYS A C     
104  O O     . LYS A 20  ? 0.6008 0.4850 0.7150 -0.0231 0.0162  -0.0355 46  LYS A O     
105  C CB    . LYS A 20  ? 0.5964 0.4537 0.6488 -0.0093 0.0201  -0.0219 46  LYS A CB    
106  C CG    . LYS A 20  ? 0.5742 0.4274 0.6094 0.0000  0.0115  -0.0204 46  LYS A CG    
107  C CD    . LYS A 20  ? 0.5826 0.4132 0.5954 0.0001  0.0127  -0.0137 46  LYS A CD    
108  C CE    . LYS A 20  ? 0.5887 0.4097 0.5886 -0.0038 0.0228  -0.0078 46  LYS A CE    
109  N NZ    . LYS A 20  ? 0.5918 0.4228 0.5863 0.0012  0.0220  -0.0064 46  LYS A NZ    
110  N N     . SER A 21  ? 0.6066 0.4942 0.7116 -0.0232 0.0363  -0.0273 47  SER A N     
111  C CA    . SER A 21  ? 0.6278 0.5215 0.7583 -0.0337 0.0456  -0.0281 47  SER A CA    
112  C C     . SER A 21  ? 0.6171 0.5363 0.7816 -0.0335 0.0389  -0.0358 47  SER A C     
113  O O     . SER A 21  ? 0.6275 0.5540 0.8198 -0.0425 0.0406  -0.0384 47  SER A O     
114  C CB    . SER A 21  ? 0.6388 0.5263 0.7625 -0.0378 0.0647  -0.0216 47  SER A CB    
115  O OG    . SER A 21  ? 0.6319 0.5354 0.7606 -0.0313 0.0687  -0.0226 47  SER A OG    
116  N N     . THR A 22  ? 0.6060 0.5374 0.7685 -0.0236 0.0303  -0.0394 48  THR A N     
117  C CA    . THR A 22  ? 0.5957 0.5470 0.7845 -0.0212 0.0195  -0.0472 48  THR A CA    
118  C C     . THR A 22  ? 0.6036 0.5485 0.7964 -0.0231 0.0041  -0.0527 48  THR A C     
119  O O     . THR A 22  ? 0.6049 0.5601 0.8258 -0.0280 -0.0027 -0.0582 48  THR A O     
120  C CB    . THR A 22  ? 0.5846 0.5442 0.7623 -0.0096 0.0136  -0.0491 48  THR A CB    
121  O OG1   . THR A 22  ? 0.5788 0.5412 0.7506 -0.0078 0.0272  -0.0444 48  THR A OG1   
122  C CG2   . THR A 22  ? 0.5731 0.5497 0.7745 -0.0061 0.0009  -0.0574 48  THR A CG2   
123  N N     . ILE A 23  ? 0.6108 0.5380 0.7759 -0.0188 -0.0015 -0.0513 49  ILE A N     
124  C CA    . ILE A 23  ? 0.6303 0.5458 0.7925 -0.0196 -0.0144 -0.0560 49  ILE A CA    
125  C C     . ILE A 23  ? 0.6543 0.5625 0.8330 -0.0324 -0.0113 -0.0555 49  ILE A C     
126  O O     . ILE A 23  ? 0.6665 0.5754 0.8619 -0.0368 -0.0225 -0.0615 49  ILE A O     
127  C CB    . ILE A 23  ? 0.6323 0.5297 0.7623 -0.0120 -0.0176 -0.0536 49  ILE A CB    
128  C CG1   . ILE A 23  ? 0.6213 0.5257 0.7372 -0.0004 -0.0218 -0.0546 49  ILE A CG1   
129  C CG2   . ILE A 23  ? 0.6482 0.5293 0.7729 -0.0129 -0.0284 -0.0579 49  ILE A CG2   
130  C CD1   . ILE A 23  ? 0.6126 0.5261 0.7377 0.0040  -0.0339 -0.0625 49  ILE A CD1   
131  N N     . VAL A 24  ? 0.6689 0.5679 0.8410 -0.0388 0.0032  -0.0482 50  VAL A N     
132  C CA    . VAL A 24  ? 0.6904 0.5809 0.8765 -0.0524 0.0095  -0.0464 50  VAL A CA    
133  C C     . VAL A 24  ? 0.6926 0.6059 0.9208 -0.0604 0.0092  -0.0510 50  VAL A C     
134  O O     . VAL A 24  ? 0.7056 0.6164 0.9523 -0.0691 0.0011  -0.0549 50  VAL A O     
135  C CB    . VAL A 24  ? 0.7036 0.5802 0.8735 -0.0574 0.0280  -0.0372 50  VAL A CB    
136  C CG1   . VAL A 24  ? 0.7193 0.5907 0.9084 -0.0731 0.0386  -0.0348 50  VAL A CG1   
137  C CG2   . VAL A 24  ? 0.7009 0.5519 0.8332 -0.0513 0.0246  -0.0332 50  VAL A CG2   
138  N N     . LYS A 25  ? 0.6868 0.6220 0.9307 -0.0568 0.0166  -0.0510 51  LYS A N     
139  C CA    . LYS A 25  ? 0.6884 0.6490 0.9766 -0.0624 0.0162  -0.0556 51  LYS A CA    
140  C C     . LYS A 25  ? 0.6878 0.6554 0.9906 -0.0592 -0.0070 -0.0650 51  LYS A C     
141  O O     . LYS A 25  ? 0.6965 0.6750 1.0347 -0.0682 -0.0135 -0.0695 51  LYS A O     
142  C CB    . LYS A 25  ? 0.6744 0.6553 0.9730 -0.0563 0.0283  -0.0541 51  LYS A CB    
143  C CG    . LYS A 25  ? 0.6936 0.6679 0.9837 -0.0615 0.0531  -0.0454 51  LYS A CG    
144  C CD    . LYS A 25  ? 0.6990 0.6953 1.0089 -0.0572 0.0663  -0.0451 51  LYS A CD    
145  C CE    . LYS A 25  ? 0.6914 0.6813 0.9666 -0.0441 0.0682  -0.0425 51  LYS A CE    
146  N NZ    . LYS A 25  ? 0.6973 0.7025 0.9862 -0.0403 0.0843  -0.0412 51  LYS A NZ    
147  N N     . GLN A 26  ? 0.6831 0.6426 0.9578 -0.0468 -0.0196 -0.0679 52  GLN A N     
148  C CA    . GLN A 26  ? 0.6842 0.6430 0.9621 -0.0420 -0.0419 -0.0766 52  GLN A CA    
149  C C     . GLN A 26  ? 0.7106 0.6512 0.9892 -0.0506 -0.0529 -0.0797 52  GLN A C     
150  O O     . GLN A 26  ? 0.7152 0.6598 1.0153 -0.0539 -0.0692 -0.0869 52  GLN A O     
151  C CB    . GLN A 26  ? 0.6744 0.6241 0.9165 -0.0273 -0.0490 -0.0778 52  GLN A CB    
152  C CG    . GLN A 26  ? 0.6375 0.6042 0.8802 -0.0184 -0.0445 -0.0771 52  GLN A CG    
153  C CD    . GLN A 26  ? 0.6187 0.6035 0.8897 -0.0158 -0.0571 -0.0845 52  GLN A CD    
154  O OE1   . GLN A 26  ? 0.6112 0.6029 0.9129 -0.0235 -0.0656 -0.0892 52  GLN A OE1   
155  N NE2   . GLN A 26  ? 0.6111 0.6030 0.8724 -0.0049 -0.0593 -0.0856 52  GLN A NE2   
156  N N     . MET A 27  ? 0.7311 0.6497 0.9851 -0.0539 -0.0453 -0.0744 53  MET A N     
157  C CA    . MET A 27  ? 0.7631 0.6603 1.0139 -0.0622 -0.0543 -0.0765 53  MET A CA    
158  C C     . MET A 27  ? 0.7776 0.6858 1.0700 -0.0788 -0.0524 -0.0772 53  MET A C     
159  O O     . MET A 27  ? 0.7958 0.6940 1.0986 -0.0861 -0.0671 -0.0823 53  MET A O     
160  C CB    . MET A 27  ? 0.7711 0.6428 0.9886 -0.0622 -0.0449 -0.0698 53  MET A CB    
161  C CG    . MET A 27  ? 0.7720 0.6312 0.9512 -0.0467 -0.0481 -0.0694 53  MET A CG    
162  S SD    . MET A 27  ? 0.7905 0.6354 0.9511 -0.0359 -0.0701 -0.0788 53  MET A SD    
163  C CE    . MET A 27  ? 0.7427 0.6123 0.9105 -0.0255 -0.0736 -0.0822 53  MET A CE    
164  N N     . LYS A 28  ? 0.7791 0.7070 1.0954 -0.0848 -0.0340 -0.0720 54  LYS A N     
165  C CA    . LYS A 28  ? 0.7965 0.7402 1.1587 -0.1008 -0.0285 -0.0721 54  LYS A CA    
166  C C     . LYS A 28  ? 0.7916 0.7596 1.1928 -0.0999 -0.0463 -0.0811 54  LYS A C     
167  O O     . LYS A 28  ? 0.8017 0.7744 1.2367 -0.1124 -0.0557 -0.0849 54  LYS A O     
168  C CB    . LYS A 28  ? 0.7923 0.7492 1.1663 -0.1056 -0.0013 -0.0640 54  LYS A CB    
169  C CG    . LYS A 28  ? 0.8271 0.7953 1.2440 -0.1241 0.0108  -0.0617 54  LYS A CG    
170  C CD    . LYS A 28  ? 0.8531 0.8307 1.2749 -0.1269 0.0403  -0.0535 54  LYS A CD    
171  C CE    . LYS A 28  ? 0.8869 0.8741 1.3503 -0.1461 0.0561  -0.0502 54  LYS A CE    
172  N NZ    . LYS A 28  ? 0.8984 0.8945 1.3658 -0.1473 0.0865  -0.0427 54  LYS A NZ    
173  N N     . ILE A 29  ? 0.7774 0.7592 1.1733 -0.0854 -0.0521 -0.0844 55  ILE A N     
174  C CA    . ILE A 29  ? 0.7785 0.7811 1.2069 -0.0820 -0.0705 -0.0930 55  ILE A CA    
175  C C     . ILE A 29  ? 0.8006 0.7829 1.2150 -0.0800 -0.0983 -0.1011 55  ILE A C     
176  O O     . ILE A 29  ? 0.8124 0.8033 1.2609 -0.0867 -0.1155 -0.1078 55  ILE A O     
177  C CB    . ILE A 29  ? 0.7593 0.7779 1.1803 -0.0663 -0.0682 -0.0938 55  ILE A CB    
178  C CG1   . ILE A 29  ? 0.7470 0.7880 1.1908 -0.0690 -0.0429 -0.0874 55  ILE A CG1   
179  C CG2   . ILE A 29  ? 0.7524 0.7832 1.1933 -0.0592 -0.0928 -0.1035 55  ILE A CG2   
180  C CD1   . ILE A 29  ? 0.7244 0.7723 1.1477 -0.0540 -0.0361 -0.0858 55  ILE A CD1   
181  N N     . ILE A 30  ? 0.8920 0.8793 0.9901 -0.0838 -0.0718 0.0271  56  ILE A N     
182  C CA    . ILE A 30  ? 0.9047 0.8907 0.9912 -0.0891 -0.0779 0.0265  56  ILE A CA    
183  C C     . ILE A 30  ? 0.9174 0.8983 0.9977 -0.0963 -0.0732 0.0214  56  ILE A C     
184  O O     . ILE A 30  ? 0.9226 0.9112 1.0060 -0.1032 -0.0783 0.0183  56  ILE A O     
185  C CB    . ILE A 30  ? 0.9061 0.8834 0.9754 -0.0881 -0.0775 0.0267  56  ILE A CB    
186  C CG1   . ILE A 30  ? 0.9121 0.8858 0.9815 -0.0847 -0.0777 0.0305  56  ILE A CG1   
187  C CG2   . ILE A 30  ? 0.9179 0.8918 0.9732 -0.0942 -0.0827 0.0258  56  ILE A CG2   
188  C CD1   . ILE A 30  ? 0.8953 0.8635 0.9547 -0.0868 -0.0695 0.0246  56  ILE A CD1   
189  N N     . HIS A 31  ? 0.9289 0.8945 0.9968 -0.0932 -0.0628 0.0196  57  HIS A N     
190  C CA    . HIS A 31  ? 0.9534 0.9012 1.0027 -0.0976 -0.0552 0.0157  57  HIS A CA    
191  C C     . HIS A 31  ? 0.9738 0.9049 1.0197 -0.1019 -0.0400 0.0125  57  HIS A C     
192  O O     . HIS A 31  ? 0.9993 0.9059 1.0232 -0.1063 -0.0290 0.0091  57  HIS A O     
193  C CB    . HIS A 31  ? 0.9599 0.8941 0.9834 -0.0870 -0.0544 0.0145  57  HIS A CB    
194  C CG    . HIS A 31  ? 0.9572 0.9046 0.9812 -0.0882 -0.0644 0.0136  57  HIS A CG    
195  N ND1   . HIS A 31  ? 0.9612 0.9174 0.9845 -0.0806 -0.0663 0.0100  57  HIS A ND1   
196  C CD2   . HIS A 31  ? 0.9667 0.9191 0.9907 -0.0974 -0.0709 0.0138  57  HIS A CD2   
197  C CE1   . HIS A 31  ? 0.9666 0.9293 0.9880 -0.0871 -0.0712 0.0082  57  HIS A CE1   
198  N NE2   . HIS A 31  ? 0.9744 0.9333 0.9943 -0.0959 -0.0749 0.0120  57  HIS A NE2   
199  N N     . GLU A 32  ? 0.9701 0.9102 1.0344 -0.1012 -0.0371 0.0129  58  GLU A N     
200  C CA    . GLU A 32  ? 0.9900 0.9153 1.0538 -0.1089 -0.0198 0.0078  58  GLU A CA    
201  C C     . GLU A 32  ? 0.9801 0.9384 1.0824 -0.1193 -0.0233 0.0009  58  GLU A C     
202  O O     . GLU A 32  ? 0.9627 0.9498 1.0843 -0.1200 -0.0392 -0.0004 58  GLU A O     
203  C CB    . GLU A 32  ? 0.9991 0.9005 1.0426 -0.0948 -0.0103 0.0123  58  GLU A CB    
204  C CG    . GLU A 32  ? 1.0252 0.8945 1.0261 -0.0797 -0.0068 0.0147  58  GLU A CG    
205  C CD    . GLU A 32  ? 1.0326 0.8881 1.0142 -0.0590 -0.0038 0.0171  58  GLU A CD    
206  O OE1   . GLU A 32  ? 1.0586 0.8927 1.0305 -0.0588 0.0106  0.0175  58  GLU A OE1   
207  O OE2   . GLU A 32  ? 1.0179 0.8853 0.9935 -0.0431 -0.0152 0.0162  58  GLU A OE2   
208  N N     . ALA A 33  ? 0.9968 0.9505 1.1073 -0.1252 -0.0087 -0.0047 59  ALA A N     
209  C CA    . ALA A 33  ? 0.9956 0.9856 1.1450 -0.1352 -0.0104 -0.0169 59  ALA A CA    
210  C C     . ALA A 33  ? 0.9754 0.9928 1.1477 -0.1212 -0.0273 -0.0110 59  ALA A C     
211  O O     . ALA A 33  ? 0.9676 1.0211 1.1705 -0.1222 -0.0367 -0.0206 59  ALA A O     
212  C CB    . ALA A 33  ? 1.0205 0.9952 1.1706 -0.1505 0.0153  -0.0290 59  ALA A CB    
213  N N     . GLY A 34  ? 0.9744 0.9754 1.1307 -0.1069 -0.0307 0.0024  60  GLY A N     
214  C CA    . GLY A 34  ? 0.9623 0.9802 1.1343 -0.0948 -0.0423 0.0083  60  GLY A CA    
215  C C     . GLY A 34  ? 0.9653 0.9905 1.1559 -0.0954 -0.0333 0.0037  60  GLY A C     
216  O O     . GLY A 34  ? 0.9788 0.9826 1.1577 -0.1007 -0.0156 0.0014  60  GLY A O     
217  N N     . TYR A 35  ? 0.9576 1.0091 1.1725 -0.0883 -0.0446 0.0022  61  TYR A N     
218  C CA    . TYR A 35  ? 0.9572 1.0209 1.1936 -0.0875 -0.0381 -0.0031 61  TYR A CA    
219  C C     . TYR A 35  ? 0.9614 1.0657 1.2315 -0.0900 -0.0457 -0.0194 61  TYR A C     
220  O O     . TYR A 35  ? 0.9597 1.0834 1.2360 -0.0776 -0.0646 -0.0189 61  TYR A O     
221  C CB    . TYR A 35  ? 0.9435 1.0013 1.1771 -0.0725 -0.0439 0.0083  61  TYR A CB    
222  C CG    . TYR A 35  ? 0.9285 0.9578 1.1346 -0.0681 -0.0381 0.0182  61  TYR A CG    
223  C CD1   . TYR A 35  ? 0.9233 0.9351 1.1186 -0.0678 -0.0237 0.0182  61  TYR A CD1   
224  C CD2   . TYR A 35  ? 0.9138 0.9352 1.1032 -0.0631 -0.0467 0.0250  61  TYR A CD2   
225  C CE1   . TYR A 35  ? 0.9199 0.9127 1.0901 -0.0590 -0.0212 0.0230  61  TYR A CE1   
226  C CE2   . TYR A 35  ? 0.9077 0.9130 1.0770 -0.0586 -0.0420 0.0278  61  TYR A CE2   
227  C CZ    . TYR A 35  ? 0.9058 0.8998 1.0665 -0.0548 -0.0310 0.0261  61  TYR A CZ    
228  O OH    . TYR A 35  ? 0.9000 0.8850 1.0412 -0.0458 -0.0291 0.0249  61  TYR A OH    
229  N N     . SER A 36  ? 0.9761 1.0921 1.2649 -0.1052 -0.0299 -0.0360 62  SER A N     
230  C CA    . SER A 36  ? 0.9803 1.1448 1.3084 -0.1081 -0.0351 -0.0586 62  SER A CA    
231  C C     . SER A 36  ? 0.9743 1.1553 1.3204 -0.0924 -0.0427 -0.0569 62  SER A C     
232  O O     . SER A 36  ? 0.9723 1.1244 1.3011 -0.0846 -0.0391 -0.0395 62  SER A O     
233  C CB    . SER A 36  ? 0.9968 1.1666 1.3389 -0.1346 -0.0099 -0.0811 62  SER A CB    
234  O OG    . SER A 36  ? 1.0092 1.1435 1.3361 -0.1422 0.0132  -0.0752 62  SER A OG    
235  N N     . GLU A 37  ? 0.9744 1.2040 1.3552 -0.0865 -0.0535 -0.0771 63  GLU A N     
236  C CA    . GLU A 37  ? 0.9702 1.2169 1.3681 -0.0695 -0.0612 -0.0776 63  GLU A CA    
237  C C     . GLU A 37  ? 0.9690 1.2024 1.3747 -0.0835 -0.0375 -0.0798 63  GLU A C     
238  O O     . GLU A 37  ? 0.9660 1.1876 1.3684 -0.0712 -0.0389 -0.0679 63  GLU A O     
239  C CB    . GLU A 37  ? 0.9718 1.2783 1.4048 -0.0564 -0.0792 -0.1031 63  GLU A CB    
240  C CG    . GLU A 37  ? 0.9756 1.2922 1.4129 -0.0276 -0.0954 -0.0980 63  GLU A CG    
241  C CD    . GLU A 37  ? 0.9875 1.3676 1.4582 -0.0090 -0.1150 -0.1270 63  GLU A CD    
242  O OE1   . GLU A 37  ? 0.9965 1.4014 1.4668 -0.0002 -0.1314 -0.1382 63  GLU A OE1   
243  O OE2   . GLU A 37  ? 0.9790 1.3864 1.4760 -0.0009 -0.1150 -0.1401 63  GLU A OE2   
244  N N     . GLU A 38  ? 0.9788 1.2089 1.3900 -0.1097 -0.0139 -0.0950 64  GLU A N     
245  C CA    . GLU A 38  ? 0.9877 1.1965 1.3977 -0.1247 0.0129  -0.0982 64  GLU A CA    
246  C C     . GLU A 38  ? 0.9884 1.1407 1.3562 -0.1174 0.0198  -0.0699 64  GLU A C     
247  O O     . GLU A 38  ? 0.9863 1.1268 1.3528 -0.1131 0.0278  -0.0645 64  GLU A O     
248  C CB    . GLU A 38  ? 1.0123 1.2179 1.4265 -0.1559 0.0412  -0.1210 64  GLU A CB    
249  C CG    . GLU A 38  ? 1.0170 1.2868 1.4777 -0.1672 0.0372  -0.1570 64  GLU A CG    
250  C CD    . GLU A 38  ? 1.0179 1.3360 1.5236 -0.1700 0.0417  -0.1833 64  GLU A CD    
251  O OE1   . GLU A 38  ? 1.0283 1.3847 1.5675 -0.1941 0.0585  -0.2198 64  GLU A OE1   
252  O OE2   . GLU A 38  ? 1.0018 1.3213 1.5108 -0.1495 0.0300  -0.1701 64  GLU A OE2   
253  N N     . GLU A 39  ? 0.9905 1.1120 1.3252 -0.1152 0.0161  -0.0547 65  GLU A N     
254  C CA    . GLU A 39  ? 0.9900 1.0672 1.2862 -0.1046 0.0184  -0.0322 65  GLU A CA    
255  C C     . GLU A 39  ? 0.9640 1.0500 1.2656 -0.0839 0.0000  -0.0192 65  GLU A C     
256  O O     . GLU A 39  ? 0.9617 1.0282 1.2504 -0.0766 0.0058  -0.0100 65  GLU A O     
257  C CB    . GLU A 39  ? 1.0000 1.0517 1.2648 -0.1055 0.0159  -0.0233 65  GLU A CB    
258  C CG    . GLU A 39  ? 1.0396 1.0641 1.2842 -0.1246 0.0392  -0.0324 65  GLU A CG    
259  C CD    . GLU A 39  ? 1.0556 1.0657 1.2775 -0.1257 0.0331  -0.0273 65  GLU A CD    
260  O OE1   . GLU A 39  ? 1.0426 1.0848 1.2851 -0.1253 0.0153  -0.0315 65  GLU A OE1   
261  O OE2   . GLU A 39  ? 1.0856 1.0510 1.2661 -0.1246 0.0458  -0.0196 65  GLU A OE2   
262  N N     . CYS A 40  ? 0.9476 1.0602 1.2644 -0.0739 -0.0205 -0.0198 66  CYS A N     
263  C CA    . CYS A 40  ? 0.9341 1.0480 1.2504 -0.0551 -0.0351 -0.0087 66  CYS A CA    
264  C C     . CYS A 40  ? 0.9279 1.0520 1.2633 -0.0499 -0.0302 -0.0122 66  CYS A C     
265  O O     . CYS A 40  ? 0.9230 1.0308 1.2481 -0.0401 -0.0305 -0.0010 66  CYS A O     
266  C CB    . CYS A 40  ? 0.9365 1.0717 1.2591 -0.0433 -0.0557 -0.0111 66  CYS A CB    
267  S SG    . CYS A 40  ? 0.9371 1.0513 1.2287 -0.0433 -0.0645 -0.0002 66  CYS A SG    
268  N N     . LYS A 41  ? 0.9259 1.0788 1.2907 -0.0580 -0.0240 -0.0303 67  LYS A N     
269  C CA    . LYS A 41  ? 0.9185 1.0850 1.3049 -0.0551 -0.0178 -0.0370 67  LYS A CA    
270  C C     . LYS A 41  ? 0.9159 1.0475 1.2819 -0.0594 -0.0002 -0.0263 67  LYS A C     
271  O O     . LYS A 41  ? 0.9106 1.0421 1.2829 -0.0506 0.0004  -0.0227 67  LYS A O     
272  C CB    . LYS A 41  ? 0.9242 1.1299 1.3465 -0.0687 -0.0096 -0.0639 67  LYS A CB    
273  C CG    . LYS A 41  ? 0.9247 1.1601 1.3784 -0.0616 -0.0098 -0.0762 67  LYS A CG    
274  C CD    . LYS A 41  ? 0.9372 1.2191 1.4308 -0.0779 -0.0002 -0.1093 67  LYS A CD    
275  C CE    . LYS A 41  ? 0.9358 1.2506 1.4628 -0.0708 0.0002  -0.1241 67  LYS A CE    
276  N NZ    . LYS A 41  ? 0.9397 1.3114 1.5124 -0.0862 0.0083  -0.1630 67  LYS A NZ    
277  N N     . GLN A 42  ? 0.9226 1.0236 1.2607 -0.0701 0.0130  -0.0218 68  GLN A N     
278  C CA    . GLN A 42  ? 0.9292 0.9945 1.2392 -0.0695 0.0286  -0.0133 68  GLN A CA    
279  C C     . GLN A 42  ? 0.9113 0.9637 1.2043 -0.0529 0.0181  0.0013  68  GLN A C     
280  O O     . GLN A 42  ? 0.9162 0.9509 1.1936 -0.0473 0.0269  0.0051  68  GLN A O     
281  C CB    . GLN A 42  ? 0.9582 0.9896 1.2347 -0.0804 0.0445  -0.0134 68  GLN A CB    
282  C CG    . GLN A 42  ? 0.9875 1.0232 1.2754 -0.1025 0.0631  -0.0312 68  GLN A CG    
283  C CD    . GLN A 42  ? 1.0186 1.0497 1.3144 -0.1116 0.0846  -0.0415 68  GLN A CD    
284  O OE1   . GLN A 42  ? 1.0385 1.0362 1.3056 -0.1038 0.0954  -0.0321 68  GLN A OE1   
285  N NE2   . GLN A 42  ? 1.0113 1.0786 1.3462 -0.1275 0.0912  -0.0633 68  GLN A NE2   
286  N N     . TYR A 43  ? 0.8898 0.9508 1.1840 -0.0458 0.0012  0.0071  69  TYR A N     
287  C CA    . TYR A 43  ? 0.8732 0.9230 1.1526 -0.0349 -0.0050 0.0164  69  TYR A CA    
288  C C     . TYR A 43  ? 0.8575 0.9178 1.1540 -0.0260 -0.0096 0.0176  69  TYR A C     
289  O O     . TYR A 43  ? 0.8552 0.9063 1.1418 -0.0199 -0.0115 0.0222  69  TYR A O     
290  C CB    . TYR A 43  ? 0.8722 0.9173 1.1373 -0.0344 -0.0157 0.0213  69  TYR A CB    
291  C CG    . TYR A 43  ? 0.8826 0.9109 1.1226 -0.0388 -0.0108 0.0218  69  TYR A CG    
292  C CD1   . TYR A 43  ? 0.8868 0.9016 1.1047 -0.0320 -0.0077 0.0230  69  TYR A CD1   
293  C CD2   . TYR A 43  ? 0.8963 0.9240 1.1343 -0.0485 -0.0092 0.0183  69  TYR A CD2   
294  C CE1   . TYR A 43  ? 0.9050 0.9036 1.0958 -0.0311 -0.0047 0.0225  69  TYR A CE1   
295  C CE2   . TYR A 43  ? 0.9109 0.9176 1.1211 -0.0510 -0.0037 0.0192  69  TYR A CE2   
296  C CZ    . TYR A 43  ? 0.9185 0.9094 1.1035 -0.0405 -0.0022 0.0221  69  TYR A CZ    
297  O OH    . TYR A 43  ? 0.9214 0.8909 1.0755 -0.0383 0.0017  0.0221  69  TYR A OH    
298  N N     . LYS A 44  ? 0.8439 0.9234 1.1657 -0.0259 -0.0098 0.0109  70  LYS A N     
299  C CA    . LYS A 44  ? 0.8297 0.9182 1.1662 -0.0146 -0.0153 0.0113  70  LYS A CA    
300  C C     . LYS A 44  ? 0.8168 0.8926 1.1478 -0.0115 -0.0059 0.0145  70  LYS A C     
301  O O     . LYS A 44  ? 0.8193 0.8871 1.1461 -0.0036 -0.0088 0.0188  70  LYS A O     
302  C CB    . LYS A 44  ? 0.8296 0.9480 1.1970 -0.0140 -0.0173 -0.0010 70  LYS A CB    
303  C CG    . LYS A 44  ? 0.8364 0.9658 1.2152 0.0035  -0.0289 -0.0014 70  LYS A CG    
304  C CD    . LYS A 44  ? 0.8381 1.0074 1.2501 0.0066  -0.0344 -0.0191 70  LYS A CD    
305  C CE    . LYS A 44  ? 0.8465 1.0242 1.2653 0.0296  -0.0464 -0.0201 70  LYS A CE    
306  N NZ    . LYS A 44  ? 0.8456 1.0712 1.2991 0.0369  -0.0552 -0.0420 70  LYS A NZ    
307  N N     . ALA A 45  ? 0.8042 0.8750 1.1315 -0.0174 0.0067  0.0114  71  ALA A N     
308  C CA    . ALA A 45  ? 0.7932 0.8558 1.1148 -0.0127 0.0148  0.0120  71  ALA A CA    
309  C C     . ALA A 45  ? 0.7860 0.8375 1.0877 -0.0085 0.0123  0.0150  71  ALA A C     
310  O O     . ALA A 45  ? 0.7824 0.8339 1.0873 -0.0041 0.0136  0.0139  71  ALA A O     
311  C CB    . ALA A 45  ? 0.8008 0.8538 1.1127 -0.0170 0.0293  0.0081  71  ALA A CB    
312  N N     . VAL A 46  ? 0.7212 0.6756 0.9316 -0.0462 0.0850  0.0067  72  VAL A N     
313  C CA    . VAL A 46  ? 0.7094 0.6573 0.8857 -0.0301 0.0713  0.0013  72  VAL A CA    
314  C C     . VAL A 46  ? 0.6710 0.6496 0.8402 -0.0163 0.0686  -0.0154 72  VAL A C     
315  O O     . VAL A 46  ? 0.6630 0.6448 0.8012 -0.0070 0.0692  -0.0160 72  VAL A O     
316  C CB    . VAL A 46  ? 0.7316 0.6538 0.9235 -0.0251 0.0467  -0.0053 72  VAL A CB    
317  C CG1   . VAL A 46  ? 0.7303 0.6629 0.9631 -0.0232 0.0332  -0.0286 72  VAL A CG1   
318  C CG2   . VAL A 46  ? 0.7232 0.6432 0.8945 -0.0086 0.0357  -0.0148 72  VAL A CG2   
319  N N     . VAL A 47  ? 0.6535 0.6526 0.8515 -0.0178 0.0627  -0.0261 73  VAL A N     
320  C CA    . VAL A 47  ? 0.6300 0.6536 0.8178 -0.0111 0.0560  -0.0338 73  VAL A CA    
321  C C     . VAL A 47  ? 0.6194 0.6517 0.7988 -0.0099 0.0737  -0.0221 73  VAL A C     
322  O O     . VAL A 47  ? 0.6097 0.6489 0.7608 -0.0025 0.0726  -0.0218 73  VAL A O     
323  C CB    . VAL A 47  ? 0.6324 0.6706 0.8541 -0.0168 0.0383  -0.0426 73  VAL A CB    
324  C CG1   . VAL A 47  ? 0.6152 0.6732 0.8296 -0.0150 0.0274  -0.0399 73  VAL A CG1   
325  C CG2   . VAL A 47  ? 0.6444 0.6767 0.8628 -0.0178 0.0195  -0.0623 73  VAL A CG2   
326  N N     . TYR A 48  ? 0.6213 0.6540 0.8280 -0.0190 0.0924  -0.0153 74  TYR A N     
327  C CA    . TYR A 48  ? 0.6146 0.6568 0.8205 -0.0193 0.1135  -0.0122 74  TYR A CA    
328  C C     . TYR A 48  ? 0.6252 0.6515 0.7752 -0.0170 0.1237  -0.0052 74  TYR A C     
329  O O     . TYR A 48  ? 0.6161 0.6501 0.7509 -0.0094 0.1256  -0.0072 74  TYR A O     
330  C CB    . TYR A 48  ? 0.6251 0.6763 0.8773 -0.0332 0.1382  -0.0138 74  TYR A CB    
331  C CG    . TYR A 48  ? 0.6166 0.6895 0.9411 -0.0331 0.1252  -0.0226 74  TYR A CG    
332  C CD1   . TYR A 48  ? 0.6177 0.6996 0.9511 -0.0224 0.0923  -0.0248 74  TYR A CD1   
333  C CD2   . TYR A 48  ? 0.6244 0.7091 1.0092 -0.0466 0.1443  -0.0276 74  TYR A CD2   
334  C CE1   . TYR A 48  ? 0.6126 0.7101 1.0108 -0.0240 0.0712  -0.0294 74  TYR A CE1   
335  C CE2   . TYR A 48  ? 0.6198 0.7250 1.0827 -0.0457 0.1267  -0.0362 74  TYR A CE2   
336  C CZ    . TYR A 48  ? 0.6104 0.7199 1.0786 -0.0336 0.0865  -0.0359 74  TYR A CZ    
337  O OH    . TYR A 48  ? 0.6081 0.7333 1.1502 -0.0341 0.0594  -0.0407 74  TYR A OH    
338  N N     . SER A 49  ? 0.6467 0.6479 0.7694 -0.0242 0.1249  0.0042  75  SER A N     
339  C CA    . SER A 49  ? 0.6639 0.6464 0.7352 -0.0233 0.1262  0.0131  75  SER A CA    
340  C C     . SER A 49  ? 0.6329 0.6204 0.6901 -0.0059 0.1069  0.0063  75  SER A C     
341  O O     . SER A 49  ? 0.6274 0.6165 0.6587 -0.0013 0.1102  0.0071  75  SER A O     
342  C CB    . SER A 49  ? 0.7090 0.6580 0.7581 -0.0366 0.1216  0.0298  75  SER A CB    
343  O OG    . SER A 49  ? 0.7359 0.6750 0.8097 -0.0291 0.0974  0.0263  75  SER A OG    
344  N N     . ASN A 50  ? 0.6134 0.6053 0.6890 0.0013  0.0892  -0.0034 76  ASN A N     
345  C CA    . ASN A 50  ? 0.5885 0.5924 0.6545 0.0132  0.0775  -0.0149 76  ASN A CA    
346  C C     . ASN A 50  ? 0.5686 0.5942 0.6276 0.0157  0.0826  -0.0152 76  ASN A C     
347  O O     . ASN A 50  ? 0.5569 0.5868 0.5968 0.0213  0.0819  -0.0157 76  ASN A O     
348  C CB    . ASN A 50  ? 0.5854 0.5970 0.6711 0.0153  0.0643  -0.0326 76  ASN A CB    
349  C CG    . ASN A 50  ? 0.5895 0.5782 0.6918 0.0173  0.0535  -0.0379 76  ASN A CG    
350  O OD1   . ASN A 50  ? 0.5783 0.5694 0.7035 0.0175  0.0444  -0.0558 76  ASN A OD1   
351  N ND2   . ASN A 50  ? 0.5849 0.5488 0.6768 0.0175  0.0507  -0.0227 76  ASN A ND2   
352  N N     . THR A 51  ? 0.5617 0.5993 0.6447 0.0110  0.0850  -0.0140 77  THR A N     
353  C CA    . THR A 51  ? 0.5466 0.6001 0.6375 0.0125  0.0830  -0.0117 77  THR A CA    
354  C C     . THR A 51  ? 0.5490 0.5980 0.6295 0.0147  0.0984  -0.0080 77  THR A C     
355  O O     . THR A 51  ? 0.5403 0.5954 0.6127 0.0188  0.0940  -0.0064 77  THR A O     
356  C CB    . THR A 51  ? 0.5454 0.6096 0.6820 0.0075  0.0767  -0.0116 77  THR A CB    
357  O OG1   . THR A 51  ? 0.5468 0.6135 0.6871 0.0034  0.0589  -0.0167 77  THR A OG1   
358  C CG2   . THR A 51  ? 0.5118 0.5876 0.6677 0.0093  0.0657  -0.0064 77  THR A CG2   
359  N N     . ILE A 52  ? 0.5675 0.6046 0.6444 0.0088  0.1164  -0.0069 78  ILE A N     
360  C CA    . ILE A 52  ? 0.5747 0.6072 0.6348 0.0065  0.1338  -0.0085 78  ILE A CA    
361  C C     . ILE A 52  ? 0.5861 0.6032 0.5993 0.0100  0.1264  -0.0035 78  ILE A C     
362  O O     . ILE A 52  ? 0.5869 0.6059 0.5890 0.0137  0.1278  -0.0067 78  ILE A O     
363  C CB    . ILE A 52  ? 0.5961 0.6237 0.6602 -0.0080 0.1602  -0.0111 78  ILE A CB    
364  C CG1   . ILE A 52  ? 0.5839 0.6331 0.7138 -0.0097 0.1680  -0.0207 78  ILE A CG1   
365  C CG2   . ILE A 52  ? 0.6191 0.6403 0.6500 -0.0145 0.1799  -0.0172 78  ILE A CG2   
366  C CD1   . ILE A 52  ? 0.6007 0.6518 0.7476 -0.0277 0.1978  -0.0256 78  ILE A CD1   
367  N N     . GLN A 53  ? 0.5929 0.5939 0.5883 0.0094  0.1152  0.0029  79  GLN A N     
368  C CA    . GLN A 53  ? 0.5998 0.5884 0.5692 0.0152  0.1006  0.0061  79  GLN A CA    
369  C C     . GLN A 53  ? 0.5697 0.5786 0.5495 0.0257  0.0930  -0.0014 79  GLN A C     
370  O O     . GLN A 53  ? 0.5811 0.5872 0.5459 0.0288  0.0887  -0.0012 79  GLN A O     
371  C CB    . GLN A 53  ? 0.6149 0.5863 0.5887 0.0163  0.0840  0.0100  79  GLN A CB    
372  C CG    . GLN A 53  ? 0.6493 0.5903 0.6022 0.0015  0.0847  0.0260  79  GLN A CG    
373  C CD    . GLN A 53  ? 0.6652 0.5911 0.6440 0.0016  0.0687  0.0287  79  GLN A CD    
374  O OE1   . GLN A 53  ? 0.6094 0.5520 0.6234 0.0121  0.0626  0.0128  79  GLN A OE1   
375  N NE2   . GLN A 53  ? 0.7068 0.5989 0.6658 -0.0131 0.0610  0.0487  79  GLN A NE2   
376  N N     . SER A 54  ? 0.5434 0.5718 0.5457 0.0275  0.0904  -0.0068 80  SER A N     
377  C CA    . SER A 54  ? 0.5297 0.5772 0.5341 0.0303  0.0841  -0.0107 80  SER A CA    
378  C C     . SER A 54  ? 0.5276 0.5797 0.5325 0.0301  0.0866  -0.0056 80  SER A C     
379  O O     . SER A 54  ? 0.5263 0.5824 0.5236 0.0320  0.0833  -0.0058 80  SER A O     
380  C CB    . SER A 54  ? 0.5243 0.5872 0.5393 0.0255  0.0783  -0.0148 80  SER A CB    
381  O OG    . SER A 54  ? 0.5291 0.5902 0.5471 0.0265  0.0752  -0.0266 80  SER A OG    
382  N N     . ILE A 55  ? 0.5255 0.5777 0.5494 0.0278  0.0920  -0.0036 81  ILE A N     
383  C CA    . ILE A 55  ? 0.5212 0.5753 0.5598 0.0288  0.0931  -0.0031 81  ILE A CA    
384  C C     . ILE A 55  ? 0.5345 0.5752 0.5508 0.0300  0.1033  -0.0091 81  ILE A C     
385  O O     . ILE A 55  ? 0.5351 0.5759 0.5541 0.0319  0.0998  -0.0108 81  ILE A O     
386  C CB    . ILE A 55  ? 0.5208 0.5808 0.6046 0.0275  0.0943  -0.0048 81  ILE A CB    
387  C CG1   . ILE A 55  ? 0.5285 0.5897 0.6430 0.0300  0.0884  -0.0055 81  ILE A CG1   
388  C CG2   . ILE A 55  ? 0.5206 0.5762 0.6132 0.0244  0.1160  -0.0151 81  ILE A CG2   
389  C CD1   . ILE A 55  ? 0.5221 0.5876 0.6387 0.0263  0.0635  0.0113  81  ILE A CD1   
390  N N     . ILE A 56  ? 0.5487 0.5755 0.5397 0.0262  0.1126  -0.0107 82  ILE A N     
391  C CA    . ILE A 56  ? 0.5736 0.5831 0.5281 0.0224  0.1166  -0.0134 82  ILE A CA    
392  C C     . ILE A 56  ? 0.5754 0.5815 0.5162 0.0282  0.0976  -0.0090 82  ILE A C     
393  O O     . ILE A 56  ? 0.5938 0.5956 0.5248 0.0287  0.0936  -0.0131 82  ILE A O     
394  C CB    . ILE A 56  ? 0.6073 0.5979 0.5290 0.0106  0.1265  -0.0092 82  ILE A CB    
395  C CG1   . ILE A 56  ? 0.6219 0.6195 0.5575 0.0006  0.1543  -0.0205 82  ILE A CG1   
396  C CG2   . ILE A 56  ? 0.6314 0.5973 0.5008 0.0037  0.1167  -0.0039 82  ILE A CG2   
397  C CD1   . ILE A 56  ? 0.6394 0.6209 0.5401 -0.0181 0.1703  -0.0149 82  ILE A CD1   
398  N N     . ALA A 57  ? 0.5607 0.5707 0.5088 0.0325  0.0864  -0.0048 83  ALA A N     
399  C CA    . ALA A 57  ? 0.5576 0.5715 0.5104 0.0382  0.0716  -0.0062 83  ALA A CA    
400  C C     . ALA A 57  ? 0.5406 0.5716 0.5082 0.0392  0.0718  -0.0087 83  ALA A C     
401  O O     . ALA A 57  ? 0.5563 0.5855 0.5238 0.0408  0.0627  -0.0106 83  ALA A O     
402  C CB    . ALA A 57  ? 0.5459 0.5702 0.5192 0.0423  0.0663  -0.0105 83  ALA A CB    
403  N N     . ILE A 58  ? 0.5214 0.5664 0.5046 0.0365  0.0781  -0.0065 84  ILE A N     
404  C CA    . ILE A 58  ? 0.5080 0.5644 0.5066 0.0336  0.0744  -0.0029 84  ILE A CA    
405  C C     . ILE A 58  ? 0.5219 0.5654 0.5234 0.0347  0.0748  -0.0069 84  ILE A C     
406  O O     . ILE A 58  ? 0.5241 0.5690 0.5331 0.0338  0.0677  -0.0069 84  ILE A O     
407  C CB    . ILE A 58  ? 0.4994 0.5677 0.5125 0.0273  0.0724  0.0059  84  ILE A CB    
408  C CG1   . ILE A 58  ? 0.4939 0.5764 0.4967 0.0226  0.0730  0.0046  84  ILE A CG1   
409  C CG2   . ILE A 58  ? 0.5001 0.5736 0.5276 0.0202  0.0633  0.0163  84  ILE A CG2   
410  C CD1   . ILE A 58  ? 0.4974 0.5862 0.5031 0.0137  0.0660  0.0137  84  ILE A CD1   
411  N N     . ILE A 59  ? 0.5377 0.5704 0.5364 0.0349  0.0854  -0.0139 85  ILE A N     
412  C CA    . ILE A 59  ? 0.5549 0.5767 0.5544 0.0341  0.0913  -0.0271 85  ILE A CA    
413  C C     . ILE A 59  ? 0.5772 0.5856 0.5421 0.0328  0.0831  -0.0309 85  ILE A C     
414  O O     . ILE A 59  ? 0.5881 0.5927 0.5609 0.0327  0.0769  -0.0385 85  ILE A O     
415  C CB    . ILE A 59  ? 0.5777 0.5947 0.5764 0.0303  0.1124  -0.0405 85  ILE A CB    
416  C CG1   . ILE A 59  ? 0.5619 0.5926 0.6075 0.0323  0.1159  -0.0377 85  ILE A CG1   
417  C CG2   . ILE A 59  ? 0.5933 0.6021 0.5910 0.0270  0.1239  -0.0631 85  ILE A CG2   
418  C CD1   . ILE A 59  ? 0.5722 0.6101 0.6710 0.0364  0.1013  -0.0342 85  ILE A CD1   
419  N N     . ARG A 60  ? 0.5897 0.5887 0.5224 0.0314  0.0781  -0.0249 86  ARG A N     
420  C CA    . ARG A 60  ? 0.6213 0.6039 0.5244 0.0294  0.0609  -0.0246 86  ARG A CA    
421  C C     . ARG A 60  ? 0.6025 0.5972 0.5355 0.0348  0.0445  -0.0236 86  ARG A C     
422  O O     . ARG A 60  ? 0.6268 0.6114 0.5516 0.0329  0.0313  -0.0291 86  ARG A O     
423  C CB    . ARG A 60  ? 0.6352 0.6035 0.5141 0.0276  0.0505  -0.0135 86  ARG A CB    
424  C CG    . ARG A 60  ? 0.6790 0.6298 0.5182 0.0158  0.0651  -0.0108 86  ARG A CG    
425  C CD    . ARG A 60  ? 0.7193 0.6403 0.5174 0.0073  0.0437  0.0041  86  ARG A CD    
426  N NE    . ARG A 60  ? 0.7711 0.6771 0.5341 -0.0077 0.0592  0.0118  86  ARG A NE    
427  C CZ    . ARG A 60  ? 0.8377 0.7294 0.5462 -0.0278 0.0767  0.0077  86  ARG A CZ    
428  N NH1   . ARG A 60  ? 0.8716 0.7598 0.5523 -0.0336 0.0787  -0.0069 86  ARG A NH1   
429  N NH2   . ARG A 60  ? 0.8730 0.7546 0.5547 -0.0447 0.0942  0.0159  86  ARG A NH2   
430  N N     . ALA A 61  ? 0.5676 0.5848 0.5332 0.0387  0.0463  -0.0180 87  ALA A N     
431  C CA    . ALA A 61  ? 0.5507 0.5863 0.5483 0.0390  0.0385  -0.0180 87  ALA A CA    
432  C C     . ALA A 61  ? 0.5488 0.5856 0.5623 0.0348  0.0386  -0.0185 87  ALA A C     
433  O O     . ALA A 61  ? 0.5470 0.5871 0.5783 0.0330  0.0279  -0.0208 87  ALA A O     
434  C CB    . ALA A 61  ? 0.5225 0.5838 0.5407 0.0376  0.0475  -0.0152 87  ALA A CB    
435  N N     . MET A 62  ? 0.5502 0.5834 0.5666 0.0334  0.0480  -0.0175 88  MET A N     
436  C CA    . MET A 62  ? 0.5607 0.5898 0.6033 0.0307  0.0438  -0.0196 88  MET A CA    
437  C C     . MET A 62  ? 0.5866 0.5981 0.6173 0.0314  0.0363  -0.0360 88  MET A C     
438  O O     . MET A 62  ? 0.5882 0.5985 0.6440 0.0288  0.0253  -0.0383 88  MET A O     
439  C CB    . MET A 62  ? 0.5631 0.5887 0.6241 0.0316  0.0516  -0.0205 88  MET A CB    
440  C CG    . MET A 62  ? 0.5490 0.5883 0.6253 0.0271  0.0495  -0.0014 88  MET A CG    
441  S SD    . MET A 62  ? 0.5846 0.6181 0.6963 0.0305  0.0517  -0.0046 88  MET A SD    
442  C CE    . MET A 62  ? 0.5611 0.5833 0.7270 0.0290  0.0348  -0.0044 88  MET A CE    
443  N N     . GLY A 63  ? 0.6100 0.6064 0.5982 0.0317  0.0407  -0.0463 89  GLY A N     
444  C CA    . GLY A 63  ? 0.6565 0.6333 0.6147 0.0277  0.0309  -0.0615 89  GLY A CA    
445  C C     . GLY A 63  ? 0.6638 0.6409 0.6278 0.0280  0.0061  -0.0557 89  GLY A C     
446  O O     . GLY A 63  ? 0.6753 0.6461 0.6510 0.0254  -0.0075 -0.0655 89  GLY A O     
447  N N     . ARG A 64  ? 0.6558 0.6414 0.6215 0.0314  -0.0005 -0.0429 90  ARG A N     
448  C CA    . ARG A 64  ? 0.6632 0.6542 0.6524 0.0333  -0.0239 -0.0404 90  ARG A CA    
449  C C     . ARG A 64  ? 0.6302 0.6457 0.6754 0.0318  -0.0221 -0.0398 90  ARG A C     
450  O O     . ARG A 64  ? 0.6361 0.6520 0.7054 0.0299  -0.0406 -0.0448 90  ARG A O     
451  C CB    . ARG A 64  ? 0.6603 0.6589 0.6576 0.0387  -0.0278 -0.0323 90  ARG A CB    
452  C CG    . ARG A 64  ? 0.7349 0.7049 0.6809 0.0369  -0.0368 -0.0265 90  ARG A CG    
453  C CD    . ARG A 64  ? 0.8020 0.7794 0.7749 0.0441  -0.0438 -0.0201 90  ARG A CD    
454  N NE    . ARG A 64  ? 0.8974 0.8415 0.8412 0.0415  -0.0746 -0.0102 90  ARG A NE    
455  C CZ    . ARG A 64  ? 0.9180 0.8599 0.9009 0.0489  -0.0983 -0.0065 90  ARG A CZ    
456  N NH1   . ARG A 64  ? 0.8753 0.8517 0.9287 0.0597  -0.0882 -0.0186 90  ARG A NH1   
457  N NH2   . ARG A 64  ? 0.9868 0.8905 0.9392 0.0434  -0.1335 0.0084  90  ARG A NH2   
458  N N     . LEU A 65  ? 0.5985 0.6323 0.6618 0.0296  -0.0021 -0.0317 91  LEU A N     
459  C CA    . LEU A 65  ? 0.5795 0.6367 0.6867 0.0216  0.0015  -0.0245 91  LEU A CA    
460  C C     . LEU A 65  ? 0.5899 0.6361 0.7144 0.0157  -0.0032 -0.0235 91  LEU A C     
461  O O     . LEU A 65  ? 0.5812 0.6415 0.7406 0.0049  -0.0034 -0.0131 91  LEU A O     
462  C CB    . LEU A 65  ? 0.5577 0.6374 0.6670 0.0163  0.0206  -0.0128 91  LEU A CB    
463  C CG    . LEU A 65  ? 0.5464 0.6454 0.6590 0.0198  0.0276  -0.0186 91  LEU A CG    
464  C CD1   . LEU A 65  ? 0.5257 0.6422 0.6269 0.0122  0.0468  -0.0111 91  LEU A CD1   
465  C CD2   . LEU A 65  ? 0.5576 0.6795 0.7156 0.0160  0.0236  -0.0271 91  LEU A CD2   
466  N N     . LYS A 66  ? 0.6141 0.6352 0.7163 0.0207  -0.0060 -0.0362 92  LYS A N     
467  C CA    . LYS A 66  ? 0.6327 0.6399 0.7594 0.0181  -0.0097 -0.0429 92  LYS A CA    
468  C C     . LYS A 66  ? 0.6161 0.6318 0.7777 0.0117  -0.0055 -0.0226 92  LYS A C     
469  O O     . LYS A 66  ? 0.6193 0.6346 0.8199 0.0024  -0.0164 -0.0124 92  LYS A O     
470  C CB    . LYS A 66  ? 0.6557 0.6543 0.8040 0.0143  -0.0291 -0.0542 92  LYS A CB    
471  C CG    . LYS A 66  ? 0.7076 0.6832 0.8703 0.0149  -0.0341 -0.0759 92  LYS A CG    
472  C CD    . LYS A 66  ? 0.7823 0.7396 0.8906 0.0187  -0.0264 -0.1035 92  LYS A CD    
473  C CE    . LYS A 66  ? 0.8383 0.7791 0.9680 0.0193  -0.0207 -0.1335 92  LYS A CE    
474  N NZ    . LYS A 66  ? 0.8769 0.8054 1.0409 0.0151  -0.0420 -0.1490 92  LYS A NZ    
475  N N     . ILE A 67  ? 0.6037 0.6247 0.7498 0.0142  0.0065  -0.0140 93  ILE A N     
476  C CA    . ILE A 67  ? 0.6030 0.6256 0.7747 0.0075  0.0039  0.0062  93  ILE A CA    
477  C C     . ILE A 67  ? 0.6135 0.6202 0.8010 0.0175  0.0067  -0.0094 93  ILE A C     
478  O O     . ILE A 67  ? 0.6077 0.6144 0.7664 0.0255  0.0218  -0.0249 93  ILE A O     
479  C CB    . ILE A 67  ? 0.5913 0.6335 0.7375 0.0012  0.0132  0.0247  93  ILE A CB    
480  C CG1   . ILE A 67  ? 0.5879 0.6527 0.7243 -0.0081 0.0187  0.0296  93  ILE A CG1   
481  C CG2   . ILE A 67  ? 0.5939 0.6331 0.7586 -0.0098 0.0026  0.0498  93  ILE A CG2   
482  C CD1   . ILE A 67  ? 0.5693 0.6552 0.6777 -0.0118 0.0331  0.0336  93  ILE A CD1   
483  N N     . ASP A 68  ? 0.6269 0.6203 0.8669 0.0157  -0.0077 -0.0068 94  ASP A N     
484  C CA    . ASP A 68  ? 0.6456 0.6272 0.9241 0.0257  -0.0052 -0.0276 94  ASP A CA    
485  C C     . ASP A 68  ? 0.6311 0.6176 0.9286 0.0251  -0.0101 -0.0075 94  ASP A C     
486  O O     . ASP A 68  ? 0.6254 0.6179 0.9100 0.0130  -0.0227 0.0267  94  ASP A O     
487  C CB    . ASP A 68  ? 0.6742 0.6369 1.0180 0.0261  -0.0231 -0.0391 94  ASP A CB    
488  C CG    . ASP A 68  ? 0.7173 0.6734 1.0442 0.0261  -0.0212 -0.0640 94  ASP A CG    
489  O OD1   . ASP A 68  ? 0.7462 0.7072 1.0152 0.0291  -0.0041 -0.0835 94  ASP A OD1   
490  O OD2   . ASP A 68  ? 0.7617 0.7047 1.1339 0.0213  -0.0410 -0.0619 94  ASP A OD2   
491  N N     . PHE A 69  ? 0.6285 0.6136 0.9557 0.0356  0.0005  -0.0309 95  PHE A N     
492  C CA    . PHE A 69  ? 0.6211 0.6088 0.9855 0.0365  -0.0101 -0.0156 95  PHE A CA    
493  C C     . PHE A 69  ? 0.6431 0.6139 1.0749 0.0307  -0.0474 0.0088  95  PHE A C     
494  O O     . PHE A 69  ? 0.6627 0.6186 1.1411 0.0331  -0.0576 -0.0040 95  PHE A O     
495  C CB    . PHE A 69  ? 0.6164 0.6089 1.0174 0.0486  0.0116  -0.0527 95  PHE A CB    
496  C CG    . PHE A 69  ? 0.5890 0.5939 0.9222 0.0493  0.0455  -0.0705 95  PHE A CG    
497  C CD1   . PHE A 69  ? 0.5570 0.5731 0.8499 0.0461  0.0499  -0.0507 95  PHE A CD1   
498  C CD2   . PHE A 69  ? 0.5817 0.5839 0.8882 0.0504  0.0704  -0.1061 95  PHE A CD2   
499  C CE1   . PHE A 69  ? 0.5503 0.5727 0.7854 0.0451  0.0765  -0.0631 95  PHE A CE1   
500  C CE2   . PHE A 69  ? 0.5824 0.5902 0.8200 0.0462  0.0964  -0.1156 95  PHE A CE2   
501  C CZ    . PHE A 69  ? 0.5627 0.5796 0.7687 0.0442  0.0986  -0.0926 95  PHE A CZ    
502  N N     . GLY A 70  ? 0.6901 0.7759 1.0471 0.0953  0.0458  0.0882  96  GLY A N     
503  C CA    . GLY A 70  ? 0.7358 0.7856 1.0828 0.1072  0.0557  0.0981  96  GLY A CA    
504  C C     . GLY A 70  ? 0.7464 0.7854 1.0916 0.1029  0.0357  0.0731  96  GLY A C     
505  O O     . GLY A 70  ? 0.7728 0.7852 1.1390 0.0975  0.0393  0.0776  96  GLY A O     
506  N N     . ASP A 71  ? 0.7331 0.7880 1.0555 0.1065  0.0201  0.0491  97  ASP A N     
507  C CA    . ASP A 71  ? 0.7455 0.7910 1.0699 0.1077  0.0116  0.0275  97  ASP A CA    
508  C C     . ASP A 71  ? 0.7309 0.7890 1.0539 0.0897  0.0028  0.0037  97  ASP A C     
509  O O     . ASP A 71  ? 0.7032 0.7896 1.0167 0.0873  -0.0009 -0.0004 97  ASP A O     
510  C CB    . ASP A 71  ? 0.7488 0.8033 1.0594 0.1308  0.0055  0.0270  97  ASP A CB    
511  C CG    . ASP A 71  ? 0.7984 0.8302 1.0863 0.1504  0.0062  0.0520  97  ASP A CG    
512  O OD1   . ASP A 71  ? 0.8285 0.8448 1.0947 0.1498  0.0183  0.0696  97  ASP A OD1   
513  O OD2   . ASP A 71  ? 0.8291 0.8547 1.1185 0.1695  -0.0031 0.0574  97  ASP A OD2   
514  N N     . SER A 72  ? 0.7673 0.7916 1.0866 0.0774  0.0004  -0.0117 98  SER A N     
515  C CA    . SER A 72  ? 0.7889 0.8040 1.0835 0.0595  -0.0099 -0.0334 98  SER A CA    
516  C C     . SER A 72  ? 0.7836 0.8114 1.0568 0.0736  0.0010  -0.0495 98  SER A C     
517  O O     . SER A 72  ? 0.7984 0.8223 1.0427 0.0629  -0.0032 -0.0629 98  SER A O     
518  C CB    . SER A 72  ? 0.8579 0.8089 1.1288 0.0415  -0.0175 -0.0484 98  SER A CB    
519  O OG    . SER A 72  ? 0.9071 0.8202 1.1778 0.0589  0.0009  -0.0483 98  SER A OG    
520  N N     . ALA A 73  ? 0.7749 0.8181 1.0671 0.0974  0.0140  -0.0442 99  ALA A N     
521  C CA    . ALA A 73  ? 0.7612 0.8294 1.0606 0.1097  0.0256  -0.0513 99  ALA A CA    
522  C C     . ALA A 73  ? 0.7217 0.8298 1.0184 0.0997  0.0156  -0.0491 99  ALA A C     
523  O O     . ALA A 73  ? 0.7210 0.8405 1.0147 0.0998  0.0262  -0.0581 99  ALA A O     
524  C CB    . ALA A 73  ? 0.7583 0.8464 1.0998 0.1341  0.0304  -0.0376 99  ALA A CB    
525  N N     . ARG A 74  ? 0.6988 0.8199 0.9940 0.0934  0.0022  -0.0350 100 ARG A N     
526  C CA    . ARG A 74  ? 0.6706 0.8153 0.9539 0.0872  -0.0022 -0.0310 100 ARG A CA    
527  C C     . ARG A 74  ? 0.6695 0.8120 0.9329 0.0736  -0.0007 -0.0413 100 ARG A C     
528  O O     . ARG A 74  ? 0.6529 0.8098 0.9047 0.0712  0.0019  -0.0423 100 ARG A O     
529  C CB    . ARG A 74  ? 0.6679 0.8099 0.9441 0.0891  -0.0046 -0.0107 100 ARG A CB    
530  C CG    . ARG A 74  ? 0.6954 0.8256 0.9656 0.1045  -0.0084 0.0022  100 ARG A CG    
531  C CD    . ARG A 74  ? 0.7221 0.8646 0.9857 0.1089  -0.0229 -0.0023 100 ARG A CD    
532  N NE    . ARG A 74  ? 0.7566 0.8976 1.0393 0.1229  -0.0350 0.0048  100 ARG A NE    
533  C CZ    . ARG A 74  ? 0.7438 0.9034 1.0725 0.1291  -0.0325 -0.0010 100 ARG A CZ    
534  N NH1   . ARG A 74  ? 0.7685 0.9283 1.1208 0.1462  -0.0434 0.0118  100 ARG A NH1   
535  N NH2   . ARG A 74  ? 0.7319 0.9031 1.0782 0.1219  -0.0157 -0.0168 100 ARG A NH2   
536  N N     . ALA A 75  ? 0.6970 0.8129 0.9491 0.0635  -0.0060 -0.0485 101 ALA A N     
537  C CA    . ALA A 75  ? 0.7179 0.8205 0.9379 0.0498  -0.0145 -0.0566 101 ALA A CA    
538  C C     . ALA A 75  ? 0.7334 0.8270 0.9234 0.0566  0.0043  -0.0721 101 ALA A C     
539  O O     . ALA A 75  ? 0.7357 0.8324 0.9010 0.0520  0.0041  -0.0724 101 ALA A O     
540  C CB    . ALA A 75  ? 0.7706 0.8307 0.9714 0.0336  -0.0330 -0.0639 101 ALA A CB    
541  N N     . ASP A 76  ? 0.7497 0.8324 0.9489 0.0700  0.0250  -0.0805 102 ASP A N     
542  C CA    . ASP A 76  ? 0.7655 0.8462 0.9584 0.0796  0.0535  -0.0881 102 ASP A CA    
543  C C     . ASP A 76  ? 0.7090 0.8402 0.9412 0.0795  0.0544  -0.0778 102 ASP A C     
544  O O     . ASP A 76  ? 0.7115 0.8424 0.9279 0.0763  0.0691  -0.0804 102 ASP A O     
545  C CB    . ASP A 76  ? 0.8075 0.8658 1.0166 0.0982  0.0815  -0.0928 102 ASP A CB    
546  C CG    . ASP A 76  ? 0.9100 0.8873 1.0453 0.0978  0.0915  -0.1101 102 ASP A CG    
547  O OD1   . ASP A 76  ? 0.9789 0.9109 1.0459 0.0946  0.1044  -0.1217 102 ASP A OD1   
548  O OD2   . ASP A 76  ? 0.9518 0.8996 1.0862 0.0998  0.0855  -0.1122 102 ASP A OD2   
549  N N     . ASP A 77  ? 0.6727 0.8355 0.9447 0.0815  0.0377  -0.0660 103 ASP A N     
550  C CA    . ASP A 77  ? 0.6500 0.8408 0.9355 0.0753  0.0275  -0.0581 103 ASP A CA    
551  C C     . ASP A 77  ? 0.6489 0.8295 0.8922 0.0654  0.0274  -0.0582 103 ASP A C     
552  O O     . ASP A 77  ? 0.6446 0.8295 0.8833 0.0595  0.0364  -0.0595 103 ASP A O     
553  C CB    . ASP A 77  ? 0.6418 0.8397 0.9368 0.0788  0.0045  -0.0461 103 ASP A CB    
554  C CG    . ASP A 77  ? 0.6501 0.8673 0.9946 0.0888  -0.0039 -0.0395 103 ASP A CG    
555  O OD1   . ASP A 77  ? 0.6649 0.9019 1.0552 0.0928  0.0108  -0.0409 103 ASP A OD1   
556  O OD2   . ASP A 77  ? 0.6659 0.8772 1.0056 0.0952  -0.0236 -0.0288 103 ASP A OD2   
557  N N     . ALA A 78  ? 0.6553 0.8237 0.8771 0.0639  0.0180  -0.0531 104 ALA A N     
558  C CA    . ALA A 78  ? 0.6588 0.8236 0.8550 0.0592  0.0163  -0.0451 104 ALA A CA    
559  C C     . ALA A 78  ? 0.6880 0.8371 0.8522 0.0553  0.0256  -0.0543 104 ALA A C     
560  O O     . ALA A 78  ? 0.6952 0.8428 0.8409 0.0545  0.0336  -0.0497 104 ALA A O     
561  C CB    . ALA A 78  ? 0.6562 0.8216 0.8627 0.0576  0.0025  -0.0312 104 ALA A CB    
562  N N     . ARG A 79  ? 0.7238 0.8482 0.8694 0.0549  0.0282  -0.0669 105 ARG A N     
563  C CA    . ARG A 79  ? 0.7781 0.8680 0.8721 0.0550  0.0437  -0.0767 105 ARG A CA    
564  C C     . ARG A 79  ? 0.7699 0.8716 0.8804 0.0592  0.0751  -0.0776 105 ARG A C     
565  O O     . ARG A 79  ? 0.7951 0.8812 0.8717 0.0582  0.0890  -0.0755 105 ARG A O     
566  C CB    . ARG A 79  ? 0.8405 0.8820 0.8972 0.0573  0.0486  -0.0920 105 ARG A CB    
567  C CG    . ARG A 79  ? 0.9335 0.9116 0.8993 0.0542  0.0475  -0.1009 105 ARG A CG    
568  C CD    . ARG A 79  ? 1.0354 0.9446 0.9443 0.0531  0.0443  -0.1180 105 ARG A CD    
569  N NE    . ARG A 79  ? 1.0457 0.9495 0.9550 0.0337  -0.0062 -0.1156 105 ARG A NE    
570  C CZ    . ARG A 79  ? 1.0121 0.9338 0.9745 0.0294  -0.0174 -0.1137 105 ARG A CZ    
571  N NH1   . ARG A 79  ? 0.9663 0.9120 0.9794 0.0457  0.0136  -0.1141 105 ARG A NH1   
572  N NH2   . ARG A 79  ? 1.0211 0.9376 0.9919 0.0080  -0.0620 -0.1077 105 ARG A NH2   
573  N N     . GLN A 80  ? 0.7407 0.8707 0.9095 0.0628  0.0831  -0.0771 106 GLN A N     
574  C CA    . GLN A 80  ? 0.7312 0.8829 0.9445 0.0619  0.1065  -0.0738 106 GLN A CA    
575  C C     . GLN A 80  ? 0.7042 0.8711 0.9221 0.0492  0.0956  -0.0669 106 GLN A C     
576  O O     . GLN A 80  ? 0.7158 0.8831 0.9458 0.0423  0.1162  -0.0645 106 GLN A O     
577  C CB    . GLN A 80  ? 0.7131 0.8978 0.9995 0.0681  0.1035  -0.0694 106 GLN A CB    
578  C CG    . GLN A 80  ? 0.7231 0.9426 1.0846 0.0648  0.1209  -0.0599 106 GLN A CG    
579  C CD    . GLN A 80  ? 0.7649 0.9758 1.1560 0.0824  0.1687  -0.0570 106 GLN A CD    
580  O OE1   . GLN A 80  ? 0.7683 1.0155 1.2440 0.0825  0.1894  -0.0427 106 GLN A OE1   
581  N NE2   . GLN A 80  ? 0.8184 0.9757 1.1408 0.0971  0.1875  -0.0686 106 GLN A NE2   
582  N N     . LEU A 81  ? 0.6761 0.8464 0.8811 0.0468  0.0685  -0.0624 107 LEU A N     
583  C CA    . LEU A 81  ? 0.6675 0.8310 0.8557 0.0385  0.0618  -0.0568 107 LEU A CA    
584  C C     . LEU A 81  ? 0.6893 0.8296 0.8389 0.0367  0.0827  -0.0550 107 LEU A C     
585  O O     . LEU A 81  ? 0.6996 0.8298 0.8483 0.0260  0.0914  -0.0539 107 LEU A O     
586  C CB    . LEU A 81  ? 0.6617 0.8172 0.8272 0.0451  0.0443  -0.0485 107 LEU A CB    
587  C CG    . LEU A 81  ? 0.6748 0.8021 0.7999 0.0452  0.0472  -0.0401 107 LEU A CG    
588  C CD1   . LEU A 81  ? 0.6894 0.8000 0.8089 0.0314  0.0360  -0.0457 107 LEU A CD1   
589  C CD2   . LEU A 81  ? 0.6661 0.7864 0.7789 0.0591  0.0445  -0.0258 107 LEU A CD2   
590  N N     . PHE A 82  ? 0.7038 0.8295 0.8178 0.0453  0.0871  -0.0538 108 PHE A N     
591  C CA    . PHE A 82  ? 0.7386 0.8368 0.8057 0.0476  0.1028  -0.0482 108 PHE A CA    
592  C C     . PHE A 82  ? 0.7722 0.8544 0.8360 0.0443  0.1364  -0.0534 108 PHE A C     
593  O O     . PHE A 82  ? 0.8031 0.8622 0.8402 0.0424  0.1562  -0.0472 108 PHE A O     
594  C CB    . PHE A 82  ? 0.7589 0.8435 0.7866 0.0555  0.0854  -0.0424 108 PHE A CB    
595  C CG    . PHE A 82  ? 0.7289 0.8340 0.7765 0.0595  0.0608  -0.0272 108 PHE A CG    
596  C CD1   . PHE A 82  ? 0.7374 0.8386 0.7738 0.0678  0.0634  -0.0073 108 PHE A CD1   
597  C CD2   . PHE A 82  ? 0.6974 0.8230 0.7797 0.0578  0.0420  -0.0285 108 PHE A CD2   
598  C CE1   . PHE A 82  ? 0.7151 0.8367 0.7828 0.0762  0.0518  0.0134  108 PHE A CE1   
599  C CE2   . PHE A 82  ? 0.6894 0.8336 0.7996 0.0629  0.0289  -0.0090 108 PHE A CE2   
600  C CZ    . PHE A 82  ? 0.6861 0.8304 0.7930 0.0731  0.0360  0.0132  108 PHE A CZ    
601  N N     . VAL A 83  ? 0.7728 0.8638 0.8672 0.0462  0.1491  -0.0614 109 VAL A N     
602  C CA    . VAL A 83  ? 0.8029 0.8828 0.9131 0.0468  0.1924  -0.0606 109 VAL A CA    
603  C C     . VAL A 83  ? 0.7768 0.8899 0.9617 0.0290  0.1961  -0.0541 109 VAL A C     
604  O O     . VAL A 83  ? 0.8031 0.8994 0.9853 0.0210  0.2230  -0.0475 109 VAL A O     
605  C CB    . VAL A 83  ? 0.8256 0.9013 0.9535 0.0597  0.2137  -0.0664 109 VAL A CB    
606  C CG1   . VAL A 83  ? 0.8662 0.9303 1.0216 0.0652  0.2716  -0.0586 109 VAL A CG1   
607  C CG2   . VAL A 83  ? 0.8680 0.8921 0.9055 0.0710  0.2031  -0.0764 109 VAL A CG2   
608  N N     . LEU A 84  ? 0.6600 1.0286 0.8044 -0.0107 0.0964  -0.0792 110 LEU A N     
609  C CA    . LEU A 84  ? 0.6607 0.9934 0.8207 -0.0165 0.0978  -0.0679 110 LEU A CA    
610  C C     . LEU A 84  ? 0.6751 0.9777 0.8145 -0.0182 0.1042  -0.0328 110 LEU A C     
611  O O     . LEU A 84  ? 0.6836 0.9778 0.8346 -0.0240 0.1153  -0.0213 110 LEU A O     
612  C CB    . LEU A 84  ? 0.6401 0.9393 0.8294 -0.0158 0.0788  -0.0843 110 LEU A CB    
613  C CG    . LEU A 84  ? 0.6265 0.9474 0.8546 -0.0149 0.0724  -0.1189 110 LEU A CG    
614  C CD1   . LEU A 84  ? 0.6081 0.8938 0.8655 -0.0127 0.0533  -0.1240 110 LEU A CD1   
615  C CD2   . LEU A 84  ? 0.6222 0.9721 0.8682 -0.0205 0.0864  -0.1314 110 LEU A CD2   
616  N N     . ALA A 85  ? 0.6806 0.9672 0.7957 -0.0133 0.0974  -0.0182 111 ALA A N     
617  C CA    . ALA A 85  ? 0.6966 0.9574 0.7971 -0.0140 0.1034  0.0127  111 ALA A CA    
618  C C     . ALA A 85  ? 0.7242 1.0159 0.8130 -0.0146 0.1241  0.0370  111 ALA A C     
619  O O     . ALA A 85  ? 0.7324 1.0075 0.8308 -0.0185 0.1359  0.0604  111 ALA A O     
620  C CB    . ALA A 85  ? 0.6880 0.9300 0.7667 -0.0081 0.0911  0.0198  111 ALA A CB    
621  N N     . GLY A 86  ? 0.7453 1.0863 0.8175 -0.0105 0.1287  0.0308  112 GLY A N     
622  C CA    . GLY A 86  ? 0.7843 1.1707 0.8430 -0.0101 0.1486  0.0547  112 GLY A CA    
623  C C     . GLY A 86  ? 0.8052 1.2088 0.8869 -0.0179 0.1648  0.0544  112 GLY A C     
624  O O     . GLY A 86  ? 0.8275 1.2512 0.9071 -0.0196 0.1840  0.0864  112 GLY A O     
625  N N     . ALA A 87  ? 0.8030 1.2002 0.9102 -0.0223 0.1577  0.0204  113 ALA A N     
626  C CA    . ALA A 87  ? 0.8216 1.2307 0.9560 -0.0304 0.1717  0.0154  113 ALA A CA    
627  C C     . ALA A 87  ? 0.8338 1.1983 0.9886 -0.0362 0.1794  0.0396  113 ALA A C     
628  O O     . ALA A 87  ? 0.8478 1.2209 1.0259 -0.0434 0.1959  0.0462  113 ALA A O     
629  C CB    . ALA A 87  ? 0.8027 1.2124 0.9645 -0.0326 0.1597  -0.0274 113 ALA A CB    
630  N N     . ALA A 88  ? 0.8312 1.1508 0.9812 -0.0335 0.1675  0.0491  114 ALA A N     
631  C CA    . ALA A 88  ? 0.8432 1.1259 1.0110 -0.0373 0.1755  0.0741  114 ALA A CA    
632  C C     . ALA A 88  ? 0.8373 1.0924 1.0446 -0.0451 0.1746  0.0569  114 ALA A C     
633  O O     . ALA A 88  ? 0.8242 1.0583 1.0376 -0.0445 0.1558  0.0312  114 ALA A O     
634  C CB    . ALA A 88  ? 0.8698 1.1757 1.0360 -0.0377 0.1994  0.1152  114 ALA A CB    
635  N N     . GLU A 89  ? 0.8544 1.1138 1.0908 -0.0522 0.1954  0.0723  115 GLU A N     
636  C CA    . GLU A 89  ? 0.8524 1.0831 1.1328 -0.0599 0.1980  0.0616  115 GLU A CA    
637  C C     . GLU A 89  ? 0.8395 1.0310 1.1235 -0.0578 0.1857  0.0626  115 GLU A C     
638  O O     . GLU A 89  ? 0.8190 0.9936 1.1034 -0.0568 0.1659  0.0367  115 GLU A O     
639  C CB    . GLU A 89  ? 0.8424 1.0792 1.1404 -0.0632 0.1879  0.0243  115 GLU A CB    
640  C CG    . GLU A 89  ? 0.8544 1.0715 1.2003 -0.0711 0.1915  0.0101  115 GLU A CG    
641  C CD    . GLU A 89  ? 0.8954 1.1230 1.2775 -0.0798 0.2197  0.0278  115 GLU A CD    
642  O OE1   . GLU A 89  ? 0.9155 1.1773 1.2907 -0.0814 0.2343  0.0365  115 GLU A OE1   
643  O OE2   . GLU A 89  ? 0.9055 1.1101 1.3278 -0.0853 0.2278  0.0309  115 GLU A OE2   
644  N N     . GLU A 90  ? 0.8478 1.0301 1.1348 -0.0567 0.1981  0.0948  116 GLU A N     
645  C CA    . GLU A 90  ? 0.8367 0.9858 1.1350 -0.0556 0.1914  0.0979  116 GLU A CA    
646  C C     . GLU A 90  ? 0.8174 0.9474 1.1605 -0.0630 0.1881  0.0697  116 GLU A C     
647  O O     . GLU A 90  ? 0.8287 0.9603 1.2163 -0.0707 0.2052  0.0706  116 GLU A O     
648  C CB    . GLU A 90  ? 0.8617 1.0071 1.1764 -0.0549 0.2114  0.1389  116 GLU A CB    
649  C CG    . GLU A 90  ? 0.8740 0.9944 1.1844 -0.0499 0.2033  0.1483  116 GLU A CG    
650  C CD    . GLU A 90  ? 0.9225 1.0396 1.2596 -0.0485 0.2240  0.1919  116 GLU A CD    
651  O OE1   . GLU A 90  ? 0.9406 1.0685 1.2441 -0.0399 0.2224  0.2184  116 GLU A OE1   
652  O OE2   . GLU A 90  ? 0.9270 1.0323 1.3229 -0.0558 0.2420  0.2003  116 GLU A OE2   
653  N N     . GLY A 91  ? 0.7875 0.9048 1.1196 -0.0607 0.1661  0.0443  117 GLY A N     
654  C CA    . GLY A 91  ? 0.7632 0.8722 1.1329 -0.0663 0.1595  0.0141  117 GLY A CA    
655  C C     . GLY A 91  ? 0.7399 0.8637 1.1053 -0.0665 0.1446  -0.0144 117 GLY A C     
656  O O     . GLY A 91  ? 0.7333 0.8584 1.1293 -0.0704 0.1381  -0.0404 117 GLY A O     
657  N N     . PHE A 92  ? 0.7226 0.8610 1.0547 -0.0618 0.1388  -0.0115 118 PHE A N     
658  C CA    . PHE A 92  ? 0.6995 0.8518 1.0338 -0.0610 0.1249  -0.0365 118 PHE A CA    
659  C C     . PHE A 92  ? 0.6816 0.8412 0.9778 -0.0529 0.1087  -0.0370 118 PHE A C     
660  O O     . PHE A 92  ? 0.6839 0.8525 0.9552 -0.0498 0.1156  -0.0219 118 PHE A O     
661  C CB    . PHE A 92  ? 0.7088 0.8780 1.0728 -0.0673 0.1414  -0.0423 118 PHE A CB    
662  C CG    . PHE A 92  ? 0.6960 0.8780 1.0755 -0.0671 0.1276  -0.0709 118 PHE A CG    
663  C CD1   . PHE A 92  ? 0.6939 0.8749 1.1091 -0.0709 0.1219  -0.0929 118 PHE A CD1   
664  C CD2   . PHE A 92  ? 0.6880 0.8867 1.0513 -0.0625 0.1199  -0.0779 118 PHE A CD2   
665  C CE1   . PHE A 92  ? 0.6885 0.8845 1.1195 -0.0694 0.1078  -0.1171 118 PHE A CE1   
666  C CE2   . PHE A 92  ? 0.6691 0.8790 1.0532 -0.0613 0.1065  -0.1026 118 PHE A CE2   
667  C CZ    . PHE A 92  ? 0.6735 0.8819 1.0896 -0.0643 0.1000  -0.1201 118 PHE A CZ    
668  N N     . MET A 93  ? 0.6570 0.8163 0.9528 -0.0492 0.0873  -0.0544 119 MET A N     
669  C CA    . MET A 93  ? 0.6372 0.8015 0.9102 -0.0418 0.0713  -0.0564 119 MET A CA    
670  C C     . MET A 93  ? 0.6186 0.7995 0.9151 -0.0412 0.0646  -0.0760 119 MET A C     
671  O O     . MET A 93  ? 0.6098 0.7936 0.9306 -0.0421 0.0552  -0.0900 119 MET A O     
672  C CB    . MET A 93  ? 0.6297 0.7822 0.8868 -0.0370 0.0519  -0.0543 119 MET A CB    
673  C CG    . MET A 93  ? 0.6303 0.7842 0.8687 -0.0296 0.0376  -0.0516 119 MET A CG    
674  S SD    . MET A 93  ? 0.6665 0.8077 0.8817 -0.0248 0.0199  -0.0411 119 MET A SD    
675  C CE    . MET A 93  ? 0.6519 0.7788 0.8417 -0.0269 0.0348  -0.0247 119 MET A CE    
676  N N     . THR A 94  ? 0.6083 0.8044 0.9002 -0.0392 0.0691  -0.0789 120 THR A N     
677  C CA    . THR A 94  ? 0.5948 0.8081 0.9145 -0.0380 0.0631  -0.1000 120 THR A CA    
678  C C     . THR A 94  ? 0.5799 0.7871 0.9062 -0.0304 0.0391  -0.1051 120 THR A C     
679  O O     . THR A 94  ? 0.5765 0.7700 0.8801 -0.0261 0.0294  -0.0919 120 THR A O     
680  C CB    . THR A 94  ? 0.5970 0.8357 0.9146 -0.0384 0.0757  -0.1067 120 THR A CB    
681  O OG1   . THR A 94  ? 0.5934 0.8332 0.8880 -0.0322 0.0687  -0.1023 120 THR A OG1   
682  C CG2   . THR A 94  ? 0.6100 0.8610 0.9192 -0.0452 0.1008  -0.0942 120 THR A CG2   
683  N N     . ALA A 95  ? 0.5709 0.7896 0.9320 -0.0286 0.0302  -0.1223 121 ALA A N     
684  C CA    . ALA A 95  ? 0.5559 0.7724 0.9344 -0.0205 0.0084  -0.1239 121 ALA A CA    
685  C C     . ALA A 95  ? 0.5484 0.7632 0.9177 -0.0157 0.0057  -0.1208 121 ALA A C     
686  O O     . ALA A 95  ? 0.5399 0.7439 0.9094 -0.0097 -0.0095 -0.1099 121 ALA A O     
687  C CB    . ALA A 95  ? 0.5542 0.7863 0.9787 -0.0191 0.0023  -0.1435 121 ALA A CB    
688  N N     . GLU A 96  ? 0.5512 0.7815 0.9153 -0.0184 0.0210  -0.1312 122 GLU A N     
689  C CA    . GLU A 96  ? 0.5479 0.7842 0.9094 -0.0140 0.0188  -0.1356 122 GLU A CA    
690  C C     . GLU A 96  ? 0.5402 0.7603 0.8589 -0.0126 0.0187  -0.1141 122 GLU A C     
691  O O     . GLU A 96  ? 0.5348 0.7468 0.8565 -0.0074 0.0077  -0.1108 122 GLU A O     
692  C CB    . GLU A 96  ? 0.5526 0.8224 0.9237 -0.0166 0.0338  -0.1582 122 GLU A CB    
693  C CG    . GLU A 96  ? 0.5696 0.8531 0.9669 -0.0111 0.0267  -0.1774 122 GLU A CG    
694  C CD    . GLU A 96  ? 0.6085 0.9358 1.0121 -0.0136 0.0418  -0.2042 122 GLU A CD    
695  O OE1   . GLU A 96  ? 0.6423 0.9907 1.0321 -0.0194 0.0579  -0.2056 122 GLU A OE1   
696  O OE2   . GLU A 96  ? 0.6284 0.9734 1.0542 -0.0098 0.0382  -0.2251 122 GLU A OE2   
697  N N     . LEU A 97  ? 0.5445 0.7594 0.8295 -0.0171 0.0312  -0.0992 123 LEU A N     
698  C CA    . LEU A 97  ? 0.5416 0.7398 0.7893 -0.0156 0.0307  -0.0785 123 LEU A CA    
699  C C     . LEU A 97  ? 0.5281 0.7036 0.7757 -0.0125 0.0130  -0.0674 123 LEU A C     
700  O O     . LEU A 97  ? 0.5240 0.6907 0.7597 -0.0084 0.0048  -0.0592 123 LEU A O     
701  C CB    . LEU A 97  ? 0.5518 0.7482 0.7747 -0.0208 0.0479  -0.0634 123 LEU A CB    
702  C CG    . LEU A 97  ? 0.5566 0.7392 0.7446 -0.0189 0.0496  -0.0429 123 LEU A CG    
703  C CD1   . LEU A 97  ? 0.5504 0.7473 0.7221 -0.0137 0.0486  -0.0450 123 LEU A CD1   
704  C CD2   . LEU A 97  ? 0.5824 0.7637 0.7597 -0.0237 0.0676  -0.0265 123 LEU A CD2   
705  N N     . ALA A 98  ? 0.5204 0.6921 0.7830 -0.0145 0.0074  -0.0681 124 ALA A N     
706  C CA    . ALA A 98  ? 0.5176 0.6802 0.7818 -0.0110 -0.0100 -0.0584 124 ALA A CA    
707  C C     . ALA A 98  ? 0.5150 0.6771 0.7972 -0.0041 -0.0242 -0.0557 124 ALA A C     
708  O O     . ALA A 98  ? 0.5166 0.6691 0.7838 -0.0010 -0.0326 -0.0405 124 ALA A O     
709  C CB    . ALA A 98  ? 0.5133 0.6843 0.7999 -0.0128 -0.0154 -0.0658 124 ALA A CB    
710  N N     . GLY A 99  ? 0.5124 0.6857 0.8320 -0.0021 -0.0258 -0.0712 125 GLY A N     
711  C CA    . GLY A 99  ? 0.5092 0.6822 0.8624 0.0043  -0.0378 -0.0715 125 GLY A CA    
712  C C     . GLY A 99  ? 0.5150 0.6814 0.8525 0.0059  -0.0349 -0.0680 125 GLY A C     
713  O O     . GLY A 99  ? 0.5172 0.6737 0.8631 0.0102  -0.0458 -0.0536 125 GLY A O     
714  N N     . VAL A 100 ? 0.5198 0.6952 0.8355 0.0025  -0.0199 -0.0799 126 VAL A N     
715  C CA    . VAL A 100 ? 0.5281 0.7046 0.8295 0.0044  -0.0166 -0.0813 126 VAL A CA    
716  C C     . VAL A 100 ? 0.5294 0.6854 0.7968 0.0052  -0.0221 -0.0568 126 VAL A C     
717  O O     . VAL A 100 ? 0.5331 0.6824 0.8092 0.0087  -0.0290 -0.0519 126 VAL A O     
718  C CB    . VAL A 100 ? 0.5355 0.7344 0.8137 0.0013  0.0004  -0.0949 126 VAL A CB    
719  C CG1   . VAL A 100 ? 0.5319 0.7318 0.7804 0.0035  0.0032  -0.0893 126 VAL A CG1   
720  C CG2   . VAL A 100 ? 0.5207 0.7490 0.8387 0.0014  0.0050  -0.1256 126 VAL A CG2   
721  N N     . ILE A 101 ? 0.5354 0.6831 0.7704 0.0017  -0.0186 -0.0434 127 ILE A N     
722  C CA    . ILE A 101 ? 0.5391 0.6715 0.7425 0.0017  -0.0225 -0.0239 127 ILE A CA    
723  C C     . ILE A 101 ? 0.5431 0.6694 0.7619 0.0050  -0.0388 -0.0098 127 ILE A C     
724  O O     . ILE A 101 ? 0.5468 0.6652 0.7542 0.0070  -0.0438 0.0029  127 ILE A O     
725  C CB    . ILE A 101 ? 0.5385 0.6667 0.7139 -0.0032 -0.0136 -0.0177 127 ILE A CB    
726  C CG1   . ILE A 101 ? 0.5412 0.6775 0.7026 -0.0056 0.0035  -0.0229 127 ILE A CG1   
727  C CG2   . ILE A 101 ? 0.5430 0.6589 0.6915 -0.0032 -0.0180 -0.0021 127 ILE A CG2   
728  C CD1   . ILE A 101 ? 0.5422 0.6729 0.6883 -0.0105 0.0150  -0.0149 127 ILE A CD1   
729  N N     . LYS A 102 ? 0.5457 0.6792 0.7907 0.0060  -0.0469 -0.0104 128 LYS A N     
730  C CA    . LYS A 102 ? 0.5538 0.6895 0.8161 0.0104  -0.0629 0.0077  128 LYS A CA    
731  C C     . LYS A 102 ? 0.5540 0.6840 0.8470 0.0153  -0.0688 0.0145  128 LYS A C     
732  O O     . LYS A 102 ? 0.5640 0.6911 0.8542 0.0178  -0.0769 0.0362  128 LYS A O     
733  C CB    . LYS A 102 ? 0.5551 0.7051 0.8457 0.0122  -0.0716 0.0059  128 LYS A CB    
734  C CG    . LYS A 102 ? 0.5585 0.7195 0.8248 0.0086  -0.0721 0.0059  128 LYS A CG    
735  C CD    . LYS A 102 ? 0.5715 0.7514 0.8689 0.0111  -0.0817 0.0016  128 LYS A CD    
736  C CE    . LYS A 102 ? 0.5786 0.7729 0.8587 0.0064  -0.0795 -0.0082 128 LYS A CE    
737  N NZ    . LYS A 102 ? 0.5872 0.8076 0.8953 0.0104  -0.0926 -0.0100 128 LYS A NZ    
738  N N     . ARG A 103 ? 0.5512 0.6829 0.8778 0.0164  -0.0641 -0.0053 129 ARG A N     
739  C CA    . ARG A 103 ? 0.5495 0.6773 0.9196 0.0207  -0.0686 -0.0050 129 ARG A CA    
740  C C     . ARG A 103 ? 0.5502 0.6699 0.8956 0.0197  -0.0628 -0.0043 129 ARG A C     
741  O O     . ARG A 103 ? 0.5503 0.6633 0.9232 0.0226  -0.0679 0.0059  129 ARG A O     
742  C CB    . ARG A 103 ? 0.5432 0.6813 0.9642 0.0219  -0.0650 -0.0337 129 ARG A CB    
743  C CG    . ARG A 103 ? 0.5572 0.7030 1.0175 0.0244  -0.0728 -0.0344 129 ARG A CG    
744  C CD    . ARG A 103 ? 0.5404 0.6970 1.0636 0.0262  -0.0703 -0.0644 129 ARG A CD    
745  N NE    . ARG A 103 ? 0.5393 0.7114 1.0427 0.0213  -0.0550 -0.0970 129 ARG A NE    
746  C CZ    . ARG A 103 ? 0.5465 0.7324 1.0324 0.0172  -0.0467 -0.1121 129 ARG A CZ    
747  N NH1   . ARG A 103 ? 0.5453 0.7294 1.0333 0.0171  -0.0524 -0.1021 129 ARG A NH1   
748  N NH2   . ARG A 103 ? 0.5434 0.7495 1.0119 0.0132  -0.0322 -0.1370 129 ARG A NH2   
