data_3OOT
# 
_entry.id   3OOT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OOT         
RCSB  RCSB061385   
WWPDB D_1000061385 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OQF . unspecified 
PDB 3OQK . unspecified 
# 
_pdbx_database_status.entry_id                        3OOT 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'Bocskei, Z.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Discovery and optimization of a new class of potent and non-chiral indole-3-carboxamide-based renin inhibitors.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            20 
_citation.page_first                6268 
_citation.page_last                 6272 
_citation.year                      2010 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20850300 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2010.08.092 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Scheiper, B.'   1 ? 
primary 'Matter, H.'     2 ? 
primary 'Steinhagen, H.' 3 ? 
primary 'Stilz, U.'      4 ? 
primary 'Bocskei, Z.'    5 ? 
primary 'Fleury, V.'     6 ? 
primary 'McCort, G.'     7 ? 
# 
_cell.length_a           143.554 
_cell.length_b           143.554 
_cell.length_c           143.554 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3OOT 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.entry_id                         3OOT 
_symmetry.Int_Tables_number                198 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Renin                                                                                    37267.008 2   3.4.23.15 
? 'unp residues 67-406' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                 221.208   2   ?         
? ?                     ? 
3 non-polymer syn '2-(3-fluoro-2-methylbenzyl)-4-methyl-1-phenyl-3-(piperazin-1-ylcarbonyl)-1H-indol-5-ol' 457.539   2   ?         
? ?                     ? 
4 water       nat water                                                                                    18.015    120 ?         
? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Angiotensinogenase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFI
RKFYTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFI
RKFYTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   THR n 
1 3   LEU n 
1 4   GLY n 
1 5   ASN n 
1 6   THR n 
1 7   THR n 
1 8   SER n 
1 9   SER n 
1 10  VAL n 
1 11  ILE n 
1 12  LEU n 
1 13  THR n 
1 14  ASN n 
1 15  TYR n 
1 16  MET n 
1 17  ASP n 
1 18  THR n 
1 19  GLN n 
1 20  TYR n 
1 21  TYR n 
1 22  GLY n 
1 23  GLU n 
1 24  ILE n 
1 25  GLY n 
1 26  ILE n 
1 27  GLY n 
1 28  THR n 
1 29  PRO n 
1 30  PRO n 
1 31  GLN n 
1 32  THR n 
1 33  PHE n 
1 34  LYS n 
1 35  VAL n 
1 36  VAL n 
1 37  PHE n 
1 38  ASP n 
1 39  THR n 
1 40  GLY n 
1 41  SER n 
1 42  SER n 
1 43  ASN n 
1 44  VAL n 
1 45  TRP n 
1 46  VAL n 
1 47  PRO n 
1 48  SER n 
1 49  SER n 
1 50  LYS n 
1 51  CYS n 
1 52  SER n 
1 53  ARG n 
1 54  LEU n 
1 55  TYR n 
1 56  THR n 
1 57  ALA n 
1 58  CYS n 
1 59  VAL n 
1 60  TYR n 
1 61  HIS n 
1 62  LYS n 
1 63  LEU n 
1 64  PHE n 
1 65  ASP n 
1 66  ALA n 
1 67  SER n 
1 68  ASP n 
1 69  SER n 
1 70  SER n 
1 71  SER n 
1 72  TYR n 
1 73  LYS n 
1 74  HIS n 
1 75  ASN n 
1 76  GLY n 
1 77  THR n 
1 78  GLU n 
1 79  LEU n 
1 80  THR n 
1 81  LEU n 
1 82  ARG n 
1 83  TYR n 
1 84  SER n 
1 85  THR n 
1 86  GLY n 
1 87  THR n 
1 88  VAL n 
1 89  SER n 
1 90  GLY n 
1 91  PHE n 
1 92  LEU n 
1 93  SER n 
1 94  GLN n 
1 95  ASP n 
1 96  ILE n 
1 97  ILE n 
1 98  THR n 
1 99  VAL n 
1 100 GLY n 
1 101 GLY n 
1 102 ILE n 
1 103 THR n 
1 104 VAL n 
1 105 THR n 
1 106 GLN n 
1 107 MET n 
1 108 PHE n 
1 109 GLY n 
1 110 GLU n 
1 111 VAL n 
1 112 THR n 
1 113 GLU n 
1 114 MET n 
1 115 PRO n 
1 116 ALA n 
1 117 LEU n 
1 118 PRO n 
1 119 PHE n 
1 120 MET n 
1 121 LEU n 
1 122 ALA n 
1 123 GLU n 
1 124 PHE n 
1 125 ASP n 
1 126 GLY n 
1 127 VAL n 
1 128 VAL n 
1 129 GLY n 
1 130 MET n 
1 131 GLY n 
1 132 PHE n 
1 133 ILE n 
1 134 GLU n 
1 135 GLN n 
1 136 ALA n 
1 137 ILE n 
1 138 GLY n 
1 139 ARG n 
1 140 VAL n 
1 141 THR n 
1 142 PRO n 
1 143 ILE n 
1 144 PHE n 
1 145 ASP n 
1 146 ASN n 
1 147 ILE n 
1 148 ILE n 
1 149 SER n 
1 150 GLN n 
1 151 GLY n 
1 152 VAL n 
1 153 LEU n 
1 154 LYS n 
1 155 GLU n 
1 156 ASP n 
1 157 VAL n 
1 158 PHE n 
1 159 SER n 
1 160 PHE n 
1 161 TYR n 
1 162 TYR n 
1 163 ASN n 
1 164 ARG n 
1 165 ASP n 
1 166 SER n 
1 167 GLU n 
1 168 ASN n 
1 169 SER n 
1 170 GLN n 
1 171 SER n 
1 172 LEU n 
1 173 GLY n 
1 174 GLY n 
1 175 GLN n 
1 176 ILE n 
1 177 VAL n 
1 178 LEU n 
1 179 GLY n 
1 180 GLY n 
1 181 SER n 
1 182 ASP n 
1 183 PRO n 
1 184 GLN n 
1 185 HIS n 
1 186 TYR n 
1 187 GLU n 
1 188 GLY n 
1 189 ASN n 
1 190 PHE n 
1 191 HIS n 
1 192 TYR n 
1 193 ILE n 
1 194 ASN n 
1 195 LEU n 
1 196 ILE n 
1 197 LYS n 
1 198 THR n 
1 199 GLY n 
1 200 VAL n 
1 201 TRP n 
1 202 GLN n 
1 203 ILE n 
1 204 GLN n 
1 205 MET n 
1 206 LYS n 
1 207 GLY n 
1 208 VAL n 
1 209 SER n 
1 210 VAL n 
1 211 GLY n 
1 212 SER n 
1 213 SER n 
1 214 THR n 
1 215 LEU n 
1 216 LEU n 
1 217 CYS n 
1 218 GLU n 
1 219 ASP n 
1 220 GLY n 
1 221 CYS n 
1 222 LEU n 
1 223 ALA n 
1 224 LEU n 
1 225 VAL n 
1 226 ASP n 
1 227 THR n 
1 228 GLY n 
1 229 ALA n 
1 230 SER n 
1 231 TYR n 
1 232 ILE n 
1 233 SER n 
1 234 GLY n 
1 235 SER n 
1 236 THR n 
1 237 SER n 
1 238 SER n 
1 239 ILE n 
1 240 GLU n 
1 241 LYS n 
1 242 LEU n 
1 243 MET n 
1 244 GLU n 
1 245 ALA n 
1 246 LEU n 
1 247 GLY n 
1 248 ALA n 
1 249 LYS n 
1 250 LYS n 
1 251 ARG n 
1 252 LEU n 
1 253 PHE n 
1 254 ASP n 
1 255 TYR n 
1 256 VAL n 
1 257 VAL n 
1 258 LYS n 
1 259 CYS n 
1 260 ASN n 
1 261 GLU n 
1 262 GLY n 
1 263 PRO n 
1 264 THR n 
1 265 LEU n 
1 266 PRO n 
1 267 ASP n 
1 268 ILE n 
1 269 SER n 
1 270 PHE n 
1 271 HIS n 
1 272 LEU n 
1 273 GLY n 
1 274 GLY n 
1 275 LYS n 
1 276 GLU n 
1 277 TYR n 
1 278 THR n 
1 279 LEU n 
1 280 THR n 
1 281 SER n 
1 282 ALA n 
1 283 ASP n 
1 284 TYR n 
1 285 VAL n 
1 286 PHE n 
1 287 GLN n 
1 288 GLU n 
1 289 SER n 
1 290 TYR n 
1 291 SER n 
1 292 SER n 
1 293 LYS n 
1 294 LYS n 
1 295 LEU n 
1 296 CYS n 
1 297 THR n 
1 298 LEU n 
1 299 ALA n 
1 300 ILE n 
1 301 HIS n 
1 302 ALA n 
1 303 MET n 
1 304 ASP n 
1 305 ILE n 
1 306 PRO n 
1 307 PRO n 
1 308 PRO n 
1 309 THR n 
1 310 GLY n 
1 311 PRO n 
1 312 THR n 
1 313 TRP n 
1 314 ALA n 
1 315 LEU n 
1 316 GLY n 
1 317 ALA n 
1 318 THR n 
1 319 PHE n 
1 320 ILE n 
1 321 ARG n 
1 322 LYS n 
1 323 PHE n 
1 324 TYR n 
1 325 THR n 
1 326 GLU n 
1 327 PHE n 
1 328 ASP n 
1 329 ARG n 
1 330 ARG n 
1 331 ASN n 
1 332 ASN n 
1 333 ARG n 
1 334 ILE n 
1 335 GLY n 
1 336 PHE n 
1 337 ALA n 
1 338 LEU n 
1 339 ALA n 
1 340 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 REN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HUMAN EMBRYONIC KIDNEY CELL (CRL-1573)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RENI_HUMAN 
_struct_ref.pdbx_db_accession          P00797 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELT
LRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSF
YYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFI
RKFYTEFDRRNNRIGFALAR
;
_struct_ref.pdbx_align_begin           67 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OOT A 1 ? 340 ? P00797 67 ? 406 ? -5 326 
2 1 3OOT B 1 ? 340 ? P00797 67 ? 406 ? -5 326 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                  ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                 ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                               ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                          ? 
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                                 ? 
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                          ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                  ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                    ? 
'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                               ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                  ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                   ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                               ? 
'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                 ? 
'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                            ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                  ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                   ? 
'C3 H7 N O3'      105.093 
SSR non-polymer                  . '2-(3-fluoro-2-methylbenzyl)-4-methyl-1-phenyl-3-(piperazin-1-ylcarbonyl)-1H-indol-5-ol' 
'[2-(3-Fluoro-2-methyl-benzyl)-5-hydroxy-4-methyl-1-phenyl-1H-indol-3-yl]-piperazin-1-yl-methanone' 'C28 H28 F N3 O2' 457.539 
THR 'L-peptide linking'          y THREONINE                                                                                ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                               ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                 ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                   ? 
'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3OOT 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.34 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   63.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'0.05M CITRATE PH=4.5, 10-12% PEG3350, 0.6M NACL, 20 MG/ML RENIN, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-02-23 
_diffrn_detector.details                'Osmic blue mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3OOT 
_reflns.d_resolution_high            2.550 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   31582 
_reflns.pdbx_Rmerge_I_obs            0.102 
_reflns.pdbx_netI_over_sigmaI        9.400 
_reflns.pdbx_chi_squared             1.128 
_reflns.pdbx_redundancy              2.200 
_reflns.percent_possible_obs         97.700 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.550 2.640  ? ? ? 0.643 ? ? 0.996 1.900 ? 3152 98.300 ? 1  
2.640 2.750  ? ? ? 0.529 ? ? 1.105 2.200 ? 3196 99.900 ? 2  
2.750 2.870  ? ? ? 0.399 ? ? 1.195 2.300 ? 3180 99.900 ? 3  
2.870 3.020  ? ? ? 0.294 ? ? 1.183 2.300 ? 3190 99.700 ? 4  
3.020 3.210  ? ? ? 0.222 ? ? 1.153 2.300 ? 3195 99.400 ? 5  
3.210 3.460  ? ? ? 0.145 ? ? 1.206 2.300 ? 3166 98.900 ? 6  
3.460 3.810  ? ? ? 0.096 ? ? 1.242 2.300 ? 3157 97.700 ? 7  
3.810 4.360  ? ? ? 0.070 ? ? 1.152 2.300 ? 3111 96.200 ? 8  
4.360 5.490  ? ? ? 0.056 ? ? 1.010 2.200 ? 3134 96.100 ? 9  
5.490 50.000 ? ? ? 0.059 ? ? 0.985 2.200 ? 3101 91.700 ? 10 
# 
_refine.entry_id                                 3OOT 
_refine.ls_d_res_high                            2.5500 
_refine.ls_d_res_low                             33.1800 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.5000 
_refine.ls_number_reflns_obs                     31544 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;POSITION OF WATER MOLECULES WERE TAKEN FROM A HIGHER RESOLUTION STRUCTURE (2.05 A). WATERS WERE REFINED AND RETAINED ONLY IF THE ISOTROPIC DISPLACEMENT PARAMETER REMAINED BELOW 80 A**2
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1841 
_refine.ls_R_factor_R_work                       0.1823 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2203 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9800 
_refine.ls_number_reflns_R_free                  1571 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               54.0084 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            0.0000 
_refine.aniso_B[3][3]                            0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9520 
_refine.correlation_coeff_Fo_to_Fc_free          0.9275 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                144.740 
_refine.B_iso_min                                25.050 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3OOT 
_refine_analyze.Luzzati_coordinate_error_obs    0.314 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5196 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             120 
_refine_hist.number_atoms_total               5412 
_refine_hist.d_res_high                       2.5500 
_refine_hist.d_res_low                        33.1800 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_dihedral_angle_d        1796 ?      ? 2.000  'X-RAY DIFFRACTION' ? 
t_trig_c_planes           118  ?      ? 2.000  'X-RAY DIFFRACTION' ? 
t_gen_planes              798  ?      ? 5.000  'X-RAY DIFFRACTION' ? 
t_it                      5428 ?      ? 20.000 'X-RAY DIFFRACTION' ? 
t_nbd                     ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_improper_torsion        ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_pseud_angle             ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_chiral_improper_torsion 716  ?      ? 5.000  'X-RAY DIFFRACTION' ? 
t_sum_occupancies         ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_utility_distance        ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_utility_angle           ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_utility_torsion         ?    ?      ? ?      'X-RAY DIFFRACTION' ? 
t_ideal_dist_contact      5804 ?      ? 4.000  'X-RAY DIFFRACTION' ? 
t_bond_d                  5428 0.009  ? 2.000  'X-RAY DIFFRACTION' ? 
t_angle_deg               7378 1.230  ? 2.000  'X-RAY DIFFRACTION' ? 
t_omega_torsion           ?    3.420  ? ?      'X-RAY DIFFRACTION' ? 
t_other_torsion           ?    20.840 ? ?      'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.5500 
_refine_ls_shell.d_res_low                        2.6300 
_refine_ls_shell.pdbx_total_number_of_bins_used   16 
_refine_ls_shell.percent_reflns_obs               97.5000 
_refine_ls_shell.number_reflns_R_work             2639 
_refine_ls_shell.R_factor_all                     0.2426 
_refine_ls_shell.R_factor_R_work                  0.2402 
_refine_ls_shell.R_factor_R_free                  0.2898 
_refine_ls_shell.percent_reflns_R_free            4.9400 
_refine_ls_shell.number_reflns_R_free             137 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2776 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OOT 
_struct.title                     'Crystal Structure Analysis of Renin-indole-piperazin inhibitor complexes' 
_struct.pdbx_descriptor           'Renin (E.C.3.4.23.15)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OOT 
_struct_keywords.text            'RENIN HUMAN, ASPARTYL PROTEASE, RENIN INHIBITION, HYPERTENSION, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 55  ? HIS A 61  ? TYR A 47  HIS A 53  1 ? 7  
HELX_P HELX_P2  2  ASP A 65  ? SER A 69  ? ASP A 57  SER A 61  5 ? 5  
HELX_P HELX_P3  3  PRO A 115 ? MET A 120 ? PRO A 108 MET A 113 1 ? 6  
HELX_P HELX_P4  4  PHE A 132 ? VAL A 140 ? PHE A 125 VAL A 133 5 ? 9  
HELX_P HELX_P5  5  PRO A 142 ? GLN A 150 ? PRO A 135 GLN A 143 1 ? 9  
HELX_P HELX_P6  6  SER A 235 ? GLY A 247 ? SER A 224 GLY A 236 1 ? 13 
HELX_P HELX_P7  7  GLU A 261 ? LEU A 265 ? GLU A 251 LEU A 255 5 ? 5  
HELX_P HELX_P8  8  THR A 280 ? TYR A 284 ? THR A 270 TYR A 274 1 ? 5  
HELX_P HELX_P9  9  GLY A 316 ? LYS A 322 ? GLY A 302 LYS A 308 1 ? 7  
HELX_P HELX_P10 10 TYR B 55  ? TYR B 60  ? TYR B 47  TYR B 52  1 ? 6  
HELX_P HELX_P11 11 ASP B 65  ? SER B 69  ? ASP B 57  SER B 61  5 ? 5  
HELX_P HELX_P12 12 PRO B 115 ? MET B 120 ? PRO B 108 MET B 113 1 ? 6  
HELX_P HELX_P13 13 PHE B 132 ? VAL B 140 ? PHE B 125 VAL B 133 5 ? 9  
HELX_P HELX_P14 14 PRO B 142 ? GLN B 150 ? PRO B 135 GLN B 143 1 ? 9  
HELX_P HELX_P15 15 SER B 235 ? GLY B 247 ? SER B 224 GLY B 236 1 ? 13 
HELX_P HELX_P16 16 GLU B 261 ? LEU B 265 ? GLU B 251 LEU B 255 5 ? 5  
HELX_P HELX_P17 17 THR B 280 ? VAL B 285 ? THR B 270 VAL B 275 1 ? 6  
HELX_P HELX_P18 18 GLY B 316 ? LYS B 322 ? GLY B 302 LYS B 308 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 51  SG  ? ? ? 1_555 A CYS 58  SG ? ? A CYS 45  A CYS 50  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf2 disulf ?   ? A CYS 217 SG  ? ? ? 1_555 A CYS 221 SG ? ? A CYS 206 A CYS 210 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf3 disulf ?   ? A CYS 259 SG  ? ? ? 1_555 A CYS 296 SG ? ? A CYS 249 A CYS 282 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf4 disulf ?   ? B CYS 51  SG  ? ? ? 1_555 B CYS 58  SG ? ? B CYS 45  B CYS 50  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf5 disulf ?   ? B CYS 217 SG  ? ? ? 1_555 B CYS 221 SG ? ? B CYS 206 B CYS 210 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf6 disulf ?   ? B CYS 259 SG  ? ? ? 1_555 B CYS 296 SG ? ? B CYS 249 B CYS 282 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1 covale one ? A ASN 75  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 67  A NAG 367 1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
covale2 covale one ? B ASN 75  ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 67  B NAG 367 1_555 ? ? ? ? ? ? ? 1.474 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 28  A . ? THR 22  A PRO 29  A ? PRO 23  A 1 -1.76 
2 LEU 117 A . ? LEU 110 A PRO 118 A ? PRO 111 A 1 10.35 
3 PRO 307 A . ? PRO 293 A PRO 308 A ? PRO 294 A 1 6.30  
4 GLY 310 A . ? GLY 296 A PRO 311 A ? PRO 297 A 1 -0.77 
5 THR 28  B . ? THR 22  B PRO 29  B ? PRO 23  B 1 -3.72 
6 LEU 117 B . ? LEU 110 B PRO 118 B ? PRO 111 B 1 9.28  
7 PRO 307 B . ? PRO 293 B PRO 308 B ? PRO 294 B 1 5.61  
8 GLY 310 B . ? GLY 296 B PRO 311 B ? PRO 297 B 1 -0.99 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9  ? 
B ? 13 ? 
C ? 3  ? 
D ? 3  ? 
E ? 2  ? 
F ? 4  ? 
G ? 9  ? 
H ? 13 ? 
I ? 5  ? 
J ? 4  ? 
K ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
B 4  5  ? anti-parallel 
B 5  6  ? parallel      
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
B 12 13 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
E 1  2  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? parallel      
H 4  5  ? anti-parallel 
H 5  6  ? parallel      
H 6  7  ? anti-parallel 
H 7  8  ? anti-parallel 
H 8  9  ? anti-parallel 
H 9  10 ? anti-parallel 
H 10 11 ? anti-parallel 
H 11 12 ? anti-parallel 
H 12 13 ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? parallel      
I 3  4  ? anti-parallel 
I 4  5  ? parallel      
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? anti-parallel 
K 1  2  ? anti-parallel 
K 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 73  ? ARG A 82  ? LYS A 65  ARG A 74  
A 2  THR A 87  ? VAL A 99  ? THR A 79  VAL A 91  
A 3  GLN A 19  ? ILE A 26  ? GLN A 13  ILE A 20  
A 4  SER A 8   ? TYR A 15  ? SER A 2   TYR A 9   
A 5  GLY A 174 ? LEU A 178 ? GLY A 163 LEU A 167 
A 6  VAL A 157 ? TYR A 162 ? VAL A 150 TYR A 155 
A 7  PHE A 323 ? ASP A 328 ? PHE A 309 ASP A 314 
A 8  ARG A 333 ? ALA A 339 ? ARG A 319 ALA A 325 
A 9  TYR A 186 ? ASN A 194 ? TYR A 175 ASN A 183 
B 1  LYS A 73  ? ARG A 82  ? LYS A 65  ARG A 74  
B 2  THR A 87  ? VAL A 99  ? THR A 79  VAL A 91  
B 3  ILE A 102 ? GLU A 113 ? ILE A 94  GLU A 106 
B 4  VAL A 44  ? PRO A 47  ? VAL A 38  PRO A 41  
B 5  GLY A 126 ? GLY A 129 ? GLY A 119 GLY A 122 
B 6  GLN A 31  ? ASP A 38  ? GLN A 25  ASP A 32  
B 7  GLN A 19  ? ILE A 26  ? GLN A 13  ILE A 20  
B 8  SER A 8   ? TYR A 15  ? SER A 2   TYR A 9   
B 9  GLY A 174 ? LEU A 178 ? GLY A 163 LEU A 167 
B 10 VAL A 157 ? TYR A 162 ? VAL A 150 TYR A 155 
B 11 PHE A 323 ? ASP A 328 ? PHE A 309 ASP A 314 
B 12 ARG A 333 ? ALA A 339 ? ARG A 319 ALA A 325 
B 13 TYR A 186 ? ASN A 194 ? TYR A 175 ASN A 183 
C 1  GLN A 202 ? MET A 205 ? GLN A 191 MET A 194 
C 2  CYS A 221 ? VAL A 225 ? CYS A 210 VAL A 214 
C 3  TRP A 313 ? LEU A 315 ? TRP A 299 LEU A 301 
D 1  VAL A 208 ? VAL A 210 ? VAL A 197 VAL A 199 
D 2  ILE A 268 ? LEU A 272 ? ILE A 258 LEU A 262 
D 3  LYS A 275 ? LEU A 279 ? LYS A 265 LEU A 269 
E 1  ILE A 232 ? GLY A 234 ? ILE A 221 GLY A 223 
E 2  ILE A 300 ? ALA A 302 ? ILE A 286 ALA A 288 
F 1  LYS A 249 ? LYS A 250 ? LYS A 238 LYS A 239 
F 2  TYR A 255 ? LYS A 258 ? TYR A 245 LYS A 248 
F 3  LEU A 295 ? LEU A 298 ? LEU A 281 LEU A 284 
F 4  VAL A 285 ? PHE A 286 ? VAL A 275 PHE A 276 
G 1  LYS B 73  ? ARG B 82  ? LYS B 65  ARG B 74  
G 2  THR B 87  ? VAL B 99  ? THR B 79  VAL B 91  
G 3  GLN B 19  ? ILE B 26  ? GLN B 13  ILE B 20  
G 4  SER B 8   ? TYR B 15  ? SER B 2   TYR B 9   
G 5  GLY B 174 ? LEU B 178 ? GLY B 163 LEU B 167 
G 6  VAL B 157 ? TYR B 162 ? VAL B 150 TYR B 155 
G 7  PHE B 323 ? ASP B 328 ? PHE B 309 ASP B 314 
G 8  ARG B 333 ? ALA B 339 ? ARG B 319 ALA B 325 
G 9  TYR B 186 ? ASN B 194 ? TYR B 175 ASN B 183 
H 1  LYS B 73  ? ARG B 82  ? LYS B 65  ARG B 74  
H 2  THR B 87  ? VAL B 99  ? THR B 79  VAL B 91  
H 3  ILE B 102 ? GLU B 113 ? ILE B 94  GLU B 106 
H 4  VAL B 44  ? PRO B 47  ? VAL B 38  PRO B 41  
H 5  GLY B 126 ? GLY B 129 ? GLY B 119 GLY B 122 
H 6  GLN B 31  ? ASP B 38  ? GLN B 25  ASP B 32  
H 7  GLN B 19  ? ILE B 26  ? GLN B 13  ILE B 20  
H 8  SER B 8   ? TYR B 15  ? SER B 2   TYR B 9   
H 9  GLY B 174 ? LEU B 178 ? GLY B 163 LEU B 167 
H 10 VAL B 157 ? TYR B 162 ? VAL B 150 TYR B 155 
H 11 PHE B 323 ? ASP B 328 ? PHE B 309 ASP B 314 
H 12 ARG B 333 ? ALA B 339 ? ARG B 319 ALA B 325 
H 13 TYR B 186 ? ASN B 194 ? TYR B 175 ASN B 183 
I 1  GLN B 202 ? MET B 205 ? GLN B 191 MET B 194 
I 2  CYS B 221 ? VAL B 225 ? CYS B 210 VAL B 214 
I 3  TRP B 313 ? LEU B 315 ? TRP B 299 LEU B 301 
I 4  ILE B 232 ? GLY B 234 ? ILE B 221 GLY B 223 
I 5  ILE B 300 ? ALA B 302 ? ILE B 286 ALA B 288 
J 1  SER B 213 ? LEU B 216 ? SER B 202 LEU B 205 
J 2  VAL B 208 ? VAL B 210 ? VAL B 197 VAL B 199 
J 3  ILE B 268 ? LEU B 272 ? ILE B 258 LEU B 262 
J 4  LYS B 275 ? LEU B 279 ? LYS B 265 LEU B 269 
K 1  LYS B 249 ? LYS B 250 ? LYS B 238 LYS B 239 
K 2  TYR B 255 ? LYS B 258 ? TYR B 245 LYS B 248 
K 3  LEU B 295 ? THR B 297 ? LEU B 281 THR B 283 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N LYS A 73  ? N LYS A 65  O GLN A 94  ? O GLN A 86  
A 2  3  O THR A 98  ? O THR A 90  N GLY A 25  ? N GLY A 19  
A 3  4  O TYR A 21  ? O TYR A 15  N THR A 13  ? N THR A 7   
A 4  5  N SER A 8   ? N SER A 2   O LEU A 178 ? O LEU A 167 
A 5  6  O GLN A 175 ? O GLN A 164 N TYR A 161 ? N TYR A 154 
A 6  7  N PHE A 158 ? N PHE A 151 O PHE A 327 ? O PHE A 313 
A 7  8  N GLU A 326 ? N GLU A 312 O GLY A 335 ? O GLY A 321 
A 8  9  O ILE A 334 ? O ILE A 320 N ILE A 193 ? N ILE A 182 
B 1  2  N LYS A 73  ? N LYS A 65  O GLN A 94  ? O GLN A 86  
B 2  3  N ILE A 97  ? N ILE A 89  O VAL A 104 ? O VAL A 96  
B 3  4  O GLY A 109 ? O GLY A 102 N VAL A 44  ? N VAL A 38  
B 4  5  N TRP A 45  ? N TRP A 39  O VAL A 127 ? O VAL A 120 
B 5  6  O VAL A 128 ? O VAL A 121 N VAL A 36  ? N VAL A 30  
B 6  7  O VAL A 35  ? O VAL A 29  N GLY A 22  ? N GLY A 16  
B 7  8  O TYR A 21  ? O TYR A 15  N THR A 13  ? N THR A 7   
B 8  9  N SER A 8   ? N SER A 2   O LEU A 178 ? O LEU A 167 
B 9  10 O GLN A 175 ? O GLN A 164 N TYR A 161 ? N TYR A 154 
B 10 11 N PHE A 158 ? N PHE A 151 O PHE A 327 ? O PHE A 313 
B 11 12 N GLU A 326 ? N GLU A 312 O GLY A 335 ? O GLY A 321 
B 12 13 O ILE A 334 ? O ILE A 320 N ILE A 193 ? N ILE A 182 
C 1  2  N MET A 205 ? N MET A 194 O CYS A 221 ? O CYS A 210 
C 2  3  N LEU A 224 ? N LEU A 213 O TRP A 313 ? O TRP A 299 
D 1  2  N SER A 209 ? N SER A 198 O SER A 269 ? O SER A 259 
D 2  3  N ILE A 268 ? N ILE A 258 O LEU A 279 ? O LEU A 269 
E 1  2  N ILE A 232 ? N ILE A 221 O HIS A 301 ? O HIS A 287 
F 1  2  N LYS A 249 ? N LYS A 238 O VAL A 256 ? O VAL A 246 
F 2  3  N VAL A 257 ? N VAL A 247 O CYS A 296 ? O CYS A 282 
F 3  4  O THR A 297 ? O THR A 283 N PHE A 286 ? N PHE A 276 
G 1  2  N LEU B 79  ? N LEU B 71  O GLY B 90  ? O GLY B 82  
G 2  3  O THR B 98  ? O THR B 90  N GLY B 25  ? N GLY B 19  
G 3  4  O TYR B 21  ? O TYR B 15  N THR B 13  ? N THR B 7   
G 4  5  N SER B 8   ? N SER B 2   O LEU B 178 ? O LEU B 167 
G 5  6  O VAL B 177 ? O VAL B 166 N SER B 159 ? N SER B 152 
G 6  7  N PHE B 158 ? N PHE B 151 O PHE B 327 ? O PHE B 313 
G 7  8  N GLU B 326 ? N GLU B 312 O GLY B 335 ? O GLY B 321 
G 8  9  O ILE B 334 ? O ILE B 320 N ILE B 193 ? N ILE B 182 
H 1  2  N LEU B 79  ? N LEU B 71  O GLY B 90  ? O GLY B 82  
H 2  3  N ILE B 97  ? N ILE B 89  O VAL B 104 ? O VAL B 96  
H 3  4  O GLY B 109 ? O GLY B 102 N VAL B 44  ? N VAL B 38  
H 4  5  N TRP B 45  ? N TRP B 39  O VAL B 127 ? O VAL B 120 
H 5  6  O VAL B 128 ? O VAL B 121 N VAL B 36  ? N VAL B 30  
H 6  7  O VAL B 35  ? O VAL B 29  N GLY B 22  ? N GLY B 16  
H 7  8  O TYR B 21  ? O TYR B 15  N THR B 13  ? N THR B 7   
H 8  9  N SER B 8   ? N SER B 2   O LEU B 178 ? O LEU B 167 
H 9  10 O VAL B 177 ? O VAL B 166 N SER B 159 ? N SER B 152 
H 10 11 N PHE B 158 ? N PHE B 151 O PHE B 327 ? O PHE B 313 
H 11 12 N GLU B 326 ? N GLU B 312 O GLY B 335 ? O GLY B 321 
H 12 13 O ILE B 334 ? O ILE B 320 N ILE B 193 ? N ILE B 182 
I 1  2  N MET B 205 ? N MET B 194 O CYS B 221 ? O CYS B 210 
I 2  3  N LEU B 224 ? N LEU B 213 O TRP B 313 ? O TRP B 299 
I 3  4  O ALA B 314 ? O ALA B 300 N SER B 233 ? N SER B 222 
I 4  5  N ILE B 232 ? N ILE B 221 O HIS B 301 ? O HIS B 287 
J 1  2  O LEU B 216 ? O LEU B 205 N VAL B 208 ? N VAL B 197 
J 2  3  N SER B 209 ? N SER B 198 O SER B 269 ? O SER B 259 
J 3  4  N ILE B 268 ? N ILE B 258 O LEU B 279 ? O LEU B 269 
K 1  2  N LYS B 249 ? N LYS B 238 O VAL B 256 ? O VAL B 246 
K 2  3  N VAL B 257 ? N VAL B 247 O CYS B 296 ? O CYS B 282 
# 
_atom_sites.entry_id                    3OOT 
_atom_sites.fract_transf_matrix[1][1]   0.006966 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006966 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006966 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 4   ? -17.088 -36.413 28.967  1.00 72.58  ? -2  GLY A N   1 
ATOM   2    C CA  . GLY A 1 4   ? -18.411 -35.802 28.943  1.00 72.86  ? -2  GLY A CA  1 
ATOM   3    C C   . GLY A 1 4   ? -19.530 -36.716 28.476  1.00 78.43  ? -2  GLY A C   1 
ATOM   4    O O   . GLY A 1 4   ? -19.299 -37.903 28.206  1.00 78.56  ? -2  GLY A O   1 
ATOM   5    N N   . ASN A 1 5   ? -20.757 -36.152 28.368  1.00 75.12  ? -1  ASN A N   1 
ATOM   6    C CA  . ASN A 1 5   ? -21.985 -36.852 27.969  1.00 75.54  ? -1  ASN A CA  1 
ATOM   7    C C   . ASN A 1 5   ? -22.567 -36.393 26.625  1.00 79.09  ? -1  ASN A C   1 
ATOM   8    O O   . ASN A 1 5   ? -23.393 -37.112 26.051  1.00 79.59  ? -1  ASN A O   1 
ATOM   9    C CB  . ASN A 1 5   ? -23.072 -36.640 29.045  1.00 80.76  ? -1  ASN A CB  1 
ATOM   10   C CG  . ASN A 1 5   ? -23.121 -37.676 30.148  1.00 122.99 ? -1  ASN A CG  1 
ATOM   11   O OD1 . ASN A 1 5   ? -23.431 -38.856 29.919  1.00 121.63 ? -1  ASN A OD1 1 
ATOM   12   N ND2 . ASN A 1 5   ? -22.905 -37.238 31.388  1.00 118.00 ? -1  ASN A ND2 1 
ATOM   13   N N   . THR A 1 6   ? -22.196 -35.184 26.160  1.00 73.94  ? 0   THR A N   1 
ATOM   14   C CA  . THR A 1 6   ? -22.777 -34.554 24.966  1.00 72.32  ? 0   THR A CA  1 
ATOM   15   C C   . THR A 1 6   ? -22.175 -34.844 23.587  1.00 71.86  ? 0   THR A C   1 
ATOM   16   O O   . THR A 1 6   ? -20.983 -35.130 23.441  1.00 70.40  ? 0   THR A O   1 
ATOM   17   C CB  . THR A 1 6   ? -23.029 -33.035 25.181  1.00 81.95  ? 0   THR A CB  1 
ATOM   18   O OG1 . THR A 1 6   ? -21.798 -32.312 25.118  1.00 81.54  ? 0   THR A OG1 1 
ATOM   19   C CG2 . THR A 1 6   ? -23.787 -32.717 26.478  1.00 80.74  ? 0   THR A CG2 1 
ATOM   20   N N   . THR A 1 7   ? -23.062 -34.733 22.571  1.00 66.01  ? 1   THR A N   1 
ATOM   21   C CA  . THR A 1 7   ? -22.852 -34.831 21.123  1.00 64.30  ? 1   THR A CA  1 
ATOM   22   C C   . THR A 1 7   ? -23.542 -33.593 20.524  1.00 66.30  ? 1   THR A C   1 
ATOM   23   O O   . THR A 1 7   ? -24.710 -33.330 20.858  1.00 67.11  ? 1   THR A O   1 
ATOM   24   C CB  . THR A 1 7   ? -23.367 -36.182 20.592  1.00 66.03  ? 1   THR A CB  1 
ATOM   25   O OG1 . THR A 1 7   ? -22.263 -37.087 20.516  1.00 63.76  ? 1   THR A OG1 1 
ATOM   26   C CG2 . THR A 1 7   ? -24.044 -36.081 19.224  1.00 63.37  ? 1   THR A CG2 1 
ATOM   27   N N   . SER A 1 8   ? -22.811 -32.809 19.695  1.00 59.18  ? 2   SER A N   1 
ATOM   28   C CA  . SER A 1 8   ? -23.339 -31.589 19.083  1.00 56.94  ? 2   SER A CA  1 
ATOM   29   C C   . SER A 1 8   ? -23.206 -31.690 17.562  1.00 57.69  ? 2   SER A C   1 
ATOM   30   O O   . SER A 1 8   ? -22.131 -32.006 17.054  1.00 57.52  ? 2   SER A O   1 
ATOM   31   C CB  . SER A 1 8   ? -22.621 -30.356 19.640  1.00 59.76  ? 2   SER A CB  1 
ATOM   32   O OG  . SER A 1 8   ? -23.000 -29.151 18.995  1.00 69.88  ? 2   SER A OG  1 
ATOM   33   N N   . SER A 1 9   ? -24.298 -31.456 16.841  1.00 52.26  ? 3   SER A N   1 
ATOM   34   C CA  . SER A 1 9   ? -24.274 -31.518 15.379  1.00 51.14  ? 3   SER A CA  1 
ATOM   35   C C   . SER A 1 9   ? -24.459 -30.147 14.709  1.00 54.35  ? 3   SER A C   1 
ATOM   36   O O   . SER A 1 9   ? -25.276 -29.332 15.155  1.00 54.57  ? 3   SER A O   1 
ATOM   37   C CB  . SER A 1 9   ? -25.258 -32.558 14.847  1.00 53.05  ? 3   SER A CB  1 
ATOM   38   O OG  . SER A 1 9   ? -26.585 -32.071 14.795  1.00 64.48  ? 3   SER A OG  1 
ATOM   39   N N   . VAL A 1 10  ? -23.679 -29.892 13.648  1.00 48.82  ? 4   VAL A N   1 
ATOM   40   C CA  . VAL A 1 10  ? -23.777 -28.657 12.866  1.00 47.07  ? 4   VAL A CA  1 
ATOM   41   C C   . VAL A 1 10  ? -24.320 -29.051 11.490  1.00 48.01  ? 4   VAL A C   1 
ATOM   42   O O   . VAL A 1 10  ? -23.713 -29.881 10.814  1.00 47.07  ? 4   VAL A O   1 
ATOM   43   C CB  . VAL A 1 10  ? -22.429 -27.878 12.770  1.00 50.22  ? 4   VAL A CB  1 
ATOM   44   C CG1 . VAL A 1 10  ? -22.571 -26.593 11.932  1.00 49.83  ? 4   VAL A CG1 1 
ATOM   45   C CG2 . VAL A 1 10  ? -21.892 -27.545 14.154  1.00 49.92  ? 4   VAL A CG2 1 
ATOM   46   N N   . ILE A 1 11  ? -25.470 -28.491 11.099  1.00 43.41  ? 5   ILE A N   1 
ATOM   47   C CA  . ILE A 1 11  ? -26.068 -28.739 9.779   1.00 42.44  ? 5   ILE A CA  1 
ATOM   48   C C   . ILE A 1 11  ? -25.315 -27.875 8.751   1.00 42.33  ? 5   ILE A C   1 
ATOM   49   O O   . ILE A 1 11  ? -25.099 -26.682 8.983   1.00 41.47  ? 5   ILE A O   1 
ATOM   50   C CB  . ILE A 1 11  ? -27.623 -28.480 9.765   1.00 45.54  ? 5   ILE A CB  1 
ATOM   51   C CG1 . ILE A 1 11  ? -28.397 -29.389 10.759  1.00 46.05  ? 5   ILE A CG1 1 
ATOM   52   C CG2 . ILE A 1 11  ? -28.228 -28.558 8.361   1.00 45.90  ? 5   ILE A CG2 1 
ATOM   53   C CD1 . ILE A 1 11  ? -27.998 -30.943 10.830  1.00 55.16  ? 5   ILE A CD1 1 
ATOM   54   N N   . LEU A 1 12  ? -24.928 -28.480 7.627   1.00 36.36  ? 6   LEU A N   1 
ATOM   55   C CA  . LEU A 1 12  ? -24.206 -27.806 6.546   1.00 34.53  ? 6   LEU A CA  1 
ATOM   56   C C   . LEU A 1 12  ? -25.073 -27.609 5.319   1.00 37.58  ? 6   LEU A C   1 
ATOM   57   O O   . LEU A 1 12  ? -25.963 -28.406 5.037   1.00 36.92  ? 6   LEU A O   1 
ATOM   58   C CB  . LEU A 1 12  ? -22.935 -28.596 6.138   1.00 33.77  ? 6   LEU A CB  1 
ATOM   59   C CG  . LEU A 1 12  ? -21.975 -28.996 7.236   1.00 36.56  ? 6   LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 12  ? -20.841 -29.816 6.675   1.00 35.71  ? 6   LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 12  ? -21.502 -27.778 8.021   1.00 36.43  ? 6   LEU A CD2 1 
ATOM   62   N N   . THR A 1 13  ? -24.758 -26.570 4.565   1.00 35.12  ? 7   THR A N   1 
ATOM   63   C CA  . THR A 1 13  ? -25.416 -26.233 3.311   1.00 34.96  ? 7   THR A CA  1 
ATOM   64   C C   . THR A 1 13  ? -24.478 -26.699 2.202   1.00 38.86  ? 7   THR A C   1 
ATOM   65   O O   . THR A 1 13  ? -23.281 -26.445 2.268   1.00 38.81  ? 7   THR A O   1 
ATOM   66   C CB  . THR A 1 13  ? -25.654 -24.715 3.275   1.00 40.89  ? 7   THR A CB  1 
ATOM   67   O OG1 . THR A 1 13  ? -26.401 -24.331 4.433   1.00 43.92  ? 7   THR A OG1 1 
ATOM   68   C CG2 . THR A 1 13  ? -26.330 -24.243 2.004   1.00 32.15  ? 7   THR A CG2 1 
ATOM   69   N N   . ASN A 1 14  ? -25.010 -27.402 1.215   1.00 35.44  ? 8   ASN A N   1 
ATOM   70   C CA  . ASN A 1 14  ? -24.230 -27.863 0.074   1.00 35.30  ? 8   ASN A CA  1 
ATOM   71   C C   . ASN A 1 14  ? -24.441 -26.888 -1.070  1.00 39.96  ? 8   ASN A C   1 
ATOM   72   O O   . ASN A 1 14  ? -25.550 -26.767 -1.594  1.00 39.24  ? 8   ASN A O   1 
ATOM   73   C CB  . ASN A 1 14  ? -24.672 -29.274 -0.324  1.00 33.58  ? 8   ASN A CB  1 
ATOM   74   C CG  . ASN A 1 14  ? -24.055 -29.914 -1.542  1.00 44.08  ? 8   ASN A CG  1 
ATOM   75   O OD1 . ASN A 1 14  ? -24.329 -31.072 -1.805  1.00 46.29  ? 8   ASN A OD1 1 
ATOM   76   N ND2 . ASN A 1 14  ? -23.238 -29.231 -2.309  1.00 27.89  ? 8   ASN A ND2 1 
ATOM   77   N N   . TYR A 1 15  ? -23.377 -26.195 -1.449  1.00 38.22  ? 9   TYR A N   1 
ATOM   78   C CA  . TYR A 1 15  ? -23.398 -25.262 -2.567  1.00 39.13  ? 9   TYR A CA  1 
ATOM   79   C C   . TYR A 1 15  ? -22.617 -25.881 -3.735  1.00 45.66  ? 9   TYR A C   1 
ATOM   80   O O   . TYR A 1 15  ? -21.383 -25.962 -3.687  1.00 45.28  ? 9   TYR A O   1 
ATOM   81   C CB  . TYR A 1 15  ? -22.852 -23.865 -2.165  1.00 40.78  ? 9   TYR A CB  1 
ATOM   82   C CG  . TYR A 1 15  ? -22.742 -22.912 -3.337  1.00 44.96  ? 9   TYR A CG  1 
ATOM   83   C CD1 . TYR A 1 15  ? -23.866 -22.268 -3.845  1.00 47.43  ? 9   TYR A CD1 1 
ATOM   84   C CD2 . TYR A 1 15  ? -21.526 -22.713 -3.991  1.00 46.52  ? 9   TYR A CD2 1 
ATOM   85   C CE1 . TYR A 1 15  ? -23.780 -21.432 -4.959  1.00 48.66  ? 9   TYR A CE1 1 
ATOM   86   C CE2 . TYR A 1 15  ? -21.433 -21.898 -5.120  1.00 47.28  ? 9   TYR A CE2 1 
ATOM   87   C CZ  . TYR A 1 15  ? -22.562 -21.253 -5.591  1.00 55.86  ? 9   TYR A CZ  1 
ATOM   88   O OH  . TYR A 1 15  ? -22.477 -20.461 -6.698  1.00 59.39  ? 9   TYR A OH  1 
ATOM   89   N N   . MET A 1 16  ? -23.348 -26.352 -4.762  1.00 44.58  ? 10  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -22.825 -26.917 -6.021  1.00 45.21  ? 10  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -21.820 -28.074 -5.872  1.00 44.38  ? 10  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -20.987 -28.276 -6.759  1.00 44.30  ? 10  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -22.220 -25.806 -6.905  1.00 49.02  ? 10  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -23.110 -24.604 -7.088  1.00 55.63  ? 10  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -22.756 -23.748 -8.640  1.00 63.70  ? 10  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -20.914 -23.402 -8.463  1.00 60.14  ? 10  MET A CE  1 
ATOM   97   N N   . ASP A 1 17  ? -21.867 -28.803 -4.754  1.00 37.33  ? 11  ASP A N   1 
ATOM   98   C CA  . ASP A 1 17  ? -20.944 -29.908 -4.470  1.00 36.60  ? 11  ASP A CA  1 
ATOM   99   C C   . ASP A 1 17  ? -19.476 -29.491 -4.247  1.00 37.22  ? 11  ASP A C   1 
ATOM   100  O O   . ASP A 1 17  ? -18.615 -30.360 -4.113  1.00 34.68  ? 11  ASP A O   1 
ATOM   101  C CB  . ASP A 1 17  ? -21.052 -31.024 -5.541  1.00 38.36  ? 11  ASP A CB  1 
ATOM   102  C CG  . ASP A 1 17  ? -22.160 -32.017 -5.294  1.00 42.29  ? 11  ASP A CG  1 
ATOM   103  O OD1 . ASP A 1 17  ? -22.791 -31.945 -4.217  1.00 41.14  ? 11  ASP A OD1 1 
ATOM   104  O OD2 . ASP A 1 17  ? -22.346 -32.918 -6.144  1.00 48.88  ? 11  ASP A OD2 1 
ATOM   105  N N   . THR A 1 18  ? -19.195 -28.174 -4.201  1.00 33.38  ? 12  THR A N   1 
ATOM   106  C CA  . THR A 1 18  ? -17.839 -27.649 -4.035  1.00 32.63  ? 12  THR A CA  1 
ATOM   107  C C   . THR A 1 18  ? -17.619 -26.924 -2.697  1.00 36.22  ? 12  THR A C   1 
ATOM   108  O O   . THR A 1 18  ? -16.474 -26.770 -2.265  1.00 34.87  ? 12  THR A O   1 
ATOM   109  C CB  . THR A 1 18  ? -17.464 -26.742 -5.205  1.00 35.12  ? 12  THR A CB  1 
ATOM   110  O OG1 . THR A 1 18  ? -18.369 -25.654 -5.254  1.00 39.31  ? 12  THR A OG1 1 
ATOM   111  C CG2 . THR A 1 18  ? -17.433 -27.454 -6.535  1.00 25.05  ? 12  THR A CG2 1 
ATOM   112  N N   . GLN A 1 19  ? -18.706 -26.464 -2.050  1.00 33.14  ? 13  GLN A N   1 
ATOM   113  C CA  . GLN A 1 19  ? -18.610 -25.725 -0.791  1.00 32.22  ? 13  GLN A CA  1 
ATOM   114  C C   . GLN A 1 19  ? -19.655 -26.227 0.158   1.00 35.63  ? 13  GLN A C   1 
ATOM   115  O O   . GLN A 1 19  ? -20.833 -26.235 -0.182  1.00 35.35  ? 13  GLN A O   1 
ATOM   116  C CB  . GLN A 1 19  ? -18.792 -24.195 -1.017  1.00 32.76  ? 13  GLN A CB  1 
ATOM   117  C CG  . GLN A 1 19  ? -17.667 -23.519 -1.808  1.00 32.84  ? 13  GLN A CG  1 
ATOM   118  C CD  . GLN A 1 19  ? -17.978 -22.103 -2.225  1.00 44.45  ? 13  GLN A CD  1 
ATOM   119  O OE1 . GLN A 1 19  ? -18.375 -21.279 -1.410  1.00 41.43  ? 13  GLN A OE1 1 
ATOM   120  N NE2 . GLN A 1 19  ? -17.782 -21.769 -3.501  1.00 31.78  ? 13  GLN A NE2 1 
ATOM   121  N N   . TYR A 1 20  ? -19.231 -26.641 1.353   1.00 31.70  ? 14  TYR A N   1 
ATOM   122  C CA  . TYR A 1 20  ? -20.135 -27.107 2.399   1.00 31.34  ? 14  TYR A CA  1 
ATOM   123  C C   . TYR A 1 20  ? -19.875 -26.223 3.580   1.00 37.60  ? 14  TYR A C   1 
ATOM   124  O O   . TYR A 1 20  ? -18.761 -26.211 4.117   1.00 37.47  ? 14  TYR A O   1 
ATOM   125  C CB  . TYR A 1 20  ? -19.901 -28.582 2.751   1.00 31.65  ? 14  TYR A CB  1 
ATOM   126  C CG  . TYR A 1 20  ? -20.206 -29.534 1.620   1.00 32.19  ? 14  TYR A CG  1 
ATOM   127  C CD1 . TYR A 1 20  ? -21.389 -30.266 1.599   1.00 34.32  ? 14  TYR A CD1 1 
ATOM   128  C CD2 . TYR A 1 20  ? -19.302 -29.725 0.581   1.00 31.40  ? 14  TYR A CD2 1 
ATOM   129  C CE1 . TYR A 1 20  ? -21.660 -31.174 0.572   1.00 34.26  ? 14  TYR A CE1 1 
ATOM   130  C CE2 . TYR A 1 20  ? -19.573 -30.603 -0.463  1.00 31.35  ? 14  TYR A CE2 1 
ATOM   131  C CZ  . TYR A 1 20  ? -20.739 -31.353 -0.447  1.00 41.59  ? 14  TYR A CZ  1 
ATOM   132  O OH  . TYR A 1 20  ? -20.992 -32.234 -1.473  1.00 43.34  ? 14  TYR A OH  1 
ATOM   133  N N   . TYR A 1 21  ? -20.877 -25.431 3.949   1.00 34.89  ? 15  TYR A N   1 
ATOM   134  C CA  . TYR A 1 21  ? -20.709 -24.484 5.036   1.00 35.09  ? 15  TYR A CA  1 
ATOM   135  C C   . TYR A 1 21  ? -21.809 -24.565 6.078   1.00 40.40  ? 15  TYR A C   1 
ATOM   136  O O   . TYR A 1 21  ? -22.953 -24.904 5.754   1.00 39.59  ? 15  TYR A O   1 
ATOM   137  C CB  . TYR A 1 21  ? -20.539 -23.037 4.491   1.00 36.04  ? 15  TYR A CB  1 
ATOM   138  C CG  . TYR A 1 21  ? -21.620 -22.580 3.534   1.00 38.29  ? 15  TYR A CG  1 
ATOM   139  C CD1 . TYR A 1 21  ? -21.446 -22.683 2.160   1.00 40.05  ? 15  TYR A CD1 1 
ATOM   140  C CD2 . TYR A 1 21  ? -22.803 -22.009 4.004   1.00 39.69  ? 15  TYR A CD2 1 
ATOM   141  C CE1 . TYR A 1 21  ? -22.438 -22.270 1.271   1.00 41.84  ? 15  TYR A CE1 1 
ATOM   142  C CE2 . TYR A 1 21  ? -23.797 -21.576 3.124   1.00 40.83  ? 15  TYR A CE2 1 
ATOM   143  C CZ  . TYR A 1 21  ? -23.611 -21.714 1.757   1.00 52.31  ? 15  TYR A CZ  1 
ATOM   144  O OH  . TYR A 1 21  ? -24.576 -21.289 0.872   1.00 57.81  ? 15  TYR A OH  1 
ATOM   145  N N   . GLY A 1 22  ? -21.441 -24.221 7.310   1.00 37.41  ? 16  GLY A N   1 
ATOM   146  C CA  . GLY A 1 22  ? -22.336 -24.152 8.454   1.00 37.19  ? 16  GLY A CA  1 
ATOM   147  C C   . GLY A 1 22  ? -22.381 -22.751 9.030   1.00 43.31  ? 16  GLY A C   1 
ATOM   148  O O   . GLY A 1 22  ? -21.812 -21.810 8.450   1.00 42.35  ? 16  GLY A O   1 
ATOM   149  N N   . GLU A 1 23  ? -23.052 -22.598 10.189  1.00 41.81  ? 17  GLU A N   1 
ATOM   150  C CA  . GLU A 1 23  ? -23.142 -21.305 10.858  1.00 42.14  ? 17  GLU A CA  1 
ATOM   151  C C   . GLU A 1 23  ? -22.470 -21.303 12.192  1.00 45.09  ? 17  GLU A C   1 
ATOM   152  O O   . GLU A 1 23  ? -22.531 -22.293 12.921  1.00 46.24  ? 17  GLU A O   1 
ATOM   153  C CB  . GLU A 1 23  ? -24.592 -20.870 11.064  1.00 44.35  ? 17  GLU A CB  1 
ATOM   154  C CG  . GLU A 1 23  ? -25.397 -20.690 9.793   1.00 62.08  ? 17  GLU A CG  1 
ATOM   155  C CD  . GLU A 1 23  ? -26.398 -19.560 9.839   1.00 82.08  ? 17  GLU A CD  1 
ATOM   156  O OE1 . GLU A 1 23  ? -26.977 -19.308 10.924  1.00 83.15  ? 17  GLU A OE1 1 
ATOM   157  O OE2 . GLU A 1 23  ? -26.589 -18.917 8.782   1.00 61.51  ? 17  GLU A OE2 1 
ATOM   158  N N   . ILE A 1 24  ? -21.847 -20.168 12.527  1.00 38.87  ? 18  ILE A N   1 
ATOM   159  C CA  . ILE A 1 24  ? -21.254 -19.904 13.829  1.00 36.74  ? 18  ILE A CA  1 
ATOM   160  C C   . ILE A 1 24  ? -21.687 -18.500 14.231  1.00 38.57  ? 18  ILE A C   1 
ATOM   161  O O   . ILE A 1 24  ? -21.974 -17.674 13.362  1.00 38.10  ? 18  ILE A O   1 
ATOM   162  C CB  . ILE A 1 24  ? -19.710 -20.117 13.922  1.00 39.48  ? 18  ILE A CB  1 
ATOM   163  C CG1 . ILE A 1 24  ? -18.919 -19.169 12.981  1.00 39.10  ? 18  ILE A CG1 1 
ATOM   164  C CG2 . ILE A 1 24  ? -19.316 -21.605 13.756  1.00 39.67  ? 18  ILE A CG2 1 
ATOM   165  C CD1 . ILE A 1 24  ? -17.524 -18.808 13.428  1.00 36.53  ? 18  ILE A CD1 1 
ATOM   166  N N   . GLY A 1 25  ? -21.750 -18.263 15.540  1.00 33.42  ? 19  GLY A N   1 
ATOM   167  C CA  . GLY A 1 25  ? -22.085 -16.977 16.132  1.00 31.87  ? 19  GLY A CA  1 
ATOM   168  C C   . GLY A 1 25  ? -20.880 -16.470 16.878  1.00 36.02  ? 19  GLY A C   1 
ATOM   169  O O   . GLY A 1 25  ? -20.235 -17.242 17.579  1.00 36.28  ? 19  GLY A O   1 
ATOM   170  N N   . ILE A 1 26  ? -20.512 -15.193 16.671  1.00 33.34  ? 20  ILE A N   1 
ATOM   171  C CA  . ILE A 1 26  ? -19.353 -14.584 17.339  1.00 32.57  ? 20  ILE A CA  1 
ATOM   172  C C   . ILE A 1 26  ? -19.814 -13.326 18.048  1.00 38.32  ? 20  ILE A C   1 
ATOM   173  O O   . ILE A 1 26  ? -20.420 -12.451 17.410  1.00 37.43  ? 20  ILE A O   1 
ATOM   174  C CB  . ILE A 1 26  ? -18.151 -14.271 16.386  1.00 35.00  ? 20  ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 26  ? -17.809 -15.453 15.447  1.00 34.96  ? 20  ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 26  ? -16.907 -13.780 17.176  1.00 34.94  ? 20  ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 26  ? -16.798 -15.102 14.363  1.00 36.12  ? 20  ILE A CD1 1 
ATOM   178  N N   . GLY A 1 27  ? -19.508 -13.242 19.346  1.00 35.86  ? 21  GLY A N   1 
ATOM   179  C CA  . GLY A 1 27  ? -19.795 -12.067 20.156  1.00 36.35  ? 21  GLY A CA  1 
ATOM   180  C C   . GLY A 1 27  ? -21.114 -12.023 20.881  1.00 40.91  ? 21  GLY A C   1 
ATOM   181  O O   . GLY A 1 27  ? -21.904 -12.966 20.804  1.00 41.28  ? 21  GLY A O   1 
ATOM   182  N N   . THR A 1 28  ? -21.331 -10.914 21.617  1.00 37.91  ? 22  THR A N   1 
ATOM   183  C CA  . THR A 1 28  ? -22.530 -10.661 22.430  1.00 37.22  ? 22  THR A CA  1 
ATOM   184  C C   . THR A 1 28  ? -23.140 -9.296  22.063  1.00 39.77  ? 22  THR A C   1 
ATOM   185  O O   . THR A 1 28  ? -22.541 -8.262  22.363  1.00 39.97  ? 22  THR A O   1 
ATOM   186  C CB  . THR A 1 28  ? -22.234 -10.809 23.932  1.00 41.34  ? 22  THR A CB  1 
ATOM   187  O OG1 . THR A 1 28  ? -21.493 -12.013 24.171  1.00 41.56  ? 22  THR A OG1 1 
ATOM   188  C CG2 . THR A 1 28  ? -23.490 -10.806 24.757  1.00 37.44  ? 22  THR A CG2 1 
ATOM   189  N N   . PRO A 1 29  ? -24.318 -9.257  21.410  1.00 34.13  ? 23  PRO A N   1 
ATOM   190  C CA  . PRO A 1 29  ? -25.137 -10.395 20.940  1.00 33.96  ? 23  PRO A CA  1 
ATOM   191  C C   . PRO A 1 29  ? -24.460 -11.097 19.754  1.00 39.47  ? 23  PRO A C   1 
ATOM   192  O O   . PRO A 1 29  ? -23.614 -10.475 19.110  1.00 37.87  ? 23  PRO A O   1 
ATOM   193  C CB  . PRO A 1 29  ? -26.473 -9.731  20.581  1.00 35.14  ? 23  PRO A CB  1 
ATOM   194  C CG  . PRO A 1 29  ? -26.098 -8.350  20.164  1.00 38.93  ? 23  PRO A CG  1 
ATOM   195  C CD  . PRO A 1 29  ? -24.912 -7.965  21.023  1.00 34.47  ? 23  PRO A CD  1 
ATOM   196  N N   . PRO A 1 30  ? -24.758 -12.380 19.452  1.00 37.88  ? 24  PRO A N   1 
ATOM   197  C CA  . PRO A 1 30  ? -24.047 -13.043 18.332  1.00 37.71  ? 24  PRO A CA  1 
ATOM   198  C C   . PRO A 1 30  ? -24.186 -12.409 16.944  1.00 42.93  ? 24  PRO A C   1 
ATOM   199  O O   . PRO A 1 30  ? -25.258 -11.951 16.529  1.00 43.05  ? 24  PRO A O   1 
ATOM   200  C CB  . PRO A 1 30  ? -24.575 -14.487 18.352  1.00 39.07  ? 24  PRO A CB  1 
ATOM   201  C CG  . PRO A 1 30  ? -25.219 -14.657 19.683  1.00 43.00  ? 24  PRO A CG  1 
ATOM   202  C CD  . PRO A 1 30  ? -25.721 -13.297 20.097  1.00 38.20  ? 24  PRO A CD  1 
ATOM   203  N N   . GLN A 1 31  ? -23.056 -12.371 16.234  1.00 39.25  ? 25  GLN A N   1 
ATOM   204  C CA  . GLN A 1 31  ? -22.945 -11.941 14.847  1.00 37.49  ? 25  GLN A CA  1 
ATOM   205  C C   . GLN A 1 31  ? -22.753 -13.262 14.086  1.00 38.45  ? 25  GLN A C   1 
ATOM   206  O O   . GLN A 1 31  ? -21.888 -14.062 14.443  1.00 38.53  ? 25  GLN A O   1 
ATOM   207  C CB  . GLN A 1 31  ? -21.751 -10.994 14.684  1.00 38.72  ? 25  GLN A CB  1 
ATOM   208  C CG  . GLN A 1 31  ? -22.075 -9.572  15.133  1.00 33.75  ? 25  GLN A CG  1 
ATOM   209  C CD  . GLN A 1 31  ? -20.895 -8.656  15.089  1.00 43.73  ? 25  GLN A CD  1 
ATOM   210  O OE1 . GLN A 1 31  ? -20.445 -8.190  16.131  1.00 33.48  ? 25  GLN A OE1 1 
ATOM   211  N NE2 . GLN A 1 31  ? -20.429 -8.298  13.881  1.00 34.51  ? 25  GLN A NE2 1 
ATOM   212  N N   . THR A 1 32  ? -23.631 -13.551 13.150  1.00 33.82  ? 26  THR A N   1 
ATOM   213  C CA  . THR A 1 32  ? -23.578 -14.832 12.448  1.00 33.65  ? 26  THR A CA  1 
ATOM   214  C C   . THR A 1 32  ? -22.779 -14.795 11.159  1.00 36.69  ? 26  THR A C   1 
ATOM   215  O O   . THR A 1 32  ? -22.777 -13.787 10.438  1.00 34.37  ? 26  THR A O   1 
ATOM   216  C CB  . THR A 1 32  ? -24.953 -15.495 12.326  1.00 38.87  ? 26  THR A CB  1 
ATOM   217  O OG1 . THR A 1 32  ? -25.809 -14.573 11.674  1.00 44.73  ? 26  THR A OG1 1 
ATOM   218  C CG2 . THR A 1 32  ? -25.542 -15.881 13.689  1.00 33.93  ? 26  THR A CG2 1 
ATOM   219  N N   . PHE A 1 33  ? -22.032 -15.896 10.928  1.00 32.08  ? 27  PHE A N   1 
ATOM   220  C CA  . PHE A 1 33  ? -21.157 -16.080 9.782   1.00 30.74  ? 27  PHE A CA  1 
ATOM   221  C C   . PHE A 1 33  ? -21.309 -17.468 9.179   1.00 36.54  ? 27  PHE A C   1 
ATOM   222  O O   . PHE A 1 33  ? -21.527 -18.440 9.905   1.00 37.13  ? 27  PHE A O   1 
ATOM   223  C CB  . PHE A 1 33  ? -19.691 -15.855 10.195  1.00 31.34  ? 27  PHE A CB  1 
ATOM   224  C CG  . PHE A 1 33  ? -19.429 -14.454 10.687  1.00 32.18  ? 27  PHE A CG  1 
ATOM   225  C CD1 . PHE A 1 33  ? -19.046 -13.451 9.807   1.00 34.44  ? 27  PHE A CD1 1 
ATOM   226  C CD2 . PHE A 1 33  ? -19.593 -14.126 12.030  1.00 33.74  ? 27  PHE A CD2 1 
ATOM   227  C CE1 . PHE A 1 33  ? -18.833 -12.150 10.261  1.00 34.99  ? 27  PHE A CE1 1 
ATOM   228  C CE2 . PHE A 1 33  ? -19.389 -12.821 12.474  1.00 35.69  ? 27  PHE A CE2 1 
ATOM   229  C CZ  . PHE A 1 33  ? -19.013 -11.845 11.587  1.00 33.18  ? 27  PHE A CZ  1 
ATOM   230  N N   . LYS A 1 34  ? -21.189 -17.553 7.847   1.00 33.53  ? 28  LYS A N   1 
ATOM   231  C CA  . LYS A 1 34  ? -21.210 -18.815 7.112   1.00 33.27  ? 28  LYS A CA  1 
ATOM   232  C C   . LYS A 1 34  ? -19.751 -19.238 7.071   1.00 37.84  ? 28  LYS A C   1 
ATOM   233  O O   . LYS A 1 34  ? -18.899 -18.439 6.675   1.00 37.97  ? 28  LYS A O   1 
ATOM   234  C CB  . LYS A 1 34  ? -21.773 -18.619 5.702   1.00 34.88  ? 28  LYS A CB  1 
ATOM   235  C CG  . LYS A 1 34  ? -23.263 -18.335 5.663   1.00 35.71  ? 28  LYS A CG  1 
ATOM   236  C CD  . LYS A 1 34  ? -23.686 -17.839 4.299   1.00 48.51  ? 28  LYS A CD  1 
ATOM   237  C CE  . LYS A 1 34  ? -25.080 -17.265 4.347   1.00 71.42  ? 28  LYS A CE  1 
ATOM   238  N NZ  . LYS A 1 34  ? -25.539 -16.791 3.013   1.00 85.88  ? 28  LYS A NZ  1 
ATOM   239  N N   . VAL A 1 35  ? -19.439 -20.434 7.585   1.00 33.59  ? 29  VAL A N   1 
ATOM   240  C CA  . VAL A 1 35  ? -18.048 -20.905 7.647   1.00 31.88  ? 29  VAL A CA  1 
ATOM   241  C C   . VAL A 1 35  ? -17.855 -22.303 7.092   1.00 35.39  ? 29  VAL A C   1 
ATOM   242  O O   . VAL A 1 35  ? -18.760 -23.126 7.157   1.00 33.70  ? 29  VAL A O   1 
ATOM   243  C CB  . VAL A 1 35  ? -17.436 -20.804 9.075   1.00 34.98  ? 29  VAL A CB  1 
ATOM   244  C CG1 . VAL A 1 35  ? -17.323 -19.351 9.549   1.00 34.69  ? 29  VAL A CG1 1 
ATOM   245  C CG2 . VAL A 1 35  ? -18.206 -21.660 10.085  1.00 34.61  ? 29  VAL A CG2 1 
ATOM   246  N N   . VAL A 1 36  ? -16.639 -22.579 6.590   1.00 33.54  ? 30  VAL A N   1 
ATOM   247  C CA  . VAL A 1 36  ? -16.198 -23.898 6.138   1.00 32.63  ? 30  VAL A CA  1 
ATOM   248  C C   . VAL A 1 36  ? -15.408 -24.513 7.318   1.00 36.57  ? 30  VAL A C   1 
ATOM   249  O O   . VAL A 1 36  ? -14.611 -23.825 7.974   1.00 36.13  ? 30  VAL A O   1 
ATOM   250  C CB  . VAL A 1 36  ? -15.393 -23.838 4.811   1.00 36.80  ? 30  VAL A CB  1 
ATOM   251  C CG1 . VAL A 1 36  ? -14.706 -25.164 4.512   1.00 37.65  ? 30  VAL A CG1 1 
ATOM   252  C CG2 . VAL A 1 36  ? -16.308 -23.515 3.659   1.00 36.90  ? 30  VAL A CG2 1 
ATOM   253  N N   . PHE A 1 37  ? -15.692 -25.776 7.638   1.00 33.10  ? 31  PHE A N   1 
ATOM   254  C CA  . PHE A 1 37  ? -14.985 -26.482 8.711   1.00 31.57  ? 31  PHE A CA  1 
ATOM   255  C C   . PHE A 1 37  ? -13.903 -27.269 8.006   1.00 36.56  ? 31  PHE A C   1 
ATOM   256  O O   . PHE A 1 37  ? -14.177 -28.232 7.285   1.00 36.09  ? 31  PHE A O   1 
ATOM   257  C CB  . PHE A 1 37  ? -15.947 -27.337 9.532   1.00 31.78  ? 31  PHE A CB  1 
ATOM   258  C CG  . PHE A 1 37  ? -16.970 -26.503 10.277  1.00 32.30  ? 31  PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 37  ? -18.148 -26.092 9.655   1.00 34.33  ? 31  PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 37  ? -16.772 -26.153 11.607  1.00 33.86  ? 31  PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 37  ? -19.116 -25.365 10.350  1.00 34.60  ? 31  PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 37  ? -17.727 -25.387 12.292  1.00 36.47  ? 31  PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 37  ? -18.894 -25.002 11.660  1.00 34.03  ? 31  PHE A CZ  1 
ATOM   264  N N   . ASP A 1 38  ? -12.675 -26.754 8.125   1.00 34.01  ? 32  ASP A N   1 
ATOM   265  C CA  . ASP A 1 38  ? -11.490 -27.196 7.405   1.00 33.34  ? 32  ASP A CA  1 
ATOM   266  C C   . ASP A 1 38  ? -10.449 -27.980 8.227   1.00 36.82  ? 32  ASP A C   1 
ATOM   267  O O   . ASP A 1 38  ? -9.788  -27.410 9.083   1.00 36.62  ? 32  ASP A O   1 
ATOM   268  C CB  . ASP A 1 38  ? -10.872 -25.953 6.720   1.00 34.68  ? 32  ASP A CB  1 
ATOM   269  C CG  . ASP A 1 38  ? -9.570  -26.156 5.982   1.00 38.71  ? 32  ASP A CG  1 
ATOM   270  O OD1 . ASP A 1 38  ? -9.357  -27.263 5.439   1.00 38.94  ? 32  ASP A OD1 1 
ATOM   271  O OD2 . ASP A 1 38  ? -8.797  -25.192 5.887   1.00 38.35  ? 32  ASP A OD2 1 
ATOM   272  N N   . THR A 1 39  ? -10.248 -29.265 7.885   1.00 33.06  ? 33  THR A N   1 
ATOM   273  C CA  . THR A 1 39  ? -9.262  -30.149 8.535   1.00 32.65  ? 33  THR A CA  1 
ATOM   274  C C   . THR A 1 39  ? -7.853  -29.924 7.958   1.00 38.03  ? 33  THR A C   1 
ATOM   275  O O   . THR A 1 39  ? -6.868  -30.432 8.508   1.00 38.38  ? 33  THR A O   1 
ATOM   276  C CB  . THR A 1 39  ? -9.693  -31.621 8.430   1.00 39.13  ? 33  THR A CB  1 
ATOM   277  O OG1 . THR A 1 39  ? -9.978  -31.923 7.062   1.00 38.87  ? 33  THR A OG1 1 
ATOM   278  C CG2 . THR A 1 39  ? -10.905 -31.951 9.313   1.00 37.81  ? 33  THR A CG2 1 
ATOM   279  N N   . GLY A 1 40  ? -7.776  -29.157 6.866   1.00 34.10  ? 34  GLY A N   1 
ATOM   280  C CA  . GLY A 1 40  ? -6.531  -28.798 6.198   1.00 32.83  ? 34  GLY A CA  1 
ATOM   281  C C   . GLY A 1 40  ? -5.873  -27.540 6.723   1.00 36.24  ? 34  GLY A C   1 
ATOM   282  O O   . GLY A 1 40  ? -4.882  -27.092 6.147   1.00 37.24  ? 34  GLY A O   1 
ATOM   283  N N   . SER A 1 41  ? -6.426  -26.942 7.806   1.00 32.60  ? 35  SER A N   1 
ATOM   284  C CA  . SER A 1 41  ? -5.919  -25.719 8.470   1.00 31.97  ? 35  SER A CA  1 
ATOM   285  C C   . SER A 1 41  ? -6.362  -25.691 9.955   1.00 36.20  ? 35  SER A C   1 
ATOM   286  O O   . SER A 1 41  ? -7.224  -26.481 10.333  1.00 33.78  ? 35  SER A O   1 
ATOM   287  C CB  . SER A 1 41  ? -6.305  -24.447 7.707   1.00 31.78  ? 35  SER A CB  1 
ATOM   288  O OG  . SER A 1 41  ? -7.646  -24.039 7.928   1.00 30.78  ? 35  SER A OG  1 
ATOM   289  N N   . SER A 1 42  ? -5.752  -24.810 10.786  1.00 34.38  ? 36  SER A N   1 
ATOM   290  C CA  . SER A 1 42  ? -5.993  -24.765 12.240  1.00 34.17  ? 36  SER A CA  1 
ATOM   291  C C   . SER A 1 42  ? -6.436  -23.421 12.802  1.00 39.32  ? 36  SER A C   1 
ATOM   292  O O   . SER A 1 42  ? -6.630  -23.308 14.019  1.00 39.07  ? 36  SER A O   1 
ATOM   293  C CB  . SER A 1 42  ? -4.739  -25.212 12.986  1.00 35.56  ? 36  SER A CB  1 
ATOM   294  O OG  . SER A 1 42  ? -4.086  -26.263 12.298  1.00 42.45  ? 36  SER A OG  1 
ATOM   295  N N   . ASN A 1 43  ? -6.583  -22.400 11.943  1.00 35.72  ? 37  ASN A N   1 
ATOM   296  C CA  . ASN A 1 43  ? -6.983  -21.060 12.381  1.00 34.14  ? 37  ASN A CA  1 
ATOM   297  C C   . ASN A 1 43  ? -8.429  -20.724 12.082  1.00 37.00  ? 37  ASN A C   1 
ATOM   298  O O   . ASN A 1 43  ? -8.969  -21.134 11.057  1.00 37.75  ? 37  ASN A O   1 
ATOM   299  C CB  . ASN A 1 43  ? -6.068  -20.007 11.769  1.00 30.10  ? 37  ASN A CB  1 
ATOM   300  C CG  . ASN A 1 43  ? -4.661  -20.073 12.293  1.00 35.97  ? 37  ASN A CG  1 
ATOM   301  O OD1 . ASN A 1 43  ? -3.878  -20.949 11.928  1.00 32.34  ? 37  ASN A OD1 1 
ATOM   302  N ND2 . ASN A 1 43  ? -4.305  -19.148 13.165  1.00 25.18  ? 37  ASN A ND2 1 
ATOM   303  N N   . VAL A 1 44  ? -9.046  -19.943 12.972  1.00 30.75  ? 38  VAL A N   1 
ATOM   304  C CA  . VAL A 1 44  ? -10.398 -19.433 12.784  1.00 28.22  ? 38  VAL A CA  1 
ATOM   305  C C   . VAL A 1 44  ? -10.238 -17.974 12.334  1.00 31.53  ? 38  VAL A C   1 
ATOM   306  O O   . VAL A 1 44  ? -9.490  -17.205 12.944  1.00 31.30  ? 38  VAL A O   1 
ATOM   307  C CB  . VAL A 1 44  ? -11.259 -19.506 14.085  1.00 30.33  ? 38  VAL A CB  1 
ATOM   308  C CG1 . VAL A 1 44  ? -12.682 -19.031 13.826  1.00 28.69  ? 38  VAL A CG1 1 
ATOM   309  C CG2 . VAL A 1 44  ? -11.254 -20.910 14.698  1.00 29.89  ? 38  VAL A CG2 1 
ATOM   310  N N   . TRP A 1 45  ? -10.938 -17.599 11.277  1.00 27.37  ? 39  TRP A N   1 
ATOM   311  C CA  . TRP A 1 45  ? -10.969 -16.229 10.809  1.00 26.89  ? 39  TRP A CA  1 
ATOM   312  C C   . TRP A 1 45  ? -12.284 -15.895 10.174  1.00 30.10  ? 39  TRP A C   1 
ATOM   313  O O   . TRP A 1 45  ? -12.957 -16.775 9.643   1.00 29.61  ? 39  TRP A O   1 
ATOM   314  C CB  . TRP A 1 45  ? -9.796  -15.895 9.859   1.00 26.06  ? 39  TRP A CB  1 
ATOM   315  C CG  . TRP A 1 45  ? -9.758  -16.653 8.561   1.00 26.86  ? 39  TRP A CG  1 
ATOM   316  C CD1 . TRP A 1 45  ? -8.995  -17.739 8.284   1.00 29.99  ? 39  TRP A CD1 1 
ATOM   317  C CD2 . TRP A 1 45  ? -10.413 -16.299 7.329   1.00 26.41  ? 39  TRP A CD2 1 
ATOM   318  N NE1 . TRP A 1 45  ? -9.140  -18.098 6.967   1.00 29.86  ? 39  TRP A NE1 1 
ATOM   319  C CE2 . TRP A 1 45  ? -10.007 -17.233 6.355   1.00 30.47  ? 39  TRP A CE2 1 
ATOM   320  C CE3 . TRP A 1 45  ? -11.333 -15.305 6.963   1.00 27.37  ? 39  TRP A CE3 1 
ATOM   321  C CZ2 . TRP A 1 45  ? -10.476 -17.199 5.032   1.00 29.03  ? 39  TRP A CZ2 1 
ATOM   322  C CZ3 . TRP A 1 45  ? -11.802 -15.275 5.659   1.00 28.67  ? 39  TRP A CZ3 1 
ATOM   323  C CH2 . TRP A 1 45  ? -11.370 -16.213 4.707   1.00 29.30  ? 39  TRP A CH2 1 
ATOM   324  N N   . VAL A 1 46  ? -12.645 -14.616 10.237  1.00 28.02  ? 40  VAL A N   1 
ATOM   325  C CA  . VAL A 1 46  ? -13.819 -14.018 9.593   1.00 28.53  ? 40  VAL A CA  1 
ATOM   326  C C   . VAL A 1 46  ? -13.400 -12.645 9.041   1.00 32.25  ? 40  VAL A C   1 
ATOM   327  O O   . VAL A 1 46  ? -12.455 -12.035 9.576   1.00 31.04  ? 40  VAL A O   1 
ATOM   328  C CB  . VAL A 1 46  ? -15.096 -13.913 10.502  1.00 32.04  ? 40  VAL A CB  1 
ATOM   329  C CG1 . VAL A 1 46  ? -15.712 -15.291 10.779  1.00 31.99  ? 40  VAL A CG1 1 
ATOM   330  C CG2 . VAL A 1 46  ? -14.839 -13.117 11.792  1.00 30.80  ? 40  VAL A CG2 1 
ATOM   331  N N   . PRO A 1 47  ? -14.076 -12.123 7.994   1.00 30.41  ? 41  PRO A N   1 
ATOM   332  C CA  . PRO A 1 47  ? -13.746 -10.771 7.532   1.00 30.25  ? 41  PRO A CA  1 
ATOM   333  C C   . PRO A 1 47  ? -14.079 -9.746  8.628   1.00 33.21  ? 41  PRO A C   1 
ATOM   334  O O   . PRO A 1 47  ? -15.059 -9.899  9.358   1.00 30.85  ? 41  PRO A O   1 
ATOM   335  C CB  . PRO A 1 47  ? -14.631 -10.597 6.296   1.00 31.70  ? 41  PRO A CB  1 
ATOM   336  C CG  . PRO A 1 47  ? -15.105 -11.967 5.943   1.00 35.92  ? 41  PRO A CG  1 
ATOM   337  C CD  . PRO A 1 47  ? -15.217 -12.668 7.233   1.00 32.12  ? 41  PRO A CD  1 
ATOM   338  N N   . SER A 1 48  ? -13.211 -8.740  8.777   1.00 30.86  ? 42  SER A N   1 
ATOM   339  C CA  . SER A 1 48  ? -13.331 -7.678  9.778   1.00 30.44  ? 42  SER A CA  1 
ATOM   340  C C   . SER A 1 48  ? -13.991 -6.445  9.205   1.00 35.46  ? 42  SER A C   1 
ATOM   341  O O   . SER A 1 48  ? -13.854 -6.169  8.014   1.00 36.99  ? 42  SER A O   1 
ATOM   342  C CB  . SER A 1 48  ? -11.944 -7.305  10.298  1.00 32.52  ? 42  SER A CB  1 
ATOM   343  O OG  . SER A 1 48  ? -11.995 -6.257  11.244  1.00 42.06  ? 42  SER A OG  1 
ATOM   344  N N   . SER A 1 49  ? -14.659 -5.673  10.061  1.00 32.80  ? 43  SER A N   1 
ATOM   345  C CA  . SER A 1 49  ? -15.276 -4.388  9.697   1.00 33.13  ? 43  SER A CA  1 
ATOM   346  C C   . SER A 1 49  ? -14.147 -3.377  9.336   1.00 38.32  ? 43  SER A C   1 
ATOM   347  O O   . SER A 1 49  ? -14.359 -2.458  8.552   1.00 38.38  ? 43  SER A O   1 
ATOM   348  C CB  . SER A 1 49  ? -16.123 -3.860  10.854  1.00 35.08  ? 43  SER A CB  1 
ATOM   349  O OG  . SER A 1 49  ? -15.353 -3.698  12.035  1.00 40.21  ? 43  SER A OG  1 
ATOM   350  N N   . LYS A 1 50  ? -12.944 -3.593  9.890   1.00 35.68  ? 44  LYS A N   1 
ATOM   351  C CA  . LYS A 1 50  ? -11.749 -2.784  9.653   1.00 35.60  ? 44  LYS A CA  1 
ATOM   352  C C   . LYS A 1 50  ? -11.090 -3.088  8.288   1.00 39.05  ? 44  LYS A C   1 
ATOM   353  O O   . LYS A 1 50  ? -10.092 -2.463  7.949   1.00 39.86  ? 44  LYS A O   1 
ATOM   354  C CB  . LYS A 1 50  ? -10.751 -2.927  10.820  1.00 37.89  ? 44  LYS A CB  1 
ATOM   355  C CG  . LYS A 1 50  ? -11.109 -2.075  12.021  1.00 56.75  ? 44  LYS A CG  1 
ATOM   356  C CD  . LYS A 1 50  ? -10.938 -2.848  13.324  1.00 72.34  ? 44  LYS A CD  1 
ATOM   357  C CE  . LYS A 1 50  ? -11.904 -2.373  14.385  1.00 76.73  ? 44  LYS A CE  1 
ATOM   358  N NZ  . LYS A 1 50  ? -12.039 -3.360  15.480  1.00 85.91  ? 44  LYS A NZ  1 
ATOM   359  N N   . CYS A 1 51  ? -11.647 -4.028  7.508   1.00 34.84  ? 45  CYS A N   1 
ATOM   360  C CA  . CYS A 1 51  ? -11.167 -4.353  6.162   1.00 34.07  ? 45  CYS A CA  1 
ATOM   361  C C   . CYS A 1 51  ? -11.535 -3.204  5.204   1.00 39.37  ? 45  CYS A C   1 
ATOM   362  O O   . CYS A 1 51  ? -12.704 -2.808  5.151   1.00 39.88  ? 45  CYS A O   1 
ATOM   363  C CB  . CYS A 1 51  ? -11.745 -5.684  5.682   1.00 33.46  ? 45  CYS A CB  1 
ATOM   364  S SG  . CYS A 1 51  ? -11.367 -6.079  3.949   1.00 36.84  ? 45  CYS A SG  1 
ATOM   365  N N   . SER A 1 52  ? -10.549 -2.699  4.440   1.00 37.03  ? 46  SER A N   1 
ATOM   366  C CA  . SER A 1 52  ? -10.751 -1.631  3.459   1.00 37.40  ? 46  SER A CA  1 
ATOM   367  C C   . SER A 1 52  ? -11.748 -2.078  2.410   1.00 41.90  ? 46  SER A C   1 
ATOM   368  O O   . SER A 1 52  ? -11.608 -3.184  1.864   1.00 40.77  ? 46  SER A O   1 
ATOM   369  C CB  . SER A 1 52  ? -9.434  -1.255  2.781   1.00 41.81  ? 46  SER A CB  1 
ATOM   370  O OG  . SER A 1 52  ? -9.660  -0.433  1.640   1.00 53.34  ? 46  SER A OG  1 
ATOM   371  N N   . ARG A 1 53  A -12.749 -1.223  2.118   1.00 39.74  ? 46  ARG A N   1 
ATOM   372  C CA  . ARG A 1 53  A -13.765 -1.564  1.110   1.00 39.47  ? 46  ARG A CA  1 
ATOM   373  C C   . ARG A 1 53  A -13.241 -1.572  -0.345  1.00 42.50  ? 46  ARG A C   1 
ATOM   374  O O   . ARG A 1 53  A -14.002 -1.863  -1.268  1.00 43.04  ? 46  ARG A O   1 
ATOM   375  C CB  . ARG A 1 53  A -15.090 -0.814  1.322   1.00 40.24  ? 46  ARG A CB  1 
ATOM   376  C CG  . ARG A 1 53  A -15.604 -0.786  2.780   1.00 51.78  ? 46  ARG A CG  1 
ATOM   377  C CD  . ARG A 1 53  A -15.720 -2.149  3.491   1.00 60.64  ? 46  ARG A CD  1 
ATOM   378  N NE  . ARG A 1 53  A -15.551 -1.995  4.943   1.00 65.33  ? 46  ARG A NE  1 
ATOM   379  C CZ  . ARG A 1 53  A -16.554 -1.869  5.806   1.00 76.32  ? 46  ARG A CZ  1 
ATOM   380  N NH1 . ARG A 1 53  A -17.812 -1.950  5.391   1.00 62.18  ? 46  ARG A NH1 1 
ATOM   381  N NH2 . ARG A 1 53  A -16.309 -1.704  7.095   1.00 65.33  ? 46  ARG A NH2 1 
ATOM   382  N N   . LEU A 1 54  B -11.909 -1.342  -0.529  1.00 36.76  ? 46  LEU A N   1 
ATOM   383  C CA  . LEU A 1 54  B -11.235 -1.481  -1.806  1.00 36.57  ? 46  LEU A CA  1 
ATOM   384  C C   . LEU A 1 54  B -11.008 -2.988  -2.112  1.00 39.98  ? 46  LEU A C   1 
ATOM   385  O O   . LEU A 1 54  B -10.697 -3.368  -3.246  1.00 41.12  ? 46  LEU A O   1 
ATOM   386  C CB  . LEU A 1 54  B -9.930  -0.675  -1.845  1.00 37.22  ? 46  LEU A CB  1 
ATOM   387  C CG  . LEU A 1 54  B -10.060 0.848   -1.978  1.00 42.10  ? 46  LEU A CG  1 
ATOM   388  C CD1 . LEU A 1 54  B -8.709  1.534   -1.716  1.00 42.64  ? 46  LEU A CD1 1 
ATOM   389  C CD2 . LEU A 1 54  B -10.613 1.247   -3.344  1.00 41.16  ? 46  LEU A CD2 1 
ATOM   390  N N   . TYR A 1 55  ? -11.186 -3.841  -1.093  1.00 34.74  ? 47  TYR A N   1 
ATOM   391  C CA  . TYR A 1 55  ? -11.227 -5.292  -1.239  1.00 33.27  ? 47  TYR A CA  1 
ATOM   392  C C   . TYR A 1 55  ? -12.712 -5.592  -1.427  1.00 36.84  ? 47  TYR A C   1 
ATOM   393  O O   . TYR A 1 55  ? -13.499 -5.490  -0.483  1.00 35.67  ? 47  TYR A O   1 
ATOM   394  C CB  . TYR A 1 55  ? -10.674 -6.010  0.003   1.00 33.06  ? 47  TYR A CB  1 
ATOM   395  C CG  . TYR A 1 55  ? -9.178  -5.867  0.137   1.00 34.14  ? 47  TYR A CG  1 
ATOM   396  C CD1 . TYR A 1 55  ? -8.315  -6.559  -0.703  1.00 36.22  ? 47  TYR A CD1 1 
ATOM   397  C CD2 . TYR A 1 55  ? -8.622  -5.013  1.083   1.00 34.64  ? 47  TYR A CD2 1 
ATOM   398  C CE1 . TYR A 1 55  ? -6.933  -6.405  -0.607  1.00 37.85  ? 47  TYR A CE1 1 
ATOM   399  C CE2 . TYR A 1 55  ? -7.241  -4.845  1.183   1.00 35.71  ? 47  TYR A CE2 1 
ATOM   400  C CZ  . TYR A 1 55  ? -6.399  -5.561  0.349   1.00 44.95  ? 47  TYR A CZ  1 
ATOM   401  O OH  . TYR A 1 55  ? -5.033  -5.437  0.452   1.00 49.13  ? 47  TYR A OH  1 
ATOM   402  N N   . THR A 1 56  ? -13.099 -5.868  -2.676  1.00 34.32  ? 48  THR A N   1 
ATOM   403  C CA  . THR A 1 56  ? -14.477 -6.178  -3.082  1.00 33.41  ? 48  THR A CA  1 
ATOM   404  C C   . THR A 1 56  ? -15.039 -7.369  -2.336  1.00 36.84  ? 48  THR A C   1 
ATOM   405  O O   . THR A 1 56  ? -16.221 -7.348  -2.017  1.00 37.20  ? 48  THR A O   1 
ATOM   406  C CB  . THR A 1 56  ? -14.569 -6.257  -4.600  1.00 33.32  ? 48  THR A CB  1 
ATOM   407  O OG1 . THR A 1 56  ? -14.027 -5.033  -5.085  1.00 28.33  ? 48  THR A OG1 1 
ATOM   408  C CG2 . THR A 1 56  ? -15.998 -6.392  -5.102  1.00 30.37  ? 48  THR A CG2 1 
ATOM   409  N N   . ALA A 1 57  ? -14.190 -8.376  -2.004  1.00 33.07  ? 49  ALA A N   1 
ATOM   410  C CA  . ALA A 1 57  ? -14.571 -9.557  -1.211  1.00 32.62  ? 49  ALA A CA  1 
ATOM   411  C C   . ALA A 1 57  ? -15.125 -9.137  0.149   1.00 37.00  ? 49  ALA A C   1 
ATOM   412  O O   . ALA A 1 57  ? -16.022 -9.804  0.654   1.00 36.86  ? 49  ALA A O   1 
ATOM   413  C CB  . ALA A 1 57  ? -13.381 -10.471 -1.016  1.00 33.26  ? 49  ALA A CB  1 
ATOM   414  N N   . CYS A 1 58  ? -14.627 -8.004  0.719   1.00 34.06  ? 50  CYS A N   1 
ATOM   415  C CA  . CYS A 1 58  ? -15.098 -7.457  1.998   1.00 34.29  ? 50  CYS A CA  1 
ATOM   416  C C   . CYS A 1 58  ? -16.417 -6.715  1.848   1.00 41.43  ? 50  CYS A C   1 
ATOM   417  O O   . CYS A 1 58  ? -17.134 -6.546  2.832   1.00 43.58  ? 50  CYS A O   1 
ATOM   418  C CB  . CYS A 1 58  ? -14.037 -6.583  2.657   1.00 33.86  ? 50  CYS A CB  1 
ATOM   419  S SG  . CYS A 1 58  ? -12.697 -7.513  3.437   1.00 36.79  ? 50  CYS A SG  1 
ATOM   420  N N   . VAL A 1 59  ? -16.731 -6.255  0.631   1.00 36.62  ? 51  VAL A N   1 
ATOM   421  C CA  . VAL A 1 59  ? -17.989 -5.572  0.341   1.00 35.85  ? 51  VAL A CA  1 
ATOM   422  C C   . VAL A 1 59  ? -19.113 -6.645  0.254   1.00 41.32  ? 51  VAL A C   1 
ATOM   423  O O   . VAL A 1 59  ? -20.221 -6.395  0.706   1.00 41.79  ? 51  VAL A O   1 
ATOM   424  C CB  . VAL A 1 59  ? -17.879 -4.687  -0.947  1.00 38.18  ? 51  VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 59  ? -19.206 -4.029  -1.307  1.00 36.90  ? 51  VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 59  ? -16.782 -3.635  -0.818  1.00 37.61  ? 51  VAL A CG2 1 
ATOM   427  N N   . TYR A 1 60  ? -18.810 -7.837  -0.274  1.00 40.11  ? 52  TYR A N   1 
ATOM   428  C CA  . TYR A 1 60  ? -19.797 -8.909  -0.432  1.00 42.36  ? 52  TYR A CA  1 
ATOM   429  C C   . TYR A 1 60  ? -20.021 -9.852  0.756   1.00 42.99  ? 52  TYR A C   1 
ATOM   430  O O   . TYR A 1 60  ? -21.101 -10.423 0.915   1.00 44.03  ? 52  TYR A O   1 
ATOM   431  C CB  . TYR A 1 60  ? -19.583 -9.670  -1.744  1.00 47.19  ? 52  TYR A CB  1 
ATOM   432  C CG  . TYR A 1 60  ? -20.046 -8.864  -2.946  1.00 56.03  ? 52  TYR A CG  1 
ATOM   433  C CD1 . TYR A 1 60  ? -19.159 -8.054  -3.656  1.00 58.49  ? 52  TYR A CD1 1 
ATOM   434  C CD2 . TYR A 1 60  ? -21.383 -8.882  -3.355  1.00 58.59  ? 52  TYR A CD2 1 
ATOM   435  C CE1 . TYR A 1 60  ? -19.579 -7.319  -4.763  1.00 58.94  ? 52  TYR A CE1 1 
ATOM   436  C CE2 . TYR A 1 60  ? -21.808 -8.163  -4.472  1.00 59.55  ? 52  TYR A CE2 1 
ATOM   437  C CZ  . TYR A 1 60  ? -20.901 -7.386  -5.169  1.00 71.34  ? 52  TYR A CZ  1 
ATOM   438  O OH  . TYR A 1 60  ? -21.320 -6.688  -6.269  1.00 83.22  ? 52  TYR A OH  1 
ATOM   439  N N   . HIS A 1 61  ? -19.044 -9.962  1.619   1.00 34.77  ? 53  HIS A N   1 
ATOM   440  C CA  . HIS A 1 61  ? -19.148 -10.836 2.770   1.00 31.01  ? 53  HIS A CA  1 
ATOM   441  C C   . HIS A 1 61  ? -19.573 -10.106 4.050   1.00 32.29  ? 53  HIS A C   1 
ATOM   442  O O   . HIS A 1 61  ? -19.420 -8.886  4.153   1.00 30.17  ? 53  HIS A O   1 
ATOM   443  C CB  . HIS A 1 61  ? -17.826 -11.613 2.948   1.00 29.29  ? 53  HIS A CB  1 
ATOM   444  C CG  . HIS A 1 61  ? -17.673 -12.704 1.948   1.00 30.93  ? 53  HIS A CG  1 
ATOM   445  N ND1 . HIS A 1 61  ? -16.748 -12.612 0.941   1.00 32.59  ? 53  HIS A ND1 1 
ATOM   446  C CD2 . HIS A 1 61  ? -18.373 -13.853 1.796   1.00 31.18  ? 53  HIS A CD2 1 
ATOM   447  C CE1 . HIS A 1 61  ? -16.893 -13.712 0.223   1.00 30.89  ? 53  HIS A CE1 1 
ATOM   448  N NE2 . HIS A 1 61  ? -17.868 -14.483 0.694   1.00 30.86  ? 53  HIS A NE2 1 
ATOM   449  N N   . LYS A 1 62  ? -20.099 -10.867 5.020   1.00 28.78  ? 54  LYS A N   1 
ATOM   450  C CA  . LYS A 1 62  ? -20.504 -10.363 6.326   1.00 28.51  ? 54  LYS A CA  1 
ATOM   451  C C   . LYS A 1 62  ? -19.226 -10.055 7.107   1.00 32.59  ? 54  LYS A C   1 
ATOM   452  O O   . LYS A 1 62  ? -18.313 -10.887 7.147   1.00 32.03  ? 54  LYS A O   1 
ATOM   453  C CB  . LYS A 1 62  ? -21.352 -11.434 7.059   1.00 31.24  ? 54  LYS A CB  1 
ATOM   454  C CG  . LYS A 1 62  ? -21.831 -11.024 8.444   1.00 47.89  ? 54  LYS A CG  1 
ATOM   455  C CD  . LYS A 1 62  ? -23.338 -11.091 8.544   1.00 61.96  ? 54  LYS A CD  1 
ATOM   456  C CE  . LYS A 1 62  ? -23.807 -10.836 9.949   1.00 83.10  ? 54  LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 62  ? -25.059 -11.587 10.241  1.00 99.49  ? 54  LYS A NZ  1 
ATOM   458  N N   . LEU A 1 63  ? -19.153 -8.858  7.706   1.00 30.09  ? 55  LEU A N   1 
ATOM   459  C CA  . LEU A 1 63  ? -17.980 -8.419  8.472   1.00 29.96  ? 55  LEU A CA  1 
ATOM   460  C C   . LEU A 1 63  ? -18.226 -8.422  9.960   1.00 36.65  ? 55  LEU A C   1 
ATOM   461  O O   . LEU A 1 63  ? -19.324 -8.081  10.403  1.00 37.98  ? 55  LEU A O   1 
ATOM   462  C CB  . LEU A 1 63  ? -17.523 -7.014  8.049   1.00 29.74  ? 55  LEU A CB  1 
ATOM   463  C CG  . LEU A 1 63  ? -17.392 -6.711  6.561   1.00 33.25  ? 55  LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 63  ? -17.165 -5.250  6.356   1.00 31.80  ? 55  LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 63  ? -16.251 -7.493  5.928   1.00 34.81  ? 55  LEU A CD2 1 
ATOM   466  N N   . PHE A 1 64  ? -17.188 -8.768  10.741  1.00 34.30  ? 56  PHE A N   1 
ATOM   467  C CA  . PHE A 1 64  ? -17.263 -8.755  12.196  1.00 33.79  ? 56  PHE A CA  1 
ATOM   468  C C   . PHE A 1 64  ? -16.950 -7.374  12.728  1.00 39.78  ? 56  PHE A C   1 
ATOM   469  O O   . PHE A 1 64  ? -15.895 -6.812  12.429  1.00 41.27  ? 56  PHE A O   1 
ATOM   470  C CB  . PHE A 1 64  ? -16.352 -9.804  12.835  1.00 35.15  ? 56  PHE A CB  1 
ATOM   471  C CG  . PHE A 1 64  ? -16.406 -9.799  14.346  1.00 35.90  ? 56  PHE A CG  1 
ATOM   472  C CD1 . PHE A 1 64  ? -17.545 -10.239 15.021  1.00 38.35  ? 56  PHE A CD1 1 
