data_3OP5
# 
_entry.id   3OP5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OP5         
RCSB  RCSB061397   
WWPDB D_1000061397 
# 
_pdbx_database_status.entry_id                        3OP5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Allerston, C.K.'                      1  
'Uttarkar, S.'                         2  
'Savitsky, P.'                         3  
'Elkins, J.M.'                         4  
'Filippakopoulos, P.'                  5  
'Krojer, T.'                           6  
'Rellos, P.'                           7  
'Fedorov, O.'                          8  
'Eswaran, J.'                          9  
'Brenner, B.'                          10 
'Keates, T.'                           11 
'Das, S.'                              12 
'King, O.'                             13 
'Chalk, R.'                            14 
'Berridge, G.'                         15 
'von Delft, F.'                        16 
'Gileadi, O.'                          17 
'Arrowsmith, C.H.'                     18 
'Edwards, A.M.'                        19 
'Weigelt, J.'                          20 
'Bountra, C.'                          21 
'Knapp, S.'                            22 
'Structural Genomics Consortium (SGC)' 23 
# 
_citation.id                        primary 
_citation.title                     
;Structural characterization of human Vaccinia-Related Kinases (VRK) bound to small-molecule inhibitors identifies different P-loop conformations.
;
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_volume            7 
_citation.page_first                7501 
_citation.page_last                 7501 
_citation.year                      2017 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   28790404 
_citation.pdbx_database_id_DOI      10.1038/s41598-017-07755-y 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Counago, R.M.'       1  0000-0003-1847-5090 
primary 'Allerston, C.K.'     2  ?                   
primary 'Savitsky, P.'        3  ?                   
primary 'Azevedo, H.'         4  ?                   
primary 'Godoi, P.H.'         5  ?                   
primary 'Wells, C.I.'         6  ?                   
primary 'Mascarello, A.'      7  ?                   
primary 'de Souza Gama, F.H.' 8  ?                   
primary 'Massirer, K.B.'      9  ?                   
primary 'Zuercher, W.J.'      10 ?                   
primary 'Guimaraes, C.R.W.'   11 ?                   
primary 'Gileadi, O.'         12 ?                   
# 
_cell.entry_id           3OP5 
_cell.length_a           92.970 
_cell.length_b           97.190 
_cell.length_c           191.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OP5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase VRK1'                                                  41138.125 4   2.7.11.1 
'K34A, K35A, E36A, E212A, K214A, E215A, E292A, K293A, K295A, K359A, K360A' 'KINASE DOMAIN, RESIDUES 3-369' ? 
2 non-polymer syn '[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]pyrimidin-2-yl}amino)phenyl]acetonitrile' 331.374   4   ?        ? 
?                               ? 
3 non-polymer syn 1,2-ETHANEDIOL                                                                          62.068    5   ?        ? 
?                               ? 
4 non-polymer syn GLYCEROL                                                                                92.094    2   ?        ? 
?                               ? 
5 water       nat water                                                                                   18.015    900 ?        ? 
?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Vaccinia-related kinase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ARG n 
1 4   VAL n 
1 5   LYS n 
1 6   ALA n 
1 7   ALA n 
1 8   GLN n 
1 9   ALA n 
1 10  GLY n 
1 11  ARG n 
1 12  GLN n 
1 13  SER n 
1 14  SER n 
1 15  ALA n 
1 16  LYS n 
1 17  ARG n 
1 18  HIS n 
1 19  LEU n 
1 20  ALA n 
1 21  GLU n 
1 22  GLN n 
1 23  PHE n 
1 24  ALA n 
1 25  VAL n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ILE n 
1 30  THR n 
1 31  ASP n 
1 32  MET n 
1 33  ALA n 
1 34  ALA n 
1 35  ALA n 
1 36  ALA n 
1 37  TRP n 
1 38  LYS n 
1 39  VAL n 
1 40  GLY n 
1 41  LEU n 
1 42  PRO n 
1 43  ILE n 
1 44  GLY n 
1 45  GLN n 
1 46  GLY n 
1 47  GLY n 
1 48  PHE n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  TYR n 
1 53  LEU n 
1 54  ALA n 
1 55  ASP n 
1 56  MET n 
1 57  ASN n 
1 58  SER n 
1 59  SER n 
1 60  GLU n 
1 61  SER n 
1 62  VAL n 
1 63  GLY n 
1 64  SER n 
1 65  ASP n 
1 66  ALA n 
1 67  PRO n 
1 68  CYS n 
1 69  VAL n 
1 70  VAL n 
1 71  LYS n 
1 72  VAL n 
1 73  GLU n 
1 74  PRO n 
1 75  SER n 
1 76  ASP n 
1 77  ASN n 
1 78  GLY n 
1 79  PRO n 
1 80  LEU n 
1 81  PHE n 
1 82  THR n 
1 83  GLU n 
1 84  LEU n 
1 85  LYS n 
1 86  PHE n 
1 87  TYR n 
1 88  GLN n 
1 89  ARG n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  PRO n 
1 94  GLU n 
1 95  GLN n 
1 96  ILE n 
1 97  GLN n 
1 98  LYS n 
1 99  TRP n 
1 100 ILE n 
1 101 ARG n 
1 102 THR n 
1 103 ARG n 
1 104 LYS n 
1 105 LEU n 
1 106 LYS n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 VAL n 
1 111 PRO n 
1 112 LYS n 
1 113 TYR n 
1 114 TRP n 
1 115 GLY n 
1 116 SER n 
1 117 GLY n 
1 118 LEU n 
1 119 HIS n 
1 120 ASP n 
1 121 LYS n 
1 122 ASN n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
1 126 TYR n 
1 127 ARG n 
1 128 PHE n 
1 129 MET n 
1 130 ILE n 
1 131 MET n 
1 132 ASP n 
1 133 ARG n 
1 134 PHE n 
1 135 GLY n 
1 136 SER n 
1 137 ASP n 
1 138 LEU n 
1 139 GLN n 
1 140 LYS n 
1 141 ILE n 
1 142 TYR n 
1 143 GLU n 
1 144 ALA n 
1 145 ASN n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 PHE n 
1 150 SER n 
1 151 ARG n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 GLN n 
1 157 LEU n 
1 158 SER n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 TYR n 
1 168 ILE n 
1 169 HIS n 
1 170 GLU n 
1 171 HIS n 
1 172 GLU n 
1 173 TYR n 
1 174 VAL n 
1 175 HIS n 
1 176 GLY n 
1 177 ASP n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 SER n 
1 182 ASN n 
1 183 LEU n 
1 184 LEU n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 LYS n 
1 189 ASN n 
1 190 PRO n 
1 191 ASP n 
1 192 GLN n 
1 193 VAL n 
1 194 TYR n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 TYR n 
1 199 GLY n 
1 200 LEU n 
1 201 ALA n 
1 202 TYR n 
1 203 ARG n 
1 204 TYR n 
1 205 CYS n 
1 206 PRO n 
1 207 GLU n 
1 208 GLY n 
1 209 VAL n 
1 210 HIS n 
1 211 LYS n 
1 212 ALA n 
1 213 TYR n 
1 214 ALA n 
1 215 ALA n 
1 216 ASP n 
1 217 PRO n 
1 218 LYS n 
1 219 ARG n 
1 220 CYS n 
1 221 HIS n 
1 222 ASP n 
1 223 GLY n 
1 224 THR n 
1 225 ILE n 
1 226 GLU n 
1 227 PHE n 
1 228 THR n 
1 229 SER n 
1 230 ILE n 
1 231 ASP n 
1 232 ALA n 
1 233 HIS n 
1 234 ASN n 
1 235 GLY n 
1 236 VAL n 
1 237 ALA n 
1 238 PRO n 
1 239 SER n 
1 240 ARG n 
1 241 ARG n 
1 242 GLY n 
1 243 ASP n 
1 244 LEU n 
1 245 GLU n 
1 246 ILE n 
1 247 LEU n 
1 248 GLY n 
1 249 TYR n 
1 250 CYS n 
1 251 MET n 
1 252 ILE n 
1 253 GLN n 
1 254 TRP n 
1 255 LEU n 
1 256 THR n 
1 257 GLY n 
1 258 HIS n 
1 259 LEU n 
1 260 PRO n 
1 261 TRP n 
1 262 GLU n 
1 263 ASP n 
1 264 ASN n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 TYR n 
1 271 VAL n 
1 272 ARG n 
1 273 ASP n 
1 274 SER n 
1 275 LYS n 
1 276 ILE n 
1 277 ARG n 
1 278 TYR n 
1 279 ARG n 
1 280 GLU n 
1 281 ASN n 
1 282 ILE n 
1 283 ALA n 
1 284 SER n 
1 285 LEU n 
1 286 MET n 
1 287 ASP n 
1 288 LYS n 
1 289 CYS n 
1 290 PHE n 
1 291 PRO n 
1 292 ALA n 
1 293 ALA n 
1 294 ASN n 
1 295 ALA n 
1 296 PRO n 
1 297 GLY n 
1 298 GLU n 
1 299 ILE n 
1 300 ALA n 
1 301 LYS n 
1 302 TYR n 
1 303 MET n 
1 304 GLU n 
1 305 THR n 
1 306 VAL n 
1 307 LYS n 
1 308 LEU n 
1 309 LEU n 
1 310 ASP n 
1 311 TYR n 
1 312 THR n 
1 313 GLU n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 TYR n 
1 318 GLU n 
1 319 ASN n 
1 320 LEU n 
1 321 ARG n 
1 322 ASP n 
1 323 ILE n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 GLY n 
1 328 LEU n 
1 329 LYS n 
1 330 ALA n 
1 331 ILE n 
1 332 GLY n 
1 333 SER n 
1 334 LYS n 
1 335 ASP n 
1 336 ASP n 
1 337 GLY n 
1 338 LYS n 
1 339 LEU n 
1 340 ASP n 
1 341 LEU n 
1 342 SER n 
1 343 VAL n 
1 344 VAL n 
1 345 GLU n 
1 346 ASN n 
1 347 GLY n 
1 348 GLY n 
1 349 LEU n 
1 350 LYS n 
1 351 ALA n 
1 352 LYS n 
1 353 THR n 
1 354 ILE n 
1 355 THR n 
1 356 LYS n 
1 357 LYS n 
1 358 ARG n 
1 359 ALA n 
1 360 ALA n 
1 361 GLU n 
1 362 ILE n 
1 363 GLU n 
1 364 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 VRK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VRK1_HUMAN 
_struct_ref.pdbx_db_accession          Q99986 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFT
ELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRIL
DILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRG
DLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRD
ILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEE
;
_struct_ref.pdbx_align_begin           3 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OP5 A 3 ? 364 ? Q99986 3 ? 364 ? 3 364 
2 1 3OP5 B 3 ? 364 ? Q99986 3 ? 364 ? 3 364 
3 1 3OP5 C 3 ? 364 ? Q99986 3 ? 364 ? 3 364 
4 1 3OP5 D 3 ? 364 ? Q99986 3 ? 364 ? 3 364 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OP5 SER A 1   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      1   1  
1 3OP5 MET A 2   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      2   2  
1 3OP5 ALA A 34  ? UNP Q99986 LYS 34  'ENGINEERED MUTATION' 34  3  
1 3OP5 ALA A 35  ? UNP Q99986 LYS 35  'ENGINEERED MUTATION' 35  4  
1 3OP5 ALA A 36  ? UNP Q99986 GLU 36  'ENGINEERED MUTATION' 36  5  
1 3OP5 ALA A 212 ? UNP Q99986 GLU 212 'ENGINEERED MUTATION' 212 6  
1 3OP5 ALA A 214 ? UNP Q99986 LYS 214 'ENGINEERED MUTATION' 214 7  
1 3OP5 ALA A 215 ? UNP Q99986 GLU 215 'ENGINEERED MUTATION' 215 8  
1 3OP5 ALA A 292 ? UNP Q99986 GLU 292 'ENGINEERED MUTATION' 292 9  
1 3OP5 ALA A 293 ? UNP Q99986 LYS 293 'ENGINEERED MUTATION' 293 10 
1 3OP5 ALA A 295 ? UNP Q99986 LYS 295 'ENGINEERED MUTATION' 295 11 
1 3OP5 ALA A 359 ? UNP Q99986 LYS 359 'ENGINEERED MUTATION' 359 12 
1 3OP5 ALA A 360 ? UNP Q99986 LYS 360 'ENGINEERED MUTATION' 360 13 
2 3OP5 SER B 1   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      1   14 
2 3OP5 MET B 2   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      2   15 
2 3OP5 ALA B 34  ? UNP Q99986 LYS 34  'ENGINEERED MUTATION' 34  16 
2 3OP5 ALA B 35  ? UNP Q99986 LYS 35  'ENGINEERED MUTATION' 35  17 
2 3OP5 ALA B 36  ? UNP Q99986 GLU 36  'ENGINEERED MUTATION' 36  18 
2 3OP5 ALA B 212 ? UNP Q99986 GLU 212 'ENGINEERED MUTATION' 212 19 
2 3OP5 ALA B 214 ? UNP Q99986 LYS 214 'ENGINEERED MUTATION' 214 20 
2 3OP5 ALA B 215 ? UNP Q99986 GLU 215 'ENGINEERED MUTATION' 215 21 
2 3OP5 ALA B 292 ? UNP Q99986 GLU 292 'ENGINEERED MUTATION' 292 22 
2 3OP5 ALA B 293 ? UNP Q99986 LYS 293 'ENGINEERED MUTATION' 293 23 
2 3OP5 ALA B 295 ? UNP Q99986 LYS 295 'ENGINEERED MUTATION' 295 24 
2 3OP5 ALA B 359 ? UNP Q99986 LYS 359 'ENGINEERED MUTATION' 359 25 
2 3OP5 ALA B 360 ? UNP Q99986 LYS 360 'ENGINEERED MUTATION' 360 26 
3 3OP5 SER C 1   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      1   27 
3 3OP5 MET C 2   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      2   28 
3 3OP5 ALA C 34  ? UNP Q99986 LYS 34  'ENGINEERED MUTATION' 34  29 
3 3OP5 ALA C 35  ? UNP Q99986 LYS 35  'ENGINEERED MUTATION' 35  30 
3 3OP5 ALA C 36  ? UNP Q99986 GLU 36  'ENGINEERED MUTATION' 36  31 
3 3OP5 ALA C 212 ? UNP Q99986 GLU 212 'ENGINEERED MUTATION' 212 32 
3 3OP5 ALA C 214 ? UNP Q99986 LYS 214 'ENGINEERED MUTATION' 214 33 
3 3OP5 ALA C 215 ? UNP Q99986 GLU 215 'ENGINEERED MUTATION' 215 34 
3 3OP5 ALA C 292 ? UNP Q99986 GLU 292 'ENGINEERED MUTATION' 292 35 
3 3OP5 ALA C 293 ? UNP Q99986 LYS 293 'ENGINEERED MUTATION' 293 36 
3 3OP5 ALA C 295 ? UNP Q99986 LYS 295 'ENGINEERED MUTATION' 295 37 
3 3OP5 ALA C 359 ? UNP Q99986 LYS 359 'ENGINEERED MUTATION' 359 38 
3 3OP5 ALA C 360 ? UNP Q99986 LYS 360 'ENGINEERED MUTATION' 360 39 
4 3OP5 SER D 1   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      1   40 
4 3OP5 MET D 2   ? UNP Q99986 ?   ?   'EXPRESSION TAG'      2   41 
4 3OP5 ALA D 34  ? UNP Q99986 LYS 34  'ENGINEERED MUTATION' 34  42 
4 3OP5 ALA D 35  ? UNP Q99986 LYS 35  'ENGINEERED MUTATION' 35  43 
4 3OP5 ALA D 36  ? UNP Q99986 GLU 36  'ENGINEERED MUTATION' 36  44 
4 3OP5 ALA D 212 ? UNP Q99986 GLU 212 'ENGINEERED MUTATION' 212 45 
4 3OP5 ALA D 214 ? UNP Q99986 LYS 214 'ENGINEERED MUTATION' 214 46 
4 3OP5 ALA D 215 ? UNP Q99986 GLU 215 'ENGINEERED MUTATION' 215 47 
4 3OP5 ALA D 292 ? UNP Q99986 GLU 292 'ENGINEERED MUTATION' 292 48 
4 3OP5 ALA D 293 ? UNP Q99986 LYS 293 'ENGINEERED MUTATION' 293 49 
4 3OP5 ALA D 295 ? UNP Q99986 LYS 295 'ENGINEERED MUTATION' 295 50 
4 3OP5 ALA D 359 ? UNP Q99986 LYS 359 'ENGINEERED MUTATION' 359 51 
4 3OP5 ALA D 360 ? UNP Q99986 LYS 360 'ENGINEERED MUTATION' 360 52 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                 ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                              ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                         ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                ? 'C3 H7 N O2 S' 
121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                          
'ETHYLENE GLYCOL'               'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                               ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                         ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                 ? 'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                                                                
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                               ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                   ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                 ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                  ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                              ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                           ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                 ? 'C5 H9 N O2' 
115.130 
REB non-polymer         . '[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]pyrimidin-2-yl}amino)phenyl]acetonitrile' ? 'C18 H17 N7' 
331.374 
SER 'L-peptide linking' y SERINE                                                                                  ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                               ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                              ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                  ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          3OP5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2m K/Na(tartrate), 20% PEG 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     3OP5 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             46.338 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   67821 
_reflns.number_all                   67821 
_reflns.percent_possible_obs         98.900 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.113 
_reflns.pdbx_netI_over_sigmaI        7.800 
_reflns.B_iso_Wilson_estimate        47.65 
_reflns.pdbx_redundancy              3.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.400 2.530  98.600 0.548 0.548 1.4  3.400 ? ? ? ? ? ? 1  1 
2.530 2.680  99.800 0.444 0.444 1.7  3.600 ? ? ? ? ? ? 2  1 
2.680 2.870  99.200 0.305 0.305 2.5  3.600 ? ? ? ? ? ? 3  1 
2.870 3.100  99.300 0.196 0.196 3.9  3.600 ? ? ? ? ? ? 4  1 
3.100 3.390  99.600 0.125 0.125 6.0  3.600 ? ? ? ? ? ? 5  1 
3.390 3.790  99.400 0.083 0.083 8.6  3.500 ? ? ? ? ? ? 6  1 
3.790 4.380  99.000 0.060 0.060 11.2 3.500 ? ? ? ? ? ? 7  1 
4.380 5.370  98.100 0.064 0.064 9.7  3.500 ? ? ? ? ? ? 8  1 
5.370 7.590  95.900 0.062 0.062 9.5  3.400 ? ? ? ? ? ? 9  1 
7.590 46.338 96.500 0.032 0.032 16.6 3.500 ? ? ? ? ? ? 10 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3OP5 
_refine.ls_number_reflns_obs                     67764 
_refine.ls_number_reflns_all                     65757 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.338 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.5500 
_refine.ls_R_factor_obs                          0.1793 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1783 
_refine.ls_R_factor_R_free                       0.2133 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.96 
_refine.ls_number_reflns_R_free                  2007 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.050 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.9412 
_refine.correlation_coeff_Fo_to_Fc_free          0.9127 
_refine.B_iso_mean                               46.15 
_refine.aniso_B[1][1]                            -1.5191 
_refine.aniso_B[2][2]                            -3.5682 
_refine.aniso_B[3][3]                            5.0873 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'ENSEMBL OF PDB ENTRIES 2V62, 2JII and 1CKJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.310 
_refine.pdbx_overall_ESU_R_Free                  0.2420 
_refine.overall_SU_ML                            0.1690 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.3780 
_refine.overall_SU_R_Cruickshank_DPI             0.3100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3OP5 
_refine_analyze.Luzzati_coordinate_error_obs    0.285 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9754 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         132 
_refine_hist.number_atoms_solvent             900 
_refine_hist.number_atoms_total               10786 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        46.338 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.009 ? 2.00  10128 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.97  ? 2.00  13709 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  4560  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  249   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  1487  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 10128 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_omega_torsion           4.02  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           2.73  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  1285  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  12127 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.46 
_refine_ls_shell.number_reflns_R_work             4719 
_refine_ls_shell.R_factor_R_work                  0.2119 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2492 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            2.98 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                4864 
_refine_ls_shell.R_factor_all                     0.2130 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3OP5 
_struct.title                     'Human vaccinia-related kinase 1' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase VRK1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OP5 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Adenosine Triphosphate, Amino Acid Sequence, Binding Sites, Catalytic Domain, Models, Molecular, Molecular Sequence Data, Phosphotransferases, Protein Conformation, Protein Folding, Surface Entropy Reduction, Structural Genomics, Structural Genomics Consortium, SGC, transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 4 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 2 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 77  ? ALA A 91  ? ASN A 77  ALA A 91  1 ? 15 
HELX_P HELX_P2  2  LYS A 92  ? ARG A 103 ? LYS A 92  ARG A 103 1 ? 12 
HELX_P HELX_P3  3  LEU A 138 ? ASN A 145 ? LEU A 138 ASN A 145 1 ? 8  
HELX_P HELX_P4  4  SER A 150 ? HIS A 171 ? SER A 150 HIS A 171 1 ? 22 
HELX_P HELX_P5  5  LYS A 179 ? SER A 181 ? LYS A 179 SER A 181 5 ? 3  
HELX_P HELX_P6  6  CYS A 205 ? VAL A 209 ? CYS A 205 VAL A 209 5 ? 5  
HELX_P HELX_P7  7  SER A 229 ? ASN A 234 ? SER A 229 ASN A 234 1 ? 6  
HELX_P HELX_P8  8  SER A 239 ? GLY A 257 ? SER A 239 GLY A 257 1 ? 19 
HELX_P HELX_P9  9  TRP A 261 ? LEU A 265 ? TRP A 261 LEU A 265 5 ? 5  
HELX_P HELX_P10 10 ASP A 267 ? ASN A 281 ? ASP A 267 ASN A 281 1 ? 15 
HELX_P HELX_P11 11 ASN A 281 ? PHE A 290 ? ASN A 281 PHE A 290 1 ? 10 
HELX_P HELX_P12 12 PRO A 296 ? LEU A 308 ? PRO A 296 LEU A 308 1 ? 13 
HELX_P HELX_P13 13 LEU A 316 ? ILE A 331 ? LEU A 316 ILE A 331 1 ? 16 
HELX_P HELX_P14 14 ASN B 77  ? ALA B 91  ? ASN B 77  ALA B 91  1 ? 15 
HELX_P HELX_P15 15 LYS B 92  ? ARG B 103 ? LYS B 92  ARG B 103 1 ? 12 
HELX_P HELX_P16 16 LEU B 138 ? ASN B 145 ? LEU B 138 ASN B 145 1 ? 8  
HELX_P HELX_P17 17 SER B 150 ? HIS B 171 ? SER B 150 HIS B 171 1 ? 22 
HELX_P HELX_P18 18 LYS B 179 ? SER B 181 ? LYS B 179 SER B 181 5 ? 3  
HELX_P HELX_P19 19 CYS B 205 ? VAL B 209 ? CYS B 205 VAL B 209 5 ? 5  
HELX_P HELX_P20 20 SER B 229 ? ASN B 234 ? SER B 229 ASN B 234 1 ? 6  
HELX_P HELX_P21 21 SER B 239 ? GLY B 257 ? SER B 239 GLY B 257 1 ? 19 
HELX_P HELX_P22 22 TRP B 261 ? LEU B 265 ? TRP B 261 LEU B 265 5 ? 5  
HELX_P HELX_P23 23 ASP B 267 ? ASN B 281 ? ASP B 267 ASN B 281 1 ? 15 
HELX_P HELX_P24 24 ASN B 281 ? PHE B 290 ? ASN B 281 PHE B 290 1 ? 10 
HELX_P HELX_P25 25 PRO B 296 ? LEU B 308 ? PRO B 296 LEU B 308 1 ? 13 
HELX_P HELX_P26 26 LEU B 316 ? ILE B 331 ? LEU B 316 ILE B 331 1 ? 16 
HELX_P HELX_P27 27 LEU C 80  ? ALA C 91  ? LEU C 80  ALA C 91  1 ? 12 
HELX_P HELX_P28 28 LYS C 92  ? ARG C 103 ? LYS C 92  ARG C 103 1 ? 12 
HELX_P HELX_P29 29 LEU C 138 ? ASN C 145 ? LEU C 138 ASN C 145 1 ? 8  
HELX_P HELX_P30 30 SER C 150 ? HIS C 171 ? SER C 150 HIS C 171 1 ? 22 
HELX_P HELX_P31 31 LYS C 179 ? SER C 181 ? LYS C 179 SER C 181 5 ? 3  
HELX_P HELX_P32 32 CYS C 205 ? VAL C 209 ? CYS C 205 VAL C 209 5 ? 5  
HELX_P HELX_P33 33 SER C 229 ? ASN C 234 ? SER C 229 ASN C 234 1 ? 6  
HELX_P HELX_P34 34 SER C 239 ? GLY C 257 ? SER C 239 GLY C 257 1 ? 19 
HELX_P HELX_P35 35 TRP C 261 ? LEU C 265 ? TRP C 261 LEU C 265 5 ? 5  
HELX_P HELX_P36 36 ASP C 267 ? ASN C 281 ? ASP C 267 ASN C 281 1 ? 15 
HELX_P HELX_P37 37 ASN C 281 ? PHE C 290 ? ASN C 281 PHE C 290 1 ? 10 
HELX_P HELX_P38 38 PRO C 296 ? LEU C 308 ? PRO C 296 LEU C 308 1 ? 13 
HELX_P HELX_P39 39 LEU C 316 ? ILE C 331 ? LEU C 316 ILE C 331 1 ? 16 
HELX_P HELX_P40 40 PRO D 79  ? ALA D 91  ? PRO D 79  ALA D 91  1 ? 13 
HELX_P HELX_P41 41 LYS D 92  ? LYS D 104 ? LYS D 92  LYS D 104 1 ? 13 
HELX_P HELX_P42 42 LEU D 138 ? ASN D 145 ? LEU D 138 ASN D 145 1 ? 8  
HELX_P HELX_P43 43 SER D 150 ? HIS D 171 ? SER D 150 HIS D 171 1 ? 22 
HELX_P HELX_P44 44 LYS D 179 ? SER D 181 ? LYS D 179 SER D 181 5 ? 3  
HELX_P HELX_P45 45 CYS D 205 ? VAL D 209 ? CYS D 205 VAL D 209 5 ? 5  
HELX_P HELX_P46 46 ASP D 216 ? CYS D 220 ? ASP D 216 CYS D 220 5 ? 5  
HELX_P HELX_P47 47 SER D 229 ? ASN D 234 ? SER D 229 ASN D 234 1 ? 6  
HELX_P HELX_P48 48 SER D 239 ? GLY D 257 ? SER D 239 GLY D 257 1 ? 19 
HELX_P HELX_P49 49 TRP D 261 ? LEU D 265 ? TRP D 261 LEU D 265 5 ? 5  
HELX_P HELX_P50 50 ASP D 267 ? ASN D 281 ? ASP D 267 ASN D 281 1 ? 15 
HELX_P HELX_P51 51 ASN D 281 ? PHE D 290 ? ASN D 281 PHE D 290 1 ? 10 
HELX_P HELX_P52 52 PRO D 296 ? LEU D 308 ? PRO D 296 LEU D 308 1 ? 13 
HELX_P HELX_P53 53 LEU D 316 ? ILE D 331 ? LEU D 316 ILE D 331 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           25 
_struct_mon_prot_cis.label_asym_id          D 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            25 
_struct_mon_prot_cis.auth_asym_id           D 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    26 
_struct_mon_prot_cis.pdbx_label_asym_id_2   D 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     26 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    D 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 6 ? 
E ? 3 ? 
F ? 2 ? 
G ? 6 ? 
H ? 3 ? 
I ? 2 ? 
J ? 6 ? 
K ? 3 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 28  ? THR A 30  ? ILE A 28  THR A 30  
A 2 ALA A 36  ? PRO A 42  ? ALA A 36  PRO A 42  
A 3 CYS A 50  ? MET A 56  ? CYS A 50  MET A 56  
A 4 CYS A 68  ? PRO A 74  ? CYS A 68  PRO A 74  
A 5 LYS A 124 ? ASP A 132 ? LYS A 124 ASP A 132 
A 6 TYR A 113 ? LYS A 121 ? TYR A 113 LYS A 121 
B 1 PHE A 134 ? ASP A 137 ? PHE A 134 ASP A 137 
B 2 LEU A 183 ? ASN A 186 ? LEU A 183 ASN A 186 
B 3 VAL A 193 ? LEU A 195 ? VAL A 193 LEU A 195 
C 1 TYR A 173 ? VAL A 174 ? TYR A 173 VAL A 174 
C 2 TYR A 202 ? ARG A 203 ? TYR A 202 ARG A 203 
D 1 ILE B 28  ? THR B 30  ? ILE B 28  THR B 30  
D 2 ALA B 36  ? PRO B 42  ? ALA B 36  PRO B 42  
D 3 CYS B 50  ? MET B 56  ? CYS B 50  MET B 56  
D 4 CYS B 68  ? PRO B 74  ? CYS B 68  PRO B 74  
D 5 LYS B 124 ? ASP B 132 ? LYS B 124 ASP B 132 
D 6 TYR B 113 ? LYS B 121 ? TYR B 113 LYS B 121 
E 1 PHE B 134 ? ASP B 137 ? PHE B 134 ASP B 137 
E 2 LEU B 183 ? ASN B 186 ? LEU B 183 ASN B 186 
E 3 VAL B 193 ? LEU B 195 ? VAL B 193 LEU B 195 
F 1 TYR B 173 ? VAL B 174 ? TYR B 173 VAL B 174 
F 2 TYR B 202 ? ARG B 203 ? TYR B 202 ARG B 203 
G 1 ILE C 28  ? THR C 30  ? ILE C 28  THR C 30  
G 2 ALA C 36  ? GLY C 44  ? ALA C 36  GLY C 44  
G 3 CYS C 50  ? MET C 56  ? CYS C 50  MET C 56  
G 4 CYS C 68  ? VAL C 72  ? CYS C 68  VAL C 72  
G 5 SER C 125 ? ASP C 132 ? SER C 125 ASP C 132 
G 6 TYR C 113 ? ASP C 120 ? TYR C 113 ASP C 120 
H 1 PHE C 134 ? ASP C 137 ? PHE C 134 ASP C 137 
H 2 LEU C 183 ? ASN C 186 ? LEU C 183 ASN C 186 
H 3 VAL C 193 ? LEU C 195 ? VAL C 193 LEU C 195 
I 1 TYR C 173 ? VAL C 174 ? TYR C 173 VAL C 174 
I 2 TYR C 202 ? ARG C 203 ? TYR C 202 ARG C 203 
J 1 ILE D 28  ? THR D 30  ? ILE D 28  THR D 30  
J 2 ALA D 36  ? PRO D 42  ? ALA D 36  PRO D 42  
J 3 ILE D 51  ? MET D 56  ? ILE D 51  MET D 56  
J 4 CYS D 68  ? PRO D 74  ? CYS D 68  PRO D 74  
J 5 TYR D 126 ? ASP D 132 ? TYR D 126 ASP D 132 
J 6 TYR D 113 ? HIS D 119 ? TYR D 113 HIS D 119 
K 1 PHE D 134 ? ASP D 137 ? PHE D 134 ASP D 137 
K 2 LEU D 183 ? ASN D 186 ? LEU D 183 ASN D 186 
K 3 VAL D 193 ? LEU D 195 ? VAL D 193 LEU D 195 
L 1 TYR D 173 ? VAL D 174 ? TYR D 173 VAL D 174 
L 2 TYR D 202 ? ARG D 203 ? TYR D 202 ARG D 203 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 29  ? N ILE A 29  O TRP A 37  ? O TRP A 37  
A 2 3 N GLY A 40  ? N GLY A 40  O LEU A 53  ? O LEU A 53  
A 3 4 N CYS A 50  ? N CYS A 50  O VAL A 72  ? O VAL A 72  
A 4 5 N GLU A 73  ? N GLU A 73  O ARG A 127 ? O ARG A 127 
A 5 6 O ILE A 130 ? O ILE A 130 N GLY A 115 ? N GLY A 115 
B 1 2 N GLY A 135 ? N GLY A 135 O LEU A 185 ? O LEU A 185 
B 2 3 N LEU A 184 ? N LEU A 184 O TYR A 194 ? O TYR A 194 
C 1 2 N VAL A 174 ? N VAL A 174 O TYR A 202 ? O TYR A 202 
D 1 2 N ILE B 29  ? N ILE B 29  O TRP B 37  ? O TRP B 37  
D 2 3 N GLY B 40  ? N GLY B 40  O LEU B 53  ? O LEU B 53  
D 3 4 N TYR B 52  ? N TYR B 52  O VAL B 70  ? O VAL B 70  
D 4 5 N LYS B 71  ? N LYS B 71  O MET B 129 ? O MET B 129 
D 5 6 O ILE B 130 ? O ILE B 130 N GLY B 115 ? N GLY B 115 
E 1 2 N GLY B 135 ? N GLY B 135 O LEU B 185 ? O LEU B 185 
E 2 3 N LEU B 184 ? N LEU B 184 O TYR B 194 ? O TYR B 194 
F 1 2 N VAL B 174 ? N VAL B 174 O TYR B 202 ? O TYR B 202 
G 1 2 N ILE C 29  ? N ILE C 29  O TRP C 37  ? O TRP C 37  
G 2 3 N GLY C 40  ? N GLY C 40  O LEU C 53  ? O LEU C 53  
G 3 4 N CYS C 50  ? N CYS C 50  O VAL C 72  ? O VAL C 72  
G 4 5 N LYS C 71  ? N LYS C 71  O MET C 129 ? O MET C 129 
G 5 6 O ILE C 130 ? O ILE C 130 N GLY C 115 ? N GLY C 115 
H 1 2 N GLY C 135 ? N GLY C 135 O LEU C 185 ? O LEU C 185 
H 2 3 N LEU C 184 ? N LEU C 184 O TYR C 194 ? O TYR C 194 
I 1 2 N VAL C 174 ? N VAL C 174 O TYR C 202 ? O TYR C 202 
J 1 2 N ILE D 29  ? N ILE D 29  O TRP D 37  ? O TRP D 37  
J 2 3 N GLY D 40  ? N GLY D 40  O LEU D 53  ? O LEU D 53  
J 3 4 N TYR D 52  ? N TYR D 52  O VAL D 70  ? O VAL D 70  
J 4 5 N VAL D 69  ? N VAL D 69  O MET D 131 ? O MET D 131 
J 5 6 O ILE D 130 ? O ILE D 130 N GLY D 115 ? N GLY D 115 
K 1 2 N GLY D 135 ? N GLY D 135 O LEU D 185 ? O LEU D 185 
K 2 3 N LEU D 184 ? N LEU D 184 O TYR D 194 ? O TYR D 194 
L 1 2 N VAL D 174 ? N VAL D 174 O TYR D 202 ? O TYR D 202 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE REB A 365' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 366' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 367' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE REB B 365' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL B 366' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO B 367' 
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE REB C 365' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO C 366' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO C 367' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO C 368' 
BC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE REB D 365' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ILE A 43  ? ILE A 43  . ? 1_555 ? 