749  N N     . LEU A 104 ? 0.5467 0.6683 0.8451 0.0158  -0.0518 -0.0141 130 LEU A N     
750  C CA    . LEU A 104 ? 0.5534 0.6695 0.8230 0.0154  -0.0471 -0.0117 130 LEU A CA    
751  C C     . LEU A 104 ? 0.5571 0.6610 0.8013 0.0151  -0.0540 0.0161  130 LEU A C     
752  O O     . LEU A 104 ? 0.5589 0.6565 0.8167 0.0170  -0.0583 0.0266  130 LEU A O     
753  C CB    . LEU A 104 ? 0.5497 0.6745 0.7785 0.0125  -0.0340 -0.0244 130 LEU A CB    
754  C CG    . LEU A 104 ? 0.5405 0.6880 0.7904 0.0132  -0.0259 -0.0533 130 LEU A CG    
755  C CD1   . LEU A 104 ? 0.5280 0.6899 0.7366 0.0108  -0.0126 -0.0574 130 LEU A CD1   
756  C CD2   . LEU A 104 ? 0.5315 0.6867 0.8110 0.0164  -0.0276 -0.0685 130 LEU A CD2   
757  N N     . TRP A 105 ? 0.5617 0.6658 0.7747 0.0124  -0.0546 0.0261  131 TRP A N     
758  C CA    . TRP A 105 ? 0.5680 0.6696 0.7563 0.0116  -0.0606 0.0479  131 TRP A CA    
759  C C     . TRP A 105 ? 0.5793 0.6838 0.7993 0.0154  -0.0725 0.0693  131 TRP A C     
760  O O     . TRP A 105 ? 0.5928 0.6965 0.7988 0.0153  -0.0756 0.0874  131 TRP A O     
761  C CB    . TRP A 105 ? 0.5663 0.6755 0.7299 0.0082  -0.0602 0.0483  131 TRP A CB    
762  C CG    . TRP A 105 ? 0.5516 0.6680 0.6908 0.0069  -0.0661 0.0644  131 TRP A CG    
763  C CD1   . TRP A 105 ? 0.5428 0.6793 0.6847 0.0075  -0.0759 0.0744  131 TRP A CD1   
764  C CD2   . TRP A 105 ? 0.5311 0.6416 0.6406 0.0051  -0.0626 0.0701  131 TRP A CD2   
765  N NE1   . TRP A 105 ? 0.5584 0.7053 0.6732 0.0056  -0.0781 0.0844  131 TRP A NE1   
766  C CE2   . TRP A 105 ? 0.5376 0.6662 0.6334 0.0039  -0.0698 0.0818  131 TRP A CE2   
767  C CE3   . TRP A 105 ? 0.5206 0.6167 0.6146 0.0048  -0.0544 0.0653  131 TRP A CE3   
768  C CZ2   . TRP A 105 ? 0.5263 0.6573 0.5953 0.0016  -0.0682 0.0872  131 TRP A CZ2   
769  C CZ3   . TRP A 105 ? 0.5010 0.5958 0.5691 0.0031  -0.0536 0.0724  131 TRP A CZ3   
770  C CH2   . TRP A 105 ? 0.5371 0.6482 0.5937 0.0011  -0.0600 0.0826  131 TRP A CH2   
771  N N     . LYS A 106 ? 0.5839 0.6930 0.8499 0.0190  -0.0785 0.0688  132 LYS A N     
772  C CA    . LYS A 106 ? 0.5903 0.7032 0.8979 0.0238  -0.0895 0.0940  132 LYS A CA    
773  C C     . LYS A 106 ? 0.5817 0.6826 0.9316 0.0259  -0.0876 0.0940  132 LYS A C     
774  O O     . LYS A 106 ? 0.5863 0.6875 0.9700 0.0293  -0.0945 0.1209  132 LYS A O     
775  C CB    . LYS A 106 ? 0.6002 0.7237 0.9479 0.0276  -0.0972 0.0940  132 LYS A CB    
776  C CG    . LYS A 106 ? 0.6427 0.7775 1.0286 0.0338  -0.1106 0.1289  132 LYS A CG    
777  C CD    . LYS A 106 ? 0.6921 0.8519 1.0391 0.0340  -0.1189 0.1501  132 LYS A CD    
778  C CE    . LYS A 106 ? 0.7249 0.9060 1.1134 0.0419  -0.1334 0.1842  132 LYS A CE    
779  N NZ    . LYS A 106 ? 0.7402 0.9570 1.0964 0.0430  -0.1425 0.1938  132 LYS A NZ    
780  N N     . ASP A 107 ? 0.5655 0.6601 0.9180 0.0242  -0.0781 0.0643  133 ASP A N     
781  C CA    . ASP A 107 ? 0.5603 0.6486 0.9603 0.0259  -0.0756 0.0550  133 ASP A CA    
782  C C     . ASP A 107 ? 0.5606 0.6411 0.9468 0.0251  -0.0761 0.0777  133 ASP A C     
783  O O     . ASP A 107 ? 0.5598 0.6399 0.8867 0.0220  -0.0735 0.0843  133 ASP A O     
784  C CB    . ASP A 107 ? 0.5517 0.6462 0.9472 0.0243  -0.0652 0.0156  133 ASP A CB    
785  C CG    . ASP A 107 ? 0.5650 0.6595 1.0095 0.0257  -0.0623 -0.0012 133 ASP A CG    
786  O OD1   . ASP A 107 ? 0.5877 0.6843 1.1045 0.0284  -0.0648 -0.0116 133 ASP A OD1   
787  O OD2   . ASP A 107 ? 0.5671 0.6608 0.9833 0.0243  -0.0574 -0.0060 133 ASP A OD2   
788  N N     . SER A 108 ? 0.5580 0.6328 1.0043 0.0276  -0.0785 0.0893  134 SER A N     
789  C CA    . SER A 108 ? 0.5614 0.6303 1.0046 0.0266  -0.0785 0.1150  134 SER A CA    
790  C C     . SER A 108 ? 0.5529 0.6173 0.9670 0.0234  -0.0698 0.0928  134 SER A C     
791  O O     . SER A 108 ? 0.5648 0.6266 0.9489 0.0212  -0.0688 0.1109  134 SER A O     
792  C CB    . SER A 108 ? 0.5706 0.6344 1.0964 0.0301  -0.0822 0.1370  134 SER A CB    
793  O OG    . SER A 108 ? 0.5626 0.6217 1.1524 0.0310  -0.0771 0.1028  134 SER A OG    
794  N N     . GLY A 109 ? 0.5387 0.6074 0.9619 0.0235  -0.0638 0.0535  135 GLY A N     
795  C CA    . GLY A 109 ? 0.5285 0.6005 0.9190 0.0218  -0.0565 0.0312  135 GLY A CA    
796  C C     . GLY A 109 ? 0.5249 0.5990 0.8346 0.0197  -0.0539 0.0340  135 GLY A C     
797  O O     . GLY A 109 ? 0.5174 0.5882 0.7900 0.0182  -0.0515 0.0402  135 GLY A O     
798  N N     . VAL A 110 ? 0.5188 0.5984 0.8081 0.0196  -0.0540 0.0290  136 VAL A N     
799  C CA    . VAL A 110 ? 0.5132 0.5936 0.7390 0.0173  -0.0508 0.0329  136 VAL A CA    
800  C C     . VAL A 110 ? 0.5190 0.5922 0.7159 0.0152  -0.0552 0.0617  136 VAL A C     
801  O O     . VAL A 110 ? 0.5194 0.5907 0.6730 0.0133  -0.0515 0.0633  136 VAL A O     
802  C CB    . VAL A 110 ? 0.5126 0.5995 0.7356 0.0169  -0.0504 0.0260  136 VAL A CB    
803  C CG1   . VAL A 110 ? 0.4989 0.5845 0.6690 0.0139  -0.0472 0.0337  136 VAL A CG1   
804  C CG2   . VAL A 110 ? 0.5019 0.6036 0.7446 0.0182  -0.0438 -0.0051 136 VAL A CG2   
805  N N     . GLN A 111 ? 0.5241 0.5975 0.7480 0.0159  -0.0630 0.0846  137 GLN A N     
806  C CA    . GLN A 111 ? 0.5291 0.6060 0.7296 0.0141  -0.0673 0.1125  137 GLN A CA    
807  C C     . GLN A 111 ? 0.5281 0.5992 0.7246 0.0128  -0.0638 0.1174  137 GLN A C     
808  O O     . GLN A 111 ? 0.5373 0.6115 0.6924 0.0100  -0.0623 0.1241  137 GLN A O     
809  C CB    . GLN A 111 ? 0.5371 0.6237 0.7705 0.0164  -0.0767 0.1402  137 GLN A CB    
810  C CG    . GLN A 111 ? 0.5399 0.6391 0.7606 0.0169  -0.0817 0.1395  137 GLN A CG    
811  C CD    . GLN A 111 ? 0.5387 0.6473 0.7021 0.0129  -0.0796 0.1344  137 GLN A CD    
812  O OE1   . GLN A 111 ? 0.5570 0.6774 0.6959 0.0109  -0.0814 0.1499  137 GLN A OE1   
813  N NE2   . GLN A 111 ? 0.5256 0.6311 0.6729 0.0113  -0.0748 0.1120  137 GLN A NE2   
814  N N     . ALA A 112 ? 0.5174 0.5818 0.7609 0.0145  -0.0620 0.1104  138 ALA A N     
815  C CA    . ALA A 112 ? 0.5119 0.5714 0.7576 0.0132  -0.0579 0.1108  138 ALA A CA    
816  C C     . ALA A 112 ? 0.4995 0.5590 0.6922 0.0120  -0.0522 0.0910  138 ALA A C     
817  O O     . ALA A 112 ? 0.5050 0.5639 0.6712 0.0098  -0.0505 0.0995  138 ALA A O     
818  C CB    . ALA A 112 ? 0.5051 0.5601 0.8176 0.0152  -0.0557 0.0966  138 ALA A CB    
819  N N     . CYS A 113 ? 0.4883 0.5511 0.6679 0.0138  -0.0490 0.0670  139 CYS A N     
820  C CA    . CYS A 113 ? 0.4780 0.5436 0.6131 0.0141  -0.0435 0.0524  139 CYS A CA    
821  C C     . CYS A 113 ? 0.4797 0.5428 0.5674 0.0114  -0.0434 0.0663  139 CYS A C     
822  O O     . CYS A 113 ? 0.4833 0.5451 0.5414 0.0110  -0.0403 0.0654  139 CYS A O     
823  C CB    . CYS A 113 ? 0.4686 0.5451 0.6052 0.0169  -0.0393 0.0279  139 CYS A CB    
824  S SG    . CYS A 113 ? 0.4610 0.5475 0.5506 0.0194  -0.0323 0.0159  139 CYS A SG    
825  N N     . PHE A 114 ? 0.4775 0.5425 0.5636 0.0099  -0.0469 0.0762  140 PHE A N     
826  C CA    . PHE A 114 ? 0.4846 0.5526 0.5367 0.0068  -0.0473 0.0847  140 PHE A CA    
827  C C     . PHE A 114 ? 0.4935 0.5657 0.5327 0.0041  -0.0495 0.0997  140 PHE A C     
828  O O     . PHE A 114 ? 0.5019 0.5761 0.5117 0.0019  -0.0466 0.0970  140 PHE A O     
829  C CB    . PHE A 114 ? 0.4848 0.5606 0.5466 0.0060  -0.0523 0.0909  140 PHE A CB    
830  C CG    . PHE A 114 ? 0.4729 0.5595 0.5083 0.0025  -0.0537 0.0959  140 PHE A CG    
831  C CD1   . PHE A 114 ? 0.4707 0.5543 0.4846 0.0006  -0.0472 0.0826  140 PHE A CD1   
832  C CD2   . PHE A 114 ? 0.4855 0.5902 0.5223 0.0012  -0.0612 0.1139  140 PHE A CD2   
833  C CE1   . PHE A 114 ? 0.4863 0.5830 0.4854 -0.0030 -0.0479 0.0810  140 PHE A CE1   
834  C CE2   . PHE A 114 ? 0.4840 0.6085 0.4987 -0.0021 -0.0627 0.1125  140 PHE A CE2   
835  C CZ    . PHE A 114 ? 0.4837 0.6033 0.4820 -0.0045 -0.0560 0.0930  140 PHE A CZ    
836  N N     . ASN A 115 ? 0.4975 0.5730 0.5632 0.0042  -0.0538 0.1162  141 ASN A N     
837  C CA    . ASN A 115 ? 0.5107 0.5946 0.5678 0.0014  -0.0546 0.1329  141 ASN A CA    
838  C C     . ASN A 115 ? 0.5056 0.5802 0.5532 0.0011  -0.0489 0.1223  141 ASN A C     
839  O O     . ASN A 115 ? 0.5133 0.5953 0.5463 -0.0018 -0.0479 0.1310  141 ASN A O     
840  C CB    . ASN A 115 ? 0.5175 0.6085 0.6125 0.0020  -0.0594 0.1590  141 ASN A CB    
841  C CG    . ASN A 115 ? 0.5331 0.6420 0.6315 0.0028  -0.0667 0.1756  141 ASN A CG    
842  O OD1   . ASN A 115 ? 0.5579 0.6814 0.6236 0.0010  -0.0683 0.1702  141 ASN A OD1   
843  N ND2   . ASN A 115 ? 0.5454 0.6552 0.6889 0.0059  -0.0712 0.1945  141 ASN A ND2   
844  N N     . ARG A 116 ? 0.4964 0.5601 0.5526 0.0045  -0.0454 0.1023  142 ARG A N     
845  C CA    . ARG A 116 ? 0.4896 0.5495 0.5343 0.0055  -0.0409 0.0898  142 ARG A CA    
846  C C     . ARG A 116 ? 0.4845 0.5433 0.4925 0.0070  -0.0372 0.0775  142 ARG A C     
847  O O     . ARG A 116 ? 0.4845 0.5428 0.4847 0.0101  -0.0340 0.0656  142 ARG A O     
848  C CB    . ARG A 116 ? 0.4852 0.5430 0.5673 0.0088  -0.0395 0.0750  142 ARG A CB    
849  C CG    . ARG A 116 ? 0.4675 0.5235 0.5963 0.0069  -0.0412 0.0898  142 ARG A CG    
850  C CD    . ARG A 116 ? 0.4397 0.4954 0.6200 0.0097  -0.0397 0.0701  142 ARG A CD    
851  N NE    . ARG A 116 ? 0.4482 0.5098 0.6183 0.0122  -0.0360 0.0447  142 ARG A NE    
852  C CZ    . ARG A 116 ? 0.4506 0.5213 0.6595 0.0151  -0.0342 0.0175  142 ARG A CZ    
853  N NH1   . ARG A 116 ? 0.4317 0.5030 0.6988 0.0154  -0.0348 0.0104  142 ARG A NH1   
854  N NH2   . ARG A 116 ? 0.4274 0.5106 0.6205 0.0181  -0.0320 -0.0042 142 ARG A NH2   
855  N N     . SER A 117 ? 0.4917 0.5524 0.4817 0.0050  -0.0375 0.0811  143 SER A N     
856  C CA    . SER A 117 ? 0.4907 0.5487 0.4567 0.0063  -0.0325 0.0724  143 SER A CA    
857  C C     . SER A 117 ? 0.4844 0.5408 0.4334 0.0068  -0.0296 0.0695  143 SER A C     
858  O O     . SER A 117 ? 0.4983 0.5519 0.4365 0.0105  -0.0252 0.0639  143 SER A O     
859  C CB    . SER A 117 ? 0.4961 0.5575 0.4549 0.0029  -0.0326 0.0746  143 SER A CB    
860  O OG    . SER A 117 ? 0.5001 0.5734 0.4558 -0.0016 -0.0369 0.0827  143 SER A OG    
861  N N     . ARG A 118 ? 0.4775 0.5379 0.4264 0.0037  -0.0315 0.0749  144 ARG A N     
862  C CA    . ARG A 118 ? 0.4731 0.5328 0.4092 0.0045  -0.0288 0.0696  144 ARG A CA    
863  C C     . ARG A 118 ? 0.4676 0.5244 0.4065 0.0110  -0.0271 0.0605  144 ARG A C     
864  O O     . ARG A 118 ? 0.4749 0.5319 0.4036 0.0137  -0.0252 0.0560  144 ARG A O     
865  C CB    . ARG A 118 ? 0.4687 0.5375 0.4054 -0.0006 -0.0302 0.0767  144 ARG A CB    
866  C CG    . ARG A 118 ? 0.4504 0.5182 0.4068 -0.0001 -0.0309 0.0803  144 ARG A CG    
867  C CD    . ARG A 118 ? 0.4381 0.5186 0.3968 -0.0063 -0.0311 0.0942  144 ARG A CD    
868  N NE    . ARG A 118 ? 0.4290 0.5078 0.4123 -0.0068 -0.0297 0.0989  144 ARG A NE    
869  C CZ    . ARG A 118 ? 0.4246 0.5019 0.4083 -0.0063 -0.0266 0.0890  144 ARG A CZ    
870  N NH1   . ARG A 118 ? 0.4042 0.4812 0.3645 -0.0043 -0.0253 0.0754  144 ARG A NH1   
871  N NH2   . ARG A 118 ? 0.4346 0.5112 0.4483 -0.0076 -0.0246 0.0929  144 ARG A NH2   
872  N N     . GLU A 119 ? 0.4627 0.5215 0.4181 0.0140  -0.0282 0.0558  145 GLU A N     
873  C CA    . GLU A 119 ? 0.4584 0.5253 0.4180 0.0206  -0.0272 0.0425  145 GLU A CA    
874  C C     . GLU A 119 ? 0.4637 0.5382 0.4084 0.0265  -0.0241 0.0396  145 GLU A C     
875  O O     . GLU A 119 ? 0.4657 0.5553 0.4066 0.0331  -0.0233 0.0307  145 GLU A O     
876  C CB    . GLU A 119 ? 0.4556 0.5281 0.4485 0.0208  -0.0292 0.0333  145 GLU A CB    
877  C CG    . GLU A 119 ? 0.4495 0.5151 0.4652 0.0151  -0.0308 0.0426  145 GLU A CG    
878  C CD    . GLU A 119 ? 0.4468 0.5163 0.5086 0.0155  -0.0314 0.0325  145 GLU A CD    
879  O OE1   . GLU A 119 ? 0.4498 0.5322 0.5237 0.0204  -0.0305 0.0101  145 GLU A OE1   
880  O OE2   . GLU A 119 ? 0.4530 0.5159 0.5431 0.0113  -0.0325 0.0469  145 GLU A OE2   
881  N N     . TYR A 120 ? 0.4681 0.5363 0.4058 0.0243  -0.0220 0.0477  146 TYR A N     
882  C CA    . TYR A 120 ? 0.4753 0.5509 0.4023 0.0291  -0.0171 0.0499  146 TYR A CA    
883  C C     . TYR A 120 ? 0.4876 0.5498 0.4081 0.0254  -0.0135 0.0607  146 TYR A C     
884  O O     . TYR A 120 ? 0.4976 0.5507 0.4188 0.0200  -0.0156 0.0621  146 TYR A O     
885  C CB    . TYR A 120 ? 0.4612 0.5496 0.3998 0.0303  -0.0164 0.0420  146 TYR A CB    
886  C CG    . TYR A 120 ? 0.4517 0.5300 0.4069 0.0243  -0.0190 0.0429  146 TYR A CG    
887  C CD1   . TYR A 120 ? 0.4473 0.5223 0.4251 0.0215  -0.0245 0.0391  146 TYR A CD1   
888  C CD2   . TYR A 120 ? 0.4110 0.4850 0.3642 0.0217  -0.0159 0.0488  146 TYR A CD2   
889  C CE1   . TYR A 120 ? 0.4207 0.4896 0.4164 0.0174  -0.0278 0.0441  146 TYR A CE1   
890  C CE2   . TYR A 120 ? 0.4164 0.4851 0.3856 0.0172  -0.0196 0.0494  146 TYR A CE2   
891  C CZ    . TYR A 120 ? 0.4338 0.5007 0.4232 0.0156  -0.0260 0.0483  146 TYR A CZ    
892  O OH    . TYR A 120 ? 0.4439 0.5083 0.4519 0.0125  -0.0305 0.0532  146 TYR A OH    
893  N N     . LEU A 121 ? 0.4973 0.5622 0.4155 0.0277  -0.0074 0.0672  147 LEU A N     
894  C CA    . LEU A 121 ? 0.5154 0.5681 0.4378 0.0241  -0.0026 0.0745  147 LEU A CA    
895  C C     . LEU A 121 ? 0.5103 0.5606 0.4426 0.0191  -0.0009 0.0733  147 LEU A C     
896  O O     . LEU A 121 ? 0.5321 0.5885 0.4668 0.0211  0.0046  0.0775  147 LEU A O     
897  C CB    . LEU A 121 ? 0.5281 0.5835 0.4495 0.0304  0.0048  0.0871  147 LEU A CB    
898  C CG    . LEU A 121 ? 0.5615 0.6224 0.4751 0.0372  0.0029  0.0901  147 LEU A CG    
899  C CD1   . LEU A 121 ? 0.6005 0.6711 0.5152 0.0455  0.0101  0.1088  147 LEU A CD1   
900  C CD2   . LEU A 121 ? 0.5682 0.6153 0.4874 0.0330  0.0002  0.0841  147 LEU A CD2   
901  N N     . LEU A 122 ? 0.5032 0.5489 0.4412 0.0127  -0.0058 0.0680  148 LEU A N     
902  C CA    . LEU A 122 ? 0.4874 0.5336 0.4365 0.0082  -0.0056 0.0655  148 LEU A CA    
903  C C     . LEU A 122 ? 0.4930 0.5362 0.4518 0.0030  -0.0028 0.0616  148 LEU A C     
904  O O     . LEU A 122 ? 0.4864 0.5330 0.4428 0.0000  -0.0067 0.0566  148 LEU A O     
905  C CB    . LEU A 122 ? 0.4674 0.5189 0.4207 0.0059  -0.0145 0.0628  148 LEU A CB    
906  C CG    . LEU A 122 ? 0.4585 0.5141 0.4250 0.0026  -0.0165 0.0605  148 LEU A CG    
907  C CD1   . LEU A 122 ? 0.4161 0.4728 0.3896 0.0048  -0.0101 0.0585  148 LEU A CD1   
908  C CD2   . LEU A 122 ? 0.4308 0.4926 0.4057 0.0019  -0.0262 0.0635  148 LEU A CD2   
909  N N     . ASN A 123 ? 0.4974 0.5379 0.4709 0.0015  0.0046  0.0616  149 ASN A N     
910  C CA    . ASN A 123 ? 0.5069 0.5467 0.5002 -0.0036 0.0087  0.0528  149 ASN A CA    
911  C C     . ASN A 123 ? 0.5027 0.5576 0.4976 -0.0092 0.0000  0.0399  149 ASN A C     
912  O O     . ASN A 123 ? 0.5080 0.5700 0.4954 -0.0090 -0.0071 0.0423  149 ASN A O     
913  C CB    . ASN A 123 ? 0.5090 0.5430 0.5248 -0.0044 0.0199  0.0563  149 ASN A CB    
914  C CG    . ASN A 123 ? 0.5124 0.5532 0.5340 -0.0074 0.0183  0.0511  149 ASN A CG    
915  O OD1   . ASN A 123 ? 0.5384 0.5865 0.5770 -0.0128 0.0167  0.0373  149 ASN A OD1   
916  N ND2   . ASN A 123 ? 0.5134 0.5563 0.5234 -0.0037 0.0184  0.0592  149 ASN A ND2   
917  N N     . ASP A 124 ? 0.5009 0.5651 0.5084 -0.0137 0.0005  0.0259  150 ASP A N     
918  C CA    . ASP A 124 ? 0.4986 0.5889 0.5044 -0.0184 -0.0082 0.0138  150 ASP A CA    
919  C C     . ASP A 124 ? 0.4997 0.6026 0.5239 -0.0218 -0.0087 0.0032  150 ASP A C     
920  O O     . ASP A 124 ? 0.5036 0.6353 0.5286 -0.0250 -0.0161 -0.0079 150 ASP A O     
921  C CB    . ASP A 124 ? 0.4915 0.5993 0.5002 -0.0220 -0.0091 -0.0010 150 ASP A CB    
922  C CG    . ASP A 124 ? 0.4896 0.5945 0.4744 -0.0194 -0.0129 0.0097  150 ASP A CG    
923  O OD1   . ASP A 124 ? 0.4790 0.5859 0.4449 -0.0173 -0.0199 0.0243  150 ASP A OD1   
924  O OD2   . ASP A 124 ? 0.4719 0.5726 0.4620 -0.0194 -0.0086 0.0032  150 ASP A OD2   
925  N N     . SER A 125 ? 0.5107 0.5970 0.5497 -0.0208 -0.0008 0.0070  151 SER A N     
926  C CA    . SER A 125 ? 0.5182 0.6160 0.5762 -0.0240 -0.0011 -0.0034 151 SER A CA    
927  C C     . SER A 125 ? 0.5194 0.6164 0.5643 -0.0207 -0.0077 0.0089  151 SER A C     
928  O O     . SER A 125 ? 0.5254 0.6344 0.5836 -0.0224 -0.0106 0.0015  151 SER A O     
929  C CB    . SER A 125 ? 0.5237 0.6077 0.6155 -0.0265 0.0132  -0.0092 151 SER A CB    
930  O OG    . SER A 125 ? 0.5292 0.6179 0.6468 -0.0303 0.0186  -0.0261 151 SER A OG    
931  N N     . ALA A 126 ? 0.5193 0.6046 0.5430 -0.0160 -0.0104 0.0247  152 ALA A N     
932  C CA    . ALA A 126 ? 0.5209 0.6043 0.5404 -0.0125 -0.0154 0.0337  152 ALA A CA    
933  C C     . ALA A 126 ? 0.5211 0.6244 0.5441 -0.0127 -0.0280 0.0339  152 ALA A C     
934  O O     . ALA A 126 ? 0.5239 0.6316 0.5610 -0.0122 -0.0302 0.0319  152 ALA A O     
935  C CB    . ALA A 126 ? 0.5135 0.5855 0.5166 -0.0077 -0.0158 0.0451  152 ALA A CB    
936  N N     . ALA A 127 ? 0.5301 0.6484 0.5418 -0.0131 -0.0361 0.0383  153 ALA A N     
937  C CA    . ALA A 127 ? 0.5434 0.6877 0.5584 -0.0123 -0.0484 0.0448  153 ALA A CA    
938  C C     . ALA A 127 ? 0.5515 0.7189 0.5808 -0.0152 -0.0504 0.0293  153 ALA A C     
939  O O     . ALA A 127 ? 0.5599 0.7419 0.6004 -0.0130 -0.0584 0.0335  153 ALA A O     
940  C CB    . ALA A 127 ? 0.5468 0.7104 0.5457 -0.0128 -0.0546 0.0541  153 ALA A CB    
941  N N     . TYR A 128 ? 0.5585 0.7301 0.5930 -0.0198 -0.0429 0.0101  154 TYR A N     
942  C CA    . TYR A 128 ? 0.5646 0.7624 0.6185 -0.0234 -0.0436 -0.0111 154 TYR A CA    
943  C C     . TYR A 128 ? 0.5647 0.7525 0.6386 -0.0227 -0.0413 -0.0138 154 TYR A C     
944  O O     . TYR A 128 ? 0.5694 0.7840 0.6541 -0.0221 -0.0500 -0.0195 154 TYR A O     
945  C CB    . TYR A 128 ? 0.5686 0.7661 0.6370 -0.0287 -0.0330 -0.0338 154 TYR A CB    
946  C CG    . TYR A 128 ? 0.5702 0.7932 0.6695 -0.0333 -0.0313 -0.0618 154 TYR A CG    
947  C CD1   . TYR A 128 ? 0.5707 0.8440 0.6729 -0.0356 -0.0399 -0.0819 154 TYR A CD1   
948  C CD2   . TYR A 128 ? 0.5749 0.7772 0.7027 -0.0354 -0.0207 -0.0692 154 TYR A CD2   
949  C CE1   . TYR A 128 ? 0.5789 0.8813 0.7143 -0.0397 -0.0387 -0.1131 154 TYR A CE1   
950  C CE2   . TYR A 128 ? 0.5729 0.7989 0.7356 -0.0400 -0.0184 -0.0973 154 TYR A CE2   
951  C CZ    . TYR A 128 ? 0.5857 0.8616 0.7533 -0.0421 -0.0278 -0.1211 154 TYR A CZ    
952  O OH    . TYR A 128 ? 0.5893 0.8933 0.7956 -0.0466 -0.0257 -0.1539 154 TYR A OH    
953  N N     . TYR A 129 ? 0.5646 0.7185 0.6432 -0.0225 -0.0298 -0.0092 155 TYR A N     
954  C CA    . TYR A 129 ? 0.5618 0.7076 0.6597 -0.0226 -0.0251 -0.0125 155 TYR A CA    
955  C C     . TYR A 129 ? 0.5612 0.7086 0.6568 -0.0175 -0.0350 0.0002  155 TYR A C     
956  O O     . TYR A 129 ? 0.5687 0.7308 0.6823 -0.0171 -0.0403 -0.0059 155 TYR A O     
957  C CB    . TYR A 129 ? 0.5593 0.6769 0.6625 -0.0238 -0.0085 -0.0091 155 TYR A CB    
958  C CG    . TYR A 129 ? 0.5649 0.6791 0.6892 -0.0291 0.0035  -0.0219 155 TYR A CG    
959  C CD1   . TYR A 129 ? 0.5665 0.6990 0.7209 -0.0340 0.0045  -0.0438 155 TYR A CD1   
960  C CD2   . TYR A 129 ? 0.5668 0.6612 0.6875 -0.0287 0.0140  -0.0129 155 TYR A CD2   
961  C CE1   . TYR A 129 ? 0.5734 0.7027 0.7592 -0.0393 0.0167  -0.0586 155 TYR A CE1   
962  C CE2   . TYR A 129 ? 0.5663 0.6559 0.7176 -0.0332 0.0259  -0.0233 155 TYR A CE2   
963  C CZ    . TYR A 129 ? 0.5710 0.6771 0.7573 -0.0388 0.0277  -0.0470 155 TYR A CZ    
964  O OH    . TYR A 129 ? 0.5849 0.6864 0.8129 -0.0437 0.0405  -0.0604 155 TYR A OH    
965  N N     . LEU A 130 ? 0.6604 0.7711 0.6888 -0.0513 -0.0096 -0.0077 156 LEU A N     
966  C CA    . LEU A 130 ? 0.6674 0.7729 0.6830 -0.0478 -0.0096 -0.0065 156 LEU A CA    
967  C C     . LEU A 130 ? 0.6883 0.7840 0.6873 -0.0407 -0.0135 -0.0104 156 LEU A C     
968  O O     . LEU A 130 ? 0.6964 0.7898 0.6874 -0.0352 -0.0163 -0.0115 156 LEU A O     
969  C CB    . LEU A 130 ? 0.6596 0.7586 0.6679 -0.0513 -0.0054 -0.0025 156 LEU A CB    
970  C CG    . LEU A 130 ? 0.6402 0.7431 0.6571 -0.0546 -0.0048 0.0008  156 LEU A CG    
971  C CD1   . LEU A 130 ? 0.5953 0.6932 0.6097 -0.0573 -0.0043 0.0015  156 LEU A CD1   
972  C CD2   . LEU A 130 ? 0.6019 0.7058 0.6173 -0.0527 -0.0038 0.0028  156 LEU A CD2   
973  N N     . ASN A 131 ? 0.7079 0.7945 0.6982 -0.0397 -0.0138 -0.0127 157 ASN A N     
974  C CA    . ASN A 131 ? 0.7399 0.8101 0.7069 -0.0307 -0.0187 -0.0169 157 ASN A CA    
975  C C     . ASN A 131 ? 0.7508 0.8300 0.7280 -0.0235 -0.0307 -0.0243 157 ASN A C     
976  O O     . ASN A 131 ? 0.7755 0.8418 0.7338 -0.0128 -0.0392 -0.0295 157 ASN A O     
977  C CB    . ASN A 131 ? 0.7520 0.8021 0.6995 -0.0315 -0.0125 -0.0169 157 ASN A CB    
978  C CG    . ASN A 131 ? 0.7590 0.7930 0.6899 -0.0354 -0.0008 -0.0134 157 ASN A CG    
979  O OD1   . ASN A 131 ? 0.7564 0.7858 0.6774 -0.0333 -0.0004 -0.0117 157 ASN A OD1   
980  N ND2   . ASN A 131 ? 0.7557 0.7811 0.6854 -0.0414 0.0095  -0.0134 157 ASN A ND2   
981  N N     . ASP A 132 ? 0.7400 0.8394 0.7465 -0.0288 -0.0314 -0.0259 158 ASP A N     
982  C CA    . ASP A 132 ? 0.7458 0.8579 0.7717 -0.0246 -0.0411 -0.0351 158 ASP A CA    
983  C C     . ASP A 132 ? 0.7381 0.8681 0.7883 -0.0260 -0.0398 -0.0373 158 ASP A C     
984  O O     . ASP A 132 ? 0.7322 0.8780 0.8103 -0.0280 -0.0417 -0.0446 158 ASP A O     
985  C CB    . ASP A 132 ? 0.7362 0.8556 0.7791 -0.0309 -0.0399 -0.0368 158 ASP A CB    
986  C CG    . ASP A 132 ? 0.7570 0.8598 0.7797 -0.0269 -0.0440 -0.0388 158 ASP A CG    
987  O OD1   . ASP A 132 ? 0.7803 0.8620 0.7724 -0.0214 -0.0434 -0.0366 158 ASP A OD1   
988  O OD2   . ASP A 132 ? 0.7617 0.8697 0.7975 -0.0296 -0.0463 -0.0427 158 ASP A OD2   
989  N N     . LEU A 133 ? 0.7423 0.8688 0.7825 -0.0256 -0.0349 -0.0318 159 LEU A N     
990  C CA    . LEU A 133 ? 0.7383 0.8781 0.7982 -0.0276 -0.0302 -0.0327 159 LEU A CA    
991  C C     . LEU A 133 ? 0.7467 0.9003 0.8280 -0.0200 -0.0389 -0.0451 159 LEU A C     
992  O O     . LEU A 133 ? 0.7388 0.9081 0.8496 -0.0247 -0.0328 -0.0496 159 LEU A O     
993  C CB    . LEU A 133 ? 0.7381 0.8682 0.7789 -0.0275 -0.0245 -0.0246 159 LEU A CB    
994  C CG    . LEU A 133 ? 0.7354 0.8587 0.7680 -0.0361 -0.0153 -0.0148 159 LEU A CG    
995  C CD1   . LEU A 133 ? 0.7339 0.8452 0.7448 -0.0345 -0.0130 -0.0093 159 LEU A CD1   
996  C CD2   . LEU A 133 ? 0.7307 0.8616 0.7812 -0.0430 -0.0072 -0.0131 159 LEU A CD2   
997  N N     . ASP A 134 ? 0.7681 0.9137 0.8342 -0.0078 -0.0526 -0.0516 160 ASP A N     
998  C CA    . ASP A 134 ? 0.7813 0.9400 0.8688 0.0024  -0.0655 -0.0663 160 ASP A CA    
999  C C     . ASP A 134 ? 0.7714 0.9505 0.8983 -0.0031 -0.0670 -0.0769 160 ASP A C     
1000 O O     . ASP A 134 ? 0.7626 0.9625 0.9271 -0.0055 -0.0638 -0.0861 160 ASP A O     
1001 C CB    . ASP A 134 ? 0.8090 0.9486 0.8654 0.0187  -0.0829 -0.0720 160 ASP A CB    
1002 C CG    . ASP A 134 ? 0.8429 0.9641 0.8664 0.0267  -0.0823 -0.0660 160 ASP A CG    
1003 O OD1   . ASP A 134 ? 0.8382 0.9691 0.8734 0.0232  -0.0737 -0.0626 160 ASP A OD1   
1004 O OD2   . ASP A 134 ? 0.8789 0.9721 0.8616 0.0367  -0.0894 -0.0647 160 ASP A OD2   
1005 N N     . ARG A 135 ? 0.7736 0.9455 0.8926 -0.0060 -0.0697 -0.0758 161 ARG A N     
1006 C CA    . ARG A 135 ? 0.7690 0.9566 0.9217 -0.0121 -0.0709 -0.0855 161 ARG A CA    
1007 C C     . ARG A 135 ? 0.7515 0.9509 0.9300 -0.0274 -0.0513 -0.0807 161 ARG A C     
1008 O O     . ARG A 135 ? 0.7466 0.9638 0.9638 -0.0326 -0.0478 -0.0918 161 ARG A O     
1009 C CB    . ARG A 135 ? 0.7785 0.9513 0.9102 -0.0114 -0.0770 -0.0836 161 ARG A CB    
1010 C CG    . ARG A 135 ? 0.7766 0.9622 0.9389 -0.0186 -0.0776 -0.0924 161 ARG A CG    
1011 C CD    . ARG A 135 ? 0.8017 0.9697 0.9390 -0.0163 -0.0841 -0.0905 161 ARG A CD    
1012 N NE    . ARG A 135 ? 0.8051 0.9574 0.9151 -0.0233 -0.0707 -0.0742 161 ARG A NE    
1013 C CZ    . ARG A 135 ? 0.7948 0.9492 0.9133 -0.0346 -0.0590 -0.0680 161 ARG A CZ    
1014 N NH1   . ARG A 135 ? 0.7773 0.9455 0.9271 -0.0418 -0.0565 -0.0751 161 ARG A NH1   
1015 N NH2   . ARG A 135 ? 0.7953 0.9367 0.8913 -0.0385 -0.0496 -0.0556 161 ARG A NH2   
1016 N N     . ILE A 136 ? 0.7480 0.9349 0.9038 -0.0342 -0.0385 -0.0653 162 ILE A N     
1017 C CA    . ILE A 136 ? 0.7396 0.9270 0.9058 -0.0468 -0.0212 -0.0587 162 ILE A CA    
1018 C C     . ILE A 136 ? 0.7375 0.9324 0.9225 -0.0507 -0.0085 -0.0603 162 ILE A C     
1019 O O     . ILE A 136 ? 0.7345 0.9326 0.9401 -0.0600 0.0051  -0.0627 162 ILE A O     
1020 C CB    . ILE A 136 ? 0.7400 0.9096 0.8743 -0.0503 -0.0156 -0.0436 162 ILE A CB    
1021 C CG1   . ILE A 136 ? 0.7463 0.9109 0.8762 -0.0528 -0.0189 -0.0430 162 ILE A CG1   
1022 C CG2   . ILE A 136 ? 0.7348 0.8980 0.8666 -0.0579 -0.0003 -0.0351 162 ILE A CG2   
1023 C CD1   . ILE A 136 ? 0.7675 0.9174 0.8692 -0.0527 -0.0181 -0.0324 162 ILE A CD1   
1024 N N     . ALA A 137 ? 0.7442 0.9387 0.9197 -0.0435 -0.0114 -0.0592 163 ALA A N     
1025 C CA    . ALA A 137 ? 0.7503 0.9475 0.9366 -0.0464 0.0021  -0.0587 163 ALA A CA    
1026 C C     . ALA A 137 ? 0.7532 0.9715 0.9850 -0.0474 0.0057  -0.0754 163 ALA A C     
1027 O O     . ALA A 137 ? 0.7597 0.9791 1.0060 -0.0533 0.0231  -0.0761 163 ALA A O     
1028 C CB    . ALA A 137 ? 0.7537 0.9422 0.9138 -0.0384 -0.0019 -0.0521 163 ALA A CB    
1029 N N     . GLN A 138 ? 0.7548 0.9885 1.0092 -0.0414 -0.0100 -0.0897 164 GLN A N     
1030 C CA    . GLN A 138 ? 0.7606 1.0186 1.0663 -0.0415 -0.0100 -0.1097 164 GLN A CA    
1031 C C     . GLN A 138 ? 0.7602 1.0221 1.0962 -0.0575 0.0125  -0.1133 164 GLN A C     
1032 O O     . GLN A 138 ? 0.7596 1.0097 1.0828 -0.0657 0.0181  -0.1059 164 GLN A O     
1033 C CB    . GLN A 138 ? 0.7632 1.0334 1.0834 -0.0309 -0.0349 -0.1251 164 GLN A CB    
1034 C CG    . GLN A 138 ? 0.7816 1.0469 1.0778 -0.0127 -0.0567 -0.1272 164 GLN A CG    
1035 C CD    . GLN A 138 ? 0.8172 1.0778 1.1017 -0.0015 -0.0811 -0.1353 164 GLN A CD    
1036 O OE1   . GLN A 138 ? 0.8261 1.0956 1.1342 -0.0063 -0.0848 -0.1448 164 GLN A OE1   
1037 N NE2   . GLN A 138 ? 0.8396 1.0821 1.0838 0.0136  -0.0972 -0.1316 164 GLN A NE2   
1038 N N     . PRO A 139 ? 0.7617 1.0380 1.1373 -0.0619 0.0271  -0.1252 165 PRO A N     
1039 C CA    . PRO A 139 ? 0.7659 1.0420 1.1706 -0.0780 0.0531  -0.1302 165 PRO A CA    
1040 C C     . PRO A 139 ? 0.7612 1.0520 1.2022 -0.0838 0.0477  -0.1456 165 PRO A C     
1041 O O     . PRO A 139 ? 0.7669 1.0526 1.2264 -0.0982 0.0697  -0.1486 165 PRO A O     
1042 C CB    . PRO A 139 ? 0.7704 1.0610 1.2126 -0.0789 0.0678  -0.1426 165 PRO A CB    
1043 C CG    . PRO A 139 ? 0.7640 1.0736 1.2143 -0.0616 0.0414  -0.1520 165 PRO A CG    
1044 C CD    . PRO A 139 ? 0.7643 1.0545 1.1566 -0.0521 0.0225  -0.1340 165 PRO A CD    
1045 N N     . ASN A 140 ? 0.7535 1.0583 1.2005 -0.0721 0.0189  -0.1552 166 ASN A N     
1046 C CA    . ASN A 140 ? 0.7526 1.0701 1.2295 -0.0751 0.0084  -0.1703 166 ASN A CA    
1047 C C     . ASN A 140 ? 0.7479 1.0459 1.1815 -0.0734 -0.0032 -0.1567 166 ASN A C     
1048 O O     . ASN A 140 ? 0.7485 1.0520 1.1982 -0.0756 -0.0122 -0.1666 166 ASN A O     
1049 C CB    . ASN A 140 ? 0.7565 1.1019 1.2735 -0.0615 -0.0175 -0.1946 166 ASN A CB    
1050 C CG    . ASN A 140 ? 0.7719 1.1110 1.2516 -0.0417 -0.0416 -0.1887 166 ASN A CG    
1051 O OD1   . ASN A 140 ? 0.7808 1.1113 1.2377 -0.0389 -0.0331 -0.1767 166 ASN A OD1   
1052 N ND2   . ASN A 140 ? 0.7872 1.1272 1.2579 -0.0275 -0.0711 -0.1975 166 ASN A ND2   
1053 N N     . TYR A 141 ? 0.7416 1.0174 1.1226 -0.0698 -0.0025 -0.1352 167 TYR A N     
1054 C CA    . TYR A 141 ? 0.7339 0.9906 1.0735 -0.0682 -0.0106 -0.1215 167 TYR A CA    
1055 C C     . TYR A 141 ? 0.7347 0.9847 1.0819 -0.0810 0.0011  -0.1210 167 TYR A C     
1056 O O     . TYR A 141 ? 0.7361 0.9792 1.0919 -0.0932 0.0245  -0.1178 167 TYR A O     
1057 C CB    . TYR A 141 ? 0.7328 0.9686 1.0250 -0.0661 -0.0049 -0.1003 167 TYR A CB    
1058 C CG    . TYR A 141 ? 0.7169 0.9326 0.9730 -0.0690 -0.0039 -0.0854 167 TYR A CG    
1059 C CD1   . TYR A 141 ? 0.7077 0.9180 0.9430 -0.0611 -0.0212 -0.0843 167 TYR A CD1   
1060 C CD2   . TYR A 141 ? 0.7115 0.9110 0.9523 -0.0783 0.0142  -0.0731 167 TYR A CD2   
1061 C CE1   . TYR A 141 ? 0.7096 0.9034 0.9167 -0.0639 -0.0189 -0.0722 167 TYR A CE1   
1062 C CE2   . TYR A 141 ? 0.7046 0.8876 0.9162 -0.0794 0.0133  -0.0614 167 TYR A CE2   
1063 C CZ    . TYR A 141 ? 0.7064 0.8889 0.9044 -0.0728 -0.0026 -0.0614 167 TYR A CZ    
1064 O OH    . TYR A 141 ? 0.7078 0.8758 0.8815 -0.0739 -0.0022 -0.0513 167 TYR A OH    
1065 N N     . ILE A 142 ? 0.7355 0.9838 1.0760 -0.0773 -0.0146 -0.1244 168 ILE A N     
1066 C CA    . ILE A 142 ? 0.7374 0.9759 1.0769 -0.0873 -0.0064 -0.1221 168 ILE A CA    
1067 C C     . ILE A 142 ? 0.7372 0.9563 1.0302 -0.0817 -0.0151 -0.1067 168 ILE A C     
1068 O O     . ILE A 142 ? 0.7428 0.9613 1.0203 -0.0703 -0.0346 -0.1089 168 ILE A O     
1069 C CB    . ILE A 142 ? 0.7417 0.9970 1.1221 -0.0892 -0.0165 -0.1435 168 ILE A CB    
1070 C CG1   . ILE A 142 ? 0.7417 1.0199 1.1774 -0.0955 -0.0069 -0.1622 168 ILE A CG1   
1071 C CG2   . ILE A 142 ? 0.7430 0.9849 1.1180 -0.0994 -0.0079 -0.1402 168 ILE A CG2   
1072 C CD1   . ILE A 142 ? 0.7442 1.0457 1.2269 -0.0926 -0.0249 -0.1883 168 ILE A CD1   
1073 N N     . PRO A 143 ? 0.7372 0.9378 1.0063 -0.0888 -0.0004 -0.0918 169 PRO A N     
1074 C CA    . PRO A 143 ? 0.7365 0.9212 0.9682 -0.0841 -0.0071 -0.0791 169 PRO A CA    
1075 C C     . PRO A 143 ? 0.7403 0.9242 0.9725 -0.0816 -0.0198 -0.0861 169 PRO A C     
1076 O O     . PRO A 143 ? 0.7453 0.9304 0.9965 -0.0892 -0.0147 -0.0930 169 PRO A O     
1077 C CB    . PRO A 143 ? 0.7385 0.9058 0.9544 -0.0922 0.0105  -0.0666 169 PRO A CB    
1078 C CG    . PRO A 143 ? 0.7413 0.9102 0.9711 -0.0978 0.0259  -0.0677 169 PRO A CG    
1079 C CD    . PRO A 143 ? 0.7427 0.9333 1.0146 -0.0997 0.0231  -0.0859 169 PRO A CD    
1080 N N     . THR A 144 ? 0.7455 0.9243 0.9547 -0.0709 -0.0350 -0.0845 170 THR A N     
1081 C CA    . THR A 144 ? 0.7555 0.9265 0.9545 -0.0670 -0.0462 -0.0888 170 THR A CA    
1082 C C     . THR A 144 ? 0.7602 0.9169 0.9426 -0.0732 -0.0356 -0.0777 170 THR A C     
1083 O O     . THR A 144 ? 0.7589 0.9105 0.9338 -0.0782 -0.0227 -0.0667 170 THR A O     
1084 C CB    . THR A 144 ? 0.7676 0.9278 0.9362 -0.0535 -0.0613 -0.0880 170 THR A CB    
1085 O OG1   . THR A 144 ? 0.7534 0.9009 0.8926 -0.0530 -0.0529 -0.0728 170 THR A OG1   
1086 C CG2   . THR A 144 ? 0.7580 0.9289 0.9375 -0.0443 -0.0741 -0.0989 170 THR A CG2   
1087 N N     . GLN A 145 ? 0.7697 0.9184 0.9449 -0.0716 -0.0423 -0.0813 171 GLN A N     
1088 C CA    . GLN A 145 ? 0.7737 0.9086 0.9330 -0.0755 -0.0340 -0.0720 171 GLN A CA    
1089 C C     . GLN A 145 ? 0.7660 0.8910 0.8979 -0.0714 -0.0302 -0.0588 171 GLN A C     
1090 O O     . GLN A 145 ? 0.7660 0.8847 0.8917 -0.0753 -0.0206 -0.0500 171 GLN A O     
1091 C CB    . GLN A 145 ? 0.7891 0.9161 0.9438 -0.0730 -0.0430 -0.0792 171 GLN A CB    
1092 C CG    . GLN A 145 ? 0.8059 0.9231 0.9586 -0.0799 -0.0334 -0.0748 171 GLN A CG    
1093 C CD    . GLN A 145 ? 0.8394 0.9510 0.9949 -0.0792 -0.0420 -0.0849 171 GLN A CD    
1094 O OE1   . GLN A 145 ? 0.8514 0.9659 1.0279 -0.0873 -0.0379 -0.0920 171 GLN A OE1   
1095 N NE2   . GLN A 145 ? 0.8514 0.9517 0.9835 -0.0698 -0.0526 -0.0860 171 GLN A NE2   
1096 N N     . GLN A 146 ? 0.7647 0.8866 0.8802 -0.0631 -0.0379 -0.0587 172 GLN A N     
1097 C CA    . GLN A 146 ? 0.7599 0.8731 0.8535 -0.0603 -0.0329 -0.0486 172 GLN A CA    
1098 C C     . GLN A 146 ? 0.7404 0.8607 0.8401 -0.0643 -0.0247 -0.0412 172 GLN A C     
1099 O O     . GLN A 146 ? 0.7323 0.8477 0.8241 -0.0658 -0.0182 -0.0334 172 GLN A O     
1100 C CB    . GLN A 146 ? 0.7754 0.8788 0.8472 -0.0509 -0.0409 -0.0511 172 GLN A CB    
1101 C CG    . GLN A 146 ? 0.8020 0.8928 0.8512 -0.0492 -0.0331 -0.0427 172 GLN A CG    
1102 C CD    . GLN A 146 ? 0.8350 0.9126 0.8728 -0.0499 -0.0275 -0.0407 172 GLN A CD    
1103 O OE1   . GLN A 146 ? 0.8519 0.9232 0.8877 -0.0485 -0.0321 -0.0458 172 GLN A OE1   
1104 N NE2   . GLN A 146 ? 0.8305 0.9041 0.8628 -0.0520 -0.0174 -0.0345 172 GLN A NE2   
1105 N N     . ASP A 147 ? 0.7271 0.8584 0.8415 -0.0653 -0.0255 -0.0450 173 ASP A N     
1106 C CA    . ASP A 147 ? 0.7101 0.8448 0.8287 -0.0692 -0.0168 -0.0387 173 ASP A CA    
1107 C C     . ASP A 147 ? 0.7073 0.8348 0.8265 -0.0753 -0.0073 -0.0332 173 ASP A C     
1108 O O     . ASP A 147 ? 0.7074 0.8283 0.8151 -0.0751 -0.0029 -0.0252 173 ASP A O     
1109 C CB    . ASP A 147 ? 0.7084 0.8555 0.8481 -0.0708 -0.0163 -0.0459 173 ASP A CB    
1110 C CG    . ASP A 147 ? 0.7040 0.8568 0.8412 -0.0624 -0.0272 -0.0515 173 ASP A CG    
1111 O OD1   . ASP A 147 ? 0.6865 0.8299 0.8004 -0.0559 -0.0328 -0.0480 173 ASP A OD1   
1112 O OD2   . ASP A 147 ? 0.7165 0.8819 0.8756 -0.0622 -0.0293 -0.0604 173 ASP A OD2   
1113 N N     . VAL A 148 ? 0.7037 0.8303 0.8347 -0.0799 -0.0052 -0.0384 174 VAL A N     
1114 C CA    . VAL A 148 ? 0.7067 0.8215 0.8347 -0.0849 0.0041  -0.0340 174 VAL A CA    
1115 C C     . VAL A 148 ? 0.7036 0.8084 0.8138 -0.0809 0.0019  -0.0273 174 VAL A C     
1116 O O     . VAL A 148 ? 0.7076 0.8013 0.8071 -0.0805 0.0065  -0.0210 174 VAL A O     
1117 C CB    . VAL A 148 ? 0.7136 0.8284 0.8586 -0.0912 0.0073  -0.0425 174 VAL A CB    
1118 C CG1   . VAL A 148 ? 0.7322 0.8286 0.8666 -0.0950 0.0168  -0.0374 174 VAL A CG1   
1119 C CG2   . VAL A 148 ? 0.7142 0.8396 0.8837 -0.0967 0.0128  -0.0510 174 VAL A CG2   
1120 N N     . LEU A 149 ? 0.6976 0.8048 0.8043 -0.0770 -0.0052 -0.0299 175 LEU A N     
1121 C CA    . LEU A 149 ? 0.6954 0.7957 0.7905 -0.0734 -0.0059 -0.0260 175 LEU A CA    
1122 C C     . LEU A 149 ? 0.6862 0.7873 0.7746 -0.0705 -0.0052 -0.0203 175 LEU A C     
1123 O O     . LEU A 149 ? 0.6894 0.7854 0.7741 -0.0686 -0.0043 -0.0170 175 LEU A O     
1124 C CB    . LEU A 149 ? 0.7032 0.8024 0.7930 -0.0700 -0.0112 -0.0307 175 LEU A CB    
1125 C CG    . LEU A 149 ? 0.7194 0.8097 0.7997 -0.0671 -0.0100 -0.0301 175 LEU A CG    
1126 C CD1   . LEU A 149 ? 0.7269 0.8115 0.8104 -0.0687 -0.0067 -0.0287 175 LEU A CD1   
1127 C CD2   . LEU A 149 ? 0.7258 0.8097 0.7971 -0.0640 -0.0150 -0.0362 175 LEU A CD2   
1128 N N     . ARG A 150 ? 0.6724 0.7799 0.7604 -0.0698 -0.0066 -0.0202 176 ARG A N     
1129 C CA    . ARG A 150 ? 0.6594 0.7678 0.7418 -0.0678 -0.0061 -0.0158 176 ARG A CA    
1130 C C     . ARG A 150 ? 0.6594 0.7631 0.7396 -0.0684 -0.0035 -0.0112 176 ARG A C     
1131 O O     . ARG A 150 ? 0.6569 0.7593 0.7322 -0.0658 -0.0051 -0.0084 176 ARG A O     
1132 C CB    . ARG A 150 ? 0.6554 0.7688 0.7345 -0.0660 -0.0083 -0.0173 176 ARG A CB    
1133 C CG    . ARG A 150 ? 0.6538 0.7628 0.7238 -0.0628 -0.0102 -0.0204 176 ARG A CG    
1134 C CD    . ARG A 150 ? 0.6526 0.7570 0.7188 -0.0626 -0.0058 -0.0184 176 ARG A CD    
1135 N NE    . ARG A 150 ? 0.6528 0.7481 0.7052 -0.0602 -0.0030 -0.0203 176 ARG A NE    
1136 C CZ    . ARG A 150 ? 0.6506 0.7419 0.7014 -0.0611 0.0037  -0.0200 176 ARG A CZ    
1137 N NH1   . ARG A 150 ? 0.6184 0.7177 0.6838 -0.0633 0.0049  -0.0191 176 ARG A NH1   
1138 N NH2   . ARG A 150 ? 0.6723 0.7494 0.7060 -0.0595 0.0095  -0.0219 176 ARG A NH2   
1139 N N     . THR A 151 ? 0.6633 0.7614 0.7455 -0.0717 0.0008  -0.0112 177 THR A N     
1140 C CA    . THR A 151 ? 0.6729 0.7585 0.7450 -0.0716 0.0054  -0.0066 177 THR A CA    
1141 C C     . THR A 151 ? 0.6810 0.7541 0.7406 -0.0661 0.0013  -0.0033 177 THR A C     
1142 O O     . THR A 151 ? 0.6696 0.7427 0.7320 -0.0640 -0.0020 -0.0050 177 THR A O     
1143 C CB    . THR A 151 ? 0.6848 0.7615 0.7595 -0.0773 0.0153  -0.0080 177 THR A CB    
1144 O OG1   . THR A 151 ? 0.6936 0.7622 0.7684 -0.0788 0.0167  -0.0096 177 THR A OG1   
1145 C CG2   . THR A 151 ? 0.6830 0.7754 0.7767 -0.0817 0.0175  -0.0142 177 THR A CG2   
1146 N N     . ARG A 152 ? 0.6970 0.7587 0.7427 -0.0626 0.0008  0.0004  178 ARG A N     
1147 C CA    . ARG A 152 ? 0.7216 0.7693 0.7540 -0.0549 -0.0063 0.0018  178 ARG A CA    
1148 C C     . ARG A 152 ? 0.7664 0.7851 0.7735 -0.0524 -0.0012 0.0060  178 ARG A C     
1149 O O     . ARG A 152 ? 0.7792 0.7883 0.7738 -0.0525 0.0029  0.0090  178 ARG A O     
1150 C CB    . ARG A 152 ? 0.7037 0.7605 0.7392 -0.0507 -0.0149 0.0008  178 ARG A CB    
1151 C CG    . ARG A 152 ? 0.6668 0.7457 0.7225 -0.0535 -0.0163 -0.0032 178 ARG A CG    
1152 C CD    . ARG A 152 ? 0.6090 0.6958 0.6680 -0.0524 -0.0201 -0.0044 178 ARG A CD    
1153 N NE    . ARG A 152 ? 0.5948 0.6740 0.6499 -0.0453 -0.0297 -0.0064 178 ARG A NE    
1154 C CZ    . ARG A 152 ? 0.5854 0.6699 0.6541 -0.0412 -0.0367 -0.0127 178 ARG A CZ    
1155 N NH1   . ARG A 152 ? 0.5723 0.6498 0.6383 -0.0330 -0.0484 -0.0164 178 ARG A NH1   
1156 N NH2   . ARG A 152 ? 0.5751 0.6710 0.6605 -0.0443 -0.0325 -0.0164 178 ARG A NH2   
1157 N N     . VAL A 153 ? 0.8049 0.8058 0.8013 -0.0501 0.0000  0.0062  179 VAL A N     
1158 C CA    . VAL A 153 ? 0.8635 0.8281 0.8281 -0.0465 0.0062  0.0103  179 VAL A CA    
1159 C C     . VAL A 153 ? 0.9041 0.8488 0.8476 -0.0328 -0.0078 0.0101  179 VAL A C     
1160 O O     . VAL A 153 ? 0.8913 0.8531 0.8519 -0.0281 -0.0199 0.0056  179 VAL A O     
1161 C CB    . VAL A 153 ? 0.8765 0.8278 0.8391 -0.0542 0.0208  0.0102  179 VAL A CB    
1162 C CG1   . VAL A 153 ? 0.8561 0.8239 0.8398 -0.0664 0.0342  0.0081  179 VAL A CG1   
1163 C CG2   . VAL A 153 ? 0.8624 0.8237 0.8385 -0.0536 0.0151  0.0067  179 VAL A CG2   
1164 N N     . LYS A 154 ? 0.9673 0.8744 0.8733 -0.0256 -0.0064 0.0140  180 LYS A N     
1165 C CA    . LYS A 154 ? 1.0253 0.9037 0.9033 -0.0101 -0.0205 0.0130  180 LYS A CA    
1166 C C     . LYS A 154 ? 1.0579 0.9150 0.9230 -0.0101 -0.0134 0.0138  180 LYS A C     
1167 O O     . LYS A 154 ? 1.0626 0.9148 0.9291 -0.0220 0.0056  0.0163  180 LYS A O     
1168 C CB    . LYS A 154 ? 1.0707 0.9079 0.9040 -0.0010 -0.0209 0.0172  180 LYS A CB    
1169 C CG    . LYS A 154 ? 1.0751 0.9247 0.9127 0.0050  -0.0356 0.0149  180 LYS A CG    
1170 C CD    . LYS A 154 ? 1.1419 0.9430 0.9275 0.0152  -0.0356 0.0193  180 LYS A CD    
1171 C CE    . LYS A 154 ? 1.1633 0.9645 0.9435 0.0295  -0.0605 0.0137  180 LYS A CE    
1172 N NZ    . LYS A 154 ? 1.2314 0.9734 0.9501 0.0460  -0.0670 0.0163  180 LYS A NZ    
1173 N N     . THR A 155 ? 1.0906 0.9350 0.9449 0.0032  -0.0286 0.0105  181 THR A N     
1174 C CA    . THR A 155 ? 1.1286 0.9481 0.9659 0.0048  -0.0223 0.0114  181 THR A CA    
1175 C C     . THR A 155 ? 1.1893 0.9604 0.9791 0.0242  -0.0345 0.0115  181 THR A C     
1176 O O     . THR A 155 ? 1.2037 0.9695 0.9835 0.0390  -0.0544 0.0079  181 THR A O     
1177 C CB    . THR A 155 ? 1.0925 0.9478 0.9695 0.0000  -0.0257 0.0063  181 THR A CB    
1178 O OG1   . THR A 155 ? 1.0542 0.9537 0.9717 -0.0122 -0.0223 0.0044  181 THR A OG1   
1179 C CG2   . THR A 155 ? 1.1067 0.9437 0.9739 -0.0073 -0.0102 0.0084  181 THR A CG2   
1180 N N     . THR A 156 ? 1.2332 0.9673 0.9930 0.0244  -0.0226 0.0148  182 THR A N     
1181 C CA    . THR A 156 ? 1.2983 0.9798 1.0071 0.0437  -0.0328 0.0150  182 THR A CA    
1182 C C     . THR A 156 ? 1.2915 0.9879 1.0197 0.0519  -0.0471 0.0087  182 THR A C     
1183 O O     . THR A 156 ? 1.2957 0.9864 1.0252 0.0442  -0.0340 0.0102  182 THR A O     
1184 C CB    . THR A 156 ? 1.3546 0.9770 1.0113 0.0394  -0.0079 0.0226  182 THR A CB    
1185 O OG1   . THR A 156 ? 1.3615 0.9737 1.0067 0.0294  0.0094  0.0277  182 THR A OG1   
1186 C CG2   . THR A 156 ? 1.4242 0.9816 1.0158 0.0623  -0.0190 0.0236  182 THR A CG2   
1187 N N     . GLY A 157 ? 1.2828 0.9994 1.0289 0.0670  -0.0733 0.0004  183 GLY A N     
1188 C CA    . GLY A 157 ? 1.2784 1.0070 1.0427 0.0782  -0.0890 -0.0075 183 GLY A CA    
1189 C C     . GLY A 157 ? 1.2306 1.0010 1.0417 0.0626  -0.0779 -0.0090 183 GLY A C     
1190 O O     . GLY A 157 ? 1.1842 0.9939 1.0322 0.0457  -0.0674 -0.0081 183 GLY A O     
1191 N N     . ILE A 158 ? 1.2454 1.0033 1.0507 0.0699  -0.0808 -0.0117 184 ILE A N     
1192 C CA    . ILE A 158 ? 1.2074 0.9992 1.0519 0.0586  -0.0727 -0.0142 184 ILE A CA    
1193 C C     . ILE A 158 ? 1.1861 0.9858 1.0378 0.0357  -0.0478 -0.0071 184 ILE A C     
1194 O O     . ILE A 158 ? 1.2172 0.9820 1.0347 0.0299  -0.0329 -0.0002 184 ILE A O     
1195 C CB    . ILE A 158 ? 1.2366 1.0045 1.0648 0.0717  -0.0792 -0.0175 184 ILE A CB    
1196 C CG1   . ILE A 158 ? 1.2709 1.0234 1.0861 0.0979  -0.1064 -0.0261 184 ILE A CG1   
1197 C CG2   . ILE A 158 ? 1.1946 1.0008 1.0669 0.0630  -0.0745 -0.0221 184 ILE A CG2   
1198 C CD1   . ILE A 158 ? 1.3505 1.0357 1.0964 0.1148  -0.1113 -0.0216 184 ILE A CD1   
1199 N N     . VAL A 159 ? 1.1378 0.9820 1.0343 0.0232  -0.0433 -0.0100 185 VAL A N     
1200 C CA    . VAL A 159 ? 1.1176 0.9728 1.0262 0.0039  -0.0242 -0.0064 185 VAL A CA    
1201 C C     . VAL A 159 ? 1.1109 0.9744 1.0342 0.0014  -0.0217 -0.0098 185 VAL A C     
1202 O O     . VAL A 159 ? 1.0958 0.9791 1.0405 0.0092  -0.0324 -0.0157 185 VAL A O     
1203 C CB    . VAL A 159 ? 1.0739 0.9687 1.0158 -0.0078 -0.0214 -0.0071 185 VAL A CB    
1204 C CG1   . VAL A 159 ? 1.0571 0.9617 1.0112 -0.0253 -0.0050 -0.0055 185 VAL A CG1   
1205 C CG2   . VAL A 159 ? 1.0813 0.9692 1.0099 -0.0047 -0.0248 -0.0042 185 VAL A CG2   
1206 N N     . GLU A 160 ? 1.1238 0.9714 1.0367 -0.0096 -0.0065 -0.0070 186 GLU A N     
1207 C CA    . GLU A 160 ? 1.1201 0.9733 1.0447 -0.0136 -0.0029 -0.0101 186 GLU A CA    
1208 C C     . GLU A 160 ? 1.1040 0.9672 1.0423 -0.0321 0.0119  -0.0101 186 GLU A C     
1209 O O     . GLU A 160 ? 1.1266 0.9683 1.0492 -0.0406 0.0248  -0.0074 186 GLU A O     
1210 C CB    . GLU A 160 ? 1.1669 0.9789 1.0574 -0.0031 -0.0033 -0.0091 186 GLU A CB    
1211 C CG    . GLU A 160 ? 1.1782 0.9934 1.0783 -0.0048 -0.0011 -0.0126 186 GLU A CG    
1212 C CD    . GLU A 160 ? 1.2511 1.0192 1.1124 0.0015  0.0035  -0.0106 186 GLU A CD    
1213 O OE1   . GLU A 160 ? 1.2990 1.0297 1.1227 0.0122  0.0013  -0.0071 186 GLU A OE1   
1214 O OE2   . GLU A 160 ? 1.2602 1.0250 1.1248 -0.0033 0.0094  -0.0126 186 GLU A OE2   
1215 N N     . THR A 161 ? 1.0696 0.9639 1.0373 -0.0379 0.0102  -0.0143 187 THR A N     
1216 C CA    . THR A 161 ? 1.0592 0.9592 1.0385 -0.0521 0.0201  -0.0170 187 THR A CA    
1217 C C     . THR A 161 ? 1.0636 0.9581 1.0428 -0.0501 0.0192  -0.0203 187 THR A C     
1218 O O     . THR A 161 ? 1.0540 0.9567 1.0382 -0.0400 0.0108  -0.0219 187 THR A O     
1219 C CB    . THR A 161 ? 1.0245 0.9584 1.0314 -0.0604 0.0188  -0.0199 187 THR A CB    
1220 O OG1   . THR A 161 ? 1.0008 0.9562 1.0211 -0.0532 0.0095  -0.0215 187 THR A OG1   
1221 C CG2   . THR A 161 ? 1.0225 0.9599 1.0299 -0.0650 0.0225  -0.0172 187 THR A CG2   
1222 N N     . HIS A 162 ? 1.0771 0.9575 1.0524 -0.0601 0.0288  -0.0225 188 HIS A N     
1223 C CA    . HIS A 162 ? 1.0845 0.9577 1.0586 -0.0600 0.0291  -0.0261 188 HIS A CA    
1224 C C     . HIS A 162 ? 1.0614 0.9531 1.0570 -0.0722 0.0310  -0.0326 188 HIS A C     
1225 O O     . HIS A 162 ? 1.0548 0.9537 1.0621 -0.0829 0.0362  -0.0351 188 HIS A O     
1226 C CB    . HIS A 162 ? 1.1276 0.9605 1.0730 -0.0592 0.0376  -0.0242 188 HIS A CB    
1227 C CG    . HIS A 162 ? 1.1625 0.9738 1.0950 -0.0683 0.0509  -0.0222 188 HIS A CG    
1228 N ND1   . HIS A 162 ? 1.2019 0.9902 1.1085 -0.0605 0.0523  -0.0161 188 HIS A ND1   
1229 C CD2   . HIS A 162 ? 1.1811 0.9889 1.1235 -0.0845 0.0643  -0.0266 188 HIS A CD2   
1230 C CE1   . HIS A 162 ? 1.2269 0.9959 1.1250 -0.0720 0.0685  -0.0156 188 HIS A CE1   
1231 N NE2   . HIS A 162 ? 1.2168 0.9992 1.1398 -0.0872 0.0766  -0.0226 188 HIS A NE2   
1232 N N     . PHE A 163 ? 1.0516 0.9503 1.0524 -0.0693 0.0260  -0.0361 189 PHE A N     
1233 C CA    . PHE A 163 ? 1.0379 0.9485 1.0531 -0.0776 0.0245  -0.0434 189 PHE A CA    
1234 C C     . PHE A 163 ? 1.0468 0.9486 1.0547 -0.0729 0.0221  -0.0462 189 PHE A C     
1235 O O     . PHE A 163 ? 1.0502 0.9465 1.0492 -0.0623 0.0206  -0.0429 189 PHE A O     
1236 C CB    . PHE A 163 ? 1.0105 0.9488 1.0421 -0.0780 0.0179  -0.0449 189 PHE A CB    
1237 C CG    . PHE A 163 ? 0.9902 0.9390 1.0209 -0.0675 0.0132  -0.0416 189 PHE A CG    
1238 C CD1   . PHE A 163 ? 0.9849 0.9342 1.0135 -0.0632 0.0110  -0.0447 189 PHE A CD1   
1239 C CD2   . PHE A 163 ? 0.9736 0.9302 1.0061 -0.0622 0.0121  -0.0364 189 PHE A CD2   
1240 C CE1   . PHE A 163 ? 0.9789 0.9371 1.0100 -0.0551 0.0105  -0.0432 189 PHE A CE1   
1241 C CE2   . PHE A 163 ? 0.9635 0.9316 1.0012 -0.0540 0.0090  -0.0357 189 PHE A CE2   
1242 C CZ    . PHE A 163 ? 0.9635 0.9328 1.0020 -0.0510 0.0096  -0.0393 189 PHE A CZ    
1243 N N     . THR A 164 ? 1.0519 0.9523 1.0648 -0.0803 0.0213  -0.0536 190 THR A N     
1244 C CA    . THR A 164 ? 1.0627 0.9532 1.0667 -0.0763 0.0188  -0.0571 190 THR A CA    
1245 C C     . THR A 164 ? 1.0482 0.9540 1.0576 -0.0740 0.0111  -0.0613 190 THR A C     
1246 O O     . THR A 164 ? 1.0392 0.9581 1.0603 -0.0795 0.0061  -0.0662 190 THR A O     
1247 C CB    . THR A 164 ? 1.0856 0.9570 1.0862 -0.0851 0.0225  -0.0635 190 THR A CB    
1248 O OG1   . THR A 164 ? 1.1023 0.9546 1.0938 -0.0883 0.0324  -0.0594 190 THR A OG1   
1249 C CG2   . THR A 164 ? 1.1011 0.9574 1.0874 -0.0794 0.0206  -0.0659 190 THR A CG2   
1250 N N     . PHE A 165 ? 1.0490 0.9504 1.0482 -0.0650 0.0111  -0.0599 191 PHE A N     
1251 C CA    . PHE A 165 ? 1.0468 0.9530 1.0418 -0.0613 0.0070  -0.0631 191 PHE A CA    
1252 C C     . PHE A 165 ? 1.0656 0.9540 1.0446 -0.0546 0.0104  -0.0643 191 PHE A C     
1253 O O     . PHE A 165 ? 1.0680 0.9515 1.0458 -0.0489 0.0164  -0.0605 191 PHE A O     
1254 C CB    . PHE A 165 ? 1.0282 0.9518 1.0305 -0.0572 0.0082  -0.0584 191 PHE A CB    
1255 C CG    . PHE A 165 ? 1.0302 0.9530 1.0229 -0.0533 0.0068  -0.0612 191 PHE A CG    
1256 C CD1   . PHE A 165 ? 1.0366 0.9560 1.0226 -0.0557 -0.0020 -0.0675 191 PHE A CD1   
1257 C CD2   . PHE A 165 ? 1.0296 0.9529 1.0195 -0.0468 0.0146  -0.0585 191 PHE A CD2   
1258 C CE1   . PHE A 165 ? 1.0451 0.9561 1.0136 -0.0501 -0.0035 -0.0698 191 PHE A CE1   
1259 C CE2   . PHE A 165 ? 1.0334 0.9490 1.0086 -0.0435 0.0168  -0.0607 191 PHE A CE2   
1260 C CZ    . PHE A 165 ? 1.0474 0.9541 1.0079 -0.0444 0.0074  -0.0656 191 PHE A CZ    
1261 N N     . LYS A 166 ? 1.0802 0.9573 1.0461 -0.0541 0.0059  -0.0705 192 LYS A N     
1262 C CA    . LYS A 166 ? 1.1026 0.9581 1.0490 -0.0481 0.0098  -0.0725 192 LYS A CA    
1263 C C     . LYS A 166 ? 1.1114 0.9554 1.0568 -0.0476 0.0149  -0.0706 192 LYS A C     
1264 O O     . LYS A 166 ? 1.1178 0.9539 1.0574 -0.0400 0.0223  -0.0683 192 LYS A O     
1265 C CB    . LYS A 166 ? 1.1025 0.9571 1.0413 -0.0400 0.0180  -0.0699 192 LYS A CB    
1266 C CG    . LYS A 166 ? 1.1113 0.9642 1.0381 -0.0388 0.0139  -0.0726 192 LYS A CG    
1267 C CD    . LYS A 166 ? 1.1286 0.9759 1.0464 -0.0323 0.0268  -0.0702 192 LYS A CD    
1268 C CE    . LYS A 166 ? 1.1445 0.9822 1.0420 -0.0301 0.0236  -0.0724 192 LYS A CE    
1269 N NZ    . LYS A 166 ? 1.1588 0.9861 1.0450 -0.0253 0.0402  -0.0706 192 LYS A NZ    
1270 N N     . ASP A 167 ? 1.1135 0.9553 1.0651 -0.0557 0.0120  -0.0724 193 ASP A N     
1271 C CA    . ASP A 167 ? 1.1295 0.9546 1.0754 -0.0563 0.0170  -0.0708 193 ASP A CA    
1272 C C     . ASP A 167 ? 1.1222 0.9493 1.0700 -0.0484 0.0228  -0.0632 193 ASP A C     
1273 O O     . ASP A 167 ? 1.1416 0.9510 1.0784 -0.0429 0.0265  -0.0620 193 ASP A O     
1274 C CB    . ASP A 167 ? 1.1572 0.9587 1.0845 -0.0536 0.0174  -0.0757 193 ASP A CB    
1275 C CG    . ASP A 167 ? 1.1725 0.9684 1.0973 -0.0608 0.0085  -0.0854 193 ASP A CG    
1276 O OD1   . ASP A 167 ? 1.1866 0.9777 1.0990 -0.0558 0.0036  -0.0891 193 ASP A OD1   
1277 O OD2   . ASP A 167 ? 1.1775 0.9717 1.1122 -0.0711 0.0066  -0.0904 193 ASP A OD2   
1278 N N     . LEU A 168 ? 1.0850 0.9282 1.1567 0.0807  -0.1383 -0.1511 194 LEU A N     
1279 C CA    . LEU A 168 ? 1.0653 0.9073 1.1309 0.0692  -0.1206 -0.1321 194 LEU A CA    
1280 C C     . LEU A 168 ? 1.0452 0.8815 1.1333 0.0479  -0.1070 -0.1113 194 LEU A C     
1281 O O     . LEU A 168 ? 1.0383 0.8780 1.1301 0.0419  -0.1023 -0.1064 194 LEU A O     
1282 C CB    . LEU A 168 ? 1.0606 0.9163 1.0804 0.0754  -0.1050 -0.1240 194 LEU A CB    
1283 C CG    . LEU A 168 ? 1.0787 0.9447 1.0684 0.0975  -0.1116 -0.1396 194 LEU A CG    
1284 C CD1   . LEU A 168 ? 1.0659 0.9468 1.0179 0.0997  -0.0922 -0.1252 194 LEU A CD1   
1285 C CD2   . LEU A 168 ? 1.0807 0.9415 1.0820 0.1055  -0.1218 -0.1518 194 LEU A CD2   
1286 N N     . HIS A 169 ? 1.0375 0.8655 1.1405 0.0377  -0.1009 -0.0992 195 HIS A N     
1287 C CA    . HIS A 169 ? 1.0233 0.8476 1.1407 0.0198  -0.0855 -0.0778 195 HIS A CA    
1288 C C     . HIS A 169 ? 1.0052 0.8372 1.0855 0.0156  -0.0664 -0.0624 195 HIS A C     
1289 O O     . HIS A 169 ? 1.0051 0.8353 1.0733 0.0160  -0.0625 -0.0567 195 HIS A O     
1290 C CB    . HIS A 169 ? 1.0329 0.8435 1.1855 0.0115  -0.0889 -0.0702 195 HIS A CB    
1291 C CG    . HIS A 169 ? 1.0551 0.8569 1.2563 0.0106  -0.1055 -0.0804 195 HIS A CG    
1292 N ND1   . HIS A 169 ? 1.0680 0.8697 1.3002 -0.0002 -0.1009 -0.0723 195 HIS A ND1   
1293 C CD2   . HIS A 169 ? 1.0806 0.8736 1.3093 0.0195  -0.1274 -0.0987 195 HIS A CD2   
1294 C CE1   . HIS A 169 ? 1.0793 0.8724 1.3584 0.0009  -0.1194 -0.0843 195 HIS A CE1   
1295 N NE2   . HIS A 169 ? 1.0900 0.8770 1.3678 0.0131  -0.1367 -0.1012 195 HIS A NE2   
1296 N N     . PHE A 170 ? 0.9874 0.8278 1.0526 0.0123  -0.0563 -0.0568 196 PHE A N     
1297 C CA    . PHE A 170 ? 0.9673 0.8144 1.0030 0.0081  -0.0401 -0.0434 196 PHE A CA    
1298 C C     . PHE A 170 ? 0.9573 0.7998 1.0014 -0.0055 -0.0272 -0.0261 196 PHE A C     
1299 O O     . PHE A 170 ? 0.9552 0.7960 1.0212 -0.0129 -0.0243 -0.0219 196 PHE A O     
1300 C CB    . PHE A 170 ? 0.9603 0.8176 0.9771 0.0116  -0.0359 -0.0452 196 PHE A CB    
1301 C CG    . PHE A 170 ? 0.9629 0.8281 0.9573 0.0264  -0.0425 -0.0562 196 PHE A CG    
1302 C CD1   . PHE A 170 ? 0.9538 0.8263 0.9231 0.0303  -0.0342 -0.0505 196 PHE A CD1   
1303 C CD2   . PHE A 170 ? 0.9727 0.8390 0.9720 0.0375  -0.0570 -0.0720 196 PHE A CD2   
1304 C CE1   . PHE A 170 ? 0.9640 0.8461 0.9123 0.0449  -0.0373 -0.0581 196 PHE A CE1   
1305 C CE2   . PHE A 170 ? 0.9860 0.8611 0.9595 0.0536  -0.0619 -0.0812 196 PHE A CE2   
1306 C CZ    . PHE A 170 ? 0.9821 0.8658 0.9298 0.0572  -0.0505 -0.0731 196 PHE A CZ    
1307 N N     . LYS A 171 ? 0.9491 0.7906 0.9758 -0.0079 -0.0196 -0.0163 197 LYS A N     
1308 C CA    . LYS A 171 ? 0.9422 0.7820 0.9642 -0.0177 -0.0063 -0.0003 197 LYS A CA    
1309 C C     . LYS A 171 ? 0.9258 0.7736 0.9184 -0.0167 0.0018  0.0028  197 LYS A C     
1310 O O     . LYS A 171 ? 0.9245 0.7735 0.9022 -0.0127 0.0006  0.0027  197 LYS A O     
1311 C CB    . LYS A 171 ? 0.9558 0.7852 0.9865 -0.0212 -0.0067 0.0094  197 LYS A CB    
1312 C CG    . LYS A 171 ? 0.9737 0.7942 1.0413 -0.0246 -0.0134 0.0098  197 LYS A CG    
1313 C CD    . LYS A 171 ? 0.9963 0.8052 1.0750 -0.0246 -0.0195 0.0155  197 LYS A CD    
1314 C CE    . LYS A 171 ? 1.0263 0.8258 1.1489 -0.0278 -0.0284 0.0146  197 LYS A CE    
1315 N NZ    . LYS A 171 ? 1.0434 0.8297 1.1824 -0.0300 -0.0325 0.0252  197 LYS A NZ    
1316 N N     . MET A 172 ? 0.9094 0.7628 0.8978 -0.0200 0.0092  0.0049  198 MET A N     
1317 C CA    . MET A 172 ? 0.8934 0.7537 0.8601 -0.0192 0.0153  0.0069  198 MET A CA    
1318 C C     . MET A 172 ? 0.8888 0.7473 0.8461 -0.0251 0.0248  0.0169  198 MET A C     
1319 O O     . MET A 172 ? 0.8875 0.7467 0.8510 -0.0295 0.0317  0.0207  198 MET A O     
1320 C CB    . MET A 172 ? 0.8860 0.7532 0.8530 -0.0171 0.0152  0.0012  198 MET A CB    
1321 C CG    . MET A 172 ? 0.8856 0.7591 0.8358 -0.0160 0.0198  0.0035  198 MET A CG    
1322 S SD    . MET A 172 ? 0.8736 0.7540 0.8243 -0.0119 0.0180  -0.0012 198 MET A SD    
1323 C CE    . MET A 172 ? 0.8869 0.7715 0.8296 -0.0007 0.0098  -0.0074 198 MET A CE    
1324 N N     . PHE A 173 ? 0.8828 0.7401 0.8252 -0.0237 0.0245  0.0203  199 PHE A N     
1325 C CA    . PHE A 173 ? 0.8836 0.7389 0.8125 -0.0265 0.0307  0.0277  199 PHE A CA    
1326 C C     . PHE A 173 ? 0.8702 0.7316 0.7872 -0.0252 0.0320  0.0246  199 PHE A C     
1327 O O     . PHE A 173 ? 0.8631 0.7281 0.7782 -0.0222 0.0276  0.0213  199 PHE A O     
1328 C CB    . PHE A 173 ? 0.8938 0.7423 0.8160 -0.0252 0.0269  0.0332  199 PHE A CB    
1329 C CG    . PHE A 173 ? 0.9108 0.7512 0.8469 -0.0271 0.0257  0.0390  199 PHE A CG    
1330 C CD1   . PHE A 173 ? 0.9292 0.7648 0.8636 -0.0305 0.0331  0.0510  199 PHE A CD1   
1331 C CD2   . PHE A 173 ? 0.9075 0.7451 0.8594 -0.0244 0.0169  0.0329  199 PHE A CD2   
1332 C CE1   . PHE A 173 ? 0.9400 0.7675 0.8924 -0.0331 0.0323  0.0592  199 PHE A CE1   
1333 C CE2   . PHE A 173 ? 0.9180 0.7466 0.8884 -0.0264 0.0137  0.0378  199 PHE A CE2   
1334 C CZ    . PHE A 173 ? 0.9311 0.7542 0.9039 -0.0315 0.0216  0.0522  199 PHE A CZ    
1335 N N     . ASP A 174 ? 0.8685 0.7314 0.7800 -0.0271 0.0384  0.0259  200 ASP A N     
1336 C CA    . ASP A 174 ? 0.8601 0.7264 0.7621 -0.0258 0.0383  0.0225  200 ASP A CA    
1337 C C     . ASP A 174 ? 0.8752 0.7378 0.7602 -0.0243 0.0403  0.0258  200 ASP A C     
1338 O O     . ASP A 174 ? 0.8808 0.7438 0.7607 -0.0247 0.0481  0.0288  200 ASP A O     
1339 C CB    . ASP A 174 ? 0.8519 0.7233 0.7617 -0.0268 0.0421  0.0182  200 ASP A CB    
1340 C CG    . ASP A 174 ? 0.8354 0.7088 0.7390 -0.0253 0.0413  0.0137  200 ASP A CG    
1341 O OD1   . ASP A 174 ? 0.8187 0.6907 0.7165 -0.0236 0.0356  0.0127  200 ASP A OD1   
1342 O OD2   . ASP A 174 ? 0.8140 0.6903 0.7219 -0.0255 0.0453  0.0103  200 ASP A OD2   
1343 N N     . VAL A 175 ? 0.8838 0.7439 0.7602 -0.0217 0.0333  0.0253  201 VAL A N     
1344 C CA    . VAL A 175 ? 0.9120 0.7681 0.7686 -0.0179 0.0319  0.0271  201 VAL A CA    
1345 C C     . VAL A 175 ? 0.9248 0.7841 0.7723 -0.0150 0.0333  0.0201  201 VAL A C     
1346 O O     . VAL A 175 ? 0.9475 0.8056 0.7760 -0.0107 0.0374  0.0218  201 VAL A O     
1347 C CB    . VAL A 175 ? 0.9164 0.7690 0.7698 -0.0151 0.0212  0.0265  201 VAL A CB    
1348 C CG1   . VAL A 175 ? 0.9414 0.7891 0.7717 -0.0094 0.0173  0.0275  201 VAL A CG1   
1349 C CG2   . VAL A 175 ? 0.9153 0.7646 0.7776 -0.0165 0.0196  0.0322  201 VAL A CG2   
1350 N N     . GLY A 176 ? 0.9213 0.7848 0.7823 -0.0162 0.0301  0.0127  202 GLY A N     
1351 C CA    . GLY A 176 ? 0.9362 0.8023 0.7947 -0.0135 0.0305  0.0044  202 GLY A CA    
1352 C C     . GLY A 176 ? 0.9606 0.8240 0.8083 -0.0076 0.0201  -0.0033 202 GLY A C     
1353 O O     . GLY A 176 ? 0.9620 0.8222 0.8088 -0.0065 0.0115  -0.0023 202 GLY A O     
1354 N N     . GLY A 177 ? 0.9835 0.8483 0.8244 -0.0027 0.0198  -0.0125 203 GLY A N     
1355 C CA    . GLY A 177 ? 1.0180 0.8800 0.8513 0.0044  0.0069  -0.0240 203 GLY A CA    
1356 C C     . GLY A 177 ? 1.0627 0.9216 0.8631 0.0136  0.0052  -0.0245 203 GLY A C     
1357 O O     . GLY A 177 ? 1.0808 0.9369 0.8718 0.0217  -0.0078 -0.0359 203 GLY A O     
1358 N N     . GLN A 178 ? 1.0815 0.9408 0.8657 0.0130  0.0176  -0.0119 204 GLN A N     
1359 C CA    . GLN A 178 ? 1.1267 0.9833 0.8770 0.0221  0.0190  -0.0074 204 GLN A CA    
1360 C C     . GLN A 178 ? 1.1350 0.9844 0.8812 0.0234  0.0057  -0.0045 204 GLN A C     
1361 O O     . GLN A 178 ? 1.1157 0.9631 0.8799 0.0154  0.0055  0.0037  204 GLN A O     
1362 C CB    . GLN A 178 ? 1.1362 0.9958 0.8781 0.0196  0.0379  0.0083  204 GLN A CB    
1363 C CG    . GLN A 178 ? 1.1580 1.0266 0.9016 0.0207  0.0523  0.0056  204 GLN A CG    
1364 C CD    . GLN A 178 ? 1.1504 1.0225 0.9282 0.0115  0.0531  0.0001  204 GLN A CD    
1365 O OE1   . GLN A 178 ? 1.1399 1.0091 0.9394 0.0028  0.0492  0.0042  204 GLN A OE1   
1366 N NE2   . GLN A 178 ? 1.1587 1.0374 0.9398 0.0148  0.0581  -0.0093 204 GLN A NE2   
1367 N N     . ARG A 179 ? 1.1677 1.0136 0.8905 0.0346  -0.0066 -0.0129 205 ARG A N     
1368 C CA    . ARG A 179 ? 1.1810 1.0202 0.9014 0.0375  -0.0224 -0.0128 205 ARG A CA    
1369 C C     . ARG A 179 ? 1.1893 1.0238 0.8957 0.0363  -0.0154 0.0056  205 ARG A C     
1370 O O     . ARG A 179 ? 1.2132 1.0477 0.8926 0.0413  -0.0036 0.0160  205 ARG A O     
1371 C CB    . ARG A 179 ? 1.2160 1.0522 0.9126 0.0520  -0.0392 -0.0278 205 ARG A CB    
1372 C CG    . ARG A 179 ? 1.2320 1.0623 0.9384 0.0544  -0.0604 -0.0331 205 ARG A CG    
1373 C CD    . ARG A 179 ? 1.2951 1.1202 0.9654 0.0714  -0.0764 -0.0429 205 ARG A CD    
1374 N NE    . ARG A 179 ? 1.3160 1.1351 0.9945 0.0737  -0.0954 -0.0442 205 ARG A NE    
1375 C CZ    . ARG A 179 ? 1.3310 1.1448 0.9949 0.0746  -0.0945 -0.0292 205 ARG A CZ    
1376 N NH1   . ARG A 179 ? 1.3343 1.1475 0.9762 0.0728  -0.0752 -0.0103 205 ARG A NH1   
1377 N NH2   . ARG A 179 ? 1.3333 1.1423 1.0088 0.0772  -0.1135 -0.0329 205 ARG A NH2   
1378 N N     . SER A 180 ? 1.1718 1.0029 0.8990 0.0301  -0.0221 0.0102  206 SER A N     
1379 C CA    . SER A 180 ? 1.1770 1.0024 0.8982 0.0283  -0.0177 0.0267  206 SER A CA    
1380 C C     . SER A 180 ? 1.1849 1.0037 0.9052 0.0329  -0.0349 0.0258  206 SER A C     
1381 O O     . SER A 180 ? 1.1677 0.9885 0.9106 0.0315  -0.0476 0.0147  206 SER A O     
1382 C CB    . SER A 180 ? 1.1479 0.9757 0.8979 0.0164  -0.0067 0.0343  206 SER A CB    
1383 O OG    . SER A 180 ? 1.1534 0.9861 0.9023 0.0130  0.0093  0.0384  206 SER A OG    
1384 N N     . GLU A 181 ? 1.2110 1.0222 0.9073 0.0386  -0.0348 0.0388  207 GLU A N     
1385 C CA    . GLU A 181 ? 1.2220 1.0255 0.9148 0.0442  -0.0515 0.0400  207 GLU A CA    
1386 C C     . GLU A 181 ? 1.1891 0.9925 0.9184 0.0352  -0.0543 0.0419  207 GLU A C     
1387 O O     . GLU A 181 ? 1.1584 0.9655 0.9082 0.0257  -0.0416 0.0466  207 GLU A O     
1388 C CB    . GLU A 181 ? 1.2612 1.0560 0.9186 0.0526  -0.0488 0.0568  207 GLU A CB    
1389 C CG    . GLU A 181 ? 1.3101 1.1053 0.9235 0.0667  -0.0499 0.0538  207 GLU A CG    
1390 C CD    . GLU A 181 ? 1.3667 1.1532 0.9428 0.0772  -0.0493 0.0724  207 GLU A CD    
1391 O OE1   . GLU A 181 ? 1.3709 1.1539 0.9511 0.0710  -0.0345 0.0936  207 GLU A OE1   
1392 O OE2   . GLU A 181 ? 1.4037 1.1862 0.9472 0.0922  -0.0645 0.0662  207 GLU A OE2   
1393 N N     . ARG A 182 ? 1.1904 0.9904 0.9275 0.0396  -0.0716 0.0371  208 ARG A N     
1394 C CA    . ARG A 182 ? 1.1646 0.9662 0.9356 0.0339  -0.0757 0.0370  208 ARG A CA    