ATOM   473  C CD2 . PHE A 1 64  ? -15.326 -9.334  15.094  1.00 36.43  ? 56  PHE A CD2 1 
ATOM   474  C CE1 . PHE A 1 64  ? -17.598 -10.222 16.416  1.00 38.63  ? 56  PHE A CE1 1 
ATOM   475  C CE2 . PHE A 1 64  ? -15.374 -9.328  16.488  1.00 39.37  ? 56  PHE A CE2 1 
ATOM   476  C CZ  . PHE A 1 64  ? -16.517 -9.765  17.140  1.00 37.51  ? 56  PHE A CZ  1 
ATOM   477  N N   . ASP A 1 65  ? -17.867 -6.834  13.531  1.00 35.73  ? 57  ASP A N   1 
ATOM   478  C CA  . ASP A 1 65  ? -17.682 -5.530  14.123  1.00 34.92  ? 57  ASP A CA  1 
ATOM   479  C C   . ASP A 1 65  ? -17.540 -5.711  15.627  1.00 37.54  ? 57  ASP A C   1 
ATOM   480  O O   . ASP A 1 65  ? -18.503 -6.088  16.310  1.00 36.43  ? 57  ASP A O   1 
ATOM   481  C CB  . ASP A 1 65  ? -18.828 -4.575  13.746  1.00 36.36  ? 57  ASP A CB  1 
ATOM   482  C CG  . ASP A 1 65  ? -18.514 -3.092  13.890  1.00 43.12  ? 57  ASP A CG  1 
ATOM   483  O OD1 . ASP A 1 65  ? -17.546 -2.747  14.621  1.00 44.36  ? 57  ASP A OD1 1 
ATOM   484  O OD2 . ASP A 1 65  ? -19.235 -2.279  13.287  1.00 45.66  ? 57  ASP A OD2 1 
ATOM   485  N N   . ALA A 1 66  ? -16.308 -5.471  16.125  1.00 32.34  ? 58  ALA A N   1 
ATOM   486  C CA  . ALA A 1 66  ? -15.942 -5.601  17.531  1.00 31.42  ? 58  ALA A CA  1 
ATOM   487  C C   . ALA A 1 66  ? -16.678 -4.580  18.416  1.00 39.01  ? 58  ALA A C   1 
ATOM   488  O O   . ALA A 1 66  ? -16.966 -4.876  19.584  1.00 40.20  ? 58  ALA A O   1 
ATOM   489  C CB  . ALA A 1 66  ? -14.440 -5.455  17.694  1.00 31.63  ? 58  ALA A CB  1 
ATOM   490  N N   . SER A 1 67  ? -16.985 -3.392  17.841  1.00 36.37  ? 59  SER A N   1 
ATOM   491  C CA  . SER A 1 67  ? -17.711 -2.261  18.433  1.00 36.75  ? 59  SER A CA  1 
ATOM   492  C C   . SER A 1 67  ? -19.079 -2.630  18.983  1.00 40.36  ? 59  SER A C   1 
ATOM   493  O O   . SER A 1 67  ? -19.591 -1.887  19.811  1.00 40.28  ? 59  SER A O   1 
ATOM   494  C CB  . SER A 1 67  ? -17.928 -1.174  17.383  1.00 41.62  ? 59  SER A CB  1 
ATOM   495  O OG  . SER A 1 67  ? -16.685 -0.571  17.078  1.00 61.94  ? 59  SER A OG  1 
ATOM   496  N N   . ASP A 1 68  ? -19.698 -3.720  18.470  1.00 35.60  ? 60  ASP A N   1 
ATOM   497  C CA  . ASP A 1 68  ? -21.033 -4.188  18.847  1.00 34.55  ? 60  ASP A CA  1 
ATOM   498  C C   . ASP A 1 68  ? -20.990 -5.442  19.691  1.00 37.40  ? 60  ASP A C   1 
ATOM   499  O O   . ASP A 1 68  ? -22.039 -6.056  19.899  1.00 36.47  ? 60  ASP A O   1 
ATOM   500  C CB  . ASP A 1 68  ? -21.898 -4.434  17.593  1.00 36.22  ? 60  ASP A CB  1 
ATOM   501  C CG  . ASP A 1 68  ? -22.176 -3.201  16.758  1.00 49.03  ? 60  ASP A CG  1 
ATOM   502  O OD1 . ASP A 1 68  ? -22.402 -2.116  17.352  1.00 49.82  ? 60  ASP A OD1 1 
ATOM   503  O OD2 . ASP A 1 68  ? -22.179 -3.320  15.506  1.00 55.88  ? 60  ASP A OD2 1 
ATOM   504  N N   . SER A 1 69  ? -19.780 -5.860  20.142  1.00 33.68  ? 61  SER A N   1 
ATOM   505  C CA  . SER A 1 69  ? -19.633 -7.033  21.008  1.00 33.24  ? 61  SER A CA  1 
ATOM   506  C C   . SER A 1 69  ? -19.163 -6.609  22.398  1.00 38.85  ? 61  SER A C   1 
ATOM   507  O O   . SER A 1 69  ? -18.160 -5.896  22.542  1.00 39.06  ? 61  SER A O   1 
ATOM   508  C CB  . SER A 1 69  ? -18.697 -8.074  20.416  1.00 34.18  ? 61  SER A CB  1 
ATOM   509  O OG  . SER A 1 69  ? -18.594 -9.199  21.277  1.00 34.97  ? 61  SER A OG  1 
ATOM   510  N N   . SER A 1 70  ? -19.921 -7.027  23.417  1.00 35.63  ? 62  SER A N   1 
ATOM   511  C CA  . SER A 1 70  ? -19.650 -6.717  24.817  1.00 35.27  ? 62  SER A CA  1 
ATOM   512  C C   . SER A 1 70  ? -18.649 -7.693  25.412  1.00 40.29  ? 62  SER A C   1 
ATOM   513  O O   . SER A 1 70  ? -18.015 -7.372  26.425  1.00 40.80  ? 62  SER A O   1 
ATOM   514  C CB  . SER A 1 70  ? -20.943 -6.710  25.619  1.00 37.46  ? 62  SER A CB  1 
ATOM   515  O OG  . SER A 1 70  ? -21.576 -7.977  25.557  1.00 51.30  ? 62  SER A OG  1 
ATOM   516  N N   . SER A 1 71  ? -18.504 -8.881  24.779  1.00 36.03  ? 63  SER A N   1 
ATOM   517  C CA  . SER A 1 71  ? -17.584 -9.942  25.208  1.00 35.58  ? 63  SER A CA  1 
ATOM   518  C C   . SER A 1 71  ? -16.194 -9.878  24.544  1.00 39.61  ? 63  SER A C   1 
ATOM   519  O O   . SER A 1 71  ? -15.315 -10.640 24.928  1.00 40.77  ? 63  SER A O   1 
ATOM   520  C CB  . SER A 1 71  ? -18.219 -11.315 25.008  1.00 38.16  ? 63  SER A CB  1 
ATOM   521  O OG  . SER A 1 71  ? -18.855 -11.441 23.749  1.00 43.73  ? 63  SER A OG  1 
ATOM   522  N N   . TYR A 1 72  ? -15.994 -8.959  23.574  1.00 34.98  ? 64  TYR A N   1 
ATOM   523  C CA  . TYR A 1 72  ? -14.759 -8.777  22.811  1.00 34.09  ? 64  TYR A CA  1 
ATOM   524  C C   . TYR A 1 72  ? -13.568 -8.450  23.688  1.00 40.26  ? 64  TYR A C   1 
ATOM   525  O O   . TYR A 1 72  ? -13.662 -7.607  24.570  1.00 41.79  ? 64  TYR A O   1 
ATOM   526  C CB  . TYR A 1 72  ? -14.959 -7.698  21.721  1.00 34.46  ? 64  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 72  ? -13.689 -7.171  21.077  1.00 34.47  ? 64  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 72  ? -13.150 -5.944  21.453  1.00 35.63  ? 64  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 72  ? -13.037 -7.892  20.078  1.00 35.04  ? 64  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 72  ? -11.978 -5.459  20.874  1.00 36.53  ? 64  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 72  ? -11.877 -7.405  19.471  1.00 35.56  ? 64  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 72  ? -11.349 -6.187  19.872  1.00 43.40  ? 64  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 72  ? -10.188 -5.707  19.295  1.00 40.64  ? 64  TYR A OH  1 
ATOM   534  N N   . LYS A 1 73  ? -12.450 -9.113  23.434  1.00 37.07  ? 65  LYS A N   1 
ATOM   535  C CA  . LYS A 1 73  ? -11.183 -8.890  24.117  1.00 37.50  ? 65  LYS A CA  1 
ATOM   536  C C   . LYS A 1 73  ? -10.173 -8.628  23.015  1.00 43.35  ? 65  LYS A C   1 
ATOM   537  O O   . LYS A 1 73  ? -9.942  -9.480  22.154  1.00 42.87  ? 65  LYS A O   1 
ATOM   538  C CB  . LYS A 1 73  ? -10.753 -10.114 24.962  1.00 40.70  ? 65  LYS A CB  1 
ATOM   539  C CG  . LYS A 1 73  ? -11.656 -10.428 26.138  1.00 58.37  ? 65  LYS A CG  1 
ATOM   540  C CD  . LYS A 1 73  ? -11.311 -9.732  27.422  1.00 69.47  ? 65  LYS A CD  1 
ATOM   541  C CE  . LYS A 1 73  ? -12.256 -10.146 28.540  1.00 73.47  ? 65  LYS A CE  1 
ATOM   542  N NZ  . LYS A 1 73  ? -13.648 -9.637  28.333  1.00 79.69  ? 65  LYS A NZ  1 
ATOM   543  N N   . HIS A 1 74  ? -9.612  -7.433  23.013  1.00 41.90  ? 66  HIS A N   1 
ATOM   544  C CA  . HIS A 1 74  ? -8.626  -6.963  22.051  1.00 41.88  ? 66  HIS A CA  1 
ATOM   545  C C   . HIS A 1 74  ? -7.321  -7.708  22.253  1.00 43.50  ? 66  HIS A C   1 
ATOM   546  O O   . HIS A 1 74  ? -7.027  -8.145  23.369  1.00 43.82  ? 66  HIS A O   1 
ATOM   547  C CB  . HIS A 1 74  ? -8.426  -5.435  22.241  1.00 43.57  ? 66  HIS A CB  1 
ATOM   548  C CG  . HIS A 1 74  ? -7.302  -4.838  21.446  1.00 48.19  ? 66  HIS A CG  1 
ATOM   549  N ND1 . HIS A 1 74  ? -6.027  -4.692  21.988  1.00 50.38  ? 66  HIS A ND1 1 
ATOM   550  C CD2 . HIS A 1 74  ? -7.284  -4.396  20.161  1.00 50.41  ? 66  HIS A CD2 1 
ATOM   551  C CE1 . HIS A 1 74  ? -5.282  -4.177  21.013  1.00 49.86  ? 66  HIS A CE1 1 
ATOM   552  N NE2 . HIS A 1 74  ? -5.994  -3.976  19.899  1.00 50.01  ? 66  HIS A NE2 1 
ATOM   553  N N   . ASN A 1 75  ? -6.554  -7.868  21.162  1.00 38.13  ? 67  ASN A N   1 
ATOM   554  C CA  . ASN A 1 75  ? -5.202  -8.421  21.150  1.00 37.47  ? 67  ASN A CA  1 
ATOM   555  C C   . ASN A 1 75  ? -4.402  -7.610  20.113  1.00 39.65  ? 67  ASN A C   1 
ATOM   556  O O   . ASN A 1 75  ? -3.521  -6.836  20.497  1.00 38.27  ? 67  ASN A O   1 
ATOM   557  C CB  . ASN A 1 75  ? -5.185  -9.926  20.888  1.00 40.59  ? 67  ASN A CB  1 
ATOM   558  C CG  . ASN A 1 75  ? -3.788  -10.496 20.954  1.00 62.55  ? 67  ASN A CG  1 
ATOM   559  O OD1 . ASN A 1 75  ? -3.040  -10.442 19.980  1.00 54.78  ? 67  ASN A OD1 1 
ATOM   560  N ND2 . ASN A 1 75  ? -3.396  -11.041 22.106  1.00 58.48  ? 67  ASN A ND2 1 
ATOM   561  N N   . GLY A 1 76  ? -4.775  -7.727  18.831  1.00 35.44  ? 68  GLY A N   1 
ATOM   562  C CA  . GLY A 1 76  ? -4.200  -6.938  17.747  1.00 34.56  ? 68  GLY A CA  1 
ATOM   563  C C   . GLY A 1 76  ? -2.921  -7.423  17.105  1.00 39.67  ? 68  GLY A C   1 
ATOM   564  O O   . GLY A 1 76  ? -2.375  -6.724  16.253  1.00 39.94  ? 68  GLY A O   1 
ATOM   565  N N   . THR A 1 77  ? -2.424  -8.610  17.486  1.00 37.27  ? 69  THR A N   1 
ATOM   566  C CA  . THR A 1 77  ? -1.221  -9.191  16.880  1.00 37.09  ? 69  THR A CA  1 
ATOM   567  C C   . THR A 1 77  ? -1.522  -9.496  15.399  1.00 40.99  ? 69  THR A C   1 
ATOM   568  O O   . THR A 1 77  ? -2.543  -10.112 15.107  1.00 40.20  ? 69  THR A O   1 
ATOM   569  C CB  . THR A 1 77  ? -0.816  -10.482 17.624  1.00 42.07  ? 69  THR A CB  1 
ATOM   570  O OG1 . THR A 1 77  ? -0.490  -10.164 18.973  1.00 40.57  ? 69  THR A OG1 1 
ATOM   571  C CG2 . THR A 1 77  ? 0.348   -11.213 16.956  1.00 37.58  ? 69  THR A CG2 1 
ATOM   572  N N   . GLU A 1 78  ? -0.631  -9.102  14.483  1.00 37.59  ? 70  GLU A N   1 
ATOM   573  C CA  . GLU A 1 78  ? -0.837  -9.350  13.060  1.00 37.02  ? 70  GLU A CA  1 
ATOM   574  C C   . GLU A 1 78  ? -0.638  -10.795 12.702  1.00 41.25  ? 70  GLU A C   1 
ATOM   575  O O   . GLU A 1 78  ? 0.147   -11.485 13.332  1.00 40.98  ? 70  GLU A O   1 
ATOM   576  C CB  . GLU A 1 78  ? 0.051   -8.457  12.204  1.00 38.26  ? 70  GLU A CB  1 
ATOM   577  C CG  . GLU A 1 78  ? -0.519  -7.058  12.019  1.00 55.81  ? 70  GLU A CG  1 
ATOM   578  C CD  . GLU A 1 78  ? 0.472   -5.913  11.854  1.00 94.09  ? 70  GLU A CD  1 
ATOM   579  O OE1 . GLU A 1 78  ? 1.666   -6.172  11.566  1.00 94.43  ? 70  GLU A OE1 1 
ATOM   580  O OE2 . GLU A 1 78  ? 0.040   -4.744  11.996  1.00 90.91  ? 70  GLU A OE2 1 
ATOM   581  N N   . LEU A 1 79  ? -1.402  -11.269 11.732  1.00 39.57  ? 71  LEU A N   1 
ATOM   582  C CA  . LEU A 1 79  ? -1.269  -12.621 11.225  1.00 40.65  ? 71  LEU A CA  1 
ATOM   583  C C   . LEU A 1 79  ? -1.548  -12.723 9.734   1.00 41.77  ? 71  LEU A C   1 
ATOM   584  O O   . LEU A 1 79  ? -2.411  -12.021 9.192   1.00 41.20  ? 71  LEU A O   1 
ATOM   585  C CB  . LEU A 1 79  ? -1.982  -13.693 12.079  1.00 41.68  ? 71  LEU A CB  1 
ATOM   586  C CG  . LEU A 1 79  ? -3.400  -14.079 11.729  1.00 47.83  ? 71  LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 79  ? -3.716  -15.476 12.258  1.00 48.82  ? 71  LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 79  ? -4.388  -13.039 12.209  1.00 49.63  ? 71  LEU A CD2 1 
ATOM   589  N N   . THR A 1 80  ? -0.723  -13.527 9.071   1.00 36.00  ? 72  THR A N   1 
ATOM   590  C CA  . THR A 1 80  ? -0.795  -13.805 7.647   1.00 34.72  ? 72  THR A CA  1 
ATOM   591  C C   . THR A 1 80  ? -1.050  -15.303 7.494   1.00 37.62  ? 72  THR A C   1 
ATOM   592  O O   . THR A 1 80  ? -0.276  -16.125 8.000   1.00 36.01  ? 72  THR A O   1 
ATOM   593  C CB  . THR A 1 80  ? 0.431   -13.260 6.899   1.00 41.08  ? 72  THR A CB  1 
ATOM   594  O OG1 . THR A 1 80  ? 0.439   -11.832 6.987   1.00 45.92  ? 72  THR A OG1 1 
ATOM   595  C CG2 . THR A 1 80  ? 0.429   -13.639 5.439   1.00 38.25  ? 72  THR A CG2 1 
ATOM   596  N N   . LEU A 1 81  ? -2.170  -15.645 6.831   1.00 34.20  ? 73  LEU A N   1 
ATOM   597  C CA  . LEU A 1 81  ? -2.563  -17.021 6.593   1.00 34.03  ? 73  LEU A CA  1 
ATOM   598  C C   . LEU A 1 81  ? -2.469  -17.328 5.115   1.00 36.41  ? 73  LEU A C   1 
ATOM   599  O O   . LEU A 1 81  ? -3.241  -16.805 4.315   1.00 37.43  ? 73  LEU A O   1 
ATOM   600  C CB  . LEU A 1 81  ? -3.975  -17.286 7.124   1.00 35.00  ? 73  LEU A CB  1 
ATOM   601  C CG  . LEU A 1 81  ? -4.217  -17.001 8.603   1.00 40.33  ? 73  LEU A CG  1 
ATOM   602  C CD1 . LEU A 1 81  ? -5.665  -16.769 8.866   1.00 39.42  ? 73  LEU A CD1 1 
ATOM   603  C CD2 . LEU A 1 81  ? -3.706  -18.133 9.463   1.00 46.32  ? 73  LEU A CD2 1 
ATOM   604  N N   . ARG A 1 82  ? -1.502  -18.174 4.761   1.00 32.07  ? 74  ARG A N   1 
ATOM   605  C CA  . ARG A 1 82  ? -1.234  -18.596 3.392   1.00 31.39  ? 74  ARG A CA  1 
ATOM   606  C C   . ARG A 1 82  ? -1.859  -19.955 3.116   1.00 33.92  ? 74  ARG A C   1 
ATOM   607  O O   . ARG A 1 82  ? -1.674  -20.901 3.883   1.00 34.04  ? 74  ARG A O   1 
ATOM   608  C CB  . ARG A 1 82  ? 0.285   -18.615 3.128   1.00 32.80  ? 74  ARG A CB  1 
ATOM   609  C CG  . ARG A 1 82  ? 0.920   -17.217 3.167   1.00 43.34  ? 74  ARG A CG  1 
ATOM   610  C CD  . ARG A 1 82  ? 2.438   -17.244 3.009   1.00 53.35  ? 74  ARG A CD  1 
ATOM   611  N NE  . ARG A 1 82  ? 3.031   -15.925 3.255   1.00 70.44  ? 74  ARG A NE  1 
ATOM   612  C CZ  . ARG A 1 82  ? 3.385   -15.465 4.455   1.00 90.40  ? 74  ARG A CZ  1 
ATOM   613  N NH1 . ARG A 1 82  ? 3.216   -16.214 5.540   1.00 79.91  ? 74  ARG A NH1 1 
ATOM   614  N NH2 . ARG A 1 82  ? 3.897   -14.247 4.580   1.00 76.61  ? 74  ARG A NH2 1 
ATOM   615  N N   . TYR A 1 83  ? -2.658  -20.037 2.067   1.00 29.79  ? 75  TYR A N   1 
ATOM   616  C CA  . TYR A 1 83  ? -3.328  -21.273 1.676   1.00 29.03  ? 75  TYR A CA  1 
ATOM   617  C C   . TYR A 1 83  ? -2.957  -21.558 0.245   1.00 35.57  ? 75  TYR A C   1 
ATOM   618  O O   . TYR A 1 83  ? -2.419  -20.674 -0.435  1.00 35.52  ? 75  TYR A O   1 
ATOM   619  C CB  . TYR A 1 83  ? -4.848  -21.119 1.781   1.00 29.72  ? 75  TYR A CB  1 
ATOM   620  C CG  . TYR A 1 83  ? -5.346  -20.763 3.160   1.00 30.40  ? 75  TYR A CG  1 
ATOM   621  C CD1 . TYR A 1 83  ? -5.419  -21.724 4.168   1.00 30.75  ? 75  TYR A CD1 1 
ATOM   622  C CD2 . TYR A 1 83  ? -5.837  -19.492 3.432   1.00 31.57  ? 75  TYR A CD2 1 
ATOM   623  C CE1 . TYR A 1 83  ? -5.923  -21.415 5.426   1.00 30.04  ? 75  TYR A CE1 1 
ATOM   624  C CE2 . TYR A 1 83  ? -6.336  -19.165 4.691   1.00 32.86  ? 75  TYR A CE2 1 
ATOM   625  C CZ  . TYR A 1 83  ? -6.389  -20.136 5.685   1.00 37.64  ? 75  TYR A CZ  1 
ATOM   626  O OH  . TYR A 1 83  ? -6.919  -19.832 6.924   1.00 34.01  ? 75  TYR A OH  1 
ATOM   627  N N   . SER A 1 84  ? -3.259  -22.780 -0.227  1.00 33.88  ? 76  SER A N   1 
ATOM   628  C CA  . SER A 1 84  ? -2.951  -23.229 -1.584  1.00 34.49  ? 76  SER A CA  1 
ATOM   629  C C   . SER A 1 84  ? -3.550  -22.331 -2.669  1.00 38.69  ? 76  SER A C   1 
ATOM   630  O O   . SER A 1 84  ? -2.888  -22.100 -3.687  1.00 36.78  ? 76  SER A O   1 
ATOM   631  C CB  . SER A 1 84  ? -3.417  -24.664 -1.784  1.00 38.84  ? 76  SER A CB  1 
ATOM   632  O OG  . SER A 1 84  ? -2.768  -25.527 -0.863  1.00 55.23  ? 76  SER A OG  1 
ATOM   633  N N   . THR A 1 85  ? -4.788  -21.814 -2.430  1.00 34.53  ? 77  THR A N   1 
ATOM   634  C CA  . THR A 1 85  ? -5.532  -20.992 -3.389  1.00 33.33  ? 77  THR A CA  1 
ATOM   635  C C   . THR A 1 85  ? -5.420  -19.479 -3.232  1.00 34.49  ? 77  THR A C   1 
ATOM   636  O O   . THR A 1 85  ? -5.859  -18.741 -4.119  1.00 36.65  ? 77  THR A O   1 
ATOM   637  C CB  . THR A 1 85  ? -7.005  -21.398 -3.405  1.00 39.63  ? 77  THR A CB  1 
ATOM   638  O OG1 . THR A 1 85  ? -7.571  -21.149 -2.113  1.00 34.31  ? 77  THR A OG1 1 
ATOM   639  C CG2 . THR A 1 85  ? -7.207  -22.831 -3.859  1.00 35.51  ? 77  THR A CG2 1 
ATOM   640  N N   . GLY A 1 86  ? -4.904  -19.023 -2.106  1.00 27.69  ? 78  GLY A N   1 
ATOM   641  C CA  . GLY A 1 86  ? -4.783  -17.595 -1.839  1.00 27.05  ? 78  GLY A CA  1 
ATOM   642  C C   . GLY A 1 86  ? -4.348  -17.293 -0.418  1.00 33.37  ? 78  GLY A C   1 
ATOM   643  O O   . GLY A 1 86  ? -4.115  -18.214 0.377   1.00 33.54  ? 78  GLY A O   1 
ATOM   644  N N   . THR A 1 87  ? -4.253  -15.989 -0.089  1.00 30.50  ? 79  THR A N   1 
ATOM   645  C CA  . THR A 1 87  ? -3.760  -15.512 1.201   1.00 30.55  ? 79  THR A CA  1 
ATOM   646  C C   . THR A 1 87  ? -4.673  -14.452 1.795   1.00 37.79  ? 79  THR A C   1 
ATOM   647  O O   . THR A 1 87  ? -5.267  -13.650 1.058   1.00 36.78  ? 79  THR A O   1 
ATOM   648  C CB  . THR A 1 87  ? -2.348  -14.926 1.007   1.00 30.46  ? 79  THR A CB  1 
ATOM   649  O OG1 . THR A 1 87  ? -1.517  -15.929 0.415   1.00 30.38  ? 79  THR A OG1 1 
ATOM   650  C CG2 . THR A 1 87  ? -1.722  -14.388 2.306   1.00 25.57  ? 79  THR A CG2 1 
ATOM   651  N N   . VAL A 1 88  ? -4.764  -14.450 3.144   1.00 34.13  ? 80  VAL A N   1 
ATOM   652  C CA  . VAL A 1 88  ? -5.504  -13.459 3.911   1.00 33.18  ? 80  VAL A CA  1 
ATOM   653  C C   . VAL A 1 88  ? -4.589  -12.919 5.018   1.00 36.32  ? 80  VAL A C   1 
ATOM   654  O O   . VAL A 1 88  ? -3.703  -13.626 5.514   1.00 34.61  ? 80  VAL A O   1 
ATOM   655  C CB  . VAL A 1 88  ? -6.873  -13.950 4.470   1.00 36.33  ? 80  VAL A CB  1 
ATOM   656  C CG1 . VAL A 1 88  ? -7.887  -14.179 3.355   1.00 35.80  ? 80  VAL A CG1 1 
ATOM   657  C CG2 . VAL A 1 88  ? -6.716  -15.192 5.353   1.00 36.16  ? 80  VAL A CG2 1 
ATOM   658  N N   . SER A 1 89  ? -4.822  -11.664 5.398   1.00 33.16  ? 81  SER A N   1 
ATOM   659  C CA  . SER A 1 89  ? -4.101  -11.012 6.475   1.00 32.85  ? 81  SER A CA  1 
ATOM   660  C C   . SER A 1 89  ? -5.060  -10.257 7.341   1.00 36.85  ? 81  SER A C   1 
ATOM   661  O O   . SER A 1 89  ? -6.101  -9.779  6.874   1.00 38.10  ? 81  SER A O   1 
ATOM   662  C CB  . SER A 1 89  ? -3.031  -10.076 5.936   1.00 37.13  ? 81  SER A CB  1 
ATOM   663  O OG  . SER A 1 89  ? -1.909  -10.825 5.509   1.00 53.72  ? 81  SER A OG  1 
ATOM   664  N N   . GLY A 1 90  ? -4.709  -10.176 8.610   1.00 31.68  ? 82  GLY A N   1 
ATOM   665  C CA  . GLY A 1 90  ? -5.488  -9.476  9.613   1.00 30.51  ? 82  GLY A CA  1 
ATOM   666  C C   . GLY A 1 90  ? -4.730  -9.432  10.908  1.00 35.33  ? 82  GLY A C   1 
ATOM   667  O O   . GLY A 1 90  ? -3.491  -9.445  10.916  1.00 36.26  ? 82  GLY A O   1 
ATOM   668  N N   . PHE A 1 91  ? -5.469  -9.412  12.003  1.00 31.27  ? 83  PHE A N   1 
ATOM   669  C CA  . PHE A 1 91  ? -4.921  -9.368  13.365  1.00 29.79  ? 83  PHE A CA  1 
ATOM   670  C C   . PHE A 1 91  ? -5.758  -10.267 14.274  1.00 34.95  ? 83  PHE A C   1 
ATOM   671  O O   . PHE A 1 91  ? -6.903  -10.605 13.936  1.00 33.69  ? 83  PHE A O   1 
ATOM   672  C CB  . PHE A 1 91  ? -4.895  -7.915  13.901  1.00 30.01  ? 83  PHE A CB  1 
ATOM   673  C CG  . PHE A 1 91  ? -6.242  -7.228  13.875  1.00 29.73  ? 83  PHE A CG  1 
ATOM   674  C CD1 . PHE A 1 91  ? -7.108  -7.317  14.957  1.00 31.22  ? 83  PHE A CD1 1 
ATOM   675  C CD2 . PHE A 1 91  ? -6.659  -6.523  12.751  1.00 29.71  ? 83  PHE A CD2 1 
ATOM   676  C CE1 . PHE A 1 91  ? -8.358  -6.702  14.920  1.00 31.94  ? 83  PHE A CE1 1 
ATOM   677  C CE2 . PHE A 1 91  ? -7.920  -5.930  12.706  1.00 31.53  ? 83  PHE A CE2 1 
ATOM   678  C CZ  . PHE A 1 91  ? -8.760  -6.015  13.785  1.00 29.89  ? 83  PHE A CZ  1 
ATOM   679  N N   . LEU A 1 92  ? -5.194  -10.640 15.424  1.00 33.49  ? 84  LEU A N   1 
ATOM   680  C CA  . LEU A 1 92  ? -5.877  -11.487 16.398  1.00 34.23  ? 84  LEU A CA  1 
ATOM   681  C C   . LEU A 1 92  ? -6.876  -10.739 17.252  1.00 36.17  ? 84  LEU A C   1 
ATOM   682  O O   . LEU A 1 92  ? -6.692  -9.560  17.561  1.00 35.23  ? 84  LEU A O   1 
ATOM   683  C CB  . LEU A 1 92  ? -4.875  -12.240 17.289  1.00 35.00  ? 84  LEU A CB  1 
ATOM   684  C CG  . LEU A 1 92  ? -4.099  -13.378 16.623  1.00 40.36  ? 84  LEU A CG  1 
ATOM   685  C CD1 . LEU A 1 92  ? -3.036  -13.902 17.559  1.00 40.12  ? 84  LEU A CD1 1 
ATOM   686  C CD2 . LEU A 1 92  ? -5.041  -14.513 16.140  1.00 41.35  ? 84  LEU A CD2 1 
ATOM   687  N N   . SER A 1 93  ? -7.938  -11.443 17.635  1.00 33.32  ? 85  SER A N   1 
ATOM   688  C CA  . SER A 1 93  ? -9.018  -10.941 18.485  1.00 33.15  ? 85  SER A CA  1 
ATOM   689  C C   . SER A 1 93  ? -9.561  -12.099 19.304  1.00 37.08  ? 85  SER A C   1 
ATOM   690  O O   . SER A 1 93  ? -9.464  -13.247 18.871  1.00 38.01  ? 85  SER A O   1 
ATOM   691  C CB  . SER A 1 93  ? -10.140 -10.360 17.630  1.00 35.45  ? 85  SER A CB  1 
ATOM   692  O OG  . SER A 1 93  ? -9.891  -8.994  17.350  1.00 43.12  ? 85  SER A OG  1 
ATOM   693  N N   . GLN A 1 94  ? -10.126 -11.809 20.478  1.00 32.35  ? 86  GLN A N   1 
ATOM   694  C CA  . GLN A 1 94  ? -10.739 -12.832 21.308  1.00 32.66  ? 86  GLN A CA  1 
ATOM   695  C C   . GLN A 1 94  ? -12.210 -12.492 21.538  1.00 36.73  ? 86  GLN A C   1 
ATOM   696  O O   . GLN A 1 94  ? -12.570 -11.327 21.755  1.00 35.64  ? 86  GLN A O   1 
ATOM   697  C CB  . GLN A 1 94  ? -9.998  -13.010 22.648  1.00 34.28  ? 86  GLN A CB  1 
ATOM   698  C CG  . GLN A 1 94  ? -10.376 -14.302 23.390  1.00 40.51  ? 86  GLN A CG  1 
ATOM   699  C CD  . GLN A 1 94  ? -9.908  -14.290 24.821  1.00 55.96  ? 86  GLN A CD  1 
ATOM   700  O OE1 . GLN A 1 94  ? -8.875  -14.861 25.161  1.00 42.18  ? 86  GLN A OE1 1 
ATOM   701  N NE2 . GLN A 1 94  ? -10.672 -13.659 25.695  1.00 57.73  ? 86  GLN A NE2 1 
ATOM   702  N N   . ASP A 1 95  ? -13.054 -13.520 21.469  1.00 32.72  ? 87  ASP A N   1 
ATOM   703  C CA  . ASP A 1 95  ? -14.477 -13.408 21.708  1.00 31.96  ? 87  ASP A CA  1 
ATOM   704  C C   . ASP A 1 95  ? -15.069 -14.786 21.934  1.00 37.48  ? 87  ASP A C   1 
ATOM   705  O O   . ASP A 1 95  ? -14.352 -15.787 21.867  1.00 35.95  ? 87  ASP A O   1 
ATOM   706  C CB  . ASP A 1 95  ? -15.190 -12.657 20.565  1.00 33.03  ? 87  ASP A CB  1 
ATOM   707  C CG  . ASP A 1 95  ? -16.337 -11.785 21.035  1.00 38.04  ? 87  ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 95  ? -17.036 -12.188 21.998  1.00 39.73  ? 87  ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 95  ? -16.547 -10.703 20.435  1.00 33.67  ? 87  ASP A OD2 1 
ATOM   710  N N   . ILE A 1 96  ? -16.372 -14.819 22.244  1.00 36.35  ? 88  ILE A N   1 
ATOM   711  C CA  . ILE A 1 96  ? -17.166 -16.001 22.505  1.00 37.64  ? 88  ILE A CA  1 
ATOM   712  C C   . ILE A 1 96  ? -17.737 -16.525 21.175  1.00 42.71  ? 88  ILE A C   1 
ATOM   713  O O   . ILE A 1 96  ? -18.448 -15.794 20.477  1.00 43.16  ? 88  ILE A O   1 
ATOM   714  C CB  . ILE A 1 96  ? -18.262 -15.597 23.545  1.00 41.86  ? 88  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 96  ? -17.664 -15.548 24.967  1.00 42.98  ? 88  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 96  ? -19.514 -16.497 23.477  1.00 43.64  ? 88  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 96  ? -18.570 -14.852 26.010  1.00 58.36  ? 88  ILE A CD1 1 
ATOM   718  N N   . ILE A 1 97  ? -17.424 -17.780 20.832  1.00 39.31  ? 89  ILE A N   1 
ATOM   719  C CA  . ILE A 1 97  ? -17.929 -18.427 19.617  1.00 39.04  ? 89  ILE A CA  1 
ATOM   720  C C   . ILE A 1 97  ? -18.946 -19.515 19.955  1.00 43.98  ? 89  ILE A C   1 
ATOM   721  O O   . ILE A 1 97  ? -18.698 -20.312 20.842  1.00 44.14  ? 89  ILE A O   1 
ATOM   722  C CB  . ILE A 1 97  ? -16.787 -18.925 18.678  1.00 41.15  ? 89  ILE A CB  1 
ATOM   723  C CG1 . ILE A 1 97  ? -15.884 -17.737 18.239  1.00 40.78  ? 89  ILE A CG1 1 
ATOM   724  C CG2 . ILE A 1 97  ? -17.351 -19.691 17.463  1.00 40.55  ? 89  ILE A CG2 1 
ATOM   725  C CD1 . ILE A 1 97  ? -14.742 -18.068 17.262  1.00 44.22  ? 89  ILE A CD1 1 
ATOM   726  N N   . THR A 1 98  ? -20.087 -19.534 19.260  1.00 42.44  ? 90  THR A N   1 
ATOM   727  C CA  . THR A 1 98  ? -21.130 -20.544 19.431  1.00 43.36  ? 90  THR A CA  1 
ATOM   728  C C   . THR A 1 98  ? -21.131 -21.461 18.218  1.00 48.60  ? 90  THR A C   1 
ATOM   729  O O   . THR A 1 98  ? -21.323 -20.983 17.099  1.00 48.46  ? 90  THR A O   1 
ATOM   730  C CB  . THR A 1 98  ? -22.515 -19.913 19.642  1.00 54.56  ? 90  THR A CB  1 
ATOM   731  O OG1 . THR A 1 98  ? -22.418 -18.801 20.541  1.00 55.96  ? 90  THR A OG1 1 
ATOM   732  C CG2 . THR A 1 98  ? -23.533 -20.926 20.172  1.00 53.32  ? 90  THR A CG2 1 
ATOM   733  N N   . VAL A 1 99  ? -20.878 -22.771 18.446  1.00 45.52  ? 91  VAL A N   1 
ATOM   734  C CA  . VAL A 1 99  ? -20.874 -23.828 17.432  1.00 45.32  ? 91  VAL A CA  1 
ATOM   735  C C   . VAL A 1 99  ? -21.870 -24.901 17.878  1.00 52.28  ? 91  VAL A C   1 
ATOM   736  O O   . VAL A 1 99  ? -21.573 -25.690 18.776  1.00 52.52  ? 91  VAL A O   1 
ATOM   737  C CB  . VAL A 1 99  ? -19.479 -24.462 17.159  1.00 48.76  ? 91  VAL A CB  1 
ATOM   738  C CG1 . VAL A 1 99  ? -19.383 -24.970 15.722  1.00 48.43  ? 91  VAL A CG1 1 
ATOM   739  C CG2 . VAL A 1 99  ? -18.336 -23.510 17.473  1.00 48.07  ? 91  VAL A CG2 1 
ATOM   740  N N   . GLY A 1 100 ? -23.053 -24.873 17.284  1.00 51.40  ? 92  GLY A N   1 
ATOM   741  C CA  . GLY A 1 100 ? -24.145 -25.811 17.536  1.00 51.77  ? 92  GLY A CA  1 
ATOM   742  C C   . GLY A 1 100 ? -24.416 -26.180 18.976  1.00 56.53  ? 92  GLY A C   1 
ATOM   743  O O   . GLY A 1 100 ? -24.474 -27.366 19.304  1.00 56.43  ? 92  GLY A O   1 
ATOM   744  N N   . GLY A 1 101 ? -24.590 -25.177 19.832  1.00 52.85  ? 93  GLY A N   1 
ATOM   745  C CA  . GLY A 1 101 ? -24.879 -25.407 21.243  1.00 52.27  ? 93  GLY A CA  1 
ATOM   746  C C   . GLY A 1 101 ? -23.681 -25.293 22.163  1.00 55.64  ? 93  GLY A C   1 
ATOM   747  O O   . GLY A 1 101 ? -23.842 -25.021 23.361  1.00 56.60  ? 93  GLY A O   1 
ATOM   748  N N   . ILE A 1 102 ? -22.473 -25.527 21.628  1.00 49.33  ? 94  ILE A N   1 
ATOM   749  C CA  . ILE A 1 102 ? -21.260 -25.374 22.428  1.00 47.60  ? 94  ILE A CA  1 
ATOM   750  C C   . ILE A 1 102 ? -20.794 -23.916 22.323  1.00 50.42  ? 94  ILE A C   1 
ATOM   751  O O   . ILE A 1 102 ? -20.761 -23.357 21.230  1.00 50.67  ? 94  ILE A O   1 
ATOM   752  C CB  . ILE A 1 102 ? -20.166 -26.404 22.060  1.00 49.68  ? 94  ILE A CB  1 
ATOM   753  C CG1 . ILE A 1 102 ? -20.641 -27.841 22.351  1.00 49.57  ? 94  ILE A CG1 1 
ATOM   754  C CG2 . ILE A 1 102 ? -18.880 -26.125 22.828  1.00 49.19  ? 94  ILE A CG2 1 
ATOM   755  C CD1 . ILE A 1 102 ? -19.811 -28.949 21.678  1.00 58.11  ? 94  ILE A CD1 1 
ATOM   756  N N   . THR A 1 103 ? -20.493 -23.299 23.460  1.00 46.46  ? 95  THR A N   1 
ATOM   757  C CA  . THR A 1 103 ? -20.005 -21.923 23.552  1.00 45.89  ? 95  THR A CA  1 
ATOM   758  C C   . THR A 1 103 ? -18.550 -22.001 24.005  1.00 49.71  ? 95  THR A C   1 
ATOM   759  O O   . THR A 1 103 ? -18.264 -22.701 24.973  1.00 51.38  ? 95  THR A O   1 
ATOM   760  C CB  . THR A 1 103 ? -20.905 -21.085 24.465  1.00 54.27  ? 95  THR A CB  1 
ATOM   761  O OG1 . THR A 1 103 ? -22.243 -21.152 24.002  1.00 58.55  ? 95  THR A OG1 1 
ATOM   762  C CG2 . THR A 1 103 ? -20.496 -19.655 24.512  1.00 54.48  ? 95  THR A CG2 1 
ATOM   763  N N   . VAL A 1 104 ? -17.632 -21.344 23.277  1.00 43.38  ? 96  VAL A N   1 
ATOM   764  C CA  . VAL A 1 104 ? -16.197 -21.334 23.563  1.00 42.65  ? 96  VAL A CA  1 
ATOM   765  C C   . VAL A 1 104 ? -15.632 -19.932 23.505  1.00 46.12  ? 96  VAL A C   1 
ATOM   766  O O   . VAL A 1 104 ? -15.980 -19.172 22.619  1.00 45.57  ? 96  VAL A O   1 
ATOM   767  C CB  . VAL A 1 104 ? -15.351 -22.247 22.615  1.00 46.85  ? 96  VAL A CB  1 
ATOM   768  C CG1 . VAL A 1 104 ? -15.162 -23.638 23.179  1.00 46.99  ? 96  VAL A CG1 1 
ATOM   769  C CG2 . VAL A 1 104 ? -15.894 -22.290 21.185  1.00 46.34  ? 96  VAL A CG2 1 
ATOM   770  N N   . THR A 1 105 ? -14.699 -19.618 24.402  1.00 43.33  ? 97  THR A N   1 
ATOM   771  C CA  . THR A 1 105 ? -13.940 -18.369 24.361  1.00 42.52  ? 97  THR A CA  1 
ATOM   772  C C   . THR A 1 105 ? -12.802 -18.723 23.406  1.00 45.48  ? 97  THR A C   1 
ATOM   773  O O   . THR A 1 105 ? -12.036 -19.659 23.677  1.00 44.92  ? 97  THR A O   1 
ATOM   774  C CB  . THR A 1 105 ? -13.497 -17.941 25.760  1.00 46.54  ? 97  THR A CB  1 
ATOM   775  O OG1 . THR A 1 105 ? -14.670 -17.733 26.553  1.00 53.25  ? 97  THR A OG1 1 
ATOM   776  C CG2 . THR A 1 105 ? -12.672 -16.672 25.742  1.00 40.87  ? 97  THR A CG2 1 
ATOM   777  N N   . GLN A 1 106 ? -12.769 -18.050 22.244  1.00 40.49  ? 99  GLN A N   1 
ATOM   778  C CA  . GLN A 1 106 ? -11.822 -18.366 21.182  1.00 39.83  ? 99  GLN A CA  1 
ATOM   779  C C   . GLN A 1 106 ? -11.056 -17.173 20.629  1.00 42.11  ? 99  GLN A C   1 
ATOM   780  O O   . GLN A 1 106 ? -11.600 -16.071 20.493  1.00 40.62  ? 99  GLN A O   1 
ATOM   781  C CB  . GLN A 1 106 ? -12.568 -19.112 20.052  1.00 41.15  ? 99  GLN A CB  1 
ATOM   782  C CG  . GLN A 1 106 ? -11.733 -19.640 18.874  1.00 44.81  ? 99  GLN A CG  1 
ATOM   783  C CD  . GLN A 1 106 ? -10.736 -20.706 19.238  1.00 51.69  ? 99  GLN A CD  1 
ATOM   784  O OE1 . GLN A 1 106 ? -9.622  -20.735 18.728  1.00 51.49  ? 99  GLN A OE1 1 
ATOM   785  N NE2 . GLN A 1 106 ? -11.096 -21.595 20.131  1.00 36.66  ? 99  GLN A NE2 1 
ATOM   786  N N   . MET A 1 107 ? -9.784  -17.427 20.297  1.00 39.22  ? 100 MET A N   1 
ATOM   787  C CA  . MET A 1 107 ? -8.882  -16.488 19.635  1.00 39.90  ? 100 MET A CA  1 
ATOM   788  C C   . MET A 1 107 ? -9.029  -16.755 18.134  1.00 39.07  ? 100 MET A C   1 
ATOM   789  O O   . MET A 1 107 ? -8.879  -17.895 17.675  1.00 37.40  ? 100 MET A O   1 
ATOM   790  C CB  . MET A 1 107 ? -7.439  -16.716 20.076  1.00 43.71  ? 100 MET A CB  1 
ATOM   791  C CG  . MET A 1 107 ? -7.042  -15.940 21.284  1.00 50.28  ? 100 MET A CG  1 
ATOM   792  S SD  . MET A 1 107 ? -6.359  -14.331 20.810  1.00 57.65  ? 100 MET A SD  1 
ATOM   793  C CE  . MET A 1 107 ? -5.485  -13.947 22.282  1.00 54.99  ? 100 MET A CE  1 
ATOM   794  N N   . PHE A 1 108 ? -9.404  -15.723 17.392  1.00 33.04  ? 101 PHE A N   1 
ATOM   795  C CA  . PHE A 1 108 ? -9.620  -15.811 15.947  1.00 31.59  ? 101 PHE A CA  1 
ATOM   796  C C   . PHE A 1 108 ? -9.014  -14.608 15.203  1.00 34.00  ? 101 PHE A C   1 
ATOM   797  O O   . PHE A 1 108 ? -8.717  -13.578 15.814  1.00 33.09  ? 101 PHE A O   1 
ATOM   798  C CB  . PHE A 1 108 ? -11.129 -15.961 15.652  1.00 32.50  ? 101 PHE A CB  1 
ATOM   799  C CG  . PHE A 1 108 ? -11.953 -14.752 16.013  1.00 32.58  ? 101 PHE A CG  1 
ATOM   800  C CD1 . PHE A 1 108 ? -12.381 -14.547 17.316  1.00 33.27  ? 101 PHE A CD1 1 
ATOM   801  C CD2 . PHE A 1 108 ? -12.299 -13.813 15.047  1.00 34.20  ? 101 PHE A CD2 1 
ATOM   802  C CE1 . PHE A 1 108 ? -13.112 -13.405 17.658  1.00 33.97  ? 101 PHE A CE1 1 
ATOM   803  C CE2 . PHE A 1 108 ? -13.028 -12.672 15.391  1.00 36.34  ? 101 PHE A CE2 1 
ATOM   804  C CZ  . PHE A 1 108 ? -13.434 -12.482 16.696  1.00 33.98  ? 101 PHE A CZ  1 
ATOM   805  N N   . GLY A 1 109 ? -8.845  -14.758 13.898  1.00 31.51  ? 102 GLY A N   1 
ATOM   806  C CA  . GLY A 1 109 ? -8.318  -13.704 13.035  1.00 30.90  ? 102 GLY A CA  1 
ATOM   807  C C   . GLY A 1 109 ? -9.416  -12.809 12.493  1.00 34.86  ? 102 GLY A C   1 
ATOM   808  O O   . GLY A 1 109 ? -10.464 -13.284 12.042  1.00 33.67  ? 102 GLY A O   1 
ATOM   809  N N   . GLU A 1 110 ? -9.197  -11.495 12.569  1.00 32.27  ? 103 GLU A N   1 
ATOM   810  C CA  . GLU A 1 110 ? -10.103 -10.502 11.994  1.00 31.79  ? 103 GLU A CA  1 
ATOM   811  C C   . GLU A 1 110 ? -9.423  -10.131 10.682  1.00 34.81  ? 103 GLU A C   1 
ATOM   812  O O   . GLU A 1 110 ? -8.393  -9.475  10.710  1.00 35.30  ? 103 GLU A O   1 
ATOM   813  C CB  . GLU A 1 110 ? -10.224 -9.287  12.926  1.00 33.10  ? 103 GLU A CB  1 
ATOM   814  C CG  . GLU A 1 110 ? -11.589 -9.180  13.577  1.00 43.69  ? 103 GLU A CG  1 
ATOM   815  C CD  . GLU A 1 110 ? -11.763 -7.943  14.430  1.00 53.66  ? 103 GLU A CD  1 
ATOM   816  O OE1 . GLU A 1 110 ? -12.325 -6.946  13.926  1.00 33.99  ? 103 GLU A OE1 1 
ATOM   817  O OE2 . GLU A 1 110 ? -11.336 -7.969  15.605  1.00 45.41  ? 103 GLU A OE2 1 
ATOM   818  N N   . VAL A 1 111 ? -9.913  -10.658 9.552   1.00 30.37  ? 104 VAL A N   1 
ATOM   819  C CA  . VAL A 1 111 ? -9.293  -10.439 8.237   1.00 29.36  ? 104 VAL A CA  1 
ATOM   820  C C   . VAL A 1 111 ? -9.527  -9.033  7.675   1.00 33.06  ? 104 VAL A C   1 
ATOM   821  O O   . VAL A 1 111 ? -10.677 -8.594  7.540   1.00 32.18  ? 104 VAL A O   1 
ATOM   822  C CB  . VAL A 1 111 ? -9.588  -11.600 7.248   1.00 32.61  ? 104 VAL A CB  1 
ATOM   823  C CG1 . VAL A 1 111 ? -9.309  -11.214 5.801   1.00 32.47  ? 104 VAL A CG1 1 
ATOM   824  C CG2 . VAL A 1 111 ? -8.802  -12.846 7.639   1.00 32.23  ? 104 VAL A CG2 1 
ATOM   825  N N   . THR A 1 112 ? -8.423  -8.323  7.374   1.00 29.14  ? 105 THR A N   1 
ATOM   826  C CA  . THR A 1 112 ? -8.456  -6.958  6.827   1.00 29.06  ? 105 THR A CA  1 
ATOM   827  C C   . THR A 1 112 ? -7.995  -6.886  5.362   1.00 33.80  ? 105 THR A C   1 
ATOM   828  O O   . THR A 1 112 ? -8.204  -5.871  4.695   1.00 33.41  ? 105 THR A O   1 
ATOM   829  C CB  . THR A 1 112 ? -7.700  -5.976  7.727   1.00 33.05  ? 105 THR A CB  1 
ATOM   830  O OG1 . THR A 1 112 ? -6.340  -6.392  7.793   1.00 41.04  ? 105 THR A OG1 1 
ATOM   831  C CG2 . THR A 1 112 ? -8.293  -5.896  9.137   1.00 28.27  ? 105 THR A CG2 1 
ATOM   832  N N   . GLU A 1 113 ? -7.358  -7.954  4.868   1.00 30.68  ? 106 GLU A N   1 
ATOM   833  C CA  . GLU A 1 113 ? -6.874  -8.035  3.492   1.00 30.83  ? 106 GLU A CA  1 
ATOM   834  C C   . GLU A 1 113 ? -7.335  -9.364  2.978   1.00 35.14  ? 106 GLU A C   1 
ATOM   835  O O   . GLU A 1 113 ? -6.921  -10.413 3.486   1.00 33.77  ? 106 GLU A O   1 
ATOM   836  C CB  . GLU A 1 113 ? -5.345  -7.866  3.398   1.00 31.97  ? 106 GLU A CB  1 
ATOM   837  C CG  . GLU A 1 113 ? -4.896  -6.438  3.689   1.00 40.32  ? 106 GLU A CG  1 
ATOM   838  C CD  . GLU A 1 113 ? -3.417  -6.229  3.947   1.00 71.41  ? 106 GLU A CD  1 
ATOM   839  O OE1 . GLU A 1 113 ? -2.794  -7.083  4.616   1.00 67.00  ? 106 GLU A OE1 1 
ATOM   840  O OE2 . GLU A 1 113 ? -2.887  -5.180  3.517   1.00 82.70  ? 106 GLU A OE2 1 
ATOM   841  N N   . MET A 1 114 ? -8.252  -9.306  2.007   1.00 33.25  ? 107 MET A N   1 
ATOM   842  C CA  . MET A 1 114 ? -8.935  -10.460 1.448   1.00 34.68  ? 107 MET A CA  1 
ATOM   843  C C   . MET A 1 114 ? -9.054  -10.323 -0.089  1.00 40.27  ? 107 MET A C   1 
ATOM   844  O O   . MET A 1 114 ? -9.948  -9.607  -0.553  1.00 40.27  ? 107 MET A O   1 
ATOM   845  C CB  . MET A 1 114 ? -10.322 -10.542 2.128   1.00 36.72  ? 107 MET A CB  1 
ATOM   846  C CG  . MET A 1 114 ? -11.039 -11.852 1.973   1.00 40.35  ? 107 MET A CG  1 
ATOM   847  S SD  . MET A 1 114 ? -12.601 -11.674 2.834   1.00 44.54  ? 107 MET A SD  1 
ATOM   848  C CE  . MET A 1 114 ? -13.403 -13.100 2.352   1.00 41.52  ? 107 MET A CE  1 
ATOM   849  N N   . PRO A 1 115 ? -8.170  -10.988 -0.889  1.00 36.94  ? 108 PRO A N   1 
ATOM   850  C CA  . PRO A 1 115 ? -8.259  -10.851 -2.363  1.00 36.19  ? 108 PRO A CA  1 
ATOM   851  C C   . PRO A 1 115 ? -9.522  -11.419 -2.980  1.00 37.75  ? 108 PRO A C   1 
ATOM   852  O O   . PRO A 1 115 ? -10.047 -12.424 -2.511  1.00 36.11  ? 108 PRO A O   1 
ATOM   853  C CB  . PRO A 1 115 ? -7.008  -11.563 -2.885  1.00 37.51  ? 108 PRO A CB  1 
ATOM   854  C CG  . PRO A 1 115 ? -6.600  -12.466 -1.809  1.00 42.47  ? 108 PRO A CG  1 
ATOM   855  C CD  . PRO A 1 115 ? -7.025  -11.833 -0.503  1.00 37.99  ? 108 PRO A CD  1 
ATOM   856  N N   . ALA A 1 116 ? -9.995  -10.751 -4.045  1.00 35.44  ? 109 ALA A N   1 
ATOM   857  C CA  . ALA A 1 116 ? -11.173 -11.109 -4.845  1.00 35.28  ? 109 ALA A CA  1 
ATOM   858  C C   . ALA A 1 116 ? -11.030 -12.509 -5.419  1.00 37.59  ? 109 ALA A C   1 
ATOM   859  O O   . ALA A 1 116 ? -12.009 -13.235 -5.548  1.00 37.10  ? 109 ALA A O   1 
ATOM   860  C CB  . ALA A 1 116 ? -11.350 -10.096 -5.959  1.00 36.17  ? 109 ALA A CB  1 
ATOM   861  N N   . LEU A 1 117 ? -9.798  -12.885 -5.746  1.00 34.80  ? 110 LEU A N   1 
ATOM   862  C CA  . LEU A 1 117 ? -9.472  -14.210 -6.204  1.00 35.39  ? 110 LEU A CA  1 
ATOM   863  C C   . LEU A 1 117 ? -8.684  -14.907 -5.119  1.00 36.29  ? 110 LEU A C   1 
ATOM   864  O O   . LEU A 1 117 ? -7.618  -14.441 -4.772  1.00 36.51  ? 110 LEU A O   1 
ATOM   865  C CB  . LEU A 1 117 ? -8.736  -14.172 -7.537  1.00 36.54  ? 110 LEU A CB  1 
ATOM   866  C CG  . LEU A 1 117 ? -9.683  -13.986 -8.720  1.00 42.93  ? 110 LEU A CG  1 
ATOM   867  C CD1 . LEU A 1 117 ? -9.111  -13.033 -9.752  1.00 42.42  ? 110 LEU A CD1 1 
ATOM   868  C CD2 . LEU A 1 117 ? -10.078 -15.326 -9.309  1.00 50.14  ? 110 LEU A CD2 1 
ATOM   869  N N   . PRO A 1 118 ? -9.252  -15.917 -4.445  1.00 31.84  ? 111 PRO A N   1 
ATOM   870  C CA  . PRO A 1 118 ? -10.516 -16.601 -4.763  1.00 31.75  ? 111 PRO A CA  1 
ATOM   871  C C   . PRO A 1 118 ? -11.751 -16.210 -3.945  1.00 36.05  ? 111 PRO A C   1 
ATOM   872  O O   . PRO A 1 118 ? -12.830 -16.743 -4.208  1.00 34.88  ? 111 PRO A O   1 
ATOM   873  C CB  . PRO A 1 118 ? -10.150 -18.070 -4.473  1.00 32.74  ? 111 PRO A CB  1 
ATOM   874  C CG  . PRO A 1 118 ? -9.241  -17.971 -3.261  1.00 36.81  ? 111 PRO A CG  1 
ATOM   875  C CD  . PRO A 1 118 ? -8.505  -16.645 -3.391  1.00 33.06  ? 111 PRO A CD  1 
ATOM   876  N N   . PHE A 1 119 ? -11.593 -15.344 -2.939  1.00 33.09  ? 112 PHE A N   1 
ATOM   877  C CA  . PHE A 1 119 ? -12.634 -15.052 -1.950  1.00 32.90  ? 112 PHE A CA  1 
ATOM   878  C C   . PHE A 1 119 ? -13.954 -14.485 -2.401  1.00 40.56  ? 112 PHE A C   1 
ATOM   879  O O   . PHE A 1 119 ? -14.951 -14.693 -1.719  1.00 40.48  ? 112 PHE A O   1 
ATOM   880  C CB  . PHE A 1 119 ? -12.065 -14.415 -0.686  1.00 33.53  ? 112 PHE A CB  1 
ATOM   881  C CG  . PHE A 1 119 ? -11.029 -15.313 -0.064  1.00 33.40  ? 112 PHE A CG  1 
ATOM   882  C CD1 . PHE A 1 119 ? -11.405 -16.451 0.642   1.00 35.16  ? 112 PHE A CD1 1 
ATOM   883  C CD2 . PHE A 1 119 ? -9.674  -15.062 -0.240  1.00 35.37  ? 112 PHE A CD2 1 
ATOM   884  C CE1 . PHE A 1 119 ? -10.444 -17.301 1.203   1.00 35.95  ? 112 PHE A CE1 1 
ATOM   885  C CE2 . PHE A 1 119 ? -8.716  -15.914 0.320   1.00 38.04  ? 112 PHE A CE2 1 
ATOM   886  C CZ  . PHE A 1 119 ? -9.110  -17.027 1.046   1.00 35.55  ? 112 PHE A CZ  1 
ATOM   887  N N   . MET A 1 120 ? -14.008 -13.903 -3.592  1.00 40.32  ? 113 MET A N   1 
ATOM   888  C CA  . MET A 1 120 ? -15.270 -13.433 -4.154  1.00 41.10  ? 113 MET A CA  1 
ATOM   889  C C   . MET A 1 120 ? -16.129 -14.621 -4.633  1.00 45.60  ? 113 MET A C   1 
ATOM   890  O O   . MET A 1 120 ? -17.345 -14.486 -4.749  1.00 46.29  ? 113 MET A O   1 
ATOM   891  C CB  . MET A 1 120 ? -15.009 -12.435 -5.275  1.00 44.08  ? 113 MET A CB  1 
ATOM   892  C CG  . MET A 1 120 ? -14.878 -11.036 -4.769  1.00 49.15  ? 113 MET A CG  1 
ATOM   893  S SD  . MET A 1 120 ? -16.474 -10.248 -4.741  1.00 54.75  ? 113 MET A SD  1 
ATOM   894  C CE  . MET A 1 120 ? -16.669 -9.931  -6.502  1.00 50.56  ? 113 MET A CE  1 
ATOM   895  N N   . LEU A 1 121 ? -15.487 -15.778 -4.890  1.00 41.20  ? 114 LEU A N   1 
ATOM   896  C CA  . LEU A 1 121 ? -16.137 -17.015 -5.324  1.00 41.19  ? 114 LEU A CA  1 
ATOM   897  C C   . LEU A 1 121 ? -16.659 -17.831 -4.145  1.00 43.66  ? 114 LEU A C   1 
ATOM   898  O O   . LEU A 1 121 ? -17.422 -18.776 -4.342  1.00 43.76  ? 114 LEU A O   1 
ATOM   899  C CB  . LEU A 1 121 ? -15.165 -17.864 -6.140  1.00 41.89  ? 114 LEU A CB  1 
ATOM   900  C CG  . LEU A 1 121 ? -14.571 -17.191 -7.395  1.00 47.20  ? 114 LEU A CG  1 
ATOM   901  C CD1 . LEU A 1 121 ? -13.683 -18.175 -8.161  1.00 48.41  ? 114 LEU A CD1 1 
ATOM   902  C CD2 . LEU A 1 121 ? -15.671 -16.650 -8.292  1.00 44.22  ? 114 LEU A CD2 1 
ATOM   903  N N   . ALA A 1 122 ? -16.227 -17.479 -2.919  1.00 37.59  ? 115 ALA A N   1 
ATOM   904  C CA  . ALA A 1 122 ? -16.623 -18.136 -1.687  1.00 35.54  ? 115 ALA A CA  1 
ATOM   905  C C   . ALA A 1 122 ? -18.017 -17.725 -1.287  1.00 37.39  ? 115 ALA A C   1 
ATOM   906  O O   . ALA A 1 122 ? -18.324 -16.533 -1.235  1.00 37.78  ? 115 ALA A O   1 
ATOM   907  C CB  . ALA A 1 122 ? -15.645 -17.789 -0.570  1.00 35.89  ? 115 ALA A CB  1 
ATOM   908  N N   . GLU A 1 123 ? -18.860 -18.706 -0.990  1.00 33.56  ? 116 GLU A N   1 
ATOM   909  C CA  . GLU A 1 123 ? -20.200 -18.475 -0.462  1.00 34.30  ? 116 GLU A CA  1 
ATOM   910  C C   . GLU A 1 123 ? -20.066 -18.291 1.041   1.00 37.41  ? 116 GLU A C   1 
ATOM   911  O O   . GLU A 1 123 ? -20.836 -17.555 1.653   1.00 39.35  ? 116 GLU A O   1 
ATOM   912  C CB  . GLU A 1 123 ? -21.165 -19.628 -0.818  1.00 36.21  ? 116 GLU A CB  1 
ATOM   913  C CG  . GLU A 1 123 ? -21.864 -19.425 -2.154  1.00 51.17  ? 116 GLU A CG  1 
ATOM   914  C CD  . GLU A 1 123 ? -22.756 -18.198 -2.190  1.00 72.24  ? 116 GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 123 ? -23.561 -18.016 -1.246  1.00 70.21  ? 116 GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 123 ? -22.601 -17.382 -3.127  1.00 66.12  ? 116 GLU A OE2 1 
ATOM   917  N N   . PHE A 1 124 ? -19.053 -18.933 1.623   1.00 30.94  ? 117 PHE A N   1 
ATOM   918  C CA  . PHE A 1 124 ? -18.732 -18.810 3.038   1.00 29.71  ? 117 PHE A CA  1 
ATOM   919  C C   . PHE A 1 124 ? -18.020 -17.450 3.299   1.00 32.76  ? 117 PHE A C   1 
ATOM   920  O O   . PHE A 1 124 ? -17.360 -16.900 2.407   1.00 30.97  ? 117 PHE A O   1 
ATOM   921  C CB  . PHE A 1 124 ? -17.855 -20.003 3.482   1.00 30.35  ? 117 PHE A CB  1 
ATOM   922  C CG  . PHE A 1 124 ? -16.553 -20.159 2.724   1.00 31.16  ? 117 PHE A CG  1 
ATOM   923  C CD1 . PHE A 1 124 ? -16.492 -20.919 1.559   1.00 34.64  ? 117 PHE A CD1 1 
ATOM   924  C CD2 . PHE A 1 124 ? -15.384 -19.566 3.185   1.00 31.67  ? 117 PHE A CD2 1 
ATOM   925  C CE1 . PHE A 1 124 ? -15.279 -21.092 0.879   1.00 34.75  ? 117 PHE A CE1 1 
ATOM   926  C CE2 . PHE A 1 124 ? -14.183 -19.704 2.484   1.00 34.32  ? 117 PHE A CE2 1 
ATOM   927  C CZ  . PHE A 1 124 ? -14.133 -20.484 1.347   1.00 33.01  ? 117 PHE A CZ  1 
ATOM   928  N N   . ASP A 1 125 ? -18.152 -16.934 4.523   1.00 30.27  ? 118 ASP A N   1 
ATOM   929  C CA  . ASP A 1 125 ? -17.525 -15.680 4.961   1.00 29.93  ? 118 ASP A CA  1 
ATOM   930  C C   . ASP A 1 125 ? -16.157 -15.975 5.553   1.00 32.88  ? 118 ASP A C   1 
ATOM   931  O O   . ASP A 1 125 ? -15.189 -15.266 5.263   1.00 33.01  ? 118 ASP A O   1 
ATOM   932  C CB  . ASP A 1 125 ? -18.387 -14.948 6.013   1.00 30.68  ? 118 ASP A CB  1 
ATOM   933  C CG  . ASP A 1 125 ? -19.797 -14.688 5.567   1.00 33.06  ? 118 ASP A CG  1 
ATOM   934  O OD1 . ASP A 1 125 ? -19.970 -14.046 4.515   1.00 30.43  ? 118 ASP A OD1 1 
ATOM   935  O OD2 . ASP A 1 125 ? -20.735 -15.135 6.272   1.00 38.94  ? 118 ASP A OD2 1 
ATOM   936  N N   . GLY A 1 126 ? -16.093 -17.000 6.387   1.00 28.03  ? 119 GLY A N   1 
ATOM   937  C CA  . GLY A 1 126 ? -14.857 -17.370 7.051   1.00 28.30  ? 119 GLY A CA  1 
ATOM   938  C C   . GLY A 1 126 ? -14.560 -18.846 7.051   1.00 34.50  ? 119 GLY A C   1 
ATOM   939  O O   . GLY A 1 126 ? -15.232 -19.640 6.387   1.00 34.63  ? 119 GLY A O   1 
ATOM   940  N N   . VAL A 1 127 ? -13.539 -19.210 7.831   1.00 32.58  ? 120 VAL A N   1 
ATOM   941  C CA  . VAL A 1 127 ? -13.017 -20.557 7.967   1.00 31.99  ? 120 VAL A CA  1 
ATOM   942  C C   . VAL A 1 127 ? -12.874 -20.927 9.447   1.00 36.31  ? 120 VAL A C   1 
ATOM   943  O O   . VAL A 1 127 ? -12.507 -20.081 10.260  1.00 34.82  ? 120 VAL A O   1 
ATOM   944  C CB  . VAL A 1 127 ? -11.664 -20.640 7.205   1.00 35.37  ? 120 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 127 ? -10.885 -21.922 7.536   1.00 34.57  ? 120 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 127 ? -11.893 -20.520 5.696   1.00 35.19  ? 120 VAL A CG2 1 
ATOM   947  N N   . VAL A 1 128 ? -13.187 -22.198 9.782   1.00 33.22  ? 121 VAL A N   1 
ATOM   948  C CA  . VAL A 1 128 ? -13.001 -22.772 11.107  1.00 32.84  ? 121 VAL A CA  1 
ATOM   949  C C   . VAL A 1 128 ? -12.016 -23.940 10.888  1.00 38.34  ? 121 VAL A C   1 
ATOM   950  O O   . VAL A 1 128 ? -12.381 -24.966 10.306  1.00 39.79  ? 121 VAL A O   1 
ATOM   951  C CB  . VAL A 1 128 ? -14.327 -23.200 11.817  1.00 35.80  ? 121 VAL A CB  1 
ATOM   952  C CG1 . VAL A 1 128 ? -14.042 -24.028 13.065  1.00 35.15  ? 121 VAL A CG1 1 
ATOM   953  C CG2 . VAL A 1 128 ? -15.174 -21.989 12.185  1.00 35.29  ? 121 VAL A CG2 1 
ATOM   954  N N   . GLY A 1 129 ? -10.765 -23.728 11.265  1.00 33.07  ? 122 GLY A N   1 
ATOM   955  C CA  . GLY A 1 129 ? -9.736  -24.738 11.122  1.00 33.14  ? 122 GLY A CA  1 
ATOM   956  C C   . GLY A 1 129 ? -9.886  -25.844 12.146  1.00 37.17  ? 122 GLY A C   1 
ATOM   957  O O   . GLY A 1 129 ? -9.965  -25.569 13.343  1.00 37.63  ? 122 GLY A O   1 
ATOM   958  N N   . MET A 1 130 ? -9.923  -27.091 11.672  1.00 33.42  ? 123 MET A N   1 
ATOM   959  C CA  . MET A 1 130 ? -10.136 -28.328 12.425  1.00 34.15  ? 123 MET A CA  1 
ATOM   960  C C   . MET A 1 130 ? -8.849  -29.127 12.537  1.00 38.61  ? 123 MET A C   1 
ATOM   961  O O   . MET A 1 130 ? -8.878  -30.302 12.898  1.00 39.11  ? 123 MET A O   1 
ATOM   962  C CB  . MET A 1 130 ? -11.237 -29.183 11.759  1.00 36.77  ? 123 MET A CB  1 
ATOM   963  C CG  . MET A 1 130 ? -12.601 -28.504 11.678  1.00 41.28  ? 123 MET A CG  1 
ATOM   964  S SD  . MET A 1 130 ? -13.285 -28.038 13.288  1.00 47.06  ? 123 MET A SD  1 
ATOM   965  C CE  . MET A 1 130 ? -13.955 -29.594 13.827  1.00 43.91  ? 123 MET A CE  1 
ATOM   966  N N   . GLY A 1 131 ? -7.735  -28.481 12.228  1.00 35.12  ? 124 GLY A N   1 
ATOM   967  C CA  . GLY A 1 131 ? -6.407  -29.071 12.318  1.00 35.19  ? 124 GLY A CA  1 
ATOM   968  C C   . GLY A 1 131 ? -5.827  -29.006 13.724  1.00 40.06  ? 124 GLY A C   1 
ATOM   969  O O   . GLY A 1 131 ? -6.513  -28.659 14.692  1.00 38.68  ? 124 GLY A O   1 
ATOM   970  N N   . PHE A 1 132 ? -4.556  -29.347 13.846  1.00 39.64  ? 125 PHE A N   1 
ATOM   971  C CA  . PHE A 1 132 ? -3.850  -29.379 15.126  1.00 40.70  ? 125 PHE A CA  1 
ATOM   972  C C   . PHE A 1 132 ? -3.112  -28.059 15.416  1.00 45.79  ? 125 PHE A C   1 
ATOM   973  O O   . PHE A 1 132 ? -2.768  -27.337 14.482  1.00 44.55  ? 125 PHE A O   1 
ATOM   974  C CB  . PHE A 1 132 ? -2.848  -30.537 15.123  1.00 42.35  ? 125 PHE A CB  1 
ATOM   975  C CG  . PHE A 1 132 ? -3.439  -31.924 14.985  1.00 43.97  ? 125 PHE A CG  1 
ATOM   976  C CD1 . PHE A 1 132 ? -3.838  -32.413 13.739  1.00 46.27  ? 125 PHE A CD1 1 
ATOM   977  C CD2 . PHE A 1 132 ? -3.526  -32.775 16.085  1.00 46.08  ? 125 PHE A CD2 1 
ATOM   978  C CE1 . PHE A 1 132 ? -4.346  -33.714 13.601  1.00 46.86  ? 125 PHE A CE1 1 
ATOM   979  C CE2 . PHE A 1 132 ? -4.019  -34.090 15.943  1.00 48.71  ? 125 PHE A CE2 1 
ATOM   980  C CZ  . PHE A 1 132 ? -4.437  -34.546 14.703  1.00 46.36  ? 125 PHE A CZ  1 
ATOM   981  N N   . ILE A 1 133 ? -2.811  -27.785 16.702  1.00 43.82  ? 126 ILE A N   1 
ATOM   982  C CA  . ILE A 1 133 ? -2.049  -26.600 17.132  1.00 44.10  ? 126 ILE A CA  1 
ATOM   983  C C   . ILE A 1 133 ? -0.673  -26.505 16.442  1.00 50.28  ? 126 ILE A C   1 
ATOM   984  O O   . ILE A 1 133 ? -0.153  -25.404 16.254  1.00 51.24  ? 126 ILE A O   1 
ATOM   985  C CB  . ILE A 1 133 ? -1.975  -26.466 18.678  1.00 46.74  ? 126 ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 133 ? -1.547  -25.025 19.107  1.00 46.34  ? 126 ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 133 ? -1.132  -27.585 19.324  1.00 46.91  ? 126 ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 133 ? -1.802  -24.638 20.575  1.00 53.17  ? 126 ILE A CD1 1 
ATOM   989  N N   . GLU A 1 134 ? -0.127  -27.658 16.005  1.00 46.46  ? 127 GLU A N   1 
ATOM   990  C CA  . GLU A 1 134 ? 1.167   -27.757 15.312  1.00 45.32  ? 127 GLU A CA  1 
ATOM   991  C C   . GLU A 1 134 ? 1.150   -27.002 13.986  1.00 48.96  ? 127 GLU A C   1 
ATOM   992  O O   . GLU A 1 134 ? 2.198   -26.552 13.531  1.00 48.64  ? 127 GLU A O   1 
ATOM   993  C CB  . GLU A 1 134 ? 1.558   -29.237 15.096  1.00 45.98  ? 127 GLU A CB  1 
ATOM   994  C CG  . GLU A 1 134 ? 1.963   -29.983 16.361  1.00 49.87  ? 127 GLU A CG  1 
ATOM   995  C CD  . GLU A 1 134 ? 0.873   -30.597 17.225  1.00 76.68  ? 127 GLU A CD  1 
ATOM   996  O OE1 . GLU A 1 134 ? -0.288  -30.127 17.185  1.00 66.67  ? 127 GLU A OE1 1 
ATOM   997  O OE2 . GLU A 1 134 ? 1.200   -31.538 17.983  1.00 79.70  ? 127 GLU A OE2 1 
ATOM   998  N N   . GLN A 1 135 ? -0.040  -26.873 13.368  1.00 45.85  ? 128 GLN A N   1 
ATOM   999  C CA  . GLN A 1 135 ? -0.227  -26.189 12.083  1.00 45.81  ? 128 GLN A CA  1 
ATOM   1000 C C   . GLN A 1 135 ? -0.852  -24.794 12.214  1.00 48.48  ? 128 GLN A C   1 
ATOM   1001 O O   . GLN A 1 135 ? -1.019  -24.101 11.203  1.00 47.35  ? 128 GLN A O   1 
ATOM   1002 C CB  . GLN A 1 135 ? -1.040  -27.068 11.122  1.00 47.74  ? 128 GLN A CB  1 
ATOM   1003 C CG  . GLN A 1 135 ? -0.357  -28.375 10.743  1.00 69.80  ? 128 GLN A CG  1 
ATOM   1004 C CD  . GLN A 1 135 ? 0.722   -28.178 9.730   1.00 93.00  ? 128 GLN A CD  1 
ATOM   1005 O OE1 . GLN A 1 135 ? 1.892   -27.934 10.065  1.00 88.26  ? 128 GLN A OE1 1 
ATOM   1006 N NE2 . GLN A 1 135 ? 0.325   -28.270 8.473   1.00 87.41  ? 128 GLN A NE2 1 
ATOM   1007 N N   . ALA A 1 136 ? -1.199  -24.386 13.461  1.00 44.88  ? 129 ALA A N   1 
ATOM   1008 C CA  . ALA A 1 136 ? -1.803  -23.089 13.744  1.00 43.74  ? 129 ALA A CA  1 
ATOM   1009 C C   . ALA A 1 136 ? -0.778  -21.982 13.591  1.00 48.00  ? 129 ALA A C   1 
ATOM   1010 O O   . ALA A 1 136 ? 0.295   -22.036 14.200  1.00 48.97  ? 129 ALA A O   1 
ATOM   1011 C CB  . ALA A 1 136 ? -2.395  -23.075 15.146  1.00 43.94  ? 129 ALA A CB  1 
ATOM   1012 N N   . ILE A 1 137 ? -1.090  -20.993 12.751  1.00 43.17  ? 130 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 137 ? -0.223  -19.835 12.559  1.00 42.12  ? 130 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 137 ? -0.389  -18.963 13.815  1.00 47.80  ? 130 ILE A C   1 
ATOM   1015 O O   . ILE A 1 137 ? -1.517  -18.768 14.276  1.00 47.37  ? 130 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 137 ? -0.520  -19.105 11.215  1.00 43.90  ? 130 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 137 ? -0.303  -20.040 10.003  1.00 43.74  ? 130 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 137 ? 0.276   -17.809 11.076  1.00 44.24  ? 130 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 137 ? 1.114   -20.622 9.793   1.00 47.78  ? 130 ILE A CD1 1 
ATOM   1020 N N   . GLY A 1 138 ? 0.733   -18.559 14.408  1.00 45.20  ? 131 GLY A N   1 
ATOM   1021 C CA  . GLY A 1 138 ? 0.746   -17.767 15.635  1.00 45.47  ? 131 GLY A CA  1 
ATOM   1022 C C   . GLY A 1 138 ? 0.555   -18.569 16.912  1.00 50.06  ? 131 GLY A C   1 
ATOM   1023 O O   . GLY A 1 138 ? 0.346   -17.988 17.981  1.00 49.26  ? 131 GLY A O   1 
ATOM   1024 N N   . ARG A 1 139 ? 0.634   -19.911 16.811  1.00 48.70  ? 132 ARG A N   1 
ATOM   1025 C CA  . ARG A 1 139 ? 0.460   -20.872 17.912  1.00 49.81  ? 132 ARG A CA  1 
ATOM   1026 C C   . ARG A 1 139 ? -0.840  -20.681 18.716  1.00 51.62  ? 132 ARG A C   1 
ATOM   1027 O O   . ARG A 1 139 ? -0.913  -21.060 19.889  1.00 52.99  ? 132 ARG A O   1 
ATOM   1028 C CB  . ARG A 1 139 ? 1.699   -20.927 18.830  1.00 55.24  ? 132 ARG A CB  1 
ATOM   1029 C CG  . ARG A 1 139 ? 2.643   -22.093 18.544  1.00 76.81  ? 132 ARG A CG  1 
ATOM   1030 C CD  . ARG A 1 139 ? 3.903   -21.616 17.829  1.00 99.79  ? 132 ARG A CD  1 
ATOM   1031 N NE  . ARG A 1 139 ? 4.806   -20.844 18.701  1.00 116.11 ? 132 ARG A NE  1 
ATOM   1032 C CZ  . ARG A 1 139 ? 5.044   -19.535 18.590  1.00 132.12 ? 132 ARG A CZ  1 
ATOM   1033 N NH1 . ARG A 1 139 ? 4.460   -18.822 17.633  1.00 116.83 ? 132 ARG A NH1 1 
ATOM   1034 N NH2 . ARG A 1 139 ? 5.877   -18.933 19.430  1.00 119.62 ? 132 ARG A NH2 1 
ATOM   1035 N N   . VAL A 1 140 ? -1.868  -20.110 18.075  1.00 44.54  ? 133 VAL A N   1 
ATOM   1036 C CA  . VAL A 1 140 ? -3.180  -19.895 18.684  1.00 42.66  ? 133 VAL A CA  1 
ATOM   1037 C C   . VAL A 1 140 ? -3.920  -21.211 18.793  1.00 45.79  ? 133 VAL A C   1 
ATOM   1038 O O   . VAL A 1 140 ? -4.026  -21.932 17.802  1.00 47.02  ? 133 VAL A O   1 
ATOM   1039 C CB  . VAL A 1 140 ? -4.013  -18.728 18.048  1.00 45.59  ? 133 VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1 140 ? -3.729  -18.542 16.570  1.00 45.52  ? 133 VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1 140 ? -5.505  -18.885 18.287  1.00 45.18  ? 133 VAL A CG2 1 
ATOM   1042 N N   . THR A 1 141 ? -4.400  -21.537 20.004  1.00 41.81  ? 134 THR A N   1 
ATOM   1043 C CA  . THR A 1 141 ? -5.154  -22.761 20.309  1.00 41.48  ? 134 THR A CA  1 
ATOM   1044 C C   . THR A 1 141 ? -6.365  -22.943 19.358  1.00 43.81  ? 134 THR A C   1 
ATOM   1045 O O   . THR A 1 141 ? -7.233  -22.072 19.327  1.00 42.68  ? 134 THR A O   1 
ATOM   1046 C CB  . THR A 1 141 ? -5.562  -22.785 21.803  1.00 47.97  ? 134 THR A CB  1 
ATOM   1047 O OG1 . THR A 1 141 ? -4.420  -22.494 22.606  1.00 51.54  ? 134 THR A OG1 1 
ATOM   1048 C CG2 . THR A 1 141 ? -6.180  -24.118 22.229  1.00 42.82  ? 134 THR A CG2 1 
ATOM   1049 N N   . PRO A 1 142 ? -6.434  -24.061 18.590  1.00 39.99  ? 135 PRO A N   1 
ATOM   1050 C CA  . PRO A 1 142 ? -7.576  -24.265 17.681  1.00 38.98  ? 135 PRO A CA  1 
ATOM   1051 C C   . PRO A 1 142 ? -8.868  -24.533 18.435  1.00 42.17  ? 135 PRO A C   1 
ATOM   1052 O O   . PRO A 1 142 ? -8.828  -25.017 19.557  1.00 41.54  ? 135 PRO A O   1 
ATOM   1053 C CB  . PRO A 1 142 ? -7.153  -25.478 16.831  1.00 40.60  ? 135 PRO A CB  1 
ATOM   1054 C CG  . PRO A 1 142 ? -5.678  -25.661 17.088  1.00 45.09  ? 135 PRO A CG  1 
ATOM   1055 C CD  . PRO A 1 142 ? -5.484  -25.188 18.498  1.00 41.34  ? 135 PRO A CD  1 
ATOM   1056 N N   . ILE A 1 143 ? -10.006 -24.195 17.823  1.00 39.37  ? 136 ILE A N   1 
ATOM   1057 C CA  . ILE A 1 143 ? -11.341 -24.322 18.414  1.00 38.98  ? 136 ILE A CA  1 
ATOM   1058 C C   . ILE A 1 143 ? -11.645 -25.684 19.041  1.00 43.49  ? 136 ILE A C   1 
ATOM   1059 O O   . ILE A 1 143 ? -12.214 -25.722 20.130  1.00 41.84  ? 136 ILE A O   1 
ATOM   1060 C CB  . ILE A 1 143 ? -12.460 -23.806 17.461  1.00 41.29  ? 136 ILE A CB  1 
ATOM   1061 C CG1 . ILE A 1 143 ? -13.750 -23.490 18.222  1.00 41.02  ? 136 ILE A CG1 1 
ATOM   1062 C CG2 . ILE A 1 143 ? -12.706 -24.783 16.298  1.00 42.44  ? 136 ILE A CG2 1 
ATOM   1063 C CD1 . ILE A 1 143 ? -14.654 -22.439 17.570  1.00 50.12  ? 136 ILE A CD1 1 
ATOM   1064 N N   . PHE A 1 144 ? -11.293 -26.790 18.352  1.00 41.82  ? 137 PHE A N   1 
ATOM   1065 C CA  . PHE A 1 144 ? -11.573 -28.129 18.865  1.00 42.38  ? 137 PHE A CA  1 
ATOM   1066 C C   . PHE A 1 144 ? -10.807 -28.444 20.149  1.00 45.02  ? 137 PHE A C   1 
ATOM   1067 O O   . PHE A 1 144 ? -11.395 -28.992 21.067  1.00 45.51  ? 137 PHE A O   1 
ATOM   1068 C CB  . PHE A 1 144 ? -11.429 -29.228 17.793  1.00 44.77  ? 137 PHE A CB  1 
ATOM   1069 C CG  . PHE A 1 144 ? -12.109 -30.540 18.152  1.00 46.12  ? 137 PHE A CG  1 
ATOM   1070 C CD1 . PHE A 1 144 ? -13.494 -30.622 18.255  1.00 47.96  ? 137 PHE A CD1 1 
ATOM   1071 C CD2 . PHE A 1 144 ? -11.359 -31.685 18.422  1.00 47.50  ? 137 PHE A CD2 1 
ATOM   1072 C CE1 . PHE A 1 144 ? -14.119 -31.833 18.600  1.00 48.43  ? 137 PHE A CE1 1 
ATOM   1073 C CE2 . PHE A 1 144 ? -11.988 -32.899 18.731  1.00 49.70  ? 137 PHE A CE2 1 
ATOM   1074 C CZ  . PHE A 1 144 ? -13.360 -32.961 18.837  1.00 47.26  ? 137 PHE A CZ  1 
ATOM   1075 N N   . ASP A 1 145 ? -9.543  -28.011 20.251  1.00 41.00  ? 138 ASP A N   1 
ATOM   1076 C CA  . ASP A 1 145 ? -8.741  -28.183 21.462  1.00 41.22  ? 138 ASP A CA  1 
ATOM   1077 C C   . ASP A 1 145 ? -9.431  -27.492 22.638  1.00 46.45  ? 138 ASP A C   1 
ATOM   1078 O O   . ASP A 1 145 ? -9.517  -28.078 23.721  1.00 47.43  ? 138 ASP A O   1 
ATOM   1079 C CB  . ASP A 1 145 ? -7.305  -27.668 21.262  1.00 43.07  ? 138 ASP A CB  1 
ATOM   1080 C CG  . ASP A 1 145 ? -6.496  -28.491 20.273  1.00 56.94  ? 138 ASP A CG  1 
ATOM   1081 O OD1 . ASP A 1 145 ? -6.930  -28.617 19.103  1.00 59.57  ? 138 ASP A OD1 1 
ATOM   1082 O OD2 . ASP A 1 145 ? -5.419  -28.974 20.652  1.00 62.94  ? 138 ASP A OD2 1 
ATOM   1083 N N   . ASN A 1 146 ? -10.000 -26.297 22.396  1.00 42.68  ? 139 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 146 ? -10.760 -25.530 23.381  1.00 42.41  ? 139 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 146 ? -12.055 -26.221 23.772  1.00 48.09  ? 139 ASN A C   1 
ATOM   1086 O O   . ASN A 1 146 ? -12.420 -26.172 24.946  1.00 49.63  ? 139 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 146 ? -11.013 -24.094 22.913  1.00 41.53  ? 139 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 146 ? -9.813  -23.179 23.029  1.00 63.94  ? 139 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 146 ? -9.622  -22.276 22.219  1.00 54.40  ? 139 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 146 ? -8.985  -23.363 24.052  1.00 62.58  ? 139 ASN A ND2 1 
ATOM   1091 N N   . ILE A 1 147 ? -12.735 -26.886 22.812  1.00 44.64  ? 140 ILE A N   1 
ATOM   1092 C CA  . ILE A 1 147 ? -13.961 -27.648 23.084  1.00 44.08  ? 140 ILE A CA  1 
ATOM   1093 C C   . ILE A 1 147 ? -13.605 -28.875 23.952  1.00 49.92  ? 140 ILE A C   1 
ATOM   1094 O O   . ILE A 1 147 ? -14.281 -29.120 24.952  1.00 50.05  ? 140 ILE A O   1 
ATOM   1095 C CB  . ILE A 1 147 ? -14.765 -27.987 21.795  1.00 46.41  ? 140 ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 147 ? -15.240 -26.680 21.085  1.00 46.45  ? 140 ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 147 ? -15.964 -28.901 22.107  1.00 46.69  ? 140 ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 147 ? -15.858 -26.864 19.649  1.00 46.28  ? 140 ILE A CD1 1 
ATOM   1099 N N   . ILE A 1 148 ? -12.496 -29.584 23.615  1.00 47.03  ? 141 ILE A N   1 
ATOM   1100 C CA  . ILE A 1 148 ? -11.966 -30.730 24.370  1.00 47.30  ? 141 ILE A CA  1 
ATOM   1101 C C   . ILE A 1 148 ? -11.752 -30.342 25.842  1.00 54.47  ? 141 ILE A C   1 
ATOM   1102 O O   . ILE A 1 148 ? -12.225 -31.064 26.723  1.00 56.09  ? 141 ILE A O   1 
ATOM   1103 C CB  . ILE A 1 148 ? -10.665 -31.318 23.730  1.00 49.69  ? 141 ILE A CB  1 
ATOM   1104 C CG1 . ILE A 1 148 ? -10.915 -31.948 22.343  1.00 50.04  ? 141 ILE A CG1 1 
ATOM   1105 C CG2 . ILE A 1 148 ? -9.981  -32.317 24.654  1.00 48.82  ? 141 ILE A CG2 1 
ATOM   1106 C CD1 . ILE A 1 148 ? -12.168 -32.666 22.190  1.00 60.18  ? 141 ILE A CD1 1 
ATOM   1107 N N   . SER A 1 149 ? -11.085 -29.182 26.091  1.00 50.49  ? 142 SER A N   1 
ATOM   1108 C CA  . SER A 1 149 ? -10.785 -28.602 27.407  1.00 50.49  ? 142 SER A CA  1 
ATOM   1109 C C   . SER A 1 149 ? -11.993 -28.434 28.320  1.00 56.21  ? 142 SER A C   1 
ATOM   1110 O O   . SER A 1 149 ? -11.841 -28.454 29.540  1.00 56.82  ? 142 SER A O   1 
ATOM   1111 C CB  . SER A 1 149 ? -10.084 -27.261 27.251  1.00 54.00  ? 142 SER A CB  1 
ATOM   1112 O OG  . SER A 1 149 ? -8.789  -27.473 26.717  1.00 66.76  ? 142 SER A OG  1 
ATOM   1113 N N   . GLN A 1 150 ? -13.186 -28.275 27.741  1.00 53.44  ? 143 GLN A N   1 
ATOM   1114 C CA  . GLN A 1 150 ? -14.437 -28.141 28.484  1.00 53.24  ? 143 GLN A CA  1 
ATOM   1115 C C   . GLN A 1 150 ? -14.946 -29.475 29.056  1.00 57.81  ? 143 GLN A C   1 
ATOM   1116 O O   . GLN A 1 150 ? -15.805 -29.461 29.941  1.00 58.11  ? 143 GLN A O   1 
ATOM   1117 C CB  . GLN A 1 150 ? -15.512 -27.515 27.592  1.00 54.32  ? 143 GLN A CB  1 
ATOM   1118 C CG  . GLN A 1 150 ? -15.487 -26.003 27.636  1.00 65.13  ? 143 GLN A CG  1 
ATOM   1119 C CD  . GLN A 1 150 ? -16.485 -25.371 26.715  1.00 86.83  ? 143 GLN A CD  1 
ATOM   1120 O OE1 . GLN A 1 150 ? -16.133 -24.468 25.959  1.00 85.33  ? 143 GLN A OE1 1 
ATOM   1121 N NE2 . GLN A 1 150 ? -17.752 -25.784 26.789  1.00 78.87  ? 143 GLN A NE2 1 
ATOM   1122 N N   . GLY A 1 151 ? -14.441 -30.595 28.529  1.00 54.21  ? 144 GLY A N   1 
ATOM   1123 C CA  . GLY A 1 151 ? -14.836 -31.944 28.923  1.00 54.78  ? 144 GLY A CA  1 
ATOM   1124 C C   . GLY A 1 151 ? -16.332 -32.179 28.839  1.00 61.72  ? 144 GLY A C   1 
ATOM   1125 O O   . GLY A 1 151 ? -16.935 -32.650 29.802  1.00 63.35  ? 144 GLY A O   1 
ATOM   1126 N N   . VAL A 1 152 ? -16.947 -31.807 27.711  1.00 58.78  ? 145 VAL A N   1 
ATOM   1127 C CA  . VAL A 1 152 ? -18.391 -31.945 27.482  1.00 59.14  ? 145 VAL A CA  1 
ATOM   1128 C C   . VAL A 1 152 ? -18.730 -33.063 26.474  1.00 64.00  ? 145 VAL A C   1 
ATOM   1129 O O   . VAL A 1 152 ? -19.811 -33.650 26.547  1.00 63.37  ? 145 VAL A O   1 
ATOM   1130 C CB  . VAL A 1 152 ? -19.084 -30.600 27.104  1.00 63.11  ? 145 VAL A CB  1 
ATOM   1131 C CG1 . VAL A 1 152 ? -19.125 -29.646 28.293  1.00 63.15  ? 145 VAL A CG1 1 
ATOM   1132 C CG2 . VAL A 1 152 ? -18.417 -29.936 25.897  1.00 62.87  ? 145 VAL A CG2 1 
ATOM   1133 N N   . LEU A 1 153 ? -17.818 -33.329 25.530  1.00 61.10  ? 146 LEU A N   1 
ATOM   1134 C CA  . LEU A 1 153 ? -18.023 -34.310 24.472  1.00 61.34  ? 146 LEU A CA  1 
ATOM   1135 C C   . LEU A 1 153 ? -17.886 -35.749 24.944  1.00 68.11  ? 146 LEU A C   1 
ATOM   1136 O O   . LEU A 1 153 ? -16.976 -36.049 25.722  1.00 68.15  ? 146 LEU A O   1 
ATOM   1137 C CB  . LEU A 1 153 ? -17.068 -34.055 23.289  1.00 60.79  ? 146 LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 153 ? -17.073 -32.667 22.641  1.00 63.53  ? 146 LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 153 ? -15.926 -32.531 21.705  1.00 62.56  ? 146 LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 153 ? -18.367 -32.407 21.909  1.00 64.34  ? 146 LEU A CD2 1 
ATOM   1141 N N   . LYS A 1 154 ? -18.772 -36.646 24.441  1.00 65.68  ? 147 LYS A N   1 
ATOM   1142 C CA  . LYS A 1 154 ? -18.752 -38.083 24.729  1.00 65.87  ? 147 LYS A CA  1 
ATOM   1143 C C   . LYS A 1 154 ? -17.382 -38.641 24.360  1.00 69.65  ? 147 LYS A C   1 
ATOM   1144 O O   . LYS A 1 154 ? -16.700 -39.214 25.211  1.00 70.07  ? 147 LYS A O   1 
ATOM   1145 C CB  . LYS A 1 154 ? -19.853 -38.822 23.941  1.00 69.22  ? 147 LYS A CB  1 
ATOM   1146 C CG  . LYS A 1 154 ? -21.071 -39.166 24.776  1.00 90.68  ? 147 LYS A CG  1 
ATOM   1147 C CD  . LYS A 1 154 ? -21.775 -40.406 24.250  1.00 103.25 ? 147 LYS A CD  1 
ATOM   1148 C CE  . LYS A 1 154 ? -22.534 -41.105 25.346  1.00 115.46 ? 147 LYS A CE  1 
ATOM   1149 N NZ  . LYS A 1 154 ? -22.779 -42.533 25.014  1.00 121.66 ? 147 LYS A NZ  1 
ATOM   1150 N N   . GLU A 1 155 ? -16.955 -38.392 23.112  1.00 64.96  ? 148 GLU A N   1 
ATOM   1151 C CA  . GLU A 1 155 ? -15.671 -38.817 22.570  1.00 63.78  ? 148 GLU A CA  1 
ATOM   1152 C C   . GLU A 1 155 ? -14.882 -37.619 22.024  1.00 64.80  ? 148 GLU A C   1 
ATOM   1153 O O   . GLU A 1 155 ? -15.450 -36.614 21.601  1.00 63.12  ? 148 GLU A O   1 
ATOM   1154 C CB  . GLU A 1 155 ? -15.879 -39.853 21.449  1.00 65.33  ? 148 GLU A CB  1 
ATOM   1155 C CG  . GLU A 1 155 ? -16.246 -41.249 21.922  1.00 76.13  ? 148 GLU A CG  1 
ATOM   1156 C CD  . GLU A 1 155 ? -16.604 -42.198 20.793  1.00 97.18  ? 148 GLU A CD  1 
ATOM   1157 O OE1 . GLU A 1 155 ? -17.677 -42.017 20.172  1.00 78.26  ? 148 GLU A OE1 1 
ATOM   1158 O OE2 . GLU A 1 155 ? -15.806 -43.125 20.525  1.00 99.60  ? 148 GLU A OE2 1 
ATOM   1159 N N   . ASP A 1 156 ? -13.563 -37.762 22.002  1.00 60.63  ? 149 ASP A N   1 
ATOM   1160 C CA  . ASP A 1 156 ? -12.600 -36.797 21.491  1.00 59.69  ? 149 ASP A CA  1 
ATOM   1161 C C   . ASP A 1 156 ? -12.523 -36.967 19.970  1.00 56.60  ? 149 ASP A C   1 
ATOM   1162 O O   . ASP A 1 156 ? -11.439 -37.203 19.422  1.00 55.42  ? 149 ASP A O   1 
ATOM   1163 C CB  . ASP A 1 156 ? -11.245 -37.150 22.101  1.00 63.33  ? 149 ASP A CB  1 
ATOM   1164 C CG  . ASP A 1 156 ? -10.543 -35.998 22.755  1.00 86.48  ? 149 ASP A CG  1 
ATOM   1165 O OD1 . ASP A 1 156 ? -10.988 -35.579 23.850  1.00 88.50  ? 149 ASP A OD1 1 
ATOM   1166 O OD2 . ASP A 1 156 ? -9.496  -35.579 22.226  1.00 97.15  ? 149 ASP A OD2 1 
ATOM   1167 N N   . VAL A 1 157 ? -13.680 -36.920 19.296  1.00 48.84  ? 150 VAL A N   1 
ATOM   1168 C CA  . VAL A 1 157 ? -13.786 -37.135 17.845  1.00 46.14  ? 150 VAL A CA  1 
ATOM   1169 C C   . VAL A 1 157 ? -14.743 -36.147 17.189  1.00 45.93  ? 150 VAL A C   1 
ATOM   1170 O O   . VAL A 1 157 ? -15.605 -35.570 17.861  1.00 45.56  ? 150 VAL A O   1 
ATOM   1171 C CB  . VAL A 1 157 ? -14.172 -38.616 17.454  1.00 48.68  ? 150 VAL A CB  1 
ATOM   1172 C CG1 . VAL A 1 157 ? -13.296 -39.653 18.131  1.00 48.21  ? 150 VAL A CG1 1 
ATOM   1173 C CG2 . VAL A 1 157 ? -15.631 -38.918 17.718  1.00 47.95  ? 150 VAL A CG2 1 
ATOM   1174 N N   . PHE A 1 158 ? -14.625 -36.004 15.868  1.00 39.68  ? 151 PHE A N   1 
ATOM   1175 C CA  . PHE A 1 158 ? -15.574 -35.243 15.068  1.00 38.84  ? 151 PHE A CA  1 
ATOM   1176 C C   . PHE A 1 158 ? -15.760 -35.946 13.724  1.00 44.20  ? 151 PHE A C   1 
ATOM   1177 O O   . PHE A 1 158 ? -14.815 -36.568 13.210  1.00 43.87  ? 151 PHE A O   1 
ATOM   1178 C CB  . PHE A 1 158 ? -15.265 -33.731 14.965  1.00 39.71  ? 151 PHE A CB  1 
ATOM   1179 C CG  . PHE A 1 158 ? -13.943 -33.386 14.331  1.00 40.45  ? 151 PHE A CG  1 
ATOM   1180 C CD1 . PHE A 1 158 ? -13.844 -33.174 12.961  1.00 42.36  ? 151 PHE A CD1 1 
ATOM   1181 C CD2 . PHE A 1 158 ? -12.801 -33.246 15.108  1.00 42.47  ? 151 PHE A CD2 1 
ATOM   1182 C CE1 . PHE A 1 158 ? -12.626 -32.843 12.381  1.00 43.68  ? 151 PHE A CE1 1 
ATOM   1183 C CE2 . PHE A 1 158 ? -11.588 -32.899 14.530  1.00 45.42  ? 151 PHE A CE2 1 
ATOM   1184 C CZ  . PHE A 1 158 ? -11.502 -32.714 13.168  1.00 43.64  ? 151 PHE A CZ  1 
ATOM   1185 N N   . SER A 1 159 ? -16.982 -35.866 13.176  1.00 40.00  ? 152 SER A N   1 
ATOM   1186 C CA  . SER A 1 159 ? -17.301 -36.558 11.946  1.00 39.21  ? 152 SER A CA  1 
ATOM   1187 C C   . SER A 1 159 ? -17.876 -35.675 10.852  1.00 41.22  ? 152 SER A C   1 
ATOM   1188 O O   . SER A 1 159 ? -18.518 -34.673 11.135  1.00 40.33  ? 152 SER A O   1 
ATOM   1189 C CB  . SER A 1 159 ? -18.240 -37.717 12.245  1.00 42.95  ? 152 SER A CB  1 
ATOM   1190 O OG  . SER A 1 159 ? -17.555 -38.672 13.031  1.00 54.02  ? 152 SER A OG  1 
ATOM   1191 N N   . PHE A 1 160 ? -17.701 -36.100 9.603   1.00 35.90  ? 153 PHE A N   1 
ATOM   1192 C CA  . PHE A 1 160 ? -18.182 -35.365 8.450   1.00 34.98  ? 153 PHE A CA  1 
ATOM   1193 C C   . PHE A 1 160 ? -19.057 -36.207 7.553   1.00 38.63  ? 153 PHE A C   1 
ATOM   1194 O O   . PHE A 1 160 ? -18.660 -37.306 7.122   1.00 37.69  ? 153 PHE A O   1 
ATOM   1195 C CB  . PHE A 1 160 ? -16.995 -34.840 7.617   1.00 35.78  ? 153 PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 160 ? -16.469 -33.512 8.100   1.00 36.83  ? 153 PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 160 ? -15.626 -33.439 9.206   1.00 37.76  ? 153 PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 160 ? -16.832 -32.324 7.464   1.00 38.23  ? 153 PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 160 ? -15.151 -32.207 9.658   1.00 37.59  ? 153 PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 160 ? -16.346 -31.094 7.919   1.00 40.01  ? 153 PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 160 ? -15.500 -31.048 9.003   1.00 37.17  ? 153 PHE A CZ  1 
ATOM   1202 N N   . TYR A 1 161 ? -20.228 -35.642 7.226   1.00 33.36  ? 154 TYR A N   1 
ATOM   1203 C CA  . TYR A 1 161 ? -21.153 -36.189 6.258   1.00 33.01  ? 154 TYR A CA  1 
ATOM   1204 C C   . TYR A 1 161 ? -21.383 -35.090 5.221   1.00 38.55  ? 154 TYR A C   1 
ATOM   1205 O O   . TYR A 1 161 ? -21.796 -33.980 5.596   1.00 39.27  ? 154 TYR A O   1 
ATOM   1206 C CB  . TYR A 1 161 ? -22.494 -36.635 6.894   1.00 33.80  ? 154 TYR A CB  1 
ATOM   1207 C CG  . TYR A 1 161 ? -23.543 -36.966 5.848   1.00 34.66  ? 154 TYR A CG  1 
ATOM   1208 C CD1 . TYR A 1 161 ? -23.361 -38.030 4.959   1.00 36.31  ? 154 TYR A CD1 1 
ATOM   1209 C CD2 . TYR A 1 161 ? -24.666 -36.160 5.680   1.00 34.63  ? 154 TYR A CD2 1 
ATOM   1210 C CE1 . TYR A 1 161 ? -24.289 -38.297 3.951   1.00 37.02  ? 154 TYR A CE1 1 
ATOM   1211 C CE2 . TYR A 1 161 ? -25.599 -36.419 4.676   1.00 35.05  ? 154 TYR A CE2 1 
ATOM   1212 C CZ  . TYR A 1 161 ? -25.418 -37.500 3.826   1.00 42.33  ? 154 TYR A CZ  1 
ATOM   1213 O OH  . TYR A 1 161 ? -26.334 -37.758 2.825   1.00 44.74  ? 154 TYR A OH  1 
ATOM   1214 N N   . TYR A 1 162 ? -21.082 -35.387 3.934   1.00 33.78  ? 155 TYR A N   1 
ATOM   1215 C CA  . TYR A 1 162 ? -21.312 -34.475 2.821   1.00 33.74  ? 155 TYR A CA  1 
ATOM   1216 C C   . TYR A 1 162 ? -22.307 -35.136 1.883   1.00 39.96  ? 155 TYR A C   1 
ATOM   1217 O O   . TYR A 1 162 ? -22.041 -36.228 1.393   1.00 40.59  ? 155 TYR A O   1 
ATOM   1218 C CB  . TYR A 1 162 ? -20.009 -34.184 2.052   1.00 34.63  ? 155 TYR A CB  1 
ATOM   1219 C CG  . TYR A 1 162 ? -19.073 -33.159 2.657   1.00 35.97  ? 155 TYR A CG  1 
ATOM   1220 C CD1 . TYR A 1 162 ? -19.407 -32.475 3.827   1.00 36.93  ? 155 TYR A CD1 1 
ATOM   1221 C CD2 . TYR A 1 162 ? -17.839 -32.884 2.068   1.00 36.82  ? 155 TYR A CD2 1 
ATOM   1222 C CE1 . TYR A 1 162 ? -18.538 -31.539 4.390   1.00 36.11  ? 155 TYR A CE1 1 
ATOM   1223 C CE2 . TYR A 1 162 ? -16.960 -31.954 2.626   1.00 36.94  ? 155 TYR A CE2 1 
ATOM   1224 C CZ  . TYR A 1 162 ? -17.322 -31.268 3.773   1.00 39.93  ? 155 TYR A CZ  1 
ATOM   1225 O OH  . TYR A 1 162 ? -16.458 -30.335 4.292   1.00 34.10  ? 155 TYR A OH  1 
ATOM   1226 N N   . ASN A 1 163 ? -23.436 -34.490 1.619   1.00 38.93  ? 156 ASN A N   1 