2  AC1 13 GLY A 44  ? GLY A 44  . ? 1_555 ? 
3  AC1 13 GLN A 45  ? GLN A 45  . ? 1_555 ? 
4  AC1 13 PHE A 48  ? PHE A 48  . ? 1_555 ? 
5  AC1 13 ILE A 51  ? ILE A 51  . ? 1_555 ? 
6  AC1 13 VAL A 69  ? VAL A 69  . ? 1_555 ? 
7  AC1 13 TYR A 87  ? TYR A 87  . ? 1_555 ? 
8  AC1 13 MET A 131 ? MET A 131 . ? 1_555 ? 
9  AC1 13 ASP A 132 ? ASP A 132 . ? 1_555 ? 
10 AC1 13 ARG A 133 ? ARG A 133 . ? 1_555 ? 
11 AC1 13 PHE A 134 ? PHE A 134 . ? 1_555 ? 
12 AC1 13 HOH P .   ? HOH A 368 . ? 1_555 ? 
13 AC1 13 HOH P .   ? HOH A 487 . ? 1_555 ? 
14 AC2 7  GLN A 139 ? GLN A 139 . ? 1_555 ? 
15 AC2 7  ALA A 180 ? ALA A 180 . ? 1_555 ? 
16 AC2 7  PHE A 227 ? PHE A 227 . ? 1_555 ? 
17 AC2 7  CYS A 250 ? CYS A 250 . ? 1_555 ? 
18 AC2 7  GLN A 253 ? GLN A 253 . ? 1_555 ? 
19 AC2 7  TRP A 254 ? TRP A 254 . ? 1_555 ? 
20 AC2 7  HOH P .   ? HOH A 412 . ? 1_555 ? 
21 AC3 5  LYS A 85  ? LYS A 85  . ? 1_555 ? 
22 AC3 5  ARG A 89  ? ARG A 89  . ? 1_555 ? 
23 AC3 5  HOH P .   ? HOH A 427 . ? 1_555 ? 
24 AC3 5  HOH P .   ? HOH A 456 . ? 1_555 ? 
25 AC3 5  HOH R .   ? HOH C 532 . ? 3_545 ? 
26 AC4 12 GLY B 44  ? GLY B 44  . ? 1_555 ? 
27 AC4 12 GLN B 45  ? GLN B 45  . ? 1_555 ? 
28 AC4 12 PHE B 48  ? PHE B 48  . ? 1_555 ? 
29 AC4 12 ILE B 51  ? ILE B 51  . ? 1_555 ? 
30 AC4 12 VAL B 69  ? VAL B 69  . ? 1_555 ? 
31 AC4 12 LYS B 71  ? LYS B 71  . ? 1_555 ? 
32 AC4 12 TYR B 87  ? TYR B 87  . ? 1_555 ? 
33 AC4 12 MET B 131 ? MET B 131 . ? 1_555 ? 
34 AC4 12 ASP B 132 ? ASP B 132 . ? 1_555 ? 
35 AC4 12 ARG B 133 ? ARG B 133 . ? 1_555 ? 
36 AC4 12 PHE B 134 ? PHE B 134 . ? 1_555 ? 
37 AC4 12 HOH Q .   ? HOH B 369 . ? 1_555 ? 
38 AC5 4  ARG B 89  ? ARG B 89  . ? 1_555 ? 
39 AC5 4  HOH Q .   ? HOH B 370 . ? 1_555 ? 
40 AC5 4  HOH Q .   ? HOH B 447 . ? 1_555 ? 
41 AC5 4  HOH S .   ? HOH D 411 . ? 1_555 ? 
42 AC6 7  SER B 229 ? SER B 229 . ? 1_555 ? 
43 AC6 7  ILE B 230 ? ILE B 230 . ? 1_555 ? 
44 AC6 7  ASP B 231 ? ASP B 231 . ? 1_555 ? 
45 AC6 7  ARG B 241 ? ARG B 241 . ? 1_555 ? 
46 AC6 7  GLU B 245 ? GLU B 245 . ? 1_555 ? 
47 AC6 7  ARG B 279 ? ARG B 279 . ? 1_555 ? 
48 AC6 7  HOH Q .   ? HOH B 395 . ? 1_555 ? 
49 AC7 10 ILE C 43  ? ILE C 43  . ? 1_555 ? 
50 AC7 10 GLY C 44  ? GLY C 44  . ? 1_555 ? 
51 AC7 10 ILE C 51  ? ILE C 51  . ? 1_555 ? 
52 AC7 10 VAL C 69  ? VAL C 69  . ? 1_555 ? 
53 AC7 10 MET C 131 ? MET C 131 . ? 1_555 ? 
54 AC7 10 ASP C 132 ? ASP C 132 . ? 1_555 ? 
55 AC7 10 ARG C 133 ? ARG C 133 . ? 1_555 ? 
56 AC7 10 PHE C 134 ? PHE C 134 . ? 1_555 ? 
57 AC7 10 HOH R .   ? HOH C 369 . ? 1_555 ? 
58 AC7 10 HOH R .   ? HOH C 449 . ? 1_555 ? 
59 AC8 6  SER C 229 ? SER C 229 . ? 1_555 ? 
60 AC8 6  ILE C 230 ? ILE C 230 . ? 1_555 ? 
61 AC8 6  ASP C 231 ? ASP C 231 . ? 1_555 ? 
62 AC8 6  GLU C 245 ? GLU C 245 . ? 1_555 ? 
63 AC8 6  ARG C 279 ? ARG C 279 . ? 1_555 ? 
64 AC8 6  HOH R .   ? HOH C 399 . ? 1_555 ? 
65 AC9 7  LYS A 85  ? LYS A 85  . ? 3_555 ? 
66 AC9 7  GLN A 88  ? GLN A 88  . ? 3_555 ? 
67 AC9 7  ARG A 89  ? ARG A 89  . ? 3_555 ? 
68 AC9 7  LYS A 92  ? LYS A 92  . ? 3_555 ? 
69 AC9 7  ASP C 310 ? ASP C 310 . ? 1_555 ? 
70 AC9 7  GLU C 313 ? GLU C 313 . ? 1_555 ? 
71 AC9 7  EDO N .   ? EDO C 368 . ? 1_555 ? 
72 BC1 4  ASP C 310 ? ASP C 310 . ? 1_555 ? 
73 BC1 4  THR C 312 ? THR C 312 . ? 1_555 ? 
74 BC1 4  GLU C 313 ? GLU C 313 . ? 1_555 ? 
75 BC1 4  EDO M .   ? EDO C 367 . ? 1_555 ? 
76 BC2 8  ILE D 43  ? ILE D 43  . ? 1_555 ? 
77 BC2 8  ILE D 51  ? ILE D 51  . ? 1_555 ? 
78 BC2 8  VAL D 69  ? VAL D 69  . ? 1_555 ? 
79 BC2 8  MET D 131 ? MET D 131 . ? 1_555 ? 
80 BC2 8  ASP D 132 ? ASP D 132 . ? 1_555 ? 
81 BC2 8  ARG D 133 ? ARG D 133 . ? 1_555 ? 
82 BC2 8  PHE D 134 ? PHE D 134 . ? 1_555 ? 
83 BC2 8  HOH S .   ? HOH D 366 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3OP5 
_atom_sites.fract_transf_matrix[1][1]   0.010756 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010289 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005209 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLU A 1 21  ? 44.226  -5.753  11.653  1.00 63.93  ? 21   GLU A N   1 
ATOM   2     C CA  . GLU A 1 21  ? 43.380  -4.942  10.780  1.00 62.17  ? 21   GLU A CA  1 
ATOM   3     C C   . GLU A 1 21  ? 42.842  -5.792  9.629   1.00 61.91  ? 21   GLU A C   1 
ATOM   4     O O   . GLU A 1 21  ? 43.545  -6.060  8.651   1.00 61.95  ? 21   GLU A O   1 
ATOM   5     C CB  . GLU A 1 21  ? 44.134  -3.704  10.265  1.00 65.03  ? 21   GLU A CB  1 
ATOM   6     C CG  . GLU A 1 21  ? 43.225  -2.509  10.004  1.00 75.11  ? 21   GLU A CG  1 
ATOM   7     C CD  . GLU A 1 21  ? 42.483  -1.885  11.177  1.00 95.28  ? 21   GLU A CD  1 
ATOM   8     O OE1 . GLU A 1 21  ? 41.584  -1.055  10.912  1.00 96.61  ? 21   GLU A OE1 1 
ATOM   9     O OE2 . GLU A 1 21  ? 42.778  -2.222  12.349  1.00 83.49  ? 21   GLU A OE2 1 
ATOM   10    N N   . GLN A 1 22  ? 41.573  -6.202  9.780   1.00 54.60  ? 22   GLN A N   1 
ATOM   11    C CA  . GLN A 1 22  ? 40.798  -7.093  8.926   1.00 52.23  ? 22   GLN A CA  1 
ATOM   12    C C   . GLN A 1 22  ? 40.874  -6.760  7.426   1.00 53.57  ? 22   GLN A C   1 
ATOM   13    O O   . GLN A 1 22  ? 41.045  -7.685  6.634   1.00 53.12  ? 22   GLN A O   1 
ATOM   14    C CB  . GLN A 1 22  ? 39.331  -7.126  9.389   1.00 51.59  ? 22   GLN A CB  1 
ATOM   15    N N   . PHE A 1 23  ? 40.776  -5.472  7.034   1.00 48.72  ? 23   PHE A N   1 
ATOM   16    C CA  . PHE A 1 23  ? 40.785  -5.102  5.613   1.00 48.29  ? 23   PHE A CA  1 
ATOM   17    C C   . PHE A 1 23  ? 41.779  -4.020  5.234   1.00 53.76  ? 23   PHE A C   1 
ATOM   18    O O   . PHE A 1 23  ? 42.349  -3.345  6.087   1.00 55.35  ? 23   PHE A O   1 
ATOM   19    C CB  . PHE A 1 23  ? 39.394  -4.599  5.165   1.00 48.29  ? 23   PHE A CB  1 
ATOM   20    C CG  . PHE A 1 23  ? 38.190  -5.436  5.504   1.00 47.82  ? 23   PHE A CG  1 
ATOM   21    C CD1 . PHE A 1 23  ? 38.037  -6.711  4.973   1.00 50.42  ? 23   PHE A CD1 1 
ATOM   22    C CD2 . PHE A 1 23  ? 37.165  -4.919  6.284   1.00 48.98  ? 23   PHE A CD2 1 
ATOM   23    C CE1 . PHE A 1 23  ? 36.908  -7.480  5.273   1.00 50.34  ? 23   PHE A CE1 1 
ATOM   24    C CE2 . PHE A 1 23  ? 36.018  -5.673  6.549   1.00 50.46  ? 23   PHE A CE2 1 
ATOM   25    C CZ  . PHE A 1 23  ? 35.902  -6.954  6.054   1.00 48.42  ? 23   PHE A CZ  1 
ATOM   26    N N   . ALA A 1 24  ? 41.930  -3.836  3.921   1.00 49.76  ? 24   ALA A N   1 
ATOM   27    C CA  . ALA A 1 24  ? 42.708  -2.800  3.256   1.00 50.82  ? 24   ALA A CA  1 
ATOM   28    C C   . ALA A 1 24  ? 41.747  -1.774  2.656   1.00 54.46  ? 24   ALA A C   1 
ATOM   29    O O   . ALA A 1 24  ? 40.645  -2.151  2.256   1.00 53.12  ? 24   ALA A O   1 
ATOM   30    C CB  . ALA A 1 24  ? 43.562  -3.421  2.166   1.00 52.62  ? 24   ALA A CB  1 
ATOM   31    N N   . VAL A 1 25  ? 42.136  -0.484  2.610   1.00 51.46  ? 25   VAL A N   1 
ATOM   32    C CA  . VAL A 1 25  ? 41.297  0.567   2.018   1.00 49.93  ? 25   VAL A CA  1 
ATOM   33    C C   . VAL A 1 25  ? 41.301  0.341   0.506   1.00 51.95  ? 25   VAL A C   1 
ATOM   34    O O   . VAL A 1 25  ? 42.354  0.432   -0.129  1.00 53.39  ? 25   VAL A O   1 
ATOM   35    C CB  . VAL A 1 25  ? 41.716  2.009   2.408   1.00 54.62  ? 25   VAL A CB  1 
ATOM   36    C CG1 . VAL A 1 25  ? 40.770  3.033   1.787   1.00 53.81  ? 25   VAL A CG1 1 
ATOM   37    C CG2 . VAL A 1 25  ? 41.738  2.177   3.917   1.00 54.32  ? 25   VAL A CG2 1 
ATOM   38    N N   . GLY A 1 26  ? 40.142  -0.039  -0.023  1.00 45.01  ? 26   GLY A N   1 
ATOM   39    C CA  . GLY A 1 26  ? 39.967  -0.353  -1.436  1.00 44.23  ? 26   GLY A CA  1 
ATOM   40    C C   . GLY A 1 26  ? 39.740  -1.830  -1.708  1.00 45.51  ? 26   GLY A C   1 
ATOM   41    O O   . GLY A 1 26  ? 39.517  -2.206  -2.861  1.00 45.54  ? 26   GLY A O   1 
ATOM   42    N N   . GLU A 1 27  ? 39.795  -2.681  -0.650  1.00 39.92  ? 27   GLU A N   1 
ATOM   43    C CA  . GLU A 1 27  ? 39.588  -4.129  -0.748  1.00 38.40  ? 27   GLU A CA  1 
ATOM   44    C C   . GLU A 1 27  ? 38.143  -4.424  -1.139  1.00 40.76  ? 27   GLU A C   1 
ATOM   45    O O   . GLU A 1 27  ? 37.214  -3.783  -0.624  1.00 40.07  ? 27   GLU A O   1 
ATOM   46    C CB  . GLU A 1 27  ? 39.944  -4.830  0.582   1.00 39.45  ? 27   GLU A CB  1 
ATOM   47    C CG  . GLU A 1 27  ? 39.926  -6.356  0.527   1.00 42.37  ? 27   GLU A CG  1 
ATOM   48    C CD  . GLU A 1 27  ? 40.547  -7.107  1.693   1.00 61.26  ? 27   GLU A CD  1 
ATOM   49    O OE1 . GLU A 1 27  ? 41.170  -6.465  2.569   1.00 68.53  ? 27   GLU A OE1 1 
ATOM   50    O OE2 . GLU A 1 27  ? 40.431  -8.353  1.716   1.00 47.33  ? 27   GLU A OE2 1 
ATOM   51    N N   . ILE A 1 28  ? 37.960  -5.394  -2.047  1.00 36.07  ? 28   ILE A N   1 
ATOM   52    C CA  . ILE A 1 28  ? 36.635  -5.814  -2.504  1.00 33.84  ? 28   ILE A CA  1 
ATOM   53    C C   . ILE A 1 28  ? 36.228  -7.087  -1.758  1.00 37.24  ? 28   ILE A C   1 
ATOM   54    O O   . ILE A 1 28  ? 36.923  -8.102  -1.828  1.00 37.94  ? 28   ILE A O   1 
ATOM   55    C CB  . ILE A 1 28  ? 36.580  -5.992  -4.044  1.00 36.48  ? 28   ILE A CB  1 
ATOM   56    C CG1 . ILE A 1 28  ? 37.014  -4.698  -4.761  1.00 37.41  ? 28   ILE A CG1 1 
ATOM   57    C CG2 . ILE A 1 28  ? 35.189  -6.444  -4.501  1.00 34.62  ? 28   ILE A CG2 1 
ATOM   58    C CD1 . ILE A 1 28  ? 37.560  -4.910  -6.175  1.00 47.13  ? 28   ILE A CD1 1 
ATOM   59    N N   . ILE A 1 29  ? 35.099  -7.019  -1.048  1.00 32.23  ? 29   ILE A N   1 
ATOM   60    C CA  . ILE A 1 29  ? 34.523  -8.142  -0.299  1.00 30.90  ? 29   ILE A CA  1 
ATOM   61    C C   . ILE A 1 29  ? 33.173  -8.532  -0.923  1.00 33.34  ? 29   ILE A C   1 
ATOM   62    O O   . ILE A 1 29  ? 32.456  -7.663  -1.417  1.00 32.91  ? 29   ILE A O   1 
ATOM   63    C CB  . ILE A 1 29  ? 34.418  -7.846  1.229   1.00 32.97  ? 29   ILE A CB  1 
ATOM   64    C CG1 . ILE A 1 29  ? 33.557  -6.582  1.529   1.00 32.03  ? 29   ILE A CG1 1 
ATOM   65    C CG2 . ILE A 1 29  ? 35.851  -7.738  1.835   1.00 34.46  ? 29   ILE A CG2 1 
ATOM   66    C CD1 . ILE A 1 29  ? 33.216  -6.325  2.992   1.00 33.08  ? 29   ILE A CD1 1 
ATOM   67    N N   . THR A 1 30  ? 32.856  -9.840  -0.931  1.00 29.12  ? 30   THR A N   1 
ATOM   68    C CA  . THR A 1 30  ? 31.627  -10.390 -1.515  1.00 28.17  ? 30   THR A CA  1 
ATOM   69    C C   . THR A 1 30  ? 30.817  -11.058 -0.412  1.00 31.56  ? 30   THR A C   1 
ATOM   70    O O   . THR A 1 30  ? 31.357  -11.865 0.357   1.00 31.25  ? 30   THR A O   1 
ATOM   71    C CB  . THR A 1 30  ? 31.962  -11.347 -2.691  1.00 33.33  ? 30   THR A CB  1 
ATOM   72    O OG1 . THR A 1 30  ? 32.778  -10.653 -3.638  1.00 38.36  ? 30   THR A OG1 1 
ATOM   73    C CG2 . THR A 1 30  ? 30.735  -11.861 -3.415  1.00 28.24  ? 30   THR A CG2 1 
ATOM   74    N N   . ASP A 1 31  ? 29.522  -10.706 -0.323  1.00 27.94  ? 31   ASP A N   1 
ATOM   75    C CA  . ASP A 1 31  ? 28.638  -11.238 0.725   1.00 26.85  ? 31   ASP A CA  1 
ATOM   76    C C   . ASP A 1 31  ? 27.996  -12.582 0.286   1.00 32.56  ? 31   ASP A C   1 
ATOM   77    O O   . ASP A 1 31  ? 28.293  -13.077 -0.811  1.00 33.48  ? 31   ASP A O   1 
ATOM   78    C CB  . ASP A 1 31  ? 27.580  -10.189 1.137   1.00 26.58  ? 31   ASP A CB  1 
ATOM   79    C CG  . ASP A 1 31  ? 26.588  -9.727  0.082   1.00 29.22  ? 31   ASP A CG  1 
ATOM   80    O OD1 . ASP A 1 31  ? 26.268  -10.524 -0.829  1.00 27.83  ? 31   ASP A OD1 1 
ATOM   81    O OD2 . ASP A 1 31  ? 26.072  -8.596  0.213   1.00 33.42  ? 31   ASP A OD2 1 
ATOM   82    N N   . MET A 1 32  ? 27.126  -13.159 1.136   1.00 29.79  ? 32   MET A N   1 
ATOM   83    C CA  . MET A 1 32  ? 26.461  -14.437 0.864   1.00 31.14  ? 32   MET A CA  1 
ATOM   84    C C   . MET A 1 32  ? 25.490  -14.394 -0.336  1.00 32.84  ? 32   MET A C   1 
ATOM   85    O O   . MET A 1 32  ? 25.257  -15.433 -0.952  1.00 32.02  ? 32   MET A O   1 
ATOM   86    C CB  . MET A 1 32  ? 25.776  -15.000 2.098   1.00 34.38  ? 32   MET A CB  1 
ATOM   87    C CG  . MET A 1 32  ? 24.747  -14.127 2.743   1.00 39.42  ? 32   MET A CG  1 
ATOM   88    S SD  . MET A 1 32  ? 24.380  -14.849 4.350   1.00 45.07  ? 32   MET A SD  1 
ATOM   89    C CE  . MET A 1 32  ? 22.606  -14.701 4.345   1.00 42.22  ? 32   MET A CE  1 
ATOM   90    N N   . ALA A 1 33  ? 24.983  -13.204 -0.694  1.00 28.70  ? 33   ALA A N   1 
ATOM   91    C CA  . ALA A 1 33  ? 24.102  -12.983 -1.842  1.00 28.52  ? 33   ALA A CA  1 
ATOM   92    C C   . ALA A 1 33  ? 24.908  -12.660 -3.117  1.00 34.24  ? 33   ALA A C   1 
ATOM   93    O O   . ALA A 1 33  ? 24.324  -12.307 -4.142  1.00 34.82  ? 33   ALA A O   1 
ATOM   94    C CB  . ALA A 1 33  ? 23.138  -11.847 -1.536  1.00 28.84  ? 33   ALA A CB  1 
ATOM   95    N N   . ALA A 1 34  ? 26.248  -12.804 -3.050  1.00 30.83  ? 34   ALA A N   1 
ATOM   96    C CA  . ALA A 1 34  ? 27.236  -12.567 -4.109  1.00 31.15  ? 34   ALA A CA  1 
ATOM   97    C C   . ALA A 1 34  ? 27.323  -11.080 -4.518  1.00 34.83  ? 34   ALA A C   1 
ATOM   98    O O   . ALA A 1 34  ? 27.852  -10.764 -5.590  1.00 36.00  ? 34   ALA A O   1 
ATOM   99    C CB  . ALA A 1 34  ? 26.972  -13.455 -5.326  1.00 32.38  ? 34   ALA A CB  1 
ATOM   100   N N   . ALA A 1 35  ? 26.859  -10.170 -3.642  1.00 29.37  ? 35   ALA A N   1 
ATOM   101   C CA  . ALA A 1 35  ? 26.947  -8.721  -3.854  1.00 28.55  ? 35   ALA A CA  1 
ATOM   102   C C   . ALA A 1 35  ? 28.350  -8.236  -3.475  1.00 32.66  ? 35   ALA A C   1 
ATOM   103   O O   . ALA A 1 35  ? 28.861  -8.575  -2.400  1.00 31.25  ? 35   ALA A O   1 
ATOM   104   C CB  . ALA A 1 35  ? 25.880  -7.987  -3.040  1.00 27.95  ? 35   ALA A CB  1 
ATOM   105   N N   . ALA A 1 36  ? 28.983  -7.475  -4.375  1.00 29.76  ? 36   ALA A N   1 
ATOM   106   C CA  . ALA A 1 36  ? 30.328  -6.962  -4.162  1.00 29.59  ? 36   ALA A CA  1 
ATOM   107   C C   . ALA A 1 36  ? 30.315  -5.595  -3.465  1.00 33.51  ? 36   ALA A C   1 
ATOM   108   O O   . ALA A 1 36  ? 29.517  -4.720  -3.807  1.00 33.02  ? 36   ALA A O   1 
ATOM   109   C CB  . ALA A 1 36  ? 31.074  -6.883  -5.486  1.00 30.80  ? 36   ALA A CB  1 
ATOM   110   N N   . TRP A 1 37  ? 31.202  -5.432  -2.482  1.00 29.88  ? 37   TRP A N   1 
ATOM   111   C CA  . TRP A 1 37  ? 31.352  -4.210  -1.701  1.00 30.24  ? 37   TRP A CA  1 
ATOM   112   C C   . TRP A 1 37  ? 32.803  -3.785  -1.646  1.00 35.09  ? 37   TRP A C   1 
ATOM   113   O O   . TRP A 1 37  ? 33.692  -4.634  -1.563  1.00 34.97  ? 37   TRP A O   1 
ATOM   114   C CB  . TRP A 1 37  ? 30.830  -4.402  -0.258  1.00 28.50  ? 37   TRP A CB  1 
ATOM   115   C CG  . TRP A 1 37  ? 29.410  -4.845  -0.153  1.00 28.52  ? 37   TRP A CG  1 
ATOM   116   C CD1 . TRP A 1 37  ? 28.959  -6.131  -0.080  1.00 31.07  ? 37   TRP A CD1 1 
ATOM   117   C CD2 . TRP A 1 37  ? 28.245  -4.004  -0.120  1.00 28.27  ? 37   TRP A CD2 1 
ATOM   118   N NE1 . TRP A 1 37  ? 27.585  -6.147  0.014   1.00 30.32  ? 37   TRP A NE1 1 
ATOM   119   C CE2 . TRP A 1 37  ? 27.120  -4.853  -0.001  1.00 31.82  ? 37   TRP A CE2 1 
ATOM   120   C CE3 . TRP A 1 37  ? 28.039  -2.609  -0.176  1.00 29.75  ? 37   TRP A CE3 1 
ATOM   121   C CZ2 . TRP A 1 37  ? 25.810  -4.354  0.093   1.00 30.49  ? 37   TRP A CZ2 1 
ATOM   122   C CZ3 . TRP A 1 37  ? 26.740  -2.120  -0.122  1.00 30.81  ? 37   TRP A CZ3 1 
ATOM   123   C CH2 . TRP A 1 37  ? 25.644  -2.987  0.019   1.00 30.92  ? 37   TRP A CH2 1 
ATOM   124   N N   . LYS A 1 38  ? 33.045  -2.470  -1.664  1.00 32.67  ? 38   LYS A N   1 
ATOM   125   C CA  . LYS A 1 38  ? 34.389  -1.911  -1.575  1.00 33.21  ? 38   LYS A CA  1 
ATOM   126   C C   . LYS A 1 38  ? 34.551  -1.280  -0.200  1.00 36.33  ? 38   LYS A C   1 
ATOM   127   O O   . LYS A 1 38  ? 33.677  -0.543  0.260   1.00 34.24  ? 38   LYS A O   1 
ATOM   128   C CB  . LYS A 1 38  ? 34.664  -0.912  -2.715  1.00 36.48  ? 38   LYS A CB  1 
ATOM   129   C CG  . LYS A 1 38  ? 36.130  -0.513  -2.839  1.00 44.23  ? 38   LYS A CG  1 
ATOM   130   C CD  . LYS A 1 38  ? 36.333  0.548   -3.900  1.00 50.93  ? 38   LYS A CD  1 
ATOM   131   C CE  . LYS A 1 38  ? 37.006  -0.004  -5.126  1.00 56.36  ? 38   LYS A CE  1 
ATOM   132   N NZ  . LYS A 1 38  ? 37.217  1.053   -6.141  1.00 68.74  ? 38   LYS A NZ  1 
ATOM   133   N N   . VAL A 1 39  ? 35.663  -1.611  0.469   1.00 34.48  ? 39   VAL A N   1 
ATOM   134   C CA  . VAL A 1 39  ? 35.985  -1.136  1.812   1.00 33.67  ? 39   VAL A CA  1 
ATOM   135   C C   . VAL A 1 39  ? 36.729  0.213   1.714   1.00 39.65  ? 39   VAL A C   1 
ATOM   136   O O   . VAL A 1 39  ? 37.603  0.395   0.854   1.00 41.27  ? 39   VAL A O   1 
ATOM   137   C CB  . VAL A 1 39  ? 36.797  -2.212  2.591   1.00 37.82  ? 39   VAL A CB  1 
ATOM   138   C CG1 . VAL A 1 39  ? 37.042  -1.784  4.029   1.00 37.89  ? 39   VAL A CG1 1 
ATOM   139   C CG2 . VAL A 1 39  ? 36.092  -3.572  2.573   1.00 36.76  ? 39   VAL A CG2 1 
ATOM   140   N N   . GLY A 1 40  ? 36.342  1.145   2.578   1.00 35.82  ? 40   GLY A N   1 
ATOM   141   C CA  . GLY A 1 40  ? 36.949  2.464   2.694   1.00 36.75  ? 40   GLY A CA  1 
ATOM   142   C C   . GLY A 1 40  ? 37.786  2.606   3.950   1.00 42.19  ? 40   GLY A C   1 
ATOM   143   O O   . GLY A 1 40  ? 38.377  1.628   4.423   1.00 42.25  ? 40   GLY A O   1 
ATOM   144   N N   . LEU A 1 41  ? 37.819  3.826   4.511   1.00 39.15  ? 41   LEU A N   1 
ATOM   145   C CA  . LEU A 1 41  ? 38.605  4.166   5.695   1.00 40.19  ? 41   LEU A CA  1 
ATOM   146   C C   . LEU A 1 41  ? 37.983  3.651   7.000   1.00 43.52  ? 41   LEU A C   1 
ATOM   147   O O   . LEU A 1 41  ? 36.755  3.676   7.135   1.00 38.74  ? 41   LEU A O   1 
ATOM   148   C CB  . LEU A 1 41  ? 38.794  5.694   5.809   1.00 41.48  ? 41   LEU A CB  1 
ATOM   149   C CG  . LEU A 1 41  ? 39.697  6.367   4.774   1.00 49.18  ? 41   LEU A CG  1 
ATOM   150   C CD1 . LEU A 1 41  ? 39.514  7.859   4.802   1.00 50.55  ? 41   LEU A CD1 1 
ATOM   151   C CD2 . LEU A 1 41  ? 41.167  6.003   4.974   1.00 53.30  ? 41   LEU A CD2 1 
ATOM   152   N N   . PRO A 1 42  ? 38.826  3.239   7.995   1.00 43.38  ? 42   PRO A N   1 
ATOM   153   C CA  . PRO A 1 42  ? 38.274  2.825   9.296   1.00 42.90  ? 42   PRO A CA  1 
ATOM   154   C C   . PRO A 1 42  ? 37.713  4.028   10.045  1.00 49.25  ? 42   PRO A C   1 
ATOM   155   O O   . PRO A 1 42  ? 38.302  5.110   10.000  1.00 50.40  ? 42   PRO A O   1 
ATOM   156   C CB  . PRO A 1 42  ? 39.479  2.218   10.034  1.00 45.57  ? 42   PRO A CB  1 
ATOM   157   C CG  . PRO A 1 42  ? 40.603  2.191   9.056   1.00 51.19  ? 42   PRO A CG  1 
ATOM   158   C CD  . PRO A 1 42  ? 40.304  3.186   7.998   1.00 46.79  ? 42   PRO A CD  1 
ATOM   159   N N   . ILE A 1 43  ? 36.549  3.852   10.689  1.00 46.15  ? 43   ILE A N   1 
ATOM   160   C CA  . ILE A 1 43  ? 35.880  4.914   11.440  1.00 46.79  ? 43   ILE A CA  1 
ATOM   161   C C   . ILE A 1 43  ? 35.506  4.417   12.861  1.00 53.91  ? 43   ILE A C   1 
ATOM   162   O O   . ILE A 1 43  ? 35.002  5.206   13.658  1.00 53.05  ? 43   ILE A O   1 
ATOM   163   C CB  . ILE A 1 43  ? 34.663  5.511   10.668  1.00 48.66  ? 43   ILE A CB  1 
ATOM   164   C CG1 . ILE A 1 43  ? 33.684  4.421   10.181  1.00 47.31  ? 43   ILE A CG1 1 
ATOM   165   C CG2 . ILE A 1 43  ? 35.133  6.413   9.518   1.00 51.02  ? 43   ILE A CG2 1 
ATOM   166   C CD1 . ILE A 1 43  ? 32.277  4.905   9.922   1.00 52.10  ? 43   ILE A CD1 1 
ATOM   167   N N   . GLY A 1 44  ? 35.806  3.144   13.158  1.00 54.39  ? 44   GLY A N   1 
ATOM   168   C CA  . GLY A 1 44  ? 35.585  2.511   14.457  1.00 56.09  ? 44   GLY A CA  1 
ATOM   169   C C   . GLY A 1 44  ? 36.413  3.186   15.537  1.00 67.21  ? 44   GLY A C   1 
ATOM   170   O O   . GLY A 1 44  ? 37.648  3.166   15.482  1.00 68.44  ? 44   GLY A O   1 
ATOM   171   N N   . GLN A 1 45  ? 35.730  3.847   16.493  1.00 67.28  ? 45   GLN A N   1 
ATOM   172   C CA  . GLN A 1 45  ? 36.346  4.644   17.565  1.00 69.78  ? 45   GLN A CA  1 
ATOM   173   C C   . GLN A 1 45  ? 36.811  3.779   18.752  1.00 76.55  ? 45   GLN A C   1 
ATOM   174   O O   . GLN A 1 45  ? 35.985  3.157   19.425  1.00 75.15  ? 45   GLN A O   1 
ATOM   175   C CB  . GLN A 1 45  ? 35.369  5.736   18.058  1.00 70.75  ? 45   GLN A CB  1 
ATOM   176   C CG  . GLN A 1 45  ? 34.901  6.712   16.967  1.00 88.65  ? 45   GLN A CG  1 
ATOM   177   C CD  . GLN A 1 45  ? 33.568  7.379   17.262  1.00 108.05 ? 45   GLN A CD  1 