1395 C C     . ARG A 182 ? 1.1559 0.9529 0.9334 0.0283  -0.0643 0.0513  208 ARG A C     
1396 O O     . ARG A 182 ? 1.1287 0.9306 0.9348 0.0219  -0.0607 0.0491  208 ARG A O     
1397 C CB    . ARG A 182 ? 1.1811 0.9783 0.9546 0.0418  -0.0963 0.0320  208 ARG A CB    
1398 C CG    . ARG A 182 ? 1.1720 0.9715 0.9793 0.0384  -0.1012 0.0317  208 ARG A CG    
1399 C CD    . ARG A 182 ? 1.2125 1.0069 1.0209 0.0474  -0.1225 0.0276  208 ARG A CD    
1400 N NE    . ARG A 182 ? 1.2129 1.0089 1.0514 0.0458  -0.1264 0.0287  208 ARG A NE    
1401 C CZ    . ARG A 182 ? 1.2028 1.0111 1.0789 0.0429  -0.1291 0.0189  208 ARG A CZ    
1402 N NH1   . ARG A 182 ? 1.1992 1.0181 1.0906 0.0400  -0.1289 0.0088  208 ARG A NH1   
1403 N NH2   . ARG A 182 ? 1.1929 1.0035 1.0936 0.0433  -0.1316 0.0198  208 ARG A NH2   
1404 N N     . LYS A 183 ? 1.1797 0.9676 0.9315 0.0315  -0.0590 0.0659  209 LYS A N     
1405 C CA    . LYS A 183 ? 1.1769 0.9582 0.9385 0.0265  -0.0505 0.0806  209 LYS A CA    
1406 C C     . LYS A 183 ? 1.1499 0.9376 0.9279 0.0170  -0.0338 0.0814  209 LYS A C     
1407 O O     . LYS A 183 ? 1.1307 0.9176 0.9345 0.0114  -0.0317 0.0827  209 LYS A O     
1408 C CB    . LYS A 183 ? 1.2166 0.9865 0.9484 0.0329  -0.0491 0.0993  209 LYS A CB    
1409 C CG    . LYS A 183 ? 1.2291 0.9879 0.9766 0.0303  -0.0495 0.1146  209 LYS A CG    
1410 C CD    . LYS A 183 ? 1.2318 0.9862 0.9986 0.0333  -0.0676 0.1073  209 LYS A CD    
1411 C CE    . LYS A 183 ? 1.2724 1.0195 1.0131 0.0450  -0.0838 0.1094  209 LYS A CE    
1412 N NZ    . LYS A 183 ? 1.3116 1.0451 1.0269 0.0503  -0.0817 0.1326  209 LYS A NZ    
1413 N N     . LYS A 184 ? 1.1447 0.9387 0.9083 0.0163  -0.0236 0.0792  210 LYS A N     
1414 C CA    . LYS A 184 ? 1.1222 0.9231 0.9018 0.0080  -0.0093 0.0785  210 LYS A CA    
1415 C C     . LYS A 184 ? 1.0829 0.8916 0.8914 0.0029  -0.0122 0.0651  210 LYS A C     
1416 O O     . LYS A 184 ? 1.0670 0.8777 0.8956 -0.0028 -0.0058 0.0658  210 LYS A O     
1417 C CB    . LYS A 184 ? 1.1339 0.9410 0.8932 0.0099  0.0008  0.0768  210 LYS A CB    
1418 C CG    . LYS A 184 ? 1.1767 0.9801 0.9148 0.0125  0.0134  0.0944  210 LYS A CG    
1419 C CD    . LYS A 184 ? 1.2063 1.0163 0.9151 0.0195  0.0204  0.0908  210 LYS A CD    
1420 C CE    . LYS A 184 ? 1.2460 1.0534 0.9281 0.0251  0.0331  0.1108  210 LYS A CE    
1421 N NZ    . LYS A 184 ? 1.2674 1.0823 0.9154 0.0355  0.0396  0.1062  210 LYS A NZ    
1422 N N     . TRP A 185 ? 1.0673 0.8808 0.8786 0.0059  -0.0224 0.0534  211 TRP A N     
1423 C CA    . TRP A 185 ? 1.0343 0.8566 0.8722 0.0025  -0.0244 0.0435  211 TRP A CA    
1424 C C     . TRP A 185 ? 1.0207 0.8410 0.8774 0.0024  -0.0285 0.0453  211 TRP A C     
1425 O O     . TRP A 185 ? 1.0006 0.8266 0.8751 -0.0006 -0.0235 0.0418  211 TRP A O     
1426 C CB    . TRP A 185 ? 1.0298 0.8578 0.8715 0.0057  -0.0343 0.0330  211 TRP A CB    
1427 C CG    . TRP A 185 ? 1.0320 0.8650 0.8676 0.0047  -0.0305 0.0267  211 TRP A CG    
1428 C CD1   . TRP A 185 ? 1.0503 0.8808 0.8671 0.0103  -0.0371 0.0216  211 TRP A CD1   
1429 C CD2   . TRP A 185 ? 1.0116 0.8524 0.8603 -0.0008 -0.0207 0.0236  211 TRP A CD2   
1430 N NE1   . TRP A 185 ? 1.0408 0.8769 0.8605 0.0082  -0.0319 0.0148  211 TRP A NE1   
1431 C CE2   . TRP A 185 ? 1.0174 0.8596 0.8569 0.0009  -0.0217 0.0169  211 TRP A CE2   
1432 C CE3   . TRP A 185 ? 0.9911 0.8374 0.8572 -0.0058 -0.0125 0.0250  211 TRP A CE3   
1433 C CZ2   . TRP A 185 ? 1.0085 0.8570 0.8583 -0.0031 -0.0145 0.0129  211 TRP A CZ2   
1434 C CZ3   . TRP A 185 ? 0.9791 0.8318 0.8523 -0.0093 -0.0055 0.0217  211 TRP A CZ3   
1435 C CH2   . TRP A 185 ? 0.9902 0.8437 0.8566 -0.0085 -0.0063 0.0163  211 TRP A CH2   
1436 N N     . ILE A 186 ? 1.0291 0.8410 0.8807 0.0071  -0.0383 0.0498  212 ILE A N     
1437 C CA    . ILE A 186 ? 1.0198 0.8284 0.8896 0.0084  -0.0437 0.0507  212 ILE A CA    
1438 C C     . ILE A 186 ? 1.0132 0.8171 0.8918 0.0042  -0.0357 0.0565  212 ILE A C     
1439 O O     . ILE A 186 ? 0.9980 0.8054 0.8972 0.0041  -0.0365 0.0504  212 ILE A O     
1440 C CB    . ILE A 186 ? 1.0437 0.8418 0.9052 0.0147  -0.0568 0.0563  212 ILE A CB    
1441 C CG1   . ILE A 186 ? 1.0425 0.8464 0.9042 0.0196  -0.0682 0.0471  212 ILE A CG1   
1442 C CG2   . ILE A 186 ? 1.0397 0.8319 0.9212 0.0163  -0.0624 0.0581  212 ILE A CG2   
1443 C CD1   . ILE A 186 ? 1.0133 0.8314 0.9043 0.0186  -0.0688 0.0356  212 ILE A CD1   
1444 N N     . HIS A 187 ? 1.0245 0.8215 0.8890 0.0014  -0.0282 0.0677  213 HIS A N     
1445 C CA    . HIS A 187 ? 1.0216 0.8145 0.8998 -0.0035 -0.0207 0.0738  213 HIS A CA    
1446 C C     . HIS A 187 ? 0.9951 0.7988 0.8872 -0.0072 -0.0143 0.0629  213 HIS A C     
1447 O O     . HIS A 187 ? 0.9906 0.7937 0.9031 -0.0083 -0.0155 0.0589  213 HIS A O     
1448 C CB    . HIS A 187 ? 1.0428 0.8293 0.9052 -0.0056 -0.0111 0.0898  213 HIS A CB    
1449 C CG    . HIS A 187 ? 1.0775 0.8520 0.9249 -0.0010 -0.0163 0.1044  213 HIS A CG    
1450 N ND1   . HIS A 187 ? 1.0867 0.8520 0.9466 0.0019  -0.0286 0.1063  213 HIS A ND1   
1451 C CD2   . HIS A 187 ? 1.1093 0.8795 0.9289 0.0021  -0.0109 0.1185  213 HIS A CD2   
1452 C CE1   . HIS A 187 ? 1.1136 0.8685 0.9545 0.0063  -0.0313 0.1218  213 HIS A CE1   
1453 N NE2   . HIS A 187 ? 1.1238 0.8818 0.9382 0.0070  -0.0203 0.1299  213 HIS A NE2   
1454 N N     . CYS A 188 ? 0.9819 0.7950 0.8630 -0.0081 -0.0092 0.0573  214 CYS A N     
1455 C CA    . CYS A 188 ? 0.9573 0.7806 0.8489 -0.0107 -0.0038 0.0482  214 CYS A CA    
1456 C C     . CYS A 188 ? 0.9306 0.7605 0.8377 -0.0073 -0.0093 0.0383  214 CYS A C     
1457 O O     . CYS A 188 ? 0.9252 0.7584 0.8447 -0.0073 -0.0077 0.0331  214 CYS A O     
1458 C CB    . CYS A 188 ? 0.9541 0.7848 0.8329 -0.0115 0.0007  0.0446  214 CYS A CB    
1459 S SG    . CYS A 188 ? 1.0046 0.8329 0.8691 -0.0146 0.0118  0.0525  214 CYS A SG    
1460 N N     . PHE A 189 ? 0.9171 0.7498 0.8239 -0.0033 -0.0161 0.0354  215 PHE A N     
1461 C CA    . PHE A 189 ? 0.8949 0.7367 0.8167 0.0012  -0.0193 0.0272  215 PHE A CA    
1462 C C     . PHE A 189 ? 0.8957 0.7319 0.8301 0.0049  -0.0246 0.0249  215 PHE A C     
1463 O O     . PHE A 189 ? 0.8835 0.7282 0.8287 0.0098  -0.0250 0.0164  215 PHE A O     
1464 C CB    . PHE A 189 ? 0.8939 0.7405 0.8179 0.0045  -0.0255 0.0255  215 PHE A CB    
1465 C CG    . PHE A 189 ? 0.8905 0.7430 0.8088 0.0018  -0.0231 0.0249  215 PHE A CG    
1466 C CD1   . PHE A 189 ? 0.8981 0.7479 0.8122 0.0035  -0.0315 0.0251  215 PHE A CD1   
1467 C CD2   . PHE A 189 ? 0.8755 0.7355 0.7943 -0.0014 -0.0144 0.0232  215 PHE A CD2   
1468 C CE1   . PHE A 189 ? 0.8983 0.7526 0.8108 0.0019  -0.0318 0.0223  215 PHE A CE1   
1469 C CE2   . PHE A 189 ? 0.8804 0.7446 0.7980 -0.0036 -0.0137 0.0221  215 PHE A CE2   
1470 C CZ    . PHE A 189 ? 0.8888 0.7499 0.8042 -0.0020 -0.0227 0.0210  215 PHE A CZ    
1471 N N     . GLU A 190 ? 0.9061 0.7281 0.8393 0.0035  -0.0289 0.0328  216 GLU A N     
1472 C CA    . GLU A 190 ? 0.9099 0.7241 0.8596 0.0069  -0.0364 0.0307  216 GLU A CA    
1473 C C     . GLU A 190 ? 0.8982 0.7134 0.8602 0.0061  -0.0340 0.0243  216 GLU A C     
1474 O O     . GLU A 190 ? 0.8954 0.7073 0.8557 0.0000  -0.0278 0.0298  216 GLU A O     
1475 C CB    . GLU A 190 ? 0.9327 0.7304 0.8804 0.0052  -0.0415 0.0438  216 GLU A CB    
1476 C CG    . GLU A 190 ? 0.9517 0.7465 0.8970 0.0106  -0.0512 0.0450  216 GLU A CG    
1477 C CD    . GLU A 190 ? 0.9847 0.7645 0.9174 0.0096  -0.0547 0.0610  216 GLU A CD    
1478 O OE1   . GLU A 190 ? 1.0040 0.7770 0.9298 0.0044  -0.0472 0.0727  216 GLU A OE1   
1479 O OE2   . GLU A 190 ? 1.0063 0.7819 0.9362 0.0147  -0.0647 0.0625  216 GLU A OE2   
1480 N N     . GLY A 191 ? 0.9986 0.5840 1.1044 -0.0407 -0.2402 0.2124  217 GLY A N     
1481 C CA    . GLY A 191 ? 0.9718 0.5697 1.1113 -0.0388 -0.2305 0.1989  217 GLY A CA    
1482 C C     . GLY A 191 ? 0.9271 0.5592 1.0621 -0.0326 -0.2037 0.1782  217 GLY A C     
1483 O O     . GLY A 191 ? 0.9215 0.5586 1.0741 -0.0353 -0.1979 0.1713  217 GLY A O     
1484 N N     . VAL A 192 ? 0.9009 0.5525 1.0155 -0.0240 -0.1915 0.1679  218 VAL A N     
1485 C CA    . VAL A 192 ? 0.8647 0.5426 0.9666 -0.0191 -0.1684 0.1509  218 VAL A CA    
1486 C C     . VAL A 192 ? 0.8519 0.5269 0.9680 -0.0016 -0.1683 0.1220  218 VAL A C     
1487 O O     . VAL A 192 ? 0.8537 0.5229 0.9818 0.0106  -0.1700 0.1084  218 VAL A O     
1488 C CB    . VAL A 192 ? 0.8511 0.5479 0.9198 -0.0198 -0.1530 0.1536  218 VAL A CB    
1489 C CG1   . VAL A 192 ? 0.8479 0.5445 0.9271 -0.0053 -0.1606 0.1419  218 VAL A CG1   
1490 C CG2   . VAL A 192 ? 0.8151 0.5356 0.8706 -0.0185 -0.1313 0.1407  218 VAL A CG2   
1491 N N     . THR A 193 ? 0.8438 0.5168 0.9588 -0.0013 -0.1663 0.1115  219 THR A N     
1492 C CA    . THR A 193 ? 0.8538 0.5094 0.9573 0.0134  -0.1658 0.0843  219 THR A CA    
1493 C C     . THR A 193 ? 0.8370 0.5023 0.9033 0.0206  -0.1442 0.0713  219 THR A C     
1494 O O     . THR A 193 ? 0.8501 0.5028 0.9056 0.0315  -0.1322 0.0542  219 THR A O     
1495 C CB    . THR A 193 ? 0.8669 0.5078 0.9753 0.0115  -0.1802 0.0774  219 THR A CB    
1496 O OG1   . THR A 193 ? 0.8993 0.5353 1.0492 0.0016  -0.1969 0.0920  219 THR A OG1   
1497 C CG2   . THR A 193 ? 0.9023 0.5053 0.9825 0.0265  -0.1866 0.0500  219 THR A CG2   
1498 N N     . ALA A 194 ? 0.8100 0.4958 0.8613 0.0136  -0.1365 0.0782  220 ALA A N     
1499 C CA    . ALA A 194 ? 0.7926 0.4851 0.8086 0.0194  -0.1188 0.0672  220 ALA A CA    
1500 C C     . ALA A 194 ? 0.7570 0.4839 0.7710 0.0104  -0.1066 0.0820  220 ALA A C     
1501 O O     . ALA A 194 ? 0.7545 0.4958 0.7851 -0.0022 -0.1088 0.0978  220 ALA A O     
1502 C CB    . ALA A 194 ? 0.8126 0.4796 0.7999 0.0247  -0.1269 0.0509  220 ALA A CB    
1503 N N     . ILE A 195 ? 0.7352 0.4712 0.7282 0.0162  -0.0906 0.0752  221 ILE A N     
1504 C CA    . ILE A 195 ? 0.7028 0.4671 0.6866 0.0101  -0.0791 0.0843  221 ILE A CA    
1505 C C     . ILE A 195 ? 0.6967 0.4602 0.6534 0.0149  -0.0702 0.0705  221 ILE A C     
1506 O O     . ILE A 195 ? 0.7088 0.4499 0.6409 0.0245  -0.0630 0.0551  221 ILE A O     
1507 C CB    . ILE A 195 ? 0.6944 0.4684 0.6834 0.0129  -0.0740 0.0884  221 ILE A CB    
1508 C CG1   . ILE A 195 ? 0.7034 0.4714 0.7110 0.0058  -0.0912 0.1066  221 ILE A CG1   
1509 C CG2   . ILE A 195 ? 0.6628 0.4599 0.6340 0.0103  -0.0616 0.0910  221 ILE A CG2   
1510 C CD1   . ILE A 195 ? 0.6790 0.4430 0.7068 0.0127  -0.1001 0.1056  221 ILE A CD1   
1511 N N     . ILE A 196 ? 0.6746 0.4568 0.6354 0.0073  -0.0696 0.0753  222 ILE A N     
1512 C CA    . ILE A 196 ? 0.6611 0.4451 0.6013 0.0111  -0.0651 0.0646  222 ILE A CA    
1513 C C     . ILE A 196 ? 0.6373 0.4525 0.5739 0.0073  -0.0483 0.0712  222 ILE A C     
1514 O O     . ILE A 196 ? 0.6249 0.4616 0.5767 -0.0033 -0.0430 0.0827  222 ILE A O     
1515 C CB    . ILE A 196 ? 0.6625 0.4448 0.6235 0.0073  -0.0802 0.0599  222 ILE A CB    
1516 C CG1   . ILE A 196 ? 0.6841 0.4335 0.6544 0.0105  -0.1033 0.0541  222 ILE A CG1   
1517 C CG2   . ILE A 196 ? 0.6453 0.4192 0.5820 0.0133  -0.0835 0.0475  222 ILE A CG2   
1518 C CD1   . ILE A 196 ? 0.6934 0.4335 0.6932 0.0093  -0.1273 0.0449  222 ILE A CD1   
1519 N N     . PHE A 197 ? 0.6302 0.4417 0.5432 0.0151  -0.0379 0.0628  223 PHE A N     
1520 C CA    . PHE A 197 ? 0.6062 0.4431 0.5160 0.0136  -0.0254 0.0660  223 PHE A CA    
1521 C C     . PHE A 197 ? 0.6030 0.4437 0.4989 0.0151  -0.0226 0.0571  223 PHE A C     
1522 O O     . PHE A 197 ? 0.6143 0.4287 0.4832 0.0222  -0.0219 0.0462  223 PHE A O     
1523 C CB    . PHE A 197 ? 0.6052 0.4379 0.5147 0.0207  -0.0159 0.0617  223 PHE A CB    
1524 C CG    . PHE A 197 ? 0.5960 0.4532 0.5105 0.0192  -0.0106 0.0661  223 PHE A CG    
1525 C CD1   . PHE A 197 ? 0.6052 0.4717 0.5279 0.0133  -0.0207 0.0796  223 PHE A CD1   
1526 C CD2   . PHE A 197 ? 0.5780 0.4414 0.4824 0.0231  0.0014  0.0572  223 PHE A CD2   
1527 C CE1   . PHE A 197 ? 0.5805 0.4601 0.4986 0.0124  -0.0214 0.0825  223 PHE A CE1   
1528 C CE2   . PHE A 197 ? 0.5729 0.4571 0.4842 0.0224  0.0028  0.0598  223 PHE A CE2   
1529 C CZ    . PHE A 197 ? 0.5617 0.4532 0.4785 0.0175  -0.0100 0.0717  223 PHE A CZ    
1530 N N     . CYS A 198 ? 0.5817 0.4489 0.4932 0.0074  -0.0200 0.0614  224 CYS A N     
1531 C CA    . CYS A 198 ? 0.5676 0.4429 0.4795 0.0083  -0.0200 0.0522  224 CYS A CA    
1532 C C     . CYS A 198 ? 0.5458 0.4380 0.4443 0.0105  -0.0070 0.0510  224 CYS A C     
1533 O O     . CYS A 198 ? 0.5420 0.4516 0.4417 0.0063  0.0014  0.0589  224 CYS A O     
1534 C CB    . CYS A 198 ? 0.5578 0.4530 0.5075 -0.0013 -0.0198 0.0526  224 CYS A CB    
1535 S SG    . CYS A 198 ? 0.6053 0.4813 0.5862 -0.0040 -0.0382 0.0519  224 CYS A SG    
1536 N N     . VAL A 199 ? 0.5386 0.4184 0.4205 0.0167  -0.0090 0.0410  225 VAL A N     
1537 C CA    . VAL A 199 ? 0.5201 0.4122 0.3928 0.0193  0.0017  0.0380  225 VAL A CA    
1538 C C     . VAL A 199 ? 0.5235 0.4187 0.4016 0.0198  -0.0060 0.0292  225 VAL A C     
1539 O O     . VAL A 199 ? 0.5430 0.4074 0.4086 0.0234  -0.0225 0.0229  225 VAL A O     
1540 C CB    . VAL A 199 ? 0.5416 0.4056 0.3873 0.0261  0.0108  0.0338  225 VAL A CB    
1541 C CG1   . VAL A 199 ? 0.5276 0.4035 0.3717 0.0281  0.0220  0.0299  225 VAL A CG1   
1542 C CG2   . VAL A 199 ? 0.5163 0.3773 0.3721 0.0271  0.0176  0.0382  225 VAL A CG2   
1543 N N     . ALA A 200 ? 0.5046 0.4311 0.3997 0.0166  0.0023  0.0276  226 ALA A N     
1544 C CA    . ALA A 200 ? 0.5047 0.4350 0.4125 0.0183  -0.0052 0.0168  226 ALA A CA    
1545 C C     . ALA A 200 ? 0.5148 0.4260 0.3911 0.0249  -0.0040 0.0141  226 ALA A C     
1546 O O     . ALA A 200 ? 0.5083 0.4387 0.3848 0.0251  0.0094  0.0153  226 ALA A O     
1547 C CB    . ALA A 200 ? 0.4842 0.4527 0.4227 0.0117  0.0079  0.0134  226 ALA A CB    
1548 N N     . LEU A 201 ? 0.5424 0.4090 0.3878 0.0296  -0.0185 0.0103  227 LEU A N     
1549 C CA    . LEU A 201 ? 0.5598 0.3961 0.3664 0.0332  -0.0128 0.0085  227 LEU A CA    
1550 C C     . LEU A 201 ? 0.5346 0.3980 0.3633 0.0335  -0.0116 0.0035  227 LEU A C     
1551 O O     . LEU A 201 ? 0.5257 0.3907 0.3447 0.0342  0.0041  0.0043  227 LEU A O     
1552 C CB    . LEU A 201 ? 0.6138 0.3822 0.3673 0.0364  -0.0336 0.0052  227 LEU A CB    
1553 C CG    . LEU A 201 ? 0.6489 0.3709 0.3566 0.0369  -0.0292 0.0079  227 LEU A CG    
1554 C CD1   . LEU A 201 ? 0.6758 0.3238 0.3262 0.0400  -0.0616 0.0034  227 LEU A CD1   
1555 C CD2   . LEU A 201 ? 0.6450 0.3530 0.3253 0.0357  0.0069  0.0099  227 LEU A CD2   
1556 N N     . SER A 202 ? 0.5207 0.4042 0.3867 0.0328  -0.0280 -0.0037 228 SER A N     
1557 C CA    . SER A 202 ? 0.5094 0.4177 0.4033 0.0335  -0.0293 -0.0122 228 SER A CA    
1558 C C     . SER A 202 ? 0.4744 0.4288 0.3874 0.0305  -0.0055 -0.0113 228 SER A C     
1559 O O     . SER A 202 ? 0.4639 0.4382 0.3958 0.0313  -0.0039 -0.0193 228 SER A O     
1560 C CB    . SER A 202 ? 0.5050 0.4239 0.4491 0.0333  -0.0501 -0.0242 228 SER A CB    
1561 O OG    . SER A 202 ? 0.5189 0.4600 0.4939 0.0277  -0.0423 -0.0228 228 SER A OG    
1562 N N     . ASP A 203 ? 0.4670 0.4321 0.3719 0.0275  0.0085  -0.0022 229 ASP A N     
1563 C CA    . ASP A 203 ? 0.4474 0.4411 0.3576 0.0253  0.0222  -0.0007 229 ASP A CA    
1564 C C     . ASP A 203 ? 0.4391 0.4263 0.3396 0.0300  0.0263  -0.0003 229 ASP A C     
1565 O O     . ASP A 203 ? 0.4286 0.4336 0.3356 0.0301  0.0300  -0.0010 229 ASP A O     
1566 C CB    . ASP A 203 ? 0.4456 0.4438 0.3490 0.0204  0.0284  0.0095  229 ASP A CB    
1567 C CG    . ASP A 203 ? 0.4618 0.4739 0.3795 0.0120  0.0343  0.0083  229 ASP A CG    
1568 O OD1   . ASP A 203 ? 0.4673 0.4885 0.4132 0.0107  0.0336  -0.0026 229 ASP A OD1   
1569 O OD2   . ASP A 203 ? 0.5240 0.5351 0.4289 0.0059  0.0404  0.0178  229 ASP A OD2   
1570 N N     . TYR A 204 ? 0.4519 0.4074 0.3348 0.0332  0.0260  0.0001  230 TYR A N     
1571 C CA    . TYR A 204 ? 0.4486 0.3941 0.3300 0.0355  0.0378  0.0000  230 TYR A CA    
1572 C C     . TYR A 204 ? 0.4360 0.4035 0.3383 0.0372  0.0360  -0.0072 230 TYR A C     
1573 O O     . TYR A 204 ? 0.4303 0.4026 0.3494 0.0386  0.0439  -0.0084 230 TYR A O     
1574 C CB    . TYR A 204 ? 0.4800 0.3751 0.3253 0.0356  0.0450  0.0012  230 TYR A CB    
1575 C CG    . TYR A 204 ? 0.4980 0.3687 0.3232 0.0362  0.0325  -0.0026 230 TYR A CG    
1576 C CD1   . TYR A 204 ? 0.4957 0.3616 0.3250 0.0363  0.0402  -0.0054 230 TYR A CD1   
1577 C CD2   . TYR A 204 ? 0.5220 0.3718 0.3305 0.0371  0.0087  -0.0043 230 TYR A CD2   
1578 C CE1   . TYR A 204 ? 0.5441 0.3827 0.3541 0.0369  0.0245  -0.0082 230 TYR A CE1   
1579 C CE2   . TYR A 204 ? 0.5480 0.3692 0.3419 0.0387  -0.0112 -0.0086 230 TYR A CE2   
1580 C CZ    . TYR A 204 ? 0.5870 0.4016 0.3780 0.0385  -0.0032 -0.0098 230 TYR A CZ    
1581 O OH    . TYR A 204 ? 0.6430 0.4246 0.4187 0.0400  -0.0270 -0.0132 230 TYR A OH    
1582 N N     . ASP A 205 ? 0.4331 0.4137 0.3428 0.0372  0.0252  -0.0141 231 ASP A N     
1583 C CA    . ASP A 205 ? 0.4386 0.4355 0.3669 0.0394  0.0227  -0.0230 231 ASP A CA    
1584 C C     . ASP A 205 ? 0.4281 0.4601 0.3723 0.0383  0.0224  -0.0301 231 ASP A C     
1585 O O     . ASP A 205 ? 0.4171 0.4629 0.3761 0.0402  0.0193  -0.0406 231 ASP A O     
1586 C CB    . ASP A 205 ? 0.4444 0.4228 0.3711 0.0410  0.0098  -0.0291 231 ASP A CB    
1587 C CG    . ASP A 205 ? 0.4540 0.4472 0.4015 0.0402  -0.0018 -0.0373 231 ASP A CG    
1588 O OD1   . ASP A 205 ? 0.4081 0.4197 0.3627 0.0366  0.0050  -0.0359 231 ASP A OD1   
1589 O OD2   . ASP A 205 ? 0.5293 0.5131 0.4919 0.0427  -0.0183 -0.0460 231 ASP A OD2   
1590 N N     . LEU A 206 ? 0.4392 0.4785 0.3736 0.0343  0.0265  -0.0246 232 LEU A N     
1591 C CA    . LEU A 206 ? 0.4575 0.5141 0.3861 0.0305  0.0305  -0.0300 232 LEU A CA    
1592 C C     . LEU A 206 ? 0.4736 0.5307 0.3964 0.0339  0.0235  -0.0317 232 LEU A C     
1593 O O     . LEU A 206 ? 0.4770 0.5245 0.4056 0.0373  0.0170  -0.0246 232 LEU A O     
1594 C CB    . LEU A 206 ? 0.4710 0.5230 0.3800 0.0236  0.0368  -0.0206 232 LEU A CB    
1595 C CG    . LEU A 206 ? 0.4937 0.5487 0.4168 0.0182  0.0443  -0.0220 232 LEU A CG    
1596 C CD1   . LEU A 206 ? 0.5162 0.5614 0.4190 0.0113  0.0497  -0.0092 232 LEU A CD1   
1597 C CD2   . LEU A 206 ? 0.4833 0.5557 0.4284 0.0139  0.0566  -0.0384 232 LEU A CD2   
1598 N N     . VAL A 207 ? 0.4867 0.5529 0.4037 0.0334  0.0241  -0.0436 233 VAL A N     
1599 C CA    . VAL A 207 ? 0.5143 0.5752 0.4217 0.0371  0.0108  -0.0477 233 VAL A CA    
1600 C C     . VAL A 207 ? 0.5500 0.5905 0.4227 0.0343  0.0010  -0.0367 233 VAL A C     
1601 O O     . VAL A 207 ? 0.5710 0.6028 0.4130 0.0267  0.0112  -0.0299 233 VAL A O     
1602 C CB    . VAL A 207 ? 0.5309 0.5991 0.4293 0.0365  0.0149  -0.0653 233 VAL A CB    
1603 C CG1   . VAL A 207 ? 0.5816 0.6340 0.4556 0.0402  -0.0041 -0.0706 233 VAL A CG1   
1604 C CG2   . VAL A 207 ? 0.4999 0.5845 0.4410 0.0413  0.0157  -0.0756 233 VAL A CG2   
1605 N N     . LEU A 208 ? 0.5706 0.6006 0.4550 0.0404  -0.0208 -0.0354 234 LEU A N     
1606 C CA    . LEU A 208 ? 0.6265 0.6291 0.4807 0.0398  -0.0426 -0.0273 234 LEU A CA    
1607 C C     . LEU A 208 ? 0.6956 0.6730 0.4781 0.0333  -0.0442 -0.0308 234 LEU A C     
1608 O O     . LEU A 208 ? 0.7184 0.6963 0.4882 0.0348  -0.0442 -0.0449 234 LEU A O     
1609 C CB    . LEU A 208 ? 0.6254 0.6225 0.5219 0.0492  -0.0712 -0.0324 234 LEU A CB    
1610 C CG    . LEU A 208 ? 0.6529 0.6311 0.5734 0.0532  -0.0977 -0.0250 234 LEU A CG    
1611 C CD1   . LEU A 208 ? 0.6231 0.6101 0.5659 0.0504  -0.0775 -0.0139 234 LEU A CD1   
1612 C CD2   . LEU A 208 ? 0.6130 0.5971 0.6054 0.0624  -0.1173 -0.0361 234 LEU A CD2   
1613 N N     . ALA A 209 ? 0.7486 0.6986 0.4793 0.0251  -0.0429 -0.0186 235 ALA A N     
1614 C CA    . ALA A 209 ? 0.8391 0.7449 0.4820 0.0169  -0.0456 -0.0196 235 ALA A CA    
1615 C C     . ALA A 209 ? 0.8937 0.7600 0.5094 0.0247  -0.0923 -0.0226 235 ALA A C     
1616 O O     . ALA A 209 ? 0.8614 0.7365 0.5380 0.0355  -0.1230 -0.0216 235 ALA A O     
1617 C CB    . ALA A 209 ? 0.8827 0.7597 0.4728 0.0045  -0.0327 -0.0034 235 ALA A CB    
1618 N N     . GLU A 210 ? 0.9864 0.8037 0.5114 0.0188  -0.0976 -0.0279 236 GLU A N     
1619 C CA    . GLU A 210 ? 1.0544 0.8258 0.5456 0.0270  -0.1480 -0.0343 236 GLU A CA    
1620 C C     . GLU A 210 ? 1.0928 0.8228 0.5801 0.0319  -0.2001 -0.0198 236 GLU A C     
1621 O O     . GLU A 210 ? 1.0994 0.8175 0.6265 0.0443  -0.2491 -0.0265 236 GLU A O     
1622 C CB    . GLU A 210 ? 1.1560 0.8709 0.5313 0.0181  -0.1394 -0.0443 236 GLU A CB    
1623 C CG    . GLU A 210 ? 1.2290 0.8961 0.5686 0.0283  -0.1931 -0.0568 236 GLU A CG    
1624 C CD    . GLU A 210 ? 1.1736 0.8922 0.5958 0.0400  -0.1935 -0.0779 236 GLU A CD    
1625 O OE1   . GLU A 210 ? 1.1264 0.8971 0.5866 0.0365  -0.1452 -0.0874 236 GLU A OE1   
1626 O OE2   . GLU A 210 ? 1.1654 0.8691 0.6189 0.0526  -0.2455 -0.0855 236 GLU A OE2   
1627 N N     . ASP A 211 ? 1.1193 0.8275 0.5688 0.0224  -0.1913 -0.0014 237 ASP A N     
1628 C CA    . ASP A 211 ? 1.1745 0.8364 0.6155 0.0263  -0.2430 0.0123  237 ASP A CA    
1629 C C     . ASP A 211 ? 1.0785 0.7927 0.6360 0.0338  -0.2431 0.0182  237 ASP A C     
1630 O O     . ASP A 211 ? 1.1033 0.7886 0.6747 0.0373  -0.2812 0.0282  237 ASP A O     
1631 C CB    . ASP A 211 ? 1.2856 0.8759 0.6009 0.0102  -0.2384 0.0300  237 ASP A CB    
1632 C CG    . ASP A 211 ? 1.2614 0.8883 0.5827 -0.0033 -0.1766 0.0402  237 ASP A CG    
1633 O OD1   . ASP A 211 ? 1.3632 0.9374 0.6011 -0.0174 -0.1691 0.0568  237 ASP A OD1   
1634 O OD2   . ASP A 211 ? 1.1652 0.8669 0.5722 -0.0003 -0.1386 0.0318  237 ASP A OD2   
1635 N N     . GLU A 212 ? 0.9750 0.9104 0.5831 0.0737  -0.2077 -0.1012 238 GLU A N     
1636 C CA    . GLU A 212 ? 0.9125 0.8614 0.5763 0.0632  -0.1934 -0.0853 238 GLU A CA    
1637 C C     . GLU A 212 ? 0.8792 0.8542 0.6080 0.0531  -0.2142 -0.1008 238 GLU A C     
1638 O O     . GLU A 212 ? 0.8787 0.8576 0.6311 0.0424  -0.2219 -0.1223 238 GLU A O     
1639 C CB    . GLU A 212 ? 0.8779 0.8163 0.5552 0.0499  -0.1605 -0.0792 238 GLU A CB    
1640 C CG    . GLU A 212 ? 0.8649 0.7993 0.5518 0.0485  -0.1365 -0.0545 238 GLU A CG    
1641 C CD    . GLU A 212 ? 0.8414 0.7715 0.5550 0.0342  -0.1113 -0.0522 238 GLU A CD    
1642 O OE1   . GLU A 212 ? 0.7901 0.7256 0.5349 0.0285  -0.1010 -0.0409 238 GLU A OE1   
1643 O OE2   . GLU A 212 ? 0.8547 0.7750 0.5566 0.0302  -0.1026 -0.0620 238 GLU A OE2   
1644 N N     . GLU A 213 ? 0.8577 0.8499 0.6187 0.0567  -0.2220 -0.0899 239 GLU A N     
1645 C CA    . GLU A 213 ? 0.8310 0.8503 0.6632 0.0466  -0.2356 -0.1012 239 GLU A CA    
1646 C C     . GLU A 213 ? 0.7668 0.7893 0.6463 0.0310  -0.2063 -0.0925 239 GLU A C     
1647 O O     . GLU A 213 ? 0.7531 0.7857 0.6801 0.0170  -0.2047 -0.1048 239 GLU A O     
1648 C CB    . GLU A 213 ? 0.8500 0.8893 0.6990 0.0600  -0.2609 -0.0968 239 GLU A CB    
1649 C CG    . GLU A 213 ? 0.9409 0.9815 0.7513 0.0746  -0.2987 -0.1123 239 GLU A CG    
1650 C CD    . GLU A 213 ? 0.9904 1.0606 0.8433 0.0833  -0.3332 -0.1184 239 GLU A CD    
1651 O OE1   . GLU A 213 ? 0.9858 1.0732 0.8891 0.0825  -0.3251 -0.1052 239 GLU A OE1   
1652 O OE2   . GLU A 213 ? 1.0506 1.1269 0.8860 0.0922  -0.3697 -0.1375 239 GLU A OE2   
1653 N N     . MET A 214 ? 0.7315 0.7428 0.5958 0.0339  -0.1830 -0.0715 240 MET A N     
1654 C CA    . MET A 214 ? 0.6792 0.6899 0.5764 0.0218  -0.1569 -0.0637 240 MET A CA    
1655 C C     . MET A 214 ? 0.6611 0.6485 0.5233 0.0179  -0.1338 -0.0567 240 MET A C     
1656 O O     . MET A 214 ? 0.6805 0.6526 0.4953 0.0263  -0.1326 -0.0515 240 MET A O     
1657 C CB    . MET A 214 ? 0.6637 0.6833 0.5847 0.0272  -0.1502 -0.0488 240 MET A CB    
1658 C CG    . MET A 214 ? 0.6889 0.6933 0.5693 0.0400  -0.1456 -0.0318 240 MET A CG    
1659 S SD    . MET A 214 ? 0.7263 0.7376 0.6378 0.0464  -0.1367 -0.0173 240 MET A SD    
1660 C CE    . MET A 214 ? 0.6966 0.7395 0.6553 0.0529  -0.1637 -0.0267 240 MET A CE    
1661 N N     . ASN A 215 ? 0.6141 0.5990 0.5007 0.0063  -0.1151 -0.0557 241 ASN A N     
1662 C CA    . ASN A 215 ? 0.5975 0.5637 0.4590 0.0029  -0.0963 -0.0506 241 ASN A CA    
1663 C C     . ASN A 215 ? 0.5917 0.5477 0.4331 0.0086  -0.0830 -0.0331 241 ASN A C     
1664 O O     . ASN A 215 ? 0.5803 0.5419 0.4309 0.0141  -0.0853 -0.0246 241 ASN A O     
1665 C CB    . ASN A 215 ? 0.5740 0.5393 0.4652 -0.0092 -0.0835 -0.0548 241 ASN A CB    
1666 C CG    . ASN A 215 ? 0.5279 0.5022 0.4541 -0.0128 -0.0735 -0.0465 241 ASN A CG    
1667 O OD1   . ASN A 215 ? 0.4967 0.4694 0.4162 -0.0075 -0.0668 -0.0348 241 ASN A OD1   
1668 N ND2   . ASN A 215 ? 0.4789 0.4602 0.4418 -0.0215 -0.0706 -0.0526 241 ASN A ND2   
1669 N N     . ARG A 216 ? 0.5948 0.5359 0.4136 0.0073  -0.0690 -0.0286 242 ARG A N     
1670 C CA    . ARG A 216 ? 0.6029 0.5333 0.4073 0.0111  -0.0568 -0.0136 242 ARG A CA    
1671 C C     . ARG A 216 ? 0.5787 0.5122 0.4077 0.0092  -0.0514 -0.0066 242 ARG A C     
1672 O O     . ARG A 216 ? 0.5885 0.5172 0.4124 0.0153  -0.0502 0.0033  242 ARG A O     
1673 C CB    . ARG A 216 ? 0.6037 0.5221 0.3955 0.0076  -0.0417 -0.0116 242 ARG A CB    
1674 C CG    . ARG A 216 ? 0.6890 0.5994 0.4477 0.0130  -0.0411 -0.0156 242 ARG A CG    
1675 C CD    . ARG A 216 ? 0.7917 0.6919 0.5188 0.0233  -0.0365 -0.0020 242 ARG A CD    
1676 N NE    . ARG A 216 ? 0.8839 0.7751 0.5718 0.0309  -0.0351 -0.0066 242 ARG A NE    
1677 C CZ    . ARG A 216 ? 0.9536 0.8414 0.6057 0.0428  -0.0475 -0.0068 242 ARG A CZ    
1678 N NH1   . ARG A 216 ? 0.9752 0.8694 0.6303 0.0486  -0.0629 -0.0012 242 ARG A NH1   
1679 N NH2   . ARG A 216 ? 1.0122 0.8893 0.6229 0.0507  -0.0447 -0.0126 242 ARG A NH2   
1680 N N     . MET A 217 ? 0.5503 0.4892 0.4036 0.0019  -0.0470 -0.0115 243 MET A N     
1681 C CA    . MET A 217 ? 0.5383 0.4781 0.4084 0.0017  -0.0405 -0.0065 243 MET A CA    
1682 C C     . MET A 217 ? 0.5417 0.4921 0.4258 0.0084  -0.0483 -0.0050 243 MET A C     
1683 O O     . MET A 217 ? 0.5454 0.4907 0.4294 0.0136  -0.0447 0.0017  243 MET A O     
1684 C CB    . MET A 217 ? 0.5296 0.4713 0.4172 -0.0050 -0.0328 -0.0103 243 MET A CB    
1685 C CG    . MET A 217 ? 0.5351 0.4737 0.4297 -0.0030 -0.0240 -0.0055 243 MET A CG    
1686 S SD    . MET A 217 ? 0.5740 0.4959 0.4490 -0.0031 -0.0183 -0.0015 243 MET A SD    
1687 C CE    . MET A 217 ? 0.5437 0.4629 0.4204 -0.0090 -0.0132 -0.0040 243 MET A CE    
1688 N N     . HIS A 218 ? 0.5408 0.5061 0.4406 0.0085  -0.0601 -0.0122 244 HIS A N     
1689 C CA    . HIS A 218 ? 0.5457 0.5245 0.4652 0.0162  -0.0696 -0.0108 244 HIS A CA    
1690 C C     . HIS A 218 ? 0.5702 0.5426 0.4662 0.0279  -0.0783 -0.0023 244 HIS A C     
1691 O O     . HIS A 218 ? 0.5730 0.5506 0.4832 0.0363  -0.0813 0.0028  244 HIS A O     
1692 C CB    . HIS A 218 ? 0.5441 0.5433 0.4946 0.0129  -0.0828 -0.0221 244 HIS A CB    
1693 C CG    . HIS A 218 ? 0.5181 0.5250 0.5045 0.0038  -0.0700 -0.0254 244 HIS A CG    
1694 N ND1   . HIS A 218 ? 0.4857 0.4820 0.4669 -0.0054 -0.0581 -0.0274 244 HIS A ND1   
1695 C CD2   . HIS A 218 ? 0.5178 0.5405 0.5455 0.0038  -0.0645 -0.0250 244 HIS A CD2   
1696 C CE1   . HIS A 218 ? 0.4910 0.4942 0.5051 -0.0107 -0.0457 -0.0268 244 HIS A CE1   
1697 N NE2   . HIS A 218 ? 0.5012 0.5208 0.5447 -0.0056 -0.0479 -0.0255 244 HIS A NE2   
1698 N N     . GLU A 219 ? 0.5921 0.5515 0.4526 0.0297  -0.0800 0.0002  245 GLU A N     
1699 C CA    . GLU A 219 ? 0.6304 0.5786 0.4636 0.0413  -0.0837 0.0121  245 GLU A CA    
1700 C C     . GLU A 219 ? 0.6286 0.5612 0.4625 0.0414  -0.0681 0.0231  245 GLU A C     
1701 O O     . GLU A 219 ? 0.6409 0.5671 0.4743 0.0509  -0.0693 0.0330  245 GLU A O     
1702 C CB    . GLU A 219 ? 0.6600 0.5964 0.4532 0.0433  -0.0842 0.0130  245 GLU A CB    
1703 C CG    . GLU A 219 ? 0.6962 0.6436 0.4788 0.0469  -0.1042 0.0006  245 GLU A CG    
1704 C CD    . GLU A 219 ? 0.7612 0.6940 0.4987 0.0500  -0.1012 -0.0001 245 GLU A CD    
1705 O OE1   . GLU A 219 ? 0.8236 0.7598 0.5389 0.0574  -0.1196 -0.0093 245 GLU A OE1   
1706 O OE2   . GLU A 219 ? 0.7579 0.6760 0.4830 0.0459  -0.0808 0.0073  245 GLU A OE2   
1707 N N     . SER A 220 ? 0.6125 0.5383 0.4492 0.0312  -0.0547 0.0204  246 SER A N     
1708 C CA    . SER A 220 ? 0.6029 0.5151 0.4447 0.0294  -0.0428 0.0258  246 SER A CA    
1709 C C     . SER A 220 ? 0.5872 0.5042 0.4517 0.0337  -0.0430 0.0244  246 SER A C     
1710 O O     . SER A 220 ? 0.6012 0.5056 0.4668 0.0392  -0.0394 0.0307  246 SER A O     
1711 C CB    . SER A 220 ? 0.5873 0.4957 0.4306 0.0188  -0.0336 0.0204  246 SER A CB    
1712 O OG    . SER A 220 ? 0.6167 0.5096 0.4579 0.0172  -0.0254 0.0260  246 SER A OG    
1713 N N     . MET A 221 ? 0.5671 0.5010 0.4517 0.0317  -0.0456 0.0164  247 MET A N     
1714 C CA    . MET A 221 ? 0.5642 0.5055 0.4731 0.0373  -0.0428 0.0151  247 MET A CA    
1715 C C     . MET A 221 ? 0.5887 0.5347 0.5056 0.0499  -0.0527 0.0212  247 MET A C     
1716 O O     . MET A 221 ? 0.5966 0.5367 0.5241 0.0575  -0.0476 0.0242  247 MET A O     
1717 C CB    . MET A 221 ? 0.5438 0.5039 0.4776 0.0321  -0.0408 0.0073  247 MET A CB    
1718 C CG    . MET A 221 ? 0.5288 0.4820 0.4569 0.0230  -0.0284 0.0036  247 MET A CG    
1719 S SD    . MET A 221 ? 0.5241 0.4948 0.4792 0.0148  -0.0251 -0.0024 247 MET A SD    
1720 C CE    . MET A 221 ? 0.4575 0.4456 0.4514 0.0223  -0.0192 -0.0018 247 MET A CE    
1721 N N     . LYS A 222 ? 0.6052 0.5605 0.5153 0.0535  -0.0679 0.0225  248 LYS A N     
1722 C CA    . LYS A 222 ? 0.6313 0.5919 0.5460 0.0678  -0.0815 0.0294  248 LYS A CA    
1723 C C     . LYS A 222 ? 0.6465 0.5816 0.5408 0.0756  -0.0749 0.0427  248 LYS A C     
1724 O O     . LYS A 222 ? 0.6511 0.5831 0.5604 0.0863  -0.0747 0.0483  248 LYS A O     
1725 C CB    . LYS A 222 ? 0.6469 0.6185 0.5472 0.0709  -0.1016 0.0268  248 LYS A CB    
1726 C CG    . LYS A 222 ? 0.6955 0.6795 0.6054 0.0868  -0.1220 0.0312  248 LYS A CG    
1727 C CD    . LYS A 222 ? 0.7748 0.7641 0.6567 0.0911  -0.1439 0.0272  248 LYS A CD    
1728 C CE    . LYS A 222 ? 0.8312 0.8297 0.7126 0.1102  -0.1684 0.0332  248 LYS A CE    
1729 N NZ    . LYS A 222 ? 0.8520 0.8846 0.7861 0.1104  -0.1873 0.0195  248 LYS A NZ    
1730 N N     . LEU A 223 ? 0.6539 0.5706 0.5187 0.0700  -0.0676 0.0478  249 LEU A N     
1731 C CA    . LEU A 223 ? 0.6746 0.5651 0.5258 0.0736  -0.0578 0.0604  249 LEU A CA    
1732 C C     . LEU A 223 ? 0.6696 0.5495 0.5422 0.0719  -0.0465 0.0567  249 LEU A C     
1733 O O     . LEU A 223 ? 0.6935 0.5580 0.5709 0.0811  -0.0443 0.0649  249 LEU A O     
1734 C CB    . LEU A 223 ? 0.6717 0.5486 0.4979 0.0648  -0.0485 0.0641  249 LEU A CB    
1735 C CG    . LEU A 223 ? 0.7066 0.5567 0.5258 0.0651  -0.0353 0.0771  249 LEU A CG    
1736 C CD1   . LEU A 223 ? 0.7551 0.5925 0.5585 0.0809  -0.0394 0.0949  249 LEU A CD1   
1737 C CD2   . LEU A 223 ? 0.7075 0.5501 0.5129 0.0546  -0.0239 0.0787  249 LEU A CD2   
1738 N N     . PHE A 224 ? 0.6479 0.5335 0.5302 0.0614  -0.0398 0.0442  250 PHE A N     
1739 C CA    . PHE A 224 ? 0.6460 0.5199 0.5399 0.0606  -0.0303 0.0377  250 PHE A CA    
1740 C C     . PHE A 224 ? 0.6526 0.5332 0.5679 0.0725  -0.0304 0.0359  250 PHE A C     
1741 O O     . PHE A 224 ? 0.6585 0.5213 0.5794 0.0787  -0.0245 0.0356  250 PHE A O     
1742 C CB    . PHE A 224 ? 0.6269 0.5051 0.5188 0.0493  -0.0245 0.0261  250 PHE A CB    
1743 C CG    . PHE A 224 ? 0.6393 0.5039 0.5344 0.0503  -0.0167 0.0173  250 PHE A CG    
1744 C CD1   . PHE A 224 ? 0.6449 0.4864 0.5341 0.0469  -0.0147 0.0156  250 PHE A CD1   
1745 C CD2   . PHE A 224 ? 0.6224 0.4963 0.5269 0.0553  -0.0109 0.0102  250 PHE A CD2   
1746 C CE1   . PHE A 224 ? 0.6487 0.4756 0.5368 0.0490  -0.0107 0.0042  250 PHE A CE1   
1747 C CE2   . PHE A 224 ? 0.6307 0.4892 0.5295 0.0587  -0.0032 0.0010  250 PHE A CE2   
1748 C CZ    . PHE A 224 ? 0.6415 0.4759 0.5298 0.0558  -0.0050 -0.0032 250 PHE A CZ    
1749 N N     . ASP A 225 ? 0.6430 0.5492 0.5744 0.0757  -0.0369 0.0337  251 ASP A N     
1750 C CA    . ASP A 225 ? 0.6547 0.5731 0.6146 0.0885  -0.0379 0.0337  251 ASP A CA    
1751 C C     . ASP A 225 ? 0.6802 0.5840 0.6391 0.1024  -0.0438 0.0455  251 ASP A C     
1752 O O     . ASP A 225 ? 0.6836 0.5779 0.6580 0.1127  -0.0371 0.0453  251 ASP A O     
1753 C CB    . ASP A 225 ? 0.6478 0.5984 0.6305 0.0883  -0.0485 0.0307  251 ASP A CB    
1754 C CG    . ASP A 225 ? 0.6707 0.6404 0.6938 0.1008  -0.0491 0.0299  251 ASP A CG    
1755 O OD1   . ASP A 225 ? 0.7160 0.6733 0.7472 0.1115  -0.0404 0.0319  251 ASP A OD1   
1756 O OD2   . ASP A 225 ? 0.6925 0.6907 0.7438 0.1000  -0.0587 0.0262  251 ASP A OD2   
1757 N N     . SER A 226 ? 0.6959 0.5953 0.6339 0.1039  -0.0549 0.0563  252 SER A N     
1758 C CA    . SER A 226 ? 0.7319 0.6155 0.6634 0.1185  -0.0608 0.0716  252 SER A CA    
1759 C C     . SER A 226 ? 0.7501 0.5992 0.6757 0.1181  -0.0467 0.0762  252 SER A C     
1760 O O     . SER A 226 ? 0.7668 0.6030 0.7066 0.1309  -0.0448 0.0815  252 SER A O     
1761 C CB    . SER A 226 ? 0.7490 0.6331 0.6504 0.1210  -0.0736 0.0828  252 SER A CB    
1762 O OG    . SER A 226 ? 0.7861 0.6519 0.6764 0.1371  -0.0780 0.1007  252 SER A OG    
1763 N N     . ILE A 227 ? 0.7497 0.5843 0.6591 0.1035  -0.0375 0.0728  253 ILE A N     
1764 C CA    . ILE A 227 ? 0.7741 0.5771 0.6845 0.0998  -0.0258 0.0734  253 ILE A CA    
1765 C C     . ILE A 227 ? 0.7820 0.5792 0.7120 0.1033  -0.0195 0.0591  253 ILE A C     
1766 O O     . ILE A 227 ? 0.8073 0.5819 0.7479 0.1122  -0.0152 0.0617  253 ILE A O     
1767 C CB    . ILE A 227 ? 0.7597 0.5556 0.6580 0.0823  -0.0195 0.0685  253 ILE A CB    
1768 C CG1   . ILE A 227 ? 0.7694 0.5662 0.6461 0.0798  -0.0207 0.0829  253 ILE A CG1   
1769 C CG2   . ILE A 227 ? 0.7810 0.5468 0.6893 0.0772  -0.0105 0.0649  253 ILE A CG2   
1770 C CD1   . ILE A 227 ? 0.7625 0.5630 0.6319 0.0639  -0.0156 0.0764  253 ILE A CD1   
1771 N N     . CYS A 228 ? 0.7692 0.5848 0.7020 0.0972  -0.0176 0.0443  254 CYS A N     
1772 C CA    . CYS A 228 ? 0.7832 0.5916 0.7243 0.0999  -0.0088 0.0292  254 CYS A CA    
1773 C C     . CYS A 228 ? 0.7910 0.6032 0.7545 0.1176  -0.0063 0.0301  254 CYS A C     
1774 O O     . CYS A 228 ? 0.8074 0.6002 0.7764 0.1246  0.0022  0.0212  254 CYS A O     
1775 C CB    . CYS A 228 ? 0.7623 0.5887 0.6955 0.0903  -0.0057 0.0173  254 CYS A CB    
1776 S SG    . CYS A 228 ? 0.8285 0.6565 0.7673 0.0982  0.0069  0.0025  254 CYS A SG    
1777 N N     . ASN A 229 ? 0.7865 0.6235 0.7646 0.1257  -0.0148 0.0398  255 ASN A N     
1778 C CA    . ASN A 229 ? 0.7974 0.6424 0.8045 0.1438  -0.0139 0.0418  255 ASN A CA    
1779 C C     . ASN A 229 ? 0.8243 0.6521 0.8368 0.1584  -0.0211 0.0575  255 ASN A C     
1780 O O     . ASN A 229 ? 0.8368 0.6689 0.8757 0.1753  -0.0207 0.0598  255 ASN A O     
1781 C CB    . ASN A 229 ? 0.7765 0.6617 0.8081 0.1462  -0.0195 0.0407  255 ASN A CB    
1782 C CG    . ASN A 229 ? 0.7594 0.6580 0.7913 0.1353  -0.0070 0.0271  255 ASN A CG    
1783 O OD1   . ASN A 229 ? 0.7858 0.6703 0.8140 0.1375  0.0091  0.0169  255 ASN A OD1   
1784 N ND2   . ASN A 229 ? 0.7185 0.6413 0.7516 0.1245  -0.0140 0.0268  255 ASN A ND2   
1785 N N     . ASN A 230 ? 0.8400 0.6476 0.8291 0.1530  -0.0258 0.0697  256 ASN A N     
1786 C CA    . ASN A 230 ? 0.8796 0.6655 0.8690 0.1674  -0.0302 0.0884  256 ASN A CA    
1787 C C     . ASN A 230 ? 0.9087 0.6606 0.9120 0.1748  -0.0180 0.0844  256 ASN A C     
1788 O O     . ASN A 230 ? 0.9126 0.6389 0.9074 0.1628  -0.0083 0.0751  256 ASN A O     
1789 C CB    . ASN A 230 ? 0.8893 0.6597 0.8483 0.1601  -0.0334 0.1046  256 ASN A CB    
1790 C CG    . ASN A 230 ? 0.9256 0.6793 0.8791 0.1784  -0.0399 0.1287  256 ASN A CG    
1791 O OD1   . ASN A 230 ? 0.9579 0.6839 0.9252 0.1889  -0.0330 0.1351  256 ASN A OD1   
1792 N ND2   . ASN A 230 ? 0.9236 0.6920 0.8545 0.1834  -0.0535 0.1420  256 ASN A ND2   
1793 N N     . LYS A 231 ? 0.9363 0.6878 0.9633 0.1953  -0.0199 0.0905  257 LYS A N     
1794 C CA    . LYS A 231 ? 0.9711 0.6911 1.0151 0.2050  -0.0077 0.0837  257 LYS A CA    
1795 C C     . LYS A 231 ? 1.0015 0.6755 1.0337 0.1992  -0.0014 0.0915  257 LYS A C     
1796 O O     . LYS A 231 ? 1.0239 0.6677 1.0656 0.1994  0.0091  0.0785  257 LYS A O     
1797 C CB    . LYS A 231 ? 0.9902 0.7188 1.0656 0.2303  -0.0113 0.0915  257 LYS A CB    
1798 C CG    . LYS A 231 ? 1.0131 0.7266 1.1112 0.2401  0.0045  0.0734  257 LYS A CG    
1799 C CD    . LYS A 231 ? 1.0433 0.7614 1.1774 0.2669  0.0029  0.0820  257 LYS A CD    
1800 C CE    . LYS A 231 ? 1.0667 0.7581 1.2169 0.2767  0.0220  0.0637  257 LYS A CE    
1801 N NZ    . LYS A 231 ? 1.0988 0.7887 1.2868 0.3044  0.0224  0.0726  257 LYS A NZ    
1802 N N     . TRP A 232 ? 1.0085 0.6763 1.0209 0.1937  -0.0067 0.1116  258 TRP A N     
1803 C CA    . TRP A 232 ? 1.0393 0.6654 1.0457 0.1855  0.0023  0.1211  258 TRP A CA    
1804 C C     . TRP A 232 ? 1.0250 0.6391 1.0305 0.1635  0.0103  0.0986  258 TRP A C     
1805 O O     . TRP A 232 ? 1.0473 0.6251 1.0618 0.1563  0.0184  0.0983  258 TRP A O     
1806 C CB    . TRP A 232 ? 1.0551 0.6803 1.0363 0.1842  -0.0014 0.1479  258 TRP A CB    
1807 C CG    . TRP A 232 ? 1.1159 0.6974 1.0986 0.1921  0.0076  0.1723  258 TRP A CG    
1808 C CD1   . TRP A 232 ? 1.1502 0.7001 1.1565 0.2066  0.0131  0.1766  258 TRP A CD1   
1809 C CD2   . TRP A 232 ? 1.1449 0.7082 1.1050 0.1873  0.0146  0.1975  258 TRP A CD2   
1810 N NE1   . TRP A 232 ? 1.2046 0.7162 1.2059 0.2100  0.0228  0.2037  258 TRP A NE1   
1811 C CE2   . TRP A 232 ? 1.1940 0.7135 1.1664 0.1986  0.0250  0.2177  258 TRP A CE2   
1812 C CE3   . TRP A 232 ? 1.1412 0.7192 1.0722 0.1754  0.0153  0.2052  258 TRP A CE3   
1813 C CZ2   . TRP A 232 ? 1.2339 0.7239 1.1900 0.1978  0.0379  0.2472  258 TRP A CZ2   
1814 C CZ3   . TRP A 232 ? 1.1706 0.7207 1.0839 0.1755  0.0284  0.2330  258 TRP A CZ3   
1815 C CH2   . TRP A 232 ? 1.2261 0.7326 1.1518 0.1865  0.0403  0.2547  258 TRP A CH2   
1816 N N     . PHE A 233 ? 0.9942 0.6382 0.9912 0.1534  0.0070  0.0798  259 PHE A N     
1817 C CA    . PHE A 233 ? 0.9834 0.6195 0.9754 0.1342  0.0106  0.0592  259 PHE A CA    
1818 C C     . PHE A 233 ? 0.9883 0.6189 0.9856 0.1374  0.0143  0.0318  259 PHE A C     
1819 O O     . PHE A 233 ? 0.9772 0.6097 0.9635 0.1246  0.0136  0.0127  259 PHE A O     
1820 C CB    . PHE A 233 ? 0.9500 0.6161 0.9228 0.1194  0.0055  0.0594  259 PHE A CB    
1821 C CG    . PHE A 233 ? 0.9552 0.6232 0.9163 0.1168  0.0041  0.0840  259 PHE A CG    
1822 C CD1   . PHE A 233 ? 0.9834 0.6185 0.9501 0.1139  0.0120  0.0993  259 PHE A CD1   
1823 C CD2   . PHE A 233 ? 0.9181 0.6187 0.8619 0.1176  -0.0036 0.0914  259 PHE A CD2   
1824 C CE1   . PHE A 233 ? 0.9960 0.6306 0.9461 0.1136  0.0146  0.1238  259 PHE A CE1   
1825 C CE2   . PHE A 233 ? 0.9326 0.6324 0.8579 0.1174  -0.0043 0.1125  259 PHE A CE2   
1826 C CZ    . PHE A 233 ? 0.9741 0.6410 0.8998 0.1162  0.0060  0.1296  259 PHE A CZ    
1827 N N     . THR A 234 ? 1.0131 0.6355 1.0253 0.1562  0.0185  0.0302  260 THR A N     
1828 C CA    . THR A 234 ? 1.0310 0.6442 1.0455 0.1637  0.0257  0.0048  260 THR A CA    
1829 C C     . THR A 234 ? 1.0455 0.6304 1.0492 0.1501  0.0260  -0.0191 260 THR A C     
1830 O O     . THR A 234 ? 1.0457 0.6394 1.0308 0.1473  0.0270  -0.0401 260 THR A O     
1831 C CB    . THR A 234 ? 1.0666 0.6622 1.1045 0.1865  0.0322  0.0085  260 THR A CB    
1832 O OG1   . THR A 234 ? 1.0571 0.6894 1.1067 0.2006  0.0304  0.0212  260 THR A OG1   
1833 C CG2   . THR A 234 ? 1.1003 0.6719 1.1378 0.1945  0.0423  -0.0199 260 THR A CG2   
1834 N N     . ASP A 235 ? 1.0667 0.6177 1.0826 0.1421  0.0245  -0.0156 261 ASP A N     
1835 C CA    . ASP A 235 ? 1.0861 0.6087 1.1006 0.1289  0.0211  -0.0400 261 ASP A CA    
1836 C C     . ASP A 235 ? 1.0567 0.5891 1.0678 0.1063  0.0133  -0.0370 261 ASP A C     
1837 O O     . ASP A 235 ? 1.0751 0.5861 1.0937 0.0933  0.0074  -0.0548 261 ASP A O     
1838 C CB    . ASP A 235 ? 1.1387 0.6138 1.1791 0.1334  0.0251  -0.0432 261 ASP A CB    
1839 C CG    . ASP A 235 ? 1.1847 0.6389 1.2236 0.1515  0.0309  -0.0662 261 ASP A CG    
1840 O OD1   . ASP A 235 ? 1.1865 0.6618 1.2021 0.1596  0.0331  -0.0814 261 ASP A OD1   
1841 O OD2   . ASP A 235 ? 1.2394 0.6537 1.3010 0.1581  0.0352  -0.0687 261 ASP A OD2   
1842 N N     . THR A 236 ? 1.0099 0.5750 1.0125 0.1023  0.0125  -0.0159 262 THR A N     
1843 C CA    . THR A 236 ? 0.9722 0.5505 0.9716 0.0831  0.0075  -0.0118 262 THR A CA    
1844 C C     . THR A 236 ? 0.9398 0.5424 0.9158 0.0777  0.0005  -0.0315 262 THR A C     
1845 O O     . THR A 236 ? 0.9188 0.5444 0.8778 0.0876  0.0025  -0.0328 262 THR A O     
1846 C CB    . THR A 236 ? 0.9554 0.5539 0.9515 0.0832  0.0107  0.0187  262 THR A CB    
1847 O OG1   . THR A 236 ? 0.9775 0.5505 0.9894 0.0921  0.0178  0.0393  262 THR A OG1   
1848 C CG2   . THR A 236 ? 0.9271 0.5358 0.9230 0.0645  0.0092  0.0236  262 THR A CG2   
1849 N N     . SER A 237 ? 0.9304 0.5269 0.9086 0.0625  -0.0075 -0.0464 263 SER A N     
1850 C CA    . SER A 237 ? 0.9075 0.5242 0.8612 0.0580  -0.0156 -0.0629 263 SER A CA    
1851 C C     . SER A 237 ? 0.8606 0.5117 0.8063 0.0515  -0.0147 -0.0446 263 SER A C     
1852 O O     . SER A 237 ? 0.8505 0.5048 0.8114 0.0398  -0.0147 -0.0317 263 SER A O     
1853 C CB    . SER A 237 ? 0.9264 0.5260 0.8876 0.0455  -0.0286 -0.0854 263 SER A CB    
1854 O OG    . SER A 237 ? 0.9830 0.5496 0.9453 0.0525  -0.0319 -0.1084 263 SER A OG    
1855 N N     . ILE A 238 ? 0.8293 0.5049 0.7534 0.0593  -0.0122 -0.0435 264 ILE A N     
1856 C CA    . ILE A 238 ? 0.7836 0.4899 0.6999 0.0534  -0.0124 -0.0301 264 ILE A CA    
1857 C C     . ILE A 238 ? 0.7655 0.4828 0.6654 0.0452  -0.0197 -0.0433 264 ILE A C     
1858 O O     . ILE A 238 ? 0.7662 0.4861 0.6449 0.0518  -0.0196 -0.0563 264 ILE A O     
1859 C CB    . ILE A 238 ? 0.7718 0.5005 0.6821 0.0650  -0.0063 -0.0196 264 ILE A CB    
1860 C CG1   . ILE A 238 ? 0.7861 0.5034 0.7123 0.0772  -0.0017 -0.0081 264 ILE A CG1   
1861 C CG2   . ILE A 238 ? 0.7399 0.4964 0.6452 0.0579  -0.0083 -0.0067 264 ILE A CG2   
1862 C CD1   . ILE A 238 ? 0.7797 0.4909 0.7160 0.0734  -0.0022 0.0127  264 ILE A CD1   
1863 N N     . ILE A 239 ? 0.7401 0.4632 0.6499 0.0320  -0.0245 -0.0382 265 ILE A N     
1864 C CA    . ILE A 239 ? 0.7168 0.4511 0.6165 0.0244  -0.0330 -0.0478 265 ILE A CA    
1865 C C     . ILE A 239 ? 0.6876 0.4487 0.5824 0.0205  -0.0292 -0.0329 265 ILE A C     
1866 O O     . ILE A 239 ? 0.6731 0.4394 0.5803 0.0166  -0.0240 -0.0171 265 ILE A O     
1867 C CB    . ILE A 239 ? 0.7274 0.4478 0.6500 0.0128  -0.0427 -0.0569 265 ILE A CB    
1868 C CG1   . ILE A 239 ? 0.7648 0.4560 0.6912 0.0171  -0.0485 -0.0758 265 ILE A CG1   
1869 C CG2   . ILE A 239 ? 0.7086 0.4426 0.6242 0.0065  -0.0543 -0.0662 265 ILE A CG2   
1870 C CD1   . ILE A 239 ? 0.7707 0.4410 0.7356 0.0079  -0.0486 -0.0743 265 ILE A CD1   
1871 N N     . LEU A 240 ? 0.6701 0.4455 0.5444 0.0227  -0.0310 -0.0380 266 LEU A N     
1872 C CA    . LEU A 240 ? 0.6350 0.4335 0.5045 0.0196  -0.0277 -0.0272 266 LEU A CA    
1873 C C     . LEU A 240 ? 0.6316 0.4356 0.4978 0.0124  -0.0358 -0.0332 266 LEU A C     
1874 O O     . LEU A 240 ? 0.6497 0.4481 0.4987 0.0161  -0.0422 -0.0454 266 LEU A O     
1875 C CB    . LEU A 240 ? 0.6247 0.4346 0.4796 0.0285  -0.0208 -0.0261 266 LEU A CB    
1876 C CG    . LEU A 240 ? 0.5938 0.4258 0.4461 0.0253  -0.0178 -0.0180 266 LEU A CG    
1877 C CD1   . LEU A 240 ? 0.5393 0.3818 0.4039 0.0220  -0.0172 -0.0053 266 LEU A CD1   
1878 C CD2   . LEU A 240 ? 0.5637 0.4040 0.4084 0.0333  -0.0093 -0.0191 266 LEU A CD2   
1879 N N     . PHE A 241 ? 0.6070 0.4205 0.4883 0.0038  -0.0353 -0.0245 267 PHE A N     
1880 C CA    . PHE A 241 ? 0.5945 0.4162 0.4793 -0.0021 -0.0423 -0.0282 267 PHE A CA    
1881 C C     . PHE A 241 ? 0.5710 0.4098 0.4448 -0.0014 -0.0365 -0.0200 267 PHE A C     
1882 O O     . PHE A 241 ? 0.5540 0.4007 0.4331 -0.0035 -0.0290 -0.0094 267 PHE A O     
1883 C CB    . PHE A 241 ? 0.5924 0.4137 0.5075 -0.0118 -0.0425 -0.0243 267 PHE A CB    
1884 C CG    . PHE A 241 ? 0.6297 0.4356 0.5654 -0.0159 -0.0526 -0.0365 267 PHE A CG    
1885 C CD1   . PHE A 241 ? 0.6499 0.4398 0.5712 -0.0096 -0.0608 -0.0507 267 PHE A CD1   
1886 C CD2   . PHE A 241 ? 0.6405 0.4474 0.6132 -0.0261 -0.0528 -0.0345 267 PHE A CD2   
1887 C CE1   . PHE A 241 ? 0.6729 0.4465 0.6147 -0.0139 -0.0725 -0.0653 267 PHE A CE1   
1888 C CE2   . PHE A 241 ? 0.6606 0.4537 0.6612 -0.0318 -0.0636 -0.0474 267 PHE A CE2   
1889 C CZ    . PHE A 241 ? 0.6758 0.4516 0.6601 -0.0259 -0.0752 -0.0640 267 PHE A CZ    
1890 N N     . LEU A 242 ? 0.5714 0.4135 0.4278 0.0022  -0.0399 -0.0250 268 LEU A N     
1891 C CA    . LEU A 242 ? 0.5508 0.4064 0.4008 0.0019  -0.0345 -0.0183 268 LEU A CA    
1892 C C     . LEU A 242 ? 0.5463 0.4067 0.4064 -0.0029 -0.0410 -0.0192 268 LEU A C     
1893 O O     . LEU A 242 ? 0.5604 0.4173 0.4116 0.0001  -0.0503 -0.0253 268 LEU A O     
1894 C CB    . LEU A 242 ? 0.5571 0.4114 0.3851 0.0094  -0.0306 -0.0200 268 LEU A CB    
1895 C CG    . LEU A 242 ? 0.5582 0.4118 0.3835 0.0150  -0.0218 -0.0187 268 LEU A CG    
1896 C CD1   . LEU A 242 ? 0.5569 0.4086 0.3635 0.0226  -0.0137 -0.0195 268 LEU A CD1   
1897 C CD2   . LEU A 242 ? 0.5547 0.4217 0.3958 0.0118  -0.0167 -0.0104 268 LEU A CD2   
1898 N N     . ASN A 243 ? 0.5289 0.3967 0.4065 -0.0088 -0.0361 -0.0127 269 ASN A N     
1899 C CA    . ASN A 243 ? 0.5250 0.3976 0.4240 -0.0139 -0.0397 -0.0133 269 ASN A CA    
1900 C C     . ASN A 243 ? 0.5108 0.3936 0.4083 -0.0137 -0.0361 -0.0096 269 ASN A C     
1901 O O     . ASN A 243 ? 0.4988 0.3837 0.3803 -0.0112 -0.0306 -0.0067 269 ASN A O     
1902 C CB    . ASN A 243 ? 0.5208 0.3921 0.4410 -0.0195 -0.0318 -0.0074 269 ASN A CB    
1903 C CG    . ASN A 243 ? 0.5425 0.4194 0.4948 -0.0254 -0.0335 -0.0083 269 ASN A CG    
1904 O OD1   . ASN A 243 ? 0.5415 0.4185 0.5071 -0.0262 -0.0475 -0.0177 269 ASN A OD1   
1905 N ND2   . ASN A 243 ? 0.5238 0.4056 0.4889 -0.0286 -0.0192 0.0010  269 ASN A ND2   
1906 N N     . LYS A 244 ? 0.5063 0.3952 0.4250 -0.0163 -0.0393 -0.0104 270 LYS A N     
1907 C CA    . LYS A 244 ? 0.5106 0.4072 0.4313 -0.0148 -0.0361 -0.0077 270 LYS A CA    
1908 C C     . LYS A 244 ? 0.5169 0.4095 0.4151 -0.0084 -0.0418 -0.0087 270 LYS A C     
1909 O O     . LYS A 244 ? 0.5101 0.4042 0.4020 -0.0071 -0.0349 -0.0050 270 LYS A O     
1910 C CB    . LYS A 244 ? 0.5005 0.4007 0.4180 -0.0166 -0.0212 -0.0020 270 LYS A CB    
1911 C CG    . LYS A 244 ? 0.5104 0.4130 0.4462 -0.0206 -0.0109 0.0023  270 LYS A CG    
1912 C CD    . LYS A 244 ? 0.5131 0.4170 0.4360 -0.0194 0.0027  0.0065  270 LYS A CD    
1913 C CE    . LYS A 244 ? 0.5489 0.4518 0.4825 -0.0212 0.0167  0.0137  270 LYS A CE    
1914 N NZ    . LYS A 244 ? 0.5613 0.4625 0.4724 -0.0173 0.0297  0.0168  270 LYS A NZ    
1915 N N     . LYS A 245 ? 0.5284 0.4136 0.4139 -0.0040 -0.0536 -0.0138 271 LYS A N     
1916 C CA    . LYS A 245 ? 0.5483 0.4263 0.4064 0.0040  -0.0566 -0.0125 271 LYS A CA    
1917 C C     . LYS A 245 ? 0.5537 0.4346 0.4175 0.0082  -0.0617 -0.0091 271 LYS A C     
1918 O O     . LYS A 245 ? 0.5627 0.4377 0.4086 0.0134  -0.0564 -0.0028 271 LYS A O     
1919 C CB    . LYS A 245 ? 0.5731 0.4398 0.4094 0.0103  -0.0683 -0.0201 271 LYS A CB    
1920 C CG    . LYS A 245 ? 0.5735 0.4409 0.4235 0.0115  -0.0889 -0.0294 271 LYS A CG    
1921 C CD    . LYS A 245 ? 0.6241 0.4774 0.4481 0.0180  -0.1012 -0.0403 271 LYS A CD    
1922 C CE    . LYS A 245 ? 0.6662 0.5206 0.5061 0.0191  -0.1264 -0.0527 271 LYS A CE    
1923 N NZ    . LYS A 245 ? 0.7434 0.5803 0.5473 0.0282  -0.1403 -0.0660 271 LYS A NZ    
1924 N N     . ASP A 246 ? 0.5520 0.4418 0.4449 0.0061  -0.0706 -0.0123 272 ASP A N     
1925 C CA    . ASP A 246 ? 0.5580 0.4531 0.4648 0.0109  -0.0754 -0.0090 272 ASP A CA    
1926 C C     . ASP A 246 ? 0.5469 0.4432 0.4571 0.0087  -0.0578 -0.0021 272 ASP A C     
1927 O O     . ASP A 246 ? 0.5640 0.4550 0.4661 0.0150  -0.0566 0.0032  272 ASP A O     
1928 C CB    . ASP A 246 ? 0.5555 0.4640 0.5039 0.0081  -0.0865 -0.0144 272 ASP A CB    
1929 C CG    . ASP A 246 ? 0.5536 0.4710 0.5317 -0.0023 -0.0712 -0.0139 272 ASP A CG    
1930 O OD1   . ASP A 246 ? 0.5413 0.4530 0.5055 -0.0074 -0.0613 -0.0133 272 ASP A OD1   
1931 O OD2   . ASP A 246 ? 0.5555 0.4852 0.5706 -0.0041 -0.0680 -0.0131 272 ASP A OD2   
1932 N N     . LEU A 247 ? 0.5293 0.4304 0.4490 0.0009  -0.0445 -0.0027 273 LEU A N     
1933 C CA    . LEU A 247 ? 0.5162 0.4173 0.4370 -0.0008 -0.0301 -0.0001 273 LEU A CA    
1934 C C     . LEU A 247 ? 0.5136 0.4056 0.4105 -0.0003 -0.0248 0.0023  273 LEU A C     
1935 O O     . LEU A 247 ? 0.5192 0.4066 0.4164 0.0006  -0.0181 0.0042  273 LEU A O     
1936 C CB    . LEU A 247 ? 0.5131 0.4202 0.4440 -0.0070 -0.0190 -0.0017 273 LEU A CB    
1937 C CG    . LEU A 247 ? 0.5082 0.4251 0.4704 -0.0083 -0.0162 -0.0020 273 LEU A CG    
1938 C CD1   . LEU A 247 ? 0.5020 0.4199 0.4632 -0.0125 -0.0013 -0.0004 273 LEU A CD1   
1939 C CD2   . LEU A 247 ? 0.4660 0.3871 0.4478 -0.0030 -0.0145 -0.0016 273 LEU A CD2   
1940 N N     . PHE A 248 ? 0.4194 0.4988 0.5280 0.0089  0.0060  0.0133  274 PHE A N     
1941 C CA    . PHE A 248 ? 0.4232 0.4623 0.5065 0.0146  0.0049  0.0232  274 PHE A CA    
1942 C C     . PHE A 248 ? 0.4433 0.4706 0.5425 0.0317  -0.0081 0.0405  274 PHE A C     
1943 O O     . PHE A 248 ? 0.4478 0.4484 0.5526 0.0402  -0.0035 0.0437  274 PHE A O     
1944 C CB    . PHE A 248 ? 0.4178 0.4383 0.4540 0.0008  0.0009  0.0295  274 PHE A CB    
1945 C CG    . PHE A 248 ? 0.4227 0.4124 0.4396 0.0041  0.0041  0.0356  274 PHE A CG    
1946 C CD1   . PHE A 248 ? 0.3912 0.3680 0.4080 0.0022  0.0139  0.0253  274 PHE A CD1   
1947 C CD2   . PHE A 248 ? 0.4445 0.4214 0.4415 0.0062  -0.0024 0.0505  274 PHE A CD2   
1948 C CE1   . PHE A 248 ? 0.3883 0.3461 0.3983 0.0033  0.0174  0.0288  274 PHE A CE1   
1949 C CE2   . PHE A 248 ? 0.4438 0.3996 0.4272 0.0058  0.0059  0.0542  274 PHE A CE2   
1950 C CZ    . PHE A 248 ? 0.4469 0.3962 0.4424 0.0046  0.0159  0.0429  274 PHE A CZ    
1951 N N     . GLU A 249 ? 0.4564 0.5011 0.5611 0.0348  -0.0266 0.0524  275 GLU A N     
1952 C CA    . GLU A 249 ? 0.4976 0.5259 0.6056 0.0491  -0.0453 0.0742  275 GLU A CA    
1953 C C     . GLU A 249 ? 0.5050 0.5331 0.6671 0.0714  -0.0470 0.0712  275 GLU A C     
1954 O O     . GLU A 249 ? 0.5235 0.5154 0.6831 0.0820  -0.0540 0.0875  275 GLU A O     
1955 C CB    . GLU A 249 ? 0.5189 0.5685 0.6190 0.0464  -0.0705 0.0863  275 GLU A CB    
1956 C CG    . GLU A 249 ? 0.5968 0.6230 0.6860 0.0590  -0.0952 0.1136  275 GLU A CG    
1957 C CD    . GLU A 249 ? 0.6891 0.7376 0.7678 0.0556  -0.1257 0.1247  275 GLU A CD    
1958 O OE1   . GLU A 249 ? 0.7135 0.7861 0.7781 0.0381  -0.1249 0.1122  275 GLU A OE1   
1959 O OE2   . GLU A 249 ? 0.7388 0.7767 0.8210 0.0694  -0.1536 0.1469  275 GLU A OE2   
1960 N N     . GLU A 250 ? 0.4988 0.5661 0.7097 0.0772  -0.0392 0.0492  276 GLU A N     
1961 C CA    . GLU A 250 ? 0.5224 0.5927 0.7914 0.1007  -0.0359 0.0371  276 GLU A CA    
1962 C C     . GLU A 250 ? 0.5259 0.5561 0.7857 0.1012  -0.0161 0.0261  276 GLU A C     
1963 O O     . GLU A 250 ? 0.5632 0.5659 0.8518 0.1204  -0.0209 0.0278  276 GLU A O     
1964 C CB    . GLU A 250 ? 0.5074 0.6383 0.8325 0.1042  -0.0261 0.0109  276 GLU A CB    
1965 C CG    . GLU A 250 ? 0.5486 0.7239 0.9058 0.1089  -0.0516 0.0205  276 GLU A CG    
1966 C CD    . GLU A 250 ? 0.6373 0.7974 1.0290 0.1388  -0.0847 0.0414  276 GLU A CD    
1967 O OE1   . GLU A 250 ? 0.6711 0.8345 1.1249 0.1663  -0.0835 0.0285  276 GLU A OE1   
1968 O OE2   . GLU A 250 ? 0.6825 0.8236 1.0359 0.1350  -0.1130 0.0703  276 GLU A OE2   
1969 N N     . LYS A 251 ? 0.5090 0.5329 0.7295 0.0802  0.0021  0.0155  277 LYS A N     
1970 C CA    . LYS A 251 ? 0.5261 0.5185 0.7376 0.0766  0.0183  0.0017  277 LYS A CA    
1971 C C     . LYS A 251 ? 0.5418 0.4870 0.7261 0.0727  0.0125  0.0227  277 LYS A C     
1972 O O     . LYS A 251 ? 0.5567 0.4698 0.7526 0.0763  0.0182  0.0165  277 LYS A O     
1973 C CB    . LYS A 251 ? 0.5020 0.5063 0.6796 0.0546  0.0344  -0.0153 277 LYS A CB    
1974 C CG    . LYS A 251 ? 0.5233 0.5600 0.7180 0.0513  0.0522  -0.0442 277 LYS A CG    
1975 C CD    . LYS A 251 ? 0.5440 0.5761 0.6892 0.0271  0.0622  -0.0535 277 LYS A CD    
1976 C CE    . LYS A 251 ? 0.5476 0.6145 0.6908 0.0143  0.0799  -0.0745 277 LYS A CE    
1977 N NZ    . LYS A 251 ? 0.5775 0.6265 0.6705 -0.0057 0.0883  -0.0863 277 LYS A NZ    
1978 N N     . ILE A 252 ? 0.5414 0.4834 0.6884 0.0620  0.0042  0.0442  278 ILE A N     
1979 C CA    . ILE A 252 ? 0.5717 0.4799 0.6884 0.0511  0.0071  0.0597  278 ILE A CA    
1980 C C     . ILE A 252 ? 0.6277 0.4942 0.7575 0.0595  0.0013  0.0764  278 ILE A C     
1981 O O     . ILE A 252 ? 0.6514 0.4893 0.7717 0.0481  0.0105  0.0801  278 ILE A O     
1982 C CB    . ILE A 252 ? 0.5697 0.4845 0.6434 0.0395  0.0024  0.0758  278 ILE A CB    
1983 C CG1   . ILE A 252 ? 0.5745 0.4702 0.6240 0.0250  0.0151  0.0796  278 ILE A CG1   
1984 C CG2   . ILE A 252 ? 0.5844 0.4962 0.6486 0.0475  -0.0180 0.1003  278 ILE A CG2   
1985 C CD1   . ILE A 252 ? 0.5522 0.4589 0.6075 0.0172  0.0265  0.0565  278 ILE A CD1   
1986 N N     . LYS A 253 ? 0.6635 0.5272 0.8199 0.0791  -0.0152 0.0857  279 LYS A N     
1987 C CA    . LYS A 253 ? 0.7298 0.5470 0.9047 0.0920  -0.0259 0.1015  279 LYS A CA    
1988 C C     . LYS A 253 ? 0.7384 0.5291 0.9438 0.0948  -0.0121 0.0784  279 LYS A C     
1989 O O     . LYS A 253 ? 0.7876 0.5276 0.9887 0.0898  -0.0128 0.0918  279 LYS A O     
1990 C CB    . LYS A 253 ? 0.7547 0.5833 0.9669 0.1189  -0.0504 0.1090  279 LYS A CB    
1991 C CG    . LYS A 253 ? 0.7397 0.6255 0.9515 0.1195  -0.0600 0.1065  279 LYS A CG    
1992 C CD    . LYS A 253 ? 0.8093 0.7080 1.0680 0.1475  -0.0899 0.1164  279 LYS A CD    
1993 C CE    . LYS A 253 ? 0.7934 0.7507 1.0567 0.1447  -0.1028 0.1144  279 LYS A CE    
1994 N NZ    . LYS A 253 ? 0.8285 0.8091 1.1524 0.1734  -0.1335 0.1195  279 LYS A NZ    
1995 N N     . LYS A 254 ? 0.7030 0.5252 0.9351 0.1001  0.0006  0.0435  280 LYS A N     
1996 C CA    . LYS A 254 ? 0.7141 0.5121 0.9760 0.1062  0.0117  0.0156  280 LYS A CA    
1997 C C     . LYS A 254 ? 0.6758 0.4776 0.9146 0.0829  0.0298  -0.0070 280 LYS A C     
1998 O O     . LYS A 254 ? 0.7043 0.4742 0.9547 0.0799  0.0363  -0.0250 280 LYS A O     
1999 C CB    . LYS A 254 ? 0.7219 0.5480 1.0345 0.1318  0.0138  -0.0116 280 LYS A CB    
2000 C CG    . LYS A 254 ? 0.7017 0.5927 1.0102 0.1247  0.0263  -0.0313 280 LYS A CG    
2001 C CD    . LYS A 254 ? 0.7375 0.6711 1.0999 0.1490  0.0219  -0.0422 280 LYS A CD    
2002 C CE    . LYS A 254 ? 0.7199 0.7161 1.0724 0.1336  0.0357  -0.0567 280 LYS A CE    
2003 N NZ    . LYS A 254 ? 0.7275 0.7745 1.1284 0.1498  0.0245  -0.0545 280 LYS A NZ    
2004 N N     . SER A 255 ? 0.6131 0.4506 0.8199 0.0670  0.0344  -0.0061 281 SER A N     
2005 C CA    . SER A 255 ? 0.5750 0.4191 0.7589 0.0468  0.0443  -0.0235 281 SER A CA    
2006 C C     . SER A 255 ? 0.5433 0.3880 0.6989 0.0301  0.0418  -0.0022 281 SER A C     
2007 O O     . SER A 255 ? 0.5223 0.3912 0.6575 0.0285  0.0385  0.0096  281 SER A O     
2008 C CB    . SER A 255 ? 0.5479 0.4319 0.7195 0.0435  0.0514  -0.0448 281 SER A CB    
2009 O OG    . SER A 255 ? 0.5826 0.4719 0.7787 0.0546  0.0611  -0.0726 281 SER A OG    
2010 N N     . PRO A 256 ? 0.5468 0.3670 0.7043 0.0165  0.0448  -0.0008 282 PRO A N     
2011 C CA    . PRO A 256 ? 0.5290 0.3562 0.6689 0.0017  0.0469  0.0165  282 PRO A CA    
2012 C C     . PRO A 256 ? 0.4966 0.3583 0.6203 -0.0045 0.0465  0.0043  282 PRO A C     
2013 O O     . PRO A 256 ? 0.4915 0.3622 0.6146 -0.0060 0.0443  -0.0178 282 PRO A O     
2014 C CB    . PRO A 256 ? 0.5540 0.3531 0.7107 -0.0138 0.0520  0.0150  282 PRO A CB    
2015 C CG    . PRO A 256 ? 0.5750 0.3582 0.7501 -0.0100 0.0504  -0.0119 282 PRO A CG    
2016 C CD    . PRO A 256 ? 0.5751 0.3617 0.7542 0.0125  0.0475  -0.0171 282 PRO A CD    
2017 N N     . LEU A 257 ? 0.4763 0.3528 0.5829 -0.0082 0.0478  0.0187  283 LEU A N     
2018 C CA    . LEU A 257 ? 0.4450 0.3465 0.5387 -0.0112 0.0446  0.0093  283 LEU A CA    
2019 C C     . LEU A 257 ? 0.4429 0.3494 0.5554 -0.0219 0.0434  -0.0058 283 LEU A C     
2020 O O     . LEU A 257 ? 0.4142 0.3358 0.5202 -0.0222 0.0343  -0.0169 283 LEU A O     
2021 C CB    . LEU A 257 ? 0.4326 0.3448 0.5066 -0.0111 0.0477  0.0238  283 LEU A CB    
2022 C CG    . LEU A 257 ? 0.4237 0.3543 0.4848 -0.0098 0.0418  0.0141  283 LEU A CG    
2023 C CD1   . LEU A 257 ? 0.3788 0.3122 0.4213 -0.0052 0.0314  0.0086  283 LEU A CD1   
2024 C CD2   . LEU A 257 ? 0.4091 0.3467 0.4547 -0.0100 0.0491  0.0224  283 LEU A CD2   
2025 N N     . THR A 258 ? 0.4685 0.3599 0.6047 -0.0317 0.0496  -0.0054 284 THR A N     
2026 C CA    . THR A 258 ? 0.4806 0.3808 0.6424 -0.0447 0.0459  -0.0217 284 THR A CA    
2027 C C     . THR A 258 ? 0.4774 0.3758 0.6326 -0.0442 0.0317  -0.0446 284 THR A C     
2028 O O     . THR A 258 ? 0.4827 0.3933 0.6522 -0.0536 0.0209  -0.0588 284 THR A O     
2029 C CB    . THR A 258 ? 0.5019 0.3827 0.6909 -0.0607 0.0557  -0.0174 284 THR A CB    
2030 O OG1   . THR A 258 ? 0.5448 0.3875 0.7268 -0.0549 0.0580  -0.0096 284 THR A OG1   
2031 C CG2   . THR A 258 ? 0.5291 0.4233 0.7255 -0.0711 0.0718  0.0001  284 THR A CG2   
2032 N N     . ILE A 259 ? 0.4714 0.3575 0.6057 -0.0347 0.0320  -0.0491 285 ILE A N     
2033 C CA    . ILE A 259 ? 0.4877 0.3748 0.6012 -0.0363 0.0231  -0.0704 285 ILE A CA    
2034 C C     . ILE A 259 ? 0.4754 0.3828 0.5664 -0.0379 0.0085  -0.0697 285 ILE A C     
2035 O O     . ILE A 259 ? 0.4880 0.3965 0.5675 -0.0461 -0.0064 -0.0839 285 ILE A O     
2036 C CB    . ILE A 259 ? 0.4927 0.3743 0.5904 -0.0257 0.0320  -0.0758 285 ILE A CB    
2037 C CG1   . ILE A 259 ? 0.5037 0.3587 0.6268 -0.0202 0.0414  -0.0837 285 ILE A CG1   
2038 C CG2   . ILE A 259 ? 0.5150 0.4022 0.5789 -0.0324 0.0274  -0.0964 285 ILE A CG2   
2039 C CD1   . ILE A 259 ? 0.4872 0.3456 0.6140 -0.0032 0.0506  -0.0842 285 ILE A CD1   