ATOM   1227 C CA  . ASN A 1 163 ? -24.425 -35.043 0.717   1.00 40.76  ? 156 ASN A CA  1 
ATOM   1228 C C   . ASN A 1 163 ? -24.067 -34.794 -0.737  1.00 50.79  ? 156 ASN A C   1 
ATOM   1229 O O   . ASN A 1 163 ? -23.344 -33.846 -1.065  1.00 49.63  ? 156 ASN A O   1 
ATOM   1230 C CB  . ASN A 1 163 ? -25.818 -34.502 1.064   1.00 42.07  ? 156 ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 163 ? -26.997 -35.341 0.604   1.00 50.71  ? 156 ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 163 ? -26.883 -36.363 -0.083  1.00 33.75  ? 156 ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 163 ? -28.176 -34.899 0.959   1.00 40.90  ? 156 ASN A ND2 1 
ATOM   1234 N N   . ARG A 1 164 ? -24.501 -35.736 -1.573  1.00 54.36  ? 157 ARG A N   1 
ATOM   1235 C CA  . ARG A 1 164 ? -24.316 -35.759 -3.023  1.00 57.99  ? 157 ARG A CA  1 
ATOM   1236 C C   . ARG A 1 164 ? -25.243 -34.743 -3.647  1.00 70.94  ? 157 ARG A C   1 
ATOM   1237 O O   . ARG A 1 164 ? -24.870 -34.044 -4.589  1.00 71.51  ? 157 ARG A O   1 
ATOM   1238 C CB  . ARG A 1 164 ? -24.660 -37.152 -3.612  1.00 57.31  ? 157 ARG A CB  1 
ATOM   1239 C CG  . ARG A 1 164 ? -24.526 -38.337 -2.644  1.00 64.87  ? 157 ARG A CG  1 
ATOM   1240 C CD  . ARG A 1 164 ? -24.384 -39.659 -3.367  1.00 64.87  ? 157 ARG A CD  1 
ATOM   1241 N NE  . ARG A 1 164 ? -23.027 -39.810 -3.890  1.00 77.31  ? 157 ARG A NE  1 
ATOM   1242 C CZ  . ARG A 1 164 ? -22.043 -40.472 -3.282  1.00 92.19  ? 157 ARG A CZ  1 
ATOM   1243 N NH1 . ARG A 1 164 ? -22.266 -41.101 -2.129  1.00 63.86  ? 157 ARG A NH1 1 
ATOM   1244 N NH2 . ARG A 1 164 ? -20.834 -40.527 -3.832  1.00 85.74  ? 157 ARG A NH2 1 
ATOM   1245 N N   . ASP A 1 165 ? -26.467 -34.696 -3.133  1.00 73.80  ? 158 ASP A N   1 
ATOM   1246 C CA  . ASP A 1 165 ? -27.524 -33.854 -3.645  1.00 77.11  ? 158 ASP A CA  1 
ATOM   1247 C C   . ASP A 1 165 ? -27.363 -32.422 -3.215  1.00 87.35  ? 158 ASP A C   1 
ATOM   1248 O O   . ASP A 1 165 ? -27.256 -32.138 -2.014  1.00 87.33  ? 158 ASP A O   1 
ATOM   1249 C CB  . ASP A 1 165 ? -28.903 -34.411 -3.252  1.00 79.59  ? 158 ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 165 ? -30.008 -33.984 -4.187  1.00 94.84  ? 158 ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 165 ? -30.350 -32.774 -4.194  1.00 95.59  ? 158 ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 165 ? -30.534 -34.856 -4.918  1.00 103.36 ? 158 ASP A OD2 1 
ATOM   1253 N N   . SER A 1 166 ? -27.363 -31.519 -4.210  1.00 88.29  ? 159 SER A N   1 
ATOM   1254 C CA  . SER A 1 166 ? -27.244 -30.079 -4.010  1.00 90.41  ? 159 SER A CA  1 
ATOM   1255 C C   . SER A 1 166 ? -28.452 -29.316 -4.568  1.00 100.96 ? 159 SER A C   1 
ATOM   1256 O O   . SER A 1 166 ? -28.738 -28.214 -4.086  1.00 101.57 ? 159 SER A O   1 
ATOM   1257 C CB  . SER A 1 166 ? -25.943 -29.560 -4.616  1.00 92.87  ? 159 SER A CB  1 
ATOM   1258 O OG  . SER A 1 166 ? -26.153 -28.690 -5.717  1.00 98.92  ? 159 SER A OG  1 
ATOM   1259 N N   . GLU A 1 167 ? -29.143 -29.894 -5.588  1.00 101.00 ? 160 GLU A N   1 
ATOM   1260 C CA  . GLU A 1 167 ? -30.292 -29.283 -6.281  1.00 102.25 ? 160 GLU A CA  1 
ATOM   1261 C C   . GLU A 1 167 ? -31.693 -29.486 -5.638  1.00 107.42 ? 160 GLU A C   1 
ATOM   1262 O O   . GLU A 1 167 ? -32.716 -29.191 -6.277  1.00 107.01 ? 160 GLU A O   1 
ATOM   1263 C CB  . GLU A 1 167 ? -30.275 -29.609 -7.797  1.00 103.94 ? 160 GLU A CB  1 
ATOM   1264 C CG  . GLU A 1 167 ? -30.593 -31.051 -8.161  1.00 116.79 ? 160 GLU A CG  1 
ATOM   1265 C CD  . GLU A 1 167 ? -31.522 -31.205 -9.350  1.00 143.78 ? 160 GLU A CD  1 
ATOM   1266 O OE1 . GLU A 1 167 ? -31.039 -31.610 -10.433 1.00 139.02 ? 160 GLU A OE1 1 
ATOM   1267 O OE2 . GLU A 1 167 ? -32.735 -30.930 -9.197  1.00 140.85 ? 160 GLU A OE2 1 
ATOM   1268 N N   . ASN A 1 168 A -31.737 -29.939 -4.369  1.00 104.60 ? 160 ASN A N   1 
ATOM   1269 C CA  . ASN A 1 168 A -33.007 -30.156 -3.679  1.00 104.62 ? 160 ASN A CA  1 
ATOM   1270 C C   . ASN A 1 168 A -33.046 -29.624 -2.252  1.00 108.55 ? 160 ASN A C   1 
ATOM   1271 O O   . ASN A 1 168 A -32.032 -29.643 -1.546  1.00 108.22 ? 160 ASN A O   1 
ATOM   1272 C CB  . ASN A 1 168 A -33.394 -31.635 -3.710  1.00 105.72 ? 160 ASN A CB  1 
ATOM   1273 C CG  . ASN A 1 168 A -34.770 -31.891 -4.266  1.00 130.82 ? 160 ASN A CG  1 
ATOM   1274 O OD1 . ASN A 1 168 A -35.047 -31.667 -5.455  1.00 124.18 ? 160 ASN A OD1 1 
ATOM   1275 N ND2 . ASN A 1 168 A -35.655 -32.401 -3.420  1.00 123.20 ? 160 ASN A ND2 1 
ATOM   1276 N N   . SER A 1 169 B -34.234 -29.147 -1.837  1.00 104.93 ? 160 SER A N   1 
ATOM   1277 C CA  . SER A 1 169 B -34.515 -28.665 -0.480  1.00 104.48 ? 160 SER A CA  1 
ATOM   1278 C C   . SER A 1 169 B -35.017 -29.862 0.339   1.00 106.25 ? 160 SER A C   1 
ATOM   1279 O O   . SER A 1 169 B -35.331 -30.910 -0.246  1.00 106.14 ? 160 SER A O   1 
ATOM   1280 C CB  . SER A 1 169 B -35.567 -27.558 -0.505  1.00 108.67 ? 160 SER A CB  1 
ATOM   1281 O OG  . SER A 1 169 B -35.048 -26.367 -1.075  1.00 118.61 ? 160 SER A OG  1 
ATOM   1282 N N   . GLN A 1 170 C -35.068 -29.721 1.692   1.00 100.14 ? 160 GLN A N   1 
ATOM   1283 C CA  . GLN A 1 170 C -35.477 -30.767 2.661   1.00 98.46  ? 160 GLN A CA  1 
ATOM   1284 C C   . GLN A 1 170 C -34.452 -31.938 2.721   1.00 97.33  ? 160 GLN A C   1 
ATOM   1285 O O   . GLN A 1 170 C -34.477 -32.734 3.670   1.00 97.34  ? 160 GLN A O   1 
ATOM   1286 C CB  . GLN A 1 170 C -36.915 -31.316 2.402   1.00 99.94  ? 160 GLN A CB  1 
ATOM   1287 C CG  . GLN A 1 170 C -38.003 -30.263 2.113   1.00 119.57 ? 160 GLN A CG  1 
ATOM   1288 C CD  . GLN A 1 170 C -39.002 -30.049 3.231   1.00 138.73 ? 160 GLN A CD  1 
ATOM   1289 O OE1 . GLN A 1 170 C -39.284 -28.912 3.627   1.00 132.05 ? 160 GLN A OE1 1 
ATOM   1290 N NE2 . GLN A 1 170 C -39.612 -31.124 3.719   1.00 132.99 ? 160 GLN A NE2 1 
ATOM   1291 N N   . SER A 1 171 D -33.553 -32.018 1.707   1.00 88.48  ? 160 SER A N   1 
ATOM   1292 C CA  . SER A 1 171 D -32.535 -33.051 1.529   1.00 85.25  ? 160 SER A CA  1 
ATOM   1293 C C   . SER A 1 171 D -31.465 -33.111 2.623   1.00 81.36  ? 160 SER A C   1 
ATOM   1294 O O   . SER A 1 171 D -31.190 -34.220 3.098   1.00 82.37  ? 160 SER A O   1 
ATOM   1295 C CB  . SER A 1 171 D -31.889 -32.950 0.146   1.00 88.53  ? 160 SER A CB  1 
ATOM   1296 O OG  . SER A 1 171 D -31.068 -31.801 0.017   1.00 97.22  ? 160 SER A OG  1 
ATOM   1297 N N   . LEU A 1 172 ? -30.860 -31.935 3.007   1.00 68.81  ? 161 LEU A N   1 
ATOM   1298 C CA  . LEU A 1 172 ? -29.760 -31.754 3.987   1.00 64.10  ? 161 LEU A CA  1 
ATOM   1299 C C   . LEU A 1 172 ? -28.403 -31.811 3.263   1.00 58.54  ? 161 LEU A C   1 
ATOM   1300 O O   . LEU A 1 172 ? -28.025 -32.866 2.752   1.00 57.58  ? 161 LEU A O   1 
ATOM   1301 C CB  . LEU A 1 172 ? -29.827 -32.745 5.171   1.00 63.78  ? 161 LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 172 ? -28.643 -32.798 6.119   1.00 68.00  ? 161 LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 172 ? -28.996 -32.199 7.448   1.00 67.83  ? 161 LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 172 ? -28.146 -34.213 6.274   1.00 69.14  ? 161 LEU A CD2 1 
ATOM   1305 N N   . GLY A 1 173 ? -27.710 -30.672 3.213   1.00 48.36  ? 162 GLY A N   1 
ATOM   1306 C CA  . GLY A 1 173 ? -26.435 -30.531 2.514   1.00 45.94  ? 162 GLY A CA  1 
ATOM   1307 C C   . GLY A 1 173 ? -25.265 -31.320 3.067   1.00 43.34  ? 162 GLY A C   1 
ATOM   1308 O O   . GLY A 1 173 ? -24.413 -31.817 2.331   1.00 41.54  ? 162 GLY A O   1 
ATOM   1309 N N   . GLY A 1 174 ? -25.225 -31.410 4.370   1.00 37.91  ? 163 GLY A N   1 
ATOM   1310 C CA  . GLY A 1 174 ? -24.185 -32.123 5.083   1.00 37.26  ? 163 GLY A CA  1 
ATOM   1311 C C   . GLY A 1 174 ? -24.386 -31.975 6.568   1.00 40.49  ? 163 GLY A C   1 
ATOM   1312 O O   . GLY A 1 174 ? -25.337 -31.320 7.021   1.00 38.56  ? 163 GLY A O   1 
ATOM   1313 N N   . GLN A 1 175 ? -23.493 -32.591 7.333   1.00 37.87  ? 164 GLN A N   1 
ATOM   1314 C CA  . GLN A 1 175 ? -23.543 -32.556 8.789   1.00 36.98  ? 164 GLN A CA  1 
ATOM   1315 C C   . GLN A 1 175 ? -22.204 -32.913 9.393   1.00 39.47  ? 164 GLN A C   1 
ATOM   1316 O O   . GLN A 1 175 ? -21.554 -33.859 8.946   1.00 39.20  ? 164 GLN A O   1 
ATOM   1317 C CB  . GLN A 1 175 ? -24.618 -33.527 9.305   1.00 38.40  ? 164 GLN A CB  1 
ATOM   1318 C CG  . GLN A 1 175 ? -24.534 -33.840 10.799  1.00 43.83  ? 164 GLN A CG  1 
ATOM   1319 C CD  . GLN A 1 175 ? -25.348 -35.052 11.111  1.00 57.23  ? 164 GLN A CD  1 
ATOM   1320 O OE1 . GLN A 1 175 ? -24.848 -36.181 11.089  1.00 45.05  ? 164 GLN A OE1 1 
ATOM   1321 N NE2 . GLN A 1 175 ? -26.615 -34.834 11.355  1.00 51.63  ? 164 GLN A NE2 1 
ATOM   1322 N N   . ILE A 1 176 ? -21.822 -32.160 10.428  1.00 36.37  ? 165 ILE A N   1 
ATOM   1323 C CA  . ILE A 1 176 ? -20.656 -32.381 11.278  1.00 36.49  ? 165 ILE A CA  1 
ATOM   1324 C C   . ILE A 1 176 ? -21.190 -32.782 12.655  1.00 41.85  ? 165 ILE A C   1 
ATOM   1325 O O   . ILE A 1 176 ? -22.114 -32.153 13.178  1.00 41.61  ? 165 ILE A O   1 
ATOM   1326 C CB  . ILE A 1 176 ? -19.729 -31.139 11.399  1.00 39.99  ? 165 ILE A CB  1 
ATOM   1327 C CG1 . ILE A 1 176 ? -19.277 -30.662 10.023  1.00 41.83  ? 165 ILE A CG1 1 
ATOM   1328 C CG2 . ILE A 1 176 ? -18.510 -31.418 12.296  1.00 39.12  ? 165 ILE A CG2 1 
ATOM   1329 C CD1 . ILE A 1 176 ? -19.002 -29.302 10.011  1.00 47.69  ? 165 ILE A CD1 1 
ATOM   1330 N N   . VAL A 1 177 ? -20.618 -33.834 13.228  1.00 39.93  ? 166 VAL A N   1 
ATOM   1331 C CA  . VAL A 1 177 ? -20.966 -34.257 14.570  1.00 40.02  ? 166 VAL A CA  1 
ATOM   1332 C C   . VAL A 1 177 ? -19.710 -34.052 15.392  1.00 45.30  ? 166 VAL A C   1 
ATOM   1333 O O   . VAL A 1 177 ? -18.637 -34.530 15.015  1.00 44.37  ? 166 VAL A O   1 
ATOM   1334 C CB  . VAL A 1 177 ? -21.505 -35.714 14.660  1.00 43.54  ? 166 VAL A CB  1 
ATOM   1335 C CG1 . VAL A 1 177 ? -21.940 -36.046 16.087  1.00 43.36  ? 166 VAL A CG1 1 
ATOM   1336 C CG2 . VAL A 1 177 ? -22.662 -35.935 13.696  1.00 43.02  ? 166 VAL A CG2 1 
ATOM   1337 N N   . LEU A 1 178 ? -19.831 -33.285 16.471  1.00 43.33  ? 167 LEU A N   1 
ATOM   1338 C CA  . LEU A 1 178 ? -18.743 -33.063 17.411  1.00 42.92  ? 167 LEU A CA  1 
ATOM   1339 C C   . LEU A 1 178 ? -19.008 -34.026 18.575  1.00 47.51  ? 167 LEU A C   1 
ATOM   1340 O O   . LEU A 1 178 ? -20.095 -34.003 19.157  1.00 45.32  ? 167 LEU A O   1 
ATOM   1341 C CB  . LEU A 1 178 ? -18.689 -31.586 17.893  1.00 42.44  ? 167 LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 178 ? -18.602 -30.471 16.815  1.00 46.48  ? 167 LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 178 ? -18.858 -29.096 17.424  1.00 45.96  ? 167 LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 178 ? -17.253 -30.458 16.106  1.00 48.37  ? 167 LEU A CD2 1 
ATOM   1345 N N   . GLY A 1 179 ? -18.055 -34.919 18.837  1.00 46.97  ? 168 GLY A N   1 
ATOM   1346 C CA  . GLY A 1 179 ? -18.150 -35.882 19.929  1.00 47.88  ? 168 GLY A CA  1 
ATOM   1347 C C   . GLY A 1 179 ? -18.598 -37.291 19.576  1.00 53.14  ? 168 GLY A C   1 
ATOM   1348 O O   . GLY A 1 179 ? -18.715 -38.135 20.470  1.00 53.07  ? 168 GLY A O   1 
ATOM   1349 N N   . GLY A 1 180 ? -18.845 -37.546 18.288  1.00 50.02  ? 169 GLY A N   1 
ATOM   1350 C CA  . GLY A 1 180 ? -19.282 -38.851 17.792  1.00 49.71  ? 169 GLY A CA  1 
ATOM   1351 C C   . GLY A 1 180 ? -19.474 -38.934 16.294  1.00 53.98  ? 169 GLY A C   1 
ATOM   1352 O O   . GLY A 1 180 ? -18.900 -38.144 15.543  1.00 53.06  ? 169 GLY A O   1 
ATOM   1353 N N   . SER A 1 181 ? -20.291 -39.918 15.863  1.00 51.60  ? 170 SER A N   1 
ATOM   1354 C CA  . SER A 1 181 ? -20.683 -40.217 14.472  1.00 51.16  ? 170 SER A CA  1 
ATOM   1355 C C   . SER A 1 181 ? -22.170 -40.444 14.413  1.00 55.76  ? 170 SER A C   1 
ATOM   1356 O O   . SER A 1 181 ? -22.749 -40.936 15.384  1.00 56.51  ? 170 SER A O   1 
ATOM   1357 C CB  . SER A 1 181 ? -20.000 -41.486 13.981  1.00 54.92  ? 170 SER A CB  1 
ATOM   1358 O OG  . SER A 1 181 ? -18.639 -41.224 13.697  1.00 65.64  ? 170 SER A OG  1 
ATOM   1359 N N   . ASP A 1 182 ? -22.803 -40.096 13.286  1.00 51.88  ? 171 ASP A N   1 
ATOM   1360 C CA  . ASP A 1 182 ? -24.236 -40.322 13.120  1.00 50.99  ? 171 ASP A CA  1 
ATOM   1361 C C   . ASP A 1 182 ? -24.436 -41.618 12.322  1.00 56.27  ? 171 ASP A C   1 
ATOM   1362 O O   . ASP A 1 182 ? -24.152 -41.640 11.120  1.00 56.15  ? 171 ASP A O   1 
ATOM   1363 C CB  . ASP A 1 182 ? -24.938 -39.118 12.467  1.00 51.59  ? 171 ASP A CB  1 
ATOM   1364 C CG  . ASP A 1 182 ? -26.452 -39.217 12.439  1.00 54.56  ? 171 ASP A CG  1 
ATOM   1365 O OD1 . ASP A 1 182 ? -26.987 -40.287 12.803  1.00 57.05  ? 171 ASP A OD1 1 
ATOM   1366 O OD2 . ASP A 1 182 ? -27.103 -38.228 12.057  1.00 55.35  ? 171 ASP A OD2 1 
ATOM   1367 N N   . PRO A 1 183 ? -24.937 -42.703 12.973  1.00 53.07  ? 172 PRO A N   1 
ATOM   1368 C CA  . PRO A 1 183 ? -25.112 -43.993 12.260  1.00 51.84  ? 172 PRO A CA  1 
ATOM   1369 C C   . PRO A 1 183 ? -26.189 -43.988 11.183  1.00 52.64  ? 172 PRO A C   1 
ATOM   1370 O O   . PRO A 1 183 ? -26.281 -44.938 10.410  1.00 51.41  ? 172 PRO A O   1 
ATOM   1371 C CB  . PRO A 1 183 ? -25.397 -44.999 13.386  1.00 53.54  ? 172 PRO A CB  1 
ATOM   1372 C CG  . PRO A 1 183 ? -25.011 -44.275 14.667  1.00 58.45  ? 172 PRO A CG  1 
ATOM   1373 C CD  . PRO A 1 183 ? -25.310 -42.835 14.395  1.00 54.25  ? 172 PRO A CD  1 
ATOM   1374 N N   . GLN A 1 184 ? -26.963 -42.892 11.101  1.00 48.47  ? 173 GLN A N   1 
ATOM   1375 C CA  . GLN A 1 184 ? -27.982 -42.694 10.075  1.00 48.37  ? 173 GLN A CA  1 
ATOM   1376 C C   . GLN A 1 184 ? -27.314 -42.372 8.726   1.00 50.82  ? 173 GLN A C   1 
ATOM   1377 O O   . GLN A 1 184 ? -27.941 -42.552 7.678   1.00 51.52  ? 173 GLN A O   1 
ATOM   1378 C CB  . GLN A 1 184 ? -28.907 -41.530 10.459  1.00 50.00  ? 173 GLN A CB  1 
ATOM   1379 C CG  . GLN A 1 184 ? -29.824 -41.811 11.647  1.00 82.88  ? 173 GLN A CG  1 
ATOM   1380 C CD  . GLN A 1 184 ? -31.105 -42.492 11.227  1.00 115.81 ? 173 GLN A CD  1 
ATOM   1381 O OE1 . GLN A 1 184 ? -31.243 -43.719 11.313  1.00 113.28 ? 173 GLN A OE1 1 
ATOM   1382 N NE2 . GLN A 1 184 ? -32.072 -41.710 10.761  1.00 112.14 ? 173 GLN A NE2 1 
ATOM   1383 N N   . HIS A 1 185 ? -26.049 -41.886 8.759   1.00 44.61  ? 174 HIS A N   1 
ATOM   1384 C CA  . HIS A 1 185 ? -25.314 -41.448 7.576   1.00 43.53  ? 174 HIS A CA  1 
ATOM   1385 C C   . HIS A 1 185 ? -24.165 -42.318 7.061   1.00 48.25  ? 174 HIS A C   1 
ATOM   1386 O O   . HIS A 1 185 ? -23.479 -41.941 6.106   1.00 48.62  ? 174 HIS A O   1 
ATOM   1387 C CB  . HIS A 1 185 ? -24.992 -39.953 7.652   1.00 43.74  ? 174 HIS A CB  1 
ATOM   1388 C CG  . HIS A 1 185 ? -26.231 -39.115 7.609   1.00 46.87  ? 174 HIS A CG  1 
ATOM   1389 N ND1 . HIS A 1 185 ? -27.104 -39.169 6.522   1.00 48.48  ? 174 HIS A ND1 1 
ATOM   1390 C CD2 . HIS A 1 185 ? -26.734 -38.261 8.531   1.00 48.63  ? 174 HIS A CD2 1 
ATOM   1391 C CE1 . HIS A 1 185 ? -28.089 -38.331 6.806   1.00 47.79  ? 174 HIS A CE1 1 
ATOM   1392 N NE2 . HIS A 1 185 ? -27.914 -37.756 7.999   1.00 48.44  ? 174 HIS A NE2 1 
ATOM   1393 N N   . TYR A 1 186 ? -23.991 -43.502 7.654   1.00 44.59  ? 175 TYR A N   1 
ATOM   1394 C CA  . TYR A 1 186 ? -23.022 -44.483 7.184   1.00 45.16  ? 175 TYR A CA  1 
ATOM   1395 C C   . TYR A 1 186 ? -23.562 -45.885 7.364   1.00 49.01  ? 175 TYR A C   1 
ATOM   1396 O O   . TYR A 1 186 ? -24.500 -46.096 8.128   1.00 48.70  ? 175 TYR A O   1 
ATOM   1397 C CB  . TYR A 1 186 ? -21.630 -44.321 7.827   1.00 47.10  ? 175 TYR A CB  1 
ATOM   1398 C CG  . TYR A 1 186 ? -21.581 -44.599 9.316   1.00 47.88  ? 175 TYR A CG  1 
ATOM   1399 C CD1 . TYR A 1 186 ? -21.776 -43.575 10.241  1.00 49.74  ? 175 TYR A CD1 1 
ATOM   1400 C CD2 . TYR A 1 186 ? -21.265 -45.870 9.799   1.00 48.32  ? 175 TYR A CD2 1 
ATOM   1401 C CE1 . TYR A 1 186 ? -21.707 -43.815 11.612  1.00 51.67  ? 175 TYR A CE1 1 
ATOM   1402 C CE2 . TYR A 1 186 ? -21.200 -46.126 11.170  1.00 48.99  ? 175 TYR A CE2 1 
ATOM   1403 C CZ  . TYR A 1 186 ? -21.436 -45.096 12.074  1.00 57.04  ? 175 TYR A CZ  1 
ATOM   1404 O OH  . TYR A 1 186 ? -21.366 -45.323 13.427  1.00 57.50  ? 175 TYR A OH  1 
ATOM   1405 N N   . GLU A 1 187 ? -22.934 -46.844 6.708   1.00 45.13  ? 176 GLU A N   1 
ATOM   1406 C CA  . GLU A 1 187 ? -23.308 -48.244 6.810   1.00 43.98  ? 176 GLU A CA  1 
ATOM   1407 C C   . GLU A 1 187 ? -22.063 -49.087 6.796   1.00 49.76  ? 176 GLU A C   1 
ATOM   1408 O O   . GLU A 1 187 ? -21.034 -48.719 6.210   1.00 48.63  ? 176 GLU A O   1 
ATOM   1409 C CB  . GLU A 1 187 ? -24.317 -48.659 5.731   1.00 44.71  ? 176 GLU A CB  1 
ATOM   1410 C CG  . GLU A 1 187 ? -23.782 -48.693 4.310   1.00 45.91  ? 176 GLU A CG  1 
ATOM   1411 C CD  . GLU A 1 187 ? -24.864 -48.774 3.256   1.00 60.51  ? 176 GLU A CD  1 
ATOM   1412 O OE1 . GLU A 1 187 ? -26.060 -48.859 3.620   1.00 56.03  ? 176 GLU A OE1 1 
ATOM   1413 O OE2 . GLU A 1 187 ? -24.515 -48.733 2.055   1.00 54.06  ? 176 GLU A OE2 1 
ATOM   1414 N N   . GLY A 1 188 ? -22.162 -50.214 7.468   1.00 48.28  ? 177 GLY A N   1 
ATOM   1415 C CA  . GLY A 1 188 ? -21.025 -51.092 7.669   1.00 48.02  ? 177 GLY A CA  1 
ATOM   1416 C C   . GLY A 1 188 ? -20.256 -50.551 8.851   1.00 52.88  ? 177 GLY A C   1 
ATOM   1417 O O   . GLY A 1 188 ? -20.811 -49.846 9.720   1.00 52.30  ? 177 GLY A O   1 
ATOM   1418 N N   . ASN A 1 189 ? -18.969 -50.858 8.872   1.00 51.08  ? 178 ASN A N   1 
ATOM   1419 C CA  . ASN A 1 189 ? -18.127 -50.421 9.981   1.00 51.94  ? 178 ASN A CA  1 
ATOM   1420 C C   . ASN A 1 189 ? -16.965 -49.577 9.520   1.00 53.84  ? 178 ASN A C   1 
ATOM   1421 O O   . ASN A 1 189 ? -16.539 -49.678 8.359   1.00 51.05  ? 178 ASN A O   1 
ATOM   1422 C CB  . ASN A 1 189 ? -17.636 -51.633 10.791  1.00 57.46  ? 178 ASN A CB  1 
ATOM   1423 C CG  . ASN A 1 189 ? -18.750 -52.399 11.460  1.00 91.80  ? 178 ASN A CG  1 
ATOM   1424 O OD1 . ASN A 1 189 ? -19.319 -51.967 12.474  1.00 88.96  ? 178 ASN A OD1 1 
ATOM   1425 N ND2 . ASN A 1 189 ? -19.088 -53.552 10.894  1.00 83.59  ? 178 ASN A ND2 1 
ATOM   1426 N N   . PHE A 1 190 ? -16.470 -48.731 10.441  1.00 51.92  ? 179 PHE A N   1 
ATOM   1427 C CA  . PHE A 1 190 ? -15.324 -47.892 10.186  1.00 53.02  ? 179 PHE A CA  1 
ATOM   1428 C C   . PHE A 1 190 ? -14.059 -48.720 10.056  1.00 60.88  ? 179 PHE A C   1 
ATOM   1429 O O   . PHE A 1 190 ? -13.889 -49.733 10.738  1.00 60.50  ? 179 PHE A O   1 
ATOM   1430 C CB  . PHE A 1 190 ? -15.144 -46.849 11.295  1.00 54.31  ? 179 PHE A CB  1 
ATOM   1431 C CG  . PHE A 1 190 ? -16.123 -45.710 11.257  1.00 55.02  ? 179 PHE A CG  1 
ATOM   1432 C CD1 . PHE A 1 190 ? -16.048 -44.739 10.263  1.00 58.10  ? 179 PHE A CD1 1 
ATOM   1433 C CD2 . PHE A 1 190 ? -17.103 -45.589 12.230  1.00 56.32  ? 179 PHE A CD2 1 
ATOM   1434 C CE1 . PHE A 1 190 ? -16.972 -43.699 10.212  1.00 58.74  ? 179 PHE A CE1 1 
ATOM   1435 C CE2 . PHE A 1 190 ? -18.018 -44.537 12.195  1.00 59.25  ? 179 PHE A CE2 1 
ATOM   1436 C CZ  . PHE A 1 190 ? -17.953 -43.604 11.179  1.00 57.95  ? 179 PHE A CZ  1 
ATOM   1437 N N   . HIS A 1 191 ? -13.206 -48.295 9.120   1.00 61.13  ? 180 HIS A N   1 
ATOM   1438 C CA  . HIS A 1 191 ? -11.876 -48.852 8.889   1.00 63.11  ? 180 HIS A CA  1 
ATOM   1439 C C   . HIS A 1 191 ? -10.932 -47.712 9.246   1.00 62.64  ? 180 HIS A C   1 
ATOM   1440 O O   . HIS A 1 191 ? -10.992 -46.650 8.624   1.00 61.06  ? 180 HIS A O   1 
ATOM   1441 C CB  . HIS A 1 191 ? -11.691 -49.335 7.439   1.00 66.12  ? 180 HIS A CB  1 
ATOM   1442 C CG  . HIS A 1 191 ? -12.656 -50.420 7.052   1.00 71.94  ? 180 HIS A CG  1 
ATOM   1443 N ND1 . HIS A 1 191 ? -13.774 -50.152 6.257   1.00 74.99  ? 180 HIS A ND1 1 
ATOM   1444 C CD2 . HIS A 1 191 ? -12.650 -51.742 7.366   1.00 74.56  ? 180 HIS A CD2 1 
ATOM   1445 C CE1 . HIS A 1 191 ? -14.399 -51.316 6.113   1.00 74.42  ? 180 HIS A CE1 1 
ATOM   1446 N NE2 . HIS A 1 191 ? -13.763 -52.300 6.761   1.00 74.57  ? 180 HIS A NE2 1 
ATOM   1447 N N   . TYR A 1 192 ? -10.149 -47.884 10.319  1.00 57.44  ? 181 TYR A N   1 
ATOM   1448 C CA  . TYR A 1 192 ? -9.282  -46.812 10.763  1.00 56.59  ? 181 TYR A CA  1 
ATOM   1449 C C   . TYR A 1 192 ? -7.917  -46.890 10.152  1.00 62.04  ? 181 TYR A C   1 
ATOM   1450 O O   . TYR A 1 192 ? -7.372  -47.980 9.988   1.00 63.38  ? 181 TYR A O   1 
ATOM   1451 C CB  . TYR A 1 192 ? -9.232  -46.735 12.286  1.00 56.82  ? 181 TYR A CB  1 
ATOM   1452 C CG  . TYR A 1 192 ? -10.577 -46.435 12.907  1.00 57.63  ? 181 TYR A CG  1 
ATOM   1453 C CD1 . TYR A 1 192 ? -11.003 -45.122 13.099  1.00 59.19  ? 181 TYR A CD1 1 
ATOM   1454 C CD2 . TYR A 1 192 ? -11.424 -47.461 13.310  1.00 57.92  ? 181 TYR A CD2 1 
ATOM   1455 C CE1 . TYR A 1 192 ? -12.230 -44.839 13.691  1.00 58.66  ? 181 TYR A CE1 1 
ATOM   1456 C CE2 . TYR A 1 192 ? -12.666 -47.192 13.880  1.00 58.51  ? 181 TYR A CE2 1 
ATOM   1457 C CZ  . TYR A 1 192 ? -13.059 -45.877 14.078  1.00 64.91  ? 181 TYR A CZ  1 
ATOM   1458 O OH  . TYR A 1 192 ? -14.275 -45.589 14.650  1.00 66.32  ? 181 TYR A OH  1 
ATOM   1459 N N   . ILE A 1 193 ? -7.383  -45.730 9.764   1.00 58.30  ? 182 ILE A N   1 
ATOM   1460 C CA  . ILE A 1 193 ? -6.044  -45.600 9.208   1.00 57.68  ? 182 ILE A CA  1 
ATOM   1461 C C   . ILE A 1 193 ? -5.321  -44.636 10.148  1.00 61.45  ? 182 ILE A C   1 
ATOM   1462 O O   . ILE A 1 193 ? -5.827  -43.543 10.394  1.00 61.73  ? 182 ILE A O   1 
ATOM   1463 C CB  . ILE A 1 193 ? -6.057  -45.135 7.717   1.00 60.68  ? 182 ILE A CB  1 
ATOM   1464 C CG1 . ILE A 1 193 ? -6.854  -46.125 6.818   1.00 61.64  ? 182 ILE A CG1 1 
ATOM   1465 C CG2 . ILE A 1 193 ? -4.632  -44.993 7.181   1.00 60.37  ? 182 ILE A CG2 1 
ATOM   1466 C CD1 . ILE A 1 193 ? -7.930  -45.542 6.013   1.00 65.34  ? 182 ILE A CD1 1 
ATOM   1467 N N   . ASN A 1 194 ? -4.181  -45.060 10.724  1.00 56.60  ? 183 ASN A N   1 
ATOM   1468 C CA  . ASN A 1 194 ? -3.426  -44.212 11.648  1.00 55.10  ? 183 ASN A CA  1 
ATOM   1469 C C   . ASN A 1 194 ? -2.652  -43.135 10.906  1.00 54.92  ? 183 ASN A C   1 
ATOM   1470 O O   . ASN A 1 194 ? -2.184  -43.353 9.782   1.00 53.63  ? 183 ASN A O   1 
ATOM   1471 C CB  . ASN A 1 194 ? -2.468  -45.030 12.524  1.00 56.78  ? 183 ASN A CB  1 
ATOM   1472 C CG  . ASN A 1 194 ? -3.115  -46.094 13.383  1.00 82.89  ? 183 ASN A CG  1 
ATOM   1473 O OD1 . ASN A 1 194 ? -2.787  -47.279 13.289  1.00 86.44  ? 183 ASN A OD1 1 
ATOM   1474 N ND2 . ASN A 1 194 ? -4.027  -45.702 14.253  1.00 70.26  ? 183 ASN A ND2 1 
ATOM   1475 N N   . LEU A 1 195 ? -2.523  -41.967 11.552  1.00 49.65  ? 184 LEU A N   1 
ATOM   1476 C CA  . LEU A 1 195 ? -1.790  -40.817 11.036  1.00 48.83  ? 184 LEU A CA  1 
ATOM   1477 C C   . LEU A 1 195 ? -0.304  -41.145 11.118  1.00 55.82  ? 184 LEU A C   1 
ATOM   1478 O O   . LEU A 1 195 ? 0.102   -41.834 12.060  1.00 56.50  ? 184 LEU A O   1 
ATOM   1479 C CB  . LEU A 1 195 ? -2.073  -39.568 11.916  1.00 47.81  ? 184 LEU A CB  1 
ATOM   1480 C CG  . LEU A 1 195 ? -3.511  -39.052 12.056  1.00 50.52  ? 184 LEU A CG  1 
ATOM   1481 C CD1 . LEU A 1 195 ? -3.568  -37.877 13.015  1.00 49.52  ? 184 LEU A CD1 1 
ATOM   1482 C CD2 . LEU A 1 195 ? -4.077  -38.638 10.724  1.00 53.37  ? 184 LEU A CD2 1 
ATOM   1483 N N   . ILE A 1 196 ? 0.517   -40.657 10.176  1.00 53.54  ? 185 ILE A N   1 
ATOM   1484 C CA  . ILE A 1 196 ? 1.971   -40.865 10.253  1.00 54.19  ? 185 ILE A CA  1 
ATOM   1485 C C   . ILE A 1 196 ? 2.456   -40.257 11.587  1.00 61.75  ? 185 ILE A C   1 
ATOM   1486 O O   . ILE A 1 196 ? 2.978   -40.960 12.463  1.00 62.05  ? 185 ILE A O   1 
ATOM   1487 C CB  . ILE A 1 196 ? 2.709   -40.228 9.036   1.00 56.70  ? 185 ILE A CB  1 
ATOM   1488 C CG1 . ILE A 1 196 ? 2.355   -40.942 7.717   1.00 56.21  ? 185 ILE A CG1 1 
ATOM   1489 C CG2 . ILE A 1 196 ? 4.232   -40.157 9.258   1.00 57.31  ? 185 ILE A CG2 1 
ATOM   1490 C CD1 . ILE A 1 196 ? 1.696   -40.068 6.773   1.00 59.23  ? 185 ILE A CD1 1 
ATOM   1491 N N   . LYS A 1 197 ? 2.194   -38.963 11.744  1.00 59.96  ? 186 LYS A N   1 
ATOM   1492 C CA  . LYS A 1 197 ? 2.575   -38.168 12.905  1.00 60.05  ? 186 LYS A CA  1 
ATOM   1493 C C   . LYS A 1 197 ? 1.385   -37.316 13.367  1.00 64.25  ? 186 LYS A C   1 
ATOM   1494 O O   . LYS A 1 197 ? 0.508   -37.002 12.557  1.00 63.98  ? 186 LYS A O   1 
ATOM   1495 C CB  . LYS A 1 197 ? 3.772   -37.256 12.533  1.00 62.54  ? 186 LYS A CB  1 
ATOM   1496 C CG  . LYS A 1 197 ? 3.510   -36.338 11.326  1.00 80.36  ? 186 LYS A CG  1 
ATOM   1497 C CD  . LYS A 1 197 ? 4.773   -35.731 10.755  1.00 88.62  ? 186 LYS A CD  1 
ATOM   1498 C CE  . LYS A 1 197 ? 4.460   -34.796 9.614   1.00 101.35 ? 186 LYS A CE  1 
ATOM   1499 N NZ  . LYS A 1 197 ? 4.069   -33.449 10.105  1.00 113.54 ? 186 LYS A NZ  1 
ATOM   1500 N N   . THR A 1 198 ? 1.353   -36.938 14.664  1.00 61.36  ? 187 THR A N   1 
ATOM   1501 C CA  . THR A 1 198 ? 0.345   -36.013 15.217  1.00 60.88  ? 187 THR A CA  1 
ATOM   1502 C C   . THR A 1 198 ? 0.717   -34.611 14.657  1.00 62.26  ? 187 THR A C   1 
ATOM   1503 O O   . THR A 1 198 ? 1.886   -34.352 14.324  1.00 62.45  ? 187 THR A O   1 
ATOM   1504 C CB  . THR A 1 198 ? 0.355   -36.043 16.767  1.00 69.50  ? 187 THR A CB  1 
ATOM   1505 O OG1 . THR A 1 198 ? 0.270   -37.395 17.209  1.00 71.13  ? 187 THR A OG1 1 
ATOM   1506 C CG2 . THR A 1 198 ? -0.791  -35.250 17.386  1.00 68.37  ? 187 THR A CG2 1 
ATOM   1507 N N   . GLY A 1 199 ? -0.280  -33.753 14.512  1.00 54.86  ? 188 GLY A N   1 
ATOM   1508 C CA  . GLY A 1 199 ? -0.075  -32.414 13.978  1.00 53.00  ? 188 GLY A CA  1 
ATOM   1509 C C   . GLY A 1 199 ? -0.708  -32.148 12.634  1.00 53.23  ? 188 GLY A C   1 
ATOM   1510 O O   . GLY A 1 199 ? -1.027  -30.998 12.330  1.00 53.64  ? 188 GLY A O   1 
ATOM   1511 N N   . VAL A 1 200 ? -0.915  -33.202 11.828  1.00 46.79  ? 189 VAL A N   1 
ATOM   1512 C CA  . VAL A 1 200 ? -1.495  -33.087 10.492  1.00 46.08  ? 189 VAL A CA  1 
ATOM   1513 C C   . VAL A 1 200 ? -2.470  -34.248 10.196  1.00 50.68  ? 189 VAL A C   1 
ATOM   1514 O O   . VAL A 1 200 ? -2.159  -35.398 10.513  1.00 51.81  ? 189 VAL A O   1 
ATOM   1515 C CB  . VAL A 1 200 ? -0.392  -32.859 9.409   1.00 49.15  ? 189 VAL A CB  1 
ATOM   1516 C CG1 . VAL A 1 200 ? 0.655   -33.981 9.388   1.00 48.94  ? 189 VAL A CG1 1 
ATOM   1517 C CG2 . VAL A 1 200 ? -0.990  -32.618 8.030   1.00 48.76  ? 189 VAL A CG2 1 
ATOM   1518 N N   . TRP A 1 201 ? -3.661  -33.945 9.615   1.00 45.32  ? 190 TRP A N   1 
ATOM   1519 C CA  . TRP A 1 201 ? -4.656  -34.970 9.259   1.00 43.56  ? 190 TRP A CA  1 
ATOM   1520 C C   . TRP A 1 201 ? -4.211  -35.630 7.954   1.00 48.94  ? 190 TRP A C   1 
ATOM   1521 O O   . TRP A 1 201 ? -4.836  -35.469 6.904   1.00 48.97  ? 190 TRP A O   1 
ATOM   1522 C CB  . TRP A 1 201 ? -6.079  -34.371 9.160   1.00 40.61  ? 190 TRP A CB  1 
ATOM   1523 C CG  . TRP A 1 201 ? -6.687  -33.985 10.472  1.00 40.27  ? 190 TRP A CG  1 
ATOM   1524 C CD1 . TRP A 1 201 ? -7.041  -32.730 10.871  1.00 42.89  ? 190 TRP A CD1 1 
ATOM   1525 C CD2 . TRP A 1 201 ? -7.047  -34.869 11.553  1.00 39.63  ? 190 TRP A CD2 1 
ATOM   1526 N NE1 . TRP A 1 201 ? -7.617  -32.773 12.124  1.00 42.02  ? 190 TRP A NE1 1 
ATOM   1527 C CE2 . TRP A 1 201 ? -7.620  -34.072 12.572  1.00 43.17  ? 190 TRP A CE2 1 
ATOM   1528 C CE3 . TRP A 1 201 ? -6.961  -36.264 11.749  1.00 40.13  ? 190 TRP A CE3 1 
ATOM   1529 C CZ2 . TRP A 1 201 ? -8.080  -34.617 13.778  1.00 41.77  ? 190 TRP A CZ2 1 
ATOM   1530 C CZ3 . TRP A 1 201 ? -7.411  -36.801 12.950  1.00 41.10  ? 190 TRP A CZ3 1 
ATOM   1531 C CH2 . TRP A 1 201 ? -7.967  -35.982 13.944  1.00 41.40  ? 190 TRP A CH2 1 
ATOM   1532 N N   . GLN A 1 202 ? -3.092  -36.347 8.031   1.00 46.89  ? 191 GLN A N   1 
ATOM   1533 C CA  . GLN A 1 202 ? -2.437  -36.968 6.894   1.00 47.48  ? 191 GLN A CA  1 
ATOM   1534 C C   . GLN A 1 202 ? -2.090  -38.417 7.211   1.00 54.49  ? 191 GLN A C   1 
ATOM   1535 O O   . GLN A 1 202 ? -1.625  -38.741 8.310   1.00 54.95  ? 191 GLN A O   1 
ATOM   1536 C CB  . GLN A 1 202 ? -1.188  -36.156 6.552   1.00 48.15  ? 191 GLN A CB  1 
ATOM   1537 C CG  . GLN A 1 202 ? -0.517  -36.493 5.242   1.00 52.03  ? 191 GLN A CG  1 
ATOM   1538 C CD  . GLN A 1 202 ? 0.655   -35.579 5.032   1.00 64.58  ? 191 GLN A CD  1 
ATOM   1539 O OE1 . GLN A 1 202 ? 0.687   -34.829 4.073   1.00 57.60  ? 191 GLN A OE1 1 
ATOM   1540 N NE2 . GLN A 1 202 ? 1.616   -35.560 5.961   1.00 57.91  ? 191 GLN A NE2 1 
ATOM   1541 N N   . ILE A 1 203 ? -2.348  -39.285 6.231   1.00 50.96  ? 192 ILE A N   1 
ATOM   1542 C CA  . ILE A 1 203 ? -2.134  -40.723 6.318   1.00 49.58  ? 192 ILE A CA  1 
ATOM   1543 C C   . ILE A 1 203 ? -1.289  -41.199 5.134   1.00 54.72  ? 192 ILE A C   1 
ATOM   1544 O O   . ILE A 1 203 ? -1.176  -40.494 4.126   1.00 54.04  ? 192 ILE A O   1 
ATOM   1545 C CB  . ILE A 1 203 ? -3.506  -41.452 6.386   1.00 51.41  ? 192 ILE A CB  1 
ATOM   1546 C CG1 . ILE A 1 203 ? -4.411  -41.115 5.145   1.00 51.50  ? 192 ILE A CG1 1 
ATOM   1547 C CG2 . ILE A 1 203 ? -4.206  -41.174 7.726   1.00 50.44  ? 192 ILE A CG2 1 
ATOM   1548 C CD1 . ILE A 1 203 ? -5.610  -42.011 4.913   1.00 52.85  ? 192 ILE A CD1 1 
ATOM   1549 N N   . GLN A 1 204 ? -0.708  -42.409 5.260   1.00 52.05  ? 193 GLN A N   1 
ATOM   1550 C CA  . GLN A 1 204 ? 0.086   -43.047 4.213   1.00 51.58  ? 193 GLN A CA  1 
ATOM   1551 C C   . GLN A 1 204 ? -0.872  -43.634 3.169   1.00 54.52  ? 193 GLN A C   1 
ATOM   1552 O O   . GLN A 1 204 ? -1.883  -44.228 3.538   1.00 53.60  ? 193 GLN A O   1 
ATOM   1553 C CB  . GLN A 1 204 ? 0.951   -44.160 4.844   1.00 53.20  ? 193 GLN A CB  1 
ATOM   1554 C CG  . GLN A 1 204 ? 1.925   -44.876 3.897   1.00 74.80  ? 193 GLN A CG  1 
ATOM   1555 C CD  . GLN A 1 204 ? 3.157   -44.067 3.578   1.00 102.45 ? 193 GLN A CD  1 
ATOM   1556 O OE1 . GLN A 1 204 ? 3.938   -43.704 4.465   1.00 102.97 ? 193 GLN A OE1 1 
ATOM   1557 N NE2 . GLN A 1 204 ? 3.375   -43.800 2.297   1.00 93.00  ? 193 GLN A NE2 1 
ATOM   1558 N N   . MET A 1 205 ? -0.553  -43.465 1.883   1.00 51.96  ? 194 MET A N   1 
ATOM   1559 C CA  . MET A 1 205 ? -1.315  -44.036 0.771   1.00 53.13  ? 194 MET A CA  1 
ATOM   1560 C C   . MET A 1 205 ? -0.360  -44.966 -0.029  1.00 60.87  ? 194 MET A C   1 
ATOM   1561 O O   . MET A 1 205 ? 0.770   -44.571 -0.352  1.00 60.54  ? 194 MET A O   1 
ATOM   1562 C CB  . MET A 1 205 ? -1.930  -42.931 -0.112  1.00 55.38  ? 194 MET A CB  1 
ATOM   1563 C CG  . MET A 1 205 ? -2.699  -43.465 -1.305  1.00 59.03  ? 194 MET A CG  1 
ATOM   1564 S SD  . MET A 1 205 ? -4.059  -42.414 -1.843  1.00 63.32  ? 194 MET A SD  1 
ATOM   1565 C CE  . MET A 1 205 ? -3.174  -41.107 -2.632  1.00 59.91  ? 194 MET A CE  1 
ATOM   1566 N N   . LYS A 1 206 ? -0.799  -46.201 -0.315  1.00 59.34  ? 195 LYS A N   1 
ATOM   1567 C CA  . LYS A 1 206 ? 0.048   -47.168 -1.011  1.00 59.61  ? 195 LYS A CA  1 
ATOM   1568 C C   . LYS A 1 206 ? -0.372  -47.522 -2.443  1.00 64.53  ? 195 LYS A C   1 
ATOM   1569 O O   . LYS A 1 206 ? -0.362  -48.696 -2.812  1.00 66.22  ? 195 LYS A O   1 
ATOM   1570 C CB  . LYS A 1 206 ? 0.320   -48.404 -0.129  1.00 62.22  ? 195 LYS A CB  1 
ATOM   1571 C CG  . LYS A 1 206 ? 1.339   -48.126 0.981   1.00 84.39  ? 195 LYS A CG  1 
ATOM   1572 C CD  . LYS A 1 206 ? 1.647   -49.347 1.856   1.00 96.37  ? 195 LYS A CD  1 
ATOM   1573 C CE  . LYS A 1 206 ? 2.550   -49.001 3.024   1.00 103.39 ? 195 LYS A CE  1 
ATOM   1574 N NZ  . LYS A 1 206 ? 2.834   -50.186 3.880   1.00 108.92 ? 195 LYS A NZ  1 
ATOM   1575 N N   . GLY A 1 207 ? -0.690  -46.510 -3.248  1.00 59.83  ? 196 GLY A N   1 
ATOM   1576 C CA  . GLY A 1 207 ? -1.075  -46.712 -4.644  1.00 59.07  ? 196 GLY A CA  1 
ATOM   1577 C C   . GLY A 1 207 ? -2.391  -46.106 -5.095  1.00 60.19  ? 196 GLY A C   1 
ATOM   1578 O O   . GLY A 1 207 ? -3.352  -46.054 -4.326  1.00 60.16  ? 196 GLY A O   1 
ATOM   1579 N N   . VAL A 1 208 ? -2.428  -45.634 -6.351  1.00 54.56  ? 197 VAL A N   1 
ATOM   1580 C CA  . VAL A 1 208 ? -3.616  -45.072 -6.992  1.00 54.24  ? 197 VAL A CA  1 
ATOM   1581 C C   . VAL A 1 208 ? -3.799  -45.839 -8.310  1.00 62.21  ? 197 VAL A C   1 
ATOM   1582 O O   . VAL A 1 208 ? -2.928  -45.797 -9.186  1.00 61.35  ? 197 VAL A O   1 
ATOM   1583 C CB  . VAL A 1 208 ? -3.592  -43.523 -7.179  1.00 56.18  ? 197 VAL A CB  1 
ATOM   1584 C CG1 . VAL A 1 208 ? -4.874  -43.024 -7.843  1.00 55.26  ? 197 VAL A CG1 1 
ATOM   1585 C CG2 . VAL A 1 208 ? -3.389  -42.810 -5.853  1.00 55.50  ? 197 VAL A CG2 1 
ATOM   1586 N N   . SER A 1 209 ? -4.909  -46.582 -8.415  1.00 61.37  ? 198 SER A N   1 
ATOM   1587 C CA  . SER A 1 209 ? -5.229  -47.421 -9.570  1.00 61.88  ? 198 SER A CA  1 
ATOM   1588 C C   . SER A 1 209 ? -6.248  -46.764 -10.480 1.00 67.37  ? 198 SER A C   1 
ATOM   1589 O O   . SER A 1 209 ? -7.296  -46.328 -10.013 1.00 67.42  ? 198 SER A O   1 
ATOM   1590 C CB  . SER A 1 209 ? -5.765  -48.781 -9.110  1.00 65.64  ? 198 SER A CB  1 
ATOM   1591 O OG  . SER A 1 209 ? -5.194  -49.224 -7.886  1.00 74.65  ? 198 SER A OG  1 
ATOM   1592 N N   . VAL A 1 210 ? -5.945  -46.711 -11.781 1.00 65.84  ? 199 VAL A N   1 
ATOM   1593 C CA  . VAL A 1 210 ? -6.839  -46.206 -12.825 1.00 67.27  ? 199 VAL A CA  1 
ATOM   1594 C C   . VAL A 1 210 ? -7.203  -47.453 -13.624 1.00 77.52  ? 199 VAL A C   1 
ATOM   1595 O O   . VAL A 1 210 ? -6.362  -47.997 -14.344 1.00 78.49  ? 199 VAL A O   1 
ATOM   1596 C CB  . VAL A 1 210 ? -6.188  -45.110 -13.714 1.00 70.49  ? 199 VAL A CB  1 
ATOM   1597 C CG1 . VAL A 1 210 ? -7.150  -44.603 -14.793 1.00 70.08  ? 199 VAL A CG1 1 
ATOM   1598 C CG2 . VAL A 1 210 ? -5.670  -43.964 -12.873 1.00 69.99  ? 199 VAL A CG2 1 
ATOM   1599 N N   . GLY A 1 211 ? -8.419  -47.936 -13.431 1.00 77.63  ? 200 GLY A N   1 
ATOM   1600 C CA  . GLY A 1 211 ? -8.881  -49.155 -14.075 1.00 79.37  ? 200 GLY A CA  1 
ATOM   1601 C C   . GLY A 1 211 ? -8.224  -50.357 -13.433 1.00 88.40  ? 200 GLY A C   1 
ATOM   1602 O O   . GLY A 1 211 ? -8.279  -50.510 -12.209 1.00 88.56  ? 200 GLY A O   1 
ATOM   1603 N N   . SER A 1 212 ? -7.553  -51.186 -14.247 1.00 88.36  ? 201 SER A N   1 
ATOM   1604 C CA  . SER A 1 212 ? -6.879  -52.395 -13.773 1.00 89.55  ? 201 SER A CA  1 
ATOM   1605 C C   . SER A 1 212 ? -5.519  -52.103 -13.133 1.00 94.40  ? 201 SER A C   1 
ATOM   1606 O O   . SER A 1 212 ? -5.259  -52.528 -11.995 1.00 94.05  ? 201 SER A O   1 
ATOM   1607 C CB  . SER A 1 212 ? -6.727  -53.399 -14.914 1.00 94.46  ? 201 SER A CB  1 
ATOM   1608 O OG  . SER A 1 212 ? -6.131  -54.602 -14.458 1.00 106.04 ? 201 SER A OG  1 
ATOM   1609 N N   . SER A 1 213 ? -4.642  -51.427 -13.891 1.00 91.30  ? 202 SER A N   1 
ATOM   1610 C CA  . SER A 1 213 ? -3.280  -51.099 -13.473 1.00 91.28  ? 202 SER A CA  1 
ATOM   1611 C C   . SER A 1 213 ? -3.177  -50.026 -12.372 1.00 94.12  ? 202 SER A C   1 
ATOM   1612 O O   . SER A 1 213 ? -3.987  -49.099 -12.327 1.00 93.78  ? 202 SER A O   1 
ATOM   1613 C CB  . SER A 1 213 ? -2.402  -50.755 -14.680 1.00 94.99  ? 202 SER A CB  1 
ATOM   1614 O OG  . SER A 1 213 ? -3.107  -50.116 -15.736 1.00 102.93 ? 202 SER A OG  1 
ATOM   1615 N N   . THR A 1 214 ? -2.180  -50.187 -11.471 1.00 89.21  ? 203 THR A N   1 
ATOM   1616 C CA  . THR A 1 214 ? -1.829  -49.261 -10.391 1.00 87.73  ? 203 THR A CA  1 
ATOM   1617 C C   . THR A 1 214 ? -0.851  -48.271 -11.023 1.00 87.99  ? 203 THR A C   1 
ATOM   1618 O O   . THR A 1 214 ? 0.365   -48.379 -10.856 1.00 87.37  ? 203 THR A O   1 
ATOM   1619 C CB  . THR A 1 214 ? -1.300  -50.016 -9.144  1.00 95.51  ? 203 THR A CB  1 
ATOM   1620 O OG1 . THR A 1 214 ? -2.279  -50.973 -8.723  1.00 99.12  ? 203 THR A OG1 1 
ATOM   1621 C CG2 . THR A 1 214 ? -0.969  -49.077 -7.977  1.00 91.49  ? 203 THR A CG2 1 
ATOM   1622 N N   . LEU A 1 215 ? -1.403  -47.344 -11.813 1.00 82.44  ? 204 LEU A N   1 
ATOM   1623 C CA  . LEU A 1 215 ? -0.649  -46.342 -12.550 1.00 81.67  ? 204 LEU A CA  1 
ATOM   1624 C C   . LEU A 1 215 ? 0.192   -45.384 -11.689 1.00 82.77  ? 204 LEU A C   1 
ATOM   1625 O O   . LEU A 1 215 ? 1.220   -44.902 -12.172 1.00 83.36  ? 204 LEU A O   1 
ATOM   1626 C CB  . LEU A 1 215 ? -1.563  -45.554 -13.527 1.00 82.10  ? 204 LEU A CB  1 
ATOM   1627 C CG  . LEU A 1 215 ? -1.956  -46.181 -14.903 1.00 87.40  ? 204 LEU A CG  1 
ATOM   1628 C CD1 . LEU A 1 215 ? -0.804  -46.943 -15.570 1.00 88.04  ? 204 LEU A CD1 1 
ATOM   1629 C CD2 . LEU A 1 215 ? -3.173  -47.057 -14.802 1.00 89.50  ? 204 LEU A CD2 1 
ATOM   1630 N N   . LEU A 1 216 ? -0.223  -45.095 -10.439 1.00 75.81  ? 205 LEU A N   1 
ATOM   1631 C CA  . LEU A 1 216 ? 0.505   -44.140 -9.605  1.00 74.09  ? 205 LEU A CA  1 
ATOM   1632 C C   . LEU A 1 216 ? 0.673   -44.560 -8.165  1.00 75.32  ? 205 LEU A C   1 
ATOM   1633 O O   . LEU A 1 216 ? 0.039   -45.517 -7.715  1.00 74.76  ? 205 LEU A O   1 
ATOM   1634 C CB  . LEU A 1 216 ? -0.207  -42.778 -9.640  1.00 74.06  ? 205 LEU A CB  1 
ATOM   1635 C CG  . LEU A 1 216 ? -0.142  -41.990 -10.936 1.00 78.94  ? 205 LEU A CG  1 
ATOM   1636 C CD1 . LEU A 1 216 ? -1.479  -41.353 -11.237 1.00 79.20  ? 205 LEU A CD1 1 
ATOM   1637 C CD2 . LEU A 1 216 ? 0.961   -40.948 -10.872 1.00 82.45  ? 205 LEU A CD2 1 
ATOM   1638 N N   . CYS A 1 217 ? 1.516   -43.800 -7.431  1.00 70.31  ? 206 CYS A N   1 
ATOM   1639 C CA  . CYS A 1 217 ? 1.781   -43.945 -6.003  1.00 69.64  ? 206 CYS A CA  1 
ATOM   1640 C C   . CYS A 1 217 ? 2.270   -45.345 -5.542  1.00 77.32  ? 206 CYS A C   1 
ATOM   1641 O O   . CYS A 1 217 ? 2.138   -45.703 -4.366  1.00 77.76  ? 206 CYS A O   1 
ATOM   1642 C CB  . CYS A 1 217 ? 0.606   -43.414 -5.180  1.00 68.76  ? 206 CYS A CB  1 
ATOM   1643 S SG  . CYS A 1 217 ? 0.879   -43.406 -3.391  1.00 72.17  ? 206 CYS A SG  1 
ATOM   1644 N N   . GLU A 1 218 ? 2.896   -46.115 -6.462  1.00 76.21  ? 207 GLU A N   1 
ATOM   1645 C CA  . GLU A 1 218 ? 3.529   -47.394 -6.103  1.00 76.95  ? 207 GLU A CA  1 
ATOM   1646 C C   . GLU A 1 218 ? 4.822   -47.006 -5.363  1.00 82.00  ? 207 GLU A C   1 
ATOM   1647 O O   . GLU A 1 218 ? 5.450   -45.997 -5.714  1.00 81.67  ? 207 GLU A O   1 
ATOM   1648 C CB  . GLU A 1 218 ? 3.767   -48.324 -7.316  1.00 78.62  ? 207 GLU A CB  1 
ATOM   1649 C CG  . GLU A 1 218 ? 4.577   -47.747 -8.468  1.00 94.82  ? 207 GLU A CG  1 
ATOM   1650 C CD  . GLU A 1 218 ? 3.821   -46.849 -9.433  1.00 127.65 ? 207 GLU A CD  1 
ATOM   1651 O OE1 . GLU A 1 218 ? 3.407   -47.344 -10.508 1.00 125.57 ? 207 GLU A OE1 1 
ATOM   1652 O OE2 . GLU A 1 218 ? 3.671   -45.642 -9.127  1.00 124.41 ? 207 GLU A OE2 1 
ATOM   1653 N N   . ASP A 1 219 ? 5.146   -47.733 -4.278  1.00 79.24  ? 208 ASP A N   1 
ATOM   1654 C CA  . ASP A 1 219 ? 6.248   -47.444 -3.336  1.00 79.50  ? 208 ASP A CA  1 
ATOM   1655 C C   . ASP A 1 219 ? 5.796   -46.384 -2.291  1.00 81.17  ? 208 ASP A C   1 
ATOM   1656 O O   . ASP A 1 219 ? 6.630   -45.862 -1.540  1.00 81.64  ? 208 ASP A O   1 
ATOM   1657 C CB  . ASP A 1 219 ? 7.599   -47.029 -4.016  1.00 82.15  ? 208 ASP A CB  1 
ATOM   1658 C CG  . ASP A 1 219 ? 8.230   -48.008 -4.994  1.00 97.06  ? 208 ASP A CG  1 
ATOM   1659 O OD1 . ASP A 1 219 ? 7.977   -49.231 -4.866  1.00 98.06  ? 208 ASP A OD1 1 
ATOM   1660 O OD2 . ASP A 1 219 ? 9.023   -47.557 -5.855  1.00 103.53 ? 208 ASP A OD2 1 
ATOM   1661 N N   . GLY A 1 220 ? 4.490   -46.090 -2.253  1.00 74.39  ? 209 GLY A N   1 
ATOM   1662 C CA  . GLY A 1 220 ? 3.891   -45.148 -1.313  1.00 72.87  ? 209 GLY A CA  1 
ATOM   1663 C C   . GLY A 1 220 ? 3.968   -43.673 -1.663  1.00 73.56  ? 209 GLY A C   1 
ATOM   1664 O O   . GLY A 1 220 ? 4.789   -43.240 -2.480  1.00 72.17  ? 209 GLY A O   1 
ATOM   1665 N N   . CYS A 1 221 ? 3.058   -42.903 -1.044  1.00 68.32  ? 210 CYS A N   1 
ATOM   1666 C CA  . CYS A 1 221 ? 2.915   -41.443 -1.113  1.00 66.86  ? 210 CYS A CA  1 
ATOM   1667 C C   . CYS A 1 221 ? 1.989   -41.005 0.014   1.00 65.90  ? 210 CYS A C   1 
ATOM   1668 O O   . CYS A 1 221 ? 1.529   -41.852 0.784   1.00 65.82  ? 210 CYS A O   1 
ATOM   1669 C CB  . CYS A 1 221 ? 2.420   -40.971 -2.478  1.00 67.70  ? 210 CYS A CB  1 
ATOM   1670 S SG  . CYS A 1 221 ? 0.723   -41.458 -2.859  1.00 71.93  ? 210 CYS A SG  1 
ATOM   1671 N N   . LEU A 1 222 ? 1.728   -39.695 0.136   1.00 58.74  ? 211 LEU A N   1 
ATOM   1672 C CA  . LEU A 1 222 ? 0.885   -39.171 1.219   1.00 55.68  ? 211 LEU A CA  1 
ATOM   1673 C C   . LEU A 1 222 ? -0.507  -38.707 0.776   1.00 53.75  ? 211 LEU A C   1 
ATOM   1674 O O   . LEU A 1 222 ? -0.707  -38.317 -0.380  1.00 52.14  ? 211 LEU A O   1 
ATOM   1675 C CB  . LEU A 1 222 ? 1.610   -38.033 1.957   1.00 55.07  ? 211 LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 222 ? 3.053   -38.252 2.393   1.00 58.46  ? 211 LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 222 ? 3.691   -36.941 2.804   1.00 57.46  ? 211 LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 222 ? 3.142   -39.274 3.507   1.00 61.08  ? 211 LEU A CD2 1 
ATOM   1679 N N   . ALA A 1 223 ? -1.455  -38.726 1.719   1.00 48.19  ? 212 ALA A N   1 
ATOM   1680 C CA  . ALA A 1 223 ? -2.833  -38.271 1.515   1.00 47.39  ? 212 ALA A CA  1 
ATOM   1681 C C   . ALA A 1 223 ? -3.339  -37.441 2.701   1.00 50.50  ? 212 ALA A C   1 
ATOM   1682 O O   . ALA A 1 223 ? -3.507  -37.945 3.819   1.00 50.89  ? 212 ALA A O   1 
ATOM   1683 C CB  . ALA A 1 223 ? -3.755  -39.451 1.263   1.00 47.96  ? 212 ALA A CB  1 
ATOM   1684 N N   . LEU A 1 224 ? -3.539  -36.152 2.458   1.00 45.13  ? 213 LEU A N   1 
ATOM   1685 C CA  . LEU A 1 224 ? -4.088  -35.236 3.450   1.00 43.91  ? 213 LEU A CA  1 
ATOM   1686 C C   . LEU A 1 224 ? -5.629  -35.335 3.327   1.00 45.65  ? 213 LEU A C   1 
ATOM   1687 O O   . LEU A 1 224 ? -6.152  -35.340 2.208   1.00 45.53  ? 213 LEU A O   1 
ATOM   1688 C CB  . LEU A 1 224 ? -3.570  -33.818 3.135   1.00 43.82  ? 213 LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 224 ? -4.137  -32.628 3.905   1.00 48.00  ? 213 LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 224 ? -3.715  -32.663 5.362   1.00 47.95  ? 213 LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 224 ? -3.691  -31.337 3.259   1.00 48.25  ? 213 LEU A CD2 1 
ATOM   1692 N N   . VAL A 1 225 ? -6.341  -35.520 4.444   1.00 40.66  ? 214 VAL A N   1 
ATOM   1693 C CA  . VAL A 1 225 ? -7.808  -35.610 4.389   1.00 40.20  ? 214 VAL A CA  1 
ATOM   1694 C C   . VAL A 1 225 ? -8.311  -34.209 4.724   1.00 44.96  ? 214 VAL A C   1 
ATOM   1695 O O   . VAL A 1 225 ? -8.317  -33.803 5.886   1.00 44.65  ? 214 VAL A O   1 
ATOM   1696 C CB  . VAL A 1 225 ? -8.402  -36.751 5.273   1.00 43.60  ? 214 VAL A CB  1 
ATOM   1697 C CG1 . VAL A 1 225 ? -9.926  -36.784 5.181   1.00 43.39  ? 214 VAL A CG1 1 
ATOM   1698 C CG2 . VAL A 1 225 ? -7.821  -38.115 4.884   1.00 42.82  ? 214 VAL A CG2 1 
ATOM   1699 N N   . ASP A 1 226 ? -8.628  -33.436 3.671   1.00 40.70  ? 215 ASP A N   1 
ATOM   1700 C CA  . ASP A 1 226 ? -9.022  -32.024 3.730   1.00 38.02  ? 215 ASP A CA  1 
ATOM   1701 C C   . ASP A 1 226 ? -10.507 -31.792 3.404   1.00 39.74  ? 215 ASP A C   1 
ATOM   1702 O O   . ASP A 1 226 ? -10.905 -31.798 2.240   1.00 38.03  ? 215 ASP A O   1 
ATOM   1703 C CB  . ASP A 1 226 ? -8.109  -31.217 2.787   1.00 38.63  ? 215 ASP A CB  1 
ATOM   1704 C CG  . ASP A 1 226 ? -8.174  -29.718 2.908   1.00 43.37  ? 215 ASP A CG  1 
ATOM   1705 O OD1 . ASP A 1 226 ? -9.213  -29.201 3.367   1.00 44.62  ? 215 ASP A OD1 1 
ATOM   1706 O OD2 . ASP A 1 226 ? -7.209  -29.055 2.498   1.00 47.08  ? 215 ASP A OD2 1 
ATOM   1707 N N   . THR A 1 227 ? -11.308 -31.525 4.453   1.00 36.34  ? 216 THR A N   1 
ATOM   1708 C CA  . THR A 1 227 ? -12.754 -31.252 4.372   1.00 34.96  ? 216 THR A CA  1 
ATOM   1709 C C   . THR A 1 227 ? -13.106 -29.964 3.626   1.00 37.47  ? 216 THR A C   1 
ATOM   1710 O O   . THR A 1 227 ? -14.215 -29.859 3.095   1.00 36.39  ? 216 THR A O   1 
ATOM   1711 C CB  . THR A 1 227 ? -13.390 -31.313 5.761   1.00 40.66  ? 216 THR A CB  1 
ATOM   1712 O OG1 . THR A 1 227 ? -12.755 -30.353 6.606   1.00 41.15  ? 216 THR A OG1 1 
ATOM   1713 C CG2 . THR A 1 227 ? -13.286 -32.704 6.387   1.00 38.20  ? 216 THR A CG2 1 
ATOM   1714 N N   . GLY A 1 228 ? -12.164 -29.012 3.581   1.00 34.13  ? 217 GLY A N   1 
ATOM   1715 C CA  . GLY A 1 228 ? -12.328 -27.728 2.900   1.00 33.68  ? 217 GLY A CA  1 
ATOM   1716 C C   . GLY A 1 228 ? -12.010 -27.759 1.415   1.00 38.45  ? 217 GLY A C   1 
ATOM   1717 O O   . GLY A 1 228 ? -12.461 -26.885 0.673   1.00 39.85  ? 217 GLY A O   1 
ATOM   1718 N N   . ALA A 1 229 ? -11.245 -28.759 0.962   1.00 32.70  ? 218 ALA A N   1 
ATOM   1719 C CA  . ALA A 1 229 ? -10.899 -28.892 -0.445  1.00 31.98  ? 218 ALA A CA  1 
ATOM   1720 C C   . ALA A 1 229 ? -12.130 -29.388 -1.213  1.00 38.61  ? 218 ALA A C   1 
ATOM   1721 O O   . ALA A 1 229 ? -12.759 -30.376 -0.808  1.00 39.82  ? 218 ALA A O   1 
ATOM   1722 C CB  . ALA A 1 229 ? -9.730  -29.870 -0.601  1.00 32.49  ? 218 ALA A CB  1 
ATOM   1723 N N   . SER A 1 230 ? -12.487 -28.701 -2.319  1.00 34.24  ? 219 SER A N   1 
ATOM   1724 C CA  . SER A 1 230 ? -13.648 -29.052 -3.139  1.00 32.43  ? 219 SER A CA  1 
ATOM   1725 C C   . SER A 1 230 ? -13.496 -30.363 -3.852  1.00 40.62  ? 219 SER A C   1 
ATOM   1726 O O   . SER A 1 230 ? -14.485 -31.082 -4.045  1.00 42.45  ? 219 SER A O   1 
ATOM   1727 C CB  . SER A 1 230 ? -13.886 -27.982 -4.190  1.00 31.16  ? 219 SER A CB  1 
ATOM   1728 O OG  . SER A 1 230 ? -14.290 -26.774 -3.580  1.00 37.94  ? 219 SER A OG  1 
ATOM   1729 N N   . TYR A 1 231 ? -12.265 -30.627 -4.335  1.00 37.21  ? 220 TYR A N   1 
ATOM   1730 C CA  . TYR A 1 231 ? -11.917 -31.762 -5.161  1.00 36.29  ? 220 TYR A CA  1 
ATOM   1731 C C   . TYR A 1 231 ? -10.849 -32.622 -4.517  1.00 37.81  ? 220 TYR A C   1 
ATOM   1732 O O   . TYR A 1 231 ? -10.279 -32.248 -3.491  1.00 36.29  ? 220 TYR A O   1 
ATOM   1733 C CB  . TYR A 1 231 ? -11.329 -31.219 -6.476  1.00 38.38  ? 220 TYR A CB  1 
ATOM   1734 C CG  . TYR A 1 231 ? -12.254 -30.449 -7.394  1.00 42.92  ? 220 TYR A CG  1 
ATOM   1735 C CD1 . TYR A 1 231 ? -11.787 -29.917 -8.595  1.00 46.63  ? 220 TYR A CD1 1 
ATOM   1736 C CD2 . TYR A 1 231 ? -13.615 -30.339 -7.120  1.00 44.13  ? 220 TYR A CD2 1 
ATOM   1737 C CE1 . TYR A 1 231 ? -12.639 -29.229 -9.462  1.00 50.76  ? 220 TYR A CE1 1 
ATOM   1738 C CE2 . TYR A 1 231 ? -14.466 -29.618 -7.954  1.00 45.64  ? 220 TYR A CE2 1 
ATOM   1739 C CZ  . TYR A 1 231 ? -13.977 -29.069 -9.130  1.00 58.83  ? 220 TYR A CZ  1 
ATOM   1740 O OH  . TYR A 1 231 ? -14.825 -28.391 -9.979  1.00 63.11  ? 220 TYR A OH  1 
ATOM   1741 N N   . ILE A 1 232 ? -10.586 -33.789 -5.134  1.00 34.45  ? 221 ILE A N   1 
ATOM   1742 C CA  . ILE A 1 232 ? -9.439  -34.640 -4.848  1.00 35.36  ? 221 ILE A CA  1 
ATOM   1743 C C   . ILE A 1 232 ? -8.284  -33.943 -5.624  1.00 38.55  ? 221 ILE A C   1 
ATOM   1744 O O   . ILE A 1 232 ? -8.467  -33.587 -6.784  1.00 38.37  ? 221 ILE A O   1 
ATOM   1745 C CB  . ILE A 1 232 ? -9.652  -36.116 -5.332  1.00 38.83  ? 221 ILE A CB  1 
ATOM   1746 C CG1 . ILE A 1 232 ? -10.572 -36.884 -4.349  1.00 38.98  ? 221 ILE A CG1 1 
ATOM   1747 C CG2 . ILE A 1 232 ? -8.293  -36.855 -5.564  1.00 39.36  ? 221 ILE A CG2 1 
ATOM   1748 C CD1 . ILE A 1 232 ? -11.170 -38.063 -4.892  1.00 37.88  ? 221 ILE A CD1 1 
ATOM   1749 N N   . SER A 1 233 ? -7.147  -33.696 -4.981  1.00 35.78  ? 222 SER A N   1 
ATOM   1750 C CA  . SER A 1 233 ? -5.987  -33.093 -5.652  1.00 35.35  ? 222 SER A CA  1 
ATOM   1751 C C   . SER A 1 233 ? -4.738  -33.949 -5.525  1.00 39.48  ? 222 SER A C   1 
ATOM   1752 O O   . SER A 1 233 ? -4.587  -34.706 -4.572  1.00 37.22  ? 222 SER A O   1 
ATOM   1753 C CB  . SER A 1 233 ? -5.725  -31.670 -5.156  1.00 36.73  ? 222 SER A CB  1 
ATOM   1754 O OG  . SER A 1 233 ? -5.217  -31.629 -3.829  1.00 41.23  ? 222 SER A OG  1 
ATOM   1755 N N   . GLY A 1 234 ? -3.856  -33.804 -6.496  1.00 40.11  ? 223 GLY A N   1 
ATOM   1756 C CA  . GLY A 1 234 ? -2.538  -34.430 -6.521  1.00 41.48  ? 223 GLY A CA  1 
ATOM   1757 C C   . GLY A 1 234 ? -1.521  -33.430 -7.026  1.00 49.23  ? 223 GLY A C   1 
ATOM   1758 O O   . GLY A 1 234 ? -1.886  -32.295 -7.366  1.00 49.19  ? 223 GLY A O   1 
ATOM   1759 N N   . SER A 1 235 ? -0.237  -33.836 -7.090  1.00 48.31  ? 224 SER A N   1 
ATOM   1760 C CA  . SER A 1 235 ? 0.841   -32.985 -7.611  1.00 48.65  ? 224 SER A CA  1 
ATOM   1761 C C   . SER A 1 235 ? 0.601   -32.823 -9.103  1.00 51.66  ? 224 SER A C   1 
ATOM   1762 O O   . SER A 1 235 ? -0.037  -33.694 -9.696  1.00 49.92  ? 224 SER A O   1 
ATOM   1763 C CB  . SER A 1 235 ? 2.198   -33.634 -7.363  1.00 53.00  ? 224 SER A CB  1 
ATOM   1764 O OG  . SER A 1 235 ? 2.301   -34.864 -8.060  1.00 63.49  ? 224 SER A OG  1 
ATOM   1765 N N   . THR A 1 236 ? 1.082   -31.719 -9.710  1.00 49.63  ? 225 THR A N   1 
ATOM   1766 C CA  . THR A 1 236 ? 0.892   -31.475 -11.143 1.00 50.11  ? 225 THR A CA  1 
ATOM   1767 C C   . THR A 1 236 ? 1.332   -32.674 -12.001 1.00 57.65  ? 225 THR A C   1 
ATOM   1768 O O   . THR A 1 236 ? 0.593   -33.053 -12.907 1.00 57.79  ? 225 THR A O   1 
ATOM   1769 C CB  . THR A 1 236 ? 1.457   -30.114 -11.570 1.00 51.61  ? 225 THR A CB  1 
ATOM   1770 O OG1 . THR A 1 236 ? 0.901   -29.113 -10.733 1.00 49.54  ? 225 THR A OG1 1 
ATOM   1771 C CG2 . THR A 1 236 ? 1.108   -29.761 -13.006 1.00 48.34  ? 225 THR A CG2 1 
ATOM   1772 N N   . SER A 1 237 ? 2.478   -33.311 -11.661 1.00 55.12  ? 226 SER A N   1 
ATOM   1773 C CA  . SER A 1 237 ? 2.985   -34.481 -12.377 1.00 55.27  ? 226 SER A CA  1 
ATOM   1774 C C   . SER A 1 237 ? 2.075   -35.704 -12.230 1.00 57.59  ? 226 SER A C   1 
ATOM   1775 O O   . SER A 1 237 ? 1.791   -36.346 -13.243 1.00 58.05  ? 226 SER A O   1 
ATOM   1776 C CB  . SER A 1 237 ? 4.431   -34.792 -11.993 1.00 60.56  ? 226 SER A CB  1 
ATOM   1777 O OG  . SER A 1 237 ? 4.614   -34.954 -10.595 1.00 71.00  ? 226 SER A OG  1 
ATOM   1778 N N   . SER A 1 238 ? 1.592   -36.007 -10.999 1.00 52.25  ? 227 SER A N   1 
ATOM   1779 C CA  . SER A 1 238 ? 0.655   -37.120 -10.752 1.00 50.99  ? 227 SER A CA  1 
ATOM   1780 C C   . SER A 1 238 ? -0.668  -36.889 -11.505 1.00 55.02  ? 227 SER A C   1 
ATOM   1781 O O   . SER A 1 238 ? -1.205  -37.828 -12.091 1.00 53.64  ? 227 SER A O   1 
ATOM   1782 C CB  . SER A 1 238 ? 0.340   -37.258 -9.268  1.00 53.26  ? 227 SER A CB  1 
ATOM   1783 O OG  . SER A 1 238 ? 1.483   -37.575 -8.496  1.00 61.25  ? 227 SER A OG  1 
ATOM   1784 N N   . ILE A 1 239 ? -1.165  -35.622 -11.498 1.00 52.18  ? 228 ILE A N   1 
ATOM   1785 C CA  . ILE A 1 239 ? -2.417  -35.205 -12.129 1.00 52.40  ? 228 ILE A CA  1 
ATOM   1786 C C   . ILE A 1 239 ? -2.381  -35.271 -13.652 1.00 59.84  ? 228 ILE A C   1 
ATOM   1787 O O   . ILE A 1 239 ? -3.232  -35.937 -14.240 1.00 59.83  ? 228 ILE A O   1 
ATOM   1788 C CB  . ILE A 1 239 ? -3.027  -33.907 -11.500 1.00 54.36  ? 228 ILE A CB  1 
ATOM   1789 C CG1 . ILE A 1 239 ? -3.436  -34.127 -10.030 1.00 54.40  ? 228 ILE A CG1 1 
ATOM   1790 C CG2 . ILE A 1 239 ? -4.190  -33.323 -12.299 1.00 54.22  ? 228 ILE A CG2 1 
ATOM   1791 C CD1 . ILE A 1 239 ? -4.288  -35.368 -9.688  1.00 59.44  ? 228 ILE A CD1 1 
ATOM   1792 N N   . GLU A 1 240 ? -1.368  -34.639 -14.276 1.00 59.03  ? 229 GLU A N   1 
ATOM   1793 C CA  . GLU A 1 240 ? -1.085  -34.641 -15.723 1.00 59.27  ? 229 GLU A CA  1 
ATOM   1794 C C   . GLU A 1 240 ? -0.999  -36.113 -16.244 1.00 61.38  ? 229 GLU A C   1 
ATOM   1795 O O   . GLU A 1 240 ? -1.513  -36.404 -17.333 1.00 58.94  ? 229 GLU A O   1 
ATOM   1796 C CB  . GLU A 1 240 ? 0.207   -33.832 -15.976 1.00 61.18  ? 229 GLU A CB  1 
ATOM   1797 C CG  . GLU A 1 240 ? 0.849   -33.938 -17.355 1.00 81.87  ? 229 GLU A CG  1 
ATOM   1798 C CD  . GLU A 1 240 ? 2.366   -34.095 -17.381 1.00 112.14 ? 229 GLU A CD  1 
ATOM   1799 O OE1 . GLU A 1 240 ? 3.027   -33.813 -16.352 1.00 99.97  ? 229 GLU A OE1 1 
ATOM   1800 O OE2 . GLU A 1 240 ? 2.895   -34.502 -18.442 1.00 107.86 ? 229 GLU A OE2 1 
ATOM   1801 N N   . LYS A 1 241 ? -0.443  -37.040 -15.408 1.00 58.89  ? 230 LYS A N   1 
ATOM   1802 C CA  . LYS A 1 241 ? -0.327  -38.472 -15.714 1.00 59.73  ? 230 LYS A CA  1 
ATOM   1803 C C   . LYS A 1 241 ? -1.687  -39.169 -15.603 1.00 64.79  ? 230 LYS A C   1 
ATOM   1804 O O   . LYS A 1 241 ? -2.071  -39.856 -16.543 1.00 65.08  ? 230 LYS A O   1 
ATOM   1805 C CB  . LYS A 1 241 ? 0.733   -39.165 -14.830 1.00 63.23  ? 230 LYS A CB  1 
ATOM   1806 C CG  . LYS A 1 241 ? 1.332   -40.423 -15.464 1.00 83.78  ? 230 LYS A CG  1 
ATOM   1807 C CD  . LYS A 1 241 ? 1.722   -41.487 -14.435 1.00 94.86  ? 230 LYS A CD  1 
ATOM   1808 C CE  . LYS A 1 241 ? 3.205   -41.804 -14.421 1.00 105.21 ? 230 LYS A CE  1 
ATOM   1809 N NZ  . LYS A 1 241 ? 3.561   -42.805 -13.373 1.00 108.55 ? 230 LYS A NZ  1 
ATOM   1810 N N   . LEU A 1 242 ? -2.399  -39.007 -14.457 1.00 61.94  ? 231 LEU A N   1 
ATOM   1811 C CA  . LEU A 1 242 ? -3.747  -39.529 -14.204 1.00 61.93  ? 231 LEU A CA  1 
ATOM   1812 C C   . LEU A 1 242 ? -4.716  -39.061 -15.308 1.00 64.97  ? 231 LEU A C   1 
ATOM   1813 O O   . LEU A 1 242 ? -5.446  -39.884 -15.857 1.00 63.93  ? 231 LEU A O   1 
ATOM   1814 C CB  . LEU A 1 242 ? -4.245  -39.078 -12.799 1.00 62.27  ? 231 LEU A CB  1 
ATOM   1815 C CG  . LEU A 1 242 ? -5.767  -39.130 -12.481 1.00 66.77  ? 231 LEU A CG  1 
ATOM   1816 C CD1 . LEU A 1 242 ? -6.247  -40.528 -12.333 1.00 66.66  ? 231 LEU A CD1 1 
ATOM   1817 C CD2 . LEU A 1 242 ? -6.079  -38.426 -11.189 1.00 69.46  ? 231 LEU A CD2 1 
ATOM   1818 N N   . MET A 1 243 ? -4.698  -37.753 -15.644 1.00 61.52  ? 232 MET A N   1 
ATOM   1819 C CA  . MET A 1 243 ? -5.564  -37.166 -16.667 1.00 61.55  ? 232 MET A CA  1 
ATOM   1820 C C   . MET A 1 243 ? -5.334  -37.712 -18.063 1.00 71.81  ? 232 MET A C   1 
ATOM   1821 O O   . MET A 1 243 ? -6.296  -37.856 -18.817 1.00 72.12  ? 232 MET A O   1 
ATOM   1822 C CB  . MET A 1 243 ? -5.534  -35.632 -16.628 1.00 62.52  ? 232 MET A CB  1 
ATOM   1823 C CG  . MET A 1 243 ? -6.140  -35.068 -15.343 1.00 64.22  ? 232 MET A CG  1 
ATOM   1824 S SD  . MET A 1 243 ? -7.894  -35.442 -15.119 1.00 65.60  ? 232 MET A SD  1 
ATOM   1825 C CE  . MET A 1 243 ? -8.134  -34.844 -13.515 1.00 62.39  ? 232 MET A CE  1 
ATOM   1826 N N   . GLU A 1 244 ? -4.067  -38.041 -18.399 1.00 71.79  ? 233 GLU A N   1 
ATOM   1827 C CA  . GLU A 1 244 ? -3.671  -38.639 -19.679 1.00 72.30  ? 233 GLU A CA  1 
ATOM   1828 C C   . GLU A 1 244 ? -4.323  -40.027 -19.783 1.00 74.62  ? 233 GLU A C   1 
ATOM   1829 O O   . GLU A 1 244 ? -4.919  -40.347 -20.814 1.00 73.95  ? 233 GLU A O   1 
ATOM   1830 C CB  . GLU A 1 244 ? -2.144  -38.764 -19.747 1.00 74.27  ? 233 GLU A CB  1 
ATOM   1831 C CG  . GLU A 1 244 ? -1.579  -38.892 -21.153 1.00 90.02  ? 233 GLU A CG  1 
ATOM   1832 C CD  . GLU A 1 244 ? -0.086  -39.165 -21.215 1.00 119.60 ? 233 GLU A CD  1 
ATOM   1833 O OE1 . GLU A 1 244 ? 0.326   -40.065 -21.984 1.00 114.36 ? 233 GLU A OE1 1 
ATOM   1834 O OE2 . GLU A 1 244 ? 0.673   -38.481 -20.489 1.00 116.84 ? 233 GLU A OE2 1 
ATOM   1835 N N   . ALA A 1 245 ? -4.266  -40.811 -18.682 1.00 70.22  ? 234 ALA A N   1 
ATOM   1836 C CA  . ALA A 1 245 ? -4.860  -42.144 -18.575 1.00 69.58  ? 234 ALA A CA  1 
ATOM   1837 C C   . ALA A 1 245 ? -6.374  -42.102 -18.772 1.00 73.47  ? 234 ALA A C   1 
ATOM   1838 O O   . ALA A 1 245 ? -6.919  -42.987 -19.432 1.00 73.84  ? 234 ALA A O   1 
ATOM   1839 C CB  . ALA A 1 245 ? -4.522  -42.768 -17.226 1.00 70.15  ? 234 ALA A CB  1 
ATOM   1840 N N   . LEU A 1 246 ? -7.047  -41.067 -18.229 1.00 68.91  ? 235 LEU A N   1 
ATOM   1841 C CA  . LEU A 1 246 ? -8.499  -40.922 -18.349 1.00 67.89  ? 235 LEU A CA  1 
ATOM   1842 C C   . LEU A 1 246 ? -8.905  -40.389 -19.712 1.00 69.95  ? 235 LEU A C   1 
ATOM   1843 O O   . LEU A 1 246 ? -9.977  -40.727 -20.192 1.00 69.97  ? 235 LEU A O   1 
ATOM   1844 C CB  . LEU A 1 246 ? -9.081  -40.018 -17.245 1.00 67.73  ? 235 LEU A CB  1 
ATOM   1845 C CG  . LEU A 1 246 ? -8.873  -40.427 -15.776 1.00 71.53  ? 235 LEU A CG  1 
ATOM   1846 C CD1 . LEU A 1 246 ? -9.352  -39.337 -14.861 1.00 71.10  ? 235 LEU A CD1 1 
ATOM   1847 C CD2 . LEU A 1 246 ? -9.584  -41.732 -15.435 1.00 73.82  ? 235 LEU A CD2 1 
ATOM   1848 N N   . GLY A 1 247 ? -8.055  -39.568 -20.317 1.00 65.19  ? 236 GLY A N   1 
ATOM   1849 C CA  . GLY A 1 247 ? -8.320  -38.966 -21.617 1.00 64.74  ? 236 GLY A CA  1 
ATOM   1850 C C   . GLY A 1 247 ? -8.832  -37.553 -21.505 1.00 69.57  ? 236 GLY A C   1 
ATOM   1851 O O   . GLY A 1 247 ? -9.327  -36.990 -22.481 1.00 67.71  ? 236 GLY A O   1 
ATOM   1852 N N   . ALA A 1 248 ? -8.701  -36.969 -20.302 1.00 69.11  ? 237 ALA A N   1 
ATOM   1853 C CA  . ALA A 1 248 ? -9.142  -35.608 -19.973 1.00 69.40  ? 237 ALA A CA  1 
ATOM   1854 C C   . ALA A 1 248 ? -8.174  -34.585 -20.522 1.00 74.49  ? 237 ALA A C   1 
ATOM   1855 O O   . ALA A 1 248 ? -6.973  -34.866 -20.617 1.00 74.48  ? 237 ALA A O   1 
ATOM   1856 C CB  . ALA A 1 248 ? -9.298  -35.447 -18.463 1.00 70.09  ? 237 ALA A CB  1 
ATOM   1857 N N   . LYS A 1 249 ? -8.712  -33.406 -20.891 1.00 71.73  ? 238 LYS A N   1 
ATOM   1858 C CA  . LYS A 1 249 ? -8.026  -32.261 -21.477 1.00 72.28  ? 238 LYS A CA  1 
ATOM   1859 C C   . LYS A 1 249 ? -7.792  -31.166 -20.463 1.00 79.73  ? 238 LYS A C   1 
ATOM   1860 O O   . LYS A 1 249 ? -8.740  -30.655 -19.856 1.00 78.21  ? 238 LYS A O   1 
ATOM   1861 C CB  . LYS A 1 249 ? -8.852  -31.689 -22.635 1.00 75.09  ? 238 LYS A CB  1 
ATOM   1862 C CG  . LYS A 1 249 ? -8.488  -32.249 -24.009 1.00 96.62  ? 238 LYS A CG  1 
ATOM   1863 C CD  . LYS A 1 249 ? -9.579  -31.974 -25.066 1.00 111.98 ? 238 LYS A CD  1 
ATOM   1864 C CE  . LYS A 1 249 ? -9.748  -30.523 -25.492 1.00 127.98 ? 238 LYS A CE  1 
ATOM   1865 N NZ  . LYS A 1 249 ? -8.585  -30.016 -26.270 1.00 138.70 ? 238 LYS A NZ  1 
ATOM   1866 N N   . LYS A 1 250 ? -6.520  -30.764 -20.326 1.00 80.70  ? 239 LYS A N   1 
ATOM   1867 C CA  . LYS A 1 250 ? -6.095  -29.708 -19.408 1.00 81.86  ? 239 LYS A CA  1 
ATOM   1868 C C   . LYS A 1 250 ? -6.550  -28.338 -19.870 1.00 87.53  ? 239 LYS A C   1 
ATOM   1869 O O   . LYS A 1 250 ? -6.237  -27.927 -20.991 1.00 88.34  ? 239 LYS A O   1 
ATOM   1870 C CB  . LYS A 1 250 ? -4.555  -29.729 -19.193 1.00 84.54  ? 239 LYS A CB  1 
ATOM   1871 C CG  . LYS A 1 250 ? -4.082  -28.846 -18.025 1.00 95.89  ? 239 LYS A CG  1 
ATOM   1872 C CD  . LYS A 1 250 ? -2.558  -28.803 -17.856 1.00 102.68 ? 239 LYS A CD  1 
ATOM   1873 C CE  . LYS A 1 250 ? -1.997  -27.392 -17.895 1.00 110.26 ? 239 LYS A CE  1 
ATOM   1874 N NZ  . LYS A 1 250 ? -2.562  -26.511 -16.831 1.00 114.89 ? 239 LYS A NZ  1 
ATOM   1875 N N   . ARG A 1 251 ? -7.267  -27.632 -19.001 1.00 84.47  ? 240 ARG A N   1 
ATOM   1876 C CA  . ARG A 1 251 ? -7.668  -26.256 -19.263 1.00 85.23  ? 240 ARG A CA  1 
ATOM   1877 C C   . ARG A 1 251 ? -6.842  -25.337 -18.321 1.00 91.89  ? 240 ARG A C   1 
ATOM   1878 O O   . ARG A 1 251 ? -5.811  -25.805 -17.794 1.00 92.36  ? 240 ARG A O   1 
ATOM   1879 C CB  . ARG A 1 251 ? -9.176  -26.077 -19.101 1.00 84.82  ? 240 ARG A CB  1 
ATOM   1880 C CG  . ARG A 1 251 ? -9.880  -25.808 -20.408 1.00 93.21  ? 240 ARG A CG  1 
ATOM   1881 C CD  . ARG A 1 251 ? -10.884 -24.693 -20.251 1.00 106.26 ? 240 ARG A CD  1 
ATOM   1882 N NE  . ARG A 1 251 ? -11.815 -24.958 -19.152 1.00 122.96 ? 240 ARG A NE  1 
ATOM   1883 C CZ  . ARG A 1 251 ? -12.965 -25.615 -19.275 1.00 136.86 ? 240 ARG A CZ  1 
ATOM   1884 N NH1 . ARG A 1 251 ? -13.353 -26.070 -20.461 1.00 124.33 ? 240 ARG A NH1 1 
ATOM   1885 N NH2 . ARG A 1 251 ? -13.742 -25.811 -18.218 1.00 119.54 ? 240 ARG A NH2 1 
ATOM   1886 N N   . LEU A 1 252 ? -7.261  -24.040 -18.131 1.00 88.12  ? 242 LEU A N   1 
ATOM   1887 C CA  . LEU A 1 252 ? -6.562  -23.060 -17.275 1.00 87.41  ? 242 LEU A CA  1 
ATOM   1888 C C   . LEU A 1 252 ? -6.477  -23.596 -15.855 1.00 87.88  ? 242 LEU A C   1 
ATOM   1889 O O   . LEU A 1 252 ? -5.368  -23.799 -15.350 1.00 88.10  ? 242 LEU A O   1 
ATOM   1890 C CB  . LEU A 1 252 ? -7.308  -21.692 -17.261 1.00 88.15  ? 242 LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 252 ? -6.536  -20.328 -17.278 1.00 93.11  ? 242 LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 252 ? -5.287  -20.300 -16.384 1.00 92.83  ? 242 LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 252 ? -6.259  -19.862 -18.687 1.00 96.15  ? 242 LEU A CD2 1 
ATOM   1894 N N   . PHE A 1 253 ? -7.657  -23.869 -15.237 1.00 80.52  ? 243 PHE A N   1 
ATOM   1895 C CA  . PHE A 1 253 ? -7.773  -24.343 -13.868 1.00 78.15  ? 243 PHE A CA  1 
ATOM   1896 C C   . PHE A 1 253 ? -8.296  -25.785 -13.736 1.00 76.86  ? 243 PHE A C   1 
ATOM   1897 O O   . PHE A 1 253 ? -7.601  -26.618 -13.152 1.00 75.47  ? 243 PHE A O   1 
ATOM   1898 C CB  . PHE A 1 253 ? -8.554  -23.325 -13.012 1.00 80.07  ? 243 PHE A CB  1 
ATOM   1899 C CG  . PHE A 1 253 ? -7.899  -21.957 -12.916 1.00 82.12  ? 243 PHE A CG  1 
ATOM   1900 C CD1 . PHE A 1 253 ? -6.901  -21.705 -11.977 1.00 85.25  ? 243 PHE A CD1 1 
ATOM   1901 C CD2 . PHE A 1 253 ? -8.279  -20.921 -13.768 1.00 84.01  ? 243 PHE A CD2 1 
ATOM   1902 C CE1 . PHE A 1 253 ? -6.292  -20.447 -11.898 1.00 85.32  ? 243 PHE A CE1 1 
ATOM   1903 C CE2 . PHE A 1 253 ? -7.668  -19.665 -13.685 1.00 85.91  ? 243 PHE A CE2 1 
ATOM   1904 C CZ  . PHE A 1 253 ? -6.679  -19.442 -12.756 1.00 83.96  ? 243 PHE A CZ  1 
ATOM   1905 N N   . ASP A 1 254 ? -9.492  -26.094 -14.274 1.00 71.16  ? 244 ASP A N   1 
ATOM   1906 C CA  . ASP A 1 254 ? -10.037 -27.454 -14.150 1.00 69.72  ? 244 ASP A CA  1 
ATOM   1907 C C   . ASP A 1 254 ? -9.963  -28.322 -15.407 1.00 68.06  ? 244 ASP A C   1 
ATOM   1908 O O   . ASP A 1 254 ? -9.848  -27.786 -16.504 1.00 66.41  ? 244 ASP A O   1 
ATOM   1909 C CB  . ASP A 1 254 ? -11.431 -27.469 -13.480 1.00 72.28  ? 244 ASP A CB  1 
ATOM   1910 C CG  . ASP A 1 254 ? -12.586 -26.826 -14.235 1.00 91.80  ? 244 ASP A CG  1 
ATOM   1911 O OD1 . ASP A 1 254 ? -12.603 -26.910 -15.492 1.00 94.01  ? 244 ASP A OD1 1 
ATOM   1912 O OD2 . ASP A 1 254 ? -13.526 -26.318 -13.566 1.00 99.72  ? 244 ASP A OD2 1 
ATOM   1913 N N   . TYR A 1 255 ? -10.042 -29.664 -15.238 1.00 62.25  ? 245 TYR A N   1 
ATOM   1914 C CA  . TYR A 1 255 ? -9.994  -30.663 -16.319 1.00 60.33  ? 245 TYR A CA  1 
ATOM   1915 C C   . TYR A 1 255 ? -11.352 -31.018 -16.885 1.00 62.20  ? 245 TYR A C   1 
ATOM   1916 O O   . TYR A 1 255 ? -12.328 -31.133 -16.134 1.00 61.71  ? 245 TYR A O   1 
ATOM   1917 C CB  . TYR A 1 255 ? -9.266  -31.925 -15.871 1.00 60.59  ? 245 TYR A CB  1 
ATOM   1918 C CG  . TYR A 1 255 ? -7.777  -31.721 -15.788 1.00 62.03  ? 245 TYR A CG  1 
ATOM   1919 C CD1 . TYR A 1 255 ? -6.943  -32.097 -16.836 1.00 63.79  ? 245 TYR A CD1 1 
ATOM   1920 C CD2 . TYR A 1 255 ? -7.196  -31.126 -14.672 1.00 63.09  ? 245 TYR A CD2 1 
ATOM   1921 C CE1 . TYR A 1 255 ? -5.562  -31.935 -16.753 1.00 64.22  ? 245 TYR A CE1 1 
ATOM   1922 C CE2 . TYR A 1 255 ? -5.823  -30.913 -14.598 1.00 63.99  ? 245 TYR A CE2 1 
ATOM   1923 C CZ  . TYR A 1 255 ? -5.009  -31.322 -15.640 1.00 72.16  ? 245 TYR A CZ  1 
ATOM   1924 O OH  . TYR A 1 255 ? -3.655  -31.109 -15.567 1.00 75.16  ? 245 TYR A OH  1 
ATOM   1925 N N   . VAL A 1 256 ? -11.417 -31.190 -18.222 1.00 57.05  ? 246 VAL A N   1 
ATOM   1926 C CA  . VAL A 1 256 ? -12.683 -31.525 -18.875 1.00 55.59  ? 246 VAL A CA  1 
ATOM   1927 C C   . VAL A 1 256 ? -12.611 -32.820 -19.642 1.00 58.68  ? 246 VAL A C   1 
ATOM   1928 O O   . VAL A 1 256 ? -11.526 -33.336 -19.905 1.00 58.78  ? 246 VAL A O   1 
ATOM   1929 C CB  . VAL A 1 256 ? -13.333 -30.382 -19.698 1.00 58.73  ? 246 VAL A CB  1 
ATOM   1930 C CG1 . VAL A 1 256 ? -13.784 -29.238 -18.808 1.00 58.26  ? 246 VAL A CG1 1 
ATOM   1931 C CG2 . VAL A 1 256 ? -12.407 -29.883 -20.790 1.00 58.41  ? 246 VAL A CG2 1 
ATOM   1932 N N   . VAL A 1 257 ? -13.782 -33.343 -19.989 1.00 53.98  ? 247 VAL A N   1 
ATOM   1933 C CA  . VAL A 1 257 ? -14.000 -34.568 -20.740 1.00 52.76  ? 247 VAL A CA  1 
ATOM   1934 C C   . VAL A 1 257 ? -15.264 -34.337 -21.555 1.00 56.71  ? 247 VAL A C   1 
ATOM   1935 O O   . VAL A 1 257 ? -16.075 -33.477 -21.186 1.00 56.44  ? 247 VAL A O   1 
ATOM   1936 C CB  . VAL A 1 257 ? -14.077 -35.770 -19.763 1.00 55.81  ? 247 VAL A CB  1 
ATOM   1937 C CG1 . VAL A 1 257 ? -15.506 -36.224 -19.461 1.00 55.48  ? 247 VAL A CG1 1 
ATOM   1938 C CG2 . VAL A 1 257 ? -13.220 -36.918 -20.231 1.00 55.57  ? 247 VAL A CG2 1 
ATOM   1939 N N   . LYS A 1 258 ? -15.406 -35.034 -22.690 1.00 53.45  ? 248 LYS A N   1 
ATOM   1940 C CA  . LYS A 1 258 ? -16.602 -34.896 -23.525 1.00 53.28  ? 248 LYS A CA  1 
ATOM   1941 C C   . LYS A 1 258 ? -17.715 -35.562 -22.730 1.00 55.01  ? 248 LYS A C   1 
ATOM   1942 O O   . LYS A 1 258 ? -17.523 -36.676 -22.241 1.00 54.00  ? 248 LYS A O   1 
ATOM   1943 C CB  . LYS A 1 258 ? -16.392 -35.577 -24.898 1.00 56.65  ? 248 LYS A CB  1 
ATOM   1944 C CG  . LYS A 1 258 ? -15.422 -34.848 -25.822 1.00 72.37  ? 248 LYS A CG  1 
ATOM   1945 C CD  . LYS A 1 258 ? -15.437 -35.414 -27.204 1.00 86.01  ? 248 LYS A CD  1 
ATOM   1946 C CE  . LYS A 1 258 ? -15.893 -34.379 -28.179 1.00 96.97  ? 248 LYS A CE  1 
ATOM   1947 N NZ  . LYS A 1 258 ? -17.152 -34.783 -28.856 1.00 104.90 ? 248 LYS A NZ  1 
ATOM   1948 N N   . CYS A 1 259 ? -18.838 -34.864 -22.528 1.00 51.88  ? 249 CYS A N   1 
ATOM   1949 C CA  . CYS A 1 259 ? -19.919 -35.399 -21.687 1.00 51.10  ? 249 CYS A CA  1 
ATOM   1950 C C   . CYS A 1 259 ? -20.389 -36.807 -22.009 1.00 54.69  ? 249 CYS A C   1 
ATOM   1951 O O   . CYS A 1 259 ? -20.685 -37.562 -21.090 1.00 54.23  ? 249 CYS A O   1 
ATOM   1952 C CB  . CYS A 1 259 ? -21.070 -34.416 -21.544 1.00 50.78  ? 249 CYS A CB  1 
ATOM   1953 S SG  . CYS A 1 259 ? -20.628 -32.904 -20.650 1.00 54.47  ? 249 CYS A SG  1 
ATOM   1954 N N   . ASN A 1 260 ? -20.357 -37.182 -23.299 1.00 51.88  ? 250 ASN A N   1 
ATOM   1955 C CA  . ASN A 1 260 ? -20.726 -38.502 -23.823 1.00 52.00  ? 250 ASN A CA  1 
ATOM   1956 C C   . ASN A 1 260 ? -19.771 -39.584 -23.350 1.00 55.94  ? 250 ASN A C   1 
ATOM   1957 O O   . ASN A 1 260 ? -20.142 -40.754 -23.250 1.00 55.10  ? 250 ASN A O   1 
ATOM   1958 C CB  . ASN A 1 260 ? -20.743 -38.470 -25.358 1.00 54.71  ? 250 ASN A CB  1 
ATOM   1959 C CG  . ASN A 1 260 ? -19.402 -38.183 -25.998 1.00 73.39  ? 250 ASN A CG  1 
ATOM   1960 O OD1 . ASN A 1 260 ? -18.983 -37.032 -26.146 1.00 69.53  ? 250 ASN A OD1 1 
ATOM   1961 N ND2 . ASN A 1 260 ? -18.703 -39.231 -26.386 1.00 61.03  ? 250 ASN A ND2 1 
ATOM   1962 N N   . GLU A 1 261 ? -18.532 -39.186 -23.085 1.00 53.29  ? 251 GLU A N   1 
ATOM   1963 C CA  . GLU A 1 261 ? -17.473 -40.091 -22.658 1.00 53.11  ? 251 GLU A CA  1 
ATOM   1964 C C   . GLU A 1 261 ? -17.451 -40.348 -21.159 1.00 56.53  ? 251 GLU A C   1 
ATOM   1965 O O   . GLU A 1 261 ? -16.936 -41.391 -20.731 1.00 56.16  ? 251 GLU A O   1 
ATOM   1966 C CB  . GLU A 1 261 ? -16.114 -39.635 -23.188 1.00 54.45  ? 251 GLU A CB  1 
ATOM   1967 C CG  . GLU A 1 261 ? -15.918 -39.998 -24.646 1.00 68.14  ? 251 GLU A CG  1 
ATOM   1968 C CD  . GLU A 1 261 ? -14.683 -39.464 -25.335 1.00 104.61 ? 251 GLU A CD  1 
ATOM   1969 O OE1 . GLU A 1 261 ? -14.359 -40.021 -26.408 1.00 120.73 ? 251 GLU A OE1 1 
ATOM   1970 O OE2 . GLU A 1 261 ? -13.953 -38.635 -24.745 1.00 99.77  ? 251 GLU A OE2 1 
ATOM   1971 N N   . GLY A 1 262 ? -18.036 -39.422 -20.389 1.00 51.48  ? 252 GLY A N   1 
ATOM   1972 C CA  . GLY A 1 262 ? -18.144 -39.497 -18.935 1.00 50.77  ? 252 GLY A CA  1 
ATOM   1973 C C   . GLY A 1 262 ? -18.464 -40.868 -18.353 1.00 54.68  ? 252 GLY A C   1 
ATOM   1974 O O   . GLY A 1 262 ? -17.619 -41.447 -17.661 1.00 54.33  ? 252 GLY A O   1 
ATOM   1975 N N   . PRO A 1 263 ? -19.653 -41.456 -18.622 1.00 52.17  ? 253 PRO A N   1 
ATOM   1976 C CA  . PRO A 1 263 ? -19.942 -42.787 -18.044 1.00 52.14  ? 253 PRO A CA  1 
ATOM   1977 C C   . PRO A 1 263 ? -19.002 -43.942 -18.453 1.00 58.47  ? 253 PRO A C   1 
ATOM   1978 O O   . PRO A 1 263 ? -18.968 -44.937 -17.737 1.00 58.31  ? 253 PRO A O   1 
ATOM   1979 C CB  . PRO A 1 263 ? -21.409 -43.037 -18.401 1.00 53.62  ? 253 PRO A CB  1 
ATOM   1980 C CG  . PRO A 1 263 ? -21.950 -41.723 -18.899 1.00 58.14  ? 253 PRO A CG  1 
ATOM   1981 C CD  . PRO A 1 263 ? -20.785 -40.956 -19.433 1.00 53.66  ? 253 PRO A CD  1 
ATOM   1982 N N   . THR A 1 264 ? -18.206 -43.796 -19.552 1.00 56.90  ? 254 THR A N   1 
ATOM   1983 C CA  . THR A 1 264 ? -17.268 -44.825 -20.025 1.00 57.49  ? 254 THR A CA  1 
ATOM   1984 C C   . THR A 1 264 ? -15.932 -44.818 -19.252 1.00 62.73  ? 254 THR A C   1 
ATOM   1985 O O   . THR A 1 264 ? -15.170 -45.780 -19.350 1.00 63.56  ? 254 THR A O   1 