ATOM   178   O OE1 . GLN A 1 45  ? 32.604  6.761   17.735  1.00 100.75 ? 45   GLN A OE1 1 
ATOM   179   N NE2 . GLN A 1 45  ? 33.458  8.647   16.899  1.00 102.35 ? 45   GLN A NE2 1 
ATOM   180   N N   . GLY A 1 46  ? 38.129  3.771   18.988  1.00 76.25  ? 46   GLY A N   1 
ATOM   181   C CA  . GLY A 1 46  ? 38.786  3.054   20.080  1.00 77.46  ? 46   GLY A CA  1 
ATOM   182   C C   . GLY A 1 46  ? 38.548  1.557   20.119  1.00 81.86  ? 46   GLY A C   1 
ATOM   183   O O   . GLY A 1 46  ? 37.874  1.056   21.024  1.00 81.11  ? 46   GLY A O   1 
ATOM   184   N N   . PHE A 1 48  ? 35.103  0.492   21.239  1.00 68.12  ? 48   PHE A N   1 
ATOM   185   C CA  . PHE A 1 48  ? 34.042  0.059   20.331  1.00 66.46  ? 48   PHE A CA  1 
ATOM   186   C C   . PHE A 1 48  ? 34.578  -0.970  19.294  1.00 69.67  ? 48   PHE A C   1 
ATOM   187   O O   . PHE A 1 48  ? 35.746  -1.367  19.374  1.00 70.88  ? 48   PHE A O   1 
ATOM   188   C CB  . PHE A 1 48  ? 33.389  1.270   19.643  1.00 67.66  ? 48   PHE A CB  1 
ATOM   189   N N   . GLY A 1 49  ? 33.708  -1.402  18.368  1.00 63.30  ? 49   GLY A N   1 
ATOM   190   C CA  . GLY A 1 49  ? 34.006  -2.406  17.346  1.00 62.01  ? 49   GLY A CA  1 
ATOM   191   C C   . GLY A 1 49  ? 34.871  -1.995  16.163  1.00 63.02  ? 49   GLY A C   1 
ATOM   192   O O   . GLY A 1 49  ? 35.318  -0.845  16.067  1.00 63.67  ? 49   GLY A O   1 
ATOM   193   N N   . CYS A 1 50  ? 35.124  -2.971  15.257  1.00 55.47  ? 50   CYS A N   1 
ATOM   194   C CA  . CYS A 1 50  ? 35.911  -2.825  14.028  1.00 53.63  ? 50   CYS A CA  1 
ATOM   195   C C   . CYS A 1 50  ? 34.972  -2.427  12.866  1.00 47.99  ? 50   CYS A C   1 
ATOM   196   O O   . CYS A 1 50  ? 34.257  -3.269  12.322  1.00 46.05  ? 50   CYS A O   1 
ATOM   197   C CB  . CYS A 1 50  ? 36.669  -4.117  13.739  1.00 55.44  ? 50   CYS A CB  1 
ATOM   198   S SG  . CYS A 1 50  ? 37.656  -4.078  12.222  1.00 60.97  ? 50   CYS A SG  1 
ATOM   199   N N   . ILE A 1 51  ? 34.935  -1.127  12.535  1.00 39.56  ? 51   ILE A N   1 
ATOM   200   C CA  . ILE A 1 51  ? 34.027  -0.564  11.536  1.00 36.55  ? 51   ILE A CA  1 
ATOM   201   C C   . ILE A 1 51  ? 34.786  0.293   10.524  1.00 38.26  ? 51   ILE A C   1 
ATOM   202   O O   . ILE A 1 51  ? 35.590  1.142   10.904  1.00 37.92  ? 51   ILE A O   1 
ATOM   203   C CB  . ILE A 1 51  ? 32.880  0.252   12.232  1.00 38.61  ? 51   ILE A CB  1 
ATOM   204   C CG1 . ILE A 1 51  ? 32.116  -0.598  13.277  1.00 38.15  ? 51   ILE A CG1 1 
ATOM   205   C CG2 . ILE A 1 51  ? 31.896  0.852   11.214  1.00 38.44  ? 51   ILE A CG2 1 
ATOM   206   C CD1 . ILE A 1 51  ? 31.636  0.161   14.496  1.00 43.21  ? 51   ILE A CD1 1 
ATOM   207   N N   . TYR A 1 52  ? 34.488  0.086   9.226   1.00 34.95  ? 52   TYR A N   1 
ATOM   208   C CA  . TYR A 1 52  ? 35.047  0.826   8.084   1.00 34.97  ? 52   TYR A CA  1 
ATOM   209   C C   . TYR A 1 52  ? 33.925  1.437   7.266   1.00 37.62  ? 52   TYR A C   1 
ATOM   210   O O   . TYR A 1 52  ? 32.803  0.936   7.302   1.00 36.63  ? 52   TYR A O   1 
ATOM   211   C CB  . TYR A 1 52  ? 35.860  -0.102  7.158   1.00 36.34  ? 52   TYR A CB  1 
ATOM   212   C CG  . TYR A 1 52  ? 37.002  -0.867  7.789   1.00 39.08  ? 52   TYR A CG  1 
ATOM   213   C CD1 . TYR A 1 52  ? 36.767  -2.018  8.534   1.00 41.03  ? 52   TYR A CD1 1 
ATOM   214   C CD2 . TYR A 1 52  ? 38.326  -0.512  7.539   1.00 40.65  ? 52   TYR A CD2 1 
ATOM   215   C CE1 . TYR A 1 52  ? 37.814  -2.749  9.084   1.00 43.31  ? 52   TYR A CE1 1 
ATOM   216   C CE2 . TYR A 1 52  ? 39.383  -1.238  8.084   1.00 42.24  ? 52   TYR A CE2 1 
ATOM   217   C CZ  . TYR A 1 52  ? 39.121  -2.363  8.848   1.00 50.82  ? 52   TYR A CZ  1 
ATOM   218   O OH  . TYR A 1 52  ? 40.137  -3.109  9.384   1.00 54.89  ? 52   TYR A OH  1 
ATOM   219   N N   . LEU A 1 53  ? 34.231  2.476   6.474   1.00 34.40  ? 53   LEU A N   1 
ATOM   220   C CA  . LEU A 1 53  ? 33.270  3.036   5.529   1.00 32.90  ? 53   LEU A CA  1 
ATOM   221   C C   . LEU A 1 53  ? 33.161  2.043   4.371   1.00 35.35  ? 53   LEU A C   1 
ATOM   222   O O   . LEU A 1 53  ? 34.126  1.325   4.087   1.00 33.95  ? 53   LEU A O   1 
ATOM   223   C CB  . LEU A 1 53  ? 33.692  4.430   5.032   1.00 33.86  ? 53   LEU A CB  1 
ATOM   224   C CG  . LEU A 1 53  ? 33.589  5.592   6.024   1.00 38.65  ? 53   LEU A CG  1 
ATOM   225   C CD1 . LEU A 1 53  ? 34.373  6.785   5.524   1.00 40.60  ? 53   LEU A CD1 1 
ATOM   226   C CD2 . LEU A 1 53  ? 32.148  6.003   6.259   1.00 38.36  ? 53   LEU A CD2 1 
ATOM   227   N N   . ALA A 1 54  ? 31.986  1.945   3.752   1.00 31.81  ? 54   ALA A N   1 
ATOM   228   C CA  . ALA A 1 54  ? 31.787  1.007   2.659   1.00 31.97  ? 54   ALA A CA  1 
ATOM   229   C C   . ALA A 1 54  ? 30.809  1.548   1.628   1.00 38.16  ? 54   ALA A C   1 
ATOM   230   O O   . ALA A 1 54  ? 30.037  2.467   1.910   1.00 39.20  ? 54   ALA A O   1 
ATOM   231   C CB  . ALA A 1 54  ? 31.292  -0.328  3.205   1.00 31.45  ? 54   ALA A CB  1 
ATOM   232   N N   . ASP A 1 55  ? 30.849  0.968   0.430   1.00 34.14  ? 55   ASP A N   1 
ATOM   233   C CA  . ASP A 1 55  ? 29.953  1.281   -0.671  1.00 34.27  ? 55   ASP A CA  1 
ATOM   234   C C   . ASP A 1 55  ? 29.938  0.116   -1.633  1.00 38.75  ? 55   ASP A C   1 
ATOM   235   O O   . ASP A 1 55  ? 30.750  -0.809  -1.511  1.00 37.64  ? 55   ASP A O   1 
ATOM   236   C CB  . ASP A 1 55  ? 30.395  2.574   -1.394  1.00 37.43  ? 55   ASP A CB  1 
ATOM   237   C CG  . ASP A 1 55  ? 29.321  3.302   -2.205  1.00 42.75  ? 55   ASP A CG  1 
ATOM   238   O OD1 . ASP A 1 55  ? 28.193  2.753   -2.346  1.00 41.41  ? 55   ASP A OD1 1 
ATOM   239   O OD2 . ASP A 1 55  ? 29.597  4.432   -2.670  1.00 44.98  ? 55   ASP A OD2 1 
ATOM   240   N N   . MET A 1 56  ? 29.026  0.188   -2.611  1.00 36.26  ? 56   MET A N   1 
ATOM   241   C CA  . MET A 1 56  ? 28.876  -0.738  -3.719  1.00 35.37  ? 56   MET A CA  1 
ATOM   242   C C   . MET A 1 56  ? 30.182  -0.682  -4.523  1.00 41.60  ? 56   MET A C   1 
ATOM   243   O O   . MET A 1 56  ? 30.733  0.416   -4.697  1.00 43.03  ? 56   MET A O   1 
ATOM   244   C CB  . MET A 1 56  ? 27.642  -0.297  -4.539  1.00 37.56  ? 56   MET A CB  1 
ATOM   245   C CG  . MET A 1 56  ? 27.190  -1.301  -5.572  1.00 41.33  ? 56   MET A CG  1 
ATOM   246   S SD  . MET A 1 56  ? 25.510  -1.007  -6.172  1.00 44.54  ? 56   MET A SD  1 
ATOM   247   C CE  . MET A 1 56  ? 25.841  -0.297  -7.723  1.00 43.16  ? 56   MET A CE  1 
ATOM   248   N N   . ASN A 1 57  ? 30.712  -1.861  -4.953  1.00 38.06  ? 57   ASN A N   1 
ATOM   249   C CA  . ASN A 1 57  ? 31.944  -1.988  -5.741  1.00 38.19  ? 57   ASN A CA  1 
ATOM   250   C C   . ASN A 1 57  ? 31.839  -1.222  -7.071  1.00 44.69  ? 57   ASN A C   1 
ATOM   251   O O   . ASN A 1 57  ? 30.872  -1.390  -7.822  1.00 44.35  ? 57   ASN A O   1 
ATOM   252   C CB  . ASN A 1 57  ? 32.243  -3.461  -6.009  1.00 35.11  ? 57   ASN A CB  1 
ATOM   253   C CG  . ASN A 1 57  ? 33.500  -3.747  -6.793  1.00 45.71  ? 57   ASN A CG  1 
ATOM   254   O OD1 . ASN A 1 57  ? 34.591  -3.258  -6.481  1.00 38.80  ? 57   ASN A OD1 1 
ATOM   255   N ND2 . ASN A 1 57  ? 33.374  -4.596  -7.804  1.00 34.02  ? 57   ASN A ND2 1 
ATOM   256   N N   . SER A 1 58  ? 32.833  -0.370  -7.338  1.00 44.08  ? 58   SER A N   1 
ATOM   257   C CA  . SER A 1 58  ? 32.939  0.456   -8.542  1.00 46.36  ? 58   SER A CA  1 
ATOM   258   C C   . SER A 1 58  ? 34.405  0.810   -8.821  1.00 54.74  ? 58   SER A C   1 
ATOM   259   O O   . SER A 1 58  ? 35.284  0.476   -8.016  1.00 54.89  ? 58   SER A O   1 
ATOM   260   C CB  . SER A 1 58  ? 32.096  1.728   -8.409  1.00 49.74  ? 58   SER A CB  1 
ATOM   261   O OG  . SER A 1 58  ? 32.589  2.608   -7.410  1.00 61.19  ? 58   SER A OG  1 
ATOM   262   N N   . SER A 1 59  ? 34.661  1.479   -9.968  1.00 54.00  ? 59   SER A N   1 
ATOM   263   C CA  . SER A 1 59  ? 35.984  1.940   -10.404 1.00 55.67  ? 59   SER A CA  1 
ATOM   264   C C   . SER A 1 59  ? 36.537  3.000   -9.438  1.00 60.76  ? 59   SER A C   1 
ATOM   265   O O   . SER A 1 59  ? 37.747  3.055   -9.209  1.00 62.06  ? 59   SER A O   1 
ATOM   266   C CB  . SER A 1 59  ? 35.905  2.509   -11.818 1.00 58.89  ? 59   SER A CB  1 
ATOM   267   N N   . GLU A 1 60  ? 35.637  3.821   -8.865  1.00 56.08  ? 60   GLU A N   1 
ATOM   268   C CA  . GLU A 1 60  ? 35.963  4.890   -7.921  1.00 56.13  ? 60   GLU A CA  1 
ATOM   269   C C   . GLU A 1 60  ? 36.208  4.340   -6.513  1.00 57.69  ? 60   GLU A C   1 
ATOM   270   O O   . GLU A 1 60  ? 35.579  3.356   -6.108  1.00 56.34  ? 60   GLU A O   1 
ATOM   271   C CB  . GLU A 1 60  ? 34.830  5.939   -7.887  1.00 57.37  ? 60   GLU A CB  1 
ATOM   272   C CG  . GLU A 1 60  ? 34.850  6.907   -9.061  1.00 69.22  ? 60   GLU A CG  1 
ATOM   273   C CD  . GLU A 1 60  ? 35.961  7.938   -9.024  1.00 87.14  ? 60   GLU A CD  1 
ATOM   274   N N   . SER A 1 61  ? 37.111  4.992   -5.764  1.00 53.33  ? 61   SER A N   1 
ATOM   275   C CA  . SER A 1 61  ? 37.431  4.632   -4.384  1.00 51.85  ? 61   SER A CA  1 
ATOM   276   C C   . SER A 1 61  ? 36.257  4.999   -3.454  1.00 53.87  ? 61   SER A C   1 
ATOM   277   O O   . SER A 1 61  ? 35.382  5.784   -3.839  1.00 53.51  ? 61   SER A O   1 
ATOM   278   C CB  . SER A 1 61  ? 38.709  5.337   -3.938  1.00 55.90  ? 61   SER A CB  1 
ATOM   279   O OG  . SER A 1 61  ? 38.553  6.747   -3.930  1.00 63.07  ? 61   SER A OG  1 
ATOM   280   N N   . VAL A 1 62  ? 36.229  4.431   -2.242  1.00 48.72  ? 62   VAL A N   1 
ATOM   281   C CA  . VAL A 1 62  ? 35.165  4.737   -1.277  1.00 46.61  ? 62   VAL A CA  1 
ATOM   282   C C   . VAL A 1 62  ? 35.511  6.080   -0.612  1.00 52.14  ? 62   VAL A C   1 
ATOM   283   O O   . VAL A 1 62  ? 36.592  6.224   -0.022  1.00 51.81  ? 62   VAL A O   1 
ATOM   284   C CB  . VAL A 1 62  ? 34.928  3.587   -0.271  1.00 47.81  ? 62   VAL A CB  1 
ATOM   285   C CG1 . VAL A 1 62  ? 33.977  4.008   0.841   1.00 46.39  ? 62   VAL A CG1 1 
ATOM   286   C CG2 . VAL A 1 62  ? 34.397  2.354   -0.986  1.00 46.45  ? 62   VAL A CG2 1 
ATOM   287   N N   . GLY A 1 63  ? 34.604  7.048   -0.772  1.00 49.79  ? 63   GLY A N   1 
ATOM   288   C CA  . GLY A 1 63  ? 34.770  8.406   -0.270  1.00 51.39  ? 63   GLY A CA  1 
ATOM   289   C C   . GLY A 1 63  ? 34.351  8.629   1.168   1.00 56.70  ? 63   GLY A C   1 
ATOM   290   O O   . GLY A 1 63  ? 33.905  7.701   1.855   1.00 55.16  ? 63   GLY A O   1 
ATOM   291   N N   . SER A 1 64  ? 34.494  9.885   1.629   1.00 55.20  ? 64   SER A N   1 
ATOM   292   C CA  . SER A 1 64  ? 34.110  10.302  2.978   1.00 54.62  ? 64   SER A CA  1 
ATOM   293   C C   . SER A 1 64  ? 32.582  10.385  3.098   1.00 57.91  ? 64   SER A C   1 
ATOM   294   O O   . SER A 1 64  ? 32.060  10.346  4.206   1.00 56.87  ? 64   SER A O   1 
ATOM   295   C CB  . SER A 1 64  ? 34.749  11.645  3.332   1.00 58.88  ? 64   SER A CB  1 
ATOM   296   O OG  . SER A 1 64  ? 34.165  12.728  2.626   1.00 66.83  ? 64   SER A OG  1 
ATOM   297   N N   . ASP A 1 65  ? 31.880  10.503  1.952   1.00 54.78  ? 65   ASP A N   1 
ATOM   298   C CA  . ASP A 1 65  ? 30.422  10.594  1.830   1.00 53.84  ? 65   ASP A CA  1 
ATOM   299   C C   . ASP A 1 65  ? 29.760  9.194   1.639   1.00 55.14  ? 65   ASP A C   1 
ATOM   300   O O   . ASP A 1 65  ? 28.583  9.125   1.258   1.00 55.48  ? 65   ASP A O   1 
ATOM   301   C CB  . ASP A 1 65  ? 30.077  11.512  0.633   1.00 57.22  ? 65   ASP A CB  1 
ATOM   302   C CG  . ASP A 1 65  ? 30.527  10.956  -0.703  1.00 71.47  ? 65   ASP A CG  1 
ATOM   303   O OD1 . ASP A 1 65  ? 31.730  11.071  -1.018  1.00 75.37  ? 65   ASP A OD1 1 
ATOM   304   O OD2 . ASP A 1 65  ? 29.683  10.382  -1.421  1.00 76.35  ? 65   ASP A OD2 1 
ATOM   305   N N   . ALA A 1 66  ? 30.516  8.090   1.910   1.00 47.89  ? 66   ALA A N   1 
ATOM   306   C CA  . ALA A 1 66  ? 30.084  6.690   1.776   1.00 44.26  ? 66   ALA A CA  1 
ATOM   307   C C   . ALA A 1 66  ? 28.708  6.435   2.419   1.00 42.75  ? 66   ALA A C   1 
ATOM   308   O O   . ALA A 1 66  ? 28.473  6.894   3.539   1.00 40.92  ? 66   ALA A O   1 
ATOM   309   C CB  . ALA A 1 66  ? 31.121  5.764   2.385   1.00 44.56  ? 66   ALA A CB  1 
ATOM   310   N N   . PRO A 1 67  ? 27.773  5.750   1.712   1.00 36.61  ? 67   PRO A N   1 
ATOM   311   C CA  . PRO A 1 67  ? 26.426  5.535   2.280   1.00 34.71  ? 67   PRO A CA  1 
ATOM   312   C C   . PRO A 1 67  ? 26.311  4.323   3.209   1.00 37.12  ? 67   PRO A C   1 
ATOM   313   O O   . PRO A 1 67  ? 25.282  4.174   3.886   1.00 36.14  ? 67   PRO A O   1 
ATOM   314   C CB  . PRO A 1 67  ? 25.551  5.339   1.042   1.00 36.18  ? 67   PRO A CB  1 
ATOM   315   C CG  . PRO A 1 67  ? 26.472  4.775   0.017   1.00 41.11  ? 67   PRO A CG  1 
ATOM   316   C CD  . PRO A 1 67  ? 27.880  5.187   0.350   1.00 37.37  ? 67   PRO A CD  1 
ATOM   317   N N   . CYS A 1 68  ? 27.353  3.468   3.251   1.00 32.45  ? 68   CYS A N   1 
ATOM   318   C CA  . CYS A 1 68  ? 27.360  2.259   4.071   1.00 30.64  ? 68   CYS A CA  1 
ATOM   319   C C   . CYS A 1 68  ? 28.562  2.191   4.985   1.00 32.04  ? 68   CYS A C   1 
ATOM   320   O O   . CYS A 1 68  ? 29.540  2.931   4.823   1.00 31.33  ? 68   CYS A O   1 
ATOM   321   C CB  . CYS A 1 68  ? 27.304  1.019   3.183   1.00 31.10  ? 68   CYS A CB  1 
ATOM   322   S SG  . CYS A 1 68  ? 25.733  0.794   2.318   1.00 34.71  ? 68   CYS A SG  1 
ATOM   323   N N   . VAL A 1 69  ? 28.471  1.266   5.950   1.00 27.02  ? 69   VAL A N   1 
ATOM   324   C CA  . VAL A 1 69  ? 29.557  0.873   6.833   1.00 26.97  ? 69   VAL A CA  1 
ATOM   325   C C   . VAL A 1 69  ? 29.662  -0.664  6.822   1.00 29.48  ? 69   VAL A C   1 
ATOM   326   O O   . VAL A 1 69  ? 28.655  -1.364  6.653   1.00 27.37  ? 69   VAL A O   1 
ATOM   327   C CB  . VAL A 1 69  ? 29.508  1.423   8.289   1.00 30.37  ? 69   VAL A CB  1 
ATOM   328   C CG1 . VAL A 1 69  ? 29.622  2.942   8.320   1.00 30.60  ? 69   VAL A CG1 1 
ATOM   329   C CG2 . VAL A 1 69  ? 28.287  0.913   9.069   1.00 28.66  ? 69   VAL A CG2 1 
ATOM   330   N N   . VAL A 1 70  ? 30.876  -1.178  7.040   1.00 25.75  ? 70   VAL A N   1 
ATOM   331   C CA  . VAL A 1 70  ? 31.069  -2.608  7.193   1.00 24.77  ? 70   VAL A CA  1 
ATOM   332   C C   . VAL A 1 70  ? 31.538  -2.839  8.641   1.00 30.57  ? 70   VAL A C   1 
ATOM   333   O O   . VAL A 1 70  ? 32.480  -2.188  9.100   1.00 31.93  ? 70   VAL A O   1 
ATOM   334   C CB  . VAL A 1 70  ? 31.971  -3.285  6.114   1.00 28.26  ? 70   VAL A CB  1 
ATOM   335   C CG1 . VAL A 1 70  ? 33.359  -2.653  6.023   1.00 28.67  ? 70   VAL A CG1 1 
ATOM   336   C CG2 . VAL A 1 70  ? 32.057  -4.798  6.323   1.00 27.48  ? 70   VAL A CG2 1 
ATOM   337   N N   . LYS A 1 71  ? 30.824  -3.710  9.370   1.00 26.36  ? 71   LYS A N   1 
ATOM   338   C CA  . LYS A 1 71  ? 31.174  -4.114  10.732  1.00 26.71  ? 71   LYS A CA  1 
ATOM   339   C C   . LYS A 1 71  ? 31.810  -5.502  10.656  1.00 31.73  ? 71   LYS A C   1 
ATOM   340   O O   . LYS A 1 71  ? 31.231  -6.394  10.043  1.00 30.39  ? 71   LYS A O   1 
ATOM   341   C CB  . LYS A 1 71  ? 29.942  -4.106  11.654  1.00 28.26  ? 71   LYS A CB  1 
ATOM   342   C CG  . LYS A 1 71  ? 30.277  -4.155  13.140  1.00 47.54  ? 71   LYS A CG  1 
ATOM   343   C CD  . LYS A 1 71  ? 29.034  -3.945  14.006  1.00 57.35  ? 71   LYS A CD  1 
ATOM   344   C CE  . LYS A 1 71  ? 29.266  -4.290  15.463  1.00 71.02  ? 71   LYS A CE  1 
ATOM   345   N NZ  . LYS A 1 71  ? 29.942  -3.197  16.211  1.00 85.20  ? 71   LYS A NZ  1 
ATOM   346   N N   . VAL A 1 72  ? 32.995  -5.679  11.270  1.00 30.23  ? 72   VAL A N   1 
ATOM   347   C CA  . VAL A 1 72  ? 33.756  -6.935  11.254  1.00 31.26  ? 72   VAL A CA  1 
ATOM   348   C C   . VAL A 1 72  ? 34.105  -7.418  12.651  1.00 35.67  ? 72   VAL A C   1 
ATOM   349   O O   . VAL A 1 72  ? 34.597  -6.644  13.481  1.00 35.32  ? 72   VAL A O   1 
ATOM   350   C CB  . VAL A 1 72  ? 35.072  -6.839  10.434  1.00 36.98  ? 72   VAL A CB  1 
ATOM   351   C CG1 . VAL A 1 72  ? 35.254  -8.058  9.536   1.00 37.08  ? 72   VAL A CG1 1 
ATOM   352   C CG2 . VAL A 1 72  ? 35.163  -5.542  9.643   1.00 37.08  ? 72   VAL A CG2 1 
ATOM   353   N N   . GLU A 1 73  ? 33.949  -8.727  12.870  1.00 32.24  ? 73   GLU A N   1 
ATOM   354   C CA  . GLU A 1 73  ? 34.303  -9.415  14.113  1.00 32.69  ? 73   GLU A CA  1 
ATOM   355   C C   . GLU A 1 73  ? 34.729  -10.847 13.784  1.00 37.41  ? 73   GLU A C   1 
ATOM   356   O O   . GLU A 1 73  ? 34.311  -11.353 12.746  1.00 36.02  ? 73   GLU A O   1 
ATOM   357   C CB  . GLU A 1 73  ? 33.114  -9.428  15.118  1.00 33.17  ? 73   GLU A CB  1 
ATOM   358   C CG  . GLU A 1 73  ? 32.746  -8.098  15.772  1.00 43.32  ? 73   GLU A CG  1 
ATOM   359   C CD  . GLU A 1 73  ? 33.782  -7.429  16.656  1.00 67.03  ? 73   GLU A CD  1 
ATOM   360   O OE1 . GLU A 1 73  ? 34.666  -8.136  17.193  1.00 66.04  ? 73   GLU A OE1 1 
ATOM   361   O OE2 . GLU A 1 73  ? 33.696  -6.192  16.827  1.00 63.68  ? 73   GLU A OE2 1 
ATOM   362   N N   . PRO A 1 74  ? 35.495  -11.561 14.642  1.00 36.46  ? 74   PRO A N   1 
ATOM   363   C CA  . PRO A 1 74  ? 35.757  -12.984 14.362  1.00 36.99  ? 74   PRO A CA  1 
ATOM   364   C C   . PRO A 1 74  ? 34.441  -13.777 14.307  1.00 40.14  ? 74   PRO A C   1 
ATOM   365   O O   . PRO A 1 74  ? 33.481  -13.414 14.993  1.00 37.60  ? 74   PRO A O   1 
ATOM   366   C CB  . PRO A 1 74  ? 36.624  -13.420 15.552  1.00 39.75  ? 74   PRO A CB  1 
ATOM   367   C CG  . PRO A 1 74  ? 37.170  -12.158 16.126  1.00 43.98  ? 74   PRO A CG  1 
ATOM   368   C CD  . PRO A 1 74  ? 36.084  -11.163 15.939  1.00 38.17  ? 74   PRO A CD  1 
ATOM   369   N N   . SER A 1 75  ? 34.391  -14.841 13.486  1.00 38.73  ? 75   SER A N   1 
ATOM   370   C CA  . SER A 1 75  ? 33.215  -15.706 13.320  1.00 39.29  ? 75   SER A CA  1 
ATOM   371   C C   . SER A 1 75  ? 32.617  -16.212 14.656  1.00 45.65  ? 75   SER A C   1 
ATOM   372   O O   . SER A 1 75  ? 31.403  -16.375 14.751  1.00 44.64  ? 75   SER A O   1 
ATOM   373   C CB  . SER A 1 75  ? 33.567  -16.912 12.458  1.00 43.84  ? 75   SER A CB  1 
ATOM   374   O OG  . SER A 1 75  ? 33.684  -16.536 11.099  1.00 55.95  ? 75   SER A OG  1 
ATOM   375   N N   . ASP A 1 76  ? 33.463  -16.440 15.675  1.00 45.02  ? 76   ASP A N   1 
ATOM   376   C CA  . ASP A 1 76  ? 33.052  -16.959 16.982  1.00 46.13  ? 76   ASP A CA  1 
ATOM   377   C C   . ASP A 1 76  ? 32.443  -15.886 17.906  1.00 50.74  ? 76   ASP A C   1 
ATOM   378   O O   . ASP A 1 76  ? 32.070  -16.210 19.044  1.00 52.01  ? 76   ASP A O   1 
ATOM   379   C CB  . ASP A 1 76  ? 34.235  -17.659 17.695  1.00 50.20  ? 76   ASP A CB  1 
ATOM   380   C CG  . ASP A 1 76  ? 35.513  -16.840 17.799  1.00 68.24  ? 76   ASP A CG  1 
ATOM   381   O OD1 . ASP A 1 76  ? 35.558  -15.909 18.642  1.00 69.05  ? 76   ASP A OD1 1 
ATOM   382   O OD2 . ASP A 1 76  ? 36.478  -17.147 17.057  1.00 77.58  ? 76   ASP A OD2 1 
ATOM   383   N N   . ASN A 1 77  ? 32.329  -14.626 17.436  1.00 45.44  ? 77   ASN A N   1 
ATOM   384   C CA  . ASN A 1 77  ? 31.776  -13.541 18.247  1.00 43.68  ? 77   ASN A CA  1 
ATOM   385   C C   . ASN A 1 77  ? 30.261  -13.708 18.425  1.00 45.12  ? 77   ASN A C   1 
ATOM   386   O O   . ASN A 1 77  ? 29.514  -13.823 17.440  1.00 43.51  ? 77   ASN A O   1 
ATOM   387   C CB  . ASN A 1 77  ? 32.108  -12.171 17.651  1.00 42.29  ? 77   ASN A CB  1 
ATOM   388   C CG  . ASN A 1 77  ? 31.815  -11.011 18.569  1.00 54.02  ? 77   ASN A CG  1 
ATOM   389   O OD1 . ASN A 1 77  ? 30.814  -10.304 18.417  1.00 41.15  ? 77   ASN A OD1 1 
ATOM   390   N ND2 . ASN A 1 77  ? 32.701  -10.761 19.520  1.00 48.62  ? 77   ASN A ND2 1 
ATOM   391   N N   . GLY A 1 78  ? 29.853  -13.762 19.697  1.00 39.96  ? 78   GLY A N   1 
ATOM   392   C CA  . GLY A 1 78  ? 28.469  -13.892 20.130  1.00 38.08  ? 78   GLY A CA  1 
ATOM   393   C C   . GLY A 1 78  ? 27.616  -12.692 19.767  1.00 39.51  ? 78   GLY A C   1 
ATOM   394   O O   . GLY A 1 78  ? 26.628  -12.872 19.048  1.00 39.48  ? 78   GLY A O   1 
ATOM   395   N N   . PRO A 1 79  ? 27.971  -11.442 20.200  1.00 33.89  ? 79   PRO A N   1 
ATOM   396   C CA  . PRO A 1 79  ? 27.122  -10.281 19.877  1.00 32.15  ? 79   PRO A CA  1 
ATOM   397   C C   . PRO A 1 79  ? 26.956  -9.999  18.386  1.00 36.11  ? 79   PRO A C   1 