2040 N N     . CYS A 260 ? 0.4551 0.3736 0.5378 -0.0299 0.0104  -0.0529 286 CYS A N     
2041 C CA    . CYS A 260 ? 0.4532 0.3814 0.5149 -0.0282 -0.0037 -0.0498 286 CYS A CA    
2042 C C     . CYS A 260 ? 0.4510 0.3947 0.5426 -0.0269 -0.0112 -0.0481 286 CYS A C     
2043 O O     . CYS A 260 ? 0.4552 0.4044 0.5439 -0.0259 -0.0316 -0.0532 286 CYS A O     
2044 C CB    . CYS A 260 ? 0.4341 0.3632 0.4735 -0.0213 0.0023  -0.0366 286 CYS A CB    
2045 S SG    . CYS A 260 ? 0.4602 0.3865 0.4660 -0.0209 -0.0153 -0.0322 286 CYS A SG    
2046 N N     . TYR A 261 ? 0.4415 0.3926 0.5619 -0.0270 0.0051  -0.0408 287 TYR A N     
2047 C CA    . TYR A 261 ? 0.4374 0.4117 0.5924 -0.0267 0.0067  -0.0418 287 TYR A CA    
2048 C C     . TYR A 261 ? 0.4574 0.4370 0.6503 -0.0405 0.0199  -0.0439 287 TYR A C     
2049 O O     . TYR A 261 ? 0.4722 0.4470 0.6668 -0.0447 0.0406  -0.0310 287 TYR A O     
2050 C CB    . TYR A 261 ? 0.4215 0.4014 0.5661 -0.0183 0.0204  -0.0305 287 TYR A CB    
2051 C CG    . TYR A 261 ? 0.4058 0.3765 0.5147 -0.0074 0.0085  -0.0278 287 TYR A CG    
2052 C CD1   . TYR A 261 ? 0.3838 0.3615 0.5000 0.0019  -0.0070 -0.0351 287 TYR A CD1   
2053 C CD2   . TYR A 261 ? 0.4018 0.3558 0.4741 -0.0068 0.0116  -0.0182 287 TYR A CD2   
2054 C CE1   . TYR A 261 ? 0.3886 0.3481 0.4691 0.0092  -0.0191 -0.0311 287 TYR A CE1   
2055 C CE2   . TYR A 261 ? 0.3730 0.3177 0.4138 -0.0022 0.0016  -0.0156 287 TYR A CE2   
2056 C CZ    . TYR A 261 ? 0.3971 0.3401 0.4387 0.0045  -0.0134 -0.0212 287 TYR A CZ    
2057 O OH    . TYR A 261 ? 0.4451 0.3695 0.4532 0.0066  -0.0244 -0.0173 287 TYR A OH    
2058 N N     . PRO A 262 ? 0.4733 0.4602 0.6934 -0.0506 0.0063  -0.0591 288 PRO A N     
2059 C CA    . PRO A 262 ? 0.4932 0.4788 0.7488 -0.0689 0.0180  -0.0620 288 PRO A CA    
2060 C C     . PRO A 262 ? 0.4989 0.5086 0.7877 -0.0766 0.0412  -0.0531 288 PRO A C     
2061 O O     . PRO A 262 ? 0.5228 0.5219 0.8281 -0.0947 0.0584  -0.0466 288 PRO A O     
2062 C CB    . PRO A 262 ? 0.5034 0.5038 0.7863 -0.0783 -0.0063 -0.0830 288 PRO A CB    
2063 C CG    . PRO A 262 ? 0.5009 0.4964 0.7446 -0.0649 -0.0316 -0.0880 288 PRO A CG    
2064 C CD    . PRO A 262 ? 0.4712 0.4665 0.6887 -0.0477 -0.0232 -0.0729 288 PRO A CD    
2065 N N     . GLU A 263 ? 0.4886 0.5277 0.7852 -0.0644 0.0430  -0.0538 289 GLU A N     
2066 C CA    . GLU A 263 ? 0.5040 0.5739 0.8328 -0.0724 0.0697  -0.0514 289 GLU A CA    
2067 C C     . GLU A 263 ? 0.5128 0.5631 0.7976 -0.0720 0.0952  -0.0310 289 GLU A C     
2068 O O     . GLU A 263 ? 0.5301 0.5998 0.8276 -0.0836 0.1223  -0.0271 289 GLU A O     
2069 C CB    . GLU A 263 ? 0.4898 0.6069 0.8632 -0.0594 0.0610  -0.0691 289 GLU A CB    
2070 C CG    . GLU A 263 ? 0.5133 0.6249 0.8545 -0.0336 0.0525  -0.0688 289 GLU A CG    
2071 C CD    . GLU A 263 ? 0.5389 0.6174 0.8361 -0.0205 0.0198  -0.0662 289 GLU A CD    
2072 O OE1   . GLU A 263 ? 0.5124 0.5721 0.7970 -0.0294 0.0046  -0.0664 289 GLU A OE1   
2073 O OE2   . GLU A 263 ? 0.5599 0.6296 0.8321 -0.0030 0.0116  -0.0652 289 GLU A OE2   
2074 N N     . TYR A 264 ? 0.5057 0.5203 0.7387 -0.0607 0.0863  -0.0187 290 TYR A N     
2075 C CA    . TYR A 264 ? 0.5195 0.5134 0.7081 -0.0599 0.1018  0.0015  290 TYR A CA    
2076 C C     . TYR A 264 ? 0.5562 0.5329 0.7437 -0.0816 0.1229  0.0190  290 TYR A C     
2077 O O     . TYR A 264 ? 0.5779 0.5272 0.7733 -0.0904 0.1174  0.0241  290 TYR A O     
2078 C CB    . TYR A 264 ? 0.5140 0.4782 0.6625 -0.0462 0.0850  0.0096  290 TYR A CB    
2079 C CG    . TYR A 264 ? 0.5397 0.4859 0.6446 -0.0436 0.0926  0.0301  290 TYR A CG    
2080 C CD1   . TYR A 264 ? 0.5525 0.5122 0.6330 -0.0384 0.0994  0.0298  290 TYR A CD1   
2081 C CD2   . TYR A 264 ? 0.5686 0.4827 0.6574 -0.0454 0.0902  0.0484  290 TYR A CD2   
2082 C CE1   . TYR A 264 ? 0.5657 0.5093 0.6012 -0.0384 0.1026  0.0473  290 TYR A CE1   
2083 C CE2   . TYR A 264 ? 0.6002 0.4989 0.6491 -0.0426 0.0906  0.0689  290 TYR A CE2   
2084 C CZ    . TYR A 264 ? 0.6083 0.5233 0.6279 -0.0406 0.0963  0.0682  290 TYR A CZ    
2085 O OH    . TYR A 264 ? 0.6412 0.5417 0.6163 -0.0400 0.0931  0.0868  290 TYR A OH    
2086 N N     . ALA A 265 ? 0.5813 0.5699 0.7551 -0.0918 0.1478  0.0279  291 ALA A N     
2087 C CA    . ALA A 265 ? 0.6305 0.5965 0.7918 -0.1174 0.1690  0.0498  291 ALA A CA    
2088 C C     . ALA A 265 ? 0.6640 0.5940 0.7584 -0.1167 0.1720  0.0780  291 ALA A C     
2089 O O     . ALA A 265 ? 0.7196 0.6218 0.7906 -0.1379 0.1860  0.1017  291 ALA A O     
2090 C CB    . ALA A 265 ? 0.6426 0.6502 0.8412 -0.1407 0.2002  0.0404  291 ALA A CB    
2091 N N     . GLY A 266 ? 0.6480 0.5761 0.7104 -0.0944 0.1559  0.0767  292 GLY A N     
2092 C CA    . GLY A 266 ? 0.6848 0.5841 0.6856 -0.0926 0.1520  0.1012  292 GLY A CA    
2093 C C     . GLY A 266 ? 0.7063 0.5606 0.6966 -0.0869 0.1304  0.1232  292 GLY A C     
2094 O O     . GLY A 266 ? 0.6917 0.5329 0.7198 -0.0859 0.1226  0.1177  292 GLY A O     
2095 N N     . SER A 267 ? 0.7441 0.5745 0.6846 -0.0821 0.1191  0.1462  293 SER A N     
2096 C CA    . SER A 267 ? 0.7748 0.5658 0.7124 -0.0705 0.0945  0.1661  293 SER A CA    
2097 C C     . SER A 267 ? 0.7243 0.5326 0.6866 -0.0445 0.0724  0.1479  293 SER A C     
2098 O O     . SER A 267 ? 0.6770 0.5190 0.6408 -0.0379 0.0730  0.1277  293 SER A O     
2099 C CB    . SER A 267 ? 0.8444 0.6041 0.7207 -0.0756 0.0854  0.2003  293 SER A CB    
2100 O OG    . SER A 267 ? 0.8473 0.6259 0.6989 -0.0598 0.0677  0.1964  293 SER A OG    
2101 N N     . ASN A 268 ? 0.7446 0.5281 0.7267 -0.0304 0.0539  0.1546  294 ASN A N     
2102 C CA    . ASN A 268 ? 0.7160 0.5202 0.7214 -0.0086 0.0375  0.1374  294 ASN A CA    
2103 C C     . ASN A 268 ? 0.7330 0.5396 0.7153 0.0042  0.0160  0.1535  294 ASN A C     
2104 O O     . ASN A 268 ? 0.7409 0.5495 0.7518 0.0229  -0.0011 0.1507  294 ASN A O     
2105 C CB    . ASN A 268 ? 0.7136 0.5023 0.7651 0.0011  0.0337  0.1233  294 ASN A CB    
2106 C CG    . ASN A 268 ? 0.7004 0.5032 0.7754 -0.0102 0.0488  0.0973  294 ASN A CG    
2107 O OD1   . ASN A 268 ? 0.6574 0.4942 0.7333 -0.0096 0.0513  0.0776  294 ASN A OD1   
2108 N ND2   . ASN A 268 ? 0.7255 0.4991 0.8185 -0.0219 0.0556  0.0984  294 ASN A ND2   
2109 N N     . THR A 269 ? 0.7442 0.5530 0.6766 -0.0065 0.0172  0.1681  295 THR A N     
2110 C CA    . THR A 269 ? 0.7326 0.5530 0.6389 0.0016  -0.0048 0.1771  295 THR A CA    
2111 C C     . THR A 269 ? 0.6584 0.5191 0.5762 0.0051  -0.0029 0.1493  295 THR A C     
2112 O O     . THR A 269 ? 0.6274 0.5013 0.5482 -0.0025 0.0162  0.1301  295 THR A O     
2113 C CB    . THR A 269 ? 0.7954 0.6007 0.6312 -0.0146 -0.0044 0.1997  295 THR A CB    
2114 O OG1   . THR A 269 ? 0.7739 0.5957 0.5876 -0.0309 0.0241  0.1828  295 THR A OG1   
2115 C CG2   . THR A 269 ? 0.8677 0.6257 0.6777 -0.0228 -0.0086 0.2339  295 THR A CG2   
2116 N N     . TYR A 270 ? 0.6262 0.5058 0.5521 0.0159  -0.0245 0.1482  296 TYR A N     
2117 C CA    . TYR A 270 ? 0.5680 0.4790 0.4953 0.0137  -0.0246 0.1268  296 TYR A CA    
2118 C C     . TYR A 270 ? 0.5686 0.4776 0.4509 -0.0006 -0.0102 0.1196  296 TYR A C     
2119 O O     . TYR A 270 ? 0.5370 0.4563 0.4286 -0.0033 0.0025  0.0991  296 TYR A O     
2120 C CB    . TYR A 270 ? 0.5647 0.4972 0.4985 0.0204  -0.0512 0.1311  296 TYR A CB    
2121 C CG    . TYR A 270 ? 0.5476 0.5046 0.4703 0.0108  -0.0517 0.1125  296 TYR A CG    
2122 C CD1   . TYR A 270 ? 0.4902 0.4662 0.4440 0.0099  -0.0415 0.0915  296 TYR A CD1   
2123 C CD2   . TYR A 270 ? 0.5723 0.5271 0.4467 0.0000  -0.0623 0.1160  296 TYR A CD2   
2124 C CE1   . TYR A 270 ? 0.4817 0.4703 0.4213 -0.0018 -0.0431 0.0780  296 TYR A CE1   
2125 C CE2   . TYR A 270 ? 0.5492 0.5174 0.4127 -0.0102 -0.0639 0.0984  296 TYR A CE2   
2126 C CZ    . TYR A 270 ? 0.5335 0.5166 0.4308 -0.0114 -0.0546 0.0809  296 TYR A CZ    
2127 O OH    . TYR A 270 ? 0.5026 0.4896 0.3850 -0.0245 -0.0575 0.0666  296 TYR A OH    
2128 N N     . GLU A 271 ? 0.6070 0.5008 0.4393 -0.0090 -0.0132 0.1361  297 GLU A N     
2129 C CA    . GLU A 271 ? 0.6177 0.5106 0.4033 -0.0217 0.0019  0.1259  297 GLU A CA    
2130 C C     . GLU A 271 ? 0.5933 0.4897 0.3951 -0.0257 0.0318  0.1085  297 GLU A C     
2131 O O     . GLU A 271 ? 0.5680 0.4758 0.3727 -0.0248 0.0388  0.0858  297 GLU A O     
2132 C CB    . GLU A 271 ? 0.6922 0.5643 0.4147 -0.0330 -0.0021 0.1486  297 GLU A CB    
2133 C CG    . GLU A 271 ? 0.7210 0.5948 0.4129 -0.0321 -0.0359 0.1596  297 GLU A CG    
2134 C CD    . GLU A 271 ? 0.7190 0.5972 0.4548 -0.0165 -0.0662 0.1768  297 GLU A CD    
2135 O OE1   . GLU A 271 ? 0.6840 0.5522 0.4615 -0.0067 -0.0611 0.1851  297 GLU A OE1   
2136 O OE2   . GLU A 271 ? 0.7353 0.6280 0.4666 -0.0137 -0.0963 0.1801  297 GLU A OE2   
2137 N N     . GLU A 272 ? 0.6104 0.4959 0.4257 -0.0305 0.0470  0.1192  298 GLU A N     
2138 C CA    . GLU A 272 ? 0.6066 0.5028 0.4459 -0.0361 0.0737  0.1028  298 GLU A CA    
2139 C C     . GLU A 272 ? 0.5550 0.4672 0.4467 -0.0254 0.0703  0.0816  298 GLU A C     
2140 O O     . GLU A 272 ? 0.5443 0.4719 0.4536 -0.0253 0.0832  0.0620  298 GLU A O     
2141 C CB    . GLU A 272 ? 0.6333 0.5140 0.4755 -0.0494 0.0904  0.1204  298 GLU A CB    
2142 C CG    . GLU A 272 ? 0.7385 0.6072 0.5197 -0.0673 0.1059  0.1358  298 GLU A CG    
2143 C CD    . GLU A 272 ? 0.7967 0.6553 0.5803 -0.0878 0.1321  0.1486  298 GLU A CD    
2144 O OE1   . GLU A 272 ? 0.7785 0.6433 0.6179 -0.0884 0.1390  0.1411  298 GLU A OE1   
2145 O OE2   . GLU A 272 ? 0.8870 0.7307 0.6119 -0.1068 0.1461  0.1659  298 GLU A OE2   
2146 N N     . ALA A 273 ? 0.5290 0.4382 0.4447 -0.0164 0.0527  0.0849  299 ALA A N     
2147 C CA    . ALA A 273 ? 0.4896 0.4093 0.4439 -0.0102 0.0497  0.0671  299 ALA A CA    
2148 C C     . ALA A 273 ? 0.4712 0.4013 0.4151 -0.0061 0.0400  0.0532  299 ALA A C     
2149 O O     . ALA A 273 ? 0.4570 0.3929 0.4154 -0.0044 0.0408  0.0376  299 ALA A O     
2150 C CB    . ALA A 273 ? 0.4793 0.3913 0.4608 -0.0040 0.0404  0.0720  299 ALA A CB    
2151 N N     . ALA A 274 ? 0.4859 0.4157 0.4035 -0.0061 0.0282  0.0598  300 ALA A N     
2152 C CA    . ALA A 274 ? 0.4824 0.4157 0.3843 -0.0071 0.0191  0.0477  300 ALA A CA    
2153 C C     . ALA A 274 ? 0.4969 0.4244 0.3801 -0.0081 0.0288  0.0341  300 ALA A C     
2154 O O     . ALA A 274 ? 0.4948 0.4179 0.3813 -0.0056 0.0239  0.0200  300 ALA A O     
2155 C CB    . ALA A 274 ? 0.4981 0.4350 0.3796 -0.0101 0.0031  0.0567  300 ALA A CB    
2156 N N     . ALA A 275 ? 0.5157 0.4412 0.3778 -0.0118 0.0427  0.0380  301 ALA A N     
2157 C CA    . ALA A 275 ? 0.5317 0.4575 0.3819 -0.0111 0.0582  0.0203  301 ALA A CA    
2158 C C     . ALA A 275 ? 0.4998 0.4366 0.3963 -0.0036 0.0663  0.0066  301 ALA A C     
2159 O O     . ALA A 275 ? 0.5022 0.4376 0.4072 0.0046  0.0648  -0.0120 301 ALA A O     
2160 C CB    . ALA A 275 ? 0.5641 0.4900 0.3810 -0.0210 0.0787  0.0277  301 ALA A CB    
2161 N N     . TYR A 276 ? 0.4794 0.4248 0.4066 -0.0063 0.0721  0.0156  302 TYR A N     
2162 C CA    . TYR A 276 ? 0.4680 0.4273 0.4424 -0.0017 0.0750  0.0033  302 TYR A CA    
2163 C C     . TYR A 276 ? 0.4520 0.4043 0.4365 0.0077  0.0528  -0.0066 302 TYR A C     
2164 O O     . TYR A 276 ? 0.4554 0.4136 0.4632 0.0165  0.0497  -0.0217 302 TYR A O     
2165 C CB    . TYR A 276 ? 0.4556 0.4177 0.4562 -0.0095 0.0793  0.0147  302 TYR A CB    
2166 C CG    . TYR A 276 ? 0.4347 0.4163 0.4849 -0.0090 0.0831  0.0005  302 TYR A CG    
2167 C CD1   . TYR A 276 ? 0.4402 0.4457 0.5152 -0.0137 0.1052  -0.0091 302 TYR A CD1   
2168 C CD2   . TYR A 276 ? 0.4071 0.3870 0.4797 -0.0052 0.0641  -0.0051 302 TYR A CD2   
2169 C CE1   . TYR A 276 ? 0.4222 0.4540 0.5540 -0.0132 0.1052  -0.0241 302 TYR A CE1   
2170 C CE2   . TYR A 276 ? 0.3815 0.3807 0.4995 -0.0056 0.0612  -0.0184 302 TYR A CE2   
2171 C CZ    . TYR A 276 ? 0.4135 0.4404 0.5657 -0.0087 0.0798  -0.0277 302 TYR A CZ    
2172 O OH    . TYR A 276 ? 0.4428 0.4959 0.6494 -0.0093 0.0735  -0.0420 302 TYR A OH    
2173 N N     . ILE A 277 ? 0.4515 0.3911 0.4177 0.0052  0.0375  0.0024  303 ILE A N     
2174 C CA    . ILE A 277 ? 0.4609 0.3895 0.4252 0.0079  0.0188  -0.0030 303 ILE A CA    
2175 C C     . ILE A 277 ? 0.4920 0.4044 0.4358 0.0130  0.0117  -0.0125 303 ILE A C     
2176 O O     . ILE A 277 ? 0.5067 0.4066 0.4584 0.0202  -0.0019 -0.0207 303 ILE A O     
2177 C CB    . ILE A 277 ? 0.4521 0.3772 0.4036 0.0004  0.0105  0.0066  303 ILE A CB    
2178 C CG1   . ILE A 277 ? 0.4209 0.3558 0.3967 -0.0010 0.0169  0.0103  303 ILE A CG1   
2179 C CG2   . ILE A 277 ? 0.4705 0.3813 0.4085 -0.0029 -0.0052 0.0028  303 ILE A CG2   
2180 C CD1   . ILE A 277 ? 0.4277 0.3652 0.4010 -0.0050 0.0135  0.0142  303 ILE A CD1   
2181 N N     . GLN A 278 ? 0.5071 0.4154 0.4230 0.0098  0.0184  -0.0118 304 GLN A N     
2182 C CA    . GLN A 278 ? 0.5327 0.4207 0.4273 0.0140  0.0132  -0.0251 304 GLN A CA    
2183 C C     . GLN A 278 ? 0.5415 0.4327 0.4651 0.0297  0.0201  -0.0441 304 GLN A C     
2184 O O     . GLN A 278 ? 0.5580 0.4263 0.4844 0.0397  0.0054  -0.0550 304 GLN A O     
2185 C CB    . GLN A 278 ? 0.5539 0.4384 0.4097 0.0059  0.0195  -0.0244 304 GLN A CB    
2186 C CG    . GLN A 278 ? 0.5852 0.4411 0.4135 0.0069  0.0105  -0.0402 304 GLN A CG    
2187 C CD    . GLN A 278 ? 0.6167 0.4682 0.4014 -0.0014 0.0168  -0.0458 304 GLN A CD    
2188 O OE1   . GLN A 278 ? 0.6165 0.4844 0.3845 -0.0104 0.0214  -0.0313 304 GLN A OE1   
2189 N NE2   . GLN A 278 ? 0.6027 0.4273 0.3656 0.0014  0.0142  -0.0670 304 GLN A NE2   
2190 N N     . CYS A 279 ? 0.5398 0.4592 0.4890 0.0316  0.0415  -0.0479 305 CYS A N     
2191 C CA    . CYS A 279 ? 0.5559 0.4924 0.5481 0.0466  0.0511  -0.0687 305 CYS A CA    
2192 C C     . CYS A 279 ? 0.5370 0.4746 0.5707 0.0574  0.0285  -0.0704 305 CYS A C     
2193 O O     . CYS A 279 ? 0.5590 0.4903 0.6180 0.0752  0.0173  -0.0866 305 CYS A O     
2194 C CB    . CYS A 279 ? 0.5550 0.5267 0.5668 0.0395  0.0826  -0.0709 305 CYS A CB    
2195 S SG    . CYS A 279 ? 0.6701 0.6379 0.6273 0.0303  0.1098  -0.0773 305 CYS A SG    
2196 N N     . GLN A 280 ? 0.5106 0.4529 0.5490 0.0474  0.0194  -0.0545 306 GLN A N     
2197 C CA    . GLN A 280 ? 0.5062 0.4471 0.5715 0.0534  -0.0049 -0.0548 306 GLN A CA    
2198 C C     . GLN A 280 ? 0.5284 0.4304 0.5710 0.0625  -0.0332 -0.0552 306 GLN A C     
2199 O O     . GLN A 280 ? 0.5474 0.4450 0.6191 0.0782  -0.0536 -0.0635 306 GLN A O     
2200 C CB    . GLN A 280 ? 0.4891 0.4329 0.5463 0.0383  -0.0083 -0.0401 306 GLN A CB    
2201 C CG    . GLN A 280 ? 0.4810 0.4551 0.5700 0.0302  0.0129  -0.0400 306 GLN A CG    
2202 C CD    . GLN A 280 ? 0.5350 0.5386 0.6827 0.0370  0.0099  -0.0546 306 GLN A CD    
2203 O OE1   . GLN A 280 ? 0.5648 0.5648 0.7282 0.0450  -0.0173 -0.0594 306 GLN A OE1   
2204 N NE2   . GLN A 280 ? 0.5368 0.5710 0.7170 0.0320  0.0368  -0.0608 306 GLN A NE2   
2205 N N     . PHE A 281 ? 0.5356 0.4085 0.5287 0.0522  -0.0356 -0.0459 307 PHE A N     
2206 C CA    . PHE A 281 ? 0.5734 0.4016 0.5373 0.0547  -0.0594 -0.0439 307 PHE A CA    
2207 C C     . PHE A 281 ? 0.6118 0.4218 0.5864 0.0738  -0.0607 -0.0631 307 PHE A C     
2208 O O     . PHE A 281 ? 0.6464 0.4303 0.6357 0.0901  -0.0851 -0.0681 307 PHE A O     
2209 C CB    . PHE A 281 ? 0.5771 0.3863 0.4916 0.0330  -0.0593 -0.0296 307 PHE A CB    
2210 C CG    . PHE A 281 ? 0.5730 0.3844 0.4733 0.0172  -0.0669 -0.0142 307 PHE A CG    
2211 C CD1   . PHE A 281 ? 0.5401 0.3855 0.4535 0.0100  -0.0505 -0.0103 307 PHE A CD1   
2212 C CD2   . PHE A 281 ? 0.6153 0.3907 0.4859 0.0088  -0.0899 -0.0045 307 PHE A CD2   
2213 C CE1   . PHE A 281 ? 0.5297 0.3778 0.4307 -0.0032 -0.0539 -0.0021 307 PHE A CE1   
2214 C CE2   . PHE A 281 ? 0.6184 0.3977 0.4690 -0.0084 -0.0921 0.0064  307 PHE A CE2   
2215 C CZ    . PHE A 281 ? 0.5677 0.3857 0.4359 -0.0132 -0.0728 0.0048  307 PHE A CZ    
2216 N N     . GLU A 282 ? 0.6116 0.4323 0.5775 0.0731  -0.0362 -0.0752 308 GLU A N     
2217 C CA    . GLU A 282 ? 0.6476 0.4481 0.6187 0.0910  -0.0338 -0.0994 308 GLU A CA    
2218 C C     . GLU A 282 ? 0.6451 0.4718 0.6820 0.1179  -0.0312 -0.1204 308 GLU A C     
2219 O O     . GLU A 282 ? 0.6838 0.4859 0.7391 0.1403  -0.0420 -0.1400 308 GLU A O     
2220 C CB    . GLU A 282 ? 0.6564 0.4630 0.5942 0.0812  -0.0073 -0.1099 308 GLU A CB    
2221 C CG    . GLU A 282 ? 0.6755 0.4586 0.5569 0.0567  -0.0159 -0.0923 308 GLU A CG    
2222 C CD    . GLU A 282 ? 0.7097 0.4940 0.5518 0.0467  0.0018  -0.1029 308 GLU A CD    
2223 O OE1   . GLU A 282 ? 0.7458 0.5495 0.5958 0.0560  0.0263  -0.1228 308 GLU A OE1   
2224 O OE2   . GLU A 282 ? 0.7024 0.4705 0.5047 0.0276  -0.0088 -0.0922 308 GLU A OE2   
2225 N N     . ASP A 283 ? 0.6056 0.4822 0.6835 0.1159  -0.0183 -0.1177 309 ASP A N     
2226 C CA    . ASP A 283 ? 0.6116 0.5252 0.7642 0.1387  -0.0164 -0.1382 309 ASP A CA    
2227 C C     . ASP A 283 ? 0.6163 0.5084 0.7998 0.1581  -0.0598 -0.1352 309 ASP A C     
2228 O O     . ASP A 283 ? 0.6347 0.5514 0.8856 0.1837  -0.0660 -0.1559 309 ASP A O     
2229 C CB    . ASP A 283 ? 0.5784 0.5513 0.7684 0.1260  0.0091  -0.1362 309 ASP A CB    
2230 C CG    . ASP A 283 ? 0.6213 0.6203 0.7959 0.1136  0.0545  -0.1458 309 ASP A CG    
2231 O OD1   . ASP A 283 ? 0.6810 0.6579 0.8187 0.1169  0.0666  -0.1585 309 ASP A OD1   
2232 O OD2   . ASP A 283 ? 0.6514 0.6894 0.8457 0.0980  0.0771  -0.1399 309 ASP A OD2   
2233 N N     . LEU A 284 ? 0.7056 0.6962 0.8222 0.1400  -0.0507 -0.0999 310 LEU A N     
2234 C CA    . LEU A 284 ? 0.6983 0.6806 0.8461 0.1467  -0.0839 -0.0906 310 LEU A CA    
2235 C C     . LEU A 284 ? 0.7138 0.6853 0.8936 0.1547  -0.0805 -0.0978 310 LEU A C     
2236 O O     . LEU A 284 ? 0.7236 0.6835 0.9399 0.1656  -0.1061 -0.0929 310 LEU A O     
2237 C CB    . LEU A 284 ? 0.6948 0.6549 0.7806 0.1429  -0.1073 -0.0733 310 LEU A CB    
2238 C CG    . LEU A 284 ? 0.6625 0.6314 0.7196 0.1353  -0.1139 -0.0658 310 LEU A CG    
2239 C CD1   . LEU A 284 ? 0.6187 0.5629 0.6086 0.1279  -0.1200 -0.0537 310 LEU A CD1   
2240 C CD2   . LEU A 284 ? 0.6222 0.5993 0.7262 0.1419  -0.1408 -0.0648 310 LEU A CD2   
2241 N N     . ASN A 285 ? 0.7216 0.6919 0.8839 0.1520  -0.0526 -0.1110 311 ASN A N     
2242 C CA    . ASN A 285 ? 0.7471 0.7087 0.9430 0.1581  -0.0434 -0.1218 311 ASN A CA    
2243 C C     . ASN A 285 ? 0.7612 0.7355 1.0391 0.1653  -0.0333 -0.1321 311 ASN A C     
2244 O O     . ASN A 285 ? 0.7610 0.7454 1.0553 0.1621  -0.0021 -0.1445 311 ASN A O     
2245 C CB    . ASN A 285 ? 0.7533 0.7101 0.9099 0.1549  -0.0189 -0.1399 311 ASN A CB    
2246 C CG    . ASN A 285 ? 0.7610 0.7073 0.9490 0.1597  -0.0089 -0.1537 311 ASN A CG    
2247 O OD1   . ASN A 285 ? 0.7570 0.7003 1.0014 0.1663  -0.0145 -0.1497 311 ASN A OD1   
2248 N ND2   . ASN A 285 ? 0.7589 0.6979 0.9128 0.1585  0.0021  -0.1732 311 ASN A ND2   
2249 N N     . LYS A 286 ? 0.7871 0.7538 1.1169 0.1763  -0.0577 -0.1280 312 LYS A N     
2250 C CA    . LYS A 286 ? 0.8060 0.7874 1.2360 0.1853  -0.0560 -0.1417 312 LYS A CA    
2251 C C     . LYS A 286 ? 0.8285 0.8048 1.2966 0.1883  -0.0268 -0.1582 312 LYS A C     
2252 O O     . LYS A 286 ? 0.8325 0.8215 1.3908 0.1929  -0.0104 -0.1755 312 LYS A O     
2253 C CB    . LYS A 286 ? 0.8230 0.7956 1.2926 0.2016  -0.1105 -0.1315 312 LYS A CB    
2254 C CG    . LYS A 286 ? 0.8264 0.8044 1.2692 0.1997  -0.1396 -0.1211 312 LYS A CG    
2255 C CD    . LYS A 286 ? 0.8752 0.8393 1.3604 0.2212  -0.2006 -0.1187 312 LYS A CD    
2256 C CE    . LYS A 286 ? 0.8846 0.8512 1.3377 0.2191  -0.2300 -0.1118 312 LYS A CE    
2257 N NZ    . LYS A 286 ? 0.9475 0.8909 1.4289 0.2452  -0.3001 -0.1131 312 LYS A NZ    
2258 N N     . ARG A 287 ? 0.8534 0.8110 1.2615 0.1849  -0.0182 -0.1566 313 ARG A N     
2259 C CA    . ARG A 287 ? 0.8835 0.8330 1.3171 0.1868  0.0094  -0.1745 313 ARG A CA    
2260 C C     . ARG A 287 ? 0.8974 0.8417 1.2636 0.1776  0.0435  -0.1906 313 ARG A C     
2261 O O     . ARG A 287 ? 0.9074 0.8385 1.2399 0.1763  0.0457  -0.1990 313 ARG A O     
2262 C CB    . ARG A 287 ? 0.9026 0.8269 1.3336 0.1938  -0.0113 -0.1649 313 ARG A CB    
2263 C CG    . ARG A 287 ? 0.9384 0.8467 1.4110 0.2104  -0.0526 -0.1478 313 ARG A CG    
2264 C CD    . ARG A 287 ? 0.9867 0.9046 1.5645 0.2233  -0.0502 -0.1635 313 ARG A CD    
2265 N NE    . ARG A 287 ? 1.0346 0.9384 1.6575 0.2449  -0.1023 -0.1522 313 ARG A NE    
2266 C CZ    . ARG A 287 ? 1.0380 0.9604 1.6967 0.2510  -0.1330 -0.1529 313 ARG A CZ    
2267 N NH1   . ARG A 287 ? 1.0052 0.9609 1.6610 0.2346  -0.1091 -0.1609 313 ARG A NH1   
2268 N NH2   . ARG A 287 ? 1.0827 0.9846 1.7780 0.2761  -0.1906 -0.1472 313 ARG A NH2   
2269 N N     . LYS A 288 ? 0.9127 0.8609 1.2588 0.1734  0.0686  -0.1968 314 LYS A N     
2270 C CA    . LYS A 288 ? 0.9503 0.8783 1.2097 0.1709  0.0953  -0.2106 314 LYS A CA    
2271 C C     . LYS A 288 ? 0.9940 0.8981 1.2383 0.1754  0.1213  -0.2355 314 LYS A C     
2272 O O     . LYS A 288 ? 1.0253 0.9097 1.1917 0.1780  0.1180  -0.2490 314 LYS A O     
2273 C CB    . LYS A 288 ? 0.9711 0.8907 1.2172 0.1685  0.1296  -0.2119 314 LYS A CB    
2274 C CG    . LYS A 288 ? 0.9449 0.8799 1.1704 0.1636  0.1084  -0.1927 314 LYS A CG    
2275 C CD    . LYS A 288 ? 0.9659 0.8804 1.0792 0.1642  0.1037  -0.1915 314 LYS A CD    
2276 C CE    . LYS A 288 ? 0.9354 0.8644 1.0329 0.1585  0.0874  -0.1726 314 LYS A CE    
2277 N NZ    . LYS A 288 ? 0.9265 0.8631 1.0887 0.1542  0.1152  -0.1709 314 LYS A NZ    
2278 N N     . ASP A 289 ? 1.0023 0.9068 1.3248 0.1778  0.1440  -0.2452 315 ASP A N     
2279 C CA    . ASP A 289 ? 1.0473 0.9260 1.3604 0.1816  0.1742  -0.2708 315 ASP A CA    
2280 C C     . ASP A 289 ? 1.0336 0.9156 1.3509 0.1832  0.1462  -0.2763 315 ASP A C     
2281 O O     . ASP A 289 ? 1.0739 0.9332 1.3495 0.1862  0.1577  -0.3008 315 ASP A O     
2282 C CB    . ASP A 289 ? 1.0589 0.9369 1.4674 0.1825  0.2135  -0.2818 315 ASP A CB    
2283 C CG    . ASP A 289 ? 1.0852 0.9556 1.5076 0.1784  0.2536  -0.2822 315 ASP A CG    
2284 O OD1   . ASP A 289 ? 1.1187 0.9719 1.4522 0.1764  0.2589  -0.2749 315 ASP A OD1   
2285 O OD2   . ASP A 289 ? 1.0880 0.9678 1.6189 0.1774  0.2819  -0.2920 315 ASP A OD2   
2286 N N     . THR A 290 ? 0.9875 0.8896 1.3503 0.1821  0.1115  -0.2552 316 THR A N     
2287 C CA    . THR A 290 ? 0.9765 0.8731 1.3523 0.1822  0.0943  -0.2574 316 THR A CA    
2288 C C     . THR A 290 ? 0.9591 0.8554 1.2755 0.1762  0.0710  -0.2546 316 THR A C     
2289 O O     . THR A 290 ? 0.9741 0.8619 1.2808 0.1743  0.0703  -0.2755 316 THR A O     
2290 C CB    . THR A 290 ? 0.9642 0.8614 1.4118 0.1881  0.0752  -0.2355 316 THR A CB    
2291 O OG1   . THR A 290 ? 0.9775 0.8745 1.5003 0.1951  0.0959  -0.2478 316 THR A OG1   
2292 C CG2   . THR A 290 ? 0.9731 0.8503 1.4135 0.1869  0.0619  -0.2296 316 THR A CG2   
2293 N N     . LYS A 291 ? 0.9261 0.8326 1.2134 0.1730  0.0531  -0.2328 317 LYS A N     
2294 C CA    . LYS A 291 ? 0.9017 0.8081 1.1511 0.1664  0.0322  -0.2256 317 LYS A CA    
2295 C C     . LYS A 291 ? 0.8985 0.8106 1.0816 0.1653  0.0279  -0.2369 317 LYS A C     
2296 O O     . LYS A 291 ? 0.9024 0.8175 1.0592 0.1676  0.0354  -0.2293 317 LYS A O     
2297 C CB    . LYS A 291 ? 0.8863 0.7904 1.1444 0.1655  0.0127  -0.1916 317 LYS A CB    
2298 C CG    . LYS A 291 ? 0.8860 0.7756 1.1147 0.1576  0.0013  -0.1814 317 LYS A CG    
2299 C CD    . LYS A 291 ? 0.9074 0.7674 1.1639 0.1567  0.0114  -0.1842 317 LYS A CD    
2300 C CE    . LYS A 291 ? 0.9132 0.7486 1.1445 0.1466  0.0136  -0.1759 317 LYS A CE    
2301 N NZ    . LYS A 291 ? 0.9524 0.7535 1.2155 0.1433  0.0360  -0.1852 317 LYS A NZ    
2302 N N     . GLU A 292 ? 0.8929 0.8028 1.0548 0.1631  0.0159  -0.2572 318 GLU A N     
2303 C CA    . GLU A 292 ? 0.8954 0.8059 0.9949 0.1665  0.0014  -0.2698 318 GLU A CA    
2304 C C     . GLU A 292 ? 0.8570 0.7784 0.9607 0.1573  -0.0177 -0.2611 318 GLU A C     
2305 O O     . GLU A 292 ? 0.8497 0.7697 0.9970 0.1499  -0.0183 -0.2711 318 GLU A O     
2306 C CB    . GLU A 292 ? 0.9441 0.8390 1.0162 0.1772  -0.0041 -0.3118 318 GLU A CB    
2307 C CG    . GLU A 292 ? 0.9932 0.8717 0.9792 0.1902  -0.0224 -0.3264 318 GLU A CG    
2308 C CD    . GLU A 292 ? 1.0852 0.9282 1.0161 0.2082  -0.0258 -0.3648 318 GLU A CD    
2309 O OE1   . GLU A 292 ? 1.1223 0.9480 1.0579 0.2101  0.0037  -0.3684 318 GLU A OE1   
2310 O OE2   . GLU A 292 ? 1.1326 0.9605 1.0144 0.2225  -0.0605 -0.3938 318 GLU A OE2   
2311 N N     . ILE A 293 ? 0.8310 0.7586 0.8936 0.1565  -0.0265 -0.2432 319 ILE A N     
2312 C CA    . ILE A 293 ? 0.7966 0.7321 0.8555 0.1488  -0.0426 -0.2401 319 ILE A CA    
2313 C C     . ILE A 293 ? 0.8130 0.7486 0.8514 0.1578  -0.0640 -0.2779 319 ILE A C     
2314 O O     . ILE A 293 ? 0.8518 0.7736 0.8336 0.1731  -0.0708 -0.2917 319 ILE A O     
2315 C CB    . ILE A 293 ? 0.7798 0.7215 0.8022 0.1457  -0.0462 -0.2098 319 ILE A CB    
2316 C CG1   . ILE A 293 ? 0.7665 0.7082 0.8063 0.1438  -0.0350 -0.1802 319 ILE A CG1   
2317 C CG2   . ILE A 293 ? 0.7436 0.6895 0.7703 0.1352  -0.0566 -0.2047 319 ILE A CG2   
2318 C CD1   . ILE A 293 ? 0.7679 0.6974 0.8437 0.1379  -0.0350 -0.1633 319 ILE A CD1   
2319 N N     . TYR A 294 ? 0.7929 0.7365 0.8760 0.1502  -0.0743 -0.2968 320 TYR A N     
2320 C CA    . TYR A 294 ? 0.8059 0.7537 0.8884 0.1610  -0.1054 -0.3383 320 TYR A CA    
2321 C C     . TYR A 294 ? 0.7852 0.7434 0.8595 0.1567  -0.1190 -0.3296 320 TYR A C     
2322 O O     . TYR A 294 ? 0.7593 0.7256 0.8917 0.1402  -0.1082 -0.3289 320 TYR A O     
2323 C CB    . TYR A 294 ? 0.8087 0.7617 0.9755 0.1561  -0.1064 -0.3789 320 TYR A CB    
2324 C CG    . TYR A 294 ? 0.8312 0.7730 1.0079 0.1602  -0.0915 -0.3881 320 TYR A CG    
2325 C CD1   . TYR A 294 ? 0.8835 0.8123 1.0197 0.1806  -0.1132 -0.4221 320 TYR A CD1   
2326 C CD2   . TYR A 294 ? 0.8096 0.7448 1.0266 0.1461  -0.0565 -0.3626 320 TYR A CD2   
2327 C CE1   . TYR A 294 ? 0.9123 0.8285 1.0582 0.1834  -0.0956 -0.4319 320 TYR A CE1   
2328 C CE2   . TYR A 294 ? 0.8407 0.7660 1.0732 0.1503  -0.0422 -0.3712 320 TYR A CE2   
2329 C CZ    . TYR A 294 ? 0.8838 0.8031 1.0858 0.1671  -0.0595 -0.4065 320 TYR A CZ    
2330 O OH    . TYR A 294 ? 0.9096 0.8173 1.1286 0.1701  -0.0416 -0.4164 320 TYR A OH    
2331 N N     . THR A 295 ? 0.5948 0.5046 0.6288 0.0653  -0.0561 -0.1033 321 THR A N     
2332 C CA    . THR A 295 ? 0.5683 0.4923 0.5980 0.0577  -0.0699 -0.1020 321 THR A CA    
2333 C C     . THR A 295 ? 0.5743 0.4878 0.5814 0.0488  -0.0747 -0.1114 321 THR A C     
2334 O O     . THR A 295 ? 0.5870 0.4888 0.5803 0.0448  -0.0684 -0.1176 321 THR A O     
2335 C CB    . THR A 295 ? 0.5594 0.5022 0.5998 0.0572  -0.0710 -0.0970 321 THR A CB    
2336 O OG1   . THR A 295 ? 0.5435 0.5023 0.6096 0.0653  -0.0689 -0.0865 321 THR A OG1   
2337 C CG2   . THR A 295 ? 0.5436 0.4940 0.5758 0.0495  -0.0849 -0.0961 321 THR A CG2   
2338 N N     . HIS A 296 ? 0.5626 0.4821 0.5671 0.0452  -0.0859 -0.1124 322 HIS A N     
2339 C CA    . HIS A 296 ? 0.5608 0.4778 0.5521 0.0395  -0.0937 -0.1198 322 HIS A CA    
2340 C C     . HIS A 296 ? 0.5493 0.4793 0.5459 0.0397  -0.1050 -0.1191 322 HIS A C     
2341 O O     . HIS A 296 ? 0.5443 0.4846 0.5506 0.0406  -0.1069 -0.1148 322 HIS A O     
2342 C CB    . HIS A 296 ? 0.5724 0.4844 0.5567 0.0351  -0.0936 -0.1251 322 HIS A CB    
2343 C CG    . HIS A 296 ? 0.6154 0.5077 0.5888 0.0334  -0.0821 -0.1269 322 HIS A CG    
2344 N ND1   . HIS A 296 ? 0.6330 0.5109 0.5878 0.0264  -0.0789 -0.1328 322 HIS A ND1   
2345 C CD2   . HIS A 296 ? 0.6284 0.5094 0.6048 0.0375  -0.0732 -0.1233 322 HIS A CD2   
2346 C CE1   . HIS A 296 ? 0.6540 0.5113 0.5990 0.0255  -0.0664 -0.1346 322 HIS A CE1   
2347 N NE2   . HIS A 296 ? 0.6637 0.5217 0.6229 0.0338  -0.0628 -0.1289 322 HIS A NE2   
2348 N N     . PHE A 297 ? 0.5384 0.4646 0.5261 0.0381  -0.1129 -0.1231 323 PHE A N     
2349 C CA    . PHE A 297 ? 0.5294 0.4614 0.5196 0.0399  -0.1234 -0.1250 323 PHE A CA    
2350 C C     . PHE A 297 ? 0.5316 0.4708 0.5258 0.0408  -0.1280 -0.1329 323 PHE A C     
2351 O O     . PHE A 297 ? 0.5477 0.4826 0.5357 0.0384  -0.1299 -0.1359 323 PHE A O     
2352 C CB    . PHE A 297 ? 0.5334 0.4535 0.5111 0.0386  -0.1311 -0.1239 323 PHE A CB    
2353 C CG    . PHE A 297 ? 0.5126 0.4318 0.4877 0.0354  -0.1279 -0.1169 323 PHE A CG    
2354 C CD1   . PHE A 297 ? 0.4923 0.4102 0.4650 0.0317  -0.1177 -0.1134 323 PHE A CD1   
2355 C CD2   . PHE A 297 ? 0.4750 0.3964 0.4503 0.0349  -0.1337 -0.1145 323 PHE A CD2   
2356 C CE1   . PHE A 297 ? 0.4819 0.4063 0.4565 0.0280  -0.1143 -0.1070 323 PHE A CE1   
2357 C CE2   . PHE A 297 ? 0.4737 0.3980 0.4463 0.0290  -0.1315 -0.1071 323 PHE A CE2   
2358 C CZ    . PHE A 297 ? 0.4810 0.4099 0.4555 0.0257  -0.1221 -0.1030 323 PHE A CZ    
2359 N N     . THR A 298 ? 0.5198 0.4718 0.5238 0.0424  -0.1293 -0.1365 324 THR A N     
2360 C CA    . THR A 298 ? 0.5211 0.4873 0.5328 0.0413  -0.1299 -0.1448 324 THR A CA    
2361 C C     . THR A 298 ? 0.5246 0.5022 0.5466 0.0467  -0.1350 -0.1529 324 THR A C     
2362 O O     . THR A 298 ? 0.5247 0.4968 0.5448 0.0490  -0.1361 -0.1518 324 THR A O     
2363 C CB    . THR A 298 ? 0.5145 0.4869 0.5267 0.0339  -0.1212 -0.1437 324 THR A CB    
2364 O OG1   . THR A 298 ? 0.5141 0.4907 0.5288 0.0322  -0.1195 -0.1409 324 THR A OG1   
2365 C CG2   . THR A 298 ? 0.5272 0.4840 0.5304 0.0314  -0.1147 -0.1365 324 THR A CG2   
2366 N N     . CYS A 299 ? 0.5444 0.5384 0.5776 0.0483  -0.1376 -0.1616 325 CYS A N     
2367 C CA    . CYS A 299 ? 0.5622 0.5733 0.6108 0.0539  -0.1382 -0.1726 325 CYS A CA    
2368 C C     . CYS A 299 ? 0.5652 0.5993 0.6206 0.0442  -0.1305 -0.1787 325 CYS A C     
2369 O O     . CYS A 299 ? 0.5690 0.6150 0.6297 0.0416  -0.1333 -0.1807 325 CYS A O     
2370 C CB    . CYS A 299 ? 0.5679 0.5817 0.6286 0.0664  -0.1501 -0.1773 325 CYS A CB    
2371 S SG    . CYS A 299 ? 0.5758 0.6124 0.6618 0.0778  -0.1484 -0.1937 325 CYS A SG    
2372 N N     . ALA A 300 ? 0.5757 0.6142 0.6269 0.0357  -0.1217 -0.1805 326 ALA A N     
2373 C CA    . ALA A 300 ? 0.5837 0.6372 0.6327 0.0214  -0.1142 -0.1836 326 ALA A CA    
2374 C C     . ALA A 300 ? 0.5888 0.6745 0.6573 0.0215  -0.1125 -0.1982 326 ALA A C     
2375 O O     . ALA A 300 ? 0.5924 0.6943 0.6604 0.0091  -0.1088 -0.2014 326 ALA A O     
2376 C CB    . ALA A 300 ? 0.5936 0.6415 0.6301 0.0102  -0.1075 -0.1804 326 ALA A CB    
2377 N N     . THR A 301 ? 0.5930 0.6880 0.6792 0.0357  -0.1153 -0.2073 327 THR A N     
2378 C CA    . THR A 301 ? 0.6020 0.7323 0.7150 0.0404  -0.1132 -0.2225 327 THR A CA    
2379 C C     . THR A 301 ? 0.6141 0.7566 0.7429 0.0485  -0.1253 -0.2205 327 THR A C     
2380 O O     . THR A 301 ? 0.6147 0.7927 0.7710 0.0529  -0.1261 -0.2312 327 THR A O     
2381 C CB    . THR A 301 ? 0.6091 0.7418 0.7361 0.0545  -0.1100 -0.2347 327 THR A CB    
2382 O OG1   . THR A 301 ? 0.6099 0.7101 0.7286 0.0684  -0.1205 -0.2261 327 THR A OG1   
2383 C CG2   . THR A 301 ? 0.6005 0.7308 0.7123 0.0404  -0.0960 -0.2405 327 THR A CG2   
2384 N N     . ASP A 302 ? 0.6294 0.7447 0.7411 0.0491  -0.1345 -0.2068 328 ASP A N     
2385 C CA    . ASP A 302 ? 0.6504 0.7713 0.7688 0.0520  -0.1474 -0.2023 328 ASP A CA    
2386 C C     . ASP A 302 ? 0.6556 0.7779 0.7571 0.0325  -0.1442 -0.1973 328 ASP A C     
2387 O O     . ASP A 302 ? 0.6651 0.7569 0.7403 0.0251  -0.1418 -0.1876 328 ASP A O     
2388 C CB    . ASP A 302 ? 0.6626 0.7498 0.7683 0.0622  -0.1592 -0.1918 328 ASP A CB    
2389 C CG    . ASP A 302 ? 0.6892 0.7787 0.7978 0.0632  -0.1750 -0.1860 328 ASP A CG    
2390 O OD1   . ASP A 302 ? 0.7098 0.8278 0.8307 0.0559  -0.1776 -0.1890 328 ASP A OD1   
2391 O OD2   . ASP A 302 ? 0.7350 0.7969 0.8304 0.0688  -0.1857 -0.1776 328 ASP A OD2   
2392 N N     . THR A 303 ? 0.6613 0.8193 0.7785 0.0241  -0.1436 -0.2047 329 THR A N     
2393 C CA    . THR A 303 ? 0.6750 0.8350 0.7736 0.0022  -0.1397 -0.2019 329 THR A CA    
2394 C C     . THR A 303 ? 0.6938 0.8243 0.7678 -0.0035 -0.1476 -0.1903 329 THR A C     
2395 O O     . THR A 303 ? 0.7073 0.8107 0.7521 -0.0169 -0.1401 -0.1850 329 THR A O     
2396 C CB    . THR A 303 ? 0.6736 0.8836 0.7963 -0.0068 -0.1393 -0.2123 329 THR A CB    
2397 O OG1   . THR A 303 ? 0.6634 0.8962 0.8005 -0.0070 -0.1267 -0.2245 329 THR A OG1   
2398 C CG2   . THR A 303 ? 0.6910 0.8998 0.7890 -0.0329 -0.1367 -0.2088 329 THR A CG2   
2399 N N     . LYS A 304 ? 0.7020 0.8347 0.7862 0.0061  -0.1625 -0.1867 330 LYS A N     
2400 C CA    . LYS A 304 ? 0.7209 0.8237 0.7783 -0.0014 -0.1697 -0.1765 330 LYS A CA    
2401 C C     . LYS A 304 ? 0.7166 0.7756 0.7466 -0.0002 -0.1604 -0.1704 330 LYS A C     
2402 O O     . LYS A 304 ? 0.7305 0.7639 0.7321 -0.0134 -0.1536 -0.1663 330 LYS A O     
2403 C CB    . LYS A 304 ? 0.7368 0.8445 0.8078 0.0097  -0.1893 -0.1720 330 LYS A CB    
2404 C CG    . LYS A 304 ? 0.7890 0.8599 0.8263 0.0000  -0.1959 -0.1616 330 LYS A CG    
2405 C CD    . LYS A 304 ? 0.8480 0.9131 0.8919 0.0109  -0.2166 -0.1549 330 LYS A CD    
2406 C CE    . LYS A 304 ? 0.8925 0.9237 0.8980 -0.0055 -0.2225 -0.1455 330 LYS A CE    
2407 N NZ    . LYS A 304 ? 0.9259 0.9714 0.9215 -0.0266 -0.2292 -0.1434 330 LYS A NZ    
2408 N N     . ASN A 305 ? 0.6959 0.7469 0.7350 0.0154  -0.1595 -0.1702 331 ASN A N     
2409 C CA    . ASN A 305 ? 0.6856 0.7029 0.7051 0.0176  -0.1518 -0.1640 331 ASN A CA    
2410 C C     . ASN A 305 ? 0.6839 0.6912 0.6901 0.0081  -0.1370 -0.1635 331 ASN A C     
2411 O O     . ASN A 305 ? 0.6943 0.6741 0.6800 0.0038  -0.1302 -0.1581 331 ASN A O     
2412 C CB    . ASN A 305 ? 0.6734 0.6876 0.7047 0.0331  -0.1543 -0.1641 331 ASN A CB    
2413 C CG    . ASN A 305 ? 0.6719 0.6589 0.6866 0.0336  -0.1467 -0.1572 331 ASN A CG    
2414 O OD1   . ASN A 305 ? 0.6598 0.6477 0.6781 0.0357  -0.1391 -0.1573 331 ASN A OD1   
2415 N ND2   . ASN A 305 ? 0.6797 0.6443 0.6760 0.0299  -0.1483 -0.1511 331 ASN A ND2   
2416 N N     . VAL A 306 ? 0.6690 0.6976 0.6864 0.0045  -0.1319 -0.1694 332 VAL A N     
2417 C CA    . VAL A 306 ? 0.6733 0.6895 0.6758 -0.0057 -0.1207 -0.1673 332 VAL A CA    
2418 C C     . VAL A 306 ? 0.7027 0.7024 0.6822 -0.0203 -0.1177 -0.1654 332 VAL A C     
2419 O O     . VAL A 306 ? 0.7139 0.6835 0.6741 -0.0233 -0.1098 -0.1600 332 VAL A O     
2420 C CB    . VAL A 306 ? 0.6658 0.7075 0.6796 -0.0115 -0.1164 -0.1744 332 VAL A CB    
2421 C CG1   . VAL A 306 ? 0.6610 0.6849 0.6544 -0.0247 -0.1080 -0.1700 332 VAL A CG1   
2422 C CG2   . VAL A 306 ? 0.6379 0.6881 0.6681 0.0014  -0.1171 -0.1770 332 VAL A CG2   
2423 N N     . GLN A 307 ? 0.7176 0.7363 0.6995 -0.0291 -0.1243 -0.1697 333 GLN A N     
2424 C CA    . GLN A 307 ? 0.7513 0.7542 0.7073 -0.0468 -0.1225 -0.1686 333 GLN A CA    
2425 C C     . GLN A 307 ? 0.7663 0.7300 0.6994 -0.0447 -0.1195 -0.1629 333 GLN A C     
2426 O O     . GLN A 307 ? 0.7873 0.7194 0.6944 -0.0534 -0.1096 -0.1613 333 GLN A O     
2427 C CB    . GLN A 307 ? 0.7583 0.7945 0.7247 -0.0565 -0.1333 -0.1727 333 GLN A CB    
2428 C CG    . GLN A 307 ? 0.7950 0.8170 0.7311 -0.0798 -0.1325 -0.1718 333 GLN A CG    
2429 C CD    . GLN A 307 ? 0.8330 0.8926 0.7826 -0.0897 -0.1464 -0.1736 333 GLN A CD    
2430 O OE1   . GLN A 307 ? 0.8360 0.9397 0.8224 -0.0802 -0.1540 -0.1779 333 GLN A OE1   
2431 N NE2   . GLN A 307 ? 0.8510 0.8937 0.7717 -0.1088 -0.1498 -0.1705 333 GLN A NE2   
2432 N N     . PHE A 308 ? 0.7620 0.7264 0.7037 -0.0337 -0.1274 -0.1605 334 PHE A N     
2433 C CA    . PHE A 308 ? 0.7812 0.7121 0.7016 -0.0332 -0.1232 -0.1565 334 PHE A CA    
2434 C C     . PHE A 308 ? 0.7810 0.6880 0.6972 -0.0246 -0.1091 -0.1539 334 PHE A C     
2435 O O     . PHE A 308 ? 0.8033 0.6798 0.6973 -0.0297 -0.0978 -0.1535 334 PHE A O     
2436 C CB    . PHE A 308 ? 0.7790 0.7150 0.7083 -0.0243 -0.1356 -0.1536 334 PHE A CB    
2437 C CG    . PHE A 308 ? 0.8129 0.7167 0.7177 -0.0278 -0.1304 -0.1505 334 PHE A CG    
2438 C CD1   . PHE A 308 ? 0.8334 0.7212 0.7107 -0.0449 -0.1328 -0.1504 334 PHE A CD1   
2439 C CD2   . PHE A 308 ? 0.8084 0.6994 0.7161 -0.0165 -0.1223 -0.1481 334 PHE A CD2   
2440 C CE1   . PHE A 308 ? 0.8668 0.7245 0.7185 -0.0508 -0.1253 -0.1496 334 PHE A CE1   
2441 C CE2   . PHE A 308 ? 0.8298 0.6950 0.7158 -0.0215 -0.1148 -0.1470 334 PHE A CE2   
2442 C CZ    . PHE A 308 ? 0.8473 0.6951 0.7048 -0.0385 -0.1154 -0.1485 334 PHE A CZ    
2443 N N     . VAL A 309 ? 0.7553 0.6765 0.6933 -0.0117 -0.1097 -0.1521 335 VAL A N     
2444 C CA    . VAL A 309 ? 0.7513 0.6567 0.6911 -0.0028 -0.0998 -0.1474 335 VAL A CA    
2445 C C     . VAL A 309 ? 0.7693 0.6578 0.6969 -0.0093 -0.0905 -0.1466 335 VAL A C     
2446 O O     . VAL A 309 ? 0.7821 0.6447 0.7010 -0.0052 -0.0805 -0.1434 335 VAL A O     
2447 C CB    . VAL A 309 ? 0.7231 0.6479 0.6855 0.0084  -0.1045 -0.1449 335 VAL A CB    
2448 C CG1   . VAL A 309 ? 0.7222 0.6358 0.6880 0.0147  -0.0966 -0.1381 335 VAL A CG1   
2449 C CG2   . VAL A 309 ? 0.7126 0.6420 0.6810 0.0156  -0.1126 -0.1444 335 VAL A CG2   
2450 N N     . PHE A 310 ? 0.7758 0.6783 0.7027 -0.0196 -0.0937 -0.1496 336 PHE A N     
2451 C CA    . PHE A 310 ? 0.8086 0.6902 0.7179 -0.0290 -0.0869 -0.1480 336 PHE A CA    
2452 C C     . PHE A 310 ? 0.8451 0.6936 0.7252 -0.0391 -0.0797 -0.1502 336 PHE A C     
2453 O O     . PHE A 310 ? 0.8695 0.6855 0.7328 -0.0404 -0.0714 -0.1476 336 PHE A O     
2454 C CB    . PHE A 310 ? 0.8030 0.7072 0.7138 -0.0423 -0.0910 -0.1514 336 PHE A CB    
2455 C CG    . PHE A 310 ? 0.8329 0.7135 0.7268 -0.0502 -0.0864 -0.1466 336 PHE A CG    
2456 C CD1   . PHE A 310 ? 0.8372 0.7143 0.7412 -0.0410 -0.0868 -0.1390 336 PHE A CD1   
2457 C CD2   . PHE A 310 ? 0.8679 0.7257 0.7325 -0.0680 -0.0830 -0.1484 336 PHE A CD2   
2458 C CE1   . PHE A 310 ? 0.8789 0.7303 0.7657 -0.0484 -0.0856 -0.1321 336 PHE A CE1   
2459 C CE2   . PHE A 310 ? 0.9090 0.7376 0.7536 -0.0757 -0.0804 -0.1427 336 PHE A CE2   
2460 C CZ    . PHE A 310 ? 0.8996 0.7245 0.7560 -0.0651 -0.0824 -0.1340 336 PHE A CZ    
2461 N N     . ASP A 311 ? 0.8553 0.7091 0.7275 -0.0466 -0.0834 -0.1546 337 ASP A N     
2462 C CA    . ASP A 311 ? 0.9067 0.7264 0.7467 -0.0585 -0.0756 -0.1574 337 ASP A CA    
2463 C C     . ASP A 311 ? 0.9205 0.7077 0.7553 -0.0453 -0.0625 -0.1561 337 ASP A C     
2464 O O     . ASP A 311 ? 0.9546 0.7042 0.7668 -0.0484 -0.0503 -0.1577 337 ASP A O     
2465 C CB    . ASP A 311 ? 0.9145 0.7480 0.7465 -0.0710 -0.0848 -0.1606 337 ASP A CB    
2466 C CG    . ASP A 311 ? 0.9806 0.7767 0.7731 -0.0880 -0.0764 -0.1641 337 ASP A CG    
2467 O OD1   . ASP A 311 ? 1.0383 0.8235 0.8071 -0.1070 -0.0752 -0.1665 337 ASP A OD1   
2468 O OD2   . ASP A 311 ? 1.0174 0.7936 0.7993 -0.0848 -0.0703 -0.1651 337 ASP A OD2   
2469 N N     . ALA A 312 ? 0.8987 0.7004 0.7545 -0.0309 -0.0642 -0.1537 338 ALA A N     
2470 C CA    . ALA A 312 ? 0.9136 0.6942 0.7707 -0.0185 -0.0510 -0.1531 338 ALA A CA    
2471 C C     . ALA A 312 ? 0.9215 0.6897 0.7903 -0.0053 -0.0436 -0.1481 338 ALA A C     
2472 O O     . ALA A 312 ? 0.9514 0.6904 0.8130 0.0013  -0.0293 -0.1496 338 ALA A O     
2473 C CB    . ALA A 312 ? 0.8886 0.6909 0.7647 -0.0092 -0.0562 -0.1508 338 ALA A CB    
2474 N N     . VAL A 313 ? 0.9004 0.6898 0.7870 -0.0019 -0.0534 -0.1421 339 VAL A N     
2475 C CA    . VAL A 313 ? 0.9070 0.6854 0.8032 0.0077  -0.0511 -0.1346 339 VAL A CA    
2476 C C     . VAL A 313 ? 0.9543 0.6928 0.8228 -0.0002 -0.0440 -0.1361 339 VAL A C     
2477 O O     . VAL A 313 ? 0.9780 0.6896 0.8483 0.0118  -0.0362 -0.1319 339 VAL A O     
2478 C CB    . VAL A 313 ? 0.8769 0.6850 0.7907 0.0070  -0.0639 -0.1285 339 VAL A CB    
2479 C CG1   . VAL A 313 ? 0.8837 0.6762 0.8001 0.0117  -0.0646 -0.1190 339 VAL A CG1   
2480 C CG2   . VAL A 313 ? 0.8356 0.6741 0.7743 0.0168  -0.0694 -0.1263 339 VAL A CG2   
2481 N N     . THR A 314 ? 0.9716 0.7063 0.8150 -0.0204 -0.0473 -0.1417 340 THR A N     
2482 C CA    . THR A 314 ? 1.0230 0.7164 0.8322 -0.0333 -0.0413 -0.1438 340 THR A CA    
2483 C C     . THR A 314 ? 1.0680 0.7186 0.8574 -0.0285 -0.0249 -0.1497 340 THR A C     
2484 O O     . THR A 314 ? 1.1076 0.7156 0.8816 -0.0240 -0.0164 -0.1485 340 THR A O     
2485 C CB    . THR A 314 ? 1.0278 0.7330 0.8146 -0.0596 -0.0487 -0.1489 340 THR A CB    
2486 O OG1   . THR A 314 ? 0.9965 0.7381 0.8015 -0.0635 -0.0602 -0.1452 340 THR A OG1   
2487 C CG2   . THR A 314 ? 1.0725 0.7307 0.8172 -0.0769 -0.0423 -0.1513 340 THR A CG2   
2488 N N     . ASP A 315 ? 1.0679 0.7276 0.8567 -0.0297 -0.0202 -0.1563 341 ASP A N     
2489 C CA    . ASP A 315 ? 1.1140 0.7371 0.8849 -0.0263 -0.0019 -0.1640 341 ASP A CA    
2490 C C     . ASP A 315 ? 1.1198 0.7336 0.9177 0.0006  0.0091  -0.1607 341 ASP A C     
2491 O O     . ASP A 315 ? 1.1674 0.7408 0.9517 0.0075  0.0264  -0.1666 341 ASP A O     
2492 C CB    . ASP A 315 ? 1.1039 0.7425 0.8680 -0.0359 -0.0014 -0.1704 341 ASP A CB    
2493 C CG    . ASP A 315 ? 1.1298 0.7664 0.8608 -0.0640 -0.0094 -0.1745 341 ASP A CG    
2494 O OD1   . ASP A 315 ? 1.1514 0.7781 0.8653 -0.0770 -0.0142 -0.1735 341 ASP A OD1   
2495 O OD2   . ASP A 315 ? 1.1437 0.7893 0.8644 -0.0749 -0.0120 -0.1780 341 ASP A OD2   
2496 N N     . VAL A 316 ? 1.0801 0.7314 0.9165 0.0156  -0.0005 -0.1514 342 VAL A N     
2497 C CA    . VAL A 316 ? 1.0827 0.7349 0.9511 0.0405  0.0061  -0.1454 342 VAL A CA    
2498 C C     . VAL A 316 ? 1.1161 0.7351 0.9813 0.0490  0.0057  -0.1385 342 VAL A C     
2499 O O     . VAL A 316 ? 1.1469 0.7388 1.0200 0.0668  0.0190  -0.1394 342 VAL A O     
2500 C CB    . VAL A 316 ? 1.0326 0.7345 0.9389 0.0497  -0.0065 -0.1362 342 VAL A CB    
2501 C CG1   . VAL A 316 ? 1.0300 0.7377 0.9701 0.0717  -0.0070 -0.1250 342 VAL A CG1   
2502 C CG2   . VAL A 316 ? 1.0108 0.7343 0.9219 0.0475  -0.0018 -0.1426 342 VAL A CG2   
2503 N N     . ILE A 317 ? 1.1159 0.7362 0.9691 0.0359  -0.0092 -0.1319 343 ILE A N     
2504 C CA    . ILE A 317 ? 1.1549 0.7411 0.9989 0.0394  -0.0134 -0.1233 343 ILE A CA    
2505 C C     . ILE A 317 ? 1.2232 0.7490 1.0286 0.0346  0.0009  -0.1319 343 ILE A C     
2506 O O     . ILE A 317 ? 1.2624 0.7499 1.0688 0.0504  0.0055  -0.1272 343 ILE A O     
2507 C CB    . ILE A 317 ? 1.1397 0.7423 0.9739 0.0207  -0.0316 -0.1158 343 ILE A CB    
2508 C CG1   . ILE A 317 ? 1.0883 0.7412 0.9600 0.0286  -0.0441 -0.1066 343 ILE A CG1   
2509 C CG2   . ILE A 317 ? 1.1837 0.7411 0.9951 0.0173  -0.0364 -0.1075 343 ILE A CG2   
2510 C CD1   . ILE A 317 ? 1.0580 0.7387 0.9224 0.0081  -0.0578 -0.1050 343 ILE A CD1   
2511 N N     . ILE A 318 ? 1.2413 0.7575 1.0126 0.0128  0.0071  -0.1441 344 ILE A N     
2512 C CA    . ILE A 318 ? 1.3097 0.7668 1.0382 0.0042  0.0225  -0.1544 344 ILE A CA    
2513 C C     . ILE A 318 ? 1.3427 0.7752 1.0856 0.0292  0.0435  -0.1612 344 ILE A C     
2514 O O     . ILE A 318 ? 1.3934 0.7765 1.1276 0.0427  0.0525  -0.1609 344 ILE A O     
2515 C CB    . ILE A 318 ? 1.3161 0.7735 1.0066 -0.0260 0.0246  -0.1657 344 ILE A CB    
2516 C CG1   . ILE A 318 ? 1.2983 0.7777 0.9741 -0.0513 0.0062  -0.1607 344 ILE A CG1   
2517 C CG2   . ILE A 318 ? 1.3837 0.7759 1.0266 -0.0357 0.0433  -0.1776 344 ILE A CG2   
2518 C CD1   . ILE A 318 ? 1.2881 0.7868 0.9409 -0.0786 0.0031  -0.1688 344 ILE A CD1   
2519 N N     . LYS A 319 ? 1.3196 0.7864 1.0848 0.0354  0.0514  -0.1673 345 LYS A N     
2520 C CA    . LYS A 319 ? 1.3530 0.8041 1.1319 0.0554  0.0746  -0.1769 345 LYS A CA    
2521 C C     . LYS A 319 ? 1.3663 0.8122 1.1855 0.0885  0.0767  -0.1678 345 LYS A C     
2522 O O     . LYS A 319 ? 1.4135 0.8234 1.2346 0.1062  0.0970  -0.1761 345 LYS A O     
2523 C CB    . LYS A 319 ? 1.3150 0.8113 1.1131 0.0538  0.0792  -0.1824 345 LYS A CB    
2524 C CG    . LYS A 319 ? 1.3363 0.8227 1.0909 0.0247  0.0845  -0.1947 345 LYS A CG    
2525 C CD    . LYS A 319 ? 1.3195 0.8454 1.0907 0.0230  0.0875  -0.1984 345 LYS A CD    
2526 C CE    . LYS A 319 ? 1.3336 0.8594 1.0650 -0.0083 0.0820  -0.2045 345 LYS A CE    
2527 N NZ    . LYS A 319 ? 1.3117 0.8761 1.0580 -0.0115 0.0788  -0.2046 345 LYS A NZ    
2528 N N     . ASN A 320 ? 1.3314 0.8129 1.1826 0.0962  0.0554  -0.1508 346 ASN A N     
2529 C CA    . ASN A 320 ? 1.3432 0.8232 1.2331 0.1250  0.0511  -0.1378 346 ASN A CA    
2530 C C     . ASN A 320 ? 1.4009 0.8194 1.2645 0.1280  0.0477  -0.1325 346 ASN A C     
2531 O O     . ASN A 320 ? 1.3972 0.8161 1.2629 0.1257  0.0266  -0.1162 346 ASN A O     
2532 C CB    . ASN A 320 ? 1.2867 0.8236 1.2139 0.1279  0.0287  -0.1209 346 ASN A CB    
2533 C CG    . ASN A 320 ? 1.2505 0.8424 1.2065 0.1294  0.0327  -0.1249 346 ASN A CG    
2534 O OD1   . ASN A 320 ? 1.2739 0.8643 1.2306 0.1332  0.0530  -0.1386 346 ASN A OD1   
2535 N ND2   . ASN A 320 ? 1.2112 0.8491 1.1874 0.1243  0.0138  -0.1134 346 ASN A ND2   
2536 N N     . ASN A 321 ? 1.4612 0.8234 1.2958 0.1309  0.0690  -0.1467 347 ASN A N     
2537 C CA    . ASN A 321 ? 1.5286 0.8206 1.3344 0.1363  0.0693  -0.1438 347 ASN A CA    
2538 C C     . ASN A 321 ? 1.5827 0.8334 1.4004 0.1654  0.0954  -0.1556 347 ASN A C     
2539 O O     . ASN A 321 ? 1.5839 0.8421 1.4029 0.1667  0.1193  -0.1735 347 ASN A O     
2540 C CB    . ASN A 321 ? 1.5614 0.8107 1.2990 0.1000  0.0678  -0.1511 347 ASN A CB    
2541 C CG    . ASN A 321 ? 1.5419 0.8065 1.2650 0.0776  0.0402  -0.1355 347 ASN A CG    
2542 O OD1   . ASN A 321 ? 1.4734 0.7987 1.2154 0.0661  0.0269  -0.1305 347 ASN A OD1   
2543 N ND2   . ASN A 321 ? 1.5897 0.7965 1.2763 0.0700  0.0325  -0.1288 347 ASN A ND2   
2544 N N     . ARG B 6   ? 0.6597 1.2714 1.3831 0.0024  -0.1977 -0.1249 32  ARG B N     
2545 C CA    . ARG B 6   ? 0.6601 1.2734 1.4004 -0.0196 -0.1895 -0.1346 32  ARG B CA    
2546 C C     . ARG B 6   ? 0.6469 1.2320 1.3656 -0.0398 -0.1563 -0.1169 32  ARG B C     
2547 O O     . ARG B 6   ? 0.6543 1.2191 1.3554 -0.0521 -0.1515 -0.1125 32  ARG B O     
2548 C CB    . ARG B 6   ? 0.6622 1.3198 1.4771 -0.0283 -0.1911 -0.1625 32  ARG B CB    
2549 C CG    . ARG B 6   ? 0.6777 1.3385 1.5193 -0.0514 -0.1817 -0.1754 32  ARG B CG    
2550 C CD    . ARG B 6   ? 0.7028 1.4074 1.6233 -0.0623 -0.1766 -0.2027 32  ARG B CD    
2551 N NE    . ARG B 6   ? 0.7013 1.4157 1.6471 -0.0683 -0.1497 -0.1982 32  ARG B NE    
2552 C CZ    . ARG B 6   ? 0.7073 1.4628 1.7187 -0.0700 -0.1473 -0.2203 32  ARG B CZ    
2553 N NH1   . ARG B 6   ? 0.7113 1.5033 1.7713 -0.0651 -0.1721 -0.2485 32  ARG B NH1   
2554 N NH2   . ARG B 6   ? 0.7088 1.4714 1.7381 -0.0763 -0.1204 -0.2159 32  ARG B NH2   
2555 N N     . GLU B 7   ? 0.6306 1.2158 1.3516 -0.0427 -0.1337 -0.1075 33  GLU B N     
2556 C CA    . GLU B 7   ? 0.6174 1.1759 1.3073 -0.0573 -0.1050 -0.0872 33  GLU B CA    
2557 C C     . GLU B 7   ? 0.6060 1.1330 1.2337 -0.0428 -0.1102 -0.0671 33  GLU B C     
2558 O O     . GLU B 7   ? 0.6064 1.1383 1.2290 -0.0261 -0.1182 -0.0668 33  GLU B O     
2559 C CB    . GLU B 7   ? 0.6159 1.1943 1.3384 -0.0685 -0.0773 -0.0894 33  GLU B CB    
2560 C CG    . GLU B 7   ? 0.6290 1.1952 1.3482 -0.0918 -0.0465 -0.0772 33  GLU B CG    
2561 C CD    . GLU B 7   ? 0.6419 1.2347 1.4013 -0.1045 -0.0195 -0.0838 33  GLU B CD    
2562 O OE1   . GLU B 7   ? 0.6359 1.2292 1.3762 -0.1010 -0.0057 -0.0757 33  GLU B OE1   
2563 O OE2   . GLU B 7   ? 0.6513 1.2652 1.4625 -0.1187 -0.0109 -0.0988 33  GLU B OE2   
2564 N N     . VAL B 8   ? 0.5907 1.0853 1.1752 -0.0488 -0.1056 -0.0513 34  VAL B N     
2565 C CA    . VAL B 8   ? 0.5754 1.0398 1.1030 -0.0363 -0.1103 -0.0340 34  VAL B CA    
2566 C C     . VAL B 8   ? 0.5601 1.0046 1.0584 -0.0473 -0.0850 -0.0154 34  VAL B C     
2567 O O     . VAL B 8   ? 0.5571 0.9897 1.0512 -0.0622 -0.0730 -0.0079 34  VAL B O     
2568 C CB    . VAL B 8   ? 0.5834 1.0264 1.0786 -0.0295 -0.1314 -0.0322 34  VAL B CB    
2569 C CG1   . VAL B 8   ? 0.5837 0.9961 1.0237 -0.0176 -0.1332 -0.0150 34  VAL B CG1   
2570 C CG2   . VAL B 8   ? 0.5957 1.0607 1.1137 -0.0169 -0.1590 -0.0501 34  VAL B CG2   
2571 N N     . LYS B 9   ? 0.5418 0.9834 1.0209 -0.0393 -0.0775 -0.0083 35  LYS B N     
2572 C CA    . LYS B 9   ? 0.5275 0.9582 0.9818 -0.0490 -0.0542 0.0064  35  LYS B CA    
2573 C C     . LYS B 9   ? 0.5122 0.9141 0.9148 -0.0396 -0.0576 0.0201  35  LYS B C     
2574 O O     . LYS B 9   ? 0.5065 0.9049 0.8979 -0.0248 -0.0661 0.0181  35  LYS B O     
2575 C CB    . LYS B 9   ? 0.5279 0.9855 1.0093 -0.0538 -0.0353 0.0000  35  LYS B CB    
2576 C CG    . LYS B 9   ? 0.5471 1.0293 1.0761 -0.0696 -0.0231 -0.0096 35  LYS B CG    
2577 C CD    . LYS B 9   ? 0.5674 1.0797 1.1279 -0.0741 -0.0042 -0.0195 35  LYS B CD    
2578 C CE    . LYS B 9   ? 0.5792 1.1174 1.1838 -0.0612 -0.0195 -0.0407 35  LYS B CE    
2579 N NZ    . LYS B 9   ? 0.5684 1.1369 1.2080 -0.0658 0.0001  -0.0528 35  LYS B NZ    
2580 N N     . LEU B 10  ? 0.5002 0.8812 0.8747 -0.0483 -0.0502 0.0341  36  LEU B N     
2581 C CA    . LEU B 10  ? 0.4861 0.8397 0.8149 -0.0410 -0.0538 0.0456  36  LEU B CA    
2582 C C     . LEU B 10  ? 0.4736 0.8245 0.7804 -0.0483 -0.0343 0.0580  36  LEU B C     
2583 O O     . LEU B 10  ? 0.4826 0.8373 0.7948 -0.0616 -0.0206 0.0660  36  LEU B O     
2584 C CB    . LEU B 10  ? 0.4906 0.8214 0.8035 -0.0424 -0.0654 0.0498  36  LEU B CB    
2585 C CG    . LEU B 10  ? 0.5000 0.8346 0.8296 -0.0364 -0.0863 0.0366  36  LEU B CG    
2586 C CD1   . LEU B 10  ? 0.5019 0.8163 0.8183 -0.0415 -0.0929 0.0388  36  LEU B CD1   
2587 C CD2   . LEU B 10  ? 0.4985 0.8305 0.8143 -0.0181 -0.1022 0.0324  36  LEU B CD2   
2588 N N     . LEU B 11  ? 0.4523 0.7971 0.7349 -0.0394 -0.0329 0.0594  37  LEU B N     
2589 C CA    . LEU B 11  ? 0.4411 0.7832 0.6973 -0.0444 -0.0183 0.0696  37  LEU B CA    
2590 C C     . LEU B 11  ? 0.4336 0.7478 0.6537 -0.0396 -0.0252 0.0789  37  LEU B C     
2591 O O     . LEU B 11  ? 0.4277 0.7284 0.6358 -0.0285 -0.0352 0.0747  37  LEU B O     
2592 C CB    . LEU B 11  ? 0.4362 0.7955 0.6951 -0.0398 -0.0089 0.0608  37  LEU B CB    
2593 C CG    . LEU B 11  ? 0.4338 0.7960 0.6650 -0.0435 0.0048  0.0667  37  LEU B CG    
2594 C CD1   . LEU B 11  ? 0.4263 0.8002 0.6535 -0.0577 0.0194  0.0785  37  LEU B CD1   
2595 C CD2   . LEU B 11  ? 0.4091 0.7886 0.6494 -0.0381 0.0125  0.0524  37  LEU B CD2   
2596 N N     . LEU B 12  ? 0.4346 0.7401 0.6394 -0.0480 -0.0191 0.0922  38  LEU B N     
2597 C CA    . LEU B 12  ? 0.4313 0.7144 0.6043 -0.0445 -0.0227 0.1007  38  LEU B CA    
2598 C C     . LEU B 12  ? 0.4246 0.7164 0.5778 -0.0425 -0.0132 0.1015  38  LEU B C     
2599 O O     . LEU B 12  ? 0.4331 0.7454 0.5882 -0.0493 -0.0003 0.1045  38  LEU B O     
2600 C CB    . LEU B 12  ? 0.4418 0.7135 0.6112 -0.0531 -0.0202 0.1148  38  LEU B CB    
2601 C CG    . LEU B 12  ? 0.4487 0.7084 0.6367 -0.0562 -0.0293 0.1125  38  LEU B CG    
2602 C CD1   . LEU B 12  ? 0.4625 0.7186 0.6597 -0.0675 -0.0200 0.1261  38  LEU B CD1   
2603 C CD2   . LEU B 12  ? 0.4748 0.7104 0.6448 -0.0485 -0.0425 0.1094  38  LEU B CD2   
2604 N N     . LEU B 13  ? 0.4060 0.6834 0.5407 -0.0338 -0.0187 0.0975  39  LEU B N     
2605 C CA    . LEU B 13  ? 0.3945 0.6786 0.5110 -0.0322 -0.0110 0.0956  39  LEU B CA    
2606 C C     . LEU B 13  ? 0.3945 0.6560 0.4880 -0.0286 -0.0168 0.1006  39  LEU B C     
2607 O O     . LEU B 13  ? 0.3895 0.6288 0.4810 -0.0249 -0.0264 0.1015  39  LEU B O     
2608 C CB    . LEU B 13  ? 0.3853 0.6774 0.5108 -0.0250 -0.0084 0.0805  39  LEU B CB    
2609 C CG    . LEU B 13  ? 0.4000 0.7175 0.5520 -0.0269 -0.0011 0.0710  39  LEU B CG    
2610 C CD1   . LEU B 13  ? 0.4019 0.7194 0.5634 -0.0173 -0.0003 0.0566  39  LEU B CD1   
2611 C CD2   . LEU B 13  ? 0.3766 0.7211 0.5266 -0.0370 0.0135  0.0730  39  LEU B CD2   
2612 N N     . GLY B 14  ? 0.3869 0.6564 0.4638 -0.0297 -0.0108 0.1022  40  GLY B N     
2613 C CA    . GLY B 14  ? 0.3750 0.6278 0.4342 -0.0258 -0.0149 0.1032  40  GLY B CA    
2614 C C     . GLY B 14  ? 0.3845 0.6533 0.4294 -0.0292 -0.0102 0.1099  40  GLY B C     
2615 O O     . GLY B 14  ? 0.3968 0.6860 0.4421 -0.0349 -0.0041 0.1178  40  GLY B O     
2616 N N     . ALA B 15  ? 0.3695 0.6303 0.4018 -0.0255 -0.0129 0.1072  41  ALA B N     
2617 C CA    . ALA B 15  ? 0.3747 0.6523 0.3933 -0.0266 -0.0117 0.1128  41  ALA B CA    
2618 C C     . ALA B 15  ? 0.3872 0.6645 0.4034 -0.0305 -0.0136 0.1341  41  ALA B C     
2619 O O     . ALA B 15  ? 0.3863 0.6441 0.4131 -0.0323 -0.0169 0.1420  41  ALA B O     
2620 C CB    . ALA B 15  ? 0.3682 0.6336 0.3796 -0.0218 -0.0162 0.1063  41  ALA B CB    
2621 N N     . GLY B 16  ? 0.3956 0.6945 0.3982 -0.0316 -0.0113 0.1434  42  GLY B N     
2622 C CA    . GLY B 16  ? 0.4141 0.7082 0.4130 -0.0331 -0.0135 0.1667  42  GLY B CA    
2623 C C     . GLY B 16  ? 0.4205 0.6853 0.4254 -0.0289 -0.0226 0.1701  42  GLY B C     
2624 O O     . GLY B 16  ? 0.4028 0.6607 0.4055 -0.0240 -0.0271 0.1566  42  GLY B O     
2625 N N     . GLU B 17  ? 0.4300 0.6771 0.4454 -0.0316 -0.0237 0.1863  43  GLU B N     
2626 C CA    . GLU B 17  ? 0.4339 0.6538 0.4578 -0.0286 -0.0309 0.1899  43  GLU B CA    
2627 C C     . GLU B 17  ? 0.4225 0.6208 0.4558 -0.0283 -0.0342 0.1730  43  GLU B C     
2628 O O     . GLU B 17  ? 0.4312 0.6094 0.4683 -0.0255 -0.0391 0.1704  43  GLU B O     
2629 C CB    . GLU B 17  ? 0.4350 0.6597 0.4486 -0.0213 -0.0370 0.1920  43  GLU B CB    
2630 C CG    . GLU B 17  ? 0.4564 0.7068 0.4552 -0.0193 -0.0363 0.2082  43  GLU B CG    
2631 C CD    . GLU B 17  ? 0.4900 0.7318 0.4943 -0.0213 -0.0341 0.2351  43  GLU B CD    
2632 O OE1   . GLU B 17  ? 0.5533 0.8152 0.5444 -0.0233 -0.0285 0.2503  43  GLU B OE1   
2633 O OE2   . GLU B 17  ? 0.4648 0.6795 0.4870 -0.0214 -0.0365 0.2409  43  GLU B OE2   
2634 N N     . SER B 18  ? 0.4192 0.6221 0.4556 -0.0305 -0.0313 0.1616  44  SER B N     
2635 C CA    . SER B 18  ? 0.4066 0.5908 0.4475 -0.0288 -0.0353 0.1476  44  SER B CA    
2636 C C     . SER B 18  ? 0.4131 0.5821 0.4699 -0.0331 -0.0382 0.1508  44  SER B C     
2637 O O     . SER B 18  ? 0.4134 0.5650 0.4715 -0.0313 -0.0434 0.1411  44  SER B O     
2638 C CB    . SER B 18  ? 0.3962 0.5916 0.4347 -0.0268 -0.0324 0.1338  44  SER B CB    
2639 O OG    . SER B 18  ? 0.4004 0.6136 0.4491 -0.0313 -0.0277 0.1363  44  SER B OG    
2640 N N     . GLY B 19  ? 0.4201 0.5962 0.4893 -0.0392 -0.0342 0.1634  45  GLY B N     
2641 C CA    . GLY B 19  ? 0.4254 0.5880 0.5150 -0.0446 -0.0360 0.1645  45  GLY B CA    
2642 C C     . GLY B 19  ? 0.4265 0.6021 0.5344 -0.0513 -0.0317 0.1636  45  GLY B C     
2643 O O     . GLY B 19  ? 0.4287 0.5957 0.5575 -0.0568 -0.0329 0.1621  45  GLY B O     
2644 N N     . LYS B 20  ? 0.4257 0.6235 0.5287 -0.0515 -0.0259 0.1625  46  LYS B N     
2645 C CA    . LYS B 20  ? 0.4275 0.6417 0.5502 -0.0579 -0.0202 0.1598  46  LYS B CA    
2646 C C     . LYS B 20  ? 0.4452 0.6570 0.5890 -0.0677 -0.0126 0.1728  46  LYS B C     
2647 O O     . LYS B 20  ? 0.4468 0.6577 0.6163 -0.0731 -0.0136 0.1650  46  LYS B O     
2648 C CB    . LYS B 20  ? 0.4197 0.6594 0.5330 -0.0572 -0.0122 0.1578  46  LYS B CB    
2649 C CG    . LYS B 20  ? 0.3903 0.6315 0.4867 -0.0481 -0.0170 0.1448  46  LYS B CG    
2650 C CD    . LYS B 20  ? 0.3877 0.6555 0.4797 -0.0484 -0.0078 0.1396  46  LYS B CD    
2651 C CE    . LYS B 20  ? 0.3760 0.6580 0.4493 -0.0510 -0.0001 0.1523  46  LYS B CE    
2652 N NZ    . LYS B 20  ? 0.3751 0.6496 0.4279 -0.0441 -0.0060 0.1505  46  LYS B NZ    
2653 N N     . SER B 21  ? 0.4602 0.6711 0.5948 -0.0698 -0.0050 0.1925  47  SER B N     
2654 C CA    . SER B 21  ? 0.4833 0.6886 0.6380 -0.0791 0.0048  0.2086  47  SER B CA    
2655 C C     . SER B 21  ? 0.4822 0.6636 0.6604 -0.0817 -0.0008 0.2039  47  SER B C     
2656 O O     . SER B 21  ? 0.4975 0.6760 0.7047 -0.0910 0.0057  0.2046  47  SER B O     
2657 C CB    . SER B 21  ? 0.5027 0.7071 0.6394 -0.0779 0.0117  0.2338  47  SER B CB    
2658 O OG    . SER B 21  ? 0.5318 0.7618 0.6456 -0.0766 0.0179  0.2374  47  SER B OG    
2659 N N     . THR B 22  ? 0.4788 0.6437 0.6456 -0.0743 -0.0117 0.1981  48  THR B N     
2660 C CA    . THR B 22  ? 0.4808 0.6235 0.6672 -0.0764 -0.0171 0.1912  48  THR B CA    
2661 C C     . THR B 22  ? 0.4737 0.6218 0.6791 -0.0803 -0.0227 0.1695  48  THR B C     
2662 O O     . THR B 22  ? 0.4848 0.6241 0.7187 -0.0876 -0.0218 0.1640  48  THR B O     
2663 C CB    . THR B 22  ? 0.4745 0.6011 0.6425 -0.0675 -0.0265 0.1871  48  THR B CB    
2664 O OG1   . THR B 22  ? 0.4778 0.6037 0.6308 -0.0630 -0.0229 0.2065  48  THR B OG1   
2665 C CG2   . THR B 22  ? 0.4732 0.5774 0.6624 -0.0705 -0.0302 0.1788  48  THR B CG2   
2666 N N     . ILE B 23  ? 0.4648 0.6276 0.6561 -0.0748 -0.0289 0.1569  49  ILE B N     
2667 C CA    . ILE B 23  ? 0.4662 0.6371 0.6731 -0.0756 -0.0371 0.1370  49  ILE B CA    
2668 C C     . ILE B 23  ? 0.4824 0.6679 0.7235 -0.0863 -0.0285 0.1365  49  ILE B C     
2669 O O     . ILE B 23  ? 0.4943 0.6788 0.7629 -0.0920 -0.0325 0.1237  49  ILE B O     
2670 C CB    . ILE B 23  ? 0.4528 0.6359 0.6392 -0.0659 -0.0443 0.1269  49  ILE B CB    
2671 C CG1   . ILE B 23  ? 0.4324 0.5984 0.5899 -0.0566 -0.0525 0.1235  49  ILE B CG1   
2672 C CG2   . ILE B 23  ? 0.4457 0.6432 0.6522 -0.0658 -0.0525 0.1098  49  ILE B CG2   
2673 C CD1   . ILE B 23  ? 0.4224 0.5719 0.5830 -0.0562 -0.0625 0.1118  49  ILE B CD1   
2674 N N     . VAL B 24  ? 0.4954 0.6955 0.7353 -0.0898 -0.0157 0.1494  50  VAL B N     
2675 C CA    . VAL B 24  ? 0.5109 0.7250 0.7829 -0.1013 -0.0033 0.1511  50  VAL B CA    
2676 C C     . VAL B 24  ? 0.5365 0.7331 0.8374 -0.1113 0.0027  0.1563  50  VAL B C     
2677 O O     . VAL B 24  ? 0.5359 0.7386 0.8731 -0.1198 0.0037  0.1427  50  VAL B O     
2678 C CB    . VAL B 24  ? 0.5174 0.7470 0.7763 -0.1039 0.0123  0.1679  50  VAL B CB    
2679 C CG1   . VAL B 24  ? 0.5312 0.7701 0.8225 -0.1177 0.0295  0.1741  50  VAL B CG1   
2680 C CG2   . VAL B 24  ? 0.4935 0.7442 0.7358 -0.0962 0.0082  0.1568  50  VAL B CG2   
2681 N N     . LYS B 25  ? 0.5576 0.7329 0.8455 -0.1100 0.0064  0.1744  51  LYS B N     
2682 C CA    . LYS B 25  ? 0.5858 0.7409 0.9030 -0.1188 0.0142  0.1819  51  LYS B CA    
2683 C C     . LYS B 25  ? 0.5874 0.7329 0.9271 -0.1203 0.0023  0.1578  51  LYS B C     
2684 O O     . LYS B 25  ? 0.5946 0.7342 0.9734 -0.1311 0.0087  0.1516  51  LYS B O     