ATOM   1986 C CB  . THR A 1 264 ? -17.012 -44.711 -21.552 1.00 68.21  ? 254 THR A CB  1 
ATOM   1987 O OG1 . THR A 1 264 ? -16.048 -43.683 -21.825 1.00 72.42  ? 254 THR A OG1 1 
ATOM   1988 C CG2 . THR A 1 264 ? -18.285 -44.498 -22.365 1.00 65.49  ? 254 THR A CG2 1 
ATOM   1989 N N   . LEU A 1 265 ? -15.639 -43.720 -18.522 1.00 58.58  ? 255 LEU A N   1 
ATOM   1990 C CA  . LEU A 1 265 ? -14.397 -43.517 -17.763 1.00 57.51  ? 255 LEU A CA  1 
ATOM   1991 C C   . LEU A 1 265 ? -14.102 -44.634 -16.758 1.00 59.78  ? 255 LEU A C   1 
ATOM   1992 O O   . LEU A 1 265 ? -15.038 -45.214 -16.202 1.00 59.70  ? 255 LEU A O   1 
ATOM   1993 C CB  . LEU A 1 265 ? -14.418 -42.148 -17.070 1.00 57.67  ? 255 LEU A CB  1 
ATOM   1994 C CG  . LEU A 1 265 ? -13.644 -41.001 -17.738 1.00 62.64  ? 255 LEU A CG  1 
ATOM   1995 C CD1 . LEU A 1 265 ? -14.185 -40.675 -19.113 1.00 62.50  ? 255 LEU A CD1 1 
ATOM   1996 C CD2 . LEU A 1 265 ? -13.721 -39.757 -16.907 1.00 64.54  ? 255 LEU A CD2 1 
ATOM   1997 N N   . PRO A 1 266 ? -12.818 -45.009 -16.555 1.00 54.94  ? 256 PRO A N   1 
ATOM   1998 C CA  . PRO A 1 266 ? -12.535 -46.109 -15.610 1.00 53.51  ? 256 PRO A CA  1 
ATOM   1999 C C   . PRO A 1 266 ? -12.632 -45.677 -14.164 1.00 54.31  ? 256 PRO A C   1 
ATOM   2000 O O   . PRO A 1 266 ? -12.535 -44.496 -13.869 1.00 54.21  ? 256 PRO A O   1 
ATOM   2001 C CB  . PRO A 1 266 ? -11.100 -46.515 -15.963 1.00 55.50  ? 256 PRO A CB  1 
ATOM   2002 C CG  . PRO A 1 266 ? -10.469 -45.249 -16.483 1.00 59.88  ? 256 PRO A CG  1 
ATOM   2003 C CD  . PRO A 1 266 ? -11.576 -44.468 -17.168 1.00 55.80  ? 256 PRO A CD  1 
ATOM   2004 N N   . ASP A 1 267 ? -12.770 -46.641 -13.265 1.00 49.91  ? 257 ASP A N   1 
ATOM   2005 C CA  . ASP A 1 267 ? -12.809 -46.422 -11.822 1.00 49.13  ? 257 ASP A CA  1 
ATOM   2006 C C   . ASP A 1 267 ? -11.446 -45.949 -11.350 1.00 53.69  ? 257 ASP A C   1 
ATOM   2007 O O   . ASP A 1 267 ? -10.441 -46.302 -11.967 1.00 53.89  ? 257 ASP A O   1 
ATOM   2008 C CB  . ASP A 1 267 ? -13.131 -47.745 -11.102 1.00 50.57  ? 257 ASP A CB  1 
ATOM   2009 C CG  . ASP A 1 267 ? -14.534 -48.274 -11.275 1.00 57.06  ? 257 ASP A CG  1 
ATOM   2010 O OD1 . ASP A 1 267 ? -15.384 -47.545 -11.856 1.00 57.33  ? 257 ASP A OD1 1 
ATOM   2011 O OD2 . ASP A 1 267 ? -14.795 -49.402 -10.812 1.00 62.44  ? 257 ASP A OD2 1 
ATOM   2012 N N   . ILE A 1 268 ? -11.407 -45.150 -10.270 1.00 49.71  ? 258 ILE A N   1 
ATOM   2013 C CA  . ILE A 1 268 ? -10.168 -44.682 -9.652  1.00 48.85  ? 258 ILE A CA  1 
ATOM   2014 C C   . ILE A 1 268 ? -10.176 -45.244 -8.236  1.00 52.22  ? 258 ILE A C   1 
ATOM   2015 O O   . ILE A 1 268 ? -11.158 -45.072 -7.515  1.00 51.47  ? 258 ILE A O   1 
ATOM   2016 C CB  . ILE A 1 268 ? -9.980  -43.129 -9.700  1.00 52.38  ? 258 ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 268 ? -9.972  -42.609 -11.171 1.00 53.02  ? 258 ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 268 ? -8.692  -42.709 -8.959  1.00 52.88  ? 258 ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 268 ? -9.913  -41.111 -11.382 1.00 55.03  ? 258 ILE A CD1 1 
ATOM   2020 N N   . SER A 1 269 ? -9.104  -45.956 -7.853  1.00 49.02  ? 259 SER A N   1 
ATOM   2021 C CA  . SER A 1 269 ? -9.007  -46.558 -6.529  1.00 48.22  ? 259 SER A CA  1 
ATOM   2022 C C   . SER A 1 269 ? -7.844  -46.024 -5.750  1.00 50.94  ? 259 SER A C   1 
ATOM   2023 O O   . SER A 1 269 ? -6.774  -45.804 -6.300  1.00 49.94  ? 259 SER A O   1 
ATOM   2024 C CB  . SER A 1 269 ? -8.937  -48.077 -6.621  1.00 52.21  ? 259 SER A CB  1 
ATOM   2025 O OG  . SER A 1 269 ? -10.095 -48.604 -7.250  1.00 64.72  ? 259 SER A OG  1 
ATOM   2026 N N   . PHE A 1 270 ? -8.060  -45.831 -4.454  1.00 48.65  ? 260 PHE A N   1 
ATOM   2027 C CA  . PHE A 1 270 ? -7.086  -45.316 -3.509  1.00 48.84  ? 260 PHE A CA  1 
ATOM   2028 C C   . PHE A 1 270 ? -6.832  -46.389 -2.470  1.00 57.05  ? 260 PHE A C   1 
ATOM   2029 O O   . PHE A 1 270 ? -7.769  -46.829 -1.801  1.00 56.84  ? 260 PHE A O   1 
ATOM   2030 C CB  . PHE A 1 270 ? -7.616  -44.016 -2.850  1.00 49.70  ? 260 PHE A CB  1 
ATOM   2031 C CG  . PHE A 1 270 ? -7.905  -42.901 -3.832  1.00 50.01  ? 260 PHE A CG  1 
ATOM   2032 C CD1 . PHE A 1 270 ? -6.919  -41.976 -4.171  1.00 51.94  ? 260 PHE A CD1 1 
ATOM   2033 C CD2 . PHE A 1 270 ? -9.157  -42.784 -4.431  1.00 51.20  ? 260 PHE A CD2 1 
ATOM   2034 C CE1 . PHE A 1 270 ? -7.178  -40.958 -5.095  1.00 52.54  ? 260 PHE A CE1 1 
ATOM   2035 C CE2 . PHE A 1 270 ? -9.414  -41.772 -5.362  1.00 53.89  ? 260 PHE A CE2 1 
ATOM   2036 C CZ  . PHE A 1 270 ? -8.423  -40.863 -5.685  1.00 51.82  ? 260 PHE A CZ  1 
ATOM   2037 N N   . HIS A 1 271 ? -5.575  -46.843 -2.373  1.00 57.26  ? 261 HIS A N   1 
ATOM   2038 C CA  . HIS A 1 271 ? -5.120  -47.856 -1.426  1.00 59.19  ? 261 HIS A CA  1 
ATOM   2039 C C   . HIS A 1 271 ? -4.838  -47.192 -0.085  1.00 59.68  ? 261 HIS A C   1 
ATOM   2040 O O   . HIS A 1 271 ? -3.820  -46.517 0.056   1.00 58.55  ? 261 HIS A O   1 
ATOM   2041 C CB  . HIS A 1 271 ? -3.807  -48.482 -1.920  1.00 62.42  ? 261 HIS A CB  1 
ATOM   2042 C CG  . HIS A 1 271 ? -3.929  -49.531 -2.975  1.00 67.89  ? 261 HIS A CG  1 
ATOM   2043 N ND1 . HIS A 1 271 ? -3.665  -49.246 -4.312  1.00 70.73  ? 261 HIS A ND1 1 
ATOM   2044 C CD2 . HIS A 1 271 ? -4.158  -50.860 -2.847  1.00 71.19  ? 261 HIS A CD2 1 
ATOM   2045 C CE1 . HIS A 1 271 ? -3.753  -50.403 -4.953  1.00 70.86  ? 261 HIS A CE1 1 
ATOM   2046 N NE2 . HIS A 1 271 ? -4.068  -51.402 -4.118  1.00 71.30  ? 261 HIS A NE2 1 
ATOM   2047 N N   . LEU A 1 272 ? -5.701  -47.408 0.910   1.00 55.61  ? 262 LEU A N   1 
ATOM   2048 C CA  . LEU A 1 272 ? -5.525  -46.814 2.245   1.00 55.41  ? 262 LEU A CA  1 
ATOM   2049 C C   . LEU A 1 272 ? -5.757  -47.856 3.323   1.00 61.28  ? 262 LEU A C   1 
ATOM   2050 O O   . LEU A 1 272 ? -6.799  -48.516 3.312   1.00 60.75  ? 262 LEU A O   1 
ATOM   2051 C CB  . LEU A 1 272 ? -6.493  -45.623 2.463   1.00 55.06  ? 262 LEU A CB  1 
ATOM   2052 C CG  . LEU A 1 272 ? -6.543  -44.532 1.391   1.00 58.30  ? 262 LEU A CG  1 
ATOM   2053 C CD1 . LEU A 1 272 ? -7.826  -43.744 1.484   1.00 58.07  ? 262 LEU A CD1 1 
ATOM   2054 C CD2 . LEU A 1 272 ? -5.317  -43.639 1.461   1.00 58.29  ? 262 LEU A CD2 1 
ATOM   2055 N N   . GLY A 1 273 ? -4.785  -47.990 4.229   1.00 59.93  ? 263 GLY A N   1 
ATOM   2056 C CA  . GLY A 1 273 ? -4.810  -48.931 5.347   1.00 60.45  ? 263 GLY A CA  1 
ATOM   2057 C C   . GLY A 1 273 ? -5.137  -50.363 4.970   1.00 66.65  ? 263 GLY A C   1 
ATOM   2058 O O   . GLY A 1 273 ? -5.949  -51.005 5.646   1.00 67.14  ? 263 GLY A O   1 
ATOM   2059 N N   . GLY A 1 274 ? -4.550  -50.833 3.864   1.00 63.93  ? 264 GLY A N   1 
ATOM   2060 C CA  . GLY A 1 274 ? -4.735  -52.186 3.340   1.00 64.46  ? 264 GLY A CA  1 
ATOM   2061 C C   . GLY A 1 274 ? -6.030  -52.444 2.589   1.00 69.52  ? 264 GLY A C   1 
ATOM   2062 O O   . GLY A 1 274 ? -6.226  -53.542 2.055   1.00 70.00  ? 264 GLY A O   1 
ATOM   2063 N N   . LYS A 1 275 ? -6.915  -51.426 2.533   1.00 64.84  ? 265 LYS A N   1 
ATOM   2064 C CA  . LYS A 1 275 ? -8.225  -51.453 1.875   1.00 63.51  ? 265 LYS A CA  1 
ATOM   2065 C C   . LYS A 1 275 ? -8.226  -50.608 0.603   1.00 64.70  ? 265 LYS A C   1 
ATOM   2066 O O   . LYS A 1 275 ? -7.417  -49.685 0.477   1.00 64.97  ? 265 LYS A O   1 
ATOM   2067 C CB  . LYS A 1 275 ? -9.284  -50.903 2.839   1.00 66.19  ? 265 LYS A CB  1 
ATOM   2068 C CG  . LYS A 1 275 ? -10.031 -51.963 3.619   1.00 81.93  ? 265 LYS A CG  1 
ATOM   2069 C CD  . LYS A 1 275 ? -11.405 -51.454 4.044   1.00 94.39  ? 265 LYS A CD  1 
ATOM   2070 C CE  . LYS A 1 275 ? -12.512 -51.623 3.018   1.00 105.81 ? 265 LYS A CE  1 
ATOM   2071 N NZ  . LYS A 1 275 ? -12.555 -50.507 2.034   1.00 112.80 ? 265 LYS A NZ  1 
ATOM   2072 N N   . GLU A 1 276 ? -9.152  -50.892 -0.318  1.00 59.19  ? 266 GLU A N   1 
ATOM   2073 C CA  . GLU A 1 276 ? -9.271  -50.135 -1.562  1.00 58.45  ? 266 GLU A CA  1 
ATOM   2074 C C   . GLU A 1 276 ? -10.542 -49.274 -1.541  1.00 59.88  ? 266 GLU A C   1 
ATOM   2075 O O   . GLU A 1 276 ? -11.642 -49.804 -1.355  1.00 60.30  ? 266 GLU A O   1 
ATOM   2076 C CB  . GLU A 1 276 ? -9.250  -51.079 -2.765  1.00 60.41  ? 266 GLU A CB  1 
ATOM   2077 C CG  . GLU A 1 276 ? -8.652  -50.453 -4.007  1.00 77.77  ? 266 GLU A CG  1 
ATOM   2078 C CD  . GLU A 1 276 ? -7.258  -50.904 -4.397  1.00 110.24 ? 266 GLU A CD  1 
ATOM   2079 O OE1 . GLU A 1 276 ? -6.955  -52.110 -4.264  1.00 118.68 ? 266 GLU A OE1 1 
ATOM   2080 O OE2 . GLU A 1 276 ? -6.486  -50.049 -4.886  1.00 103.08 ? 266 GLU A OE2 1 
ATOM   2081 N N   . TYR A 1 277 ? -10.380 -47.934 -1.680  1.00 52.94  ? 267 TYR A N   1 
ATOM   2082 C CA  . TYR A 1 277 ? -11.480 -46.953 -1.679  1.00 49.72  ? 267 TYR A CA  1 
ATOM   2083 C C   . TYR A 1 277 ? -11.689 -46.514 -3.116  1.00 51.49  ? 267 TYR A C   1 
ATOM   2084 O O   . TYR A 1 277 ? -10.864 -45.794 -3.673  1.00 51.59  ? 267 TYR A O   1 
ATOM   2085 C CB  . TYR A 1 277 ? -11.197 -45.801 -0.700  1.00 48.81  ? 267 TYR A CB  1 
ATOM   2086 C CG  . TYR A 1 277 ? -11.176 -46.266 0.746   1.00 48.39  ? 267 TYR A CG  1 
ATOM   2087 C CD1 . TYR A 1 277 ? -12.335 -46.277 1.512   1.00 49.69  ? 267 TYR A CD1 1 
ATOM   2088 C CD2 . TYR A 1 277 ? -10.020 -46.788 1.315   1.00 49.33  ? 267 TYR A CD2 1 
ATOM   2089 C CE1 . TYR A 1 277 ? -12.337 -46.761 2.818   1.00 50.15  ? 267 TYR A CE1 1 
ATOM   2090 C CE2 . TYR A 1 277 ? -10.010 -47.269 2.622   1.00 50.41  ? 267 TYR A CE2 1 
ATOM   2091 C CZ  . TYR A 1 277 ? -11.170 -47.248 3.371   1.00 58.39  ? 267 TYR A CZ  1 
ATOM   2092 O OH  . TYR A 1 277 ? -11.162 -47.722 4.662   1.00 64.10  ? 267 TYR A OH  1 
ATOM   2093 N N   . THR A 1 278 ? -12.733 -47.060 -3.749  1.00 46.54  ? 268 THR A N   1 
ATOM   2094 C CA  . THR A 1 278 ? -13.006 -46.879 -5.169  1.00 46.03  ? 268 THR A CA  1 
ATOM   2095 C C   . THR A 1 278 ? -14.065 -45.835 -5.483  1.00 51.42  ? 268 THR A C   1 
ATOM   2096 O O   . THR A 1 278 ? -15.148 -45.820 -4.880  1.00 52.21  ? 268 THR A O   1 
ATOM   2097 C CB  . THR A 1 278 ? -13.312 -48.261 -5.832  1.00 48.77  ? 268 THR A CB  1 
ATOM   2098 O OG1 . THR A 1 278 ? -12.270 -49.179 -5.499  1.00 49.47  ? 268 THR A OG1 1 
ATOM   2099 C CG2 . THR A 1 278 ? -13.477 -48.196 -7.371  1.00 41.50  ? 268 THR A CG2 1 
ATOM   2100 N N   . LEU A 1 279 ? -13.752 -45.001 -6.490  1.00 47.44  ? 269 LEU A N   1 
ATOM   2101 C CA  . LEU A 1 279 ? -14.628 -43.989 -7.048  1.00 47.49  ? 269 LEU A CA  1 
ATOM   2102 C C   . LEU A 1 279 ? -14.952 -44.342 -8.513  1.00 50.73  ? 269 LEU A C   1 
ATOM   2103 O O   . LEU A 1 279 ? -14.063 -44.469 -9.338  1.00 49.83  ? 269 LEU A O   1 
ATOM   2104 C CB  . LEU A 1 279 ? -13.995 -42.580 -6.977  1.00 47.50  ? 269 LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 279 ? -13.709 -41.928 -5.602  1.00 52.26  ? 269 LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 279 ? -13.570 -40.468 -5.778  1.00 51.90  ? 269 LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 279 ? -14.828 -42.155 -4.573  1.00 56.46  ? 269 LEU A CD2 1 
ATOM   2108 N N   . THR A 1 280 ? -16.220 -44.442 -8.825  1.00 47.98  ? 270 THR A N   1 
ATOM   2109 C CA  . THR A 1 280 ? -16.761 -44.709 -10.148 1.00 47.79  ? 270 THR A CA  1 
ATOM   2110 C C   . THR A 1 280 ? -16.782 -43.354 -10.914 1.00 52.10  ? 270 THR A C   1 
ATOM   2111 O O   . THR A 1 280 ? -16.669 -42.308 -10.279 1.00 51.72  ? 270 THR A O   1 
ATOM   2112 C CB  . THR A 1 280 ? -18.121 -45.408 -9.889  1.00 52.83  ? 270 THR A CB  1 
ATOM   2113 O OG1 . THR A 1 280 ? -17.892 -46.818 -9.819  1.00 51.53  ? 270 THR A OG1 1 
ATOM   2114 C CG2 . THR A 1 280 ? -19.213 -45.081 -10.893 1.00 51.71  ? 270 THR A CG2 1 
ATOM   2115 N N   . SER A 1 281 ? -16.928 -43.355 -12.252 1.00 48.57  ? 271 SER A N   1 
ATOM   2116 C CA  . SER A 1 281 ? -17.019 -42.096 -12.992 1.00 48.64  ? 271 SER A CA  1 
ATOM   2117 C C   . SER A 1 281 ? -18.208 -41.214 -12.542 1.00 52.22  ? 271 SER A C   1 
ATOM   2118 O O   . SER A 1 281 ? -18.142 -39.999 -12.668 1.00 52.12  ? 271 SER A O   1 
ATOM   2119 C CB  . SER A 1 281 ? -17.025 -42.318 -14.504 1.00 52.16  ? 271 SER A CB  1 
ATOM   2120 O OG  . SER A 1 281 ? -18.156 -43.028 -14.973 1.00 59.10  ? 271 SER A OG  1 
ATOM   2121 N N   . ALA A 1 282 ? -19.255 -41.822 -11.965 1.00 48.42  ? 272 ALA A N   1 
ATOM   2122 C CA  . ALA A 1 282 ? -20.447 -41.139 -11.441 1.00 47.35  ? 272 ALA A CA  1 
ATOM   2123 C C   . ALA A 1 282 ? -20.067 -40.313 -10.209 1.00 48.09  ? 272 ALA A C   1 
ATOM   2124 O O   . ALA A 1 282 ? -20.659 -39.257 -9.980  1.00 47.25  ? 272 ALA A O   1 
ATOM   2125 C CB  . ALA A 1 282 ? -21.522 -42.163 -11.076 1.00 47.87  ? 272 ALA A CB  1 
ATOM   2126 N N   . ASP A 1 283 ? -19.056 -40.784 -9.453  1.00 41.97  ? 273 ASP A N   1 
ATOM   2127 C CA  . ASP A 1 283 ? -18.554 -40.120 -8.253  1.00 41.28  ? 273 ASP A CA  1 
ATOM   2128 C C   . ASP A 1 283 ? -17.621 -38.930 -8.524  1.00 43.82  ? 273 ASP A C   1 
ATOM   2129 O O   . ASP A 1 283 ? -17.550 -38.028 -7.687  1.00 43.07  ? 273 ASP A O   1 
ATOM   2130 C CB  . ASP A 1 283 ? -17.817 -41.128 -7.343  1.00 43.06  ? 273 ASP A CB  1 
ATOM   2131 C CG  . ASP A 1 283 ? -18.648 -42.290 -6.869  1.00 49.92  ? 273 ASP A CG  1 
ATOM   2132 O OD1 . ASP A 1 283 ? -19.718 -42.047 -6.269  1.00 53.23  ? 273 ASP A OD1 1 
ATOM   2133 O OD2 . ASP A 1 283 ? -18.202 -43.442 -7.045  1.00 48.53  ? 273 ASP A OD2 1 
ATOM   2134 N N   . TYR A 1 284 ? -16.867 -38.956 -9.643  1.00 40.10  ? 274 TYR A N   1 
ATOM   2135 C CA  . TYR A 1 284 ? -15.859 -37.936 -9.934  1.00 39.96  ? 274 TYR A CA  1 
ATOM   2136 C C   . TYR A 1 284 ? -16.073 -37.051 -11.173 1.00 44.50  ? 274 TYR A C   1 
ATOM   2137 O O   . TYR A 1 284 ? -15.261 -36.158 -11.417 1.00 44.21  ? 274 TYR A O   1 
ATOM   2138 C CB  . TYR A 1 284 ? -14.443 -38.521 -9.855  1.00 40.49  ? 274 TYR A CB  1 
ATOM   2139 C CG  . TYR A 1 284 ? -14.063 -39.450 -10.986 1.00 42.75  ? 274 TYR A CG  1 
ATOM   2140 C CD1 . TYR A 1 284 ? -13.724 -38.950 -12.245 1.00 45.36  ? 274 TYR A CD1 1 
ATOM   2141 C CD2 . TYR A 1 284 ? -13.932 -40.821 -10.772 1.00 42.43  ? 274 TYR A CD2 1 
ATOM   2142 C CE1 . TYR A 1 284 ? -13.330 -39.795 -13.277 1.00 46.59  ? 274 TYR A CE1 1 
ATOM   2143 C CE2 . TYR A 1 284 ? -13.531 -41.674 -11.796 1.00 42.56  ? 274 TYR A CE2 1 
ATOM   2144 C CZ  . TYR A 1 284 ? -13.223 -41.153 -13.043 1.00 52.34  ? 274 TYR A CZ  1 
ATOM   2145 O OH  . TYR A 1 284 ? -12.818 -41.967 -14.064 1.00 55.10  ? 274 TYR A OH  1 
ATOM   2146 N N   . VAL A 1 285 ? -17.142 -37.288 -11.941 1.00 40.79  ? 275 VAL A N   1 
ATOM   2147 C CA  . VAL A 1 285 ? -17.450 -36.464 -13.110 1.00 41.15  ? 275 VAL A CA  1 
ATOM   2148 C C   . VAL A 1 285 ? -18.697 -35.664 -12.799 1.00 47.52  ? 275 VAL A C   1 
ATOM   2149 O O   . VAL A 1 285 ? -19.688 -36.240 -12.347 1.00 45.95  ? 275 VAL A O   1 
ATOM   2150 C CB  . VAL A 1 285 ? -17.632 -37.253 -14.445 1.00 44.44  ? 275 VAL A CB  1 
ATOM   2151 C CG1 . VAL A 1 285 ? -17.889 -36.317 -15.629 1.00 44.07  ? 275 VAL A CG1 1 
ATOM   2152 C CG2 . VAL A 1 285 ? -16.443 -38.139 -14.734 1.00 44.36  ? 275 VAL A CG2 1 
ATOM   2153 N N   . PHE A 1 286 ? -18.665 -34.341 -13.074 1.00 47.44  ? 276 PHE A N   1 
ATOM   2154 C CA  . PHE A 1 286 ? -19.838 -33.482 -12.923 1.00 48.41  ? 276 PHE A CA  1 
ATOM   2155 C C   . PHE A 1 286 ? -20.631 -33.634 -14.216 1.00 53.63  ? 276 PHE A C   1 
ATOM   2156 O O   . PHE A 1 286 ? -20.418 -32.914 -15.195 1.00 53.44  ? 276 PHE A O   1 
ATOM   2157 C CB  . PHE A 1 286 ? -19.473 -32.019 -12.588 1.00 50.79  ? 276 PHE A CB  1 
ATOM   2158 C CG  . PHE A 1 286 ? -18.879 -31.804 -11.210 1.00 53.14  ? 276 PHE A CG  1 
ATOM   2159 C CD1 . PHE A 1 286 ? -19.607 -32.107 -10.063 1.00 56.09  ? 276 PHE A CD1 1 
ATOM   2160 C CD2 . PHE A 1 286 ? -17.614 -31.247 -11.059 1.00 56.85  ? 276 PHE A CD2 1 
ATOM   2161 C CE1 . PHE A 1 286 ? -19.064 -31.893 -8.799  1.00 57.26  ? 276 PHE A CE1 1 
ATOM   2162 C CE2 . PHE A 1 286 ? -17.081 -31.021 -9.791  1.00 60.21  ? 276 PHE A CE2 1 
ATOM   2163 C CZ  . PHE A 1 286 ? -17.810 -31.341 -8.673  1.00 57.59  ? 276 PHE A CZ  1 
ATOM   2164 N N   . GLN A 1 287 ? -21.481 -34.666 -14.231 1.00 51.67  ? 277 GLN A N   1 
ATOM   2165 C CA  . GLN A 1 287 ? -22.279 -35.099 -15.374 1.00 52.01  ? 277 GLN A CA  1 
ATOM   2166 C C   . GLN A 1 287 ? -23.479 -34.190 -15.662 1.00 59.11  ? 277 GLN A C   1 
ATOM   2167 O O   . GLN A 1 287 ? -24.632 -34.620 -15.545 1.00 59.58  ? 277 GLN A O   1 
ATOM   2168 C CB  . GLN A 1 287 ? -22.685 -36.575 -15.179 1.00 52.83  ? 277 GLN A CB  1 
ATOM   2169 C CG  . GLN A 1 287 ? -22.958 -37.341 -16.469 1.00 60.82  ? 277 GLN A CG  1 
ATOM   2170 C CD  . GLN A 1 287 ? -21.722 -37.623 -17.278 1.00 73.02  ? 277 GLN A CD  1 
ATOM   2171 O OE1 . GLN A 1 287 ? -20.704 -38.125 -16.770 1.00 68.76  ? 277 GLN A OE1 1 
ATOM   2172 N NE2 . GLN A 1 287 ? -21.800 -37.317 -18.566 1.00 57.98  ? 277 GLN A NE2 1 
ATOM   2173 N N   . GLU A 1 288 ? -23.200 -32.941 -16.082 1.00 57.35  ? 278 GLU A N   1 
ATOM   2174 C CA  . GLU A 1 288 ? -24.228 -31.942 -16.385 1.00 58.23  ? 278 GLU A CA  1 
ATOM   2175 C C   . GLU A 1 288 ? -25.093 -32.272 -17.619 1.00 64.65  ? 278 GLU A C   1 
ATOM   2176 O O   . GLU A 1 288 ? -26.211 -31.750 -17.728 1.00 65.36  ? 278 GLU A O   1 
ATOM   2177 C CB  . GLU A 1 288 ? -23.643 -30.516 -16.451 1.00 59.86  ? 278 GLU A CB  1 
ATOM   2178 C CG  . GLU A 1 288 ? -22.981 -30.007 -15.168 1.00 75.05  ? 278 GLU A CG  1 
ATOM   2179 C CD  . GLU A 1 288 ? -23.778 -30.089 -13.873 1.00 107.57 ? 278 GLU A CD  1 
ATOM   2180 O OE1 . GLU A 1 288 ? -24.891 -29.515 -13.819 1.00 109.83 ? 278 GLU A OE1 1 
ATOM   2181 O OE2 . GLU A 1 288 ? -23.279 -30.713 -12.906 1.00 100.20 ? 278 GLU A OE2 1 
ATOM   2182 N N   . SER A 1 289 ? -24.580 -33.147 -18.533 1.00 60.95  ? 279 SER A N   1 
ATOM   2183 C CA  . SER A 1 289 ? -25.244 -33.635 -19.757 1.00 59.96  ? 279 SER A CA  1 
ATOM   2184 C C   . SER A 1 289 ? -24.544 -34.893 -20.323 1.00 62.29  ? 279 SER A C   1 
ATOM   2185 O O   . SER A 1 289 ? -23.643 -35.434 -19.676 1.00 61.04  ? 279 SER A O   1 
ATOM   2186 C CB  . SER A 1 289 ? -25.349 -32.534 -20.812 1.00 63.38  ? 279 SER A CB  1 
ATOM   2187 O OG  . SER A 1 289 ? -24.202 -32.468 -21.643 1.00 74.10  ? 279 SER A OG  1 
ATOM   2188 N N   . TYR A 1 290 A -24.987 -35.368 -21.510 1.00 58.92  ? 279 TYR A N   1 
ATOM   2189 C CA  . TYR A 1 290 A -24.430 -36.538 -22.208 1.00 58.73  ? 279 TYR A CA  1 
ATOM   2190 C C   . TYR A 1 290 A -24.037 -36.180 -23.648 1.00 63.92  ? 279 TYR A C   1 
ATOM   2191 O O   . TYR A 1 290 A -23.616 -37.051 -24.422 1.00 62.72  ? 279 TYR A O   1 
ATOM   2192 C CB  . TYR A 1 290 A -25.428 -37.721 -22.207 1.00 58.70  ? 279 TYR A CB  1 
ATOM   2193 C CG  . TYR A 1 290 A -25.795 -38.214 -20.829 1.00 58.48  ? 279 TYR A CG  1 
ATOM   2194 C CD1 . TYR A 1 290 A -24.894 -38.955 -20.071 1.00 59.87  ? 279 TYR A CD1 1 
ATOM   2195 C CD2 . TYR A 1 290 A -27.049 -37.946 -20.280 1.00 58.72  ? 279 TYR A CD2 1 
ATOM   2196 C CE1 . TYR A 1 290 A -25.218 -39.395 -18.790 1.00 60.65  ? 279 TYR A CE1 1 
ATOM   2197 C CE2 . TYR A 1 290 A -27.390 -38.395 -19.004 1.00 59.19  ? 279 TYR A CE2 1 
ATOM   2198 C CZ  . TYR A 1 290 A -26.467 -39.116 -18.261 1.00 66.44  ? 279 TYR A CZ  1 
ATOM   2199 O OH  . TYR A 1 290 A -26.771 -39.567 -17.002 1.00 68.08  ? 279 TYR A OH  1 
ATOM   2200 N N   . SER A 1 291 B -24.193 -34.896 -24.001 1.00 62.12  ? 279 SER A N   1 
ATOM   2201 C CA  . SER A 1 291 B -23.902 -34.384 -25.333 1.00 62.77  ? 279 SER A CA  1 
ATOM   2202 C C   . SER A 1 291 B -22.419 -34.466 -25.678 1.00 68.12  ? 279 SER A C   1 
ATOM   2203 O O   . SER A 1 291 B -21.562 -34.214 -24.823 1.00 67.89  ? 279 SER A O   1 
ATOM   2204 C CB  . SER A 1 291 B -24.396 -32.949 -25.464 1.00 66.95  ? 279 SER A CB  1 
ATOM   2205 O OG  . SER A 1 291 B -23.960 -32.365 -26.682 1.00 80.58  ? 279 SER A OG  1 
ATOM   2206 N N   . SER A 1 292 C -22.130 -34.801 -26.950 1.00 64.91  ? 279 SER A N   1 
ATOM   2207 C CA  . SER A 1 292 C -20.780 -34.857 -27.515 1.00 64.50  ? 279 SER A CA  1 
ATOM   2208 C C   . SER A 1 292 C -20.309 -33.426 -27.741 1.00 67.30  ? 279 SER A C   1 
ATOM   2209 O O   . SER A 1 292 C -19.110 -33.169 -27.739 1.00 67.35  ? 279 SER A O   1 
ATOM   2210 C CB  . SER A 1 292 C -20.787 -35.592 -28.853 1.00 68.88  ? 279 SER A CB  1 
ATOM   2211 O OG  . SER A 1 292 C -21.646 -36.719 -28.843 1.00 80.66  ? 279 SER A OG  1 
ATOM   2212 N N   . LYS A 1 293 D -21.275 -32.501 -27.937 1.00 63.25  ? 279 LYS A N   1 
ATOM   2213 C CA  . LYS A 1 293 D -21.108 -31.067 -28.188 1.00 62.74  ? 279 LYS A CA  1 
ATOM   2214 C C   . LYS A 1 293 D -20.972 -30.250 -26.885 1.00 66.61  ? 279 LYS A C   1 
ATOM   2215 O O   . LYS A 1 293 D -20.964 -29.010 -26.917 1.00 66.04  ? 279 LYS A O   1 
ATOM   2216 C CB  . LYS A 1 293 D -22.280 -30.562 -29.054 1.00 65.36  ? 279 LYS A CB  1 
ATOM   2217 C CG  . LYS A 1 293 D -22.243 -31.099 -30.478 1.00 81.48  ? 279 LYS A CG  1 
ATOM   2218 C CD  . LYS A 1 293 D -23.589 -31.641 -30.928 1.00 92.91  ? 279 LYS A CD  1 
ATOM   2219 C CE  . LYS A 1 293 D -23.448 -32.348 -32.244 1.00 102.18 ? 279 LYS A CE  1 
ATOM   2220 N NZ  . LYS A 1 293 D -23.354 -31.385 -33.369 1.00 110.75 ? 279 LYS A NZ  1 
ATOM   2221 N N   . LYS A 1 294 ? -20.847 -30.961 -25.741 1.00 62.74  ? 280 LYS A N   1 
ATOM   2222 C CA  . LYS A 1 294 ? -20.673 -30.379 -24.409 1.00 61.99  ? 280 LYS A CA  1 
ATOM   2223 C C   . LYS A 1 294 ? -19.481 -30.993 -23.679 1.00 61.54  ? 280 LYS A C   1 
ATOM   2224 O O   . LYS A 1 294 ? -19.134 -32.160 -23.888 1.00 60.69  ? 280 LYS A O   1 
ATOM   2225 C CB  . LYS A 1 294 ? -21.951 -30.533 -23.564 1.00 66.16  ? 280 LYS A CB  1 
ATOM   2226 C CG  . LYS A 1 294 ? -22.939 -29.362 -23.676 1.00 89.91  ? 280 LYS A CG  1 
ATOM   2227 C CD  . LYS A 1 294 ? -22.696 -28.247 -22.631 1.00 105.70 ? 280 LYS A CD  1 
ATOM   2228 C CE  . LYS A 1 294 ? -23.230 -28.548 -21.241 1.00 117.17 ? 280 LYS A CE  1 
ATOM   2229 N NZ  . LYS A 1 294 ? -24.715 -28.461 -21.171 1.00 125.16 ? 280 LYS A NZ  1 
ATOM   2230 N N   . LEU A 1 295 ? -18.862 -30.197 -22.821 1.00 55.81  ? 281 LEU A N   1 
ATOM   2231 C CA  . LEU A 1 295 ? -17.729 -30.619 -22.015 1.00 55.17  ? 281 LEU A CA  1 
ATOM   2232 C C   . LEU A 1 295 ? -18.106 -30.661 -20.535 1.00 56.44  ? 281 LEU A C   1 
ATOM   2233 O O   . LEU A 1 295 ? -18.761 -29.738 -20.033 1.00 55.55  ? 281 LEU A O   1 
ATOM   2234 C CB  . LEU A 1 295 ? -16.534 -29.697 -22.239 1.00 55.44  ? 281 LEU A CB  1 
ATOM   2235 C CG  . LEU A 1 295 ? -15.937 -29.681 -23.640 1.00 59.83  ? 281 LEU A CG  1 
ATOM   2236 C CD1 . LEU A 1 295 ? -15.005 -28.517 -23.793 1.00 59.86  ? 281 LEU A CD1 1 
ATOM   2237 C CD2 . LEU A 1 295 ? -15.209 -30.984 -23.957 1.00 62.01  ? 281 LEU A CD2 1 
ATOM   2238 N N   . CYS A 1 296 ? -17.737 -31.769 -19.859 1.00 50.92  ? 282 CYS A N   1 
ATOM   2239 C CA  . CYS A 1 296 ? -18.033 -32.024 -18.441 1.00 49.97  ? 282 CYS A CA  1 
ATOM   2240 C C   . CYS A 1 296 ? -16.780 -31.931 -17.583 1.00 50.07  ? 282 CYS A C   1 
ATOM   2241 O O   . CYS A 1 296 ? -15.734 -32.436 -17.980 1.00 48.84  ? 282 CYS A O   1 
ATOM   2242 C CB  . CYS A 1 296 ? -18.734 -33.371 -18.256 1.00 50.41  ? 282 CYS A CB  1 
ATOM   2243 S SG  . CYS A 1 296 ? -20.498 -33.362 -18.662 1.00 54.26  ? 282 CYS A SG  1 
ATOM   2244 N N   . THR A 1 297 ? -16.885 -31.307 -16.401 1.00 45.55  ? 283 THR A N   1 
ATOM   2245 C CA  . THR A 1 297 ? -15.730 -31.143 -15.518 1.00 45.66  ? 283 THR A CA  1 
ATOM   2246 C C   . THR A 1 297 ? -15.551 -32.316 -14.573 1.00 49.37  ? 283 THR A C   1 
ATOM   2247 O O   . THR A 1 297 ? -16.527 -32.950 -14.163 1.00 48.41  ? 283 THR A O   1 
ATOM   2248 C CB  . THR A 1 297 ? -15.771 -29.798 -14.750 1.00 57.99  ? 283 THR A CB  1 
ATOM   2249 O OG1 . THR A 1 297 ? -17.010 -29.697 -14.080 1.00 61.44  ? 283 THR A OG1 1 
ATOM   2250 C CG2 . THR A 1 297 ? -15.612 -28.588 -15.643 1.00 58.20  ? 283 THR A CG2 1 
ATOM   2251 N N   . LEU A 1 298 ? -14.294 -32.591 -14.214 1.00 45.42  ? 284 LEU A N   1 
ATOM   2252 C CA  . LEU A 1 298 ? -13.960 -33.642 -13.264 1.00 44.37  ? 284 LEU A CA  1 
ATOM   2253 C C   . LEU A 1 298 ? -13.725 -32.993 -11.905 1.00 46.34  ? 284 LEU A C   1 
ATOM   2254 O O   . LEU A 1 298 ? -13.206 -31.876 -11.838 1.00 45.50  ? 284 LEU A O   1 
ATOM   2255 C CB  . LEU A 1 298 ? -12.729 -34.457 -13.697 1.00 44.39  ? 284 LEU A CB  1 
ATOM   2256 C CG  . LEU A 1 298 ? -12.649 -35.016 -15.105 1.00 49.13  ? 284 LEU A CG  1 
ATOM   2257 C CD1 . LEU A 1 298 ? -11.557 -36.055 -15.211 1.00 49.41  ? 284 LEU A CD1 1 
ATOM   2258 C CD2 . LEU A 1 298 ? -13.965 -35.638 -15.551 1.00 49.90  ? 284 LEU A CD2 1 
ATOM   2259 N N   . ALA A 1 299 ? -14.136 -33.687 -10.829 1.00 41.77  ? 285 ALA A N   1 
ATOM   2260 C CA  . ALA A 1 299 ? -14.016 -33.242 -9.444  1.00 40.52  ? 285 ALA A CA  1 
ATOM   2261 C C   . ALA A 1 299 ? -12.635 -33.658 -8.864  1.00 42.04  ? 285 ALA A C   1 
ATOM   2262 O O   . ALA A 1 299 ? -12.518 -34.099 -7.716  1.00 37.73  ? 285 ALA A O   1 
ATOM   2263 C CB  . ALA A 1 299 ? -15.166 -33.814 -8.642  1.00 41.24  ? 285 ALA A CB  1 
ATOM   2264 N N   . ILE A 1 300 ? -11.586 -33.524 -9.726  1.00 41.32  ? 286 ILE A N   1 
ATOM   2265 C CA  . ILE A 1 300 ? -10.157 -33.801 -9.493  1.00 41.25  ? 286 ILE A CA  1 
ATOM   2266 C C   . ILE A 1 300 ? -9.328  -32.688 -10.143 1.00 45.73  ? 286 ILE A C   1 
ATOM   2267 O O   . ILE A 1 300 ? -9.602  -32.325 -11.281 1.00 45.22  ? 286 ILE A O   1 
ATOM   2268 C CB  . ILE A 1 300 ? -9.724  -35.201 -10.047 1.00 44.07  ? 286 ILE A CB  1 
ATOM   2269 C CG1 . ILE A 1 300 ? -10.650 -36.338 -9.540  1.00 44.66  ? 286 ILE A CG1 1 
ATOM   2270 C CG2 . ILE A 1 300 ? -8.247  -35.500 -9.717  1.00 43.81  ? 286 ILE A CG2 1 
ATOM   2271 C CD1 . ILE A 1 300 ? -10.493 -37.674 -10.216 1.00 51.34  ? 286 ILE A CD1 1 
ATOM   2272 N N   . HIS A 1 301 ? -8.285  -32.188 -9.464  1.00 42.94  ? 287 HIS A N   1 
ATOM   2273 C CA  . HIS A 1 301 ? -7.403  -31.180 -10.061 1.00 43.11  ? 287 HIS A CA  1 
ATOM   2274 C C   . HIS A 1 301 ? -5.976  -31.191 -9.494  1.00 48.03  ? 287 HIS A C   1 
ATOM   2275 O O   . HIS A 1 301 ? -5.685  -31.956 -8.578  1.00 47.49  ? 287 HIS A O   1 
ATOM   2276 C CB  . HIS A 1 301 ? -8.050  -29.780 -10.096 1.00 43.94  ? 287 HIS A CB  1 
ATOM   2277 C CG  . HIS A 1 301 ? -8.192  -29.095 -8.774  1.00 47.43  ? 287 HIS A CG  1 
ATOM   2278 N ND1 . HIS A 1 301 ? -8.676  -27.799 -8.696  1.00 49.36  ? 287 HIS A ND1 1 
ATOM   2279 C CD2 . HIS A 1 301 ? -7.935  -29.542 -7.521  1.00 49.71  ? 287 HIS A CD2 1 
ATOM   2280 C CE1 . HIS A 1 301 ? -8.681  -27.493 -7.410  1.00 49.16  ? 287 HIS A CE1 1 
ATOM   2281 N NE2 . HIS A 1 301 ? -8.242  -28.509 -6.664  1.00 49.68  ? 287 HIS A NE2 1 
ATOM   2282 N N   . ALA A 1 302 ? -5.071  -30.388 -10.052 1.00 45.62  ? 288 ALA A N   1 
ATOM   2283 C CA  . ALA A 1 302 ? -3.693  -30.376 -9.547  1.00 45.20  ? 288 ALA A CA  1 
ATOM   2284 C C   . ALA A 1 302 ? -3.501  -29.330 -8.464  1.00 49.25  ? 288 ALA A C   1 
ATOM   2285 O O   . ALA A 1 302 ? -4.086  -28.249 -8.549  1.00 48.79  ? 288 ALA A O   1 
ATOM   2286 C CB  . ALA A 1 302 ? -2.722  -30.138 -10.681 1.00 45.61  ? 288 ALA A CB  1 
ATOM   2287 N N   . MET A 1 303 ? -2.711  -29.662 -7.424  1.00 45.41  ? 289 MET A N   1 
ATOM   2288 C CA  . MET A 1 303 ? -2.361  -28.755 -6.328  1.00 45.11  ? 289 MET A CA  1 
ATOM   2289 C C   . MET A 1 303 ? -1.004  -29.119 -5.794  1.00 51.19  ? 289 MET A C   1 
ATOM   2290 O O   . MET A 1 303 ? -0.824  -30.216 -5.246  1.00 50.98  ? 289 MET A O   1 
ATOM   2291 C CB  . MET A 1 303 ? -3.371  -28.764 -5.177  1.00 47.14  ? 289 MET A CB  1 
ATOM   2292 C CG  . MET A 1 303 ? -4.409  -27.687 -5.247  1.00 50.56  ? 289 MET A CG  1 
ATOM   2293 S SD  . MET A 1 303 ? -3.820  -26.004 -5.214  1.00 53.94  ? 289 MET A SD  1 
ATOM   2294 C CE  . MET A 1 303 ? -5.229  -25.209 -5.925  1.00 50.53  ? 289 MET A CE  1 
ATOM   2295 N N   . ASP A 1 304 ? -0.032  -28.218 -5.978  1.00 48.18  ? 290 ASP A N   1 
ATOM   2296 C CA  . ASP A 1 304 ? 1.302   -28.494 -5.467  1.00 48.39  ? 290 ASP A CA  1 
ATOM   2297 C C   . ASP A 1 304 ? 1.390   -27.912 -4.081  1.00 52.83  ? 290 ASP A C   1 
ATOM   2298 O O   . ASP A 1 304 ? 1.465   -26.692 -3.919  1.00 53.15  ? 290 ASP A O   1 
ATOM   2299 C CB  . ASP A 1 304 ? 2.408   -28.006 -6.425  1.00 49.64  ? 290 ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 304 ? 2.394   -28.713 -7.769  1.00 58.14  ? 290 ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 304 ? 2.563   -29.958 -7.791  1.00 57.30  ? 290 ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 304 ? 2.228   -28.022 -8.797  1.00 65.22  ? 290 ASP A OD2 1 
ATOM   2303 N N   . ILE A 1 305 ? 1.248   -28.783 -3.076  1.00 49.10  ? 291 ILE A N   1 
ATOM   2304 C CA  . ILE A 1 305 ? 1.283   -28.374 -1.674  1.00 49.14  ? 291 ILE A CA  1 
ATOM   2305 C C   . ILE A 1 305 ? 2.749   -28.390 -1.231  1.00 56.34  ? 291 ILE A C   1 
ATOM   2306 O O   . ILE A 1 305 ? 3.422   -29.411 -1.395  1.00 55.95  ? 291 ILE A O   1 
ATOM   2307 C CB  . ILE A 1 305 ? 0.321   -29.217 -0.791  1.00 51.57  ? 291 ILE A CB  1 
ATOM   2308 C CG1 . ILE A 1 305 ? -1.154  -28.941 -1.163  1.00 50.87  ? 291 ILE A CG1 1 
ATOM   2309 C CG2 . ILE A 1 305 ? 0.557   -28.968 0.700   1.00 52.60  ? 291 ILE A CG2 1 
ATOM   2310 C CD1 . ILE A 1 305 ? -2.003  -30.167 -1.240  1.00 55.79  ? 291 ILE A CD1 1 
ATOM   2311 N N   . PRO A 1 306 ? 3.286   -27.231 -0.784  1.00 56.10  ? 292 PRO A N   1 
ATOM   2312 C CA  . PRO A 1 306 ? 4.720   -27.172 -0.437  1.00 56.96  ? 292 PRO A CA  1 
ATOM   2313 C C   . PRO A 1 306 ? 5.069   -27.860 0.879   1.00 65.05  ? 292 PRO A C   1 
ATOM   2314 O O   . PRO A 1 306 ? 4.162   -28.037 1.707   1.00 65.69  ? 292 PRO A O   1 
ATOM   2315 C CB  . PRO A 1 306 ? 5.001   -25.669 -0.369  1.00 58.33  ? 292 PRO A CB  1 
ATOM   2316 C CG  . PRO A 1 306 ? 3.698   -25.056 0.003   1.00 62.58  ? 292 PRO A CG  1 
ATOM   2317 C CD  . PRO A 1 306 ? 2.628   -25.915 -0.608  1.00 57.95  ? 292 PRO A CD  1 
ATOM   2318 N N   . PRO A 1 307 ? 6.369   -28.203 1.131   1.00 62.86  ? 293 PRO A N   1 
ATOM   2319 C CA  . PRO A 1 307 ? 6.734   -28.817 2.423   1.00 62.59  ? 293 PRO A CA  1 
ATOM   2320 C C   . PRO A 1 307 ? 6.509   -27.863 3.606   1.00 66.30  ? 293 PRO A C   1 
ATOM   2321 O O   . PRO A 1 307 ? 6.379   -26.655 3.379   1.00 66.61  ? 293 PRO A O   1 
ATOM   2322 C CB  . PRO A 1 307 ? 8.212   -29.197 2.237   1.00 64.40  ? 293 PRO A CB  1 
ATOM   2323 C CG  . PRO A 1 307 ? 8.443   -29.167 0.752   1.00 68.98  ? 293 PRO A CG  1 
ATOM   2324 C CD  . PRO A 1 307 ? 7.559   -28.064 0.267   1.00 64.65  ? 293 PRO A CD  1 
ATOM   2325 N N   . PRO A 1 308 ? 6.349   -28.348 4.858   1.00 62.51  ? 294 PRO A N   1 
ATOM   2326 C CA  . PRO A 1 308 ? 6.479   -29.744 5.339   1.00 62.26  ? 294 PRO A CA  1 
ATOM   2327 C C   . PRO A 1 308 ? 5.343   -30.700 4.972   1.00 64.30  ? 294 PRO A C   1 
ATOM   2328 O O   . PRO A 1 308 ? 5.606   -31.886 4.766   1.00 63.05  ? 294 PRO A O   1 
ATOM   2329 C CB  . PRO A 1 308 ? 6.648   -29.572 6.856   1.00 63.97  ? 294 PRO A CB  1 
ATOM   2330 C CG  . PRO A 1 308 ? 5.878   -28.319 7.171   1.00 68.38  ? 294 PRO A CG  1 
ATOM   2331 C CD  . PRO A 1 308 ? 6.090   -27.415 5.976   1.00 63.86  ? 294 PRO A CD  1 
ATOM   2332 N N   . THR A 1 309 ? 4.095   -30.182 4.889   1.00 60.15  ? 295 THR A N   1 
ATOM   2333 C CA  . THR A 1 309 ? 2.871   -30.929 4.573   1.00 59.24  ? 295 THR A CA  1 
ATOM   2334 C C   . THR A 1 309 ? 2.976   -31.708 3.261   1.00 62.99  ? 295 THR A C   1 
ATOM   2335 O O   . THR A 1 309 ? 2.661   -32.896 3.222   1.00 62.08  ? 295 THR A O   1 
ATOM   2336 C CB  . THR A 1 309 ? 1.648   -29.992 4.558   1.00 61.98  ? 295 THR A CB  1 
ATOM   2337 O OG1 . THR A 1 309 ? 1.651   -29.180 5.718   1.00 62.25  ? 295 THR A OG1 1 
ATOM   2338 C CG2 . THR A 1 309 ? 0.331   -30.742 4.475   1.00 58.12  ? 295 THR A CG2 1 
ATOM   2339 N N   . GLY A 1 310 ? 3.415   -31.031 2.209   1.00 59.72  ? 296 GLY A N   1 
ATOM   2340 C CA  . GLY A 1 310 ? 3.523   -31.628 0.891   1.00 59.59  ? 296 GLY A CA  1 
ATOM   2341 C C   . GLY A 1 310 ? 4.919   -32.012 0.444   1.00 64.58  ? 296 GLY A C   1 
ATOM   2342 O O   . GLY A 1 310 ? 5.895   -31.813 1.174   1.00 64.32  ? 296 GLY A O   1 
ATOM   2343 N N   . PRO A 1 311 ? 5.046   -32.575 -0.776  1.00 61.75  ? 297 PRO A N   1 
ATOM   2344 C CA  . PRO A 1 311 ? 3.965   -32.879 -1.734  1.00 61.56  ? 297 PRO A CA  1 
ATOM   2345 C C   . PRO A 1 311 ? 3.035   -33.987 -1.242  1.00 62.32  ? 297 PRO A C   1 
ATOM   2346 O O   . PRO A 1 311 ? 3.507   -34.960 -0.646  1.00 62.22  ? 297 PRO A O   1 
ATOM   2347 C CB  . PRO A 1 311 ? 4.726   -33.231 -3.020  1.00 63.58  ? 297 PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 311 ? 6.036   -33.760 -2.546  1.00 67.94  ? 297 PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 311 ? 6.366   -32.962 -1.308  1.00 63.39  ? 297 PRO A CD  1 
ATOM   2350 N N   . THR A 1 312 ? 1.712   -33.796 -1.431  1.00 55.97  ? 298 THR A N   1 
ATOM   2351 C CA  . THR A 1 312 ? 0.664   -34.744 -1.014  1.00 54.12  ? 298 THR A CA  1 
ATOM   2352 C C   . THR A 1 312 ? -0.490  -34.727 -1.954  1.00 56.29  ? 298 THR A C   1 
ATOM   2353 O O   . THR A 1 312 ? -0.697  -33.756 -2.693  1.00 56.47  ? 298 THR A O   1 
ATOM   2354 C CB  . THR A 1 312 ? -0.083  -34.272 0.239   1.00 56.35  ? 298 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 312 ? 0.208   -32.940 0.630   1.00 64.20  ? 298 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 312 ? -0.111  -35.249 1.330   1.00 47.15  ? 298 THR A CG2 1 
ATOM   2357 N N   . TRP A 1 313 ? -1.324  -35.760 -1.824  1.00 51.05  ? 299 TRP A N   1 
ATOM   2358 C CA  . TRP A 1 313 ? -2.634  -35.839 -2.423  1.00 49.27  ? 299 TRP A CA  1 
ATOM   2359 C C   . TRP A 1 313 ? -3.532  -35.253 -1.344  1.00 48.44  ? 299 TRP A C   1 
ATOM   2360 O O   . TRP A 1 313 ? -3.177  -35.261 -0.157  1.00 46.58  ? 299 TRP A O   1 
ATOM   2361 C CB  . TRP A 1 313 ? -3.041  -37.287 -2.664  1.00 48.35  ? 299 TRP A CB  1 
ATOM   2362 C CG  . TRP A 1 313 ? -2.347  -37.919 -3.822  1.00 49.86  ? 299 TRP A CG  1 
ATOM   2363 C CD1 . TRP A 1 313 ? -1.089  -38.440 -3.835  1.00 52.96  ? 299 TRP A CD1 1 
ATOM   2364 C CD2 . TRP A 1 313 ? -2.901  -38.168 -5.117  1.00 49.77  ? 299 TRP A CD2 1 
ATOM   2365 N NE1 . TRP A 1 313 ? -0.817  -38.990 -5.067  1.00 52.72  ? 299 TRP A NE1 1 
ATOM   2366 C CE2 . TRP A 1 313 ? -1.907  -38.823 -5.879  1.00 53.97  ? 299 TRP A CE2 1 
ATOM   2367 C CE3 . TRP A 1 313 ? -4.139  -37.887 -5.719  1.00 51.02  ? 299 TRP A CE3 1 
ATOM   2368 C CZ2 . TRP A 1 313 ? -2.113  -39.204 -7.207  1.00 53.01  ? 299 TRP A CZ2 1 
ATOM   2369 C CZ3 . TRP A 1 313 ? -4.343  -38.270 -7.035  1.00 52.51  ? 299 TRP A CZ3 1 
ATOM   2370 C CH2 . TRP A 1 313 ? -3.338  -38.923 -7.762  1.00 53.13  ? 299 TRP A CH2 1 
ATOM   2371 N N   . ALA A 1 314 ? -4.680  -34.723 -1.745  1.00 43.42  ? 300 ALA A N   1 
ATOM   2372 C CA  . ALA A 1 314 ? -5.643  -34.209 -0.784  1.00 41.51  ? 300 ALA A CA  1 
ATOM   2373 C C   . ALA A 1 314 ? -6.969  -34.828 -1.130  1.00 44.38  ? 300 ALA A C   1 
ATOM   2374 O O   . ALA A 1 314 ? -7.371  -34.767 -2.289  1.00 43.76  ? 300 ALA A O   1 
ATOM   2375 C CB  . ALA A 1 314 ? -5.716  -32.696 -0.846  1.00 41.61  ? 300 ALA A CB  1 
ATOM   2376 N N   . LEU A 1 315 ? -7.600  -35.515 -0.158  1.00 40.16  ? 301 LEU A N   1 
ATOM   2377 C CA  . LEU A 1 315 ? -8.903  -36.162 -0.328  1.00 39.07  ? 301 LEU A CA  1 
ATOM   2378 C C   . LEU A 1 315 ? -9.942  -35.206 0.212   1.00 42.01  ? 301 LEU A C   1 
ATOM   2379 O O   . LEU A 1 315 ? -10.096 -35.082 1.424   1.00 41.78  ? 301 LEU A O   1 
ATOM   2380 C CB  . LEU A 1 315 ? -8.957  -37.535 0.380   1.00 39.43  ? 301 LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 315 ? -7.885  -38.580 -0.025  1.00 44.17  ? 301 LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 315 ? -7.906  -39.769 0.907   1.00 44.56  ? 301 LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 315 ? -8.065  -39.053 -1.454  1.00 45.06  ? 301 LEU A CD2 1 
ATOM   2384 N N   . GLY A 1 316 ? -10.554 -34.446 -0.697  1.00 38.76  ? 302 GLY A N   1 
ATOM   2385 C CA  . GLY A 1 316 ? -11.553 -33.422 -0.406  1.00 37.49  ? 302 GLY A CA  1 
ATOM   2386 C C   . GLY A 1 316 ? -12.984 -33.898 -0.507  1.00 40.25  ? 302 GLY A C   1 
ATOM   2387 O O   . GLY A 1 316 ? -13.229 -35.102 -0.442  1.00 40.45  ? 302 GLY A O   1 
ATOM   2388 N N   . ALA A 1 317 ? -13.946 -32.958 -0.663  1.00 36.60  ? 303 ALA A N   1 
ATOM   2389 C CA  . ALA A 1 317 ? -15.395 -33.248 -0.749  1.00 36.44  ? 303 ALA A CA  1 
ATOM   2390 C C   . ALA A 1 317 ? -15.761 -34.402 -1.690  1.00 41.65  ? 303 ALA A C   1 
ATOM   2391 O O   . ALA A 1 317 ? -16.605 -35.204 -1.328  1.00 41.62  ? 303 ALA A O   1 
ATOM   2392 C CB  . ALA A 1 317 ? -16.179 -32.000 -1.121  1.00 36.80  ? 303 ALA A CB  1 
ATOM   2393 N N   . THR A 1 318 ? -15.101 -34.518 -2.859  1.00 39.51  ? 304 THR A N   1 
ATOM   2394 C CA  . THR A 1 318 ? -15.334 -35.607 -3.826  1.00 39.99  ? 304 THR A CA  1 
ATOM   2395 C C   . THR A 1 318 ? -15.241 -36.999 -3.150  1.00 43.67  ? 304 THR A C   1 
ATOM   2396 O O   . THR A 1 318 ? -16.049 -37.883 -3.432  1.00 43.30  ? 304 THR A O   1 
ATOM   2397 C CB  . THR A 1 318 ? -14.323 -35.481 -4.968  1.00 46.35  ? 304 THR A CB  1 
ATOM   2398 O OG1 . THR A 1 318 ? -14.424 -34.171 -5.484  1.00 50.31  ? 304 THR A OG1 1 
ATOM   2399 C CG2 . THR A 1 318 ? -14.551 -36.485 -6.076  1.00 42.01  ? 304 THR A CG2 1 
ATOM   2400 N N   . PHE A 1 319 ? -14.245 -37.164 -2.275  1.00 38.95  ? 305 PHE A N   1 
ATOM   2401 C CA  . PHE A 1 319 ? -13.985 -38.388 -1.559  1.00 38.22  ? 305 PHE A CA  1 
ATOM   2402 C C   . PHE A 1 319 ? -14.954 -38.542 -0.376  1.00 42.27  ? 305 PHE A C   1 
ATOM   2403 O O   . PHE A 1 319 ? -15.469 -39.634 -0.155  1.00 41.97  ? 305 PHE A O   1 
ATOM   2404 C CB  . PHE A 1 319 ? -12.510 -38.416 -1.090  1.00 39.22  ? 305 PHE A CB  1 
ATOM   2405 C CG  . PHE A 1 319 ? -12.072 -39.754 -0.550  1.00 39.64  ? 305 PHE A CG  1 
ATOM   2406 C CD1 . PHE A 1 319 ? -12.226 -40.061 0.798   1.00 41.03  ? 305 PHE A CD1 1 
ATOM   2407 C CD2 . PHE A 1 319 ? -11.505 -40.709 -1.388  1.00 41.20  ? 305 PHE A CD2 1 
ATOM   2408 C CE1 . PHE A 1 319 ? -11.839 -41.302 1.298   1.00 41.42  ? 305 PHE A CE1 1 
ATOM   2409 C CE2 . PHE A 1 319 ? -11.115 -41.952 -0.889  1.00 43.50  ? 305 PHE A CE2 1 
ATOM   2410 C CZ  . PHE A 1 319 ? -11.279 -42.237 0.457   1.00 40.98  ? 305 PHE A CZ  1 
ATOM   2411 N N   . ILE A 1 320 ? -15.164 -37.454 0.395   1.00 38.66  ? 306 ILE A N   1 
ATOM   2412 C CA  . ILE A 1 320 ? -15.998 -37.420 1.599   1.00 37.89  ? 306 ILE A CA  1 
ATOM   2413 C C   . ILE A 1 320 ? -17.474 -37.716 1.299   1.00 42.93  ? 306 ILE A C   1 
ATOM   2414 O O   . ILE A 1 320 ? -18.134 -38.387 2.093   1.00 44.07  ? 306 ILE A O   1 
ATOM   2415 C CB  . ILE A 1 320 ? -15.706 -36.164 2.477   1.00 40.28  ? 306 ILE A CB  1 
ATOM   2416 C CG1 . ILE A 1 320 ? -14.232 -36.221 2.980   1.00 40.13  ? 306 ILE A CG1 1 
ATOM   2417 C CG2 . ILE A 1 320 ? -16.670 -36.048 3.670   1.00 39.89  ? 306 ILE A CG2 1 
ATOM   2418 C CD1 . ILE A 1 320 ? -13.620 -34.933 3.364   1.00 41.51  ? 306 ILE A CD1 1 
ATOM   2419 N N   . ARG A 1 321 ? -17.949 -37.322 0.117   1.00 37.45  ? 307 ARG A N   1 
ATOM   2420 C CA  . ARG A 1 321 ? -19.307 -37.597 -0.321  1.00 36.25  ? 307 ARG A CA  1 
ATOM   2421 C C   . ARG A 1 321 ? -19.577 -39.105 -0.377  1.00 42.16  ? 307 ARG A C   1 
ATOM   2422 O O   . ARG A 1 321 ? -20.660 -39.547 0.020   1.00 42.07  ? 307 ARG A O   1 
ATOM   2423 C CB  . ARG A 1 321 ? -19.535 -36.987 -1.688  1.00 32.97  ? 307 ARG A CB  1 
ATOM   2424 C CG  . ARG A 1 321 ? -20.077 -35.606 -1.615  1.00 36.16  ? 307 ARG A CG  1 
ATOM   2425 C CD  . ARG A 1 321 ? -20.689 -35.231 -2.942  1.00 44.18  ? 307 ARG A CD  1 
ATOM   2426 N NE  . ARG A 1 321 ? -19.706 -35.091 -4.028  1.00 45.89  ? 307 ARG A NE  1 
ATOM   2427 C CZ  . ARG A 1 321 ? -18.952 -34.015 -4.226  1.00 58.51  ? 307 ARG A CZ  1 
ATOM   2428 N NH1 . ARG A 1 321 ? -19.007 -32.993 -3.382  1.00 51.56  ? 307 ARG A NH1 1 
ATOM   2429 N NH2 . ARG A 1 321 ? -18.121 -33.962 -5.260  1.00 42.59  ? 307 ARG A NH2 1 
ATOM   2430 N N   . LYS A 1 322 ? -18.583 -39.891 -0.842  1.00 39.06  ? 308 LYS A N   1 
ATOM   2431 C CA  . LYS A 1 322 ? -18.700 -41.348 -0.918  1.00 38.92  ? 308 LYS A CA  1 
ATOM   2432 C C   . LYS A 1 322 ? -18.424 -42.007 0.463   1.00 40.41  ? 308 LYS A C   1 
ATOM   2433 O O   . LYS A 1 322 ? -19.104 -42.959 0.838   1.00 37.72  ? 308 LYS A O   1 
ATOM   2434 C CB  . LYS A 1 322 ? -17.780 -41.917 -2.034  1.00 42.20  ? 308 LYS A CB  1 
ATOM   2435 C CG  . LYS A 1 322 ? -17.922 -43.416 -2.226  1.00 51.29  ? 308 LYS A CG  1 
ATOM   2436 C CD  . LYS A 1 322 ? -18.245 -43.802 -3.626  1.00 55.20  ? 308 LYS A CD  1 
ATOM   2437 C CE  . LYS A 1 322 ? -18.294 -45.303 -3.701  1.00 49.93  ? 308 LYS A CE  1 
ATOM   2438 N NZ  . LYS A 1 322 ? -18.077 -45.779 -5.082  1.00 52.69  ? 308 LYS A NZ  1 
ATOM   2439 N N   . PHE A 1 323 ? -17.437 -41.473 1.211   1.00 37.41  ? 309 PHE A N   1 
ATOM   2440 C CA  . PHE A 1 323 ? -16.994 -42.019 2.494   1.00 36.39  ? 309 PHE A CA  1 
ATOM   2441 C C   . PHE A 1 323 ? -17.162 -41.124 3.707   1.00 41.49  ? 309 PHE A C   1 
ATOM   2442 O O   . PHE A 1 323 ? -16.407 -40.166 3.891   1.00 42.00  ? 309 PHE A O   1 
ATOM   2443 C CB  . PHE A 1 323 ? -15.546 -42.559 2.412   1.00 37.09  ? 309 PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 323 ? -15.380 -43.583 1.315   1.00 37.58  ? 309 PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 323 ? -15.895 -44.871 1.458   1.00 39.27  ? 309 PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 323 ? -14.771 -43.239 0.100   1.00 38.16  ? 309 PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 323 ? -15.794 -45.799 0.405   1.00 39.86  ? 309 PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 323 ? -14.644 -44.171 -0.941  1.00 40.47  ? 309 PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 323 ? -15.160 -45.445 -0.786  1.00 38.83  ? 309 PHE A CZ  1 
ATOM   2450 N N   . TYR A 1 324 ? -18.117 -41.487 4.578   1.00 37.71  ? 310 TYR A N   1 
ATOM   2451 C CA  . TYR A 1 324 ? -18.352 -40.824 5.857   1.00 37.08  ? 310 TYR A CA  1 
ATOM   2452 C C   . TYR A 1 324 ? -17.018 -40.893 6.615   1.00 43.15  ? 310 TYR A C   1 
ATOM   2453 O O   . TYR A 1 324 ? -16.427 -41.972 6.733   1.00 42.63  ? 310 TYR A O   1 
ATOM   2454 C CB  . TYR A 1 324 ? -19.451 -41.570 6.625   1.00 37.24  ? 310 TYR A CB  1 
ATOM   2455 C CG  . TYR A 1 324 ? -19.913 -40.846 7.871   1.00 36.55  ? 310 TYR A CG  1 
ATOM   2456 C CD1 . TYR A 1 324 ? -19.245 -41.009 9.083   1.00 38.43  ? 310 TYR A CD1 1 
ATOM   2457 C CD2 . TYR A 1 324 ? -21.037 -40.029 7.849   1.00 35.67  ? 310 TYR A CD2 1 
ATOM   2458 C CE1 . TYR A 1 324 ? -19.670 -40.354 10.237  1.00 38.92  ? 310 TYR A CE1 1 
ATOM   2459 C CE2 . TYR A 1 324 ? -21.469 -39.367 8.995   1.00 36.35  ? 310 TYR A CE2 1 
ATOM   2460 C CZ  . TYR A 1 324 ? -20.774 -39.521 10.186  1.00 42.75  ? 310 TYR A CZ  1 
ATOM   2461 O OH  . TYR A 1 324 ? -21.190 -38.873 11.322  1.00 41.68  ? 310 TYR A OH  1 
ATOM   2462 N N   . THR A 1 325 ? -16.496 -39.733 7.026   1.00 41.31  ? 311 THR A N   1 
ATOM   2463 C CA  . THR A 1 325 ? -15.182 -39.628 7.665   1.00 40.67  ? 311 THR A CA  1 
ATOM   2464 C C   . THR A 1 325 ? -15.268 -39.244 9.141   1.00 44.57  ? 311 THR A C   1 
ATOM   2465 O O   . THR A 1 325 ? -15.941 -38.275 9.497   1.00 44.78  ? 311 THR A O   1 
ATOM   2466 C CB  . THR A 1 325 ? -14.295 -38.676 6.839   1.00 43.57  ? 311 THR A CB  1 
ATOM   2467 O OG1 . THR A 1 325 ? -14.374 -39.042 5.461   1.00 41.67  ? 311 THR A OG1 1 
ATOM   2468 C CG2 . THR A 1 325 ? -12.848 -38.693 7.274   1.00 39.77  ? 311 THR A CG2 1 
ATOM   2469 N N   . GLU A 1 326 ? -14.577 -40.008 9.990   1.00 40.89  ? 312 GLU A N   1 
ATOM   2470 C CA  . GLU A 1 326 ? -14.478 -39.751 11.423  1.00 40.30  ? 312 GLU A CA  1 
ATOM   2471 C C   . GLU A 1 326 ? -13.031 -39.380 11.749  1.00 44.79  ? 312 GLU A C   1 
ATOM   2472 O O   . GLU A 1 326 ? -12.101 -40.102 11.365  1.00 45.23  ? 312 GLU A O   1 
ATOM   2473 C CB  . GLU A 1 326 ? -14.944 -40.965 12.246  1.00 41.39  ? 312 GLU A CB  1 
ATOM   2474 C CG  . GLU A 1 326 ? -15.016 -40.679 13.741  1.00 49.07  ? 312 GLU A CG  1 
ATOM   2475 C CD  . GLU A 1 326 ? -15.248 -41.905 14.594  1.00 66.55  ? 312 GLU A CD  1 
ATOM   2476 O OE1 . GLU A 1 326 ? -14.274 -42.639 14.861  1.00 63.65  ? 312 GLU A OE1 1 
ATOM   2477 O OE2 . GLU A 1 326 ? -16.408 -42.135 14.995  1.00 64.51  ? 312 GLU A OE2 1 
ATOM   2478 N N   . PHE A 1 327 ? -12.848 -38.236 12.417  1.00 40.90  ? 313 PHE A N   1 
ATOM   2479 C CA  . PHE A 1 327 ? -11.537 -37.738 12.813  1.00 40.88  ? 313 PHE A CA  1 
ATOM   2480 C C   . PHE A 1 327 ? -11.350 -38.005 14.287  1.00 48.72  ? 313 PHE A C   1 
ATOM   2481 O O   . PHE A 1 327 ? -12.045 -37.411 15.113  1.00 47.87  ? 313 PHE A O   1 
ATOM   2482 C CB  . PHE A 1 327 ? -11.426 -36.249 12.498  1.00 41.66  ? 313 PHE A CB  1 
ATOM   2483 C CG  . PHE A 1 327 ? -11.447 -35.966 11.018  1.00 41.29  ? 313 PHE A CG  1 
ATOM   2484 C CD1 . PHE A 1 327 ? -10.268 -35.928 10.288  1.00 42.34  ? 313 PHE A CD1 1 
ATOM   2485 C CD2 . PHE A 1 327 ? -12.650 -35.741 10.354  1.00 41.67  ? 313 PHE A CD2 1 
ATOM   2486 C CE1 . PHE A 1 327 ? -10.288 -35.678 8.919   1.00 43.08  ? 313 PHE A CE1 1 
ATOM   2487 C CE2 . PHE A 1 327 ? -12.670 -35.483 8.987   1.00 43.84  ? 313 PHE A CE2 1 
ATOM   2488 C CZ  . PHE A 1 327 ? -11.489 -35.461 8.275   1.00 41.97  ? 313 PHE A CZ  1 
ATOM   2489 N N   . ASP A 1 328 ? -10.463 -38.962 14.609  1.00 48.40  ? 314 ASP A N   1 
ATOM   2490 C CA  . ASP A 1 328 ? -10.215 -39.423 15.978  1.00 49.17  ? 314 ASP A CA  1 
ATOM   2491 C C   . ASP A 1 328 ? -8.990  -38.763 16.581  1.00 53.14  ? 314 ASP A C   1 
ATOM   2492 O O   . ASP A 1 328 ? -7.863  -39.151 16.271  1.00 52.60  ? 314 ASP A O   1 
ATOM   2493 C CB  . ASP A 1 328 ? -10.104 -40.968 15.989  1.00 51.52  ? 314 ASP A CB  1 
ATOM   2494 C CG  . ASP A 1 328 ? -10.143 -41.680 17.333  1.00 60.58  ? 314 ASP A CG  1 
ATOM   2495 O OD1 . ASP A 1 328 ? -9.995  -40.997 18.384  1.00 61.65  ? 314 ASP A OD1 1 
ATOM   2496 O OD2 . ASP A 1 328 ? -10.291 -42.919 17.336  1.00 63.89  ? 314 ASP A OD2 1 
ATOM   2497 N N   . ARG A 1 329 ? -9.219  -37.760 17.439  1.00 50.88  ? 315 ARG A N   1 
ATOM   2498 C CA  . ARG A 1 329 ? -8.152  -37.022 18.108  1.00 52.22  ? 315 ARG A CA  1 
ATOM   2499 C C   . ARG A 1 329 ? -7.499  -37.843 19.215  1.00 61.45  ? 315 ARG A C   1 
ATOM   2500 O O   . ARG A 1 329 ? -6.295  -37.680 19.467  1.00 62.82  ? 315 ARG A O   1 
ATOM   2501 C CB  . ARG A 1 329 ? -8.669  -35.691 18.687  1.00 50.86  ? 315 ARG A CB  1 
ATOM   2502 C CG  . ARG A 1 329 ? -8.730  -34.533 17.702  1.00 55.63  ? 315 ARG A CG  1 
ATOM   2503 C CD  . ARG A 1 329 ? -7.355  -34.072 17.262  1.00 63.17  ? 315 ARG A CD  1 
ATOM   2504 N NE  . ARG A 1 329 ? -6.518  -33.619 18.379  1.00 70.06  ? 315 ARG A NE  1 
ATOM   2505 C CZ  . ARG A 1 329 ? -6.513  -32.382 18.875  1.00 73.08  ? 315 ARG A CZ  1 
ATOM   2506 N NH1 . ARG A 1 329 ? -7.311  -31.450 18.366  1.00 48.86  ? 315 ARG A NH1 1 
ATOM   2507 N NH2 . ARG A 1 329 ? -5.717  -32.070 19.887  1.00 58.37  ? 315 ARG A NH2 1 
ATOM   2508 N N   . ARG A 1 330 ? -8.302  -38.695 19.895  1.00 58.47  ? 316 ARG A N   1 
ATOM   2509 C CA  . ARG A 1 330 ? -7.862  -39.554 20.989  1.00 58.33  ? 316 ARG A CA  1 
ATOM   2510 C C   . ARG A 1 330 ? -6.794  -40.540 20.536  1.00 61.88  ? 316 ARG A C   1 
ATOM   2511 O O   . ARG A 1 330 ? -5.748  -40.629 21.180  1.00 62.52  ? 316 ARG A O   1 
ATOM   2512 C CB  . ARG A 1 330 ? -9.065  -40.279 21.625  1.00 59.34  ? 316 ARG A CB  1 
ATOM   2513 C CG  . ARG A 1 330 ? -8.747  -41.354 22.675  1.00 73.86  ? 316 ARG A CG  1 
ATOM   2514 C CD  . ARG A 1 330 ? -8.148  -40.819 23.957  1.00 92.97  ? 316 ARG A CD  1 
ATOM   2515 N NE  . ARG A 1 330 ? -7.934  -41.896 24.927  1.00 114.76 ? 316 ARG A NE  1 
ATOM   2516 C CZ  . ARG A 1 330 ? -6.743  -42.259 25.395  1.00 136.03 ? 316 ARG A CZ  1 
ATOM   2517 N NH1 . ARG A 1 330 ? -6.643  -43.258 26.264  1.00 126.28 ? 316 ARG A NH1 1 
ATOM   2518 N NH2 . ARG A 1 330 ? -5.649  -41.588 25.049  1.00 123.57 ? 316 ARG A NH2 1 
ATOM   2519 N N   . ASN A 1 331 ? -7.038  -41.250 19.422  1.00 56.50  ? 317 ASN A N   1 
ATOM   2520 C CA  . ASN A 1 331 ? -6.119  -42.268 18.927  1.00 55.49  ? 317 ASN A CA  1 
ATOM   2521 C C   . ASN A 1 331 ? -5.304  -41.870 17.704  1.00 58.15  ? 317 ASN A C   1 
ATOM   2522 O O   . ASN A 1 331 ? -4.620  -42.728 17.133  1.00 57.68  ? 317 ASN A O   1 
ATOM   2523 C CB  . ASN A 1 331 ? -6.875  -43.572 18.695  1.00 56.18  ? 317 ASN A CB  1 
ATOM   2524 C CG  . ASN A 1 331 ? -7.618  -44.078 19.914  1.00 75.22  ? 317 ASN A CG  1 
ATOM   2525 O OD1 . ASN A 1 331 ? -8.842  -44.196 19.920  1.00 65.48  ? 317 ASN A OD1 1 
ATOM   2526 N ND2 . ASN A 1 331 ? -6.902  -44.350 20.990  1.00 68.41  ? 317 ASN A ND2 1 
ATOM   2527 N N   . ASN A 1 332 ? -5.350  -40.576 17.315  1.00 52.99  ? 318 ASN A N   1 
ATOM   2528 C CA  . ASN A 1 332 ? -4.655  -40.040 16.146  1.00 51.69  ? 318 ASN A CA  1 
ATOM   2529 C C   . ASN A 1 332 ? -4.816  -40.949 14.914  1.00 53.71  ? 318 ASN A C   1 
ATOM   2530 O O   . ASN A 1 332 ? -3.848  -41.513 14.399  1.00 51.75  ? 318 ASN A O   1 
ATOM   2531 C CB  . ASN A 1 332 ? -3.184  -39.677 16.445  1.00 50.76  ? 318 ASN A CB  1 
ATOM   2532 C CG  . ASN A 1 332 ? -2.967  -38.636 17.524  1.00 71.06  ? 318 ASN A CG  1 
ATOM   2533 O OD1 . ASN A 1 332 ? -2.079  -38.774 18.356  1.00 65.87  ? 318 ASN A OD1 1 
ATOM   2534 N ND2 . ASN A 1 332 ? -3.756  -37.572 17.570  1.00 64.74  ? 318 ASN A ND2 1 
ATOM   2535 N N   . ARG A 1 333 ? -6.077  -41.121 14.489  1.00 50.90  ? 319 ARG A N   1 
ATOM   2536 C CA  . ARG A 1 333 ? -6.462  -41.917 13.315  1.00 50.50  ? 319 ARG A CA  1 
ATOM   2537 C C   . ARG A 1 333 ? -7.673  -41.314 12.610  1.00 52.97  ? 319 ARG A C   1 
ATOM   2538 O O   . ARG A 1 333 ? -8.391  -40.490 13.185  1.00 53.25  ? 319 ARG A O   1 
ATOM   2539 C CB  . ARG A 1 333 ? -6.720  -43.406 13.654  1.00 49.51  ? 319 ARG A CB  1 
ATOM   2540 C CG  . ARG A 1 333 ? -7.229  -43.677 15.048  1.00 56.39  ? 319 ARG A CG  1 
ATOM   2541 C CD  . ARG A 1 333 ? -7.523  -45.151 15.238  1.00 67.34  ? 319 ARG A CD  1 
ATOM   2542 N NE  . ARG A 1 333 ? -8.868  -45.260 15.735  1.00 64.96  ? 319 ARG A NE  1 
ATOM   2543 C CZ  . ARG A 1 333 ? -9.499  -46.331 16.188  1.00 72.08  ? 319 ARG A CZ  1 
ATOM   2544 N NH1 . ARG A 1 333 ? -10.712 -46.211 16.688  1.00 48.29  ? 319 ARG A NH1 1 
ATOM   2545 N NH2 . ARG A 1 333 ? -8.915  -47.530 16.159  1.00 63.30  ? 319 ARG A NH2 1 
ATOM   2546 N N   . ILE A 1 334 ? -7.897  -41.746 11.366  1.00 47.25  ? 320 ILE A N   1 
ATOM   2547 C CA  . ILE A 1 334 ? -9.035  -41.346 10.552  1.00 45.95  ? 320 ILE A CA  1 
ATOM   2548 C C   . ILE A 1 334 ? -9.822  -42.612 10.226  1.00 49.07  ? 320 ILE A C   1 
ATOM   2549 O O   . ILE A 1 334 ? -9.239  -43.609 9.801   1.00 47.31  ? 320 ILE A O   1 
ATOM   2550 C CB  . ILE A 1 334 ? -8.571  -40.575 9.276   1.00 48.15  ? 320 ILE A CB  1 
ATOM   2551 C CG1 . ILE A 1 334 ? -7.962  -39.196 9.663   1.00 46.96  ? 320 ILE A CG1 1 
ATOM   2552 C CG2 . ILE A 1 334 ? -9.725  -40.422 8.255   1.00 49.52  ? 320 ILE A CG2 1 
ATOM   2553 C CD1 . ILE A 1 334 ? -7.158  -38.556 8.604   1.00 46.28  ? 320 ILE A CD1 1 
ATOM   2554 N N   . GLY A 1 335 ? -11.126 -42.561 10.445  1.00 46.59  ? 321 GLY A N   1 
ATOM   2555 C CA  . GLY A 1 335 ? -12.005 -43.681 10.140  1.00 46.51  ? 321 GLY A CA  1 
ATOM   2556 C C   . GLY A 1 335 ? -12.888 -43.414 8.941   1.00 50.45  ? 321 GLY A C   1 
ATOM   2557 O O   . GLY A 1 335 ? -13.468 -42.331 8.837   1.00 51.30  ? 321 GLY A O   1 
ATOM   2558 N N   . PHE A 1 336 ? -12.986 -44.384 8.022   1.00 45.92  ? 322 PHE A N   1 
ATOM   2559 C CA  . PHE A 1 336 ? -13.849 -44.275 6.834   1.00 45.47  ? 322 PHE A CA  1 
ATOM   2560 C C   . PHE A 1 336 ? -14.918 -45.354 6.807   1.00 49.97  ? 322 PHE A C   1 
ATOM   2561 O O   . PHE A 1 336 ? -14.651 -46.502 7.167   1.00 49.84  ? 322 PHE A O   1 
ATOM   2562 C CB  . PHE A 1 336 ? -13.052 -44.354 5.514   1.00 46.51  ? 322 PHE A CB  1 
ATOM   2563 C CG  . PHE A 1 336 ? -12.076 -43.240 5.264   1.00 47.44  ? 322 PHE A CG  1 
ATOM   2564 C CD1 . PHE A 1 336 ? -12.515 -41.935 5.099   1.00 50.12  ? 322 PHE A CD1 1 
ATOM   2565 C CD2 . PHE A 1 336 ? -10.719 -43.504 5.123   1.00 49.00  ? 322 PHE A CD2 1 
ATOM   2566 C CE1 . PHE A 1 336 ? -11.609 -40.909 4.839   1.00 50.87  ? 322 PHE A CE1 1 
ATOM   2567 C CE2 . PHE A 1 336 ? -9.812  -42.476 4.880   1.00 51.36  ? 322 PHE A CE2 1 
ATOM   2568 C CZ  . PHE A 1 336 ? -10.263 -41.187 4.731   1.00 49.62  ? 322 PHE A CZ  1 
ATOM   2569 N N   . ALA A 1 337 ? -16.109 -44.990 6.330   1.00 45.99  ? 323 ALA A N   1 
ATOM   2570 C CA  . ALA A 1 337 ? -17.257 -45.873 6.156   1.00 45.61  ? 323 ALA A CA  1 
ATOM   2571 C C   . ALA A 1 337 ? -18.075 -45.394 4.960   1.00 48.74  ? 323 ALA A C   1 
ATOM   2572 O O   . ALA A 1 337 ? -18.099 -44.197 4.678   1.00 48.31  ? 323 ALA A O   1 
ATOM   2573 C CB  . ALA A 1 337 ? -18.124 -45.898 7.415   1.00 46.13  ? 323 ALA A CB  1 
ATOM   2574 N N   . LEU A 1 338 ? -18.741 -46.330 4.266   1.00 44.76  ? 324 LEU A N   1 
ATOM   2575 C CA  . LEU A 1 338 ? -19.592 -46.040 3.126   1.00 44.85  ? 324 LEU A CA  1 
ATOM   2576 C C   . LEU A 1 338 ? -20.718 -45.115 3.609   1.00 48.27  ? 324 LEU A C   1 
ATOM   2577 O O   . LEU A 1 338 ? -21.392 -45.427 4.598   1.00 47.83  ? 324 LEU A O   1 
ATOM   2578 C CB  . LEU A 1 338 ? -20.157 -47.362 2.587   1.00 45.39  ? 324 LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 338 ? -20.152 -47.675 1.061   1.00 50.83  ? 324 LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 338 ? -21.544 -48.099 0.611   1.00 51.42  ? 324 LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 338 ? -19.570 -46.532 0.164   1.00 50.38  ? 324 LEU A CD2 1 
ATOM   2582 N N   . ALA A 1 339 ? -20.840 -43.929 2.989   1.00 44.47  ? 325 ALA A N   1 
ATOM   2583 C CA  . ALA A 1 339 ? -21.865 -42.958 3.374   1.00 43.97  ? 325 ALA A CA  1 
ATOM   2584 C C   . ALA A 1 339 ? -23.232 -43.315 2.792   1.00 49.83  ? 325 ALA A C   1 
ATOM   2585 O O   . ALA A 1 339 ? -23.308 -44.003 1.772   1.00 50.53  ? 325 ALA A O   1 
ATOM   2586 C CB  . ALA A 1 339 ? -21.451 -41.556 2.940   1.00 44.66  ? 325 ALA A CB  1 
ATOM   2587 N N   . ARG A 1 340 ? -24.315 -42.847 3.447   1.00 47.81  ? 326 ARG A N   1 
ATOM   2588 C CA  . ARG A 1 340 ? -25.715 -43.037 3.030   1.00 48.50  ? 326 ARG A CA  1 
ATOM   2589 C C   . ARG A 1 340 ? -26.618 -41.852 3.448   1.00 52.36  ? 326 ARG A C   1 
ATOM   2590 O O   . ARG A 1 340 ? -26.223 -41.072 4.352   1.00 49.72  ? 326 ARG A O   1 
ATOM   2591 C CB  . ARG A 1 340 ? -26.264 -44.392 3.528   1.00 47.52  ? 326 ARG A CB  1 
ATOM   2592 C CG  . ARG A 1 340 ? -26.507 -44.485 5.028   1.00 55.13  ? 326 ARG A CG  1 
ATOM   2593 C CD  . ARG A 1 340 ? -27.200 -45.783 5.360   1.00 63.44  ? 326 ARG A CD  1 
ATOM   2594 N NE  . ARG A 1 340 ? -27.520 -45.891 6.778   1.00 71.82  ? 326 ARG A NE  1 
ATOM   2595 C CZ  . ARG A 1 340 ? -27.919 -47.010 7.374   1.00 86.92  ? 326 ARG A CZ  1 
ATOM   2596 N NH1 . ARG A 1 340 ? -28.051 -48.132 6.674   1.00 69.14  ? 326 ARG A NH1 1 
ATOM   2597 N NH2 . ARG A 1 340 ? -28.192 -47.016 8.671   1.00 77.19  ? 326 ARG A NH2 1 
ATOM   2598 O OXT . ARG A 1 340 ? -27.734 -41.725 2.893   1.00 77.28  ? 326 ARG A OXT 1 
ATOM   2599 N N   . GLY B 1 4   ? -33.382 -59.481 12.498  1.00 60.03  ? -2  GLY B N   1 
ATOM   2600 C CA  . GLY B 1 4   ? -32.215 -58.614 12.631  1.00 59.90  ? -2  GLY B CA  1 
ATOM   2601 C C   . GLY B 1 4   ? -32.523 -57.166 12.969  1.00 64.72  ? -2  GLY B C   1 
ATOM   2602 O O   . GLY B 1 4   ? -33.683 -56.799 13.170  1.00 64.22  ? -2  GLY B O   1 
ATOM   2603 N N   . ASN B 1 5   ? -31.472 -56.329 13.020  1.00 63.15  ? -1  ASN B N   1 
ATOM   2604 C CA  . ASN B 1 5   ? -31.529 -54.893 13.356  1.00 63.66  ? -1  ASN B CA  1 
ATOM   2605 C C   . ASN B 1 5   ? -31.154 -53.955 12.195  1.00 66.84  ? -1  ASN B C   1 
ATOM   2606 O O   . ASN B 1 5   ? -31.439 -52.757 12.268  1.00 67.19  ? -1  ASN B O   1 
ATOM   2607 C CB  . ASN B 1 5   ? -30.548 -54.594 14.517  1.00 69.63  ? -1  ASN B CB  1 
ATOM   2608 C CG  . ASN B 1 5   ? -31.120 -54.705 15.911  1.00 111.46 ? -1  ASN B CG  1 
ATOM   2609 O OD1 . ASN B 1 5   ? -32.002 -53.934 16.318  1.00 111.45 ? -1  ASN B OD1 1 
ATOM   2610 N ND2 . ASN B 1 5   ? -30.563 -55.608 16.710  1.00 103.38 ? -1  ASN B ND2 1 
ATOM   2611 N N   . THR B 1 6   ? -30.451 -54.472 11.174  1.00 62.03  ? 0   THR B N   1 
ATOM   2612 C CA  . THR B 1 6   ? -29.913 -53.654 10.087  1.00 61.51  ? 0   THR B CA  1 
ATOM   2613 C C   . THR B 1 6   ? -30.764 -53.408 8.835   1.00 63.42  ? 0   THR B C   1 
ATOM   2614 O O   . THR B 1 6   ? -31.627 -54.197 8.454   1.00 63.08  ? 0   THR B O   1 
ATOM   2615 C CB  . THR B 1 6   ? -28.464 -54.106 9.698   1.00 70.85  ? 0   THR B CB  1 
ATOM   2616 O OG1 . THR B 1 6   ? -28.502 -55.333 8.963   1.00 71.79  ? 0   THR B OG1 1 
ATOM   2617 C CG2 . THR B 1 6   ? -27.517 -54.228 10.902  1.00 67.84  ? 0   THR B CG2 1 
ATOM   2618 N N   . THR B 1 7   ? -30.484 -52.279 8.202   1.00 57.39  ? 1   THR B N   1 
ATOM   2619 C CA  . THR B 1 7   ? -30.951 -51.898 6.889   1.00 55.21  ? 1   THR B CA  1 
ATOM   2620 C C   . THR B 1 7   ? -29.656 -51.567 6.151   1.00 55.86  ? 1   THR B C   1 
ATOM   2621 O O   . THR B 1 7   ? -28.655 -51.203 6.768   1.00 55.01  ? 1   THR B O   1 
ATOM   2622 C CB  . THR B 1 7   ? -31.963 -50.735 6.875   1.00 59.40  ? 1   THR B CB  1 
ATOM   2623 O OG1 . THR B 1 7   ? -31.333 -49.497 7.208   1.00 60.09  ? 1   THR B OG1 1 
ATOM   2624 C CG2 . THR B 1 7   ? -33.198 -51.001 7.716   1.00 59.00  ? 1   THR B CG2 1 
ATOM   2625 N N   . SER B 1 8   ? -29.668 -51.719 4.846   1.00 51.11  ? 2   SER B N   1 
ATOM   2626 C CA  . SER B 1 8   ? -28.530 -51.410 3.999   1.00 49.50  ? 2   SER B CA  1 
ATOM   2627 C C   . SER B 1 8   ? -29.005 -50.753 2.720   1.00 49.95  ? 2   SER B C   1 
ATOM   2628 O O   . SER B 1 8   ? -29.892 -51.278 2.050   1.00 48.33  ? 2   SER B O   1 
ATOM   2629 C CB  . SER B 1 8   ? -27.743 -52.675 3.705   1.00 52.90  ? 2   SER B CB  1 
ATOM   2630 O OG  . SER B 1 8   ? -26.710 -52.434 2.771   1.00 58.51  ? 2   SER B OG  1 
ATOM   2631 N N   . SER B 1 9   ? -28.436 -49.580 2.400   1.00 46.55  ? 3   SER B N   1 
ATOM   2632 C CA  . SER B 1 9   ? -28.815 -48.840 1.203   1.00 46.34  ? 3   SER B CA  1 
ATOM   2633 C C   . SER B 1 9   ? -27.743 -48.813 0.110   1.00 49.24  ? 3   SER B C   1 
ATOM   2634 O O   . SER B 1 9   ? -26.566 -48.646 0.400   1.00 48.89  ? 3   SER B O   1 
ATOM   2635 C CB  . SER B 1 9   ? -29.297 -47.436 1.553   1.00 50.63  ? 3   SER B CB  1 
ATOM   2636 O OG  . SER B 1 9   ? -28.233 -46.517 1.727   1.00 61.85  ? 3   SER B OG  1 
ATOM   2637 N N   . VAL B 1 10  ? -28.159 -48.991 -1.147  1.00 44.55  ? 4   VAL B N   1 
ATOM   2638 C CA  . VAL B 1 10  ? -27.263 -48.956 -2.299  1.00 43.18  ? 4   VAL B CA  1 
ATOM   2639 C C   . VAL B 1 10  ? -27.645 -47.725 -3.115  1.00 44.58  ? 4   VAL B C   1 
ATOM   2640 O O   . VAL B 1 10  ? -28.798 -47.624 -3.541  1.00 43.97  ? 4   VAL B O   1 
ATOM   2641 C CB  . VAL B 1 10  ? -27.344 -50.260 -3.144  1.00 46.85  ? 4   VAL B CB  1 
ATOM   2642 C CG1 . VAL B 1 10  ? -26.452 -50.184 -4.368  1.00 45.91  ? 4   VAL B CG1 1 
ATOM   2643 C CG2 . VAL B 1 10  ? -27.001 -51.489 -2.309  1.00 47.02  ? 4   VAL B CG2 1 
ATOM   2644 N N   . ILE B 1 11  ? -26.694 -46.784 -3.311  1.00 38.94  ? 5   ILE B N   1 
ATOM   2645 C CA  . ILE B 1 11  ? -26.922 -45.578 -4.125  1.00 38.36  ? 5   ILE B CA  1 
ATOM   2646 C C   . ILE B 1 11  ? -26.834 -45.972 -5.605  1.00 40.98  ? 5   ILE B C   1 
ATOM   2647 O O   . ILE B 1 11  ? -25.906 -46.682 -5.987  1.00 42.00  ? 5   ILE B O   1 
ATOM   2648 C CB  . ILE B 1 11  ? -25.951 -44.408 -3.756  1.00 41.64  ? 5   ILE B CB  1 
ATOM   2649 C CG1 . ILE B 1 11  ? -26.090 -43.951 -2.271  1.00 43.50  ? 5   ILE B CG1 1 
ATOM   2650 C CG2 . ILE B 1 11  ? -26.048 -43.226 -4.715  1.00 40.17  ? 5   ILE B CG2 1 
ATOM   2651 C CD1 . ILE B 1 11  ? -27.551 -43.792 -1.669  1.00 54.72  ? 5   ILE B CD1 1 
ATOM   2652 N N   . LEU B 1 12  ? -27.795 -45.526 -6.418  1.00 35.15  ? 6   LEU B N   1 
ATOM   2653 C CA  . LEU B 1 12  ? -27.863 -45.832 -7.850  1.00 33.74  ? 6   LEU B CA  1 
ATOM   2654 C C   . LEU B 1 12  ? -27.566 -44.618 -8.692  1.00 36.44  ? 6   LEU B C   1 
ATOM   2655 O O   . LEU B 1 12  ? -27.873 -43.488 -8.315  1.00 34.91  ? 6   LEU B O   1 
ATOM   2656 C CB  . LEU B 1 12  ? -29.252 -46.382 -8.263  1.00 33.38  ? 6   LEU B CB  1 
ATOM   2657 C CG  . LEU B 1 12  ? -29.806 -47.551 -7.465  1.00 38.65  ? 6   LEU B CG  1 
ATOM   2658 C CD1 . LEU B 1 12  ? -31.194 -47.934 -7.956  1.00 38.68  ? 6   LEU B CD1 1 
ATOM   2659 C CD2 . LEU B 1 12  ? -28.857 -48.741 -7.494  1.00 40.35  ? 6   LEU B CD2 1 
ATOM   2660 N N   . THR B 1 13  ? -27.036 -44.871 -9.877  1.00 34.04  ? 7   THR B N   1 
ATOM   2661 C CA  . THR B 1 13  ? -26.722 -43.863 -10.874 1.00 34.13  ? 7   THR B CA  1 
ATOM   2662 C C   . THR B 1 13  ? -27.847 -43.918 -11.901 1.00 39.53  ? 7   THR B C   1 
ATOM   2663 O O   . THR B 1 13  ? -28.236 -45.003 -12.336 1.00 39.53  ? 7   THR B O   1 
ATOM   2664 C CB  . THR B 1 13  ? -25.344 -44.189 -11.481 1.00 40.12  ? 7   THR B CB  1 
ATOM   2665 O OG1 . THR B 1 13  ? -24.375 -44.268 -10.429 1.00 48.34  ? 7   THR B OG1 1 
ATOM   2666 C CG2 . THR B 1 13  ? -24.909 -43.211 -12.538 1.00 31.04  ? 7   THR B CG2 1 
ATOM   2667 N N   . ASN B 1 14  ? -28.381 -42.763 -12.269 1.00 36.93  ? 8   ASN B N   1 
ATOM   2668 C CA  . ASN B 1 14  ? -29.432 -42.690 -13.280 1.00 37.26  ? 8   ASN B CA  1 
ATOM   2669 C C   . ASN B 1 14  ? -28.784 -42.307 -14.601 1.00 43.54  ? 8   ASN B C   1 
ATOM   2670 O O   . ASN B 1 14  ? -28.245 -41.206 -14.735 1.00 44.72  ? 8   ASN B O   1 
ATOM   2671 C CB  . ASN B 1 14  ? -30.463 -41.651 -12.866 1.00 32.47  ? 8   ASN B CB  1 
ATOM   2672 C CG  . ASN B 1 14  ? -31.584 -41.332 -13.820 1.00 47.68  ? 8   ASN B CG  1 
ATOM   2673 O OD1 . ASN B 1 14  ? -31.722 -41.843 -14.927 1.00 34.32  ? 8   ASN B OD1 1 
ATOM   2674 N ND2 . ASN B 1 14  ? -32.447 -40.463 -13.377 1.00 50.38  ? 8   ASN B ND2 1 
ATOM   2675 N N   . TYR B 1 15  ? -28.828 -43.217 -15.561 1.00 39.87  ? 9   TYR B N   1 
ATOM   2676 C CA  . TYR B 1 15  ? -28.302 -42.987 -16.893 1.00 40.00  ? 9   TYR B CA  1 
ATOM   2677 C C   . TYR B 1 15  ? -29.474 -42.831 -17.874 1.00 44.97  ? 9   TYR B C   1 
ATOM   2678 O O   . TYR B 1 15  ? -30.156 -43.811 -18.194 1.00 45.53  ? 9   TYR B O   1 
ATOM   2679 C CB  . TYR B 1 15  ? -27.322 -44.113 -17.321 1.00 41.84  ? 9   TYR B CB  1 
ATOM   2680 C CG  . TYR B 1 15  ? -26.842 -43.969 -18.752 1.00 44.80  ? 9   TYR B CG  1 
ATOM   2681 C CD1 . TYR B 1 15  ? -25.852 -43.044 -19.090 1.00 46.64  ? 9   TYR B CD1 1 
ATOM   2682 C CD2 . TYR B 1 15  ? -27.435 -44.694 -19.784 1.00 45.77  ? 9   TYR B CD2 1 
ATOM   2683 C CE1 . TYR B 1 15  ? -25.450 -42.865 -20.414 1.00 47.67  ? 9   TYR B CE1 1 
ATOM   2684 C CE2 . TYR B 1 15  ? -27.053 -44.509 -21.115 1.00 46.58  ? 9   TYR B CE2 1 
ATOM   2685 C CZ  . TYR B 1 15  ? -26.047 -43.606 -21.424 1.00 54.16  ? 9   TYR B CZ  1 
ATOM   2686 O OH  . TYR B 1 15  ? -25.665 -43.425 -22.733 1.00 54.91  ? 9   TYR B OH  1 
ATOM   2687 N N   . MET B 1 16  ? -29.722 -41.588 -18.314 1.00 42.07  ? 10  MET B N   1 
ATOM   2688 C CA  . MET B 1 16  ? -30.741 -41.204 -19.305 1.00 43.12  ? 10  MET B CA  1 
ATOM   2689 C C   . MET B 1 16  ? -32.190 -41.655 -18.997 1.00 44.47  ? 10  MET B C   1 
ATOM   2690 O O   . MET B 1 16  ? -33.000 -41.794 -19.919 1.00 43.78  ? 10  MET B O   1 
ATOM   2691 C CB  . MET B 1 16  ? -30.327 -41.667 -20.716 1.00 46.73  ? 10  MET B CB  1 
ATOM   2692 C CG  . MET B 1 16  ? -28.919 -41.301 -21.103 1.00 52.44  ? 10  MET B CG  1 
ATOM   2693 S SD  . MET B 1 16  ? -28.729 -41.143 -22.893 1.00 59.30  ? 10  MET B SD  1 
ATOM   2694 C CE  . MET B 1 16  ? -29.341 -42.802 -23.464 1.00 56.29  ? 10  MET B CE  1 
ATOM   2695 N N   . ASP B 1 17  ? -32.507 -41.913 -17.722 1.00 39.60  ? 11  ASP B N   1 
ATOM   2696 C CA  . ASP B 1 17  ? -33.827 -42.378 -17.286 1.00 38.88  ? 11  ASP B CA  1 
ATOM   2697 C C   . ASP B 1 17  ? -34.185 -43.792 -17.758 1.00 40.78  ? 11  ASP B C   1 
ATOM   2698 O O   . ASP B 1 17  ? -35.317 -44.224 -17.540 1.00 40.60  ? 11  ASP B O   1 
ATOM   2699 C CB  . ASP B 1 17  ? -34.928 -41.352 -17.643 1.00 40.79  ? 11  ASP B CB  1 
ATOM   2700 C CG  . ASP B 1 17  ? -35.093 -40.242 -16.642 1.00 49.99  ? 11  ASP B CG  1 
ATOM   2701 O OD1 . ASP B 1 17  ? -34.461 -40.312 -15.570 1.00 51.74  ? 11  ASP B OD1 1 
ATOM   2702 O OD2 . ASP B 1 17  ? -35.901 -39.337 -16.900 1.00 57.77  ? 11  ASP B OD2 1 
ATOM   2703 N N   . THR B 1 18  ? -33.224 -44.519 -18.369 1.00 35.29  ? 12  THR B N   1 
ATOM   2704 C CA  . THR B 1 18  ? -33.459 -45.872 -18.899 1.00 34.70  ? 12  THR B CA  1 
ATOM   2705 C C   . THR B 1 18  ? -32.664 -46.958 -18.174 1.00 40.21  ? 12  THR B C   1 
ATOM   2706 O O   . THR B 1 18  ? -33.017 -48.139 -18.282 1.00 39.42  ? 12  THR B O   1 
ATOM   2707 C CB  . THR B 1 18  ? -33.180 -45.926 -20.404 1.00 37.71  ? 12  THR B CB  1 
ATOM   2708 O OG1 . THR B 1 18  ? -31.805 -45.583 -20.637 1.00 42.01  ? 12  THR B OG1 1 
ATOM   2709 C CG2 . THR B 1 18  ? -34.133 -45.030 -21.228 1.00 30.49  ? 12  THR B CG2 1 
ATOM   2710 N N   . GLN B 1 19  ? -31.574 -46.569 -17.459 1.00 36.62  ? 13  GLN B N   1 
ATOM   2711 C CA  . GLN B 1 19  ? -30.717 -47.514 -16.736 1.00 34.91  ? 13  GLN B CA  1 
ATOM   2712 C C   . GLN B 1 19  ? -30.372 -46.962 -15.381 1.00 35.90  ? 13  GLN B C   1 
ATOM   2713 O O   . GLN B 1 19  ? -29.866 -45.857 -15.287 1.00 33.87  ? 13  GLN B O   1 
ATOM   2714 C CB  . GLN B 1 19  ? -29.416 -47.802 -17.517 1.00 36.10  ? 13  GLN B CB  1 
ATOM   2715 C CG  . GLN B 1 19  ? -29.597 -48.545 -18.831 1.00 34.91  ? 13  GLN B CG  1 
ATOM   2716 C CD  . GLN B 1 19  ? -28.325 -48.572 -19.649 1.00 49.81  ? 13  GLN B CD  1 
ATOM   2717 O OE1 . GLN B 1 19  ? -27.241 -48.931 -19.171 1.00 44.11  ? 13  GLN B OE1 1 
ATOM   2718 N NE2 . GLN B 1 19  ? -28.439 -48.213 -20.913 1.00 36.68  ? 13  GLN B NE2 1 
ATOM   2719 N N   . TYR B 1 20  ? -30.630 -47.737 -14.333 1.00 34.35  ? 14  TYR B N   1 
ATOM   2720 C CA  . TYR B 1 20  ? -30.313 -47.366 -12.955 1.00 33.94  ? 14  TYR B CA  1 
ATOM   2721 C C   . TYR B 1 20  ? -29.429 -48.448 -12.420 1.00 42.43  ? 14  TYR B C   1 
ATOM   2722 O O   . TYR B 1 20  ? -29.841 -49.610 -12.339 1.00 43.55  ? 14  TYR B O   1 
ATOM   2723 C CB  . TYR B 1 20  ? -31.576 -47.220 -12.105 1.00 32.92  ? 14  TYR B CB  1 
ATOM   2724 C CG  . TYR B 1 20  ? -32.482 -46.089 -12.542 1.00 31.38  ? 14  TYR B CG  1 
ATOM   2725 C CD1 . TYR B 1 20  ? -32.493 -44.872 -11.858 1.00 32.28  ? 14  TYR B CD1 1 
ATOM   2726 C CD2 . TYR B 1 20  ? -33.335 -46.234 -13.634 1.00 31.00  ? 14  TYR B CD2 1 
ATOM   2727 C CE1 . TYR B 1 20  ? -33.349 -43.840 -12.239 1.00 32.15  ? 14  TYR B CE1 1 
ATOM   2728 C CE2 . TYR B 1 20  ? -34.166 -45.194 -14.044 1.00 31.67  ? 14  TYR B CE2 1 
ATOM   2729 C CZ  . TYR B 1 20  ? -34.194 -44.015 -13.322 1.00 35.17  ? 14  TYR B CZ  1 
ATOM   2730 O OH  . TYR B 1 20  ? -35.031 -43.016 -13.727 1.00 36.04  ? 14  TYR B OH  1 
ATOM   2731 N N   . TYR B 1 21  ? -28.190 -48.093 -12.117 1.00 40.46  ? 15  TYR B N   1 
ATOM   2732 C CA  . TYR B 1 21  ? -27.227 -49.081 -11.655 1.00 41.32  ? 15  TYR B CA  1 
ATOM   2733 C C   . TYR B 1 21  ? -26.486 -48.675 -10.391 1.00 44.19  ? 15  TYR B C   1 
ATOM   2734 O O   . TYR B 1 21  ? -26.251 -47.485 -10.161 1.00 42.39  ? 15  TYR B O   1 
ATOM   2735 C CB  . TYR B 1 21  ? -26.241 -49.461 -12.789 1.00 43.21  ? 15  TYR B CB  1 
ATOM   2736 C CG  . TYR B 1 21  ? -25.546 -48.291 -13.454 1.00 44.29  ? 15  TYR B CG  1 
ATOM   2737 C CD1 . TYR B 1 21  ? -26.044 -47.733 -14.631 1.00 46.38  ? 15  TYR B CD1 1 
ATOM   2738 C CD2 . TYR B 1 21  ? -24.374 -47.761 -12.928 1.00 45.33  ? 15  TYR B CD2 1 
ATOM   2739 C CE1 . TYR B 1 21  ? -25.411 -46.650 -15.245 1.00 48.90  ? 15  TYR B CE1 1 
ATOM   2740 C CE2 . TYR B 1 21  ? -23.722 -46.689 -13.542 1.00 47.24  ? 15  TYR B CE2 1 
ATOM   2741 C CZ  . TYR B 1 21  ? -24.247 -46.132 -14.700 1.00 59.91  ? 15  TYR B CZ  1 
ATOM   2742 O OH  . TYR B 1 21  ? -23.609 -45.073 -15.318 1.00 66.11  ? 15  TYR B OH  1 
ATOM   2743 N N   . GLY B 1 22  ? -26.114 -49.684 -9.611  1.00 41.13  ? 16  GLY B N   1 