ATOM   398   O O   . PRO A 1 79  ? 25.869  -9.566  18.007  1.00 34.54  ? 79   PRO A O   1 
ATOM   399   C CB  . PRO A 1 79  ? 27.824  -9.114  20.580  1.00 33.77  ? 79   PRO A CB  1 
ATOM   400   C CG  . PRO A 1 79  ? 28.586  -9.749  21.681  1.00 38.79  ? 79   PRO A CG  1 
ATOM   401   C CD  . PRO A 1 79  ? 29.068  -11.041 21.110  1.00 35.46  ? 79   PRO A CD  1 
ATOM   402   N N   . LEU A 1 80  ? 27.985  -10.265 17.531  1.00 34.04  ? 80   LEU A N   1 
ATOM   403   C CA  . LEU A 1 80  ? 27.818  -10.024 16.096  1.00 32.96  ? 80   LEU A CA  1 
ATOM   404   C C   . LEU A 1 80  ? 26.791  -10.996 15.502  1.00 32.19  ? 80   LEU A C   1 
ATOM   405   O O   . LEU A 1 80  ? 26.030  -10.581 14.625  1.00 30.40  ? 80   LEU A O   1 
ATOM   406   C CB  . LEU A 1 80  ? 29.131  -10.065 15.306  1.00 34.84  ? 80   LEU A CB  1 
ATOM   407   C CG  . LEU A 1 80  ? 29.071  -9.308  13.939  1.00 40.35  ? 80   LEU A CG  1 
ATOM   408   C CD1 . LEU A 1 80  ? 29.241  -7.806  14.115  1.00 41.66  ? 80   LEU A CD1 1 
ATOM   409   C CD2 . LEU A 1 80  ? 30.104  -9.788  13.004  1.00 40.18  ? 80   LEU A CD2 1 
ATOM   410   N N   . PHE A 1 81  ? 26.737  -12.252 16.007  1.00 27.28  ? 81   PHE A N   1 
ATOM   411   C CA  . PHE A 1 81  ? 25.761  -13.250 15.579  1.00 26.56  ? 81   PHE A CA  1 
ATOM   412   C C   . PHE A 1 81  ? 24.340  -12.827 16.002  1.00 32.46  ? 81   PHE A C   1 
ATOM   413   O O   . PHE A 1 81  ? 23.413  -12.982 15.204  1.00 33.74  ? 81   PHE A O   1 
ATOM   414   C CB  . PHE A 1 81  ? 26.087  -14.658 16.119  1.00 28.73  ? 81   PHE A CB  1 
ATOM   415   C CG  . PHE A 1 81  ? 25.067  -15.704 15.697  1.00 29.42  ? 81   PHE A CG  1 
ATOM   416   C CD1 . PHE A 1 81  ? 25.133  -16.300 14.439  1.00 31.66  ? 81   PHE A CD1 1 
ATOM   417   C CD2 . PHE A 1 81  ? 23.994  -16.029 16.523  1.00 30.34  ? 81   PHE A CD2 1 
ATOM   418   C CE1 . PHE A 1 81  ? 24.158  -17.224 14.031  1.00 31.84  ? 81   PHE A CE1 1 
ATOM   419   C CE2 . PHE A 1 81  ? 23.029  -16.956 16.117  1.00 32.60  ? 81   PHE A CE2 1 
ATOM   420   C CZ  . PHE A 1 81  ? 23.113  -17.542 14.870  1.00 30.30  ? 81   PHE A CZ  1 
ATOM   421   N N   . THR A 1 82  ? 24.172  -12.322 17.247  1.00 27.60  ? 82   THR A N   1 
ATOM   422   C CA  . THR A 1 82  ? 22.900  -11.837 17.788  1.00 25.73  ? 82   THR A CA  1 
ATOM   423   C C   . THR A 1 82  ? 22.433  -10.637 16.960  1.00 27.66  ? 82   THR A C   1 
ATOM   424   O O   . THR A 1 82  ? 21.264  -10.580 16.585  1.00 27.26  ? 82   THR A O   1 
ATOM   425   C CB  . THR A 1 82  ? 23.053  -11.469 19.284  1.00 31.38  ? 82   THR A CB  1 
ATOM   426   O OG1 . THR A 1 82  ? 23.450  -12.638 19.993  1.00 30.97  ? 82   THR A OG1 1 
ATOM   427   C CG2 . THR A 1 82  ? 21.749  -10.874 19.924  1.00 30.84  ? 82   THR A CG2 1 
ATOM   428   N N   . GLU A 1 83  ? 23.351  -9.688  16.676  1.00 23.04  ? 83   GLU A N   1 
ATOM   429   C CA  . GLU A 1 83  ? 23.066  -8.475  15.914  1.00 22.15  ? 83   GLU A CA  1 
ATOM   430   C C   . GLU A 1 83  ? 22.692  -8.808  14.473  1.00 26.51  ? 83   GLU A C   1 
ATOM   431   O O   . GLU A 1 83  ? 21.727  -8.245  13.959  1.00 25.86  ? 83   GLU A O   1 
ATOM   432   C CB  . GLU A 1 83  ? 24.254  -7.516  15.956  1.00 23.19  ? 83   GLU A CB  1 
ATOM   433   C CG  . GLU A 1 83  ? 23.893  -6.131  15.462  1.00 27.43  ? 83   GLU A CG  1 
ATOM   434   C CD  . GLU A 1 83  ? 24.883  -5.046  15.805  1.00 41.45  ? 83   GLU A CD  1 
ATOM   435   O OE1 . GLU A 1 83  ? 26.098  -5.276  15.618  1.00 41.22  ? 83   GLU A OE1 1 
ATOM   436   O OE2 . GLU A 1 83  ? 24.442  -3.952  16.225  1.00 36.32  ? 83   GLU A OE2 1 
ATOM   437   N N   . LEU A 1 84  ? 23.439  -9.741  13.836  1.00 23.83  ? 84   LEU A N   1 
ATOM   438   C CA  . LEU A 1 84  ? 23.186  -10.188 12.473  1.00 22.79  ? 84   LEU A CA  1 
ATOM   439   C C   . LEU A 1 84  ? 21.806  -10.844 12.369  1.00 26.05  ? 84   LEU A C   1 
ATOM   440   O O   . LEU A 1 84  ? 21.068  -10.554 11.428  1.00 25.09  ? 84   LEU A O   1 
ATOM   441   C CB  . LEU A 1 84  ? 24.295  -11.133 11.970  1.00 22.72  ? 84   LEU A CB  1 
ATOM   442   C CG  . LEU A 1 84  ? 24.204  -11.609 10.504  1.00 25.99  ? 84   LEU A CG  1 
ATOM   443   C CD1 . LEU A 1 84  ? 23.931  -10.465 9.530   1.00 24.05  ? 84   LEU A CD1 1 
ATOM   444   C CD2 . LEU A 1 84  ? 25.432  -12.364 10.118  1.00 26.94  ? 84   LEU A CD2 1 
ATOM   445   N N   . LYS A 1 85  ? 21.454  -11.696 13.342  1.00 23.39  ? 85   LYS A N   1 
ATOM   446   C CA  . LYS A 1 85  ? 20.163  -12.378 13.389  1.00 23.20  ? 85   LYS A CA  1 
ATOM   447   C C   . LYS A 1 85  ? 19.021  -11.373 13.505  1.00 26.87  ? 85   LYS A C   1 
ATOM   448   O O   . LYS A 1 85  ? 18.042  -11.531 12.785  1.00 26.95  ? 85   LYS A O   1 
ATOM   449   C CB  . LYS A 1 85  ? 20.098  -13.415 14.527  1.00 25.71  ? 85   LYS A CB  1 
ATOM   450   C CG  . LYS A 1 85  ? 20.769  -14.769 14.212  1.00 26.15  ? 85   LYS A CG  1 
ATOM   451   C CD  . LYS A 1 85  ? 20.528  -15.336 12.793  1.00 36.96  ? 85   LYS A CD  1 
ATOM   452   C CE  . LYS A 1 85  ? 19.100  -15.746 12.495  1.00 38.59  ? 85   LYS A CE  1 
ATOM   453   N NZ  . LYS A 1 85  ? 18.850  -15.780 11.035  1.00 51.37  ? 85   LYS A NZ  1 
ATOM   454   N N   . PHE A 1 86  ? 19.173  -10.305 14.331  1.00 23.08  ? 86   PHE A N   1 
ATOM   455   C CA  . PHE A 1 86  ? 18.156  -9.256  14.466  1.00 22.16  ? 86   PHE A CA  1 
ATOM   456   C C   . PHE A 1 86  ? 17.908  -8.572  13.111  1.00 25.84  ? 86   PHE A C   1 
ATOM   457   O O   . PHE A 1 86  ? 16.760  -8.441  12.693  1.00 25.46  ? 86   PHE A O   1 
ATOM   458   C CB  . PHE A 1 86  ? 18.539  -8.196  15.537  1.00 23.13  ? 86   PHE A CB  1 
ATOM   459   C CG  . PHE A 1 86  ? 17.736  -6.919  15.382  1.00 23.57  ? 86   PHE A CG  1 
ATOM   460   C CD1 . PHE A 1 86  ? 16.444  -6.824  15.898  1.00 25.41  ? 86   PHE A CD1 1 
ATOM   461   C CD2 . PHE A 1 86  ? 18.246  -5.841  14.654  1.00 24.05  ? 86   PHE A CD2 1 
ATOM   462   C CE1 . PHE A 1 86  ? 15.675  -5.676  15.680  1.00 26.18  ? 86   PHE A CE1 1 
ATOM   463   C CE2 . PHE A 1 86  ? 17.486  -4.695  14.440  1.00 26.22  ? 86   PHE A CE2 1 
ATOM   464   C CZ  . PHE A 1 86  ? 16.201  -4.620  14.943  1.00 24.87  ? 86   PHE A CZ  1 
ATOM   465   N N   . TYR A 1 87  ? 18.989  -8.101  12.464  1.00 23.16  ? 87   TYR A N   1 
ATOM   466   C CA  . TYR A 1 87  ? 18.966  -7.381  11.185  1.00 22.72  ? 87   TYR A CA  1 
ATOM   467   C C   . TYR A 1 87  ? 18.406  -8.247  10.044  1.00 24.33  ? 87   TYR A C   1 
ATOM   468   O O   . TYR A 1 87  ? 17.621  -7.745  9.234   1.00 22.97  ? 87   TYR A O   1 
ATOM   469   C CB  . TYR A 1 87  ? 20.363  -6.836  10.814  1.00 24.30  ? 87   TYR A CB  1 
ATOM   470   C CG  . TYR A 1 87  ? 20.688  -5.524  11.493  1.00 27.41  ? 87   TYR A CG  1 
ATOM   471   C CD1 . TYR A 1 87  ? 21.669  -5.446  12.476  1.00 28.75  ? 87   TYR A CD1 1 
ATOM   472   C CD2 . TYR A 1 87  ? 19.999  -4.362  11.173  1.00 29.67  ? 87   TYR A CD2 1 
ATOM   473   C CE1 . TYR A 1 87  ? 21.951  -4.243  13.127  1.00 27.97  ? 87   TYR A CE1 1 
ATOM   474   C CE2 . TYR A 1 87  ? 20.271  -3.156  11.820  1.00 30.94  ? 87   TYR A CE2 1 
ATOM   475   C CZ  . TYR A 1 87  ? 21.251  -3.100  12.793  1.00 34.25  ? 87   TYR A CZ  1 
ATOM   476   O OH  . TYR A 1 87  ? 21.523  -1.903  13.401  1.00 32.80  ? 87   TYR A OH  1 
ATOM   477   N N   . GLN A 1 88  ? 18.772  -9.538  9.998   1.00 19.80  ? 88   GLN A N   1 
ATOM   478   C CA  . GLN A 1 88  ? 18.273  -10.469 8.990   1.00 19.34  ? 88   GLN A CA  1 
ATOM   479   C C   . GLN A 1 88  ? 16.786  -10.730 9.151   1.00 25.89  ? 88   GLN A C   1 
ATOM   480   O O   . GLN A 1 88  ? 16.079  -10.831 8.148   1.00 27.96  ? 88   GLN A O   1 
ATOM   481   C CB  . GLN A 1 88  ? 19.024  -11.795 9.058   1.00 20.42  ? 88   GLN A CB  1 
ATOM   482   C CG  . GLN A 1 88  ? 20.368  -11.759 8.353   1.00 28.99  ? 88   GLN A CG  1 
ATOM   483   C CD  . GLN A 1 88  ? 21.021  -13.108 8.296   1.00 38.77  ? 88   GLN A CD  1 
ATOM   484   O OE1 . GLN A 1 88  ? 20.665  -14.053 9.011   1.00 34.52  ? 88   GLN A OE1 1 
ATOM   485   N NE2 . GLN A 1 88  ? 22.008  -13.221 7.447   1.00 34.49  ? 88   GLN A NE2 1 
ATOM   486   N N   . ARG A 1 89  ? 16.311  -10.841 10.406  1.00 22.77  ? 89   ARG A N   1 
ATOM   487   C CA  . ARG A 1 89  ? 14.919  -11.135 10.740  1.00 23.00  ? 89   ARG A CA  1 
ATOM   488   C C   . ARG A 1 89  ? 13.995  -9.926  10.690  1.00 27.50  ? 89   ARG A C   1 
ATOM   489   O O   . ARG A 1 89  ? 12.851  -10.067 10.256  1.00 26.62  ? 89   ARG A O   1 
ATOM   490   C CB  . ARG A 1 89  ? 14.815  -11.747 12.159  1.00 21.85  ? 89   ARG A CB  1 
ATOM   491   C CG  . ARG A 1 89  ? 15.415  -13.137 12.273  1.00 30.34  ? 89   ARG A CG  1 
ATOM   492   C CD  . ARG A 1 89  ? 14.895  -13.931 13.440  1.00 24.86  ? 89   ARG A CD  1 
ATOM   493   N NE  . ARG A 1 89  ? 15.765  -13.855 14.595  1.00 31.50  ? 89   ARG A NE  1 
ATOM   494   C CZ  . ARG A 1 89  ? 16.343  -14.895 15.183  1.00 40.34  ? 89   ARG A CZ  1 
ATOM   495   N NH1 . ARG A 1 89  ? 16.176  -16.120 14.699  1.00 22.14  ? 89   ARG A NH1 1 
ATOM   496   N NH2 . ARG A 1 89  ? 17.086  -14.721 16.258  1.00 28.88  ? 89   ARG A NH2 1 
ATOM   497   N N   . ALA A 1 90  ? 14.450  -8.772  11.202  1.00 26.09  ? 90   ALA A N   1 
ATOM   498   C CA  . ALA A 1 90  ? 13.603  -7.598  11.400  1.00 26.55  ? 90   ALA A CA  1 
ATOM   499   C C   . ALA A 1 90  ? 14.001  -6.339  10.611  1.00 32.10  ? 90   ALA A C   1 
ATOM   500   O O   . ALA A 1 90  ? 13.197  -5.419  10.580  1.00 31.98  ? 90   ALA A O   1 
ATOM   501   C CB  . ALA A 1 90  ? 13.573  -7.260  12.898  1.00 26.63  ? 90   ALA A CB  1 
ATOM   502   N N   . ALA A 1 91  ? 15.199  -6.266  9.995   1.00 29.13  ? 91   ALA A N   1 
ATOM   503   C CA  . ALA A 1 91  ? 15.612  -5.033  9.338   1.00 28.89  ? 91   ALA A CA  1 
ATOM   504   C C   . ALA A 1 91  ? 15.948  -5.170  7.839   1.00 35.77  ? 91   ALA A C   1 
ATOM   505   O O   . ALA A 1 91  ? 16.829  -4.457  7.322   1.00 36.12  ? 91   ALA A O   1 
ATOM   506   C CB  . ALA A 1 91  ? 16.791  -4.433  10.078  1.00 29.12  ? 91   ALA A CB  1 
ATOM   507   N N   . LYS A 1 92  ? 15.199  -6.017  7.118   1.00 31.86  ? 92   LYS A N   1 
ATOM   508   C CA  . LYS A 1 92  ? 15.383  -6.139  5.667   1.00 30.98  ? 92   LYS A CA  1 
ATOM   509   C C   . LYS A 1 92  ? 14.835  -4.856  5.020   1.00 33.72  ? 92   LYS A C   1 
ATOM   510   O O   . LYS A 1 92  ? 13.790  -4.391  5.468   1.00 33.34  ? 92   LYS A O   1 
ATOM   511   C CB  . LYS A 1 92  ? 14.692  -7.390  5.114   1.00 33.74  ? 92   LYS A CB  1 
ATOM   512   C CG  . LYS A 1 92  ? 15.302  -8.701  5.596   1.00 43.88  ? 92   LYS A CG  1 
ATOM   513   C CD  . LYS A 1 92  ? 14.546  -9.921  5.044   1.00 52.68  ? 92   LYS A CD  1 
ATOM   514   C CE  . LYS A 1 92  ? 13.261  -10.267 5.777   1.00 56.28  ? 92   LYS A CE  1 
ATOM   515   N NZ  . LYS A 1 92  ? 13.511  -10.807 7.142   1.00 56.80  ? 92   LYS A NZ  1 
ATOM   516   N N   . PRO A 1 93  ? 15.535  -4.219  4.042   1.00 29.82  ? 93   PRO A N   1 
ATOM   517   C CA  . PRO A 1 93  ? 15.051  -2.931  3.494   1.00 29.93  ? 93   PRO A CA  1 
ATOM   518   C C   . PRO A 1 93  ? 13.570  -2.886  3.100   1.00 33.85  ? 93   PRO A C   1 
ATOM   519   O O   . PRO A 1 93  ? 12.915  -1.896  3.419   1.00 33.88  ? 93   PRO A O   1 
ATOM   520   C CB  . PRO A 1 93  ? 15.953  -2.718  2.271   1.00 31.69  ? 93   PRO A CB  1 
ATOM   521   C CG  . PRO A 1 93  ? 17.229  -3.377  2.654   1.00 34.68  ? 93   PRO A CG  1 
ATOM   522   C CD  . PRO A 1 93  ? 16.816  -4.610  3.410   1.00 29.89  ? 93   PRO A CD  1 
ATOM   523   N N   . GLU A 1 94  ? 13.043  -3.936  2.433   1.00 30.98  ? 94   GLU A N   1 
ATOM   524   C CA  . GLU A 1 94  ? 11.640  -3.993  1.996   1.00 31.77  ? 94   GLU A CA  1 
ATOM   525   C C   . GLU A 1 94  ? 10.680  -4.139  3.194   1.00 32.65  ? 94   GLU A C   1 
ATOM   526   O O   . GLU A 1 94  ? 9.571   -3.606  3.136   1.00 32.56  ? 94   GLU A O   1 
ATOM   527   C CB  . GLU A 1 94  ? 11.408  -5.105  0.932   1.00 34.11  ? 94   GLU A CB  1 
ATOM   528   C CG  . GLU A 1 94  ? 11.425  -6.556  1.424   1.00 50.69  ? 94   GLU A CG  1 
ATOM   529   C CD  . GLU A 1 94  ? 12.750  -7.201  1.806   1.00 72.96  ? 94   GLU A CD  1 
ATOM   530   O OE1 . GLU A 1 94  ? 13.821  -6.581  1.598   1.00 52.99  ? 94   GLU A OE1 1 
ATOM   531   O OE2 . GLU A 1 94  ? 12.712  -8.373  2.252   1.00 69.18  ? 94   GLU A OE2 1 
ATOM   532   N N   . GLN A 1 95  ? 11.119  -4.830  4.273   1.00 27.95  ? 95   GLN A N   1 
ATOM   533   C CA  . GLN A 1 95  ? 10.375  -5.017  5.531   1.00 27.72  ? 95   GLN A CA  1 
ATOM   534   C C   . GLN A 1 95  ? 10.098  -3.673  6.194   1.00 33.00  ? 95   GLN A C   1 
ATOM   535   O O   . GLN A 1 95  ? 8.973   -3.422  6.627   1.00 34.04  ? 95   GLN A O   1 
ATOM   536   C CB  . GLN A 1 95  ? 11.202  -5.889  6.480   1.00 27.98  ? 95   GLN A CB  1 
ATOM   537   C CG  . GLN A 1 95  ? 10.434  -6.696  7.521   1.00 38.09  ? 95   GLN A CG  1 
ATOM   538   C CD  . GLN A 1 95  ? 11.342  -7.715  8.160   1.00 44.17  ? 95   GLN A CD  1 
ATOM   539   O OE1 . GLN A 1 95  ? 12.569  -7.723  7.948   1.00 35.60  ? 95   GLN A OE1 1 
ATOM   540   N NE2 . GLN A 1 95  ? 10.753  -8.602  8.946   1.00 32.47  ? 95   GLN A NE2 1 
ATOM   541   N N   . ILE A 1 96  ? 11.131  -2.802  6.248   1.00 29.98  ? 96   ILE A N   1 
ATOM   542   C CA  . ILE A 1 96  ? 11.090  -1.474  6.862   1.00 30.00  ? 96   ILE A CA  1 
ATOM   543   C C   . ILE A 1 96  ? 10.215  -0.540  6.014   1.00 35.44  ? 96   ILE A C   1 
ATOM   544   O O   . ILE A 1 96  ? 9.350   0.138   6.574   1.00 37.37  ? 96   ILE A O   1 
ATOM   545   C CB  . ILE A 1 96  ? 12.539  -0.948  7.088   1.00 32.34  ? 96   ILE A CB  1 
ATOM   546   C CG1 . ILE A 1 96  ? 13.204  -1.728  8.249   1.00 31.16  ? 96   ILE A CG1 1 
ATOM   547   C CG2 . ILE A 1 96  ? 12.579  0.568   7.354   1.00 33.54  ? 96   ILE A CG2 1 
ATOM   548   C CD1 . ILE A 1 96  ? 14.712  -1.523  8.415   1.00 34.19  ? 96   ILE A CD1 1 
ATOM   549   N N   . GLN A 1 97  ? 10.409  -0.537  4.683   1.00 30.58  ? 97   GLN A N   1 
ATOM   550   C CA  . GLN A 1 97  ? 9.659   0.311   3.755   1.00 31.67  ? 97   GLN A CA  1 
ATOM   551   C C   . GLN A 1 97  ? 8.169   -0.014  3.746   1.00 36.10  ? 97   GLN A C   1 
ATOM   552   O O   . GLN A 1 97  ? 7.364   0.914   3.686   1.00 36.19  ? 97   GLN A O   1 
ATOM   553   C CB  . GLN A 1 97  ? 10.232  0.241   2.323   1.00 33.35  ? 97   GLN A CB  1 
ATOM   554   C CG  . GLN A 1 97  ? 11.536  1.039   2.131   1.00 42.44  ? 97   GLN A CG  1 
ATOM   555   C CD  . GLN A 1 97  ? 11.506  2.474   2.634   1.00 55.88  ? 97   GLN A CD  1 
ATOM   556   O OE1 . GLN A 1 97  ? 12.378  2.895   3.403   1.00 45.39  ? 97   GLN A OE1 1 
ATOM   557   N NE2 . GLN A 1 97  ? 10.500  3.256   2.236   1.00 52.12  ? 97   GLN A NE2 1 
ATOM   558   N N   . LYS A 1 98  ? 7.797   -1.309  3.822   1.00 32.97  ? 98   LYS A N   1 
ATOM   559   C CA  . LYS A 1 98  ? 6.396   -1.740  3.879   1.00 33.78  ? 98   LYS A CA  1 
ATOM   560   C C   . LYS A 1 98  ? 5.737   -1.182  5.155   1.00 38.23  ? 98   LYS A C   1 
ATOM   561   O O   . LYS A 1 98  ? 4.630   -0.659  5.076   1.00 40.33  ? 98   LYS A O   1 
ATOM   562   C CB  . LYS A 1 98  ? 6.294   -3.272  3.824   1.00 36.09  ? 98   LYS A CB  1 
ATOM   563   C CG  . LYS A 1 98  ? 4.882   -3.798  3.588   1.00 49.76  ? 98   LYS A CG  1 
ATOM   564   C CD  . LYS A 1 98  ? 4.906   -5.285  3.246   1.00 62.22  ? 98   LYS A CD  1 
ATOM   565   C CE  . LYS A 1 98  ? 3.556   -5.939  3.416   1.00 75.98  ? 98   LYS A CE  1 
ATOM   566   N NZ  . LYS A 1 98  ? 3.389   -6.495  4.785   1.00 87.17  ? 98   LYS A NZ  1 
ATOM   567   N N   . TRP A 1 99  ? 6.449   -1.231  6.305   1.00 33.14  ? 99   TRP A N   1 
ATOM   568   C CA  . TRP A 1 99  ? 5.997   -0.703  7.598   1.00 32.45  ? 99   TRP A CA  1 
ATOM   569   C C   . TRP A 1 99  ? 5.841   0.821   7.539   1.00 36.51  ? 99   TRP A C   1 
ATOM   570   O O   . TRP A 1 99  ? 4.834   1.331   8.027   1.00 36.08  ? 99   TRP A O   1 
ATOM   571   C CB  . TRP A 1 99  ? 6.979   -1.097  8.712   1.00 29.67  ? 99   TRP A CB  1 
ATOM   572   C CG  . TRP A 1 99  ? 6.578   -0.644  10.094  1.00 30.10  ? 99   TRP A CG  1 
ATOM   573   C CD1 . TRP A 1 99  ? 6.835   0.569   10.665  1.00 32.92  ? 99   TRP A CD1 1 
ATOM   574   C CD2 . TRP A 1 99  ? 5.919   -1.429  11.099  1.00 29.70  ? 99   TRP A CD2 1 
ATOM   575   N NE1 . TRP A 1 99  ? 6.359   0.597   11.955  1.00 32.74  ? 99   TRP A NE1 1 
ATOM   576   C CE2 . TRP A 1 99  ? 5.816   -0.624  12.259  1.00 33.79  ? 99   TRP A CE2 1 
ATOM   577   C CE3 . TRP A 1 99  ? 5.437   -2.746  11.148  1.00 30.89  ? 99   TRP A CE3 1 
ATOM   578   C CZ2 . TRP A 1 99  ? 5.216   -1.078  13.440  1.00 32.99  ? 99   TRP A CZ2 1 
ATOM   579   C CZ3 . TRP A 1 99  ? 4.856   -3.200  12.326  1.00 32.15  ? 99   TRP A CZ3 1 
ATOM   580   C CH2 . TRP A 1 99  ? 4.760   -2.374  13.456  1.00 32.80  ? 99   TRP A CH2 1 
ATOM   581   N N   . ILE A 1 100 ? 6.844   1.543   6.976   1.00 32.82  ? 100  ILE A N   1 
ATOM   582   C CA  . ILE A 1 100 ? 6.829   3.005   6.838   1.00 33.30  ? 100  ILE A CA  1 
ATOM   583   C C   . ILE A 1 100 ? 5.561   3.414   6.080   1.00 40.94  ? 100  ILE A C   1 
ATOM   584   O O   . ILE A 1 100 ? 4.830   4.281   6.544   1.00 42.61  ? 100  ILE A O   1 
ATOM   585   C CB  . ILE A 1 100 ? 8.130   3.516   6.141   1.00 35.12  ? 100  ILE A CB  1 
ATOM   586   C CG1 . ILE A 1 100 ? 9.332   3.459   7.098   1.00 32.93  ? 100  ILE A CG1 1 
ATOM   587   C CG2 . ILE A 1 100 ? 7.960   4.925   5.540   1.00 36.49  ? 100  ILE A CG2 1 
ATOM   588   C CD1 . ILE A 1 100 ? 10.708  3.627   6.398   1.00 29.22  ? 100  ILE A CD1 1 
ATOM   589   N N   . ARG A 1 101 ? 5.288   2.740   4.954   1.00 38.64  ? 101  ARG A N   1 
ATOM   590   C CA  . ARG A 1 101 ? 4.143   2.958   4.068   1.00 40.45  ? 101  ARG A CA  1 
ATOM   591   C C   . ARG A 1 101 ? 2.808   2.725   4.781   1.00 46.17  ? 101  ARG A C   1 
ATOM   592   O O   . ARG A 1 101 ? 1.973   3.627   4.821   1.00 47.80  ? 101  ARG A O   1 
ATOM   593   C CB  . ARG A 1 101 ? 4.255   2.023   2.864   1.00 40.61  ? 101  ARG A CB  1 
ATOM   594   C CG  . ARG A 1 101 ? 3.958   2.684   1.537   1.00 57.97  ? 101  ARG A CG  1 
ATOM   595   C CD  . ARG A 1 101 ? 3.629   1.680   0.434   1.00 73.30  ? 101  ARG A CD  1 
ATOM   596   N NE  . ARG A 1 101 ? 4.572   0.559   0.360   1.00 78.31  ? 101  ARG A NE  1 
ATOM   597   C CZ  . ARG A 1 101 ? 4.241   -0.721  0.518   1.00 92.27  ? 101  ARG A CZ  1 
ATOM   598   N NH1 . ARG A 1 101 ? 2.980   -1.067  0.764   1.00 82.19  ? 101  ARG A NH1 1 
ATOM   599   N NH2 . ARG A 1 101 ? 5.169   -1.667  0.431   1.00 71.81  ? 101  ARG A NH2 1 
ATOM   600   N N   . THR A 1 102 ? 2.628   1.530   5.361   1.00 42.59  ? 102  THR A N   1 
ATOM   601   C CA  . THR A 1 102 ? 1.414   1.088   6.059   1.00 43.33  ? 102  THR A CA  1 
ATOM   602   C C   . THR A 1 102 ? 1.100   1.964   7.295   1.00 46.84  ? 102  THR A C   1 
ATOM   603   O O   . THR A 1 102 ? -0.053  2.366   7.457   1.00 48.64  ? 102  THR A O   1 
ATOM   604   C CB  . THR A 1 102 ? 1.523   -0.408  6.433   1.00 52.62  ? 102  THR A CB  1 
ATOM   605   O OG1 . THR A 1 102 ? 2.763   -0.649  7.097   1.00 55.00  ? 102  THR A OG1 1 
ATOM   606   C CG2 . THR A 1 102 ? 1.423   -1.335  5.210   1.00 49.14  ? 102  THR A CG2 1 
ATOM   607   N N   . ARG A 1 103 ? 2.119   2.295   8.124   1.00 40.82  ? 103  ARG A N   1 
ATOM   608   C CA  . ARG A 1 103 ? 1.987   3.126   9.333   1.00 39.77  ? 103  ARG A CA  1 
ATOM   609   C C   . ARG A 1 103 ? 1.996   4.636   9.012   1.00 45.22  ? 103  ARG A C   1 
ATOM   610   O O   . ARG A 1 103 ? 1.835   5.450   9.925   1.00 45.21  ? 103  ARG A O   1 
ATOM   611   C CB  . ARG A 1 103 ? 3.104   2.815   10.360  1.00 36.36  ? 103  ARG A CB  1 
ATOM   612   C CG  . ARG A 1 103 ? 3.159   1.390   10.932  1.00 43.91  ? 103  ARG A CG  1 
ATOM   613   C CD  . ARG A 1 103 ? 1.815   0.846   11.341  1.00 53.89  ? 103  ARG A CD  1 
ATOM   614   N NE  . ARG A 1 103 ? 1.879   -0.284  12.266  1.00 64.57  ? 103  ARG A NE  1 
ATOM   615   C CZ  . ARG A 1 103 ? 1.748   -0.178  13.590  1.00 76.99  ? 103  ARG A CZ  1 
ATOM   616   N NH1 . ARG A 1 103 ? 1.648   1.017   14.163  1.00 57.76  ? 103  ARG A NH1 1 
ATOM   617   N NH2 . ARG A 1 103 ? 1.770   -1.262  14.354  1.00 66.12  ? 103  ARG A NH2 1 