2685 C CB    . LYS B 25  ? 0.5989 0.7333 0.8973 -0.1140 0.0183  0.2066  51  LYS B CB    
2686 C CG    . LYS B 25  ? 0.6155 0.7596 0.8913 -0.1130 0.0306  0.2329  51  LYS B CG    
2687 C CD    . LYS B 25  ? 0.6421 0.7640 0.9177 -0.1121 0.0381  0.2601  51  LYS B CD    
2688 C CE    . LYS B 25  ? 0.6640 0.7948 0.8987 -0.1027 0.0384  0.2818  51  LYS B CE    
2689 N NZ    . LYS B 25  ? 0.6547 0.7733 0.8708 -0.0906 0.0239  0.2802  51  LYS B NZ    
2690 N N     . GLN B 26  ? 0.5789 0.7236 0.8940 -0.1101 -0.0140 0.1435  52  GLN B N     
2691 C CA    . GLN B 26  ? 0.5857 0.7249 0.9143 -0.1106 -0.0266 0.1193  52  GLN B CA    
2692 C C     . GLN B 26  ? 0.5928 0.7543 0.9508 -0.1166 -0.0308 0.0984  52  GLN B C     
2693 O O     . GLN B 26  ? 0.6043 0.7639 0.9921 -0.1234 -0.0346 0.0805  52  GLN B O     
2694 C CB    . GLN B 26  ? 0.5763 0.7096 0.8675 -0.0981 -0.0411 0.1113  52  GLN B CB    
2695 C CG    . GLN B 26  ? 0.5757 0.6859 0.8482 -0.0934 -0.0388 0.1246  52  GLN B CG    
2696 C CD    . GLN B 26  ? 0.5826 0.6728 0.8772 -0.0983 -0.0394 0.1150  52  GLN B CD    
2697 O OE1   . GLN B 26  ? 0.5856 0.6767 0.9165 -0.1083 -0.0362 0.1047  52  GLN B OE1   
2698 N NE2   . GLN B 26  ? 0.5712 0.6442 0.8469 -0.0917 -0.0428 0.1161  52  GLN B NE2   
2699 N N     . MET B 27  ? 0.5903 0.7746 0.9432 -0.1142 -0.0301 0.0989  53  MET B N     
2700 C CA    . MET B 27  ? 0.5965 0.8056 0.9834 -0.1199 -0.0327 0.0802  53  MET B CA    
2701 C C     . MET B 27  ? 0.6125 0.8211 1.0473 -0.1361 -0.0176 0.0798  53  MET B C     
2702 O O     . MET B 27  ? 0.6151 0.8362 1.0865 -0.1428 -0.0229 0.0573  53  MET B O     
2703 C CB    . MET B 27  ? 0.5878 0.8207 0.9656 -0.1152 -0.0306 0.0830  53  MET B CB    
2704 C CG    . MET B 27  ? 0.5815 0.8168 0.9202 -0.0995 -0.0450 0.0799  53  MET B CG    
2705 S SD    . MET B 27  ? 0.6075 0.8433 0.9413 -0.0903 -0.0698 0.0557  53  MET B SD    
2706 C CE    . MET B 27  ? 0.5847 0.7877 0.8811 -0.0852 -0.0731 0.0639  53  MET B CE    
2707 N N     . LYS B 28  ? 0.6299 0.8247 1.0648 -0.1422 0.0013  0.1048  54  LYS B N     
2708 C CA    . LYS B 28  ? 0.6526 0.8405 1.1313 -0.1578 0.0197  0.1101  54  LYS B CA    
2709 C C     . LYS B 28  ? 0.6625 0.8293 1.1659 -0.1627 0.0157  0.0977  54  LYS B C     
2710 O O     . LYS B 28  ? 0.6735 0.8422 1.2249 -0.1756 0.0232  0.0842  54  LYS B O     
2711 C CB    . LYS B 28  ? 0.6685 0.8445 1.1328 -0.1605 0.0402  0.1444  54  LYS B CB    
2712 C CG    . LYS B 28  ? 0.7121 0.8796 1.2197 -0.1768 0.0635  0.1552  54  LYS B CG    
2713 C CD    . LYS B 28  ? 0.7479 0.9097 1.2351 -0.1786 0.0841  0.1909  54  LYS B CD    
2714 C CE    . LYS B 28  ? 0.7972 0.9477 1.3288 -0.1953 0.1093  0.2029  54  LYS B CE    
2715 N NZ    . LYS B 28  ? 0.8345 0.9792 1.3438 -0.1972 0.1306  0.2402  54  LYS B NZ    
2716 N N     . ILE B 29  ? 0.6620 0.8100 1.1352 -0.1528 0.0047  0.1000  55  ILE B N     
2717 C CA    . ILE B 29  ? 0.6746 0.8023 1.1687 -0.1566 0.0015  0.0871  55  ILE B CA    
2718 C C     . ILE B 29  ? 0.6718 0.8160 1.1797 -0.1571 -0.0162 0.0508  55  ILE B C     
2719 O O     . ILE B 29  ? 0.6835 0.8259 1.2334 -0.1679 -0.0141 0.0313  55  ILE B O     
2720 C CB    . ILE B 29  ? 0.6716 0.7740 1.1306 -0.1461 -0.0025 0.1013  55  ILE B CB    
2721 C CG1   . ILE B 29  ? 0.6823 0.7685 1.1335 -0.1457 0.0140  0.1370  55  ILE B CG1   
2722 C CG2   . ILE B 29  ? 0.6777 0.7620 1.1582 -0.1495 -0.0069 0.0823  55  ILE B CG2   
2723 C CD1   . ILE B 29  ? 0.6756 0.7468 1.0854 -0.1323 0.0078  0.1527  55  ILE B CD1   
2724 N N     . ILE B 30  ? 0.6614 0.8222 1.1343 -0.1453 -0.0338 0.0416  56  ILE B N     
2725 C CA    . ILE B 30  ? 0.6637 0.8410 1.1408 -0.1427 -0.0533 0.0101  56  ILE B CA    
2726 C C     . ILE B 30  ? 0.6696 0.8769 1.1894 -0.1511 -0.0549 -0.0095 56  ILE B C     
2727 O O     . ILE B 30  ? 0.6786 0.8950 1.2322 -0.1587 -0.0612 -0.0362 56  ILE B O     
2728 C CB    . ILE B 30  ? 0.6496 0.8319 1.0742 -0.1261 -0.0711 0.0091  56  ILE B CB    
2729 C CG1   . ILE B 30  ? 0.6505 0.8044 1.0384 -0.1192 -0.0692 0.0238  56  ILE B CG1   
2730 C CG2   . ILE B 30  ? 0.6519 0.8523 1.0773 -0.1224 -0.0921 -0.0210 56  ILE B CG2   
2731 C CD1   . ILE B 30  ? 0.6206 0.7748 0.9578 -0.1043 -0.0780 0.0331  56  ILE B CD1   
2732 N N     . HIS B 31  ? 0.9983 0.9826 1.0165 -0.0987 -0.0290 -0.0273 57  HIS B N     
2733 C CA    . HIS B 31  ? 1.0029 1.0047 1.0227 -0.1025 -0.0337 -0.0209 57  HIS B CA    
2734 C C     . HIS B 31  ? 1.0092 1.0181 1.0374 -0.1011 -0.0313 -0.0146 57  HIS B C     
2735 O O     . HIS B 31  ? 1.0120 1.0364 1.0427 -0.1061 -0.0344 -0.0086 57  HIS B O     
2736 C CB    . HIS B 31  ? 0.9931 1.0057 1.0133 -0.0936 -0.0419 -0.0154 57  HIS B CB    
2737 C CG    . HIS B 31  ? 0.9917 1.0037 1.0075 -0.0987 -0.0463 -0.0167 57  HIS B CG    
2738 N ND1   . HIS B 31  ? 0.9921 0.9966 1.0105 -0.0901 -0.0502 -0.0160 57  HIS B ND1   
2739 C CD2   . HIS B 31  ? 1.0004 1.0211 1.0105 -0.1119 -0.0477 -0.0172 57  HIS B CD2   
2740 C CE1   . HIS B 31  ? 0.9929 1.0028 1.0090 -0.0982 -0.0538 -0.0139 57  HIS B CE1   
2741 N NE2   . HIS B 31  ? 0.9999 1.0209 1.0098 -0.1111 -0.0519 -0.0149 57  HIS B NE2   
2742 N N     . GLU B 32  ? 1.0159 1.0158 1.0498 -0.0948 -0.0260 -0.0141 58  GLU B N     
2743 C CA    . GLU B 32  ? 1.0213 1.0309 1.0661 -0.0942 -0.0237 -0.0049 58  GLU B CA    
2744 C C     . GLU B 32  ? 1.0374 1.0310 1.0903 -0.1042 -0.0189 -0.0081 58  GLU B C     
2745 O O     . GLU B 32  ? 1.0452 1.0244 1.0939 -0.1142 -0.0185 -0.0192 58  GLU B O     
2746 C CB    . GLU B 32  ? 1.0106 1.0306 1.0586 -0.0765 -0.0229 0.0016  58  GLU B CB    
2747 C CG    . GLU B 32  ? 1.0004 1.0368 1.0437 -0.0642 -0.0295 0.0029  58  GLU B CG    
2748 C CD    . GLU B 32  ? 0.9964 1.0376 1.0403 -0.0447 -0.0301 0.0026  58  GLU B CD    
2749 O OE1   . GLU B 32  ? 0.9995 1.0461 1.0491 -0.0398 -0.0248 0.0081  58  GLU B OE1   
2750 O OE2   . GLU B 32  ? 0.9876 1.0279 1.0277 -0.0343 -0.0369 -0.0028 58  GLU B OE2   
2751 N N     . ALA B 33  ? 1.0466 1.0448 1.1123 -0.1005 -0.0160 0.0016  59  ALA B N     
2752 C CA    . ALA B 33  ? 1.0674 1.0524 1.1475 -0.1104 -0.0137 0.0021  59  ALA B CA    
2753 C C     . ALA B 33  ? 1.0755 1.0379 1.1565 -0.1065 -0.0087 -0.0061 59  ALA B C     
2754 O O     . ALA B 33  ? 1.0861 1.0365 1.1821 -0.1122 -0.0071 -0.0051 59  ALA B O     
2755 C CB    . ALA B 33  ? 1.0664 1.0709 1.1645 -0.1100 -0.0139 0.0209  59  ALA B CB    
2756 N N     . GLY B 34  ? 1.0765 1.0328 1.1435 -0.0971 -0.0072 -0.0137 60  GLY B N     
2757 C CA    . GLY B 34  ? 1.0831 1.0209 1.1506 -0.0918 -0.0023 -0.0199 60  GLY B CA    
2758 C C     . GLY B 34  ? 1.0850 1.0265 1.1661 -0.0843 0.0009  -0.0081 60  GLY B C     
2759 O O     . GLY B 34  ? 1.0753 1.0381 1.1582 -0.0755 -0.0001 0.0036  60  GLY B O     
2760 N N     . TYR B 35  ? 1.0970 1.0203 1.1884 -0.0872 0.0046  -0.0113 61  TYR B N     
2761 C CA    . TYR B 35  ? 1.0996 1.0264 1.2069 -0.0819 0.0076  0.0015  61  TYR B CA    
2762 C C     . TYR B 35  ? 1.1160 1.0305 1.2455 -0.0942 0.0070  0.0040  61  TYR B C     
2763 O O     . TYR B 35  ? 1.1281 1.0201 1.2592 -0.1012 0.0070  -0.0106 61  TYR B O     
2764 C CB    . TYR B 35  ? 1.0919 1.0087 1.1938 -0.0702 0.0119  -0.0022 61  TYR B CB    
2765 C CG    . TYR B 35  ? 1.0748 1.0046 1.1610 -0.0564 0.0101  -0.0024 61  TYR B CG    
2766 C CD1   . TYR B 35  ? 1.0597 1.0137 1.1480 -0.0447 0.0092  0.0096  61  TYR B CD1   
2767 C CD2   . TYR B 35  ? 1.0690 0.9888 1.1401 -0.0546 0.0081  -0.0146 61  TYR B CD2   
2768 C CE1   . TYR B 35  ? 1.0445 1.0093 1.1203 -0.0305 0.0055  0.0062  61  TYR B CE1   
2769 C CE2   . TYR B 35  ? 1.0540 0.9832 1.1152 -0.0421 0.0038  -0.0150 61  TYR B CE2   
2770 C CZ    . TYR B 35  ? 1.0482 0.9982 1.1118 -0.0297 0.0020  -0.0062 61  TYR B CZ    
2771 O OH    . TYR B 35  ? 1.0379 0.9960 1.0933 -0.0160 -0.0041 -0.0097 61  TYR B OH    
2772 N N     . SER B 36  ? 1.1197 1.0511 1.2682 -0.0961 0.0055  0.0229  62  SER B N     
2773 C CA    . SER B 36  ? 1.1367 1.0580 1.3132 -0.1078 0.0026  0.0297  62  SER B CA    
2774 C C     . SER B 36  ? 1.1424 1.0464 1.3319 -0.1038 0.0065  0.0301  62  SER B C     
2775 O O     . SER B 36  ? 1.1339 1.0359 1.3094 -0.0920 0.0118  0.0258  62  SER B O     
2776 C CB    . SER B 36  ? 1.1343 1.0843 1.3295 -0.1111 -0.0006 0.0546  62  SER B CB    
2777 O OG    . SER B 36  ? 1.1188 1.0948 1.3122 -0.0974 0.0037  0.0707  62  SER B OG    
2778 N N     . GLU B 37  ? 1.1588 1.0502 1.3775 -0.1136 0.0026  0.0356  63  GLU B N     
2779 C CA    . GLU B 37  ? 1.1654 1.0411 1.4021 -0.1107 0.0052  0.0386  63  GLU B CA    
2780 C C     . GLU B 37  ? 1.1512 1.0528 1.3924 -0.0999 0.0097  0.0619  63  GLU B C     
2781 O O     . GLU B 37  ? 1.1458 1.0412 1.3812 -0.0900 0.0152  0.0594  63  GLU B O     
2782 C CB    . GLU B 37  ? 1.1854 1.0429 1.4576 -0.1242 -0.0025 0.0411  63  GLU B CB    
2783 C CG    . GLU B 37  ? 1.2033 1.0337 1.4924 -0.1223 -0.0012 0.0333  63  GLU B CG    
2784 C CD    . GLU B 37  ? 1.2377 1.0464 1.5651 -0.1352 -0.0116 0.0322  63  GLU B CD    
2785 O OE1   . GLU B 37  ? 1.2478 1.0680 1.5985 -0.1457 -0.0200 0.0492  63  GLU B OE1   
2786 O OE2   . GLU B 37  ? 1.2466 1.0272 1.5828 -0.1343 -0.0123 0.0144  63  GLU B OE2   
2787 N N     . GLU B 38  ? 1.1453 1.0788 1.3960 -0.1011 0.0074  0.0841  64  GLU B N     
2788 C CA    . GLU B 38  ? 1.1338 1.1001 1.3906 -0.0907 0.0110  0.1080  64  GLU B CA    
2789 C C     . GLU B 38  ? 1.1152 1.1000 1.3402 -0.0734 0.0163  0.1019  64  GLU B C     
2790 O O     . GLU B 38  ? 1.1097 1.1101 1.3342 -0.0617 0.0202  0.1114  64  GLU B O     
2791 C CB    . GLU B 38  ? 1.1357 1.1357 1.4164 -0.0975 0.0065  0.1362  64  GLU B CB    
2792 C CG    . GLU B 38  ? 1.1439 1.1551 1.4157 -0.1041 0.0021  0.1335  64  GLU B CG    
2793 C CD    . GLU B 38  ? 1.1736 1.1587 1.4669 -0.1229 -0.0063 0.1280  64  GLU B CD    
2794 O OE1   . GLU B 38  ? 1.1824 1.1301 1.4698 -0.1270 -0.0073 0.1032  64  GLU B OE1   
2795 O OE2   . GLU B 38  ? 1.1820 1.1862 1.4989 -0.1330 -0.0126 0.1482  64  GLU B OE2   
2796 N N     . GLU B 39  ? 1.1073 1.0910 1.3076 -0.0717 0.0152  0.0862  65  GLU B N     
2797 C CA    . GLU B 39  ? 1.0910 1.0865 1.2637 -0.0557 0.0175  0.0772  65  GLU B CA    
2798 C C     . GLU B 39  ? 1.0821 1.0537 1.2458 -0.0484 0.0212  0.0639  65  GLU B C     
2799 O O     . GLU B 39  ? 1.0732 1.0585 1.2277 -0.0340 0.0231  0.0660  65  GLU B O     
2800 C CB    . GLU B 39  ? 1.0917 1.0851 1.2441 -0.0574 0.0142  0.0626  65  GLU B CB    
2801 C CG    . GLU B 39  ? 1.0960 1.1230 1.2498 -0.0574 0.0111  0.0757  65  GLU B CG    
2802 C CD    . GLU B 39  ? 1.1052 1.1270 1.2422 -0.0614 0.0073  0.0619  65  GLU B CD    
2803 O OE1   . GLU B 39  ? 1.1184 1.1113 1.2518 -0.0723 0.0061  0.0470  65  GLU B OE1   
2804 O OE2   . GLU B 39  ? 1.0970 1.1458 1.2247 -0.0532 0.0053  0.0658  65  GLU B OE2   
2805 N N     . CYS B 40  ? 1.0834 1.0209 1.2503 -0.0579 0.0216  0.0499  66  CYS B N     
2806 C CA    . CYS B 40  ? 1.0773 0.9917 1.2394 -0.0528 0.0254  0.0386  66  CYS B CA    
2807 C C     . CYS B 40  ? 1.0721 0.9945 1.2502 -0.0461 0.0286  0.0540  66  CYS B C     
2808 O O     . CYS B 40  ? 1.0642 0.9827 1.2328 -0.0356 0.0314  0.0496  66  CYS B O     
2809 C CB    . CYS B 40  ? 1.0908 0.9730 1.2586 -0.0643 0.0253  0.0229  66  CYS B CB    
2810 S SG    . CYS B 40  ? 1.0984 0.9715 1.2446 -0.0712 0.0223  0.0024  66  CYS B SG    
2811 N N     . LYS B 41  ? 1.0731 1.0083 1.2770 -0.0528 0.0274  0.0736  67  LYS B N     
2812 C CA    . LYS B 41  ? 1.0671 1.0138 1.2905 -0.0482 0.0299  0.0924  67  LYS B CA    
2813 C C     . LYS B 41  ? 1.0487 1.0296 1.2579 -0.0316 0.0321  0.1016  67  LYS B C     
2814 O O     . LYS B 41  ? 1.0462 1.0332 1.2617 -0.0240 0.0350  0.1100  67  LYS B O     
2815 C CB    . LYS B 41  ? 1.0790 1.0367 1.3368 -0.0600 0.0264  0.1152  67  LYS B CB    
2816 C CG    . LYS B 41  ? 1.1019 1.0233 1.3834 -0.0747 0.0227  0.1075  67  LYS B CG    
2817 C CD    . LYS B 41  ? 1.1291 1.0635 1.4485 -0.0868 0.0164  0.1326  67  LYS B CD    
2818 C CE    . LYS B 41  ? 1.1561 1.0541 1.4992 -0.1018 0.0092  0.1209  67  LYS B CE    
2819 N NZ    . LYS B 41  ? 1.1641 1.0503 1.4883 -0.1081 0.0059  0.0996  67  LYS B NZ    
2820 N N     . GLN B 42  ? 1.0349 1.0390 1.2259 -0.0252 0.0300  0.0992  68  GLN B N     
2821 C CA    . GLN B 42  ? 1.0200 1.0568 1.1951 -0.0070 0.0304  0.1024  68  GLN B CA    
2822 C C     . GLN B 42  ? 1.0065 1.0234 1.1624 0.0038  0.0308  0.0835  68  GLN B C     
2823 O O     . GLN B 42  ? 1.0010 1.0368 1.1516 0.0180  0.0312  0.0869  68  GLN B O     
2824 C CB    . GLN B 42  ? 1.0186 1.0823 1.1799 -0.0021 0.0269  0.1012  68  GLN B CB    
2825 C CG    . GLN B 42  ? 1.0359 1.1322 1.2160 -0.0092 0.0263  0.1245  68  GLN B CG    
2826 C CD    . GLN B 42  ? 1.0527 1.1762 1.2189 -0.0035 0.0231  0.1224  68  GLN B CD    
2827 O OE1   . GLN B 42  ? 1.0630 1.1702 1.2088 -0.0005 0.0203  0.1019  68  GLN B OE1   
2828 N NE2   . GLN B 42  ? 1.0524 1.2194 1.2313 -0.0023 0.0232  0.1453  68  GLN B NE2   
2829 N N     . TYR B 43  ? 0.9981 0.9793 1.1447 -0.0030 0.0301  0.0645  69  TYR B N     
2830 C CA    . TYR B 43  ? 0.9831 0.9450 1.1132 0.0052  0.0293  0.0478  69  TYR B CA    
2831 C C     . TYR B 43  ? 0.9761 0.9186 1.1164 0.0049  0.0336  0.0489  69  TYR B C     
2832 O O     . TYR B 43  ? 0.9712 0.9034 1.1010 0.0133  0.0328  0.0395  69  TYR B O     
2833 C CB    . TYR B 43  ? 0.9842 0.9224 1.1009 -0.0017 0.0267  0.0299  69  TYR B CB    
2834 C CG    . TYR B 43  ? 0.9828 0.9390 1.0874 0.0010  0.0214  0.0270  69  TYR B CG    
2835 C CD1   . TYR B 43  ? 0.9819 0.9495 1.0718 0.0154  0.0157  0.0196  69  TYR B CD1   
2836 C CD2   . TYR B 43  ? 0.9873 0.9490 1.0971 -0.0104 0.0209  0.0311  69  TYR B CD2   
2837 C CE1   . TYR B 43  ? 0.9790 0.9630 1.0599 0.0190  0.0101  0.0164  69  TYR B CE1   
2838 C CE2   . TYR B 43  ? 0.9845 0.9637 1.0841 -0.0076 0.0162  0.0292  69  TYR B CE2   
2839 C CZ    . TYR B 43  ? 0.9823 0.9727 1.0676 0.0073  0.0111  0.0218  69  TYR B CZ    
2840 O OH    . TYR B 43  ? 0.9875 0.9949 1.0648 0.0108  0.0057  0.0195  69  TYR B OH    
2841 N N     . LYS B 44  ? 0.9692 0.9067 1.1322 -0.0048 0.0370  0.0610  70  LYS B N     
2842 C CA    . LYS B 44  ? 0.9597 0.8805 1.1368 -0.0053 0.0409  0.0643  70  LYS B CA    
2843 C C     . LYS B 44  ? 0.9433 0.8807 1.1130 0.0099  0.0412  0.0687  70  LYS B C     
2844 O O     . LYS B 44  ? 0.9418 0.8602 1.1066 0.0139  0.0425  0.0597  70  LYS B O     
2845 C CB    . LYS B 44  ? 0.9679 0.8917 1.1755 -0.0156 0.0420  0.0827  70  LYS B CB    
2846 C CG    . LYS B 44  ? 0.9755 0.8751 1.2025 -0.0191 0.0451  0.0838  70  LYS B CG    
2847 C CD    . LYS B 44  ? 0.9944 0.8857 1.2542 -0.0328 0.0432  0.0957  70  LYS B CD    
2848 C CE    . LYS B 44  ? 1.0015 0.8710 1.2845 -0.0346 0.0453  0.0983  70  LYS B CE    
2849 N NZ    . LYS B 44  ? 1.0181 0.8701 1.3346 -0.0483 0.0409  0.1032  70  LYS B NZ    
2850 N N     . ALA B 45  ? 0.9273 0.9028 1.0958 0.0190  0.0396  0.0820  71  ALA B N     
2851 C CA    . ALA B 45  ? 0.9109 0.9089 1.0718 0.0352  0.0387  0.0856  71  ALA B CA    
2852 C C     . ALA B 45  ? 0.8988 0.8839 1.0367 0.0459  0.0340  0.0646  71  ALA B C     
2853 O O     . ALA B 45  ? 0.8986 0.8802 1.0341 0.0544  0.0334  0.0621  71  ALA B O     
2854 C CB    . ALA B 45  ? 0.9090 0.9561 1.0709 0.0440  0.0374  0.1016  71  ALA B CB    
2855 N N     . VAL B 46  ? 0.8848 0.8634 1.0084 0.0449  0.0296  0.0510  72  VAL B N     
2856 C CA    . VAL B 46  ? 0.8689 0.8355 0.9751 0.0541  0.0228  0.0331  72  VAL B CA    
2857 C C     . VAL B 46  ? 0.8586 0.7866 0.9650 0.0457  0.0245  0.0229  72  VAL B C     
2858 O O     . VAL B 46  ? 0.8505 0.7685 0.9501 0.0532  0.0200  0.0143  72  VAL B O     
2859 C CB    . VAL B 46  ? 0.8679 0.8473 0.9604 0.0589  0.0156  0.0239  72  VAL B CB    
2860 C CG1   . VAL B 46  ? 0.8662 0.8265 0.9584 0.0435  0.0170  0.0194  72  VAL B CG1   
2861 C CG2   . VAL B 46  ? 0.8739 0.8488 0.9539 0.0722  0.0058  0.0087  72  VAL B CG2   
2862 N N     . VAL B 47  ? 0.8530 0.7619 0.9688 0.0309  0.0304  0.0242  73  VAL B N     
2863 C CA    . VAL B 47  ? 0.8494 0.7274 0.9672 0.0238  0.0337  0.0157  73  VAL B CA    
2864 C C     . VAL B 47  ? 0.8481 0.7220 0.9731 0.0306  0.0361  0.0206  73  VAL B C     
2865 O O     . VAL B 47  ? 0.8423 0.7007 0.9622 0.0334  0.0346  0.0127  73  VAL B O     
2866 C CB    . VAL B 47  ? 0.8575 0.7194 0.9869 0.0088  0.0392  0.0154  73  VAL B CB    
2867 C CG1   . VAL B 47  ? 0.8538 0.6895 0.9885 0.0046  0.0438  0.0079  73  VAL B CG1   
2868 C CG2   . VAL B 47  ? 0.8520 0.7135 0.9717 0.0014  0.0363  0.0072  73  VAL B CG2   
2869 N N     . TYR B 48  ? 0.8476 0.7384 0.9859 0.0330  0.0392  0.0356  74  TYR B N     
2870 C CA    . TYR B 48  ? 0.8446 0.7356 0.9915 0.0393  0.0415  0.0429  74  TYR B CA    
2871 C C     . TYR B 48  ? 0.8430 0.7483 0.9763 0.0545  0.0347  0.0385  74  TYR B C     
2872 O O     . TYR B 48  ? 0.8445 0.7370 0.9772 0.0587  0.0337  0.0347  74  TYR B O     
2873 C CB    . TYR B 48  ? 0.8453 0.7539 1.0129 0.0369  0.0459  0.0629  74  TYR B CB    
2874 C CG    . TYR B 48  ? 0.8367 0.7248 1.0243 0.0222  0.0508  0.0665  74  TYR B CG    
2875 C CD1   . TYR B 48  ? 0.8235 0.6786 1.0106 0.0152  0.0531  0.0516  74  TYR B CD1   
2876 C CD2   . TYR B 48  ? 0.8279 0.7315 1.0369 0.0159  0.0520  0.0848  74  TYR B CD2   
2877 C CE1   . TYR B 48  ? 0.8295 0.6660 1.0353 0.0037  0.0559  0.0511  74  TYR B CE1   
2878 C CE2   . TYR B 48  ? 0.8273 0.7095 1.0583 0.0027  0.0538  0.0864  74  TYR B CE2   
2879 C CZ    . TYR B 48  ? 0.8314 0.6793 1.0600 -0.0025 0.0555  0.0677  74  TYR B CZ    
2880 O OH    . TYR B 48  ? 0.8292 0.6560 1.0794 -0.0137 0.0559  0.0655  74  TYR B OH    
2881 N N     . SER B 49  ? 0.8443 0.7759 0.9673 0.0630  0.0290  0.0379  75  SER B N     
2882 C CA    . SER B 49  ? 0.8487 0.7938 0.9589 0.0790  0.0199  0.0296  75  SER B CA    
2883 C C     . SER B 49  ? 0.8526 0.7712 0.9535 0.0793  0.0126  0.0132  75  SER B C     
2884 O O     . SER B 49  ? 0.8508 0.7657 0.9495 0.0883  0.0064  0.0082  75  SER B O     
2885 C CB    . SER B 49  ? 0.8480 0.8278 0.9496 0.0891  0.0148  0.0298  75  SER B CB    
2886 O OG    . SER B 49  ? 0.8591 0.8540 0.9506 0.1067  0.0050  0.0203  75  SER B OG    
2887 N N     . ASN B 50  ? 0.6770 0.5892 0.6525 0.0711  0.1031  0.1508  76  ASN B N     
2888 C CA    . ASN B 50  ? 0.6643 0.5888 0.6485 0.0623  0.0834  0.1452  76  ASN B CA    
2889 C C     . ASN B 50  ? 0.6621 0.5905 0.6212 0.0556  0.0650  0.1320  76  ASN B C     
2890 O O     . ASN B 50  ? 0.6622 0.5872 0.6093 0.0551  0.0535  0.1233  76  ASN B O     
2891 C CB    . ASN B 50  ? 0.6391 0.5937 0.6731 0.0460  0.0720  0.1626  76  ASN B CB    
2892 C CG    . ASN B 50  ? 0.6454 0.5986 0.7347 0.0525  0.0872  0.1818  76  ASN B CG    
2893 O OD1   . ASN B 50  ? 0.6471 0.6262 0.7856 0.0384  0.0754  0.2049  76  ASN B OD1   
2894 N ND2   . ASN B 50  ? 0.6628 0.5872 0.7493 0.0698  0.1147  0.1712  76  ASN B ND2   
2895 N N     . THR B 51  ? 0.6597 0.5941 0.6257 0.0507  0.0657  0.1296  77  THR B N     
2896 C CA    . THR B 51  ? 0.6542 0.5911 0.6228 0.0442  0.0563  0.1158  77  THR B CA    
2897 C C     . THR B 51  ? 0.6803 0.5962 0.6236 0.0572  0.0467  0.1182  77  THR B C     
2898 O O     . THR B 51  ? 0.6816 0.5976 0.6285 0.0538  0.0333  0.1088  77  THR B O     
2899 C CB    . THR B 51  ? 0.6497 0.5945 0.6561 0.0366  0.0667  0.1106  77  THR B CB    
2900 O OG1   . THR B 51  ? 0.6452 0.6114 0.6666 0.0186  0.0719  0.1068  77  THR B OG1   
2901 C CG2   . THR B 51  ? 0.6424 0.5908 0.6782 0.0267  0.0661  0.0906  77  THR B CG2   
2902 N N     . ILE B 52  ? 0.7107 0.6111 0.6270 0.0676  0.0527  0.1323  78  ILE B N     
2903 C CA    . ILE B 52  ? 0.7499 0.6355 0.6267 0.0708  0.0380  0.1393  78  ILE B CA    
2904 C C     . ILE B 52  ? 0.7701 0.6451 0.6083 0.0703  0.0333  0.1218  78  ILE B C     
2905 O O     . ILE B 52  ? 0.7843 0.6546 0.6085 0.0669  0.0110  0.1166  78  ILE B O     
2906 C CB    . ILE B 52  ? 0.7917 0.6694 0.6399 0.0732  0.0470  0.1632  78  ILE B CB    
2907 C CG1   . ILE B 52  ? 0.7706 0.6591 0.6812 0.0740  0.0480  0.1828  78  ILE B CG1   
2908 C CG2   . ILE B 52  ? 0.8502 0.7183 0.6367 0.0660  0.0266  0.1735  78  ILE B CG2   
2909 C CD1   . ILE B 52  ? 0.7989 0.6849 0.7010 0.0765  0.0633  0.2116  78  ILE B CD1   
2910 N N     . GLN B 53  ? 0.7730 0.6447 0.6114 0.0729  0.0544  0.1133  79  GLN B N     
2911 C CA    . GLN B 53  ? 0.7889 0.6504 0.6186 0.0724  0.0566  0.0938  79  GLN B CA    
2912 C C     . GLN B 53  ? 0.7552 0.6284 0.6154 0.0687  0.0340  0.0889  79  GLN B C     
2913 O O     . GLN B 53  ? 0.7778 0.6411 0.6262 0.0671  0.0225  0.0744  79  GLN B O     
2914 C CB    . GLN B 53  ? 0.7893 0.6494 0.6549 0.0763  0.0851  0.0919  79  GLN B CB    
2915 C CG    . GLN B 53  ? 0.8476 0.6912 0.6852 0.0785  0.1190  0.0887  79  GLN B CG    
2916 C CD    . GLN B 53  ? 0.8438 0.6932 0.7484 0.0839  0.1458  0.0995  79  GLN B CD    
2917 O OE1   . GLN B 53  ? 0.7776 0.6484 0.7434 0.0828  0.1310  0.1166  79  GLN B OE1   
2918 N NE2   . GLN B 53  ? 0.8826 0.7154 0.7763 0.0856  0.1851  0.0920  79  GLN B NE2   
2919 N N     . SER B 54  ? 0.7096 0.6046 0.6064 0.0634  0.0296  0.0983  80  SER B N     
2920 C CA    . SER B 54  ? 0.6805 0.5907 0.6027 0.0544  0.0159  0.0946  80  SER B CA    
2921 C C     . SER B 54  ? 0.6853 0.5884 0.6027 0.0543  -0.0008 0.0861  80  SER B C     
2922 O O     . SER B 54  ? 0.6844 0.5856 0.6108 0.0529  -0.0124 0.0788  80  SER B O     
2923 C CB    . SER B 54  ? 0.6568 0.5952 0.6031 0.0384  0.0193  0.1017  80  SER B CB    
2924 O OG    . SER B 54  ? 0.6318 0.5819 0.5951 0.0348  0.0256  0.1178  80  SER B OG    
2925 N N     . ILE B 55  ? 0.6914 0.5919 0.6105 0.0557  -0.0033 0.0911  81  ILE B N     
2926 C CA    . ILE B 55  ? 0.6943 0.5907 0.6335 0.0549  -0.0228 0.0914  81  ILE B CA    
2927 C C     . ILE B 55  ? 0.7381 0.6172 0.6359 0.0577  -0.0449 0.0927  81  ILE B C     
2928 O O     . ILE B 55  ? 0.7415 0.6184 0.6561 0.0548  -0.0656 0.0881  81  ILE B O     
2929 C CB    . ILE B 55  ? 0.6866 0.5875 0.6698 0.0541  -0.0204 0.1027  81  ILE B CB    
2930 C CG1   . ILE B 55  ? 0.6838 0.5842 0.7225 0.0520  -0.0390 0.1062  81  ILE B CG1   
2931 C CG2   . ILE B 55  ? 0.7166 0.6091 0.6708 0.0600  -0.0233 0.1257  81  ILE B CG2   
2932 C CD1   . ILE B 55  ? 0.6549 0.5644 0.7311 0.0437  -0.0293 0.0838  81  ILE B CD1   
2933 N N     . ILE B 56  ? 0.7770 0.6448 0.6202 0.0591  -0.0380 0.0956  82  ILE B N     
2934 C CA    . ILE B 56  ? 0.8416 0.6941 0.6279 0.0523  -0.0523 0.0861  82  ILE B CA    
2935 C C     . ILE B 56  ? 0.8370 0.6837 0.6378 0.0520  -0.0526 0.0600  82  ILE B C     
2936 O O     . ILE B 56  ? 0.8623 0.7039 0.6585 0.0448  -0.0786 0.0517  82  ILE B O     
2937 C CB    . ILE B 56  ? 0.8940 0.7355 0.6141 0.0484  -0.0303 0.0843  82  ILE B CB    
2938 C CG1   . ILE B 56  ? 0.9259 0.7736 0.6223 0.0424  -0.0437 0.1186  82  ILE B CG1   
2939 C CG2   . ILE B 56  ? 0.9535 0.7781 0.6143 0.0353  -0.0288 0.0542  82  ILE B CG2   
2940 C CD1   . ILE B 56  ? 0.9693 0.8107 0.6097 0.0384  -0.0141 0.1232  82  ILE B CD1   
2941 N N     . ALA B 57  ? 0.8030 0.6535 0.6336 0.0581  -0.0275 0.0525  83  ALA B N     
2942 C CA    . ALA B 57  ? 0.7921 0.6403 0.6578 0.0581  -0.0261 0.0367  83  ALA B CA    
2943 C C     . ALA B 57  ? 0.7702 0.6268 0.6709 0.0552  -0.0514 0.0390  83  ALA B C     
2944 O O     . ALA B 57  ? 0.7895 0.6368 0.7004 0.0523  -0.0633 0.0231  83  ALA B O     
2945 C CB    . ALA B 57  ? 0.7504 0.6116 0.6639 0.0620  -0.0042 0.0470  83  ALA B CB    
2946 N N     . ILE B 58  ? 0.7390 0.6124 0.6653 0.0543  -0.0550 0.0547  84  ILE B N     
2947 C CA    . ILE B 58  ? 0.7275 0.6088 0.6978 0.0502  -0.0702 0.0551  84  ILE B CA    
2948 C C     . ILE B 58  ? 0.7682 0.6370 0.7340 0.0484  -0.1018 0.0541  84  ILE B C     
2949 O O     . ILE B 58  ? 0.7762 0.6421 0.7710 0.0457  -0.1188 0.0467  84  ILE B O     
2950 C CB    . ILE B 58  ? 0.6905 0.5916 0.6946 0.0442  -0.0555 0.0625  84  ILE B CB    
2951 C CG1   . ILE B 58  ? 0.6702 0.5908 0.6719 0.0360  -0.0339 0.0668  84  ILE B CG1   
2952 C CG2   . ILE B 58  ? 0.6680 0.5750 0.7262 0.0385  -0.0617 0.0586  84  ILE B CG2   
2953 C CD1   . ILE B 58  ? 0.6479 0.5875 0.6585 0.0227  -0.0146 0.0651  84  ILE B CD1   
2954 N N     . ILE B 59  ? 0.8046 0.6690 0.7385 0.0471  -0.1131 0.0670  85  ILE B N     
2955 C CA    . ILE B 59  ? 0.8583 0.7177 0.7845 0.0385  -0.1525 0.0786  85  ILE B CA    
2956 C C     . ILE B 59  ? 0.9175 0.7624 0.7871 0.0281  -0.1676 0.0555  85  ILE B C     
2957 O O     . ILE B 59  ? 0.9380 0.7810 0.8262 0.0191  -0.1998 0.0520  85  ILE B O     
2958 C CB    . ILE B 59  ? 0.8849 0.7480 0.7878 0.0350  -0.1624 0.1081  85  ILE B CB    
2959 C CG1   . ILE B 59  ? 0.8400 0.7159 0.8295 0.0424  -0.1501 0.1256  85  ILE B CG1   
2960 C CG2   . ILE B 59  ? 0.9557 0.8184 0.8253 0.0171  -0.2109 0.1287  85  ILE B CG2   
2961 C CD1   . ILE B 59  ? 0.8578 0.7379 0.8412 0.0440  -0.1417 0.1504  85  ILE B CD1   
2962 N N     . ARG B 60  ? 0.9495 0.7838 0.7604 0.0274  -0.1404 0.0360  86  ARG B N     
2963 C CA    . ARG B 60  ? 1.0143 0.8318 0.7786 0.0150  -0.1380 0.0003  86  ARG B CA    
2964 C C     . ARG B 60  ? 0.9879 0.8023 0.8182 0.0193  -0.1401 -0.0196 86  ARG B C     
2965 O O     . ARG B 60  ? 1.0388 0.8405 0.8533 0.0056  -0.1515 -0.0494 86  ARG B O     
2966 C CB    . ARG B 60  ? 1.0329 0.8399 0.7582 0.0175  -0.0933 -0.0179 86  ARG B CB    
2967 C CG    . ARG B 60  ? 1.1265 0.9135 0.7917 -0.0017 -0.0783 -0.0619 86  ARG B CG    
2968 C CD    . ARG B 60  ? 1.1739 0.9521 0.8005 -0.0014 -0.0309 -0.0729 86  ARG B CD    
2969 N NE    . ARG B 60  ? 1.2723 1.0531 0.7999 -0.0210 -0.0394 -0.0592 86  ARG B NE    
2970 C CZ    . ARG B 60  ? 1.3135 1.0903 0.7991 -0.0228 -0.0013 -0.0583 86  ARG B CZ    
2971 N NH1   . ARG B 60  ? 1.2808 1.0499 0.8237 -0.0048 0.0465  -0.0712 86  ARG B NH1   
2972 N NH2   . ARG B 60  ? 1.3809 1.1641 0.7746 -0.0447 -0.0132 -0.0383 86  ARG B NH2   
2973 N N     . ALA B 61  ? 0.9202 0.7481 0.8228 0.0340  -0.1287 -0.0033 87  ALA B N     
2974 C CA    . ALA B 61  ? 0.8927 0.7232 0.8651 0.0370  -0.1295 -0.0111 87  ALA B CA    
2975 C C     . ALA B 61  ? 0.8860 0.7228 0.9027 0.0332  -0.1627 -0.0010 87  ALA B C     
2976 O O     . ALA B 61  ? 0.8843 0.7180 0.9490 0.0312  -0.1722 -0.0124 87  ALA B O     
2977 C CB    . ALA B 61  ? 0.8321 0.6796 0.8517 0.0462  -0.1014 0.0062  87  ALA B CB    
2978 N N     . MET B 62  ? 0.8838 0.7294 0.9019 0.0325  -0.1781 0.0221  88  MET B N     
2979 C CA    . MET B 62  ? 0.8867 0.7377 0.9654 0.0282  -0.2103 0.0356  88  MET B CA    
2980 C C     . MET B 62  ? 0.9503 0.7904 1.0034 0.0123  -0.2534 0.0240  88  MET B C     
2981 O O     . MET B 62  ? 0.9471 0.7887 1.0625 0.0082  -0.2790 0.0250  88  MET B O     
2982 C CB    . MET B 62  ? 0.8754 0.7368 0.9788 0.0291  -0.2179 0.0650  88  MET B CB    
2983 C CG    . MET B 62  ? 0.8263 0.7003 0.9716 0.0377  -0.1761 0.0688  88  MET B CG    
2984 S SD    . MET B 62  ? 0.8329 0.7152 1.0307 0.0382  -0.1775 0.0958  88  MET B SD    
2985 C CE    . MET B 62  ? 0.8049 0.6931 1.1338 0.0355  -0.1882 0.1025  88  MET B CE    
2986 N N     . GLY B 63  ? 1.0167 0.8473 0.9756 -0.0005 -0.2599 0.0116  89  GLY B N     
2987 C CA    . GLY B 63  ? 1.1044 0.9260 1.0109 -0.0262 -0.2967 -0.0090 89  GLY B CA    
2988 C C     . GLY B 63  ? 1.1148 0.9223 1.0490 -0.0278 -0.2843 -0.0522 89  GLY B C     
2989 O O     . GLY B 63  ? 1.1422 0.9481 1.1067 -0.0418 -0.3204 -0.0619 89  GLY B O     
2990 N N     . ARG B 64  ? 1.0913 0.8900 1.0304 -0.0142 -0.2351 -0.0743 90  ARG B N     
2991 C CA    . ARG B 64  ? 1.1006 0.8862 1.0895 -0.0140 -0.2173 -0.1111 90  ARG B CA    
2992 C C     . ARG B 64  ? 1.0426 0.8382 1.1407 -0.0019 -0.2277 -0.0934 90  ARG B C     
2993 O O     . ARG B 64  ? 1.0635 0.8502 1.2094 -0.0096 -0.2392 -0.1181 90  ARG B O     
2994 C CB    . ARG B 64  ? 1.0869 0.8646 1.0803 -0.0023 -0.1640 -0.1266 90  ARG B CB    
2995 C CG    . ARG B 64  ? 1.1864 0.9427 1.1038 -0.0224 -0.1426 -0.1760 90  ARG B CG    
2996 C CD    . ARG B 64  ? 1.1980 0.9522 1.0865 -0.0122 -0.0975 -0.1717 90  ARG B CD    
2997 N NE    . ARG B 64  ? 1.3022 1.0341 1.1269 -0.0343 -0.0655 -0.2262 90  ARG B NE    
2998 C CZ    . ARG B 64  ? 1.3453 1.0726 1.1036 -0.0382 -0.0327 -0.2307 90  ARG B CZ    
2999 N NH1   . ARG B 64  ? 1.2890 1.0323 1.0381 -0.0198 -0.0325 -0.1818 90  ARG B NH1   
3000 N NH2   . ARG B 64  ? 1.4440 1.1500 1.1464 -0.0637 0.0041  -0.2889 90  ARG B NH2   
3001 N N     . LEU B 65  ? 1.0711 0.8989 0.9814 -0.0020 -0.1240 -0.0693 91  LEU B N     
3002 C CA    . LEU B 65  ? 1.0769 0.8974 1.0047 -0.0166 -0.1180 -0.0598 91  LEU B CA    
3003 C C     . LEU B 65  ? 1.0702 0.9227 1.0277 -0.0237 -0.1166 -0.0519 91  LEU B C     
3004 O O     . LEU B 65  ? 1.0699 0.9253 1.0471 -0.0367 -0.1101 -0.0441 91  LEU B O     
3005 C CB    . LEU B 65  ? 1.0661 0.8731 0.9870 -0.0143 -0.1011 -0.0509 91  LEU B CB    
3006 C CG    . LEU B 65  ? 1.0787 0.8518 0.9729 -0.0081 -0.1032 -0.0580 91  LEU B CG    
3007 C CD1   . LEU B 65  ? 1.0596 0.8252 0.9478 -0.0041 -0.0869 -0.0492 91  LEU B CD1   
3008 C CD2   . LEU B 65  ? 1.1011 0.8427 0.9889 -0.0195 -0.1161 -0.0632 91  LEU B CD2   
3009 N N     . LYS B 66  ? 1.0701 0.9475 1.0303 -0.0151 -0.1231 -0.0539 92  LYS B N     
3010 C CA    . LYS B 66  ? 1.0682 0.9786 1.0560 -0.0171 -0.1239 -0.0468 92  LYS B CA    
3011 C C     . LYS B 66  ? 1.0582 0.9801 1.0697 -0.0213 -0.1071 -0.0346 92  LYS B C     
3012 O O     . LYS B 66  ? 1.0627 0.9963 1.1004 -0.0340 -0.1064 -0.0319 92  LYS B O     
3013 C CB    . LYS B 66  ? 1.0853 1.0055 1.0876 -0.0270 -0.1422 -0.0547 92  LYS B CB    
3014 C CG    . LYS B 66  ? 1.0978 1.0287 1.0837 -0.0169 -0.1584 -0.0642 92  LYS B CG    
3015 C CD    . LYS B 66  ? 1.1193 1.0741 1.1276 -0.0231 -0.1752 -0.0681 92  LYS B CD    
3016 C CE    . LYS B 66  ? 1.0991 1.0859 1.1323 -0.0190 -0.1707 -0.0557 92  LYS B CE    
3017 N NZ    . LYS B 66  ? 1.1098 1.1208 1.1693 -0.0256 -0.1880 -0.0603 92  LYS B NZ    
3018 N N     . ILE B 67  ? 1.0500 0.9690 1.0525 -0.0107 -0.0935 -0.0285 93  ILE B N     
3019 C CA    . ILE B 67  ? 1.0405 0.9742 1.0638 -0.0096 -0.0781 -0.0191 93  ILE B CA    
3020 C C     . ILE B 67  ? 1.0321 0.9864 1.0621 0.0040  -0.0799 -0.0144 93  ILE B C     
3021 O O     . ILE B 67  ? 1.0293 0.9755 1.0374 0.0141  -0.0821 -0.0150 93  ILE B O     
3022 C CB    . ILE B 67  ? 1.0394 0.9506 1.0464 -0.0072 -0.0626 -0.0167 93  ILE B CB    
3023 C CG1   . ILE B 67  ? 1.0598 0.9460 1.0561 -0.0209 -0.0621 -0.0189 93  ILE B CG1   
3024 C CG2   . ILE B 67  ? 1.0222 0.9505 1.0492 -0.0031 -0.0471 -0.0095 93  ILE B CG2   
3025 C CD1   . ILE B 67  ? 1.0571 0.9132 1.0256 -0.0161 -0.0546 -0.0196 93  ILE B CD1   
3026 N N     . ASP B 68  ? 1.0311 1.0127 1.0923 0.0040  -0.0798 -0.0097 94  ASP B N     
3027 C CA    . ASP B 68  ? 1.0263 1.0247 1.0962 0.0174  -0.0821 -0.0032 94  ASP B CA    
3028 C C     . ASP B 68  ? 1.0117 1.0070 1.0875 0.0257  -0.0660 0.0019  94  ASP B C     
3029 O O     . ASP B 68  ? 1.0066 0.9950 1.0855 0.0205  -0.0524 0.0005  94  ASP B O     
3030 C CB    . ASP B 68  ? 1.0312 1.0603 1.1324 0.0166  -0.0940 -0.0020 94  ASP B CB    
3031 C CG    . ASP B 68  ? 1.0393 1.0833 1.1705 0.0027  -0.0903 -0.0056 94  ASP B CG    
3032 O OD1   . ASP B 68  ? 1.0428 1.0896 1.1877 0.0004  -0.0736 -0.0037 94  ASP B OD1   
3033 O OD2   . ASP B 68  ? 1.0577 1.1122 1.1992 -0.0062 -0.1040 -0.0106 94  ASP B OD2   
3034 N N     . PHE B 69  ? 1.0082 1.0074 1.0836 0.0383  -0.0683 0.0082  95  PHE B N     
3035 C CA    . PHE B 69  ? 0.9991 0.9942 1.0815 0.0477  -0.0561 0.0121  95  PHE B CA    
3036 C C     . PHE B 69  ? 0.9961 1.0119 1.1136 0.0481  -0.0484 0.0112  95  PHE B C     
3037 O O     . PHE B 69  ? 0.9983 1.0373 1.1403 0.0433  -0.0550 0.0099  95  PHE B O     
3038 C CB    . PHE B 69  ? 0.9983 0.9931 1.0763 0.0594  -0.0633 0.0206  95  PHE B CB    
3039 C CG    . PHE B 69  ? 1.0027 0.9824 1.0470 0.0592  -0.0683 0.0216  95  PHE B CG    
3040 C CD1   . PHE B 69  ? 0.9916 0.9505 1.0156 0.0608  -0.0585 0.0197  95  PHE B CD1   
3041 C CD2   . PHE B 69  ? 1.0042 0.9929 1.0376 0.0579  -0.0830 0.0232  95  PHE B CD2   
3042 C CE1   . PHE B 69  ? 0.9963 0.9460 0.9923 0.0608  -0.0619 0.0191  95  PHE B CE1   
3043 C CE2   . PHE B 69  ? 1.0076 0.9865 1.0095 0.0581  -0.0860 0.0226  95  PHE B CE2   
3044 C CZ    . PHE B 69  ? 1.0077 0.9683 0.9922 0.0594  -0.0747 0.0205  95  PHE B CZ    
3045 N N     . GLY B 70  ? 0.9912 1.0004 1.1119 0.0541  -0.0344 0.0102  96  GLY B N     
3046 C CA    . GLY B 70  ? 0.9906 1.0217 1.1446 0.0582  -0.0257 0.0077  96  GLY B CA    
3047 C C     . GLY B 70  ? 0.9926 1.0444 1.1748 0.0691  -0.0380 0.0117  96  GLY B C     
3048 O O     . GLY B 70  ? 0.9928 1.0729 1.2068 0.0676  -0.0406 0.0089  96  GLY B O     
3049 N N     . ASP B 71  ? 0.9955 1.0329 1.1660 0.0796  -0.0462 0.0187  97  ASP B N     
3050 C CA    . ASP B 71  ? 1.0025 1.0526 1.1936 0.0908  -0.0607 0.0254  97  ASP B CA    
3051 C C     . ASP B 71  ? 1.0097 1.0517 1.1770 0.0896  -0.0768 0.0347  97  ASP B C     
3052 O O     . ASP B 71  ? 1.0104 1.0309 1.1450 0.0865  -0.0746 0.0377  97  ASP B O     
3053 C CB    . ASP B 71  ? 1.0051 1.0459 1.2080 0.1054  -0.0570 0.0274  97  ASP B CB    
3054 C CG    . ASP B 71  ? 1.0249 1.0785 1.2548 0.1183  -0.0729 0.0338  97  ASP B CG    
3055 O OD1   . ASP B 71  ? 1.0317 1.1066 1.2980 0.1262  -0.0711 0.0267  97  ASP B OD1   
3056 O OD2   . ASP B 71  ? 1.0484 1.0917 1.2629 0.1207  -0.0873 0.0459  97  ASP B OD2   
3057 N N     . SER B 72  ? 1.0163 1.0778 1.2007 0.0930  -0.0931 0.0386  98  SER B N     
3058 C CA    . SER B 72  ? 1.0284 1.0882 1.1905 0.0919  -0.1102 0.0465  98  SER B CA    
3059 C C     . SER B 72  ? 1.0364 1.0743 1.1713 0.0982  -0.1134 0.0594  98  SER B C     
3060 O O     . SER B 72  ? 1.0479 1.0807 1.1528 0.0945  -0.1214 0.0647  98  SER B O     
3061 C CB    . SER B 72  ? 1.0387 1.1247 1.2286 0.0972  -0.1285 0.0483  98  SER B CB    
3062 O OG    . SER B 72  ? 1.0306 1.1411 1.2526 0.0908  -0.1245 0.0366  98  SER B OG    
3063 N N     . ALA B 73  ? 1.0320 1.0580 1.1781 0.1073  -0.1073 0.0641  99  ALA B N     
3064 C CA    . ALA B 73  ? 1.0424 1.0472 1.1684 0.1120  -0.1103 0.0780  99  ALA B CA    
3065 C C     . ALA B 73  ? 1.0361 1.0224 1.1276 0.1034  -0.0983 0.0768  99  ALA B C     
3066 O O     . ALA B 73  ? 1.0475 1.0221 1.1153 0.1027  -0.1014 0.0885  99  ALA B O     
3067 C CB    . ALA B 73  ? 1.0444 1.0400 1.1964 0.1240  -0.1086 0.0814  99  ALA B CB    
3068 N N     . ARG B 74  ? 1.0191 1.0037 1.1082 0.0968  -0.0849 0.0631  100 ARG B N     
3069 C CA    . ARG B 74  ? 1.0139 0.9819 1.0738 0.0901  -0.0744 0.0588  100 ARG B CA    
3070 C C     . ARG B 74  ? 1.0250 0.9962 1.0550 0.0836  -0.0817 0.0602  100 ARG B C     
3071 O O     . ARG B 74  ? 1.0251 0.9853 1.0304 0.0805  -0.0760 0.0600  100 ARG B O     
3072 C CB    . ARG B 74  ? 0.9970 0.9617 1.0601 0.0851  -0.0614 0.0445  100 ARG B CB    
3073 C CG    . ARG B 74  ? 0.9889 0.9537 1.0785 0.0915  -0.0523 0.0401  100 ARG B CG    
3074 C CD    . ARG B 74  ? 0.9928 0.9403 1.0833 0.0994  -0.0487 0.0452  100 ARG B CD    
3075 N NE    . ARG B 74  ? 1.0018 0.9558 1.1240 0.1103  -0.0521 0.0475  100 ARG B NE    
3076 C CZ    . ARG B 74  ? 1.0083 0.9616 1.1405 0.1174  -0.0645 0.0598  100 ARG B CZ    
3077 N NH1   . ARG B 74  ? 1.0112 0.9693 1.1746 0.1289  -0.0685 0.0592  100 ARG B NH1   
3078 N NH2   . ARG B 74  ? 1.0152 0.9626 1.1254 0.1136  -0.0733 0.0726  100 ARG B NH2   
3079 N N     . ALA B 75  ? 1.0353 1.0236 1.0691 0.0822  -0.0945 0.0600  101 ALA B N     
3080 C CA    . ALA B 75  ? 1.0524 1.0465 1.0584 0.0776  -0.1039 0.0596  101 ALA B CA    
3081 C C     . ALA B 75  ? 1.0740 1.0636 1.0571 0.0808  -0.1076 0.0745  101 ALA B C     
3082 O O     . ALA B 75  ? 1.0829 1.0715 1.0358 0.0768  -0.1062 0.0726  101 ALA B O     
3083 C CB    . ALA B 75  ? 1.0586 1.0728 1.0775 0.0766  -0.1192 0.0565  101 ALA B CB    
3084 N N     . ASP B 76  ? 1.0868 1.0737 1.0847 0.0879  -0.1121 0.0891  102 ASP B N     
3085 C CA    . ASP B 76  ? 1.1119 1.0911 1.0896 0.0893  -0.1149 0.1069  102 ASP B CA    
3086 C C     . ASP B 76  ? 1.1047 1.0669 1.0739 0.0860  -0.0986 0.1075  102 ASP B C     
3087 O O     . ASP B 76  ? 1.1192 1.0791 1.0624 0.0818  -0.0956 0.1159  102 ASP B O     
3088 C CB    . ASP B 76  ? 1.1295 1.1071 1.1272 0.0982  -0.1275 0.1231  102 ASP B CB    
3089 C CG    . ASP B 76  ? 1.1689 1.1402 1.1406 0.0979  -0.1349 0.1449  102 ASP B CG    
3090 O OD1   . ASP B 76  ? 1.2049 1.1874 1.1651 0.1005  -0.1513 0.1534  102 ASP B OD1   
3091 O OD2   . ASP B 76  ? 1.1711 1.1267 1.1334 0.0945  -0.1247 0.1540  102 ASP B OD2   
3092 N N     . ASP B 77  ? 1.0846 1.0368 1.0760 0.0879  -0.0882 0.0981  103 ASP B N     
3093 C CA    . ASP B 77  ? 1.0763 1.0133 1.0623 0.0851  -0.0737 0.0943  103 ASP B CA    
3094 C C     . ASP B 77  ? 1.0714 1.0123 1.0293 0.0780  -0.0674 0.0839  103 ASP B C     
3095 O O     . ASP B 77  ? 1.0754 1.0128 1.0167 0.0744  -0.0611 0.0884  103 ASP B O     
3096 C CB    . ASP B 77  ? 1.0581 0.9867 1.0689 0.0887  -0.0650 0.0821  103 ASP B CB    
3097 C CG    . ASP B 77  ? 1.0633 0.9850 1.1027 0.0975  -0.0686 0.0898  103 ASP B CG    
3098 O OD1   . ASP B 77  ? 1.0932 1.0103 1.1330 0.1001  -0.0774 0.1064  103 ASP B OD1   
3099 O OD2   . ASP B 77  ? 1.0495 0.9700 1.1104 0.1020  -0.0630 0.0789  103 ASP B OD2   
3100 N N     . ALA B 78  ? 1.0633 1.0121 1.0180 0.0759  -0.0695 0.0696  104 ALA B N     
3101 C CA    . ALA B 78  ? 1.0661 1.0173 0.9965 0.0711  -0.0663 0.0569  104 ALA B CA    
3102 C C     . ALA B 78  ? 1.0909 1.0526 0.9940 0.0690  -0.0696 0.0643  104 ALA B C     
3103 O O     . ALA B 78  ? 1.0913 1.0528 0.9775 0.0665  -0.0614 0.0589  104 ALA B O     
3104 C CB    . ALA B 78  ? 1.0593 1.0164 0.9921 0.0687  -0.0726 0.0435  104 ALA B CB    
3105 N N     . ARG B 79  ? 1.1142 1.0868 1.0131 0.0705  -0.0817 0.0766  105 ARG B N     
3106 C CA    . ARG B 79  ? 1.1433 1.1274 1.0128 0.0685  -0.0854 0.0866  105 ARG B CA    
3107 C C     . ARG B 79  ? 1.1523 1.1290 1.0171 0.0660  -0.0749 0.1016  105 ARG B C     
3108 O O     . ARG B 79  ? 1.1632 1.1477 1.0052 0.0616  -0.0670 0.1006  105 ARG B O     
3109 C CB    . ARG B 79  ? 1.1657 1.1601 1.0331 0.0717  -0.1024 0.0990  105 ARG B CB    
3110 C CG    . ARG B 79  ? 1.1695 1.1749 1.0414 0.0727  -0.1145 0.0841  105 ARG B CG    
3111 C CD    . ARG B 79  ? 1.1969 1.2141 1.0697 0.0767  -0.1332 0.0952  105 ARG B CD    
3112 N NE    . ARG B 79  ? 1.2048 1.2325 1.0900 0.0764  -0.1444 0.0793  105 ARG B NE    
3113 C CZ    . ARG B 79  ? 1.2004 1.2299 1.1210 0.0783  -0.1493 0.0766  105 ARG B CZ    
3114 N NH1   . ARG B 79  ? 1.1947 1.2163 1.1413 0.0829  -0.1451 0.0874  105 ARG B NH1   
3115 N NH2   . ARG B 79  ? 1.1976 1.2381 1.1293 0.0754  -0.1588 0.0622  105 ARG B NH2   
3116 N N     . GLN B 80  ? 1.1509 1.1136 1.0396 0.0686  -0.0751 0.1144  106 GLN B N     
3117 C CA    . GLN B 80  ? 1.1617 1.1130 1.0524 0.0653  -0.0669 0.1295  106 GLN B CA    
3118 C C     . GLN B 80  ? 1.1436 1.0908 1.0348 0.0612  -0.0512 0.1161  106 GLN B C     
3119 O O     . GLN B 80  ? 1.1532 1.1006 1.0359 0.0551  -0.0426 0.1249  106 GLN B O     
3120 C CB    . GLN B 80  ? 1.1626 1.0969 1.0834 0.0710  -0.0727 0.1412  106 GLN B CB    
3121 C CG    . GLN B 80  ? 1.1812 1.0986 1.1091 0.0674  -0.0669 0.1574  106 GLN B CG    
3122 C CD    . GLN B 80  ? 1.2258 1.1434 1.1340 0.0628  -0.0738 0.1839  106 GLN B CD    
3123 O OE1   . GLN B 80  ? 1.2462 1.1805 1.1263 0.0607  -0.0790 0.1885  106 GLN B OE1   
3124 N NE2   . GLN B 80  ? 1.2334 1.1309 1.1552 0.0610  -0.0744 0.2016  106 GLN B NE2   
3125 N N     . LEU B 81  ? 1.1183 1.0623 1.0196 0.0641  -0.0479 0.0954  107 LEU B N     
3126 C CA    . LEU B 81  ? 1.1023 1.0420 1.0035 0.0621  -0.0358 0.0806  107 LEU B CA    
3127 C C     . LEU B 81  ? 1.1139 1.0702 0.9890 0.0573  -0.0302 0.0760  107 LEU B C     
3128 O O     . LEU B 81  ? 1.1141 1.0716 0.9890 0.0529  -0.0201 0.0779  107 LEU B O     
3129 C CB    . LEU B 81  ? 1.0816 1.0143 0.9920 0.0659  -0.0356 0.0607  107 LEU B CB    
3130 C CG    . LEU B 81  ? 1.0626 0.9911 0.9678 0.0654  -0.0269 0.0429  107 LEU B CG    
3131 C CD1   . LEU B 81  ? 1.0473 0.9630 0.9686 0.0656  -0.0185 0.0443  107 LEU B CD1   
3132 C CD2   . LEU B 81  ? 1.0534 0.9755 0.9593 0.0679  -0.0301 0.0266  107 LEU B CD2   
3133 N N     . PHE B 82  ? 1.1247 1.0953 0.9797 0.0581  -0.0371 0.0688  108 PHE B N     
3134 C CA    . PHE B 82  ? 1.1439 1.1341 0.9723 0.0553  -0.0326 0.0617  108 PHE B CA    
3135 C C     . PHE B 82  ? 1.1700 1.1715 0.9850 0.0489  -0.0267 0.0824  108 PHE B C     
3136 O O     . PHE B 82  ? 1.1753 1.1894 0.9817 0.0444  -0.0150 0.0788  108 PHE B O     
3137 C CB    . PHE B 82  ? 1.1534 1.1556 0.9631 0.0583  -0.0439 0.0506  108 PHE B CB    
3138 C CG    . PHE B 82  ? 1.1405 1.1332 0.9581 0.0620  -0.0478 0.0280  108 PHE B CG    
3139 C CD1   . PHE B 82  ? 1.1423 1.1389 0.9497 0.0638  -0.0434 0.0072  108 PHE B CD1   
3140 C CD2   . PHE B 82  ? 1.1337 1.1139 0.9696 0.0636  -0.0561 0.0278  108 PHE B CD2   
3141 C CE1   . PHE B 82  ? 1.1289 1.1121 0.9420 0.0668  -0.0487 -0.0116 108 PHE B CE1   
3142 C CE2   . PHE B 82  ? 1.1246 1.0943 0.9663 0.0648  -0.0592 0.0096  108 PHE B CE2   
3143 C CZ    . PHE B 82  ? 1.1229 1.0918 0.9522 0.0663  -0.0562 -0.0092 108 PHE B CZ    
3144 N N     . VAL B 83  ? 1.1887 1.1862 1.0031 0.0481  -0.0352 0.1044  109 VAL B N     
3145 C CA    . VAL B 83  ? 1.2204 1.2237 1.0207 0.0409  -0.0317 0.1291  109 VAL B CA    
3146 C C     . VAL B 83  ? 1.2162 1.2084 1.0356 0.0345  -0.0190 0.1369  109 VAL B C     
3147 O O     . VAL B 83  ? 1.2338 1.2393 1.0406 0.0257  -0.0076 0.1447  109 VAL B O     
3148 C CB    . VAL B 83  ? 1.2422 1.2376 1.0407 0.0433  -0.0471 0.1517  109 VAL B CB    
3149 C CG1   . VAL B 83  ? 1.2736 1.2657 1.0618 0.0351  -0.0442 0.1813  109 VAL B CG1   
3150 C CG2   . VAL B 83  ? 1.2554 1.2676 1.0299 0.0478  -0.0598 0.1455  109 VAL B CG2   
3151 N N     . LEU B 84  ? 1.1955 1.1651 1.0457 0.0385  -0.0206 0.1337  110 LEU B N     
3152 C CA    . LEU B 84  ? 1.1921 1.1482 1.0641 0.0334  -0.0111 0.1386  110 LEU B CA    
3153 C C     . LEU B 84  ? 1.1767 1.1434 1.0510 0.0308  0.0020  0.1184  110 LEU B C     
3154 O O     . LEU B 84  ? 1.1819 1.1485 1.0665 0.0228  0.0118  0.1242  110 LEU B O     
3155 C CB    . LEU B 84  ? 1.1754 1.1058 1.0783 0.0404  -0.0177 0.1378  110 LEU B CB    
3156 C CG    . LEU B 84  ? 1.2018 1.1162 1.1144 0.0416  -0.0285 0.1618  110 LEU B CG    
3157 C CD1   . LEU B 84  ? 1.1839 1.0773 1.1285 0.0508  -0.0338 0.1544  110 LEU B CD1   
3158 C CD2   . LEU B 84  ? 1.2288 1.1377 1.1390 0.0302  -0.0235 0.1851  110 LEU B CD2   
3159 N N     . ALA B 85  ? 1.1581 1.1330 1.0248 0.0374  0.0009  0.0949  111 ALA B N     
3160 C CA    . ALA B 85  ? 1.1451 1.1290 1.0140 0.0378  0.0103  0.0731  111 ALA B CA    
3161 C C     . ALA B 85  ? 1.1636 1.1755 1.0154 0.0300  0.0213  0.0750  111 ALA B C     
3162 O O     . ALA B 85  ? 1.1609 1.1787 1.0255 0.0241  0.0322  0.0734  111 ALA B O     
3163 C CB    . ALA B 85  ? 1.1280 1.1109 0.9907 0.0468  0.0040  0.0495  111 ALA B CB    
3164 N N     . GLY B 86  ? 1.1831 1.2139 1.0064 0.0299  0.0184  0.0777  112 GLY B N     
3165 C CA    . GLY B 86  ? 1.2054 1.2678 1.0073 0.0233  0.0295  0.0784  112 GLY B CA    
3166 C C     . GLY B 86  ? 1.2277 1.2952 1.0308 0.0097  0.0395  0.1053  112 GLY B C     
3167 O O     . GLY B 86  ? 1.2423 1.3370 1.0366 0.0017  0.0535  0.1050  112 GLY B O     
3168 N N     . ALA B 87  ? 1.2331 1.2748 1.0484 0.0068  0.0323  0.1284  113 ALA B N     
3169 C CA    . ALA B 87  ? 1.2589 1.2973 1.0772 -0.0067 0.0388  0.1575  113 ALA B CA    
3170 C C     . ALA B 87  ? 1.2437 1.2688 1.0970 -0.0127 0.0467  0.1559  113 ALA B C     
3171 O O     . ALA B 87  ? 1.2658 1.2966 1.1239 -0.0269 0.0569  0.1735  113 ALA B O     
3172 C CB    . ALA B 87  ? 1.2784 1.2940 1.0917 -0.0057 0.0242  0.1836  113 ALA B CB    
3173 N N     . ALA B 88  ? 1.2075 1.2153 1.0846 -0.0026 0.0418  0.1351  114 ALA B N     
3174 C CA    . ALA B 88  ? 1.1898 1.1824 1.1004 -0.0057 0.0461  0.1303  114 ALA B CA    
3175 C C     . ALA B 88  ? 1.1914 1.2102 1.1087 -0.0163 0.0621  0.1234  114 ALA B C     
3176 O O     . ALA B 88  ? 1.1918 1.2410 1.0917 -0.0153 0.0696  0.1092  114 ALA B O     
3177 C CB    . ALA B 88  ? 1.1569 1.1319 1.0837 0.0080  0.0387  0.1061  114 ALA B CB    
3178 N N     . GLU B 89  ? 1.1938 1.2017 1.1383 -0.0263 0.0667  0.1324  115 GLU B N     
3179 C CA    . GLU B 89  ? 1.1920 1.2244 1.1520 -0.0367 0.0812  0.1238  115 GLU B CA    
3180 C C     . GLU B 89  ? 1.1573 1.1908 1.1347 -0.0243 0.0795  0.0900  115 GLU B C     
3181 O O     . GLU B 89  ? 1.1375 1.1418 1.1297 -0.0143 0.0687  0.0811  115 GLU B O     
3182 C CB    . GLU B 89  ? 1.2109 1.2287 1.1970 -0.0529 0.0848  0.1454  115 GLU B CB    
3183 C CG    . GLU B 89  ? 1.2175 1.2633 1.2245 -0.0666 0.1004  0.1384  115 GLU B CG    
3184 C CD    . GLU B 89  ? 1.2486 1.2786 1.2813 -0.0855 0.1033  0.1629  115 GLU B CD    
3185 O OE1   . GLU B 89  ? 1.2866 1.3122 1.3035 -0.0985 0.1053  0.1948  115 GLU B OE1   
3186 O OE2   . GLU B 89  ? 1.2379 1.2590 1.3064 -0.0877 0.1025  0.1504  115 GLU B OE2   
3187 N N     . GLU B 90  ? 1.1489 1.2166 1.1231 -0.0244 0.0897  0.0711  116 GLU B N     
3188 C CA    . GLU B 90  ? 1.1178 1.1887 1.1071 -0.0125 0.0872  0.0392  116 GLU B CA    
3189 C C     . GLU B 90  ? 1.1033 1.1583 1.1298 -0.0168 0.0863  0.0358  116 GLU B C     
3190 O O     . GLU B 90  ? 1.1159 1.1881 1.1624 -0.0314 0.0969  0.0427  116 GLU B O     
3191 C CB    . GLU B 90  ? 1.1223 1.2363 1.1037 -0.0121 0.0984  0.0206  116 GLU B CB    
3192 C CG    . GLU B 90  ? 1.1025 1.2190 1.0928 0.0036  0.0925  -0.0134 116 GLU B CG    
3193 C CD    . GLU B 90  ? 1.1153 1.2764 1.1133 0.0021  0.1048  -0.0326 116 GLU B CD    
3194 O OE1   . GLU B 90  ? 1.1279 1.3180 1.1019 0.0029  0.1114  -0.0358 116 GLU B OE1   
3195 O OE2   . GLU B 90  ? 1.1103 1.2790 1.1394 0.0008  0.1072  -0.0459 116 GLU B OE2   
3196 N N     . GLY B 91  ? 1.0782 1.1011 1.1137 -0.0047 0.0736  0.0254  117 GLY B N     
3197 C CA    . GLY B 91  ? 1.0633 1.0676 1.1314 -0.0059 0.0697  0.0191  117 GLY B CA    
3198 C C     . GLY B 91  ? 1.0635 1.0307 1.1404 -0.0067 0.0609  0.0365  117 GLY B C     
3199 O O     . GLY B 91  ? 1.0544 1.0026 1.1571 -0.0060 0.0557  0.0302  117 GLY B O     
3200 N N     . PHE B 92  ? 1.0718 1.0295 1.1284 -0.0071 0.0580  0.0568  118 PHE B N     
3201 C CA    . PHE B 92  ? 1.0799 1.0048 1.1456 -0.0074 0.0492  0.0748  118 PHE B CA    
3202 C C     . PHE B 92  ? 1.0710 0.9832 1.1144 0.0037  0.0405  0.0803  118 PHE B C     
3203 O O     . PHE B 92  ? 1.0783 1.0065 1.0962 0.0023  0.0426  0.0894  118 PHE B O     
3204 C CB    . PHE B 92  ? 1.1151 1.0401 1.1890 -0.0258 0.0543  0.1037  118 PHE B CB    
3205 C CG    . PHE B 92  ? 1.1320 1.0613 1.2377 -0.0389 0.0605  0.1013  118 PHE B CG    
3206 C CD1   . PHE B 92  ? 1.1485 1.0467 1.2836 -0.0407 0.0522  0.1046  118 PHE B CD1   
3207 C CD2   . PHE B 92  ? 1.1423 1.1086 1.2507 -0.0493 0.0743  0.0945  118 PHE B CD2   
3208 C CE1   . PHE B 92  ? 1.1667 1.0684 1.3340 -0.0539 0.0565  0.1016  118 PHE B CE1   
3209 C CE2   . PHE B 92  ? 1.1602 1.1337 1.3021 -0.0626 0.0801  0.0916  118 PHE B CE2   
3210 C CZ    . PHE B 92  ? 1.1680 1.1082 1.3397 -0.0656 0.0706  0.0956  118 PHE B CZ    
3211 N N     . MET B 93  ? 1.0528 0.9382 1.1068 0.0147  0.0307  0.0737  119 MET B N     
3212 C CA    . MET B 93  ? 1.0456 0.9187 1.0866 0.0240  0.0223  0.0806  119 MET B CA    
3213 C C     . MET B 93  ? 1.0608 0.9106 1.1171 0.0214  0.0151  0.1019  119 MET B C     
3214 O O     . MET B 93  ? 1.0592 0.8890 1.1409 0.0218  0.0118  0.0989  119 MET B O     
3215 C CB    . MET B 93  ? 1.0233 0.8861 1.0640 0.0387  0.0172  0.0583  119 MET B CB    
3216 C CG    . MET B 93  ? 1.0207 0.8797 1.0470 0.0471  0.0106  0.0620  119 MET B CG    
3217 S SD    . MET B 93  ? 1.0199 0.8711 1.0421 0.0607  0.0077  0.0374  119 MET B SD    
3218 C CE    . MET B 93  ? 0.9919 0.8644 0.9916 0.0594  0.0126  0.0223  119 MET B CE    
3219 N N     . THR B 94  ? 1.0070 0.7584 1.0397 0.1249  0.0230  0.1955  120 THR B N     
3220 C CA    . THR B 94  ? 1.0193 0.7536 1.0548 0.1298  0.0211  0.1965  120 THR B CA    
3221 C C     . THR B 94  ? 1.0036 0.7335 1.0355 0.1215  0.0051  0.1686  120 THR B C     
3222 O O     . THR B 94  ? 0.9815 0.7226 1.0007 0.1173  -0.0034 0.1497  120 THR B O     
3223 C CB    . THR B 94  ? 1.0457 0.7722 1.0472 0.1558  0.0289  0.2096  120 THR B CB    
3224 O OG1   . THR B 94  ? 1.0442 0.7749 1.0108 0.1647  0.0150  0.1905  120 THR B OG1   
3225 C CG2   . THR B 94  ? 1.0608 0.7866 1.0517 0.1698  0.0499  0.2369  120 THR B CG2   
3226 N N     . ALA B 95  ? 1.0103 0.7219 1.0545 0.1205  0.0040  0.1680  121 ALA B N     
3227 C CA    . ALA B 95  ? 1.0026 0.7046 1.0431 0.1173  -0.0046 0.1455  121 ALA B CA    
3228 C C     . ALA B 95  ? 0.9904 0.7066 1.0105 0.1323  -0.0100 0.1366  121 ALA B C     
3229 O O     . ALA B 95  ? 0.9738 0.6929 0.9934 0.1292  -0.0157 0.1183  121 ALA B O     
3230 C CB    . ALA B 95  ? 1.0256 0.7019 1.0803 0.1184  -0.0011 0.1502  121 ALA B CB    
3231 N N     . GLU B 96  ? 1.0002 0.7220 1.0032 0.1489  -0.0087 0.1513  122 GLU B N     
3232 C CA    . GLU B 96  ? 1.0007 0.7306 0.9841 0.1632  -0.0203 0.1461  122 GLU B CA    
3233 C C     . GLU B 96  ? 0.9756 0.7221 0.9454 0.1589  -0.0290 0.1317  122 GLU B C     
3234 O O     . GLU B 96  ? 0.9651 0.7203 0.9406 0.1591  -0.0403 0.1179  122 GLU B O     
3235 C CB    . GLU B 96  ? 1.0342 0.7552 0.9915 0.1829  -0.0192 0.1661  122 GLU B CB    
3236 C CG    . GLU B 96  ? 1.0649 0.7862 1.0056 0.1975  -0.0382 0.1631  122 GLU B CG    
3237 C CD    . GLU B 96  ? 1.1353 0.8396 1.0364 0.2181  -0.0398 0.1824  122 GLU B CD    
3238 O OE1   . GLU B 96  ? 1.1597 0.8567 1.0270 0.2242  -0.0309 0.1905  122 GLU B OE1   
3239 O OE2   . GLU B 96  ? 1.1701 0.8654 1.0716 0.2298  -0.0487 0.1908  122 GLU B OE2   
3240 N N     . LEU B 97  ? 0.9669 0.7179 0.9235 0.1558  -0.0222 0.1371  123 LEU B N     
3241 C CA    . LEU B 97  ? 0.9435 0.7080 0.8856 0.1523  -0.0286 0.1250  123 LEU B CA    
3242 C C     . LEU B 97  ? 0.9084 0.6834 0.8733 0.1347  -0.0318 0.1062  123 LEU B C     
3243 O O     . LEU B 97  ? 0.8938 0.6800 0.8547 0.1334  -0.0409 0.0923  123 LEU B O     
3244 C CB    . LEU B 97  ? 0.9517 0.7163 0.8769 0.1553  -0.0158 0.1387  123 LEU B CB    
3245 C CG    . LEU B 97  ? 0.9347 0.7097 0.8423 0.1535  -0.0185 0.1295  123 LEU B CG    
3246 C CD1   . LEU B 97  ? 0.9428 0.7154 0.8226 0.1631  -0.0374 0.1160  123 LEU B CD1   
3247 C CD2   . LEU B 97  ? 0.9446 0.7141 0.8349 0.1625  0.0000  0.1491  123 LEU B CD2   
3248 N N     . ALA B 98  ? 0.8987 0.6657 0.8846 0.1219  -0.0252 0.1062  124 ALA B N     
3249 C CA    . ALA B 98  ? 0.8777 0.6436 0.8744 0.1076  -0.0280 0.0883  124 ALA B CA    
3250 C C     . ALA B 98  ? 0.8723 0.6392 0.8725 0.1145  -0.0321 0.0758  124 ALA B C     
3251 O O     . ALA B 98  ? 0.8531 0.6275 0.8545 0.1097  -0.0341 0.0620  124 ALA B O     
3252 C CB    . ALA B 98  ? 0.8884 0.6331 0.8986 0.0951  -0.0246 0.0903  124 ALA B CB    
3253 N N     . GLY B 99  ? 0.8847 0.6448 0.8906 0.1268  -0.0324 0.0834  125 GLY B N     
3254 C CA    . GLY B 99  ? 0.8830 0.6467 0.9035 0.1353  -0.0359 0.0775  125 GLY B CA    
3255 C C     . GLY B 99  ? 0.8695 0.6543 0.8892 0.1406  -0.0495 0.0739  125 GLY B C     
3256 O O     . GLY B 99  ? 0.8572 0.6514 0.8953 0.1398  -0.0506 0.0650  125 GLY B O     
3257 N N     . VAL B 100 ? 0.8770 0.6652 0.8741 0.1470  -0.0591 0.0819  126 VAL B N     
3258 C CA    . VAL B 100 ? 0.8776 0.6770 0.8660 0.1524  -0.0771 0.0784  126 VAL B CA    
3259 C C     . VAL B 100 ? 0.8548 0.6675 0.8453 0.1410  -0.0759 0.0647  126 VAL B C     
3260 O O     . VAL B 100 ? 0.8423 0.6671 0.8523 0.1402  -0.0855 0.0573  126 VAL B O     
3261 C CB    . VAL B 100 ? 0.9067 0.6944 0.8545 0.1640  -0.0856 0.0893  126 VAL B CB    
3262 C CG1   . VAL B 100 ? 0.9102 0.6999 0.8400 0.1686  -0.1082 0.0830  126 VAL B CG1   
3263 C CG2   . VAL B 100 ? 0.9373 0.7110 0.8822 0.1767  -0.0878 0.1041  126 VAL B CG2   
3264 N N     . ILE B 101 ? 0.8485 0.6597 0.8247 0.1320  -0.0641 0.0636  127 ILE B N     
3265 C CA    . ILE B 101 ? 0.8294 0.6518 0.8080 0.1207  -0.0615 0.0520  127 ILE B CA    
3266 C C     . ILE B 101 ? 0.8202 0.6451 0.8243 0.1148  -0.0560 0.0416  127 ILE B C     
3267 O O     . ILE B 101 ? 0.8094 0.6463 0.8237 0.1121  -0.0589 0.0331  127 ILE B O     
3268 C CB    . ILE B 101 ? 0.8255 0.6458 0.7931 0.1114  -0.0506 0.0560  127 ILE B CB    
3269 C CG1   . ILE B 101 ? 0.8359 0.6517 0.7782 0.1212  -0.0492 0.0697  127 ILE B CG1   
3270 C CG2   . ILE B 101 ? 0.8035 0.6355 0.7735 0.1004  -0.0499 0.0450  127 ILE B CG2   
3271 C CD1   . ILE B 101 ? 0.8176 0.6314 0.7631 0.1147  -0.0354 0.0823  127 ILE B CD1   
3272 N N     . LYS B 102 ? 0.8336 0.6434 0.8460 0.1145  -0.0463 0.0434  128 LYS B N     
3273 C CA    . LYS B 102 ? 0.8378 0.6394 0.8640 0.1123  -0.0356 0.0346  128 LYS B CA    
3274 C C     . LYS B 102 ? 0.8296 0.6443 0.8855 0.1222  -0.0380 0.0352  128 LYS B C     
3275 O O     . LYS B 102 ? 0.8179 0.6388 0.8859 0.1205  -0.0314 0.0284  128 LYS B O     
3276 C CB    . LYS B 102 ? 0.8647 0.6389 0.8872 0.1120  -0.0252 0.0364  128 LYS B CB    
3277 C CG    . LYS B 102 ? 0.8994 0.6532 0.9229 0.1129  -0.0104 0.0269  128 LYS B CG    
3278 C CD    . LYS B 102 ? 0.9225 0.6640 0.9214 0.1002  -0.0078 0.0150  128 LYS B CD    
3279 C CE    . LYS B 102 ? 0.9654 0.6733 0.9409 0.0897  -0.0092 0.0128  128 LYS B CE    
3280 N NZ    . LYS B 102 ? 1.0097 0.6782 0.9749 0.0966  0.0033  0.0087  128 LYS B NZ    
3281 N N     . ARG B 103 ? 0.8342 0.6528 0.9048 0.1328  -0.0478 0.0456  129 ARG B N     
3282 C CA    . ARG B 103 ? 0.8262 0.6599 0.9356 0.1415  -0.0556 0.0506  129 ARG B CA    
3283 C C     . ARG B 103 ? 0.8033 0.6570 0.9196 0.1372  -0.0708 0.0459  129 ARG B C     
3284 O O     . ARG B 103 ? 0.7933 0.6600 0.9461 0.1383  -0.0684 0.0459  129 ARG B O     
3285 C CB    . ARG B 103 ? 0.8443 0.6771 0.9650 0.1528  -0.0698 0.0643  129 ARG B CB    
3286 C CG    . ARG B 103 ? 0.8739 0.6875 0.9994 0.1590  -0.0531 0.0708  129 ARG B CG    
3287 C CD    . ARG B 103 ? 0.9016 0.7174 1.0488 0.1718  -0.0670 0.0865  129 ARG B CD    
3288 N NE    . ARG B 103 ? 0.9259 0.7401 1.0408 0.1743  -0.0887 0.0921  129 ARG B NE    
3289 C CZ    . ARG B 103 ? 0.9408 0.7382 1.0261 0.1777  -0.0848 0.0991  129 ARG B CZ    
3290 N NH1   . ARG B 103 ? 0.9544 0.7361 1.0422 0.1766  -0.0637 0.1005  129 ARG B NH1   
3291 N NH2   . ARG B 103 ? 0.9577 0.7500 1.0087 0.1831  -0.1015 0.1054  129 ARG B NH2   
3292 N N     . LEU B 104 ? 0.7974 0.6512 0.8799 0.1334  -0.0842 0.0432  130 LEU B N     
3293 C CA    . LEU B 104 ? 0.7842 0.6505 0.8655 0.1289  -0.0982 0.0370  130 LEU B CA    
3294 C C     . LEU B 104 ? 0.7602 0.6346 0.8524 0.1201  -0.0815 0.0278  130 LEU B C     
3295 O O     . LEU B 104 ? 0.7476 0.6359 0.8729 0.1196  -0.0848 0.0269  130 LEU B O     
3296 C CB    . LEU B 104 ? 0.7940 0.6512 0.8278 0.1290  -0.1084 0.0361  130 LEU B CB    
3297 C CG    . LEU B 104 ? 0.8254 0.6695 0.8379 0.1405  -0.1297 0.0448  130 LEU B CG    
3298 C CD1   . LEU B 104 ? 0.8416 0.6681 0.7995 0.1449  -0.1264 0.0478  130 LEU B CD1   
3299 C CD2   . LEU B 104 ? 0.8210 0.6691 0.8501 0.1431  -0.1600 0.0439  130 LEU B CD2   
3300 N N     . TRP B 105 ? 0.7553 0.6193 0.8219 0.1133  -0.0646 0.0227  131 TRP B N     
3301 C CA    . TRP B 105 ? 0.7389 0.6046 0.8038 0.1051  -0.0509 0.0140  131 TRP B CA    
3302 C C     . TRP B 105 ? 0.7495 0.6134 0.8437 0.1098  -0.0347 0.0139  131 TRP B C     
3303 O O     . TRP B 105 ? 0.7417 0.6113 0.8432 0.1069  -0.0259 0.0094  131 TRP B O     
3304 C CB    . TRP B 105 ? 0.7392 0.5894 0.7713 0.0964  -0.0420 0.0108  131 TRP B CB    
3305 C CG    . TRP B 105 ? 0.7114 0.5563 0.7333 0.0879  -0.0312 0.0024  131 TRP B CG    
3306 C CD1   . TRP B 105 ? 0.7151 0.5353 0.7207 0.0844  -0.0192 -0.0021 131 TRP B CD1   
3307 C CD2   . TRP B 105 ? 0.6698 0.5290 0.6912 0.0824  -0.0328 -0.0023 131 TRP B CD2   
3308 N NE1   . TRP B 105 ? 0.7141 0.5314 0.7059 0.0776  -0.0144 -0.0091 131 TRP B NE1   
3309 C CE2   . TRP B 105 ? 0.6869 0.5308 0.6915 0.0761  -0.0213 -0.0086 131 TRP B CE2   
3310 C CE3   . TRP B 105 ? 0.6685 0.5475 0.6983 0.0825  -0.0439 -0.0022 131 TRP B CE3   
3311 C CZ2   . TRP B 105 ? 0.6674 0.5192 0.6670 0.0704  -0.0193 -0.0131 131 TRP B CZ2   
3312 C CZ3   . TRP B 105 ? 0.6546 0.5420 0.6826 0.0763  -0.0408 -0.0072 131 TRP B CZ3   
3313 C CH2   . TRP B 105 ? 0.6648 0.5408 0.6796 0.0705  -0.0279 -0.0118 131 TRP B CH2   
3314 N N     . LYS B 106 ? 0.7718 0.6266 0.8830 0.1189  -0.0282 0.0207  132 LYS B N     
3315 C CA    . LYS B 106 ? 0.7917 0.6402 0.9308 0.1276  -0.0069 0.0240  132 LYS B CA    
3316 C C     . LYS B 106 ? 0.7812 0.6558 0.9791 0.1346  -0.0136 0.0347  132 LYS B C     
3317 O O     . LYS B 106 ? 0.7862 0.6620 1.0159 0.1419  0.0072  0.0401  132 LYS B O     
3318 C CB    . LYS B 106 ? 0.8206 0.6448 0.9536 0.1356  0.0051  0.0282  132 LYS B CB    
3319 C CG    . LYS B 106 ? 0.8678 0.6668 1.0014 0.1449  0.0359  0.0276  132 LYS B CG    
3320 C CD    . LYS B 106 ? 0.9198 0.6868 1.0383 0.1522  0.0474  0.0296  132 LYS B CD    
3321 C CE    . LYS B 106 ? 0.9498 0.6795 1.0088 0.1420  0.0496  0.0161  132 LYS B CE    
3322 N NZ    . LYS B 106 ? 1.0042 0.6954 1.0479 0.1496  0.0623  0.0171  132 LYS B NZ    
3323 N N     . ASP B 107 ? 0.7716 0.6636 0.9834 0.1329  -0.0430 0.0390  133 ASP B N     
3324 C CA    . ASP B 107 ? 0.7612 0.6761 1.0320 0.1367  -0.0600 0.0501  133 ASP B CA    
3325 C C     . ASP B 107 ? 0.7452 0.6753 1.0408 0.1315  -0.0550 0.0479  133 ASP B C     
3326 O O     . ASP B 107 ? 0.7366 0.6649 0.9957 0.1223  -0.0572 0.0360  133 ASP B O     
3327 C CB    . ASP B 107 ? 0.7635 0.6823 1.0240 0.1347  -0.0981 0.0516  133 ASP B CB    
3328 C CG    . ASP B 107 ? 0.7676 0.7055 1.0876 0.1359  -0.1249 0.0625  133 ASP B CG    
3329 O OD1   . ASP B 107 ? 0.7734 0.7182 1.1418 0.1441  -0.1297 0.0778  133 ASP B OD1   
3330 O OD2   . ASP B 107 ? 0.7578 0.7031 1.0798 0.1281  -0.1426 0.0569  133 ASP B OD2   