ATOM   2744 C CA  . GLY B 1 22  ? -25.353 -49.537 -8.379  1.00 41.47  ? 16  GLY B CA  1 
ATOM   2745 C C   . GLY B 1 22  ? -24.042 -50.281 -8.435  1.00 47.14  ? 16  GLY B C   1 
ATOM   2746 O O   . GLY B 1 22  ? -23.654 -50.779 -9.492  1.00 47.62  ? 16  GLY B O   1 
ATOM   2747 N N   . GLU B 1 23  ? -23.354 -50.365 -7.299  1.00 44.14  ? 17  GLU B N   1 
ATOM   2748 C CA  . GLU B 1 23  ? -22.060 -51.040 -7.229  1.00 44.09  ? 17  GLU B CA  1 
ATOM   2749 C C   . GLU B 1 23  ? -22.100 -52.241 -6.338  1.00 46.44  ? 17  GLU B C   1 
ATOM   2750 O O   . GLU B 1 23  ? -22.724 -52.213 -5.277  1.00 44.17  ? 17  GLU B O   1 
ATOM   2751 C CB  . GLU B 1 23  ? -20.975 -50.120 -6.676  1.00 45.50  ? 17  GLU B CB  1 
ATOM   2752 C CG  . GLU B 1 23  ? -20.587 -48.950 -7.550  1.00 56.16  ? 17  GLU B CG  1 
ATOM   2753 C CD  . GLU B 1 23  ? -19.750 -47.957 -6.758  1.00 78.81  ? 17  GLU B CD  1 
ATOM   2754 O OE1 . GLU B 1 23  ? -18.859 -48.398 -5.989  1.00 53.78  ? 17  GLU B OE1 1 
ATOM   2755 O OE2 . GLU B 1 23  ? -20.023 -46.736 -6.862  1.00 79.36  ? 17  GLU B OE2 1 
ATOM   2756 N N   . ILE B 1 24  ? -21.391 -53.286 -6.756  1.00 43.10  ? 18  ILE B N   1 
ATOM   2757 C CA  . ILE B 1 24  ? -21.175 -54.497 -5.969  1.00 42.78  ? 18  ILE B CA  1 
ATOM   2758 C C   . ILE B 1 24  ? -19.694 -54.823 -6.081  1.00 49.47  ? 18  ILE B C   1 
ATOM   2759 O O   . ILE B 1 24  ? -19.039 -54.438 -7.057  1.00 49.13  ? 18  ILE B O   1 
ATOM   2760 C CB  . ILE B 1 24  ? -22.090 -55.713 -6.292  1.00 44.83  ? 18  ILE B CB  1 
ATOM   2761 C CG1 . ILE B 1 24  ? -21.918 -56.195 -7.749  1.00 45.01  ? 18  ILE B CG1 1 
ATOM   2762 C CG2 . ILE B 1 24  ? -23.544 -55.454 -5.909  1.00 44.85  ? 18  ILE B CG2 1 
ATOM   2763 C CD1 . ILE B 1 24  ? -22.222 -57.663 -7.973  1.00 44.32  ? 18  ILE B CD1 1 
ATOM   2764 N N   . GLY B 1 25  ? -19.181 -55.484 -5.063  1.00 48.10  ? 19  GLY B N   1 
ATOM   2765 C CA  . GLY B 1 25  ? -17.806 -55.937 -5.013  1.00 49.19  ? 19  GLY B CA  1 
ATOM   2766 C C   . GLY B 1 25  ? -17.814 -57.444 -4.984  1.00 57.39  ? 19  GLY B C   1 
ATOM   2767 O O   . GLY B 1 25  ? -18.620 -58.041 -4.264  1.00 56.99  ? 19  GLY B O   1 
ATOM   2768 N N   . ILE B 1 26  ? -16.977 -58.069 -5.818  1.00 56.86  ? 20  ILE B N   1 
ATOM   2769 C CA  . ILE B 1 26  ? -16.883 -59.527 -5.876  1.00 57.34  ? 20  ILE B CA  1 
ATOM   2770 C C   . ILE B 1 26  ? -15.438 -59.920 -5.642  1.00 63.55  ? 20  ILE B C   1 
ATOM   2771 O O   . ILE B 1 26  ? -14.541 -59.421 -6.337  1.00 63.72  ? 20  ILE B O   1 
ATOM   2772 C CB  . ILE B 1 26  ? -17.433 -60.134 -7.209  1.00 60.12  ? 20  ILE B CB  1 
ATOM   2773 C CG1 . ILE B 1 26  ? -18.809 -59.558 -7.607  1.00 60.06  ? 20  ILE B CG1 1 
ATOM   2774 C CG2 . ILE B 1 26  ? -17.467 -61.678 -7.145  1.00 61.09  ? 20  ILE B CG2 1 
ATOM   2775 C CD1 . ILE B 1 26  ? -19.266 -59.950 -9.003  1.00 66.75  ? 20  ILE B CD1 1 
ATOM   2776 N N   . GLY B 1 27  ? -15.235 -60.814 -4.675  1.00 61.29  ? 21  GLY B N   1 
ATOM   2777 C CA  . GLY B 1 27  ? -13.925 -61.369 -4.373  1.00 62.06  ? 21  GLY B CA  1 
ATOM   2778 C C   . GLY B 1 27  ? -13.094 -60.676 -3.322  1.00 68.05  ? 21  GLY B C   1 
ATOM   2779 O O   . GLY B 1 27  ? -13.522 -59.679 -2.735  1.00 67.94  ? 21  GLY B O   1 
ATOM   2780 N N   . THR B 1 28  ? -11.891 -61.240 -3.067  1.00 65.42  ? 22  THR B N   1 
ATOM   2781 C CA  . THR B 1 28  ? -10.929 -60.747 -2.085  1.00 65.23  ? 22  THR B CA  1 
ATOM   2782 C C   . THR B 1 28  ? -9.561  -60.526 -2.744  1.00 71.57  ? 22  THR B C   1 
ATOM   2783 O O   . THR B 1 28  ? -8.911  -61.502 -3.122  1.00 73.09  ? 22  THR B O   1 
ATOM   2784 C CB  . THR B 1 28  ? -10.861 -61.668 -0.867  1.00 69.31  ? 22  THR B CB  1 
ATOM   2785 O OG1 . THR B 1 28  ? -12.178 -62.002 -0.424  1.00 67.49  ? 22  THR B OG1 1 
ATOM   2786 C CG2 . THR B 1 28  ? -10.077 -61.052 0.274   1.00 67.20  ? 22  THR B CG2 1 
ATOM   2787 N N   . PRO B 1 29  ? -9.090  -59.265 -2.895  1.00 68.14  ? 23  PRO B N   1 
ATOM   2788 C CA  . PRO B 1 29  ? -9.769  -57.998 -2.564  1.00 67.53  ? 23  PRO B CA  1 
ATOM   2789 C C   . PRO B 1 29  ? -10.934 -57.742 -3.547  1.00 69.87  ? 23  PRO B C   1 
ATOM   2790 O O   . PRO B 1 29  ? -10.944 -58.330 -4.642  1.00 70.16  ? 23  PRO B O   1 
ATOM   2791 C CB  . PRO B 1 29  ? -8.637  -56.969 -2.678  1.00 69.39  ? 23  PRO B CB  1 
ATOM   2792 C CG  . PRO B 1 29  ? -7.739  -57.525 -3.743  1.00 74.16  ? 23  PRO B CG  1 
ATOM   2793 C CD  . PRO B 1 29  ? -7.785  -59.024 -3.548  1.00 69.91  ? 23  PRO B CD  1 
ATOM   2794 N N   . PRO B 1 30  ? -11.949 -56.915 -3.189  1.00 63.62  ? 24  PRO B N   1 
ATOM   2795 C CA  . PRO B 1 30  ? -13.083 -56.727 -4.109  1.00 61.93  ? 24  PRO B CA  1 
ATOM   2796 C C   . PRO B 1 30  ? -12.785 -56.165 -5.499  1.00 64.73  ? 24  PRO B C   1 
ATOM   2797 O O   . PRO B 1 30  ? -12.004 -55.225 -5.662  1.00 65.80  ? 24  PRO B O   1 
ATOM   2798 C CB  . PRO B 1 30  ? -14.034 -55.817 -3.324  1.00 63.10  ? 24  PRO B CB  1 
ATOM   2799 C CG  . PRO B 1 30  ? -13.604 -55.903 -1.907  1.00 67.32  ? 24  PRO B CG  1 
ATOM   2800 C CD  . PRO B 1 30  ? -12.144 -56.154 -1.933  1.00 63.88  ? 24  PRO B CD  1 
ATOM   2801 N N   . GLN B 1 31  ? -13.438 -56.761 -6.503  1.00 58.95  ? 25  GLN B N   1 
ATOM   2802 C CA  . GLN B 1 31  ? -13.455 -56.317 -7.893  1.00 57.30  ? 25  GLN B CA  1 
ATOM   2803 C C   . GLN B 1 31  ? -14.835 -55.646 -8.054  1.00 58.31  ? 25  GLN B C   1 
ATOM   2804 O O   . GLN B 1 31  ? -15.852 -56.265 -7.725  1.00 55.94  ? 25  GLN B O   1 
ATOM   2805 C CB  . GLN B 1 31  ? -13.285 -57.507 -8.834  1.00 58.44  ? 25  GLN B CB  1 
ATOM   2806 C CG  . GLN B 1 31  ? -11.834 -57.934 -8.950  1.00 65.79  ? 25  GLN B CG  1 
ATOM   2807 C CD  . GLN B 1 31  ? -11.669 -59.189 -9.761  1.00 72.60  ? 25  GLN B CD  1 
ATOM   2808 O OE1 . GLN B 1 31  ? -11.749 -59.200 -11.000 1.00 65.66  ? 25  GLN B OE1 1 
ATOM   2809 N NE2 . GLN B 1 31  ? -11.400 -60.268 -9.065  1.00 62.59  ? 25  GLN B NE2 1 
ATOM   2810 N N   . THR B 1 32  ? -14.850 -54.341 -8.428  1.00 54.50  ? 26  THR B N   1 
ATOM   2811 C CA  . THR B 1 32  ? -16.035 -53.471 -8.536  1.00 53.42  ? 26  THR B CA  1 
ATOM   2812 C C   . THR B 1 32  ? -16.754 -53.522 -9.889  1.00 57.55  ? 26  THR B C   1 
ATOM   2813 O O   . THR B 1 32  ? -16.144 -53.271 -10.937 1.00 57.87  ? 26  THR B O   1 
ATOM   2814 C CB  . THR B 1 32  ? -15.688 -52.043 -8.060  1.00 54.91  ? 26  THR B CB  1 
ATOM   2815 O OG1 . THR B 1 32  ? -15.287 -52.109 -6.693  1.00 53.77  ? 26  THR B OG1 1 
ATOM   2816 C CG2 . THR B 1 32  ? -16.859 -51.068 -8.178  1.00 52.86  ? 26  THR B CG2 1 
ATOM   2817 N N   . PHE B 1 33  ? -18.079 -53.795 -9.847  1.00 52.55  ? 27  PHE B N   1 
ATOM   2818 C CA  . PHE B 1 33  ? -18.940 -53.887 -11.030 1.00 50.71  ? 27  PHE B CA  1 
ATOM   2819 C C   . PHE B 1 33  ? -20.152 -53.007 -10.895 1.00 51.69  ? 27  PHE B C   1 
ATOM   2820 O O   . PHE B 1 33  ? -20.691 -52.857 -9.795  1.00 51.16  ? 27  PHE B O   1 
ATOM   2821 C CB  . PHE B 1 33  ? -19.386 -55.341 -11.262 1.00 52.28  ? 27  PHE B CB  1 
ATOM   2822 C CG  . PHE B 1 33  ? -18.237 -56.272 -11.527 1.00 54.13  ? 27  PHE B CG  1 
ATOM   2823 C CD1 . PHE B 1 33  ? -17.784 -56.491 -12.825 1.00 57.82  ? 27  PHE B CD1 1 
ATOM   2824 C CD2 . PHE B 1 33  ? -17.579 -56.903 -10.480 1.00 56.21  ? 27  PHE B CD2 1 
ATOM   2825 C CE1 . PHE B 1 33  ? -16.695 -57.322 -13.067 1.00 58.29  ? 27  PHE B CE1 1 
ATOM   2826 C CE2 . PHE B 1 33  ? -16.485 -57.725 -10.724 1.00 59.70  ? 27  PHE B CE2 1 
ATOM   2827 C CZ  . PHE B 1 33  ? -16.049 -57.923 -12.016 1.00 57.67  ? 27  PHE B CZ  1 
ATOM   2828 N N   . LYS B 1 34  ? -20.581 -52.425 -12.022 1.00 46.30  ? 28  LYS B N   1 
ATOM   2829 C CA  . LYS B 1 34  ? -21.793 -51.629 -12.104 1.00 44.88  ? 28  LYS B CA  1 
ATOM   2830 C C   . LYS B 1 34  ? -22.882 -52.650 -12.437 1.00 48.91  ? 28  LYS B C   1 
ATOM   2831 O O   . LYS B 1 34  ? -22.739 -53.411 -13.399 1.00 48.95  ? 28  LYS B O   1 
ATOM   2832 C CB  . LYS B 1 34  ? -21.680 -50.561 -13.200 1.00 46.12  ? 28  LYS B CB  1 
ATOM   2833 C CG  . LYS B 1 34  ? -20.707 -49.438 -12.866 1.00 42.49  ? 28  LYS B CG  1 
ATOM   2834 C CD  . LYS B 1 34  ? -20.389 -48.618 -14.105 1.00 43.98  ? 28  LYS B CD  1 
ATOM   2835 C CE  . LYS B 1 34  ? -19.181 -47.749 -13.867 1.00 63.41  ? 28  LYS B CE  1 
ATOM   2836 N NZ  . LYS B 1 34  ? -18.863 -46.917 -15.055 1.00 83.19  ? 28  LYS B NZ  1 
ATOM   2837 N N   . VAL B 1 35  ? -23.910 -52.753 -11.592 1.00 45.07  ? 29  VAL B N   1 
ATOM   2838 C CA  . VAL B 1 35  ? -24.981 -53.738 -11.797 1.00 44.45  ? 29  VAL B CA  1 
ATOM   2839 C C   . VAL B 1 35  ? -26.370 -53.138 -11.736 1.00 45.75  ? 29  VAL B C   1 
ATOM   2840 O O   . VAL B 1 35  ? -26.583 -52.146 -11.036 1.00 44.95  ? 29  VAL B O   1 
ATOM   2841 C CB  . VAL B 1 35  ? -24.879 -54.959 -10.839 1.00 48.52  ? 29  VAL B CB  1 
ATOM   2842 C CG1 . VAL B 1 35  ? -23.621 -55.773 -11.101 1.00 48.64  ? 29  VAL B CG1 1 
ATOM   2843 C CG2 . VAL B 1 35  ? -24.966 -54.540 -9.374  1.00 48.04  ? 29  VAL B CG2 1 
ATOM   2844 N N   . VAL B 1 36  ? -27.321 -53.782 -12.430 1.00 41.15  ? 30  VAL B N   1 
ATOM   2845 C CA  . VAL B 1 36  ? -28.748 -53.449 -12.402 1.00 39.72  ? 30  VAL B CA  1 
ATOM   2846 C C   . VAL B 1 36  ? -29.379 -54.447 -11.416 1.00 41.69  ? 30  VAL B C   1 
ATOM   2847 O O   . VAL B 1 36  ? -29.057 -55.641 -11.438 1.00 40.70  ? 30  VAL B O   1 
ATOM   2848 C CB  . VAL B 1 36  ? -29.408 -53.472 -13.816 1.00 42.61  ? 30  VAL B CB  1 
ATOM   2849 C CG1 . VAL B 1 36  ? -30.925 -53.444 -13.740 1.00 42.82  ? 30  VAL B CG1 1 
ATOM   2850 C CG2 . VAL B 1 36  ? -28.949 -52.289 -14.627 1.00 42.28  ? 30  VAL B CG2 1 
ATOM   2851 N N   . PHE B 1 37  ? -30.211 -53.947 -10.509 1.00 37.79  ? 31  PHE B N   1 
ATOM   2852 C CA  . PHE B 1 37  ? -30.908 -54.798 -9.547  1.00 37.43  ? 31  PHE B CA  1 
ATOM   2853 C C   . PHE B 1 37  ? -32.275 -55.050 -10.166 1.00 43.85  ? 31  PHE B C   1 
ATOM   2854 O O   . PHE B 1 37  ? -33.109 -54.142 -10.261 1.00 44.51  ? 31  PHE B O   1 
ATOM   2855 C CB  . PHE B 1 37  ? -30.952 -54.135 -8.176  1.00 38.31  ? 31  PHE B CB  1 
ATOM   2856 C CG  . PHE B 1 37  ? -29.580 -53.955 -7.568  1.00 39.35  ? 31  PHE B CG  1 
ATOM   2857 C CD1 . PHE B 1 37  ? -28.797 -52.840 -7.883  1.00 41.92  ? 31  PHE B CD1 1 
ATOM   2858 C CD2 . PHE B 1 37  ? -29.078 -54.882 -6.654  1.00 41.45  ? 31  PHE B CD2 1 
ATOM   2859 C CE1 . PHE B 1 37  ? -27.543 -52.656 -7.293  1.00 42.47  ? 31  PHE B CE1 1 
ATOM   2860 C CE2 . PHE B 1 37  ? -27.807 -54.710 -6.082  1.00 43.97  ? 31  PHE B CE2 1 
ATOM   2861 C CZ  . PHE B 1 37  ? -27.052 -53.600 -6.405  1.00 41.60  ? 31  PHE B CZ  1 
ATOM   2862 N N   . ASP B 1 38  ? -32.439 -56.269 -10.694 1.00 40.22  ? 32  ASP B N   1 
ATOM   2863 C CA  . ASP B 1 38  ? -33.567 -56.707 -11.500 1.00 39.88  ? 32  ASP B CA  1 
ATOM   2864 C C   . ASP B 1 38  ? -34.549 -57.663 -10.819 1.00 45.35  ? 32  ASP B C   1 
ATOM   2865 O O   . ASP B 1 38  ? -34.209 -58.819 -10.570 1.00 46.62  ? 32  ASP B O   1 
ATOM   2866 C CB  . ASP B 1 38  ? -33.004 -57.299 -12.819 1.00 41.28  ? 32  ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 38  ? -34.009 -57.904 -13.783 1.00 46.47  ? 32  ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 38  ? -35.154 -57.416 -13.834 1.00 49.00  ? 32  ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 38  ? -33.627 -58.806 -14.545 1.00 45.62  ? 32  ASP B OD2 1 
ATOM   2870 N N   . THR B 1 39  ? -35.801 -57.205 -10.618 1.00 41.15  ? 33  THR B N   1 
ATOM   2871 C CA  . THR B 1 39  ? -36.887 -58.000 -10.032 1.00 39.75  ? 33  THR B CA  1 
ATOM   2872 C C   . THR B 1 39  ? -37.532 -58.915 -11.078 1.00 43.73  ? 33  THR B C   1 
ATOM   2873 O O   . THR B 1 39  ? -38.312 -59.797 -10.716 1.00 44.00  ? 33  THR B O   1 
ATOM   2874 C CB  . THR B 1 39  ? -37.914 -57.097 -9.351  1.00 40.85  ? 33  THR B CB  1 
ATOM   2875 O OG1 . THR B 1 39  ? -38.356 -56.099 -10.282 1.00 39.90  ? 33  THR B OG1 1 
ATOM   2876 C CG2 . THR B 1 39  ? -37.369 -56.458 -8.054  1.00 35.71  ? 33  THR B CG2 1 
ATOM   2877 N N   . GLY B 1 40  ? -37.190 -58.706 -12.354 1.00 39.34  ? 34  GLY B N   1 
ATOM   2878 C CA  . GLY B 1 40  ? -37.685 -59.505 -13.470 1.00 39.39  ? 34  GLY B CA  1 
ATOM   2879 C C   . GLY B 1 40  ? -36.847 -60.739 -13.786 1.00 44.74  ? 34  GLY B C   1 
ATOM   2880 O O   . GLY B 1 40  ? -37.124 -61.413 -14.779 1.00 46.09  ? 34  GLY B O   1 
ATOM   2881 N N   . SER B 1 41  ? -35.809 -61.043 -12.961 1.00 40.73  ? 35  SER B N   1 
ATOM   2882 C CA  . SER B 1 41  ? -34.901 -62.200 -13.078 1.00 40.42  ? 35  SER B CA  1 
ATOM   2883 C C   . SER B 1 41  ? -34.312 -62.588 -11.705 1.00 46.38  ? 35  SER B C   1 
ATOM   2884 O O   . SER B 1 41  ? -34.430 -61.798 -10.758 1.00 45.64  ? 35  SER B O   1 
ATOM   2885 C CB  . SER B 1 41  ? -33.806 -61.965 -14.115 1.00 42.59  ? 35  SER B CB  1 
ATOM   2886 O OG  . SER B 1 41  ? -32.748 -61.147 -13.644 1.00 50.19  ? 35  SER B OG  1 
ATOM   2887 N N   . SER B 1 42  ? -33.692 -63.805 -11.589 1.00 43.58  ? 36  SER B N   1 
ATOM   2888 C CA  . SER B 1 42  ? -33.196 -64.339 -10.310 1.00 42.61  ? 36  SER B CA  1 
ATOM   2889 C C   . SER B 1 42  ? -31.721 -64.717 -10.234 1.00 47.44  ? 36  SER B C   1 
ATOM   2890 O O   . SER B 1 42  ? -31.264 -65.187 -9.182  1.00 46.81  ? 36  SER B O   1 
ATOM   2891 C CB  . SER B 1 42  ? -34.028 -65.544 -9.907  1.00 43.63  ? 36  SER B CB  1 
ATOM   2892 O OG  . SER B 1 42  ? -35.383 -65.371 -10.278 1.00 51.38  ? 36  SER B OG  1 
ATOM   2893 N N   . ASN B 1 43  ? -30.974 -64.510 -11.322 1.00 44.69  ? 37  ASN B N   1 
ATOM   2894 C CA  . ASN B 1 43  ? -29.561 -64.873 -11.361 1.00 45.00  ? 37  ASN B CA  1 
ATOM   2895 C C   . ASN B 1 43  ? -28.625 -63.687 -11.284 1.00 50.96  ? 37  ASN B C   1 
ATOM   2896 O O   . ASN B 1 43  ? -28.940 -62.617 -11.796 1.00 52.10  ? 37  ASN B O   1 
ATOM   2897 C CB  . ASN B 1 43  ? -29.251 -65.702 -12.614 1.00 45.39  ? 37  ASN B CB  1 
ATOM   2898 C CG  . ASN B 1 43  ? -29.895 -67.066 -12.608 1.00 59.97  ? 37  ASN B CG  1 
ATOM   2899 O OD1 . ASN B 1 43  ? -31.100 -67.213 -12.833 1.00 54.21  ? 37  ASN B OD1 1 
ATOM   2900 N ND2 . ASN B 1 43  ? -29.102 -68.092 -12.360 1.00 47.62  ? 37  ASN B ND2 1 
ATOM   2901 N N   . VAL B 1 44  ? -27.460 -63.891 -10.659 1.00 47.83  ? 38  VAL B N   1 
ATOM   2902 C CA  . VAL B 1 44  ? -26.396 -62.897 -10.574 1.00 47.85  ? 38  VAL B CA  1 
ATOM   2903 C C   . VAL B 1 44  ? -25.351 -63.288 -11.615 1.00 51.65  ? 38  VAL B C   1 
ATOM   2904 O O   . VAL B 1 44  ? -24.945 -64.445 -11.675 1.00 51.63  ? 38  VAL B O   1 
ATOM   2905 C CB  . VAL B 1 44  ? -25.741 -62.807 -9.167  1.00 51.51  ? 38  VAL B CB  1 
ATOM   2906 C CG1 . VAL B 1 44  ? -24.693 -61.693 -9.112  1.00 50.81  ? 38  VAL B CG1 1 
ATOM   2907 C CG2 . VAL B 1 44  ? -26.785 -62.614 -8.075  1.00 51.58  ? 38  VAL B CG2 1 
ATOM   2908 N N   . TRP B 1 45  ? -24.927 -62.335 -12.432 1.00 47.86  ? 39  TRP B N   1 
ATOM   2909 C CA  . TRP B 1 45  ? -23.879 -62.553 -13.408 1.00 47.69  ? 39  TRP B CA  1 
ATOM   2910 C C   . TRP B 1 45  ? -23.095 -61.297 -13.668 1.00 52.83  ? 39  TRP B C   1 
ATOM   2911 O O   . TRP B 1 45  ? -23.626 -60.203 -13.539 1.00 52.26  ? 39  TRP B O   1 
ATOM   2912 C CB  . TRP B 1 45  ? -24.394 -63.168 -14.720 1.00 46.22  ? 39  TRP B CB  1 
ATOM   2913 C CG  . TRP B 1 45  ? -25.355 -62.330 -15.513 1.00 47.28  ? 39  TRP B CG  1 
ATOM   2914 C CD1 . TRP B 1 45  ? -26.713 -62.463 -15.545 1.00 49.95  ? 39  TRP B CD1 1 
ATOM   2915 C CD2 . TRP B 1 45  ? -25.026 -61.333 -16.490 1.00 47.27  ? 39  TRP B CD2 1 
ATOM   2916 N NE1 . TRP B 1 45  ? -27.252 -61.599 -16.460 1.00 49.57  ? 39  TRP B NE1 1 
ATOM   2917 C CE2 . TRP B 1 45  ? -26.242 -60.883 -17.049 1.00 51.11  ? 39  TRP B CE2 1 
ATOM   2918 C CE3 . TRP B 1 45  ? -23.818 -60.742 -16.923 1.00 48.63  ? 39  TRP B CE3 1 
ATOM   2919 C CZ2 . TRP B 1 45  ? -26.291 -59.882 -18.022 1.00 50.60  ? 39  TRP B CZ2 1 
ATOM   2920 C CZ3 . TRP B 1 45  ? -23.865 -59.753 -17.891 1.00 50.10  ? 39  TRP B CZ3 1 
ATOM   2921 C CH2 . TRP B 1 45  ? -25.088 -59.329 -18.428 1.00 50.97  ? 39  TRP B CH2 1 
ATOM   2922 N N   . VAL B 1 46  ? -21.825 -61.464 -14.026 1.00 50.80  ? 40  VAL B N   1 
ATOM   2923 C CA  . VAL B 1 46  ? -20.898 -60.414 -14.444 1.00 51.10  ? 40  VAL B CA  1 
ATOM   2924 C C   . VAL B 1 46  ? -20.078 -60.953 -15.639 1.00 55.54  ? 40  VAL B C   1 
ATOM   2925 O O   . VAL B 1 46  ? -19.902 -62.176 -15.746 1.00 53.44  ? 40  VAL B O   1 
ATOM   2926 C CB  . VAL B 1 46  ? -19.973 -59.855 -13.319 1.00 54.84  ? 40  VAL B CB  1 
ATOM   2927 C CG1 . VAL B 1 46  ? -20.751 -59.014 -12.308 1.00 54.69  ? 40  VAL B CG1 1 
ATOM   2928 C CG2 . VAL B 1 46  ? -19.149 -60.950 -12.643 1.00 54.31  ? 40  VAL B CG2 1 
ATOM   2929 N N   . PRO B 1 47  ? -19.548 -60.081 -16.533 1.00 53.25  ? 41  PRO B N   1 
ATOM   2930 C CA  . PRO B 1 47  ? -18.692 -60.586 -17.610 1.00 53.18  ? 41  PRO B CA  1 
ATOM   2931 C C   . PRO B 1 47  ? -17.413 -61.175 -17.018 1.00 57.99  ? 41  PRO B C   1 
ATOM   2932 O O   . PRO B 1 47  ? -16.881 -60.664 -16.024 1.00 55.96  ? 41  PRO B O   1 
ATOM   2933 C CB  . PRO B 1 47  ? -18.406 -59.339 -18.448 1.00 54.88  ? 41  PRO B CB  1 
ATOM   2934 C CG  . PRO B 1 47  ? -19.402 -58.318 -18.008 1.00 59.48  ? 41  PRO B CG  1 
ATOM   2935 C CD  . PRO B 1 47  ? -19.616 -58.608 -16.573 1.00 55.03  ? 41  PRO B CD  1 
ATOM   2936 N N   . SER B 1 48  ? -16.966 -62.294 -17.596 1.00 57.09  ? 42  SER B N   1 
ATOM   2937 C CA  . SER B 1 48  ? -15.776 -63.033 -17.165 1.00 57.71  ? 42  SER B CA  1 
ATOM   2938 C C   . SER B 1 48  ? -14.544 -62.632 -17.972 1.00 61.71  ? 42  SER B C   1 
ATOM   2939 O O   . SER B 1 48  ? -14.661 -62.250 -19.139 1.00 60.01  ? 42  SER B O   1 
ATOM   2940 C CB  . SER B 1 48  ? -16.019 -64.530 -17.332 1.00 61.59  ? 42  SER B CB  1 
ATOM   2941 O OG  . SER B 1 48  ? -14.889 -65.295 -16.954 1.00 69.56  ? 42  SER B OG  1 
ATOM   2942 N N   . SER B 1 49  ? -13.358 -62.769 -17.358 1.00 59.75  ? 43  SER B N   1 
ATOM   2943 C CA  . SER B 1 49  ? -12.066 -62.530 -18.019 1.00 60.07  ? 43  SER B CA  1 
ATOM   2944 C C   . SER B 1 49  ? -11.858 -63.607 -19.122 1.00 65.49  ? 43  SER B C   1 
ATOM   2945 O O   . SER B 1 49  ? -11.179 -63.359 -20.121 1.00 65.50  ? 43  SER B O   1 
ATOM   2946 C CB  . SER B 1 49  ? -10.931 -62.580 -17.003 1.00 62.80  ? 43  SER B CB  1 
ATOM   2947 O OG  . SER B 1 49  ? -10.905 -63.820 -16.312 1.00 72.98  ? 43  SER B OG  1 
ATOM   2948 N N   . LYS B 1 50  ? -12.505 -64.775 -18.950 1.00 62.16  ? 44  LYS B N   1 
ATOM   2949 C CA  . LYS B 1 50  ? -12.484 -65.894 -19.886 1.00 62.76  ? 44  LYS B CA  1 
ATOM   2950 C C   . LYS B 1 50  ? -13.383 -65.660 -21.120 1.00 70.00  ? 44  LYS B C   1 
ATOM   2951 O O   . LYS B 1 50  ? -13.425 -66.519 -22.001 1.00 71.07  ? 44  LYS B O   1 
ATOM   2952 C CB  . LYS B 1 50  ? -12.817 -67.219 -19.166 1.00 64.72  ? 44  LYS B CB  1 
ATOM   2953 C CG  . LYS B 1 50  ? -11.643 -67.792 -18.377 1.00 75.45  ? 44  LYS B CG  1 
ATOM   2954 C CD  . LYS B 1 50  ? -12.069 -68.289 -17.002 1.00 86.99  ? 44  LYS B CD  1 
ATOM   2955 C CE  . LYS B 1 50  ? -10.954 -68.173 -15.987 1.00 100.89 ? 44  LYS B CE  1 
ATOM   2956 N NZ  . LYS B 1 50  ? -11.464 -68.241 -14.592 1.00 110.78 ? 44  LYS B NZ  1 
ATOM   2957 N N   . CYS B 1 51  ? -14.076 -64.501 -21.199 1.00 67.64  ? 45  CYS B N   1 
ATOM   2958 C CA  . CYS B 1 51  ? -14.912 -64.133 -22.348 1.00 68.06  ? 45  CYS B CA  1 
ATOM   2959 C C   . CYS B 1 51  ? -14.008 -63.740 -23.515 1.00 74.61  ? 45  CYS B C   1 
ATOM   2960 O O   . CYS B 1 51  ? -13.119 -62.900 -23.344 1.00 74.25  ? 45  CYS B O   1 
ATOM   2961 C CB  . CYS B 1 51  ? -15.873 -62.999 -21.991 1.00 67.93  ? 45  CYS B CB  1 
ATOM   2962 S SG  . CYS B 1 51  ? -16.829 -62.359 -23.397 1.00 71.28  ? 45  CYS B SG  1 
ATOM   2963 N N   . SER B 1 52  ? -14.254 -64.324 -24.701 1.00 73.02  ? 46  SER B N   1 
ATOM   2964 C CA  . SER B 1 52  ? -13.499 -64.033 -25.923 1.00 73.71  ? 46  SER B CA  1 
ATOM   2965 C C   . SER B 1 52  ? -13.634 -62.561 -26.322 1.00 78.72  ? 46  SER B C   1 
ATOM   2966 O O   . SER B 1 52  ? -14.751 -62.046 -26.332 1.00 78.79  ? 46  SER B O   1 
ATOM   2967 C CB  . SER B 1 52  ? -13.985 -64.926 -27.063 1.00 78.22  ? 46  SER B CB  1 
ATOM   2968 O OG  . SER B 1 52  ? -13.485 -64.498 -28.320 1.00 89.08  ? 46  SER B OG  1 
ATOM   2969 N N   . ARG B 1 53  A -12.504 -61.914 -26.711 1.00 76.41  ? 46  ARG B N   1 
ATOM   2970 C CA  . ARG B 1 53  A -12.397 -60.509 -27.167 1.00 77.05  ? 46  ARG B CA  1 
ATOM   2971 C C   . ARG B 1 53  A -13.213 -60.246 -28.445 1.00 81.79  ? 46  ARG B C   1 
ATOM   2972 O O   . ARG B 1 53  A -13.393 -59.085 -28.834 1.00 81.48  ? 46  ARG B O   1 
ATOM   2973 C CB  . ARG B 1 53  A -10.918 -60.112 -27.431 1.00 79.28  ? 46  ARG B CB  1 
ATOM   2974 C CG  . ARG B 1 53  A -9.957  -60.225 -26.242 1.00 94.25  ? 46  ARG B CG  1 
ATOM   2975 C CD  . ARG B 1 53  A -10.018 -59.039 -25.291 1.00 109.64 ? 46  ARG B CD  1 
ATOM   2976 N NE  . ARG B 1 53  A -9.779  -59.458 -23.907 1.00 123.37 ? 46  ARG B NE  1 
ATOM   2977 C CZ  . ARG B 1 53  A -9.890  -58.666 -22.843 1.00 137.56 ? 46  ARG B CZ  1 
ATOM   2978 N NH1 . ARG B 1 53  A -10.237 -57.391 -22.986 1.00 121.41 ? 46  ARG B NH1 1 
ATOM   2979 N NH2 . ARG B 1 53  A -9.653  -59.143 -21.627 1.00 124.62 ? 46  ARG B NH2 1 
ATOM   2980 N N   . LEU B 1 54  B -13.686 -61.327 -29.106 1.00 78.67  ? 46  LEU B N   1 
ATOM   2981 C CA  . LEU B 1 54  B -14.505 -61.258 -30.323 1.00 78.88  ? 46  LEU B CA  1 
ATOM   2982 C C   . LEU B 1 54  B -15.914 -60.758 -29.987 1.00 81.45  ? 46  LEU B C   1 
ATOM   2983 O O   . LEU B 1 54  B -16.646 -60.325 -30.876 1.00 81.67  ? 46  LEU B O   1 
ATOM   2984 C CB  . LEU B 1 54  B -14.527 -62.602 -31.090 1.00 79.35  ? 46  LEU B CB  1 
ATOM   2985 C CG  . LEU B 1 54  B -13.221 -62.993 -31.819 1.00 84.89  ? 46  LEU B CG  1 
ATOM   2986 C CD1 . LEU B 1 54  B -13.253 -64.448 -32.258 1.00 85.19  ? 46  LEU B CD1 1 
ATOM   2987 C CD2 . LEU B 1 54  B -12.926 -62.065 -33.009 1.00 87.82  ? 46  LEU B CD2 1 
ATOM   2988 N N   . TYR B 1 55  ? -16.283 -60.809 -28.690 1.00 75.54  ? 47  TYR B N   1 
ATOM   2989 C CA  . TYR B 1 55  ? -17.510 -60.237 -28.169 1.00 73.67  ? 47  TYR B CA  1 
ATOM   2990 C C   . TYR B 1 55  ? -17.104 -58.838 -27.733 1.00 74.29  ? 47  TYR B C   1 
ATOM   2991 O O   . TYR B 1 55  ? -16.391 -58.672 -26.741 1.00 72.56  ? 47  TYR B O   1 
ATOM   2992 C CB  . TYR B 1 55  ? -18.070 -61.046 -26.991 1.00 74.58  ? 47  TYR B CB  1 
ATOM   2993 C CG  . TYR B 1 55  ? -18.637 -62.376 -27.418 1.00 76.45  ? 47  TYR B CG  1 
ATOM   2994 C CD1 . TYR B 1 55  ? -19.847 -62.453 -28.104 1.00 78.32  ? 47  TYR B CD1 1 
ATOM   2995 C CD2 . TYR B 1 55  ? -17.955 -63.560 -27.158 1.00 77.21  ? 47  TYR B CD2 1 
ATOM   2996 C CE1 . TYR B 1 55  ? -20.360 -63.678 -28.526 1.00 79.30  ? 47  TYR B CE1 1 
ATOM   2997 C CE2 . TYR B 1 55  ? -18.454 -64.790 -27.579 1.00 77.98  ? 47  TYR B CE2 1 
ATOM   2998 C CZ  . TYR B 1 55  ? -19.659 -64.846 -28.258 1.00 86.20  ? 47  TYR B CZ  1 
ATOM   2999 O OH  . TYR B 1 55  ? -20.151 -66.064 -28.661 1.00 88.87  ? 47  TYR B OH  1 
ATOM   3000 N N   . THR B 1 56  ? -17.489 -57.844 -28.535 1.00 70.28  ? 48  THR B N   1 
ATOM   3001 C CA  . THR B 1 56  ? -17.197 -56.426 -28.317 1.00 69.96  ? 48  THR B CA  1 
ATOM   3002 C C   . THR B 1 56  ? -17.712 -55.934 -26.972 1.00 73.45  ? 48  THR B C   1 
ATOM   3003 O O   . THR B 1 56  ? -17.039 -55.125 -26.332 1.00 73.22  ? 48  THR B O   1 
ATOM   3004 C CB  . THR B 1 56  ? -17.679 -55.616 -29.518 1.00 77.31  ? 48  THR B CB  1 
ATOM   3005 O OG1 . THR B 1 56  ? -17.164 -56.240 -30.684 1.00 81.33  ? 48  THR B OG1 1 
ATOM   3006 C CG2 . THR B 1 56  ? -17.200 -54.191 -29.493 1.00 74.96  ? 48  THR B CG2 1 
ATOM   3007 N N   . ALA B 1 57  ? -18.882 -56.454 -26.526 1.00 69.22  ? 49  ALA B N   1 
ATOM   3008 C CA  . ALA B 1 57  ? -19.476 -56.134 -25.235 1.00 67.96  ? 49  ALA B CA  1 
ATOM   3009 C C   . ALA B 1 57  ? -18.493 -56.482 -24.087 1.00 71.87  ? 49  ALA B C   1 
ATOM   3010 O O   . ALA B 1 57  ? -18.474 -55.780 -23.081 1.00 71.84  ? 49  ALA B O   1 
ATOM   3011 C CB  . ALA B 1 57  ? -20.784 -56.888 -25.073 1.00 68.36  ? 49  ALA B CB  1 
ATOM   3012 N N   . CYS B 1 58  ? -17.643 -57.524 -24.262 1.00 67.91  ? 50  CYS B N   1 
ATOM   3013 C CA  . CYS B 1 58  ? -16.629 -57.924 -23.277 1.00 67.24  ? 50  CYS B CA  1 
ATOM   3014 C C   . CYS B 1 58  ? -15.400 -57.026 -23.310 1.00 72.28  ? 50  CYS B C   1 
ATOM   3015 O O   . CYS B 1 58  ? -14.650 -56.975 -22.334 1.00 71.96  ? 50  CYS B O   1 
ATOM   3016 C CB  . CYS B 1 58  ? -16.254 -59.389 -23.439 1.00 67.19  ? 50  CYS B CB  1 
ATOM   3017 S SG  . CYS B 1 58  ? -17.496 -60.537 -22.807 1.00 71.22  ? 50  CYS B SG  1 
ATOM   3018 N N   . VAL B 1 59  ? -15.189 -56.322 -24.430 1.00 70.01  ? 51  VAL B N   1 
ATOM   3019 C CA  . VAL B 1 59  ? -14.080 -55.377 -24.595 1.00 70.19  ? 51  VAL B CA  1 
ATOM   3020 C C   . VAL B 1 59  ? -14.435 -54.073 -23.823 1.00 73.84  ? 51  VAL B C   1 
ATOM   3021 O O   . VAL B 1 59  ? -13.561 -53.487 -23.176 1.00 72.99  ? 51  VAL B O   1 
ATOM   3022 C CB  . VAL B 1 59  ? -13.753 -55.120 -26.106 1.00 73.98  ? 51  VAL B CB  1 
ATOM   3023 C CG1 . VAL B 1 59  ? -12.658 -54.074 -26.285 1.00 73.51  ? 51  VAL B CG1 1 
ATOM   3024 C CG2 . VAL B 1 59  ? -13.371 -56.417 -26.820 1.00 73.94  ? 51  VAL B CG2 1 
ATOM   3025 N N   . TYR B 1 60  ? -15.722 -53.650 -23.875 1.00 69.84  ? 52  TYR B N   1 
ATOM   3026 C CA  . TYR B 1 60  ? -16.203 -52.417 -23.239 1.00 69.16  ? 52  TYR B CA  1 
ATOM   3027 C C   . TYR B 1 60  ? -16.782 -52.511 -21.817 1.00 67.99  ? 52  TYR B C   1 
ATOM   3028 O O   . TYR B 1 60  ? -17.172 -51.489 -21.253 1.00 68.10  ? 52  TYR B O   1 
ATOM   3029 C CB  . TYR B 1 60  ? -17.048 -51.574 -24.214 1.00 71.63  ? 52  TYR B CB  1 
ATOM   3030 C CG  . TYR B 1 60  ? -16.267 -51.254 -25.470 1.00 75.99  ? 52  TYR B CG  1 
ATOM   3031 C CD1 . TYR B 1 60  ? -16.487 -51.962 -26.648 1.00 78.21  ? 52  TYR B CD1 1 
ATOM   3032 C CD2 . TYR B 1 60  ? -15.209 -50.345 -25.444 1.00 77.61  ? 52  TYR B CD2 1 
ATOM   3033 C CE1 . TYR B 1 60  ? -15.725 -51.721 -27.792 1.00 79.75  ? 52  TYR B CE1 1 
ATOM   3034 C CE2 . TYR B 1 60  ? -14.434 -50.102 -26.579 1.00 79.06  ? 52  TYR B CE2 1 
ATOM   3035 C CZ  . TYR B 1 60  ? -14.699 -50.789 -27.756 1.00 87.78  ? 52  TYR B CZ  1 
ATOM   3036 O OH  . TYR B 1 60  ? -13.946 -50.557 -28.887 1.00 88.09  ? 52  TYR B OH  1 
ATOM   3037 N N   . HIS B 1 61  ? -16.795 -53.711 -21.224 1.00 59.74  ? 53  HIS B N   1 
ATOM   3038 C CA  . HIS B 1 61  ? -17.239 -53.901 -19.850 1.00 57.80  ? 53  HIS B CA  1 
ATOM   3039 C C   . HIS B 1 61  ? -16.118 -54.430 -18.952 1.00 61.78  ? 53  HIS B C   1 
ATOM   3040 O O   . HIS B 1 61  ? -15.151 -55.012 -19.446 1.00 63.03  ? 53  HIS B O   1 
ATOM   3041 C CB  . HIS B 1 61  ? -18.488 -54.794 -19.795 1.00 57.57  ? 53  HIS B CB  1 
ATOM   3042 C CG  . HIS B 1 61  ? -19.716 -54.078 -20.245 1.00 60.21  ? 53  HIS B CG  1 
ATOM   3043 N ND1 . HIS B 1 61  ? -20.353 -54.389 -21.440 1.00 61.62  ? 53  HIS B ND1 1 
ATOM   3044 C CD2 . HIS B 1 61  ? -20.352 -53.038 -19.672 1.00 61.53  ? 53  HIS B CD2 1 
ATOM   3045 C CE1 . HIS B 1 61  ? -21.366 -53.546 -21.537 1.00 61.01  ? 53  HIS B CE1 1 
ATOM   3046 N NE2 . HIS B 1 61  ? -21.403 -52.713 -20.499 1.00 61.38  ? 53  HIS B NE2 1 
ATOM   3047 N N   . LYS B 1 62  ? -16.243 -54.201 -17.632 1.00 56.77  ? 54  LYS B N   1 
ATOM   3048 C CA  . LYS B 1 62  ? -15.312 -54.676 -16.611 1.00 56.25  ? 54  LYS B CA  1 
ATOM   3049 C C   . LYS B 1 62  ? -15.492 -56.196 -16.501 1.00 60.51  ? 54  LYS B C   1 
ATOM   3050 O O   . LYS B 1 62  ? -16.625 -56.677 -16.403 1.00 60.83  ? 54  LYS B O   1 
ATOM   3051 C CB  . LYS B 1 62  ? -15.602 -53.986 -15.263 1.00 57.89  ? 54  LYS B CB  1 
ATOM   3052 C CG  . LYS B 1 62  ? -14.694 -54.419 -14.110 1.00 62.99  ? 54  LYS B CG  1 
ATOM   3053 C CD  . LYS B 1 62  ? -13.965 -53.244 -13.497 1.00 66.91  ? 54  LYS B CD  1 
ATOM   3054 C CE  . LYS B 1 62  ? -13.196 -53.650 -12.263 1.00 72.46  ? 54  LYS B CE  1 
ATOM   3055 N NZ  . LYS B 1 62  ? -13.127 -52.536 -11.276 1.00 79.87  ? 54  LYS B NZ  1 
ATOM   3056 N N   . LEU B 1 63  ? -14.379 -56.943 -16.537 1.00 56.08  ? 55  LEU B N   1 
ATOM   3057 C CA  . LEU B 1 63  ? -14.405 -58.403 -16.459 1.00 55.45  ? 55  LEU B CA  1 
ATOM   3058 C C   . LEU B 1 63  ? -13.936 -58.928 -15.109 1.00 59.47  ? 55  LEU B C   1 
ATOM   3059 O O   . LEU B 1 63  ? -13.009 -58.369 -14.515 1.00 57.96  ? 55  LEU B O   1 
ATOM   3060 C CB  . LEU B 1 63  ? -13.553 -59.039 -17.572 1.00 55.15  ? 55  LEU B CB  1 
ATOM   3061 C CG  . LEU B 1 63  ? -13.730 -58.524 -19.008 1.00 60.03  ? 55  LEU B CG  1 
ATOM   3062 C CD1 . LEU B 1 63  ? -12.673 -59.081 -19.896 1.00 59.81  ? 55  LEU B CD1 1 
ATOM   3063 C CD2 . LEU B 1 63  ? -15.088 -58.882 -19.578 1.00 63.99  ? 55  LEU B CD2 1 
ATOM   3064 N N   . PHE B 1 64  ? -14.560 -60.028 -14.641 1.00 56.86  ? 56  PHE B N   1 
ATOM   3065 C CA  . PHE B 1 64  ? -14.177 -60.662 -13.389 1.00 57.18  ? 56  PHE B CA  1 
ATOM   3066 C C   . PHE B 1 64  ? -13.037 -61.637 -13.629 1.00 64.28  ? 56  PHE B C   1 
ATOM   3067 O O   . PHE B 1 64  ? -13.158 -62.548 -14.460 1.00 64.49  ? 56  PHE B O   1 
ATOM   3068 C CB  . PHE B 1 64  ? -15.368 -61.351 -12.699 1.00 58.71  ? 56  PHE B CB  1 
ATOM   3069 C CG  . PHE B 1 64  ? -15.003 -62.039 -11.401 1.00 60.29  ? 56  PHE B CG  1 
ATOM   3070 C CD1 . PHE B 1 64  ? -14.655 -61.300 -10.273 1.00 63.29  ? 56  PHE B CD1 1 
ATOM   3071 C CD2 . PHE B 1 64  ? -14.986 -63.427 -11.311 1.00 61.90  ? 56  PHE B CD2 1 
ATOM   3072 C CE1 . PHE B 1 64  ? -14.302 -61.940 -9.076  1.00 64.09  ? 56  PHE B CE1 1 
ATOM   3073 C CE2 . PHE B 1 64  ? -14.635 -64.062 -10.113 1.00 64.36  ? 56  PHE B CE2 1 
ATOM   3074 C CZ  . PHE B 1 64  ? -14.301 -63.317 -9.004  1.00 62.60  ? 56  PHE B CZ  1 
ATOM   3075 N N   . ASP B 1 65  ? -11.916 -61.420 -12.912 1.00 62.29  ? 57  ASP B N   1 
ATOM   3076 C CA  . ASP B 1 65  ? -10.709 -62.246 -12.950 1.00 62.55  ? 57  ASP B CA  1 
ATOM   3077 C C   . ASP B 1 65  ? -10.663 -63.079 -11.657 1.00 65.69  ? 57  ASP B C   1 
ATOM   3078 O O   . ASP B 1 65  ? -10.379 -62.529 -10.588 1.00 64.65  ? 57  ASP B O   1 
ATOM   3079 C CB  . ASP B 1 65  ? -9.454  -61.340 -13.067 1.00 65.01  ? 57  ASP B CB  1 
ATOM   3080 C CG  . ASP B 1 65  ? -8.179  -61.984 -13.621 1.00 76.69  ? 57  ASP B CG  1 
ATOM   3081 O OD1 . ASP B 1 65  ? -8.025  -63.224 -13.488 1.00 77.82  ? 57  ASP B OD1 1 
ATOM   3082 O OD2 . ASP B 1 65  ? -7.317  -61.238 -14.150 1.00 79.29  ? 57  ASP B OD2 1 
ATOM   3083 N N   . ALA B 1 66  ? -10.978 -64.390 -11.750 1.00 62.81  ? 58  ALA B N   1 
ATOM   3084 C CA  . ALA B 1 66  ? -10.963 -65.319 -10.610 1.00 63.31  ? 58  ALA B CA  1 
ATOM   3085 C C   . ALA B 1 66  ? -9.552  -65.497 -10.014 1.00 70.98  ? 58  ALA B C   1 
ATOM   3086 O O   . ALA B 1 66  ? -9.422  -65.737 -8.810  1.00 70.89  ? 58  ALA B O   1 
ATOM   3087 C CB  . ALA B 1 66  ? -11.533 -66.658 -11.029 1.00 63.85  ? 58  ALA B CB  1 
ATOM   3088 N N   . SER B 1 67  ? -8.500  -65.348 -10.849 1.00 69.94  ? 59  SER B N   1 
ATOM   3089 C CA  . SER B 1 67  ? -7.104  -65.489 -10.423 1.00 70.74  ? 59  SER B CA  1 
ATOM   3090 C C   . SER B 1 67  ? -6.751  -64.522 -9.296  1.00 75.18  ? 59  SER B C   1 
ATOM   3091 O O   . SER B 1 67  ? -6.064  -64.924 -8.355  1.00 75.35  ? 59  SER B O   1 
ATOM   3092 C CB  . SER B 1 67  ? -6.152  -65.321 -11.605 1.00 75.69  ? 59  SER B CB  1 
ATOM   3093 O OG  . SER B 1 67  ? -5.949  -63.959 -11.951 1.00 87.11  ? 59  SER B OG  1 
ATOM   3094 N N   . ASP B 1 68  ? -7.264  -63.269 -9.372  1.00 71.45  ? 60  ASP B N   1 
ATOM   3095 C CA  . ASP B 1 68  ? -7.034  -62.203 -8.385  1.00 71.11  ? 60  ASP B CA  1 
ATOM   3096 C C   . ASP B 1 68  ? -7.857  -62.332 -7.088  1.00 73.94  ? 60  ASP B C   1 
ATOM   3097 O O   . ASP B 1 68  ? -7.671  -61.513 -6.184  1.00 73.67  ? 60  ASP B O   1 
ATOM   3098 C CB  . ASP B 1 68  ? -7.211  -60.810 -9.027  1.00 73.28  ? 60  ASP B CB  1 
ATOM   3099 C CG  . ASP B 1 68  ? -6.267  -60.528 -10.188 1.00 89.40  ? 60  ASP B CG  1 
ATOM   3100 O OD1 . ASP B 1 68  ? -5.606  -59.467 -10.172 1.00 91.07  ? 60  ASP B OD1 1 
ATOM   3101 O OD2 . ASP B 1 68  ? -6.192  -61.368 -11.114 1.00 97.16  ? 60  ASP B OD2 1 
ATOM   3102 N N   . SER B 1 69  ? -8.740  -63.363 -6.982  1.00 69.67  ? 61  SER B N   1 
ATOM   3103 C CA  . SER B 1 69  ? -9.577  -63.572 -5.798  1.00 68.61  ? 61  SER B CA  1 
ATOM   3104 C C   . SER B 1 69  ? -9.132  -64.766 -4.974  1.00 71.95  ? 61  SER B C   1 
ATOM   3105 O O   . SER B 1 69  ? -9.014  -65.876 -5.501  1.00 71.39  ? 61  SER B O   1 
ATOM   3106 C CB  . SER B 1 69  ? -11.050 -63.700 -6.179  1.00 70.55  ? 61  SER B CB  1 
ATOM   3107 O OG  . SER B 1 69  ? -11.850 -63.845 -5.015  1.00 72.47  ? 61  SER B OG  1 
ATOM   3108 N N   . SER B 1 70  ? -8.883  -64.522 -3.679  1.00 68.28  ? 62  SER B N   1 
ATOM   3109 C CA  . SER B 1 70  ? -8.444  -65.534 -2.725  1.00 68.33  ? 62  SER B CA  1 
ATOM   3110 C C   . SER B 1 70  ? -9.616  -66.323 -2.153  1.00 71.23  ? 62  SER B C   1 
ATOM   3111 O O   . SER B 1 70  ? -9.418  -67.432 -1.648  1.00 70.90  ? 62  SER B O   1 
ATOM   3112 C CB  . SER B 1 70  ? -7.641  -64.891 -1.601  1.00 72.96  ? 62  SER B CB  1 
ATOM   3113 O OG  . SER B 1 70  ? -8.425  -63.948 -0.890  1.00 82.44  ? 62  SER B OG  1 
ATOM   3114 N N   . SER B 1 71  ? -10.830 -65.745 -2.229  1.00 66.97  ? 63  SER B N   1 
ATOM   3115 C CA  . SER B 1 71  ? -12.078 -66.342 -1.730  1.00 66.07  ? 63  SER B CA  1 
ATOM   3116 C C   . SER B 1 71  ? -12.850 -67.153 -2.789  1.00 69.87  ? 63  SER B C   1 
ATOM   3117 O O   . SER B 1 71  ? -13.840 -67.803 -2.446  1.00 69.41  ? 63  SER B O   1 
ATOM   3118 C CB  . SER B 1 71  ? -12.974 -65.275 -1.104  1.00 68.31  ? 63  SER B CB  1 
ATOM   3119 O OG  . SER B 1 71  ? -13.061 -64.099 -1.895  1.00 75.86  ? 63  SER B OG  1 
ATOM   3120 N N   . TYR B 1 72  ? -12.387 -67.129 -4.059  1.00 66.88  ? 64  TYR B N   1 
ATOM   3121 C CA  . TYR B 1 72  ? -13.002 -67.820 -5.194  1.00 67.31  ? 64  TYR B CA  1 
ATOM   3122 C C   . TYR B 1 72  ? -13.105 -69.332 -4.995  1.00 72.69  ? 64  TYR B C   1 
ATOM   3123 O O   . TYR B 1 72  ? -12.146 -69.975 -4.574  1.00 72.54  ? 64  TYR B O   1 
ATOM   3124 C CB  . TYR B 1 72  ? -12.254 -67.468 -6.501  1.00 68.83  ? 64  TYR B CB  1 
ATOM   3125 C CG  . TYR B 1 72  ? -12.576 -68.349 -7.693  1.00 72.38  ? 64  TYR B CG  1 
ATOM   3126 C CD1 . TYR B 1 72  ? -11.713 -69.369 -8.085  1.00 74.76  ? 64  TYR B CD1 1 
ATOM   3127 C CD2 . TYR B 1 72  ? -13.730 -68.145 -8.445  1.00 73.45  ? 64  TYR B CD2 1 
ATOM   3128 C CE1 . TYR B 1 72  ? -12.004 -70.182 -9.179  1.00 75.81  ? 64  TYR B CE1 1 
ATOM   3129 C CE2 . TYR B 1 72  ? -14.023 -68.941 -9.551  1.00 74.33  ? 64  TYR B CE2 1 
ATOM   3130 C CZ  . TYR B 1 72  ? -13.155 -69.955 -9.917  1.00 82.33  ? 64  TYR B CZ  1 
ATOM   3131 O OH  . TYR B 1 72  ? -13.451 -70.752 -10.998 1.00 84.72  ? 64  TYR B OH  1 
ATOM   3132 N N   . LYS B 1 73  ? -14.270 -69.887 -5.303  1.00 70.41  ? 65  LYS B N   1 
ATOM   3133 C CA  . LYS B 1 73  ? -14.543 -71.317 -5.255  1.00 71.02  ? 65  LYS B CA  1 
ATOM   3134 C C   . LYS B 1 73  ? -15.042 -71.668 -6.650  1.00 76.29  ? 65  LYS B C   1 
ATOM   3135 O O   . LYS B 1 73  ? -16.072 -71.148 -7.086  1.00 76.32  ? 65  LYS B O   1 
ATOM   3136 C CB  . LYS B 1 73  ? -15.634 -71.643 -4.219  1.00 73.73  ? 65  LYS B CB  1 
ATOM   3137 C CG  . LYS B 1 73  ? -15.192 -72.123 -2.853  1.00 88.78  ? 65  LYS B CG  1 
ATOM   3138 C CD  . LYS B 1 73  ? -15.029 -73.668 -2.857  1.00 101.92 ? 65  LYS B CD  1 
ATOM   3139 C CE  . LYS B 1 73  ? -15.261 -74.356 -1.533  1.00 115.10 ? 65  LYS B CE  1 
ATOM   3140 N NZ  . LYS B 1 73  ? -16.704 -74.444 -1.172  1.00 121.84 ? 65  LYS B NZ  1 
ATOM   3141 N N   . HIS B 1 74  ? -14.280 -72.508 -7.361  1.00 73.29  ? 66  HIS B N   1 
ATOM   3142 C CA  . HIS B 1 74  ? -14.593 -72.974 -8.701  1.00 73.36  ? 66  HIS B CA  1 
ATOM   3143 C C   . HIS B 1 74  ? -15.805 -73.899 -8.644  1.00 76.59  ? 66  HIS B C   1 
ATOM   3144 O O   . HIS B 1 74  ? -16.026 -74.567 -7.629  1.00 76.96  ? 66  HIS B O   1 
ATOM   3145 C CB  . HIS B 1 74  ? -13.361 -73.714 -9.283  1.00 74.75  ? 66  HIS B CB  1 
ATOM   3146 C CG  . HIS B 1 74  ? -13.605 -74.414 -10.591 1.00 78.93  ? 66  HIS B CG  1 
ATOM   3147 N ND1 . HIS B 1 74  ? -13.973 -75.755 -10.638 1.00 81.16  ? 66  HIS B ND1 1 
ATOM   3148 C CD2 . HIS B 1 74  ? -13.568 -73.927 -11.855 1.00 81.18  ? 66  HIS B CD2 1 
ATOM   3149 C CE1 . HIS B 1 74  ? -14.141 -76.036 -11.923 1.00 80.75  ? 66  HIS B CE1 1 
ATOM   3150 N NE2 . HIS B 1 74  ? -13.904 -74.969 -12.695 1.00 81.00  ? 66  HIS B NE2 1 
ATOM   3151 N N   . ASN B 1 75  ? -16.586 -73.925 -9.732  1.00 71.82  ? 67  ASN B N   1 
ATOM   3152 C CA  . ASN B 1 75  ? -17.716 -74.831 -9.934  1.00 71.37  ? 67  ASN B CA  1 
ATOM   3153 C C   . ASN B 1 75  ? -17.679 -75.244 -11.414 1.00 75.10  ? 67  ASN B C   1 
ATOM   3154 O O   . ASN B 1 75  ? -17.371 -76.397 -11.714 1.00 75.75  ? 67  ASN B O   1 
ATOM   3155 C CB  . ASN B 1 75  ? -19.053 -74.223 -9.498  1.00 71.02  ? 67  ASN B CB  1 
ATOM   3156 C CG  . ASN B 1 75  ? -20.205 -75.182 -9.654  1.00 86.22  ? 67  ASN B CG  1 
ATOM   3157 O OD1 . ASN B 1 75  ? -20.766 -75.334 -10.744 1.00 69.25  ? 67  ASN B OD1 1 
ATOM   3158 N ND2 . ASN B 1 75  ? -20.572 -75.858 -8.575  1.00 84.82  ? 67  ASN B ND2 1 
ATOM   3159 N N   . GLY B 1 76  ? -17.903 -74.288 -12.313 1.00 69.92  ? 68  GLY B N   1 
ATOM   3160 C CA  . GLY B 1 76  ? -17.785 -74.493 -13.750 1.00 68.71  ? 68  GLY B CA  1 
ATOM   3161 C C   . GLY B 1 76  ? -18.967 -75.052 -14.501 1.00 70.81  ? 68  GLY B C   1 
ATOM   3162 O O   . GLY B 1 76  ? -18.836 -75.306 -15.704 1.00 70.31  ? 68  GLY B O   1 
ATOM   3163 N N   . THR B 1 77  ? -20.119 -75.248 -13.824 1.00 66.70  ? 69  THR B N   1 
ATOM   3164 C CA  . THR B 1 77  ? -21.345 -75.730 -14.476 1.00 66.85  ? 69  THR B CA  1 
ATOM   3165 C C   . THR B 1 77  ? -21.776 -74.684 -15.517 1.00 71.91  ? 69  THR B C   1 
ATOM   3166 O O   . THR B 1 77  ? -21.887 -73.506 -15.178 1.00 71.44  ? 69  THR B O   1 
ATOM   3167 C CB  . THR B 1 77  ? -22.441 -75.990 -13.435 1.00 75.17  ? 69  THR B CB  1 
ATOM   3168 O OG1 . THR B 1 77  ? -22.008 -77.017 -12.552 1.00 73.19  ? 69  THR B OG1 1 
ATOM   3169 C CG2 . THR B 1 77  ? -23.775 -76.376 -14.058 1.00 74.73  ? 69  THR B CG2 1 
ATOM   3170 N N   . GLU B 1 78  ? -21.946 -75.120 -16.782 1.00 69.31  ? 70  GLU B N   1 
ATOM   3171 C CA  . GLU B 1 78  ? -22.352 -74.290 -17.914 1.00 69.76  ? 70  GLU B CA  1 
ATOM   3172 C C   . GLU B 1 78  ? -23.745 -73.696 -17.657 1.00 73.48  ? 70  GLU B C   1 
ATOM   3173 O O   . GLU B 1 78  ? -24.646 -74.408 -17.209 1.00 72.96  ? 70  GLU B O   1 
ATOM   3174 C CB  . GLU B 1 78  ? -22.331 -75.111 -19.219 1.00 71.62  ? 70  GLU B CB  1 
ATOM   3175 C CG  . GLU B 1 78  ? -22.280 -74.260 -20.485 1.00 87.61  ? 70  GLU B CG  1 
ATOM   3176 C CD  . GLU B 1 78  ? -23.480 -74.362 -21.415 1.00 112.50 ? 70  GLU B CD  1 
ATOM   3177 O OE1 . GLU B 1 78  ? -23.723 -75.466 -21.957 1.00 105.67 ? 70  GLU B OE1 1 
ATOM   3178 O OE2 . GLU B 1 78  ? -24.146 -73.324 -21.644 1.00 104.74 ? 70  GLU B OE2 1 
ATOM   3179 N N   . LEU B 1 79  ? -23.903 -72.388 -17.938 1.00 69.84  ? 71  LEU B N   1 
ATOM   3180 C CA  . LEU B 1 79  ? -25.124 -71.602 -17.723 1.00 69.03  ? 71  LEU B CA  1 
ATOM   3181 C C   . LEU B 1 79  ? -25.623 -70.906 -19.006 1.00 71.11  ? 71  LEU B C   1 
ATOM   3182 O O   . LEU B 1 79  ? -24.806 -70.329 -19.731 1.00 71.47  ? 71  LEU B O   1 
ATOM   3183 C CB  . LEU B 1 79  ? -24.784 -70.501 -16.694 1.00 68.89  ? 71  LEU B CB  1 
ATOM   3184 C CG  . LEU B 1 79  ? -25.671 -70.314 -15.468 1.00 73.08  ? 71  LEU B CG  1 
ATOM   3185 C CD1 . LEU B 1 79  ? -25.228 -69.120 -14.699 1.00 73.13  ? 71  LEU B CD1 1 
ATOM   3186 C CD2 . LEU B 1 79  ? -27.114 -70.093 -15.840 1.00 75.86  ? 71  LEU B CD2 1 
ATOM   3187 N N   . THR B 1 80  ? -26.954 -70.916 -19.261 1.00 65.54  ? 72  THR B N   1 
ATOM   3188 C CA  . THR B 1 80  ? -27.556 -70.155 -20.368 1.00 64.86  ? 72  THR B CA  1 
ATOM   3189 C C   . THR B 1 80  ? -28.752 -69.360 -19.828 1.00 67.40  ? 72  THR B C   1 
ATOM   3190 O O   . THR B 1 80  ? -29.715 -69.950 -19.332 1.00 67.41  ? 72  THR B O   1 
ATOM   3191 C CB  . THR B 1 80  ? -27.841 -70.999 -21.625 1.00 67.27  ? 72  THR B CB  1 
ATOM   3192 O OG1 . THR B 1 80  ? -26.603 -71.523 -22.128 1.00 65.19  ? 72  THR B OG1 1 
ATOM   3193 C CG2 . THR B 1 80  ? -28.529 -70.183 -22.724 1.00 61.31  ? 72  THR B CG2 1 
ATOM   3194 N N   . LEU B 1 81  ? -28.654 -68.024 -19.884 1.00 61.75  ? 73  LEU B N   1 
ATOM   3195 C CA  . LEU B 1 81  ? -29.686 -67.124 -19.376 1.00 60.36  ? 73  LEU B CA  1 
ATOM   3196 C C   . LEU B 1 81  ? -30.344 -66.395 -20.513 1.00 63.46  ? 73  LEU B C   1 
ATOM   3197 O O   . LEU B 1 81  ? -29.719 -65.552 -21.155 1.00 62.69  ? 73  LEU B O   1 
ATOM   3198 C CB  . LEU B 1 81  ? -29.101 -66.124 -18.352 1.00 59.89  ? 73  LEU B CB  1 
ATOM   3199 C CG  . LEU B 1 81  ? -28.406 -66.720 -17.149 1.00 63.69  ? 73  LEU B CG  1 
ATOM   3200 C CD1 . LEU B 1 81  ? -27.414 -65.756 -16.568 1.00 63.65  ? 73  LEU B CD1 1 
ATOM   3201 C CD2 . LEU B 1 81  ? -29.405 -67.145 -16.115 1.00 65.37  ? 73  LEU B CD2 1 
ATOM   3202 N N   . ARG B 1 82  ? -31.582 -66.763 -20.826 1.00 60.88  ? 74  ARG B N   1 
ATOM   3203 C CA  . ARG B 1 82  ? -32.291 -66.059 -21.887 1.00 60.78  ? 74  ARG B CA  1 
ATOM   3204 C C   . ARG B 1 82  ? -33.320 -65.092 -21.332 1.00 61.41  ? 74  ARG B C   1 
ATOM   3205 O O   . ARG B 1 82  ? -34.062 -65.416 -20.400 1.00 62.22  ? 74  ARG B O   1 
ATOM   3206 C CB  . ARG B 1 82  ? -32.801 -66.951 -23.032 1.00 63.40  ? 74  ARG B CB  1 
ATOM   3207 C CG  . ARG B 1 82  ? -33.631 -68.155 -22.632 1.00 81.07  ? 74  ARG B CG  1 
ATOM   3208 C CD  . ARG B 1 82  ? -34.241 -68.849 -23.850 1.00 101.94 ? 74  ARG B CD  1 
ATOM   3209 N NE  . ARG B 1 82  ? -33.241 -69.290 -24.833 1.00 114.65 ? 74  ARG B NE  1 
ATOM   3210 C CZ  . ARG B 1 82  ? -32.589 -70.450 -24.788 1.00 129.30 ? 74  ARG B CZ  1 
ATOM   3211 N NH1 . ARG B 1 82  ? -32.810 -71.308 -23.796 1.00 116.96 ? 74  ARG B NH1 1 
ATOM   3212 N NH2 . ARG B 1 82  ? -31.706 -70.758 -25.728 1.00 114.35 ? 74  ARG B NH2 1 
ATOM   3213 N N   . TYR B 1 83  ? -33.267 -63.868 -21.843 1.00 53.06  ? 75  TYR B N   1 
ATOM   3214 C CA  . TYR B 1 83  ? -34.094 -62.742 -21.442 1.00 50.41  ? 75  TYR B CA  1 
ATOM   3215 C C   . TYR B 1 83  ? -34.873 -62.278 -22.654 1.00 54.21  ? 75  TYR B C   1 
ATOM   3216 O O   . TYR B 1 83  ? -34.555 -62.698 -23.762 1.00 54.44  ? 75  TYR B O   1 
ATOM   3217 C CB  . TYR B 1 83  ? -33.189 -61.608 -20.951 1.00 49.38  ? 75  TYR B CB  1 
ATOM   3218 C CG  . TYR B 1 83  ? -32.299 -61.964 -19.782 1.00 47.94  ? 75  TYR B CG  1 
ATOM   3219 C CD1 . TYR B 1 83  ? -32.812 -62.045 -18.490 1.00 49.22  ? 75  TYR B CD1 1 
ATOM   3220 C CD2 . TYR B 1 83  ? -30.926 -62.133 -19.950 1.00 47.76  ? 75  TYR B CD2 1 
ATOM   3221 C CE1 . TYR B 1 83  ? -31.988 -62.323 -17.397 1.00 48.71  ? 75  TYR B CE1 1 
ATOM   3222 C CE2 . TYR B 1 83  ? -30.088 -62.410 -18.863 1.00 48.18  ? 75  TYR B CE2 1 
ATOM   3223 C CZ  . TYR B 1 83  ? -30.625 -62.496 -17.586 1.00 51.84  ? 75  TYR B CZ  1 
ATOM   3224 O OH  . TYR B 1 83  ? -29.812 -62.752 -16.510 1.00 46.25  ? 75  TYR B OH  1 
ATOM   3225 N N   . SER B 1 84  ? -35.871 -61.397 -22.456 1.00 50.31  ? 76  SER B N   1 
ATOM   3226 C CA  . SER B 1 84  ? -36.717 -60.855 -23.531 1.00 49.52  ? 76  SER B CA  1 
ATOM   3227 C C   . SER B 1 84  ? -35.923 -60.159 -24.630 1.00 53.52  ? 76  SER B C   1 
ATOM   3228 O O   . SER B 1 84  ? -36.300 -60.247 -25.795 1.00 53.67  ? 76  SER B O   1 
ATOM   3229 C CB  . SER B 1 84  ? -37.736 -59.871 -22.968 1.00 51.49  ? 76  SER B CB  1 
ATOM   3230 O OG  . SER B 1 84  ? -38.571 -60.477 -22.004 1.00 57.50  ? 76  SER B OG  1 
ATOM   3231 N N   . THR B 1 85  ? -34.838 -59.465 -24.261 1.00 50.35  ? 77  THR B N   1 
ATOM   3232 C CA  . THR B 1 85  ? -34.014 -58.674 -25.179 1.00 50.49  ? 77  THR B CA  1 
ATOM   3233 C C   . THR B 1 85  ? -32.760 -59.356 -25.727 1.00 55.24  ? 77  THR B C   1 
ATOM   3234 O O   . THR B 1 85  ? -32.151 -58.817 -26.654 1.00 55.72  ? 77  THR B O   1 
ATOM   3235 C CB  . THR B 1 85  ? -33.628 -57.331 -24.528 1.00 50.96  ? 77  THR B CB  1 
ATOM   3236 O OG1 . THR B 1 85  ? -32.837 -57.586 -23.364 1.00 45.71  ? 77  THR B OG1 1 
ATOM   3237 C CG2 . THR B 1 85  ? -34.831 -56.463 -24.207 1.00 48.79  ? 77  THR B CG2 1 
ATOM   3238 N N   . GLY B 1 86  ? -32.352 -60.466 -25.124 1.00 51.13  ? 78  GLY B N   1 
ATOM   3239 C CA  . GLY B 1 86  ? -31.143 -61.170 -25.520 1.00 51.28  ? 78  GLY B CA  1 
ATOM   3240 C C   . GLY B 1 86  ? -30.761 -62.307 -24.600 1.00 56.38  ? 78  GLY B C   1 
ATOM   3241 O O   . GLY B 1 86  ? -31.458 -62.573 -23.617 1.00 55.89  ? 78  GLY B O   1 
ATOM   3242 N N   . THR B 1 87  ? -29.628 -62.972 -24.913 1.00 53.21  ? 79  THR B N   1 
ATOM   3243 C CA  . THR B 1 87  ? -29.124 -64.145 -24.194 1.00 53.10  ? 79  THR B CA  1 
ATOM   3244 C C   . THR B 1 87  ? -27.650 -64.022 -23.832 1.00 58.79  ? 79  THR B C   1 
ATOM   3245 O O   . THR B 1 87  ? -26.869 -63.457 -24.598 1.00 58.98  ? 79  THR B O   1 
ATOM   3246 C CB  . THR B 1 87  ? -29.376 -65.407 -25.047 1.00 54.93  ? 79  THR B CB  1 
ATOM   3247 O OG1 . THR B 1 87  ? -30.779 -65.499 -25.341 1.00 60.31  ? 79  THR B OG1 1 
ATOM   3248 C CG2 . THR B 1 87  ? -28.905 -66.695 -24.377 1.00 47.32  ? 79  THR B CG2 1 
ATOM   3249 N N   . VAL B 1 88  ? -27.283 -64.568 -22.661 1.00 54.57  ? 80  VAL B N   1 
ATOM   3250 C CA  . VAL B 1 88  ? -25.907 -64.649 -22.180 1.00 54.00  ? 80  VAL B CA  1 
ATOM   3251 C C   . VAL B 1 88  ? -25.624 -66.091 -21.769 1.00 57.21  ? 80  VAL B C   1 
ATOM   3252 O O   . VAL B 1 88  ? -26.533 -66.817 -21.345 1.00 55.56  ? 80  VAL B O   1 
ATOM   3253 C CB  . VAL B 1 88  ? -25.514 -63.636 -21.059 1.00 57.59  ? 80  VAL B CB  1 
ATOM   3254 C CG1 . VAL B 1 88  ? -25.488 -62.210 -21.573 1.00 56.98  ? 80  VAL B CG1 1 
ATOM   3255 C CG2 . VAL B 1 88  ? -26.407 -63.762 -19.834 1.00 57.53  ? 80  VAL B CG2 1 
ATOM   3256 N N   . SER B 1 89  ? -24.360 -66.495 -21.900 1.00 54.48  ? 81  SER B N   1 
ATOM   3257 C CA  . SER B 1 89  ? -23.895 -67.814 -21.511 1.00 54.17  ? 81  SER B CA  1 
ATOM   3258 C C   . SER B 1 89  ? -22.582 -67.693 -20.799 1.00 57.57  ? 81  SER B C   1 
ATOM   3259 O O   . SER B 1 89  ? -21.792 -66.781 -21.064 1.00 57.31  ? 81  SER B O   1 
ATOM   3260 C CB  . SER B 1 89  ? -23.763 -68.734 -22.718 1.00 58.67  ? 81  SER B CB  1 
ATOM   3261 O OG  . SER B 1 89  ? -25.037 -69.210 -23.117 1.00 70.49  ? 81  SER B OG  1 
ATOM   3262 N N   . GLY B 1 90  ? -22.374 -68.612 -19.883 1.00 53.52  ? 82  GLY B N   1 
ATOM   3263 C CA  . GLY B 1 90  ? -21.164 -68.693 -19.094 1.00 53.08  ? 82  GLY B CA  1 
ATOM   3264 C C   . GLY B 1 90  ? -21.198 -69.942 -18.256 1.00 57.92  ? 82  GLY B C   1 
ATOM   3265 O O   . GLY B 1 90  ? -21.816 -70.939 -18.636 1.00 58.30  ? 82  GLY B O   1 
ATOM   3266 N N   . PHE B 1 91  ? -20.565 -69.874 -17.099 1.00 54.10  ? 83  PHE B N   1 
ATOM   3267 C CA  . PHE B 1 91  ? -20.485 -70.976 -16.151 1.00 53.64  ? 83  PHE B CA  1 
ATOM   3268 C C   . PHE B 1 91  ? -20.630 -70.447 -14.730 1.00 58.80  ? 83  PHE B C   1 
ATOM   3269 O O   . PHE B 1 91  ? -20.424 -69.254 -14.493 1.00 59.09  ? 83  PHE B O   1 
ATOM   3270 C CB  . PHE B 1 91  ? -19.149 -71.741 -16.320 1.00 54.46  ? 83  PHE B CB  1 
ATOM   3271 C CG  . PHE B 1 91  ? -17.921 -70.873 -16.197 1.00 54.62  ? 83  PHE B CG  1 
ATOM   3272 C CD1 . PHE B 1 91  ? -17.308 -70.679 -14.964 1.00 57.65  ? 83  PHE B CD1 1 
ATOM   3273 C CD2 . PHE B 1 91  ? -17.391 -70.226 -17.308 1.00 54.92  ? 83  PHE B CD2 1 
ATOM   3274 C CE1 . PHE B 1 91  ? -16.192 -69.844 -14.846 1.00 57.93  ? 83  PHE B CE1 1 
ATOM   3275 C CE2 . PHE B 1 91  ? -16.276 -69.396 -17.188 1.00 57.17  ? 83  PHE B CE2 1 
ATOM   3276 C CZ  . PHE B 1 91  ? -15.684 -69.207 -15.962 1.00 55.43  ? 83  PHE B CZ  1 
ATOM   3277 N N   . LEU B 1 92  ? -20.954 -71.332 -13.787 1.00 56.06  ? 84  LEU B N   1 
ATOM   3278 C CA  . LEU B 1 92  ? -21.106 -70.968 -12.389 1.00 57.17  ? 84  LEU B CA  1 
ATOM   3279 C C   . LEU B 1 92  ? -19.783 -70.824 -11.658 1.00 62.77  ? 84  LEU B C   1 
ATOM   3280 O O   . LEU B 1 92  ? -18.813 -71.517 -11.958 1.00 62.92  ? 84  LEU B O   1 
ATOM   3281 C CB  . LEU B 1 92  ? -22.019 -71.951 -11.644 1.00 57.58  ? 84  LEU B CB  1 
ATOM   3282 C CG  . LEU B 1 92  ? -23.509 -71.877 -11.972 1.00 62.43  ? 84  LEU B CG  1 
ATOM   3283 C CD1 . LEU B 1 92  ? -24.254 -73.014 -11.296 1.00 62.65  ? 84  LEU B CD1 1 
ATOM   3284 C CD2 . LEU B 1 92  ? -24.107 -70.526 -11.580 1.00 63.99  ? 84  LEU B CD2 1 
ATOM   3285 N N   . SER B 1 93  ? -19.763 -69.919 -10.684 1.00 60.35  ? 85  SER B N   1 
ATOM   3286 C CA  . SER B 1 93  ? -18.621 -69.626 -9.824  1.00 60.35  ? 85  SER B CA  1 
ATOM   3287 C C   . SER B 1 93  ? -19.147 -69.198 -8.465  1.00 64.08  ? 85  SER B C   1 
ATOM   3288 O O   . SER B 1 93  ? -20.263 -68.688 -8.374  1.00 64.38  ? 85  SER B O   1 
ATOM   3289 C CB  . SER B 1 93  ? -17.777 -68.502 -10.418 1.00 64.31  ? 85  SER B CB  1 
ATOM   3290 O OG  . SER B 1 93  ? -16.822 -69.015 -11.329 1.00 76.06  ? 85  SER B OG  1 
ATOM   3291 N N   . GLN B 1 94  ? -18.355 -69.402 -7.415  1.00 59.76  ? 86  GLN B N   1 
ATOM   3292 C CA  . GLN B 1 94  ? -18.724 -68.975 -6.072  1.00 59.52  ? 86  GLN B CA  1 
ATOM   3293 C C   . GLN B 1 94  ? -17.672 -68.019 -5.537  1.00 64.89  ? 86  GLN B C   1 
ATOM   3294 O O   . GLN B 1 94  ? -16.465 -68.221 -5.731  1.00 65.34  ? 86  GLN B O   1 
ATOM   3295 C CB  . GLN B 1 94  ? -18.932 -70.163 -5.114  1.00 60.52  ? 86  GLN B CB  1 
ATOM   3296 C CG  . GLN B 1 94  ? -19.644 -69.783 -3.811  1.00 69.76  ? 86  GLN B CG  1 
ATOM   3297 C CD  . GLN B 1 94  ? -19.532 -70.847 -2.749  1.00 80.83  ? 86  GLN B CD  1 
ATOM   3298 O OE1 . GLN B 1 94  ? -20.445 -71.662 -2.560  1.00 78.71  ? 86  GLN B OE1 1 
ATOM   3299 N NE2 . GLN B 1 94  ? -18.408 -70.863 -2.029  1.00 60.05  ? 86  GLN B NE2 1 
ATOM   3300 N N   . ASP B 1 95  ? -18.143 -66.955 -4.888  1.00 60.85  ? 87  ASP B N   1 
ATOM   3301 C CA  . ASP B 1 95  ? -17.298 -65.959 -4.264  1.00 60.17  ? 87  ASP B CA  1 
ATOM   3302 C C   . ASP B 1 95  ? -18.120 -65.128 -3.291  1.00 64.92  ? 87  ASP B C   1 
ATOM   3303 O O   . ASP B 1 95  ? -19.330 -65.334 -3.161  1.00 65.37  ? 87  ASP B O   1 
ATOM   3304 C CB  . ASP B 1 95  ? -16.582 -65.080 -5.310  1.00 61.38  ? 87  ASP B CB  1 
ATOM   3305 C CG  . ASP B 1 95  ? -15.179 -64.679 -4.901  1.00 65.65  ? 87  ASP B CG  1 
ATOM   3306 O OD1 . ASP B 1 95  ? -14.951 -64.454 -3.689  1.00 64.71  ? 87  ASP B OD1 1 
ATOM   3307 O OD2 . ASP B 1 95  ? -14.311 -64.571 -5.792  1.00 70.98  ? 87  ASP B OD2 1 
ATOM   3308 N N   . ILE B 1 96  ? -17.442 -64.222 -2.583  1.00 61.28  ? 88  ILE B N   1 
ATOM   3309 C CA  . ILE B 1 96  ? -17.977 -63.306 -1.595  1.00 61.14  ? 88  ILE B CA  1 
ATOM   3310 C C   . ILE B 1 96  ? -18.423 -62.022 -2.313  1.00 64.72  ? 88  ILE B C   1 
ATOM   3311 O O   . ILE B 1 96  ? -17.617 -61.363 -2.984  1.00 64.73  ? 88  ILE B O   1 
ATOM   3312 C CB  . ILE B 1 96  ? -16.873 -63.081 -0.518  1.00 64.72  ? 88  ILE B CB  1 
ATOM   3313 C CG1 . ILE B 1 96  ? -16.820 -64.269 0.466   1.00 65.57  ? 88  ILE B CG1 1 
ATOM   3314 C CG2 . ILE B 1 96  ? -17.007 -61.741 0.221   1.00 65.46  ? 88  ILE B CG2 1 
ATOM   3315 C CD1 . ILE B 1 96  ? -15.557 -64.340 1.358   1.00 75.81  ? 88  ILE B CD1 1 
ATOM   3316 N N   . ILE B 1 97  ? -19.718 -61.678 -2.176  1.00 59.88  ? 89  ILE B N   1 
ATOM   3317 C CA  . ILE B 1 97  ? -20.276 -60.462 -2.768  1.00 58.04  ? 89  ILE B CA  1 
ATOM   3318 C C   . ILE B 1 97  ? -20.575 -59.427 -1.677  1.00 58.07  ? 89  ILE B C   1 
ATOM   3319 O O   . ILE B 1 97  ? -21.138 -59.770 -0.646  1.00 57.03  ? 89  ILE B O   1 
ATOM   3320 C CB  . ILE B 1 97  ? -21.478 -60.751 -3.711  1.00 60.98  ? 89  ILE B CB  1 
ATOM   3321 C CG1 . ILE B 1 97  ? -21.042 -61.669 -4.887  1.00 61.38  ? 89  ILE B CG1 1 
ATOM   3322 C CG2 . ILE B 1 97  ? -22.102 -59.445 -4.225  1.00 61.59  ? 89  ILE B CG2 1 
ATOM   3323 C CD1 . ILE B 1 97  ? -22.103 -62.011 -5.945  1.00 66.90  ? 89  ILE B CD1 1 
ATOM   3324 N N   . THR B 1 98  ? -20.156 -58.175 -1.895  1.00 53.86  ? 90  THR B N   1 
ATOM   3325 C CA  . THR B 1 98  ? -20.412 -57.057 -0.984  1.00 52.99  ? 90  THR B CA  1 
ATOM   3326 C C   . THR B 1 98  ? -21.460 -56.149 -1.613  1.00 53.40  ? 90  THR B C   1 
ATOM   3327 O O   . THR B 1 98  ? -21.236 -55.606 -2.699  1.00 51.31  ? 90  THR B O   1 
ATOM   3328 C CB  . THR B 1 98  ? -19.136 -56.270 -0.651  1.00 63.91  ? 90  THR B CB  1 
ATOM   3329 O OG1 . THR B 1 98  ? -18.074 -57.179 -0.404  1.00 69.16  ? 90  THR B OG1 1 
ATOM   3330 C CG2 . THR B 1 98  ? -19.323 -55.340 0.552   1.00 60.86  ? 90  THR B CG2 1 
ATOM   3331 N N   . VAL B 1 99  ? -22.617 -56.015 -0.939  1.00 49.79  ? 91  VAL B N   1 
ATOM   3332 C CA  . VAL B 1 99  ? -23.734 -55.159 -1.358  1.00 49.04  ? 91  VAL B CA  1 
ATOM   3333 C C   . VAL B 1 99  ? -23.996 -54.183 -0.215  1.00 52.63  ? 91  VAL B C   1 
ATOM   3334 O O   . VAL B 1 99  ? -24.591 -54.576 0.795   1.00 53.19  ? 91  VAL B O   1 
ATOM   3335 C CB  . VAL B 1 99  ? -25.036 -55.929 -1.751  1.00 52.50  ? 91  VAL B CB  1 
ATOM   3336 C CG1 . VAL B 1 99  ? -25.835 -55.148 -2.790  1.00 52.20  ? 91  VAL B CG1 1 
ATOM   3337 C CG2 . VAL B 1 99  ? -24.756 -57.349 -2.234  1.00 52.33  ? 91  VAL B CG2 1 
ATOM   3338 N N   . GLY B 1 100 ? -23.495 -52.957 -0.365  1.00 47.95  ? 92  GLY B N   1 
ATOM   3339 C CA  . GLY B 1 100 ? -23.621 -51.860 0.593   1.00 48.10  ? 92  GLY B CA  1 
ATOM   3340 C C   . GLY B 1 100 ? -23.478 -52.209 2.064   1.00 55.26  ? 92  GLY B C   1 
ATOM   3341 O O   . GLY B 1 100 ? -24.365 -51.913 2.865   1.00 56.31  ? 92  GLY B O   1 
ATOM   3342 N N   . GLY B 1 101 ? -22.381 -52.839 2.437   1.00 53.46  ? 93  GLY B N   1 
ATOM   3343 C CA  . GLY B 1 101 ? -22.174 -53.198 3.839   1.00 54.49  ? 93  GLY B CA  1 
ATOM   3344 C C   . GLY B 1 101 ? -22.479 -54.643 4.185   1.00 60.59  ? 93  GLY B C   1 
ATOM   3345 O O   . GLY B 1 101 ? -21.937 -55.169 5.163   1.00 60.68  ? 93  GLY B O   1 
ATOM   3346 N N   . ILE B 1 102 ? -23.365 -55.291 3.418   1.00 57.91  ? 94  ILE B N   1 
ATOM   3347 C CA  . ILE B 1 102 ? -23.660 -56.699 3.651   1.00 58.56  ? 94  ILE B CA  1 
ATOM   3348 C C   . ILE B 1 102 ? -22.676 -57.514 2.813   1.00 63.96  ? 94  ILE B C   1 
ATOM   3349 O O   . ILE B 1 102 ? -22.470 -57.219 1.633   1.00 63.33  ? 94  ILE B O   1 
ATOM   3350 C CB  . ILE B 1 102 ? -25.149 -57.070 3.378   1.00 61.93  ? 94  ILE B CB  1 
ATOM   3351 C CG1 . ILE B 1 102 ? -26.068 -56.343 4.359   1.00 62.79  ? 94  ILE B CG1 1 
ATOM   3352 C CG2 . ILE B 1 102 ? -25.390 -58.600 3.423   1.00 62.93  ? 94  ILE B CG2 1 
ATOM   3353 C CD1 . ILE B 1 102 ? -27.542 -56.385 3.969   1.00 72.65  ? 94  ILE B CD1 1 
ATOM   3354 N N   . THR B 1 103 ? -22.053 -58.522 3.439   1.00 61.14  ? 95  THR B N   1 
ATOM   3355 C CA  . THR B 1 103 ? -21.120 -59.442 2.789   1.00 60.80  ? 95  THR B CA  1 
ATOM   3356 C C   . THR B 1 103 ? -21.823 -60.807 2.700   1.00 63.28  ? 95  THR B C   1 
ATOM   3357 O O   . THR B 1 103 ? -22.400 -61.269 3.690   1.00 62.78  ? 95  THR B O   1 
ATOM   3358 C CB  . THR B 1 103 ? -19.729 -59.362 3.462   1.00 72.04  ? 95  THR B CB  1 
ATOM   3359 O OG1 . THR B 1 103 ? -18.702 -59.668 2.523   1.00 76.34  ? 95  THR B OG1 1 
ATOM   3360 C CG2 . THR B 1 103 ? -19.596 -60.172 4.760   1.00 70.56  ? 95  THR B CG2 1 
ATOM   3361 N N   . VAL B 1 104 ? -21.844 -61.407 1.507   1.00 59.24  ? 96  VAL B N   1 
ATOM   3362 C CA  . VAL B 1 104 ? -22.572 -62.660 1.295   1.00 58.96  ? 96  VAL B CA  1 
ATOM   3363 C C   . VAL B 1 104 ? -21.857 -63.634 0.342   1.00 61.80  ? 96  VAL B C   1 
ATOM   3364 O O   . VAL B 1 104 ? -21.386 -63.213 -0.723  1.00 60.20  ? 96  VAL B O   1 
ATOM   3365 C CB  . VAL B 1 104 ? -24.052 -62.344 0.881   1.00 63.30  ? 96  VAL B CB  1 
ATOM   3366 C CG1 . VAL B 1 104 ? -24.135 -61.463 -0.374  1.00 62.76  ? 96  VAL B CG1 1 
ATOM   3367 C CG2 . VAL B 1 104 ? -24.889 -63.608 0.723   1.00 63.34  ? 96  VAL B CG2 1 
ATOM   3368 N N   . THR B 1 105 ? -21.795 -64.938 0.720   1.00 59.06  ? 97  THR B N   1 
ATOM   3369 C CA  . THR B 1 105 ? -21.169 -65.980 -0.106  1.00 59.56  ? 97  THR B CA  1 
ATOM   3370 C C   . THR B 1 105 ? -22.222 -66.330 -1.139  1.00 64.00  ? 97  THR B C   1 
ATOM   3371 O O   . THR B 1 105 ? -23.314 -66.791 -0.773  1.00 64.17  ? 97  THR B O   1 
ATOM   3372 C CB  . THR B 1 105 ? -20.682 -67.165 0.751   1.00 70.90  ? 97  THR B CB  1 
ATOM   3373 O OG1 . THR B 1 105 ? -19.765 -66.674 1.734   1.00 76.89  ? 97  THR B OG1 1 
ATOM   3374 C CG2 . THR B 1 105 ? -20.012 -68.259 -0.077  1.00 64.93  ? 97  THR B CG2 1 
ATOM   3375 N N   . GLN B 1 106 ? -21.926 -66.028 -2.419  1.00 59.15  ? 99  GLN B N   1 
ATOM   3376 C CA  . GLN B 1 106 ? -22.891 -66.177 -3.497  1.00 58.34  ? 99  GLN B CA  1 
ATOM   3377 C C   . GLN B 1 106 ? -22.386 -66.925 -4.716  1.00 65.02  ? 99  GLN B C   1 
ATOM   3378 O O   . GLN B 1 106 ? -21.227 -66.781 -5.119  1.00 64.36  ? 99  GLN B O   1 
ATOM   3379 C CB  . GLN B 1 106 ? -23.401 -64.774 -3.896  1.00 58.42  ? 99  GLN B CB  1 
ATOM   3380 C CG  . GLN B 1 106 ? -24.533 -64.704 -4.935  1.00 44.37  ? 99  GLN B CG  1 
ATOM   3381 C CD  . GLN B 1 106 ? -25.846 -65.339 -4.512  1.00 51.37  ? 99  GLN B CD  1 
ATOM   3382 O OE1 . GLN B 1 106 ? -26.550 -65.970 -5.307  1.00 46.44  ? 99  GLN B OE1 1 
ATOM   3383 N NE2 . GLN B 1 106 ? -26.208 -65.213 -3.257  1.00 34.10  ? 99  GLN B NE2 1 
ATOM   3384 N N   . MET B 1 107 ? -23.299 -67.707 -5.313  1.00 63.80  ? 100 MET B N   1 
ATOM   3385 C CA  . MET B 1 107 ? -23.104 -68.430 -6.558  1.00 64.68  ? 100 MET B CA  1 
ATOM   3386 C C   . MET B 1 107 ? -23.600 -67.497 -7.658  1.00 65.78  ? 100 MET B C   1 
ATOM   3387 O O   . MET B 1 107 ? -24.740 -67.027 -7.618  1.00 65.50  ? 100 MET B O   1 
ATOM   3388 C CB  . MET B 1 107 ? -23.904 -69.735 -6.561  1.00 68.36  ? 100 MET B CB  1 
ATOM   3389 C CG  . MET B 1 107 ? -23.159 -70.899 -5.996  1.00 74.52  ? 100 MET B CG  1 
ATOM   3390 S SD  . MET B 1 107 ? -22.243 -71.749 -7.291  1.00 81.69  ? 100 MET B SD  1 
ATOM   3391 C CE  . MET B 1 107 ? -21.979 -73.318 -6.491  1.00 78.99  ? 100 MET B CE  1 
ATOM   3392 N N   . PHE B 1 108 ? -22.722 -67.183 -8.603  1.00 60.62  ? 101 PHE B N   1 
ATOM   3393 C CA  . PHE B 1 108 ? -23.019 -66.283 -9.710  1.00 59.39  ? 101 PHE B CA  1 
ATOM   3394 C C   . PHE B 1 108 ? -22.475 -66.817 -11.041 1.00 64.94  ? 101 PHE B C   1 
ATOM   3395 O O   . PHE B 1 108 ? -21.614 -67.703 -11.058 1.00 65.16  ? 101 PHE B O   1 
ATOM   3396 C CB  . PHE B 1 108 ? -22.466 -64.874 -9.406  1.00 60.30  ? 101 PHE B CB  1 
ATOM   3397 C CG  . PHE B 1 108 ? -20.963 -64.791 -9.341  1.00 60.73  ? 101 PHE B CG  1 
ATOM   3398 C CD1 . PHE B 1 108 ? -20.281 -65.141 -8.184  1.00 63.24  ? 101 PHE B CD1 1 
ATOM   3399 C CD2 . PHE B 1 108 ? -20.227 -64.363 -10.438 1.00 61.94  ? 101 PHE B CD2 1 
ATOM   3400 C CE1 . PHE B 1 108 ? -18.889 -65.094 -8.136  1.00 63.71  ? 101 PHE B CE1 1 
ATOM   3401 C CE2 . PHE B 1 108 ? -18.834 -64.317 -10.388 1.00 64.17  ? 101 PHE B CE2 1 
ATOM   3402 C CZ  . PHE B 1 108 ? -18.175 -64.682 -9.236  1.00 62.04  ? 101 PHE B CZ  1 
ATOM   3403 N N   . GLY B 1 109 ? -22.979 -66.266 -12.137 1.00 61.05  ? 102 GLY B N   1 
ATOM   3404 C CA  . GLY B 1 109 ? -22.545 -66.628 -13.477 1.00 60.14  ? 102 GLY B CA  1 
ATOM   3405 C C   . GLY B 1 109 ? -21.384 -65.780 -13.956 1.00 63.02  ? 102 GLY B C   1 
ATOM   3406 O O   . GLY B 1 109 ? -21.384 -64.558 -13.790 1.00 61.89  ? 102 GLY B O   1 
ATOM   3407 N N   . GLU B 1 110 ? -20.364 -66.432 -14.527 1.00 59.26  ? 103 GLU B N   1 
ATOM   3408 C CA  . GLU B 1 110 ? -19.221 -65.756 -15.131 1.00 57.84  ? 103 GLU B CA  1 
ATOM   3409 C C   . GLU B 1 110 ? -19.545 -65.800 -16.614 1.00 59.91  ? 103 GLU B C   1 
ATOM   3410 O O   . GLU B 1 110 ? -19.487 -66.870 -17.203 1.00 59.42  ? 103 GLU B O   1 
ATOM   3411 C CB  . GLU B 1 110 ? -17.926 -66.506 -14.813 1.00 58.90  ? 103 GLU B CB  1 
ATOM   3412 C CG  . GLU B 1 110 ? -17.011 -65.749 -13.878 1.00 63.31  ? 103 GLU B CG  1 
ATOM   3413 C CD  . GLU B 1 110 ? -15.687 -66.436 -13.620 1.00 72.62  ? 103 GLU B CD  1 
ATOM   3414 O OE1 . GLU B 1 110 ? -14.685 -66.085 -14.287 1.00 73.15  ? 103 GLU B OE1 1 
ATOM   3415 O OE2 . GLU B 1 110 ? -15.656 -67.336 -12.751 1.00 54.78  ? 103 GLU B OE2 1 
ATOM   3416 N N   . VAL B 1 111 ? -20.016 -64.685 -17.184 1.00 56.03  ? 104 VAL B N   1 
ATOM   3417 C CA  . VAL B 1 111 ? -20.445 -64.628 -18.587 1.00 55.87  ? 104 VAL B CA  1 
ATOM   3418 C C   . VAL B 1 111 ? -19.281 -64.645 -19.586 1.00 60.94  ? 104 VAL B C   1 
ATOM   3419 O O   . VAL B 1 111 ? -18.386 -63.806 -19.505 1.00 60.57  ? 104 VAL B O   1 
ATOM   3420 C CB  . VAL B 1 111 ? -21.516 -63.526 -18.833 1.00 58.87  ? 104 VAL B CB  1 
ATOM   3421 C CG1 . VAL B 1 111 ? -21.686 -63.192 -20.312 1.00 58.50  ? 104 VAL B CG1 1 
ATOM   3422 C CG2 . VAL B 1 111 ? -22.853 -63.942 -18.230 1.00 58.54  ? 104 VAL B CG2 1 
ATOM   3423 N N   . THR B 1 112 ? -19.299 -65.623 -20.509 1.00 58.62  ? 105 THR B N   1 
ATOM   3424 C CA  . THR B 1 112 ? -18.273 -65.791 -21.543 1.00 59.33  ? 105 THR B CA  1 
ATOM   3425 C C   . THR B 1 112 ? -18.794 -65.488 -22.952 1.00 66.00  ? 105 THR B C   1 
ATOM   3426 O O   . THR B 1 112 ? -17.992 -65.330 -23.877 1.00 67.34  ? 105 THR B O   1 
ATOM   3427 C CB  . THR B 1 112 ? -17.604 -67.167 -21.447 1.00 66.34  ? 105 THR B CB  1 
ATOM   3428 O OG1 . THR B 1 112 ? -18.592 -68.173 -21.662 1.00 65.05  ? 105 THR B OG1 1 
ATOM   3429 C CG2 . THR B 1 112 ? -16.907 -67.395 -20.106 1.00 64.91  ? 105 THR B CG2 1 
ATOM   3430 N N   . GLU B 1 113 ? -20.125 -65.429 -23.120 1.00 62.85  ? 106 GLU B N   1 
ATOM   3431 C CA  . GLU B 1 113 ? -20.767 -65.131 -24.400 1.00 63.72  ? 106 GLU B CA  1 
ATOM   3432 C C   . GLU B 1 113 ? -21.792 -64.063 -24.124 1.00 67.02  ? 106 GLU B C   1 
ATOM   3433 O O   . GLU B 1 113 ? -22.745 -64.288 -23.378 1.00 66.99  ? 106 GLU B O   1 
ATOM   3434 C CB  . GLU B 1 113 ? -21.387 -66.388 -25.042 1.00 65.72  ? 106 GLU B CB  1 
ATOM   3435 C CG  . GLU B 1 113 ? -20.338 -67.363 -25.558 1.00 82.06  ? 106 GLU B CG  1 
ATOM   3436 C CD  . GLU B 1 113 ? -20.814 -68.760 -25.907 1.00 109.39 ? 106 GLU B CD  1 
ATOM   3437 O OE1 . GLU B 1 113 ? -21.689 -69.297 -25.191 1.00 105.09 ? 106 GLU B OE1 1 
ATOM   3438 O OE2 . GLU B 1 113 ? -20.259 -69.342 -26.866 1.00 104.05 ? 106 GLU B OE2 1 
ATOM   3439 N N   . MET B 1 114 ? -21.544 -62.874 -24.674 1.00 62.56  ? 107 MET B N   1 
ATOM   3440 C CA  . MET B 1 114 ? -22.316 -61.665 -24.433 1.00 61.62  ? 107 MET B CA  1 
ATOM   3441 C C   . MET B 1 114 ? -22.522 -60.873 -25.755 1.00 65.35  ? 107 MET B C   1 
ATOM   3442 O O   . MET B 1 114 ? -21.605 -60.164 -26.182 1.00 65.84  ? 107 MET B O   1 
ATOM   3443 C CB  . MET B 1 114 ? -21.537 -60.841 -23.387 1.00 63.44  ? 107 MET B CB  1 
ATOM   3444 C CG  . MET B 1 114 ? -22.310 -59.760 -22.713 1.00 66.40  ? 107 MET B CG  1 
ATOM   3445 S SD  . MET B 1 114 ? -21.172 -58.992 -21.536 1.00 69.69  ? 107 MET B SD  1 
ATOM   3446 C CE  . MET B 1 114 ? -22.089 -57.590 -21.074 1.00 66.73  ? 107 MET B CE  1 
ATOM   3447 N N   . PRO B 1 115 ? -23.710 -60.979 -26.413 1.00 60.38  ? 108 PRO B N   1 
ATOM   3448 C CA  . PRO B 1 115 ? -23.931 -60.250 -27.676 1.00 59.44  ? 108 PRO B CA  1 
ATOM   3449 C C   . PRO B 1 115 ? -23.972 -58.736 -27.551 1.00 63.05  ? 108 PRO B C   1 
ATOM   3450 O O   . PRO B 1 115 ? -24.440 -58.204 -26.545 1.00 63.58  ? 108 PRO B O   1 
ATOM   3451 C CB  . PRO B 1 115 ? -25.277 -60.786 -28.176 1.00 61.06  ? 108 PRO B CB  1 
ATOM   3452 C CG  . PRO B 1 115 ? -25.946 -61.307 -26.994 1.00 65.69  ? 108 PRO B CG  1 
ATOM   3453 C CD  . PRO B 1 115 ? -24.886 -61.794 -26.061 1.00 61.76  ? 108 PRO B CD  1 
ATOM   3454 N N   . ALA B 1 116 ? -23.488 -58.054 -28.600 1.00 58.95  ? 109 ALA B N   1 
ATOM   3455 C CA  . ALA B 1 116 ? -23.438 -56.598 -28.733 1.00 58.68  ? 109 ALA B CA  1 
ATOM   3456 C C   . ALA B 1 116 ? -24.838 -56.001 -28.622 1.00 61.41  ? 109 ALA B C   1 
ATOM   3457 O O   . ALA B 1 116 ? -25.008 -54.901 -28.101 1.00 60.01  ? 109 ALA B O   1 
ATOM   3458 C CB  . ALA B 1 116 ? -22.812 -56.208 -30.069 1.00 59.27  ? 109 ALA B CB  1 
ATOM   3459 N N   . LEU B 1 117 ? -25.830 -56.735 -29.109 1.00 58.10  ? 110 LEU B N   1 
ATOM   3460 C CA  . LEU B 1 117 ? -27.224 -56.350 -28.995 1.00 57.92  ? 110 LEU B CA  1 
ATOM   3461 C C   . LEU B 1 117 ? -27.877 -57.296 -28.023 1.00 59.83  ? 110 LEU B C   1 
ATOM   3462 O O   . LEU B 1 117 ? -27.916 -58.495 -28.283 1.00 58.28  ? 110 LEU B O   1 
ATOM   3463 C CB  . LEU B 1 117 ? -27.933 -56.368 -30.345 1.00 58.34  ? 110 LEU B CB  1 
ATOM   3464 C CG  . LEU B 1 117 ? -27.725 -55.103 -31.123 1.00 64.36  ? 110 LEU B CG  1 
ATOM   3465 C CD1 . LEU B 1 117 ? -27.448 -55.397 -32.614 1.00 65.80  ? 110 LEU B CD1 1 
ATOM   3466 C CD2 . LEU B 1 117 ? -28.868 -54.113 -30.875 1.00 65.16  ? 110 LEU B CD2 1 
ATOM   3467 N N   . PRO B 1 118 ? -28.258 -56.815 -26.826 1.00 57.26  ? 111 PRO B N   1 
ATOM   3468 C CA  . PRO B 1 118 ? -28.296 -55.414 -26.374 1.00 57.10  ? 111 PRO B CA  1 
ATOM   3469 C C   . PRO B 1 118 ? -27.158 -54.933 -25.465 1.00 60.40  ? 111 PRO B C   1 
ATOM   3470 O O   . PRO B 1 118 ? -27.148 -53.761 -25.091 1.00 60.33  ? 111 PRO B O   1 
ATOM   3471 C CB  . PRO B 1 118 ? -29.603 -55.385 -25.589 1.00 59.03  ? 111 PRO B CB  1 
ATOM   3472 C CG  . PRO B 1 118 ? -29.649 -56.746 -24.926 1.00 63.35  ? 111 PRO B CG  1 
ATOM   3473 C CD  . PRO B 1 118 ? -28.922 -57.701 -25.852 1.00 58.78  ? 111 PRO B CD  1 
ATOM   3474 N N   . PHE B 1 119 ? -26.232 -55.821 -25.080 1.00 56.39  ? 112 PHE B N   1 
ATOM   3475 C CA  . PHE B 1 119 ? -25.212 -55.533 -24.069 1.00 56.09  ? 112 PHE B CA  1 
ATOM   3476 C C   . PHE B 1 119 ? -24.208 -54.417 -24.299 1.00 58.17  ? 112 PHE B C   1 
ATOM   3477 O O   . PHE B 1 119 ? -23.686 -53.862 -23.336 1.00 55.75  ? 112 PHE B O   1 
ATOM   3478 C CB  . PHE B 1 119 ? -24.619 -56.806 -23.472 1.00 58.10  ? 112 PHE B CB  1 
ATOM   3479 C CG  . PHE B 1 119 ? -25.717 -57.657 -22.877 1.00 60.36  ? 112 PHE B CG  1 
ATOM   3480 C CD1 . PHE B 1 119 ? -26.309 -57.312 -21.666 1.00 63.62  ? 112 PHE B CD1 1 
ATOM   3481 C CD2 . PHE B 1 119 ? -26.216 -58.763 -23.566 1.00 63.58  ? 112 PHE B CD2 1 
ATOM   3482 C CE1 . PHE B 1 119 ? -27.358 -58.081 -21.137 1.00 64.89  ? 112 PHE B CE1 1 
ATOM   3483 C CE2 . PHE B 1 119 ? -27.281 -59.523 -23.048 1.00 66.64  ? 112 PHE B CE2 1 
ATOM   3484 C CZ  . PHE B 1 119 ? -27.845 -59.177 -21.841 1.00 64.50  ? 112 PHE B CZ  1 
ATOM   3485 N N   . MET B 1 120 ? -24.031 -54.003 -25.546 1.00 55.94  ? 113 MET B N   1 
ATOM   3486 C CA  . MET B 1 120 ? -23.171 -52.869 -25.851 1.00 56.59  ? 113 MET B CA  1 
ATOM   3487 C C   . MET B 1 120 ? -23.874 -51.550 -25.511 1.00 58.09  ? 113 MET B C   1 
ATOM   3488 O O   . MET B 1 120 ? -23.207 -50.527 -25.334 1.00 58.05  ? 113 MET B O   1 
ATOM   3489 C CB  . MET B 1 120 ? -22.741 -52.893 -27.310 1.00 59.58  ? 113 MET B CB  1 
ATOM   3490 C CG  . MET B 1 120 ? -21.484 -53.687 -27.521 1.00 64.20  ? 113 MET B CG  1 
ATOM   3491 S SD  . MET B 1 120 ? -20.024 -52.668 -27.203 1.00 69.41  ? 113 MET B SD  1 
ATOM   3492 C CE  . MET B 1 120 ? -19.975 -51.691 -28.704 1.00 66.56  ? 113 MET B CE  1 
ATOM   3493 N N   . LEU B 1 121 ? -25.215 -51.588 -25.380 1.00 51.63  ? 114 LEU B N   1 
ATOM   3494 C CA  . LEU B 1 121 ? -26.029 -50.439 -25.003 1.00 49.84  ? 114 LEU B CA  1 
ATOM   3495 C C   . LEU B 1 121 ? -26.036 -50.247 -23.494 1.00 52.23  ? 114 LEU B C   1 
ATOM   3496 O O   . LEU B 1 121 ? -26.360 -49.160 -23.031 1.00 51.77  ? 114 LEU B O   1 
ATOM   3497 C CB  . LEU B 1 121 ? -27.471 -50.600 -25.518 1.00 49.22  ? 114 LEU B CB  1 
ATOM   3498 C CG  . LEU B 1 121 ? -27.650 -50.782 -27.020 1.00 52.96  ? 114 LEU B CG  1 
ATOM   3499 C CD1 . LEU B 1 121 ? -29.113 -50.757 -27.393 1.00 51.95  ? 114 LEU B CD1 1 
ATOM   3500 C CD2 . LEU B 1 121 ? -26.949 -49.724 -27.781 1.00 57.01  ? 114 LEU B CD2 1 
ATOM   3501 N N   . ALA B 1 122 ? -25.659 -51.300 -22.740 1.00 47.25  ? 115 ALA B N   1 
ATOM   3502 C CA  . ALA B 1 122 ? -25.634 -51.322 -21.296 1.00 45.86  ? 115 ALA B CA  1 
ATOM   3503 C C   . ALA B 1 122 ? -24.479 -50.535 -20.728 1.00 49.92  ? 115 ALA B C   1 
ATOM   3504 O O   . ALA B 1 122 ? -23.337 -50.740 -21.124 1.00 51.18  ? 115 ALA B O   1 