ATOM   618   N N   . LYS A 1 104 ? 2.178   5.003   7.723   1.00 43.01  ? 104  LYS A N   1 
ATOM   619   C CA  . LYS A 1 104 ? 2.205   6.385   7.201   1.00 44.03  ? 104  LYS A CA  1 
ATOM   620   C C   . LYS A 1 104 ? 3.269   7.249   7.944   1.00 46.15  ? 104  LYS A C   1 
ATOM   621   O O   . LYS A 1 104 ? 2.990   8.384   8.337   1.00 47.35  ? 104  LYS A O   1 
ATOM   622   C CB  . LYS A 1 104 ? 0.800   7.055   7.256   1.00 48.54  ? 104  LYS A CB  1 
ATOM   623   C CG  . LYS A 1 104 ? -0.367  6.200   6.771   1.00 59.47  ? 104  LYS A CG  1 
ATOM   624   C CD  . LYS A 1 104 ? -0.856  6.572   5.397   1.00 71.71  ? 104  LYS A CD  1 
ATOM   625   C CE  . LYS A 1 104 ? -1.745  5.479   4.857   1.00 83.80  ? 104  LYS A CE  1 
ATOM   626   N NZ  . LYS A 1 104 ? -0.982  4.405   4.158   1.00 86.80  ? 104  LYS A NZ  1 
ATOM   627   N N   . LEU A 1 105 ? 4.478   6.691   8.138   1.00 39.15  ? 105  LEU A N   1 
ATOM   628   C CA  . LEU A 1 105 ? 5.602   7.367   8.804   1.00 36.74  ? 105  LEU A CA  1 
ATOM   629   C C   . LEU A 1 105 ? 6.449   8.116   7.785   1.00 42.04  ? 105  LEU A C   1 
ATOM   630   O O   . LEU A 1 105 ? 6.458   7.742   6.607   1.00 42.41  ? 105  LEU A O   1 
ATOM   631   C CB  . LEU A 1 105 ? 6.491   6.354   9.556   1.00 34.22  ? 105  LEU A CB  1 
ATOM   632   C CG  . LEU A 1 105 ? 5.837   5.376   10.527  1.00 36.46  ? 105  LEU A CG  1 
ATOM   633   C CD1 . LEU A 1 105 ? 6.819   4.299   10.934  1.00 33.92  ? 105  LEU A CD1 1 
ATOM   634   C CD2 . LEU A 1 105 ? 5.290   6.092   11.752  1.00 38.38  ? 105  LEU A CD2 1 
ATOM   635   N N   . LYS A 1 106 ? 7.179   9.158   8.230   1.00 38.37  ? 106  LYS A N   1 
ATOM   636   C CA  . LYS A 1 106 ? 8.082   9.914   7.354   1.00 38.34  ? 106  LYS A CA  1 
ATOM   637   C C   . LYS A 1 106 ? 9.340   9.078   7.107   1.00 40.65  ? 106  LYS A C   1 
ATOM   638   O O   . LYS A 1 106 ? 9.867   9.049   5.990   1.00 42.06  ? 106  LYS A O   1 
ATOM   639   C CB  . LYS A 1 106 ? 8.428   11.284  7.954   1.00 41.68  ? 106  LYS A CB  1 
ATOM   640   C CG  . LYS A 1 106 ? 7.299   12.311  7.810   1.00 66.94  ? 106  LYS A CG  1 
ATOM   641   C CD  . LYS A 1 106 ? 7.697   13.649  8.400   1.00 83.17  ? 106  LYS A CD  1 
ATOM   642   C CE  . LYS A 1 106 ? 6.593   14.675  8.370   1.00 97.49  ? 106  LYS A CE  1 
ATOM   643   N NZ  . LYS A 1 106 ? 6.991   15.910  9.101   1.00 105.66 ? 106  LYS A NZ  1 
ATOM   644   N N   . TYR A 1 107 ? 9.777   8.352   8.150   1.00 34.09  ? 107  TYR A N   1 
ATOM   645   C CA  . TYR A 1 107 ? 10.928  7.450   8.156   1.00 31.85  ? 107  TYR A CA  1 
ATOM   646   C C   . TYR A 1 107 ? 10.804  6.506   9.371   1.00 32.18  ? 107  TYR A C   1 
ATOM   647   O O   . TYR A 1 107 ? 9.882   6.651   10.164  1.00 31.00  ? 107  TYR A O   1 
ATOM   648   C CB  . TYR A 1 107 ? 12.248  8.276   8.185   1.00 32.50  ? 107  TYR A CB  1 
ATOM   649   C CG  . TYR A 1 107 ? 12.753  8.599   9.576   1.00 33.11  ? 107  TYR A CG  1 
ATOM   650   C CD1 . TYR A 1 107 ? 13.849  7.935   10.107  1.00 34.13  ? 107  TYR A CD1 1 
ATOM   651   C CD2 . TYR A 1 107 ? 12.117  9.551   10.371  1.00 33.74  ? 107  TYR A CD2 1 
ATOM   652   C CE1 . TYR A 1 107 ? 14.304  8.208   11.392  1.00 34.93  ? 107  TYR A CE1 1 
ATOM   653   C CE2 . TYR A 1 107 ? 12.549  9.813   11.669  1.00 34.19  ? 107  TYR A CE2 1 
ATOM   654   C CZ  . TYR A 1 107 ? 13.645  9.144   12.175  1.00 41.10  ? 107  TYR A CZ  1 
ATOM   655   O OH  . TYR A 1 107 ? 14.083  9.419   13.450  1.00 40.51  ? 107  TYR A OH  1 
ATOM   656   N N   . LEU A 1 108 ? 11.728  5.539   9.504   1.00 27.26  ? 108  LEU A N   1 
ATOM   657   C CA  . LEU A 1 108 ? 11.803  4.637   10.646  1.00 26.00  ? 108  LEU A CA  1 
ATOM   658   C C   . LEU A 1 108 ? 13.271  4.519   11.051  1.00 28.87  ? 108  LEU A C   1 
ATOM   659   O O   . LEU A 1 108 ? 14.108  4.143   10.235  1.00 29.43  ? 108  LEU A O   1 
ATOM   660   C CB  . LEU A 1 108 ? 11.165  3.259   10.362  1.00 25.77  ? 108  LEU A CB  1 
ATOM   661   C CG  . LEU A 1 108 ? 11.219  2.233   11.509  1.00 28.59  ? 108  LEU A CG  1 
ATOM   662   C CD1 . LEU A 1 108 ? 10.233  2.566   12.621  1.00 28.39  ? 108  LEU A CD1 1 
ATOM   663   C CD2 . LEU A 1 108 ? 11.004  0.849   10.989  1.00 29.49  ? 108  LEU A CD2 1 
ATOM   664   N N   . GLY A 1 109 ? 13.565  4.848   12.296  1.00 23.61  ? 109  GLY A N   1 
ATOM   665   C CA  . GLY A 1 109 ? 14.924  4.840   12.820  1.00 23.25  ? 109  GLY A CA  1 
ATOM   666   C C   . GLY A 1 109 ? 15.558  3.499   13.110  1.00 25.82  ? 109  GLY A C   1 
ATOM   667   O O   . GLY A 1 109 ? 16.327  3.378   14.065  1.00 25.53  ? 109  GLY A O   1 
ATOM   668   N N   . VAL A 1 110 ? 15.262  2.495   12.288  1.00 23.10  ? 110  VAL A N   1 
ATOM   669   C CA  . VAL A 1 110 ? 15.874  1.167   12.363  1.00 22.31  ? 110  VAL A CA  1 
ATOM   670   C C   . VAL A 1 110 ? 16.893  1.112   11.210  1.00 28.16  ? 110  VAL A C   1 
ATOM   671   O O   . VAL A 1 110 ? 16.503  1.356   10.060  1.00 28.80  ? 110  VAL A O   1 
ATOM   672   C CB  . VAL A 1 110 ? 14.843  0.009   12.315  1.00 25.70  ? 110  VAL A CB  1 
ATOM   673   C CG1 . VAL A 1 110 ? 15.538  -1.346  12.296  1.00 24.41  ? 110  VAL A CG1 1 
ATOM   674   C CG2 . VAL A 1 110 ? 13.876  0.091   13.494  1.00 25.80  ? 110  VAL A CG2 1 
ATOM   675   N N   . PRO A 1 111 ? 18.200  0.875   11.480  1.00 23.27  ? 111  PRO A N   1 
ATOM   676   C CA  . PRO A 1 111 ? 19.182  0.861   10.376  1.00 22.84  ? 111  PRO A CA  1 
ATOM   677   C C   . PRO A 1 111 ? 18.924  -0.287  9.411   1.00 26.50  ? 111  PRO A C   1 
ATOM   678   O O   . PRO A 1 111 ? 18.489  -1.347  9.836   1.00 24.81  ? 111  PRO A O   1 
ATOM   679   C CB  . PRO A 1 111 ? 20.529  0.710   11.096  1.00 24.63  ? 111  PRO A CB  1 
ATOM   680   C CG  . PRO A 1 111 ? 20.248  1.094   12.547  1.00 28.94  ? 111  PRO A CG  1 
ATOM   681   C CD  . PRO A 1 111 ? 18.849  0.614   12.779  1.00 24.02  ? 111  PRO A CD  1 
ATOM   682   N N   . LYS A 1 112 ? 19.087  -0.057  8.112   1.00 24.93  ? 112  LYS A N   1 
ATOM   683   C CA  . LYS A 1 112 ? 18.820  -1.102  7.129   1.00 25.11  ? 112  LYS A CA  1 
ATOM   684   C C   . LYS A 1 112 ? 20.010  -2.071  6.995   1.00 28.14  ? 112  LYS A C   1 
ATOM   685   O O   . LYS A 1 112 ? 21.170  -1.675  7.145   1.00 26.28  ? 112  LYS A O   1 
ATOM   686   C CB  . LYS A 1 112 ? 18.449  -0.498  5.764   1.00 28.45  ? 112  LYS A CB  1 
ATOM   687   C CG  . LYS A 1 112 ? 17.006  -0.050  5.720   1.00 27.01  ? 112  LYS A CG  1 
ATOM   688   C CD  . LYS A 1 112 ? 16.668  0.699   4.462   1.00 31.55  ? 112  LYS A CD  1 
ATOM   689   C CE  . LYS A 1 112 ? 15.219  1.113   4.516   1.00 41.29  ? 112  LYS A CE  1 
ATOM   690   N NZ  . LYS A 1 112 ? 14.877  2.056   3.430   1.00 52.87  ? 112  LYS A NZ  1 
ATOM   691   N N   . TYR A 1 113 ? 19.674  -3.359  6.767   1.00 24.97  ? 113  TYR A N   1 
ATOM   692   C CA  . TYR A 1 113 ? 20.596  -4.473  6.576   1.00 24.36  ? 113  TYR A CA  1 
ATOM   693   C C   . TYR A 1 113 ? 20.847  -4.636  5.070   1.00 27.29  ? 113  TYR A C   1 
ATOM   694   O O   . TYR A 1 113 ? 19.890  -4.817  4.320   1.00 26.55  ? 113  TYR A O   1 
ATOM   695   C CB  . TYR A 1 113 ? 20.002  -5.757  7.215   1.00 25.23  ? 113  TYR A CB  1 
ATOM   696   C CG  . TYR A 1 113 ? 20.721  -7.030  6.816   1.00 25.97  ? 113  TYR A CG  1 
ATOM   697   C CD1 . TYR A 1 113 ? 21.994  -7.317  7.302   1.00 26.96  ? 113  TYR A CD1 1 
ATOM   698   C CD2 . TYR A 1 113 ? 20.135  -7.939  5.943   1.00 26.53  ? 113  TYR A CD2 1 
ATOM   699   C CE1 . TYR A 1 113 ? 22.666  -8.476  6.921   1.00 26.87  ? 113  TYR A CE1 1 
ATOM   700   C CE2 . TYR A 1 113 ? 20.798  -9.100  5.556   1.00 27.62  ? 113  TYR A CE2 1 
ATOM   701   C CZ  . TYR A 1 113 ? 22.054  -9.378  6.069   1.00 34.58  ? 113  TYR A CZ  1 
ATOM   702   O OH  . TYR A 1 113 ? 22.702  -10.531 5.686   1.00 33.81  ? 113  TYR A OH  1 
ATOM   703   N N   . TRP A 1 114 ? 22.119  -4.576  4.618   1.00 24.12  ? 114  TRP A N   1 
ATOM   704   C CA  . TRP A 1 114 ? 22.417  -4.653  3.176   1.00 24.50  ? 114  TRP A CA  1 
ATOM   705   C C   . TRP A 1 114 ? 23.145  -5.908  2.765   1.00 29.59  ? 114  TRP A C   1 
ATOM   706   O O   . TRP A 1 114 ? 23.239  -6.195  1.574   1.00 30.22  ? 114  TRP A O   1 
ATOM   707   C CB  . TRP A 1 114 ? 23.214  -3.427  2.707   1.00 23.42  ? 114  TRP A CB  1 
ATOM   708   C CG  . TRP A 1 114 ? 22.441  -2.165  2.920   1.00 23.92  ? 114  TRP A CG  1 
ATOM   709   C CD1 . TRP A 1 114 ? 22.543  -1.313  3.980   1.00 26.31  ? 114  TRP A CD1 1 
ATOM   710   C CD2 . TRP A 1 114 ? 21.298  -1.735  2.166   1.00 23.80  ? 114  TRP A CD2 1 
ATOM   711   N NE1 . TRP A 1 114 ? 21.570  -0.344  3.902   1.00 25.99  ? 114  TRP A NE1 1 
ATOM   712   C CE2 . TRP A 1 114 ? 20.801  -0.569  2.787   1.00 27.62  ? 114  TRP A CE2 1 
ATOM   713   C CE3 . TRP A 1 114 ? 20.666  -2.205  0.996   1.00 25.07  ? 114  TRP A CE3 1 
ATOM   714   C CZ2 . TRP A 1 114 ? 19.709  0.144   2.272   1.00 27.26  ? 114  TRP A CZ2 1 
ATOM   715   C CZ3 . TRP A 1 114 ? 19.575  -1.509  0.497   1.00 26.59  ? 114  TRP A CZ3 1 
ATOM   716   C CH2 . TRP A 1 114 ? 19.109  -0.348  1.128   1.00 27.37  ? 114  TRP A CH2 1 
ATOM   717   N N   . GLY A 1 115 ? 23.635  -6.667  3.726   1.00 25.52  ? 115  GLY A N   1 
ATOM   718   C CA  . GLY A 1 115 ? 24.339  -7.884  3.376   1.00 25.18  ? 115  GLY A CA  1 
ATOM   719   C C   . GLY A 1 115 ? 25.313  -8.329  4.425   1.00 29.66  ? 115  GLY A C   1 
ATOM   720   O O   . GLY A 1 115 ? 25.711  -7.561  5.305   1.00 29.15  ? 115  GLY A O   1 
ATOM   721   N N   . SER A 1 116 ? 25.693  -9.585  4.319   1.00 26.70  ? 116  SER A N   1 
ATOM   722   C CA  . SER A 1 116 ? 26.578  -10.215 5.271   1.00 26.60  ? 116  SER A CA  1 
ATOM   723   C C   . SER A 1 116 ? 27.374  -11.300 4.605   1.00 30.69  ? 116  SER A C   1 
ATOM   724   O O   . SER A 1 116 ? 26.917  -11.902 3.634   1.00 29.57  ? 116  SER A O   1 
ATOM   725   C CB  . SER A 1 116 ? 25.756  -10.806 6.412   1.00 30.07  ? 116  SER A CB  1 
ATOM   726   O OG  . SER A 1 116 ? 26.607  -11.042 7.517   1.00 46.91  ? 116  SER A OG  1 
ATOM   727   N N   . GLY A 1 117 ? 28.542  -11.574 5.142   1.00 29.30  ? 117  GLY A N   1 
ATOM   728   C CA  . GLY A 1 117 ? 29.382  -12.628 4.599   1.00 30.65  ? 117  GLY A CA  1 
ATOM   729   C C   . GLY A 1 117 ? 30.498  -13.071 5.511   1.00 37.92  ? 117  GLY A C   1 
ATOM   730   O O   . GLY A 1 117 ? 30.490  -12.813 6.722   1.00 36.17  ? 117  GLY A O   1 
ATOM   731   N N   . LEU A 1 118 ? 31.461  -13.765 4.911   1.00 38.80  ? 118  LEU A N   1 
ATOM   732   C CA  . LEU A 1 118 ? 32.624  -14.276 5.614   1.00 40.34  ? 118  LEU A CA  1 
ATOM   733   C C   . LEU A 1 118 ? 33.866  -13.844 4.895   1.00 47.13  ? 118  LEU A C   1 
ATOM   734   O O   . LEU A 1 118 ? 33.892  -13.767 3.663   1.00 48.02  ? 118  LEU A O   1 
ATOM   735   C CB  . LEU A 1 118 ? 32.588  -15.799 5.774   1.00 40.84  ? 118  LEU A CB  1 
ATOM   736   C CG  . LEU A 1 118 ? 31.500  -16.377 6.664   1.00 45.11  ? 118  LEU A CG  1 
ATOM   737   C CD1 . LEU A 1 118 ? 31.357  -17.863 6.431   1.00 46.30  ? 118  LEU A CD1 1 
ATOM   738   C CD2 . LEU A 1 118 ? 31.743  -16.060 8.132   1.00 47.56  ? 118  LEU A CD2 1 
ATOM   739   N N   . HIS A 1 119 ? 34.885  -13.517 5.682   1.00 44.90  ? 119  HIS A N   1 
ATOM   740   C CA  . HIS A 1 119 ? 36.166  -13.039 5.198   1.00 45.93  ? 119  HIS A CA  1 
ATOM   741   C C   . HIS A 1 119 ? 37.286  -13.679 6.008   1.00 51.32  ? 119  HIS A C   1 
ATOM   742   O O   . HIS A 1 119 ? 37.168  -13.820 7.226   1.00 49.05  ? 119  HIS A O   1 
ATOM   743   C CB  . HIS A 1 119 ? 36.198  -11.505 5.304   1.00 46.73  ? 119  HIS A CB  1 
ATOM   744   C CG  . HIS A 1 119 ? 37.498  -10.886 4.903   1.00 51.54  ? 119  HIS A CG  1 
ATOM   745   N ND1 . HIS A 1 119 ? 38.409  -10.450 5.851   1.00 53.93  ? 119  HIS A ND1 1 
ATOM   746   C CD2 . HIS A 1 119 ? 37.995  -10.638 3.667   1.00 53.67  ? 119  HIS A CD2 1 
ATOM   747   C CE1 . HIS A 1 119 ? 39.431  -9.965  5.164   1.00 54.44  ? 119  HIS A CE1 1 
ATOM   748   N NE2 . HIS A 1 119 ? 39.223  -10.049 3.847   1.00 54.69  ? 119  HIS A NE2 1 
ATOM   749   N N   . ASP A 1 120 ? 38.353  -14.104 5.322   1.00 52.13  ? 120  ASP A N   1 
ATOM   750   C CA  . ASP A 1 120 ? 39.518  -14.701 5.976   1.00 54.43  ? 120  ASP A CA  1 
ATOM   751   C C   . ASP A 1 120 ? 40.711  -13.749 5.964   1.00 59.32  ? 120  ASP A C   1 
ATOM   752   O O   . ASP A 1 120 ? 40.980  -13.092 4.951   1.00 58.42  ? 120  ASP A O   1 
ATOM   753   C CB  . ASP A 1 120 ? 39.923  -16.027 5.310   1.00 57.92  ? 120  ASP A CB  1 
ATOM   754   C CG  . ASP A 1 120 ? 38.893  -17.139 5.382   1.00 71.31  ? 120  ASP A CG  1 
ATOM   755   O OD1 . ASP A 1 120 ? 38.365  -17.398 6.498   1.00 70.69  ? 120  ASP A OD1 1 
ATOM   756   O OD2 . ASP A 1 120 ? 38.673  -17.802 4.347   1.00 80.30  ? 120  ASP A OD2 1 
ATOM   757   N N   . LYS A 1 121 ? 41.437  -13.704 7.091   1.00 57.27  ? 121  LYS A N   1 
ATOM   758   C CA  . LYS A 1 121 ? 42.659  -12.920 7.256   1.00 58.45  ? 121  LYS A CA  1 
ATOM   759   C C   . LYS A 1 121 ? 43.621  -13.701 8.153   1.00 64.01  ? 121  LYS A C   1 
ATOM   760   O O   . LYS A 1 121 ? 43.307  -13.957 9.322   1.00 63.17  ? 121  LYS A O   1 
ATOM   761   C CB  . LYS A 1 121 ? 42.378  -11.506 7.804   1.00 60.06  ? 121  LYS A CB  1 
ATOM   762   C CG  . LYS A 1 121 ? 43.397  -10.482 7.309   1.00 71.60  ? 121  LYS A CG  1 
ATOM   763   C CD  . LYS A 1 121 ? 43.904  -9.543  8.390   1.00 79.88  ? 121  LYS A CD  1 
ATOM   764   C CE  . LYS A 1 121 ? 45.136  -8.812  7.897   1.00 90.54  ? 121  LYS A CE  1 
ATOM   765   N NZ  . LYS A 1 121 ? 45.753  -7.967  8.954   1.00 97.91  ? 121  LYS A NZ  1 
ATOM   766   N N   . ASN A 1 122 ? 44.776  -14.116 7.567   1.00 62.63  ? 122  ASN A N   1 
ATOM   767   C CA  . ASN A 1 122 ? 45.866  -14.876 8.202   1.00 64.44  ? 122  ASN A CA  1 
ATOM   768   C C   . ASN A 1 122 ? 45.360  -16.221 8.798   1.00 67.87  ? 122  ASN A C   1 
ATOM   769   O O   . ASN A 1 122 ? 45.701  -16.581 9.931   1.00 68.20  ? 122  ASN A O   1 
ATOM   770   C CB  . ASN A 1 122 ? 46.587  -14.029 9.279   1.00 66.14  ? 122  ASN A CB  1 
ATOM   771   C CG  . ASN A 1 122 ? 47.110  -12.690 8.810   1.00 84.43  ? 122  ASN A CG  1 
ATOM   772   O OD1 . ASN A 1 122 ? 47.765  -12.568 7.767   1.00 75.01  ? 122  ASN A OD1 1 
ATOM   773   N ND2 . ASN A 1 122 ? 46.867  -11.658 9.605   1.00 76.34  ? 122  ASN A ND2 1 
ATOM   774   N N   . GLY A 1 123 ? 44.545  -16.938 8.027   1.00 63.01  ? 123  GLY A N   1 
ATOM   775   C CA  . GLY A 1 123 ? 44.000  -18.224 8.447   1.00 62.58  ? 123  GLY A CA  1 
ATOM   776   C C   . GLY A 1 123 ? 42.707  -18.157 9.234   1.00 64.35  ? 123  GLY A C   1 
ATOM   777   O O   . GLY A 1 123 ? 41.852  -19.029 9.063   1.00 63.65  ? 123  GLY A O   1 
ATOM   778   N N   . LYS A 1 124 ? 42.553  -17.136 10.110  1.00 59.28  ? 124  LYS A N   1 
ATOM   779   C CA  . LYS A 1 124 ? 41.355  -16.934 10.934  1.00 56.50  ? 124  LYS A CA  1 
ATOM   780   C C   . LYS A 1 124 ? 40.154  -16.464 10.083  1.00 55.39  ? 124  LYS A C   1 
ATOM   781   O O   . LYS A 1 124 ? 40.343  -15.753 9.091   1.00 53.04  ? 124  LYS A O   1 
ATOM   782   C CB  . LYS A 1 124 ? 41.640  -15.930 12.058  1.00 59.08  ? 124  LYS A CB  1 
ATOM   783   N N   . SER A 1 125 ? 38.923  -16.874 10.479  1.00 50.37  ? 125  SER A N   1 
ATOM   784   C CA  . SER A 1 125 ? 37.669  -16.519 9.803   1.00 48.36  ? 125  SER A CA  1 
ATOM   785   C C   . SER A 1 125 ? 36.932  -15.387 10.540  1.00 48.18  ? 125  SER A C   1 
ATOM   786   O O   . SER A 1 125 ? 36.822  -15.400 11.772  1.00 47.54  ? 125  SER A O   1 
ATOM   787   C CB  . SER A 1 125 ? 36.756  -17.734 9.666   1.00 53.10  ? 125  SER A CB  1 
ATOM   788   O OG  . SER A 1 125 ? 35.617  -17.441 8.870   1.00 60.16  ? 125  SER A OG  1 
ATOM   789   N N   . TYR A 1 126 ? 36.427  -14.415 9.762   1.00 41.64  ? 126  TYR A N   1 
ATOM   790   C CA  . TYR A 1 126 ? 35.724  -13.232 10.251  1.00 39.48  ? 126  TYR A CA  1 
ATOM   791   C C   . TYR A 1 126 ? 34.367  -13.061 9.588   1.00 41.62  ? 126  TYR A C   1 
ATOM   792   O O   . TYR A 1 126 ? 34.213  -13.287 8.385   1.00 43.00  ? 126  TYR A O   1 
ATOM   793   C CB  . TYR A 1 126 ? 36.570  -11.963 10.014  1.00 41.05  ? 126  TYR A CB  1 
ATOM   794   C CG  . TYR A 1 126 ? 37.885  -11.961 10.769  1.00 44.42  ? 126  TYR A CG  1 
ATOM   795   C CD1 . TYR A 1 126 ? 37.977  -11.412 12.046  1.00 46.40  ? 126  TYR A CD1 1 
ATOM   796   C CD2 . TYR A 1 126 ? 39.036  -12.513 10.210  1.00 46.84  ? 126  TYR A CD2 1 
ATOM   797   C CE1 . TYR A 1 126 ? 39.175  -11.436 12.759  1.00 48.91  ? 126  TYR A CE1 1 
ATOM   798   C CE2 . TYR A 1 126 ? 40.238  -12.551 10.918  1.00 49.65  ? 126  TYR A CE2 1 
ATOM   799   C CZ  . TYR A 1 126 ? 40.303  -12.007 12.192  1.00 56.10  ? 126  TYR A CZ  1 
ATOM   800   O OH  . TYR A 1 126 ? 41.478  -12.037 12.901  1.00 58.66  ? 126  TYR A OH  1 
ATOM   801   N N   . ARG A 1 127 ? 33.411  -12.578 10.373  1.00 34.91  ? 127  ARG A N   1 
ATOM   802   C CA  . ARG A 1 127 ? 32.048  -12.276 9.955   1.00 32.88  ? 127  ARG A CA  1 
ATOM   803   C C   . ARG A 1 127 ? 31.899  -10.768 9.717   1.00 34.11  ? 127  ARG A C   1 
ATOM   804   O O   . ARG A 1 127 ? 32.321  -9.978  10.555  1.00 32.61  ? 127  ARG A O   1 
ATOM   805   C CB  . ARG A 1 127 ? 31.062  -12.749 11.047  1.00 32.09  ? 127  ARG A CB  1 
ATOM   806   C CG  . ARG A 1 127 ? 29.588  -12.647 10.658  1.00 42.19  ? 127  ARG A CG  1 
ATOM   807   C CD  . ARG A 1 127 ? 28.596  -12.905 11.799  1.00 48.29  ? 127  ARG A CD  1 
ATOM   808   N NE  . ARG A 1 127 ? 28.948  -14.028 12.677  1.00 55.35  ? 127  ARG A NE  1 
ATOM   809   C CZ  . ARG A 1 127 ? 28.771  -15.316 12.389  1.00 64.49  ? 127  ARG A CZ  1 
ATOM   810   N NH1 . ARG A 1 127 ? 28.270  -15.680 11.216  1.00 47.71  ? 127  ARG A NH1 1 
ATOM   811   N NH2 . ARG A 1 127 ? 29.121  -16.248 13.262  1.00 52.94  ? 127  ARG A NH2 1 
ATOM   812   N N   . PHE A 1 128 ? 31.297  -10.371 8.586   1.00 29.59  ? 128  PHE A N   1 
ATOM   813   C CA  . PHE A 1 128 ? 31.051  -8.958  8.309   1.00 28.06  ? 128  PHE A CA  1 
ATOM   814   C C   . PHE A 1 128 ? 29.558  -8.701  7.981   1.00 30.83  ? 128  PHE A C   1 
ATOM   815   O O   . PHE A 1 128 ? 28.859  -9.594  7.496   1.00 28.56  ? 128  PHE A O   1 
ATOM   816   C CB  . PHE A 1 128 ? 31.974  -8.415  7.203   1.00 29.83  ? 128  PHE A CB  1 
ATOM   817   C CG  . PHE A 1 128 ? 31.686  -8.891  5.799   1.00 31.06  ? 128  PHE A CG  1 
ATOM   818   C CD1 . PHE A 1 128 ? 30.738  -8.246  5.007   1.00 33.55  ? 128  PHE A CD1 1 
ATOM   819   C CD2 . PHE A 1 128 ? 32.394  -9.954  5.250   1.00 33.66  ? 128  PHE A CD2 1 
ATOM   820   C CE1 . PHE A 1 128 ? 30.476  -8.681  3.700   1.00 35.19  ? 128  PHE A CE1 1 
ATOM   821   C CE2 . PHE A 1 128 ? 32.157  -10.369 3.932   1.00 37.18  ? 128  PHE A CE2 1 
ATOM   822   C CZ  . PHE A 1 128 ? 31.203  -9.726  3.162   1.00 34.86  ? 128  PHE A CZ  1 
ATOM   823   N N   . MET A 1 129 ? 29.092  -7.471  8.266   1.00 28.55  ? 129  MET A N   1 
ATOM   824   C CA  . MET A 1 129 ? 27.735  -6.976  8.004   1.00 27.95  ? 129  MET A CA  1 
ATOM   825   C C   . MET A 1 129 ? 27.789  -5.638  7.333   1.00 31.34  ? 129  MET A C   1 
ATOM   826   O O   . MET A 1 129 ? 28.499  -4.747  7.823   1.00 30.91  ? 129  MET A O   1 
ATOM   827   C CB  . MET A 1 129 ? 26.934  -6.762  9.297   1.00 29.92  ? 129  MET A CB  1 
ATOM   828   C CG  . MET A 1 129 ? 26.706  -7.942  10.151  1.00 34.09  ? 129  MET A CG  1 
ATOM   829   S SD  . MET A 1 129 ? 25.731  -7.370  11.585  1.00 38.12  ? 129  MET A SD  1 
ATOM   830   C CE  . MET A 1 129 ? 24.215  -6.912  10.754  1.00 34.22  ? 129  MET A CE  1 
ATOM   831   N N   . ILE A 1 130 ? 26.976  -5.442  6.294   1.00 27.31  ? 130  ILE A N   1 
ATOM   832   C CA  . ILE A 1 130 ? 26.882  -4.143  5.635   1.00 27.28  ? 130  ILE A CA  1 
ATOM   833   C C   . ILE A 1 130 ? 25.616  -3.462  6.146   1.00 32.87  ? 130  ILE A C   1 
ATOM   834   O O   . ILE A 1 130 ? 24.529  -4.037  6.083   1.00 32.08  ? 130  ILE A O   1 
ATOM   835   C CB  . ILE A 1 130 ? 26.916  -4.209  4.088   1.00 30.07  ? 130  ILE A CB  1 
ATOM   836   C CG1 . ILE A 1 130 ? 27.971  -5.214  3.514   1.00 29.83  ? 130  ILE A CG1 1 
ATOM   837   C CG2 . ILE A 1 130 ? 27.002  -2.801  3.479   1.00 31.34  ? 130  ILE A CG2 1 