3331 N N     . SER B 108 ? 0.7404 0.6863 1.1034 0.1382  -0.0476 0.0620  134 SER B N     
3332 C CA    . SER B 108 ? 0.7260 0.6857 1.1233 0.1362  -0.0348 0.0647  134 SER B CA    
3333 C C     . SER B 108 ? 0.7129 0.6870 1.1147 0.1243  -0.0674 0.0591  134 SER B C     
3334 O O     . SER B 108 ? 0.7020 0.6802 1.0991 0.1188  -0.0574 0.0535  134 SER B O     
3335 C CB    . SER B 108 ? 0.7330 0.7077 1.2132 0.1481  -0.0180 0.0868  134 SER B CB    
3336 O OG    . SER B 108 ? 0.7300 0.7250 1.2699 0.1473  -0.0536 0.1008  134 SER B OG    
3337 N N     . GLY B 109 ? 0.7155 0.6925 1.1218 0.1215  -0.1064 0.0608  135 GLY B N     
3338 C CA    . GLY B 109 ? 0.7138 0.6919 1.1062 0.1116  -0.1407 0.0526  135 GLY B CA    
3339 C C     . GLY B 109 ? 0.7111 0.6736 1.0257 0.1056  -0.1336 0.0345  135 GLY B C     
3340 O O     . GLY B 109 ? 0.7002 0.6666 1.0089 0.0987  -0.1313 0.0276  135 GLY B O     
3341 N N     . VAL B 110 ? 0.7191 0.6649 0.9797 0.1086  -0.1292 0.0293  136 VAL B N     
3342 C CA    . VAL B 110 ? 0.7143 0.6470 0.9102 0.1038  -0.1201 0.0170  136 VAL B CA    
3343 C C     . VAL B 110 ? 0.7002 0.6384 0.8958 0.0986  -0.0924 0.0118  136 VAL B C     
3344 O O     . VAL B 110 ? 0.6973 0.6351 0.8672 0.0921  -0.0937 0.0040  136 VAL B O     
3345 C CB    . VAL B 110 ? 0.7258 0.6425 0.8813 0.1083  -0.1123 0.0175  136 VAL B CB    
3346 C CG1   . VAL B 110 ? 0.7148 0.6215 0.8174 0.1028  -0.1007 0.0093  136 VAL B CG1   
3347 C CG2   . VAL B 110 ? 0.7395 0.6473 0.8859 0.1150  -0.1403 0.0232  136 VAL B CG2   
3348 N N     . GLN B 111 ? 0.7005 0.6402 0.9223 0.1031  -0.0671 0.0172  137 GLN B N     
3349 C CA    . GLN B 111 ? 0.6910 0.6291 0.9073 0.1010  -0.0402 0.0136  137 GLN B CA    
3350 C C     . GLN B 111 ? 0.6759 0.6315 0.9287 0.0973  -0.0435 0.0158  137 GLN B C     
3351 O O     . GLN B 111 ? 0.6769 0.6314 0.9079 0.0919  -0.0331 0.0094  137 GLN B O     
3352 C CB    . GLN B 111 ? 0.7083 0.6347 0.9373 0.1109  -0.0106 0.0199  137 GLN B CB    
3353 C CG    . GLN B 111 ? 0.7219 0.6223 0.9006 0.1115  -0.0009 0.0135  137 GLN B CG    
3354 C CD    . GLN B 111 ? 0.7265 0.6146 0.8509 0.1009  0.0000  0.0017  137 GLN B CD    
3355 O OE1   . GLN B 111 ? 0.7350 0.6203 0.8498 0.0984  0.0127  -0.0017 137 GLN B OE1   
3356 N NE2   . GLN B 111 ? 0.7113 0.5923 0.8038 0.0953  -0.0131 -0.0018 137 GLN B NE2   
3357 N N     . ALA B 112 ? 0.6671 0.6386 0.9792 0.0997  -0.0596 0.0263  138 ALA B N     
3358 C CA    . ALA B 112 ? 0.6488 0.6366 1.0045 0.0950  -0.0667 0.0303  138 ALA B CA    
3359 C C     . ALA B 112 ? 0.6405 0.6239 0.9569 0.0851  -0.0909 0.0174  138 ALA B C     
3360 O O     . ALA B 112 ? 0.6294 0.6193 0.9551 0.0798  -0.0878 0.0153  138 ALA B O     
3361 C CB    . ALA B 112 ? 0.6515 0.6563 1.0862 0.0978  -0.0857 0.0465  138 ALA B CB    
3362 N N     . CYS B 113 ? 0.6458 0.6156 0.9179 0.0846  -0.1124 0.0104  139 CYS B N     
3363 C CA    . CYS B 113 ? 0.6473 0.6054 0.8709 0.0794  -0.1294 -0.0007 139 CYS B CA    
3364 C C     . CYS B 113 ? 0.6311 0.5847 0.8083 0.0764  -0.1047 -0.0080 139 CYS B C     
3365 O O     . CYS B 113 ? 0.6313 0.5841 0.7916 0.0715  -0.1062 -0.0137 139 CYS B O     
3366 C CB    . CYS B 113 ? 0.6723 0.6121 0.8581 0.0838  -0.1546 -0.0029 139 CYS B CB    
3367 S SG    . CYS B 113 ? 0.7027 0.6197 0.8262 0.0822  -0.1731 -0.0144 139 CYS B SG    
3368 N N     . PHE B 114 ? 0.6182 0.5668 0.7765 0.0790  -0.0844 -0.0070 140 PHE B N     
3369 C CA    . PHE B 114 ? 0.6033 0.5464 0.7244 0.0746  -0.0653 -0.0118 140 PHE B CA    
3370 C C     . PHE B 114 ? 0.5931 0.5446 0.7299 0.0708  -0.0507 -0.0124 140 PHE B C     
3371 O O     . PHE B 114 ? 0.5858 0.5368 0.6976 0.0654  -0.0472 -0.0165 140 PHE B O     
3372 C CB    . PHE B 114 ? 0.6061 0.5374 0.7106 0.0770  -0.0490 -0.0105 140 PHE B CB    
3373 C CG    . PHE B 114 ? 0.5743 0.4965 0.6452 0.0707  -0.0343 -0.0146 140 PHE B CG    
3374 C CD1   . PHE B 114 ? 0.5354 0.4566 0.5768 0.0646  -0.0408 -0.0162 140 PHE B CD1   
3375 C CD2   . PHE B 114 ? 0.5587 0.4704 0.6272 0.0719  -0.0144 -0.0151 140 PHE B CD2   
3376 C CE1   . PHE B 114 ? 0.5248 0.4389 0.5428 0.0573  -0.0323 -0.0174 140 PHE B CE1   
3377 C CE2   . PHE B 114 ? 0.5379 0.4356 0.5706 0.0653  -0.0070 -0.0191 140 PHE B CE2   
3378 C CZ    . PHE B 114 ? 0.5345 0.4356 0.5461 0.0567  -0.0183 -0.0199 140 PHE B CZ    
3379 N N     . ASN B 115 ? 0.5958 0.5550 0.7765 0.0752  -0.0399 -0.0058 141 ASN B N     
3380 C CA    . ASN B 115 ? 0.5959 0.5613 0.7943 0.0745  -0.0215 -0.0031 141 ASN B CA    
3381 C C     . ASN B 115 ? 0.5825 0.5616 0.8082 0.0692  -0.0362 -0.0030 141 ASN B C     
3382 O O     . ASN B 115 ? 0.5770 0.5620 0.8174 0.0682  -0.0215 0.0000  141 ASN B O     
3383 C CB    . ASN B 115 ? 0.6095 0.5749 0.8464 0.0845  0.0018  0.0076  141 ASN B CB    
3384 C CG    . ASN B 115 ? 0.6473 0.5884 0.8414 0.0901  0.0248  0.0050  141 ASN B CG    
3385 O OD1   . ASN B 115 ? 0.6750 0.6011 0.8189 0.0853  0.0308  -0.0028 141 ASN B OD1   
3386 N ND2   . ASN B 115 ? 0.6649 0.5992 0.8790 0.1002  0.0360  0.0122  141 ASN B ND2   
3387 N N     . ARG B 116 ? 0.5813 0.5606 0.8093 0.0666  -0.0656 -0.0062 142 ARG B N     
3388 C CA    . ARG B 116 ? 0.5735 0.5559 0.8135 0.0610  -0.0841 -0.0092 142 ARG B CA    
3389 C C     . ARG B 116 ? 0.5760 0.5440 0.7570 0.0585  -0.0944 -0.0195 142 ARG B C     
3390 O O     . ARG B 116 ? 0.5885 0.5473 0.7623 0.0566  -0.1162 -0.0244 142 ARG B O     
3391 C CB    . ARG B 116 ? 0.5811 0.5672 0.8708 0.0609  -0.1127 -0.0038 142 ARG B CB    
3392 C CG    . ARG B 116 ? 0.5778 0.5831 0.9438 0.0632  -0.0996 0.0113  142 ARG B CG    
3393 C CD    . ARG B 116 ? 0.5898 0.6004 1.0129 0.0622  -0.1323 0.0200  142 ARG B CD    
3394 N NE    . ARG B 116 ? 0.6195 0.6178 1.0345 0.0542  -0.1704 0.0117  142 ARG B NE    
3395 C CZ    . ARG B 116 ? 0.6362 0.6307 1.0907 0.0504  -0.2103 0.0162  142 ARG B CZ    
3396 N NH1   . ARG B 116 ? 0.6545 0.6631 1.1693 0.0538  -0.2167 0.0316  142 ARG B NH1   
3397 N NH2   . ARG B 116 ? 0.6639 0.6371 1.0972 0.0437  -0.2453 0.0060  142 ARG B NH2   
3398 N N     . SER B 117 ? 0.5648 0.5280 0.7045 0.0591  -0.0780 -0.0214 143 SER B N     
3399 C CA    . SER B 117 ? 0.5655 0.5180 0.6568 0.0583  -0.0803 -0.0260 143 SER B CA    
3400 C C     . SER B 117 ? 0.5584 0.5118 0.6443 0.0547  -0.0793 -0.0287 143 SER B C     
3401 O O     . SER B 117 ? 0.5718 0.5134 0.6229 0.0569  -0.0833 -0.0310 143 SER B O     
3402 C CB    . SER B 117 ? 0.5577 0.5085 0.6218 0.0573  -0.0632 -0.0237 143 SER B CB    
3403 O OG    . SER B 117 ? 0.5496 0.5071 0.6190 0.0527  -0.0458 -0.0224 143 SER B OG    
3404 N N     . ARG B 118 ? 0.5422 0.5078 0.6620 0.0510  -0.0711 -0.0266 144 ARG B N     
3405 C CA    . ARG B 118 ? 0.5410 0.5075 0.6604 0.0477  -0.0699 -0.0283 144 ARG B CA    
3406 C C     . ARG B 118 ? 0.5655 0.5172 0.6853 0.0485  -0.0954 -0.0341 144 ARG B C     
3407 O O     . ARG B 118 ? 0.5729 0.5169 0.6809 0.0474  -0.0971 -0.0373 144 ARG B O     
3408 C CB    . ARG B 118 ? 0.5246 0.5058 0.6817 0.0448  -0.0535 -0.0226 144 ARG B CB    
3409 C CG    . ARG B 118 ? 0.5240 0.5140 0.7366 0.0462  -0.0568 -0.0167 144 ARG B CG    
3410 C CD    . ARG B 118 ? 0.5277 0.5298 0.7766 0.0461  -0.0352 -0.0079 144 ARG B CD    
3411 N NE    . ARG B 118 ? 0.5642 0.5668 0.8193 0.0413  -0.0414 -0.0097 144 ARG B NE    
3412 C CZ    . ARG B 118 ? 0.5481 0.5548 0.8523 0.0380  -0.0548 -0.0063 144 ARG B CZ    
3413 N NH1   . ARG B 118 ? 0.5473 0.5620 0.9073 0.0387  -0.0634 0.0016  144 ARG B NH1   
3414 N NH2   . ARG B 118 ? 0.5390 0.5413 0.8405 0.0339  -0.0600 -0.0093 144 ARG B NH2   
3415 N N     . GLU B 119 ? 0.5869 0.5307 0.7177 0.0507  -0.1169 -0.0354 145 GLU B N     
3416 C CA    . GLU B 119 ? 0.6231 0.5438 0.7462 0.0515  -0.1484 -0.0419 145 GLU B CA    
3417 C C     . GLU B 119 ? 0.6569 0.5481 0.7118 0.0601  -0.1567 -0.0479 145 GLU B C     
3418 O O     . GLU B 119 ? 0.7043 0.5643 0.7309 0.0635  -0.1817 -0.0551 145 GLU B O     
3419 C CB    . GLU B 119 ? 0.6272 0.5528 0.8010 0.0494  -0.1720 -0.0376 145 GLU B CB    
3420 C CG    . GLU B 119 ? 0.6176 0.5711 0.8665 0.0437  -0.1606 -0.0273 145 GLU B CG    
3421 C CD    . GLU B 119 ? 0.6606 0.6228 0.9709 0.0426  -0.1815 -0.0182 145 GLU B CD    
3422 O OE1   . GLU B 119 ? 0.7083 0.6507 1.0173 0.0407  -0.2203 -0.0222 145 GLU B OE1   
3423 O OE2   . GLU B 119 ? 0.6551 0.6408 1.0140 0.0446  -0.1594 -0.0058 145 GLU B OE2   
3424 N N     . TYR B 120 ? 0.6414 0.5380 0.6685 0.0643  -0.1359 -0.0439 146 TYR B N     
3425 C CA    . TYR B 120 ? 0.6713 0.5416 0.6375 0.0745  -0.1355 -0.0450 146 TYR B CA    
3426 C C     . TYR B 120 ? 0.6557 0.5387 0.6067 0.0751  -0.1055 -0.0378 146 TYR B C     
3427 O O     . TYR B 120 ? 0.6290 0.5337 0.6059 0.0676  -0.0905 -0.0351 146 TYR B O     
3428 C CB    . TYR B 120 ? 0.6901 0.5458 0.6397 0.0811  -0.1523 -0.0443 146 TYR B CB    
3429 C CG    . TYR B 120 ? 0.6511 0.5321 0.6351 0.0777  -0.1427 -0.0376 146 TYR B CG    
3430 C CD1   . TYR B 120 ? 0.6132 0.5136 0.6540 0.0714  -0.1500 -0.0357 146 TYR B CD1   
3431 C CD2   . TYR B 120 ? 0.6326 0.5149 0.5936 0.0819  -0.1253 -0.0314 146 TYR B CD2   
3432 C CE1   . TYR B 120 ? 0.5976 0.5145 0.6640 0.0711  -0.1379 -0.0294 146 TYR B CE1   
3433 C CE2   . TYR B 120 ? 0.6119 0.5102 0.5988 0.0793  -0.1173 -0.0266 146 TYR B CE2   
3434 C CZ    . TYR B 120 ? 0.6025 0.5162 0.6382 0.0747  -0.1227 -0.0264 146 TYR B CZ    
3435 O OH    . TYR B 120 ? 0.6072 0.5310 0.6633 0.0747  -0.1112 -0.0215 146 TYR B OH    
3436 N N     . LEU B 121 ? 0.6823 0.5506 0.5932 0.0843  -0.0975 -0.0326 147 LEU B N     
3437 C CA    . LEU B 121 ? 0.6708 0.5515 0.5762 0.0842  -0.0721 -0.0221 147 LEU B CA    
3438 C C     . LEU B 121 ? 0.6548 0.5443 0.5640 0.0837  -0.0651 -0.0141 147 LEU B C     
3439 O O     . LEU B 121 ? 0.6937 0.5655 0.5742 0.0937  -0.0657 -0.0097 147 LEU B O     
3440 C CB    . LEU B 121 ? 0.7105 0.5663 0.5726 0.0969  -0.0620 -0.0176 147 LEU B CB    
3441 C CG    . LEU B 121 ? 0.7583 0.5934 0.6046 0.1001  -0.0703 -0.0268 147 LEU B CG    
3442 C CD1   . LEU B 121 ? 0.8269 0.6230 0.6143 0.1184  -0.0602 -0.0231 147 LEU B CD1   
3443 C CD2   . LEU B 121 ? 0.7375 0.5991 0.6211 0.0892  -0.0599 -0.0255 147 LEU B CD2   
3444 N N     . LEU B 122 ? 0.6130 0.5254 0.5540 0.0728  -0.0586 -0.0123 148 LEU B N     
3445 C CA    . LEU B 122 ? 0.5903 0.5068 0.5354 0.0709  -0.0542 -0.0063 148 LEU B CA    
3446 C C     . LEU B 122 ? 0.5750 0.5040 0.5291 0.0629  -0.0406 0.0028  148 LEU B C     
3447 O O     . LEU B 122 ? 0.5560 0.4965 0.5252 0.0545  -0.0378 0.0006  148 LEU B O     
3448 C CB    . LEU B 122 ? 0.5743 0.4974 0.5443 0.0663  -0.0613 -0.0127 148 LEU B CB    
3449 C CG    . LEU B 122 ? 0.5752 0.4966 0.5476 0.0653  -0.0577 -0.0085 148 LEU B CG    
3450 C CD1   . LEU B 122 ? 0.5649 0.4719 0.5159 0.0752  -0.0629 -0.0033 148 LEU B CD1   
3451 C CD2   . LEU B 122 ? 0.5400 0.4658 0.5375 0.0630  -0.0589 -0.0137 148 LEU B CD2   
3452 N N     . ASN B 123 ? 0.5795 0.5049 0.5255 0.0658  -0.0333 0.0151  149 ASN B N     
3453 C CA    . ASN B 123 ? 0.5661 0.5027 0.5276 0.0569  -0.0253 0.0274  149 ASN B CA    
3454 C C     . ASN B 123 ? 0.5534 0.4943 0.5288 0.0439  -0.0316 0.0216  149 ASN B C     
3455 O O     . ASN B 123 ? 0.5534 0.4872 0.5270 0.0445  -0.0366 0.0129  149 ASN B O     
3456 C CB    . ASN B 123 ? 0.5783 0.5099 0.5379 0.0626  -0.0168 0.0445  149 ASN B CB    
3457 C CG    . ASN B 123 ? 0.5814 0.5066 0.5437 0.0601  -0.0224 0.0442  149 ASN B CG    
3458 O OD1   . ASN B 123 ? 0.5718 0.5008 0.5519 0.0482  -0.0258 0.0484  149 ASN B OD1   
3459 N ND2   . ASN B 123 ? 0.6162 0.5283 0.5593 0.0710  -0.0258 0.0386  149 ASN B ND2   
3460 N N     . ASP B 124 ? 0.5443 0.4930 0.5307 0.0335  -0.0315 0.0272  150 ASP B N     
3461 C CA    . ASP B 124 ? 0.5424 0.4855 0.5285 0.0227  -0.0380 0.0207  150 ASP B CA    
3462 C C     . ASP B 124 ? 0.5604 0.4914 0.5471 0.0151  -0.0450 0.0259  150 ASP B C     
3463 O O     . ASP B 124 ? 0.5709 0.4884 0.5487 0.0060  -0.0527 0.0214  150 ASP B O     
3464 C CB    . ASP B 124 ? 0.5324 0.4832 0.5224 0.0154  -0.0389 0.0231  150 ASP B CB    
3465 C CG    . ASP B 124 ? 0.5264 0.4821 0.5142 0.0204  -0.0334 0.0127  150 ASP B CG    
3466 O OD1   . ASP B 124 ? 0.5182 0.4672 0.5026 0.0248  -0.0321 0.0018  150 ASP B OD1   
3467 O OD2   . ASP B 124 ? 0.4892 0.4556 0.4835 0.0202  -0.0299 0.0173  150 ASP B OD2   
3468 N N     . SER B 125 ? 0.5687 0.4996 0.5619 0.0199  -0.0425 0.0357  151 SER B N     
3469 C CA    . SER B 125 ? 0.5880 0.5057 0.5850 0.0140  -0.0488 0.0406  151 SER B CA    
3470 C C     . SER B 125 ? 0.5956 0.5016 0.5806 0.0229  -0.0465 0.0309  151 SER B C     
3471 O O     . SER B 125 ? 0.6177 0.5101 0.6040 0.0200  -0.0502 0.0336  151 SER B O     
3472 C CB    . SER B 125 ? 0.5908 0.5167 0.6111 0.0136  -0.0454 0.0630  151 SER B CB    
3473 O OG    . SER B 125 ? 0.5861 0.5227 0.6284 0.0029  -0.0506 0.0762  151 SER B OG    
3474 N N     . ALA B 126 ? 0.5900 0.5004 0.5670 0.0331  -0.0424 0.0209  152 ALA B N     
3475 C CA    . ALA B 126 ? 0.6013 0.5041 0.5737 0.0427  -0.0425 0.0151  152 ALA B CA    
3476 C C     . ALA B 126 ? 0.6165 0.5034 0.5868 0.0396  -0.0436 0.0071  152 ALA B C     
3477 O O     . ALA B 126 ? 0.6262 0.5019 0.5963 0.0420  -0.0443 0.0103  152 ALA B O     
3478 C CB    . ALA B 126 ? 0.5926 0.5025 0.5635 0.0519  -0.0436 0.0075  152 ALA B CB    
3479 N N     . ALA B 127 ? 0.6211 0.5034 0.5869 0.0361  -0.0414 -0.0022 153 ALA B N     
3480 C CA    . ALA B 127 ? 0.6457 0.5051 0.6015 0.0367  -0.0377 -0.0095 153 ALA B CA    
3481 C C     . ALA B 127 ? 0.6701 0.5063 0.6115 0.0264  -0.0449 -0.0069 153 ALA B C     
3482 O O     . ALA B 127 ? 0.6951 0.5074 0.6268 0.0282  -0.0435 -0.0103 153 ALA B O     
3483 C CB    . ALA B 127 ? 0.6497 0.5046 0.5989 0.0383  -0.0293 -0.0175 153 ALA B CB    
3484 N N     . TYR B 128 ? 0.6654 0.5075 0.6089 0.0154  -0.0538 0.0003  154 TYR B N     
3485 C CA    . TYR B 128 ? 0.6971 0.5177 0.6348 0.0027  -0.0669 0.0050  154 TYR B CA    
3486 C C     . TYR B 128 ? 0.7067 0.5202 0.6564 0.0039  -0.0683 0.0126  154 TYR B C     
3487 O O     . TYR B 128 ? 0.7369 0.5196 0.6736 -0.0015 -0.0754 0.0089  154 TYR B O     
3488 C CB    . TYR B 128 ? 0.6869 0.5225 0.6397 -0.0089 -0.0775 0.0171  154 TYR B CB    
3489 C CG    . TYR B 128 ? 0.7204 0.5363 0.6790 -0.0244 -0.0967 0.0258  154 TYR B CG    
3490 C CD1   . TYR B 128 ? 0.7632 0.5472 0.6941 -0.0361 -0.1142 0.0181  154 TYR B CD1   
3491 C CD2   . TYR B 128 ? 0.7158 0.5409 0.7065 -0.0271 -0.0986 0.0428  154 TYR B CD2   
3492 C CE1   . TYR B 128 ? 0.7887 0.5497 0.7260 -0.0524 -0.1386 0.0259  154 TYR B CE1   
3493 C CE2   . TYR B 128 ? 0.7422 0.5495 0.7481 -0.0431 -0.1189 0.0531  154 TYR B CE2   
3494 C CZ    . TYR B 128 ? 0.7840 0.5592 0.7644 -0.0569 -0.1414 0.0441  154 TYR B CZ    
3495 O OH    . TYR B 128 ? 0.8119 0.5661 0.8093 -0.0747 -0.1677 0.0545  154 TYR B OH    
3496 N N     . TYR B 129 ? 0.6924 0.5295 0.6625 0.0120  -0.0613 0.0233  155 TYR B N     
3497 C CA    . TYR B 129 ? 0.7083 0.5390 0.6890 0.0155  -0.0599 0.0327  155 TYR B CA    
3498 C C     . TYR B 129 ? 0.7210 0.5400 0.6909 0.0273  -0.0531 0.0230  155 TYR B C     
3499 O O     . TYR B 129 ? 0.7439 0.5418 0.7127 0.0266  -0.0545 0.0240  155 TYR B O     
3500 C CB    . TYR B 129 ? 0.6955 0.5488 0.6947 0.0222  -0.0527 0.0507  155 TYR B CB    
3501 C CG    . TYR B 129 ? 0.6993 0.5640 0.7218 0.0114  -0.0565 0.0673  155 TYR B CG    
3502 C CD1   . TYR B 129 ? 0.7296 0.5809 0.7702 -0.0042 -0.0700 0.0759  155 TYR B CD1   
3503 C CD2   . TYR B 129 ? 0.6875 0.5743 0.7167 0.0171  -0.0478 0.0759  155 TYR B CD2   
3504 C CE1   . TYR B 129 ? 0.7346 0.5993 0.8080 -0.0151 -0.0761 0.0951  155 TYR B CE1   
3505 C CE2   . TYR B 129 ? 0.6843 0.5840 0.7429 0.0085  -0.0491 0.0949  155 TYR B CE2   
3506 C CZ    . TYR B 129 ? 0.7092 0.6001 0.7937 -0.0079 -0.0639 0.1056  155 TYR B CZ    
3507 O OH    . TYR B 129 ? 0.7032 0.6092 0.8274 -0.0174 -0.0679 0.1279  155 TYR B OH    
3508 N N     . LEU B 130 ? 0.7089 0.5409 0.6754 0.0377  -0.0469 0.0150  156 LEU B N     
3509 C CA    . LEU B 130 ? 0.7205 0.5476 0.6883 0.0498  -0.0418 0.0104  156 LEU B CA    
3510 C C     . LEU B 130 ? 0.7535 0.5528 0.7103 0.0495  -0.0371 0.0008  156 LEU B C     
3511 O O     . LEU B 130 ? 0.7778 0.5659 0.7386 0.0576  -0.0326 0.0015  156 LEU B O     
3512 C CB    . LEU B 130 ? 0.6961 0.5437 0.6713 0.0593  -0.0407 0.0066  156 LEU B CB    
3513 C CG    . LEU B 130 ? 0.6764 0.5389 0.6515 0.0660  -0.0452 0.0151  156 LEU B CG    
3514 C CD1   . LEU B 130 ? 0.6544 0.5316 0.6320 0.0700  -0.0491 0.0091  156 LEU B CD1   
3515 C CD2   . LEU B 130 ? 0.6839 0.5397 0.6591 0.0766  -0.0474 0.0220  156 LEU B CD2   
3516 N N     . ASN B 131 ? 0.7734 0.5574 0.7121 0.0418  -0.0372 -0.0074 157 ASN B N     
3517 C CA    . ASN B 131 ? 0.8145 0.5607 0.7288 0.0439  -0.0305 -0.0170 157 ASN B CA    
3518 C C     . ASN B 131 ? 0.8538 0.5652 0.7521 0.0347  -0.0402 -0.0165 157 ASN B C     
3519 O O     . ASN B 131 ? 0.8956 0.5664 0.7672 0.0381  -0.0349 -0.0248 157 ASN B O     
3520 C CB    . ASN B 131 ? 0.8283 0.5631 0.7188 0.0416  -0.0265 -0.0260 157 ASN B CB    
3521 C CG    . ASN B 131 ? 0.8098 0.5652 0.7165 0.0542  -0.0107 -0.0275 157 ASN B CG    
3522 O OD1   . ASN B 131 ? 0.8044 0.5680 0.7336 0.0660  -0.0012 -0.0247 157 ASN B OD1   
3523 N ND2   . ASN B 131 ? 0.8144 0.5782 0.7143 0.0512  -0.0092 -0.0302 157 ASN B ND2   
3524 N N     . ASP B 132 ? 0.8477 0.5723 0.7634 0.0241  -0.0534 -0.0052 158 ASP B N     
3525 C CA    . ASP B 132 ? 0.8829 0.5790 0.7956 0.0122  -0.0668 -0.0008 158 ASP B CA    
3526 C C     . ASP B 132 ? 0.8785 0.5857 0.8187 0.0169  -0.0638 0.0128  158 ASP B C     
3527 O O     . ASP B 132 ? 0.8917 0.5904 0.8470 0.0060  -0.0747 0.0238  158 ASP B O     
3528 C CB    . ASP B 132 ? 0.8848 0.5877 0.8066 -0.0052 -0.0851 0.0070  158 ASP B CB    
3529 C CG    . ASP B 132 ? 0.9177 0.5962 0.8045 -0.0130 -0.0947 -0.0055 158 ASP B CG    
3530 O OD1   . ASP B 132 ? 0.9457 0.5985 0.7962 -0.0036 -0.0839 -0.0205 158 ASP B OD1   
3531 O OD2   . ASP B 132 ? 0.9153 0.5999 0.8123 -0.0278 -0.1125 0.0021  158 ASP B OD2   
3532 N N     . LEU B 133 ? 0.8260 0.7460 0.9112 0.0325  -0.0592 0.0300  159 LEU B N     
3533 C CA    . LEU B 133 ? 0.8476 0.7613 0.9228 0.0476  -0.0566 0.0368  159 LEU B CA    
3534 C C     . LEU B 133 ? 0.8794 0.7585 0.9379 0.0529  -0.0563 0.0443  159 LEU B C     
3535 O O     . LEU B 133 ? 0.8949 0.7531 0.9502 0.0537  -0.0504 0.0562  159 LEU B O     
3536 C CB    . LEU B 133 ? 0.8461 0.7862 0.9157 0.0661  -0.0571 0.0248  159 LEU B CB    
3537 C CG    . LEU B 133 ? 0.8369 0.8043 0.9192 0.0664  -0.0549 0.0215  159 LEU B CG    
3538 C CD1   . LEU B 133 ? 0.8493 0.8513 0.9363 0.0788  -0.0578 0.0016  159 LEU B CD1   
3539 C CD2   . LEU B 133 ? 0.8581 0.8112 0.9298 0.0763  -0.0510 0.0352  159 LEU B CD2   
3540 N N     . ASP B 134 ? 0.8911 0.7618 0.9389 0.0558  -0.0605 0.0372  160 ASP B N     
3541 C CA    . ASP B 134 ? 0.9250 0.7603 0.9554 0.0601  -0.0600 0.0428  160 ASP B CA    
3542 C C     . ASP B 134 ? 0.9359 0.7455 0.9772 0.0437  -0.0574 0.0534  160 ASP B C     
3543 O O     . ASP B 134 ? 0.9658 0.7469 0.9966 0.0481  -0.0498 0.0618  160 ASP B O     
3544 C CB    . ASP B 134 ? 0.9277 0.7574 0.9485 0.0604  -0.0656 0.0332  160 ASP B CB    
3545 C CG    . ASP B 134 ? 0.9306 0.7808 0.9406 0.0798  -0.0661 0.0217  160 ASP B CG    
3546 O OD1   . ASP B 134 ? 0.9210 0.7906 0.9299 0.0946  -0.0645 0.0197  160 ASP B OD1   
3547 O OD2   . ASP B 134 ? 0.9368 0.7841 0.9396 0.0813  -0.0687 0.0134  160 ASP B OD2   
3548 N N     . ARG B 135 ? 0.9182 0.7374 0.9806 0.0257  -0.0627 0.0518  161 ARG B N     
3549 C CA    . ARG B 135 ? 0.9252 0.7271 1.0051 0.0096  -0.0634 0.0571  161 ARG B CA    
3550 C C     . ARG B 135 ? 0.9227 0.7284 1.0188 0.0061  -0.0538 0.0671  161 ARG B C     
3551 O O     . ARG B 135 ? 0.9441 0.7268 1.0476 0.0004  -0.0459 0.0734  161 ARG B O     
3552 C CB    . ARG B 135 ? 0.9100 0.7198 1.0024 -0.0036 -0.0751 0.0499  161 ARG B CB    
3553 C CG    . ARG B 135 ? 0.9125 0.7140 1.0296 -0.0192 -0.0796 0.0513  161 ARG B CG    
3554 C CD    . ARG B 135 ? 0.9147 0.7204 1.0353 -0.0264 -0.0942 0.0424  161 ARG B CD    
3555 N NE    . ARG B 135 ? 0.8935 0.7226 1.0148 -0.0255 -0.0944 0.0420  161 ARG B NE    
3556 C CZ    . ARG B 135 ? 0.8764 0.7204 1.0182 -0.0319 -0.0947 0.0453  161 ARG B CZ    
3557 N NH1   . ARG B 135 ? 0.8754 0.7174 1.0433 -0.0403 -0.0948 0.0485  161 ARG B NH1   
3558 N NH2   . ARG B 135 ? 0.8611 0.7214 0.9983 -0.0303 -0.0932 0.0446  161 ARG B NH2   
3559 N N     . ILE B 136 ? 0.8988 0.7314 1.0006 0.0091  -0.0523 0.0677  162 ILE B N     
3560 C CA    . ILE B 136 ? 0.8974 0.7340 1.0143 0.0056  -0.0432 0.0772  162 ILE B CA    
3561 C C     . ILE B 136 ? 0.9261 0.7455 1.0234 0.0215  -0.0297 0.0861  162 ILE B C     
3562 O O     . ILE B 136 ? 0.9359 0.7403 1.0417 0.0174  -0.0177 0.0958  162 ILE B O     
3563 C CB    . ILE B 136 ? 0.8681 0.7360 0.9980 0.0016  -0.0460 0.0751  162 ILE B CB    
3564 C CG1   . ILE B 136 ? 0.8568 0.7450 0.9706 0.0166  -0.0453 0.0696  162 ILE B CG1   
3565 C CG2   . ILE B 136 ? 0.8532 0.7294 0.9949 -0.0111 -0.0574 0.0677  162 ILE B CG2   
3566 C CD1   . ILE B 136 ? 0.8429 0.7555 0.9678 0.0143  -0.0428 0.0699  162 ILE B CD1   
3567 N N     . ALA B 137 ? 0.9461 0.7662 1.0162 0.0409  -0.0311 0.0820  163 ALA B N     
3568 C CA    . ALA B 137 ? 0.9842 0.7877 1.0269 0.0626  -0.0206 0.0891  163 ALA B CA    
3569 C C     . ALA B 137 ? 1.0323 0.7891 1.0576 0.0661  -0.0071 0.0989  163 ALA B C     
3570 O O     . ALA B 137 ? 1.0671 0.8006 1.0676 0.0829  0.0061  0.1081  163 ALA B O     
3571 C CB    . ALA B 137 ? 0.9827 0.8050 1.0035 0.0848  -0.0288 0.0784  163 ALA B CB    
3572 N N     . GLN B 138 ? 1.0450 0.7849 1.0806 0.0512  -0.0096 0.0963  164 GLN B N     
3573 C CA    . GLN B 138 ? 1.0926 0.7858 1.1144 0.0510  0.0043  0.1031  164 GLN B CA    
3574 C C     . GLN B 138 ? 1.1097 0.7820 1.1490 0.0388  0.0236  0.1139  164 GLN B C     
3575 O O     . GLN B 138 ? 1.0837 0.7808 1.1506 0.0279  0.0232  0.1154  164 GLN B O     
3576 C CB    . GLN B 138 ? 1.0942 0.7785 1.1271 0.0360  -0.0052 0.0946  164 GLN B CB    
3577 C CG    . GLN B 138 ? 1.1112 0.7997 1.1186 0.0508  -0.0173 0.0860  164 GLN B CG    
3578 C CD    . GLN B 138 ? 1.1292 0.8154 1.1496 0.0348  -0.0296 0.0764  164 GLN B CD    
3579 O OE1   . GLN B 138 ? 1.1571 0.8241 1.1964 0.0168  -0.0271 0.0761  164 GLN B OE1   
3580 N NE2   . GLN B 138 ? 1.1077 0.8134 1.1186 0.0418  -0.0426 0.0670  164 GLN B NE2   
3581 N N     . PRO B 139 ? 1.1598 0.7842 1.1825 0.0407  0.0430  0.1210  165 PRO B N     
3582 C CA    . PRO B 139 ? 1.1804 0.7815 1.2248 0.0256  0.0654  0.1293  165 PRO B CA    
3583 C C     . PRO B 139 ? 1.1682 0.7755 1.2626 -0.0057 0.0612  0.1200  165 PRO B C     
3584 O O     . PRO B 139 ? 1.1602 0.7743 1.2917 -0.0227 0.0711  0.1215  165 PRO B O     
3585 C CB    . PRO B 139 ? 1.2465 0.7880 1.2470 0.0422  0.0904  0.1395  165 PRO B CB    
3586 C CG    . PRO B 139 ? 1.2564 0.7954 1.2106 0.0697  0.0772  0.1364  165 PRO B CG    
3587 C CD    . PRO B 139 ? 1.2024 0.7890 1.1815 0.0597  0.0483  0.1223  165 PRO B CD    
3588 N N     . ASN B 140 ? 1.1702 0.7757 1.2653 -0.0117 0.0460  0.1092  166 ASN B N     
3589 C CA    . ASN B 140 ? 1.1616 0.7744 1.3008 -0.0381 0.0366  0.0966  166 ASN B CA    
3590 C C     . ASN B 140 ? 1.1069 0.7706 1.2806 -0.0487 0.0132  0.0880  166 ASN B C     
3591 O O     . ASN B 140 ? 1.0952 0.7704 1.3009 -0.0657 -0.0009 0.0752  166 ASN B O     
3592 C CB    . ASN B 140 ? 1.1854 0.7754 1.3068 -0.0379 0.0273  0.0876  166 ASN B CB    
3593 C CG    . ASN B 140 ? 1.2633 0.7956 1.3544 -0.0313 0.0526  0.0946  166 ASN B CG    
3594 O OD1   . ASN B 140 ? 1.3066 0.8110 1.3960 -0.0317 0.0796  0.1048  166 ASN B OD1   
3595 N ND2   . ASN B 140 ? 1.2849 0.7953 1.3491 -0.0247 0.0454  0.0892  166 ASN B ND2   
3596 N N     . TYR B 141 ? 1.0754 0.7667 1.2402 -0.0372 0.0097  0.0941  167 TYR B N     
3597 C CA    . TYR B 141 ? 1.0262 0.7603 1.2112 -0.0425 -0.0106 0.0873  167 TYR B CA    
3598 C C     . TYR B 141 ? 1.0048 0.7592 1.2366 -0.0602 -0.0109 0.0847  167 TYR B C     
3599 O O     . TYR B 141 ? 1.0018 0.7577 1.2452 -0.0609 0.0053  0.0938  167 TYR B O     
3600 C CB    . TYR B 141 ? 1.0052 0.7609 1.1641 -0.0245 -0.0136 0.0923  167 TYR B CB    
3601 C CG    . TYR B 141 ? 0.9609 0.7548 1.1397 -0.0302 -0.0261 0.0886  167 TYR B CG    
3602 C CD1   . TYR B 141 ? 0.9389 0.7490 1.1221 -0.0355 -0.0453 0.0777  167 TYR B CD1   
3603 C CD2   . TYR B 141 ? 0.9352 0.7443 1.1234 -0.0286 -0.0173 0.0964  167 TYR B CD2   
3604 C CE1   . TYR B 141 ? 0.9036 0.7416 1.0986 -0.0388 -0.0541 0.0751  167 TYR B CE1   
3605 C CE2   . TYR B 141 ? 0.8988 0.7390 1.1019 -0.0331 -0.0273 0.0932  167 TYR B CE2   
3606 C CZ    . TYR B 141 ? 0.8884 0.7419 1.0941 -0.0380 -0.0452 0.0827  167 TYR B CZ    
3607 O OH    . TYR B 141 ? 0.8454 0.7231 1.0600 -0.0408 -0.0528 0.0802  167 TYR B OH    
3608 N N     . ILE B 142 ? 0.9878 0.7577 1.2441 -0.0722 -0.0303 0.0714  168 ILE B N     
3609 C CA    . ILE B 142 ? 0.9641 0.7616 1.2625 -0.0846 -0.0379 0.0656  168 ILE B CA    
3610 C C     . ILE B 142 ? 0.9281 0.7540 1.2149 -0.0773 -0.0574 0.0625  168 ILE B C     
3611 O O     . ILE B 142 ? 0.9290 0.7523 1.1927 -0.0719 -0.0723 0.0557  168 ILE B O     
3612 C CB    . ILE B 142 ? 0.9766 0.7721 1.3131 -0.1014 -0.0480 0.0496  168 ILE B CB    
3613 C CG1   . ILE B 142 ? 1.0181 0.7763 1.3555 -0.1086 -0.0306 0.0491  168 ILE B CG1   
3614 C CG2   . ILE B 142 ? 0.9653 0.7883 1.3523 -0.1132 -0.0491 0.0443  168 ILE B CG2   
3615 C CD1   . ILE B 142 ? 1.0358 0.7898 1.4040 -0.1239 -0.0441 0.0294  168 ILE B CD1   
3616 N N     . PRO B 143 ? 0.9009 0.7502 1.2009 -0.0767 -0.0548 0.0678  169 PRO B N     
3617 C CA    . PRO B 143 ? 0.8750 0.7475 1.1668 -0.0716 -0.0707 0.0641  169 PRO B CA    
3618 C C     . PRO B 143 ? 0.8738 0.7550 1.1850 -0.0779 -0.0921 0.0496  169 PRO B C     
3619 O O     . PRO B 143 ? 0.8785 0.7682 1.2295 -0.0880 -0.0941 0.0433  169 PRO B O     
3620 C CB    . PRO B 143 ? 0.8555 0.7461 1.1617 -0.0712 -0.0596 0.0733  169 PRO B CB    
3621 C CG    . PRO B 143 ? 0.8675 0.7410 1.1690 -0.0689 -0.0370 0.0847  169 PRO B CG    
3622 C CD    . PRO B 143 ? 0.9008 0.7499 1.2126 -0.0771 -0.0332 0.0798  169 PRO B CD    
3623 N N     . THR B 144 ? 0.8724 0.7508 1.1554 -0.0706 -0.1075 0.0431  170 THR B N     
3624 C CA    . THR B 144 ? 0.8760 0.7591 1.1658 -0.0708 -0.1299 0.0293  170 THR B CA    
3625 C C     . THR B 144 ? 0.8607 0.7667 1.1643 -0.0681 -0.1355 0.0294  170 THR B C     
3626 O O     . THR B 144 ? 0.8414 0.7596 1.1520 -0.0684 -0.1211 0.0403  170 THR B O     
3627 C CB    . THR B 144 ? 0.8884 0.7559 1.1351 -0.0608 -0.1409 0.0243  170 THR B CB    
3628 O OG1   . THR B 144 ? 0.8720 0.7443 1.0905 -0.0527 -0.1320 0.0327  170 THR B OG1   
3629 C CG2   . THR B 144 ? 0.9016 0.7460 1.1334 -0.0617 -0.1374 0.0230  170 THR B CG2   
3630 N N     . GLN B 145 ? 0.8696 0.7792 1.1735 -0.0635 -0.1569 0.0168  171 GLN B N     
3631 C CA    . GLN B 145 ? 0.8587 0.7857 1.1667 -0.0565 -0.1646 0.0158  171 GLN B CA    
3632 C C     . GLN B 145 ? 0.8412 0.7634 1.1095 -0.0479 -0.1534 0.0273  171 GLN B C     
3633 O O     . GLN B 145 ? 0.8256 0.7620 1.1011 -0.0470 -0.1441 0.0353  171 GLN B O     
3634 C CB    . GLN B 145 ? 0.8824 0.8071 1.1849 -0.0476 -0.1916 -0.0007 171 GLN B CB    
3635 C CG    . GLN B 145 ? 0.9079 0.8487 1.2618 -0.0557 -0.2060 -0.0169 171 GLN B CG    
3636 C CD    . GLN B 145 ? 0.9144 0.8845 1.3045 -0.0535 -0.2121 -0.0212 171 GLN B CD    
3637 O OE1   . GLN B 145 ? 0.9176 0.8902 1.2830 -0.0385 -0.2210 -0.0204 171 GLN B OE1   
3638 N NE2   . GLN B 145 ? 0.9089 0.8994 1.3574 -0.0680 -0.2058 -0.0265 171 GLN B NE2   
3639 N N     . GLN B 146 ? 0.8429 0.7450 1.0714 -0.0423 -0.1529 0.0270  172 GLN B N     
3640 C CA    . GLN B 146 ? 0.8296 0.7259 1.0226 -0.0358 -0.1410 0.0339  172 GLN B CA    
3641 C C     . GLN B 146 ? 0.7989 0.7077 1.0009 -0.0409 -0.1205 0.0454  172 GLN B C     
3642 O O     . GLN B 146 ? 0.7898 0.7055 0.9818 -0.0382 -0.1110 0.0505  172 GLN B O     
3643 C CB    . GLN B 146 ? 0.8493 0.7219 1.0032 -0.0300 -0.1426 0.0293  172 GLN B CB    
3644 C CG    . GLN B 146 ? 0.8604 0.7227 0.9769 -0.0225 -0.1325 0.0313  172 GLN B CG    
3645 C CD    . GLN B 146 ? 0.8835 0.7408 0.9868 -0.0134 -0.1410 0.0291  172 GLN B CD    
3646 O OE1   . GLN B 146 ? 0.9086 0.7661 1.0219 -0.0086 -0.1607 0.0220  172 GLN B OE1   
3647 N NE2   . GLN B 146 ? 0.8665 0.7188 0.9471 -0.0101 -0.1264 0.0338  172 GLN B NE2   
3648 N N     . ASP B 147 ? 0.7859 0.6950 1.0041 -0.0469 -0.1136 0.0486  173 ASP B N     
3649 C CA    . ASP B 147 ? 0.7622 0.6797 0.9848 -0.0480 -0.0958 0.0588  173 ASP B CA    
3650 C C     . ASP B 147 ? 0.7382 0.6729 0.9833 -0.0502 -0.0893 0.0655  173 ASP B C     
3651 O O     . ASP B 147 ? 0.7230 0.6658 0.9587 -0.0471 -0.0782 0.0716  173 ASP B O     
3652 C CB    . ASP B 147 ? 0.7726 0.6802 1.0043 -0.0512 -0.0893 0.0615  173 ASP B CB    
3653 C CG    . ASP B 147 ? 0.7956 0.6861 1.0017 -0.0470 -0.0930 0.0562  173 ASP B CG    
3654 O OD1   . ASP B 147 ? 0.8002 0.6904 0.9805 -0.0410 -0.0932 0.0531  173 ASP B OD1   
3655 O OD2   . ASP B 147 ? 0.8374 0.7132 1.0496 -0.0502 -0.0936 0.0547  173 ASP B OD2   
3656 N N     . VAL B 148 ? 0.7317 0.6729 1.0086 -0.0556 -0.0965 0.0627  174 VAL B N     
3657 C CA    . VAL B 148 ? 0.7118 0.6703 1.0151 -0.0577 -0.0909 0.0679  174 VAL B CA    
3658 C C     . VAL B 148 ? 0.7015 0.6672 0.9875 -0.0503 -0.0947 0.0682  174 VAL B C     
3659 O O     . VAL B 148 ? 0.6844 0.6596 0.9723 -0.0491 -0.0831 0.0763  174 VAL B O     
3660 C CB    . VAL B 148 ? 0.7203 0.6874 1.0676 -0.0655 -0.0987 0.0606  174 VAL B CB    
3661 C CG1   . VAL B 148 ? 0.7054 0.6934 1.0809 -0.0658 -0.0954 0.0635  174 VAL B CG1   
3662 C CG2   . VAL B 148 ? 0.7274 0.6837 1.0937 -0.0747 -0.0865 0.0628  174 VAL B CG2   
3663 N N     . LEU B 149 ? 0.7094 0.6664 0.9746 -0.0443 -0.1097 0.0595  175 LEU B N     
3664 C CA    . LEU B 149 ? 0.7105 0.6640 0.9478 -0.0355 -0.1103 0.0599  175 LEU B CA    
3665 C C     . LEU B 149 ? 0.6934 0.6450 0.9083 -0.0357 -0.0919 0.0672  175 LEU B C     
3666 O O     . LEU B 149 ? 0.6847 0.6409 0.8929 -0.0329 -0.0841 0.0716  175 LEU B O     
3667 C CB    . LEU B 149 ? 0.7366 0.6697 0.9411 -0.0272 -0.1241 0.0505  175 LEU B CB    
3668 C CG    . LEU B 149 ? 0.7650 0.6960 0.9663 -0.0164 -0.1430 0.0424  175 LEU B CG    
3669 C CD1   . LEU B 149 ? 0.8065 0.7100 0.9666 -0.0065 -0.1540 0.0342  175 LEU B CD1   
3670 C CD2   . LEU B 149 ? 0.7556 0.6905 0.9471 -0.0091 -0.1367 0.0481  175 LEU B CD2   
3671 N N     . ARG B 150 ? 0.6887 0.6340 0.8930 -0.0383 -0.0859 0.0666  176 ARG B N     
3672 C CA    . ARG B 150 ? 0.6788 0.6248 0.8640 -0.0377 -0.0714 0.0682  176 ARG B CA    
3673 C C     . ARG B 150 ? 0.6662 0.6276 0.8663 -0.0393 -0.0589 0.0760  176 ARG B C     
3674 O O     . ARG B 150 ? 0.6564 0.6228 0.8438 -0.0379 -0.0484 0.0752  176 ARG B O     
3675 C CB    . ARG B 150 ? 0.6855 0.6217 0.8557 -0.0373 -0.0717 0.0625  176 ARG B CB    
3676 C CG    . ARG B 150 ? 0.6993 0.6164 0.8415 -0.0338 -0.0772 0.0546  176 ARG B CG    
3677 C CD    . ARG B 150 ? 0.6885 0.6017 0.8088 -0.0323 -0.0644 0.0528  176 ARG B CD    
3678 N NE    . ARG B 150 ? 0.7008 0.5905 0.7893 -0.0286 -0.0630 0.0457  176 ARG B NE    
3679 C CZ    . ARG B 150 ? 0.7176 0.5961 0.7829 -0.0283 -0.0478 0.0421  176 ARG B CZ    
3680 N NH1   . ARG B 150 ? 0.6864 0.5769 0.7581 -0.0321 -0.0346 0.0440  176 ARG B NH1   
3681 N NH2   . ARG B 150 ? 0.7569 0.6092 0.7913 -0.0244 -0.0440 0.0362  176 ARG B NH2   
3682 N N     . THR B 151 ? 0.6707 0.6385 0.8975 -0.0419 -0.0590 0.0822  177 THR B N     
3683 C CA    . THR B 151 ? 0.6725 0.6492 0.9087 -0.0410 -0.0459 0.0908  177 THR B CA    
3684 C C     . THR B 151 ? 0.6695 0.6554 0.9036 -0.0393 -0.0395 0.0943  177 THR B C     
3685 O O     . THR B 151 ? 0.6670 0.6530 0.9014 -0.0392 -0.0455 0.0925  177 THR B O     
3686 C CB    . THR B 151 ? 0.6780 0.6543 0.9429 -0.0448 -0.0429 0.0970  177 THR B CB    
3687 O OG1   . THR B 151 ? 0.6824 0.6662 0.9719 -0.0487 -0.0502 0.0956  177 THR B OG1   
3688 C CG2   . THR B 151 ? 0.6960 0.6589 0.9621 -0.0470 -0.0463 0.0940  177 THR B CG2   
3689 N N     . ARG B 152 ? 0.6744 0.6664 0.9035 -0.0360 -0.0278 0.0988  178 ARG B N     
3690 C CA    . ARG B 152 ? 0.6754 0.6747 0.9003 -0.0343 -0.0202 0.1017  178 ARG B CA    
3691 C C     . ARG B 152 ? 0.6879 0.6913 0.9261 -0.0315 -0.0102 0.1120  178 ARG B C     
3692 O O     . ARG B 152 ? 0.6961 0.6981 0.9254 -0.0259 -0.0036 0.1138  178 ARG B O     
3693 C CB    . ARG B 152 ? 0.6688 0.6708 0.8713 -0.0324 -0.0148 0.0935  178 ARG B CB    
3694 C CG    . ARG B 152 ? 0.6597 0.6539 0.8467 -0.0352 -0.0195 0.0829  178 ARG B CG    
3695 C CD    . ARG B 152 ? 0.6147 0.6156 0.7892 -0.0345 -0.0129 0.0718  178 ARG B CD    
3696 N NE    . ARG B 152 ? 0.5952 0.6054 0.7673 -0.0341 -0.0029 0.0700  178 ARG B NE    
3697 C CZ    . ARG B 152 ? 0.6123 0.6165 0.7751 -0.0383 0.0043  0.0675  178 ARG B CZ    
3698 N NH1   . ARG B 152 ? 0.6013 0.5886 0.7525 -0.0409 0.0027  0.0669  178 ARG B NH1   
3699 N NH2   . ARG B 152 ? 0.5920 0.6039 0.7533 -0.0384 0.0136  0.0650  178 ARG B NH2   
3700 N N     . VAL B 153 ? 0.9966 0.9367 0.9942 0.0013  -0.1511 0.0660  179 VAL B N     
3701 C CA    . VAL B 153 ? 1.0424 0.9861 1.0049 -0.0118 -0.1505 0.0899  179 VAL B CA    
3702 C C     . VAL B 153 ? 1.0235 1.0158 0.9950 -0.0123 -0.1281 0.0757  179 VAL B C     
3703 O O     . VAL B 153 ? 0.9830 0.9960 0.9871 -0.0105 -0.1112 0.0555  179 VAL B O     
3704 C CB    . VAL B 153 ? 1.0612 0.9876 1.0045 -0.0372 -0.1458 0.1221  179 VAL B CB    
3705 C CG1   . VAL B 153 ? 1.1149 0.9818 1.0409 -0.0389 -0.1774 0.1406  179 VAL B CG1   
3706 C CG2   . VAL B 153 ? 1.0145 0.9592 0.9863 -0.0462 -0.1208 0.1144  179 VAL B CG2   
3707 N N     . LYS B 154 ? 1.0674 1.0769 1.0084 -0.0140 -0.1308 0.0860  180 LYS B N     
3708 C CA    . LYS B 154 ? 1.0629 1.1193 1.0075 -0.0132 -0.1124 0.0719  180 LYS B CA    
3709 C C     . LYS B 154 ? 1.0551 1.1293 1.0018 -0.0306 -0.0904 0.0836  180 LYS B C     
3710 O O     . LYS B 154 ? 1.0745 1.1332 1.0047 -0.0482 -0.0908 0.1117  180 LYS B O     
3711 C CB    . LYS B 154 ? 1.1040 1.1820 1.0107 -0.0079 -0.1221 0.0788  180 LYS B CB    
3712 C CG    . LYS B 154 ? 1.1123 1.2002 1.0279 0.0146  -0.1362 0.0502  180 LYS B CG    
3713 C CD    . LYS B 154 ? 1.1647 1.2801 1.0382 0.0212  -0.1450 0.0566  180 LYS B CD    
3714 C CE    . LYS B 154 ? 1.1678 1.3007 1.0541 0.0447  -0.1586 0.0222  180 LYS B CE    
3715 N NZ    . LYS B 154 ? 1.1879 1.2888 1.0765 0.0581  -0.1845 0.0192  180 LYS B NZ    
3716 N N     . THR B 155 ? 1.0353 1.1399 1.0040 -0.0254 -0.0745 0.0609  181 THR B N     
3717 C CA    . THR B 155 ? 1.0319 1.1619 1.0033 -0.0358 -0.0557 0.0655  181 THR B CA    
3718 C C     . THR B 155 ? 1.0603 1.2415 1.0031 -0.0351 -0.0502 0.0682  181 THR B C     
3719 O O     . THR B 155 ? 1.0702 1.2743 1.0072 -0.0185 -0.0559 0.0474  181 THR B O     
3720 C CB    . THR B 155 ? 0.9951 1.1280 1.0028 -0.0282 -0.0458 0.0393  181 THR B CB    
3721 O OG1   . THR B 155 ? 0.9960 1.1370 1.0154 -0.0125 -0.0537 0.0122  181 THR B OG1   
3722 C CG2   . THR B 155 ? 0.9776 1.0742 1.0098 -0.0339 -0.0450 0.0425  181 THR B CG2   
3723 N N     . THR B 156 ? 1.0793 1.2844 1.0049 -0.0533 -0.0398 0.0925  182 THR B N     
3724 C CA    . THR B 156 ? 1.1051 1.3770 1.0049 -0.0539 -0.0304 0.0946  182 THR B CA    
3725 C C     . THR B 156 ? 1.0773 1.3924 0.9995 -0.0471 -0.0137 0.0724  182 THR B C     
3726 O O     . THR B 156 ? 1.0762 1.4164 0.9990 -0.0645 -0.0013 0.0890  182 THR B O     
3727 C CB    . THR B 156 ? 1.1518 1.4376 1.0129 -0.0818 -0.0311 0.1396  182 THR B CB    
3728 O OG1   . THR B 156 ? 1.1475 1.4223 1.0212 -0.1063 -0.0232 0.1614  182 THR B OG1   
3729 C CG2   . THR B 156 ? 1.1898 1.4223 1.0263 -0.0847 -0.0545 0.1609  182 THR B CG2   
3730 N N     . GLY B 157 ? 1.0597 1.3800 1.0019 -0.0216 -0.0168 0.0337  183 GLY B N     
3731 C CA    . GLY B 157 ? 1.0397 1.3932 1.0025 -0.0079 -0.0085 0.0065  183 GLY B CA    
3732 C C     . GLY B 157 ? 1.0070 1.3119 1.0043 -0.0096 -0.0076 0.0008  183 GLY B C     
3733 O O     . GLY B 157 ? 0.9933 1.2521 1.0108 -0.0020 -0.0176 -0.0132 183 GLY B O     
3734 N N     . ILE B 158 ? 0.9936 1.3146 0.9970 -0.0213 0.0042  0.0128  184 ILE B N     
3735 C CA    . ILE B 158 ? 0.9646 1.2467 0.9957 -0.0228 0.0056  0.0097  184 ILE B CA    
3736 C C     . ILE B 158 ? 0.9589 1.2221 0.9874 -0.0486 0.0116  0.0430  184 ILE B C     
3737 O O     . ILE B 158 ? 0.9706 1.2728 0.9847 -0.0649 0.0194  0.0624  184 ILE B O     
3738 C CB    . ILE B 158 ? 0.9596 1.2777 1.0051 -0.0049 0.0086  -0.0166 184 ILE B CB    
3739 C CG1   . ILE B 158 ? 0.9714 1.2945 1.0221 0.0236  -0.0049 -0.0541 184 ILE B CG1   
3740 C CG2   . ILE B 158 ? 0.9353 1.2143 1.0035 -0.0084 0.0094  -0.0140 184 ILE B CG2   
3741 C CD1   . ILE B 158 ? 0.9709 1.3347 1.0316 0.0488  -0.0083 -0.0866 184 ILE B CD1   
3742 N N     . VAL B 159 ? 0.9429 1.1497 0.9859 -0.0530 0.0066  0.0488  185 VAL B N     
3743 C CA    . VAL B 159 ? 0.9421 1.1230 0.9848 -0.0727 0.0070  0.0742  185 VAL B CA    
3744 C C     . VAL B 159 ? 0.9232 1.1035 0.9858 -0.0730 0.0135  0.0694  185 VAL B C     
3745 O O     . VAL B 159 ? 0.9090 1.0773 0.9876 -0.0580 0.0132  0.0502  185 VAL B O     
3746 C CB    . VAL B 159 ? 0.9425 1.0699 0.9872 -0.0731 -0.0046 0.0798  185 VAL B CB    
3747 C CG1   . VAL B 159 ? 0.9477 1.0462 0.9908 -0.0892 -0.0100 0.1013  185 VAL B CG1   
3748 C CG2   . VAL B 159 ? 0.9659 1.0927 0.9919 -0.0689 -0.0143 0.0813  185 VAL B CG2   
3749 N N     . GLU B 160 ? 0.9285 1.1199 0.9891 -0.0914 0.0169  0.0884  186 GLU B N     
3750 C CA    . GLU B 160 ? 0.9131 1.1047 0.9915 -0.0924 0.0210  0.0851  186 GLU B CA    
3751 C C     . GLU B 160 ? 0.9163 1.0731 0.9956 -0.1107 0.0138  0.1056  186 GLU B C     
3752 O O     . GLU B 160 ? 0.9428 1.0864 1.0076 -0.1273 0.0058  0.1262  186 GLU B O     
3753 C CB    . GLU B 160 ? 0.9193 1.1766 1.0014 -0.0942 0.0310  0.0799  186 GLU B CB    
3754 C CG    . GLU B 160 ? 0.9221 1.1842 1.0239 -0.0929 0.0332  0.0741  186 GLU B CG    
3755 C CD    . GLU B 160 ? 0.9523 1.2875 1.0605 -0.1017 0.0422  0.0739  186 GLU B CD    
3756 O OE1   . GLU B 160 ? 0.9798 1.3732 1.0783 -0.1013 0.0492  0.0706  186 GLU B OE1   
3757 O OE2   . GLU B 160 ? 0.9509 1.2924 1.0746 -0.1083 0.0423  0.0755  186 GLU B OE2   
3758 N N     . THR B 161 ? 0.8957 1.0343 0.9905 -0.1058 0.0132  0.0989  187 THR B N     
3759 C CA    . THR B 161 ? 0.8998 1.0141 0.9987 -0.1201 0.0048  0.1121  187 THR B CA    
3760 C C     . THR B 161 ? 0.8847 1.0199 0.9999 -0.1168 0.0102  0.1029  187 THR B C     
3761 O O     . THR B 161 ? 0.8668 1.0103 0.9890 -0.0979 0.0160  0.0856  187 THR B O     
3762 C CB    . THR B 161 ? 0.9026 0.9643 1.0003 -0.1118 -0.0071 0.1098  187 THR B CB    
3763 O OG1   . THR B 161 ? 0.9168 0.9538 1.0176 -0.1229 -0.0203 0.1188  187 THR B OG1   
3764 C CG2   . THR B 161 ? 0.8811 0.9353 0.9888 -0.0916 -0.0012 0.0914  187 THR B CG2   
3765 N N     . HIS B 162 ? 0.8972 1.0393 1.0187 -0.1357 0.0053  0.1149  188 HIS B N     
3766 C CA    . HIS B 162 ? 0.8871 1.0534 1.0256 -0.1326 0.0083  0.1052  188 HIS B CA    
3767 C C     . HIS B 162 ? 0.8923 1.0230 1.0377 -0.1395 -0.0055 0.1092  188 HIS B C     
3768 O O     . HIS B 162 ? 0.9180 1.0229 1.0594 -0.1588 -0.0189 0.1251  188 HIS B O     
3769 C CB    . HIS B 162 ? 0.8958 1.1308 1.0424 -0.1468 0.0177  0.1085  188 HIS B CB    
3770 C CG    . HIS B 162 ? 0.9405 1.1890 1.0813 -0.1818 0.0140  0.1359  188 HIS B CG    
3771 N ND1   . HIS B 162 ? 0.9700 1.2294 1.1246 -0.2086 0.0067  0.1496  188 HIS B ND1   
3772 C CD2   . HIS B 162 ? 0.9785 1.2308 1.1000 -0.1967 0.0145  0.1546  188 HIS B CD2   
3773 C CE1   . HIS B 162 ? 1.0108 1.2765 1.1549 -0.2416 0.0022  0.1785  188 HIS B CE1   
3774 N NE2   . HIS B 162 ? 1.0123 1.2742 1.1341 -0.2341 0.0072  0.1827  188 HIS B NE2   
3775 N N     . PHE B 163 ? 0.8726 0.9985 1.0264 -0.1220 -0.0057 0.0939  189 PHE B N     
3776 C CA    . PHE B 163 ? 0.8799 0.9769 1.0391 -0.1226 -0.0198 0.0918  189 PHE B CA    
3777 C C     . PHE B 163 ? 0.8679 0.9829 1.0372 -0.1078 -0.0181 0.0772  189 PHE B C     
3778 O O     . PHE B 163 ? 0.8527 0.9866 1.0213 -0.0912 -0.0082 0.0676  189 PHE B O     
3779 C CB    . PHE B 163 ? 0.8852 0.9349 1.0328 -0.1097 -0.0285 0.0883  189 PHE B CB    
3780 C CG    . PHE B 163 ? 0.8561 0.9034 0.9970 -0.0871 -0.0177 0.0774  189 PHE B CG    
3781 C CD1   . PHE B 163 ? 0.8455 0.8878 0.9859 -0.0712 -0.0188 0.0673  189 PHE B CD1   
3782 C CD2   . PHE B 163 ? 0.8413 0.8918 0.9758 -0.0838 -0.0082 0.0789  189 PHE B CD2   
3783 C CE1   . PHE B 163 ? 0.8331 0.8728 0.9661 -0.0569 -0.0100 0.0635  189 PHE B CE1   
3784 C CE2   . PHE B 163 ? 0.8289 0.8740 0.9599 -0.0686 -0.0012 0.0717  189 PHE B CE2   
3785 C CZ    . PHE B 163 ? 0.8235 0.8628 0.9535 -0.0574 -0.0019 0.0663  189 PHE B CZ    
3786 N N     . THR B 164 ? 0.8800 0.9852 1.0579 -0.1127 -0.0317 0.0746  190 THR B N     
3787 C CA    . THR B 164 ? 0.8751 0.9945 1.0604 -0.0974 -0.0339 0.0604  190 THR B CA    
3788 C C     . THR B 164 ? 0.8783 0.9621 1.0510 -0.0778 -0.0420 0.0515  190 THR B C     
3789 O O     . THR B 164 ? 0.8927 0.9464 1.0616 -0.0809 -0.0548 0.0518  190 THR B O     
3790 C CB    . THR B 164 ? 0.8878 1.0340 1.0947 -0.1168 -0.0440 0.0607  190 THR B CB    
3791 O OG1   . THR B 164 ? 0.8901 1.0804 1.1076 -0.1392 -0.0343 0.0718  190 THR B OG1   
3792 C CG2   . THR B 164 ? 0.8808 1.0503 1.0961 -0.0982 -0.0464 0.0437  190 THR B CG2   
3793 N N     . PHE B 165 ? 0.8677 0.9574 1.0323 -0.0565 -0.0364 0.0434  191 PHE B N     
3794 C CA    . PHE B 165 ? 0.8745 0.9444 1.0234 -0.0385 -0.0402 0.0374  191 PHE B CA    
3795 C C     . PHE B 165 ? 0.8774 0.9599 1.0193 -0.0209 -0.0393 0.0320  191 PHE B C     
3796 O O     . PHE B 165 ? 0.8706 0.9611 1.0111 -0.0158 -0.0319 0.0348  191 PHE B O     
3797 C CB    . PHE B 165 ? 0.8675 0.9207 1.0029 -0.0350 -0.0307 0.0437  191 PHE B CB    
3798 C CG    . PHE B 165 ? 0.8679 0.9158 0.9874 -0.0191 -0.0310 0.0392  191 PHE B CG    
3799 C CD1   . PHE B 165 ? 0.8789 0.9238 0.9966 -0.0110 -0.0446 0.0270  191 PHE B CD1   
3800 C CD2   . PHE B 165 ? 0.8668 0.9160 0.9732 -0.0132 -0.0192 0.0471  191 PHE B CD2   
3801 C CE1   . PHE B 165 ? 0.8923 0.9471 0.9938 0.0055  -0.0431 0.0208  191 PHE B CE1   
3802 C CE2   . PHE B 165 ? 0.8705 0.9267 0.9613 -0.0030 -0.0169 0.0468  191 PHE B CE2   
3803 C CZ    . PHE B 165 ? 0.8864 0.9512 0.9740 0.0076  -0.0272 0.0327  191 PHE B CZ    
3804 N N     . LYS B 166 ? 0.8953 0.9776 1.0316 -0.0095 -0.0503 0.0227  192 LYS B N     
3805 C CA    . LYS B 166 ? 0.9097 1.0027 1.0359 0.0081  -0.0538 0.0182  192 LYS B CA    
3806 C C     . LYS B 166 ? 0.9067 1.0215 1.0483 0.0081  -0.0541 0.0151  192 LYS B C     
3807 O O     . LYS B 166 ? 0.9153 1.0279 1.0460 0.0216  -0.0520 0.0177  192 LYS B O     
3808 C CB    . LYS B 166 ? 0.9188 0.9995 1.0175 0.0203  -0.0454 0.0287  192 LYS B CB    
3809 C CG    . LYS B 166 ? 0.9428 1.0237 1.0245 0.0281  -0.0470 0.0256  192 LYS B CG    
3810 C CD    . LYS B 166 ? 0.9718 1.0522 1.0262 0.0344  -0.0372 0.0408  192 LYS B CD    
3811 C CE    . LYS B 166 ? 0.9947 1.0939 1.0334 0.0432  -0.0366 0.0347  192 LYS B CE    
3812 N NZ    . LYS B 166 ? 1.0024 1.1127 1.0157 0.0423  -0.0242 0.0536  192 LYS B NZ    
3813 N N     . ASP B 167 ? 0.9009 1.0381 1.0684 -0.0075 -0.0590 0.0092  193 ASP B N     
3814 C CA    . ASP B 167 ? 0.8977 1.0743 1.0862 -0.0092 -0.0588 0.0022  193 ASP B CA    
3815 C C     . ASP B 167 ? 0.8822 1.0707 1.0734 -0.0125 -0.0454 0.0073  193 ASP B C     
3816 O O     . ASP B 167 ? 0.8781 1.1111 1.0902 -0.0190 -0.0428 0.0009  193 ASP B O     
3817 C CB    . ASP B 167 ? 0.9115 1.1003 1.0951 0.0159  -0.0689 -0.0099 193 ASP B CB    
3818 C CG    . ASP B 167 ? 0.9332 1.1238 1.1186 0.0203  -0.0846 -0.0201 193 ASP B CG    
3819 O OD1   . ASP B 167 ? 0.9362 1.1109 1.1237 0.0070  -0.0893 -0.0190 193 ASP B OD1   
3820 O OD2   . ASP B 167 ? 0.9526 1.1589 1.1365 0.0398  -0.0955 -0.0315 193 ASP B OD2   
3821 N N     . LEU B 168 ? 0.8768 1.0321 1.0481 -0.0078 -0.0376 0.0169  194 LEU B N     
3822 C CA    . LEU B 168 ? 0.8659 1.0268 1.0373 -0.0063 -0.0285 0.0182  194 LEU B CA    
3823 C C     . LEU B 168 ? 0.8515 1.0254 1.0322 -0.0297 -0.0194 0.0260  194 LEU B C     
3824 O O     . LEU B 168 ? 0.8505 1.0039 1.0283 -0.0450 -0.0202 0.0356  194 LEU B O     
3825 C CB    . LEU B 168 ? 0.8753 0.9944 1.0238 0.0054  -0.0269 0.0259  194 LEU B CB    
3826 C CG    . LEU B 168 ? 0.8948 0.9904 1.0246 0.0239  -0.0365 0.0276  194 LEU B CG    
3827 C CD1   . LEU B 168 ? 0.9066 0.9640 1.0158 0.0236  -0.0330 0.0423  194 LEU B CD1   
3828 C CD2   . LEU B 168 ? 0.9103 1.0210 1.0453 0.0444  -0.0484 0.0140  194 LEU B CD2   
3829 N N     . HIS B 169 ? 0.8438 1.0535 1.0340 -0.0300 -0.0130 0.0205  195 HIS B N     
3830 C CA    . HIS B 169 ? 0.8361 1.0661 1.0308 -0.0517 -0.0039 0.0297  195 HIS B CA    
3831 C C     . HIS B 169 ? 0.8294 1.0349 1.0091 -0.0435 0.0018  0.0314  195 HIS B C     
3832 O O     . HIS B 169 ? 0.8314 1.0550 1.0119 -0.0269 0.0027  0.0184  195 HIS B O     
3833 C CB    . HIS B 169 ? 0.8378 1.1400 1.0528 -0.0586 0.0006  0.0214  195 HIS B CB    
3834 C CG    . HIS B 169 ? 0.8541 1.1874 1.0893 -0.0762 -0.0049 0.0228  195 HIS B CG    
3835 N ND1   . HIS B 169 ? 0.8651 1.2036 1.1094 -0.0600 -0.0152 0.0086  195 HIS B ND1   
3836 C CD2   . HIS B 169 ? 0.8697 1.2301 1.1185 -0.1106 -0.0041 0.0376  195 HIS B CD2   
3837 C CE1   . HIS B 169 ? 0.8728 1.2423 1.1383 -0.0829 -0.0202 0.0116  195 HIS B CE1   
3838 N NE2   . HIS B 169 ? 0.8766 1.2581 1.1457 -0.1158 -0.0141 0.0306  195 HIS B NE2   
3839 N N     . PHE B 170 ? 0.7252 1.0764 1.1376 -0.0567 -0.0466 -0.0657 196 PHE B N     
3840 C CA    . PHE B 170 ? 0.7036 1.0452 1.0716 -0.0507 -0.0277 -0.0464 196 PHE B CA    
3841 C C     . PHE B 170 ? 0.6883 1.0406 1.0666 -0.0694 -0.0004 -0.0288 196 PHE B C     
3842 O O     . PHE B 170 ? 0.6973 1.0427 1.0940 -0.0866 0.0073  -0.0235 196 PHE B O     
3843 C CB    . PHE B 170 ? 0.7164 1.0198 1.0353 -0.0386 -0.0331 -0.0390 196 PHE B CB    
3844 C CG    . PHE B 170 ? 0.7237 1.0104 1.0118 -0.0135 -0.0526 -0.0500 196 PHE B CG    
3845 C CD1   . PHE B 170 ? 0.7510 1.0183 1.0384 -0.0034 -0.0772 -0.0661 196 PHE B CD1   
3846 C CD2   . PHE B 170 ? 0.7069 0.9927 0.9634 0.0011  -0.0466 -0.0442 196 PHE B CD2   
3847 C CE1   . PHE B 170 ? 0.7685 1.0148 1.0190 0.0240  -0.0944 -0.0757 196 PHE B CE1   
3848 C CE2   . PHE B 170 ? 0.7282 0.9927 0.9504 0.0258  -0.0611 -0.0522 196 PHE B CE2   
3849 C CZ    . PHE B 170 ? 0.7537 0.9981 0.9704 0.0389  -0.0845 -0.0676 196 PHE B CZ    
3850 N N     . LYS B 171 ? 0.6684 1.0330 1.0303 -0.0645 0.0134  -0.0200 197 LYS B N     
3851 C CA    . LYS B 171 ? 0.6618 1.0281 1.0156 -0.0748 0.0374  -0.0024 197 LYS B CA    
3852 C C     . LYS B 171 ? 0.6484 1.0000 0.9557 -0.0634 0.0412  0.0085  197 LYS B C     
3853 O O     . LYS B 171 ? 0.6380 0.9966 0.9325 -0.0523 0.0378  0.0051  197 LYS B O     
3854 C CB    . LYS B 171 ? 0.6573 1.0563 1.0447 -0.0821 0.0523  -0.0032 197 LYS B CB    
3855 C CG    . LYS B 171 ? 0.6794 1.0918 1.1170 -0.1015 0.0595  -0.0061 197 LYS B CG    
3856 C CD    . LYS B 171 ? 0.6830 1.1363 1.1647 -0.1059 0.0719  -0.0110 197 LYS B CD    
3857 C CE    . LYS B 171 ? 0.7085 1.1782 1.2510 -0.1270 0.0755  -0.0169 197 LYS B CE    
3858 N NZ    . LYS B 171 ? 0.7144 1.2304 1.3086 -0.1322 0.0908  -0.0210 197 LYS B NZ    
3859 N N     . MET B 172 ? 0.6488 0.9793 0.9322 -0.0660 0.0473  0.0209  198 MET B N     
3860 C CA    . MET B 172 ? 0.6383 0.9581 0.8856 -0.0567 0.0491  0.0302  198 MET B CA    
3861 C C     . MET B 172 ? 0.6373 0.9585 0.8728 -0.0616 0.0653  0.0430  198 MET B C     
3862 O O     . MET B 172 ? 0.6513 0.9618 0.8854 -0.0689 0.0743  0.0508  198 MET B O     
3863 C CB    . MET B 172 ? 0.6470 0.9437 0.8735 -0.0501 0.0407  0.0327  198 MET B CB    
3864 C CG    . MET B 172 ? 0.6415 0.9327 0.8394 -0.0406 0.0423  0.0413  198 MET B CG    
3865 S SD    . MET B 172 ? 0.6633 0.9312 0.8389 -0.0294 0.0349  0.0441  198 MET B SD    
3866 C CE    . MET B 172 ? 0.6562 0.9185 0.8244 -0.0148 0.0222  0.0333  198 MET B CE    
3867 N N     . PHE B 173 ? 0.6240 0.9538 0.8473 -0.0561 0.0676  0.0444  199 PHE B N     
3868 C CA    . PHE B 173 ? 0.6302 0.9591 0.8376 -0.0567 0.0791  0.0539  199 PHE B CA    
3869 C C     . PHE B 173 ? 0.6224 0.9423 0.8041 -0.0502 0.0740  0.0596  199 PHE B C     
3870 O O     . PHE B 173 ? 0.6102 0.9300 0.7882 -0.0455 0.0649  0.0564  199 PHE B O     
3871 C CB    . PHE B 173 ? 0.6288 0.9731 0.8412 -0.0544 0.0848  0.0501  199 PHE B CB    
3872 C CG    . PHE B 173 ? 0.6588 1.0203 0.9036 -0.0601 0.0912  0.0440  199 PHE B CG    
3873 C CD1   . PHE B 173 ? 0.6881 1.0510 0.9468 -0.0695 0.1079  0.0510  199 PHE B CD1   
3874 C CD2   . PHE B 173 ? 0.6634 1.0400 0.9263 -0.0554 0.0812  0.0312  199 PHE B CD2   
3875 C CE1   . PHE B 173 ? 0.6953 1.0799 0.9938 -0.0772 0.1155  0.0452  199 PHE B CE1   
3876 C CE2   . PHE B 173 ? 0.6705 1.0697 0.9711 -0.0601 0.0854  0.0235  199 PHE B CE2   
3877 C CZ    . PHE B 173 ? 0.6824 1.0884 1.0050 -0.0724 0.1030  0.0305  199 PHE B CZ    
3878 N N     . ASP B 174 ? 0.6286 0.9410 0.7934 -0.0492 0.0806  0.0679  200 ASP B N     
3879 C CA    . ASP B 174 ? 0.6220 0.9309 0.7683 -0.0428 0.0743  0.0715  200 ASP B CA    
3880 C C     . ASP B 174 ? 0.6416 0.9465 0.7690 -0.0385 0.0794  0.0753  200 ASP B C     
3881 O O     . ASP B 174 ? 0.6598 0.9526 0.7746 -0.0373 0.0888  0.0819  200 ASP B O     
3882 C CB    . ASP B 174 ? 0.6204 0.9191 0.7600 -0.0402 0.0716  0.0766  200 ASP B CB    
3883 C CG    . ASP B 174 ? 0.5986 0.8994 0.7246 -0.0326 0.0653  0.0800  200 ASP B CG    
3884 O OD1   . ASP B 174 ? 0.5690 0.8795 0.6957 -0.0317 0.0600  0.0769  200 ASP B OD1   
3885 O OD2   . ASP B 174 ? 0.5641 0.8565 0.6797 -0.0270 0.0645  0.0847  200 ASP B OD2   
3886 N N     . VAL B 175 ? 0.6461 0.9566 0.7677 -0.0350 0.0728  0.0708  201 VAL B N     
3887 C CA    . VAL B 175 ? 0.6767 0.9802 0.7746 -0.0271 0.0731  0.0719  201 VAL B CA    
3888 C C     . VAL B 175 ? 0.6937 0.9893 0.7745 -0.0200 0.0660  0.0757  201 VAL B C     
3889 O O     . VAL B 175 ? 0.7211 1.0032 0.7756 -0.0105 0.0695  0.0792  201 VAL B O     
3890 C CB    . VAL B 175 ? 0.6741 0.9814 0.7692 -0.0248 0.0636  0.0639  201 VAL B CB    
3891 C CG1   . VAL B 175 ? 0.7069 1.0026 0.7726 -0.0135 0.0604  0.0631  201 VAL B CG1   
3892 C CG2   . VAL B 175 ? 0.6672 0.9817 0.7751 -0.0275 0.0697  0.0593  201 VAL B CG2   
3893 N N     . GLY B 176 ? 0.6876 0.9917 0.7817 -0.0221 0.0565  0.0748  202 GLY B N     
3894 C CA    . GLY B 176 ? 0.7051 1.0082 0.7897 -0.0140 0.0484  0.0771  202 GLY B CA    
3895 C C     . GLY B 176 ? 0.7272 1.0321 0.8006 -0.0065 0.0347  0.0713  202 GLY B C     
3896 O O     . GLY B 176 ? 0.7233 1.0327 0.8032 -0.0106 0.0283  0.0648  202 GLY B O     
3897 N N     . GLY B 177 ? 0.7569 1.0550 0.8107 0.0061  0.0284  0.0725  203 GLY B N     
3898 C CA    . GLY B 177 ? 0.7865 1.0877 0.8320 0.0155  0.0098  0.0643  203 GLY B CA    
3899 C C     . GLY B 177 ? 0.8320 1.1115 0.8408 0.0276  0.0086  0.0616  203 GLY B C     
3900 O O     . GLY B 177 ? 0.8522 1.1298 0.8493 0.0379  -0.0101 0.0527  203 GLY B O     
3901 N N     . GLN B 178 ? 0.8502 1.1135 0.8413 0.0273  0.0283  0.0688  204 GLN B N     
3902 C CA    . GLN B 178 ? 0.8946 1.1364 0.8480 0.0408  0.0323  0.0683  204 GLN B CA    
3903 C C     . GLN B 178 ? 0.8870 1.1347 0.8485 0.0365  0.0244  0.0591  204 GLN B C     
3904 O O     . GLN B 178 ? 0.8597 1.1192 0.8462 0.0228  0.0332  0.0595  204 GLN B O     
3905 C CB    . GLN B 178 ? 0.9128 1.1379 0.8492 0.0414  0.0600  0.0809  204 GLN B CB    
3906 C CG    . GLN B 178 ? 0.9835 1.1788 0.8680 0.0623  0.0683  0.0850  204 GLN B CG    
3907 C CD    . GLN B 178 ? 1.0226 1.2019 0.8953 0.0602  0.1001  0.0997  204 GLN B CD    
3908 O OE1   . GLN B 178 ? 1.0425 1.2086 0.9092 0.0586  0.1099  0.1089  204 GLN B OE1   
3909 N NE2   . GLN B 178 ? 1.0374 1.2174 0.9078 0.0603  0.1168  0.1020  204 GLN B NE2   
3910 N N     . ARG B 179 ? 0.9149 1.1517 0.8527 0.0499  0.0055  0.0495  205 ARG B N     
3911 C CA    . ARG B 179 ? 0.9227 1.1565 0.8591 0.0489  -0.0045 0.0397  205 ARG B CA    
3912 C C     . ARG B 179 ? 0.9306 1.1540 0.8480 0.0537  0.0174  0.0452  205 ARG B C     
3913 O O     . ARG B 179 ? 0.9563 1.1646 0.8435 0.0665  0.0354  0.0541  205 ARG B O     
3914 C CB    . ARG B 179 ? 0.9649 1.1836 0.8747 0.0650  -0.0318 0.0268  205 ARG B CB    
3915 C CG    . ARG B 179 ? 0.9689 1.2065 0.9113 0.0573  -0.0569 0.0178  205 ARG B CG    
3916 C CD    . ARG B 179 ? 1.0257 1.2525 0.9571 0.0658  -0.0884 0.0006  205 ARG B CD    
3917 N NE    . ARG B 179 ? 1.0415 1.2914 1.0101 0.0589  -0.1124 -0.0085 205 ARG B NE    
3918 C CZ    . ARG B 179 ? 1.0289 1.2951 1.0407 0.0399  -0.1292 -0.0181 205 ARG B CZ    
3919 N NH1   . ARG B 179 ? 1.0235 1.2800 1.0409 0.0268  -0.1264 -0.0201 205 ARG B NH1   
3920 N NH2   . ARG B 179 ? 1.0161 1.3083 1.0665 0.0343  -0.1483 -0.0257 205 ARG B NH2   
3921 N N     . SER B 180 ? 0.9070 1.1385 0.8428 0.0440  0.0168  0.0401  206 SER B N     
3922 C CA    . SER B 180 ? 0.9040 1.1340 0.8316 0.0480  0.0364  0.0435  206 SER B CA    
3923 C C     . SER B 180 ? 0.9136 1.1337 0.8286 0.0537  0.0226  0.0320  206 SER B C     
3924 O O     . SER B 180 ? 0.8989 1.1197 0.8297 0.0438  0.0022  0.0231  206 SER B O     
3925 C CB    . SER B 180 ? 0.8625 1.1151 0.8304 0.0304  0.0529  0.0496  206 SER B CB    
3926 O OG    . SER B 180 ? 0.8554 1.1131 0.8350 0.0240  0.0619  0.0588  206 SER B OG    
3927 N N     . GLU B 181 ? 0.9375 1.1470 0.8237 0.0698  0.0352  0.0328  207 GLU B N     
3928 C CA    . GLU B 181 ? 0.9587 1.1529 0.8236 0.0799  0.0217  0.0214  207 GLU B CA    
3929 C C     . GLU B 181 ? 0.9260 1.1354 0.8184 0.0696  0.0278  0.0190  207 GLU B C     
3930 O O     . GLU B 181 ? 0.8888 1.1222 0.8151 0.0574  0.0446  0.0261  207 GLU B O     
3931 C CB    . GLU B 181 ? 1.0152 1.1857 0.8264 0.1085  0.0287  0.0217  207 GLU B CB    
3932 C CG    . GLU B 181 ? 1.0702 1.2132 0.8416 0.1244  0.0075  0.0159  207 GLU B CG    
3933 C CD    . GLU B 181 ? 1.1600 1.2715 0.8683 0.1573  0.0100  0.0137  207 GLU B CD    
3934 O OE1   . GLU B 181 ? 1.1865 1.2922 0.8795 0.1678  0.0151  0.0100  207 GLU B OE1   
3935 O OE2   . GLU B 181 ? 1.2031 1.2933 0.8726 0.1757  0.0063  0.0155  207 GLU B OE2   
3936 N N     . ARG B 182 ? 0.9419 1.1335 0.8166 0.0760  0.0116  0.0079  208 ARG B N     
3937 C CA    . ARG B 182 ? 0.9233 1.1204 0.8158 0.0688  0.0110  0.0032  208 ARG B CA    
3938 C C     . ARG B 182 ? 0.8972 1.1221 0.8124 0.0694  0.0362  0.0098  208 ARG B C     
3939 O O     . ARG B 182 ? 0.8625 1.1052 0.8127 0.0545  0.0391  0.0109  208 ARG B O     
3940 C CB    . ARG B 182 ? 0.9678 1.1344 0.8222 0.0846  -0.0051 -0.0086 208 ARG B CB    
3941 C CG    . ARG B 182 ? 0.9770 1.1397 0.8414 0.0789  -0.0099 -0.0146 208 ARG B CG    
3942 C CD    . ARG B 182 ? 1.0479 1.1801 0.8678 0.1008  -0.0199 -0.0252 208 ARG B CD    
3943 N NE    . ARG B 182 ? 1.0680 1.1910 0.8928 0.0967  -0.0253 -0.0308 208 ARG B NE    
3944 C CZ    . ARG B 182 ? 1.1123 1.1993 0.9211 0.0909  -0.0471 -0.0395 208 ARG B CZ    
3945 N NH1   . ARG B 182 ? 1.1495 1.2101 0.9422 0.0872  -0.0681 -0.0456 208 ARG B NH1   
3946 N NH2   . ARG B 182 ? 1.1246 1.1998 0.9330 0.0894  -0.0486 -0.0428 208 ARG B NH2   
3947 N N     . LYS B 183 ? 0.9141 1.1426 0.8099 0.0874  0.0543  0.0138  209 LYS B N     
3948 C CA    . LYS B 183 ? 0.8933 1.1514 0.8149 0.0892  0.0778  0.0180  209 LYS B CA    
3949 C C     . LYS B 183 ? 0.8467 1.1320 0.8136 0.0691  0.0915  0.0271  209 LYS B C     
3950 O O     . LYS B 183 ? 0.8195 1.1299 0.8220 0.0620  0.0988  0.0256  209 LYS B O     
3951 C CB    . LYS B 183 ? 0.9327 1.1903 0.8257 0.1129  0.0981  0.0222  209 LYS B CB    
3952 C CG    . LYS B 183 ? 0.9842 1.2161 0.8310 0.1375  0.0859  0.0117  209 LYS B CG    
3953 C CD    . LYS B 183 ? 0.9919 1.2393 0.8544 0.1427  0.0860  0.0033  209 LYS B CD    
3954 C CE    . LYS B 183 ? 1.0516 1.2790 0.8654 0.1742  0.0853  -0.0035 209 LYS B CE    
3955 N NZ    . LYS B 183 ? 1.0459 1.2960 0.8756 0.1854  0.0921  -0.0100 209 LYS B NZ    
3956 N N     . LYS B 184 ? 0.8388 1.1171 0.8026 0.0617  0.0927  0.0350  210 LYS B N     
3957 C CA    . LYS B 184 ? 0.8079 1.1048 0.8090 0.0433  0.1026  0.0429  210 LYS B CA    
3958 C C     . LYS B 184 ? 0.7667 1.0707 0.7968 0.0271  0.0864  0.0371  210 LYS B C     
3959 O O     . LYS B 184 ? 0.7385 1.0618 0.8033 0.0157  0.0934  0.0389  210 LYS B O     
3960 C CB    . LYS B 184 ? 0.8263 1.1087 0.8098 0.0429  0.1062  0.0522  210 LYS B CB    
3961 C CG    . LYS B 184 ? 0.8316 1.1279 0.8462 0.0275  0.1217  0.0621  210 LYS B CG    
3962 C CD    . LYS B 184 ? 0.9042 1.1840 0.8919 0.0353  0.1391  0.0744  210 LYS B CD    
3963 C CE    . LYS B 184 ? 0.9155 1.2094 0.9339 0.0230  0.1655  0.0850  210 LYS B CE    
3964 N NZ    . LYS B 184 ? 0.9709 1.2444 0.9572 0.0334  0.1897  0.0990  210 LYS B NZ    
3965 N N     . TRP B 185 ? 0.7621 1.0483 0.7770 0.0268  0.0653  0.0302  211 TRP B N     
3966 C CA    . TRP B 185 ? 0.7322 1.0203 0.7685 0.0137  0.0530  0.0264  211 TRP B CA    
3967 C C     . TRP B 185 ? 0.7224 1.0180 0.7689 0.0173  0.0540  0.0195  211 TRP B C     
3968 O O     . TRP B 185 ? 0.6955 1.0008 0.7659 0.0089  0.0534  0.0190  211 TRP B O     
3969 C CB    . TRP B 185 ? 0.7399 1.0068 0.7612 0.0104  0.0328  0.0218  211 TRP B CB    
3970 C CG    . TRP B 185 ? 0.7261 0.9941 0.7537 0.0024  0.0275  0.0269  211 TRP B CG    
3971 C CD1   . TRP B 185 ? 0.7388 0.9944 0.7452 0.0089  0.0171  0.0253  211 TRP B CD1   
3972 C CD2   . TRP B 185 ? 0.6993 0.9811 0.7544 -0.0103 0.0305  0.0330  211 TRP B CD2   
3973 N NE1   . TRP B 185 ? 0.7193 0.9832 0.7411 0.0009  0.0135  0.0299  211 TRP B NE1   
3974 C CE2   . TRP B 185 ? 0.6959 0.9758 0.7470 -0.0109 0.0227  0.0353  211 TRP B CE2   
3975 C CE3   . TRP B 185 ? 0.6695 0.9637 0.7494 -0.0186 0.0377  0.0358  211 TRP B CE3   