ATOM   3505 C CB  . ALA B 1 122 ? -25.561 -52.764 -20.814 1.00 46.15  ? 115 ALA B CB  1 
ATOM   3506 N N   . GLU B 1 123 ? -24.773 -49.651 -19.784 1.00 45.49  ? 116 GLU B N   1 
ATOM   3507 C CA  . GLU B 1 123 ? -23.758 -48.915 -19.039 1.00 45.36  ? 116 GLU B CA  1 
ATOM   3508 C C   . GLU B 1 123 ? -23.317 -49.804 -17.870 1.00 49.58  ? 116 GLU B C   1 
ATOM   3509 O O   . GLU B 1 123 ? -22.179 -49.725 -17.414 1.00 49.61  ? 116 GLU B O   1 
ATOM   3510 C CB  . GLU B 1 123 ? -24.295 -47.572 -18.538 1.00 46.81  ? 116 GLU B CB  1 
ATOM   3511 C CG  . GLU B 1 123 ? -24.085 -46.445 -19.530 1.00 55.36  ? 116 GLU B CG  1 
ATOM   3512 C CD  . GLU B 1 123 ? -22.623 -46.149 -19.804 1.00 89.58  ? 116 GLU B CD  1 
ATOM   3513 O OE1 . GLU B 1 123 ? -21.842 -46.040 -18.829 1.00 100.40 ? 116 GLU B OE1 1 
ATOM   3514 O OE2 . GLU B 1 123 ? -22.245 -46.099 -20.996 1.00 84.66  ? 116 GLU B OE2 1 
ATOM   3515 N N   . PHE B 1 124 ? -24.218 -50.685 -17.421 1.00 45.62  ? 117 PHE B N   1 
ATOM   3516 C CA  . PHE B 1 124 ? -23.964 -51.656 -16.372 1.00 44.44  ? 117 PHE B CA  1 
ATOM   3517 C C   . PHE B 1 124 ? -23.140 -52.817 -16.954 1.00 48.08  ? 117 PHE B C   1 
ATOM   3518 O O   . PHE B 1 124 ? -23.226 -53.101 -18.153 1.00 47.13  ? 117 PHE B O   1 
ATOM   3519 C CB  . PHE B 1 124 ? -25.295 -52.165 -15.774 1.00 45.47  ? 117 PHE B CB  1 
ATOM   3520 C CG  . PHE B 1 124 ? -26.254 -52.790 -16.763 1.00 45.85  ? 117 PHE B CG  1 
ATOM   3521 C CD1 . PHE B 1 124 ? -27.192 -52.010 -17.439 1.00 47.05  ? 117 PHE B CD1 1 
ATOM   3522 C CD2 . PHE B 1 124 ? -26.239 -54.165 -17.000 1.00 47.17  ? 117 PHE B CD2 1 
ATOM   3523 C CE1 . PHE B 1 124 ? -28.113 -52.599 -18.311 1.00 47.66  ? 117 PHE B CE1 1 
ATOM   3524 C CE2 . PHE B 1 124 ? -27.130 -54.746 -17.908 1.00 49.28  ? 117 PHE B CE2 1 
ATOM   3525 C CZ  . PHE B 1 124 ? -28.067 -53.960 -18.549 1.00 47.22  ? 117 PHE B CZ  1 
ATOM   3526 N N   . ASP B 1 125 ? -22.357 -53.490 -16.095 1.00 44.21  ? 118 ASP B N   1 
ATOM   3527 C CA  . ASP B 1 125 ? -21.525 -54.633 -16.463 1.00 43.13  ? 118 ASP B CA  1 
ATOM   3528 C C   . ASP B 1 125 ? -22.307 -55.917 -16.283 1.00 48.09  ? 118 ASP B C   1 
ATOM   3529 O O   . ASP B 1 125 ? -22.276 -56.789 -17.152 1.00 49.32  ? 118 ASP B O   1 
ATOM   3530 C CB  . ASP B 1 125 ? -20.249 -54.680 -15.607 1.00 43.69  ? 118 ASP B CB  1 
ATOM   3531 C CG  . ASP B 1 125 ? -19.434 -53.411 -15.640 1.00 45.60  ? 118 ASP B CG  1 
ATOM   3532 O OD1 . ASP B 1 125 ? -19.077 -52.967 -16.748 1.00 47.39  ? 118 ASP B OD1 1 
ATOM   3533 O OD2 . ASP B 1 125 ? -19.160 -52.851 -14.552 1.00 47.63  ? 118 ASP B OD2 1 
ATOM   3534 N N   . GLY B 1 126 ? -22.996 -56.029 -15.159 1.00 43.92  ? 119 GLY B N   1 
ATOM   3535 C CA  . GLY B 1 126 ? -23.773 -57.217 -14.851 1.00 43.52  ? 119 GLY B CA  1 
ATOM   3536 C C   . GLY B 1 126 ? -25.162 -56.953 -14.322 1.00 47.93  ? 119 GLY B C   1 
ATOM   3537 O O   . GLY B 1 126 ? -25.649 -55.817 -14.337 1.00 46.88  ? 119 GLY B O   1 
ATOM   3538 N N   . VAL B 1 127 ? -25.799 -58.031 -13.848 1.00 44.97  ? 120 VAL B N   1 
ATOM   3539 C CA  . VAL B 1 127 ? -27.155 -58.062 -13.333 1.00 44.36  ? 120 VAL B CA  1 
ATOM   3540 C C   . VAL B 1 127 ? -27.187 -58.761 -11.970 1.00 49.25  ? 120 VAL B C   1 
ATOM   3541 O O   . VAL B 1 127 ? -26.465 -59.733 -11.747 1.00 49.03  ? 120 VAL B O   1 
ATOM   3542 C CB  . VAL B 1 127 ? -28.067 -58.758 -14.378 1.00 48.16  ? 120 VAL B CB  1 
ATOM   3543 C CG1 . VAL B 1 127 ? -29.449 -59.101 -13.812 1.00 48.18  ? 120 VAL B CG1 1 
ATOM   3544 C CG2 . VAL B 1 127 ? -28.204 -57.904 -15.635 1.00 47.94  ? 120 VAL B CG2 1 
ATOM   3545 N N   . VAL B 1 128 ? -28.012 -58.236 -11.055 1.00 45.85  ? 121 VAL B N   1 
ATOM   3546 C CA  . VAL B 1 128 ? -28.270 -58.825 -9.750  1.00 45.39  ? 121 VAL B CA  1 
ATOM   3547 C C   . VAL B 1 128 ? -29.776 -59.110 -9.760  1.00 49.96  ? 121 VAL B C   1 
ATOM   3548 O O   . VAL B 1 128 ? -30.592 -58.182 -9.712  1.00 50.06  ? 121 VAL B O   1 
ATOM   3549 C CB  . VAL B 1 128 ? -27.805 -57.962 -8.535  1.00 48.17  ? 121 VAL B CB  1 
ATOM   3550 C CG1 . VAL B 1 128 ? -28.358 -58.506 -7.223  1.00 47.88  ? 121 VAL B CG1 1 
ATOM   3551 C CG2 . VAL B 1 128 ? -26.288 -57.878 -8.464  1.00 47.43  ? 121 VAL B CG2 1 
ATOM   3552 N N   . GLY B 1 129 ? -30.108 -60.390 -9.896  1.00 45.56  ? 122 GLY B N   1 
ATOM   3553 C CA  . GLY B 1 129 ? -31.479 -60.875 -9.906  1.00 44.56  ? 122 GLY B CA  1 
ATOM   3554 C C   . GLY B 1 129 ? -32.109 -60.773 -8.535  1.00 45.88  ? 122 GLY B C   1 
ATOM   3555 O O   . GLY B 1 129 ? -31.539 -61.244 -7.543  1.00 44.42  ? 122 GLY B O   1 
ATOM   3556 N N   . MET B 1 130 ? -33.269 -60.110 -8.475  1.00 41.75  ? 123 MET B N   1 
ATOM   3557 C CA  . MET B 1 130 ? -34.028 -59.866 -7.244  1.00 40.57  ? 123 MET B CA  1 
ATOM   3558 C C   . MET B 1 130 ? -35.314 -60.668 -7.243  1.00 45.67  ? 123 MET B C   1 
ATOM   3559 O O   . MET B 1 130 ? -36.201 -60.408 -6.431  1.00 46.43  ? 123 MET B O   1 
ATOM   3560 C CB  . MET B 1 130 ? -34.334 -58.360 -7.077  1.00 42.37  ? 123 MET B CB  1 
ATOM   3561 C CG  . MET B 1 130 ? -33.115 -57.467 -6.982  1.00 45.44  ? 123 MET B CG  1 
ATOM   3562 S SD  . MET B 1 130 ? -32.028 -57.877 -5.609  1.00 50.47  ? 123 MET B SD  1 
ATOM   3563 C CE  . MET B 1 130 ? -32.841 -57.092 -4.274  1.00 47.08  ? 123 MET B CE  1 
ATOM   3564 N N   . GLY B 1 131 ? -35.406 -61.632 -8.156  1.00 42.64  ? 124 GLY B N   1 
ATOM   3565 C CA  . GLY B 1 131 ? -36.545 -62.529 -8.279  1.00 42.44  ? 124 GLY B CA  1 
ATOM   3566 C C   . GLY B 1 131 ? -36.476 -63.702 -7.320  1.00 46.91  ? 124 GLY B C   1 
ATOM   3567 O O   . GLY B 1 131 ? -35.640 -63.742 -6.407  1.00 45.45  ? 124 GLY B O   1 
ATOM   3568 N N   . PHE B 1 132 ? -37.369 -64.666 -7.526  1.00 45.85  ? 125 PHE B N   1 
ATOM   3569 C CA  . PHE B 1 132 ? -37.480 -65.842 -6.661  1.00 46.49  ? 125 PHE B CA  1 
ATOM   3570 C C   . PHE B 1 132 ? -36.682 -67.025 -7.202  1.00 54.38  ? 125 PHE B C   1 
ATOM   3571 O O   . PHE B 1 132 ? -36.451 -67.098 -8.411  1.00 55.01  ? 125 PHE B O   1 
ATOM   3572 C CB  . PHE B 1 132 ? -38.958 -66.233 -6.526  1.00 47.46  ? 125 PHE B CB  1 
ATOM   3573 C CG  . PHE B 1 132 ? -39.857 -65.216 -5.861  1.00 48.25  ? 125 PHE B CG  1 
ATOM   3574 C CD1 . PHE B 1 132 ? -40.332 -64.114 -6.567  1.00 50.64  ? 125 PHE B CD1 1 
ATOM   3575 C CD2 . PHE B 1 132 ? -40.271 -65.387 -4.546  1.00 49.43  ? 125 PHE B CD2 1 
ATOM   3576 C CE1 . PHE B 1 132 ? -41.180 -63.190 -5.961  1.00 51.32  ? 125 PHE B CE1 1 
ATOM   3577 C CE2 . PHE B 1 132 ? -41.126 -64.471 -3.944  1.00 52.36  ? 125 PHE B CE2 1 
ATOM   3578 C CZ  . PHE B 1 132 ? -41.567 -63.370 -4.653  1.00 50.45  ? 125 PHE B CZ  1 
ATOM   3579 N N   . ILE B 1 133 ? -36.313 -67.980 -6.317  1.00 52.18  ? 126 ILE B N   1 
ATOM   3580 C CA  . ILE B 1 133 ? -35.607 -69.211 -6.699  1.00 52.80  ? 126 ILE B CA  1 
ATOM   3581 C C   . ILE B 1 133 ? -36.367 -70.019 -7.778  1.00 57.36  ? 126 ILE B C   1 
ATOM   3582 O O   . ILE B 1 133 ? -35.735 -70.717 -8.561  1.00 57.72  ? 126 ILE B O   1 
ATOM   3583 C CB  . ILE B 1 133 ? -35.197 -70.056 -5.461  1.00 56.26  ? 126 ILE B CB  1 
ATOM   3584 C CG1 . ILE B 1 133 ? -34.099 -71.100 -5.828  1.00 57.07  ? 126 ILE B CG1 1 
ATOM   3585 C CG2 . ILE B 1 133 ? -36.424 -70.661 -4.738  1.00 56.20  ? 126 ILE B CG2 1 
ATOM   3586 C CD1 . ILE B 1 133 ? -33.335 -71.741 -4.657  1.00 62.99  ? 126 ILE B CD1 1 
ATOM   3587 N N   . GLU B 1 134 ? -37.708 -69.857 -7.857  1.00 53.75  ? 127 GLU B N   1 
ATOM   3588 C CA  . GLU B 1 134 ? -38.580 -70.511 -8.831  1.00 53.48  ? 127 GLU B CA  1 
ATOM   3589 C C   . GLU B 1 134 ? -38.230 -70.119 -10.265 1.00 59.96  ? 127 GLU B C   1 
ATOM   3590 O O   . GLU B 1 134 ? -38.482 -70.893 -11.180 1.00 60.61  ? 127 GLU B O   1 
ATOM   3591 C CB  . GLU B 1 134 ? -40.062 -70.187 -8.536  1.00 54.54  ? 127 GLU B CB  1 
ATOM   3592 C CG  . GLU B 1 134 ? -40.628 -70.857 -7.291  1.00 60.58  ? 127 GLU B CG  1 
ATOM   3593 C CD  . GLU B 1 134 ? -40.411 -70.194 -5.942  1.00 79.63  ? 127 GLU B CD  1 
ATOM   3594 O OE1 . GLU B 1 134 ? -39.438 -69.420 -5.793  1.00 62.91  ? 127 GLU B OE1 1 
ATOM   3595 O OE2 . GLU B 1 134 ? -41.207 -70.477 -5.016  1.00 79.49  ? 127 GLU B OE2 1 
ATOM   3596 N N   . GLN B 1 135 ? -37.667 -68.915 -10.462 1.00 57.96  ? 128 GLN B N   1 
ATOM   3597 C CA  . GLN B 1 135 ? -37.288 -68.392 -11.777 1.00 57.96  ? 128 GLN B CA  1 
ATOM   3598 C C   . GLN B 1 135 ? -35.769 -68.438 -12.019 1.00 60.74  ? 128 GLN B C   1 
ATOM   3599 O O   . GLN B 1 135 ? -35.318 -68.064 -13.108 1.00 60.11  ? 128 GLN B O   1 
ATOM   3600 C CB  . GLN B 1 135 ? -37.829 -66.961 -11.967 1.00 59.70  ? 128 GLN B CB  1 
ATOM   3601 C CG  . GLN B 1 135 ? -39.349 -66.855 -11.986 1.00 81.72  ? 128 GLN B CG  1 
ATOM   3602 C CD  . GLN B 1 135 ? -39.965 -67.323 -13.279 1.00 103.61 ? 128 GLN B CD  1 
ATOM   3603 O OE1 . GLN B 1 135 ? -40.240 -68.514 -13.460 1.00 98.38  ? 128 GLN B OE1 1 
ATOM   3604 N NE2 . GLN B 1 135 ? -40.215 -66.393 -14.204 1.00 96.07  ? 128 GLN B NE2 1 
ATOM   3605 N N   . ALA B 1 136 ? -34.982 -68.892 -11.007 1.00 56.31  ? 129 ALA B N   1 
ATOM   3606 C CA  . ALA B 1 136 ? -33.524 -69.005 -11.095 1.00 56.22  ? 129 ALA B CA  1 
ATOM   3607 C C   . ALA B 1 136 ? -33.133 -70.150 -12.007 1.00 63.27  ? 129 ALA B C   1 
ATOM   3608 O O   . ALA B 1 136 ? -33.589 -71.285 -11.821 1.00 63.19  ? 129 ALA B O   1 
ATOM   3609 C CB  . ALA B 1 136 ? -32.912 -69.204 -9.714  1.00 56.55  ? 129 ALA B CB  1 
ATOM   3610 N N   . ILE B 1 137 ? -32.319 -69.847 -13.019 1.00 61.01  ? 130 ILE B N   1 
ATOM   3611 C CA  . ILE B 1 137 ? -31.828 -70.862 -13.941 1.00 61.17  ? 130 ILE B CA  1 
ATOM   3612 C C   . ILE B 1 137 ? -30.743 -71.630 -13.188 1.00 66.53  ? 130 ILE B C   1 
ATOM   3613 O O   . ILE B 1 137 ? -29.908 -71.013 -12.522 1.00 66.35  ? 130 ILE B O   1 
ATOM   3614 C CB  . ILE B 1 137 ? -31.367 -70.247 -15.292 1.00 64.19  ? 130 ILE B CB  1 
ATOM   3615 C CG1 . ILE B 1 137 ? -32.569 -69.547 -16.003 1.00 64.61  ? 130 ILE B CG1 1 
ATOM   3616 C CG2 . ILE B 1 137 ? -30.669 -71.292 -16.183 1.00 64.93  ? 130 ILE B CG2 1 
ATOM   3617 C CD1 . ILE B 1 137 ? -32.534 -69.297 -17.599 1.00 76.13  ? 130 ILE B CD1 1 
ATOM   3618 N N   . GLY B 1 138 ? -30.842 -72.959 -13.213 1.00 63.81  ? 131 GLY B N   1 
ATOM   3619 C CA  . GLY B 1 138 ? -29.915 -73.849 -12.520 1.00 63.69  ? 131 GLY B CA  1 
ATOM   3620 C C   . GLY B 1 138 ? -30.199 -74.019 -11.042 1.00 67.55  ? 131 GLY B C   1 
ATOM   3621 O O   . GLY B 1 138 ? -29.359 -74.556 -10.316 1.00 67.13  ? 131 GLY B O   1 
ATOM   3622 N N   . ARG B 1 139 ? -31.391 -73.565 -10.591 1.00 64.25  ? 132 ARG B N   1 
ATOM   3623 C CA  . ARG B 1 139 ? -31.869 -73.616 -9.204  1.00 64.29  ? 132 ARG B CA  1 
ATOM   3624 C C   . ARG B 1 139 ? -30.893 -73.016 -8.183  1.00 66.78  ? 132 ARG B C   1 
ATOM   3625 O O   . ARG B 1 139 ? -30.940 -73.374 -7.001  1.00 66.80  ? 132 ARG B O   1 
ATOM   3626 C CB  . ARG B 1 139 ? -32.323 -75.033 -8.809  1.00 68.22  ? 132 ARG B CB  1 
ATOM   3627 C CG  . ARG B 1 139 ? -33.834 -75.244 -8.870  1.00 90.97  ? 132 ARG B CG  1 
ATOM   3628 C CD  . ARG B 1 139 ? -34.264 -76.012 -10.103 1.00 113.16 ? 132 ARG B CD  1 
ATOM   3629 N NE  . ARG B 1 139 ? -35.192 -77.090 -9.765  1.00 128.77 ? 132 ARG B NE  1 
ATOM   3630 C CZ  . ARG B 1 139 ? -34.987 -78.370 -10.057 1.00 144.74 ? 132 ARG B CZ  1 
ATOM   3631 N NH1 . ARG B 1 139 ? -33.890 -78.742 -10.708 1.00 131.55 ? 132 ARG B NH1 1 
ATOM   3632 N NH2 . ARG B 1 139 ? -35.881 -79.288 -9.711  1.00 131.58 ? 132 ARG B NH2 1 
ATOM   3633 N N   . VAL B 1 140 ? -30.022 -72.088 -8.638  1.00 61.71  ? 133 VAL B N   1 
ATOM   3634 C CA  . VAL B 1 140 ? -29.046 -71.408 -7.782  1.00 60.70  ? 133 VAL B CA  1 
ATOM   3635 C C   . VAL B 1 140 ? -29.764 -70.393 -6.904  1.00 61.73  ? 133 VAL B C   1 
ATOM   3636 O O   . VAL B 1 140 ? -30.532 -69.584 -7.414  1.00 62.89  ? 133 VAL B O   1 
ATOM   3637 C CB  . VAL B 1 140 ? -27.783 -70.849 -8.529  1.00 64.64  ? 133 VAL B CB  1 
ATOM   3638 C CG1 . VAL B 1 140 ? -28.094 -70.421 -9.957  1.00 64.40  ? 133 VAL B CG1 1 
ATOM   3639 C CG2 . VAL B 1 140 ? -27.107 -69.720 -7.761  1.00 64.31  ? 133 VAL B CG2 1 
ATOM   3640 N N   . THR B 1 141 ? -29.547 -70.482 -5.586  1.00 55.48  ? 134 THR B N   1 
ATOM   3641 C CA  . THR B 1 141 ? -30.130 -69.609 -4.566  1.00 54.61  ? 134 THR B CA  1 
ATOM   3642 C C   . THR B 1 141 ? -29.883 -68.117 -4.891  1.00 57.72  ? 134 THR B C   1 
ATOM   3643 O O   . THR B 1 141 ? -28.713 -67.716 -4.995  1.00 57.96  ? 134 THR B O   1 
ATOM   3644 C CB  . THR B 1 141 ? -29.617 -70.009 -3.166  1.00 60.05  ? 134 THR B CB  1 
ATOM   3645 O OG1 . THR B 1 141 ? -29.815 -71.409 -2.972  1.00 62.32  ? 134 THR B OG1 1 
ATOM   3646 C CG2 . THR B 1 141 ? -30.310 -69.261 -2.053  1.00 58.14  ? 134 THR B CG2 1 
ATOM   3647 N N   . PRO B 1 142 ? -30.963 -67.295 -5.067  1.00 52.34  ? 135 PRO B N   1 
ATOM   3648 C CA  . PRO B 1 142 ? -30.765 -65.866 -5.372  1.00 51.13  ? 135 PRO B CA  1 
ATOM   3649 C C   . PRO B 1 142 ? -30.171 -65.115 -4.195  1.00 52.02  ? 135 PRO B C   1 
ATOM   3650 O O   . PRO B 1 142 ? -30.340 -65.536 -3.051  1.00 52.51  ? 135 PRO B O   1 
ATOM   3651 C CB  . PRO B 1 142 ? -32.173 -65.370 -5.719  1.00 53.05  ? 135 PRO B CB  1 
ATOM   3652 C CG  . PRO B 1 142 ? -33.007 -66.611 -5.916  1.00 57.69  ? 135 PRO B CG  1 
ATOM   3653 C CD  . PRO B 1 142 ? -32.403 -67.612 -4.988  1.00 53.49  ? 135 PRO B CD  1 
ATOM   3654 N N   . ILE B 1 143 ? -29.445 -64.029 -4.481  1.00 46.00  ? 136 ILE B N   1 
ATOM   3655 C CA  . ILE B 1 143 ? -28.745 -63.212 -3.480  1.00 44.33  ? 136 ILE B CA  1 
ATOM   3656 C C   . ILE B 1 143 ? -29.582 -62.813 -2.271  1.00 47.03  ? 136 ILE B C   1 
ATOM   3657 O O   . ILE B 1 143 ? -29.083 -62.880 -1.151  1.00 46.93  ? 136 ILE B O   1 
ATOM   3658 C CB  . ILE B 1 143 ? -27.971 -62.021 -4.127  1.00 46.65  ? 136 ILE B CB  1 
ATOM   3659 C CG1 . ILE B 1 143 ? -26.874 -61.476 -3.186  1.00 46.54  ? 136 ILE B CG1 1 
ATOM   3660 C CG2 . ILE B 1 143 ? -28.915 -60.916 -4.609  1.00 47.26  ? 136 ILE B CG2 1 
ATOM   3661 C CD1 . ILE B 1 143 ? -25.708 -60.769 -3.875  1.00 52.50  ? 136 ILE B CD1 1 
ATOM   3662 N N   . PHE B 1 144 ? -30.836 -62.386 -2.496  1.00 42.45  ? 137 PHE B N   1 
ATOM   3663 C CA  . PHE B 1 144 ? -31.691 -61.945 -1.411  1.00 42.84  ? 137 PHE B CA  1 
ATOM   3664 C C   . PHE B 1 144 ? -32.044 -63.062 -0.436  1.00 50.80  ? 137 PHE B C   1 
ATOM   3665 O O   . PHE B 1 144 ? -32.004 -62.833 0.777   1.00 49.90  ? 137 PHE B O   1 
ATOM   3666 C CB  . PHE B 1 144 ? -32.920 -61.150 -1.906  1.00 43.45  ? 137 PHE B CB  1 
ATOM   3667 C CG  . PHE B 1 144 ? -33.580 -60.333 -0.818  1.00 43.30  ? 137 PHE B CG  1 
ATOM   3668 C CD1 . PHE B 1 144 ? -32.920 -59.247 -0.242  1.00 45.06  ? 137 PHE B CD1 1 
ATOM   3669 C CD2 . PHE B 1 144 ? -34.859 -60.649 -0.368  1.00 43.67  ? 137 PHE B CD2 1 
ATOM   3670 C CE1 . PHE B 1 144 ? -33.524 -58.503 0.775   1.00 45.54  ? 137 PHE B CE1 1 
ATOM   3671 C CE2 . PHE B 1 144 ? -35.470 -59.897 0.637   1.00 45.79  ? 137 PHE B CE2 1 
ATOM   3672 C CZ  . PHE B 1 144 ? -34.797 -58.832 1.208   1.00 43.70  ? 137 PHE B CZ  1 
ATOM   3673 N N   . ASP B 1 145 ? -32.316 -64.280 -0.951  1.00 49.78  ? 138 ASP B N   1 
ATOM   3674 C CA  . ASP B 1 145 ? -32.594 -65.453 -0.114  1.00 50.08  ? 138 ASP B CA  1 
ATOM   3675 C C   . ASP B 1 145 ? -31.400 -65.711 0.809   1.00 54.64  ? 138 ASP B C   1 
ATOM   3676 O O   . ASP B 1 145 ? -31.596 -65.952 2.000   1.00 54.60  ? 138 ASP B O   1 
ATOM   3677 C CB  . ASP B 1 145 ? -32.919 -66.677 -0.982  1.00 51.93  ? 138 ASP B CB  1 
ATOM   3678 C CG  . ASP B 1 145 ? -34.230 -66.561 -1.742  1.00 64.53  ? 138 ASP B CG  1 
ATOM   3679 O OD1 . ASP B 1 145 ? -34.380 -65.598 -2.539  1.00 67.99  ? 138 ASP B OD1 1 
ATOM   3680 O OD2 . ASP B 1 145 ? -35.086 -67.446 -1.580  1.00 66.19  ? 138 ASP B OD2 1 
ATOM   3681 N N   . ASN B 1 146 ? -30.167 -65.549 0.277   1.00 51.66  ? 139 ASN B N   1 
ATOM   3682 C CA  . ASN B 1 146 ? -28.926 -65.696 1.034   1.00 52.09  ? 139 ASN B CA  1 
ATOM   3683 C C   . ASN B 1 146 ? -28.760 -64.613 2.077   1.00 58.29  ? 139 ASN B C   1 
ATOM   3684 O O   . ASN B 1 146 ? -28.271 -64.911 3.166   1.00 59.30  ? 139 ASN B O   1 
ATOM   3685 C CB  . ASN B 1 146 ? -27.707 -65.767 0.110   1.00 53.88  ? 139 ASN B CB  1 
ATOM   3686 C CG  . ASN B 1 146 ? -27.515 -67.100 -0.580  1.00 81.11  ? 139 ASN B CG  1 
ATOM   3687 O OD1 . ASN B 1 146 ? -27.034 -67.162 -1.716  1.00 78.90  ? 139 ASN B OD1 1 
ATOM   3688 N ND2 . ASN B 1 146 ? -27.860 -68.204 0.087   1.00 70.60  ? 139 ASN B ND2 1 
ATOM   3689 N N   . ILE B 1 147 ? -29.180 -63.366 1.770   1.00 56.12  ? 140 ILE B N   1 
ATOM   3690 C CA  . ILE B 1 147 ? -29.119 -62.250 2.720   1.00 56.66  ? 140 ILE B CA  1 
ATOM   3691 C C   . ILE B 1 147 ? -30.120 -62.522 3.867   1.00 62.48  ? 140 ILE B C   1 
ATOM   3692 O O   . ILE B 1 147 ? -29.748 -62.374 5.036   1.00 62.26  ? 140 ILE B O   1 
ATOM   3693 C CB  . ILE B 1 147 ? -29.268 -60.848 2.043   1.00 59.84  ? 140 ILE B CB  1 
ATOM   3694 C CG1 . ILE B 1 147 ? -28.113 -60.580 1.053   1.00 59.92  ? 140 ILE B CG1 1 
ATOM   3695 C CG2 . ILE B 1 147 ? -29.310 -59.732 3.097   1.00 60.35  ? 140 ILE B CG2 1 
ATOM   3696 C CD1 . ILE B 1 147 ? -28.267 -59.359 0.151   1.00 65.49  ? 140 ILE B CD1 1 
ATOM   3697 N N   . ILE B 1 148 ? -31.354 -62.994 3.527   1.00 60.27  ? 141 ILE B N   1 
ATOM   3698 C CA  . ILE B 1 148 ? -32.413 -63.374 4.484   1.00 59.97  ? 141 ILE B CA  1 
ATOM   3699 C C   . ILE B 1 148 ? -31.857 -64.386 5.499   1.00 65.75  ? 141 ILE B C   1 
ATOM   3700 O O   . ILE B 1 148 ? -31.995 -64.167 6.707   1.00 66.04  ? 141 ILE B O   1 
ATOM   3701 C CB  . ILE B 1 148 ? -33.694 -63.909 3.773   1.00 62.43  ? 141 ILE B CB  1 
ATOM   3702 C CG1 . ILE B 1 148 ? -34.404 -62.796 2.959   1.00 62.43  ? 141 ILE B CG1 1 
ATOM   3703 C CG2 . ILE B 1 148 ? -34.649 -64.580 4.776   1.00 63.07  ? 141 ILE B CG2 1 
ATOM   3704 C CD1 . ILE B 1 148 ? -35.756 -63.190 2.181   1.00 67.74  ? 141 ILE B CD1 1 
ATOM   3705 N N   . SER B 1 149 ? -31.181 -65.453 4.993   1.00 62.65  ? 142 SER B N   1 
ATOM   3706 C CA  . SER B 1 149 ? -30.548 -66.542 5.757   1.00 62.14  ? 142 SER B CA  1 
ATOM   3707 C C   . SER B 1 149 ? -29.590 -66.081 6.842   1.00 65.07  ? 142 SER B C   1 
ATOM   3708 O O   . SER B 1 149 ? -29.440 -66.781 7.840   1.00 65.18  ? 142 SER B O   1 
ATOM   3709 C CB  . SER B 1 149 ? -29.839 -67.511 4.821   1.00 65.85  ? 142 SER B CB  1 
ATOM   3710 O OG  . SER B 1 149 ? -30.790 -68.205 4.032   1.00 74.71  ? 142 SER B OG  1 
ATOM   3711 N N   . GLN B 1 150 ? -28.959 -64.913 6.660   1.00 61.12  ? 143 GLN B N   1 
ATOM   3712 C CA  . GLN B 1 150 ? -28.033 -64.321 7.626   1.00 61.07  ? 143 GLN B CA  1 
ATOM   3713 C C   . GLN B 1 150 ? -28.737 -63.731 8.856   1.00 66.59  ? 143 GLN B C   1 
ATOM   3714 O O   . GLN B 1 150 ? -28.077 -63.492 9.871   1.00 67.09  ? 143 GLN B O   1 
ATOM   3715 C CB  . GLN B 1 150 ? -27.178 -63.243 6.950   1.00 62.25  ? 143 GLN B CB  1 
ATOM   3716 C CG  . GLN B 1 150 ? -25.929 -63.789 6.301   1.00 73.19  ? 143 GLN B CG  1 
ATOM   3717 C CD  . GLN B 1 150 ? -25.123 -62.730 5.584   1.00 88.68  ? 143 GLN B CD  1 
ATOM   3718 O OE1 . GLN B 1 150 ? -24.731 -62.905 4.434   1.00 86.32  ? 143 GLN B OE1 1 
ATOM   3719 N NE2 . GLN B 1 150 ? -24.810 -61.624 6.250   1.00 78.05  ? 143 GLN B NE2 1 
ATOM   3720 N N   . GLY B 1 151 ? -30.046 -63.477 8.747   1.00 63.77  ? 144 GLY B N   1 
ATOM   3721 C CA  . GLY B 1 151 ? -30.851 -62.885 9.815   1.00 63.64  ? 144 GLY B CA  1 
ATOM   3722 C C   . GLY B 1 151 ? -30.308 -61.559 10.319  1.00 66.91  ? 144 GLY B C   1 
ATOM   3723 O O   . GLY B 1 151 ? -30.175 -61.372 11.526  1.00 66.87  ? 144 GLY B O   1 
ATOM   3724 N N   . VAL B 1 152 ? -29.949 -60.646 9.398   1.00 62.35  ? 145 VAL B N   1 
ATOM   3725 C CA  . VAL B 1 152 ? -29.383 -59.328 9.724   1.00 61.38  ? 145 VAL B CA  1 
ATOM   3726 C C   . VAL B 1 152 ? -30.360 -58.175 9.461   1.00 62.24  ? 145 VAL B C   1 
ATOM   3727 O O   . VAL B 1 152 ? -30.279 -57.134 10.121  1.00 61.00  ? 145 VAL B O   1 
ATOM   3728 C CB  . VAL B 1 152 ? -28.003 -59.074 9.049   1.00 65.83  ? 145 VAL B CB  1 
ATOM   3729 C CG1 . VAL B 1 152 ? -26.914 -59.964 9.659   1.00 66.08  ? 145 VAL B CG1 1 
ATOM   3730 C CG2 . VAL B 1 152 ? -28.068 -59.241 7.526   1.00 65.59  ? 145 VAL B CG2 1 
ATOM   3731 N N   . LEU B 1 153 ? -31.266 -58.361 8.481   1.00 56.90  ? 146 LEU B N   1 
ATOM   3732 C CA  . LEU B 1 153 ? -32.227 -57.343 8.062   1.00 55.03  ? 146 LEU B CA  1 
ATOM   3733 C C   . LEU B 1 153 ? -33.376 -57.166 9.035   1.00 56.63  ? 146 LEU B C   1 
ATOM   3734 O O   . LEU B 1 153 ? -33.900 -58.152 9.543   1.00 57.21  ? 146 LEU B O   1 
ATOM   3735 C CB  . LEU B 1 153 ? -32.771 -57.642 6.655   1.00 54.61  ? 146 LEU B CB  1 
ATOM   3736 C CG  . LEU B 1 153 ? -31.772 -57.806 5.505   1.00 58.38  ? 146 LEU B CG  1 
ATOM   3737 C CD1 . LEU B 1 153 ? -32.477 -58.311 4.279   1.00 57.66  ? 146 LEU B CD1 1 
ATOM   3738 C CD2 . LEU B 1 153 ? -31.055 -56.506 5.184   1.00 59.92  ? 146 LEU B CD2 1 
ATOM   3739 N N   . LYS B 1 154 ? -33.788 -55.904 9.268   1.00 51.33  ? 147 LYS B N   1 
ATOM   3740 C CA  . LYS B 1 154 ? -34.923 -55.539 10.117  1.00 50.43  ? 147 LYS B CA  1 
ATOM   3741 C C   . LYS B 1 154 ? -36.166 -56.267 9.612   1.00 52.41  ? 147 LYS B C   1 
ATOM   3742 O O   . LYS B 1 154 ? -36.783 -57.007 10.372  1.00 52.33  ? 147 LYS B O   1 
ATOM   3743 C CB  . LYS B 1 154 ? -35.160 -54.021 10.088  1.00 53.06  ? 147 LYS B CB  1 
ATOM   3744 C CG  . LYS B 1 154 ? -34.636 -53.299 11.320  1.00 69.64  ? 147 LYS B CG  1 
ATOM   3745 C CD  . LYS B 1 154 ? -35.429 -52.027 11.634  1.00 79.58  ? 147 LYS B CD  1 
ATOM   3746 C CE  . LYS B 1 154 ? -34.764 -50.739 11.179  1.00 92.74  ? 147 LYS B CE  1 
ATOM   3747 N NZ  . LYS B 1 154 ? -33.552 -50.396 11.980  1.00 103.48 ? 147 LYS B NZ  1 
ATOM   3748 N N   . GLU B 1 155 ? -36.470 -56.116 8.307   1.00 47.40  ? 148 GLU B N   1 
ATOM   3749 C CA  . GLU B 1 155 ? -37.603 -56.739 7.620   1.00 46.37  ? 148 GLU B CA  1 
ATOM   3750 C C   . GLU B 1 155 ? -37.146 -57.537 6.391   1.00 48.89  ? 148 GLU B C   1 
ATOM   3751 O O   . GLU B 1 155 ? -36.124 -57.229 5.776   1.00 47.72  ? 148 GLU B O   1 
ATOM   3752 C CB  . GLU B 1 155 ? -38.608 -55.660 7.180   1.00 47.68  ? 148 GLU B CB  1 
ATOM   3753 C CG  . GLU B 1 155 ? -39.475 -55.104 8.296   1.00 61.63  ? 148 GLU B CG  1 
ATOM   3754 C CD  . GLU B 1 155 ? -40.333 -53.928 7.860   1.00 103.42 ? 148 GLU B CD  1 
ATOM   3755 O OE1 . GLU B 1 155 ? -39.763 -52.838 7.615   1.00 110.28 ? 148 GLU B OE1 1 
ATOM   3756 O OE2 . GLU B 1 155 ? -41.572 -54.096 7.763   1.00 101.63 ? 148 GLU B OE2 1 
ATOM   3757 N N   . ASP B 1 156 ? -37.958 -58.529 6.009   1.00 45.47  ? 149 ASP B N   1 
ATOM   3758 C CA  . ASP B 1 156 ? -37.789 -59.401 4.847   1.00 45.23  ? 149 ASP B CA  1 
ATOM   3759 C C   . ASP B 1 156 ? -38.306 -58.664 3.608   1.00 47.43  ? 149 ASP B C   1 
ATOM   3760 O O   . ASP B 1 156 ? -39.173 -59.177 2.887   1.00 47.16  ? 149 ASP B O   1 
ATOM   3761 C CB  . ASP B 1 156 ? -38.637 -60.657 5.065   1.00 47.97  ? 149 ASP B CB  1 
ATOM   3762 C CG  . ASP B 1 156 ? -37.889 -61.940 4.887   1.00 65.20  ? 149 ASP B CG  1 
ATOM   3763 O OD1 . ASP B 1 156 ? -37.069 -62.272 5.778   1.00 66.42  ? 149 ASP B OD1 1 
ATOM   3764 O OD2 . ASP B 1 156 ? -38.170 -62.658 3.888   1.00 74.01  ? 149 ASP B OD2 1 
ATOM   3765 N N   . VAL B 1 157 ? -37.821 -57.426 3.399   1.00 41.97  ? 150 VAL B N   1 
ATOM   3766 C CA  . VAL B 1 157 ? -38.263 -56.565 2.297   1.00 40.17  ? 150 VAL B CA  1 
ATOM   3767 C C   . VAL B 1 157 ? -37.099 -55.814 1.623   1.00 41.42  ? 150 VAL B C   1 
ATOM   3768 O O   . VAL B 1 157 ? -36.027 -55.645 2.212   1.00 41.77  ? 150 VAL B O   1 
ATOM   3769 C CB  . VAL B 1 157 ? -39.375 -55.553 2.734   1.00 42.57  ? 150 VAL B CB  1 
ATOM   3770 C CG1 . VAL B 1 157 ? -40.542 -56.232 3.465   1.00 42.18  ? 150 VAL B CG1 1 
ATOM   3771 C CG2 . VAL B 1 157 ? -38.799 -54.401 3.552   1.00 41.85  ? 150 VAL B CG2 1 
ATOM   3772 N N   . PHE B 1 158 ? -37.340 -55.318 0.408   1.00 34.19  ? 151 PHE B N   1 
ATOM   3773 C CA  . PHE B 1 158 ? -36.411 -54.430 -0.283  1.00 32.58  ? 151 PHE B CA  1 
ATOM   3774 C C   . PHE B 1 158 ? -37.193 -53.377 -1.033  1.00 36.60  ? 151 PHE B C   1 
ATOM   3775 O O   . PHE B 1 158 ? -38.295 -53.663 -1.513  1.00 37.73  ? 151 PHE B O   1 
ATOM   3776 C CB  . PHE B 1 158 ? -35.341 -55.149 -1.120  1.00 33.09  ? 151 PHE B CB  1 
ATOM   3777 C CG  . PHE B 1 158 ? -35.869 -56.014 -2.229  1.00 32.92  ? 151 PHE B CG  1 
ATOM   3778 C CD1 . PHE B 1 158 ? -36.054 -55.497 -3.501  1.00 34.30  ? 151 PHE B CD1 1 
ATOM   3779 C CD2 . PHE B 1 158 ? -36.158 -57.355 -2.009  1.00 32.97  ? 151 PHE B CD2 1 
ATOM   3780 C CE1 . PHE B 1 158 ? -36.528 -56.303 -4.531  1.00 34.83  ? 151 PHE B CE1 1 
ATOM   3781 C CE2 . PHE B 1 158 ? -36.614 -58.165 -3.044  1.00 34.70  ? 151 PHE B CE2 1 
ATOM   3782 C CZ  . PHE B 1 158 ? -36.811 -57.630 -4.297  1.00 32.89  ? 151 PHE B CZ  1 
ATOM   3783 N N   . SER B 1 159 ? -36.687 -52.138 -1.053  1.00 32.75  ? 152 SER B N   1 
ATOM   3784 C CA  . SER B 1 159 ? -37.366 -50.989 -1.676  1.00 31.97  ? 152 SER B CA  1 
ATOM   3785 C C   . SER B 1 159 ? -36.563 -50.327 -2.783  1.00 37.46  ? 152 SER B C   1 
ATOM   3786 O O   . SER B 1 159 ? -35.345 -50.259 -2.695  1.00 37.33  ? 152 SER B O   1 
ATOM   3787 C CB  . SER B 1 159 ? -37.684 -49.939 -0.618  1.00 33.01  ? 152 SER B CB  1 
ATOM   3788 O OG  . SER B 1 159 ? -38.583 -50.438 0.356   1.00 42.43  ? 152 SER B OG  1 
ATOM   3789 N N   . PHE B 1 160 ? -37.261 -49.733 -3.757  1.00 34.91  ? 153 PHE B N   1 
ATOM   3790 C CA  . PHE B 1 160 ? -36.682 -49.027 -4.889  1.00 33.91  ? 153 PHE B CA  1 
ATOM   3791 C C   . PHE B 1 160 ? -37.140 -47.596 -4.985  1.00 36.68  ? 153 PHE B C   1 
ATOM   3792 O O   . PHE B 1 160 ? -38.338 -47.328 -4.964  1.00 35.84  ? 153 PHE B O   1 
ATOM   3793 C CB  . PHE B 1 160 ? -37.048 -49.747 -6.199  1.00 36.03  ? 153 PHE B CB  1 
ATOM   3794 C CG  . PHE B 1 160 ? -36.120 -50.874 -6.555  1.00 38.16  ? 153 PHE B CG  1 
ATOM   3795 C CD1 . PHE B 1 160 ? -36.240 -52.116 -5.942  1.00 40.25  ? 153 PHE B CD1 1 
ATOM   3796 C CD2 . PHE B 1 160 ? -35.115 -50.693 -7.493  1.00 41.16  ? 153 PHE B CD2 1 
ATOM   3797 C CE1 . PHE B 1 160 ? -35.370 -53.152 -6.260  1.00 41.52  ? 153 PHE B CE1 1 
ATOM   3798 C CE2 . PHE B 1 160 ? -34.240 -51.731 -7.805  1.00 43.81  ? 153 PHE B CE2 1 
ATOM   3799 C CZ  . PHE B 1 160 ? -34.379 -52.956 -7.194  1.00 41.21  ? 153 PHE B CZ  1 
ATOM   3800 N N   . TYR B 1 161 ? -36.179 -46.682 -5.148  1.00 33.74  ? 154 TYR B N   1 
ATOM   3801 C CA  . TYR B 1 161 ? -36.395 -45.273 -5.429  1.00 33.30  ? 154 TYR B CA  1 
ATOM   3802 C C   . TYR B 1 161 ? -35.618 -44.961 -6.707  1.00 38.83  ? 154 TYR B C   1 
ATOM   3803 O O   . TYR B 1 161 ? -34.414 -45.214 -6.755  1.00 39.73  ? 154 TYR B O   1 
ATOM   3804 C CB  . TYR B 1 161 ? -35.926 -44.360 -4.274  1.00 34.40  ? 154 TYR B CB  1 
ATOM   3805 C CG  . TYR B 1 161 ? -35.922 -42.894 -4.665  1.00 34.66  ? 154 TYR B CG  1 
ATOM   3806 C CD1 . TYR B 1 161 ? -37.105 -42.236 -4.997  1.00 36.24  ? 154 TYR B CD1 1 
ATOM   3807 C CD2 . TYR B 1 161 ? -34.728 -42.190 -4.795  1.00 34.77  ? 154 TYR B CD2 1 
ATOM   3808 C CE1 . TYR B 1 161 ? -37.099 -40.911 -5.425  1.00 35.90  ? 154 TYR B CE1 1 
ATOM   3809 C CE2 . TYR B 1 161 ? -34.711 -40.862 -5.220  1.00 35.15  ? 154 TYR B CE2 1 
ATOM   3810 C CZ  . TYR B 1 161 ? -35.900 -40.224 -5.525  1.00 42.07  ? 154 TYR B CZ  1 
ATOM   3811 O OH  . TYR B 1 161 ? -35.889 -38.921 -5.953  1.00 44.44  ? 154 TYR B OH  1 
ATOM   3812 N N   . TYR B 1 162 ? -36.308 -44.471 -7.749  1.00 35.08  ? 155 TYR B N   1 
ATOM   3813 C CA  . TYR B 1 162 ? -35.697 -44.062 -9.015  1.00 34.58  ? 155 TYR B CA  1 
ATOM   3814 C C   . TYR B 1 162 ? -35.973 -42.569 -9.193  1.00 39.55  ? 155 TYR B C   1 
ATOM   3815 O O   . TYR B 1 162 ? -37.133 -42.163 -9.207  1.00 40.56  ? 155 TYR B O   1 
ATOM   3816 C CB  . TYR B 1 162 ? -36.305 -44.829 -10.208 1.00 34.97  ? 155 TYR B CB  1 
ATOM   3817 C CG  . TYR B 1 162 ? -35.798 -46.236 -10.444 1.00 34.79  ? 155 TYR B CG  1 
ATOM   3818 C CD1 . TYR B 1 162 ? -34.783 -46.780 -9.654  1.00 36.02  ? 155 TYR B CD1 1 
ATOM   3819 C CD2 . TYR B 1 162 ? -36.327 -47.028 -11.460 1.00 34.28  ? 155 TYR B CD2 1 
ATOM   3820 C CE1 . TYR B 1 162 ? -34.314 -48.078 -9.872  1.00 33.40  ? 155 TYR B CE1 1 
ATOM   3821 C CE2 . TYR B 1 162 ? -35.867 -48.329 -11.681 1.00 34.01  ? 155 TYR B CE2 1 
ATOM   3822 C CZ  . TYR B 1 162 ? -34.845 -48.840 -10.898 1.00 35.76  ? 155 TYR B CZ  1 
ATOM   3823 O OH  . TYR B 1 162 ? -34.371 -50.111 -11.131 1.00 34.73  ? 155 TYR B OH  1 
ATOM   3824 N N   . ASN B 1 163 ? -34.940 -41.754 -9.338  1.00 35.37  ? 156 ASN B N   1 
ATOM   3825 C CA  . ASN B 1 163 ? -35.131 -40.323 -9.545  1.00 35.52  ? 156 ASN B CA  1 
ATOM   3826 C C   . ASN B 1 163 ? -35.368 -39.979 -11.029 1.00 43.33  ? 156 ASN B C   1 
ATOM   3827 O O   . ASN B 1 163 ? -35.073 -40.788 -11.890 1.00 41.27  ? 156 ASN B O   1 
ATOM   3828 C CB  . ASN B 1 163 ? -33.930 -39.570 -9.014  1.00 34.10  ? 156 ASN B CB  1 
ATOM   3829 C CG  . ASN B 1 163 ? -34.152 -38.108 -8.663  1.00 47.72  ? 156 ASN B CG  1 
ATOM   3830 O OD1 . ASN B 1 163 ? -35.231 -37.525 -8.855  1.00 42.23  ? 156 ASN B OD1 1 
ATOM   3831 N ND2 . ASN B 1 163 ? -33.116 -37.481 -8.136  1.00 33.87  ? 156 ASN B ND2 1 
ATOM   3832 N N   . ARG B 1 164 ? -35.825 -38.748 -11.341 1.00 46.98  ? 157 ARG B N   1 
ATOM   3833 C CA  . ARG B 1 164 ? -36.049 -38.231 -12.711 1.00 49.69  ? 157 ARG B CA  1 
ATOM   3834 C C   . ARG B 1 164 ? -34.811 -37.415 -13.168 1.00 63.92  ? 157 ARG B C   1 
ATOM   3835 O O   . ARG B 1 164 ? -33.827 -37.323 -12.429 1.00 63.31  ? 157 ARG B O   1 
ATOM   3836 C CB  . ARG B 1 164 ? -37.293 -37.303 -12.735 1.00 48.09  ? 157 ARG B CB  1 
ATOM   3837 C CG  . ARG B 1 164 ? -38.629 -37.971 -12.379 1.00 56.75  ? 157 ARG B CG  1 
ATOM   3838 C CD  . ARG B 1 164 ? -39.735 -36.975 -12.054 1.00 59.96  ? 157 ARG B CD  1 
ATOM   3839 N NE  . ARG B 1 164 ? -40.326 -37.221 -10.733 1.00 69.66  ? 157 ARG B NE  1 
ATOM   3840 C CZ  . ARG B 1 164 ? -41.421 -37.952 -10.514 1.00 84.61  ? 157 ARG B CZ  1 
ATOM   3841 N NH1 . ARG B 1 164 ? -42.063 -38.527 -11.531 1.00 75.40  ? 157 ARG B NH1 1 
ATOM   3842 N NH2 . ARG B 1 164 ? -41.880 -38.117 -9.279  1.00 57.59  ? 157 ARG B NH2 1 
ATOM   3843 N N   . ASP B 1 165 ? -34.885 -36.806 -14.382 1.00 69.35  ? 158 ASP B N   1 
ATOM   3844 C CA  . ASP B 1 165 ? -33.887 -35.917 -15.007 1.00 72.39  ? 158 ASP B CA  1 
ATOM   3845 C C   . ASP B 1 165 ? -32.447 -36.378 -14.774 1.00 81.63  ? 158 ASP B C   1 
ATOM   3846 O O   . ASP B 1 165 ? -31.754 -35.886 -13.875 1.00 82.16  ? 158 ASP B O   1 
ATOM   3847 C CB  . ASP B 1 165 ? -34.128 -34.443 -14.577 1.00 75.31  ? 158 ASP B CB  1 
ATOM   3848 C CG  . ASP B 1 165 ? -33.276 -33.378 -15.259 1.00 94.01  ? 158 ASP B CG  1 
ATOM   3849 O OD1 . ASP B 1 165 ? -32.072 -33.276 -14.931 1.00 94.85  ? 158 ASP B OD1 1 
ATOM   3850 O OD2 . ASP B 1 165 ? -33.843 -32.562 -16.021 1.00 105.23 ? 158 ASP B OD2 1 
ATOM   3851 N N   . SER B 1 166 ? -32.019 -37.354 -15.580 1.00 81.70  ? 159 SER B N   1 
ATOM   3852 C CA  . SER B 1 166 ? -30.678 -37.953 -15.581 1.00 83.23  ? 159 SER B CA  1 
ATOM   3853 C C   . SER B 1 166 ? -29.538 -36.929 -15.606 1.00 92.30  ? 159 SER B C   1 
ATOM   3854 O O   . SER B 1 166 ? -28.492 -37.163 -14.988 1.00 92.41  ? 159 SER B O   1 
ATOM   3855 C CB  . SER B 1 166 ? -30.532 -38.847 -16.801 1.00 85.78  ? 159 SER B CB  1 
ATOM   3856 O OG  . SER B 1 166 ? -30.943 -38.168 -17.978 1.00 91.25  ? 159 SER B OG  1 
ATOM   3857 N N   . GLU B 1 167 ? -29.756 -35.805 -16.340 1.00 91.71  ? 160 GLU B N   1 
ATOM   3858 C CA  . GLU B 1 167 ? -28.834 -34.689 -16.573 1.00 92.24  ? 160 GLU B CA  1 
ATOM   3859 C C   . GLU B 1 167 ? -28.669 -33.724 -15.380 1.00 98.88  ? 160 GLU B C   1 
ATOM   3860 O O   . GLU B 1 167 ? -29.291 -32.652 -15.352 1.00 98.90  ? 160 GLU B O   1 
ATOM   3861 C CB  . GLU B 1 167 ? -29.219 -33.934 -17.865 1.00 93.28  ? 160 GLU B CB  1 
ATOM   3862 C CG  . GLU B 1 167 ? -28.877 -34.678 -19.146 1.00 101.02 ? 160 GLU B CG  1 
ATOM   3863 C CD  . GLU B 1 167 ? -29.260 -33.997 -20.448 1.00 114.48 ? 160 GLU B CD  1 
ATOM   3864 O OE1 . GLU B 1 167 ? -29.080 -32.761 -20.564 1.00 98.53  ? 160 GLU B OE1 1 
ATOM   3865 O OE2 . GLU B 1 167 ? -29.700 -34.715 -21.374 1.00 106.21 ? 160 GLU B OE2 1 
ATOM   3866 N N   . ASN B 1 168 A -27.800 -34.118 -14.409 1.00 96.65  ? 160 ASN B N   1 
ATOM   3867 C CA  . ASN B 1 168 A -27.377 -33.380 -13.205 1.00 96.81  ? 160 ASN B CA  1 
ATOM   3868 C C   . ASN B 1 168 A -26.573 -34.244 -12.233 1.00 100.87 ? 160 ASN B C   1 
ATOM   3869 O O   . ASN B 1 168 A -27.054 -35.294 -11.785 1.00 99.98  ? 160 ASN B O   1 
ATOM   3870 C CB  . ASN B 1 168 A -28.528 -32.673 -12.473 1.00 98.63  ? 160 ASN B CB  1 
ATOM   3871 C CG  . ASN B 1 168 A -28.121 -31.335 -11.896 1.00 121.45 ? 160 ASN B CG  1 
ATOM   3872 O OD1 . ASN B 1 168 A -27.973 -31.178 -10.679 1.00 116.45 ? 160 ASN B OD1 1 
ATOM   3873 N ND2 . ASN B 1 168 A -27.922 -30.341 -12.760 1.00 110.93 ? 160 ASN B ND2 1 
ATOM   3874 N N   . SER B 1 169 B -25.342 -33.786 -11.908 1.00 97.70  ? 160 SER B N   1 
ATOM   3875 C CA  . SER B 1 169 B -24.430 -34.447 -10.960 1.00 97.10  ? 160 SER B CA  1 
ATOM   3876 C C   . SER B 1 169 B -24.846 -34.136 -9.518  1.00 98.24  ? 160 SER B C   1 
ATOM   3877 O O   . SER B 1 169 B -24.586 -34.926 -8.602  1.00 98.36  ? 160 SER B O   1 
ATOM   3878 C CB  . SER B 1 169 B -22.995 -33.978 -11.181 1.00 100.84 ? 160 SER B CB  1 
ATOM   3879 O OG  . SER B 1 169 B -22.088 -34.654 -10.322 1.00 109.16 ? 160 SER B OG  1 
ATOM   3880 N N   . GLN B 1 170 C -25.500 -32.982 -9.328  1.00 91.48  ? 160 GLN B N   1 
ATOM   3881 C CA  . GLN B 1 170 C -25.948 -32.525 -8.023  1.00 89.66  ? 160 GLN B CA  1 
ATOM   3882 C C   . GLN B 1 170 C -27.277 -33.155 -7.602  1.00 87.76  ? 160 GLN B C   1 
ATOM   3883 O O   . GLN B 1 170 C -27.958 -32.622 -6.719  1.00 88.18  ? 160 GLN B O   1 
ATOM   3884 C CB  . GLN B 1 170 C -25.962 -30.989 -7.960  1.00 91.38  ? 160 GLN B CB  1 
ATOM   3885 C CG  . GLN B 1 170 C -24.564 -30.360 -8.025  1.00 110.58 ? 160 GLN B CG  1 
ATOM   3886 C CD  . GLN B 1 170 C -24.236 -29.835 -9.401  1.00 134.31 ? 160 GLN B CD  1 
ATOM   3887 O OE1 . GLN B 1 170 C -24.906 -28.937 -9.933  1.00 131.53 ? 160 GLN B OE1 1 
ATOM   3888 N NE2 . GLN B 1 170 C -23.178 -30.366 -9.999  1.00 126.03 ? 160 GLN B NE2 1 
ATOM   3889 N N   . SER B 1 171 D -27.621 -34.318 -8.211  1.00 78.39  ? 160 SER B N   1 
ATOM   3890 C CA  . SER B 1 171 D -28.822 -35.102 -7.906  1.00 74.91  ? 160 SER B CA  1 
ATOM   3891 C C   . SER B 1 171 D -28.545 -36.610 -7.875  1.00 69.54  ? 160 SER B C   1 
ATOM   3892 O O   . SER B 1 171 D -27.874 -37.148 -8.763  1.00 68.97  ? 160 SER B O   1 
ATOM   3893 C CB  . SER B 1 171 D -29.978 -34.767 -8.849  1.00 78.37  ? 160 SER B CB  1 
ATOM   3894 O OG  . SER B 1 171 D -29.677 -35.019 -10.212 1.00 88.47  ? 160 SER B OG  1 
ATOM   3895 N N   . LEU B 1 172 ? -29.061 -37.268 -6.821  1.00 58.70  ? 161 LEU B N   1 
ATOM   3896 C CA  . LEU B 1 172 ? -29.001 -38.707 -6.562  1.00 55.03  ? 161 LEU B CA  1 
ATOM   3897 C C   . LEU B 1 172 ? -29.857 -39.439 -7.628  1.00 53.87  ? 161 LEU B C   1 
ATOM   3898 O O   . LEU B 1 172 ? -31.026 -39.100 -7.810  1.00 53.99  ? 161 LEU B O   1 
ATOM   3899 C CB  . LEU B 1 172 ? -29.550 -38.950 -5.143  1.00 54.39  ? 161 LEU B CB  1 
ATOM   3900 C CG  . LEU B 1 172 ? -29.927 -40.366 -4.741  1.00 58.60  ? 161 LEU B CG  1 
ATOM   3901 C CD1 . LEU B 1 172 ? -28.833 -40.995 -3.941  1.00 58.97  ? 161 LEU B CD1 1 
ATOM   3902 C CD2 . LEU B 1 172 ? -31.201 -40.371 -3.929  1.00 59.12  ? 161 LEU B CD2 1 
ATOM   3903 N N   . GLY B 1 173 ? -29.268 -40.410 -8.321  1.00 44.79  ? 162 GLY B N   1 
ATOM   3904 C CA  . GLY B 1 173 ? -29.962 -41.148 -9.371  1.00 42.49  ? 162 GLY B CA  1 
ATOM   3905 C C   . GLY B 1 173 ? -31.068 -42.078 -8.919  1.00 41.60  ? 162 GLY B C   1 
ATOM   3906 O O   . GLY B 1 173 ? -32.079 -42.238 -9.595  1.00 39.10  ? 162 GLY B O   1 
ATOM   3907 N N   . GLY B 1 174 ? -30.853 -42.717 -7.791  1.00 37.32  ? 163 GLY B N   1 
ATOM   3908 C CA  . GLY B 1 174 ? -31.793 -43.652 -7.207  1.00 35.75  ? 163 GLY B CA  1 
ATOM   3909 C C   . GLY B 1 174 ? -31.221 -44.270 -5.958  1.00 37.85  ? 163 GLY B C   1 
ATOM   3910 O O   . GLY B 1 174 ? -30.102 -43.950 -5.553  1.00 35.46  ? 163 GLY B O   1 
ATOM   3911 N N   . GLN B 1 175 ? -31.991 -45.170 -5.348  1.00 35.46  ? 164 GLN B N   1 
ATOM   3912 C CA  . GLN B 1 175 ? -31.591 -45.857 -4.120  1.00 34.71  ? 164 GLN B CA  1 
ATOM   3913 C C   . GLN B 1 175 ? -32.416 -47.108 -3.895  1.00 38.10  ? 164 GLN B C   1 
ATOM   3914 O O   . GLN B 1 175 ? -33.632 -47.083 -4.062  1.00 38.44  ? 164 GLN B O   1 
ATOM   3915 C CB  . GLN B 1 175 ? -31.726 -44.914 -2.911  1.00 35.43  ? 164 GLN B CB  1 
ATOM   3916 C CG  . GLN B 1 175 ? -31.687 -45.613 -1.563  1.00 50.18  ? 164 GLN B CG  1 
ATOM   3917 C CD  . GLN B 1 175 ? -32.129 -44.683 -0.493  1.00 58.41  ? 164 GLN B CD  1 
ATOM   3918 O OE1 . GLN B 1 175 ? -31.296 -44.037 0.123   1.00 55.93  ? 164 GLN B OE1 1 
ATOM   3919 N NE2 . GLN B 1 175 ? -33.436 -44.525 -0.284  1.00 39.78  ? 164 GLN B NE2 1 
ATOM   3920 N N   . ILE B 1 176 ? -31.741 -48.175 -3.478  1.00 34.94  ? 165 ILE B N   1 
ATOM   3921 C CA  . ILE B 1 176 ? -32.305 -49.452 -3.047  1.00 35.63  ? 165 ILE B CA  1 
ATOM   3922 C C   . ILE B 1 176 ? -32.049 -49.567 -1.555  1.00 39.83  ? 165 ILE B C   1 
ATOM   3923 O O   . ILE B 1 176 ? -30.941 -49.293 -1.088  1.00 38.62  ? 165 ILE B O   1 
ATOM   3924 C CB  . ILE B 1 176 ? -31.719 -50.685 -3.787  1.00 38.80  ? 165 ILE B CB  1 
ATOM   3925 C CG1 . ILE B 1 176 ? -31.894 -50.532 -5.278  1.00 40.42  ? 165 ILE B CG1 1 
ATOM   3926 C CG2 . ILE B 1 176 ? -32.355 -52.011 -3.306  1.00 38.25  ? 165 ILE B CG2 1 
ATOM   3927 C CD1 . ILE B 1 176 ? -30.925 -51.203 -5.965  1.00 53.59  ? 165 ILE B CD1 1 
ATOM   3928 N N   . VAL B 1 177 ? -33.074 -49.961 -0.807  1.00 37.30  ? 166 VAL B N   1 
ATOM   3929 C CA  . VAL B 1 177 ? -32.927 -50.205 0.618   1.00 37.00  ? 166 VAL B CA  1 
ATOM   3930 C C   . VAL B 1 177 ? -33.222 -51.686 0.795   1.00 43.10  ? 166 VAL B C   1 
ATOM   3931 O O   . VAL B 1 177 ? -34.264 -52.180 0.349   1.00 43.68  ? 166 VAL B O   1 
ATOM   3932 C CB  . VAL B 1 177 ? -33.819 -49.308 1.514   1.00 40.00  ? 166 VAL B CB  1 
ATOM   3933 C CG1 . VAL B 1 177 ? -33.545 -49.566 2.991   1.00 39.43  ? 166 VAL B CG1 1 
ATOM   3934 C CG2 . VAL B 1 177 ? -33.613 -47.835 1.198   1.00 40.03  ? 166 VAL B CG2 1 
ATOM   3935 N N   . LEU B 1 178 ? -32.277 -52.400 1.386   1.00 39.98  ? 167 LEU B N   1 
ATOM   3936 C CA  . LEU B 1 178 ? -32.442 -53.809 1.727   1.00 39.75  ? 167 LEU B CA  1 
ATOM   3937 C C   . LEU B 1 178 ? -32.828 -53.838 3.224   1.00 43.53  ? 167 LEU B C   1 
ATOM   3938 O O   . LEU B 1 178 ? -32.108 -53.266 4.050   1.00 42.03  ? 167 LEU B O   1 
ATOM   3939 C CB  . LEU B 1 178 ? -31.141 -54.596 1.482   1.00 39.93  ? 167 LEU B CB  1 
ATOM   3940 C CG  . LEU B 1 178 ? -30.503 -54.523 0.076   1.00 44.77  ? 167 LEU B CG  1 
ATOM   3941 C CD1 . LEU B 1 178 ? -29.116 -55.113 0.103   1.00 45.20  ? 167 LEU B CD1 1 
ATOM   3942 C CD2 . LEU B 1 178 ? -31.330 -55.263 -0.965  1.00 46.68  ? 167 LEU B CD2 1 
ATOM   3943 N N   . GLY B 1 179 ? -34.000 -54.409 3.529   1.00 40.16  ? 168 GLY B N   1 
ATOM   3944 C CA  . GLY B 1 179 ? -34.503 -54.549 4.898   1.00 39.67  ? 168 GLY B CA  1 
ATOM   3945 C C   . GLY B 1 179 ? -35.506 -53.512 5.361   1.00 43.26  ? 168 GLY B C   1 
ATOM   3946 O O   . GLY B 1 179 ? -35.932 -53.541 6.518   1.00 43.22  ? 168 GLY B O   1 
ATOM   3947 N N   . GLY B 1 180 ? -35.872 -52.593 4.475   1.00 39.16  ? 169 GLY B N   1 
ATOM   3948 C CA  . GLY B 1 180 ? -36.819 -51.540 4.793   1.00 38.53  ? 169 GLY B CA  1 
ATOM   3949 C C   . GLY B 1 180 ? -37.132 -50.616 3.641   1.00 44.59  ? 169 GLY B C   1 
ATOM   3950 O O   . GLY B 1 180 ? -36.956 -50.976 2.470   1.00 45.57  ? 169 GLY B O   1 
ATOM   3951 N N   . SER B 1 181 ? -37.590 -49.400 3.991   1.00 41.87  ? 170 SER B N   1 
ATOM   3952 C CA  . SER B 1 181 ? -37.944 -48.303 3.098   1.00 41.28  ? 170 SER B CA  1 
ATOM   3953 C C   . SER B 1 181 ? -37.371 -47.009 3.634   1.00 43.51  ? 170 SER B C   1 
ATOM   3954 O O   . SER B 1 181 ? -37.242 -46.857 4.848   1.00 42.45  ? 170 SER B O   1 
ATOM   3955 C CB  . SER B 1 181 ? -39.459 -48.176 3.010   1.00 46.03  ? 170 SER B CB  1 
ATOM   3956 O OG  . SER B 1 181 ? -40.006 -49.228 2.224   1.00 59.85  ? 170 SER B OG  1 
ATOM   3957 N N   . ASP B 1 182 ? -37.028 -46.071 2.737   1.00 39.96  ? 171 ASP B N   1 
ATOM   3958 C CA  . ASP B 1 182 ? -36.517 -44.768 3.156   1.00 38.91  ? 171 ASP B CA  1 
ATOM   3959 C C   . ASP B 1 182 ? -37.681 -43.760 3.121   1.00 43.22  ? 171 ASP B C   1 
ATOM   3960 O O   . ASP B 1 182 ? -38.130 -43.382 2.031   1.00 40.19  ? 171 ASP B O   1 
ATOM   3961 C CB  . ASP B 1 182 ? -35.333 -44.304 2.302   1.00 39.32  ? 171 ASP B CB  1 
ATOM   3962 C CG  . ASP B 1 182 ? -34.649 -43.043 2.796   1.00 46.48  ? 171 ASP B CG  1 
ATOM   3963 O OD1 . ASP B 1 182 ? -35.153 -42.431 3.753   1.00 49.60  ? 171 ASP B OD1 1 
ATOM   3964 O OD2 . ASP B 1 182 ? -33.597 -42.676 2.232   1.00 49.92  ? 171 ASP B OD2 1 
ATOM   3965 N N   . PRO B 1 183 ? -38.157 -43.300 4.313   1.00 42.08  ? 172 PRO B N   1 
ATOM   3966 C CA  . PRO B 1 183 ? -39.298 -42.361 4.350   1.00 41.80  ? 172 PRO B CA  1 
ATOM   3967 C C   . PRO B 1 183 ? -39.011 -40.978 3.787   1.00 46.04  ? 172 PRO B C   1 
ATOM   3968 O O   . PRO B 1 183 ? -39.935 -40.202 3.593   1.00 45.73  ? 172 PRO B O   1 
ATOM   3969 C CB  . PRO B 1 183 ? -39.696 -42.336 5.829   1.00 43.34  ? 172 PRO B CB  1 
ATOM   3970 C CG  . PRO B 1 183 ? -38.999 -43.523 6.446   1.00 47.79  ? 172 PRO B CG  1 
ATOM   3971 C CD  . PRO B 1 183 ? -37.730 -43.655 5.681   1.00 43.42  ? 172 PRO B CD  1 
ATOM   3972 N N   . GLN B 1 184 ? -37.740 -40.693 3.476   1.00 43.03  ? 173 GLN B N   1 
ATOM   3973 C CA  . GLN B 1 184 ? -37.307 -39.446 2.860   1.00 42.75  ? 173 GLN B CA  1 
ATOM   3974 C C   . GLN B 1 184 ? -37.709 -39.425 1.380   1.00 45.83  ? 173 GLN B C   1 
ATOM   3975 O O   . GLN B 1 184 ? -37.793 -38.344 0.787   1.00 45.47  ? 173 GLN B O   1 
ATOM   3976 C CB  . GLN B 1 184 ? -35.778 -39.319 2.964   1.00 44.65  ? 173 GLN B CB  1 
ATOM   3977 C CG  . GLN B 1 184 ? -35.246 -39.075 4.378   1.00 78.31  ? 173 GLN B CG  1 
ATOM   3978 C CD  . GLN B 1 184 ? -35.235 -37.608 4.729   1.00 112.42 ? 173 GLN B CD  1 
ATOM   3979 O OE1 . GLN B 1 184 ? -36.156 -37.093 5.380   1.00 111.67 ? 173 GLN B OE1 1 
ATOM   3980 N NE2 . GLN B 1 184 ? -34.186 -36.904 4.302   1.00 104.98 ? 173 GLN B NE2 1 
ATOM   3981 N N   . HIS B 1 185 ? -37.946 -40.624 0.781   1.00 41.85  ? 174 HIS B N   1 
ATOM   3982 C CA  . HIS B 1 185 ? -38.252 -40.781 -0.644  1.00 40.66  ? 174 HIS B CA  1 
ATOM   3983 C C   . HIS B 1 185 ? -39.678 -41.142 -1.056  1.00 44.12  ? 174 HIS B C   1 
ATOM   3984 O O   . HIS B 1 185 ? -39.954 -41.346 -2.239  1.00 43.76  ? 174 HIS B O   1 
ATOM   3985 C CB  . HIS B 1 185 ? -37.169 -41.597 -1.348  1.00 40.78  ? 174 HIS B CB  1 
ATOM   3986 C CG  . HIS B 1 185 ? -35.858 -40.872 -1.369  1.00 43.58  ? 174 HIS B CG  1 
ATOM   3987 N ND1 . HIS B 1 185 ? -35.726 -39.636 -1.987  1.00 44.71  ? 174 HIS B ND1 1 
ATOM   3988 C CD2 . HIS B 1 185 ? -34.674 -41.209 -0.810  1.00 43.85  ? 174 HIS B CD2 1 
ATOM   3989 C CE1 . HIS B 1 185 ? -34.465 -39.284 -1.810  1.00 43.37  ? 174 HIS B CE1 1 
ATOM   3990 N NE2 . HIS B 1 185 ? -33.796 -40.193 -1.104  1.00 43.46  ? 174 HIS B NE2 1 
ATOM   3991 N N   . TYR B 1 186 ? -40.589 -41.169 -0.090  1.00 40.55  ? 175 TYR B N   1 
ATOM   3992 C CA  . TYR B 1 186 ? -42.003 -41.375 -0.351  1.00 40.29  ? 175 TYR B CA  1 
ATOM   3993 C C   . TYR B 1 186 ? -42.843 -40.539 0.594   1.00 42.54  ? 175 TYR B C   1 
ATOM   3994 O O   . TYR B 1 186 ? -42.361 -40.117 1.645   1.00 40.89  ? 175 TYR B O   1 
ATOM   3995 C CB  . TYR B 1 186 ? -42.411 -42.868 -0.326  1.00 41.53  ? 175 TYR B CB  1 
ATOM   3996 C CG  . TYR B 1 186 ? -42.300 -43.544 1.022   1.00 43.03  ? 175 TYR B CG  1 
ATOM   3997 C CD1 . TYR B 1 186 ? -41.139 -44.197 1.398   1.00 44.46  ? 175 TYR B CD1 1 
ATOM   3998 C CD2 . TYR B 1 186 ? -43.383 -43.589 1.895   1.00 43.22  ? 175 TYR B CD2 1 
ATOM   3999 C CE1 . TYR B 1 186 ? -41.039 -44.841 2.628   1.00 46.21  ? 175 TYR B CE1 1 
ATOM   4000 C CE2 . TYR B 1 186 ? -43.294 -44.229 3.126   1.00 43.71  ? 175 TYR B CE2 1 
ATOM   4001 C CZ  . TYR B 1 186 ? -42.114 -44.843 3.497   1.00 53.13  ? 175 TYR B CZ  1 
ATOM   4002 O OH  . TYR B 1 186 ? -42.007 -45.481 4.711   1.00 56.64  ? 175 TYR B OH  1 
ATOM   4003 N N   . GLU B 1 187 ? -44.077 -40.241 0.180   1.00 40.91  ? 176 GLU B N   1 
ATOM   4004 C CA  . GLU B 1 187 ? -45.065 -39.523 0.998   1.00 41.18  ? 176 GLU B CA  1 
ATOM   4005 C C   . GLU B 1 187 ? -46.317 -40.375 1.175   1.00 44.13  ? 176 GLU B C   1 
ATOM   4006 O O   . GLU B 1 187 ? -46.634 -41.202 0.316   1.00 42.44  ? 176 GLU B O   1 
ATOM   4007 C CB  . GLU B 1 187 ? -45.380 -38.102 0.490   1.00 42.77  ? 176 GLU B CB  1 
ATOM   4008 C CG  . GLU B 1 187 ? -46.001 -38.016 -0.887  1.00 58.54  ? 176 GLU B CG  1 
ATOM   4009 C CD  . GLU B 1 187 ? -46.063 -36.585 -1.380  1.00 91.88  ? 176 GLU B CD  1 
ATOM   4010 O OE1 . GLU B 1 187 ? -45.045 -36.103 -1.929  1.00 81.78  ? 176 GLU B OE1 1 
ATOM   4011 O OE2 . GLU B 1 187 ? -47.111 -35.931 -1.172  1.00 96.38  ? 176 GLU B OE2 1 
ATOM   4012 N N   . GLY B 1 188 ? -46.977 -40.200 2.314   1.00 41.27  ? 177 GLY B N   1 
ATOM   4013 C CA  . GLY B 1 188 ? -48.178 -40.937 2.634   1.00 40.93  ? 177 GLY B CA  1 
ATOM   4014 C C   . GLY B 1 188 ? -47.834 -42.331 3.093   1.00 45.52  ? 177 GLY B C   1 
ATOM   4015 O O   . GLY B 1 188 ? -46.764 -42.560 3.671   1.00 43.69  ? 177 GLY B O   1 
ATOM   4016 N N   . ASN B 1 189 ? -48.736 -43.274 2.827   1.00 43.07  ? 178 ASN B N   1 
ATOM   4017 C CA  . ASN B 1 189 ? -48.533 -44.646 3.256   1.00 42.53  ? 178 ASN B CA  1 
ATOM   4018 C C   . ASN B 1 189 ? -48.604 -45.606 2.087   1.00 44.16  ? 178 ASN B C   1 
ATOM   4019 O O   . ASN B 1 189 ? -49.198 -45.294 1.045   1.00 43.76  ? 178 ASN B O   1 
ATOM   4020 C CB  . ASN B 1 189 ? -49.536 -45.018 4.355   1.00 43.57  ? 178 ASN B CB  1 
ATOM   4021 C CG  . ASN B 1 189 ? -49.378 -44.199 5.616   1.00 63.25  ? 178 ASN B CG  1 
ATOM   4022 O OD1 . ASN B 1 189 ? -48.453 -44.413 6.415   1.00 57.12  ? 178 ASN B OD1 1 
ATOM   4023 N ND2 . ASN B 1 189 ? -50.277 -43.233 5.819   1.00 51.92  ? 178 ASN B ND2 1 
ATOM   4024 N N   . PHE B 1 190 ? -48.006 -46.791 2.273   1.00 38.85  ? 179 PHE B N   1 
ATOM   4025 C CA  . PHE B 1 190 ? -48.010 -47.854 1.268   1.00 37.71  ? 179 PHE B CA  1 
ATOM   4026 C C   . PHE B 1 190 ? -49.385 -48.497 1.182   1.00 41.92  ? 179 PHE B C   1 
ATOM   4027 O O   . PHE B 1 190 ? -50.083 -48.609 2.195   1.00 40.99  ? 179 PHE B O   1 
ATOM   4028 C CB  . PHE B 1 190 ? -46.982 -48.940 1.633   1.00 38.82  ? 179 PHE B CB  1 
ATOM   4029 C CG  . PHE B 1 190 ? -45.550 -48.532 1.407   1.00 39.98  ? 179 PHE B CG  1 
ATOM   4030 C CD1 . PHE B 1 190 ? -45.040 -48.404 0.112   1.00 41.71  ? 179 PHE B CD1 1 
ATOM   4031 C CD2 . PHE B 1 190 ? -44.708 -48.259 2.484   1.00 42.30  ? 179 PHE B CD2 1 
ATOM   4032 C CE1 . PHE B 1 190 ? -43.727 -47.980 -0.101  1.00 42.13  ? 179 PHE B CE1 1 
ATOM   4033 C CE2 . PHE B 1 190 ? -43.389 -47.847 2.272   1.00 44.78  ? 179 PHE B CE2 1 
ATOM   4034 C CZ  . PHE B 1 190 ? -42.910 -47.714 0.980   1.00 43.03  ? 179 PHE B CZ  1 
ATOM   4035 N N   . HIS B 1 191 ? -49.784 -48.894 -0.019  1.00 37.35  ? 180 HIS B N   1 
ATOM   4036 C CA  . HIS B 1 191 ? -50.976 -49.680 -0.241  1.00 36.31  ? 180 HIS B CA  1 
ATOM   4037 C C   . HIS B 1 191 ? -50.361 -50.854 -0.929  1.00 36.46  ? 180 HIS B C   1 
ATOM   4038 O O   . HIS B 1 191 ? -49.526 -50.681 -1.818  1.00 34.61  ? 180 HIS B O   1 
ATOM   4039 C CB  . HIS B 1 191 ? -52.029 -48.995 -1.119  1.00 37.92  ? 180 HIS B CB  1 
ATOM   4040 C CG  . HIS B 1 191 ? -53.153 -49.917 -1.524  1.00 41.85  ? 180 HIS B CG  1 
ATOM   4041 N ND1 . HIS B 1 191 ? -54.135 -50.304 -0.625  1.00 43.95  ? 180 HIS B ND1 1 
ATOM   4042 C CD2 . HIS B 1 191 ? -53.424 -50.478 -2.729  1.00 44.05  ? 180 HIS B CD2 1 
ATOM   4043 C CE1 . HIS B 1 191 ? -54.952 -51.105 -1.299  1.00 43.55  ? 180 HIS B CE1 1 
ATOM   4044 N NE2 . HIS B 1 191 ? -54.567 -51.240 -2.569  1.00 43.85  ? 180 HIS B NE2 1 
ATOM   4045 N N   . TYR B 1 192 ? -50.694 -52.044 -0.449  1.00 32.26  ? 181 TYR B N   1 
ATOM   4046 C CA  . TYR B 1 192 ? -50.129 -53.299 -0.905  1.00 31.48  ? 181 TYR B CA  1 
ATOM   4047 C C   . TYR B 1 192 ? -51.031 -54.077 -1.831  1.00 38.17  ? 181 TYR B C   1 
ATOM   4048 O O   . TYR B 1 192 ? -52.250 -54.065 -1.660  1.00 39.71  ? 181 TYR B O   1 
ATOM   4049 C CB  . TYR B 1 192 ? -49.740 -54.145 0.302   1.00 31.51  ? 181 TYR B CB  1 
ATOM   4050 C CG  . TYR B 1 192 ? -48.660 -53.511 1.152   1.00 31.12  ? 181 TYR B CG  1 
ATOM   4051 C CD1 . TYR B 1 192 ? -47.316 -53.744 0.888   1.00 32.84  ? 181 TYR B CD1 1 
ATOM   4052 C CD2 . TYR B 1 192 ? -48.981 -52.681 2.231   1.00 30.53  ? 181 TYR B CD2 1 
ATOM   4053 C CE1 . TYR B 1 192 ? -46.312 -53.178 1.676   1.00 32.72  ? 181 TYR B CE1 1 
ATOM   4054 C CE2 . TYR B 1 192 ? -47.983 -52.115 3.032   1.00 30.38  ? 181 TYR B CE2 1 
ATOM   4055 C CZ  . TYR B 1 192 ? -46.650 -52.366 2.746   1.00 36.77  ? 181 TYR B CZ  1 
ATOM   4056 O OH  . TYR B 1 192 ? -45.650 -51.816 3.506   1.00 38.97  ? 181 TYR B OH  1 
ATOM   4057 N N   . ILE B 1 193 ? -50.435 -54.717 -2.834  1.00 35.12  ? 182 ILE B N   1 
ATOM   4058 C CA  . ILE B 1 193 ? -51.140 -55.546 -3.816  1.00 36.40  ? 182 ILE B CA  1 
ATOM   4059 C C   . ILE B 1 193 ? -50.508 -56.916 -3.739  1.00 43.07  ? 182 ILE B C   1 
ATOM   4060 O O   . ILE B 1 193 ? -49.281 -57.012 -3.858  1.00 44.93  ? 182 ILE B O   1 
ATOM   4061 C CB  . ILE B 1 193 ? -51.091 -54.946 -5.255  1.00 39.75  ? 182 ILE B CB  1 
ATOM   4062 C CG1 . ILE B 1 193 ? -51.729 -53.540 -5.279  1.00 40.01  ? 182 ILE B CG1 1 
ATOM   4063 C CG2 . ILE B 1 193 ? -51.805 -55.866 -6.262  1.00 40.18  ? 182 ILE B CG2 1 
ATOM   4064 C CD1 . ILE B 1 193 ? -50.892 -52.488 -5.813  1.00 44.61  ? 182 ILE B CD1 1 
ATOM   4065 N N   . ASN B 1 194 ? -51.312 -57.965 -3.477  1.00 39.13  ? 183 ASN B N   1 
ATOM   4066 C CA  . ASN B 1 194 ? -50.772 -59.324 -3.356  1.00 39.42  ? 183 ASN B CA  1 
ATOM   4067 C C   . ASN B 1 194 ? -50.431 -59.917 -4.713  1.00 44.24  ? 183 ASN B C   1 
ATOM   4068 O O   . ASN B 1 194 ? -51.107 -59.639 -5.703  1.00 43.44  ? 183 ASN B O   1 
ATOM   4069 C CB  . ASN B 1 194 ? -51.714 -60.267 -2.601  1.00 40.49  ? 183 ASN B CB  1 
ATOM   4070 C CG  . ASN B 1 194 ? -52.102 -59.841 -1.203  1.00 61.56  ? 183 ASN B CG  1 
ATOM   4071 O OD1 . ASN B 1 194 ? -53.290 -59.747 -0.886  1.00 61.18  ? 183 ASN B OD1 1 
ATOM   4072 N ND2 . ASN B 1 194 ? -51.131 -59.621 -0.323  1.00 45.63  ? 183 ASN B ND2 1 
ATOM   4073 N N   . LEU B 1 195 ? -49.372 -60.739 -4.745  1.00 40.86  ? 184 LEU B N   1 
ATOM   4074 C CA  . LEU B 1 195 ? -48.917 -61.450 -5.925  1.00 40.28  ? 184 LEU B CA  1 
ATOM   4075 C C   . LEU B 1 195 ? -49.942 -62.529 -6.270  1.00 47.99  ? 184 LEU B C   1 
ATOM   4076 O O   . LEU B 1 195 ? -50.552 -63.103 -5.365  1.00 46.10  ? 184 LEU B O   1 
ATOM   4077 C CB  . LEU B 1 195 ? -47.553 -62.122 -5.652  1.00 39.66  ? 184 LEU B CB  1 
ATOM   4078 C CG  . LEU B 1 195 ? -46.366 -61.244 -5.271  1.00 42.96  ? 184 LEU B CG  1 
ATOM   4079 C CD1 . LEU B 1 195 ? -45.161 -62.099 -4.976  1.00 42.88  ? 184 LEU B CD1 1 
ATOM   4080 C CD2 . LEU B 1 195 ? -46.033 -60.251 -6.362  1.00 40.46  ? 184 LEU B CD2 1 
ATOM   4081 N N   . ILE B 1 196 ? -50.104 -62.797 -7.586  1.00 49.23  ? 185 ILE B N   1 
ATOM   4082 C CA  . ILE B 1 196 ? -50.985 -63.816 -8.146  1.00 51.85  ? 185 ILE B CA  1 
ATOM   4083 C C   . ILE B 1 196 ? -50.590 -65.183 -7.560  1.00 62.42  ? 185 ILE B C   1 
ATOM   4084 O O   . ILE B 1 196 ? -51.443 -65.922 -7.050  1.00 63.13  ? 185 ILE B O   1 
ATOM   4085 C CB  . ILE B 1 196 ? -50.825 -63.827 -9.682  1.00 55.34  ? 185 ILE B CB  1 
ATOM   4086 C CG1 . ILE B 1 196 ? -51.307 -62.524 -10.350 1.00 55.21  ? 185 ILE B CG1 1 
ATOM   4087 C CG2 . ILE B 1 196 ? -51.430 -65.104 -10.309 1.00 57.54  ? 185 ILE B CG2 1 
ATOM   4088 C CD1 . ILE B 1 196 ? -52.771 -62.444 -10.585 1.00 67.63  ? 185 ILE B CD1 1 
ATOM   4089 N N   . LYS B 1 197 ? -49.284 -65.505 -7.670  1.00 61.88  ? 186 LYS B N   1 
ATOM   4090 C CA  . LYS B 1 197 ? -48.617 -66.716 -7.192  1.00 62.38  ? 186 LYS B CA  1 
ATOM   4091 C C   . LYS B 1 197 ? -47.209 -66.358 -6.739  1.00 66.79  ? 186 LYS B C   1 
ATOM   4092 O O   . LYS B 1 197 ? -46.635 -65.363 -7.194  1.00 67.63  ? 186 LYS B O   1 
ATOM   4093 C CB  . LYS B 1 197 ? -48.554 -67.775 -8.315  1.00 65.44  ? 186 LYS B CB  1 
ATOM   4094 C CG  . LYS B 1 197 ? -47.842 -67.308 -9.590  1.00 81.14  ? 186 LYS B CG  1 
ATOM   4095 C CD  . LYS B 1 197 ? -48.100 -68.231 -10.764 1.00 90.76  ? 186 LYS B CD  1 
ATOM   4096 C CE  . LYS B 1 197 ? -47.383 -67.763 -12.004 1.00 97.87  ? 186 LYS B CE  1 
ATOM   4097 N NZ  . LYS B 1 197 ? -45.954 -68.172 -12.001 1.00 105.73 ? 186 LYS B NZ  1 
ATOM   4098 N N   . THR B 1 198 ? -46.636 -67.197 -5.893  1.00 62.40  ? 187 THR B N   1 
ATOM   4099 C CA  . THR B 1 198 ? -45.267 -67.039 -5.426  1.00 61.26  ? 187 THR B CA  1 
ATOM   4100 C C   . THR B 1 198 ? -44.342 -67.375 -6.622  1.00 61.37  ? 187 THR B C   1 
ATOM   4101 O O   . THR B 1 198 ? -44.787 -68.040 -7.575  1.00 60.11  ? 187 THR B O   1 
ATOM   4102 C CB  . THR B 1 198 ? -45.070 -67.930 -4.174  1.00 72.04  ? 187 THR B CB  1 
ATOM   4103 O OG1 . THR B 1 198 ? -43.852 -67.593 -3.506  1.00 75.26  ? 187 THR B OG1 1 
ATOM   4104 C CG2 . THR B 1 198 ? -45.157 -69.438 -4.482  1.00 68.22  ? 187 THR B CG2 1 
ATOM   4105 N N   . GLY B 1 199 ? -43.107 -66.874 -6.601  1.00 54.79  ? 188 GLY B N   1 
ATOM   4106 C CA  . GLY B 1 199 ? -42.168 -67.204 -7.670  1.00 52.80  ? 188 GLY B CA  1 
ATOM   4107 C C   . GLY B 1 199 ? -41.910 -66.131 -8.703  1.00 52.69  ? 188 GLY B C   1 
ATOM   4108 O O   . GLY B 1 199 ? -40.846 -66.129 -9.322  1.00 51.56  ? 188 GLY B O   1 
ATOM   4109 N N   . VAL B 1 200 ? -42.863 -65.197 -8.885  1.00 46.20  ? 189 VAL B N   1 
ATOM   4110 C CA  . VAL B 1 200 ? -42.762 -64.106 -9.861  1.00 43.93  ? 189 VAL B CA  1 
ATOM   4111 C C   . VAL B 1 200 ? -43.312 -62.788 -9.264  1.00 46.05  ? 189 VAL B C   1 
ATOM   4112 O O   . VAL B 1 200 ? -44.363 -62.802 -8.627  1.00 46.64  ? 189 VAL B O   1 
ATOM   4113 C CB  . VAL B 1 200 ? -43.377 -64.515 -11.263 1.00 46.28  ? 189 VAL B CB  1 
ATOM   4114 C CG1 . VAL B 1 200 ? -44.837 -64.931 -11.170 1.00 46.28  ? 189 VAL B CG1 1 
ATOM   4115 C CG2 . VAL B 1 200 ? -43.198 -63.449 -12.341 1.00 45.30  ? 189 VAL B CG2 1 
ATOM   4116 N N   . TRP B 1 201 ? -42.597 -61.662 -9.453  1.00 40.95  ? 190 TRP B N   1 
ATOM   4117 C CA  . TRP B 1 201 ? -43.045 -60.347 -8.965  1.00 39.87  ? 190 TRP B CA  1 
ATOM   4118 C C   . TRP B 1 201 ? -44.113 -59.812 -9.936  1.00 44.53  ? 190 TRP B C   1 
ATOM   4119 O O   . TRP B 1 201 ? -43.896 -58.855 -10.675 1.00 45.97  ? 190 TRP B O   1 
ATOM   4120 C CB  . TRP B 1 201 ? -41.862 -59.367 -8.795  1.00 37.36  ? 190 TRP B CB  1 
ATOM   4121 C CG  . TRP B 1 201 ? -40.933 -59.686 -7.647  1.00 37.21  ? 190 TRP B CG  1 
ATOM   4122 C CD1 . TRP B 1 201 ? -39.614 -60.033 -7.735  1.00 40.11  ? 190 TRP B CD1 1 
ATOM   4123 C CD2 . TRP B 1 201 ? -41.238 -59.633 -6.242  1.00 36.13  ? 190 TRP B CD2 1 
ATOM   4124 N NE1 . TRP B 1 201 ? -39.074 -60.180 -6.473  1.00 39.00  ? 190 TRP B NE1 1 
ATOM   4125 C CE2 . TRP B 1 201 ? -40.049 -59.951 -5.540  1.00 39.89  ? 190 TRP B CE2 1 
ATOM   4126 C CE3 . TRP B 1 201 ? -42.393 -59.328 -5.506  1.00 36.59  ? 190 TRP B CE3 1 
ATOM   4127 C CZ2 . TRP B 1 201 ? -39.987 -59.989 -4.140  1.00 38.59  ? 190 TRP B CZ2 1 
ATOM   4128 C CZ3 . TRP B 1 201 ? -42.330 -59.372 -4.119  1.00 37.74  ? 190 TRP B CZ3 1 
ATOM   4129 C CH2 . TRP B 1 201 ? -41.141 -59.702 -3.452  1.00 38.50  ? 190 TRP B CH2 1 
ATOM   4130 N N   . GLN B 1 202 ? -45.257 -60.486 -9.953  1.00 40.06  ? 191 GLN B N   1 
ATOM   4131 C CA  . GLN B 1 202 ? -46.367 -60.217 -10.861 1.00 39.07  ? 191 GLN B CA  1 
ATOM   4132 C C   . GLN B 1 202 ? -47.675 -60.160 -10.087 1.00 42.46  ? 191 GLN B C   1 
ATOM   4133 O O   . GLN B 1 202 ? -47.926 -60.974 -9.195  1.00 42.16  ? 191 GLN B O   1 
ATOM   4134 C CB  . GLN B 1 202 ? -46.398 -61.304 -11.944 1.00 40.25  ? 191 GLN B CB  1 
ATOM   4135 C CG  . GLN B 1 202 ? -47.344 -61.054 -13.114 1.00 47.87  ? 191 GLN B CG  1 
ATOM   4136 C CD  . GLN B 1 202 ? -47.228 -62.171 -14.118 1.00 66.22  ? 191 GLN B CD  1 
ATOM   4137 O OE1 . GLN B 1 202 ? -46.872 -61.954 -15.268 1.00 58.66  ? 191 GLN B OE1 1 
ATOM   4138 N NE2 . GLN B 1 202 ? -47.458 -63.407 -13.694 1.00 64.65  ? 191 GLN B NE2 1 
ATOM   4139 N N   . ILE B 1 203 ? -48.492 -59.166 -10.418 1.00 38.55  ? 192 ILE B N   1 
ATOM   4140 C CA  . ILE B 1 203 ? -49.760 -58.875 -9.768  1.00 38.32  ? 192 ILE B CA  1 
ATOM   4141 C C   . ILE B 1 203 ? -50.863 -58.769 -10.811 1.00 44.14  ? 192 ILE B C   1 
ATOM   4142 O O   . ILE B 1 203 ? -50.579 -58.577 -11.995 1.00 43.26  ? 192 ILE B O   1 
ATOM   4143 C CB  . ILE B 1 203 ? -49.647 -57.564 -8.911  1.00 41.40  ? 192 ILE B CB  1 
ATOM   4144 C CG1 . ILE B 1 203 ? -49.201 -56.338 -9.766  1.00 41.21  ? 192 ILE B CG1 1 
ATOM   4145 C CG2 . ILE B 1 203 ? -48.756 -57.766 -7.684  1.00 41.39  ? 192 ILE B CG2 1 
ATOM   4146 C CD1 . ILE B 1 203 ? -49.412 -54.966 -9.109  1.00 44.53  ? 192 ILE B CD1 1 
ATOM   4147 N N   . GLN B 1 204 ? -52.121 -58.879 -10.365 1.00 43.12  ? 193 GLN B N   1 
ATOM   4148 C CA  . GLN B 1 204 ? -53.306 -58.762 -11.203 1.00 43.56  ? 193 GLN B CA  1 
ATOM   4149 C C   . GLN B 1 204 ? -53.554 -57.269 -11.450 1.00 47.87  ? 193 GLN B C   1 
ATOM   4150 O O   . GLN B 1 204 ? -53.448 -56.461 -10.519 1.00 48.37  ? 193 GLN B O   1 
ATOM   4151 C CB  . GLN B 1 204 ? -54.519 -59.388 -10.464 1.00 45.18  ? 193 GLN B CB  1 
ATOM   4152 C CG  . GLN B 1 204 ? -55.847 -59.420 -11.237 1.00 61.45  ? 193 GLN B CG  1 
ATOM   4153 C CD  . GLN B 1 204 ? -55.885 -60.502 -12.286 1.00 88.00  ? 193 GLN B CD  1 
ATOM   4154 O OE1 . GLN B 1 204 ? -55.771 -61.697 -11.992 1.00 82.93  ? 193 GLN B OE1 1 
ATOM   4155 N NE2 . GLN B 1 204 ? -56.077 -60.108 -13.536 1.00 85.47  ? 193 GLN B NE2 1 
ATOM   4156 N N   . MET B 1 205 ? -53.887 -56.912 -12.687 1.00 43.29  ? 194 MET B N   1 
ATOM   4157 C CA  . MET B 1 205 ? -54.229 -55.540 -13.068 1.00 43.44  ? 194 MET B CA  1 
ATOM   4158 C C   . MET B 1 205 ? -55.663 -55.553 -13.612 1.00 49.76  ? 194 MET B C   1 
ATOM   4159 O O   . MET B 1 205 ? -56.009 -56.397 -14.446 1.00 50.15  ? 194 MET B O   1 
ATOM   4160 C CB  . MET B 1 205 ? -53.220 -54.970 -14.084 1.00 45.39  ? 194 MET B CB  1 
ATOM   4161 C CG  . MET B 1 205 ? -53.562 -53.566 -14.537 1.00 48.59  ? 194 MET B CG  1 
ATOM   4162 S SD  . MET B 1 205 ? -52.139 -52.553 -14.972 1.00 52.12  ? 194 MET B SD  1 
ATOM   4163 C CE  . MET B 1 205 ? -51.697 -53.280 -16.522 1.00 49.15  ? 194 MET B CE  1 
ATOM   4164 N N   . LYS B 1 206 ? -56.494 -54.646 -13.125 1.00 47.28  ? 195 LYS B N   1 
ATOM   4165 C CA  . LYS B 1 206 ? -57.896 -54.629 -13.512 1.00 48.51  ? 195 LYS B CA  1 
ATOM   4166 C C   . LYS B 1 206 ? -58.315 -53.384 -14.321 1.00 52.75  ? 195 LYS B C   1 
ATOM   4167 O O   . LYS B 1 206 ? -59.270 -52.687 -13.970 1.00 52.59  ? 195 LYS B O   1 
ATOM   4168 C CB  . LYS B 1 206 ? -58.788 -54.885 -12.268 1.00 52.66  ? 195 LYS B CB  1 
ATOM   4169 C CG  . LYS B 1 206 ? -60.105 -55.612 -12.576 1.00 79.19  ? 195 LYS B CG  1 
ATOM   4170 C CD  . LYS B 1 206 ? -60.977 -55.788 -11.321 1.00 94.19  ? 195 LYS B CD  1 
ATOM   4171 C CE  . LYS B 1 206 ? -60.880 -57.167 -10.692 1.00 107.43 ? 195 LYS B CE  1 
ATOM   4172 N NZ  . LYS B 1 206 ? -59.570 -57.408 -10.021 1.00 115.68 ? 195 LYS B NZ  1 
ATOM   4173 N N   . GLY B 1 207 ? -57.589 -53.118 -15.397 1.00 49.12  ? 196 GLY B N   1 
ATOM   4174 C CA  . GLY B 1 207 ? -57.909 -52.011 -16.288 1.00 48.91  ? 196 GLY B CA  1 
ATOM   4175 C C   . GLY B 1 207 ? -56.848 -50.951 -16.476 1.00 52.86  ? 196 GLY B C   1 
ATOM   4176 O O   . GLY B 1 207 ? -56.114 -50.625 -15.541 1.00 53.86  ? 196 GLY B O   1 
ATOM   4177 N N   . VAL B 1 208 ? -56.764 -50.409 -17.706 1.00 47.31  ? 197 VAL B N   1 
ATOM   4178 C CA  . VAL B 1 208 ? -55.860 -49.320 -18.072 1.00 46.39  ? 197 VAL B CA  1 
ATOM   4179 C C   . VAL B 1 208 ? -56.734 -48.231 -18.699 1.00 51.45  ? 197 VAL B C   1 
ATOM   4180 O O   . VAL B 1 208 ? -57.360 -48.458 -19.734 1.00 50.35  ? 197 VAL B O   1 
ATOM   4181 C CB  . VAL B 1 208 ? -54.644 -49.743 -18.954 1.00 49.49  ? 197 VAL B CB  1 
ATOM   4182 C CG1 . VAL B 1 208 ? -53.756 -48.544 -19.273 1.00 48.99  ? 197 VAL B CG1 1 
ATOM   4183 C CG2 . VAL B 1 208 ? -53.820 -50.851 -18.287 1.00 48.99  ? 197 VAL B CG2 1 
ATOM   4184 N N   . SER B 1 209 ? -56.819 -47.073 -18.022 1.00 50.99  ? 198 SER B N   1 
ATOM   4185 C CA  . SER B 1 209 ? -57.647 -45.931 -18.414 1.00 52.00  ? 198 SER B CA  1 
ATOM   4186 C C   . SER B 1 209 ? -56.824 -44.838 -19.078 1.00 59.33  ? 198 SER B C   1 
ATOM   4187 O O   . SER B 1 209 ? -55.796 -44.419 -18.547 1.00 59.20  ? 198 SER B O   1 
ATOM   4188 C CB  . SER B 1 209 ? -58.365 -45.336 -17.202 1.00 55.18  ? 198 SER B CB  1 
ATOM   4189 O OG  . SER B 1 209 ? -58.705 -46.310 -16.230 1.00 68.07  ? 198 SER B OG  1 
ATOM   4190 N N   . VAL B 1 210 ? -57.293 -44.370 -20.231 1.00 57.63  ? 199 VAL B N   1 
ATOM   4191 C CA  . VAL B 1 210 ? -56.698 -43.274 -20.980 1.00 57.96  ? 199 VAL B CA  1 
ATOM   4192 C C   . VAL B 1 210 ? -57.734 -42.154 -20.861 1.00 66.24  ? 199 VAL B C   1 
ATOM   4193 O O   . VAL B 1 210 ? -58.806 -42.231 -21.462 1.00 66.37  ? 199 VAL B O   1 
ATOM   4194 C CB  . VAL B 1 210 ? -56.388 -43.662 -22.450 1.00 60.78  ? 199 VAL B CB  1 
ATOM   4195 C CG1 . VAL B 1 210 ? -55.760 -42.496 -23.183 1.00 60.56  ? 199 VAL B CG1 1 
ATOM   4196 C CG2 . VAL B 1 210 ? -55.486 -44.893 -22.531 1.00 60.19  ? 199 VAL B CG2 1 
ATOM   4197 N N   . GLY B 1 211 ? -57.432 -41.162 -20.034 1.00 66.19  ? 200 GLY B N   1 
ATOM   4198 C CA  . GLY B 1 211 ? -58.348 -40.069 -19.759 1.00 67.88  ? 200 GLY B CA  1 
ATOM   4199 C C   . GLY B 1 211 ? -59.494 -40.551 -18.893 1.00 77.19  ? 200 GLY B C   1 
ATOM   4200 O O   . GLY B 1 211 ? -59.264 -41.134 -17.830 1.00 77.29  ? 200 GLY B O   1 
ATOM   4201 N N   . SER B 1 212 ? -60.735 -40.349 -19.354 1.00 77.45  ? 201 SER B N   1 
ATOM   4202 C CA  . SER B 1 212 ? -61.934 -40.772 -18.617 1.00 78.87  ? 201 SER B CA  1 
ATOM   4203 C C   . SER B 1 212 ? -62.227 -42.279 -18.800 1.00 83.94  ? 201 SER B C   1 
ATOM   4204 O O   . SER B 1 212 ? -62.443 -42.994 -17.817 1.00 83.34  ? 201 SER B O   1 
ATOM   4205 C CB  . SER B 1 212 ? -63.144 -39.931 -19.029 1.00 83.54  ? 201 SER B CB  1 
ATOM   4206 O OG  . SER B 1 212 ? -63.538 -40.169 -20.373 1.00 95.07  ? 201 SER B OG  1 
ATOM   4207 N N   . SER B 1 213 ? -62.180 -42.743 -20.069 1.00 80.42  ? 202 SER B N   1 
ATOM   4208 C CA  . SER B 1 213 ? -62.475 -44.100 -20.537 1.00 79.77  ? 202 SER B CA  1 
ATOM   4209 C C   . SER B 1 213 ? -61.439 -45.209 -20.235 1.00 81.34  ? 202 SER B C   1 
ATOM   4210 O O   . SER B 1 213 ? -60.246 -45.026 -20.490 1.00 80.95  ? 202 SER B O   1 
ATOM   4211 C CB  . SER B 1 213 ? -62.827 -44.079 -22.026 1.00 83.25  ? 202 SER B CB  1 
ATOM   4212 O OG  . SER B 1 213 ? -62.069 -43.136 -22.770 1.00 90.35  ? 202 SER B OG  1 
ATOM   4213 N N   . THR B 1 214 ? -61.925 -46.387 -19.757 1.00 75.59  ? 203 THR B N   1 
ATOM   4214 C CA  . THR B 1 214 ? -61.088 -47.565 -19.479 1.00 74.03  ? 203 THR B CA  1 
ATOM   4215 C C   . THR B 1 214 ? -60.892 -48.318 -20.803 1.00 75.33  ? 203 THR B C   1 
ATOM   4216 O O   . THR B 1 214 ? -61.554 -49.320 -21.080 1.00 74.79  ? 203 THR B O   1 
ATOM   4217 C CB  . THR B 1 214 ? -61.657 -48.405 -18.313 1.00 76.54  ? 203 THR B CB  1 
ATOM   4218 O OG1 . THR B 1 214 ? -61.852 -47.555 -17.178 1.00 72.44  ? 203 THR B OG1 1 
ATOM   4219 C CG2 . THR B 1 214 ? -60.753 -49.587 -17.935 1.00 72.79  ? 203 THR B CG2 1 
ATOM   4220 N N   . LEU B 1 215 ? -59.988 -47.778 -21.624 1.00 70.27  ? 204 LEU B N   1 
ATOM   4221 C CA  . LEU B 1 215 ? -59.619 -48.240 -22.960 1.00 69.05  ? 204 LEU B CA  1 
ATOM   4222 C C   . LEU B 1 215 ? -59.223 -49.708 -23.025 1.00 68.91  ? 204 LEU B C   1 
ATOM   4223 O O   . LEU B 1 215 ? -59.566 -50.390 -23.996 1.00 68.68  ? 204 LEU B O   1 
ATOM   4224 C CB  . LEU B 1 215 ? -58.430 -47.386 -23.479 1.00 69.34  ? 204 LEU B CB  1 
ATOM   4225 C CG  . LEU B 1 215 ? -58.668 -46.194 -24.428 1.00 74.18  ? 204 LEU B CG  1 
ATOM   4226 C CD1 . LEU B 1 215 ? -58.881 -46.642 -25.859 1.00 74.34  ? 204 LEU B CD1 1 
ATOM   4227 C CD2 . LEU B 1 215 ? -59.722 -45.207 -23.909 1.00 76.36  ? 204 LEU B CD2 1 
ATOM   4228 N N   . LEU B 1 216 ? -58.447 -50.176 -22.038 1.00 62.06  ? 205 LEU B N   1 
ATOM   4229 C CA  . LEU B 1 216 ? -57.855 -51.511 -22.072 1.00 60.28  ? 205 LEU B CA  1 
ATOM   4230 C C   . LEU B 1 216 ? -57.917 -52.250 -20.763 1.00 61.40  ? 205 LEU B C   1 
ATOM   4231 O O   . LEU B 1 216 ? -58.258 -51.673 -19.733 1.00 59.72  ? 205 LEU B O   1 
ATOM   4232 C CB  . LEU B 1 216 ? -56.366 -51.376 -22.476 1.00 60.30  ? 205 LEU B CB  1 
ATOM   4233 C CG  . LEU B 1 216 ? -56.044 -51.009 -23.913 1.00 64.67  ? 205 LEU B CG  1 
ATOM   4234 C CD1 . LEU B 1 216 ? -54.931 -49.998 -23.956 1.00 64.36  ? 205 LEU B CD1 1 
ATOM   4235 C CD2 . LEU B 1 216 ? -55.695 -52.249 -24.734 1.00 68.23  ? 205 LEU B CD2 1 
ATOM   4236 N N   . CYS B 1 217 ? -57.537 -53.549 -20.812 1.00 58.34  ? 206 CYS B N   1 
ATOM   4237 C CA  . CYS B 1 217 ? -57.424 -54.464 -19.678 1.00 58.56  ? 206 CYS B CA  1 
ATOM   4238 C C   . CYS B 1 217 ? -58.702 -54.612 -18.811 1.00 67.06  ? 206 CYS B C   1 
ATOM   4239 O O   . CYS B 1 217 ? -58.631 -54.996 -17.636 1.00 65.79  ? 206 CYS B O   1 
ATOM   4240 C CB  . CYS B 1 217 ? -56.177 -54.141 -18.853 1.00 58.22  ? 206 CYS B CB  1 
ATOM   4241 S SG  . CYS B 1 217 ? -55.856 -55.286 -17.493 1.00 61.82  ? 206 CYS B SG  1 
ATOM   4242 N N   . GLU B 1 218 ? -59.886 -54.353 -19.416 1.00 67.69  ? 207 GLU B N   1 
ATOM   4243 C CA  . GLU B 1 218 ? -61.171 -54.567 -18.745 1.00 69.02  ? 207 GLU B CA  1 
ATOM   4244 C C   . GLU B 1 218 ? -61.311 -56.093 -18.639 1.00 75.51  ? 207 GLU B C   1 
ATOM   4245 O O   . GLU B 1 218 ? -60.831 -56.809 -19.534 1.00 76.38  ? 207 GLU B O   1 
ATOM   4246 C CB  . GLU B 1 218 ? -62.344 -53.916 -19.505 1.00 70.76  ? 207 GLU B CB  1 
ATOM   4247 C CG  . GLU B 1 218 ? -62.553 -54.373 -20.945 1.00 87.67  ? 207 GLU B CG  1 
ATOM   4248 C CD  . GLU B 1 218 ? -61.731 -53.650 -21.997 1.00 121.38 ? 207 GLU B CD  1 
ATOM   4249 O OE1 . GLU B 1 218 ? -61.834 -52.404 -22.082 1.00 124.86 ? 207 GLU B OE1 1 
ATOM   4250 O OE2 . GLU B 1 218 ? -61.013 -54.336 -22.762 1.00 114.98 ? 207 GLU B OE2 1 
ATOM   4251 N N   . ASP B 1 219 ? -61.846 -56.593 -17.512 1.00 71.95  ? 208 ASP B N   1 
ATOM   4252 C CA  . ASP B 1 219 ? -61.959 -58.040 -17.234 1.00 72.14  ? 208 ASP B CA  1 
ATOM   4253 C C   . ASP B 1 219 ? -60.594 -58.661 -16.850 1.00 72.38  ? 208 ASP B C   1 
ATOM   4254 O O   . ASP B 1 219 ? -60.429 -59.887 -16.861 1.00 71.91  ? 208 ASP B O   1 
ATOM   4255 C CB  . ASP B 1 219 ? -62.673 -58.836 -18.368 1.00 75.10  ? 208 ASP B CB  1 
ATOM   4256 C CG  . ASP B 1 219 ? -64.120 -58.441 -18.689 1.00 89.16  ? 208 ASP B CG  1 
ATOM   4257 O OD1 . ASP B 1 219 ? -64.802 -57.856 -17.796 1.00 89.16  ? 208 ASP B OD1 1 
ATOM   4258 O OD2 . ASP B 1 219 ? -64.586 -58.758 -19.811 1.00 96.73  ? 208 ASP B OD2 1 
ATOM   4259 N N   . GLY B 1 220 ? -59.650 -57.790 -16.492 1.00 66.17  ? 209 GLY B N   1 
ATOM   4260 C CA  . GLY B 1 220 ? -58.327 -58.151 -16.004 1.00 64.22  ? 209 GLY B CA  1 
ATOM   4261 C C   . GLY B 1 220 ? -57.265 -58.528 -17.015 1.00 63.95  ? 209 GLY B C   1 
ATOM   4262 O O   . GLY B 1 220 ? -57.565 -58.876 -18.159 1.00 63.15  ? 209 GLY B O   1 
ATOM   4263 N N   . CYS B 1 221 ? -55.998 -58.419 -16.572 1.00 57.65  ? 210 CYS B N   1 
ATOM   4264 C CA  . CYS B 1 221 ? -54.747 -58.761 -17.256 1.00 56.28  ? 210 CYS B CA  1 
ATOM   4265 C C   . CYS B 1 221 ? -53.626 -58.769 -16.215 1.00 54.83  ? 210 CYS B C   1 