ATOM   838   C CD1 . ILE A 1 130 ? 29.438  -4.881  3.723   1.00 35.19  ? 130  ILE A CD1 1 
ATOM   839   N N   . MET A 1 131 ? 25.758  -2.243  6.659   1.00 31.77  ? 131  MET A N   1 
ATOM   840   C CA  . MET A 1 131 ? 24.643  -1.477  7.195   1.00 32.84  ? 131  MET A CA  1 
ATOM   841   C C   . MET A 1 131 ? 24.755  -0.033  6.779   1.00 34.88  ? 131  MET A C   1 
ATOM   842   O O   . MET A 1 131 ? 25.776  0.357   6.218   1.00 34.73  ? 131  MET A O   1 
ATOM   843   C CB  . MET A 1 131 ? 24.611  -1.580  8.733   1.00 36.18  ? 131  MET A CB  1 
ATOM   844   C CG  . MET A 1 131 ? 24.134  -2.917  9.258   1.00 41.33  ? 131  MET A CG  1 
ATOM   845   S SD  . MET A 1 131 ? 24.704  -3.107  10.951  1.00 48.90  ? 131  MET A SD  1 
ATOM   846   C CE  . MET A 1 131 ? 26.492  -3.254  10.698  1.00 46.45  ? 131  MET A CE  1 
ATOM   847   N N   . ASP A 1 132 ? 23.700  0.761   7.060   1.00 30.32  ? 132  ASP A N   1 
ATOM   848   C CA  . ASP A 1 132 ? 23.624  2.189   6.776   1.00 30.35  ? 132  ASP A CA  1 
ATOM   849   C C   . ASP A 1 132 ? 24.697  2.970   7.521   1.00 33.45  ? 132  ASP A C   1 
ATOM   850   O O   . ASP A 1 132 ? 24.987  2.674   8.689   1.00 32.79  ? 132  ASP A O   1 
ATOM   851   C CB  . ASP A 1 132 ? 22.248  2.747   7.213   1.00 32.00  ? 132  ASP A CB  1 
ATOM   852   C CG  . ASP A 1 132 ? 21.042  2.398   6.368   1.00 34.03  ? 132  ASP A CG  1 
ATOM   853   O OD1 . ASP A 1 132 ? 21.207  2.222   5.137   1.00 33.95  ? 132  ASP A OD1 1 
ATOM   854   O OD2 . ASP A 1 132 ? 19.914  2.407   6.918   1.00 33.74  ? 132  ASP A OD2 1 
ATOM   855   N N   . ARG A 1 133 ? 25.245  3.993   6.858   1.00 30.05  ? 133  ARG A N   1 
ATOM   856   C CA  . ARG A 1 133 ? 26.206  4.912   7.448   1.00 30.32  ? 133  ARG A CA  1 
ATOM   857   C C   . ARG A 1 133 ? 25.421  6.050   8.106   1.00 34.52  ? 133  ARG A C   1 
ATOM   858   O O   . ARG A 1 133 ? 24.461  6.559   7.527   1.00 34.95  ? 133  ARG A O   1 
ATOM   859   C CB  . ARG A 1 133 ? 27.180  5.445   6.384   1.00 29.83  ? 133  ARG A CB  1 
ATOM   860   C CG  . ARG A 1 133 ? 28.358  6.236   6.936   1.00 33.62  ? 133  ARG A CG  1 
ATOM   861   C CD  . ARG A 1 133 ? 28.105  7.721   6.917   1.00 39.26  ? 133  ARG A CD  1 
ATOM   862   N NE  . ARG A 1 133 ? 29.243  8.533   7.339   1.00 48.67  ? 133  ARG A NE  1 
ATOM   863   C CZ  . ARG A 1 133 ? 30.097  9.082   6.494   1.00 57.79  ? 133  ARG A CZ  1 
ATOM   864   N NH1 . ARG A 1 133 ? 30.039  8.794   5.202   1.00 40.79  ? 133  ARG A NH1 1 
ATOM   865   N NH2 . ARG A 1 133 ? 31.028  9.913   6.933   1.00 47.42  ? 133  ARG A NH2 1 
ATOM   866   N N   . PHE A 1 134 ? 25.837  6.452   9.301   1.00 30.88  ? 134  PHE A N   1 
ATOM   867   C CA  . PHE A 1 134 ? 25.190  7.541   10.017  1.00 30.88  ? 134  PHE A CA  1 
ATOM   868   C C   . PHE A 1 134 ? 26.168  8.660   10.345  1.00 35.49  ? 134  PHE A C   1 
ATOM   869   O O   . PHE A 1 134 ? 27.383  8.502   10.188  1.00 34.29  ? 134  PHE A O   1 
ATOM   870   C CB  . PHE A 1 134 ? 24.528  7.023   11.311  1.00 31.51  ? 134  PHE A CB  1 
ATOM   871   C CG  . PHE A 1 134 ? 23.442  6.006   11.072  1.00 31.87  ? 134  PHE A CG  1 
ATOM   872   C CD1 . PHE A 1 134 ? 22.336  6.319   10.288  1.00 34.54  ? 134  PHE A CD1 1 
ATOM   873   C CD2 . PHE A 1 134 ? 23.533  4.732   11.612  1.00 32.87  ? 134  PHE A CD2 1 
ATOM   874   C CE1 . PHE A 1 134 ? 21.358  5.371   10.029  1.00 34.41  ? 134  PHE A CE1 1 
ATOM   875   C CE2 . PHE A 1 134 ? 22.543  3.789   11.369  1.00 34.76  ? 134  PHE A CE2 1 
ATOM   876   C CZ  . PHE A 1 134 ? 21.464  4.116   10.577  1.00 32.98  ? 134  PHE A CZ  1 
ATOM   877   N N   . GLY A 1 135 ? 25.604  9.781   10.799  1.00 33.29  ? 135  GLY A N   1 
ATOM   878   C CA  . GLY A 1 135 ? 26.337  10.953  11.251  1.00 34.05  ? 135  GLY A CA  1 
ATOM   879   C C   . GLY A 1 135 ? 26.709  10.819  12.714  1.00 37.74  ? 135  GLY A C   1 
ATOM   880   O O   . GLY A 1 135 ? 27.028  9.723   13.189  1.00 36.61  ? 135  GLY A O   1 
ATOM   881   N N   . SER A 1 136 ? 26.651  11.927  13.441  1.00 35.49  ? 136  SER A N   1 
ATOM   882   C CA  . SER A 1 136 ? 27.001  11.973  14.862  1.00 35.41  ? 136  SER A CA  1 
ATOM   883   C C   . SER A 1 136 ? 25.991  11.247  15.745  1.00 38.23  ? 136  SER A C   1 
ATOM   884   O O   . SER A 1 136 ? 24.806  11.158  15.408  1.00 36.59  ? 136  SER A O   1 
ATOM   885   C CB  . SER A 1 136 ? 27.109  13.423  15.323  1.00 40.10  ? 136  SER A CB  1 
ATOM   886   O OG  . SER A 1 136 ? 27.519  13.530  16.678  1.00 49.71  ? 136  SER A OG  1 
ATOM   887   N N   . ASP A 1 137 ? 26.481  10.733  16.889  1.00 35.63  ? 137  ASP A N   1 
ATOM   888   C CA  . ASP A 1 137 ? 25.645  10.128  17.914  1.00 34.46  ? 137  ASP A CA  1 
ATOM   889   C C   . ASP A 1 137 ? 25.126  11.282  18.774  1.00 37.95  ? 137  ASP A C   1 
ATOM   890   O O   . ASP A 1 137 ? 25.721  12.363  18.760  1.00 36.51  ? 137  ASP A O   1 
ATOM   891   C CB  . ASP A 1 137 ? 26.397  9.051   18.731  1.00 36.49  ? 137  ASP A CB  1 
ATOM   892   C CG  . ASP A 1 137 ? 27.565  9.544   19.573  1.00 49.47  ? 137  ASP A CG  1 
ATOM   893   O OD1 . ASP A 1 137 ? 27.331  10.301  20.519  1.00 49.07  ? 137  ASP A OD1 1 
ATOM   894   O OD2 . ASP A 1 137 ? 28.699  9.081   19.349  1.00 61.71  ? 137  ASP A OD2 1 
ATOM   895   N N   . LEU A 1 138 ? 24.020  11.072  19.503  1.00 35.99  ? 138  LEU A N   1 
ATOM   896   C CA  . LEU A 1 138 ? 23.418  12.131  20.309  1.00 36.24  ? 138  LEU A CA  1 
ATOM   897   C C   . LEU A 1 138 ? 24.231  12.492  21.544  1.00 38.59  ? 138  LEU A C   1 
ATOM   898   O O   . LEU A 1 138 ? 24.102  13.622  21.998  1.00 40.16  ? 138  LEU A O   1 
ATOM   899   C CB  . LEU A 1 138 ? 21.987  11.781  20.728  1.00 35.91  ? 138  LEU A CB  1 
ATOM   900   C CG  . LEU A 1 138 ? 20.898  11.879  19.668  1.00 41.00  ? 138  LEU A CG  1 
ATOM   901   C CD1 . LEU A 1 138 ? 19.582  11.547  20.285  1.00 41.81  ? 138  LEU A CD1 1 
ATOM   902   C CD2 . LEU A 1 138 ? 20.816  13.264  19.059  1.00 42.97  ? 138  LEU A CD2 1 
ATOM   903   N N   . GLN A 1 139 ? 25.054  11.569  22.083  1.00 33.05  ? 139  GLN A N   1 
ATOM   904   C CA  . GLN A 1 139 ? 25.875  11.827  23.278  1.00 33.77  ? 139  GLN A CA  1 
ATOM   905   C C   . GLN A 1 139 ? 26.862  12.973  23.039  1.00 39.85  ? 139  GLN A C   1 
ATOM   906   O O   . GLN A 1 139 ? 26.980  13.845  23.902  1.00 40.81  ? 139  GLN A O   1 
ATOM   907   C CB  . GLN A 1 139 ? 26.614  10.556  23.755  1.00 34.28  ? 139  GLN A CB  1 
ATOM   908   C CG  . GLN A 1 139 ? 27.315  10.687  25.118  1.00 26.49  ? 139  GLN A CG  1 
ATOM   909   C CD  . GLN A 1 139 ? 26.415  11.070  26.279  1.00 41.74  ? 139  GLN A CD  1 
ATOM   910   O OE1 . GLN A 1 139 ? 25.267  10.640  26.396  1.00 39.33  ? 139  GLN A OE1 1 
ATOM   911   N NE2 . GLN A 1 139 ? 26.931  11.863  27.195  1.00 35.88  ? 139  GLN A NE2 1 
ATOM   912   N N   . LYS A 1 140 ? 27.505  13.004  21.853  1.00 37.27  ? 140  LYS A N   1 
ATOM   913   C CA  . LYS A 1 140 ? 28.447  14.051  21.454  1.00 38.73  ? 140  LYS A CA  1 
ATOM   914   C C   . LYS A 1 140 ? 27.742  15.405  21.378  1.00 41.88  ? 140  LYS A C   1 
ATOM   915   O O   . LYS A 1 140 ? 28.267  16.383  21.899  1.00 43.03  ? 140  LYS A O   1 
ATOM   916   C CB  . LYS A 1 140 ? 29.120  13.725  20.098  1.00 42.16  ? 140  LYS A CB  1 
ATOM   917   C CG  . LYS A 1 140 ? 30.053  12.524  20.114  1.00 64.29  ? 140  LYS A CG  1 
ATOM   918   C CD  . LYS A 1 140 ? 30.844  12.422  18.808  1.00 79.67  ? 140  LYS A CD  1 
ATOM   919   C CE  . LYS A 1 140 ? 31.477  11.062  18.607  1.00 90.37  ? 140  LYS A CE  1 
ATOM   920   N NZ  . LYS A 1 140 ? 32.758  10.923  19.347  1.00 103.06 ? 140  LYS A NZ  1 
ATOM   921   N N   . ILE A 1 141 ? 26.547  15.449  20.753  1.00 37.10  ? 141  ILE A N   1 
ATOM   922   C CA  . ILE A 1 141 ? 25.731  16.660  20.573  1.00 37.29  ? 141  ILE A CA  1 
ATOM   923   C C   . ILE A 1 141 ? 25.226  17.148  21.940  1.00 41.87  ? 141  ILE A C   1 
ATOM   924   O O   . ILE A 1 141 ? 25.258  18.353  22.208  1.00 42.65  ? 141  ILE A O   1 
ATOM   925   C CB  . ILE A 1 141 ? 24.574  16.403  19.561  1.00 38.86  ? 141  ILE A CB  1 
ATOM   926   C CG1 . ILE A 1 141 ? 25.144  16.050  18.165  1.00 38.71  ? 141  ILE A CG1 1 
ATOM   927   C CG2 . ILE A 1 141 ? 23.604  17.600  19.470  1.00 39.15  ? 141  ILE A CG2 1 
ATOM   928   C CD1 . ILE A 1 141 ? 24.282  15.162  17.326  1.00 40.43  ? 141  ILE A CD1 1 
ATOM   929   N N   . TYR A 1 142 ? 24.798  16.205  22.800  1.00 37.60  ? 142  TYR A N   1 
ATOM   930   C CA  . TYR A 1 142 ? 24.306  16.438  24.161  1.00 37.14  ? 142  TYR A CA  1 
ATOM   931   C C   . TYR A 1 142 ? 25.391  17.106  25.010  1.00 42.64  ? 142  TYR A C   1 
ATOM   932   O O   . TYR A 1 142 ? 25.126  18.134  25.634  1.00 43.79  ? 142  TYR A O   1 
ATOM   933   C CB  . TYR A 1 142 ? 23.859  15.097  24.775  1.00 36.17  ? 142  TYR A CB  1 
ATOM   934   C CG  . TYR A 1 142 ? 23.417  15.141  26.223  1.00 36.01  ? 142  TYR A CG  1 
ATOM   935   C CD1 . TYR A 1 142 ? 22.147  15.591  26.572  1.00 37.36  ? 142  TYR A CD1 1 
ATOM   936   C CD2 . TYR A 1 142 ? 24.235  14.647  27.236  1.00 36.26  ? 142  TYR A CD2 1 
ATOM   937   C CE1 . TYR A 1 142 ? 21.715  15.581  27.897  1.00 37.43  ? 142  TYR A CE1 1 
ATOM   938   C CE2 . TYR A 1 142 ? 23.817  14.635  28.563  1.00 36.65  ? 142  TYR A CE2 1 
ATOM   939   C CZ  . TYR A 1 142 ? 22.550  15.086  28.886  1.00 43.73  ? 142  TYR A CZ  1 
ATOM   940   O OH  . TYR A 1 142 ? 22.146  15.065  30.192  1.00 46.63  ? 142  TYR A OH  1 
ATOM   941   N N   . GLU A 1 143 ? 26.612  16.538  25.004  1.00 39.25  ? 143  GLU A N   1 
ATOM   942   C CA  . GLU A 1 143 ? 27.768  17.055  25.742  1.00 40.32  ? 143  GLU A CA  1 
ATOM   943   C C   . GLU A 1 143 ? 28.193  18.436  25.217  1.00 46.33  ? 143  GLU A C   1 
ATOM   944   O O   . GLU A 1 143 ? 28.575  19.298  26.014  1.00 47.09  ? 143  GLU A O   1 
ATOM   945   C CB  . GLU A 1 143 ? 28.939  16.062  25.681  1.00 41.48  ? 143  GLU A CB  1 
ATOM   946   C CG  . GLU A 1 143 ? 28.763  14.879  26.620  1.00 48.89  ? 143  GLU A CG  1 
ATOM   947   C CD  . GLU A 1 143 ? 29.723  13.714  26.454  1.00 72.15  ? 143  GLU A CD  1 
ATOM   948   O OE1 . GLU A 1 143 ? 30.474  13.680  25.451  1.00 82.45  ? 143  GLU A OE1 1 
ATOM   949   O OE2 . GLU A 1 143 ? 29.700  12.812  27.322  1.00 58.07  ? 143  GLU A OE2 1 
ATOM   950   N N   . ALA A 1 144 ? 28.087  18.653  23.891  1.00 43.42  ? 144  ALA A N   1 
ATOM   951   C CA  . ALA A 1 144 ? 28.414  19.921  23.231  1.00 44.93  ? 144  ALA A CA  1 
ATOM   952   C C   . ALA A 1 144 ? 27.379  21.017  23.554  1.00 51.47  ? 144  ALA A C   1 
ATOM   953   O O   . ALA A 1 144 ? 27.696  22.209  23.438  1.00 53.68  ? 144  ALA A O   1 
ATOM   954   C CB  . ALA A 1 144 ? 28.502  19.718  21.727  1.00 45.33  ? 144  ALA A CB  1 
ATOM   955   N N   . ASN A 1 145 ? 26.150  20.616  23.955  1.00 46.35  ? 145  ASN A N   1 
ATOM   956   C CA  . ASN A 1 145 ? 25.062  21.534  24.295  1.00 46.04  ? 145  ASN A CA  1 
ATOM   957   C C   . ASN A 1 145 ? 24.926  21.667  25.823  1.00 49.35  ? 145  ASN A C   1 
ATOM   958   O O   . ASN A 1 145 ? 23.835  21.935  26.332  1.00 49.48  ? 145  ASN A O   1 
ATOM   959   C CB  . ASN A 1 145 ? 23.755  21.067  23.639  1.00 48.34  ? 145  ASN A CB  1 
ATOM   960   C CG  . ASN A 1 145 ? 22.683  22.125  23.492  1.00 83.87  ? 145  ASN A CG  1 
ATOM   961   O OD1 . ASN A 1 145 ? 22.958  23.318  23.319  1.00 82.33  ? 145  ASN A OD1 1 
ATOM   962   N ND2 . ASN A 1 145 ? 21.426  21.702  23.527  1.00 77.69  ? 145  ASN A ND2 1 
ATOM   963   N N   . ALA A 1 146 ? 26.065  21.527  26.544  1.00 45.64  ? 146  ALA A N   1 
ATOM   964   C CA  . ALA A 1 146 ? 26.230  21.646  28.002  1.00 45.20  ? 146  ALA A CA  1 
ATOM   965   C C   . ALA A 1 146 ? 25.330  20.660  28.783  1.00 46.94  ? 146  ALA A C   1 
ATOM   966   O O   . ALA A 1 146 ? 24.765  21.014  29.826  1.00 47.23  ? 146  ALA A O   1 
ATOM   967   C CB  . ALA A 1 146 ? 25.986  23.083  28.456  1.00 47.17  ? 146  ALA A CB  1 
ATOM   968   N N   . LYS A 1 147 ? 25.248  19.407  28.282  1.00 40.95  ? 147  LYS A N   1 
ATOM   969   C CA  . LYS A 1 147 ? 24.484  18.284  28.845  1.00 38.48  ? 147  LYS A CA  1 
ATOM   970   C C   . LYS A 1 147 ? 22.984  18.626  29.001  1.00 41.74  ? 147  LYS A C   1 
ATOM   971   O O   . LYS A 1 147 ? 22.374  18.312  30.017  1.00 41.46  ? 147  LYS A O   1 
ATOM   972   C CB  . LYS A 1 147 ? 25.098  17.779  30.169  1.00 39.86  ? 147  LYS A CB  1 
ATOM   973   C CG  . LYS A 1 147 ? 26.414  17.030  29.991  1.00 51.65  ? 147  LYS A CG  1 
ATOM   974   C CD  . LYS A 1 147 ? 26.813  16.281  31.250  1.00 60.59  ? 147  LYS A CD  1 
ATOM   975   C CE  . LYS A 1 147 ? 28.033  15.429  31.027  1.00 75.05  ? 147  LYS A CE  1 
ATOM   976   N NZ  . LYS A 1 147 ? 28.216  14.460  32.138  1.00 85.34  ? 147  LYS A NZ  1 
ATOM   977   N N   . ARG A 1 148 ? 22.391  19.251  27.970  1.00 38.57  ? 148  ARG A N   1 
ATOM   978   C CA  . ARG A 1 148 ? 20.963  19.599  27.936  1.00 38.06  ? 148  ARG A CA  1 
ATOM   979   C C   . ARG A 1 148 ? 20.395  19.498  26.534  1.00 40.45  ? 148  ARG A C   1 
ATOM   980   O O   . ARG A 1 148 ? 21.071  19.827  25.563  1.00 41.17  ? 148  ARG A O   1 
ATOM   981   C CB  . ARG A 1 148 ? 20.680  21.033  28.447  1.00 39.22  ? 148  ARG A CB  1 
ATOM   982   C CG  . ARG A 1 148 ? 21.060  21.384  29.882  1.00 48.26  ? 148  ARG A CG  1 
ATOM   983   C CD  . ARG A 1 148 ? 20.242  20.696  30.977  1.00 49.85  ? 148  ARG A CD  1 
ATOM   984   N NE  . ARG A 1 148 ? 20.587  21.204  32.312  1.00 42.65  ? 148  ARG A NE  1 
ATOM   985   C CZ  . ARG A 1 148 ? 21.702  20.907  32.978  1.00 55.55  ? 148  ARG A CZ  1 
ATOM   986   N NH1 . ARG A 1 148 ? 22.599  20.076  32.454  1.00 42.95  ? 148  ARG A NH1 1 
ATOM   987   N NH2 . ARG A 1 148 ? 21.922  21.425  34.177  1.00 49.29  ? 148  ARG A NH2 1 
ATOM   988   N N   . PHE A 1 149 ? 19.136  19.069  26.447  1.00 34.91  ? 149  PHE A N   1 
ATOM   989   C CA  . PHE A 1 149 ? 18.302  19.040  25.252  1.00 33.66  ? 149  PHE A CA  1 
ATOM   990   C C   . PHE A 1 149 ? 17.015  19.761  25.611  1.00 38.61  ? 149  PHE A C   1 
ATOM   991   O O   . PHE A 1 149 ? 16.518  19.595  26.729  1.00 38.27  ? 149  PHE A O   1 
ATOM   992   C CB  . PHE A 1 149 ? 18.007  17.612  24.755  1.00 34.04  ? 149  PHE A CB  1 
ATOM   993   C CG  . PHE A 1 149 ? 19.079  16.873  23.985  1.00 34.93  ? 149  PHE A CG  1 
ATOM   994   C CD1 . PHE A 1 149 ? 19.948  17.553  23.136  1.00 38.07  ? 149  PHE A CD1 1 
ATOM   995   C CD2 . PHE A 1 149 ? 19.176  15.489  24.056  1.00 35.87  ? 149  PHE A CD2 1 
ATOM   996   C CE1 . PHE A 1 149 ? 20.943  16.868  22.437  1.00 38.55  ? 149  PHE A CE1 1 
ATOM   997   C CE2 . PHE A 1 149 ? 20.157  14.803  23.339  1.00 37.94  ? 149  PHE A CE2 1 
ATOM   998   C CZ  . PHE A 1 149 ? 21.036  15.499  22.539  1.00 36.75  ? 149  PHE A CZ  1 
ATOM   999   N N   . SER A 1 150 ? 16.480  20.570  24.696  1.00 35.65  ? 150  SER A N   1 
ATOM   1000  C CA  . SER A 1 150 ? 15.239  21.300  24.931  1.00 35.73  ? 150  SER A CA  1 
ATOM   1001  C C   . SER A 1 150 ? 14.038  20.347  24.996  1.00 38.55  ? 150  SER A C   1 
ATOM   1002  O O   . SER A 1 150 ? 14.108  19.221  24.487  1.00 37.11  ? 150  SER A O   1 
ATOM   1003  C CB  . SER A 1 150 ? 15.025  22.333  23.829  1.00 40.68  ? 150  SER A CB  1 
ATOM   1004  O OG  . SER A 1 150 ? 14.935  21.720  22.552  1.00 49.80  ? 150  SER A OG  1 
ATOM   1005  N N   . ARG A 1 151 ? 12.933  20.812  25.604  1.00 35.60  ? 151  ARG A N   1 
ATOM   1006  C CA  . ARG A 1 151 ? 11.669  20.076  25.712  1.00 34.91  ? 151  ARG A CA  1 
ATOM   1007  C C   . ARG A 1 151 ? 11.203  19.646  24.308  1.00 39.05  ? 151  ARG A C   1 
ATOM   1008  O O   . ARG A 1 151 ? 10.803  18.497  24.123  1.00 38.20  ? 151  ARG A O   1 
ATOM   1009  C CB  . ARG A 1 151 ? 10.609  20.951  26.410  1.00 34.79  ? 151  ARG A CB  1 
ATOM   1010  C CG  . ARG A 1 151 ? 9.378   20.199  26.879  1.00 40.63  ? 151  ARG A CG  1 
ATOM   1011  C CD  . ARG A 1 151 ? 8.608   21.041  27.856  1.00 49.11  ? 151  ARG A CD  1 
ATOM   1012  N NE  . ARG A 1 151 ? 7.280   20.499  28.125  1.00 56.83  ? 151  ARG A NE  1 
ATOM   1013  C CZ  . ARG A 1 151 ? 6.343   21.139  28.813  1.00 70.41  ? 151  ARG A CZ  1 
ATOM   1014  N NH1 . ARG A 1 151 ? 6.575   22.351  29.297  1.00 65.92  ? 151  ARG A NH1 1 
ATOM   1015  N NH2 . ARG A 1 151 ? 5.162   20.573  29.018  1.00 53.26  ? 151  ARG A NH2 1 
ATOM   1016  N N   . LYS A 1 152 ? 11.337  20.554  23.316  1.00 36.09  ? 152  LYS A N   1 
ATOM   1017  C CA  . LYS A 1 152 ? 11.005  20.317  21.913  1.00 36.05  ? 152  LYS A CA  1 
ATOM   1018  C C   . LYS A 1 152 ? 11.857  19.169  21.356  1.00 39.71  ? 152  LYS A C   1 
ATOM   1019  O O   . LYS A 1 152 ? 11.293  18.249  20.767  1.00 38.97  ? 152  LYS A O   1 
ATOM   1020  C CB  . LYS A 1 152 ? 11.195  21.605  21.086  1.00 39.09  ? 152  LYS A CB  1 
ATOM   1021  C CG  . LYS A 1 152 ? 11.155  21.434  19.565  1.00 42.99  ? 152  LYS A CG  1 
ATOM   1022  C CD  . LYS A 1 152 ? 9.751   21.195  19.005  1.00 46.60  ? 152  LYS A CD  1 
ATOM   1023  C CE  . LYS A 1 152 ? 9.767   21.033  17.507  1.00 41.53  ? 152  LYS A CE  1 
ATOM   1024  N NZ  . LYS A 1 152 ? 8.441   20.601  16.989  1.00 47.35  ? 152  LYS A NZ  1 
ATOM   1025  N N   . THR A 1 153 ? 13.195  19.208  21.574  1.00 35.76  ? 153  THR A N   1 
ATOM   1026  C CA  . THR A 1 153 ? 14.137  18.182  21.111  1.00 34.29  ? 153  THR A CA  1 
ATOM   1027  C C   . THR A 1 153 ? 13.807  16.814  21.728  1.00 36.37  ? 153  THR A C   1 
ATOM   1028  O O   . THR A 1 153 ? 13.704  15.831  20.989  1.00 34.31  ? 153  THR A O   1 
ATOM   1029  C CB  . THR A 1 153 ? 15.585  18.607  21.426  1.00 42.58  ? 153  THR A CB  1 
ATOM   1030  O OG1 . THR A 1 153 ? 15.871  19.808  20.714  1.00 42.15  ? 153  THR A OG1 1 
ATOM   1031  C CG2 . THR A 1 153 ? 16.622  17.537  21.062  1.00 38.68  ? 153  THR A CG2 1 
ATOM   1032  N N   . VAL A 1 154 ? 13.630  16.762  23.069  1.00 32.51  ? 154  VAL A N   1 
ATOM   1033  C CA  . VAL A 1 154 ? 13.348  15.527  23.817  1.00 30.88  ? 154  VAL A CA  1 
ATOM   1034  C C   . VAL A 1 154 ? 12.025  14.898  23.349  1.00 35.70  ? 154  VAL A C   1 
ATOM   1035  O O   . VAL A 1 154 ? 11.985  13.683  23.138  1.00 36.13  ? 154  VAL A O   1 
ATOM   1036  C CB  . VAL A 1 154 ? 13.376  15.752  25.350  1.00 34.00  ? 154  VAL A CB  1 
ATOM   1037  C CG1 . VAL A 1 154 ? 12.925  14.506  26.113  1.00 32.83  ? 154  VAL A CG1 1 
ATOM   1038  C CG2 . VAL A 1 154 ? 14.767  16.171  25.804  1.00 33.65  ? 154  VAL A CG2 1 
ATOM   1039  N N   . LEU A 1 155 ? 10.970  15.708  23.152  1.00 32.26  ? 155  LEU A N   1 
ATOM   1040  C CA  . LEU A 1 155 ? 9.667   15.206  22.709  1.00 31.94  ? 155  LEU A CA  1 
ATOM   1041  C C   . LEU A 1 155 ? 9.735   14.679  21.270  1.00 35.92  ? 155  LEU A C   1 
ATOM   1042  O O   . LEU A 1 155 ? 9.197   13.604  20.996  1.00 35.62  ? 155  LEU A O   1 
ATOM   1043  C CB  . LEU A 1 155 ? 8.571   16.279  22.847  1.00 32.90  ? 155  LEU A CB  1 
ATOM   1044  C CG  . LEU A 1 155 ? 8.191   16.673  24.283  1.00 36.47  ? 155  LEU A CG  1 
ATOM   1045  C CD1 . LEU A 1 155 ? 7.446   17.989  24.307  1.00 37.53  ? 155  LEU A CD1 1 
ATOM   1046  C CD2 . LEU A 1 155 ? 7.401   15.586  24.968  1.00 36.62  ? 155  LEU A CD2 1 
ATOM   1047  N N   . GLN A 1 156 ? 10.442  15.396  20.374  1.00 32.08  ? 156  GLN A N   1 
ATOM   1048  C CA  . GLN A 1 156 ? 10.613  14.987  18.981  1.00 31.12  ? 156  GLN A CA  1 
ATOM   1049  C C   . GLN A 1 156 ? 11.449  13.708  18.881  1.00 33.18  ? 156  GLN A C   1 
ATOM   1050  O O   . GLN A 1 156 ? 11.082  12.820  18.107  1.00 31.92  ? 156  GLN A O   1 
ATOM   1051  C CB  . GLN A 1 156 ? 11.232  16.105  18.135  1.00 33.25  ? 156  GLN A CB  1 
ATOM   1052  C CG  . GLN A 1 156 ? 10.306  17.293  17.845  1.00 34.04  ? 156  GLN A CG  1 
ATOM   1053  C CD  . GLN A 1 156 ? 9.041   17.014  17.070  1.00 47.29  ? 156  GLN A CD  1 
ATOM   1054  O OE1 . GLN A 1 156 ? 8.051   17.715  17.225  1.00 46.83  ? 156  GLN A OE1 1 
ATOM   1055  N NE2 . GLN A 1 156 ? 9.037   16.032  16.189  1.00 42.25  ? 156  GLN A NE2 1 
ATOM   1056  N N   . LEU A 1 157 ? 12.532  13.590  19.694  1.00 29.62  ? 157  LEU A N   1 
ATOM   1057  C CA  . LEU A 1 157 ? 13.369  12.384  19.743  1.00 28.14  ? 157  LEU A CA  1 