3976 C CZ2   . TRP B 185 ? 0.6742 0.9658 0.7460 -0.0193 0.0236  0.0411  211 TRP B CZ2   
3977 C CZ3   . TRP B 185 ? 0.6498 0.9520 0.7469 -0.0268 0.0383  0.0417  211 TRP B CZ3   
3978 C CH2   . TRP B 185 ? 0.6450 0.9468 0.7384 -0.0271 0.0323  0.0448  211 TRP B CH2   
3979 N N     . ILE B 186 ? 0.7421 1.0313 0.7667 0.0330  0.0546  0.0137  212 ILE B N     
3980 C CA    . ILE B 186 ? 0.7386 1.0345 0.7681 0.0416  0.0543  0.0056  212 ILE B CA    
3981 C C     . ILE B 186 ? 0.7130 1.0425 0.7819 0.0374  0.0682  0.0072  212 ILE B C     
3982 O O     . ILE B 186 ? 0.6957 1.0323 0.7824 0.0354  0.0623  0.0014  212 ILE B O     
3983 C CB    . ILE B 186 ? 0.7749 1.0619 0.7730 0.0634  0.0559  -0.0002 212 ILE B CB    
3984 C CG1   . ILE B 186 ? 0.8082 1.0564 0.7651 0.0685  0.0374  -0.0050 212 ILE B CG1   
3985 C CG2   . ILE B 186 ? 0.7673 1.0683 0.7747 0.0755  0.0574  -0.0089 212 ILE B CG2   
3986 C CD1   . ILE B 186 ? 0.8194 1.0430 0.7682 0.0637  0.0198  -0.0123 212 ILE B CD1   
3987 N N     . HIS B 187 ? 0.7107 1.0578 0.7919 0.0365  0.0860  0.0147  213 HIS B N     
3988 C CA    . HIS B 187 ? 0.6917 1.0714 0.8154 0.0303  0.1003  0.0159  213 HIS B CA    
3989 C C     . HIS B 187 ? 0.6586 1.0410 0.8081 0.0128  0.0944  0.0180  213 HIS B C     
3990 O O     . HIS B 187 ? 0.6429 1.0468 0.8276 0.0080  0.0955  0.0134  213 HIS B O     
3991 C CB    . HIS B 187 ? 0.7072 1.0997 0.8352 0.0324  0.1245  0.0256  213 HIS B CB    
3992 C CG    . HIS B 187 ? 0.7630 1.1563 0.8666 0.0535  0.1338  0.0237  213 HIS B CG    
3993 N ND1   . HIS B 187 ? 0.7832 1.1837 0.8838 0.0683  0.1259  0.0120  213 HIS B ND1   
3994 C CD2   . HIS B 187 ? 0.8087 1.1939 0.8849 0.0654  0.1510  0.0322  213 HIS B CD2   
3995 C CE1   . HIS B 187 ? 0.8241 1.2225 0.8981 0.0882  0.1375  0.0130  213 HIS B CE1   
3996 N NE2   . HIS B 187 ? 0.8412 1.2300 0.8993 0.0871  0.1533  0.0255  213 HIS B NE2   
3997 N N     . CYS B 188 ? 0.6491 1.0100 0.7810 0.0052  0.0867  0.0239  214 CYS B N     
3998 C CA    . CYS B 188 ? 0.6272 0.9863 0.7755 -0.0076 0.0801  0.0261  214 CYS B CA    
3999 C C     . CYS B 188 ? 0.6022 0.9570 0.7542 -0.0058 0.0660  0.0176  214 CYS B C     
4000 O O     . CYS B 188 ? 0.5869 0.9508 0.7613 -0.0099 0.0637  0.0147  214 CYS B O     
4001 C CB    . CYS B 188 ? 0.6323 0.9730 0.7613 -0.0130 0.0754  0.0338  214 CYS B CB    
4002 S SG    . CYS B 188 ? 0.6872 1.0319 0.8287 -0.0225 0.0879  0.0447  214 CYS B SG    
4003 N N     . PHE B 189 ? 0.6044 0.9408 0.7306 0.0013  0.0563  0.0134  215 PHE B N     
4004 C CA    . PHE B 189 ? 0.6033 0.9273 0.7238 0.0049  0.0452  0.0071  215 PHE B CA    
4005 C C     . PHE B 189 ? 0.6052 0.9442 0.7381 0.0169  0.0437  -0.0036 215 PHE B C     
4006 O O     . PHE B 189 ? 0.6061 0.9424 0.7446 0.0200  0.0361  -0.0089 215 PHE B O     
4007 C CB    . PHE B 189 ? 0.6238 0.9190 0.7130 0.0073  0.0363  0.0065  215 PHE B CB    
4008 C CG    . PHE B 189 ? 0.6201 0.9041 0.7059 -0.0054 0.0338  0.0148  215 PHE B CG    
4009 C CD1   . PHE B 189 ? 0.6281 0.9010 0.6970 -0.0058 0.0296  0.0155  215 PHE B CD1   
4010 C CD2   . PHE B 189 ? 0.6115 0.8971 0.7113 -0.0146 0.0345  0.0206  215 PHE B CD2   
4011 C CE1   . PHE B 189 ? 0.6322 0.8997 0.7037 -0.0166 0.0246  0.0208  215 PHE B CE1   
4012 C CE2   . PHE B 189 ? 0.6188 0.9001 0.7206 -0.0249 0.0326  0.0275  215 PHE B CE2   
4013 C CZ    . PHE B 189 ? 0.6298 0.9041 0.7203 -0.0265 0.0270  0.0271  215 PHE B CZ    
4014 N N     . GLU B 190 ? 0.6106 0.9665 0.7477 0.0257  0.0509  -0.0073 216 GLU B N     
4015 C CA    . GLU B 190 ? 0.6105 0.9894 0.7672 0.0382  0.0499  -0.0187 216 GLU B CA    
4016 C C     . GLU B 190 ? 0.5932 0.9999 0.7943 0.0295  0.0522  -0.0212 216 GLU B C     
4017 O O     . GLU B 190 ? 0.5951 1.0159 0.8141 0.0385  0.0432  -0.0334 216 GLU B O     
4018 C CB    . GLU B 190 ? 0.6195 1.0142 0.7733 0.0504  0.0605  -0.0207 216 GLU B CB    
4019 C CG    . GLU B 190 ? 0.6300 0.9939 0.7370 0.0645  0.0529  -0.0234 216 GLU B CG    
4020 C CD    . GLU B 190 ? 0.6196 0.9937 0.7151 0.0791  0.0643  -0.0237 216 GLU B CD    
4021 O OE1   . GLU B 190 ? 0.5859 0.9871 0.7055 0.0753  0.0824  -0.0174 216 GLU B OE1   
4022 O OE2   . GLU B 190 ? 0.6526 1.0037 0.7112 0.0956  0.0560  -0.0298 216 GLU B OE2   
4023 N N     . GLY B 191 ? 0.5848 0.9958 0.8010 0.0132  0.0619  -0.0108 217 GLY B N     
4024 C CA    . GLY B 191 ? 0.5687 1.0012 0.8266 0.0022  0.0645  -0.0124 217 GLY B CA    
4025 C C     . GLY B 191 ? 0.5629 0.9812 0.8228 -0.0027 0.0509  -0.0147 217 GLY B C     
4026 O O     . GLY B 191 ? 0.5614 0.9926 0.8531 -0.0116 0.0505  -0.0171 217 GLY B O     
4027 N N     . VAL B 192 ? 0.5666 0.9565 0.7924 0.0033  0.0405  -0.0138 218 VAL B N     
4028 C CA    . VAL B 192 ? 0.5548 0.9279 0.7756 0.0012  0.0310  -0.0133 218 VAL B CA    
4029 C C     . VAL B 192 ? 0.5618 0.9187 0.7642 0.0176  0.0159  -0.0238 218 VAL B C     
4030 O O     . VAL B 192 ? 0.5773 0.9242 0.7574 0.0294  0.0128  -0.0277 218 VAL B O     
4031 C CB    . VAL B 192 ? 0.5565 0.9084 0.7543 -0.0075 0.0361  0.0008  218 VAL B CB    
4032 C CG1   . VAL B 192 ? 0.5496 0.9117 0.7588 -0.0201 0.0490  0.0106  218 VAL B CG1   
4033 C CG2   . VAL B 192 ? 0.5676 0.8993 0.7333 -0.0021 0.0345  0.0036  218 VAL B CG2   
4034 N N     . THR B 193 ? 0.5483 0.8976 0.7546 0.0202  0.0062  -0.0280 219 THR B N     
4035 C CA    . THR B 193 ? 0.5560 0.8828 0.7370 0.0389  -0.0078 -0.0367 219 THR B CA    
4036 C C     . THR B 193 ? 0.5558 0.8478 0.6981 0.0404  -0.0036 -0.0243 219 THR B C     
4037 O O     . THR B 193 ? 0.5714 0.8366 0.6803 0.0557  -0.0082 -0.0263 219 THR B O     
4038 C CB    . THR B 193 ? 0.5608 0.8945 0.7630 0.0446  -0.0228 -0.0497 219 THR B CB    
4039 O OG1   . THR B 193 ? 0.5640 0.9356 0.8142 0.0378  -0.0244 -0.0600 219 THR B OG1   
4040 C CG2   . THR B 193 ? 0.5988 0.9091 0.7709 0.0699  -0.0397 -0.0618 219 THR B CG2   
4041 N N     . ALA B 194 ? 0.4782 0.6778 0.6683 0.0845  0.0615  -0.0251 220 ALA B N     
4042 C CA    . ALA B 194 ? 0.4695 0.6618 0.6265 0.0845  0.0533  -0.0176 220 ALA B CA    
4043 C C     . ALA B 194 ? 0.4655 0.6422 0.5965 0.0796  0.0650  -0.0146 220 ALA B C     
4044 O O     . ALA B 194 ? 0.4638 0.6388 0.5999 0.0748  0.0768  -0.0161 220 ALA B O     
4045 C CB    . ALA B 194 ? 0.4607 0.6678 0.6156 0.0833  0.0394  -0.0200 220 ALA B CB    
4046 N N     . ILE B 195 ? 0.4570 0.6235 0.5621 0.0809  0.0610  -0.0085 221 ILE B N     
4047 C CA    . ILE B 195 ? 0.4515 0.6056 0.5306 0.0767  0.0679  -0.0053 221 ILE B CA    
4048 C C     . ILE B 195 ? 0.4448 0.5988 0.5094 0.0746  0.0584  -0.0028 221 ILE B C     
4049 O O     . ILE B 195 ? 0.4426 0.6016 0.5020 0.0775  0.0474  -0.0005 221 ILE B O     
4050 C CB    . ILE B 195 ? 0.4629 0.6065 0.5274 0.0791  0.0716  -0.0041 221 ILE B CB    
4051 C CG1   . ILE B 195 ? 0.4598 0.6066 0.5398 0.0799  0.0839  -0.0113 221 ILE B CG1   
4052 C CG2   . ILE B 195 ? 0.4602 0.5934 0.4958 0.0753  0.0742  -0.0005 221 ILE B CG2   
4053 C CD1   . ILE B 195 ? 0.4568 0.5983 0.5386 0.0838  0.0852  -0.0160 221 ILE B CD1   
4054 N N     . ILE B 196 ? 0.4338 0.5845 0.4954 0.0694  0.0633  -0.0027 222 ILE B N     
4055 C CA    . ILE B 196 ? 0.4304 0.5795 0.4808 0.0667  0.0570  -0.0027 222 ILE B CA    
4056 C C     . ILE B 196 ? 0.4406 0.5745 0.4670 0.0655  0.0611  0.0042  222 ILE B C     
4057 O O     . ILE B 196 ? 0.4480 0.5767 0.4732 0.0625  0.0695  0.0089  222 ILE B O     
4058 C CB    . ILE B 196 ? 0.4236 0.5796 0.4967 0.0619  0.0584  -0.0087 222 ILE B CB    
4059 C CG1   . ILE B 196 ? 0.4117 0.5860 0.5118 0.0629  0.0537  -0.0192 222 ILE B CG1   
4060 C CG2   . ILE B 196 ? 0.4062 0.5616 0.4723 0.0589  0.0528  -0.0120 222 ILE B CG2   
4061 C CD1   . ILE B 196 ? 0.4082 0.5900 0.5406 0.0578  0.0563  -0.0286 222 ILE B CD1   
4062 N N     . PHE B 197 ? 0.4341 0.5631 0.4429 0.0677  0.0550  0.0059  223 PHE B N     
4063 C CA    . PHE B 197 ? 0.4327 0.5491 0.4214 0.0669  0.0569  0.0100  223 PHE B CA    
4064 C C     . PHE B 197 ? 0.4234 0.5375 0.4084 0.0632  0.0529  0.0100  223 PHE B C     
4065 O O     . PHE B 197 ? 0.4194 0.5399 0.4048 0.0629  0.0465  0.0064  223 PHE B O     
4066 C CB    . PHE B 197 ? 0.4373 0.5488 0.4173 0.0710  0.0536  0.0110  223 PHE B CB    
4067 C CG    . PHE B 197 ? 0.4532 0.5541 0.4178 0.0707  0.0567  0.0111  223 PHE B CG    
4068 C CD1   . PHE B 197 ? 0.4565 0.5577 0.4194 0.0713  0.0644  0.0073  223 PHE B CD1   
4069 C CD2   . PHE B 197 ? 0.4467 0.5407 0.3998 0.0693  0.0522  0.0128  223 PHE B CD2   
4070 C CE1   . PHE B 197 ? 0.4646 0.5612 0.4127 0.0706  0.0661  0.0043  223 PHE B CE1   
4071 C CE2   . PHE B 197 ? 0.4646 0.5510 0.4059 0.0690  0.0536  0.0110  223 PHE B CE2   
4072 C CZ    . PHE B 197 ? 0.4698 0.5587 0.4079 0.0698  0.0599  0.0063  223 PHE B CZ    
4073 N N     . CYS B 198 ? 0.4167 0.5243 0.3995 0.0601  0.0568  0.0144  224 CYS B N     
4074 C CA    . CYS B 198 ? 0.4211 0.5255 0.4081 0.0567  0.0535  0.0145  224 CYS B CA    
4075 C C     . CYS B 198 ? 0.4225 0.5168 0.3904 0.0570  0.0506  0.0176  224 CYS B C     
4076 O O     . CYS B 198 ? 0.4342 0.5240 0.3876 0.0583  0.0529  0.0222  224 CYS B O     
4077 C CB    . CYS B 198 ? 0.4261 0.5305 0.4328 0.0530  0.0582  0.0205  224 CYS B CB    
4078 S SG    . CYS B 198 ? 0.4403 0.5567 0.4796 0.0517  0.0621  0.0144  224 CYS B SG    
4079 N N     . VAL B 199 ? 0.4092 0.5030 0.3798 0.0553  0.0458  0.0129  225 VAL B N     
4080 C CA    . VAL B 199 ? 0.4107 0.4960 0.3699 0.0551  0.0426  0.0138  225 VAL B CA    
4081 C C     . VAL B 199 ? 0.4085 0.4936 0.3851 0.0512  0.0404  0.0106  225 VAL B C     
4082 O O     . VAL B 199 ? 0.4136 0.5081 0.4048 0.0489  0.0401  0.0010  225 VAL B O     
4083 C CB    . VAL B 199 ? 0.4152 0.5016 0.3639 0.0570  0.0403  0.0102  225 VAL B CB    
4084 C CG1   . VAL B 199 ? 0.4112 0.4894 0.3544 0.0559  0.0379  0.0095  225 VAL B CG1   
4085 C CG2   . VAL B 199 ? 0.4065 0.4921 0.3477 0.0613  0.0420  0.0131  225 VAL B CG2   
4086 N N     . ALA B 200 ? 0.4099 0.4871 0.3875 0.0504  0.0385  0.0174  226 ALA B N     
4087 C CA    . ALA B 200 ? 0.4106 0.4858 0.4095 0.0473  0.0355  0.0144  226 ALA B CA    
4088 C C     . ALA B 200 ? 0.4132 0.4866 0.4039 0.0469  0.0332  0.0057  226 ALA B C     
4089 O O     . ALA B 200 ? 0.4258 0.4915 0.4025 0.0486  0.0304  0.0096  226 ALA B O     
4090 C CB    . ALA B 200 ? 0.4147 0.4837 0.4192 0.0471  0.0325  0.0284  226 ALA B CB    
4091 N N     . LEU B 201 ? 0.3984 0.4816 0.3988 0.0442  0.0349  -0.0067 227 LEU B N     
4092 C CA    . LEU B 201 ? 0.3984 0.4835 0.3926 0.0427  0.0350  -0.0140 227 LEU B CA    
4093 C C     . LEU B 201 ? 0.3935 0.4685 0.3997 0.0416  0.0321  -0.0137 227 LEU B C     
4094 O O     . LEU B 201 ? 0.3970 0.4670 0.3931 0.0420  0.0315  -0.0138 227 LEU B O     
4095 C CB    . LEU B 201 ? 0.3948 0.4986 0.3996 0.0386  0.0381  -0.0292 227 LEU B CB    
4096 C CG    . LEU B 201 ? 0.4132 0.5322 0.4024 0.0397  0.0390  -0.0298 227 LEU B CG    
4097 C CD1   . LEU B 201 ? 0.4029 0.5469 0.4051 0.0349  0.0408  -0.0480 227 LEU B CD1   
4098 C CD2   . LEU B 201 ? 0.4024 0.5192 0.3656 0.0425  0.0391  -0.0194 227 LEU B CD2   
4099 N N     . SER B 202 ? 0.3897 0.4623 0.4226 0.0401  0.0299  -0.0125 228 SER B N     
4100 C CA    . SER B 202 ? 0.3954 0.4605 0.4473 0.0392  0.0254  -0.0117 228 SER B CA    
4101 C C     . SER B 202 ? 0.4077 0.4623 0.4417 0.0428  0.0188  0.0025  228 SER B C     
4102 O O     . SER B 202 ? 0.4128 0.4627 0.4606 0.0426  0.0132  0.0036  228 SER B O     
4103 C CB    . SER B 202 ? 0.3926 0.4595 0.4868 0.0367  0.0246  -0.0128 228 SER B CB    
4104 O OG    . SER B 202 ? 0.4195 0.4862 0.5145 0.0381  0.0250  -0.0003 228 SER B OG    
4105 N N     . ASP B 203 ? 0.4191 0.4730 0.4255 0.0460  0.0191  0.0112  229 ASP B N     
4106 C CA    . ASP B 203 ? 0.4364 0.4866 0.4230 0.0490  0.0136  0.0194  229 ASP B CA    
4107 C C     . ASP B 203 ? 0.4357 0.4817 0.4136 0.0497  0.0125  0.0100  229 ASP B C     
4108 O O     . ASP B 203 ? 0.4423 0.4869 0.4107 0.0517  0.0068  0.0115  229 ASP B O     
4109 C CB    . ASP B 203 ? 0.4392 0.4933 0.4013 0.0515  0.0167  0.0259  229 ASP B CB    
4110 C CG    . ASP B 203 ? 0.4700 0.5289 0.4382 0.0509  0.0166  0.0406  229 ASP B CG    
4111 O OD1   . ASP B 203 ? 0.4979 0.5557 0.4942 0.0488  0.0143  0.0466  229 ASP B OD1   
4112 O OD2   . ASP B 203 ? 0.5051 0.5698 0.4539 0.0522  0.0200  0.0464  229 ASP B OD2   
4113 N N     . TYR B 204 ? 0.4284 0.4750 0.4108 0.0478  0.0182  0.0004  230 TYR B N     
4114 C CA    . TYR B 204 ? 0.4271 0.4700 0.4062 0.0478  0.0195  -0.0059 230 TYR B CA    
4115 C C     . TYR B 204 ? 0.4335 0.4714 0.4269 0.0473  0.0129  -0.0090 230 TYR B C     
4116 O O     . TYR B 204 ? 0.4394 0.4734 0.4299 0.0484  0.0121  -0.0132 230 TYR B O     
4117 C CB    . TYR B 204 ? 0.4194 0.4687 0.4021 0.0446  0.0274  -0.0123 230 TYR B CB    
4118 C CG    . TYR B 204 ? 0.4126 0.4661 0.4183 0.0400  0.0290  -0.0218 230 TYR B CG    
4119 C CD1   . TYR B 204 ? 0.3919 0.4531 0.4155 0.0372  0.0300  -0.0274 230 TYR B CD1   
4120 C CD2   . TYR B 204 ? 0.4208 0.4713 0.4363 0.0381  0.0304  -0.0275 230 TYR B CD2   
4121 C CE1   . TYR B 204 ? 0.3837 0.4503 0.4352 0.0328  0.0323  -0.0400 230 TYR B CE1   
4122 C CE2   . TYR B 204 ? 0.4052 0.4610 0.4452 0.0336  0.0331  -0.0386 230 TYR B CE2   
4123 C CZ    . TYR B 204 ? 0.3929 0.4572 0.4511 0.0309  0.0341  -0.0457 230 TYR B CZ    
4124 O OH    . TYR B 204 ? 0.3893 0.4605 0.4777 0.0261  0.0378  -0.0605 230 TYR B OH    
4125 N N     . ASP B 205 ? 0.4237 0.4620 0.4376 0.0460  0.0076  -0.0071 231 ASP B N     
4126 C CA    . ASP B 205 ? 0.4306 0.4655 0.4635 0.0457  0.0003  -0.0103 231 ASP B CA    
4127 C C     . ASP B 205 ? 0.4393 0.4754 0.4668 0.0489  -0.0118 0.0005  231 ASP B C     
4128 O O     . ASP B 205 ? 0.4349 0.4706 0.4799 0.0493  -0.0211 0.0005  231 ASP B O     
4129 C CB    . ASP B 205 ? 0.4235 0.4596 0.4914 0.0419  0.0018  -0.0171 231 ASP B CB    
4130 C CG    . ASP B 205 ? 0.4426 0.4805 0.5304 0.0419  -0.0025 -0.0076 231 ASP B CG    
4131 O OD1   . ASP B 205 ? 0.4180 0.4577 0.4881 0.0439  -0.0030 0.0040  231 ASP B OD1   
4132 O OD2   . ASP B 205 ? 0.4876 0.5255 0.6137 0.0398  -0.0048 -0.0118 231 ASP B OD2   
4133 N N     . LEU B 206 ? 0.4492 0.4898 0.4532 0.0510  -0.0120 0.0101  232 LEU B N     
4134 C CA    . LEU B 206 ? 0.4709 0.5191 0.4641 0.0534  -0.0225 0.0223  232 LEU B CA    
4135 C C     . LEU B 206 ? 0.4815 0.5332 0.4610 0.0554  -0.0285 0.0125  232 LEU B C     
4136 O O     . LEU B 206 ? 0.4749 0.5234 0.4444 0.0559  -0.0218 0.0000  232 LEU B O     
4137 C CB    . LEU B 206 ? 0.4717 0.5270 0.4425 0.0542  -0.0186 0.0337  232 LEU B CB    
4138 C CG    . LEU B 206 ? 0.4870 0.5406 0.4764 0.0522  -0.0138 0.0444  232 LEU B CG    
4139 C CD1   . LEU B 206 ? 0.4602 0.5218 0.4283 0.0528  -0.0086 0.0558  232 LEU B CD1   
4140 C CD2   . LEU B 206 ? 0.4758 0.5290 0.4987 0.0514  -0.0226 0.0562  232 LEU B CD2   
4141 N N     . VAL B 207 ? 0.4900 0.5493 0.4743 0.0567  -0.0419 0.0183  233 VAL B N     
4142 C CA    . VAL B 207 ? 0.5077 0.5749 0.4825 0.0585  -0.0499 0.0070  233 VAL B CA    
4143 C C     . VAL B 207 ? 0.5308 0.6119 0.4713 0.0599  -0.0481 0.0054  233 VAL B C     
4144 O O     . VAL B 207 ? 0.5476 0.6388 0.4704 0.0599  -0.0478 0.0209  233 VAL B O     
4145 C CB    . VAL B 207 ? 0.5218 0.5980 0.5114 0.0596  -0.0671 0.0151  233 VAL B CB    
4146 C CG1   . VAL B 207 ? 0.5462 0.6420 0.5137 0.0617  -0.0784 0.0079  233 VAL B CG1   
4147 C CG2   . VAL B 207 ? 0.4799 0.5434 0.5077 0.0582  -0.0683 0.0061  233 VAL B CG2   
4148 N N     . LEU B 208 ? 0.5361 0.6182 0.4723 0.0607  -0.0456 -0.0144 234 LEU B N     
4149 C CA    . LEU B 208 ? 0.5555 0.6540 0.4667 0.0619  -0.0446 -0.0247 234 LEU B CA    
4150 C C     . LEU B 208 ? 0.5748 0.6996 0.4625 0.0624  -0.0569 -0.0144 234 LEU B C     
4151 O O     . LEU B 208 ? 0.5829 0.7178 0.4768 0.0631  -0.0714 -0.0134 234 LEU B O     
4152 C CB    . LEU B 208 ? 0.5475 0.6444 0.4736 0.0627  -0.0447 -0.0500 234 LEU B CB    
4153 C CG    . LEU B 208 ? 0.5758 0.6869 0.4904 0.0637  -0.0407 -0.0701 234 LEU B CG    
4154 C CD1   . LEU B 208 ? 0.5564 0.6575 0.4678 0.0638  -0.0253 -0.0687 234 LEU B CD1   
4155 C CD2   . LEU B 208 ? 0.5786 0.6876 0.5201 0.0642  -0.0435 -0.0941 234 LEU B CD2   
4156 N N     . ALA B 209 ? 0.5876 0.7258 0.4490 0.0618  -0.0510 -0.0056 235 ALA B N     
4157 C CA    . ALA B 209 ? 0.6238 0.7934 0.4566 0.0615  -0.0602 0.0039  235 ALA B CA    
4158 C C     . ALA B 209 ? 0.6479 0.8415 0.4686 0.0622  -0.0671 -0.0233 235 ALA B C     
4159 O O     . ALA B 209 ? 0.6437 0.8305 0.4746 0.0626  -0.0591 -0.0499 235 ALA B O     
4160 C CB    . ALA B 209 ? 0.6300 0.8094 0.4392 0.0599  -0.0484 0.0170  235 ALA B CB    
4161 N N     . GLU B 210 ? 0.6788 0.9025 0.4805 0.0621  -0.0822 -0.0161 236 GLU B N     
4162 C CA    . GLU B 210 ? 0.7080 0.9607 0.4998 0.0625  -0.0924 -0.0434 236 GLU B CA    
4163 C C     . GLU B 210 ? 0.7126 0.9839 0.4871 0.0612  -0.0801 -0.0722 236 GLU B C     
4164 O O     . GLU B 210 ? 0.7172 1.0077 0.4953 0.0614  -0.0850 -0.1045 236 GLU B O     
4165 C CB    . GLU B 210 ? 0.7416 1.0303 0.5097 0.0624  -0.1117 -0.0247 236 GLU B CB    
4166 C CG    . GLU B 210 ? 0.7854 1.0591 0.5791 0.0642  -0.1265 0.0013  236 GLU B CG    
4167 C CD    . GLU B 210 ? 0.8167 1.0794 0.6441 0.0661  -0.1373 -0.0218 236 GLU B CD    
4168 O OE1   . GLU B 210 ? 0.8650 1.1588 0.6843 0.0670  -0.1543 -0.0343 236 GLU B OE1   
4169 O OE2   . GLU B 210 ? 0.7767 1.0028 0.6387 0.0664  -0.1287 -0.0270 236 GLU B OE2   
4170 N N     . ASP B 211 ? 0.7040 0.9701 0.4654 0.0599  -0.0640 -0.0630 237 ASP B N     
4171 C CA    . ASP B 211 ? 0.7158 1.0047 0.4608 0.0583  -0.0521 -0.0880 237 ASP B CA    
4172 C C     . ASP B 211 ? 0.6796 0.9380 0.4503 0.0592  -0.0343 -0.1009 237 ASP B C     
4173 O O     . ASP B 211 ? 0.6812 0.9526 0.4447 0.0581  -0.0216 -0.1170 237 ASP B O     
4174 C CB    . ASP B 211 ? 0.7485 1.0690 0.4522 0.0553  -0.0484 -0.0670 237 ASP B CB    
4175 C CG    . ASP B 211 ? 0.7554 1.0517 0.4619 0.0546  -0.0337 -0.0409 237 ASP B CG    
4176 O OD1   . ASP B 211 ? 0.7320 0.9911 0.4654 0.0565  -0.0334 -0.0258 237 ASP B OD1   
4177 O OD2   . ASP B 211 ? 0.7975 1.1143 0.4806 0.0519  -0.0218 -0.0378 237 ASP B OD2   
4178 N N     . GLU B 212 ? 0.6416 0.8624 0.4436 0.0611  -0.0337 -0.0939 238 GLU B N     
4179 C CA    . GLU B 212 ? 0.6164 0.8097 0.4430 0.0622  -0.0190 -0.1005 238 GLU B CA    
4180 C C     . GLU B 212 ? 0.5843 0.7608 0.4485 0.0639  -0.0192 -0.1235 238 GLU B C     
4181 O O     . GLU B 212 ? 0.5789 0.7530 0.4555 0.0642  -0.0303 -0.1271 238 GLU B O     
4182 C CB    . GLU B 212 ? 0.6118 0.7787 0.4419 0.0623  -0.0148 -0.0700 238 GLU B CB    
4183 C CG    . GLU B 212 ? 0.6734 0.8496 0.4810 0.0608  -0.0055 -0.0535 238 GLU B CG    
4184 C CD    . GLU B 212 ? 0.7370 0.9138 0.5508 0.0613  0.0090  -0.0711 238 GLU B CD    
4185 O OE1   . GLU B 212 ? 0.7356 0.8939 0.5780 0.0633  0.0132  -0.0857 238 GLU B OE1   
4186 O OE2   . GLU B 212 ? 0.7834 0.9804 0.5764 0.0595  0.0166  -0.0693 238 GLU B OE2   
4187 N N     . GLU B 213 ? 0.5665 0.7321 0.4529 0.0649  -0.0067 -0.1376 239 GLU B N     
4188 C CA    . GLU B 213 ? 0.5499 0.6971 0.4790 0.0664  -0.0044 -0.1543 239 GLU B CA    
4189 C C     . GLU B 213 ? 0.5184 0.6328 0.4660 0.0672  0.0010  -0.1325 239 GLU B C     
4190 O O     . GLU B 213 ? 0.5164 0.6144 0.4991 0.0680  0.0036  -0.1390 239 GLU B O     
4191 C CB    . GLU B 213 ? 0.5587 0.7150 0.5120 0.0672  0.0052  -0.1835 239 GLU B CB    
4192 C CG    . GLU B 213 ? 0.5708 0.7170 0.5275 0.0683  0.0185  -0.1742 239 GLU B CG    
4193 C CD    . GLU B 213 ? 0.5934 0.7421 0.5906 0.0697  0.0280  -0.2018 239 GLU B CD    
4194 O OE1   . GLU B 213 ? 0.6237 0.7657 0.6294 0.0711  0.0381  -0.1961 239 GLU B OE1   
4195 O OE2   . GLU B 213 ? 0.6154 0.7735 0.6407 0.0696  0.0252  -0.2304 239 GLU B OE2   
4196 N N     . MET B 214 ? 0.5015 0.6087 0.4274 0.0667  0.0033  -0.1071 240 MET B N     
4197 C CA    . MET B 214 ? 0.4711 0.5538 0.4097 0.0668  0.0082  -0.0881 240 MET B CA    
4198 C C     . MET B 214 ? 0.4670 0.5480 0.3834 0.0653  0.0046  -0.0650 240 MET B C     
4199 O O     . MET B 214 ? 0.4767 0.5732 0.3690 0.0646  0.0016  -0.0592 240 MET B O     
4200 C CB    . MET B 214 ? 0.4624 0.5374 0.4143 0.0685  0.0195  -0.0877 240 MET B CB    
4201 C CG    . MET B 214 ? 0.4693 0.5528 0.3980 0.0685  0.0245  -0.0785 240 MET B CG    
4202 S SD    . MET B 214 ? 0.5266 0.6034 0.4775 0.0711  0.0359  -0.0803 240 MET B SD    
4203 C CE    . MET B 214 ? 0.5033 0.5970 0.4726 0.0721  0.0394  -0.1131 240 MET B CE    
4204 N N     . ASN B 215 ? 0.4505 0.5151 0.3778 0.0644  0.0053  -0.0522 241 ASN B N     
4205 C CA    . ASN B 215 ? 0.4602 0.5236 0.3761 0.0627  0.0026  -0.0339 241 ASN B CA    
4206 C C     . ASN B 215 ? 0.4643 0.5291 0.3688 0.0628  0.0103  -0.0233 241 ASN B C     
4207 O O     . ASN B 215 ? 0.4515 0.5156 0.3585 0.0643  0.0178  -0.0289 241 ASN B O     
4208 C CB    . ASN B 215 ? 0.4329 0.4830 0.3667 0.0609  0.0016  -0.0283 241 ASN B CB    
4209 C CG    . ASN B 215 ? 0.4367 0.4761 0.3830 0.0607  0.0111  -0.0277 241 ASN B CG    
4210 O OD1   . ASN B 215 ? 0.4310 0.4707 0.3713 0.0615  0.0176  -0.0226 241 ASN B OD1   
4211 N ND2   . ASN B 215 ? 0.4506 0.4824 0.4156 0.0593  0.0119  -0.0315 241 ASN B ND2   
4212 N N     . ARG B 216 ? 0.4726 0.5395 0.3703 0.0612  0.0080  -0.0085 242 ARG B N     
4213 C CA    . ARG B 216 ? 0.4861 0.5568 0.3758 0.0607  0.0144  0.0015  242 ARG B CA    
4214 C C     . ARG B 216 ? 0.4749 0.5372 0.3742 0.0613  0.0223  0.0003  242 ARG B C     
4215 O O     . ARG B 216 ? 0.4850 0.5517 0.3796 0.0624  0.0286  0.0000  242 ARG B O     
4216 C CB    . ARG B 216 ? 0.4936 0.5660 0.3862 0.0586  0.0104  0.0181  242 ARG B CB    
4217 C CG    . ARG B 216 ? 0.5531 0.6419 0.4282 0.0583  0.0049  0.0267  242 ARG B CG    
4218 C CD    . ARG B 216 ? 0.6204 0.7109 0.5052 0.0566  -0.0010 0.0473  242 ARG B CD    
4219 N NE    . ARG B 216 ? 0.6993 0.8092 0.5651 0.0565  -0.0088 0.0577  242 ARG B NE    
4220 C CZ    . ARG B 216 ? 0.7217 0.8373 0.5880 0.0573  -0.0216 0.0577  242 ARG B CZ    
4221 N NH1   . ARG B 216 ? 0.7461 0.8470 0.6339 0.0580  -0.0266 0.0472  242 ARG B NH1   
4222 N NH2   . ARG B 216 ? 0.7306 0.8690 0.5761 0.0572  -0.0296 0.0685  242 ARG B NH2   
4223 N N     . MET B 217 ? 0.4619 0.5147 0.3749 0.0605  0.0219  -0.0004 243 MET B N     
4224 C CA    . MET B 217 ? 0.4523 0.5017 0.3720 0.0610  0.0278  0.0001  243 MET B CA    
4225 C C     . MET B 217 ? 0.4554 0.5041 0.3780 0.0641  0.0317  -0.0058 243 MET B C     
4226 O O     . MET B 217 ? 0.4614 0.5120 0.3865 0.0656  0.0361  -0.0026 243 MET B O     
4227 C CB    . MET B 217 ? 0.4450 0.4893 0.3761 0.0587  0.0273  0.0000  243 MET B CB    
4228 C CG    . MET B 217 ? 0.4534 0.5003 0.3875 0.0585  0.0323  0.0035  243 MET B CG    
4229 S SD    . MET B 217 ? 0.5068 0.5629 0.4403 0.0565  0.0333  0.0066  243 MET B SD    
4230 C CE    . MET B 217 ? 0.4558 0.5131 0.4020 0.0517  0.0319  0.0018  243 MET B CE    
4231 N N     . HIS B 218 ? 0.4501 0.4969 0.3780 0.0651  0.0298  -0.0155 244 HIS B N     
4232 C CA    . HIS B 218 ? 0.4563 0.5028 0.3967 0.0679  0.0338  -0.0243 244 HIS B CA    
4233 C C     . HIS B 218 ? 0.4663 0.5235 0.3980 0.0694  0.0373  -0.0308 244 HIS B C     
4234 O O     . HIS B 218 ? 0.4738 0.5310 0.4193 0.0718  0.0424  -0.0341 244 HIS B O     
4235 C CB    . HIS B 218 ? 0.4599 0.5026 0.4162 0.0682  0.0313  -0.0367 244 HIS B CB    
4236 C CG    . HIS B 218 ? 0.4543 0.4864 0.4285 0.0672  0.0327  -0.0298 244 HIS B CG    
4237 N ND1   . HIS B 218 ? 0.4558 0.4849 0.4256 0.0641  0.0299  -0.0240 244 HIS B ND1   
4238 C CD2   . HIS B 218 ? 0.4350 0.4606 0.4328 0.0685  0.0375  -0.0256 244 HIS B CD2   
4239 C CE1   . HIS B 218 ? 0.4325 0.4555 0.4186 0.0631  0.0340  -0.0178 244 HIS B CE1   
4240 N NE2   . HIS B 218 ? 0.4482 0.4689 0.4510 0.0658  0.0384  -0.0165 244 HIS B NE2   
4241 N N     . GLU B 219 ? 0.4762 0.5438 0.3875 0.0677  0.0348  -0.0311 245 GLU B N     
4242 C CA    . GLU B 219 ? 0.5054 0.5867 0.4049 0.0678  0.0402  -0.0343 245 GLU B CA    
4243 C C     . GLU B 219 ? 0.4970 0.5752 0.4018 0.0686  0.0460  -0.0244 245 GLU B C     
4244 O O     . GLU B 219 ? 0.4924 0.5751 0.4059 0.0704  0.0524  -0.0312 245 GLU B O     
4245 C CB    . GLU B 219 ? 0.5180 0.6124 0.3935 0.0652  0.0365  -0.0278 245 GLU B CB    
4246 C CG    . GLU B 219 ? 0.6199 0.7291 0.4855 0.0648  0.0317  -0.0427 245 GLU B CG    
4247 C CD    . GLU B 219 ? 0.7300 0.8575 0.5694 0.0623  0.0273  -0.0317 245 GLU B CD    
4248 O OE1   . GLU B 219 ? 0.7759 0.8977 0.6140 0.0613  0.0192  -0.0159 245 GLU B OE1   
4249 O OE2   . GLU B 219 ? 0.7742 0.9236 0.5964 0.0611  0.0322  -0.0383 245 GLU B OE2   
4250 N N     . SER B 220 ? 0.4860 0.5576 0.3898 0.0671  0.0434  -0.0107 246 SER B N     
4251 C CA    . SER B 220 ? 0.4829 0.5544 0.3929 0.0674  0.0469  -0.0030 246 SER B CA    
4252 C C     . SER B 220 ? 0.4732 0.5400 0.4005 0.0706  0.0483  -0.0047 246 SER B C     
4253 O O     . SER B 220 ? 0.4712 0.5422 0.4069 0.0725  0.0520  -0.0043 246 SER B O     
4254 C CB    . SER B 220 ? 0.4737 0.5424 0.3834 0.0646  0.0432  0.0069  246 SER B CB    
4255 O OG    . SER B 220 ? 0.5164 0.5877 0.4349 0.0648  0.0455  0.0107  246 SER B OG    
4256 N N     . MET B 221 ? 0.4733 0.5323 0.4092 0.0712  0.0453  -0.0052 247 MET B N     
4257 C CA    . MET B 221 ? 0.4754 0.5309 0.4320 0.0744  0.0465  -0.0027 247 MET B CA    
4258 C C     . MET B 221 ? 0.4865 0.5442 0.4605 0.0777  0.0510  -0.0137 247 MET B C     
4259 O O     . MET B 221 ? 0.4871 0.5459 0.4798 0.0808  0.0527  -0.0095 247 MET B O     
4260 C CB    . MET B 221 ? 0.4669 0.5142 0.4330 0.0738  0.0443  -0.0001 247 MET B CB    
4261 C CG    . MET B 221 ? 0.4685 0.5168 0.4258 0.0708  0.0419  0.0107  247 MET B CG    
4262 S SD    . MET B 221 ? 0.4990 0.5391 0.4642 0.0684  0.0413  0.0104  247 MET B SD    
4263 C CE    . MET B 221 ? 0.4043 0.4394 0.3999 0.0720  0.0445  0.0168  247 MET B CE    
4264 N N     . LYS B 222 ? 0.4974 0.5581 0.4679 0.0769  0.0525  -0.0290 248 LYS B N     
4265 C CA    . LYS B 222 ? 0.5135 0.5807 0.5023 0.0791  0.0582  -0.0457 248 LYS B CA    
4266 C C     . LYS B 222 ? 0.5116 0.5884 0.4975 0.0797  0.0638  -0.0456 248 LYS B C     
4267 O O     . LYS B 222 ? 0.5182 0.5965 0.5311 0.0828  0.0682  -0.0514 248 LYS B O     
4268 C CB    . LYS B 222 ? 0.5250 0.6010 0.5044 0.0772  0.0582  -0.0650 248 LYS B CB    
4269 C CG    . LYS B 222 ? 0.5715 0.6584 0.5732 0.0787  0.0650  -0.0890 248 LYS B CG    
4270 C CD    . LYS B 222 ? 0.6280 0.7294 0.6184 0.0764  0.0636  -0.1108 248 LYS B CD    
4271 C CE    . LYS B 222 ? 0.6517 0.7657 0.6735 0.0776  0.0707  -0.1412 248 LYS B CE    
4272 N NZ    . LYS B 222 ? 0.6673 0.7886 0.6951 0.0763  0.0659  -0.1625 248 LYS B NZ    
4273 N N     . LEU B 223 ? 0.5104 0.5933 0.4691 0.0768  0.0640  -0.0381 249 LEU B N     
4274 C CA    . LEU B 223 ? 0.5124 0.6045 0.4701 0.0766  0.0703  -0.0368 249 LEU B CA    
4275 C C     . LEU B 223 ? 0.5065 0.5935 0.4839 0.0795  0.0684  -0.0259 249 LEU B C     
4276 O O     . LEU B 223 ? 0.5091 0.6016 0.5050 0.0817  0.0734  -0.0305 249 LEU B O     
4277 C CB    . LEU B 223 ? 0.5167 0.6155 0.4471 0.0724  0.0709  -0.0277 249 LEU B CB    
4278 C CG    . LEU B 223 ? 0.5168 0.6253 0.4480 0.0712  0.0787  -0.0241 249 LEU B CG    
4279 C CD1   . LEU B 223 ? 0.5421 0.6637 0.4816 0.0719  0.0886  -0.0411 249 LEU B CD1   
4280 C CD2   . LEU B 223 ? 0.5232 0.6373 0.4333 0.0668  0.0793  -0.0118 249 LEU B CD2   
4281 N N     . PHE B 224 ? 0.4988 0.5782 0.4726 0.0794  0.0610  -0.0125 250 PHE B N     
4282 C CA    . PHE B 224 ? 0.4918 0.5717 0.4796 0.0818  0.0571  -0.0012 250 PHE B CA    
4283 C C     . PHE B 224 ? 0.5002 0.5772 0.5188 0.0866  0.0565  -0.0007 250 PHE B C     
4284 O O     . PHE B 224 ? 0.4956 0.5778 0.5330 0.0897  0.0555  0.0041  250 PHE B O     
4285 C CB    . PHE B 224 ? 0.4797 0.5575 0.4546 0.0796  0.0503  0.0101  250 PHE B CB    
4286 C CG    . PHE B 224 ? 0.4619 0.5475 0.4454 0.0813  0.0452  0.0209  250 PHE B CG    
4287 C CD1   . PHE B 224 ? 0.4473 0.5432 0.4312 0.0807  0.0449  0.0204  250 PHE B CD1   
4288 C CD2   . PHE B 224 ? 0.4839 0.5695 0.4761 0.0832  0.0404  0.0322  250 PHE B CD2   
4289 C CE1   . PHE B 224 ? 0.4472 0.5551 0.4385 0.0823  0.0385  0.0282  250 PHE B CE1   
4290 C CE2   . PHE B 224 ? 0.4800 0.5788 0.4758 0.0845  0.0342  0.0439  250 PHE B CE2   
4291 C CZ    . PHE B 224 ? 0.4548 0.5659 0.4494 0.0842  0.0324  0.0403  250 PHE B CZ    
4292 N N     . ASP B 225 ? 0.5145 0.5835 0.5433 0.0872  0.0567  -0.0053 251 ASP B N     
4293 C CA    . ASP B 225 ? 0.5331 0.5978 0.6016 0.0917  0.0571  -0.0050 251 ASP B CA    
4294 C C     . ASP B 225 ? 0.5394 0.6104 0.6335 0.0944  0.0637  -0.0203 251 ASP B C     
4295 O O     . ASP B 225 ? 0.5383 0.6093 0.6687 0.0988  0.0627  -0.0149 251 ASP B O     
4296 C CB    . ASP B 225 ? 0.5437 0.5994 0.6228 0.0910  0.0579  -0.0127 251 ASP B CB    
4297 C CG    . ASP B 225 ? 0.5746 0.6241 0.7043 0.0954  0.0588  -0.0111 251 ASP B CG    
4298 O OD1   . ASP B 225 ? 0.5987 0.6501 0.7538 0.0993  0.0567  0.0020  251 ASP B OD1   
4299 O OD2   . ASP B 225 ? 0.6131 0.6565 0.7622 0.0950  0.0610  -0.0227 251 ASP B OD2   
4300 N N     . SER B 226 ? 0.5461 0.6245 0.6223 0.0914  0.0707  -0.0386 252 SER B N     
4301 C CA    . SER B 226 ? 0.5615 0.6500 0.6588 0.0925  0.0796  -0.0569 252 SER B CA    
4302 C C     . SER B 226 ? 0.5565 0.6511 0.6593 0.0940  0.0801  -0.0479 252 SER B C     
4303 O O     . SER B 226 ? 0.5630 0.6600 0.7044 0.0980  0.0822  -0.0518 252 SER B O     
4304 C CB    . SER B 226 ? 0.5691 0.6695 0.6392 0.0879  0.0871  -0.0767 252 SER B CB    
4305 O OG    . SER B 226 ? 0.6038 0.7173 0.6976 0.0884  0.0975  -0.0994 252 SER B OG    
4306 N N     . ILE B 227 ? 0.5545 0.6519 0.6248 0.0910  0.0778  -0.0366 253 ILE B N     
4307 C CA    . ILE B 227 ? 0.5533 0.6579 0.6296 0.0917  0.0778  -0.0296 253 ILE B CA    
4308 C C     . ILE B 227 ? 0.5591 0.6616 0.6615 0.0968  0.0677  -0.0142 253 ILE B C     
4309 O O     . ILE B 227 ? 0.5643 0.6732 0.6957 0.1002  0.0680  -0.0148 253 ILE B O     
4310 C CB    . ILE B 227 ? 0.5465 0.6538 0.5888 0.0870  0.0767  -0.0211 253 ILE B CB    
4311 C CG1   . ILE B 227 ? 0.5537 0.6675 0.5731 0.0822  0.0867  -0.0312 253 ILE B CG1   
4312 C CG2   . ILE B 227 ? 0.5259 0.6407 0.5800 0.0880  0.0744  -0.0142 253 ILE B CG2   
4313 C CD1   . ILE B 227 ? 0.5659 0.6788 0.5568 0.0777  0.0844  -0.0204 253 ILE B CD1   
4314 N N     . CYS B 228 ? 0.5632 0.6593 0.6558 0.0971  0.0587  0.0004  254 CYS B N     
4315 C CA    . CYS B 228 ? 0.5750 0.6744 0.6841 0.1010  0.0481  0.0194  254 CYS B CA    
4316 C C     . CYS B 228 ? 0.5747 0.6709 0.7310 0.1069  0.0470  0.0225  254 CYS B C     
4317 O O     . CYS B 228 ? 0.5835 0.6872 0.7644 0.1114  0.0395  0.0359  254 CYS B O     
4318 C CB    . CYS B 228 ? 0.5806 0.6774 0.6639 0.0985  0.0413  0.0334  254 CYS B CB    
4319 S SG    . CYS B 228 ? 0.6726 0.7784 0.7706 0.1024  0.0290  0.0596  254 CYS B SG    
4320 N N     . ASN B 229 ? 0.5697 0.6564 0.7436 0.1072  0.0539  0.0095  255 ASN B N     
4321 C CA    . ASN B 229 ? 0.5601 0.6424 0.7897 0.1126  0.0538  0.0106  255 ASN B CA    
4322 C C     . ASN B 229 ? 0.5599 0.6469 0.8269 0.1147  0.0631  -0.0124 255 ASN B C     
4323 O O     . ASN B 229 ? 0.5604 0.6442 0.8832 0.1195  0.0635  -0.0141 255 ASN B O     
4324 C CB    . ASN B 229 ? 0.5601 0.6303 0.8018 0.1121  0.0554  0.0094  255 ASN B CB    
4325 C CG    . ASN B 229 ? 0.5624 0.6290 0.7847 0.1112  0.0467  0.0365  255 ASN B CG    
4326 O OD1   . ASN B 229 ? 0.5780 0.6486 0.8182 0.1148  0.0383  0.0622  255 ASN B OD1   
4327 N ND2   . ASN B 229 ? 0.4988 0.5606 0.6841 0.1062  0.0485  0.0317  255 ASN B ND2   
4328 N N     . ASN B 230 ? 0.5494 0.6451 0.7909 0.1109  0.0716  -0.0303 256 ASN B N     
4329 C CA    . ASN B 230 ? 0.5518 0.6558 0.8283 0.1121  0.0823  -0.0535 256 ASN B CA    
4330 C C     . ASN B 230 ? 0.5501 0.6603 0.8606 0.1171  0.0768  -0.0421 256 ASN B C     
4331 O O     . ASN B 230 ? 0.5384 0.6548 0.8242 0.1162  0.0713  -0.0296 256 ASN B O     
4332 C CB    . ASN B 230 ? 0.5526 0.6674 0.7927 0.1058  0.0954  -0.0758 256 ASN B CB    
4333 C CG    . ASN B 230 ? 0.5587 0.6856 0.8346 0.1057  0.1097  -0.1056 256 ASN B CG    
4334 O OD1   . ASN B 230 ? 0.5491 0.6807 0.8661 0.1094  0.1113  -0.1078 256 ASN B OD1   
4335 N ND2   . ASN B 230 ? 0.5577 0.6927 0.8192 0.1013  0.1199  -0.1303 256 ASN B ND2   
4336 N N     . LYS B 231 ? 0.5595 0.6687 0.9323 0.1225  0.0775  -0.0474 257 LYS B N     
4337 C CA    . LYS B 231 ? 0.5700 0.6852 0.9870 0.1283  0.0707  -0.0364 257 LYS B CA    
4338 C C     . LYS B 231 ? 0.5648 0.6935 0.9695 0.1258  0.0782  -0.0499 257 LYS B C     
4339 O O     . LYS B 231 ? 0.5624 0.6983 0.9804 0.1291  0.0691  -0.0360 257 LYS B O     
4340 C CB    . LYS B 231 ? 0.5798 0.6915 1.0738 0.1338  0.0738  -0.0469 257 LYS B CB    
4341 C CG    . LYS B 231 ? 0.6082 0.7231 1.1570 0.1416  0.0612  -0.0250 257 LYS B CG    
4342 C CD    . LYS B 231 ? 0.6509 0.7576 1.2795 0.1474  0.0610  -0.0259 257 LYS B CD    
4343 C CE    . LYS B 231 ? 0.6609 0.7745 1.3566 0.1550  0.0531  -0.0155 257 LYS B CE    
4344 N NZ    . LYS B 231 ? 0.6974 0.8024 1.4820 0.1609  0.0534  -0.0162 257 LYS B NZ    
4345 N N     . TRP B 232 ? 0.5649 0.6992 0.9445 0.1196  0.0946  -0.0760 258 TRP B N     
4346 C CA    . TRP B 232 ? 0.5632 0.7110 0.9273 0.1155  0.1053  -0.0882 258 TRP B CA    
4347 C C     . TRP B 232 ? 0.5570 0.7064 0.8811 0.1136  0.0960  -0.0671 258 TRP B C     
4348 O O     . TRP B 232 ? 0.5532 0.7129 0.8831 0.1125  0.0999  -0.0700 258 TRP B O     
4349 C CB    . TRP B 232 ? 0.5705 0.7264 0.9041 0.1082  0.1235  -0.1139 258 TRP B CB    
4350 C CG    . TRP B 232 ? 0.5842 0.7575 0.9166 0.1037  0.1400  -0.1310 258 TRP B CG    
4351 C CD1   . TRP B 232 ? 0.5854 0.7694 0.9693 0.1060  0.1487  -0.1469 258 TRP B CD1   
4352 C CD2   . TRP B 232 ? 0.5888 0.7722 0.8695 0.0959  0.1510  -0.1329 258 TRP B CD2   
4353 N NE1   . TRP B 232 ? 0.5955 0.7962 0.9601 0.0995  0.1655  -0.1590 258 TRP B NE1   
4354 C CE2   . TRP B 232 ? 0.5958 0.7965 0.8971 0.0932  0.1672  -0.1489 258 TRP B CE2   
4355 C CE3   . TRP B 232 ? 0.6007 0.7806 0.8233 0.0909  0.1488  -0.1208 258 TRP B CE3   
4356 C CZ2   . TRP B 232 ? 0.6096 0.8248 0.8739 0.0854  0.1818  -0.1506 258 TRP B CZ2   
4357 C CZ3   . TRP B 232 ? 0.6213 0.8148 0.8098 0.0837  0.1617  -0.1218 258 TRP B CZ3   
4358 C CH2   . TRP B 232 ? 0.6261 0.8374 0.8348 0.0809  0.1785  -0.1354 258 TRP B CH2   
4359 N N     . PHE B 233 ? 0.5563 0.6966 0.8451 0.1131  0.0843  -0.0479 259 PHE B N     
4360 C CA    . PHE B 233 ? 0.5516 0.6948 0.8042 0.1108  0.0753  -0.0315 259 PHE B CA    
4361 C C     . PHE B 233 ? 0.5506 0.6977 0.8202 0.1164  0.0566  -0.0094 259 PHE B C     
4362 O O     . PHE B 233 ? 0.5438 0.6972 0.7869 0.1145  0.0480  0.0012  259 PHE B O     
4363 C CB    . PHE B 233 ? 0.5530 0.6879 0.7547 0.1057  0.0752  -0.0269 259 PHE B CB    
4364 C CG    . PHE B 233 ? 0.5609 0.6979 0.7353 0.0993  0.0905  -0.0430 259 PHE B CG    
4365 C CD1   . PHE B 233 ? 0.5738 0.7206 0.7387 0.0951  0.0993  -0.0473 259 PHE B CD1   
4366 C CD2   . PHE B 233 ? 0.5673 0.6988 0.7267 0.0973  0.0957  -0.0524 259 PHE B CD2   
4367 C CE1   . PHE B 233 ? 0.5830 0.7351 0.7212 0.0890  0.1133  -0.0569 259 PHE B CE1   
4368 C CE2   . PHE B 233 ? 0.5762 0.7148 0.7072 0.0914  0.1082  -0.0651 259 PHE B CE2   
4369 C CZ    . PHE B 233 ? 0.5798 0.7291 0.6988 0.0872  0.1170  -0.0654 259 PHE B CZ    
4370 N N     . THR B 234 ? 0.5561 0.7018 0.8718 0.1230  0.0503  -0.0028 260 THR B N     
4371 C CA    . THR B 234 ? 0.5673 0.7208 0.9024 0.1289  0.0313  0.0221  260 THR B CA    
4372 C C     . THR B 234 ? 0.5665 0.7376 0.8926 0.1288  0.0220  0.0269  260 THR B C     
4373 O O     . THR B 234 ? 0.5714 0.7530 0.8797 0.1298  0.0066  0.0459  260 THR B O     
4374 C CB    . THR B 234 ? 0.5790 0.7311 0.9811 0.1365  0.0281  0.0258  260 THR B CB    
4375 O OG1   . THR B 234 ? 0.5854 0.7224 0.9995 0.1370  0.0331  0.0253  260 THR B OG1   
4376 C CG2   . THR B 234 ? 0.5919 0.7569 1.0181 0.1432  0.0070  0.0551  260 THR B CG2   
4377 N N     . ASP B 235 ? 0.5647 0.7417 0.9043 0.1270  0.0319  0.0083  261 ASP B N     
4378 C CA    . ASP B 235 ? 0.5631 0.7573 0.9029 0.1266  0.0241  0.0090  261 ASP B CA    
4379 C C     . ASP B 235 ? 0.5533 0.7493 0.8470 0.1190  0.0290  0.0028  261 ASP B C     
4380 O O     . ASP B 235 ? 0.5537 0.7647 0.8487 0.1180  0.0224  0.0013  261 ASP B O     
4381 C CB    . ASP B 235 ? 0.5643 0.7656 0.9515 0.1287  0.0321  -0.0065 261 ASP B CB    
4382 C CG    . ASP B 235 ? 0.5822 0.7873 1.0264 0.1375  0.0214  0.0025  261 ASP B CG    
4383 O OD1   . ASP B 235 ? 0.6065 0.8111 1.0954 0.1391  0.0328  -0.0139 261 ASP B OD1   
4384 O OD2   . ASP B 235 ? 0.5917 0.8020 1.0383 0.1425  0.0021  0.0268  261 ASP B OD2   
4385 N N     . THR B 236 ? 0.5466 0.7286 0.8051 0.1139  0.0399  -0.0014 262 THR B N     
4386 C CA    . THR B 236 ? 0.5344 0.7161 0.7550 0.1068  0.0449  -0.0053 262 THR B CA    
4387 C C     . THR B 236 ? 0.5326 0.7156 0.7224 0.1062  0.0315  0.0081  262 THR B C     
4388 O O     . THR B 236 ? 0.5378 0.7120 0.7186 0.1081  0.0278  0.0181  262 THR B O     
4389 C CB    . THR B 236 ? 0.5404 0.7092 0.7397 0.1016  0.0630  -0.0157 262 THR B CB    
4390 O OG1   . THR B 236 ? 0.5473 0.7182 0.7755 0.1023  0.0766  -0.0295 262 THR B OG1   
4391 C CG2   . THR B 236 ? 0.5218 0.6914 0.6933 0.0946  0.0690  -0.0176 262 THR B CG2   
4392 N N     . SER B 237 ? 0.5194 0.7152 0.6974 0.1031  0.0252  0.0068  263 SER B N     
4393 C CA    . SER B 237 ? 0.5116 0.7133 0.6603 0.1011  0.0146  0.0150  263 SER B CA    
4394 C C     . SER B 237 ? 0.4988 0.6841 0.6161 0.0954  0.0247  0.0119  263 SER B C     
4395 O O     . SER B 237 ? 0.4941 0.6717 0.6095 0.0913  0.0372  0.0025  263 SER B O     
4396 C CB    . SER B 237 ? 0.5127 0.7376 0.6649 0.0991  0.0052  0.0087  263 SER B CB    
4397 O OG    . SER B 237 ? 0.5359 0.7809 0.7118 0.1049  -0.0092 0.0151  263 SER B OG    
4398 N N     . ILE B 238 ? 0.4926 0.6743 0.5872 0.0952  0.0191  0.0217  264 ILE B N     
4399 C CA    . ILE B 238 ? 0.4754 0.6426 0.5421 0.0904  0.0260  0.0199  264 ILE B CA    
4400 C C     . ILE B 238 ? 0.4651 0.6440 0.5124 0.0863  0.0191  0.0194  264 ILE B C     
4401 O O     . ILE B 238 ? 0.4607 0.6524 0.5003 0.0876  0.0091  0.0285  264 ILE B O     
4402 C CB    . ILE B 238 ? 0.4851 0.6373 0.5457 0.0927  0.0273  0.0285  264 ILE B CB    
4403 C CG1   . ILE B 238 ? 0.4990 0.6427 0.5853 0.0969  0.0339  0.0251  264 ILE B CG1   
4404 C CG2   . ILE B 238 ? 0.4874 0.6262 0.5214 0.0879  0.0333  0.0253  264 ILE B CG2   
4405 C CD1   . ILE B 238 ? 0.5298 0.6689 0.6174 0.0940  0.0477  0.0103  264 ILE B CD1   
4406 N N     . ILE B 239 ? 0.4470 0.6231 0.4889 0.0809  0.0254  0.0091  265 ILE B N     
4407 C CA    . ILE B 239 ? 0.4280 0.6142 0.4587 0.0762  0.0215  0.0032  265 ILE B CA    
4408 C C     . ILE B 239 ? 0.4282 0.5955 0.4409 0.0728  0.0284  0.0044  265 ILE B C     
4409 O O     . ILE B 239 ? 0.4307 0.5822 0.4437 0.0722  0.0371  0.0048  265 ILE B O     
4410 C CB    . ILE B 239 ? 0.4212 0.6203 0.4729 0.0730  0.0224  -0.0105 265 ILE B CB    
4411 C CG1   . ILE B 239 ? 0.4272 0.6484 0.4973 0.0769  0.0130  -0.0125 265 ILE B CG1   
4412 C CG2   . ILE B 239 ? 0.4167 0.6261 0.4650 0.0674  0.0203  -0.0216 265 ILE B CG2   
4413 C CD1   . ILE B 239 ? 0.3892 0.6143 0.4902 0.0760  0.0180  -0.0230 265 ILE B CD1   
4414 N N     . LEU B 240 ? 0.4247 0.5965 0.4218 0.0705  0.0243  0.0052  266 LEU B N     
4415 C CA    . LEU B 240 ? 0.4196 0.5754 0.4026 0.0677  0.0289  0.0063  266 LEU B CA    
4416 C C     . LEU B 240 ? 0.4173 0.5818 0.4033 0.0619  0.0288  -0.0052 266 LEU B C     
4417 O O     . LEU B 240 ? 0.4263 0.6111 0.4091 0.0601  0.0234  -0.0109 266 LEU B O     
4418 C CB    . LEU B 240 ? 0.4204 0.5728 0.3888 0.0697  0.0259  0.0173  266 LEU B CB    
4419 C CG    . LEU B 240 ? 0.4087 0.5471 0.3642 0.0669  0.0294  0.0177  266 LEU B CG    
4420 C CD1   . LEU B 240 ? 0.3730 0.4914 0.3287 0.0671  0.0355  0.0163  266 LEU B CD1   
4421 C CD2   . LEU B 240 ? 0.4131 0.5511 0.3611 0.0688  0.0271  0.0296  266 LEU B CD2   
4422 N N     . PHE B 241 ? 0.4100 0.5623 0.4054 0.0591  0.0347  -0.0090 267 PHE B N     
4423 C CA    . PHE B 241 ? 0.4099 0.5667 0.4174 0.0538  0.0354  -0.0199 267 PHE B CA    
4424 C C     . PHE B 241 ? 0.4134 0.5553 0.4079 0.0524  0.0369  -0.0153 267 PHE B C     
4425 O O     . PHE B 241 ? 0.4063 0.5306 0.3969 0.0533  0.0402  -0.0068 267 PHE B O     
4426 C CB    . PHE B 241 ? 0.4109 0.5632 0.4456 0.0515  0.0405  -0.0229 267 PHE B CB    
4427 C CG    . PHE B 241 ? 0.4248 0.5944 0.4838 0.0511  0.0395  -0.0332 267 PHE B CG    
4428 C CD1   . PHE B 241 ? 0.4258 0.6153 0.4785 0.0534  0.0325  -0.0386 267 PHE B CD1   
4429 C CD2   . PHE B 241 ? 0.4296 0.5966 0.5212 0.0483  0.0452  -0.0359 267 PHE B CD2   
4430 C CE1   . PHE B 241 ? 0.4124 0.6200 0.4901 0.0532  0.0301  -0.0498 267 PHE B CE1   
4431 C CE2   . PHE B 241 ? 0.4305 0.6136 0.5505 0.0477  0.0447  -0.0472 267 PHE B CE2   
4432 C CZ    . PHE B 241 ? 0.4194 0.6231 0.5318 0.0503  0.0367  -0.0557 267 PHE B CZ    
4433 N N     . LEU B 242 ? 0.3641 0.4653 0.4179 -0.0173 -0.0197 -0.0089 268 LEU B N     
4434 C CA    . LEU B 242 ? 0.3639 0.4415 0.3923 -0.0158 -0.0127 -0.0071 268 LEU B CA    
4435 C C     . LEU B 242 ? 0.3780 0.4432 0.3970 -0.0248 -0.0141 -0.0133 268 LEU B C     
4436 O O     . LEU B 242 ? 0.4008 0.4621 0.4080 -0.0254 -0.0224 -0.0191 268 LEU B O     
4437 C CB    . LEU B 242 ? 0.3649 0.4364 0.3758 -0.0065 -0.0158 -0.0021 268 LEU B CB    
4438 C CG    . LEU B 242 ? 0.3785 0.4527 0.3981 0.0034  -0.0136 0.0062  268 LEU B CG    
4439 C CD1   . LEU B 242 ? 0.3931 0.4565 0.3912 0.0111  -0.0154 0.0153  268 LEU B CD1   
4440 C CD2   . LEU B 242 ? 0.3695 0.4334 0.3955 0.0032  -0.0013 0.0056  268 LEU B CD2   
4441 N N     . ASN B 243 ? 0.3730 0.4284 0.3937 -0.0306 -0.0056 -0.0119 269 ASN B N     
4442 C CA    . ASN B 243 ? 0.3798 0.4197 0.3974 -0.0398 -0.0056 -0.0149 269 ASN B CA    
4443 C C     . ASN B 243 ? 0.3810 0.3985 0.3791 -0.0342 -0.0050 -0.0142 269 ASN B C     
4444 O O     . ASN B 243 ? 0.3570 0.3762 0.3490 -0.0258 -0.0039 -0.0120 269 ASN B O     
4445 C CB    . ASN B 243 ? 0.3829 0.4239 0.4129 -0.0497 0.0051  -0.0101 269 ASN B CB    
4446 C CG    . ASN B 243 ? 0.4051 0.4240 0.4333 -0.0614 0.0070  -0.0100 269 ASN B CG    
4447 O OD1   . ASN B 243 ? 0.4112 0.4272 0.4479 -0.0683 -0.0018 -0.0189 269 ASN B OD1   
4448 N ND2   . ASN B 243 ? 0.3845 0.3836 0.3978 -0.0635 0.0180  0.0000  269 ASN B ND2   
4449 N N     . LYS B 244 ? 0.3962 0.3929 0.3898 -0.0388 -0.0062 -0.0166 270 LYS B N     
4450 C CA    . LYS B 244 ? 0.4218 0.3985 0.4033 -0.0299 -0.0076 -0.0168 270 LYS B CA    
4451 C C     . LYS B 244 ? 0.4158 0.4004 0.3943 -0.0206 -0.0097 -0.0248 270 LYS B C     
4452 O O     . LYS B 244 ? 0.4215 0.4057 0.4002 -0.0108 -0.0082 -0.0239 270 LYS B O     
4453 C CB    . LYS B 244 ? 0.4197 0.3911 0.3930 -0.0240 -0.0058 -0.0070 270 LYS B CB    
4454 C CG    . LYS B 244 ? 0.4545 0.4116 0.4193 -0.0323 0.0002  0.0027  270 LYS B CG    
4455 C CD    . LYS B 244 ? 0.5058 0.4509 0.4498 -0.0245 -0.0017 0.0119  270 LYS B CD    
4456 C CE    . LYS B 244 ? 0.5099 0.4324 0.4343 -0.0322 0.0074  0.0250  270 LYS B CE    
4457 N NZ    . LYS B 244 ? 0.5262 0.4361 0.4186 -0.0225 0.0025  0.0342  270 LYS B NZ    
4458 N N     . LYS B 245 ? 0.4129 0.4060 0.3888 -0.0236 -0.0130 -0.0327 271 LYS B N     
4459 C CA    . LYS B 245 ? 0.4300 0.4277 0.3933 -0.0152 -0.0113 -0.0391 271 LYS B CA    
4460 C C     . LYS B 245 ? 0.4479 0.4271 0.4058 -0.0079 -0.0076 -0.0485 271 LYS B C     
4461 O O     . LYS B 245 ? 0.4563 0.4415 0.4105 0.0014  0.0004  -0.0508 271 LYS B O     
4462 C CB    . LYS B 245 ? 0.4401 0.4475 0.3916 -0.0185 -0.0192 -0.0455 271 LYS B CB    
4463 C CG    . LYS B 245 ? 0.4606 0.4544 0.4076 -0.0265 -0.0285 -0.0608 271 LYS B CG    
4464 C CD    . LYS B 245 ? 0.4740 0.4854 0.4170 -0.0315 -0.0430 -0.0659 271 LYS B CD    
4465 C CE    . LYS B 245 ? 0.5251 0.5242 0.4671 -0.0425 -0.0553 -0.0850 271 LYS B CE    
4466 N NZ    . LYS B 245 ? 0.5967 0.5863 0.5000 -0.0349 -0.0600 -0.1003 271 LYS B NZ    
4467 N N     . ASP B 246 ? 0.4654 0.4213 0.4260 -0.0120 -0.0113 -0.0531 272 ASP B N     
4468 C CA    . ASP B 246 ? 0.4990 0.4310 0.4579 -0.0022 -0.0082 -0.0621 272 ASP B CA    
4469 C C     . ASP B 246 ? 0.4919 0.4291 0.4647 0.0109  -0.0045 -0.0530 272 ASP B C     
4470 O O     . ASP B 246 ? 0.5010 0.4429 0.4796 0.0237  0.0023  -0.0601 272 ASP B O     
4471 C CB    . ASP B 246 ? 0.5250 0.4231 0.4853 -0.0106 -0.0130 -0.0662 272 ASP B CB    
4472 C CG    . ASP B 246 ? 0.5576 0.4487 0.5263 -0.0185 -0.0140 -0.0479 272 ASP B CG    
4473 O OD1   . ASP B 246 ? 0.5508 0.4669 0.5227 -0.0230 -0.0132 -0.0375 272 ASP B OD1   
4474 O OD2   . ASP B 246 ? 0.5829 0.4399 0.5517 -0.0194 -0.0140 -0.0436 272 ASP B OD2   
4475 N N     . LEU B 247 ? 0.4799 0.4189 0.4587 0.0079  -0.0091 -0.0386 273 LEU B N     
4476 C CA    . LEU B 247 ? 0.4703 0.4178 0.4618 0.0196  -0.0117 -0.0314 273 LEU B CA    
4477 C C     . LEU B 247 ? 0.4466 0.4264 0.4504 0.0218  -0.0060 -0.0333 273 LEU B C     
4478 O O     . LEU B 247 ? 0.4454 0.4387 0.4696 0.0323  -0.0047 -0.0354 273 LEU B O     
4479 C CB    . LEU B 247 ? 0.4675 0.4072 0.4513 0.0156  -0.0189 -0.0170 273 LEU B CB    
4480 C CG    . LEU B 247 ? 0.5012 0.4048 0.4711 0.0115  -0.0208 -0.0095 273 LEU B CG    
4481 C CD1   . LEU B 247 ? 0.4966 0.3953 0.4499 0.0075  -0.0235 0.0061  273 LEU B CD1   
4482 C CD2   . LEU B 247 ? 0.4996 0.3756 0.4740 0.0266  -0.0249 -0.0112 273 LEU B CD2   
4483 N N     . PHE B 248 ? 0.4346 0.4266 0.4300 0.0119  -0.0022 -0.0319 274 PHE B N     
4484 C CA    . PHE B 248 ? 0.4252 0.4400 0.4300 0.0121  0.0052  -0.0308 274 PHE B CA    
4485 C C     . PHE B 248 ? 0.4437 0.4645 0.4520 0.0200  0.0178  -0.0394 274 PHE B C     
4486 O O     . PHE B 248 ? 0.4339 0.4728 0.4647 0.0240  0.0260  -0.0393 274 PHE B O     
4487 C CB    . PHE B 248 ? 0.4028 0.4234 0.3953 0.0032  0.0064  -0.0259 274 PHE B CB    
4488 C CG    . PHE B 248 ? 0.4000 0.4347 0.3989 0.0028  0.0157  -0.0216 274 PHE B CG    
4489 C CD1   . PHE B 248 ? 0.3738 0.4166 0.3910 0.0000  0.0150  -0.0175 274 PHE B CD1   
4490 C CD2   . PHE B 248 ? 0.4229 0.4591 0.4058 0.0043  0.0257  -0.0218 274 PHE B CD2   
4491 C CE1   . PHE B 248 ? 0.3748 0.4256 0.4019 -0.0030 0.0252  -0.0133 274 PHE B CE1   
4492 C CE2   . PHE B 248 ? 0.3991 0.4426 0.3854 0.0027  0.0377  -0.0140 274 PHE B CE2   
4493 C CZ    . PHE B 248 ? 0.4097 0.4597 0.4218 -0.0019 0.0382  -0.0095 274 PHE B CZ    
4494 N N     . GLU B 249 ? 0.4742 0.4803 0.4613 0.0213  0.0201  -0.0485 275 GLU B N     
4495 C CA    . GLU B 249 ? 0.5093 0.5167 0.4911 0.0303  0.0346  -0.0595 275 GLU B CA    
4496 C C     . GLU B 249 ? 0.5122 0.5242 0.5250 0.0440  0.0400  -0.0650 275 GLU B C     
4497 O O     . GLU B 249 ? 0.5241 0.5535 0.5503 0.0510  0.0575  -0.0696 275 GLU B O     
4498 C CB    . GLU B 249 ? 0.5506 0.5362 0.5001 0.0293  0.0321  -0.0729 275 GLU B CB    
4499 C CG    . GLU B 249 ? 0.6148 0.6034 0.5400 0.0359  0.0491  -0.0831 275 GLU B CG    
4500 C CD    . GLU B 249 ? 0.7087 0.6722 0.6021 0.0379  0.0456  -0.1032 275 GLU B CD    
4501 O OE1   . GLU B 249 ? 0.7262 0.6760 0.6087 0.0275  0.0273  -0.1066 275 GLU B OE1   
4502 O OE2   . GLU B 249 ? 0.7683 0.7267 0.6496 0.0493  0.0624  -0.1175 275 GLU B OE2   
4503 N N     . GLU B 250 ? 0.5107 0.5076 0.5355 0.0489  0.0262  -0.0634 276 GLU B N     
4504 C CA    . GLU B 250 ? 0.5210 0.5230 0.5791 0.0658  0.0257  -0.0665 276 GLU B CA    
4505 C C     . GLU B 250 ? 0.4891 0.5266 0.5834 0.0662  0.0242  -0.0592 276 GLU B C     
4506 O O     . GLU B 250 ? 0.4880 0.5494 0.6188 0.0775  0.0335  -0.0653 276 GLU B O     
4507 C CB    . GLU B 250 ? 0.5399 0.5109 0.5957 0.0720  0.0086  -0.0617 276 GLU B CB    
4508 C CG    . GLU B 250 ? 0.6177 0.5481 0.6484 0.0714  0.0096  -0.0714 276 GLU B CG    
4509 C CD    . GLU B 250 ? 0.6993 0.5943 0.7175 0.0658  -0.0050 -0.0596 276 GLU B CD    
4510 O OE1   . GLU B 250 ? 0.7196 0.6144 0.7461 0.0714  -0.0167 -0.0444 276 GLU B OE1   
4511 O OE2   . GLU B 250 ? 0.7514 0.6173 0.7497 0.0548  -0.0046 -0.0657 276 GLU B OE2   
4512 N N     . LYS B 251 ? 0.4646 0.5065 0.5524 0.0536  0.0127  -0.0483 277 LYS B N     
4513 C CA    . LYS B 251 ? 0.4478 0.5183 0.5682 0.0516  0.0056  -0.0441 277 LYS B CA    
4514 C C     . LYS B 251 ? 0.4295 0.5282 0.5727 0.0444  0.0248  -0.0466 277 LYS B C     
4515 O O     . LYS B 251 ? 0.4247 0.5531 0.6132 0.0469  0.0255  -0.0496 277 LYS B O     
4516 C CB    . LYS B 251 ? 0.4407 0.5025 0.5410 0.0404  -0.0095 -0.0351 277 LYS B CB    
4517 C CG    . LYS B 251 ? 0.4711 0.5096 0.5539 0.0471  -0.0280 -0.0290 277 LYS B CG    
4518 C CD    . LYS B 251 ? 0.5112 0.5481 0.5766 0.0376  -0.0397 -0.0224 277 LYS B CD    
4519 C CE    . LYS B 251 ? 0.5479 0.5578 0.5849 0.0432  -0.0541 -0.0128 277 LYS B CE    
4520 N NZ    . LYS B 251 ? 0.5876 0.5999 0.6065 0.0373  -0.0655 -0.0096 277 LYS B NZ    
4521 N N     . ILE B 252 ? 0.4231 0.5125 0.5361 0.0353  0.0396  -0.0444 278 ILE B N     
4522 C CA    . ILE B 252 ? 0.4200 0.5267 0.5435 0.0266  0.0600  -0.0413 278 ILE B CA    
4523 C C     . ILE B 252 ? 0.4429 0.5739 0.6004 0.0344  0.0823  -0.0487 278 ILE B C     
4524 O O     . ILE B 252 ? 0.4428 0.5942 0.6253 0.0256  0.1001  -0.0449 278 ILE B O     
4525 C CB    . ILE B 252 ? 0.4249 0.5124 0.5009 0.0194  0.0686  -0.0348 278 ILE B CB    
4526 C CG1   . ILE B 252 ? 0.4409 0.5372 0.5234 0.0082  0.0846  -0.0246 278 ILE B CG1   
4527 C CG2   . ILE B 252 ? 0.4494 0.5247 0.4937 0.0282  0.0803  -0.0433 278 ILE B CG2   
4528 C CD1   . ILE B 252 ? 0.4320 0.5362 0.5461 -0.0023 0.0730  -0.0205 278 ILE B CD1   
4529 N N     . LYS B 253 ? 0.4623 0.5895 0.6237 0.0508  0.0832  -0.0593 279 LYS B N     
4530 C CA    . LYS B 253 ? 0.4923 0.6451 0.6926 0.0627  0.1053  -0.0691 279 LYS B CA    
4531 C C     . LYS B 253 ? 0.4808 0.6713 0.7515 0.0661  0.0949  -0.0705 279 LYS B C     
4532 O O     . LYS B 253 ? 0.4831 0.7091 0.8029 0.0676  0.1165  -0.0753 279 LYS B O     
4533 C CB    . LYS B 253 ? 0.5195 0.6509 0.7016 0.0817  0.1083  -0.0825 279 LYS B CB    
4534 C CG    . LYS B 253 ? 0.5609 0.6535 0.6739 0.0768  0.1086  -0.0847 279 LYS B CG    
4535 C CD    . LYS B 253 ? 0.6467 0.7204 0.7387 0.0925  0.1235  -0.1032 279 LYS B CD    
4536 C CE    . LYS B 253 ? 0.6725 0.7102 0.7529 0.1012  0.1017  -0.1107 279 LYS B CE    
4537 N NZ    . LYS B 253 ? 0.7237 0.7327 0.7566 0.0852  0.0839  -0.1056 279 LYS B NZ    
4538 N N     . LYS B 254 ? 0.4762 0.6609 0.7519 0.0670  0.0621  -0.0666 280 LYS B N     
4539 C CA    . LYS B 254 ? 0.4779 0.6984 0.8162 0.0721  0.0435  -0.0694 280 LYS B CA    
4540 C C     . LYS B 254 ? 0.4521 0.6863 0.8039 0.0516  0.0305  -0.0646 280 LYS B C     
4541 O O     . LYS B 254 ? 0.4462 0.7200 0.8593 0.0475  0.0258  -0.0700 280 LYS B O     
4542 C CB    . LYS B 254 ? 0.4980 0.7023 0.8320 0.0916  0.0126  -0.0689 280 LYS B CB    
4543 C CG    . LYS B 254 ? 0.5319 0.7754 0.9277 0.1000  -0.0134 -0.0717 280 LYS B CG    
4544 C CD    . LYS B 254 ? 0.5875 0.8145 0.9795 0.1248  -0.0439 -0.0682 280 LYS B CD    
4545 C CE    . LYS B 254 ? 0.6099 0.8810 1.0628 0.1339  -0.0742 -0.0715 280 LYS B CE    
4546 N NZ    . LYS B 254 ? 0.6025 0.9320 1.1417 0.1388  -0.0567 -0.0843 280 LYS B NZ    
4547 N N     . SER B 255 ? 0.4360 0.6379 0.7344 0.0391  0.0237  -0.0567 281 SER B N     
4548 C CA    . SER B 255 ? 0.4196 0.6247 0.7225 0.0228  0.0083  -0.0548 281 SER B CA    
4549 C C     . SER B 255 ? 0.4030 0.5973 0.6888 0.0041  0.0309  -0.0485 281 SER B C     
4550 O O     . SER B 255 ? 0.4059 0.5705 0.6404 0.0031  0.0391  -0.0412 281 SER B O     
4551 C CB    . SER B 255 ? 0.4249 0.6014 0.6833 0.0264  -0.0196 -0.0509 281 SER B CB    
4552 O OG    . SER B 255 ? 0.4494 0.6287 0.7168 0.0455  -0.0402 -0.0524 281 SER B OG    
4553 N N     . PRO B 256 ? 0.3909 0.6089 0.7225 -0.0107 0.0402  -0.0509 282 PRO B N     
4554 C CA    . PRO B 256 ? 0.3938 0.5958 0.7094 -0.0272 0.0634  -0.0416 282 PRO B CA    
4555 C C     . PRO B 256 ? 0.3872 0.5568 0.6620 -0.0345 0.0474  -0.0377 282 PRO B C     
4556 O O     . PRO B 256 ? 0.3843 0.5546 0.6638 -0.0352 0.0210  -0.0457 282 PRO B O     
4557 C CB    . PRO B 256 ? 0.3946 0.6300 0.7799 -0.0431 0.0751  -0.0464 282 PRO B CB    
4558 C CG    . PRO B 256 ? 0.3899 0.6569 0.8225 -0.0374 0.0448  -0.0607 282 PRO B CG    
4559 C CD    . PRO B 256 ? 0.3933 0.6545 0.7978 -0.0130 0.0302  -0.0617 282 PRO B CD    
4560 N N     . LEU B 257 ? 0.3839 0.5263 0.6182 -0.0382 0.0636  -0.0258 283 LEU B N     
4561 C CA    . LEU B 257 ? 0.3912 0.5042 0.5907 -0.0420 0.0532  -0.0215 283 LEU B CA    
4562 C C     . LEU B 257 ? 0.4017 0.5122 0.6302 -0.0573 0.0459  -0.0278 283 LEU B C     
4563 O O     . LEU B 257 ? 0.3958 0.4843 0.6008 -0.0582 0.0333  -0.0303 283 LEU B O     
4564 C CB    . LEU B 257 ? 0.4029 0.4920 0.5614 -0.0405 0.0710  -0.0066 283 LEU B CB    
4565 C CG    . LEU B 257 ? 0.4172 0.4792 0.5401 -0.0384 0.0603  -0.0016 283 LEU B CG    
4566 C CD1   . LEU B 257 ? 0.4054 0.4668 0.5073 -0.0287 0.0400  -0.0088 283 LEU B CD1   
4567 C CD2   . LEU B 257 ? 0.4224 0.4657 0.5110 -0.0350 0.0748  0.0143  283 LEU B CD2   
4568 N N     . THR B 258 ? 0.4087 0.5431 0.6915 -0.0695 0.0544  -0.0329 284 THR B N     
4569 C CA    . THR B 258 ? 0.4270 0.5599 0.7458 -0.0878 0.0480  -0.0420 284 THR B CA    
4570 C C     . THR B 258 ? 0.4233 0.5629 0.7436 -0.0849 0.0129  -0.0602 284 THR B C     
4571 O O     . THR B 258 ? 0.4417 0.5697 0.7727 -0.0976 0.0013  -0.0718 284 THR B O     
4572 C CB    . THR B 258 ? 0.4444 0.6086 0.8325 -0.1044 0.0663  -0.0444 284 THR B CB    
4573 O OG1   . THR B 258 ? 0.4414 0.6500 0.8670 -0.0943 0.0582  -0.0535 284 THR B OG1   
4574 C CG2   . THR B 258 ? 0.4446 0.5931 0.8224 -0.1107 0.1058  -0.0236 284 THR B CG2   
4575 N N     . ILE B 259 ? 0.4104 0.5647 0.7161 -0.0678 -0.0037 -0.0628 285 ILE B N     
4576 C CA    . ILE B 259 ? 0.4200 0.5729 0.7075 -0.0613 -0.0365 -0.0751 285 ILE B CA    
4577 C C     . ILE B 259 ? 0.4328 0.5468 0.6679 -0.0625 -0.0392 -0.0752 285 ILE B C     
4578 O O     . ILE B 259 ? 0.4572 0.5637 0.6833 -0.0666 -0.0593 -0.0896 285 ILE B O     
4579 C CB    . ILE B 259 ? 0.4118 0.5736 0.6788 -0.0404 -0.0493 -0.0709 285 ILE B CB    
4580 C CG1   . ILE B 259 ? 0.4031 0.6059 0.7277 -0.0346 -0.0506 -0.0744 285 ILE B CG1   
4581 C CG2   . ILE B 259 ? 0.4186 0.5684 0.6485 -0.0330 -0.0800 -0.0780 285 ILE B CG2   
4582 C CD1   . ILE B 259 ? 0.3908 0.5967 0.6991 -0.0115 -0.0632 -0.0700 285 ILE B CD1   
4583 N N     . CYS B 260 ? 0.4295 0.5210 0.6310 -0.0576 -0.0193 -0.0605 286 CYS B N     
4584 C CA    . CYS B 260 ? 0.4392 0.4992 0.5984 -0.0552 -0.0178 -0.0589 286 CYS B CA    
4585 C C     . CYS B 260 ? 0.4633 0.5008 0.6335 -0.0667 -0.0027 -0.0573 286 CYS B C     
4586 O O     . CYS B 260 ? 0.4845 0.4997 0.6419 -0.0696 -0.0084 -0.0676 286 CYS B O     
4587 C CB    . CYS B 260 ? 0.4208 0.4732 0.5447 -0.0426 -0.0086 -0.0446 286 CYS B CB    
4588 S SG    . CYS B 260 ? 0.4196 0.4454 0.5006 -0.0364 -0.0079 -0.0436 286 CYS B SG    
4589 N N     . TYR B 261 ? 0.4610 0.5004 0.6510 -0.0721 0.0180  -0.0439 287 TYR B N     
4590 C CA    . TYR B 261 ? 0.4814 0.4936 0.6800 -0.0823 0.0347  -0.0368 287 TYR B CA    
4591 C C     . TYR B 261 ? 0.5028 0.5300 0.7544 -0.1009 0.0457  -0.0384 287 TYR B C     
4592 O O     . TYR B 261 ? 0.5001 0.5390 0.7620 -0.1022 0.0665  -0.0237 287 TYR B O     
4593 C CB    . TYR B 261 ? 0.4761 0.4716 0.6432 -0.0720 0.0521  -0.0145 287 TYR B CB    
4594 C CG    . TYR B 261 ? 0.4525 0.4399 0.5789 -0.0555 0.0428  -0.0127 287 TYR B CG    
4595 C CD1   . TYR B 261 ? 0.4324 0.3932 0.5451 -0.0509 0.0407  -0.0150 287 TYR B CD1   
4596 C CD2   . TYR B 261 ? 0.4196 0.4258 0.5259 -0.0447 0.0380  -0.0094 287 TYR B CD2   
4597 C CE1   . TYR B 261 ? 0.4104 0.3702 0.4956 -0.0366 0.0351  -0.0137 287 TYR B CE1   
4598 C CE2   . TYR B 261 ? 0.4122 0.4136 0.4895 -0.0331 0.0311  -0.0080 287 TYR B CE2   
4599 C CZ    . TYR B 261 ? 0.4166 0.3982 0.4862 -0.0294 0.0304  -0.0099 287 TYR B CZ    
4600 O OH    . TYR B 261 ? 0.4098 0.3931 0.4605 -0.0188 0.0265  -0.0090 287 TYR B OH    
4601 N N     . PRO B 262 ? 0.5233 0.5512 0.8095 -0.1164 0.0326  -0.0579 288 PRO B N     
4602 C CA    . PRO B 262 ? 0.5385 0.5901 0.8889 -0.1372 0.0399  -0.0636 288 PRO B CA    
4603 C C     . PRO B 262 ? 0.5686 0.5988 0.9338 -0.1502 0.0746  -0.0428 288 PRO B C     
4604 O O     . PRO B 262 ? 0.5758 0.6310 0.9921 -0.1657 0.0912  -0.0402 288 PRO B O     
4605 C CB    . PRO B 262 ? 0.5588 0.6041 0.9332 -0.1518 0.0155  -0.0909 288 PRO B CB    
4606 C CG    . PRO B 262 ? 0.5574 0.5815 0.8729 -0.1346 -0.0051 -0.1004 288 PRO B CG    
4607 C CD    . PRO B 262 ? 0.5409 0.5460 0.8076 -0.1161 0.0122  -0.0771 288 PRO B CD    
4608 N N     . GLU B 263 ? 0.5975 0.5829 0.9188 -0.1428 0.0862  -0.0265 289 GLU B N     
4609 C CA    . GLU B 263 ? 0.6428 0.5977 0.9651 -0.1521 0.1180  -0.0019 289 GLU B CA    
4610 C C     . GLU B 263 ? 0.6388 0.6011 0.9242 -0.1375 0.1382  0.0234  289 GLU B C     
4611 O O     . GLU B 263 ? 0.6791 0.6168 0.9542 -0.1427 0.1658  0.0476  289 GLU B O     
4612 C CB    . GLU B 263 ? 0.6817 0.5794 0.9780 -0.1496 0.1181  0.0033  289 GLU B CB    
4613 C CG    . GLU B 263 ? 0.7001 0.5791 0.9344 -0.1217 0.1125  0.0169  289 GLU B CG    
4614 C CD    . GLU B 263 ? 0.6979 0.5980 0.9108 -0.1059 0.0852  -0.0033 289 GLU B CD    
4615 O OE1   . GLU B 263 ? 0.6851 0.6134 0.9200 -0.1129 0.0681  -0.0261 289 GLU B OE1   
4616 O OE2   . GLU B 263 ? 0.7256 0.6142 0.8991 -0.0861 0.0810  0.0047  289 GLU B OE2   
4617 N N     . TYR B 264 ? 0.5968 0.5885 0.8582 -0.1195 0.1247  0.0181  290 TYR B N     
4618 C CA    . TYR B 264 ? 0.5974 0.5950 0.8201 -0.1054 0.1402  0.0363  290 TYR B CA    
4619 C C     . TYR B 264 ? 0.6156 0.6368 0.8694 -0.1170 0.1698  0.0437  290 TYR B C     
4620 O O     . TYR B 264 ? 0.5973 0.6583 0.9034 -0.1247 0.1671  0.0273  290 TYR B O     