ATOM   4266 O O   . CYS B 1 221 ? -53.893 -58.532 -15.040 1.00 53.30  ? 210 CYS B O   1 
ATOM   4267 C CB  . CYS B 1 221 ? -54.444 -57.818 -18.419 1.00 57.34  ? 210 CYS B CB  1 
ATOM   4268 S SG  . CYS B 1 221 ? -54.062 -56.121 -17.923 1.00 61.74  ? 210 CYS B SG  1 
ATOM   4269 N N   . LEU B 1 222 ? -52.384 -59.057 -16.628 1.00 48.59  ? 211 LEU B N   1 
ATOM   4270 C CA  . LEU B 1 222 ? -51.253 -59.140 -15.696 1.00 46.59  ? 211 LEU B CA  1 
ATOM   4271 C C   . LEU B 1 222 ? -50.260 -57.976 -15.782 1.00 47.55  ? 211 LEU B C   1 
ATOM   4272 O O   . LEU B 1 222 ? -50.113 -57.342 -16.833 1.00 46.72  ? 211 LEU B O   1 
ATOM   4273 C CB  . LEU B 1 222 ? -50.506 -60.478 -15.861 1.00 46.19  ? 211 LEU B CB  1 
ATOM   4274 C CG  . LEU B 1 222 ? -51.318 -61.764 -15.898 1.00 50.01  ? 211 LEU B CG  1 
ATOM   4275 C CD1 . LEU B 1 222 ? -50.465 -62.916 -16.399 1.00 49.47  ? 211 LEU B CD1 1 
ATOM   4276 C CD2 . LEU B 1 222 ? -51.930 -62.071 -14.529 1.00 50.84  ? 211 LEU B CD2 1 
ATOM   4277 N N   . ALA B 1 223 ? -49.553 -57.723 -14.664 1.00 41.79  ? 212 ALA B N   1 
ATOM   4278 C CA  . ALA B 1 223 ? -48.525 -56.688 -14.566 1.00 39.67  ? 212 ALA B CA  1 
ATOM   4279 C C   . ALA B 1 223 ? -47.298 -57.196 -13.796 1.00 41.26  ? 212 ALA B C   1 
ATOM   4280 O O   . ALA B 1 223 ? -47.361 -57.478 -12.600 1.00 39.57  ? 212 ALA B O   1 
ATOM   4281 C CB  . ALA B 1 223 ? -49.083 -55.431 -13.923 1.00 39.94  ? 212 ALA B CB  1 
ATOM   4282 N N   . LEU B 1 224 ? -46.191 -57.348 -14.505 1.00 38.45  ? 213 LEU B N   1 
ATOM   4283 C CA  . LEU B 1 224 ? -44.920 -57.735 -13.905 1.00 38.44  ? 213 LEU B CA  1 
ATOM   4284 C C   . LEU B 1 224 ? -44.247 -56.428 -13.425 1.00 40.62  ? 213 LEU B C   1 
ATOM   4285 O O   . LEU B 1 224 ? -44.239 -55.451 -14.170 1.00 39.69  ? 213 LEU B O   1 
ATOM   4286 C CB  . LEU B 1 224 ? -44.088 -58.474 -14.980 1.00 38.84  ? 213 LEU B CB  1 
ATOM   4287 C CG  . LEU B 1 224 ? -42.639 -58.846 -14.675 1.00 44.33  ? 213 LEU B CG  1 
ATOM   4288 C CD1 . LEU B 1 224 ? -42.528 -59.910 -13.576 1.00 44.11  ? 213 LEU B CD1 1 
ATOM   4289 C CD2 . LEU B 1 224 ? -41.949 -59.315 -15.937 1.00 46.73  ? 213 LEU B CD2 1 
ATOM   4290 N N   . VAL B 1 225 ? -43.802 -56.365 -12.164 1.00 36.76  ? 214 VAL B N   1 
ATOM   4291 C CA  . VAL B 1 225 ? -43.136 -55.155 -11.653 1.00 36.05  ? 214 VAL B CA  1 
ATOM   4292 C C   . VAL B 1 225 ? -41.633 -55.418 -11.815 1.00 38.11  ? 214 VAL B C   1 
ATOM   4293 O O   . VAL B 1 225 ? -41.018 -56.135 -11.019 1.00 36.24  ? 214 VAL B O   1 
ATOM   4294 C CB  . VAL B 1 225 ? -43.571 -54.748 -10.212 1.00 40.20  ? 214 VAL B CB  1 
ATOM   4295 C CG1 . VAL B 1 225 ? -42.848 -53.482 -9.750  1.00 39.95  ? 214 VAL B CG1 1 
ATOM   4296 C CG2 . VAL B 1 225 ? -45.079 -54.550 -10.130 1.00 39.71  ? 214 VAL B CG2 1 
ATOM   4297 N N   . ASP B 1 226 ? -41.080 -54.918 -12.922 1.00 36.29  ? 215 ASP B N   1 
ATOM   4298 C CA  . ASP B 1 226 ? -39.694 -55.151 -13.333 1.00 36.89  ? 215 ASP B CA  1 
ATOM   4299 C C   . ASP B 1 226 ? -38.807 -53.898 -13.206 1.00 42.92  ? 215 ASP B C   1 
ATOM   4300 O O   . ASP B 1 226 ? -38.881 -52.994 -14.042 1.00 42.54  ? 215 ASP B O   1 
ATOM   4301 C CB  . ASP B 1 226 ? -39.702 -55.680 -14.779 1.00 38.50  ? 215 ASP B CB  1 
ATOM   4302 C CG  . ASP B 1 226 ? -38.388 -56.243 -15.292 1.00 49.01  ? 215 ASP B CG  1 
ATOM   4303 O OD1 . ASP B 1 226 ? -37.327 -55.831 -14.783 1.00 50.24  ? 215 ASP B OD1 1 
ATOM   4304 O OD2 . ASP B 1 226 ? -38.422 -57.037 -16.257 1.00 51.99  ? 215 ASP B OD2 1 
ATOM   4305 N N   . THR B 1 227 ? -37.935 -53.882 -12.179 1.00 38.82  ? 216 THR B N   1 
ATOM   4306 C CA  . THR B 1 227 ? -36.997 -52.786 -11.891 1.00 37.58  ? 216 THR B CA  1 
ATOM   4307 C C   . THR B 1 227 ? -35.911 -52.595 -12.964 1.00 40.33  ? 216 THR B C   1 
ATOM   4308 O O   . THR B 1 227 ? -35.359 -51.504 -13.077 1.00 40.08  ? 216 THR B O   1 
ATOM   4309 C CB  . THR B 1 227 ? -36.414 -52.944 -10.487 1.00 40.79  ? 216 THR B CB  1 
ATOM   4310 O OG1 . THR B 1 227 ? -35.750 -54.208 -10.401 1.00 38.50  ? 216 THR B OG1 1 
ATOM   4311 C CG2 . THR B 1 227 ? -37.488 -52.850 -9.391  1.00 37.00  ? 216 THR B CG2 1 
ATOM   4312 N N   . GLY B 1 228 ? -35.610 -53.650 -13.724 1.00 36.50  ? 217 GLY B N   1 
ATOM   4313 C CA  . GLY B 1 228 ? -34.631 -53.622 -14.810 1.00 35.89  ? 217 GLY B CA  1 
ATOM   4314 C C   . GLY B 1 228 ? -35.184 -53.132 -16.148 1.00 40.18  ? 217 GLY B C   1 
ATOM   4315 O O   . GLY B 1 228 ? -34.419 -52.740 -17.030 1.00 41.14  ? 217 GLY B O   1 
ATOM   4316 N N   . ALA B 1 229 ? -36.516 -53.156 -16.326 1.00 35.45  ? 218 ALA B N   1 
ATOM   4317 C CA  . ALA B 1 229 ? -37.152 -52.695 -17.553 1.00 34.67  ? 218 ALA B CA  1 
ATOM   4318 C C   . ALA B 1 229 ? -37.154 -51.171 -17.574 1.00 39.06  ? 218 ALA B C   1 
ATOM   4319 O O   . ALA B 1 229 ? -37.561 -50.540 -16.590 1.00 38.53  ? 218 ALA B O   1 
ATOM   4320 C CB  . ALA B 1 229 ? -38.574 -53.224 -17.636 1.00 35.16  ? 218 ALA B CB  1 
ATOM   4321 N N   . SER B 1 230 ? -36.712 -50.580 -18.702 1.00 35.54  ? 219 SER B N   1 
ATOM   4322 C CA  . SER B 1 230 ? -36.613 -49.127 -18.865 1.00 35.64  ? 219 SER B CA  1 
ATOM   4323 C C   . SER B 1 230 ? -37.957 -48.394 -18.872 1.00 41.23  ? 219 SER B C   1 
ATOM   4324 O O   . SER B 1 230 ? -38.043 -47.246 -18.430 1.00 41.38  ? 219 SER B O   1 
ATOM   4325 C CB  . SER B 1 230 ? -35.851 -48.793 -20.142 1.00 39.08  ? 219 SER B CB  1 
ATOM   4326 O OG  . SER B 1 230 ? -34.495 -49.197 -20.057 1.00 50.50  ? 219 SER B OG  1 
ATOM   4327 N N   . TYR B 1 231 ? -38.988 -49.029 -19.409 1.00 38.47  ? 220 TYR B N   1 
ATOM   4328 C CA  . TYR B 1 231 ? -40.268 -48.358 -19.603 1.00 38.65  ? 220 TYR B CA  1 
ATOM   4329 C C   . TYR B 1 231 ? -41.438 -49.138 -19.081 1.00 41.88  ? 220 TYR B C   1 
ATOM   4330 O O   . TYR B 1 231 ? -41.286 -50.222 -18.511 1.00 42.44  ? 220 TYR B O   1 
ATOM   4331 C CB  . TYR B 1 231 ? -40.500 -48.200 -21.126 1.00 39.92  ? 220 TYR B CB  1 
ATOM   4332 C CG  . TYR B 1 231 ? -39.267 -47.842 -21.921 1.00 41.95  ? 220 TYR B CG  1 
ATOM   4333 C CD1 . TYR B 1 231 ? -38.738 -46.552 -21.884 1.00 43.24  ? 220 TYR B CD1 1 
ATOM   4334 C CD2 . TYR B 1 231 ? -38.625 -48.792 -22.714 1.00 43.04  ? 220 TYR B CD2 1 
ATOM   4335 C CE1 . TYR B 1 231 ? -37.596 -46.221 -22.605 1.00 43.62  ? 220 TYR B CE1 1 
ATOM   4336 C CE2 . TYR B 1 231 ? -37.486 -48.467 -23.451 1.00 43.93  ? 220 TYR B CE2 1 
ATOM   4337 C CZ  . TYR B 1 231 ? -36.984 -47.177 -23.403 1.00 53.47  ? 220 TYR B CZ  1 
ATOM   4338 O OH  . TYR B 1 231 ? -35.879 -46.846 -24.153 1.00 60.12  ? 220 TYR B OH  1 
ATOM   4339 N N   . ILE B 1 232 ? -42.629 -48.620 -19.376 1.00 35.89  ? 221 ILE B N   1 
ATOM   4340 C CA  . ILE B 1 232 ? -43.852 -49.355 -19.146 1.00 34.42  ? 221 ILE B CA  1 
ATOM   4341 C C   . ILE B 1 232 ? -44.036 -50.075 -20.483 1.00 40.64  ? 221 ILE B C   1 
ATOM   4342 O O   . ILE B 1 232 ? -43.951 -49.441 -21.547 1.00 39.89  ? 221 ILE B O   1 
ATOM   4343 C CB  . ILE B 1 232 ? -45.049 -48.454 -18.792 1.00 36.25  ? 221 ILE B CB  1 
ATOM   4344 C CG1 . ILE B 1 232 ? -44.973 -48.025 -17.327 1.00 35.27  ? 221 ILE B CG1 1 
ATOM   4345 C CG2 . ILE B 1 232 ? -46.391 -49.163 -19.080 1.00 36.22  ? 221 ILE B CG2 1 
ATOM   4346 C CD1 . ILE B 1 232 ? -45.764 -46.846 -17.033 1.00 40.23  ? 221 ILE B CD1 1 
ATOM   4347 N N   . SER B 1 233 ? -44.178 -51.406 -20.437 1.00 38.65  ? 222 SER B N   1 
ATOM   4348 C CA  . SER B 1 233 ? -44.393 -52.177 -21.659 1.00 38.28  ? 222 SER B CA  1 
ATOM   4349 C C   . SER B 1 233 ? -45.700 -52.950 -21.602 1.00 45.40  ? 222 SER B C   1 
ATOM   4350 O O   . SER B 1 233 ? -46.184 -53.305 -20.535 1.00 45.23  ? 222 SER B O   1 
ATOM   4351 C CB  . SER B 1 233 ? -43.205 -53.085 -21.980 1.00 38.28  ? 222 SER B CB  1 
ATOM   4352 O OG  . SER B 1 233 ? -43.096 -54.186 -21.098 1.00 43.06  ? 222 SER B OG  1 
ATOM   4353 N N   . GLY B 1 234 ? -46.259 -53.166 -22.764 1.00 44.63  ? 223 GLY B N   1 
ATOM   4354 C CA  . GLY B 1 234 ? -47.461 -53.946 -22.970 1.00 45.52  ? 223 GLY B CA  1 
ATOM   4355 C C   . GLY B 1 234 ? -47.258 -54.782 -24.217 1.00 51.35  ? 223 GLY B C   1 
ATOM   4356 O O   . GLY B 1 234 ? -46.210 -54.688 -24.879 1.00 50.58  ? 223 GLY B O   1 
ATOM   4357 N N   . SER B 1 235 ? -48.267 -55.606 -24.552 1.00 48.04  ? 224 SER B N   1 
ATOM   4358 C CA  . SER B 1 235 ? -48.242 -56.450 -25.745 1.00 46.95  ? 224 SER B CA  1 
ATOM   4359 C C   . SER B 1 235 ? -48.338 -55.517 -26.936 1.00 50.84  ? 224 SER B C   1 
ATOM   4360 O O   . SER B 1 235 ? -48.872 -54.418 -26.789 1.00 50.30  ? 224 SER B O   1 
ATOM   4361 C CB  . SER B 1 235 ? -49.427 -57.414 -25.734 1.00 48.75  ? 224 SER B CB  1 
ATOM   4362 O OG  . SER B 1 235 ? -50.662 -56.711 -25.770 1.00 49.71  ? 224 SER B OG  1 
ATOM   4363 N N   . THR B 1 236 ? -47.824 -55.933 -28.105 1.00 49.10  ? 225 THR B N   1 
ATOM   4364 C CA  . THR B 1 236 ? -47.869 -55.110 -29.320 1.00 48.95  ? 225 THR B CA  1 
ATOM   4365 C C   . THR B 1 236 ? -49.283 -54.584 -29.620 1.00 52.75  ? 225 THR B C   1 
ATOM   4366 O O   . THR B 1 236 ? -49.429 -53.393 -29.896 1.00 54.11  ? 225 THR B O   1 
ATOM   4367 C CB  . THR B 1 236 ? -47.135 -55.780 -30.493 1.00 56.10  ? 225 THR B CB  1 
ATOM   4368 O OG1 . THR B 1 236 ? -45.813 -56.112 -30.062 1.00 55.29  ? 225 THR B OG1 1 
ATOM   4369 C CG2 . THR B 1 236 ? -47.015 -54.859 -31.701 1.00 54.91  ? 225 THR B CG2 1 
ATOM   4370 N N   . SER B 1 237 ? -50.314 -55.436 -29.472 1.00 47.76  ? 226 SER B N   1 
ATOM   4371 C CA  . SER B 1 237 ? -51.703 -55.050 -29.695 1.00 47.77  ? 226 SER B CA  1 
ATOM   4372 C C   . SER B 1 237 ? -52.208 -54.012 -28.686 1.00 51.76  ? 226 SER B C   1 
ATOM   4373 O O   . SER B 1 237 ? -52.859 -53.047 -29.105 1.00 51.45  ? 226 SER B O   1 
ATOM   4374 C CB  . SER B 1 237 ? -52.623 -56.270 -29.767 1.00 52.87  ? 226 SER B CB  1 
ATOM   4375 O OG  . SER B 1 237 ? -52.511 -57.130 -28.644 1.00 66.05  ? 226 SER B OG  1 
ATOM   4376 N N   . SER B 1 238 ? -51.893 -54.185 -27.376 1.00 48.37  ? 227 SER B N   1 
ATOM   4377 C CA  . SER B 1 238 ? -52.297 -53.235 -26.321 1.00 48.59  ? 227 SER B CA  1 
ATOM   4378 C C   . SER B 1 238 ? -51.648 -51.868 -26.540 1.00 52.22  ? 227 SER B C   1 
ATOM   4379 O O   . SER B 1 238 ? -52.328 -50.843 -26.389 1.00 51.96  ? 227 SER B O   1 
ATOM   4380 C CB  . SER B 1 238 ? -51.914 -53.755 -24.937 1.00 52.64  ? 227 SER B CB  1 
ATOM   4381 O OG  . SER B 1 238 ? -52.564 -54.964 -24.591 1.00 61.23  ? 227 SER B OG  1 
ATOM   4382 N N   . ILE B 1 239 ? -50.332 -51.857 -26.887 1.00 48.36  ? 228 ILE B N   1 
ATOM   4383 C CA  . ILE B 1 239 ? -49.573 -50.627 -27.129 1.00 48.44  ? 228 ILE B CA  1 
ATOM   4384 C C   . ILE B 1 239 ? -50.112 -49.827 -28.318 1.00 54.52  ? 228 ILE B C   1 
ATOM   4385 O O   . ILE B 1 239 ? -50.212 -48.602 -28.198 1.00 54.12  ? 228 ILE B O   1 
ATOM   4386 C CB  . ILE B 1 239 ? -48.032 -50.832 -27.141 1.00 51.26  ? 228 ILE B CB  1 
ATOM   4387 C CG1 . ILE B 1 239 ? -47.511 -51.412 -25.798 1.00 51.26  ? 228 ILE B CG1 1 
ATOM   4388 C CG2 . ILE B 1 239 ? -47.249 -49.565 -27.579 1.00 51.82  ? 228 ILE B CG2 1 
ATOM   4389 C CD1 . ILE B 1 239 ? -47.623 -50.555 -24.555 1.00 53.34  ? 228 ILE B CD1 1 
ATOM   4390 N N   . GLU B 1 240 ? -50.506 -50.499 -29.439 1.00 52.11  ? 229 GLU B N   1 
ATOM   4391 C CA  . GLU B 1 240 ? -51.064 -49.742 -30.566 1.00 52.21  ? 229 GLU B CA  1 
ATOM   4392 C C   . GLU B 1 240 ? -52.431 -49.161 -30.298 1.00 56.68  ? 229 GLU B C   1 
ATOM   4393 O O   . GLU B 1 240 ? -52.681 -48.021 -30.684 1.00 56.92  ? 229 GLU B O   1 
ATOM   4394 C CB  . GLU B 1 240 ? -50.869 -50.349 -31.969 1.00 53.76  ? 229 GLU B CB  1 
ATOM   4395 C CG  . GLU B 1 240 ? -51.188 -51.823 -32.138 1.00 66.32  ? 229 GLU B CG  1 
ATOM   4396 C CD  . GLU B 1 240 ? -50.506 -52.487 -33.323 1.00 88.60  ? 229 GLU B CD  1 
ATOM   4397 O OE1 . GLU B 1 240 ? -49.456 -51.978 -33.784 1.00 71.98  ? 229 GLU B OE1 1 
ATOM   4398 O OE2 . GLU B 1 240 ? -51.012 -53.541 -33.775 1.00 86.50  ? 229 GLU B OE2 1 
ATOM   4399 N N   . LYS B 1 241 ? -53.263 -49.873 -29.523 1.00 53.72  ? 230 LYS B N   1 
ATOM   4400 C CA  . LYS B 1 241 ? -54.578 -49.363 -29.118 1.00 53.67  ? 230 LYS B CA  1 
ATOM   4401 C C   . LYS B 1 241 ? -54.399 -48.143 -28.221 1.00 56.66  ? 230 LYS B C   1 
ATOM   4402 O O   . LYS B 1 241 ? -55.041 -47.107 -28.450 1.00 57.04  ? 230 LYS B O   1 
ATOM   4403 C CB  . LYS B 1 241 ? -55.445 -50.454 -28.455 1.00 56.21  ? 230 LYS B CB  1 
ATOM   4404 C CG  . LYS B 1 241 ? -56.511 -50.976 -29.413 1.00 74.95  ? 230 LYS B CG  1 
ATOM   4405 C CD  . LYS B 1 241 ? -57.018 -52.369 -29.047 1.00 92.74  ? 230 LYS B CD  1 
ATOM   4406 C CE  . LYS B 1 241 ? -57.541 -53.145 -30.244 1.00 105.71 ? 230 LYS B CE  1 
ATOM   4407 N NZ  . LYS B 1 241 ? -58.774 -52.544 -30.832 1.00 113.75 ? 230 LYS B NZ  1 
ATOM   4408 N N   . LEU B 1 242 ? -53.434 -48.233 -27.281 1.00 51.18  ? 231 LEU B N   1 
ATOM   4409 C CA  . LEU B 1 242 ? -53.093 -47.148 -26.357 1.00 49.46  ? 231 LEU B CA  1 
ATOM   4410 C C   . LEU B 1 242 ? -52.540 -45.919 -27.110 1.00 51.61  ? 231 LEU B C   1 
ATOM   4411 O O   . LEU B 1 242 ? -53.019 -44.809 -26.883 1.00 51.48  ? 231 LEU B O   1 
ATOM   4412 C CB  . LEU B 1 242 ? -52.104 -47.656 -25.275 1.00 48.75  ? 231 LEU B CB  1 
ATOM   4413 C CG  . LEU B 1 242 ? -51.320 -46.620 -24.449 1.00 51.97  ? 231 LEU B CG  1 
ATOM   4414 C CD1 . LEU B 1 242 ? -52.212 -45.867 -23.502 1.00 52.25  ? 231 LEU B CD1 1 
ATOM   4415 C CD2 . LEU B 1 242 ? -50.250 -47.291 -23.639 1.00 51.66  ? 231 LEU B CD2 1 
ATOM   4416 N N   . MET B 1 243 ? -51.561 -46.129 -28.020 1.00 46.64  ? 232 MET B N   1 
ATOM   4417 C CA  . MET B 1 243 ? -50.941 -45.045 -28.797 1.00 46.27  ? 232 MET B CA  1 
ATOM   4418 C C   . MET B 1 243 ? -51.895 -44.308 -29.725 1.00 50.78  ? 232 MET B C   1 
ATOM   4419 O O   . MET B 1 243 ? -51.755 -43.098 -29.894 1.00 49.83  ? 232 MET B O   1 
ATOM   4420 C CB  . MET B 1 243 ? -49.693 -45.520 -29.542 1.00 48.45  ? 232 MET B CB  1 
ATOM   4421 C CG  . MET B 1 243 ? -48.581 -45.951 -28.623 1.00 51.74  ? 232 MET B CG  1 
ATOM   4422 S SD  . MET B 1 243 ? -47.947 -44.622 -27.595 1.00 55.32  ? 232 MET B SD  1 
ATOM   4423 C CE  . MET B 1 243 ? -46.882 -45.541 -26.537 1.00 51.74  ? 232 MET B CE  1 
ATOM   4424 N N   . GLU B 1 244 ? -52.879 -45.035 -30.299 1.00 49.23  ? 233 GLU B N   1 
ATOM   4425 C CA  . GLU B 1 244 ? -53.927 -44.491 -31.162 1.00 49.26  ? 233 GLU B CA  1 
ATOM   4426 C C   . GLU B 1 244 ? -54.771 -43.517 -30.336 1.00 52.49  ? 233 GLU B C   1 
ATOM   4427 O O   . GLU B 1 244 ? -55.028 -42.395 -30.781 1.00 52.13  ? 233 GLU B O   1 
ATOM   4428 C CB  . GLU B 1 244 ? -54.806 -45.624 -31.710 1.00 51.01  ? 233 GLU B CB  1 
ATOM   4429 C CG  . GLU B 1 244 ? -55.518 -45.277 -33.003 1.00 66.97  ? 233 GLU B CG  1 
ATOM   4430 C CD  . GLU B 1 244 ? -56.537 -46.291 -33.484 1.00 101.46 ? 233 GLU B CD  1 
ATOM   4431 O OE1 . GLU B 1 244 ? -57.583 -45.853 -34.014 1.00 105.26 ? 233 GLU B OE1 1 
ATOM   4432 O OE2 . GLU B 1 244 ? -56.294 -47.513 -33.344 1.00 100.34 ? 233 GLU B OE2 1 
ATOM   4433 N N   . ALA B 1 245 ? -55.142 -43.936 -29.100 1.00 48.73  ? 234 ALA B N   1 
ATOM   4434 C CA  . ALA B 1 245 ? -55.921 -43.137 -28.157 1.00 48.10  ? 234 ALA B CA  1 
ATOM   4435 C C   . ALA B 1 245 ? -55.198 -41.848 -27.777 1.00 54.20  ? 234 ALA B C   1 
ATOM   4436 O O   . ALA B 1 245 ? -55.844 -40.804 -27.684 1.00 55.64  ? 234 ALA B O   1 
ATOM   4437 C CB  . ALA B 1 245 ? -56.233 -43.946 -26.918 1.00 48.44  ? 234 ALA B CB  1 
ATOM   4438 N N   . LEU B 1 246 ? -53.861 -41.909 -27.598 1.00 49.74  ? 235 LEU B N   1 
ATOM   4439 C CA  . LEU B 1 246 ? -53.055 -40.738 -27.242 1.00 48.95  ? 235 LEU B CA  1 
ATOM   4440 C C   . LEU B 1 246 ? -52.820 -39.821 -28.425 1.00 53.37  ? 235 LEU B C   1 
ATOM   4441 O O   . LEU B 1 246 ? -52.699 -38.609 -28.244 1.00 53.99  ? 235 LEU B O   1 
ATOM   4442 C CB  . LEU B 1 246 ? -51.701 -41.143 -26.617 1.00 48.63  ? 235 LEU B CB  1 
ATOM   4443 C CG  . LEU B 1 246 ? -51.720 -41.977 -25.343 1.00 52.00  ? 235 LEU B CG  1 
ATOM   4444 C CD1 . LEU B 1 246 ? -50.318 -42.435 -24.992 1.00 51.82  ? 235 LEU B CD1 1 
ATOM   4445 C CD2 . LEU B 1 246 ? -52.322 -41.205 -24.191 1.00 52.42  ? 235 LEU B CD2 1 
ATOM   4446 N N   . GLY B 1 247 ? -52.737 -40.397 -29.616 1.00 49.84  ? 236 GLY B N   1 
ATOM   4447 C CA  . GLY B 1 247 ? -52.463 -39.643 -30.832 1.00 49.72  ? 236 GLY B CA  1 
ATOM   4448 C C   . GLY B 1 247 ? -50.988 -39.656 -31.188 1.00 54.61  ? 236 GLY B C   1 
ATOM   4449 O O   . GLY B 1 247 ? -50.521 -38.819 -31.970 1.00 54.72  ? 236 GLY B O   1 
ATOM   4450 N N   . ALA B 1 248 ? -50.235 -40.609 -30.589 1.00 51.11  ? 237 ALA B N   1 
ATOM   4451 C CA  . ALA B 1 248 ? -48.814 -40.815 -30.851 1.00 49.82  ? 237 ALA B CA  1 
ATOM   4452 C C   . ALA B 1 248 ? -48.670 -41.593 -32.153 1.00 52.32  ? 237 ALA B C   1 
ATOM   4453 O O   . ALA B 1 248 ? -49.543 -42.390 -32.497 1.00 51.80  ? 237 ALA B O   1 
ATOM   4454 C CB  . ALA B 1 248 ? -48.175 -41.587 -29.718 1.00 49.94  ? 237 ALA B CB  1 
ATOM   4455 N N   . LYS B 1 249 ? -47.594 -41.349 -32.894 1.00 47.85  ? 238 LYS B N   1 
ATOM   4456 C CA  . LYS B 1 249 ? -47.386 -42.068 -34.143 1.00 47.90  ? 238 LYS B CA  1 
ATOM   4457 C C   . LYS B 1 249 ? -46.050 -42.782 -34.128 1.00 52.09  ? 238 LYS B C   1 
ATOM   4458 O O   . LYS B 1 249 ? -45.144 -42.360 -33.418 1.00 50.15  ? 238 LYS B O   1 
ATOM   4459 C CB  . LYS B 1 249 ? -47.563 -41.132 -35.356 1.00 51.21  ? 238 LYS B CB  1 
ATOM   4460 C CG  . LYS B 1 249 ? -49.012 -40.668 -35.531 1.00 62.50  ? 238 LYS B CG  1 
ATOM   4461 C CD  . LYS B 1 249 ? -49.235 -39.872 -36.801 1.00 76.18  ? 238 LYS B CD  1 
ATOM   4462 C CE  . LYS B 1 249 ? -50.684 -39.460 -36.975 1.00 91.71  ? 238 LYS B CE  1 
ATOM   4463 N NZ  . LYS B 1 249 ? -51.586 -40.616 -37.258 1.00 100.21 ? 238 LYS B NZ  1 
ATOM   4464 N N   . LYS B 1 250 ? -45.949 -43.910 -34.836 1.00 52.66  ? 239 LYS B N   1 
ATOM   4465 C CA  . LYS B 1 250 ? -44.693 -44.657 -34.894 1.00 53.75  ? 239 LYS B CA  1 
ATOM   4466 C C   . LYS B 1 250 ? -43.810 -43.968 -35.917 1.00 61.67  ? 239 LYS B C   1 
ATOM   4467 O O   . LYS B 1 250 ? -44.207 -43.842 -37.085 1.00 62.29  ? 239 LYS B O   1 
ATOM   4468 C CB  . LYS B 1 250 ? -44.912 -46.142 -35.233 1.00 55.36  ? 239 LYS B CB  1 
ATOM   4469 C CG  . LYS B 1 250 ? -43.751 -47.033 -34.788 1.00 69.92  ? 239 LYS B CG  1 
ATOM   4470 C CD  . LYS B 1 250 ? -44.094 -48.515 -34.899 1.00 83.65  ? 239 LYS B CD  1 
ATOM   4471 C CE  . LYS B 1 250 ? -42.911 -49.421 -34.635 1.00 99.05  ? 239 LYS B CE  1 
ATOM   4472 N NZ  . LYS B 1 250 ? -42.621 -49.567 -33.182 1.00 110.66 ? 239 LYS B NZ  1 
ATOM   4473 N N   . ARG B 1 251 ? -42.654 -43.446 -35.453 1.00 59.68  ? 240 ARG B N   1 
ATOM   4474 C CA  . ARG B 1 251 ? -41.678 -42.741 -36.281 1.00 60.26  ? 240 ARG B CA  1 
ATOM   4475 C C   . ARG B 1 251 ? -41.025 -43.786 -37.209 1.00 67.38  ? 240 ARG B C   1 
ATOM   4476 O O   . ARG B 1 251 ? -41.495 -43.990 -38.337 1.00 67.88  ? 240 ARG B O   1 
ATOM   4477 C CB  . ARG B 1 251 ? -40.666 -41.998 -35.384 1.00 58.72  ? 240 ARG B CB  1 
ATOM   4478 C CG  . ARG B 1 251 ? -39.669 -41.117 -36.134 1.00 61.53  ? 240 ARG B CG  1 
ATOM   4479 C CD  . ARG B 1 251 ? -38.999 -40.086 -35.249 1.00 59.95  ? 240 ARG B CD  1 
ATOM   4480 N NE  . ARG B 1 251 ? -38.300 -40.688 -34.113 1.00 70.50  ? 240 ARG B NE  1 
ATOM   4481 C CZ  . ARG B 1 251 ? -37.686 -39.999 -33.154 1.00 81.85  ? 240 ARG B CZ  1 
ATOM   4482 N NH1 . ARG B 1 251 ? -37.673 -38.671 -33.186 1.00 69.52  ? 240 ARG B NH1 1 
ATOM   4483 N NH2 . ARG B 1 251 ? -37.090 -40.631 -32.152 1.00 63.41  ? 240 ARG B NH2 1 
ATOM   4484 N N   . LEU B 1 252 ? -40.004 -44.484 -36.717 1.00 64.97  ? 242 LEU B N   1 
ATOM   4485 C CA  . LEU B 1 252 ? -39.346 -45.555 -37.456 1.00 65.50  ? 242 LEU B CA  1 
ATOM   4486 C C   . LEU B 1 252 ? -39.091 -46.673 -36.482 1.00 68.70  ? 242 LEU B C   1 
ATOM   4487 O O   . LEU B 1 252 ? -39.048 -47.839 -36.876 1.00 69.62  ? 242 LEU B O   1 
ATOM   4488 C CB  . LEU B 1 252 ? -38.023 -45.083 -38.090 1.00 66.03  ? 242 LEU B CB  1 
ATOM   4489 C CG  . LEU B 1 252 ? -38.160 -44.174 -39.315 1.00 71.42  ? 242 LEU B CG  1 
ATOM   4490 C CD1 . LEU B 1 252 ? -37.151 -43.058 -39.272 1.00 71.95  ? 242 LEU B CD1 1 
ATOM   4491 C CD2 . LEU B 1 252 ? -38.049 -44.958 -40.614 1.00 73.70  ? 242 LEU B CD2 1 
ATOM   4492 N N   . PHE B 1 253 ? -38.931 -46.323 -35.203 1.00 63.15  ? 243 PHE B N   1 
ATOM   4493 C CA  . PHE B 1 253 ? -38.665 -47.300 -34.164 1.00 62.43  ? 243 PHE B CA  1 
ATOM   4494 C C   . PHE B 1 253 ? -39.552 -47.071 -32.933 1.00 65.32  ? 243 PHE B C   1 
ATOM   4495 O O   . PHE B 1 253 ? -40.092 -48.040 -32.396 1.00 65.31  ? 243 PHE B O   1 
ATOM   4496 C CB  . PHE B 1 253 ? -37.169 -47.302 -33.789 1.00 64.13  ? 243 PHE B CB  1 
ATOM   4497 C CG  . PHE B 1 253 ? -36.180 -47.367 -34.940 1.00 66.08  ? 243 PHE B CG  1 
ATOM   4498 C CD1 . PHE B 1 253 ? -35.815 -48.590 -35.503 1.00 69.30  ? 243 PHE B CD1 1 
ATOM   4499 C CD2 . PHE B 1 253 ? -35.593 -46.207 -35.445 1.00 67.91  ? 243 PHE B CD2 1 
ATOM   4500 C CE1 . PHE B 1 253 ? -34.887 -48.648 -36.554 1.00 69.90  ? 243 PHE B CE1 1 
ATOM   4501 C CE2 . PHE B 1 253 ? -34.657 -46.268 -36.487 1.00 70.28  ? 243 PHE B CE2 1 
ATOM   4502 C CZ  . PHE B 1 253 ? -34.310 -47.486 -37.034 1.00 68.38  ? 243 PHE B CZ  1 
ATOM   4503 N N   . ASP B 1 254 ? -39.703 -45.795 -32.494 1.00 60.30  ? 244 ASP B N   1 
ATOM   4504 C CA  . ASP B 1 254 ? -40.462 -45.400 -31.297 1.00 59.27  ? 244 ASP B CA  1 
ATOM   4505 C C   . ASP B 1 254 ? -41.712 -44.622 -31.623 1.00 62.66  ? 244 ASP B C   1 
ATOM   4506 O O   . ASP B 1 254 ? -41.826 -44.055 -32.714 1.00 64.11  ? 244 ASP B O   1 
ATOM   4507 C CB  . ASP B 1 254 ? -39.611 -44.502 -30.380 1.00 60.58  ? 244 ASP B CB  1 
ATOM   4508 C CG  . ASP B 1 254 ? -38.251 -45.033 -30.007 1.00 68.50  ? 244 ASP B CG  1 
ATOM   4509 O OD1 . ASP B 1 254 ? -37.289 -44.231 -29.990 1.00 71.75  ? 244 ASP B OD1 1 
ATOM   4510 O OD2 . ASP B 1 254 ? -38.147 -46.243 -29.715 1.00 67.12  ? 244 ASP B OD2 1 
ATOM   4511 N N   . TYR B 1 255 ? -42.619 -44.527 -30.641 1.00 56.46  ? 245 TYR B N   1 
ATOM   4512 C CA  . TYR B 1 255 ? -43.826 -43.726 -30.782 1.00 55.14  ? 245 TYR B CA  1 
ATOM   4513 C C   . TYR B 1 255 ? -43.486 -42.325 -30.337 1.00 57.36  ? 245 TYR B C   1 
ATOM   4514 O O   . TYR B 1 255 ? -42.960 -42.120 -29.240 1.00 57.79  ? 245 TYR B O   1 
ATOM   4515 C CB  . TYR B 1 255 ? -45.014 -44.300 -29.992 1.00 55.52  ? 245 TYR B CB  1 
ATOM   4516 C CG  . TYR B 1 255 ? -45.625 -45.533 -30.618 1.00 56.73  ? 245 TYR B CG  1 
ATOM   4517 C CD1 . TYR B 1 255 ? -46.614 -45.428 -31.593 1.00 58.39  ? 245 TYR B CD1 1 
ATOM   4518 C CD2 . TYR B 1 255 ? -45.248 -46.806 -30.206 1.00 57.86  ? 245 TYR B CD2 1 
ATOM   4519 C CE1 . TYR B 1 255 ? -47.218 -46.563 -32.134 1.00 59.63  ? 245 TYR B CE1 1 
ATOM   4520 C CE2 . TYR B 1 255 ? -45.841 -47.949 -30.742 1.00 58.81  ? 245 TYR B CE2 1 
ATOM   4521 C CZ  . TYR B 1 255 ? -46.819 -47.824 -31.712 1.00 66.36  ? 245 TYR B CZ  1 
ATOM   4522 O OH  . TYR B 1 255 ? -47.379 -48.961 -32.241 1.00 67.97  ? 245 TYR B OH  1 
ATOM   4523 N N   . VAL B 1 256 ? -43.695 -41.375 -31.229 1.00 52.23  ? 246 VAL B N   1 
ATOM   4524 C CA  . VAL B 1 256 ? -43.402 -39.966 -30.988 1.00 51.20  ? 246 VAL B CA  1 
ATOM   4525 C C   . VAL B 1 256 ? -44.666 -39.137 -30.903 1.00 52.03  ? 246 VAL B C   1 
ATOM   4526 O O   . VAL B 1 256 ? -45.755 -39.612 -31.216 1.00 52.66  ? 246 VAL B O   1 
ATOM   4527 C CB  . VAL B 1 256 ? -42.359 -39.360 -31.979 1.00 55.18  ? 246 VAL B CB  1 
ATOM   4528 C CG1 . VAL B 1 256 ? -40.974 -39.950 -31.744 1.00 54.38  ? 246 VAL B CG1 1 
ATOM   4529 C CG2 . VAL B 1 256 ? -42.793 -39.529 -33.439 1.00 55.26  ? 246 VAL B CG2 1 
ATOM   4530 N N   . VAL B 1 257 ? -44.509 -37.903 -30.439 1.00 45.08  ? 247 VAL B N   1 
ATOM   4531 C CA  . VAL B 1 257 ? -45.541 -36.898 -30.303 1.00 43.19  ? 247 VAL B CA  1 
ATOM   4532 C C   . VAL B 1 257 ? -44.833 -35.553 -30.562 1.00 45.37  ? 247 VAL B C   1 
ATOM   4533 O O   . VAL B 1 257 ? -43.607 -35.473 -30.400 1.00 43.26  ? 247 VAL B O   1 
ATOM   4534 C CB  . VAL B 1 257 ? -46.193 -37.035 -28.896 1.00 47.56  ? 247 VAL B CB  1 
ATOM   4535 C CG1 . VAL B 1 257 ? -45.674 -36.007 -27.901 1.00 47.51  ? 247 VAL B CG1 1 
ATOM   4536 C CG2 . VAL B 1 257 ? -47.714 -37.004 -28.982 1.00 47.53  ? 247 VAL B CG2 1 
ATOM   4537 N N   . LYS B 1 258 ? -45.565 -34.517 -31.012 1.00 43.29  ? 248 LYS B N   1 
ATOM   4538 C CA  . LYS B 1 258 ? -44.937 -33.197 -31.191 1.00 43.08  ? 248 LYS B CA  1 
ATOM   4539 C C   . LYS B 1 258 ? -44.661 -32.672 -29.784 1.00 47.10  ? 248 LYS B C   1 
ATOM   4540 O O   . LYS B 1 258 ? -45.563 -32.721 -28.956 1.00 47.39  ? 248 LYS B O   1 
ATOM   4541 C CB  . LYS B 1 258 ? -45.823 -32.218 -31.967 1.00 45.58  ? 248 LYS B CB  1 
ATOM   4542 C CG  . LYS B 1 258 ? -45.924 -32.460 -33.468 1.00 58.94  ? 248 LYS B CG  1 
ATOM   4543 C CD  . LYS B 1 258 ? -45.708 -31.155 -34.309 1.00 72.12  ? 248 LYS B CD  1 
ATOM   4544 C CE  . LYS B 1 258 ? -46.632 -29.946 -34.145 1.00 82.19  ? 248 LYS B CE  1 
ATOM   4545 N NZ  . LYS B 1 258 ? -48.002 -30.200 -34.664 1.00 90.48  ? 248 LYS B NZ  1 
ATOM   4546 N N   . CYS B 1 259 ? -43.397 -32.284 -29.473 1.00 44.62  ? 249 CYS B N   1 
ATOM   4547 C CA  . CYS B 1 259 ? -42.952 -31.837 -28.132 1.00 44.89  ? 249 CYS B CA  1 
ATOM   4548 C C   . CYS B 1 259 ? -43.865 -30.842 -27.437 1.00 50.42  ? 249 CYS B C   1 
ATOM   4549 O O   . CYS B 1 259 ? -44.058 -30.938 -26.225 1.00 51.56  ? 249 CYS B O   1 
ATOM   4550 C CB  . CYS B 1 259 ? -41.502 -31.357 -28.135 1.00 45.61  ? 249 CYS B CB  1 
ATOM   4551 S SG  . CYS B 1 259 ? -40.285 -32.646 -28.510 1.00 50.09  ? 249 CYS B SG  1 
ATOM   4552 N N   . ASN B 1 260 ? -44.437 -29.905 -28.196 1.00 47.45  ? 250 ASN B N   1 
ATOM   4553 C CA  . ASN B 1 260 ? -45.344 -28.888 -27.674 1.00 47.81  ? 250 ASN B CA  1 
ATOM   4554 C C   . ASN B 1 260 ? -46.699 -29.485 -27.278 1.00 52.96  ? 250 ASN B C   1 
ATOM   4555 O O   . ASN B 1 260 ? -47.284 -28.994 -26.322 1.00 52.16  ? 250 ASN B O   1 
ATOM   4556 C CB  . ASN B 1 260 ? -45.504 -27.746 -28.677 1.00 49.12  ? 250 ASN B CB  1 
ATOM   4557 C CG  . ASN B 1 260 ? -46.201 -28.123 -29.962 1.00 58.54  ? 250 ASN B CG  1 
ATOM   4558 O OD1 . ASN B 1 260 ? -45.940 -29.171 -30.570 1.00 50.65  ? 250 ASN B OD1 1 
ATOM   4559 N ND2 . ASN B 1 260 ? -47.088 -27.258 -30.413 1.00 47.05  ? 250 ASN B ND2 1 
ATOM   4560 N N   . GLU B 1 261 ? -47.193 -30.527 -28.014 1.00 50.63  ? 251 GLU B N   1 
ATOM   4561 C CA  . GLU B 1 261 ? -48.452 -31.225 -27.737 1.00 51.47  ? 251 GLU B CA  1 
ATOM   4562 C C   . GLU B 1 261 ? -48.373 -32.099 -26.465 1.00 57.69  ? 251 GLU B C   1 
ATOM   4563 O O   . GLU B 1 261 ? -49.413 -32.350 -25.861 1.00 58.23  ? 251 GLU B O   1 
ATOM   4564 C CB  . GLU B 1 261 ? -48.891 -32.070 -28.937 1.00 52.73  ? 251 GLU B CB  1 
ATOM   4565 C CG  . GLU B 1 261 ? -49.641 -31.281 -30.000 1.00 62.09  ? 251 GLU B CG  1 
ATOM   4566 C CD  . GLU B 1 261 ? -49.945 -32.030 -31.287 1.00 89.15  ? 251 GLU B CD  1 
ATOM   4567 O OE1 . GLU B 1 261 ? -50.211 -31.354 -32.308 1.00 88.11  ? 251 GLU B OE1 1 
ATOM   4568 O OE2 . GLU B 1 261 ? -49.762 -33.272 -31.320 1.00 91.53  ? 251 GLU B OE2 1 
ATOM   4569 N N   . GLY B 1 262 ? -47.153 -32.510 -26.074 1.00 53.43  ? 252 GLY B N   1 
ATOM   4570 C CA  . GLY B 1 262 ? -46.857 -33.309 -24.885 1.00 52.82  ? 252 GLY B CA  1 
ATOM   4571 C C   . GLY B 1 262 ? -47.758 -33.007 -23.699 1.00 56.40  ? 252 GLY B C   1 
ATOM   4572 O O   . GLY B 1 262 ? -48.534 -33.878 -23.285 1.00 55.78  ? 252 GLY B O   1 
ATOM   4573 N N   . PRO B 1 263 ? -47.757 -31.738 -23.211 1.00 52.11  ? 253 PRO B N   1 
ATOM   4574 C CA  . PRO B 1 263 ? -48.616 -31.362 -22.062 1.00 51.93  ? 253 PRO B CA  1 
ATOM   4575 C C   . PRO B 1 263 ? -50.147 -31.494 -22.208 1.00 56.48  ? 253 PRO B C   1 
ATOM   4576 O O   . PRO B 1 263 ? -50.868 -31.468 -21.206 1.00 56.42  ? 253 PRO B O   1 
ATOM   4577 C CB  . PRO B 1 263 ? -48.211 -29.908 -21.809 1.00 53.45  ? 253 PRO B CB  1 
ATOM   4578 C CG  . PRO B 1 263 ? -46.810 -29.822 -22.334 1.00 57.50  ? 253 PRO B CG  1 
ATOM   4579 C CD  . PRO B 1 263 ? -46.857 -30.624 -23.573 1.00 52.97  ? 253 PRO B CD  1 
ATOM   4580 N N   . THR B 1 264 ? -50.646 -31.636 -23.439 1.00 52.24  ? 254 THR B N   1 
ATOM   4581 C CA  . THR B 1 264 ? -52.076 -31.793 -23.723 1.00 51.24  ? 254 THR B CA  1 
ATOM   4582 C C   . THR B 1 264 ? -52.520 -33.263 -23.703 1.00 55.60  ? 254 THR B C   1 
ATOM   4583 O O   . THR B 1 264 ? -53.727 -33.532 -23.805 1.00 56.00  ? 254 THR B O   1 
ATOM   4584 C CB  . THR B 1 264 ? -52.468 -31.131 -25.071 1.00 54.91  ? 254 THR B CB  1 
ATOM   4585 O OG1 . THR B 1 264 ? -52.050 -31.941 -26.169 1.00 49.81  ? 254 THR B OG1 1 
ATOM   4586 C CG2 . THR B 1 264 ? -51.940 -29.720 -25.228 1.00 51.70  ? 254 THR B CG2 1 
ATOM   4587 N N   . LEU B 1 265 ? -51.563 -34.221 -23.624 1.00 51.59  ? 255 LEU B N   1 
ATOM   4588 C CA  . LEU B 1 265 ? -51.897 -35.649 -23.617 1.00 50.49  ? 255 LEU B CA  1 
ATOM   4589 C C   . LEU B 1 265 ? -52.679 -36.032 -22.359 1.00 55.23  ? 255 LEU B C   1 
ATOM   4590 O O   . LEU B 1 265 ? -52.453 -35.430 -21.303 1.00 54.93  ? 255 LEU B O   1 
ATOM   4591 C CB  . LEU B 1 265 ? -50.660 -36.547 -23.795 1.00 49.97  ? 255 LEU B CB  1 
ATOM   4592 C CG  . LEU B 1 265 ? -49.959 -36.521 -25.155 1.00 53.97  ? 255 LEU B CG  1 
ATOM   4593 C CD1 . LEU B 1 265 ? -49.060 -37.724 -25.320 1.00 53.75  ? 255 LEU B CD1 1 
ATOM   4594 C CD2 . LEU B 1 265 ? -50.944 -36.508 -26.298 1.00 55.98  ? 255 LEU B CD2 1 
ATOM   4595 N N   . PRO B 1 266 ? -53.632 -36.998 -22.443 1.00 52.29  ? 256 PRO B N   1 
ATOM   4596 C CA  . PRO B 1 266 ? -54.396 -37.359 -21.245 1.00 51.86  ? 256 PRO B CA  1 
ATOM   4597 C C   . PRO B 1 266 ? -53.585 -38.207 -20.271 1.00 54.17  ? 256 PRO B C   1 
ATOM   4598 O O   . PRO B 1 266 ? -52.594 -38.838 -20.655 1.00 54.19  ? 256 PRO B O   1 
ATOM   4599 C CB  . PRO B 1 266 ? -55.566 -38.165 -21.817 1.00 53.72  ? 256 PRO B CB  1 
ATOM   4600 C CG  . PRO B 1 266 ? -55.024 -38.791 -23.047 1.00 57.58  ? 256 PRO B CG  1 
ATOM   4601 C CD  . PRO B 1 266 ? -54.048 -37.815 -23.607 1.00 53.35  ? 256 PRO B CD  1 
ATOM   4602 N N   . ASP B 1 267 ? -54.049 -38.256 -19.020 1.00 47.71  ? 257 ASP B N   1 
ATOM   4603 C CA  . ASP B 1 267 ? -53.473 -39.075 -17.975 1.00 45.77  ? 257 ASP B CA  1 
ATOM   4604 C C   . ASP B 1 267 ? -53.683 -40.550 -18.313 1.00 49.70  ? 257 ASP B C   1 
ATOM   4605 O O   . ASP B 1 267 ? -54.659 -40.886 -18.975 1.00 50.85  ? 257 ASP B O   1 
ATOM   4606 C CB  . ASP B 1 267 ? -54.181 -38.758 -16.653 1.00 46.48  ? 257 ASP B CB  1 
ATOM   4607 C CG  . ASP B 1 267 ? -53.871 -37.396 -16.044 1.00 52.93  ? 257 ASP B CG  1 
ATOM   4608 O OD1 . ASP B 1 267 ? -52.983 -36.687 -16.574 1.00 54.23  ? 257 ASP B OD1 1 
ATOM   4609 O OD2 . ASP B 1 267 ? -54.477 -37.059 -15.012 1.00 56.97  ? 257 ASP B OD2 1 
ATOM   4610 N N   . ILE B 1 268 ? -52.773 -41.419 -17.873 1.00 45.43  ? 258 ILE B N   1 
ATOM   4611 C CA  . ILE B 1 268 ? -52.878 -42.869 -18.041 1.00 45.70  ? 258 ILE B CA  1 
ATOM   4612 C C   . ILE B 1 268 ? -52.980 -43.446 -16.638 1.00 49.80  ? 258 ILE B C   1 
ATOM   4613 O O   . ILE B 1 268 ? -52.147 -43.127 -15.788 1.00 49.64  ? 258 ILE B O   1 
ATOM   4614 C CB  . ILE B 1 268 ? -51.722 -43.500 -18.879 1.00 49.39  ? 258 ILE B CB  1 
ATOM   4615 C CG1 . ILE B 1 268 ? -51.677 -42.886 -20.296 1.00 50.28  ? 258 ILE B CG1 1 
ATOM   4616 C CG2 . ILE B 1 268 ? -51.855 -45.042 -18.939 1.00 50.20  ? 258 ILE B CG2 1 
ATOM   4617 C CD1 . ILE B 1 268 ? -50.526 -43.328 -21.180 1.00 58.50  ? 258 ILE B CD1 1 
ATOM   4618 N N   . SER B 1 269 ? -54.020 -44.252 -16.376 1.00 45.73  ? 259 SER B N   1 
ATOM   4619 C CA  . SER B 1 269 ? -54.240 -44.840 -15.057 1.00 44.65  ? 259 SER B CA  1 
ATOM   4620 C C   . SER B 1 269 ? -54.202 -46.344 -15.096 1.00 46.79  ? 259 SER B C   1 
ATOM   4621 O O   . SER B 1 269 ? -54.695 -46.963 -16.034 1.00 46.44  ? 259 SER B O   1 
ATOM   4622 C CB  . SER B 1 269 ? -55.546 -44.348 -14.447 1.00 46.27  ? 259 SER B CB  1 
ATOM   4623 O OG  . SER B 1 269 ? -55.523 -42.944 -14.272 1.00 50.69  ? 259 SER B OG  1 
ATOM   4624 N N   . PHE B 1 270 ? -53.599 -46.922 -14.073 1.00 42.80  ? 260 PHE B N   1 
ATOM   4625 C CA  . PHE B 1 270 ? -53.433 -48.355 -13.909 1.00 42.26  ? 260 PHE B CA  1 
ATOM   4626 C C   . PHE B 1 270 ? -54.192 -48.741 -12.662 1.00 49.46  ? 260 PHE B C   1 
ATOM   4627 O O   . PHE B 1 270 ? -53.922 -48.204 -11.585 1.00 48.62  ? 260 PHE B O   1 
ATOM   4628 C CB  . PHE B 1 270 ? -51.942 -48.712 -13.802 1.00 43.21  ? 260 PHE B CB  1 
ATOM   4629 C CG  . PHE B 1 270 ? -51.127 -48.335 -15.013 1.00 44.06  ? 260 PHE B CG  1 
ATOM   4630 C CD1 . PHE B 1 270 ? -50.945 -49.236 -16.057 1.00 46.23  ? 260 PHE B CD1 1 
ATOM   4631 C CD2 . PHE B 1 270 ? -50.539 -47.076 -15.114 1.00 45.88  ? 260 PHE B CD2 1 
ATOM   4632 C CE1 . PHE B 1 270 ? -50.208 -48.878 -17.190 1.00 46.76  ? 260 PHE B CE1 1 
ATOM   4633 C CE2 . PHE B 1 270 ? -49.807 -46.717 -16.254 1.00 48.07  ? 260 PHE B CE2 1 
ATOM   4634 C CZ  . PHE B 1 270 ? -49.646 -47.621 -17.282 1.00 45.91  ? 260 PHE B CZ  1 
ATOM   4635 N N   . HIS B 1 271 ? -55.194 -49.616 -12.822 1.00 49.93  ? 261 HIS B N   1 
ATOM   4636 C CA  . HIS B 1 271 ? -56.024 -50.049 -11.713 1.00 51.36  ? 261 HIS B CA  1 
ATOM   4637 C C   . HIS B 1 271 ? -55.378 -51.265 -11.069 1.00 50.18  ? 261 HIS B C   1 
ATOM   4638 O O   . HIS B 1 271 ? -55.293 -52.330 -11.678 1.00 48.58  ? 261 HIS B O   1 
ATOM   4639 C CB  . HIS B 1 271 ? -57.476 -50.295 -12.154 1.00 54.60  ? 261 HIS B CB  1 
ATOM   4640 C CG  . HIS B 1 271 ? -58.436 -50.251 -11.003 1.00 60.42  ? 261 HIS B CG  1 
ATOM   4641 N ND1 . HIS B 1 271 ? -58.570 -51.326 -10.122 1.00 63.34  ? 261 HIS B ND1 1 
ATOM   4642 C CD2 . HIS B 1 271 ? -59.245 -49.248 -10.588 1.00 63.79  ? 261 HIS B CD2 1 
ATOM   4643 C CE1 . HIS B 1 271 ? -59.467 -50.948 -9.226  1.00 63.30  ? 261 HIS B CE1 1 
ATOM   4644 N NE2 . HIS B 1 271 ? -59.888 -49.701 -9.450  1.00 63.86  ? 261 HIS B NE2 1 
ATOM   4645 N N   . LEU B 1 272 ? -54.826 -51.063 -9.869  1.00 44.86  ? 262 LEU B N   1 
ATOM   4646 C CA  . LEU B 1 272 ? -54.103 -52.091 -9.123  1.00 43.56  ? 262 LEU B CA  1 
ATOM   4647 C C   . LEU B 1 272 ? -54.596 -52.109 -7.687  1.00 47.78  ? 262 LEU B C   1 
ATOM   4648 O O   . LEU B 1 272 ? -54.608 -51.069 -7.021  1.00 47.41  ? 262 LEU B O   1 
ATOM   4649 C CB  . LEU B 1 272 ? -52.567 -51.825 -9.142  1.00 42.99  ? 262 LEU B CB  1 
ATOM   4650 C CG  . LEU B 1 272 ? -51.878 -51.591 -10.492 1.00 46.73  ? 262 LEU B CG  1 
ATOM   4651 C CD1 . LEU B 1 272 ? -50.546 -50.898 -10.314 1.00 46.21  ? 262 LEU B CD1 1 
ATOM   4652 C CD2 . LEU B 1 272 ? -51.729 -52.874 -11.268 1.00 47.97  ? 262 LEU B CD2 1 
ATOM   4653 N N   . GLY B 1 273 ? -54.981 -53.295 -7.221  1.00 44.34  ? 263 GLY B N   1 
ATOM   4654 C CA  . GLY B 1 273 ? -55.461 -53.519 -5.863  1.00 44.12  ? 263 GLY B CA  1 
ATOM   4655 C C   . GLY B 1 273 ? -56.560 -52.585 -5.401  1.00 48.12  ? 263 GLY B C   1 
ATOM   4656 O O   . GLY B 1 273 ? -56.508 -52.079 -4.279  1.00 48.22  ? 263 GLY B O   1 
ATOM   4657 N N   . GLY B 1 274 ? -57.527 -52.334 -6.283  1.00 44.98  ? 264 GLY B N   1 
ATOM   4658 C CA  . GLY B 1 274 ? -58.675 -51.483 -6.002  1.00 45.66  ? 264 GLY B CA  1 
ATOM   4659 C C   . GLY B 1 274 ? -58.432 -49.988 -6.065  1.00 52.13  ? 264 GLY B C   1 
ATOM   4660 O O   . GLY B 1 274 ? -59.383 -49.204 -5.977  1.00 53.33  ? 264 GLY B O   1 
ATOM   4661 N N   . LYS B 1 275 ? -57.160 -49.582 -6.170  1.00 48.44  ? 265 LYS B N   1 
ATOM   4662 C CA  . LYS B 1 275 ? -56.732 -48.187 -6.260  1.00 46.95  ? 265 LYS B CA  1 
ATOM   4663 C C   . LYS B 1 275 ? -56.296 -47.858 -7.694  1.00 48.40  ? 265 LYS B C   1 
ATOM   4664 O O   . LYS B 1 275 ? -56.037 -48.756 -8.505  1.00 46.65  ? 265 LYS B O   1 
ATOM   4665 C CB  . LYS B 1 275 ? -55.602 -47.900 -5.262  1.00 49.04  ? 265 LYS B CB  1 
ATOM   4666 C CG  . LYS B 1 275 ? -56.073 -47.741 -3.816  1.00 65.52  ? 265 LYS B CG  1 
ATOM   4667 C CD  . LYS B 1 275 ? -55.016 -47.084 -2.922  1.00 77.72  ? 265 LYS B CD  1 
ATOM   4668 C CE  . LYS B 1 275 ? -55.055 -45.567 -2.928  1.00 93.43  ? 265 LYS B CE  1 
ATOM   4669 N NZ  . LYS B 1 275 ? -54.413 -44.976 -4.138  1.00 103.19 ? 265 LYS B NZ  1 
ATOM   4670 N N   . GLU B 1 276 ? -56.211 -46.563 -7.993  1.00 44.86  ? 266 GLU B N   1 
ATOM   4671 C CA  . GLU B 1 276 ? -55.828 -46.070 -9.303  1.00 44.40  ? 266 GLU B CA  1 
ATOM   4672 C C   . GLU B 1 276 ? -54.461 -45.370 -9.243  1.00 45.82  ? 266 GLU B C   1 
ATOM   4673 O O   . GLU B 1 276 ? -54.281 -44.438 -8.462  1.00 46.63  ? 266 GLU B O   1 
ATOM   4674 C CB  . GLU B 1 276 ? -56.928 -45.154 -9.853  1.00 45.92  ? 266 GLU B CB  1 
ATOM   4675 C CG  . GLU B 1 276 ? -57.014 -45.216 -11.360 1.00 63.47  ? 266 GLU B CG  1 
ATOM   4676 C CD  . GLU B 1 276 ? -58.236 -45.912 -11.926 1.00 93.09  ? 266 GLU B CD  1 
ATOM   4677 O OE1 . GLU B 1 276 ? -58.134 -47.053 -12.442 1.00 73.59  ? 266 GLU B OE1 1 
ATOM   4678 O OE2 . GLU B 1 276 ? -59.314 -45.278 -11.876 1.00 99.28  ? 266 GLU B OE2 1 
ATOM   4679 N N   . TYR B 1 277 ? -53.488 -45.863 -10.034 1.00 40.35  ? 267 TYR B N   1 
ATOM   4680 C CA  . TYR B 1 277 ? -52.113 -45.330 -10.111 1.00 39.09  ? 267 TYR B CA  1 
ATOM   4681 C C   . TYR B 1 277 ? -51.994 -44.559 -11.405 1.00 43.20  ? 267 TYR B C   1 
ATOM   4682 O O   . TYR B 1 277 ? -51.946 -45.152 -12.487 1.00 42.73  ? 267 TYR B O   1 
ATOM   4683 C CB  . TYR B 1 277 ? -51.061 -46.460 -9.970  1.00 38.72  ? 267 TYR B CB  1 
ATOM   4684 C CG  . TYR B 1 277 ? -51.096 -47.063 -8.589  1.00 38.07  ? 267 TYR B CG  1 
ATOM   4685 C CD1 . TYR B 1 277 ? -50.338 -46.524 -7.555  1.00 38.91  ? 267 TYR B CD1 1 
ATOM   4686 C CD2 . TYR B 1 277 ? -51.982 -48.095 -8.278  1.00 38.69  ? 267 TYR B CD2 1 
ATOM   4687 C CE1 . TYR B 1 277 ? -50.445 -47.004 -6.252  1.00 38.28  ? 267 TYR B CE1 1 
ATOM   4688 C CE2 . TYR B 1 277 ? -52.089 -48.595 -6.978  1.00 38.93  ? 267 TYR B CE2 1 
ATOM   4689 C CZ  . TYR B 1 277 ? -51.321 -48.043 -5.966  1.00 45.55  ? 267 TYR B CZ  1 
ATOM   4690 O OH  . TYR B 1 277 ? -51.412 -48.525 -4.684  1.00 48.47  ? 267 TYR B OH  1 
ATOM   4691 N N   . THR B 1 278 ? -52.056 -43.222 -11.289 1.00 38.89  ? 268 THR B N   1 
ATOM   4692 C CA  . THR B 1 278 ? -52.099 -42.316 -12.421 1.00 38.54  ? 268 THR B CA  1 
ATOM   4693 C C   . THR B 1 278 ? -50.766 -41.669 -12.795 1.00 43.87  ? 268 THR B C   1 
ATOM   4694 O O   . THR B 1 278 ? -50.059 -41.125 -11.940 1.00 42.49  ? 268 THR B O   1 
ATOM   4695 C CB  . THR B 1 278 ? -53.229 -41.289 -12.183 1.00 42.01  ? 268 THR B CB  1 
ATOM   4696 O OG1 . THR B 1 278 ? -54.448 -41.982 -11.871 1.00 43.19  ? 268 THR B OG1 1 
ATOM   4697 C CG2 . THR B 1 278 ? -53.461 -40.364 -13.370 1.00 32.71  ? 268 THR B CG2 1 
ATOM   4698 N N   . LEU B 1 279 ? -50.474 -41.682 -14.103 1.00 41.95  ? 269 LEU B N   1 
ATOM   4699 C CA  . LEU B 1 279 ? -49.328 -41.027 -14.719 1.00 42.00  ? 269 LEU B CA  1 
ATOM   4700 C C   . LEU B 1 279 ? -49.801 -39.874 -15.607 1.00 44.55  ? 269 LEU B C   1 
ATOM   4701 O O   . LEU B 1 279 ? -50.569 -40.093 -16.534 1.00 44.00  ? 269 LEU B O   1 
ATOM   4702 C CB  . LEU B 1 279 ? -48.486 -42.016 -15.564 1.00 42.63  ? 269 LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 279 ? -47.772 -43.194 -14.887 1.00 47.64  ? 269 LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 279 ? -46.682 -43.703 -15.766 1.00 46.99  ? 269 LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 279 ? -47.125 -42.792 -13.591 1.00 51.97  ? 269 LEU B CD2 1 
ATOM   4706 N N   . THR B 1 280 ? -49.366 -38.639 -15.299 1.00 42.05  ? 270 THR B N   1 
ATOM   4707 C CA  . THR B 1 280 ? -49.637 -37.444 -16.124 1.00 42.19  ? 270 THR B CA  1 
ATOM   4708 C C   . THR B 1 280 ? -48.640 -37.475 -17.306 1.00 47.53  ? 270 THR B C   1 
ATOM   4709 O O   . THR B 1 280 ? -47.653 -38.220 -17.241 1.00 48.62  ? 270 THR B O   1 
ATOM   4710 C CB  . THR B 1 280 ? -49.502 -36.137 -15.317 1.00 48.74  ? 270 THR B CB  1 
ATOM   4711 O OG1 . THR B 1 280 ? -48.143 -35.931 -14.933 1.00 51.75  ? 270 THR B OG1 1 
ATOM   4712 C CG2 . THR B 1 280 ? -50.409 -36.087 -14.100 1.00 46.90  ? 270 THR B CG2 1 
ATOM   4713 N N   . SER B 1 281 ? -48.883 -36.686 -18.378 1.00 43.34  ? 271 SER B N   1 
ATOM   4714 C CA  . SER B 1 281 ? -48.001 -36.649 -19.555 1.00 42.52  ? 271 SER B CA  1 
ATOM   4715 C C   . SER B 1 281 ? -46.534 -36.264 -19.236 1.00 46.22  ? 271 SER B C   1 
ATOM   4716 O O   . SER B 1 281 ? -45.629 -36.664 -19.952 1.00 47.02  ? 271 SER B O   1 
ATOM   4717 C CB  . SER B 1 281 ? -48.604 -35.773 -20.644 1.00 45.76  ? 271 SER B CB  1 
ATOM   4718 O OG  . SER B 1 281 ? -48.781 -34.435 -20.210 1.00 58.21  ? 271 SER B OG  1 
ATOM   4719 N N   . ALA B 1 282 ? -46.305 -35.544 -18.134 1.00 42.55  ? 272 ALA B N   1 
ATOM   4720 C CA  . ALA B 1 282 ? -44.970 -35.146 -17.663 1.00 41.76  ? 272 ALA B CA  1 
ATOM   4721 C C   . ALA B 1 282 ? -44.194 -36.391 -17.191 1.00 46.46  ? 272 ALA B C   1 
ATOM   4722 O O   . ALA B 1 282 ? -42.963 -36.429 -17.281 1.00 46.76  ? 272 ALA B O   1 
ATOM   4723 C CB  . ALA B 1 282 ? -45.100 -34.152 -16.510 1.00 41.68  ? 272 ALA B CB  1 
ATOM   4724 N N   . ASP B 1 283 ? -44.929 -37.414 -16.710 1.00 42.57  ? 273 ASP B N   1 
ATOM   4725 C CA  . ASP B 1 283 ? -44.374 -38.677 -16.219 1.00 41.86  ? 273 ASP B CA  1 
ATOM   4726 C C   . ASP B 1 283 ? -43.988 -39.661 -17.323 1.00 45.32  ? 273 ASP B C   1 
ATOM   4727 O O   . ASP B 1 283 ? -43.073 -40.460 -17.122 1.00 45.93  ? 273 ASP B O   1 
ATOM   4728 C CB  . ASP B 1 283 ? -45.364 -39.362 -15.261 1.00 43.44  ? 273 ASP B CB  1 
ATOM   4729 C CG  . ASP B 1 283 ? -45.786 -38.533 -14.061 1.00 47.79  ? 273 ASP B CG  1 
ATOM   4730 O OD1 . ASP B 1 283 ? -44.905 -38.065 -13.326 1.00 47.60  ? 273 ASP B OD1 1 
ATOM   4731 O OD2 . ASP B 1 283 ? -46.995 -38.421 -13.817 1.00 53.74  ? 273 ASP B OD2 1 
ATOM   4732 N N   . TYR B 1 284 ? -44.692 -39.641 -18.465 1.00 41.53  ? 274 TYR B N   1 
ATOM   4733 C CA  . TYR B 1 284 ? -44.463 -40.607 -19.539 1.00 41.20  ? 274 TYR B CA  1 
ATOM   4734 C C   . TYR B 1 284 ? -43.955 -40.081 -20.895 1.00 45.52  ? 274 TYR B C   1 
ATOM   4735 O O   . TYR B 1 284 ? -43.712 -40.877 -21.809 1.00 45.45  ? 274 TYR B O   1 
ATOM   4736 C CB  . TYR B 1 284 ? -45.674 -41.548 -19.692 1.00 41.70  ? 274 TYR B CB  1 
ATOM   4737 C CG  . TYR B 1 284 ? -46.920 -40.903 -20.274 1.00 41.93  ? 274 TYR B CG  1 
ATOM   4738 C CD1 . TYR B 1 284 ? -47.023 -40.647 -21.644 1.00 42.64  ? 274 TYR B CD1 1 
ATOM   4739 C CD2 . TYR B 1 284 ? -48.033 -40.642 -19.475 1.00 42.62  ? 274 TYR B CD2 1 
ATOM   4740 C CE1 . TYR B 1 284 ? -48.180 -40.091 -22.193 1.00 40.35  ? 274 TYR B CE1 1 
ATOM   4741 C CE2 . TYR B 1 284 ? -49.209 -40.120 -20.018 1.00 43.86  ? 274 TYR B CE2 1 
ATOM   4742 C CZ  . TYR B 1 284 ? -49.280 -39.843 -21.381 1.00 47.64  ? 274 TYR B CZ  1 
ATOM   4743 O OH  . TYR B 1 284 ? -50.437 -39.318 -21.932 1.00 40.22  ? 274 TYR B OH  1 
ATOM   4744 N N   . VAL B 1 285 ? -43.776 -38.763 -21.024 1.00 41.87  ? 275 VAL B N   1 
ATOM   4745 C CA  . VAL B 1 285 ? -43.227 -38.179 -22.248 1.00 41.58  ? 275 VAL B CA  1 
ATOM   4746 C C   . VAL B 1 285 ? -41.814 -37.706 -21.940 1.00 44.64  ? 275 VAL B C   1 
ATOM   4747 O O   . VAL B 1 285 ? -41.618 -37.022 -20.936 1.00 45.77  ? 275 VAL B O   1 
ATOM   4748 C CB  . VAL B 1 285 ? -44.099 -37.019 -22.835 1.00 45.01  ? 275 VAL B CB  1 
ATOM   4749 C CG1 . VAL B 1 285 ? -43.491 -36.470 -24.125 1.00 44.47  ? 275 VAL B CG1 1 
ATOM   4750 C CG2 . VAL B 1 285 ? -45.544 -37.458 -23.067 1.00 44.43  ? 275 VAL B CG2 1 
ATOM   4751 N N   . PHE B 1 286 ? -40.843 -38.038 -22.808 1.00 40.48  ? 276 PHE B N   1 
ATOM   4752 C CA  . PHE B 1 286 ? -39.474 -37.539 -22.681 1.00 39.93  ? 276 PHE B CA  1 
ATOM   4753 C C   . PHE B 1 286 ? -39.463 -36.151 -23.302 1.00 48.13  ? 276 PHE B C   1 
ATOM   4754 O O   . PHE B 1 286 ? -39.250 -35.979 -24.507 1.00 48.51  ? 276 PHE B O   1 
ATOM   4755 C CB  . PHE B 1 286 ? -38.438 -38.475 -23.320 1.00 39.83  ? 276 PHE B CB  1 
ATOM   4756 C CG  . PHE B 1 286 ? -38.195 -39.760 -22.574 1.00 38.85  ? 276 PHE B CG  1 
ATOM   4757 C CD1 . PHE B 1 286 ? -37.732 -39.748 -21.266 1.00 39.79  ? 276 PHE B CD1 1 
ATOM   4758 C CD2 . PHE B 1 286 ? -38.374 -40.986 -23.196 1.00 39.08  ? 276 PHE B CD2 1 
ATOM   4759 C CE1 . PHE B 1 286 ? -37.462 -40.942 -20.583 1.00 39.66  ? 276 PHE B CE1 1 
ATOM   4760 C CE2 . PHE B 1 286 ? -38.112 -42.182 -22.512 1.00 41.11  ? 276 PHE B CE2 1 
ATOM   4761 C CZ  . PHE B 1 286 ? -37.658 -42.153 -21.203 1.00 38.57  ? 276 PHE B CZ  1 
ATOM   4762 N N   . GLN B 1 287 ? -39.769 -35.174 -22.458 1.00 47.47  ? 277 GLN B N   1 
ATOM   4763 C CA  . GLN B 1 287 ? -39.917 -33.763 -22.771 1.00 49.19  ? 277 GLN B CA  1 
ATOM   4764 C C   . GLN B 1 287 ? -38.542 -33.047 -22.860 1.00 58.24  ? 277 GLN B C   1 
ATOM   4765 O O   . GLN B 1 287 ? -38.236 -32.177 -22.034 1.00 57.29  ? 277 GLN B O   1 
ATOM   4766 C CB  . GLN B 1 287 ? -40.852 -33.145 -21.702 1.00 50.08  ? 277 GLN B CB  1 
ATOM   4767 C CG  . GLN B 1 287 ? -42.002 -32.287 -22.207 1.00 54.92  ? 277 GLN B CG  1 
ATOM   4768 C CD  . GLN B 1 287 ? -42.955 -32.911 -23.180 1.00 67.14  ? 277 GLN B CD  1 
ATOM   4769 O OE1 . GLN B 1 287 ? -42.742 -32.835 -24.384 1.00 67.16  ? 277 GLN B OE1 1 
ATOM   4770 N NE2 . GLN B 1 287 ? -44.102 -33.385 -22.700 1.00 50.69  ? 277 GLN B NE2 1 
ATOM   4771 N N   . GLU B 1 288 ? -37.715 -33.433 -23.877 1.00 59.21  ? 278 GLU B N   1 
ATOM   4772 C CA  . GLU B 1 288 ? -36.380 -32.862 -24.180 1.00 61.16  ? 278 GLU B CA  1 
ATOM   4773 C C   . GLU B 1 288 ? -36.512 -31.351 -24.405 1.00 69.21  ? 278 GLU B C   1 
ATOM   4774 O O   . GLU B 1 288 ? -35.711 -30.568 -23.884 1.00 70.07  ? 278 GLU B O   1 
ATOM   4775 C CB  . GLU B 1 288 ? -35.750 -33.517 -25.428 1.00 62.77  ? 278 GLU B CB  1 
ATOM   4776 C CG  . GLU B 1 288 ? -35.567 -35.027 -25.347 1.00 75.36  ? 278 GLU B CG  1 
ATOM   4777 C CD  . GLU B 1 288 ? -34.299 -35.495 -24.658 1.00 98.47  ? 278 GLU B CD  1 
ATOM   4778 O OE1 . GLU B 1 288 ? -34.381 -35.901 -23.475 1.00 93.22  ? 278 GLU B OE1 1 
ATOM   4779 O OE2 . GLU B 1 288 ? -33.228 -35.474 -25.309 1.00 92.02  ? 278 GLU B OE2 1 
ATOM   4780 N N   . SER B 1 289 ? -37.573 -30.954 -25.141 1.00 66.38  ? 279 SER B N   1 
ATOM   4781 C CA  . SER B 1 289 ? -37.965 -29.574 -25.419 1.00 65.79  ? 279 SER B CA  1 
ATOM   4782 C C   . SER B 1 289 ? -39.477 -29.506 -25.334 1.00 68.62  ? 279 SER B C   1 
ATOM   4783 O O   . SER B 1 289 ? -40.129 -30.530 -25.099 1.00 68.00  ? 279 SER B O   1 
ATOM   4784 C CB  . SER B 1 289 ? -37.504 -29.152 -26.814 1.00 68.81  ? 279 SER B CB  1 
ATOM   4785 O OG  . SER B 1 289 ? -37.962 -30.038 -27.822 1.00 75.82  ? 279 SER B OG  1 
ATOM   4786 N N   . TYR B 1 290 A -40.032 -28.302 -25.515 1.00 64.49  ? 279 TYR B N   1 
ATOM   4787 C CA  . TYR B 1 290 A -41.469 -28.047 -25.555 1.00 63.81  ? 279 TYR B CA  1 
ATOM   4788 C C   . TYR B 1 290 A -41.763 -27.365 -26.911 1.00 62.94  ? 279 TYR B C   1 
ATOM   4789 O O   . TYR B 1 290 A -42.780 -26.681 -27.082 1.00 62.11  ? 279 TYR B O   1 
ATOM   4790 C CB  . TYR B 1 290 A -41.899 -27.196 -24.339 1.00 66.65  ? 279 TYR B CB  1 
ATOM   4791 C CG  . TYR B 1 290 A -41.888 -27.962 -23.029 1.00 71.10  ? 279 TYR B CG  1 
ATOM   4792 C CD1 . TYR B 1 290 A -43.076 -28.375 -22.429 1.00 73.59  ? 279 TYR B CD1 1 
ATOM   4793 C CD2 . TYR B 1 290 A -40.689 -28.279 -22.390 1.00 72.47  ? 279 TYR B CD2 1 
ATOM   4794 C CE1 . TYR B 1 290 A -43.073 -29.078 -21.223 1.00 74.86  ? 279 TYR B CE1 1 
ATOM   4795 C CE2 . TYR B 1 290 A -40.671 -29.004 -21.199 1.00 73.76  ? 279 TYR B CE2 1 
ATOM   4796 C CZ  . TYR B 1 290 A -41.866 -29.385 -20.608 1.00 84.00  ? 279 TYR B CZ  1 
ATOM   4797 O OH  . TYR B 1 290 A -41.846 -30.102 -19.434 1.00 87.53  ? 279 TYR B OH  1 
ATOM   4798 N N   . SER B 1 291 B -40.849 -27.597 -27.881 1.00 56.22  ? 279 SER B N   1 
ATOM   4799 C CA  . SER B 1 291 B -40.853 -27.050 -29.234 1.00 55.65  ? 279 SER B CA  1 
ATOM   4800 C C   . SER B 1 291 B -41.944 -27.597 -30.171 1.00 59.28  ? 279 SER B C   1 
ATOM   4801 O O   . SER B 1 291 B -42.100 -28.819 -30.323 1.00 58.71  ? 279 SER B O   1 
ATOM   4802 C CB  . SER B 1 291 B -39.481 -27.243 -29.881 1.00 59.08  ? 279 SER B CB  1 
ATOM   4803 O OG  . SER B 1 291 B -39.378 -26.574 -31.127 1.00 67.50  ? 279 SER B OG  1 
ATOM   4804 N N   . SER B 1 292 C -42.641 -26.669 -30.868 1.00 54.74  ? 279 SER B N   1 
ATOM   4805 C CA  . SER B 1 292 C -43.627 -26.986 -31.909 1.00 53.59  ? 279 SER B CA  1 
ATOM   4806 C C   . SER B 1 292 C -42.912 -27.594 -33.127 1.00 55.32  ? 279 SER B C   1 
ATOM   4807 O O   . SER B 1 292 C -43.545 -28.309 -33.902 1.00 55.32  ? 279 SER B O   1 
ATOM   4808 C CB  . SER B 1 292 C -44.383 -25.735 -32.337 1.00 55.95  ? 279 SER B CB  1 
ATOM   4809 O OG  . SER B 1 292 C -43.481 -24.696 -32.680 1.00 63.12  ? 279 SER B OG  1 
ATOM   4810 N N   . LYS B 1 293 D -41.582 -27.349 -33.244 1.00 49.91  ? 279 LYS B N   1 
ATOM   4811 C CA  . LYS B 1 293 D -40.692 -27.786 -34.331 1.00 48.93  ? 279 LYS B CA  1 
ATOM   4812 C C   . LYS B 1 293 D -39.972 -29.137 -34.091 1.00 50.13  ? 279 LYS B C   1 
ATOM   4813 O O   . LYS B 1 293 D -39.240 -29.581 -34.981 1.00 47.54  ? 279 LYS B O   1 
ATOM   4814 C CB  . LYS B 1 293 D -39.655 -26.685 -34.657 1.00 50.80  ? 279 LYS B CB  1 
ATOM   4815 C CG  . LYS B 1 293 D -40.253 -25.297 -34.896 1.00 55.80  ? 279 LYS B CG  1 
ATOM   4816 C CD  . LYS B 1 293 D -39.197 -24.190 -34.796 1.00 56.77  ? 279 LYS B CD  1 
ATOM   4817 C CE  . LYS B 1 293 D -39.491 -23.076 -33.795 1.00 56.39  ? 279 LYS B CE  1 
ATOM   4818 N NZ  . LYS B 1 293 D -40.738 -22.317 -34.106 1.00 59.72  ? 279 LYS B NZ  1 
ATOM   4819 N N   . LYS B 1 294 ? -40.164 -29.785 -32.909 1.00 46.80  ? 280 LYS B N   1 
ATOM   4820 C CA  . LYS B 1 294 ? -39.478 -31.058 -32.592 1.00 45.75  ? 280 LYS B CA  1 
ATOM   4821 C C   . LYS B 1 294 ? -40.390 -32.200 -32.146 1.00 46.92  ? 280 LYS B C   1 
ATOM   4822 O O   . LYS B 1 294 ? -41.492 -31.950 -31.649 1.00 45.12  ? 280 LYS B O   1 
ATOM   4823 C CB  . LYS B 1 294 ? -38.350 -30.828 -31.572 1.00 47.69  ? 280 LYS B CB  1 
ATOM   4824 C CG  . LYS B 1 294 ? -37.119 -30.174 -32.168 1.00 61.76  ? 280 LYS B CG  1 
ATOM   4825 C CD  . LYS B 1 294 ? -36.390 -29.324 -31.139 1.00 73.87  ? 280 LYS B CD  1 
ATOM   4826 C CE  . LYS B 1 294 ? -35.277 -28.491 -31.742 1.00 88.19  ? 280 LYS B CE  1 
ATOM   4827 N NZ  . LYS B 1 294 ? -34.103 -29.308 -32.156 1.00 96.93  ? 280 LYS B NZ  1 
ATOM   4828 N N   . LEU B 1 295 ? -39.905 -33.461 -32.304 1.00 43.49  ? 281 LEU B N   1 
ATOM   4829 C CA  . LEU B 1 295 ? -40.628 -34.683 -31.911 1.00 42.78  ? 281 LEU B CA  1 
ATOM   4830 C C   . LEU B 1 295 ? -40.074 -35.280 -30.635 1.00 48.26  ? 281 LEU B C   1 
ATOM   4831 O O   . LEU B 1 295 ? -38.855 -35.402 -30.501 1.00 47.80  ? 281 LEU B O   1 
ATOM   4832 C CB  . LEU B 1 295 ? -40.635 -35.728 -33.025 1.00 42.04  ? 281 LEU B CB  1 
ATOM   4833 C CG  . LEU B 1 295 ? -41.308 -35.319 -34.329 1.00 45.03  ? 281 LEU B CG  1 
ATOM   4834 C CD1 . LEU B 1 295 ? -40.951 -36.299 -35.424 1.00 44.83  ? 281 LEU B CD1 1 
ATOM   4835 C CD2 . LEU B 1 295 ? -42.820 -35.206 -34.167 1.00 44.66  ? 281 LEU B CD2 1 
ATOM   4836 N N   . CYS B 1 296 ? -40.977 -35.607 -29.680 1.00 45.50  ? 282 CYS B N   1 
ATOM   4837 C CA  . CYS B 1 296 ? -40.641 -36.165 -28.366 1.00 45.21  ? 282 CYS B CA  1 
ATOM   4838 C C   . CYS B 1 296 ? -41.073 -37.629 -28.239 1.00 48.12  ? 282 CYS B C   1 
ATOM   4839 O O   . CYS B 1 296 ? -42.152 -38.000 -28.695 1.00 46.83  ? 282 CYS B O   1 
ATOM   4840 C CB  . CYS B 1 296 ? -41.241 -35.307 -27.258 1.00 45.86  ? 282 CYS B CB  1 
ATOM   4841 S SG  . CYS B 1 296 ? -40.273 -33.823 -26.855 1.00 50.14  ? 282 CYS B SG  1 
ATOM   4842 N N   . THR B 1 297 ? -40.234 -38.461 -27.607 1.00 45.04  ? 283 THR B N   1 
ATOM   4843 C CA  . THR B 1 297 ? -40.533 -39.888 -27.439 1.00 44.39  ? 283 THR B CA  1 
ATOM   4844 C C   . THR B 1 297 ? -41.301 -40.178 -26.156 1.00 45.75  ? 283 THR B C   1 
ATOM   4845 O O   . THR B 1 297 ? -41.180 -39.441 -25.167 1.00 43.75  ? 283 THR B O   1 
ATOM   4846 C CB  . THR B 1 297 ? -39.258 -40.735 -27.517 1.00 53.82  ? 283 THR B CB  1 
ATOM   4847 O OG1 . THR B 1 297 ? -38.304 -40.234 -26.569 1.00 57.52  ? 283 THR B OG1 1 
ATOM   4848 C CG2 . THR B 1 297 ? -38.663 -40.769 -28.922 1.00 50.10  ? 283 THR B CG2 1 
ATOM   4849 N N   . LEU B 1 298 ? -42.078 -41.275 -26.171 1.00 41.97  ? 284 LEU B N   1 
ATOM   4850 C CA  . LEU B 1 298 ? -42.838 -41.701 -24.987 1.00 41.30  ? 284 LEU B CA  1 
ATOM   4851 C C   . LEU B 1 298 ? -42.089 -42.834 -24.297 1.00 42.93  ? 284 LEU B C   1 
ATOM   4852 O O   . LEU B 1 298 ? -41.443 -43.634 -24.977 1.00 43.23  ? 284 LEU B O   1 
ATOM   4853 C CB  . LEU B 1 298 ? -44.273 -42.127 -25.338 1.00 41.21  ? 284 LEU B CB  1 
ATOM   4854 C CG  . LEU B 1 298 ? -45.119 -41.186 -26.248 1.00 45.86  ? 284 LEU B CG  1 
ATOM   4855 C CD1 . LEU B 1 298 ? -46.581 -41.557 -26.152 1.00 45.87  ? 284 LEU B CD1 1 
ATOM   4856 C CD2 . LEU B 1 298 ? -45.034 -39.746 -25.819 1.00 50.34  ? 284 LEU B CD2 1 
ATOM   4857 N N   . ALA B 1 299 ? -42.136 -42.865 -22.942 1.00 36.41  ? 285 ALA B N   1 
ATOM   4858 C CA  . ALA B 1 299 ? -41.479 -43.851 -22.080 1.00 34.44  ? 285 ALA B CA  1 
ATOM   4859 C C   . ALA B 1 299 ? -42.370 -45.099 -21.868 1.00 40.17  ? 285 ALA B C   1 
ATOM   4860 O O   . ALA B 1 299 ? -42.476 -45.653 -20.759 1.00 39.38  ? 285 ALA B O   1 
ATOM   4861 C CB  . ALA B 1 299 ? -41.122 -43.206 -20.758 1.00 34.58  ? 285 ALA B CB  1 
ATOM   4862 N N   . ILE B 1 300 ? -43.040 -45.504 -22.964 1.00 38.69  ? 286 ILE B N   1 
ATOM   4863 C CA  . ILE B 1 300 ? -43.943 -46.643 -23.111 1.00 39.69  ? 286 ILE B CA  1 
ATOM   4864 C C   . ILE B 1 300 ? -43.585 -47.319 -24.439 1.00 46.18  ? 286 ILE B C   1 
ATOM   4865 O O   . ILE B 1 300 ? -43.539 -46.640 -25.470 1.00 46.28  ? 286 ILE B O   1 
ATOM   4866 C CB  . ILE B 1 300 ? -45.444 -46.228 -23.050 1.00 42.96  ? 286 ILE B CB  1 
ATOM   4867 C CG1 . ILE B 1 300 ? -45.765 -45.392 -21.776 1.00 42.75  ? 286 ILE B CG1 1 
ATOM   4868 C CG2 . ILE B 1 300 ? -46.348 -47.473 -23.166 1.00 43.45  ? 286 ILE B CG2 1 
ATOM   4869 C CD1 . ILE B 1 300 ? -47.109 -44.673 -21.746 1.00 41.18  ? 286 ILE B CD1 1 
ATOM   4870 N N   . HIS B 1 301 ? -43.234 -48.625 -24.390 1.00 45.75  ? 287 HIS B N   1 
ATOM   4871 C CA  . HIS B 1 301 ? -42.800 -49.446 -25.533 1.00 47.53  ? 287 HIS B CA  1 
ATOM   4872 C C   . HIS B 1 301 ? -43.541 -50.791 -25.587 1.00 50.88  ? 287 HIS B C   1 
ATOM   4873 O O   . HIS B 1 301 ? -44.034 -51.253 -24.563 1.00 48.96  ? 287 HIS B O   1 
ATOM   4874 C CB  . HIS B 1 301 ? -41.283 -49.727 -25.427 1.00 50.38  ? 287 HIS B CB  1 
ATOM   4875 C CG  . HIS B 1 301 ? -40.400 -48.622 -25.926 1.00 56.26  ? 287 HIS B CG  1 
ATOM   4876 N ND1 . HIS B 1 301 ? -40.544 -47.301 -25.478 1.00 59.29  ? 287 HIS B ND1 1 
ATOM   4877 C CD2 . HIS B 1 301 ? -39.354 -48.677 -26.787 1.00 59.78  ? 287 HIS B CD2 1 
ATOM   4878 C CE1 . HIS B 1 301 ? -39.600 -46.602 -26.096 1.00 59.34  ? 287 HIS B CE1 1 
ATOM   4879 N NE2 . HIS B 1 301 ? -38.853 -47.383 -26.890 1.00 59.89  ? 287 HIS B NE2 1 
ATOM   4880 N N   . ALA B 1 302 ? -43.572 -51.450 -26.756 1.00 49.03  ? 288 ALA B N   1 
ATOM   4881 C CA  . ALA B 1 302 ? -44.188 -52.766 -26.847 1.00 49.59  ? 288 ALA B CA  1 
ATOM   4882 C C   . ALA B 1 302 ? -43.154 -53.854 -26.516 1.00 54.55  ? 288 ALA B C   1 
ATOM   4883 O O   . ALA B 1 302 ? -41.982 -53.715 -26.863 1.00 53.87  ? 288 ALA B O   1 
ATOM   4884 C CB  . ALA B 1 302 ? -44.779 -52.985 -28.233 1.00 50.38  ? 288 ALA B CB  1 
ATOM   4885 N N   . MET B 1 303 ? -43.597 -54.916 -25.813 1.00 52.27  ? 289 MET B N   1 
ATOM   4886 C CA  . MET B 1 303 ? -42.788 -56.080 -25.455 1.00 52.09  ? 289 MET B CA  1 
ATOM   4887 C C   . MET B 1 303 ? -43.679 -57.280 -25.342 1.00 54.97  ? 289 MET B C   1 
ATOM   4888 O O   . MET B 1 303 ? -44.549 -57.338 -24.465 1.00 54.05  ? 289 MET B O   1 
ATOM   4889 C CB  . MET B 1 303 ? -41.998 -55.886 -24.156 1.00 54.73  ? 289 MET B CB  1 
ATOM   4890 C CG  . MET B 1 303 ? -40.547 -55.561 -24.397 1.00 58.45  ? 289 MET B CG  1 
ATOM   4891 S SD  . MET B 1 303 ? -39.509 -57.013 -24.789 1.00 61.85  ? 289 MET B SD  1 
ATOM   4892 C CE  . MET B 1 303 ? -38.271 -56.212 -25.627 1.00 58.65  ? 289 MET B CE  1 
ATOM   4893 N N   . ASP B 1 304 ? -43.491 -58.233 -26.253 1.00 52.35  ? 290 ASP B N   1 
ATOM   4894 C CA  . ASP B 1 304 ? -44.273 -59.451 -26.205 1.00 52.54  ? 290 ASP B CA  1 
ATOM   4895 C C   . ASP B 1 304 ? -43.493 -60.450 -25.370 1.00 56.85  ? 290 ASP B C   1 
ATOM   4896 O O   . ASP B 1 304 ? -42.463 -60.972 -25.816 1.00 55.61  ? 290 ASP B O   1 
ATOM   4897 C CB  . ASP B 1 304 ? -44.648 -59.954 -27.607 1.00 54.03  ? 290 ASP B CB  1 
ATOM   4898 C CG  . ASP B 1 304 ? -45.556 -58.995 -28.370 1.00 61.21  ? 290 ASP B CG  1 
ATOM   4899 O OD1 . ASP B 1 304 ? -46.677 -58.711 -27.878 1.00 61.83  ? 290 ASP B OD1 1 
ATOM   4900 O OD2 . ASP B 1 304 ? -45.159 -58.550 -29.462 1.00 65.41  ? 290 ASP B OD2 1 
ATOM   4901 N N   . ILE B 1 305 ? -43.899 -60.581 -24.096 1.00 53.95  ? 291 ILE B N   1 
ATOM   4902 C CA  . ILE B 1 305 ? -43.254 -61.496 -23.164 1.00 54.78  ? 291 ILE B CA  1 
ATOM   4903 C C   . ILE B 1 305 ? -43.920 -62.869 -23.345 1.00 61.44  ? 291 ILE B C   1 
ATOM   4904 O O   . ILE B 1 305 ? -45.152 -62.967 -23.268 1.00 60.55  ? 291 ILE B O   1 
ATOM   4905 C CB  . ILE B 1 305 ? -43.245 -60.954 -21.705 1.00 57.44  ? 291 ILE B CB  1 
ATOM   4906 C CG1 . ILE B 1 305 ? -42.340 -59.709 -21.601 1.00 57.43  ? 291 ILE B CG1 1 
ATOM   4907 C CG2 . ILE B 1 305 ? -42.816 -62.031 -20.683 1.00 57.52  ? 291 ILE B CG2 1 
ATOM   4908 C CD1 . ILE B 1 305 ? -42.921 -58.590 -20.796 1.00 62.22  ? 291 ILE B CD1 1 
ATOM   4909 N N   . PRO B 1 306 ? -43.134 -63.908 -23.705 1.00 60.02  ? 292 PRO B N   1 
ATOM   4910 C CA  . PRO B 1 306 ? -43.738 -65.228 -23.963 1.00 60.55  ? 292 PRO B CA  1 
ATOM   4911 C C   . PRO B 1 306 ? -44.168 -65.975 -22.694 1.00 67.11  ? 292 PRO B C   1 
ATOM   4912 O O   . PRO B 1 306 ? -43.655 -65.655 -21.607 1.00 66.54  ? 292 PRO B O   1 
ATOM   4913 C CB  . PRO B 1 306 ? -42.634 -65.977 -24.711 1.00 61.97  ? 292 PRO B CB  1 
ATOM   4914 C CG  . PRO B 1 306 ? -41.364 -65.374 -24.204 1.00 66.40  ? 292 PRO B CG  1 
ATOM   4915 C CD  . PRO B 1 306 ? -41.668 -63.929 -23.909 1.00 61.89  ? 292 PRO B CD  1 
ATOM   4916 N N   . PRO B 1 307 ? -45.063 -67.005 -22.813 1.00 65.09  ? 293 PRO B N   1 
ATOM   4917 C CA  . PRO B 1 307 ? -45.459 -67.776 -21.619 1.00 64.97  ? 293 PRO B CA  1 
ATOM   4918 C C   . PRO B 1 307 ? -44.278 -68.554 -21.012 1.00 68.01  ? 293 PRO B C   1 
ATOM   4919 O O   . PRO B 1 307 ? -43.266 -68.733 -21.704 1.00 67.85  ? 293 PRO B O   1 
ATOM   4920 C CB  . PRO B 1 307 ? -46.584 -68.691 -22.135 1.00 66.59  ? 293 PRO B CB  1 
ATOM   4921 C CG  . PRO B 1 307 ? -47.023 -68.091 -23.436 1.00 70.90  ? 293 PRO B CG  1 
ATOM   4922 C CD  . PRO B 1 307 ? -45.763 -67.513 -24.010 1.00 66.55  ? 293 PRO B CD  1 
ATOM   4923 N N   . PRO B 1 308 ? -44.316 -68.950 -19.716 1.00 63.00  ? 294 PRO B N   1 
ATOM   4924 C CA  . PRO B 1 308 ? -45.428 -68.842 -18.745 1.00 61.98  ? 294 PRO B CA  1 
ATOM   4925 C C   . PRO B 1 308 ? -45.703 -67.449 -18.183 1.00 64.76  ? 294 PRO B C   1 
ATOM   4926 O O   . PRO B 1 308 ? -46.871 -67.136 -17.918 1.00 64.59  ? 294 PRO B O   1 
ATOM   4927 C CB  . PRO B 1 308 ? -45.050 -69.868 -17.674 1.00 63.60  ? 294 PRO B CB  1 
ATOM   4928 C CG  . PRO B 1 308 ? -43.548 -69.879 -17.694 1.00 68.50  ? 294 PRO B CG  1 
ATOM   4929 C CD  . PRO B 1 308 ? -43.165 -69.676 -19.138 1.00 64.19  ? 294 PRO B CD  1 
ATOM   4930 N N   . THR B 1 309 ? -44.638 -66.617 -18.019 1.00 60.18  ? 295 THR B N   1 
ATOM   4931 C CA  . THR B 1 309 ? -44.692 -65.250 -17.468 1.00 59.31  ? 295 THR B CA  1 
ATOM   4932 C C   . THR B 1 309 ? -45.693 -64.354 -18.217 1.00 61.38  ? 295 THR B C   1 
ATOM   4933 O O   . THR B 1 309 ? -46.527 -63.697 -17.587 1.00 59.75  ? 295 THR B O   1 
ATOM   4934 C CB  . THR B 1 309 ? -43.284 -64.631 -17.420 1.00 63.36  ? 295 THR B CB  1 
ATOM   4935 O OG1 . THR B 1 309 ? -42.388 -65.551 -16.795 1.00 63.24  ? 295 THR B OG1 1 
ATOM   4936 C CG2 . THR B 1 309 ? -43.251 -63.305 -16.663 1.00 60.01  ? 295 THR B CG2 1 
ATOM   4937 N N   . GLY B 1 310 ? -45.600 -64.353 -19.541 1.00 58.13  ? 296 GLY B N   1 
ATOM   4938 C CA  . GLY B 1 310 ? -46.459 -63.533 -20.380 1.00 58.03  ? 296 GLY B CA  1 
ATOM   4939 C C   . GLY B 1 310 ? -47.604 -64.244 -21.084 1.00 62.42  ? 296 GLY B C   1 
ATOM   4940 O O   . GLY B 1 310 ? -47.771 -65.459 -20.949 1.00 63.70  ? 296 GLY B O   1 
ATOM   4941 N N   . PRO B 1 311 ? -48.420 -63.502 -21.861 1.00 56.88  ? 297 PRO B N   1 
ATOM   4942 C CA  . PRO B 1 311 ? -48.342 -62.053 -22.096 1.00 55.62  ? 297 PRO B CA  1 
ATOM   4943 C C   . PRO B 1 311 ? -48.665 -61.239 -20.838 1.00 56.77  ? 297 PRO B C   1 
ATOM   4944 O O   . PRO B 1 311 ? -49.566 -61.596 -20.072 1.00 57.05  ? 297 PRO B O   1 
ATOM   4945 C CB  . PRO B 1 311 ? -49.316 -61.835 -23.259 1.00 57.56  ? 297 PRO B CB  1 
ATOM   4946 C CG  . PRO B 1 311 ? -50.333 -62.926 -23.105 1.00 62.76  ? 297 PRO B CG  1 
ATOM   4947 C CD  . PRO B 1 311 ? -49.544 -64.113 -22.599 1.00 58.44  ? 297 PRO B CD  1 
ATOM   4948 N N   . THR B 1 312 ? -47.879 -60.178 -20.604 1.00 49.86  ? 298 THR B N   1 
ATOM   4949 C CA  . THR B 1 312 ? -48.034 -59.275 -19.467 1.00 47.99  ? 298 THR B CA  1 
ATOM   4950 C C   . THR B 1 312 ? -47.665 -57.866 -19.853 1.00 49.95  ? 298 THR B C   1 
ATOM   4951 O O   . THR B 1 312 ? -46.932 -57.631 -20.821 1.00 49.66  ? 298 THR B O   1 
ATOM   4952 C CB  . THR B 1 312 ? -46.942 -59.509 -18.394 1.00 49.64  ? 298 THR B CB  1 
ATOM   4953 O OG1 . THR B 1 312 ? -45.896 -60.382 -18.787 1.00 49.46  ? 298 THR B OG1 1 
ATOM   4954 C CG2 . THR B 1 312 ? -47.467 -59.733 -17.040 1.00 44.24  ? 298 THR B CG2 1 
ATOM   4955 N N   . TRP B 1 313 ? -48.059 -56.942 -18.976 1.00 43.93  ? 299 TRP B N   1 
ATOM   4956 C CA  . TRP B 1 313 ? -47.592 -55.592 -18.964 1.00 42.28  ? 299 TRP B CA  1 
ATOM   4957 C C   . TRP B 1 313 ? -46.370 -55.660 -18.033 1.00 44.87  ? 299 TRP B C   1 
ATOM   4958 O O   . TRP B 1 313 ? -46.265 -56.559 -17.183 1.00 42.65  ? 299 TRP B O   1 
ATOM   4959 C CB  . TRP B 1 313 ? -48.634 -54.668 -18.349 1.00 40.77  ? 299 TRP B CB  1 
ATOM   4960 C CG  . TRP B 1 313 ? -49.796 -54.384 -19.249 1.00 41.74  ? 299 TRP B CG  1 
ATOM   4961 C CD1 . TRP B 1 313 ? -50.882 -55.182 -19.460 1.00 44.57  ? 299 TRP B CD1 1 
ATOM   4962 C CD2 . TRP B 1 313 ? -50.034 -53.178 -19.986 1.00 41.56  ? 299 TRP B CD2 1 
ATOM   4963 N NE1 . TRP B 1 313 ? -51.770 -54.561 -20.310 1.00 43.74  ? 299 TRP B NE1 1 
ATOM   4964 C CE2 . TRP B 1 313 ? -51.276 -53.330 -20.651 1.00 44.99  ? 299 TRP B CE2 1 
ATOM   4965 C CE3 . TRP B 1 313 ? -49.321 -51.978 -20.151 1.00 42.62  ? 299 TRP B CE3 1 
ATOM   4966 C CZ2 . TRP B 1 313 ? -51.815 -52.334 -21.475 1.00 43.89  ? 299 TRP B CZ2 1 
ATOM   4967 C CZ3 . TRP B 1 313 ? -49.859 -50.989 -20.969 1.00 44.07  ? 299 TRP B CZ3 1 
ATOM   4968 C CH2 . TRP B 1 313 ? -51.092 -51.168 -21.615 1.00 44.61  ? 299 TRP B CH2 1 
ATOM   4969 N N   . ALA B 1 314 ? -45.434 -54.735 -18.207 1.00 42.13  ? 300 ALA B N   1 
ATOM   4970 C CA  . ALA B 1 314 ? -44.287 -54.659 -17.309 1.00 41.74  ? 300 ALA B CA  1 
ATOM   4971 C C   . ALA B 1 314 ? -44.210 -53.208 -16.846 1.00 43.17  ? 300 ALA B C   1 
ATOM   4972 O O   . ALA B 1 314 ? -44.254 -52.298 -17.683 1.00 41.92  ? 300 ALA B O   1 
ATOM   4973 C CB  . ALA B 1 314 ? -43.010 -55.086 -18.011 1.00 42.52  ? 300 ALA B CB  1 
ATOM   4974 N N   . LEU B 1 315 ? -44.228 -53.000 -15.518 1.00 38.29  ? 301 LEU B N   1 
ATOM   4975 C CA  . LEU B 1 315 ? -44.157 -51.677 -14.917 1.00 37.37  ? 301 LEU B CA  1 
ATOM   4976 C C   . LEU B 1 315 ? -42.704 -51.481 -14.561 1.00 41.08  ? 301 LEU B C   1 
ATOM   4977 O O   . LEU B 1 315 ? -42.212 -52.030 -13.565 1.00 41.62  ? 301 LEU B O   1 
ATOM   4978 C CB  . LEU B 1 315 ? -45.097 -51.550 -13.691 1.00 37.21  ? 301 LEU B CB  1 
ATOM   4979 C CG  . LEU B 1 315 ? -46.608 -51.829 -13.930 1.00 41.81  ? 301 LEU B CG  1 
ATOM   4980 C CD1 . LEU B 1 315 ? -47.355 -51.883 -12.623 1.00 42.65  ? 301 LEU B CD1 1 
ATOM   4981 C CD2 . LEU B 1 315 ? -47.265 -50.774 -14.828 1.00 41.66  ? 301 LEU B CD2 1 
ATOM   4982 N N   . GLY B 1 316 ? -42.017 -50.778 -15.461 1.00 36.62  ? 302 GLY B N   1 
ATOM   4983 C CA  . GLY B 1 316 ? -40.592 -50.515 -15.374 1.00 35.35  ? 302 GLY B CA  1 
ATOM   4984 C C   . GLY B 1 316 ? -40.285 -49.192 -14.743 1.00 38.51  ? 302 GLY B C   1 
ATOM   4985 O O   . GLY B 1 316 ? -41.123 -48.635 -14.029 1.00 38.47  ? 302 GLY B O   1 
ATOM   4986 N N   . ALA B 1 317 ? -39.095 -48.668 -15.060 1.00 35.01  ? 303 ALA B N   1 
ATOM   4987 C CA  . ALA B 1 317 ? -38.559 -47.405 -14.546 1.00 34.57  ? 303 ALA B CA  1 
ATOM   4988 C C   . ALA B 1 317 ? -39.551 -46.242 -14.604 1.00 37.67  ? 303 ALA B C   1 
ATOM   4989 O O   . ALA B 1 317 ? -39.693 -45.515 -13.618 1.00 37.83  ? 303 ALA B O   1 
ATOM   4990 C CB  . ALA B 1 317 ? -37.251 -47.057 -15.249 1.00 35.01  ? 303 ALA B CB  1 
ATOM   4991 N N   . THR B 1 318 ? -40.288 -46.119 -15.718 1.00 33.54  ? 304 THR B N   1 
ATOM   4992 C CA  . THR B 1 318 ? -41.291 -45.067 -15.932 1.00 32.88  ? 304 THR B CA  1 
ATOM   4993 C C   . THR B 1 318 ? -42.308 -45.016 -14.783 1.00 37.04  ? 304 THR B C   1 
ATOM   4994 O O   . THR B 1 318 ? -42.685 -43.925 -14.344 1.00 36.65  ? 304 THR B O   1 
ATOM   4995 C CB  . THR B 1 318 ? -41.983 -45.272 -17.271 1.00 35.17  ? 304 THR B CB  1 
ATOM   4996 O OG1 . THR B 1 318 ? -40.982 -45.363 -18.278 1.00 41.30  ? 304 THR B OG1 1 
ATOM   4997 C CG2 . THR B 1 318 ? -42.964 -44.162 -17.609 1.00 33.28  ? 304 THR B CG2 1 
ATOM   4998 N N   . PHE B 1 319 ? -42.759 -46.198 -14.317 1.00 32.92  ? 305 PHE B N   1 
ATOM   4999 C CA  . PHE B 1 319 ? -43.738 -46.327 -13.248 1.00 31.67  ? 305 PHE B CA  1 
ATOM   5000 C C   . PHE B 1 319 ? -43.075 -46.123 -11.875 1.00 36.97  ? 305 PHE B C   1 
ATOM   5001 O O   . PHE B 1 319 ? -43.649 -45.449 -11.024 1.00 36.19  ? 305 PHE B O   1 
ATOM   5002 C CB  . PHE B 1 319 ? -44.407 -47.708 -13.330 1.00 32.52  ? 305 PHE B CB  1 
ATOM   5003 C CG  . PHE B 1 319 ? -45.592 -47.878 -12.408 1.00 33.31  ? 305 PHE B CG  1 
ATOM   5004 C CD1 . PHE B 1 319 ? -45.424 -48.338 -11.105 1.00 34.66  ? 305 PHE B CD1 1 
ATOM   5005 C CD2 . PHE B 1 319 ? -46.881 -47.571 -12.838 1.00 34.37  ? 305 PHE B CD2 1 
ATOM   5006 C CE1 . PHE B 1 319 ? -46.526 -48.468 -10.245 1.00 34.71  ? 305 PHE B CE1 1 
ATOM   5007 C CE2 . PHE B 1 319 ? -47.980 -47.711 -11.978 1.00 36.21  ? 305 PHE B CE2 1 
ATOM   5008 C CZ  . PHE B 1 319 ? -47.794 -48.169 -10.693 1.00 33.93  ? 305 PHE B CZ  1 
ATOM   5009 N N   . ILE B 1 320 ? -41.880 -46.720 -11.663 1.00 34.75  ? 306 ILE B N   1 
ATOM   5010 C CA  . ILE B 1 320 ? -41.117 -46.660 -10.413 1.00 34.15  ? 306 ILE B CA  1 
ATOM   5011 C C   . ILE B 1 320 ? -40.687 -45.240 -10.057 1.00 37.90  ? 306 ILE B C   1 
ATOM   5012 O O   . ILE B 1 320 ? -40.708 -44.875 -8.881  1.00 38.69  ? 306 ILE B O   1 
ATOM   5013 C CB  . ILE B 1 320 ? -40.014 -47.764 -10.342 1.00 36.76  ? 306 ILE B CB  1 
ATOM   5014 C CG1 . ILE B 1 320 ? -40.678 -49.167 -10.395 1.00 38.33  ? 306 ILE B CG1 1 
ATOM   5015 C CG2 . ILE B 1 320 ? -39.157 -47.638 -9.080  1.00 34.88  ? 306 ILE B CG2 1 
ATOM   5016 C CD1 . ILE B 1 320 ? -39.826 -50.293 -10.826 1.00 50.08  ? 306 ILE B CD1 1 
ATOM   5017 N N   . ARG B 1 321 ? -40.408 -44.413 -11.068 1.00 34.52  ? 307 ARG B N   1 
ATOM   5018 C CA  . ARG B 1 321 ? -40.063 -43.002 -10.884 1.00 35.04  ? 307 ARG B CA  1 
ATOM   5019 C C   . ARG B 1 321 ? -41.179 -42.242 -10.161 1.00 40.55  ? 307 ARG B C   1 
ATOM   5020 O O   . ARG B 1 321 ? -40.883 -41.427 -9.276  1.00 41.36  ? 307 ARG B O   1 
ATOM   5021 C CB  . ARG B 1 321 ? -39.773 -42.342 -12.220 1.00 32.54  ? 307 ARG B CB  1 
ATOM   5022 C CG  . ARG B 1 321 ? -38.325 -42.454 -12.615 1.00 29.35  ? 307 ARG B CG  1 
ATOM   5023 C CD  . ARG B 1 321 ? -37.990 -41.431 -13.692 1.00 37.52  ? 307 ARG B CD  1 
ATOM   5024 N NE  . ARG B 1 321 ? -38.625 -41.703 -14.981 1.00 33.39  ? 307 ARG B NE  1 
ATOM   5025 C CZ  . ARG B 1 321 ? -38.168 -42.578 -15.867 1.00 41.69  ? 307 ARG B CZ  1 
ATOM   5026 N NH1 . ARG B 1 321 ? -37.100 -43.316 -15.593 1.00 30.32  ? 307 ARG B NH1 1 