ATOM   1058  C C   . LEU A 1 157 ? 12.560  11.190  20.223  1.00 30.97  ? 157  LEU A C   1 
ATOM   1059  O O   . LEU A 1 157 ? 12.589  10.142  19.589  1.00 30.98  ? 157  LEU A O   1 
ATOM   1060  C CB  . LEU A 1 157 ? 14.589  12.557  20.682  1.00 27.80  ? 157  LEU A CB  1 
ATOM   1061  C CG  . LEU A 1 157 ? 15.743  13.444  20.227  1.00 32.28  ? 157  LEU A CG  1 
ATOM   1062  C CD1 . LEU A 1 157 ? 16.730  13.665  21.366  1.00 32.00  ? 157  LEU A CD1 1 
ATOM   1063  C CD2 . LEU A 1 157 ? 16.433  12.895  18.984  1.00 33.42  ? 157  LEU A CD2 1 
ATOM   1064  N N   . SER A 1 158 ? 11.811  11.367  21.327  1.00 26.40  ? 158  SER A N   1 
ATOM   1065  C CA  . SER A 1 158 ? 11.020  10.326  21.977  1.00 25.35  ? 158  SER A CA  1 
ATOM   1066  C C   . SER A 1 158 ? 9.899   9.808   21.107  1.00 29.22  ? 158  SER A C   1 
ATOM   1067  O O   . SER A 1 158 ? 9.635   8.607   21.145  1.00 29.18  ? 158  SER A O   1 
ATOM   1068  C CB  . SER A 1 158 ? 10.469  10.821  23.305  1.00 29.51  ? 158  SER A CB  1 
ATOM   1069  O OG  . SER A 1 158 ? 11.552  11.196  24.137  1.00 33.94  ? 158  SER A OG  1 
ATOM   1070  N N   . LEU A 1 159 ? 9.262   10.676  20.291  1.00 26.78  ? 159  LEU A N   1 
ATOM   1071  C CA  . LEU A 1 159 ? 8.214   10.240  19.359  1.00 26.10  ? 159  LEU A CA  1 
ATOM   1072  C C   . LEU A 1 159 ? 8.790   9.266   18.353  1.00 28.90  ? 159  LEU A C   1 
ATOM   1073  O O   . LEU A 1 159 ? 8.150   8.267   18.036  1.00 28.49  ? 159  LEU A O   1 
ATOM   1074  C CB  . LEU A 1 159 ? 7.562   11.432  18.625  1.00 27.44  ? 159  LEU A CB  1 
ATOM   1075  C CG  . LEU A 1 159 ? 6.588   12.298  19.436  1.00 32.73  ? 159  LEU A CG  1 
ATOM   1076  C CD1 . LEU A 1 159 ? 6.249   13.576  18.695  1.00 33.44  ? 159  LEU A CD1 1 
ATOM   1077  C CD2 . LEU A 1 159 ? 5.313   11.543  19.785  1.00 34.61  ? 159  LEU A CD2 1 
ATOM   1078  N N   . ARG A 1 160 ? 10.035  9.521   17.910  1.00 26.00  ? 160  ARG A N   1 
ATOM   1079  C CA  . ARG A 1 160 ? 10.686  8.676   16.909  1.00 25.70  ? 160  ARG A CA  1 
ATOM   1080  C C   . ARG A 1 160 ? 11.205  7.395   17.517  1.00 29.72  ? 160  ARG A C   1 
ATOM   1081  O O   . ARG A 1 160 ? 11.143  6.364   16.855  1.00 30.02  ? 160  ARG A O   1 
ATOM   1082  C CB  . ARG A 1 160 ? 11.795  9.433   16.164  1.00 23.76  ? 160  ARG A CB  1 
ATOM   1083  C CG  . ARG A 1 160 ? 11.313  10.725  15.517  1.00 23.36  ? 160  ARG A CG  1 
ATOM   1084  C CD  . ARG A 1 160 ? 10.399  10.517  14.317  1.00 32.26  ? 160  ARG A CD  1 
ATOM   1085  N NE  . ARG A 1 160 ? 8.998   10.228  14.649  1.00 32.07  ? 160  ARG A NE  1 
ATOM   1086  C CZ  . ARG A 1 160 ? 8.066   11.152  14.868  1.00 43.02  ? 160  ARG A CZ  1 
ATOM   1087  N NH1 . ARG A 1 160 ? 8.384   12.439  14.869  1.00 30.87  ? 160  ARG A NH1 1 
ATOM   1088  N NH2 . ARG A 1 160 ? 6.815   10.794  15.116  1.00 34.94  ? 160  ARG A NH2 1 
ATOM   1089  N N   . ILE A 1 161 ? 11.665  7.439   18.783  1.00 25.55  ? 161  ILE A N   1 
ATOM   1090  C CA  . ILE A 1 161 ? 12.124  6.257   19.515  1.00 23.76  ? 161  ILE A CA  1 
ATOM   1091  C C   . ILE A 1 161 ? 10.908  5.340   19.762  1.00 28.38  ? 161  ILE A C   1 
ATOM   1092  O O   . ILE A 1 161 ? 11.028  4.129   19.578  1.00 28.08  ? 161  ILE A O   1 
ATOM   1093  C CB  . ILE A 1 161 ? 12.895  6.641   20.809  1.00 25.62  ? 161  ILE A CB  1 
ATOM   1094  C CG1 . ILE A 1 161 ? 14.229  7.355   20.439  1.00 24.83  ? 161  ILE A CG1 1 
ATOM   1095  C CG2 . ILE A 1 161 ? 13.161  5.405   21.699  1.00 24.50  ? 161  ILE A CG2 1 
ATOM   1096  C CD1 . ILE A 1 161 ? 14.828  8.223   21.552  1.00 25.67  ? 161  ILE A CD1 1 
ATOM   1097  N N   . LEU A 1 162 ? 9.724   5.916   20.065  1.00 27.13  ? 162  LEU A N   1 
ATOM   1098  C CA  . LEU A 1 162 ? 8.486   5.133   20.240  1.00 27.37  ? 162  LEU A CA  1 
ATOM   1099  C C   . LEU A 1 162 ? 8.117   4.371   18.952  1.00 31.99  ? 162  LEU A C   1 
ATOM   1100  O O   . LEU A 1 162 ? 7.646   3.233   19.035  1.00 32.55  ? 162  LEU A O   1 
ATOM   1101  C CB  . LEU A 1 162 ? 7.308   6.010   20.694  1.00 28.30  ? 162  LEU A CB  1 
ATOM   1102  C CG  . LEU A 1 162 ? 7.323   6.473   22.158  1.00 32.87  ? 162  LEU A CG  1 
ATOM   1103  C CD1 . LEU A 1 162 ? 6.097   7.271   22.475  1.00 33.30  ? 162  LEU A CD1 1 
ATOM   1104  C CD2 . LEU A 1 162 ? 7.428   5.294   23.114  1.00 34.70  ? 162  LEU A CD2 1 
ATOM   1105  N N   . ASP A 1 163 ? 8.388   4.973   17.774  1.00 27.56  ? 163  ASP A N   1 
ATOM   1106  C CA  . ASP A 1 163 ? 8.168   4.347   16.472  1.00 26.76  ? 163  ASP A CA  1 
ATOM   1107  C C   . ASP A 1 163 ? 9.100   3.146   16.302  1.00 30.85  ? 163  ASP A C   1 
ATOM   1108  O O   . ASP A 1 163 ? 8.648   2.078   15.870  1.00 31.09  ? 163  ASP A O   1 
ATOM   1109  C CB  . ASP A 1 163 ? 8.383   5.362   15.321  1.00 28.43  ? 163  ASP A CB  1 
ATOM   1110  C CG  . ASP A 1 163 ? 7.313   6.433   15.164  1.00 33.04  ? 163  ASP A CG  1 
ATOM   1111  O OD1 . ASP A 1 163 ? 6.195   6.229   15.663  1.00 33.17  ? 163  ASP A OD1 1 
ATOM   1112  O OD2 . ASP A 1 163 ? 7.577   7.446   14.481  1.00 36.57  ? 163  ASP A OD2 1 
ATOM   1113  N N   . ILE A 1 164 ? 10.401  3.328   16.648  1.00 26.45  ? 164  ILE A N   1 
ATOM   1114  C CA  . ILE A 1 164 ? 11.445  2.302   16.571  1.00 25.08  ? 164  ILE A CA  1 
ATOM   1115  C C   . ILE A 1 164 ? 11.083  1.137   17.491  1.00 28.87  ? 164  ILE A C   1 
ATOM   1116  O O   . ILE A 1 164 ? 11.121  -0.024  17.059  1.00 29.53  ? 164  ILE A O   1 
ATOM   1117  C CB  . ILE A 1 164 ? 12.849  2.881   16.933  1.00 27.57  ? 164  ILE A CB  1 
ATOM   1118  C CG1 . ILE A 1 164 ? 13.291  3.961   15.931  1.00 28.05  ? 164  ILE A CG1 1 
ATOM   1119  C CG2 . ILE A 1 164 ? 13.909  1.769   17.076  1.00 26.94  ? 164  ILE A CG2 1 
ATOM   1120  C CD1 . ILE A 1 164 ? 14.365  4.955   16.474  1.00 34.97  ? 164  ILE A CD1 1 
ATOM   1121  N N   . LEU A 1 165 ? 10.750  1.456   18.760  1.00 23.85  ? 165  LEU A N   1 
ATOM   1122  C CA  . LEU A 1 165 ? 10.431  0.471   19.790  1.00 22.84  ? 165  LEU A CA  1 
ATOM   1123  C C   . LEU A 1 165 ? 9.192   -0.318  19.412  1.00 27.97  ? 165  LEU A C   1 
ATOM   1124  O O   . LEU A 1 165 ? 9.256   -1.538  19.459  1.00 28.60  ? 165  LEU A O   1 
ATOM   1125  C CB  . LEU A 1 165 ? 10.304  1.100   21.188  1.00 22.44  ? 165  LEU A CB  1 
ATOM   1126  C CG  . LEU A 1 165 ? 11.599  1.690   21.776  1.00 26.61  ? 165  LEU A CG  1 
ATOM   1127  C CD1 . LEU A 1 165 ? 11.352  2.305   23.154  1.00 25.85  ? 165  LEU A CD1 1 
ATOM   1128  C CD2 . LEU A 1 165 ? 12.766  0.660   21.803  1.00 26.87  ? 165  LEU A CD2 1 
ATOM   1129  N N   . GLU A 1 166 ? 8.115   0.338   18.940  1.00 24.74  ? 166  GLU A N   1 
ATOM   1130  C CA  . GLU A 1 166 ? 6.922   -0.381  18.473  1.00 24.66  ? 166  GLU A CA  1 
ATOM   1131  C C   . GLU A 1 166 ? 7.271   -1.400  17.368  1.00 29.36  ? 166  GLU A C   1 
ATOM   1132  O O   . GLU A 1 166 ? 6.835   -2.555  17.439  1.00 31.18  ? 166  GLU A O   1 
ATOM   1133  C CB  . GLU A 1 166 ? 5.843   0.587   17.966  1.00 26.62  ? 166  GLU A CB  1 
ATOM   1134  C CG  . GLU A 1 166 ? 4.603   -0.145  17.479  1.00 34.45  ? 166  GLU A CG  1 
ATOM   1135  C CD  . GLU A 1 166 ? 3.366   0.691   17.255  1.00 50.53  ? 166  GLU A CD  1 
ATOM   1136  O OE1 . GLU A 1 166 ? 3.492   1.926   17.096  1.00 36.73  ? 166  GLU A OE1 1 
ATOM   1137  O OE2 . GLU A 1 166 ? 2.262   0.104   17.234  1.00 48.78  ? 166  GLU A OE2 1 
ATOM   1138  N N   . TYR A 1 167 ? 8.068   -0.975  16.373  1.00 24.32  ? 167  TYR A N   1 
ATOM   1139  C CA  . TYR A 1 167 ? 8.495   -1.807  15.253  1.00 23.47  ? 167  TYR A CA  1 
ATOM   1140  C C   . TYR A 1 167 ? 9.260   -3.051  15.732  1.00 27.09  ? 167  TYR A C   1 
ATOM   1141  O O   . TYR A 1 167 ? 8.861   -4.162  15.384  1.00 26.87  ? 167  TYR A O   1 
ATOM   1142  C CB  . TYR A 1 167 ? 9.338   -0.998  14.249  1.00 23.91  ? 167  TYR A CB  1 
ATOM   1143  C CG  . TYR A 1 167 ? 9.843   -1.831  13.091  1.00 24.87  ? 167  TYR A CG  1 
ATOM   1144  C CD1 . TYR A 1 167 ? 9.033   -2.094  11.989  1.00 26.77  ? 167  TYR A CD1 1 
ATOM   1145  C CD2 . TYR A 1 167 ? 11.126  -2.366  13.099  1.00 24.94  ? 167  TYR A CD2 1 
ATOM   1146  C CE1 . TYR A 1 167 ? 9.485   -2.862  10.919  1.00 26.16  ? 167  TYR A CE1 1 
ATOM   1147  C CE2 . TYR A 1 167 ? 11.575  -3.177  12.053  1.00 25.93  ? 167  TYR A CE2 1 
ATOM   1148  C CZ  . TYR A 1 167 ? 10.753  -3.410  10.956  1.00 31.50  ? 167  TYR A CZ  1 
ATOM   1149  O OH  . TYR A 1 167 ? 11.157  -4.184  9.895   1.00 30.05  ? 167  TYR A OH  1 
ATOM   1150  N N   . ILE A 1 168 ? 10.342  -2.873  16.518  1.00 24.38  ? 168  ILE A N   1 
ATOM   1151  C CA  . ILE A 1 168 ? 11.193  -3.986  16.976  1.00 23.52  ? 168  ILE A CA  1 
ATOM   1152  C C   . ILE A 1 168 ? 10.423  -4.924  17.917  1.00 26.65  ? 168  ILE A C   1 
ATOM   1153  O O   . ILE A 1 168 ? 10.595  -6.141  17.814  1.00 26.60  ? 168  ILE A O   1 
ATOM   1154  C CB  . ILE A 1 168 ? 12.572  -3.540  17.564  1.00 25.98  ? 168  ILE A CB  1 
ATOM   1155  C CG1 . ILE A 1 168 ? 12.455  -2.772  18.901  1.00 25.88  ? 168  ILE A CG1 1 
ATOM   1156  C CG2 . ILE A 1 168 ? 13.384  -2.752  16.510  1.00 25.37  ? 168  ILE A CG2 1 
ATOM   1157  C CD1 . ILE A 1 168 ? 13.689  -2.781  19.735  1.00 25.45  ? 168  ILE A CD1 1 
ATOM   1158  N N   . HIS A 1 169 ? 9.538   -4.372  18.783  1.00 22.12  ? 169  HIS A N   1 
ATOM   1159  C CA  . HIS A 1 169 ? 8.687   -5.148  19.694  1.00 21.36  ? 169  HIS A CA  1 
ATOM   1160  C C   . HIS A 1 169 ? 7.715   -6.017  18.901  1.00 25.87  ? 169  HIS A C   1 
ATOM   1161  O O   . HIS A 1 169 ? 7.522   -7.187  19.249  1.00 25.24  ? 169  HIS A O   1 
ATOM   1162  C CB  . HIS A 1 169 ? 7.926   -4.237  20.667  1.00 22.44  ? 169  HIS A CB  1 
ATOM   1163  C CG  . HIS A 1 169 ? 8.789   -3.493  21.655  1.00 25.38  ? 169  HIS A CG  1 
ATOM   1164  N ND1 . HIS A 1 169 ? 8.254   -2.519  22.481  1.00 27.60  ? 169  HIS A ND1 1 
ATOM   1165  C CD2 . HIS A 1 169 ? 10.119  -3.581  21.900  1.00 26.36  ? 169  HIS A CD2 1 
ATOM   1166  C CE1 . HIS A 1 169 ? 9.266   -2.054  23.198  1.00 26.44  ? 169  HIS A CE1 1 
ATOM   1167  N NE2 . HIS A 1 169 ? 10.407  -2.661  22.881  1.00 26.16  ? 169  HIS A NE2 1 
ATOM   1168  N N   . GLU A 1 170 ? 7.149   -5.471  17.800  1.00 24.10  ? 170  GLU A N   1 
ATOM   1169  C CA  . GLU A 1 170 ? 6.235   -6.206  16.910  1.00 25.45  ? 170  GLU A CA  1 
ATOM   1170  C C   . GLU A 1 170 ? 6.985   -7.268  16.100  1.00 31.00  ? 170  GLU A C   1 
ATOM   1171  O O   . GLU A 1 170 ? 6.348   -8.170  15.563  1.00 32.80  ? 170  GLU A O   1 
ATOM   1172  C CB  . GLU A 1 170 ? 5.471   -5.251  15.968  1.00 27.55  ? 170  GLU A CB  1 
ATOM   1173  C CG  . GLU A 1 170 ? 4.330   -4.502  16.645  1.00 39.34  ? 170  GLU A CG  1 
ATOM   1174  C CD  . GLU A 1 170 ? 3.316   -5.371  17.366  1.00 48.61  ? 170  GLU A CD  1 
ATOM   1175  O OE1 . GLU A 1 170 ? 2.620   -6.171  16.699  1.00 45.24  ? 170  GLU A OE1 1 
ATOM   1176  O OE2 . GLU A 1 170 ? 3.233   -5.263  18.608  1.00 45.24  ? 170  GLU A OE2 1 
ATOM   1177  N N   . HIS A 1 171 ? 8.336   -7.176  16.044  1.00 26.20  ? 171  HIS A N   1 
ATOM   1178  C CA  . HIS A 1 171 ? 9.208   -8.118  15.344  1.00 25.24  ? 171  HIS A CA  1 
ATOM   1179  C C   . HIS A 1 171 ? 9.971   -9.000  16.359  1.00 29.59  ? 171  HIS A C   1 
ATOM   1180  O O   . HIS A 1 171 ? 11.047  -9.504  16.045  1.00 29.67  ? 171  HIS A O   1 
ATOM   1181  C CB  . HIS A 1 171 ? 10.139  -7.371  14.359  1.00 25.20  ? 171  HIS A CB  1 
ATOM   1182  C CG  . HIS A 1 171 ? 9.387   -6.849  13.174  1.00 28.87  ? 171  HIS A CG  1 
ATOM   1183  N ND1 . HIS A 1 171 ? 8.613   -5.707  13.261  1.00 31.10  ? 171  HIS A ND1 1 
ATOM   1184  C CD2 . HIS A 1 171 ? 9.244   -7.379  11.940  1.00 30.93  ? 171  HIS A CD2 1 
ATOM   1185  C CE1 . HIS A 1 171 ? 8.048   -5.564  12.074  1.00 31.04  ? 171  HIS A CE1 1 
ATOM   1186  N NE2 . HIS A 1 171 ? 8.408   -6.538  11.241  1.00 31.57  ? 171  HIS A NE2 1 
ATOM   1187  N N   . GLU A 1 172 ? 9.350   -9.232  17.560  1.00 26.48  ? 172  GLU A N   1 
ATOM   1188  C CA  . GLU A 1 172 ? 9.747   -10.120 18.678  1.00 25.89  ? 172  GLU A CA  1 
ATOM   1189  C C   . GLU A 1 172 ? 11.021  -9.699  19.438  1.00 27.17  ? 172  GLU A C   1 
ATOM   1190  O O   . GLU A 1 172 ? 11.545  -10.499 20.210  1.00 25.65  ? 172  GLU A O   1 
ATOM   1191  C CB  . GLU A 1 172 ? 9.942   -11.587 18.194  1.00 27.89  ? 172  GLU A CB  1 
ATOM   1192  C CG  . GLU A 1 172 ? 8.835   -12.125 17.299  1.00 34.76  ? 172  GLU A CG  1 
ATOM   1193  C CD  . GLU A 1 172 ? 9.010   -13.549 16.815  1.00 44.33  ? 172  GLU A CD  1 
ATOM   1194  O OE1 . GLU A 1 172 ? 10.154  -13.957 16.506  1.00 52.48  ? 172  GLU A OE1 1 
ATOM   1195  O OE2 . GLU A 1 172 ? 7.979   -14.243 16.689  1.00 36.84  ? 172  GLU A OE2 1 
ATOM   1196  N N   . TYR A 1 173 ? 11.499  -8.467  19.267  1.00 23.97  ? 173  TYR A N   1 
ATOM   1197  C CA  . TYR A 1 173 ? 12.733  -8.027  19.929  1.00 22.38  ? 173  TYR A CA  1 
ATOM   1198  C C   . TYR A 1 173 ? 12.559  -6.831  20.841  1.00 26.49  ? 173  TYR A C   1 
ATOM   1199  O O   . TYR A 1 173 ? 11.723  -5.971  20.594  1.00 26.31  ? 173  TYR A O   1 
ATOM   1200  C CB  . TYR A 1 173 ? 13.804  -7.649  18.880  1.00 22.23  ? 173  TYR A CB  1 
ATOM   1201  C CG  . TYR A 1 173 ? 14.554  -8.819  18.285  1.00 22.33  ? 173  TYR A CG  1 
ATOM   1202  C CD1 . TYR A 1 173 ? 15.690  -9.329  18.904  1.00 23.42  ? 173  TYR A CD1 1 
ATOM   1203  C CD2 . TYR A 1 173 ? 14.172  -9.369  17.062  1.00 22.62  ? 173  TYR A CD2 1 
ATOM   1204  C CE1 . TYR A 1 173 ? 16.404  -10.388 18.346  1.00 23.54  ? 173  TYR A CE1 1 
ATOM   1205  C CE2 . TYR A 1 173 ? 14.882  -10.424 16.487  1.00 23.22  ? 173  TYR A CE2 1 
ATOM   1206  C CZ  . TYR A 1 173 ? 16.002  -10.931 17.132  1.00 29.07  ? 173  TYR A CZ  1 
ATOM   1207  O OH  . TYR A 1 173 ? 16.705  -11.984 16.587  1.00 23.69  ? 173  TYR A OH  1 
ATOM   1208  N N   . VAL A 1 174 ? 13.425  -6.751  21.864  1.00 22.87  ? 174  VAL A N   1 
ATOM   1209  C CA  . VAL A 1 174 ? 13.572  -5.615  22.768  1.00 21.27  ? 174  VAL A CA  1 
ATOM   1210  C C   . VAL A 1 174 ? 15.057  -5.185  22.684  1.00 24.27  ? 174  VAL A C   1 
ATOM   1211  O O   . VAL A 1 174 ? 15.939  -6.027  22.488  1.00 23.43  ? 174  VAL A O   1 
ATOM   1212  C CB  . VAL A 1 174 ? 13.064  -5.826  24.228  1.00 25.07  ? 174  VAL A CB  1 
ATOM   1213  C CG1 . VAL A 1 174 ? 11.547  -5.979  24.269  1.00 24.88  ? 174  VAL A CG1 1 
ATOM   1214  C CG2 . VAL A 1 174 ? 13.759  -6.990  24.927  1.00 24.88  ? 174  VAL A CG2 1 
ATOM   1215  N N   . HIS A 1 175 ? 15.321  -3.886  22.774  1.00 21.36  ? 175  HIS A N   1 
ATOM   1216  C CA  . HIS A 1 175 ? 16.682  -3.353  22.686  1.00 21.32  ? 175  HIS A CA  1 
ATOM   1217  C C   . HIS A 1 175 ? 17.426  -3.482  24.047  1.00 25.46  ? 175  HIS A C   1 
ATOM   1218  O O   . HIS A 1 175 ? 18.561  -3.989  24.089  1.00 24.40  ? 175  HIS A O   1 
ATOM   1219  C CB  . HIS A 1 175 ? 16.634  -1.888  22.208  1.00 21.60  ? 175  HIS A CB  1 
ATOM   1220  C CG  . HIS A 1 175 ? 17.969  -1.345  21.819  1.00 24.26  ? 175  HIS A CG  1 
ATOM   1221  N ND1 . HIS A 1 175 ? 18.810  -0.785  22.751  1.00 25.29  ? 175  HIS A ND1 1 
ATOM   1222  C CD2 . HIS A 1 175 ? 18.569  -1.323  20.607  1.00 25.45  ? 175  HIS A CD2 1 
ATOM   1223  C CE1 . HIS A 1 175 ? 19.883  -0.417  22.083  1.00 25.08  ? 175  HIS A CE1 1 
ATOM   1224  N NE2 . HIS A 1 175 ? 19.780  -0.715  20.784  1.00 25.45  ? 175  HIS A NE2 1 
ATOM   1225  N N   . GLY A 1 176 ? 16.780  -2.992  25.120  1.00 22.40  ? 176  GLY A N   1 
ATOM   1226  C CA  . GLY A 1 176 ? 17.284  -3.040  26.490  1.00 22.75  ? 176  GLY A CA  1 
ATOM   1227  C C   . GLY A 1 176 ? 18.453  -2.130  26.820  1.00 29.13  ? 176  GLY A C   1 
ATOM   1228  O O   . GLY A 1 176 ? 18.967  -2.179  27.944  1.00 28.80  ? 176  GLY A O   1 
ATOM   1229  N N   . ASP A 1 177 ? 18.882  -1.277  25.861  1.00 26.10  ? 177  ASP A N   1 
ATOM   1230  C CA  . ASP A 1 177 ? 20.024  -0.398  26.081  1.00 25.82  ? 177  ASP A CA  1 
ATOM   1231  C C   . ASP A 1 177 ? 19.901  0.919   25.288  1.00 28.21  ? 177  ASP A C   1 
ATOM   1232  O O   . ASP A 1 177 ? 20.864  1.371   24.652  1.00 27.86  ? 177  ASP A O   1 
ATOM   1233  C CB  . ASP A 1 177 ? 21.338  -1.136  25.746  1.00 27.87  ? 177  ASP A CB  1 
ATOM   1234  C CG  . ASP A 1 177 ? 22.568  -0.608  26.458  1.00 35.61  ? 177  ASP A CG  1 
ATOM   1235  O OD1 . ASP A 1 177 ? 22.438  0.360   27.237  1.00 35.44  ? 177  ASP A OD1 1 
ATOM   1236  O OD2 . ASP A 1 177 ? 23.659  -1.161  26.238  1.00 43.03  ? 177  ASP A OD2 1 
ATOM   1237  N N   . ILE A 1 178 ? 18.714  1.541   25.353  1.00 24.11  ? 178  ILE A N   1 
ATOM   1238  C CA  . ILE A 1 178 ? 18.449  2.838   24.715  1.00 23.94  ? 178  ILE A CA  1 
ATOM   1239  C C   . ILE A 1 178 ? 19.205  3.921   25.523  1.00 29.03  ? 178  ILE A C   1 
ATOM   1240  O O   . ILE A 1 178 ? 19.091  3.972   26.752  1.00 29.32  ? 178  ILE A O   1 
ATOM   1241  C CB  . ILE A 1 178 ? 16.917  3.133   24.614  1.00 26.71  ? 178  ILE A CB  1 
ATOM   1242  C CG1 . ILE A 1 178 ? 16.160  2.014   23.876  1.00 26.89  ? 178  ILE A CG1 1 
ATOM   1243  C CG2 . ILE A 1 178 ? 16.625  4.506   23.988  1.00 26.70  ? 178  ILE A CG2 1 
ATOM   1244  C CD1 . ILE A 1 178 ? 15.310  1.142   24.772  1.00 26.95  ? 178  ILE A CD1 1 
ATOM   1245  N N   . LYS A 1 179 ? 19.996  4.744   24.824  1.00 24.99  ? 179  LYS A N   1 
ATOM   1246  C CA  . LYS A 1 179 ? 20.790  5.858   25.365  1.00 25.48  ? 179  LYS A CA  1 
ATOM   1247  C C   . LYS A 1 179 ? 21.268  6.734   24.196  1.00 31.01  ? 179  LYS A C   1 
ATOM   1248  O O   . LYS A 1 179 ? 21.213  6.286   23.045  1.00 31.42  ? 179  LYS A O   1 
ATOM   1249  C CB  . LYS A 1 179 ? 21.969  5.379   26.252  1.00 26.71  ? 179  LYS A CB  1 
ATOM   1250  C CG  . LYS A 1 179 ? 22.957  4.439   25.586  1.00 23.82  ? 179  LYS A CG  1 
ATOM   1251  C CD  . LYS A 1 179 ? 23.902  3.846   26.596  1.00 28.84  ? 179  LYS A CD  1 
ATOM   1252  C CE  . LYS A 1 179 ? 24.774  2.810   25.951  1.00 35.60  ? 179  LYS A CE  1 
ATOM   1253  N NZ  . LYS A 1 179 ? 25.789  2.289   26.889  1.00 35.35  ? 179  LYS A NZ  1 
ATOM   1254  N N   . ALA A 1 180 ? 21.714  7.974   24.488  1.00 26.68  ? 180  ALA A N   1 
ATOM   1255  C CA  . ALA A 1 180 ? 22.161  8.957   23.501  1.00 26.35  ? 180  ALA A CA  1 
ATOM   1256  C C   . ALA A 1 180 ? 23.338  8.453   22.632  1.00 30.64  ? 180  ALA A C   1 
ATOM   1257  O O   . ALA A 1 180 ? 23.386  8.788   21.449  1.00 31.01  ? 180  ALA A O   1 
ATOM   1258  C CB  . ALA A 1 180 ? 22.535  10.261  24.192  1.00 27.94  ? 180  ALA A CB  1 
ATOM   1259  N N   . SER A 1 181 ? 24.256  7.629   23.193  1.00 27.45  ? 181  SER A N   1 
ATOM   1260  C CA  . SER A 1 181 ? 25.394  7.089   22.434  1.00 27.10  ? 181  SER A CA  1 
ATOM   1261  C C   . SER A 1 181 ? 24.960  6.007   21.416  1.00 30.78  ? 181  SER A C   1 
ATOM   1262  O O   . SER A 1 181 ? 25.727  5.701   20.503  1.00 31.47  ? 181  SER A O   1 
ATOM   1263  C CB  . SER A 1 181 ? 26.474  6.547   23.365  1.00 29.35  ? 181  SER A CB  1 
ATOM   1264  O OG  . SER A 1 181 ? 26.077  5.350   24.012  1.00 36.67  ? 181  SER A OG  1 
ATOM   1265  N N   . ASN A 1 182 ? 23.741  5.438   21.567  1.00 26.98  ? 182  ASN A N   1 
ATOM   1266  C CA  . ASN A 1 182 ? 23.184  4.422   20.657  1.00 25.75  ? 182  ASN A CA  1 
ATOM   1267  C C   . ASN A 1 182 ? 22.166  5.048   19.690  1.00 27.63  ? 182  ASN A C   1 
ATOM   1268  O O   . ASN A 1 182 ? 21.478  4.334   18.962  1.00 25.92  ? 182  ASN A O   1 
ATOM   1269  C CB  . ASN A 1 182 ? 22.549  3.271   21.444  1.00 25.49  ? 182  ASN A CB  1 
ATOM   1270  C CG  . ASN A 1 182 ? 23.544  2.294   22.010  1.00 37.62  ? 182  ASN A CG  1 
ATOM   1271  O OD1 . ASN A 1 182 ? 24.657  2.146   21.507  1.00 29.06  ? 182  ASN A OD1 1 
ATOM   1272  N ND2 . ASN A 1 182 ? 23.156  1.593   23.069  1.00 30.17  ? 182  ASN A ND2 1 
ATOM   1273  N N   . LEU A 1 183 ? 22.092  6.385   19.679  1.00 25.15  ? 183  LEU A N   1 
ATOM   1274  C CA  . LEU A 1 183 ? 21.204  7.140   18.813  1.00 25.20  ? 183  LEU A CA  1 
ATOM   1275  C C   . LEU A 1 183 ? 22.040  7.996   17.882  1.00 31.19  ? 183  LEU A C   1 
ATOM   1276  O O   . LEU A 1 183 ? 22.719  8.918   18.320  1.00 31.61  ? 183  LEU A O   1 
ATOM   1277  C CB  . LEU A 1 183 ? 20.216  7.976   19.630  1.00 25.38  ? 183  LEU A CB  1 