4621 C CB    . TYR B 264 ? 0.5546 0.5753 0.7518 -0.0866 0.1188  0.0253  290 TYR B CB    
4622 C CG    . TYR B 264 ? 0.5454 0.5723 0.7035 -0.0730 0.1314  0.0376  290 TYR B CG    
4623 C CD1   . TYR B 264 ? 0.5591 0.5571 0.6652 -0.0631 0.1371  0.0565  290 TYR B CD1   
4624 C CD2   . TYR B 264 ? 0.5195 0.5801 0.6919 -0.0683 0.1354  0.0285  290 TYR B CD2   
4625 C CE1   . TYR B 264 ? 0.5700 0.5726 0.6346 -0.0511 0.1449  0.0640  290 TYR B CE1   
4626 C CE2   . TYR B 264 ? 0.5197 0.5816 0.6521 -0.0557 0.1467  0.0352  290 TYR B CE2   
4627 C CZ    . TYR B 264 ? 0.5427 0.5755 0.6190 -0.0483 0.1506  0.0519  290 TYR B CZ    
4628 O OH    . TYR B 264 ? 0.5673 0.6000 0.5990 -0.0366 0.1585  0.0555  290 TYR B OH    
4629 N N     . ALA B 265 ? 0.6581 0.6561 0.8789 -0.1165 0.1981  0.0689  291 ALA B N     
4630 C CA    . ALA B 265 ? 0.6916 0.7062 0.9388 -0.1298 0.2351  0.0792  291 ALA B CA    
4631 C C     . ALA B 265 ? 0.7088 0.7322 0.9042 -0.1127 0.2522  0.0897  291 ALA B C     
4632 O O     . ALA B 265 ? 0.7439 0.7757 0.9438 -0.1198 0.2885  0.1014  291 ALA B O     
4633 C CB    . ALA B 265 ? 0.7405 0.7146 0.9943 -0.1490 0.2619  0.1018  291 ALA B CB    
4634 N N     . GLY B 266 ? 0.6932 0.7142 0.8398 -0.0911 0.2269  0.0838  292 GLY B N     
4635 C CA    . GLY B 266 ? 0.7085 0.7343 0.8011 -0.0742 0.2362  0.0878  292 GLY B CA    
4636 C C     . GLY B 266 ? 0.6781 0.7464 0.8003 -0.0674 0.2341  0.0651  292 GLY B C     
4637 O O     . GLY B 266 ? 0.6494 0.7480 0.8373 -0.0754 0.2266  0.0489  292 GLY B O     
4638 N N     . SER B 267 ? 0.6917 0.7609 0.7650 -0.0515 0.2396  0.0631  293 SER B N     
4639 C CA    . SER B 267 ? 0.6744 0.7778 0.7731 -0.0427 0.2454  0.0432  293 SER B CA    
4640 C C     . SER B 267 ? 0.6213 0.7285 0.7190 -0.0306 0.2070  0.0257  293 SER B C     
4641 O O     . SER B 267 ? 0.6185 0.7024 0.6818 -0.0275 0.1824  0.0297  293 SER B O     
4642 C CB    . SER B 267 ? 0.7256 0.8236 0.7700 -0.0321 0.2745  0.0467  293 SER B CB    
4643 O OG    . SER B 267 ? 0.7704 0.8408 0.7409 -0.0184 0.2531  0.0473  293 SER B OG    
4644 N N     . ASN B 268 ? 0.5892 0.7257 0.7277 -0.0233 0.2031  0.0074  294 ASN B N     
4645 C CA    . ASN B 268 ? 0.5436 0.6800 0.6815 -0.0122 0.1697  -0.0065 294 ASN B CA    
4646 C C     . ASN B 268 ? 0.5553 0.6782 0.6436 0.0037  0.1697  -0.0148 294 ASN B C     
4647 O O     . ASN B 268 ? 0.5472 0.6826 0.6546 0.0158  0.1677  -0.0299 294 ASN B O     
4648 C CB    . ASN B 268 ? 0.5140 0.6841 0.7223 -0.0114 0.1589  -0.0198 294 ASN B CB    
4649 C CG    . ASN B 268 ? 0.5132 0.6916 0.7641 -0.0285 0.1474  -0.0167 294 ASN B CG    
4650 O OD1   . ASN B 268 ? 0.4963 0.6520 0.7240 -0.0333 0.1263  -0.0127 294 ASN B OD1   
4651 N ND2   . ASN B 268 ? 0.5122 0.7241 0.8284 -0.0381 0.1621  -0.0206 294 ASN B ND2   
4652 N N     . THR B 269 ? 0.5685 0.6644 0.5940 0.0042  0.1706  -0.0054 295 THR B N     
4653 C CA    . THR B 269 ? 0.5816 0.6607 0.5547 0.0163  0.1639  -0.0155 295 THR B CA    
4654 C C     . THR B 269 ? 0.5557 0.6164 0.5041 0.0150  0.1313  -0.0134 295 THR B C     
4655 O O     . THR B 269 ? 0.5465 0.6019 0.4982 0.0072  0.1221  0.0000  295 THR B O     
4656 C CB    . THR B 269 ? 0.6393 0.7047 0.5532 0.0191  0.1887  -0.0086 295 THR B CB    
4657 O OG1   . THR B 269 ? 0.6471 0.6951 0.5310 0.0116  0.1847  0.0131  295 THR B OG1   
4658 C CG2   . THR B 269 ? 0.6695 0.7545 0.6070 0.0191  0.2291  -0.0090 295 THR B CG2   
4659 N N     . TYR B 270 ? 0.5495 0.5998 0.4757 0.0225  0.1160  -0.0276 296 TYR B N     
4660 C CA    . TYR B 270 ? 0.5260 0.5637 0.4363 0.0199  0.0879  -0.0275 296 TYR B CA    
4661 C C     . TYR B 270 ? 0.5364 0.5658 0.4152 0.0161  0.0819  -0.0118 296 TYR B C     
4662 O O     . TYR B 270 ? 0.5117 0.5415 0.4066 0.0113  0.0674  -0.0035 296 TYR B O     
4663 C CB    . TYR B 270 ? 0.5384 0.5625 0.4241 0.0257  0.0769  -0.0458 296 TYR B CB    
4664 C CG    . TYR B 270 ? 0.5196 0.5351 0.3945 0.0199  0.0506  -0.0458 296 TYR B CG    
4665 C CD1   . TYR B 270 ? 0.4789 0.4969 0.3869 0.0146  0.0368  -0.0426 296 TYR B CD1   
4666 C CD2   . TYR B 270 ? 0.5273 0.5350 0.3598 0.0199  0.0398  -0.0486 296 TYR B CD2   
4667 C CE1   . TYR B 270 ? 0.4631 0.4776 0.3679 0.0081  0.0176  -0.0423 296 TYR B CE1   
4668 C CE2   . TYR B 270 ? 0.5115 0.5191 0.3461 0.0137  0.0157  -0.0497 296 TYR B CE2   
4669 C CZ    . TYR B 270 ? 0.4854 0.4974 0.3594 0.0073  0.0072  -0.0464 296 TYR B CZ    
4670 O OH    . TYR B 270 ? 0.4615 0.4777 0.3440 0.0002  -0.0114 -0.0471 296 TYR B OH    
4671 N N     . GLU B 271 ? 0.5829 0.6036 0.4144 0.0204  0.0933  -0.0076 297 GLU B N     
4672 C CA    . GLU B 271 ? 0.6046 0.6143 0.3977 0.0214  0.0834  0.0083  297 GLU B CA    
4673 C C     . GLU B 271 ? 0.5993 0.6066 0.4131 0.0162  0.0917  0.0307  297 GLU B C     
4674 O O     . GLU B 271 ? 0.5975 0.5999 0.4132 0.0167  0.0741  0.0405  297 GLU B O     
4675 C CB    . GLU B 271 ? 0.6635 0.6610 0.3913 0.0288  0.0945  0.0090  297 GLU B CB    
4676 C CG    . GLU B 271 ? 0.6763 0.6689 0.3702 0.0341  0.0792  -0.0150 297 GLU B CG    
4677 C CD    . GLU B 271 ? 0.6359 0.6306 0.3437 0.0368  0.0978  -0.0366 297 GLU B CD    
4678 O OE1   . GLU B 271 ? 0.5913 0.5982 0.3434 0.0351  0.1195  -0.0327 297 GLU B OE1   
4679 O OE2   . GLU B 271 ? 0.6298 0.6140 0.3074 0.0413  0.0892  -0.0589 297 GLU B OE2   
4680 N N     . GLU B 272 ? 0.6149 0.6252 0.4472 0.0111  0.1196  0.0379  298 GLU B N     
4681 C CA    . GLU B 272 ? 0.6240 0.6265 0.4775 0.0035  0.1287  0.0574  298 GLU B CA    
4682 C C     . GLU B 272 ? 0.5677 0.5779 0.4730 -0.0025 0.1108  0.0512  298 GLU B C     
4683 O O     . GLU B 272 ? 0.5710 0.5683 0.4783 -0.0030 0.1007  0.0621  298 GLU B O     
4684 C CB    . GLU B 272 ? 0.6506 0.6567 0.5192 -0.0044 0.1647  0.0654  298 GLU B CB    
4685 C CG    . GLU B 272 ? 0.7002 0.6829 0.5589 -0.0109 0.1796  0.0920  298 GLU B CG    
4686 C CD    . GLU B 272 ? 0.7414 0.7315 0.6375 -0.0251 0.2155  0.0988  298 GLU B CD    
4687 O OE1   . GLU B 272 ? 0.7535 0.7625 0.6529 -0.0248 0.2392  0.0901  298 GLU B OE1   
4688 O OE2   . GLU B 272 ? 0.7660 0.7430 0.6924 -0.0371 0.2211  0.1117  298 GLU B OE2   
4689 N N     . ALA B 273 ? 0.5274 0.5563 0.4698 -0.0050 0.1067  0.0338  299 ALA B N     
4690 C CA    . ALA B 273 ? 0.4835 0.5185 0.4662 -0.0103 0.0910  0.0274  299 ALA B CA    
4691 C C     . ALA B 273 ? 0.4749 0.5027 0.4417 -0.0054 0.0673  0.0258  299 ALA B C     
4692 O O     . ALA B 273 ? 0.4604 0.4824 0.4415 -0.0080 0.0594  0.0290  299 ALA B O     
4693 C CB    . ALA B 273 ? 0.4479 0.5030 0.4660 -0.0107 0.0893  0.0117  299 ALA B CB    
4694 N N     . ALA B 274 ? 0.4814 0.5096 0.4207 0.0010  0.0577  0.0196  300 ALA B N     
4695 C CA    . ALA B 274 ? 0.4798 0.5071 0.4121 0.0036  0.0372  0.0175  300 ALA B CA    
4696 C C     . ALA B 274 ? 0.4963 0.5150 0.4161 0.0078  0.0325  0.0324  300 ALA B C     
4697 O O     . ALA B 274 ? 0.4866 0.5072 0.4231 0.0087  0.0220  0.0330  300 ALA B O     
4698 C CB    . ALA B 274 ? 0.4941 0.5230 0.4034 0.0068  0.0272  0.0057  300 ALA B CB    
4699 N N     . ALA B 275 ? 0.5295 0.5374 0.4181 0.0121  0.0417  0.0452  301 ALA B N     
4700 C CA    . ALA B 275 ? 0.5514 0.5451 0.4242 0.0192  0.0378  0.0640  301 ALA B CA    
4701 C C     . ALA B 275 ? 0.5357 0.5172 0.4401 0.0148  0.0466  0.0722  301 ALA B C     
4702 O O     . ALA B 275 ? 0.5492 0.5216 0.4582 0.0221  0.0373  0.0806  301 ALA B O     
4703 C CB    . ALA B 275 ? 0.6065 0.5852 0.4311 0.0242  0.0499  0.0791  301 ALA B CB    
4704 N N     . TYR B 276 ? 0.5173 0.4983 0.4448 0.0037  0.0641  0.0687  302 TYR B N     
4705 C CA    . TYR B 276 ? 0.5122 0.4815 0.4728 -0.0037 0.0702  0.0704  302 TYR B CA    
4706 C C     . TYR B 276 ? 0.4868 0.4631 0.4709 -0.0023 0.0538  0.0563  302 TYR B C     
4707 O O     . TYR B 276 ? 0.5008 0.4606 0.4959 -0.0001 0.0526  0.0598  302 TYR B O     
4708 C CB    . TYR B 276 ? 0.5027 0.4793 0.4913 -0.0177 0.0878  0.0647  302 TYR B CB    
4709 C CG    . TYR B 276 ? 0.4999 0.4599 0.5208 -0.0288 0.0954  0.0668  302 TYR B CG    
4710 C CD1   . TYR B 276 ? 0.5326 0.4634 0.5461 -0.0325 0.1126  0.0874  302 TYR B CD1   
4711 C CD2   . TYR B 276 ? 0.4411 0.4106 0.4966 -0.0361 0.0850  0.0482  302 TYR B CD2   
4712 C CE1   . TYR B 276 ? 0.5387 0.4488 0.5859 -0.0453 0.1195  0.0868  302 TYR B CE1   
4713 C CE2   . TYR B 276 ? 0.4505 0.4030 0.5348 -0.0478 0.0893  0.0452  302 TYR B CE2   
4714 C CZ    . TYR B 276 ? 0.4993 0.4218 0.5828 -0.0532 0.1067  0.0633  302 TYR B CZ    
4715 O OH    . TYR B 276 ? 0.5381 0.4401 0.6540 -0.0671 0.1103  0.0572  302 TYR B OH    
4716 N N     . ILE B 277 ? 0.4579 0.4546 0.4467 -0.0028 0.0436  0.0412  303 ILE B N     
4717 C CA    . ILE B 277 ? 0.4483 0.4507 0.4514 -0.0017 0.0324  0.0302  303 ILE B CA    
4718 C C     . ILE B 277 ? 0.4711 0.4733 0.4671 0.0093  0.0231  0.0362  303 ILE B C     
4719 O O     . ILE B 277 ? 0.4739 0.4709 0.4842 0.0131  0.0219  0.0336  303 ILE B O     
4720 C CB    . ILE B 277 ? 0.4270 0.4459 0.4330 -0.0052 0.0257  0.0169  303 ILE B CB    
4721 C CG1   . ILE B 277 ? 0.4062 0.4293 0.4282 -0.0126 0.0313  0.0106  303 ILE B CG1   
4722 C CG2   . ILE B 277 ? 0.3879 0.4102 0.4001 -0.0041 0.0179  0.0091  303 ILE B CG2   
4723 C CD1   . ILE B 277 ? 0.3610 0.3959 0.3840 -0.0120 0.0245  0.0010  303 ILE B CD1   
4724 N N     . GLN B 278 ? 0.4914 0.5002 0.4668 0.0155  0.0162  0.0428  304 GLN B N     
4725 C CA    . GLN B 278 ? 0.5116 0.5258 0.4864 0.0275  0.0035  0.0491  304 GLN B CA    
4726 C C     . GLN B 278 ? 0.5471 0.5397 0.5273 0.0368  0.0078  0.0627  304 GLN B C     
4727 O O     . GLN B 278 ? 0.5583 0.5547 0.5595 0.0460  0.0025  0.0610  304 GLN B O     
4728 C CB    . GLN B 278 ? 0.5285 0.5514 0.4750 0.0328  -0.0085 0.0536  304 GLN B CB    
4729 C CG    . GLN B 278 ? 0.5348 0.5681 0.4846 0.0469  -0.0270 0.0607  304 GLN B CG    
4730 C CD    . GLN B 278 ? 0.5663 0.6085 0.4836 0.0517  -0.0442 0.0622  304 GLN B CD    
4731 O OE1   . GLN B 278 ? 0.5779 0.6150 0.4655 0.0448  -0.0393 0.0571  304 GLN B OE1   
4732 N NE2   . GLN B 278 ? 0.5848 0.6420 0.5084 0.0648  -0.0659 0.0673  304 GLN B NE2   
4733 N N     . CYS B 279 ? 0.5793 0.5478 0.5431 0.0346  0.0197  0.0761  305 CYS B N     
4734 C CA    . CYS B 279 ? 0.6179 0.5554 0.5857 0.0410  0.0269  0.0909  305 CYS B CA    
4735 C C     . CYS B 279 ? 0.5947 0.5214 0.5951 0.0368  0.0330  0.0780  305 CYS B C     
4736 O O     . CYS B 279 ? 0.6162 0.5253 0.6277 0.0490  0.0315  0.0827  305 CYS B O     
4737 C CB    . CYS B 279 ? 0.6572 0.5699 0.6045 0.0331  0.0444  0.1069  305 CYS B CB    
4738 S SG    . CYS B 279 ? 0.7916 0.6926 0.6869 0.0476  0.0393  0.1331  305 CYS B SG    
4739 N N     . GLN B 280 ? 0.5590 0.4940 0.5723 0.0213  0.0389  0.0613  306 GLN B N     
4740 C CA    . GLN B 280 ? 0.5538 0.4784 0.5896 0.0163  0.0421  0.0453  306 GLN B CA    
4741 C C     . GLN B 280 ? 0.5398 0.4751 0.5843 0.0291  0.0351  0.0360  306 GLN B C     
4742 O O     . GLN B 280 ? 0.5540 0.4700 0.6108 0.0349  0.0393  0.0294  306 GLN B O     
4743 C CB    . GLN B 280 ? 0.5345 0.4729 0.5782 0.0002  0.0431  0.0289  306 GLN B CB    
4744 C CG    . GLN B 280 ? 0.5650 0.4960 0.6155 -0.0134 0.0537  0.0348  306 GLN B CG    
4745 C CD    . GLN B 280 ? 0.6647 0.5603 0.7282 -0.0184 0.0640  0.0410  306 GLN B CD    
4746 O OE1   . GLN B 280 ? 0.7203 0.6015 0.8003 -0.0230 0.0620  0.0254  306 GLN B OE1   
4747 N NE2   . GLN B 280 ? 0.7049 0.5818 0.7571 -0.0173 0.0758  0.0636  306 GLN B NE2   
4748 N N     . PHE B 281 ? 0.5152 0.4805 0.5556 0.0334  0.0262  0.0349  307 PHE B N     
4749 C CA    . PHE B 281 ? 0.5085 0.4912 0.5642 0.0440  0.0227  0.0276  307 PHE B CA    
4750 C C     . PHE B 281 ? 0.5372 0.5163 0.6041 0.0638  0.0172  0.0405  307 PHE B C     
4751 O O     . PHE B 281 ? 0.5503 0.5237 0.6374 0.0757  0.0220  0.0348  307 PHE B O     
4752 C CB    . PHE B 281 ? 0.4718 0.4871 0.5263 0.0378  0.0163  0.0214  307 PHE B CB    
4753 C CG    . PHE B 281 ? 0.4312 0.4486 0.4804 0.0252  0.0220  0.0074  307 PHE B CG    
4754 C CD1   . PHE B 281 ? 0.4138 0.4259 0.4494 0.0137  0.0211  0.0060  307 PHE B CD1   
4755 C CD2   . PHE B 281 ? 0.4150 0.4401 0.4721 0.0266  0.0289  -0.0037 307 PHE B CD2   
4756 C CE1   . PHE B 281 ? 0.3933 0.4065 0.4223 0.0052  0.0220  -0.0051 307 PHE B CE1   
4757 C CE2   . PHE B 281 ? 0.3813 0.4039 0.4235 0.0167  0.0328  -0.0139 307 PHE B CE2   
4758 C CZ    . PHE B 281 ? 0.3966 0.4127 0.4243 0.0069  0.0268  -0.0140 307 PHE B CZ    
4759 N N     . GLU B 282 ? 0.5600 0.5413 0.6114 0.0695  0.0067  0.0576  308 GLU B N     
4760 C CA    . GLU B 282 ? 0.5909 0.5728 0.6503 0.0914  -0.0050 0.0721  308 GLU B CA    
4761 C C     . GLU B 282 ? 0.6315 0.5707 0.6937 0.1037  0.0029  0.0838  308 GLU B C     
4762 O O     . GLU B 282 ? 0.6507 0.5883 0.7326 0.1255  -0.0037 0.0902  308 GLU B O     
4763 C CB    . GLU B 282 ? 0.6101 0.6022 0.6412 0.0950  -0.0214 0.0871  308 GLU B CB    
4764 C CG    . GLU B 282 ? 0.5958 0.6273 0.6278 0.0849  -0.0327 0.0739  308 GLU B CG    
4765 C CD    . GLU B 282 ? 0.6545 0.6961 0.6572 0.0915  -0.0535 0.0845  308 GLU B CD    
4766 O OE1   . GLU B 282 ? 0.6935 0.7082 0.6623 0.1012  -0.0553 0.1046  308 GLU B OE1   
4767 O OE2   . GLU B 282 ? 0.6398 0.7138 0.6506 0.0862  -0.0678 0.0725  308 GLU B OE2   
4768 N N     . ASP B 283 ? 0.6451 0.5495 0.6925 0.0897  0.0171  0.0862  309 ASP B N     
4769 C CA    . ASP B 283 ? 0.6963 0.5521 0.7474 0.0969  0.0268  0.0970  309 ASP B CA    
4770 C C     . ASP B 283 ? 0.6908 0.5355 0.7718 0.1029  0.0344  0.0766  309 ASP B C     
4771 O O     . ASP B 283 ? 0.7313 0.5344 0.8211 0.1136  0.0408  0.0820  309 ASP B O     
4772 C CB    . ASP B 283 ? 0.7223 0.5475 0.7577 0.0755  0.0417  0.1028  309 ASP B CB    
4773 C CG    . ASP B 283 ? 0.7780 0.5976 0.7780 0.0745  0.0414  0.1289  309 ASP B CG    
4774 O OD1   . ASP B 283 ? 0.8034 0.6404 0.7843 0.0908  0.0255  0.1418  309 ASP B OD1   
4775 O OD2   . ASP B 283 ? 0.8326 0.6312 0.8241 0.0566  0.0577  0.1354  309 ASP B OD2   
4776 N N     . LEU B 284 ? 0.6454 0.5227 0.7380 0.0961  0.0357  0.0530  310 LEU B N     
4777 C CA    . LEU B 284 ? 0.6479 0.5181 0.7612 0.1031  0.0452  0.0312  310 LEU B CA    
4778 C C     . LEU B 284 ? 0.6676 0.5470 0.8084 0.1323  0.0418  0.0359  310 LEU B C     
4779 O O     . LEU B 284 ? 0.6901 0.5457 0.8484 0.1456  0.0522  0.0240  310 LEU B O     
4780 C CB    . LEU B 284 ? 0.6056 0.5070 0.7152 0.0885  0.0490  0.0088  310 LEU B CB    
4781 C CG    . LEU B 284 ? 0.5816 0.4719 0.6715 0.0639  0.0510  0.0000  310 LEU B CG    
4782 C CD1   . LEU B 284 ? 0.5381 0.4619 0.6183 0.0532  0.0497  -0.0134 310 LEU B CD1   
4783 C CD2   . LEU B 284 ? 0.5916 0.4385 0.6834 0.0586  0.0594  -0.0152 310 LEU B CD2   
4784 N N     . ASN B 285 ? 0.6631 0.5776 0.8096 0.1429  0.0260  0.0513  311 ASN B N     
4785 C CA    . ASN B 285 ? 0.6984 0.6307 0.8782 0.1725  0.0165  0.0588  311 ASN B CA    
4786 C C     . ASN B 285 ? 0.7642 0.6454 0.9461 0.1948  0.0160  0.0760  311 ASN B C     
4787 O O     . ASN B 285 ? 0.7952 0.6478 0.9486 0.1953  0.0074  0.1011  311 ASN B O     
4788 C CB    . ASN B 285 ? 0.6796 0.6576 0.8600 0.1755  -0.0063 0.0719  311 ASN B CB    
4789 C CG    . ASN B 285 ? 0.7066 0.7164 0.9308 0.2053  -0.0213 0.0774  311 ASN B CG    
4790 O OD1   . ASN B 285 ? 0.7452 0.7486 1.0048 0.2256  -0.0112 0.0698  311 ASN B OD1   
4791 N ND2   . ASN B 285 ? 0.7090 0.7549 0.9327 0.2091  -0.0469 0.0887  311 ASN B ND2   
4792 N N     . LYS B 286 ? 0.9827 0.7629 0.9900 0.0616  -0.1287 -0.0093 312 LYS B N     
4793 C CA    . LYS B 286 ? 1.0093 0.7821 1.0070 0.0745  -0.1038 -0.0003 312 LYS B CA    
4794 C C     . LYS B 286 ? 1.0184 0.8209 1.0049 0.0905  -0.0900 0.0142  312 LYS B C     
4795 O O     . LYS B 286 ? 1.0371 0.8331 1.0237 0.1024  -0.0751 0.0276  312 LYS B O     
4796 C CB    . LYS B 286 ? 1.0346 0.7690 1.0158 0.0668  -0.1002 -0.0015 312 LYS B CB    
4797 C CG    . LYS B 286 ? 1.0517 0.7546 1.0454 0.0494  -0.1188 -0.0105 312 LYS B CG    
4798 C CD    . LYS B 286 ? 1.1038 0.7700 1.0749 0.0382  -0.1081 -0.0127 312 LYS B CD    
4799 C CE    . LYS B 286 ? 1.1368 0.7798 1.0652 0.0085  -0.1235 -0.0161 312 LYS B CE    
4800 N NZ    . LYS B 286 ? 1.1586 0.7740 1.0875 -0.0182 -0.1649 -0.0154 312 LYS B NZ    
4801 N N     . ARG B 287 ? 1.0164 0.8497 0.9982 0.0897  -0.0988 0.0135  313 ARG B N     
4802 C CA    . ARG B 287 ? 1.0286 0.8957 1.0078 0.1030  -0.0937 0.0283  313 ARG B CA    
4803 C C     . ARG B 287 ? 1.0219 0.9269 0.9969 0.0963  -0.0998 0.0284  313 ARG B C     
4804 O O     . ARG B 287 ? 1.0146 0.9526 0.9861 0.0971  -0.1061 0.0303  313 ARG B O     
4805 C CB    . ARG B 287 ? 1.0304 0.9050 1.0103 0.1058  -0.0920 0.0242  313 ARG B CB    
4806 C CG    . ARG B 287 ? 1.0685 0.9244 1.0662 0.1177  -0.0745 0.0282  313 ARG B CG    
4807 C CD    . ARG B 287 ? 1.1053 0.9695 1.1127 0.1132  -0.0635 0.0121  313 ARG B CD    
4808 N NE    . ARG B 287 ? 1.1352 0.9624 1.1126 0.0864  -0.0557 -0.0089 313 ARG B NE    
4809 C CZ    . ARG B 287 ? 1.1414 0.9613 1.0819 0.0604  -0.0696 -0.0192 313 ARG B CZ    
4810 N NH1   . ARG B 287 ? 1.1162 0.9656 1.0537 0.0612  -0.0869 -0.0153 313 ARG B NH1   
4811 N NH2   . ARG B 287 ? 1.1711 0.9510 1.0747 0.0290  -0.0679 -0.0323 313 ARG B NH2   
4812 N N     . LYS B 288 ? 1.0316 0.9320 1.0081 0.0854  -0.0937 0.0222  314 LYS B N     
4813 C CA    . LYS B 288 ? 1.0328 0.9643 1.0064 0.0678  -0.0902 0.0106  314 LYS B CA    
4814 C C     . LYS B 288 ? 1.0466 1.0177 0.9936 0.0650  -0.0947 0.0271  314 LYS B C     
4815 O O     . LYS B 288 ? 1.0368 1.0392 0.9840 0.0527  -0.0969 0.0128  314 LYS B O     
4816 C CB    . LYS B 288 ? 1.0559 0.9742 1.0299 0.0520  -0.0725 0.0015  314 LYS B CB    
4817 C CG    . LYS B 288 ? 1.0424 0.9329 1.0597 0.0486  -0.0700 -0.0234 314 LYS B CG    
4818 C CD    . LYS B 288 ? 1.0250 0.9346 1.0870 0.0295  -0.0653 -0.0588 314 LYS B CD    
4819 C CE    . LYS B 288 ? 1.0171 0.8996 1.1428 0.0287  -0.0723 -0.0810 314 LYS B CE    
4820 N NZ    . LYS B 288 ? 1.0304 0.8850 1.1509 0.0296  -0.0589 -0.0772 314 LYS B NZ    
4821 N N     . ASP B 289 ? 1.0745 1.0432 1.0039 0.0748  -0.0991 0.0580  315 ASP B N     
4822 C CA    . ASP B 289 ? 1.0974 1.1017 1.0036 0.0690  -0.1128 0.0810  315 ASP B CA    
4823 C C     . ASP B 289 ? 1.0778 1.1032 1.0101 0.0920  -0.1288 0.0927  315 ASP B C     
4824 O O     . ASP B 289 ? 1.1025 1.1541 1.0323 0.0940  -0.1476 0.1187  315 ASP B O     
4825 C CB    . ASP B 289 ? 1.1558 1.1457 1.0278 0.0572  -0.1170 0.1130  315 ASP B CB    
4826 C CG    . ASP B 289 ? 1.1758 1.1219 1.0680 0.0796  -0.1153 0.1317  315 ASP B CG    
4827 O OD1   . ASP B 289 ? 1.1508 1.0700 1.0667 0.0897  -0.0995 0.1094  315 ASP B OD1   
4828 O OD2   . ASP B 289 ? 1.2286 1.1653 1.1142 0.0844  -0.1327 0.1705  315 ASP B OD2   
4829 N N     . THR B 290 ? 1.0378 1.0513 0.9959 0.1042  -0.1222 0.0723  316 THR B N     
4830 C CA    . THR B 290 ? 1.0165 1.0517 1.0002 0.1172  -0.1277 0.0697  316 THR B CA    
4831 C C     . THR B 290 ? 0.9833 1.0278 0.9606 0.1044  -0.1245 0.0411  316 THR B C     
4832 O O     . THR B 290 ? 0.9744 1.0533 0.9580 0.1030  -0.1297 0.0360  316 THR B O     
4833 C CB    . THR B 290 ? 1.0236 1.0317 1.0426 0.1367  -0.1186 0.0720  316 THR B CB    
4834 O OG1   . THR B 290 ? 1.0213 0.9835 1.0289 0.1325  -0.1052 0.0618  316 THR B OG1   
4835 C CG2   . THR B 290 ? 1.0543 1.0671 1.1038 0.1544  -0.1307 0.1048  316 THR B CG2   
4836 N N     . LYS B 291 ? 0.9644 0.9765 0.9337 0.0938  -0.1196 0.0244  317 LYS B N     
4837 C CA    . LYS B 291 ? 0.9389 0.9479 0.9057 0.0789  -0.1244 0.0032  317 LYS B CA    
4838 C C     . LYS B 291 ? 0.9227 0.9344 0.8968 0.0644  -0.1258 -0.0101 317 LYS B C     
4839 O O     . LYS B 291 ? 0.9278 0.9167 0.9118 0.0625  -0.1212 -0.0125 317 LYS B O     
4840 C CB    . LYS B 291 ? 0.9487 0.9116 0.9106 0.0738  -0.1255 -0.0037 317 LYS B CB    
4841 C CG    . LYS B 291 ? 0.9521 0.9010 0.9045 0.0535  -0.1392 -0.0172 317 LYS B CG    
4842 C CD    . LYS B 291 ? 0.9769 0.8831 0.9037 0.0383  -0.1411 -0.0199 317 LYS B CD    
4843 C CE    . LYS B 291 ? 0.9941 0.8937 0.8956 0.0137  -0.1515 -0.0284 317 LYS B CE    
4844 N NZ    . LYS B 291 ? 0.9845 0.9311 0.8895 0.0197  -0.1365 -0.0356 317 LYS B NZ    
4845 N N     . GLU B 292 ? 0.9709 0.7021 1.1850 0.1692  -0.0656 0.0977  318 GLU B N     
4846 C CA    . GLU B 292 ? 0.9460 0.6849 1.1044 0.1498  -0.0670 0.1111  318 GLU B CA    
4847 C C     . GLU B 292 ? 0.8771 0.6457 1.0153 0.1274  -0.0612 0.0778  318 GLU B C     
4848 O O     . GLU B 292 ? 0.8436 0.6475 0.9969 0.1284  -0.0655 0.0557  318 GLU B O     
4849 C CB    . GLU B 292 ? 0.9640 0.7276 1.0925 0.1621  -0.0878 0.1442  318 GLU B CB    
4850 C CG    . GLU B 292 ? 0.9607 0.7736 1.0944 0.1729  -0.1057 0.1328  318 GLU B CG    
4851 C CD    . GLU B 292 ? 1.0216 0.8389 1.1988 0.2012  -0.1155 0.1430  318 GLU B CD    
4852 O OE1   . GLU B 292 ? 1.0752 0.8709 1.2595 0.2188  -0.1214 0.1788  318 GLU B OE1   
4853 O OE2   . GLU B 292 ? 1.0089 0.8562 1.2149 0.2063  -0.1181 0.1170  318 GLU B OE2   
4854 N N     . ILE B 293 ? 0.8514 0.6078 0.9591 0.1070  -0.0512 0.0767  319 ILE B N     
4855 C CA    . ILE B 293 ? 0.7884 0.5716 0.8760 0.0869  -0.0481 0.0521  319 ILE B CA    
4856 C C     . ILE B 293 ? 0.7708 0.5774 0.8189 0.0839  -0.0639 0.0641  319 ILE B C     
4857 O O     . ILE B 293 ? 0.7945 0.5908 0.8159 0.0858  -0.0666 0.0867  319 ILE B O     
4858 C CB    . ILE B 293 ? 0.7841 0.5465 0.8641 0.0666  -0.0289 0.0390  319 ILE B CB    
4859 C CG1   . ILE B 293 ? 0.8052 0.5362 0.9256 0.0687  -0.0129 0.0270  319 ILE B CG1   
4860 C CG2   . ILE B 293 ? 0.7163 0.5110 0.7841 0.0489  -0.0270 0.0146  319 ILE B CG2   
4861 C CD1   . ILE B 293 ? 0.8041 0.5589 0.9627 0.0741  -0.0093 -0.0049 319 ILE B CD1   
4862 N N     . TYR B 294 ? 0.7246 0.5656 0.7720 0.0784  -0.0741 0.0482  320 TYR B N     
4863 C CA    . TYR B 294 ? 0.7054 0.5686 0.7242 0.0745  -0.0902 0.0506  320 TYR B CA    
4864 C C     . TYR B 294 ? 0.6701 0.5351 0.6736 0.0544  -0.0836 0.0342  320 TYR B C     
4865 O O     . TYR B 294 ? 0.6435 0.5246 0.6634 0.0438  -0.0826 0.0183  320 TYR B O     
4866 C CB    . TYR B 294 ? 0.6905 0.5883 0.7268 0.0813  -0.1089 0.0456  320 TYR B CB    
4867 C CG    . TYR B 294 ? 0.7409 0.6433 0.7984 0.1029  -0.1160 0.0596  320 TYR B CG    
4868 C CD1   . TYR B 294 ? 0.7852 0.6941 0.8258 0.1183  -0.1303 0.0814  320 TYR B CD1   
4869 C CD2   . TYR B 294 ? 0.7540 0.6610 0.8501 0.1093  -0.1088 0.0503  320 TYR B CD2   
4870 C CE1   . TYR B 294 ? 0.8255 0.7408 0.8885 0.1404  -0.1383 0.0974  320 TYR B CE1   
4871 C CE2   . TYR B 294 ? 0.7881 0.7007 0.9092 0.1321  -0.1161 0.0617  320 TYR B CE2   
4872 C CZ    . TYR B 294 ? 0.8267 0.7412 0.9317 0.1478  -0.1315 0.0870  320 TYR B CZ    
4873 O OH    . TYR B 294 ? 0.8635 0.7855 0.9956 0.1721  -0.1402 0.1012  320 TYR B OH    
4874 N N     . THR B 295 ? 0.6690 0.5223 0.6425 0.0495  -0.0792 0.0403  321 THR B N     
4875 C CA    . THR B 295 ? 0.6368 0.4911 0.5976 0.0329  -0.0721 0.0254  321 THR B CA    
4876 C C     . THR B 295 ? 0.6249 0.5010 0.5694 0.0316  -0.0895 0.0170  321 THR B C     
4877 O O     . THR B 295 ? 0.6432 0.5309 0.5698 0.0417  -0.1017 0.0243  321 THR B O     
4878 C CB    . THR B 295 ? 0.6510 0.4828 0.5946 0.0262  -0.0544 0.0324  321 THR B CB    
4879 O OG1   . THR B 295 ? 0.6748 0.4819 0.6414 0.0280  -0.0401 0.0376  321 THR B OG1   
4880 C CG2   . THR B 295 ? 0.6339 0.4708 0.5705 0.0097  -0.0460 0.0147  321 THR B CG2   
4881 N N     . HIS B 296 ? 0.5905 0.4752 0.5453 0.0196  -0.0917 0.0010  322 HIS B N     
4882 C CA    . HIS B 296 ? 0.5792 0.4784 0.5283 0.0174  -0.1079 -0.0115 322 HIS B CA    
4883 C C     . HIS B 296 ? 0.5573 0.4526 0.5043 0.0048  -0.0987 -0.0223 322 HIS B C     
4884 O O     . HIS B 296 ? 0.5447 0.4368 0.5057 -0.0049 -0.0862 -0.0222 322 HIS B O     
4885 C CB    . HIS B 296 ? 0.5708 0.4862 0.5488 0.0167  -0.1268 -0.0166 322 HIS B CB    
4886 C CG    . HIS B 296 ? 0.6072 0.5335 0.5902 0.0296  -0.1377 -0.0080 322 HIS B CG    
4887 N ND1   . HIS B 296 ? 0.6351 0.5794 0.6125 0.0379  -0.1581 -0.0142 322 HIS B ND1   
4888 C CD2   . HIS B 296 ? 0.6177 0.5430 0.6126 0.0370  -0.1316 0.0042  322 HIS B CD2   
4889 C CE1   . HIS B 296 ? 0.6422 0.5977 0.6258 0.0493  -0.1643 -0.0029 322 HIS B CE1   
4890 N NE2   . HIS B 296 ? 0.6337 0.5761 0.6291 0.0499  -0.1485 0.0089  322 HIS B NE2   
4891 N N     . PHE B 297 ? 0.5473 0.4488 0.4773 0.0063  -0.1048 -0.0331 323 PHE B N     
4892 C CA    . PHE B 297 ? 0.5240 0.4263 0.4565 -0.0026 -0.1007 -0.0453 323 PHE B CA    
4893 C C     . PHE B 297 ? 0.5085 0.4179 0.4701 -0.0045 -0.1214 -0.0560 323 PHE B C     
4894 O O     . PHE B 297 ? 0.5158 0.4330 0.4822 0.0032  -0.1403 -0.0657 323 PHE B O     
4895 C CB    . PHE B 297 ? 0.5405 0.4503 0.4434 0.0009  -0.0955 -0.0534 323 PHE B CB    
4896 C CG    . PHE B 297 ? 0.5367 0.4374 0.4179 -0.0029 -0.0729 -0.0391 323 PHE B CG    
4897 C CD1   . PHE B 297 ? 0.5614 0.4578 0.4276 0.0041  -0.0695 -0.0206 323 PHE B CD1   
4898 C CD2   . PHE B 297 ? 0.5161 0.4131 0.3964 -0.0142 -0.0562 -0.0426 323 PHE B CD2   
4899 C CE1   . PHE B 297 ? 0.5711 0.4538 0.4259 -0.0010 -0.0497 -0.0040 323 PHE B CE1   
4900 C CE2   . PHE B 297 ? 0.5428 0.4290 0.4103 -0.0206 -0.0358 -0.0302 323 PHE B CE2   
4901 C CZ    . PHE B 297 ? 0.5389 0.4151 0.3955 -0.0145 -0.0326 -0.0101 323 PHE B CZ    
4902 N N     . THR B 298 ? 0.4831 0.3923 0.4670 -0.0154 -0.1187 -0.0535 324 THR B N     
4903 C CA    . THR B 298 ? 0.4681 0.3814 0.4883 -0.0200 -0.1384 -0.0550 324 THR B CA    
4904 C C     . THR B 298 ? 0.4654 0.3794 0.5016 -0.0263 -0.1406 -0.0586 324 THR B C     
4905 O O     . THR B 298 ? 0.4585 0.3758 0.4804 -0.0305 -0.1239 -0.0572 324 THR B O     
4906 C CB    . THR B 298 ? 0.4497 0.3722 0.4948 -0.0281 -0.1392 -0.0378 324 THR B CB    
4907 O OG1   . THR B 298 ? 0.4386 0.3699 0.4815 -0.0372 -0.1200 -0.0282 324 THR B OG1   
4908 C CG2   . THR B 298 ? 0.4575 0.3815 0.4933 -0.0194 -0.1395 -0.0344 324 THR B CG2   
4909 N N     . CYS B 299 ? 0.4816 0.3925 0.5516 -0.0264 -0.1627 -0.0637 325 CYS B N     
4910 C CA    . CYS B 299 ? 0.4944 0.4055 0.5954 -0.0334 -0.1697 -0.0573 325 CYS B CA    
4911 C C     . CYS B 299 ? 0.4949 0.4099 0.6375 -0.0446 -0.1840 -0.0367 325 CYS B C     
4912 O O     . CYS B 299 ? 0.5037 0.4088 0.6772 -0.0432 -0.2059 -0.0439 325 CYS B O     
4913 C CB    . CYS B 299 ? 0.5063 0.4075 0.6216 -0.0230 -0.1860 -0.0817 325 CYS B CB    
4914 S SG    . CYS B 299 ? 0.5275 0.4242 0.6933 -0.0287 -0.2000 -0.0699 325 CYS B SG    
4915 N N     . ALA B 300 ? 0.4911 0.4255 0.6358 -0.0566 -0.1712 -0.0129 326 ALA B N     
4916 C CA    . ALA B 300 ? 0.4965 0.4465 0.6775 -0.0695 -0.1810 0.0108  326 ALA B CA    
4917 C C     . ALA B 300 ? 0.5108 0.4514 0.7429 -0.0763 -0.2050 0.0223  326 ALA B C     
4918 O O     . ALA B 300 ? 0.5182 0.4626 0.7874 -0.0860 -0.2198 0.0367  326 ALA B O     
4919 C CB    . ALA B 300 ? 0.4824 0.4670 0.6554 -0.0807 -0.1615 0.0312  326 ALA B CB    
4920 N N     . THR B 301 ? 0.5194 0.4470 0.7582 -0.0710 -0.2098 0.0159  327 THR B N     
4921 C CA    . THR B 301 ? 0.5451 0.4577 0.8401 -0.0751 -0.2342 0.0271  327 THR B CA    
4922 C C     . THR B 301 ? 0.5757 0.4564 0.8971 -0.0646 -0.2576 -0.0041 327 THR B C     
4923 O O     . THR B 301 ? 0.6023 0.4631 0.9783 -0.0663 -0.2805 -0.0016 327 THR B O     
4924 C CB    . THR B 301 ? 0.5446 0.4622 0.8445 -0.0732 -0.2311 0.0369  327 THR B CB    
4925 O OG1   . THR B 301 ? 0.5312 0.4471 0.7846 -0.0593 -0.2151 0.0074  327 THR B OG1   
4926 C CG2   . THR B 301 ? 0.5208 0.4793 0.8163 -0.0889 -0.2168 0.0753  327 THR B CG2   
4927 N N     . ASP B 302 ? 0.5849 0.4638 0.8711 -0.0540 -0.2529 -0.0333 328 ASP B N     
4928 C CA    . ASP B 302 ? 0.6135 0.4749 0.9170 -0.0428 -0.2735 -0.0693 328 ASP B CA    
4929 C C     . ASP B 302 ? 0.6224 0.4903 0.9369 -0.0494 -0.2827 -0.0683 328 ASP B C     
4930 O O     . ASP B 302 ? 0.6180 0.5016 0.8896 -0.0446 -0.2695 -0.0728 328 ASP B O     
4931 C CB    . ASP B 302 ? 0.6204 0.4871 0.8719 -0.0248 -0.2615 -0.1030 328 ASP B CB    
4932 C CG    . ASP B 302 ? 0.6525 0.5142 0.9173 -0.0115 -0.2815 -0.1457 328 ASP B CG    
4933 O OD1   . ASP B 302 ? 0.6942 0.5528 0.9900 -0.0152 -0.3004 -0.1539 328 ASP B OD1   
4934 O OD2   . ASP B 302 ? 0.6974 0.5646 0.9409 0.0027  -0.2778 -0.1739 328 ASP B OD2   
4935 N N     . THR B 303 ? 0.6372 0.4934 1.0135 -0.0606 -0.3062 -0.0612 329 THR B N     
4936 C CA    . THR B 303 ? 0.6480 0.5136 1.0463 -0.0702 -0.3176 -0.0583 329 THR B CA    
4937 C C     . THR B 303 ? 0.6606 0.5350 1.0282 -0.0552 -0.3217 -0.0973 329 THR B C     
4938 O O     . THR B 303 ? 0.6530 0.5491 0.9978 -0.0563 -0.3145 -0.0903 329 THR B O     
4939 C CB    . THR B 303 ? 0.6689 0.5153 1.1482 -0.0854 -0.3455 -0.0491 329 THR B CB    
4940 O OG1   . THR B 303 ? 0.6665 0.5132 1.1711 -0.1000 -0.3409 -0.0039 329 THR B OG1   
4941 C CG2   . THR B 303 ? 0.6622 0.5234 1.1687 -0.0986 -0.3572 -0.0448 329 THR B CG2   
4942 N N     . LYS B 304 ? 0.6855 0.5494 1.0531 -0.0400 -0.3331 -0.1381 330 LYS B N     
4943 C CA    . LYS B 304 ? 0.7023 0.5857 1.0352 -0.0244 -0.3364 -0.1755 330 LYS B CA    
4944 C C     . LYS B 304 ? 0.6819 0.5865 0.9429 -0.0163 -0.3093 -0.1615 330 LYS B C     
4945 O O     . LYS B 304 ? 0.6880 0.6138 0.9276 -0.0126 -0.3090 -0.1625 330 LYS B O     
4946 C CB    . LYS B 304 ? 0.7301 0.6087 1.0703 -0.0083 -0.3492 -0.2229 330 LYS B CB    
4947 C CG    . LYS B 304 ? 0.7625 0.6747 1.0620 0.0081  -0.3519 -0.2617 330 LYS B CG    
4948 C CD    . LYS B 304 ? 0.8081 0.7238 1.1498 0.0174  -0.3794 -0.3177 330 LYS B CD    
4949 C CE    . LYS B 304 ? 0.8397 0.8026 1.1437 0.0306  -0.3848 -0.3527 330 LYS B CE    
4950 N NZ    . LYS B 304 ? 0.8758 0.8494 1.2335 0.0338  -0.4169 -0.4074 330 LYS B NZ    
4951 N N     . ASN B 305 ? 0.6627 0.5616 0.8917 -0.0140 -0.2876 -0.1470 331 ASN B N     
4952 C CA    . ASN B 305 ? 0.6490 0.5615 0.8181 -0.0083 -0.2616 -0.1325 331 ASN B CA    
4953 C C     . ASN B 305 ? 0.6321 0.5535 0.7987 -0.0171 -0.2523 -0.1020 331 ASN B C     
4954 O O     . ASN B 305 ? 0.6395 0.5745 0.7721 -0.0090 -0.2433 -0.0991 331 ASN B O     
4955 C CB    . ASN B 305 ? 0.6268 0.5320 0.7709 -0.0075 -0.2409 -0.1242 331 ASN B CB    
4956 C CG    . ASN B 305 ? 0.6309 0.5462 0.7193 -0.0021 -0.2159 -0.1138 331 ASN B CG    
4957 O OD1   . ASN B 305 ? 0.6028 0.5151 0.6795 -0.0096 -0.1965 -0.0910 331 ASN B OD1   
4958 N ND2   . ASN B 305 ? 0.6621 0.5924 0.7187 0.0104  -0.2168 -0.1304 331 ASN B ND2   
4959 N N     . VAL B 306 ? 0.6208 0.5384 0.8257 -0.0331 -0.2547 -0.0784 332 VAL B N     
4960 C CA    . VAL B 306 ? 0.6071 0.5417 0.8120 -0.0416 -0.2435 -0.0514 332 VAL B CA    
4961 C C     . VAL B 306 ? 0.6193 0.5689 0.8421 -0.0409 -0.2597 -0.0576 332 VAL B C     
4962 O O     . VAL B 306 ? 0.6113 0.5787 0.8177 -0.0373 -0.2502 -0.0473 332 VAL B O     
4963 C CB    . VAL B 306 ? 0.5940 0.5335 0.8321 -0.0601 -0.2398 -0.0221 332 VAL B CB    
4964 C CG1   . VAL B 306 ? 0.5790 0.5472 0.8264 -0.0695 -0.2324 0.0003  332 VAL B CG1   
4965 C CG2   . VAL B 306 ? 0.5706 0.5060 0.7823 -0.0593 -0.2201 -0.0152 332 VAL B CG2   
4966 N N     . GLN B 307 ? 0.6439 0.5874 0.9036 -0.0433 -0.2850 -0.0775 333 GLN B N     
4967 C CA    . GLN B 307 ? 0.6625 0.6239 0.9395 -0.0417 -0.3033 -0.0914 333 GLN B CA    
4968 C C     . GLN B 307 ? 0.6723 0.6507 0.8973 -0.0215 -0.2975 -0.1068 333 GLN B C     
4969 O O     . GLN B 307 ? 0.6724 0.6734 0.8900 -0.0177 -0.2967 -0.0981 333 GLN B O     
4970 C CB    . GLN B 307 ? 0.6879 0.6372 1.0159 -0.0471 -0.3321 -0.1184 333 GLN B CB    
4971 C CG    . GLN B 307 ? 0.7132 0.6847 1.0683 -0.0491 -0.3538 -0.1362 333 GLN B CG    
4972 C CD    . GLN B 307 ? 0.7488 0.7046 1.1710 -0.0601 -0.3830 -0.1605 333 GLN B CD    
4973 O OE1   . GLN B 307 ? 0.7776 0.7025 1.2316 -0.0665 -0.3877 -0.1587 333 GLN B OE1   
4974 N NE2   . GLN B 307 ? 0.7710 0.7482 1.2194 -0.0621 -0.4039 -0.1838 333 GLN B NE2   
4975 N N     . PHE B 308 ? 0.6874 0.6591 0.8781 -0.0084 -0.2934 -0.1269 334 PHE B N     
4976 C CA    . PHE B 308 ? 0.7036 0.6957 0.8432 0.0094  -0.2869 -0.1351 334 PHE B CA    
4977 C C     . PHE B 308 ? 0.6887 0.6816 0.7948 0.0134  -0.2628 -0.1034 334 PHE B C     
4978 O O     . PHE B 308 ? 0.6958 0.7090 0.7849 0.0235  -0.2633 -0.0962 334 PHE B O     
4979 C CB    . PHE B 308 ? 0.7239 0.7145 0.8341 0.0200  -0.2838 -0.1590 334 PHE B CB    
4980 C CG    . PHE B 308 ? 0.7513 0.7690 0.8077 0.0362  -0.2758 -0.1606 334 PHE B CG    
4981 C CD1   . PHE B 308 ? 0.7836 0.8381 0.8337 0.0467  -0.2947 -0.1856 334 PHE B CD1   
4982 C CD2   . PHE B 308 ? 0.7596 0.7695 0.7743 0.0399  -0.2502 -0.1357 334 PHE B CD2   
4983 C CE1   . PHE B 308 ? 0.8153 0.9023 0.8151 0.0612  -0.2878 -0.1803 334 PHE B CE1   
4984 C CE2   . PHE B 308 ? 0.7908 0.8256 0.7599 0.0532  -0.2434 -0.1294 334 PHE B CE2   
4985 C CZ    . PHE B 308 ? 0.7962 0.8716 0.7564 0.0641  -0.2621 -0.1492 334 PHE B CZ    
4986 N N     . VAL B 309 ? 0.6692 0.6416 0.7698 0.0061  -0.2429 -0.0859 335 VAL B N     
4987 C CA    . VAL B 309 ? 0.6578 0.6279 0.7333 0.0094  -0.2196 -0.0620 335 VAL B CA    
4988 C C     . VAL B 309 ? 0.6492 0.6353 0.7496 0.0064  -0.2218 -0.0467 335 VAL B C     
4989 O O     . VAL B 309 ? 0.6521 0.6468 0.7361 0.0180  -0.2144 -0.0363 335 VAL B O     
4990 C CB    . VAL B 309 ? 0.6400 0.5912 0.7088 0.0006  -0.1992 -0.0525 335 VAL B CB    
4991 C CG1   . VAL B 309 ? 0.6309 0.5821 0.6909 0.0004  -0.1777 -0.0329 335 VAL B CG1   
4992 C CG2   . VAL B 309 ? 0.6446 0.5862 0.6811 0.0070  -0.1925 -0.0656 335 VAL B CG2   
4993 N N     . PHE B 310 ? 0.6393 0.6318 0.7828 -0.0087 -0.2326 -0.0440 336 PHE B N     
4994 C CA    . PHE B 310 ? 0.6397 0.6561 0.8095 -0.0136 -0.2333 -0.0296 336 PHE B CA    
4995 C C     . PHE B 310 ? 0.6593 0.6985 0.8337 -0.0028 -0.2504 -0.0377 336 PHE B C     
4996 O O     . PHE B 310 ? 0.6586 0.7187 0.8382 0.0031  -0.2461 -0.0267 336 PHE B O     
4997 C CB    . PHE B 310 ? 0.6232 0.6482 0.8393 -0.0354 -0.2396 -0.0185 336 PHE B CB    
4998 C CG    . PHE B 310 ? 0.6249 0.6810 0.8597 -0.0417 -0.2298 -0.0001 336 PHE B CG    
4999 C CD1   . PHE B 310 ? 0.6167 0.6782 0.8360 -0.0418 -0.2055 0.0110  336 PHE B CD1   
5000 C CD2   . PHE B 310 ? 0.6533 0.7393 0.9223 -0.0468 -0.2445 0.0023  336 PHE B CD2   
5001 C CE1   . PHE B 310 ? 0.6070 0.7057 0.8446 -0.0456 -0.1958 0.0223  336 PHE B CE1   
5002 C CE2   . PHE B 310 ? 0.6531 0.7766 0.9403 -0.0514 -0.2342 0.0173  336 PHE B CE2   
5003 C CZ    . PHE B 310 ? 0.6180 0.7489 0.8890 -0.0500 -0.2095 0.0262  336 PHE B CZ    
5004 N N     . ASP B 311 ? 0.6806 0.7205 0.8547 0.0007  -0.2702 -0.0596 337 ASP B N     
5005 C CA    . ASP B 311 ? 0.7038 0.7726 0.8771 0.0123  -0.2874 -0.0704 337 ASP B CA    
5006 C C     . ASP B 311 ? 0.7109 0.7860 0.8387 0.0337  -0.2745 -0.0585 337 ASP B C     
5007 O O     . ASP B 311 ? 0.7218 0.8228 0.8531 0.0442  -0.2799 -0.0506 337 ASP B O     
5008 C CB    . ASP B 311 ? 0.7276 0.8014 0.9100 0.0119  -0.3111 -0.1029 337 ASP B CB    
5009 C CG    . ASP B 311 ? 0.7713 0.8835 0.9436 0.0259  -0.3285 -0.1176 337 ASP B CG    
5010 O OD1   . ASP B 311 ? 0.8101 0.9341 0.9362 0.0443  -0.3207 -0.1116 337 ASP B OD1   
5011 O OD2   . ASP B 311 ? 0.8225 0.9566 1.0351 0.0178  -0.3509 -0.1338 337 ASP B OD2   
5012 N N     . ALA B 312 ? 0.7078 0.7599 0.7973 0.0398  -0.2580 -0.0550 338 ALA B N     
5013 C CA    . ALA B 312 ? 0.7145 0.7665 0.7658 0.0574  -0.2446 -0.0378 338 ALA B CA    
5014 C C     . ALA B 312 ? 0.7028 0.7463 0.7659 0.0598  -0.2276 -0.0154 338 ALA B C     
5015 O O     . ALA B 312 ? 0.7174 0.7717 0.7740 0.0758  -0.2268 -0.0010 338 ALA B O     
5016 C CB    . ALA B 312 ? 0.7173 0.7491 0.7305 0.0594  -0.2308 -0.0391 338 ALA B CB    
5017 N N     . VAL B 313 ? 0.6772 0.7055 0.7596 0.0450  -0.2147 -0.0135 339 VAL B N     
5018 C CA    . VAL B 313 ? 0.6612 0.6906 0.7602 0.0458  -0.1986 -0.0004 339 VAL B CA    
5019 C C     . VAL B 313 ? 0.6682 0.7323 0.7977 0.0516  -0.2115 0.0024  339 VAL B C     
5020 O O     . VAL B 313 ? 0.6742 0.7450 0.8074 0.0668  -0.2047 0.0122  339 VAL B O     
5021 C CB    . VAL B 313 ? 0.6347 0.6569 0.7496 0.0265  -0.1853 -0.0014 339 VAL B CB    
5022 C CG1   . VAL B 313 ? 0.6195 0.6654 0.7633 0.0240  -0.1750 0.0051  339 VAL B CG1   
5023 C CG2   . VAL B 313 ? 0.6204 0.6117 0.7055 0.0252  -0.1671 -0.0018 339 VAL B CG2   
5024 N N     . THR B 314 ? 0.6717 0.7578 0.8273 0.0396  -0.2309 -0.0069 340 THR B N     
5025 C CA    . THR B 314 ? 0.6870 0.8122 0.8753 0.0416  -0.2455 -0.0062 340 THR B CA    
5026 C C     . THR B 314 ? 0.7230 0.8649 0.8953 0.0656  -0.2561 -0.0035 340 THR B C     
5027 O O     . THR B 314 ? 0.7260 0.8922 0.9163 0.0774  -0.2557 0.0049  340 THR B O     
5028 C CB    . THR B 314 ? 0.6779 0.8191 0.9009 0.0210  -0.2663 -0.0177 340 THR B CB    
5029 O OG1   . THR B 314 ? 0.6570 0.7920 0.9029 -0.0005 -0.2563 -0.0102 340 THR B OG1   
5030 C CG2   . THR B 314 ? 0.6848 0.8706 0.9421 0.0220  -0.2830 -0.0188 340 THR B CG2   
5031 N N     . ASP B 315 ? 0.7583 0.8931 0.8980 0.0737  -0.2654 -0.0100 341 ASP B N     
5032 C CA    . ASP B 315 ? 0.8041 0.9618 0.9237 0.0964  -0.2764 -0.0029 341 ASP B CA    
5033 C C     . ASP B 315 ? 0.8248 0.9703 0.9369 0.1155  -0.2599 0.0217  341 ASP B C     
5034 O O     . ASP B 315 ? 0.8448 1.0175 0.9682 0.1332  -0.2688 0.0325  341 ASP B O     
5035 C CB    . ASP B 315 ? 0.8260 0.9827 0.9051 0.1013  -0.2837 -0.0116 341 ASP B CB    
5036 C CG    . ASP B 315 ? 0.8400 1.0252 0.9325 0.0916  -0.3087 -0.0417 341 ASP B CG    
5037 O OD1   . ASP B 315 ? 0.8562 1.0678 0.9880 0.0846  -0.3242 -0.0509 341 ASP B OD1   
5038 O OD2   . ASP B 315 ? 0.8519 1.0357 0.9190 0.0909  -0.3131 -0.0586 341 ASP B OD2   
5039 N N     . VAL B 316 ? 0.8302 0.9351 0.9279 0.1121  -0.2371 0.0291  342 VAL B N     
5040 C CA    . VAL B 316 ? 0.8573 0.9407 0.9541 0.1282  -0.2202 0.0487  342 VAL B CA    
5041 C C     . VAL B 316 ? 0.8524 0.9532 0.9921 0.1328  -0.2161 0.0476  342 VAL B C     
5042 O O     . VAL B 316 ? 0.8751 0.9825 1.0279 0.1546  -0.2169 0.0609  342 VAL B O     
5043 C CB    . VAL B 316 ? 0.8537 0.8917 0.9304 0.1192  -0.1969 0.0507  342 VAL B CB    
5044 C CG1   . VAL B 316 ? 0.8688 0.8818 0.9578 0.1331  -0.1797 0.0652  342 VAL B CG1   
5045 C CG2   . VAL B 316 ? 0.8735 0.9010 0.9075 0.1183  -0.1993 0.0545  342 VAL B CG2   
5046 N N     . ILE B 317 ? 0.8301 0.9426 0.9937 0.1128  -0.2119 0.0329  343 ILE B N     
5047 C CA    . ILE B 317 ? 0.8241 0.9661 1.0286 0.1141  -0.2067 0.0293  343 ILE B CA    
5048 C C     . ILE B 317 ? 0.8397 1.0255 1.0667 0.1286  -0.2269 0.0322  343 ILE B C     
5049 O O     . ILE B 317 ? 0.8461 1.0505 1.0993 0.1461  -0.2234 0.0355  343 ILE B O     
5050 C CB    . ILE B 317 ? 0.7915 0.9501 1.0162 0.0866  -0.2011 0.0185  343 ILE B CB    
5051 C CG1   . ILE B 317 ? 0.7832 0.9064 0.9890 0.0754  -0.1798 0.0159  343 ILE B CG1   
5052 C CG2   . ILE B 317 ? 0.7782 0.9847 1.0456 0.0869  -0.1977 0.0152  343 ILE B CG2   
5053 C CD1   . ILE B 317 ? 0.7603 0.8994 0.9803 0.0481  -0.1761 0.0116  343 ILE B CD1   
5054 N N     . ILE B 318 ? 0.8523 1.0566 1.0713 0.1222  -0.2486 0.0281  344 ILE B N     
5055 C CA    . ILE B 318 ? 0.8709 1.1222 1.1087 0.1341  -0.2709 0.0283  344 ILE B CA    
5056 C C     . ILE B 318 ? 0.9115 1.1637 1.1395 0.1667  -0.2732 0.0469  344 ILE B C     
5057 O O     . ILE B 318 ? 0.9185 1.2053 1.1775 0.1830  -0.2793 0.0510  344 ILE B O     
5058 C CB    . ILE B 318 ? 0.8742 1.1429 1.1026 0.1211  -0.2945 0.0147  344 ILE B CB    
5059 C CG1   . ILE B 318 ? 0.8448 1.1227 1.1050 0.0903  -0.2979 0.0000  344 ILE B CG1   
5060 C CG2   . ILE B 318 ? 0.8920 1.2105 1.1288 0.1381  -0.3186 0.0151  344 ILE B CG2   
5061 C CD1   . ILE B 318 ? 0.8553 1.1394 1.1153 0.0753  -0.3202 -0.0193 344 ILE B CD1   
5062 N N     . LYS B 319 ? 0.9436 1.1601 1.1318 0.1763  -0.2685 0.0606  345 LYS B N     
5063 C CA    . LYS B 319 ? 0.9906 1.2053 1.1706 0.2062  -0.2717 0.0863  345 LYS B CA    
5064 C C     . LYS B 319 ? 1.0016 1.1783 1.2005 0.2202  -0.2504 0.0980  345 LYS B C     
5065 O O     . LYS B 319 ? 1.0391 1.2008 1.2357 0.2440  -0.2509 0.1233  345 LYS B O     
5066 C CB    . LYS B 319 ? 1.0199 1.2277 1.1514 0.2108  -0.2795 0.1009  345 LYS B CB    
5067 C CG    . LYS B 319 ? 1.0282 1.1851 1.1265 0.1973  -0.2601 0.1026  345 LYS B CG    
5068 C CD    . LYS B 319 ? 1.0590 1.2291 1.1107 0.1962  -0.2702 0.1074  345 LYS B CD    
5069 C CE    . LYS B 319 ? 1.0505 1.2603 1.1009 0.1813  -0.2898 0.0758  345 LYS B CE    
5070 N NZ    . LYS B 319 ? 1.0697 1.2849 1.0773 0.1745  -0.2932 0.0671  345 LYS B NZ    
5071 N N     . ASN B 320 ? 0.9775 1.1420 1.1985 0.2055  -0.2327 0.0796  346 ASN B N     
5072 C CA    . ASN B 320 ? 0.9883 1.1282 1.2374 0.2191  -0.2138 0.0799  346 ASN B CA    
5073 C C     . ASN B 320 ? 0.9837 1.1691 1.2833 0.2320  -0.2169 0.0684  346 ASN B C     
5074 O O     . ASN B 320 ? 0.9817 1.1608 1.3122 0.2383  -0.2002 0.0557  346 ASN B O     
5075 C CB    . ASN B 320 ? 0.9658 1.0682 1.2057 0.1983  -0.1901 0.0657  346 ASN B CB    
5076 C CG    . ASN B 320 ? 0.9882 1.0366 1.1916 0.1977  -0.1813 0.0818  346 ASN B CG    
5077 O OD1   . ASN B 320 ? 1.0134 1.0535 1.1978 0.2127  -0.1920 0.1068  346 ASN B OD1   
5078 N ND2   . ASN B 320 ? 0.9664 0.9845 1.1602 0.1794  -0.1619 0.0694  346 ASN B ND2   
5079 N N     . ASN B 321 ? 0.9872 1.2239 1.2966 0.2357  -0.2385 0.0697  347 ASN B N     
5080 C CA    . ASN B 321 ? 0.9899 1.2786 1.3472 0.2524  -0.2454 0.0630  347 ASN B CA    
5081 C C     . ASN B 321 ? 1.0299 1.3320 1.3923 0.2850  -0.2647 0.0863  347 ASN B C     
5082 O O     . ASN B 321 ? 1.0485 1.3615 1.4499 0.3129  -0.2642 0.0898  347 ASN B O     
5083 C CB    . ASN B 321 ? 0.9572 1.3040 1.3309 0.2284  -0.2556 0.0463  347 ASN B CB    
5084 C CG    . ASN B 321 ? 0.9242 1.2674 1.3007 0.1973  -0.2373 0.0292  347 ASN B CG    
5085 O OD1   . ASN B 321 ? 0.8997 1.1993 1.2431 0.1798  -0.2284 0.0297  347 ASN B OD1   
5086 N ND2   . ASN B 321 ? 0.9034 1.2994 1.3205 0.1904  -0.2320 0.0158  347 ASN B ND2   
5087 N N     . LEU B 322 ? 1.0461 1.3518 1.3704 0.2824  -0.2821 0.1013  348 LEU B N     
5088 C CA    . LEU B 322 ? 1.0871 1.4129 1.4065 0.3111  -0.3025 0.1285  348 LEU B CA    
5089 C C     . LEU B 322 ? 1.1278 1.4029 1.4510 0.3381  -0.2928 0.1574  348 LEU B C     
5090 O O     . LEU B 322 ? 1.1324 1.3491 1.4343 0.3284  -0.2747 0.1624  348 LEU B O     
5091 C CB    . LEU B 322 ? 1.0958 1.4377 1.3670 0.2996  -0.3199 0.1349  348 LEU B CB    
5092 C CG    . LEU B 322 ? 1.0725 1.4689 1.3457 0.2776  -0.3377 0.1086  348 LEU B CG    
5093 C CD1   . LEU B 322 ? 1.0356 1.4034 1.2922 0.2423  -0.3260 0.0850  348 LEU B CD1   
5094 C CD2   . LEU B 322 ? 1.1038 1.5447 1.3490 0.2873  -0.3641 0.1185  348 LEU B CD2   
5095 N N     . ILE C 2   ? 1.0882 0.9050 1.3016 0.1709  -0.2308 0.0614  497 ILE C N     
5096 C CA    . ILE C 2   ? 1.0923 0.9500 1.2648 0.1791  -0.2454 0.0670  497 ILE C CA    
5097 C C     . ILE C 2   ? 1.0969 0.9532 1.2404 0.1807  -0.2464 0.0763  497 ILE C C     
5098 O O     . ILE C 2   ? 1.0866 0.9138 1.2311 0.1638  -0.2431 0.0708  497 ILE C O     
5099 C CB    . ILE C 2   ? 1.0698 0.9586 1.2348 0.1580  -0.2643 0.0396  497 ILE C CB    
5100 C CG1   . ILE C 2   ? 1.0770 1.0155 1.2219 0.1639  -0.2788 0.0336  497 ILE C CG1   
5101 C CG2   . ILE C 2   ? 1.0499 0.9199 1.2114 0.1311  -0.2671 0.0239  497 ILE C CG2   
5102 C CD1   . ILE C 2   ? 1.0877 1.0699 1.2371 0.1891  -0.2813 0.0392  497 ILE C CD1   
5103 N N     . GLU C 3   ? 1.1152 1.0129 1.2326 0.2064  -0.2515 0.0877  498 GLU C N     
5104 C CA    . GLU C 3   ? 1.1221 1.0362 1.2084 0.2150  -0.2566 0.0893  498 GLU C CA    
5105 C C     . GLU C 3   ? 1.0959 1.0106 1.1727 0.1826  -0.2762 0.0518  498 GLU C C     
5106 O O     . GLU C 3   ? 1.1023 1.0085 1.1616 0.1802  -0.2782 0.0476  498 GLU C O     
5107 C CB    . GLU C 3   ? 1.1530 1.1335 1.2133 0.2595  -0.2601 0.1031  498 GLU C CB    
5108 C CG    . GLU C 3   ? 1.1659 1.1993 1.2299 0.2719  -0.2723 0.0903  498 GLU C CG    
5109 C CD    . GLU C 3   ? 1.2077 1.2446 1.2807 0.3127  -0.2495 0.1338  498 GLU C CD    
5110 O OE1   . GLU C 3   ? 1.2318 1.2171 1.3227 0.3235  -0.2204 0.1728  498 GLU C OE1   
5111 O OE2   . GLU C 3   ? 1.2102 1.3022 1.2791 0.3349  -0.2580 0.1291  498 GLU C OE2   
5112 N N     . GLY C 4   ? 1.0703 0.9943 1.1634 0.1600  -0.2866 0.0281  499 GLY C N     
5113 C CA    . GLY C 4   ? 1.0464 0.9609 1.1461 0.1286  -0.2952 0.0008  499 GLY C CA    
5114 C C     . GLY C 4   ? 1.0276 0.8902 1.1245 0.1126  -0.2848 0.0077  499 GLY C C     
5115 O O     . GLY C 4   ? 1.0326 0.8807 1.1229 0.1001  -0.2871 -0.0040 499 GLY C O     
5116 N N     . LEU C 5   ? 1.0085 0.8483 1.1155 0.1155  -0.2732 0.0226  500 LEU C N     
5117 C CA    . LEU C 5   ? 0.9905 0.7982 1.0990 0.1055  -0.2648 0.0234  500 LEU C CA    
5118 C C     . LEU C 5   ? 0.9964 0.7870 1.0878 0.1130  -0.2601 0.0331  500 LEU C C     
5119 O O     . LEU C 5   ? 0.9934 0.7670 1.0749 0.1043  -0.2584 0.0282  500 LEU C O     
5120 C CB    . LEU C 5   ? 0.9781 0.7806 1.1148 0.1084  -0.2564 0.0229  500 LEU C CB    
5121 C CG    . LEU C 5   ? 0.9713 0.7613 1.1188 0.1029  -0.2500 0.0128  500 LEU C CG    
5122 C CD1   . LEU C 5   ? 0.9496 0.7510 1.0805 0.0951  -0.2532 0.0044  500 LEU C CD1   
5123 C CD2   . LEU C 5   ? 0.9536 0.7469 1.1446 0.1078  -0.2435 -0.0003 500 LEU C CD2   
5124 N N     . VAL C 6   ? 1.0071 0.8080 1.0940 0.1342  -0.2556 0.0510  501 VAL C N     
5125 C CA    . VAL C 6   ? 1.0156 0.8106 1.0867 0.1478  -0.2479 0.0669  501 VAL C CA    
5126 C C     . VAL C 6   ? 1.0197 0.8292 1.0580 0.1477  -0.2628 0.0496  501 VAL C C     
5127 O O     . VAL C 6   ? 1.0222 0.8162 1.0464 0.1461  -0.2601 0.0495  501 VAL C O     
5128 C CB    . VAL C 6   ? 1.0440 0.8538 1.1218 0.1794  -0.2320 0.1011  501 VAL C CB    
5129 C CG1   . VAL C 6   ? 1.0658 0.8865 1.1211 0.2013  -0.2232 0.1227  501 VAL C CG1   
5130 C CG2   . VAL C 6   ? 1.0402 0.8196 1.1678 0.1759  -0.2108 0.1152  501 VAL C CG2   
5131 N N     . GLU C 7   ? 1.0198 0.8619 1.0534 0.1490  -0.2783 0.0294  502 GLU C N     
5132 C CA    . GLU C 7   ? 1.0265 0.8832 1.0482 0.1442  -0.2933 -0.0015 502 GLU C CA    
5133 C C     . GLU C 7   ? 1.0085 0.8189 1.0375 0.1172  -0.2889 -0.0117 502 GLU C C     
5134 O O     . GLU C 7   ? 1.0212 0.8166 1.0342 0.1198  -0.2889 -0.0174 502 GLU C O     
5135 C CB    . GLU C 7   ? 1.0349 0.9368 1.0733 0.1415  -0.3093 -0.0318 502 GLU C CB    
5136 C CG    . GLU C 7   ? 1.0643 1.0300 1.0907 0.1774  -0.3152 -0.0241 502 GLU C CG    
5137 C CD    . GLU C 7   ? 1.1065 1.1372 1.1118 0.2072  -0.3316 -0.0503 502 GLU C CD    
5138 O OE1   . GLU C 7   ? 1.1294 1.1466 1.1198 0.2084  -0.3335 -0.0605 502 GLU C OE1   
5139 O OE2   . GLU C 7   ? 1.1125 1.2173 1.1152 0.2343  -0.3436 -0.0635 502 GLU C OE2   
5140 N N     . LEU C 8   ? 0.9800 0.7733 1.0312 0.0974  -0.2832 -0.0104 503 LEU C N     
5141 C CA    . LEU C 8   ? 0.9652 0.7236 1.0215 0.0815  -0.2733 -0.0095 503 LEU C CA    
5142 C C     . LEU C 8   ? 0.9481 0.6857 0.9833 0.0903  -0.2651 0.0049  503 LEU C C     
5143 O O     . LEU C 8   ? 0.9586 0.6757 0.9819 0.0899  -0.2617 0.0016  503 LEU C O     
5144 C CB    . LEU C 8   ? 0.9526 0.7132 1.0312 0.0703  -0.2656 -0.0025 503 LEU C CB    
5145 C CG    . LEU C 8   ? 0.9672 0.7405 1.0773 0.0543  -0.2666 -0.0165 503 LEU C CG    
5146 C CD1   . LEU C 8   ? 0.9591 0.7534 1.0869 0.0515  -0.2617 -0.0064 503 LEU C CD1   
5147 C CD2   . LEU C 8   ? 0.9977 0.7394 1.1241 0.0417  -0.2535 -0.0192 503 LEU C CD2   
5148 N N     . LEU C 9   ? 0.9215 0.6655 0.9597 0.0983  -0.2604 0.0185  504 LEU C N     
5149 C CA    . LEU C 9   ? 0.9085 0.6425 0.9415 0.1036  -0.2518 0.0264  504 LEU C CA    
5150 C C     . LEU C 9   ? 0.9194 0.6489 0.9271 0.1144  -0.2527 0.0295  504 LEU C C     
5151 O O     . LEU C 9   ? 0.9150 0.6324 0.9087 0.1152  -0.2493 0.0275  504 LEU C O     
5152 C CB    . LEU C 9   ? 0.8938 0.6350 0.9553 0.1073  -0.2436 0.0344  504 LEU C CB    
5153 C CG    . LEU C 9   ? 0.8773 0.6278 0.9673 0.1004  -0.2418 0.0222  504 LEU C CG    
5154 C CD1   . LEU C 9   ? 0.8698 0.6211 1.0002 0.1037  -0.2334 0.0254  504 LEU C CD1   
5155 C CD2   . LEU C 9   ? 0.8581 0.6179 0.9478 0.1005  -0.2388 0.0097  504 LEU C CD2   
5156 N N     . ASN C 10  ? 0.9333 0.6811 0.9324 0.1285  -0.2570 0.0351  505 ASN C N     
5157 C CA    . ASN C 10  ? 0.9485 0.7070 0.9207 0.1465  -0.2590 0.0371  505 ASN C CA    
5158 C C     . ASN C 10  ? 0.9585 0.7055 0.9146 0.1419  -0.2695 0.0108  505 ASN C C     
5159 O O     . ASN C 10  ? 0.9719 0.7101 0.9088 0.1499  -0.2672 0.0104  505 ASN C O     
5160 C CB    . ASN C 10  ? 0.9681 0.7665 0.9313 0.1729  -0.2609 0.0495  505 ASN C CB    
5161 C CG    . ASN C 10  ? 0.9711 0.7714 0.9543 0.1853  -0.2393 0.0876  505 ASN C CG    
5162 O OD1   . ASN C 10  ? 0.9692 0.7497 0.9689 0.1784  -0.2243 0.1001  505 ASN C OD1   
5163 N ND2   . ASN C 10  ? 0.9766 0.8032 0.9658 0.2051  -0.2351 0.1054  505 ASN C ND2   
5164 N N     . ARG C 11  ? 0.9570 0.7028 0.9291 0.1284  -0.2783 -0.0117 506 ARG C N     
5165 C CA    . ARG C 11  ? 0.9754 0.6988 0.9541 0.1188  -0.2816 -0.0382 506 ARG C CA    
5166 C C     . ARG C 11  ? 0.9663 0.6470 0.9445 0.1103  -0.2656 -0.0239 506 ARG C C     
5167 O O     . ARG C 11  ? 0.9888 0.6492 0.9533 0.1180  -0.2622 -0.0292 506 ARG C O     
5168 C CB    . ARG C 11  ? 0.9882 0.7222 1.0034 0.1022  -0.2892 -0.0657 506 ARG C CB    
5169 C CG    . ARG C 11  ? 1.0383 0.7444 1.0836 0.0884  -0.2873 -0.0973 506 ARG C CG    
5170 C CD    . ARG C 11  ? 1.0966 0.8338 1.1889 0.0745  -0.2994 -0.1393 506 ARG C CD    
5171 N NE    . ARG C 11  ? 1.1168 0.8404 1.2498 0.0497  -0.2863 -0.1275 506 ARG C NE    
5172 C CZ    . ARG C 11  ? 1.1168 0.8778 1.2548 0.0476  -0.2926 -0.1208 506 ARG C CZ    
5173 N NH1   . ARG C 11  ? 1.1147 0.9255 1.2213 0.0704  -0.3092 -0.1208 506 ARG C NH1   
5174 N NH2   . ARG C 11  ? 1.1146 0.8656 1.2904 0.0269  -0.2788 -0.1097 506 ARG C NH2   
5175 N N     . VAL C 12  ? 0.9805 1.4308 0.7435 0.2561  -0.0522 -0.3390 507 VAL C N     
5176 C CA    . VAL C 12  ? 0.9913 1.3377 0.7377 0.2280  -0.0313 -0.3196 507 VAL C CA    
5177 C C     . VAL C 12  ? 0.9925 1.2864 0.6988 0.2298  -0.0553 -0.2791 507 VAL C C     
5178 O O     . VAL C 12  ? 1.0040 1.2460 0.7060 0.2196  -0.0547 -0.2824 507 VAL C O     
5179 C CB    . VAL C 12  ? 1.0386 1.2996 0.7534 0.2277  0.0004  -0.3037 507 VAL C CB    
5180 C CG1   . VAL C 12  ? 1.1147 1.2362 0.7474 0.2377  0.0191  -0.2775 507 VAL C CG1   
5181 C CG2   . VAL C 12  ? 1.0307 1.3356 0.8573 0.2191  0.0415  -0.3481 507 VAL C CG2   
5182 N N     . GLN C 13  ? 0.9790 1.2946 0.6871 0.2468  -0.0732 -0.2443 508 GLN C N     
5183 C CA    . GLN C 13  ? 0.9831 1.2568 0.7304 0.2489  -0.0945 -0.2125 508 GLN C CA    
5184 C C     . GLN C 13  ? 0.9726 1.2974 0.7698 0.2562  -0.0745 -0.2015 508 GLN C C     
5185 O O     . GLN C 13  ? 0.9735 1.2589 0.8379 0.2504  -0.0863 -0.1849 508 GLN C O     
5186 C CB    . GLN C 13  ? 0.9824 1.2430 0.7693 0.2643  -0.1086 -0.1772 508 GLN C CB    
5187 C CG    . GLN C 13  ? 1.0082 1.1969 0.7320 0.2682  -0.1379 -0.1886 508 GLN C CG    
5188 C CD    . GLN C 13  ? 1.0208 1.1349 0.8047 0.2843  -0.1959 -0.1833 508 GLN C CD    
5189 O OE1   . GLN C 13  ? 1.0743 1.1031 0.7824 0.3069  -0.2363 -0.2017 508 GLN C OE1   
5190 N NE2   . GLN C 13  ? 0.9949 1.1324 0.9303 0.2831  -0.1991 -0.1622 508 GLN C NE2   
5191 N N     . SER C 14  ? 0.9815 1.3862 0.7488 0.2805  -0.0505 -0.2175 509 SER C N     
5192 C CA    . SER C 14  ? 1.0111 1.4499 0.7884 0.3091  -0.0262 -0.2062 509 SER C CA    
5193 C C     . SER C 14  ? 1.0042 1.4273 0.7944 0.2778  -0.0381 -0.2446 509 SER C C     
5194 O O     . SER C 14  ? 1.0134 1.4334 0.8321 0.2872  -0.0211 -0.2245 509 SER C O     
5195 C CB    . SER C 14  ? 1.0617 1.5736 0.7639 0.3801  -0.0114 -0.2200 509 SER C CB    
5196 O OG    . SER C 14  ? 1.0639 1.6206 0.7491 0.3795  -0.0477 -0.3038 509 SER C OG    
5197 N N     . SER C 15  ? 1.0032 1.4086 0.7849 0.2450  -0.0532 -0.2921 510 SER C N     
5198 C CA    . SER C 15  ? 1.0095 1.4060 0.8135 0.2220  -0.0501 -0.3335 510 SER C CA    
5199 C C     . SER C 15  ? 1.0180 1.3461 0.8328 0.2026  -0.0534 -0.3102 510 SER C C     
5200 O O     . SER C 15  ? 1.0262 1.2986 0.8500 0.2032  -0.0720 -0.2744 510 SER C O     
5201 C CB    . SER C 15  ? 1.0165 1.3883 0.8440 0.1990  -0.0351 -0.3717 510 SER C CB    
5202 O OG    . SER C 15  ? 1.0541 1.3328 0.8314 0.1932  -0.0279 -0.3365 510 SER C OG    
5203 N N     . GLY C 16  ? 1.0237 1.3582 0.8580 0.1905  -0.0443 -0.3405 511 GLY C N     
5204 C CA    . GLY C 16  ? 1.0420 1.3116 0.8841 0.1762  -0.0505 -0.3267 511 GLY C CA    
5205 C C     . GLY C 16  ? 1.0358 1.3476 0.9153 0.1862  -0.0444 -0.3167 511 GLY C C     
5206 O O     . GLY C 16  ? 1.0391 1.4253 0.9108 0.2132  -0.0311 -0.3349 511 GLY C O     
5207 N N     . ALA C 17  ? 1.0457 1.3009 0.9638 0.1783  -0.0591 -0.2923 512 ALA C N     
5208 C CA    . ALA C 17  ? 1.0456 1.3190 1.0128 0.1819  -0.0437 -0.2823 512 ALA C CA    
5209 C C     . ALA C 17  ? 1.0536 1.3468 1.1065 0.2100  -0.0148 -0.2256 512 ALA C C     
5210 O O     . ALA C 17  ? 1.0540 1.2992 1.2223 0.2019  -0.0334 -0.2025 512 ALA C O     
5211 C CB    . ALA C 17  ? 1.0604 1.2558 1.0388 0.1608  -0.0714 -0.2982 512 ALA C CB    
5212 N N     . HIS C 18  ? 1.0820 1.4359 1.0904 0.2571  0.0333  -0.2062 513 HIS C N     
5213 C CA    . HIS C 18  ? 1.1212 1.4771 1.1963 0.3061  0.1015  -0.1356 513 HIS C CA    
5214 C C     . HIS C 18  ? 1.1346 1.4874 1.2257 0.3145  0.1271  -0.1345 513 HIS C C     
5215 O O     . HIS C 18  ? 1.1052 1.4554 1.1671 0.2744  0.0824  -0.1908 513 HIS C O     
5216 C CB    . HIS C 18  ? 1.1950 1.5895 1.1649 0.3868  0.1522  -0.1060 513 HIS C CB    
5217 C CG    . HIS C 18  ? 1.1825 1.5935 1.1069 0.3768  0.1164  -0.1263 513 HIS C CG    
5218 N ND1   . HIS C 18  ? 1.2260 1.6860 1.0156 0.4240  0.0982  -0.1698 513 HIS C ND1   
5219 C CD2   . HIS C 18  ? 1.1417 1.5236 1.1430 0.3319  0.0876  -0.1171 513 HIS C CD2   
5220 C CE1   . HIS C 18  ? 1.2046 1.6682 0.9965 0.4004  0.0720  -0.1767 513 HIS C CE1   
5221 N NE2   . HIS C 18  ? 1.1503 1.5644 1.0567 0.3461  0.0677  -0.1424 513 HIS C NE2   
5222 N N     . ASP C 19  ? 1.0603 1.0715 0.6730 -0.0042 0.0558  0.1208  514 ASP C N     
5223 C CA    . ASP C 19  ? 1.0588 1.0103 0.6656 -0.0523 0.0648  0.0737  514 ASP C CA    
5224 C C     . ASP C 19  ? 1.0415 0.8455 0.6618 -0.0509 0.0745  0.0632  514 ASP C C     
5225 O O     . ASP C 19  ? 1.0553 0.8001 0.6753 -0.0685 0.0961  0.0456  514 ASP C O     
5226 C CB    . ASP C 19  ? 1.0911 1.1415 0.6814 -0.1289 0.0831  0.0137  514 ASP C CB    
5227 C CG    . ASP C 19  ? 1.1143 1.3836 0.6893 -0.1425 0.0724  0.0231  514 ASP C CG    
5228 O OD1   . ASP C 19  ? 1.1321 1.5805 0.7001 -0.1735 0.0689  0.0110  514 ASP C OD1   
5229 O OD2   . ASP C 19  ? 1.1318 1.4233 0.7020 -0.1221 0.0688  0.0466  514 ASP C OD2   
5230 N N     . GLN C 20  ? 1.0084 0.7768 0.6405 -0.0255 0.0658  0.0819  515 GLN C N     
5231 C CA    . GLN C 20  ? 0.9865 0.6858 0.6330 -0.0208 0.0717  0.0833  515 GLN C CA    
5232 C C     . GLN C 20  ? 0.9853 0.6625 0.6300 -0.0061 0.0677  0.0995  515 GLN C C     
5233 O O     . GLN C 20  ? 0.9766 0.6529 0.6303 -0.0112 0.0684  0.0983  515 GLN C O     
5234 C CB    . GLN C 20  ? 0.9827 0.6781 0.6403 -0.0274 0.0789  0.0740  515 GLN C CB    
5235 C CG    . GLN C 20  ? 0.9860 0.6707 0.6363 -0.0631 0.1166  0.0403  515 GLN C CG    
5236 C CD    . GLN C 20  ? 0.9706 0.6428 0.6264 -0.0746 0.1358  0.0266  515 GLN C CD    
5237 O OE1   . GLN C 20  ? 0.9475 0.5800 0.6215 -0.0443 0.1463  0.0530  515 GLN C OE1   
5238 N NE2   . GLN C 20  ? 0.9702 0.7029 0.6091 -0.1227 0.1445  -0.0146 515 GLN C NE2   
5239 N N     . ARG C 21  ? 1.0122 0.6785 0.6411 0.0056  0.0775  0.1115  516 ARG C N     
5240 C CA    . ARG C 21  ? 1.0592 0.6710 0.6735 0.0024  0.1076  0.1120  516 ARG C CA    
5241 C C     . ARG C 21  ? 1.0885 0.6757 0.6890 -0.0050 0.1240  0.1096  516 ARG C C     
5242 O O     . ARG C 21  ? 1.0804 0.6893 0.6794 0.0140  0.1155  0.1257  516 ARG C O     
5243 C CB    . ARG C 21  ? 1.1074 0.6868 0.7093 0.0369  0.1446  0.1408  516 ARG C CB    
5244 C CG    . ARG C 21  ? 1.1120 0.6943 0.7225 0.0357  0.1412  0.1368  516 ARG C CG    
5245 C CD    . ARG C 21  ? 1.1926 0.7106 0.7863 0.0731  0.2065  0.1700  516 ARG C CD    
5246 N NE    . ARG C 21  ? 1.1853 0.7044 0.7869 0.0711  0.2040  0.1652  516 ARG C NE    
5247 C CZ    . ARG C 21  ? 1.2139 0.6854 0.8082 0.0212  0.2221  0.1216  516 ARG C CZ    
5248 N NH1   . ARG C 21  ? 1.2407 0.6856 0.8182 -0.0388 0.2449  0.0752  516 ARG C NH1   
5249 N NH2   . ARG C 21  ? 1.1855 0.6641 0.7879 0.0238  0.2179  0.1212  516 ARG C NH2   
5250 N N     . GLY C 22  ? 1.1281 0.6892 0.7154 -0.0437 0.1512  0.0827  517 GLY C N     
5251 C CA    . GLY C 22  ? 1.1811 0.7115 0.7493 -0.0619 0.1794  0.0719  517 GLY C CA    
5252 C C     . GLY C 22  ? 1.1380 0.7335 0.7218 -0.0656 0.1399  0.0732  517 GLY C C     
5253 O O     . GLY C 22  ? 1.0880 0.7421 0.6961 -0.0551 0.1071  0.0834  517 GLY C O     
5254 N N     . LEU C 23  ? 1.1755 0.7460 0.7435 -0.0753 0.1593  0.0680  518 LEU C N     
5255 C CA    . LEU C 23  ? 1.1500 0.7745 0.7300 -0.0763 0.1333  0.0727  518 LEU C CA    
5256 C C     . LEU C 23  ? 1.1236 0.7444 0.7169 -0.0389 0.1088  0.0958  518 LEU C C     
5257 O O     . LEU C 23  ? 1.1319 0.7371 0.7195 -0.0176 0.1093  0.1074  518 LEU C O     
5258 C CB    . LEU C 23  ? 1.1957 0.7903 0.7515 -0.1031 0.1652  0.0552  518 LEU C CB    
5259 C CG    . LEU C 23  ? 1.2702 0.8565 0.7964 -0.1720 0.2193  0.0068  518 LEU C CG    
5260 C CD1   . LEU C 23  ? 1.3576 0.8683 0.8514 -0.1985 0.2749  -0.0140 518 LEU C CD1   
5261 C CD2   . LEU C 23  ? 1.2349 0.9865 0.7740 -0.2201 0.1960  -0.0138 518 LEU C CD2   
5262 N N     . LEU C 24  ? 1.1128 0.7651 0.7209 -0.0348 0.1006  0.1030  519 LEU C N     
5263 C CA    . LEU C 24  ? 1.1254 0.7605 0.7360 -0.0253 0.1029  0.1040  519 LEU C CA    
5264 C C     . LEU C 24  ? 1.1482 0.7782 0.7403 -0.0271 0.1004  0.0997  519 LEU C C     
5265 O O     . LEU C 24  ? 1.1607 0.7769 0.7428 -0.0259 0.1048  0.1045  519 LEU C O     
5266 C CB    . LEU C 24  ? 1.1337 0.7700 0.75