ATOM   5027 N NH2 . ARG B 1 321 ? -38.793 -42.745 -17.021 1.00 30.85  ? 307 ARG B NH2 1 
ATOM   5028 N N   . LYS B 1 322 ? -42.460 -42.542 -10.498 1.00 34.92  ? 308 LYS B N   1 
ATOM   5029 C CA  . LYS B 1 322 ? -43.610 -41.930 -9.825  1.00 33.81  ? 308 LYS B CA  1 
ATOM   5030 C C   . LYS B 1 322 ? -43.945 -42.612 -8.496  1.00 34.09  ? 308 LYS B C   1 
ATOM   5031 O O   . LYS B 1 322 ? -44.290 -41.919 -7.536  1.00 31.95  ? 308 LYS B O   1 
ATOM   5032 C CB  . LYS B 1 322 ? -44.838 -41.903 -10.735 1.00 36.22  ? 308 LYS B CB  1 
ATOM   5033 C CG  . LYS B 1 322 ? -46.026 -41.170 -10.112 1.00 41.80  ? 308 LYS B CG  1 
ATOM   5034 C CD  . LYS B 1 322 ? -46.492 -39.992 -10.898 1.00 42.80  ? 308 LYS B CD  1 
ATOM   5035 C CE  . LYS B 1 322 ? -47.704 -39.393 -10.249 1.00 52.10  ? 308 LYS B CE  1 
ATOM   5036 N NZ  . LYS B 1 322 ? -48.547 -38.656 -11.218 1.00 68.01  ? 308 LYS B NZ  1 
ATOM   5037 N N   . PHE B 1 323 ? -43.822 -43.959 -8.440  1.00 30.12  ? 309 PHE B N   1 
ATOM   5038 C CA  . PHE B 1 323 ? -44.177 -44.751 -7.263  1.00 29.67  ? 309 PHE B CA  1 
ATOM   5039 C C   . PHE B 1 323 ? -43.061 -45.511 -6.612  1.00 36.23  ? 309 PHE B C   1 
ATOM   5040 O O   . PHE B 1 323 ? -42.613 -46.533 -7.136  1.00 37.65  ? 309 PHE B O   1 
ATOM   5041 C CB  . PHE B 1 323 ? -45.394 -45.682 -7.537  1.00 30.27  ? 309 PHE B CB  1 
ATOM   5042 C CG  . PHE B 1 323 ? -46.598 -44.929 -8.011  1.00 31.20  ? 309 PHE B CG  1 
ATOM   5043 C CD1 . PHE B 1 323 ? -47.352 -44.165 -7.126  1.00 32.82  ? 309 PHE B CD1 1 
ATOM   5044 C CD2 . PHE B 1 323 ? -46.937 -44.913 -9.354  1.00 33.53  ? 309 PHE B CD2 1 
ATOM   5045 C CE1 . PHE B 1 323 ? -48.421 -43.411 -7.569  1.00 33.48  ? 309 PHE B CE1 1 
ATOM   5046 C CE2 . PHE B 1 323 ? -48.018 -44.163 -9.797  1.00 35.77  ? 309 PHE B CE2 1 
ATOM   5047 C CZ  . PHE B 1 323 ? -48.746 -43.407 -8.901  1.00 33.69  ? 309 PHE B CZ  1 
ATOM   5048 N N   . TYR B 1 324 ? -42.668 -45.055 -5.419  1.00 33.03  ? 310 TYR B N   1 
ATOM   5049 C CA  . TYR B 1 324 ? -41.692 -45.734 -4.574  1.00 32.47  ? 310 TYR B CA  1 
ATOM   5050 C C   . TYR B 1 324 ? -42.255 -47.156 -4.340  1.00 37.82  ? 310 TYR B C   1 
ATOM   5051 O O   . TYR B 1 324 ? -43.411 -47.313 -3.937  1.00 37.02  ? 310 TYR B O   1 
ATOM   5052 C CB  . TYR B 1 324 ? -41.561 -44.974 -3.248  1.00 31.87  ? 310 TYR B CB  1 
ATOM   5053 C CG  . TYR B 1 324 ? -40.435 -45.465 -2.384  1.00 30.84  ? 310 TYR B CG  1 
ATOM   5054 C CD1 . TYR B 1 324 ? -40.612 -46.544 -1.519  1.00 32.70  ? 310 TYR B CD1 1 
ATOM   5055 C CD2 . TYR B 1 324 ? -39.193 -44.841 -2.410  1.00 30.69  ? 310 TYR B CD2 1 
ATOM   5056 C CE1 . TYR B 1 324 ? -39.578 -46.997 -0.710  1.00 32.44  ? 310 TYR B CE1 1 
ATOM   5057 C CE2 . TYR B 1 324 ? -38.148 -45.286 -1.607  1.00 31.63  ? 310 TYR B CE2 1 
ATOM   5058 C CZ  . TYR B 1 324 ? -38.342 -46.367 -0.762  1.00 40.12  ? 310 TYR B CZ  1 
ATOM   5059 O OH  . TYR B 1 324 ? -37.312 -46.791 0.039   1.00 40.67  ? 310 TYR B OH  1 
ATOM   5060 N N   . THR B 1 325 ? -41.472 -48.169 -4.694  1.00 35.28  ? 311 THR B N   1 
ATOM   5061 C CA  . THR B 1 325 ? -41.910 -49.565 -4.644  1.00 34.90  ? 311 THR B CA  1 
ATOM   5062 C C   . THR B 1 325 ? -41.199 -50.371 -3.558  1.00 39.05  ? 311 THR B C   1 
ATOM   5063 O O   . THR B 1 325 ? -39.969 -50.349 -3.469  1.00 38.77  ? 311 THR B O   1 
ATOM   5064 C CB  . THR B 1 325 ? -41.753 -50.192 -6.048  1.00 37.24  ? 311 THR B CB  1 
ATOM   5065 O OG1 . THR B 1 325 ? -42.341 -49.324 -7.008  1.00 35.23  ? 311 THR B OG1 1 
ATOM   5066 C CG2 . THR B 1 325 ? -42.403 -51.548 -6.167  1.00 39.54  ? 311 THR B CG2 1 
ATOM   5067 N N   . GLU B 1 326 ? -41.985 -51.072 -2.737  1.00 34.93  ? 312 GLU B N   1 
ATOM   5068 C CA  . GLU B 1 326 ? -41.487 -51.953 -1.689  1.00 34.91  ? 312 GLU B CA  1 
ATOM   5069 C C   . GLU B 1 326 ? -41.859 -53.405 -2.062  1.00 37.90  ? 312 GLU B C   1 
ATOM   5070 O O   . GLU B 1 326 ? -43.013 -53.705 -2.368  1.00 37.65  ? 312 GLU B O   1 
ATOM   5071 C CB  . GLU B 1 326 ? -42.049 -51.552 -0.317  1.00 36.62  ? 312 GLU B CB  1 
ATOM   5072 C CG  . GLU B 1 326 ? -41.446 -52.350 0.825   1.00 47.14  ? 312 GLU B CG  1 
ATOM   5073 C CD  . GLU B 1 326 ? -42.132 -52.161 2.160   1.00 56.19  ? 312 GLU B CD  1 
ATOM   5074 O OE1 . GLU B 1 326 ? -43.162 -52.830 2.392   1.00 46.47  ? 312 GLU B OE1 1 
ATOM   5075 O OE2 . GLU B 1 326 ? -41.643 -51.346 2.975   1.00 60.55  ? 312 GLU B OE2 1 
ATOM   5076 N N   . PHE B 1 327 ? -40.862 -54.280 -2.088  1.00 34.38  ? 313 PHE B N   1 
ATOM   5077 C CA  . PHE B 1 327 ? -41.035 -55.693 -2.415  1.00 33.65  ? 313 PHE B CA  1 
ATOM   5078 C C   . PHE B 1 327 ? -41.019 -56.481 -1.129  1.00 38.16  ? 313 PHE B C   1 
ATOM   5079 O O   . PHE B 1 327 ? -39.991 -56.533 -0.455  1.00 37.63  ? 313 PHE B O   1 
ATOM   5080 C CB  . PHE B 1 327 ? -39.937 -56.140 -3.362  1.00 34.72  ? 313 PHE B CB  1 
ATOM   5081 C CG  . PHE B 1 327 ? -40.036 -55.485 -4.716  1.00 35.46  ? 313 PHE B CG  1 
ATOM   5082 C CD1 . PHE B 1 327 ? -40.768 -56.078 -5.740  1.00 37.02  ? 313 PHE B CD1 1 
ATOM   5083 C CD2 . PHE B 1 327 ? -39.395 -54.272 -4.969  1.00 36.83  ? 313 PHE B CD2 1 
ATOM   5084 C CE1 . PHE B 1 327 ? -40.870 -55.462 -6.991  1.00 38.93  ? 313 PHE B CE1 1 
ATOM   5085 C CE2 . PHE B 1 327 ? -39.489 -53.661 -6.217  1.00 39.69  ? 313 PHE B CE2 1 
ATOM   5086 C CZ  . PHE B 1 327 ? -40.238 -54.252 -7.218  1.00 38.43  ? 313 PHE B CZ  1 
ATOM   5087 N N   . ASP B 1 328 ? -42.184 -57.015 -0.745  1.00 36.16  ? 314 ASP B N   1 
ATOM   5088 C CA  . ASP B 1 328 ? -42.394 -57.732 0.516   1.00 37.05  ? 314 ASP B CA  1 
ATOM   5089 C C   . ASP B 1 328 ? -42.323 -59.225 0.317   1.00 41.22  ? 314 ASP B C   1 
ATOM   5090 O O   . ASP B 1 328 ? -43.278 -59.834 -0.168  1.00 41.11  ? 314 ASP B O   1 
ATOM   5091 C CB  . ASP B 1 328 ? -43.741 -57.306 1.146   1.00 39.24  ? 314 ASP B CB  1 
ATOM   5092 C CG  . ASP B 1 328 ? -44.031 -57.725 2.577   1.00 48.07  ? 314 ASP B CG  1 
ATOM   5093 O OD1 . ASP B 1 328 ? -43.299 -58.593 3.110   1.00 49.80  ? 314 ASP B OD1 1 
ATOM   5094 O OD2 . ASP B 1 328 ? -45.003 -57.199 3.159   1.00 50.05  ? 314 ASP B OD2 1 
ATOM   5095 N N   . ARG B 1 329 ? -41.178 -59.811 0.683   1.00 39.34  ? 315 ARG B N   1 
ATOM   5096 C CA  . ARG B 1 329 ? -40.937 -61.251 0.568   1.00 40.21  ? 315 ARG B CA  1 
ATOM   5097 C C   . ARG B 1 329 ? -41.703 -62.042 1.614   1.00 47.09  ? 315 ARG B C   1 
ATOM   5098 O O   . ARG B 1 329 ? -42.116 -63.174 1.339   1.00 49.19  ? 315 ARG B O   1 
ATOM   5099 C CB  . ARG B 1 329 ? -39.442 -61.573 0.668   1.00 40.09  ? 315 ARG B CB  1 
ATOM   5100 C CG  . ARG B 1 329 ? -38.687 -61.442 -0.652  1.00 50.22  ? 315 ARG B CG  1 
ATOM   5101 C CD  . ARG B 1 329 ? -39.111 -62.475 -1.700  1.00 64.68  ? 315 ARG B CD  1 
ATOM   5102 N NE  . ARG B 1 329 ? -38.930 -63.856 -1.252  1.00 75.58  ? 315 ARG B NE  1 
ATOM   5103 C CZ  . ARG B 1 329 ? -37.793 -64.534 -1.349  1.00 91.32  ? 315 ARG B CZ  1 
ATOM   5104 N NH1 . ARG B 1 329 ? -36.715 -63.964 -1.876  1.00 82.51  ? 315 ARG B NH1 1 
ATOM   5105 N NH2 . ARG B 1 329 ? -37.722 -65.785 -0.919  1.00 78.75  ? 315 ARG B NH2 1 
ATOM   5106 N N   . ARG B 1 330 ? -41.870 -61.459 2.815   1.00 42.88  ? 316 ARG B N   1 
ATOM   5107 C CA  . ARG B 1 330 ? -42.571 -62.074 3.933   1.00 42.33  ? 316 ARG B CA  1 
ATOM   5108 C C   . ARG B 1 330 ? -44.034 -62.386 3.591   1.00 45.63  ? 316 ARG B C   1 
ATOM   5109 O O   . ARG B 1 330 ? -44.486 -63.512 3.800   1.00 45.72  ? 316 ARG B O   1 
ATOM   5110 C CB  . ARG B 1 330 ? -42.449 -61.190 5.202   1.00 41.62  ? 316 ARG B CB  1 
ATOM   5111 C CG  . ARG B 1 330 ? -43.279 -61.647 6.421   1.00 51.82  ? 316 ARG B CG  1 
ATOM   5112 C CD  . ARG B 1 330 ? -42.912 -63.031 6.979   1.00 60.38  ? 316 ARG B CD  1 
ATOM   5113 N NE  . ARG B 1 330 ? -43.588 -63.343 8.249   1.00 66.31  ? 316 ARG B NE  1 
ATOM   5114 C CZ  . ARG B 1 330 ? -44.761 -63.967 8.377   1.00 69.05  ? 316 ARG B CZ  1 
ATOM   5115 N NH1 . ARG B 1 330 ? -45.462 -64.308 7.303   1.00 31.52  ? 316 ARG B NH1 1 
ATOM   5116 N NH2 . ARG B 1 330 ? -45.271 -64.194 9.581   1.00 66.04  ? 316 ARG B NH2 1 
ATOM   5117 N N   . ASN B 1 331 ? -44.753 -61.399 3.050   1.00 40.69  ? 317 ASN B N   1 
ATOM   5118 C CA  . ASN B 1 331 ? -46.174 -61.532 2.745   1.00 39.31  ? 317 ASN B CA  1 
ATOM   5119 C C   . ASN B 1 331 ? -46.503 -61.692 1.271   1.00 43.35  ? 317 ASN B C   1 
ATOM   5120 O O   . ASN B 1 331 ? -47.687 -61.677 0.920   1.00 43.64  ? 317 ASN B O   1 
ATOM   5121 C CB  . ASN B 1 331 ? -46.958 -60.370 3.367   1.00 33.40  ? 317 ASN B CB  1 
ATOM   5122 C CG  . ASN B 1 331 ? -46.758 -60.228 4.848   1.00 38.11  ? 317 ASN B CG  1 
ATOM   5123 O OD1 . ASN B 1 331 ? -46.262 -59.222 5.326   1.00 35.33  ? 317 ASN B OD1 1 
ATOM   5124 N ND2 . ASN B 1 331 ? -47.063 -61.255 5.601   1.00 26.14  ? 317 ASN B ND2 1 
ATOM   5125 N N   . ASN B 1 332 ? -45.477 -61.902 0.415   1.00 38.95  ? 318 ASN B N   1 
ATOM   5126 C CA  . ASN B 1 332 ? -45.636 -62.044 -1.036  1.00 38.66  ? 318 ASN B CA  1 
ATOM   5127 C C   . ASN B 1 332 ? -46.596 -60.991 -1.612  1.00 41.68  ? 318 ASN B C   1 
ATOM   5128 O O   . ASN B 1 332 ? -47.665 -61.311 -2.138  1.00 41.81  ? 318 ASN B O   1 
ATOM   5129 C CB  . ASN B 1 332 ? -46.005 -63.475 -1.461  1.00 39.27  ? 318 ASN B CB  1 
ATOM   5130 C CG  . ASN B 1 332 ? -45.014 -64.543 -1.072  1.00 67.01  ? 318 ASN B CG  1 
ATOM   5131 O OD1 . ASN B 1 332 ? -43.797 -64.426 -1.270  1.00 60.99  ? 318 ASN B OD1 1 
ATOM   5132 N ND2 . ASN B 1 332 ? -45.539 -65.655 -0.596  1.00 63.04  ? 318 ASN B ND2 1 
ATOM   5133 N N   . ARG B 1 333 ? -46.212 -59.715 -1.448  1.00 36.53  ? 319 ARG B N   1 
ATOM   5134 C CA  . ARG B 1 333 ? -46.949 -58.548 -1.940  1.00 35.22  ? 319 ARG B CA  1 
ATOM   5135 C C   . ARG B 1 333 ? -46.004 -57.443 -2.359  1.00 40.73  ? 319 ARG B C   1 
ATOM   5136 O O   . ARG B 1 333 ? -44.832 -57.444 -1.980  1.00 41.62  ? 319 ARG B O   1 
ATOM   5137 C CB  . ARG B 1 333 ? -47.986 -58.000 -0.919  1.00 31.24  ? 319 ARG B CB  1 
ATOM   5138 C CG  . ARG B 1 333 ? -47.660 -58.241 0.536   1.00 34.51  ? 319 ARG B CG  1 
ATOM   5139 C CD  . ARG B 1 333 ? -47.404 -57.043 1.400   1.00 41.00  ? 319 ARG B CD  1 
ATOM   5140 N NE  . ARG B 1 333 ? -48.531 -56.848 2.283   1.00 33.42  ? 319 ARG B NE  1 
ATOM   5141 C CZ  . ARG B 1 333 ? -48.639 -56.092 3.379   1.00 45.35  ? 319 ARG B CZ  1 
ATOM   5142 N NH1 . ARG B 1 333 ? -47.566 -55.544 3.939   1.00 30.50  ? 319 ARG B NH1 1 
ATOM   5143 N NH2 . ARG B 1 333 ? -49.808 -55.931 3.954   1.00 38.68  ? 319 ARG B NH2 1 
ATOM   5144 N N   . ILE B 1 334 ? -46.524 -56.483 -3.135  1.00 36.55  ? 320 ILE B N   1 
ATOM   5145 C CA  . ILE B 1 334 ? -45.789 -55.306 -3.572  1.00 36.37  ? 320 ILE B CA  1 
ATOM   5146 C C   . ILE B 1 334 ? -46.505 -54.078 -2.996  1.00 40.25  ? 320 ILE B C   1 
ATOM   5147 O O   . ILE B 1 334 ? -47.727 -53.973 -3.103  1.00 40.38  ? 320 ILE B O   1 
ATOM   5148 C CB  . ILE B 1 334 ? -45.682 -55.287 -5.124  1.00 39.24  ? 320 ILE B CB  1 
ATOM   5149 C CG1 . ILE B 1 334 ? -44.778 -56.448 -5.630  1.00 39.16  ? 320 ILE B CG1 1 
ATOM   5150 C CG2 . ILE B 1 334 ? -45.201 -53.920 -5.631  1.00 38.62  ? 320 ILE B CG2 1 
ATOM   5151 C CD1 . ILE B 1 334 ? -44.913 -56.795 -7.080  1.00 40.32  ? 320 ILE B CD1 1 
ATOM   5152 N N   . GLY B 1 335 ? -45.751 -53.182 -2.384  1.00 36.85  ? 321 GLY B N   1 
ATOM   5153 C CA  . GLY B 1 335 ? -46.292 -51.945 -1.829  1.00 37.18  ? 321 GLY B CA  1 
ATOM   5154 C C   . GLY B 1 335 ? -45.890 -50.725 -2.626  1.00 40.10  ? 321 GLY B C   1 
ATOM   5155 O O   . GLY B 1 335 ? -44.727 -50.593 -3.016  1.00 38.67  ? 321 GLY B O   1 
ATOM   5156 N N   . PHE B 1 336 ? -46.857 -49.843 -2.900  1.00 36.88  ? 322 PHE B N   1 
ATOM   5157 C CA  . PHE B 1 336 ? -46.613 -48.607 -3.644  1.00 36.34  ? 322 PHE B CA  1 
ATOM   5158 C C   . PHE B 1 336 ? -46.954 -47.378 -2.826  1.00 39.95  ? 322 PHE B C   1 
ATOM   5159 O O   . PHE B 1 336 ? -47.947 -47.368 -2.082  1.00 41.48  ? 322 PHE B O   1 
ATOM   5160 C CB  . PHE B 1 336 ? -47.407 -48.575 -4.954  1.00 37.90  ? 322 PHE B CB  1 
ATOM   5161 C CG  . PHE B 1 336 ? -47.045 -49.608 -5.996  1.00 39.63  ? 322 PHE B CG  1 
ATOM   5162 C CD1 . PHE B 1 336 ? -45.780 -49.624 -6.579  1.00 42.90  ? 322 PHE B CD1 1 
ATOM   5163 C CD2 . PHE B 1 336 ? -47.991 -50.510 -6.458  1.00 42.00  ? 322 PHE B CD2 1 
ATOM   5164 C CE1 . PHE B 1 336 ? -45.455 -50.563 -7.565  1.00 43.51  ? 322 PHE B CE1 1 
ATOM   5165 C CE2 . PHE B 1 336 ? -47.668 -51.444 -7.451  1.00 44.55  ? 322 PHE B CE2 1 
ATOM   5166 C CZ  . PHE B 1 336 ? -46.402 -51.465 -7.996  1.00 42.25  ? 322 PHE B CZ  1 
ATOM   5167 N N   . ALA B 1 337 ? -46.144 -46.322 -3.005  1.00 34.43  ? 323 ALA B N   1 
ATOM   5168 C CA  . ALA B 1 337 ? -46.332 -45.003 -2.386  1.00 33.78  ? 323 ALA B CA  1 
ATOM   5169 C C   . ALA B 1 337 ? -45.803 -43.927 -3.335  1.00 39.92  ? 323 ALA B C   1 
ATOM   5170 O O   . ALA B 1 337 ? -44.881 -44.182 -4.113  1.00 39.65  ? 323 ALA B O   1 
ATOM   5171 C CB  . ALA B 1 337 ? -45.621 -44.918 -1.045  1.00 33.94  ? 323 ALA B CB  1 
ATOM   5172 N N   . LEU B 1 338 ? -46.402 -42.730 -3.283  1.00 37.31  ? 324 LEU B N   1 
ATOM   5173 C CA  . LEU B 1 338 ? -46.021 -41.587 -4.102  1.00 37.38  ? 324 LEU B CA  1 
ATOM   5174 C C   . LEU B 1 338 ? -44.570 -41.243 -3.773  1.00 42.54  ? 324 LEU B C   1 
ATOM   5175 O O   . LEU B 1 338 ? -44.227 -41.073 -2.595  1.00 42.13  ? 324 LEU B O   1 
ATOM   5176 C CB  . LEU B 1 338 ? -46.949 -40.409 -3.751  1.00 37.83  ? 324 LEU B CB  1 
ATOM   5177 C CG  . LEU B 1 338 ? -47.629 -39.573 -4.863  1.00 43.36  ? 324 LEU B CG  1 
ATOM   5178 C CD1 . LEU B 1 338 ? -47.380 -38.103 -4.648  1.00 44.74  ? 324 LEU B CD1 1 
ATOM   5179 C CD2 . LEU B 1 338 ? -47.214 -39.967 -6.271  1.00 42.72  ? 324 LEU B CD2 1 
ATOM   5180 N N   . ALA B 1 339 ? -43.698 -41.245 -4.790  1.00 39.49  ? 325 ALA B N   1 
ATOM   5181 C CA  . ALA B 1 339 ? -42.280 -40.945 -4.583  1.00 39.27  ? 325 ALA B CA  1 
ATOM   5182 C C   . ALA B 1 339 ? -42.024 -39.420 -4.475  1.00 44.14  ? 325 ALA B C   1 
ATOM   5183 O O   . ALA B 1 339 ? -42.816 -38.613 -4.984  1.00 43.70  ? 325 ALA B O   1 
ATOM   5184 C CB  . ALA B 1 339 ? -41.444 -41.550 -5.695  1.00 39.44  ? 325 ALA B CB  1 
ATOM   5185 N N   . ARG B 1 340 ? -40.917 -39.042 -3.792  1.00 39.93  ? 326 ARG B N   1 
ATOM   5186 C CA  . ARG B 1 340 ? -40.470 -37.659 -3.601  1.00 38.07  ? 326 ARG B CA  1 
ATOM   5187 C C   . ARG B 1 340 ? -38.935 -37.561 -3.484  1.00 50.12  ? 326 ARG B C   1 
ATOM   5188 O O   . ARG B 1 340 ? -38.269 -38.585 -3.205  1.00 50.91  ? 326 ARG B O   1 
ATOM   5189 C CB  . ARG B 1 340 ? -41.186 -37.000 -2.394  1.00 38.05  ? 326 ARG B CB  1 
ATOM   5190 C CG  . ARG B 1 340 ? -40.779 -37.524 -1.016  1.00 43.76  ? 326 ARG B CG  1 
ATOM   5191 C CD  . ARG B 1 340 ? -41.443 -36.714 0.059   1.00 52.16  ? 326 ARG B CD  1 
ATOM   5192 N NE  . ARG B 1 340 ? -40.986 -37.095 1.393   1.00 68.12  ? 326 ARG B NE  1 
ATOM   5193 C CZ  . ARG B 1 340 ? -41.564 -36.695 2.523   1.00 97.57  ? 326 ARG B CZ  1 
ATOM   5194 N NH1 . ARG B 1 340 ? -42.632 -35.898 2.488   1.00 95.54  ? 326 ARG B NH1 1 
ATOM   5195 N NH2 . ARG B 1 340 ? -41.091 -37.095 3.695   1.00 83.41  ? 326 ARG B NH2 1 
ATOM   5196 O OXT . ARG B 1 340 ? -38.396 -36.448 -3.647  1.00 76.84  ? 326 ARG B OXT 1 
HETATM 5197 C C1  . NAG C 2 .   ? -2.099  -11.656 22.381  1.00 73.11  ? 367 NAG A C1  1 
HETATM 5198 C C2  . NAG C 2 .   ? -1.245  -10.809 23.371  1.00 74.86  ? 367 NAG A C2  1 
HETATM 5199 C C3  . NAG C 2 .   ? 0.063   -11.606 23.729  1.00 76.46  ? 367 NAG A C3  1 
HETATM 5200 C C4  . NAG C 2 .   ? -0.304  -13.033 24.339  1.00 77.16  ? 367 NAG A C4  1 
HETATM 5201 C C5  . NAG C 2 .   ? -1.177  -13.787 23.297  1.00 76.36  ? 367 NAG A C5  1 
HETATM 5202 C C6  . NAG C 2 .   ? -1.691  -15.144 23.814  1.00 77.63  ? 367 NAG A C6  1 
HETATM 5203 C C7  . NAG C 2 .   ? -1.875  -8.375  23.466  1.00 77.17  ? 367 NAG A C7  1 
HETATM 5204 C C8  . NAG C 2 .   ? -1.517  -7.016  22.943  1.00 77.89  ? 367 NAG A C8  1 
HETATM 5205 N N2  . NAG C 2 .   ? -1.064  -9.396  22.978  1.00 75.72  ? 367 NAG A N2  1 
HETATM 5206 O O3  . NAG C 2 .   ? 0.939   -10.834 24.602  1.00 78.60  ? 367 NAG A O3  1 
HETATM 5207 O O4  . NAG C 2 .   ? 0.850   -13.844 24.738  1.00 79.81  ? 367 NAG A O4  1 
HETATM 5208 O O5  . NAG C 2 .   ? -2.334  -12.983 22.906  1.00 74.57  ? 367 NAG A O5  1 
HETATM 5209 O O6  . NAG C 2 .   ? -0.838  -16.223 23.400  1.00 79.91  ? 367 NAG A O6  1 
HETATM 5210 O O7  . NAG C 2 .   ? -2.817  -8.536  24.265  1.00 79.15  ? 367 NAG A O7  1 
HETATM 5211 C C1  . SSR D 3 .   ? -10.215 -26.560 -4.273  1.00 33.36  ? 327 SSR A C1  1 
HETATM 5212 C C2  . SSR D 3 .   ? -10.868 -25.381 -3.875  1.00 33.51  ? 327 SSR A C2  1 
HETATM 5213 C C3  . SSR D 3 .   ? -10.367 -24.614 -2.816  1.00 35.94  ? 327 SSR A C3  1 
HETATM 5214 C C4  . SSR D 3 .   ? -9.196  -25.038 -2.149  1.00 37.88  ? 327 SSR A C4  1 
HETATM 5215 C C5  . SSR D 3 .   ? -8.534  -26.234 -2.547  1.00 36.06  ? 327 SSR A C5  1 
HETATM 5216 C C6  . SSR D 3 .   ? -9.043  -26.972 -3.632  1.00 35.21  ? 327 SSR A C6  1 
HETATM 5217 N N9  . SSR D 3 .   ? -10.864 -23.579 -2.097  1.00 38.65  ? 327 SSR A N9  1 
HETATM 5218 C C10 . SSR D 3 .   ? -10.037 -23.066 -1.140  1.00 34.93  ? 327 SSR A C10 1 
HETATM 5219 C C11 . SSR D 3 .   ? -9.064  -24.043 -1.030  1.00 36.41  ? 327 SSR A C11 1 
HETATM 5220 C C12 . SSR D 3 .   ? -7.204  -26.640 -1.955  1.00 32.54  ? 327 SSR A C12 1 
HETATM 5221 O O16 . SSR D 3 .   ? -8.427  -28.110 -4.071  1.00 36.88  ? 327 SSR A O16 1 
HETATM 5222 C C17 . SSR D 3 .   ? -7.850  -24.057 -0.156  1.00 39.74  ? 327 SSR A C17 1 
HETATM 5223 N N18 . SSR D 3 .   ? -7.734  -24.996 0.799   1.00 37.50  ? 327 SSR A N18 1 
HETATM 5224 C C19 . SSR D 3 .   ? -8.784  -26.025 1.000   1.00 35.63  ? 327 SSR A C19 1 
HETATM 5225 C C20 . SSR D 3 .   ? -9.073  -26.133 2.486   1.00 33.32  ? 327 SSR A C20 1 
HETATM 5226 N N21 . SSR D 3 .   ? -7.836  -26.314 3.219   1.00 31.89  ? 327 SSR A N21 1 
HETATM 5227 C C22 . SSR D 3 .   ? -6.815  -25.297 3.079   1.00 30.53  ? 327 SSR A C22 1 
HETATM 5228 C C23 . SSR D 3 .   ? -6.503  -25.060 1.610   1.00 33.24  ? 327 SSR A C23 1 
HETATM 5229 O O32 . SSR D 3 .   ? -6.997  -23.191 -0.332  1.00 44.05  ? 327 SSR A O32 1 
HETATM 5230 C C35 . SSR D 3 .   ? -11.921 -22.869 -2.576  1.00 44.24  ? 327 SSR A C35 1 
HETATM 5231 C C36 . SSR D 3 .   ? -11.813 -21.540 -3.056  1.00 43.36  ? 327 SSR A C36 1 
HETATM 5232 C C37 . SSR D 3 .   ? -12.913 -20.812 -3.504  1.00 44.07  ? 327 SSR A C37 1 
HETATM 5233 C C38 . SSR D 3 .   ? -14.177 -21.397 -3.543  1.00 44.30  ? 327 SSR A C38 1 
HETATM 5234 C C39 . SSR D 3 .   ? -14.338 -22.712 -3.104  1.00 45.62  ? 327 SSR A C39 1 
HETATM 5235 C C40 . SSR D 3 .   ? -13.230 -23.411 -2.619  1.00 46.21  ? 327 SSR A C40 1 
HETATM 5236 C C46 . SSR D 3 .   ? -10.224 -21.830 -0.271  1.00 29.79  ? 327 SSR A C46 1 
HETATM 5237 C C47 . SSR D 3 .   ? -10.092 -22.138 1.198   1.00 31.02  ? 327 SSR A C47 1 
HETATM 5238 C C50 . SSR D 3 .   ? -10.998 -22.968 1.906   1.00 33.23  ? 327 SSR A C50 1 
HETATM 5239 C C51 . SSR D 3 .   ? -10.817 -23.156 3.272   1.00 36.70  ? 327 SSR A C51 1 
HETATM 5240 C C52 . SSR D 3 .   ? -9.718  -22.581 3.932   1.00 36.00  ? 327 SSR A C52 1 
HETATM 5241 C C53 . SSR D 3 .   ? -8.833  -21.749 3.228   1.00 34.07  ? 327 SSR A C53 1 
HETATM 5242 C C54 . SSR D 3 .   ? -9.039  -21.506 1.866   1.00 31.40  ? 327 SSR A C54 1 
HETATM 5243 C C58 . SSR D 3 .   ? -12.196 -23.656 1.282   1.00 30.03  ? 327 SSR A C58 1 
HETATM 5244 F F62 . SSR D 3 .   ? -11.692 -23.926 3.942   1.00 39.92  ? 327 SSR A F62 1 
HETATM 5245 C C1  . NAG E 2 .   ? -21.665 -76.844 -8.506  1.00 96.07  ? 367 NAG B C1  1 
HETATM 5246 C C2  . NAG E 2 .   ? -21.166 -78.316 -8.337  1.00 97.90  ? 367 NAG B C2  1 
HETATM 5247 C C3  . NAG E 2 .   ? -22.386 -79.294 -8.176  1.00 99.41  ? 367 NAG B C3  1 
HETATM 5248 C C4  . NAG E 2 .   ? -23.374 -78.824 -7.055  1.00 100.01 ? 367 NAG B C4  1 
HETATM 5249 C C5  . NAG E 2 .   ? -23.762 -77.325 -7.243  1.00 99.19  ? 367 NAG B C5  1 
HETATM 5250 C C6  . NAG E 2 .   ? -24.495 -76.740 -6.001  1.00 100.30 ? 367 NAG B C6  1 
HETATM 5251 C C7  . NAG E 2 .   ? -18.771 -78.649 -9.081  1.00 100.34 ? 367 NAG B C7  1 
HETATM 5252 C C8  . NAG E 2 .   ? -17.911 -79.133 -10.218 1.00 101.11 ? 367 NAG B C8  1 
HETATM 5253 N N2  . NAG E 2 .   ? -20.129 -78.736 -9.319  1.00 98.88  ? 367 NAG B N2  1 
HETATM 5254 O O3  . NAG E 2 .   ? -21.917 -80.654 -7.947  1.00 101.46 ? 367 NAG B O3  1 
HETATM 5255 O O4  . NAG E 2 .   ? -24.598 -79.635 -6.978  1.00 102.36 ? 367 NAG B O4  1 
HETATM 5256 O O5  . NAG E 2 .   ? -22.589 -76.493 -7.457  1.00 97.49  ? 367 NAG B O5  1 
HETATM 5257 O O6  . NAG E 2 .   ? -25.912 -76.872 -6.094  1.00 102.25 ? 367 NAG B O6  1 
HETATM 5258 O O7  . NAG E 2 .   ? -18.270 -78.218 -8.037  1.00 102.29 ? 367 NAG B O7  1 
HETATM 5259 C C1  . SSR F 3 .   ? -36.728 -52.508 -22.014 1.00 42.19  ? 327 SSR B C1  1 
HETATM 5260 C C2  . SSR F 3 .   ? -35.337 -52.495 -21.908 1.00 41.26  ? 327 SSR B C2  1 
HETATM 5261 C C3  . SSR F 3 .   ? -34.656 -53.651 -21.494 1.00 43.87  ? 327 SSR B C3  1 
HETATM 5262 C C4  . SSR F 3 .   ? -35.378 -54.833 -21.221 1.00 43.97  ? 327 SSR B C4  1 
HETATM 5263 C C5  . SSR F 3 .   ? -36.788 -54.838 -21.319 1.00 44.17  ? 327 SSR B C5  1 
HETATM 5264 C C6  . SSR F 3 .   ? -37.447 -53.673 -21.713 1.00 46.16  ? 327 SSR B C6  1 
HETATM 5265 N N9  . SSR F 3 .   ? -33.341 -53.967 -21.402 1.00 44.87  ? 327 SSR B N9  1 
HETATM 5266 C C10 . SSR F 3 .   ? -33.051 -55.209 -20.942 1.00 43.49  ? 327 SSR B C10 1 
HETATM 5267 C C11 . SSR F 3 .   ? -34.309 -55.816 -20.839 1.00 44.59  ? 327 SSR B C11 1 
HETATM 5268 C C12 . SSR F 3 .   ? -37.629 -56.076 -21.098 1.00 42.92  ? 327 SSR B C12 1 
HETATM 5269 O O16 . SSR F 3 .   ? -38.814 -53.664 -21.792 1.00 51.35  ? 327 SSR B O16 1 
HETATM 5270 C C17 . SSR F 3 .   ? -34.639 -57.227 -20.398 1.00 45.79  ? 327 SSR B C17 1 
HETATM 5271 N N18 . SSR F 3 .   ? -35.239 -57.495 -19.219 1.00 44.77  ? 327 SSR B N18 1 
HETATM 5272 C C19 . SSR F 3 .   ? -35.705 -56.444 -18.293 1.00 42.90  ? 327 SSR B C19 1 
HETATM 5273 C C20 . SSR F 3 .   ? -35.131 -56.715 -16.917 1.00 41.79  ? 327 SSR B C20 1 
HETATM 5274 N N21 . SSR F 3 .   ? -35.524 -58.051 -16.508 1.00 45.36  ? 327 SSR B N21 1 
HETATM 5275 C C22 . SSR F 3 .   ? -35.220 -59.181 -17.380 1.00 46.80  ? 327 SSR B C22 1 
HETATM 5276 C C23 . SSR F 3 .   ? -35.536 -58.898 -18.857 1.00 46.97  ? 327 SSR B C23 1 
HETATM 5277 O O32 . SSR F 3 .   ? -34.286 -58.152 -21.114 1.00 47.87  ? 327 SSR B O32 1 
HETATM 5278 C C35 . SSR F 3 .   ? -32.365 -53.036 -21.537 1.00 46.87  ? 327 SSR B C35 1 
HETATM 5279 C C36 . SSR F 3 .   ? -31.344 -53.143 -22.518 1.00 46.80  ? 327 SSR B C36 1 
HETATM 5280 C C37 . SSR F 3 .   ? -30.280 -52.243 -22.645 1.00 46.29  ? 327 SSR B C37 1 
HETATM 5281 C C38 . SSR F 3 .   ? -30.219 -51.142 -21.786 1.00 48.38  ? 327 SSR B C38 1 
HETATM 5282 C C39 . SSR F 3 .   ? -31.217 -50.977 -20.822 1.00 48.85  ? 327 SSR B C39 1 
HETATM 5283 C C40 . SSR F 3 .   ? -32.253 -51.912 -20.697 1.00 48.31  ? 327 SSR B C40 1 
HETATM 5284 C C46 . SSR F 3 .   ? -31.664 -55.816 -20.704 1.00 40.43  ? 327 SSR B C46 1 
HETATM 5285 C C47 . SSR F 3 .   ? -31.559 -56.584 -19.405 1.00 36.44  ? 327 SSR B C47 1 
HETATM 5286 C C50 . SSR F 3 .   ? -31.595 -55.936 -18.165 1.00 35.20  ? 327 SSR B C50 1 
HETATM 5287 C C51 . SSR F 3 .   ? -31.518 -56.696 -17.006 1.00 37.12  ? 327 SSR B C51 1 
HETATM 5288 C C52 . SSR F 3 .   ? -31.428 -58.095 -17.077 1.00 37.61  ? 327 SSR B C52 1 
HETATM 5289 C C53 . SSR F 3 .   ? -31.377 -58.754 -18.315 1.00 35.31  ? 327 SSR B C53 1 
HETATM 5290 C C54 . SSR F 3 .   ? -31.441 -57.979 -19.475 1.00 34.69  ? 327 SSR B C54 1 
HETATM 5291 C C58 . SSR F 3 .   ? -31.667 -54.429 -18.039 1.00 34.29  ? 327 SSR B C58 1 
HETATM 5292 F F62 . SSR F 3 .   ? -31.554 -56.077 -15.809 1.00 42.12  ? 327 SSR B F62 1 
HETATM 5293 O O   . HOH G 4 .   ? -24.699 -1.863  19.060  1.00 62.28  ? 98  HOH A O   1 
HETATM 5294 O O   . HOH G 4 .   ? -9.773  -27.030 15.748  1.00 40.73  ? 328 HOH A O   1 
HETATM 5295 O O   . HOH G 4 .   ? -14.419 -2.712  -3.958  1.00 25.59  ? 329 HOH A O   1 
HETATM 5296 O O   . HOH G 4 .   ? -9.412  -23.486 14.951  1.00 42.86  ? 330 HOH A O   1 
HETATM 5297 O O   . HOH G 4 .   ? -17.227 -27.723 5.908   1.00 32.19  ? 331 HOH A O   1 
HETATM 5298 O O   . HOH G 4 .   ? -7.289  -21.592 8.975   1.00 32.97  ? 332 HOH A O   1 
HETATM 5299 O O   . HOH G 4 .   ? 1.677   -14.317 10.551  1.00 41.71  ? 333 HOH A O   1 
HETATM 5300 O O   . HOH G 4 .   ? -12.777 1.418   3.474   1.00 63.02  ? 334 HOH A O   1 
HETATM 5301 O O   . HOH G 4 .   ? -8.289  -8.065  -4.728  1.00 40.11  ? 335 HOH A O   1 
HETATM 5302 O O   . HOH G 4 .   ? -2.482  -32.145 -4.004  1.00 51.30  ? 336 HOH A O   1 
HETATM 5303 O O   . HOH G 4 .   ? -20.537 -38.359 3.286   1.00 38.67  ? 337 HOH A O   1 
HETATM 5304 O O   . HOH G 4 .   ? -7.861  -7.220  18.577  1.00 36.46  ? 338 HOH A O   1 
HETATM 5305 O O   . HOH G 4 .   ? -3.493  -23.071 9.778   1.00 43.91  ? 339 HOH A O   1 
HETATM 5306 O O   . HOH G 4 .   ? -11.329 -8.472  -2.632  1.00 35.59  ? 340 HOH A O   1 
HETATM 5307 O O   . HOH G 4 .   ? -8.699  -49.440 5.901   1.00 50.83  ? 341 HOH A O   1 
HETATM 5308 O O   . HOH G 4 .   ? -0.768  -18.522 -0.354  1.00 31.31  ? 342 HOH A O   1 
HETATM 5309 O O   . HOH G 4 .   ? -27.794 -27.774 1.127   1.00 35.23  ? 343 HOH A O   1 
HETATM 5310 O O   . HOH G 4 .   ? -19.921 -6.222  3.794   1.00 36.18  ? 344 HOH A O   1 
HETATM 5311 O O   . HOH G 4 .   ? -4.314  -31.101 9.122   1.00 47.87  ? 345 HOH A O   1 
HETATM 5312 O O   . HOH G 4 .   ? -10.934 -30.550 -12.597 1.00 51.52  ? 346 HOH A O   1 
HETATM 5313 O O   . HOH G 4 .   ? -3.942  -29.600 18.373  1.00 46.69  ? 347 HOH A O   1 
HETATM 5314 O O   . HOH G 4 .   ? -25.576 -10.826 12.777  1.00 70.17  ? 348 HOH A O   1 
HETATM 5315 O O   . HOH G 4 .   ? -14.771 -15.918 2.252   1.00 40.47  ? 349 HOH A O   1 
HETATM 5316 O O   . HOH G 4 .   ? -7.766  -19.544 15.684  1.00 41.00  ? 350 HOH A O   1 
HETATM 5317 O O   . HOH G 4 .   ? -21.526 -15.962 20.315  1.00 32.27  ? 351 HOH A O   1 
HETATM 5318 O O   . HOH G 4 .   ? -22.188 -8.319  18.552  1.00 37.96  ? 352 HOH A O   1 
HETATM 5319 O O   . HOH G 4 .   ? -10.875 -5.515  16.636  1.00 48.52  ? 353 HOH A O   1 
HETATM 5320 O O   . HOH G 4 .   ? -17.963 -49.483 5.371   1.00 49.98  ? 354 HOH A O   1 
HETATM 5321 O O   . HOH G 4 .   ? -16.721 -31.617 -5.531  1.00 32.15  ? 355 HOH A O   1 
HETATM 5322 O O   . HOH G 4 .   ? -19.544 -30.452 -15.973 1.00 49.11  ? 356 HOH A O   1 
HETATM 5323 O O   . HOH G 4 .   ? -6.310  -17.574 14.166  1.00 36.09  ? 357 HOH A O   1 
HETATM 5324 O O   . HOH G 4 .   ? 1.490   -31.826 -3.659  1.00 52.10  ? 358 HOH A O   1 
HETATM 5325 O O   . HOH G 4 .   ? -14.131 -4.959  14.246  1.00 31.61  ? 359 HOH A O   1 
HETATM 5326 O O   . HOH G 4 .   ? -22.019 -36.580 10.543  1.00 40.23  ? 360 HOH A O   1 
HETATM 5327 O O   . HOH G 4 .   ? -6.199  -21.588 16.101  1.00 39.50  ? 361 HOH A O   1 
HETATM 5328 O O   . HOH G 4 .   ? -18.400 -38.084 -4.814  1.00 46.20  ? 362 HOH A O   1 
HETATM 5329 O O   . HOH G 4 .   ? -16.446 -27.192 1.598   1.00 54.97  ? 363 HOH A O   1 
HETATM 5330 O O   . HOH G 4 .   ? -7.873  -19.860 21.397  1.00 47.17  ? 364 HOH A O   1 
HETATM 5331 O O   . HOH G 4 .   ? -14.942 -32.159 25.568  1.00 46.29  ? 365 HOH A O   1 
HETATM 5332 O O   . HOH G 4 .   ? -25.426 -24.289 10.543  1.00 40.85  ? 366 HOH A O   1 
HETATM 5333 O O   . HOH G 4 .   ? 3.691   -31.184 -5.574  1.00 53.82  ? 368 HOH A O   1 
HETATM 5334 O O   . HOH G 4 .   ? -24.883 -46.119 0.463   1.00 42.24  ? 369 HOH A O   1 
HETATM 5335 O O   . HOH G 4 .   ? -14.679 -48.934 -2.571  1.00 46.20  ? 370 HOH A O   1 
HETATM 5336 O O   . HOH G 4 .   ? -15.406 -7.421  26.906  1.00 52.23  ? 371 HOH A O   1 
HETATM 5337 O O   . HOH G 4 .   ? -10.578 -6.177  -4.593  1.00 45.01  ? 372 HOH A O   1 
HETATM 5338 O O   . HOH G 4 .   ? -9.813  -50.740 11.545  1.00 56.88  ? 373 HOH A O   1 
HETATM 5339 O O   . HOH G 4 .   ? -28.821 -28.452 4.503   1.00 57.25  ? 374 HOH A O   1 
HETATM 5340 O O   . HOH G 4 .   ? 0.788   -36.300 -5.395  1.00 57.83  ? 375 HOH A O   1 
HETATM 5341 O O   . HOH G 4 .   ? -13.391 -34.546 24.865  1.00 97.18  ? 376 HOH A O   1 
HETATM 5342 O O   . HOH G 4 .   ? -22.854 -5.242  22.715  1.00 48.05  ? 377 HOH A O   1 
HETATM 5343 O O   . HOH G 4 .   ? -21.165 -13.679 -2.198  1.00 46.54  ? 378 HOH A O   1 
HETATM 5344 O O   . HOH G 4 .   ? -3.926  -16.474 25.256  1.00 56.92  ? 379 HOH A O   1 
HETATM 5345 O O   . HOH G 4 .   ? 1.784   -18.966 -0.981  1.00 63.66  ? 380 HOH A O   1 
HETATM 5346 O O   . HOH G 4 .   ? 2.044   -40.097 -6.088  1.00 57.98  ? 381 HOH A O   1 
HETATM 5347 O O   . HOH G 4 .   ? -9.949  -23.286 -16.473 1.00 59.71  ? 382 HOH A O   1 
HETATM 5348 O O   . HOH G 4 .   ? 4.783   -31.895 -9.913  1.00 59.97  ? 383 HOH A O   1 
HETATM 5349 O O   . HOH G 4 .   ? -16.903 -23.323 -6.127  1.00 44.90  ? 384 HOH A O   1 
HETATM 5350 O O   . HOH G 4 .   ? -23.600 -23.807 14.852  1.00 53.29  ? 385 HOH A O   1 
HETATM 5351 O O   . HOH G 4 .   ? 5.083   -29.645 -3.809  1.00 49.32  ? 386 HOH A O   1 
HETATM 5352 O O   . HOH G 4 .   ? -20.587 -40.433 -15.251 1.00 57.89  ? 387 HOH A O   1 
HETATM 5353 O O   . HOH G 4 .   ? -28.839 -29.687 -0.411  1.00 62.67  ? 388 HOH A O   1 
HETATM 5354 O O   . HOH G 4 .   ? -5.578  -11.237 24.361  1.00 50.47  ? 389 HOH A O   1 
HETATM 5355 O O   . HOH G 4 .   ? -22.896 -38.479 0.367   1.00 43.06  ? 390 HOH A O   1 
HETATM 5356 O O   . HOH H 4 .   ? -32.471 -50.751 -16.871 1.00 46.81  ? 328 HOH B O   1 
HETATM 5357 O O   . HOH H 4 .   ? -38.957 -43.999 -7.456  1.00 39.49  ? 329 HOH B O   1 
HETATM 5358 O O   . HOH H 4 .   ? -37.902 -43.660 -33.866 1.00 29.49  ? 330 HOH B O   1 
HETATM 5359 O O   . HOH H 4 .   ? -32.562 -62.079 -5.125  1.00 50.29  ? 331 HOH B O   1 
HETATM 5360 O O   . HOH H 4 .   ? -29.744 -63.587 -7.267  1.00 42.39  ? 332 HOH B O   1 
HETATM 5361 O O   . HOH H 4 .   ? -38.826 -64.309 -10.036 1.00 46.82  ? 333 HOH B O   1 
HETATM 5362 O O   . HOH H 4 .   ? -35.130 -46.400 -1.448  1.00 37.19  ? 334 HOH B O   1 
HETATM 5363 O O   . HOH H 4 .   ? -51.657 -35.670 -18.529 1.00 41.66  ? 335 HOH B O   1 
HETATM 5364 O O   . HOH H 4 .   ? -36.648 -67.306 -3.689  1.00 41.17  ? 336 HOH B O   1 
HETATM 5365 O O   . HOH H 4 .   ? -54.238 -57.434 -3.494  1.00 42.25  ? 337 HOH B O   1 
HETATM 5366 O O   . HOH H 4 .   ? -27.264 -40.234 -11.222 1.00 47.13  ? 338 HOH B O   1 
HETATM 5367 O O   . HOH H 4 .   ? -54.798 -54.888 -2.474  1.00 38.36  ? 339 HOH B O   1 
HETATM 5368 O O   . HOH H 4 .   ? -37.651 -44.533 -18.750 1.00 37.51  ? 340 HOH B O   1 
HETATM 5369 O O   . HOH H 4 .   ? -37.375 -33.547 -33.651 1.00 42.13  ? 341 HOH B O   1 
HETATM 5370 O O   . HOH H 4 .   ? -23.488 -47.808 -5.322  1.00 34.60  ? 342 HOH B O   1 
HETATM 5371 O O   . HOH H 4 .   ? -33.250 -65.831 -14.121 1.00 49.72  ? 343 HOH B O   1 
HETATM 5372 O O   . HOH H 4 .   ? -52.775 -59.319 -7.661  1.00 44.70  ? 344 HOH B O   1 
HETATM 5373 O O   . HOH H 4 .   ? -30.830 -47.241 -22.975 1.00 49.47  ? 345 HOH B O   1 
HETATM 5374 O O   . HOH H 4 .   ? -43.852 -39.046 -7.509  1.00 43.60  ? 346 HOH B O   1 
HETATM 5375 O O   . HOH H 4 .   ? -38.143 -37.965 -6.984  1.00 51.80  ? 347 HOH B O   1 
HETATM 5376 O O   . HOH H 4 .   ? -50.682 -46.287 -3.023  1.00 43.70  ? 348 HOH B O   1 
HETATM 5377 O O   . HOH H 4 .   ? -30.534 -62.847 -14.005 1.00 47.60  ? 349 HOH B O   1 
HETATM 5378 O O   . HOH H 4 .   ? -24.058 -46.958 -1.929  1.00 59.40  ? 350 HOH B O   1 
HETATM 5379 O O   . HOH H 4 .   ? -37.773 -37.431 -26.431 1.00 42.51  ? 351 HOH B O   1 
HETATM 5380 O O   . HOH H 4 .   ? -45.038 -56.042 -21.993 1.00 40.40  ? 352 HOH B O   1 
HETATM 5381 O O   . HOH H 4 .   ? -40.101 -61.609 -10.963 1.00 44.92  ? 353 HOH B O   1 
HETATM 5382 O O   . HOH H 4 .   ? -19.775 -35.988 -9.089  1.00 48.39  ? 354 HOH B O   1 
HETATM 5383 O O   . HOH H 4 .   ? -28.610 -56.738 13.033  1.00 60.10  ? 355 HOH B O   1 
HETATM 5384 O O   . HOH H 4 .   ? -51.774 -59.867 -19.325 1.00 52.79  ? 356 HOH B O   1 
HETATM 5385 O O   . HOH H 4 .   ? -51.577 -57.393 1.751   1.00 36.80  ? 357 HOH B O   1 
HETATM 5386 O O   . HOH H 4 .   ? -45.695 -33.267 -20.526 1.00 47.36  ? 358 HOH B O   1 
HETATM 5387 O O   . HOH H 4 .   ? -55.005 -55.476 -8.629  1.00 38.65  ? 359 HOH B O   1 
HETATM 5388 O O   . HOH H 4 .   ? -44.520 -55.043 4.759   1.00 49.92  ? 360 HOH B O   1 
HETATM 5389 O O   . HOH H 4 .   ? -17.270 -50.760 -13.642 1.00 56.95  ? 361 HOH B O   1 
HETATM 5390 O O   . HOH H 4 .   ? -42.825 -49.903 -28.915 1.00 48.57  ? 362 HOH B O   1 
HETATM 5391 O O   . HOH H 4 .   ? -48.265 -34.939 -31.548 1.00 56.55  ? 363 HOH B O   1 
HETATM 5392 O O   . HOH H 4 .   ? -52.243 -42.005 -8.414  1.00 48.84  ? 364 HOH B O   1 
HETATM 5393 O O   . HOH H 4 .   ? -46.370 -59.664 -23.543 1.00 52.23  ? 365 HOH B O   1 
HETATM 5394 O O   . HOH H 4 .   ? -41.942 -40.948 -14.622 1.00 47.11  ? 366 HOH B O   1 
HETATM 5395 O O   . HOH H 4 .   ? -56.832 -41.648 -16.342 1.00 55.34  ? 368 HOH B O   1 
HETATM 5396 O O   . HOH H 4 .   ? -48.569 -42.398 -1.131  1.00 43.19  ? 369 HOH B O   1 
HETATM 5397 O O   . HOH H 4 .   ? -22.553 -51.778 -2.719  1.00 40.82  ? 370 HOH B O   1 
HETATM 5398 O O   . HOH H 4 .   ? -42.811 -57.924 6.123   1.00 45.49  ? 371 HOH B O   1 
HETATM 5399 O O   . HOH H 4 .   ? -28.305 -50.637 9.939   1.00 56.24  ? 372 HOH B O   1 
HETATM 5400 O O   . HOH H 4 .   ? -47.009 -47.147 5.131   1.00 54.96  ? 373 HOH B O   1 
HETATM 5401 O O   . HOH H 4 .   ? -21.655 -45.301 -3.197  1.00 52.81  ? 374 HOH B O   1 
HETATM 5402 O O   . HOH H 4 .   ? -38.668 -40.133 -8.529  1.00 43.31  ? 375 HOH B O   1 
HETATM 5403 O O   . HOH H 4 .   ? -31.504 -61.119 7.233   1.00 47.65  ? 376 HOH B O   1 
HETATM 5404 O O   . HOH H 4 .   ? -42.022 -45.058 -27.663 1.00 50.62  ? 377 HOH B O   1 
HETATM 5405 O O   . HOH H 4 .   ? -47.460 -63.890 -9.226  1.00 64.81  ? 378 HOH B O   1 
HETATM 5406 O O   . HOH H 4 .   ? -51.308 -42.361 2.173   1.00 60.46  ? 379 HOH B O   1 
HETATM 5407 O O   . HOH H 4 .   ? -51.135 -44.781 -33.348 1.00 56.48  ? 380 HOH B O   1 
HETATM 5408 O O   . HOH H 4 .   ? -31.090 -51.053 -10.608 1.00 41.19  ? 381 HOH B O   1 
HETATM 5409 O O   . HOH H 4 .   ? -50.383 -56.195 -22.534 1.00 48.60  ? 382 HOH B O   1 
HETATM 5410 O O   . HOH H 4 .   ? -50.104 -60.768 1.859   1.00 39.98  ? 383 HOH B O   1 
HETATM 5411 O O   . HOH H 4 .   ? -43.885 -24.872 -35.615 1.00 60.15  ? 384 HOH B O   1 
HETATM 5412 O O   . HOH H 4 .   ? -57.423 -44.724 -6.412  1.00 59.14  ? 385 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   -5  ?   ?   ?   A . n 
A 1 2   THR 2   -4  ?   ?   ?   A . n 
A 1 3   LEU 3   -3  ?   ?   ?   A . n 
A 1 4   GLY 4   -2  -2  GLY GLY A . n 
A 1 5   ASN 5   -1  -1  ASN ASN A . n 
A 1 6   THR 6   0   0   THR THR A . n 
A 1 7   THR 7   1   1   THR THR A . n 
A 1 8   SER 8   2   2   SER SER A . n 
A 1 9   SER 9   3   3   SER SER A . n 
A 1 10  VAL 10  4   4   VAL VAL A . n 
A 1 11  ILE 11  5   5   ILE ILE A . n 
A 1 12  LEU 12  6   6   LEU LEU A . n 
A 1 13  THR 13  7   7   THR THR A . n 
A 1 14  ASN 14  8   8   ASN ASN A . n 
A 1 15  TYR 15  9   9   TYR TYR A . n 
A 1 16  MET 16  10  10  MET MET A . n 
A 1 17  ASP 17  11  11  ASP ASP A . n 
A 1 18  THR 18  12  12  THR THR A . n 
A 1 19  GLN 19  13  13  GLN GLN A . n 
A 1 20  TYR 20  14  14  TYR TYR A . n 
A 1 21  TYR 21  15  15  TYR TYR A . n 
A 1 22  GLY 22  16  16  GLY GLY A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  ILE 24  18  18  ILE ILE A . n 
A 1 25  GLY 25  19  19  GLY GLY A . n 
A 1 26  ILE 26  20  20  ILE ILE A . n 
A 1 27  GLY 27  21  21  GLY GLY A . n 
A 1 28  THR 28  22  22  THR THR A . n 
A 1 29  PRO 29  23  23  PRO PRO A . n 
A 1 30  PRO 30  24  24  PRO PRO A . n 
A 1 31  GLN 31  25  25  GLN GLN A . n 
A 1 32  THR 32  26  26  THR THR A . n 
A 1 33  PHE 33  27  27  PHE PHE A . n 
A 1 34  LYS 34  28  28  LYS LYS A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  PHE 37  31  31  PHE PHE A . n 
A 1 38  ASP 38  32  32  ASP ASP A . n 
A 1 39  THR 39  33  33  THR THR A . n 
A 1 40  GLY 40  34  34  GLY GLY A . n 
A 1 41  SER 41  35  35  SER SER A . n 
A 1 42  SER 42  36  36  SER SER A . n 
A 1 43  ASN 43  37  37  ASN ASN A . n 
A 1 44  VAL 44  38  38  VAL VAL A . n 
A 1 45  TRP 45  39  39  TRP TRP A . n 
A 1 46  VAL 46  40  40  VAL VAL A . n 
A 1 47  PRO 47  41  41  PRO PRO A . n 
A 1 48  SER 48  42  42  SER SER A . n 
A 1 49  SER 49  43  43  SER SER A . n 
A 1 50  LYS 50  44  44  LYS LYS A . n 
A 1 51  CYS 51  45  45  CYS CYS A . n 
A 1 52  SER 52  46  46  SER SER A . n 
A 1 53  ARG 53  46  46  ARG ARG A A n 
A 1 54  LEU 54  46  46  LEU LEU A B n 
A 1 55  TYR 55  47  47  TYR TYR A . n 
A 1 56  THR 56  48  48  THR THR A . n 
A 1 57  ALA 57  49  49  ALA ALA A . n 
A 1 58  CYS 58  50  50  CYS CYS A . n 
A 1 59  VAL 59  51  51  VAL VAL A . n 
A 1 60  TYR 60  52  52  TYR TYR A . n 
A 1 61  HIS 61  53  53  HIS HIS A . n 
A 1 62  LYS 62  54  54  LYS LYS A . n 
A 1 63  LEU 63  55  55  LEU LEU A . n 
A 1 64  PHE 64  56  56  PHE PHE A . n 
A 1 65  ASP 65  57  57  ASP ASP A . n 
A 1 66  ALA 66  58  58  ALA ALA A . n 
A 1 67  SER 67  59  59  SER SER A . n 
A 1 68  ASP 68  60  60  ASP ASP A . n 
A 1 69  SER 69  61  61  SER SER A . n 
A 1 70  SER 70  62  62  SER SER A . n 
A 1 71  SER 71  63  63  SER SER A . n 
A 1 72  TYR 72  64  64  TYR TYR A . n 
A 1 73  LYS 73  65  65  LYS LYS A . n 
A 1 74  HIS 74  66  66  HIS HIS A . n 
A 1 75  ASN 75  67  67  ASN ASN A . n 
A 1 76  GLY 76  68  68  GLY GLY A . n 
A 1 77  THR 77  69  69  THR THR A . n 
A 1 78  GLU 78  70  70  GLU GLU A . n 
A 1 79  LEU 79  71  71  LEU LEU A . n 
A 1 80  THR 80  72  72  THR THR A . n 
A 1 81  LEU 81  73  73  LEU LEU A . n 
A 1 82  ARG 82  74  74  ARG ARG A . n 
A 1 83  TYR 83  75  75  TYR TYR A . n 
A 1 84  SER 84  76  76  SER SER A . n 
A 1 85  THR 85  77  77  THR THR A . n 
A 1 86  GLY 86  78  78  GLY GLY A . n 
A 1 87  THR 87  79  79  THR THR A . n 
A 1 88  VAL 88  80  80  VAL VAL A . n 
A 1 89  SER 89  81  81  SER SER A . n 
A 1 90  GLY 90  82  82  GLY GLY A . n 
A 1 91  PHE 91  83  83  PHE PHE A . n 
A 1 92  LEU 92  84  84  LEU LEU A . n 
A 1 93  SER 93  85  85  SER SER A . n 
A 1 94  GLN 94  86  86  GLN GLN A . n 
A 1 95  ASP 95  87  87  ASP ASP A . n 
A 1 96  ILE 96  88  88  ILE ILE A . n 
A 1 97  ILE 97  89  89  ILE ILE A . n 
A 1 98  THR 98  90  90  THR THR A . n 
A 1 99  VAL 99  91  91  VAL VAL A . n 
A 1 100 GLY 100 92  92  GLY GLY A . n 
A 1 101 GLY 101 93  93  GLY GLY A . n 
A 1 102 ILE 102 94  94  ILE ILE A . n 
A 1 103 THR 103 95  95  THR THR A . n 
A 1 104 VAL 104 96  96  VAL VAL A . n 
A 1 105 THR 105 97  97  THR THR A . n 
A 1 106 GLN 106 99  99  GLN GLN A . n 
A 1 107 MET 107 100 100 MET MET A . n 
A 1 108 PHE 108 101 101 PHE PHE A . n 
A 1 109 GLY 109 102 102 GLY GLY A . n 
A 1 110 GLU 110 103 103 GLU GLU A . n 
A 1 111 VAL 111 104 104 VAL VAL A . n 
A 1 112 THR 112 105 105 THR THR A . n 
A 1 113 GLU 113 106 106 GLU GLU A . n 
A 1 114 MET 114 107 107 MET MET A . n 
A 1 115 PRO 115 108 108 PRO PRO A . n 
A 1 116 ALA 116 109 109 ALA ALA A . n 
A 1 117 LEU 117 110 110 LEU LEU A . n 
A 1 118 PRO 118 111 111 PRO PRO A . n 
A 1 119 PHE 119 112 112 PHE PHE A . n 
A 1 120 MET 120 113 113 MET MET A . n 
A 1 121 LEU 121 114 114 LEU LEU A . n 
A 1 122 ALA 122 115 115 ALA ALA A . n 
A 1 123 GLU 123 116 116 GLU GLU A . n 
A 1 124 PHE 124 117 117 PHE PHE A . n 
A 1 125 ASP 125 118 118 ASP ASP A . n 
A 1 126 GLY 126 119 119 GLY GLY A . n 
A 1 127 VAL 127 120 120 VAL VAL A . n 
A 1 128 VAL 128 121 121 VAL VAL A . n 
A 1 129 GLY 129 122 122 GLY GLY A . n 
A 1 130 MET 130 123 123 MET MET A . n 
A 1 131 GLY 131 124 124 GLY GLY A . n 
A 1 132 PHE 132 125 125 PHE PHE A . n 
A 1 133 ILE 133 126 126 ILE ILE A . n 
A 1 134 GLU 134 127 127 GLU GLU A . n 
A 1 135 GLN 135 128 128 GLN GLN A . n 
A 1 136 ALA 136 129 129 ALA ALA A . n 
A 1 137 ILE 137 130 130 ILE ILE A . n 
A 1 138 GLY 138 131 131 GLY GLY A . n 
A 1 139 ARG 139 132 132 ARG ARG A . n 
A 1 140 VAL 140 133 133 VAL VAL A . n 
A 1 141 THR 141 134 134 THR THR A . n 
A 1 142 PRO 142 135 135 PRO PRO A . n 
A 1 143 ILE 143 136 136 ILE ILE A . n 
A 1 144 PHE 144 137 137 PHE PHE A . n 
A 1 145 ASP 145 138 138 ASP ASP A . n 
A 1 146 ASN 146 139 139 ASN ASN A . n 
A 1 147 ILE 147 140 140 ILE ILE A . n 
A 1 148 ILE 148 141 141 ILE ILE A . n 
A 1 149 SER 149 142 142 SER SER A . n 
A 1 150 GLN 150 143 143 GLN GLN A . n 
A 1 151 GLY 151 144 144 GLY GLY A . n 
A 1 152 VAL 152 145 145 VAL VAL A . n 
A 1 153 LEU 153 146 146 LEU LEU A . n 
A 1 154 LYS 154 147 147 LYS LYS A . n 
A 1 155 GLU 155 148 148 GLU GLU A . n 
A 1 156 ASP 156 149 149 ASP ASP A . n 
A 1 157 VAL 157 150 150 VAL VAL A . n 
A 1 158 PHE 158 151 151 PHE PHE A . n 
A 1 159 SER 159 152 152 SER SER A . n 
A 1 160 PHE 160 153 153 PHE PHE A . n 
A 1 161 TYR 161 154 154 TYR TYR A . n 
A 1 162 TYR 162 155 155 TYR TYR A . n 
A 1 163 ASN 163 156 156 ASN ASN A . n 
A 1 164 ARG 164 157 157 ARG ARG A . n 
A 1 165 ASP 165 158 158 ASP ASP A . n 
A 1 166 SER 166 159 159 SER SER A . n 
A 1 167 GLU 167 160 160 GLU GLU A . n 
A 1 168 ASN 168 160 160 ASN ASN A A n 
A 1 169 SER 169 160 160 SER SER A B n 
A 1 170 GLN 170 160 160 GLN GLN A C n 
A 1 171 SER 171 160 160 SER SER A D n 
A 1 172 LEU 172 161 161 LEU LEU A . n 
A 1 173 GLY 173 162 162 GLY GLY A . n 
A 1 174 GLY 174 163 163 GLY GLY A . n 
A 1 175 GLN 175 164 164 GLN GLN A . n 
A 1 176 ILE 176 165 165 ILE ILE A . n 
A 1 177 VAL 177 166 166 VAL VAL A . n 
A 1 178 LEU 178 167 167 LEU LEU A . n 
A 1 179 GLY 179 168 168 GLY GLY A . n 
A 1 180 GLY 180 169 169 GLY GLY A . n 
A 1 181 SER 181 170 170 SER SER A . n 
A 1 182 ASP 182 171 171 ASP ASP A . n 
A 1 183 PRO 183 172 172 PRO PRO A . n 
A 1 184 GLN 184 173 173 GLN GLN A . n 
A 1 185 HIS 185 174 174 HIS HIS A . n 
A 1 186 TYR 186 175 175 TYR TYR A . n 
A 1 187 GLU 187 176 176 GLU GLU A . n 
A 1 188 GLY 188 177 177 GLY GLY A . n 
A 1 189 ASN 189 178 178 ASN ASN A . n 
A 1 190 PHE 190 179 179 PHE PHE A . n 
A 1 191 HIS 191 180 180 HIS HIS A . n 
A 1 192 TYR 192 181 181 TYR TYR A . n 
A 1 193 ILE 193 182 182 ILE ILE A . n 
A 1 194 ASN 194 183 183 ASN ASN A . n 
A 1 195 LEU 195 184 184 LEU LEU A . n 
A 1 196 ILE 196 185 185 ILE ILE A . n 
A 1 197 LYS 197 186 186 LYS LYS A . n 
A 1 198 THR 198 187 187 THR THR A . n 
A 1 199 GLY 199 188 188 GLY GLY A . n 
A 1 200 VAL 200 189 189 VAL VAL A . n 
A 1 201 TRP 201 190 190 TRP TRP A . n 
A 1 202 GLN 202 191 191 GLN GLN A . n 
A 1 203 ILE 203 192 192 ILE ILE A . n 
A 1 204 GLN 204 193 193 GLN GLN A . n 
A 1 205 MET 205 194 194 MET MET A . n 
A 1 206 LYS 206 195 195 LYS LYS A . n 
A 1 207 GLY 207 196 196 GLY GLY A . n 
A 1 208 VAL 208 197 197 VAL VAL A . n 
A 1 209 SER 209 198 198 SER SER A . n 
A 1 210 VAL 210 199 199 VAL VAL A . n 
A 1 211 GLY 211 200 200 GLY GLY A . n 
A 1 212 SER 212 201 201 SER SER A . n 
A 1 213 SER 213 202 202 SER SER A . n 
A 1 214 THR 214 203 203 THR THR A . n 
A 1 215 LEU 215 204 204 LEU LEU A . n 
A 1 216 LEU 216 205 205 LEU LEU A . n 
A 1 217 CYS 217 206 206 CYS CYS A . n 
A 1 218 GLU 218 207 207 GLU GLU A . n 
A 1 219 ASP 219 208 208 ASP ASP A . n 
A 1 220 GLY 220 209 209 GLY GLY A . n 
A 1 221 CYS 221 210 210 CYS CYS A . n 
A 1 222 LEU 222 211 211 LEU LEU A . n 
A 1 223 ALA 223 212 212 ALA ALA A . n 
A 1 224 LEU 224 213 213 LEU LEU A . n 
A 1 225 VAL 225 214 214 VAL VAL A . n 
A 1 226 ASP 226 215 215 ASP ASP A . n 
A 1 227 THR 227 216 216 THR THR A . n 
A 1 228 GLY 228 217 217 GLY GLY A . n 
A 1 229 ALA 229 218 218 ALA ALA A . n 
A 1 230 SER 230 219 219 SER SER A . n 
A 1 231 TYR 231 220 220 TYR TYR A . n 
A 1 232 ILE 232 221 221 ILE ILE A . n 
A 1 233 SER 233 222 222 SER SER A . n 
A 1 234 GLY 234 223 223 GLY GLY A . n 
A 1 235 SER 235 224 224 SER SER A . n 
A 1 236 THR 236 225 225 THR THR A . n 
A 1 237 SER 237 226 226 SER SER A . n 
A 1 238 SER 238 227 227 SER SER A . n 
A 1 239 ILE 239 228 228 ILE ILE A . n 
A 1 240 GLU 240 229 229 GLU GLU A . n 
A 1 241 LYS 241 230 230 LYS LYS A . n 
A 1 242 LEU 242 231 231 LEU LEU A . n 
A 1 243 MET 243 232 232 MET MET A . n 
A 1 244 GLU 244 233 233 GLU GLU A . n 
A 1 245 ALA 245 234 234 ALA ALA A . n 
A 1 246 LEU 246 235 235 LEU LEU A . n 
A 1 247 GLY 247 236 236 GLY GLY A . n 
A 1 248 ALA 248 237 237 ALA ALA A . n 
A 1 249 LYS 249 238 238 LYS LYS A . n 
A 1 250 LYS 250 239 239 LYS LYS A . n 
A 1 251 ARG 251 240 240 ARG ARG A . n 
A 1 252 LEU 252 242 242 LEU LEU A . n 
A 1 253 PHE 253 243 243 PHE PHE A . n 
A 1 254 ASP 254 244 244 ASP ASP A . n 
A 1 255 TYR 255 245 245 TYR TYR A . n 
A 1 256 VAL 256 246 246 VAL VAL A . n 
A 1 257 VAL 257 247 247 VAL VAL A . n 
A 1 258 LYS 258 248 248 LYS LYS A . n 
A 1 259 CYS 259 249 249 CYS CYS A . n 
A 1 260 ASN 260 250 250 ASN ASN A . n 
A 1 261 GLU 261 251 251 GLU GLU A . n 
A 1 262 GLY 262 252 252 GLY GLY A . n 
A 1 263 PRO 263 253 253 PRO PRO A . n 
A 1 264 THR 264 254 254 THR THR A . n 
A 1 265 LEU 265 255 255 LEU LEU A . n 
A 1 266 PRO 266 256 256 PRO PRO A . n 
A 1 267 ASP 267 257 257 ASP ASP A . n 
A 1 268 ILE 268 258 258 ILE ILE A . n 
A 1 269 SER 269 259 259 SER SER A . n 
A 1 270 PHE 270 260 260 PHE PHE A . n 
A 1 271 HIS 271 261 261 HIS HIS A . n 
A 1 272 LEU 272 262 262 LEU LEU A . n 
A 1 273 GLY 273 263 263 GLY GLY A . n 
A 1 274 GLY 274 264 264 GLY GLY A . n 
A 1 275 LYS 275 265 265 LYS LYS A . n 
A 1 276 GLU 276 266 266 GLU GLU A . n 
A 1 277 TYR 277 267 267 TYR TYR A . n 
A 1 278 THR 278 268 268 THR THR A . n 
A 1 279 LEU 279 269 269 LEU LEU A . n 
A 1 280 THR 280 270 270 THR THR A . n 
A 1 281 SER 281 271 271 SER SER A . n 
A 1 282 ALA 282 272 272 ALA ALA A . n 
A 1 283 ASP 283 273 273 ASP ASP A . n 
A 1 284 TYR 284 274 274 TYR TYR A . n 
A 1 285 VAL 285 275 275 VAL VAL A . n 
A 1 286 PHE 286 276 276 PHE PHE A . n 
A 1 287 GLN 287 277 277 GLN GLN A . n 
A 1 288 GLU 288 278 278 GLU GLU A . n 
A 1 289 SER 289 279 279 SER SER A . n 
A 1 290 TYR 290 279 279 TYR TYR A A n 
A 1 291 SER 291 279 279 SER SER A B n 
A 1 292 SER 292 279 279 SER SER A C n 
A 1 293 LYS 293 279 279 LYS LYS A D n 
A 1 294 LYS 294 280 280 LYS LYS A . n 
A 1 295 LEU 295 281 281 LEU LEU A . n 
A 1 296 CYS 296 282 282 CYS CYS A . n 
A 1 297 THR 297 283 283 THR THR A . n 
A 1 298 LEU 298 284 284 LEU LEU A . n 
A 1 299 ALA 299 285 285 ALA ALA A . n 
A 1 300 ILE 300 286 286 ILE ILE A . n 
A 1 301 HIS 301 287 287 HIS HIS A . n 
A 1 302 ALA 302 288 288 ALA ALA A . n 
A 1 303 MET 303 289 289 MET MET A . n 
A 1 304 ASP 304 290 290 ASP ASP A . n 
A 1 305 ILE 305 291 291 ILE ILE A . n 
A 1 306 PRO 306 292 292 PRO PRO A . n 
A 1 307 PRO 307 293 293 PRO PRO A . n 
A 1 308 PRO 308 294 294 PRO PRO A . n 
A 1 309 THR 309 295 295 THR THR A . n 
A 1 310 GLY 310 296 296 GLY GLY A . n 
A 1 311 PRO 311 297 297 PRO PRO A . n 
A 1 312 THR 312 298 298 THR THR A . n 
A 1 313 TRP 313 299 299 TRP TRP A . n 
A 1 314 ALA 314 300 300 ALA ALA A . n 
A 1 315 LEU 315 301 301 LEU LEU A . n 
A 1 316 GLY 316 302 302 GLY GLY A . n 
A 1 317 ALA 317 303 303 ALA ALA A . n 
A 1 318 THR 318 304 304 THR THR A . n 
A 1 319 PHE 319 305 305 PHE PHE A . n 
A 1 320 ILE 320 306 306 ILE ILE A . n 
A 1 321 ARG 321 307 307 ARG ARG A . n 
A 1 322 LYS 322 308 308 LYS LYS A . n 
A 1 323 PHE 323 309 309 PHE PHE A . n 
A 1 324 TYR 324 310 310 TYR TYR A . n 
A 1 325 THR 325 311 311 THR THR A . n 
A 1 326 GLU 326 312 312 GLU GLU A . n 
A 1 327 PHE 327 313 313 PHE PHE A . n 
A 1 328 ASP 328 314 314 ASP ASP A . n 
A 1 329 ARG 329 315 315 ARG ARG A . n 
A 1 330 ARG 330 316 316 ARG ARG A . n 
A 1 331 ASN 331 317 317 ASN ASN A . n 
A 1 332 ASN 332 318 318 ASN ASN A . n 
A 1 333 ARG 333 319 319 ARG ARG A . n 
A 1 334 ILE 334 320 320 ILE ILE A . n 
A 1 335 GLY 335 321 321 GLY GLY A . n 
A 1 336 PHE 336 322 322 PHE PHE A . n 
A 1 337 ALA 337 323 323 ALA ALA A . n 
A 1 338 LEU 338 324 324 LEU LEU A . n 
A 1 339 ALA 339 325 325 ALA ALA A . n 
A 1 340 ARG 340 326 326 ARG ARG A . n 
B 1 1   LEU 1   -5  ?   ?   ?   B . n 
B 1 2   THR 2   -4  ?   ?   ?   B . n 
B 1 3   LEU 3   -3  ?   ?   ?   B . n 
B 1 4   GLY 4   -2  -2  GLY GLY B . n 
B 1 5   ASN 5   -1  -1  ASN ASN B . n 
B 1 6   THR 6   0   0   THR THR B . n 
B 1 7   THR 7   1   1   THR THR B . n 
B 1 8   SER 8   2   2   SER SER B . n 
B 1 9   SER 9   3   3   SER SER B . n 
B 1 10  VAL 10  4   4   VAL VAL B . n 
B 1 11  ILE 11  5   5   ILE ILE B . n 
B 1 12  LEU 12  6   6   LEU LEU B . n 
B 1 13  THR 13  7   7   THR THR B . n 
B 1 14  ASN 14  8   8   ASN ASN B . n 
B 1 15  TYR 15  9   9   TYR TYR B . n 
B 1 16  MET 16  10  10  MET MET B . n 
B 1 17  ASP 17  11  11  ASP ASP B . n 
B 1 18  THR 18  12  12  THR THR B . n 
B 1 19  GLN 19  13  13  GLN GLN B . n 
B 1 20  TYR 20  14  14  TYR TYR B . n 
B 1 21  TYR 21  15  15  TYR TYR B . n 
B 1 22  GLY 22  16  16  GLY GLY B . n 
B 1 23  GLU 23  17  17  GLU GLU B . n 
B 1 24  ILE 24  18  18  ILE ILE B . n 
B 1 25  GLY 25  19  19  GLY GLY B . n 
B 1 26  ILE 26  20  20  ILE ILE B . n 
B 1 27  GLY 27  21  21  GLY GLY B . n 
B 1 28  THR 28  22  22  THR THR B . n 
B 1 29  PRO 29  23  23  PRO PRO B . n 
B 1 30  PRO 30  24  24  PRO PRO B . n 
B 1 31  GLN 31  25  25  GLN GLN B . n 
B 1 32  THR 32  26  26  THR THR B . n 
B 1 33  PHE 33  27  27  PHE PHE B . n 
B 1 34  LYS 34  28  28  LYS LYS B . n 
B 1 35  VAL 35  29  29  VAL VAL B . n 
B 1 36  VAL 36  30  30  VAL VAL B . n 
B 1 37  PHE 37  31  31  PHE PHE B . n 
B 1 38  ASP 38  32  32  ASP ASP B . n 
B 1 39  THR 39  33  33  THR THR B . n 
B 1 40  GLY 40  34  34  GLY GLY B . n 
B 1 41  SER 41  35  35  SER SER B . n 
B 1 42  SER 42  36  36  SER SER B . n 
B 1 43  ASN 43  37  37  ASN ASN B . n 
B 1 44  VAL 44  38  38  VAL VAL B . n 
B 1 45  TRP 45  39  39  TRP TRP B . n 
B 1 46  VAL 46  40  40  VAL VAL B . n 
B 1 47  PRO 47  41  41  PRO PRO B . n 
B 1 48  SER 48  42  42  SER SER B . n 
B 1 49  SER 49  43  43  SER SER B . n 
B 1 50  LYS 50  44  44  LYS LYS B . n 
B 1 51  CYS 51  45  45  CYS CYS B . n 
B 1 52  SER 52  46  46  SER SER B . n 
B 1 53  ARG 53  46  46  ARG ARG B A n 
B 1 54  LEU 54  46  46  LEU LEU B B n 
B 1 55  TYR 55  47  47  TYR TYR B . n 
B 1 56  THR 56  48  48  THR THR B . n 
B 1 57  ALA 57  49  49  ALA ALA B . n 
B 1 58  CYS 58  50  50  CYS CYS B . n 
B 1 59  VAL 59  51  51  VAL VAL B . n 
B 1 60  TYR 60  52  52  TYR TYR B . n 
B 1 61  HIS 61  53  53  HIS HIS B . n 
B 1 62  LYS 62  54  54  LYS LYS B . n 
B 1 63  LEU 63  55  55  LEU LEU B . n 
B 1 64  PHE 64  56  56  PHE PHE B . n 
B 1 65  ASP 65  57  57  ASP ASP B . n 
B 1 66  ALA 66  58  58  ALA ALA B . n 
B 1 67  SER 67  59  59  SER SER B . n 
B 1 68  ASP 68  60  60  ASP ASP B . n 
B 1 69  SER 69  61  61  SER SER B . n 
B 1 70  SER 70  62  62  SER SER B . n 
B 1 71  SER 71  63  63  SER SER B . n 
B 1 72  TYR 72  64  64  TYR TYR B . n 
B 1 73  LYS 73  65  65  LYS LYS B . n 
B 1 74  HIS 74  66  66  HIS HIS B . n 
B 1 75  ASN 75  67  67  ASN ASN B . n 
B 1 76  GLY 76  68  68  GLY GLY B . n 
B 1 77  THR 77  69  69  THR THR B . n 
B 1 78  GLU 78  70  70  GLU GLU B . n 
B 1 79  LEU 79  71  71  LEU LEU B . n 
B 1 80  THR 80  72  72  THR THR B . n 
B 1 81  LEU 81  73  73  LEU LEU B . n 
B 1 82  ARG 82  74  74  ARG ARG B . n 
B 1 83  TYR 83  75  75  TYR TYR B . n 
B 1 84  SER 84  76  76  SER SER B . n 
B 1 85  THR 85  77  77  THR THR B . n 
B 1 86  GLY 86  78  78  GLY GLY B . n 
B 1 87  THR 87  79  79  THR THR B . n 
B 1 88  VAL 88  80  80  VAL VAL B . n 
B 1 89  SER 89  81  81  SER SER B . n 
B 1 90  GLY 90  82  82  GLY GLY B . n 
B 1 91  PHE 91  83  83  PHE PHE B . n 
B 1 92  LEU 92  84  84  LEU LEU B . n 
B 1 93  SER 93  85  85  SER SER B . n 
B 1 94  GLN 94  86  86  GLN GLN B . n 
B 1 95  ASP 95  87  87  ASP ASP B . n 
B 1 96  ILE 96  88  88  ILE ILE B . n 
B 1 97  ILE 97  89  89  ILE ILE B . n 
B 1 98  THR 98  90  90  THR THR B . n 
B 1 99  VAL 99  91  91  VAL VAL B . n 
B 1 100 GLY 100 92  92  GLY GLY B . n 
B 1 101 GLY 101 93  93  GLY GLY B . n 
B 1 102 ILE 102 94  94  ILE ILE B . n 
B 1 103 THR 103 95  95  THR THR B . n 
B 1 104 VAL 104 96  96  VAL VAL B . n 
B 1 105 THR 105 97  97  THR THR B . n 
B 1 106 GLN 106 99  99  GLN GLN B . n 
B 1 107 MET 107 100 100 MET MET B . n 
B 1 108 PHE 108 101 101 PHE PHE B . n 
B 1 109 GLY 109 102 102 GLY GLY B . n 
B 1 110 GLU 110 103 103 GLU GLU B . n 
B 1 111 VAL 111 104 104 VAL VAL B . n 
B 1 112 THR 112 105 105 THR THR B . n 
B 1 113 GLU 113 106 106 GLU GLU B . n 
B 1 114 MET 114 107 107 MET MET B . n 
B 1 115 PRO 115 108 108 PRO PRO B . n 
B 1 116 ALA 116 109 109 ALA ALA B . n 
B 1 117 LEU 117 110 110 LEU LEU B . n 
B 1 118 PRO 118 111 111 PRO PRO B . n 
B 1 119 PHE 119 112 112 PHE PHE B . n 
B 1 120 MET 120 113 113 MET MET B . n 
B 1 121 LEU 121 114 114 LEU LEU B . n 
B 1 122 ALA 122 115 115 ALA ALA B . n 
B 1 123 GLU 123 116 116 GLU GLU B . n 
B 1 124 PHE 124 117 117 PHE PHE B . n 
B 1 125 ASP 125 118 118 ASP ASP B . n 
B 1 126 GLY 126 119 119 GLY GLY B . n 
B 1 127 VAL 127 120 120 VAL VAL B . n 
B 1 128 VAL 128 121 121 VAL VAL B . n 
B 1 129 GLY 129 122 122 GLY GLY B . n 
B 1 130 MET 130 123 123 MET MET B . n 
B 1 131 GLY 131 124 124 GLY GLY B . n 
B 1 132 PHE 132 125 125 PHE PHE B . n 
B 1 133 ILE 133 126 126 ILE ILE B . n 
B 1 134 GLU 134 127 127 GLU GLU B . n 
B 1 135 GLN 135 128 128 GLN GLN B . n 
B 1 136 ALA 136 129 129 ALA ALA B . n 
B 1 137 ILE 137 130 130 ILE ILE B . n 
B 1 138 GLY 138 131 131 GLY GLY B . n 
B 1 139 ARG 139 132 132 ARG ARG B . n 
B 1 140 VAL 140 133 133 VAL VAL B . n 
B 1 141 THR 141 134 134 THR THR B . n 
B 1 142 PRO 142 135 135 PRO PRO B . n 
B 1 143 ILE 143 136 136 ILE ILE B . n 
B 1 144 PHE 144 137 137 PHE PHE B . n 
B 1 145 ASP 145 138 138 ASP ASP B . n 
B 1 146 ASN 146 139 139 ASN ASN B . n 
B 1 147 ILE 147 140 140 ILE ILE B . n 
B 1 148 ILE 148 141 141 ILE ILE B . n 
B 1 149 SER 149 142 142 SER SER B . n 
B 1 150 GLN 150 143 143 GLN GLN B . n 
B 1 151 GLY 151 144 144 GLY GLY B . n 
B 1 152 VAL 152 145 145 VAL VAL B . n 
B 1 153 LEU 153 146 146 LEU LEU B . n 
B 1 154 LYS 154 147 147 LYS LYS B . n 
B 1 155 GLU 155 148 148 GLU GLU B . n 
B 1 156 ASP 156 149 149 ASP ASP B . n 
B 1 157 VAL 157 150 150 VAL VAL B . n 
B 1 158 PHE 158 151 151 PHE PHE B . n 
B 1 159 SER 159 152 152 SER SER B . n 
B 1 160 PHE 160 153 153 PHE PHE B . n 
B 1 161 TYR 161 154 154 TYR TYR B . n 
B 1 162 TYR 162 155 155 TYR TYR B . n 
B 1 163 ASN 163 156 156 ASN ASN B . n 
B 1 164 ARG 164 157 157 ARG ARG B . n 
B 1 165 ASP 165 158 158 ASP ASP B . n 
B 1 166 SER 166 159 159 SER SER B . n 
B 1 167 GLU 167 160 160 GLU GLU B . n 
B 1 168 ASN 168 160 160 ASN ASN B A n 
B 1 169 SER 169 160 160 SER SER B B n 
B 1 170 GLN 170 160 160 GLN GLN B C n 
B 1 171 SER 171 160 160 SER SER B D n 
B 1 172 LEU 172 161 161 LEU LEU B . n 
B 1 173 GLY 173 162 162 GLY GLY B . n 
B 1 174 GLY 174 163 163 GLY GLY B . n 
B 1 175 GLN 175 164 164 GLN GLN B . n 
B 1 176 ILE 176 165 165 ILE ILE B . n 
B 1 177 VAL 177 166 166 VAL VAL B . n 
B 1 178 LEU 178 167 167 LEU LEU B . n 
B 1 179 GLY 179 168 168 GLY GLY B . n 
B 1 180 GLY 180 169 169 GLY GLY B . n 
B 1 181 SER 181 170 170 SER SER B . n 
B 1 182 ASP 182 171 171 ASP ASP B . n 
B 1 183 PRO 183 172 172 PRO PRO B . n 
B 1 184 GLN 184 173 173 GLN GLN B . n 
B 1 185 HIS 185 174 174 HIS HIS B . n 
B 1 186 TYR 186 175 175 TYR TYR B . n 
B 1 187 GLU 187 176 176 GLU GLU B . n 
B 1 188 GLY 188 177 177 GLY GLY B . n 
B 1 189 ASN 189 178 178 ASN ASN B . n 
B 1 190 PHE 190 179 179 PHE PHE B . n 
B 1 191 HIS 191 180 180 HIS HIS B . n 
B 1 192 TYR 192 181 181 TYR TYR B . n 
B 1 193 ILE 193 182 182 ILE ILE B . n 
B 1 194 ASN 194 183 183 ASN ASN B . n 
B 1 195 LEU 195 184 184 LEU LEU B . n 
B 1 196 ILE 196 185 185 ILE ILE B . n 
B 1 197 LYS 197 186 186 LYS LYS B . n 
B 1 198 THR 198 187 187 THR THR B . n 
B 1 199 GLY 199 188 188 GLY GLY B . n 
B 1 200 VAL 200 189 189 VAL VAL B . n 
B 1 201 TRP 201 190 190 TRP TRP B . n 
B 1 202 GLN 202 191 191 GLN GLN B . n 
B 1 203 ILE 203 192 192 ILE ILE B . n 
B 1 204 GLN 204 193 193 GLN GLN B . n 
B 1 205 MET 205 194 194 MET MET B . n 
B 1 206 LYS 206 195 195 LYS LYS B . n 
B 1 207 GLY 207 196 196 GLY GLY B . n 
B 1 208 VAL 208 197 197 VAL VAL B . n 
B 1 209 SER 209 198 198 SER SER B . n 
B 1 210 VAL 210 199 199 VAL VAL B . n 
B 1 211 GLY 211 200 200 GLY GLY B . n 
B 1 212 SER 212 201 201 SER SER B . n 
B 1 213 SER 213 202 202 SER SER B . n 
B 1 214 THR 214 203 203 THR THR B . n 
B 1 215 LEU 215 204 204 LEU LEU B . n 
B 1 216 LEU 216 205 205 LEU LEU B . n 
B 1 217 CYS 217 206 206 CYS CYS B . n 
B 1 218 GLU 218 207 207 GLU GLU B . n 
B 1 219 ASP 219 208 208 ASP ASP B . n 
B 1 220 GLY 220 209 209 GLY GLY B . n 
B 1 221 CYS 221 210 210 CYS CYS B . n 
B 1 222 LEU 222 211 211 LEU LEU B . n 
B 1 223 ALA 223 212 212 ALA ALA B . n 
B 1 224 LEU 224 213 213 LEU LEU B . n 
B 1 225 VAL 225 214 214 VAL VAL B . n 
B 1 226 ASP 226 215 215 ASP ASP B . n 
B 1 227 THR 227 216 216 THR THR B . n 
B 1 228 GLY 228 217 217 GLY GLY B . n 
B 1 229 ALA 229 218 218 ALA ALA B . n 
B 1 230 SER 230 219 219 SER SER B . n 
B 1 231 TYR 231 220 220 TYR TYR B . n 
B 1 232 ILE 232 221 221 ILE ILE B . n 
B 1 233 SER 233 222 222 SER SER B . n 
B 1 234 GLY 234 223 223 GLY GLY B . n 
B 1 235 SER 235 224 224 SER SER B . n 
B 1 236 THR 236 225 225 THR THR B . n 
B 1 237 SER 237 226 226 SER SER B . n 
B 1 238 SER 238 227 227 SER SER B . n 
B 1 239 ILE 239 228 228 ILE ILE B . n 
B 1 240 GLU 240 229 229 GLU GLU B . n 
B 1 241 LYS 241 230 230 LYS LYS B . n 
B 1 242 LEU 242 231 231 LEU LEU B . n 
B 1 243 MET 243 232 232 MET MET B . n 
B 1 244 GLU 244 233 233 GLU GLU B . n 
B 1 245 ALA 245 234 234 ALA ALA B . n 
B 1 246 LEU 246 235 235 LEU LEU B . n 
B 1 247 GLY 247 236 236 GLY GLY B . n 
B 1 248 ALA 248 237 237 ALA ALA B . n 
B 1 249 LYS 249 238 238 LYS LYS B . n 
B 1 250 LYS 250 239 239 LYS LYS B . n 
B 1 251 ARG 251 240 240 ARG ARG B . n 
B 1 252 LEU 252 242 242 LEU LEU B . n 
B 1 253 PHE 253 243 243 PHE PHE B . n 
B 1 254 ASP 254 244 244 ASP ASP B . n 
B 1 255 TYR 255 245 245 TYR TYR B . n 
B 1 256 VAL 256 246 246 VAL VAL B . n 
B 1 257 VAL 257 247 247 VAL VAL B . n 
B 1 258 LYS 258 248 248 LYS LYS B . n 
B 1 259 CYS 259 249 249 CYS CYS B . n 
B 1 260 ASN 260 250 250 ASN ASN B . n 
B 1 261 GLU 261 251 251 GLU GLU B . n 
B 1 262 GLY 262 252 252 GLY GLY B . n 
B 1 263 PRO 263 253 253 PRO PRO B . n 
B 1 264 THR 264 254 254 THR THR B . n 
B 1 265 LEU 265 255 255 LEU LEU B . n 
B 1 266 PRO 266 256 256 PRO PRO B . n 
B 1 267 ASP 267 257 257 ASP ASP B . n 
B 1 268 ILE 268 258 258 ILE ILE B . n 
B 1 269 SER 269 259 259 SER SER B . n 
B 1 270 PHE 270 260 260 PHE PHE B . n 
B 1 271 HIS 271 261 261 HIS HIS B . n 
B 1 272 LEU 272 262 262 LEU LEU B . n 
B 1 273 GLY 273 263 263 GLY GLY B . n 
B 1 274 GLY 274 264 264 GLY GLY B . n 
B 1 275 LYS 275 265 265 LYS LYS B . n 
B 1 276 GLU 276 266 266 GLU GLU B . n 
B 1 277 TYR 277 267 267 TYR TYR B . n 
B 1 278 THR 278 268 268 THR THR B . n 
B 1 279 LEU 279 269 269 LEU LEU B . n 
B 1 280 THR 280 270 270 THR THR B . n 
B 1 281 SER 281 271 271 SER SER B . n 
B 1 282 ALA 282 272 272 ALA ALA B . n 
B 1 283 ASP 283 273 273 ASP ASP B . n 
B 1 284 TYR 284 274 274 TYR TYR B . n 
B 1 285 VAL 285 275 275 VAL VAL B . n 
B 1 286 PHE 286 276 276 PHE PHE B . n 
B 1 287 GLN 287 277 277 GLN GLN B . n 
B 1 288 GLU 288 278 278 GLU GLU B . n 
B 1 289 SER 289 279 279 SER SER B . n 
B 1 290 TYR 290 279 279 TYR TYR B A n 
B 1 291 SER 291 279 279 SER SER B B n 
B 1 292 SER 292 279 279 SER SER B C n 
B 1 293 LYS 293 279 279 LYS LYS B D n 
B 1 294 LYS 294 280 280 LYS LYS B . n 
B 1 295 LEU 295 281 281 LEU LEU B . n 
B 1 296 CYS 296 282 282 CYS CYS B . n 
B 1 297 THR 297 283 283 THR THR B . n 
B 1 298 LEU 298 284 284 LEU LEU B . n 
B 1 299 ALA 299 285 285 ALA ALA B . n 
B 1 300 ILE 300 286 286 ILE ILE B . n 
B 1 301 HIS 301 287 287 HIS HIS B . n 
B 1 302 ALA 302 288 288 ALA ALA B . n 
B 1 303 MET 303 289 289 MET MET B . n 
B 1 304 ASP 304 290 290 ASP ASP B . n 
B 1 305 ILE 305 291 291 ILE ILE B . n 
B 1 306 PRO 306 292 292 PRO PRO B . n 
B 1 307 PRO 307 293 293 PRO PRO B . n 
B 1 308 PRO 308 294 294 PRO PRO B . n 
B 1 309 THR 309 295 295 THR THR B . n 
B 1 310 GLY 310 296 296 GLY GLY B . n 
B 1 311 PRO 311 297 297 PRO PRO B . n 
B 1 312 THR 312 298 298 THR THR B . n 
B 1 313 TRP 313 299 299 TRP TRP B . n 
B 1 314 ALA 314 300 300 ALA ALA B . n 
B 1 315 LEU 315 301 301 LEU LEU B . n 
B 1 316 GLY 316 302 302 GLY GLY B . n 
B 1 317 ALA 317 303 303 ALA ALA B . n 
B 1 318 THR 318 304 304 THR THR B . n 
B 1 319 PHE 319 305 305 PHE PHE B . n 
B 1 320 ILE 320 306 306 ILE ILE B . n 
B 1 321 ARG 321 307 307 ARG ARG B . n 
B 1 322 LYS 322 308 308 LYS LYS B . n 
B 1 323 PHE 323 309 309 PHE PHE B . n 
B 1 324 TYR 324 310 310 TYR TYR B . n 
B 1 325 THR 325 311 311 THR THR B . n 
B 1 326 GLU 326 312 312 GLU GLU B . n 
B 1 327 PHE 327 313 313 PHE PHE B . n 
B 1 328 ASP 328 314 314 ASP ASP B . n 
B 1 329 ARG 329 315 315 ARG ARG B . n 
B 1 330 ARG 330 316 316 ARG ARG B . n 
B 1 331 ASN 331 317 317 ASN ASN B . n 
B 1 332 ASN 332 318 318 ASN ASN B . n 
B 1 333 ARG 333 319 319 ARG ARG B . n 
B 1 334 ILE 334 320 320 ILE ILE B . n 
B 1 335 GLY 335 321 321 GLY GLY B . n 
B 1 336 PHE 336 322 322 PHE PHE B . n 
B 1 337 ALA 337 323 323 ALA ALA B . n 
B 1 338 LEU 338 324 324 LEU LEU B . n 
B 1 339 ALA 339 325 325 ALA ALA B . n 
B 1 340 ARG 340 326 326 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1  367 367 NAG NAG A . 
D 3 SSR 1  327 1   SSR SSR A . 
E 2 NAG 1  367 367 NAG NAG B . 
F 3 SSR 1  327 1   SSR SSR B . 
G 4 HOH 1  98  98  HOH HOH A . 
G 4 HOH 2  328 3   HOH HOH A . 
G 4 HOH 3  329 5   HOH HOH A . 
G 4 HOH 4  330 6   HOH HOH A . 
G 4 HOH 5  331 8   HOH HOH A . 
G 4 HOH 6  332 10  HOH HOH A . 
G 4 HOH 7  333 11  HOH HOH A . 
G 4 HOH 8  334 13  HOH HOH A . 
G 4 HOH 9  335 16  HOH HOH A . 
G 4 HOH 10 336 17  HOH HOH A . 
G 4 HOH 11 337 18  HOH HOH A . 
G 4 HOH 12 338 19  HOH HOH A . 
G 4 HOH 13 339 21  HOH HOH A . 
G 4 HOH 14 340 23  HOH HOH A . 
G 4 HOH 15 341 25  HOH HOH A . 
G 4 HOH 16 342 26  HOH HOH A . 
G 4 HOH 17 343 27  HOH HOH A . 
G 4 HOH 18 344 28  HOH HOH A . 
G 4 HOH 19 345 29  HOH HOH A . 
G 4 HOH 20 346 30  HOH HOH A . 
G 4 HOH 21 347 33  HOH HOH A . 
G 4 HOH 22 348 34  HOH HOH A . 
G 4 HOH 23 349 35  HOH HOH A . 
G 4 HOH 24 350 36  HOH HOH A . 
G 4 HOH 25 351 37  HOH HOH A . 
G 4 HOH 26 352 38  HOH HOH A . 
G 4 HOH 27 353 40  HOH HOH A . 
G 4 HOH 28 354 41  HOH HOH A . 
G 4 HOH 29 355 42  HOH HOH A . 
G 4 HOH 30 356 44  HOH HOH A . 
G 4 HOH 31 357 49  HOH HOH A . 
G 4 HOH 32 358 51  HOH HOH A . 
G 4 HOH 33 359 52  HOH HOH A . 
G 4 HOH 34 360 54  HOH HOH A . 
G 4 HOH 35 361 58  HOH HOH A . 
G 4 HOH 36 362 63  HOH HOH A . 
G 4 HOH 37 363 67  HOH HOH A . 
G 4 HOH 38 364 71  HOH HOH A . 
G 4 HOH 39 365 79  HOH HOH A . 
G 4 HOH 40 366 80  HOH HOH A . 
G 4 HOH 41 368 82  HOH HOH A . 
G 4 HOH 42 369 84  HOH HOH A . 
G 4 HOH 43 370 90  HOH HOH A . 
G 4 HOH 44 371 95  HOH HOH A . 
G 4 HOH 45 372 102 HOH HOH A . 
G 4 HOH 46 373 103 HOH HOH A . 
G 4 HOH 47 374 105 HOH HOH A . 
G 4 HOH 48 375 110 HOH HOH A . 
G 4 HOH 49 376 112 HOH HOH A . 
G 4 HOH 50 377 113 HOH HOH A . 
G 4 HOH 51 378 114 HOH HOH A . 
G 4 HOH 52 379 116 HOH HOH A . 
G 4 HOH 53 380 119 HOH HOH A . 
G 4 HOH 54 381 121 HOH HOH A . 
G 4 HOH 55 382 123 HOH HOH A . 
G 4 HOH 56 383 125 HOH HOH A . 
G 4 HOH 57 384 127 HOH HOH A . 
G 4 HOH 58 385 133 HOH HOH A . 
G 4 HOH 59 386 137 HOH HOH A . 
G 4 HOH 60 387 142 HOH HOH A . 
G 4 HOH 61 388 150 HOH HOH A . 
G 4 HOH 62 389 152 HOH HOH A . 
G 4 HOH 63 390 155 HOH HOH A . 
H 4 HOH 1  328 2   HOH HOH B . 
H 4 HOH 2  329 4   HOH HOH B . 
H 4 HOH 3  330 7   HOH HOH B . 
H 4 HOH 4  331 9   HOH HOH B . 
H 4 HOH 5  332 12  HOH HOH B . 
H 4 HOH 6  333 14  HOH HOH B . 
H 4 HOH 7  334 15  HOH HOH B . 
H 4 HOH 8  335 20  HOH HOH B . 
H 4 HOH 9  336 24  HOH HOH B . 
H 4 HOH 10 337 31  HOH HOH B . 
H 4 HOH 11 338 39  HOH HOH B . 
H 4 HOH 12 339 45  HOH HOH B . 
H 4 HOH 13 340 46  HOH HOH B . 
H 4 HOH 14 341 47  HOH HOH B . 
H 4 HOH 15 342 48  HOH HOH B . 
H 4 HOH 16 343 50  HOH HOH B . 
H 4 HOH 17 344 53  HOH HOH B . 
H 4 HOH 18 345 55  HOH HOH B . 
H 4 HOH 19 346 56  HOH HOH B . 
H 4 HOH 20 347 59  HOH HOH B . 
H 4 HOH 21 348 62  HOH HOH B . 
H 4 HOH 22 349 64  HOH HOH B . 
H 4 HOH 23 350 65  HOH HOH B . 
H 4 HOH 24 351 66  HOH HOH B . 
H 4 HOH 25 352 68  HOH HOH B . 
H 4 HOH 26 353 69  HOH HOH B . 
H 4 HOH 27 354 73  HOH HOH B . 
H 4 HOH 28 355 74  HOH HOH B . 
H 4 HOH 29 356 75  HOH HOH B . 
H 4 HOH 30 357 77  HOH HOH B . 
H 4 HOH 31 358 83  HOH HOH B . 
H 4 HOH 32 359 87  HOH HOH B . 
H 4 HOH 33 360 88  HOH HOH B . 
H 4 HOH 34 361 89  HOH HOH B . 
H 4 HOH 35 362 92  HOH HOH B . 
H 4 HOH 36 363 93  HOH HOH B . 
H 4 HOH 37 364 97  HOH HOH B . 
H 4 HOH 38 365 99  HOH HOH B . 
H 4 HOH 39 366 101 HOH HOH B . 
H 4 HOH 40 368 104 HOH HOH B . 
H 4 HOH 41 369 106 HOH HOH B . 
H 4 HOH 42 370 107 HOH HOH B . 
H 4 HOH 43 371 108 HOH HOH B . 
H 4 HOH 44 372 111 HOH HOH B . 
H 4 HOH 45 373 115 HOH HOH B . 
H 4 HOH 46 374 118 HOH HOH B . 
H 4 HOH 47 375 128 HOH HOH B . 
H 4 HOH 48 376 129 HOH HOH B . 
H 4 HOH 49 377 130 HOH HOH B . 
H 4 HOH 50 378 134 HOH HOH B . 
H 4 HOH 51 379 135 HOH HOH B . 
H 4 HOH 52 380 136 HOH HOH B . 
H 4 HOH 53 381 147 HOH HOH B . 
H 4 HOH 54 382 148 HOH HOH B . 
H 4 HOH 55 383 149 HOH HOH B . 
H 4 HOH 56 384 154 HOH HOH B . 
H 4 HOH 57 385 158 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 75 A ASN 67 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 75 B ASN 67 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-10-27 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' software                  
2 4 'Structure model' chem_comp                 
3 4 'Structure model' entity                    
4 4 'Structure model' pdbx_chem_comp_identifier 
5 4 'Structure model' pdbx_entity_nonpoly       
6 4 'Structure model' struct_conn               
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                     
2 4 'Structure model' '_chem_comp.type'                     
3 4 'Structure model' '_entity.pdbx_description'            
4 4 'Structure model' '_pdbx_entity_nonpoly.name'           
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_conn.pdbx_role'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO        .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com                 'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK    .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com                 'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 BUSTER-TNT   .     ?               program 'Gerard Bricogne'    buster-develop@GlobalPhasing.com refinement        
http://www.globalphasing.com/buster/      ?   ? 
4 PDB_EXTRACT  3.10  'June 10, 2010' package PDB                  deposit@deposit.rcsb.org         'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 CrystalClear .     ?               ?       ?                    ?                                'data collection' ? ?   ? 
6 HKL-2000     .     ?               ?       ?                    ?                                'data reduction'  ? ?   ? 
7 HKL-2000     .     ?               ?       ?                    ?                                'data scaling'    ? ?   ? 
8 BUSTER       2.9.5 ?               ?       ?                    ?                                refinement        ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 67  ? ? -141.92 -66.04  
2  1 GLN A 160 C ? 67.82   -15.43  
3  1 LEU A 161 ? ? 91.30   111.87  
4  1 ASP A 208 ? ? 82.51   11.07   
5  1 ARG A 240 ? ? -108.97 -163.94 
6  1 ALA A 285 ? ? -87.45  40.03   
7  1 ASN B 67  ? ? -141.17 -65.93  
8  1 ASP B 158 ? ? 39.69   80.60   
9  1 ASN B 160 A ? 170.21  123.45  
10 1 LYS B 195 ? ? -114.10 53.26   
11 1 ARG B 240 ? ? -69.72  -84.19  
12 1 PHE B 243 ? ? -133.53 -44.01  
13 1 ALA B 285 ? ? -87.01  39.62   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LEU -5 ? A LEU 1 
2 1 Y 1 A THR -4 ? A THR 2 
3 1 Y 1 A LEU -3 ? A LEU 3 
4 1 Y 1 B LEU -5 ? B LEU 1 
5 1 Y 1 B THR -4 ? B THR 2 
6 1 Y 1 B LEU -3 ? B LEU 3 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                 NAG 
3 '2-(3-fluoro-2-methylbenzyl)-4-methyl-1-phenyl-3-(piperazin-1-ylcarbonyl)-1H-indol-5-ol' SSR 
4 water                                                                                    HOH 
#