ATOM   1278  C CG  . LEU A 1 183 ? 19.163  7.181   20.417  1.00 28.23  ? 183  LEU A CG  1 
ATOM   1279  C CD1 . LEU A 1 183 ? 18.606  8.009   21.540  1.00 29.13  ? 183  LEU A CD1 1 
ATOM   1280  C CD2 . LEU A 1 183 ? 18.054  6.675   19.506  1.00 26.59  ? 183  LEU A CD2 1 
ATOM   1281  N N   . LEU A 1 184 ? 22.035  7.641   16.599  1.00 28.60  ? 184  LEU A N   1 
ATOM   1282  C CA  . LEU A 1 184 ? 22.834  8.299   15.568  1.00 28.50  ? 184  LEU A CA  1 
ATOM   1283  C C   . LEU A 1 184 ? 21.943  9.007   14.559  1.00 33.96  ? 184  LEU A C   1 
ATOM   1284  O O   . LEU A 1 184 ? 20.875  8.502   14.220  1.00 33.42  ? 184  LEU A O   1 
ATOM   1285  C CB  . LEU A 1 184 ? 23.734  7.262   14.873  1.00 27.08  ? 184  LEU A CB  1 
ATOM   1286  C CG  . LEU A 1 184 ? 25.089  6.948   15.530  1.00 30.46  ? 184  LEU A CG  1 
ATOM   1287  C CD1 . LEU A 1 184 ? 24.939  6.175   16.844  1.00 29.99  ? 184  LEU A CD1 1 
ATOM   1288  C CD2 . LEU A 1 184 ? 25.966  6.137   14.601  1.00 30.49  ? 184  LEU A CD2 1 
ATOM   1289  N N   . LEU A 1 185 ? 22.363  10.196  14.112  1.00 32.07  ? 185  LEU A N   1 
ATOM   1290  C CA  . LEU A 1 185 ? 21.603  10.975  13.141  1.00 32.36  ? 185  LEU A CA  1 
ATOM   1291  C C   . LEU A 1 185 ? 21.881  10.505  11.735  1.00 38.36  ? 185  LEU A C   1 
ATOM   1292  O O   . LEU A 1 185 ? 22.978  10.028  11.455  1.00 37.46  ? 185  LEU A O   1 
ATOM   1293  C CB  . LEU A 1 185 ? 21.915  12.483  13.236  1.00 33.14  ? 185  LEU A CB  1 
ATOM   1294  C CG  . LEU A 1 185 ? 21.556  13.233  14.519  1.00 37.06  ? 185  LEU A CG  1 
ATOM   1295  C CD1 . LEU A 1 185 ? 21.991  14.670  14.412  1.00 38.43  ? 185  LEU A CD1 1 
ATOM   1296  C CD2 . LEU A 1 185 ? 20.060  13.177  14.818  1.00 38.67  ? 185  LEU A CD2 1 
ATOM   1297  N N   . ASN A 1 186 ? 20.891  10.664  10.836  1.00 37.55  ? 186  ASN A N   1 
ATOM   1298  C CA  . ASN A 1 186 ? 21.036  10.342  9.421   1.00 38.26  ? 186  ASN A CA  1 
ATOM   1299  C C   . ASN A 1 186 ? 22.128  11.259  8.866   1.00 45.01  ? 186  ASN A C   1 
ATOM   1300  O O   . ASN A 1 186 ? 22.120  12.459  9.155   1.00 45.82  ? 186  ASN A O   1 
ATOM   1301  C CB  . ASN A 1 186 ? 19.697  10.519  8.694   1.00 38.38  ? 186  ASN A CB  1 
ATOM   1302  C CG  . ASN A 1 186 ? 19.714  10.176  7.232   1.00 51.38  ? 186  ASN A CG  1 
ATOM   1303  O OD1 . ASN A 1 186 ? 20.174  10.946  6.396   1.00 41.13  ? 186  ASN A OD1 1 
ATOM   1304  N ND2 . ASN A 1 186 ? 19.159  9.032   6.887   1.00 47.47  ? 186  ASN A ND2 1 
ATOM   1305  N N   . TYR A 1 187 ? 23.109  10.687  8.154   1.00 42.47  ? 187  TYR A N   1 
ATOM   1306  C CA  . TYR A 1 187 ? 24.248  11.425  7.608   1.00 43.69  ? 187  TYR A CA  1 
ATOM   1307  C C   . TYR A 1 187 ? 23.799  12.592  6.714   1.00 48.42  ? 187  TYR A C   1 
ATOM   1308  O O   . TYR A 1 187 ? 24.407  13.663  6.764   1.00 48.80  ? 187  TYR A O   1 
ATOM   1309  C CB  . TYR A 1 187 ? 25.185  10.470  6.839   1.00 45.28  ? 187  TYR A CB  1 
ATOM   1310  C CG  . TYR A 1 187 ? 26.466  11.116  6.347   1.00 48.97  ? 187  TYR A CG  1 
ATOM   1311  C CD1 . TYR A 1 187 ? 27.381  11.672  7.240   1.00 51.80  ? 187  TYR A CD1 1 
ATOM   1312  C CD2 . TYR A 1 187 ? 26.772  11.160  4.989   1.00 50.17  ? 187  TYR A CD2 1 
ATOM   1313  C CE1 . TYR A 1 187 ? 28.558  12.276  6.792   1.00 54.28  ? 187  TYR A CE1 1 
ATOM   1314  C CE2 . TYR A 1 187 ? 27.954  11.744  4.530   1.00 52.14  ? 187  TYR A CE2 1 
ATOM   1315  C CZ  . TYR A 1 187 ? 28.842  12.307  5.435   1.00 61.45  ? 187  TYR A CZ  1 
ATOM   1316  O OH  . TYR A 1 187 ? 30.014  12.866  4.975   1.00 63.34  ? 187  TYR A OH  1 
ATOM   1317  N N   . LYS A 1 188 ? 22.706  12.390  5.941   1.00 45.35  ? 188  LYS A N   1 
ATOM   1318  C CA  . LYS A 1 188 ? 22.129  13.372  5.015   1.00 46.36  ? 188  LYS A CA  1 
ATOM   1319  C C   . LYS A 1 188 ? 21.022  14.237  5.660   1.00 50.62  ? 188  LYS A C   1 
ATOM   1320  O O   . LYS A 1 188 ? 20.798  15.355  5.190   1.00 52.60  ? 188  LYS A O   1 
ATOM   1321  C CB  . LYS A 1 188 ? 21.565  12.663  3.772   1.00 48.68  ? 188  LYS A CB  1 
ATOM   1322  C CG  . LYS A 1 188 ? 22.627  12.195  2.773   1.00 61.59  ? 188  LYS A CG  1 
ATOM   1323  N N   . ASN A 1 189 ? 20.326  13.729  6.711   1.00 44.11  ? 189  ASN A N   1 
ATOM   1324  C CA  . ASN A 1 189 ? 19.240  14.456  7.374   1.00 43.29  ? 189  ASN A CA  1 
ATOM   1325  C C   . ASN A 1 189 ? 19.454  14.528  8.904   1.00 47.09  ? 189  ASN A C   1 
ATOM   1326  O O   . ASN A 1 189 ? 19.273  13.525  9.602   1.00 45.65  ? 189  ASN A O   1 
ATOM   1327  C CB  . ASN A 1 189 ? 17.878  13.823  7.045   1.00 39.19  ? 189  ASN A CB  1 
ATOM   1328  C CG  . ASN A 1 189 ? 16.675  14.694  7.332   1.00 56.63  ? 189  ASN A CG  1 
ATOM   1329  O OD1 . ASN A 1 189 ? 16.698  15.616  8.160   1.00 50.97  ? 189  ASN A OD1 1 
ATOM   1330  N ND2 . ASN A 1 189 ? 15.572  14.403  6.662   1.00 49.04  ? 189  ASN A ND2 1 
ATOM   1331  N N   . PRO A 1 190 ? 19.783  15.722  9.457   1.00 44.45  ? 190  PRO A N   1 
ATOM   1332  C CA  . PRO A 1 190 ? 19.992  15.820  10.917  1.00 43.59  ? 190  PRO A CA  1 
ATOM   1333  C C   . PRO A 1 190 ? 18.688  15.819  11.734  1.00 46.28  ? 190  PRO A C   1 
ATOM   1334  O O   . PRO A 1 190 ? 18.746  15.975  12.956  1.00 45.65  ? 190  PRO A O   1 
ATOM   1335  C CB  . PRO A 1 190 ? 20.756  17.137  11.077  1.00 46.66  ? 190  PRO A CB  1 
ATOM   1336  C CG  . PRO A 1 190 ? 20.348  17.953  9.910   1.00 52.18  ? 190  PRO A CG  1 
ATOM   1337  C CD  . PRO A 1 190 ? 20.038  17.012  8.783   1.00 47.15  ? 190  PRO A CD  1 
ATOM   1338  N N   . ASP A 1 191 ? 17.519  15.632  11.073  1.00 41.82  ? 191  ASP A N   1 
ATOM   1339  C CA  . ASP A 1 191 ? 16.218  15.571  11.746  1.00 40.83  ? 191  ASP A CA  1 
ATOM   1340  C C   . ASP A 1 191 ? 15.718  14.120  11.856  1.00 42.52  ? 191  ASP A C   1 
ATOM   1341  O O   . ASP A 1 191 ? 14.630  13.889  12.393  1.00 42.58  ? 191  ASP A O   1 
ATOM   1342  C CB  . ASP A 1 191 ? 15.172  16.461  11.048  1.00 43.74  ? 191  ASP A CB  1 
ATOM   1343  C CG  . ASP A 1 191 ? 15.342  17.952  11.298  1.00 52.81  ? 191  ASP A CG  1 
ATOM   1344  O OD1 . ASP A 1 191 ? 15.721  18.330  12.430  1.00 51.78  ? 191  ASP A OD1 1 
ATOM   1345  O OD2 . ASP A 1 191 ? 15.057  18.742  10.376  1.00 61.47  ? 191  ASP A OD2 1 
ATOM   1346  N N   . GLN A 1 192 ? 16.534  13.143  11.401  1.00 35.79  ? 192  GLN A N   1 
ATOM   1347  C CA  . GLN A 1 192 ? 16.199  11.722  11.462  1.00 32.95  ? 192  GLN A CA  1 
ATOM   1348  C C   . GLN A 1 192 ? 17.179  10.993  12.383  1.00 34.68  ? 192  GLN A C   1 
ATOM   1349  O O   . GLN A 1 192 ? 18.373  10.930  12.099  1.00 33.15  ? 192  GLN A O   1 
ATOM   1350  C CB  . GLN A 1 192 ? 16.183  11.099  10.059  1.00 33.78  ? 192  GLN A CB  1 
ATOM   1351  C CG  . GLN A 1 192 ? 15.106  11.668  9.151   1.00 38.91  ? 192  GLN A CG  1 
ATOM   1352  C CD  . GLN A 1 192 ? 14.962  10.961  7.826   1.00 52.83  ? 192  GLN A CD  1 
ATOM   1353  O OE1 . GLN A 1 192 ? 15.846  10.223  7.363   1.00 43.29  ? 192  GLN A OE1 1 
ATOM   1354  N NE2 . GLN A 1 192 ? 13.832  11.194  7.172   1.00 46.19  ? 192  GLN A NE2 1 
ATOM   1355  N N   . VAL A 1 193 ? 16.667  10.464  13.503  1.00 31.53  ? 193  VAL A N   1 
ATOM   1356  C CA  . VAL A 1 193 ? 17.468  9.732   14.490  1.00 29.70  ? 193  VAL A CA  1 
ATOM   1357  C C   . VAL A 1 193 ? 17.209  8.206   14.335  1.00 31.20  ? 193  VAL A C   1 
ATOM   1358  O O   . VAL A 1 193 ? 16.090  7.770   14.041  1.00 30.55  ? 193  VAL A O   1 
ATOM   1359  C CB  . VAL A 1 193 ? 17.244  10.267  15.936  1.00 32.90  ? 193  VAL A CB  1 
ATOM   1360  C CG1 . VAL A 1 193 ? 15.833  9.987   16.447  1.00 32.36  ? 193  VAL A CG1 1 
ATOM   1361  C CG2 . VAL A 1 193 ? 18.311  9.751   16.903  1.00 32.06  ? 193  VAL A CG2 1 
ATOM   1362  N N   . TYR A 1 194 ? 18.274  7.421   14.495  1.00 26.53  ? 194  TYR A N   1 
ATOM   1363  C CA  . TYR A 1 194 ? 18.277  5.966   14.351  1.00 25.02  ? 194  TYR A CA  1 
ATOM   1364  C C   . TYR A 1 194 ? 18.827  5.304   15.605  1.00 27.18  ? 194  TYR A C   1 
ATOM   1365  O O   . TYR A 1 194 ? 19.790  5.804   16.182  1.00 26.77  ? 194  TYR A O   1 
ATOM   1366  C CB  . TYR A 1 194 ? 19.145  5.591   13.125  1.00 25.71  ? 194  TYR A CB  1 
ATOM   1367  C CG  . TYR A 1 194 ? 18.460  5.759   11.783  1.00 26.12  ? 194  TYR A CG  1 
ATOM   1368  C CD1 . TYR A 1 194 ? 18.049  4.657   11.052  1.00 27.24  ? 194  TYR A CD1 1 
ATOM   1369  C CD2 . TYR A 1 194 ? 18.298  7.018   11.208  1.00 27.87  ? 194  TYR A CD2 1 
ATOM   1370  C CE1 . TYR A 1 194 ? 17.451  4.797   9.800   1.00 28.79  ? 194  TYR A CE1 1 
ATOM   1371  C CE2 . TYR A 1 194 ? 17.685  7.174   9.961   1.00 29.16  ? 194  TYR A CE2 1 
ATOM   1372  C CZ  . TYR A 1 194 ? 17.253  6.059   9.266   1.00 38.51  ? 194  TYR A CZ  1 
ATOM   1373  O OH  . TYR A 1 194 ? 16.641  6.199   8.036   1.00 46.27  ? 194  TYR A OH  1 
ATOM   1374  N N   . LEU A 1 195 ? 18.236  4.165   16.015  1.00 22.78  ? 195  LEU A N   1 
ATOM   1375  C CA  . LEU A 1 195 ? 18.694  3.391   17.179  1.00 20.94  ? 195  LEU A CA  1 
ATOM   1376  C C   . LEU A 1 195 ? 19.605  2.262   16.697  1.00 25.41  ? 195  LEU A C   1 
ATOM   1377  O O   . LEU A 1 195 ? 19.207  1.475   15.834  1.00 23.94  ? 195  LEU A O   1 
ATOM   1378  C CB  . LEU A 1 195 ? 17.501  2.847   17.997  1.00 19.74  ? 195  LEU A CB  1 
ATOM   1379  C CG  . LEU A 1 195 ? 17.804  2.007   19.250  1.00 22.53  ? 195  LEU A CG  1 
ATOM   1380  C CD1 . LEU A 1 195 ? 18.471  2.843   20.359  1.00 22.13  ? 195  LEU A CD1 1 
ATOM   1381  C CD2 . LEU A 1 195 ? 16.543  1.352   19.775  1.00 21.76  ? 195  LEU A CD2 1 
ATOM   1382  N N   . VAL A 1 196 ? 20.847  2.211   17.231  1.00 22.78  ? 196  VAL A N   1 
ATOM   1383  C CA  . VAL A 1 196 ? 21.852  1.215   16.839  1.00 21.58  ? 196  VAL A CA  1 
ATOM   1384  C C   . VAL A 1 196 ? 22.171  0.293   18.024  1.00 27.75  ? 196  VAL A C   1 
ATOM   1385  O O   . VAL A 1 196 ? 21.659  0.505   19.129  1.00 27.82  ? 196  VAL A O   1 
ATOM   1386  C CB  . VAL A 1 196 ? 23.144  1.865   16.239  1.00 24.78  ? 196  VAL A CB  1 
ATOM   1387  C CG1 . VAL A 1 196 ? 22.825  2.732   15.021  1.00 24.28  ? 196  VAL A CG1 1 
ATOM   1388  C CG2 . VAL A 1 196 ? 23.940  2.654   17.280  1.00 24.71  ? 196  VAL A CG2 1 
ATOM   1389  N N   . ASP A 1 197 ? 23.034  -0.726  17.776  1.00 25.41  ? 197  ASP A N   1 
ATOM   1390  C CA  . ASP A 1 197 ? 23.549  -1.739  18.705  1.00 25.27  ? 197  ASP A CA  1 
ATOM   1391  C C   . ASP A 1 197 ? 22.469  -2.757  19.115  1.00 29.70  ? 197  ASP A C   1 
ATOM   1392  O O   . ASP A 1 197 ? 21.706  -2.538  20.066  1.00 30.59  ? 197  ASP A O   1 
ATOM   1393  C CB  . ASP A 1 197 ? 24.220  -1.114  19.942  1.00 26.91  ? 197  ASP A CB  1 
ATOM   1394  C CG  . ASP A 1 197 ? 25.139  -2.035  20.724  1.00 37.88  ? 197  ASP A CG  1 
ATOM   1395  O OD1 . ASP A 1 197 ? 25.090  -3.268  20.499  1.00 38.26  ? 197  ASP A OD1 1 
ATOM   1396  O OD2 . ASP A 1 197 ? 25.898  -1.527  21.576  1.00 46.79  ? 197  ASP A OD2 1 
ATOM   1397  N N   . TYR A 1 198 ? 22.463  -3.896  18.413  1.00 24.24  ? 198  TYR A N   1 
ATOM   1398  C CA  . TYR A 1 198 ? 21.540  -4.992  18.664  1.00 23.18  ? 198  TYR A CA  1 
ATOM   1399  C C   . TYR A 1 198 ? 22.328  -6.263  19.019  1.00 28.13  ? 198  TYR A C   1 
ATOM   1400  O O   . TYR A 1 198 ? 21.773  -7.364  18.994  1.00 28.63  ? 198  TYR A O   1 
ATOM   1401  C CB  . TYR A 1 198 ? 20.602  -5.205  17.456  1.00 23.90  ? 198  TYR A CB  1 
ATOM   1402  C CG  . TYR A 1 198 ? 19.727  -3.998  17.177  1.00 24.57  ? 198  TYR A CG  1 
ATOM   1403  C CD1 . TYR A 1 198 ? 20.135  -3.012  16.288  1.00 25.29  ? 198  TYR A CD1 1 
ATOM   1404  C CD2 . TYR A 1 198 ? 18.500  -3.832  17.824  1.00 25.23  ? 198  TYR A CD2 1 
ATOM   1405  C CE1 . TYR A 1 198 ? 19.363  -1.875  16.066  1.00 25.44  ? 198  TYR A CE1 1 
ATOM   1406  C CE2 . TYR A 1 198 ? 17.704  -2.710  17.587  1.00 25.62  ? 198  TYR A CE2 1 
ATOM   1407  C CZ  . TYR A 1 198 ? 18.147  -1.728  16.719  1.00 32.77  ? 198  TYR A CZ  1 
ATOM   1408  O OH  . TYR A 1 198 ? 17.361  -0.627  16.467  1.00 36.48  ? 198  TYR A OH  1 
ATOM   1409  N N   . GLY A 1 199 ? 23.596  -6.081  19.406  1.00 24.57  ? 199  GLY A N   1 
ATOM   1410  C CA  . GLY A 1 199 ? 24.490  -7.156  19.815  1.00 24.70  ? 199  GLY A CA  1 
ATOM   1411  C C   . GLY A 1 199 ? 24.030  -7.866  21.069  1.00 31.26  ? 199  GLY A C   1 
ATOM   1412  O O   . GLY A 1 199 ? 24.330  -9.047  21.273  1.00 31.63  ? 199  GLY A O   1 
ATOM   1413  N N   . LEU A 1 200 ? 23.312  -7.129  21.928  1.00 28.59  ? 200  LEU A N   1 
ATOM   1414  C CA  . LEU A 1 200 ? 22.750  -7.663  23.162  1.00 29.36  ? 200  LEU A CA  1 
ATOM   1415  C C   . LEU A 1 200 ? 21.221  -7.468  23.177  1.00 32.09  ? 200  LEU A C   1 
ATOM   1416  O O   . LEU A 1 200 ? 20.611  -7.498  24.243  1.00 32.96  ? 200  LEU A O   1 
ATOM   1417  C CB  . LEU A 1 200 ? 23.440  -7.054  24.404  1.00 30.45  ? 200  LEU A CB  1 
ATOM   1418  C CG  . LEU A 1 200 ? 24.929  -7.418  24.547  1.00 36.95  ? 200  LEU A CG  1 
ATOM   1419  C CD1 . LEU A 1 200 ? 25.690  -6.358  25.310  1.00 38.13  ? 200  LEU A CD1 1 
ATOM   1420  C CD2 . LEU A 1 200 ? 25.112  -8.790  25.176  1.00 40.66  ? 200  LEU A CD2 1 
ATOM   1421  N N   . ALA A 1 201 ? 20.595  -7.324  21.980  1.00 27.40  ? 201  ALA A N   1 
ATOM   1422  C CA  . ALA A 1 201 ? 19.142  -7.242  21.829  1.00 26.55  ? 201  ALA A CA  1 
ATOM   1423  C C   . ALA A 1 201 ? 18.543  -8.578  22.265  1.00 29.23  ? 201  ALA A C   1 
ATOM   1424  O O   . ALA A 1 201 ? 19.245  -9.602  22.283  1.00 28.46  ? 201  ALA A O   1 
ATOM   1425  C CB  . ALA A 1 201 ? 18.768  -6.924  20.387  1.00 27.15  ? 201  ALA A CB  1 
ATOM   1426  N N   . TYR A 1 202 ? 17.273  -8.575  22.665  1.00 26.14  ? 202  TYR A N   1 
ATOM   1427  C CA  . TYR A 1 202 ? 16.692  -9.788  23.200  1.00 25.97  ? 202  TYR A CA  1 
ATOM   1428  C C   . TYR A 1 202 ? 15.378  -10.137 22.505  1.00 31.52  ? 202  TYR A C   1 
ATOM   1429  O O   . TYR A 1 202 ? 14.482  -9.300  22.387  1.00 30.77  ? 202  TYR A O   1 
ATOM   1430  C CB  . TYR A 1 202 ? 16.511  -9.630  24.732  1.00 26.23  ? 202  TYR A CB  1 
ATOM   1431  C CG  . TYR A 1 202 ? 15.954  -10.855 25.410  1.00 28.84  ? 202  TYR A CG  1 
ATOM   1432  C CD1 . TYR A 1 202 ? 14.691  -10.840 25.989  1.00 30.81  ? 202  TYR A CD1 1 
ATOM   1433  C CD2 . TYR A 1 202 ? 16.690  -12.035 25.474  1.00 30.05  ? 202  TYR A CD2 1 
ATOM   1434  C CE1 . TYR A 1 202 ? 14.174  -11.971 26.618  1.00 31.02  ? 202  TYR A CE1 1 
ATOM   1435  C CE2 . TYR A 1 202 ? 16.182  -13.168 26.094  1.00 31.62  ? 202  TYR A CE2 1 
ATOM   1436  C CZ  . TYR A 1 202 ? 14.926  -13.131 26.669  1.00 37.31  ? 202  TYR A CZ  1 
ATOM   1437  O OH  . TYR A 1 202 ? 14.426  -14.255 27.279  1.00 40.51  ? 202  TYR A OH  1 
ATOM   1438  N N   . ARG A 1 203 ? 15.273  -11.389 22.071  1.00 29.22  ? 203  ARG A N   1 
ATOM   1439  C CA  . ARG A 1 203 ? 14.088  -11.931 21.439  1.00 29.34  ? 203  ARG A CA  1 
ATOM   1440  C C   . ARG A 1 203 ? 13.170  -12.423 22.570  1.00 36.24  ? 203  ARG A C   1 
ATOM   1441  O O   . ARG A 1 203 ? 13.280  -13.570 23.024  1.00 38.57  ? 203  ARG A O   1 
ATOM   1442  C CB  . ARG A 1 203 ? 14.497  -13.023 20.445  1.00 29.43  ? 203  ARG A CB  1 
ATOM   1443  C CG  . ARG A 1 203 ? 13.475  -13.291 19.384  1.00 33.03  ? 203  ARG A CG  1 
ATOM   1444  C CD  . ARG A 1 203 ? 13.962  -14.406 18.505  1.00 34.77  ? 203  ARG A CD  1 
ATOM   1445  N NE  . ARG A 1 203 ? 12.926  -14.838 17.569  1.00 40.06  ? 203  ARG A NE  1 
ATOM   1446  C CZ  . ARG A 1 203 ? 12.857  -16.056 17.048  1.00 55.86  ? 203  ARG A CZ  1 
ATOM   1447  N NH1 . ARG A 1 203 ? 13.766  -16.971 17.361  1.00 35.98  ? 203  ARG A NH1 1 
ATOM   1448  N NH2 . ARG A 1 203 ? 11.879  -16.371 16.213  1.00 55.02  ? 203  ARG A NH2 1 
ATOM   1449  N N   . TYR A 1 204 ? 12.323  -11.502 23.085  1.00 31.97  ? 204  TYR A N   1 
ATOM   1450  C CA  . TYR A 1 204 ? 11.413  -11.704 24.230  1.00 31.41  ? 204  TYR A CA  1 
ATOM   1451  C C   . TYR A 1 204 ? 10.199  -12.593 23.880  1.00 38.12  ? 204  TYR A C   1 
ATOM   1452  O O   . TYR A 1 204 ? 9.579   -13.137 24.802  1.00 36.95  ? 204  TYR A O   1 
ATOM   1453  C CB  . TYR A 1 204 ? 10.950  -10.344 24.817  1.00 30.06  ? 204  TYR A CB  1 
ATOM   1454  C CG  . TYR A 1 204 ? 9.858   -9.677  24.005  1.00 29.29  ? 204  TYR A CG  1 
ATOM   1455  C CD1 . TYR A 1 204 ? 10.159  -8.963  22.846  1.00 29.51  ? 204  TYR A CD1 1 
ATOM   1456  C CD2 . TYR A 1 204 ? 8.514   -9.828  24.347  1.00 29.77  ? 204  TYR A CD2 1 
ATOM   1457  C CE1 . TYR A 1 204 ? 9.154   -8.395  22.063  1.00 27.55  ? 204  TYR A CE1 1 
ATOM   1458  C CE2 . TYR A 1 204 ? 7.499   -9.295  23.550  1.00 29.99  ? 204  TYR A CE2 1 
ATOM   1459  C CZ  . TYR A 1 204 ? 7.825   -8.580  22.408  1.00 34.45  ? 204  TYR A CZ  1 
ATOM   1460  O OH  . TYR A 1 204 ? 6.834   -8.042  21.622  1.00 35.17  ? 204  TYR A OH  1 
ATOM   1461  N N   . CYS A 1 205 ? 9.801   -12.694 22.587  1.00 37.02  ? 205  CYS A N   1 
ATOM   1462  C CA  . CYS A 1 205 ? 8.711   -13.615 22.281  1.00 39.30  ? 205  CYS A CA  1 
ATOM   1463  C C   . CYS A 1 205 ? 8.958   -14.362 20.954  1.00 40.77  ? 205  CYS A C   1 
ATOM   1464  O O   . CYS A 1 205 ? 8.300   -14.127 19.939  1.00 39.53  ? 205  CYS A O   1 
ATOM   1465  C CB  . CYS A 1 205 ? 7.312   -13.002 22.370  1.00 41.70  ? 205  CYS A CB  1 
ATOM   1466  S SG  . CYS A 1 205 ? 6.958   -11.736 21.142  1.00 46.31  ? 205  CYS A SG  1 
ATOM   1467  N N   . PRO A 1 206 ? 9.899   -15.337 20.994  1.00 36.91  ? 206  PRO A N   1 
ATOM   1468  C CA  . PRO A 1 206 ? 10.149  -16.152 19.795  1.00 36.83  ? 206  PRO A CA  1 
ATOM   1469  C C   . PRO A 1 206 ? 8.904   -16.944 19.410  1.00 42.38  ? 206  PRO A C   1 
ATOM   1470  O O   . PRO A 1 206 ? 8.295   -17.601 20.259  1.00 42.37  ? 206  PRO A O   1 
ATOM   1471  C CB  . PRO A 1 206 ? 11.301  -17.069 20.221  1.00 38.85  ? 206  PRO A CB  1 
ATOM   1472  C CG  . PRO A 1 206 ? 11.210  -17.125 21.733  1.00 43.19  ? 206  PRO A CG  1 
ATOM   1473  C CD  . PRO A 1 206 ? 10.737  -15.774 22.138  1.00 37.94  ? 206  PRO A CD  1 
ATOM   1474  N N   . GLU A 1 207 ? 8.495   -16.825 18.132  1.00 39.88  ? 207  GLU A N   1 
ATOM   1475  C CA  . GLU A 1 207 ? 7.328   -17.487 17.534  1.00 41.41  ? 207  GLU A CA  1 
ATOM   1476  C C   . GLU A 1 207 ? 6.018   -17.109 18.255  1.00 46.34  ? 207  GLU A C   1 
ATOM   1477  O O   . GLU A 1 207 ? 5.107   -17.930 18.367  1.00 47.65  ? 207  GLU A O   1 
ATOM   1478  C CB  . GLU A 1 207 ? 7.511   -19.029 17.484  1.00 43.93  ? 207  GLU A CB  1 
ATOM   1479  C CG  . GLU A 1 207 ? 8.850   -19.519 16.933  1.00 54.59  ? 207  GLU A CG  1 
ATOM   1480  C CD  . GLU A 1 207 ? 9.235   -19.148 15.510  1.00 69.78  ? 207  GLU A CD  1 
ATOM   1481  O OE1 . GLU A 1 207 ? 8.325   -18.958 14.671  1.00 63.02  ? 207  GLU A OE1 1 
ATOM   1482  O OE2 . GLU A 1 207 ? 10.454  -19.091 15.226  1.00 59.69  ? 207  GLU A OE2 1 
ATOM   1483  N N   . GLY A 1 208 ? 5.948   -15.867 18.728  1.00 42.51  ? 208  GLY A N   1 
ATOM   1484  C CA  . GLY A 1 208 ? 4.793   -15.324 19.436  1.00 42.76  ? 208  GLY A CA  1 
ATOM   1485  C C   . GLY A 1 208 ? 4.600   -15.808 20.860  1.00 47.62  ? 208  GLY A C   1 
ATOM   1486  O O   . GLY A 1 208 ? 3.544   -15.552 21.449  1.00 48.69  ? 208  GLY A O   1 
ATOM   1487  N N   . VAL A 1 209 ? 5.608   -16.502 21.432  1.00 43.22  ? 209  VAL A N   1 
ATOM   1488  C CA  . VAL A 1 209 ? 5.536   -17.028 22.805  1.00 43.39  ? 209  VAL A CA  1 
ATOM   1489  C C   . VAL A 1 209 ? 6.411   -16.160 23.709  1.00 43.82  ? 209  VAL A C   1 
ATOM   1490  O O   . VAL A 1 209 ? 7.638   -16.223 23.606  1.00 41.80  ? 209  VAL A O   1 
ATOM   1491  C CB  . VAL A 1 209 ? 5.920   -18.536 22.904  1.00 48.73  ? 209  VAL A CB  1 
ATOM   1492  C CG1 . VAL A 1 209 ? 5.700   -19.064 24.318  1.00 49.23  ? 209  VAL A CG1 1 
ATOM   1493  C CG2 . VAL A 1 209 ? 5.147   -19.383 21.893  1.00 49.65  ? 209  VAL A CG2 1 
ATOM   1494  N N   . HIS A 1 210 ? 5.771   -15.353 24.594  1.00 39.40  ? 210  HIS A N   1 
ATOM   1495  C CA  . HIS A 1 210 ? 6.454   -14.441 25.515  1.00 37.38  ? 210  HIS A CA  1 
ATOM   1496  C C   . HIS A 1 210 ? 7.242   -15.219 26.562  1.00 42.22  ? 210  HIS A C   1 
ATOM   1497  O O   . HIS A 1 210 ? 6.774   -16.223 27.100  1.00 41.93  ? 210  HIS A O   1 
ATOM   1498  C CB  . HIS A 1 210 ? 5.476   -13.448 26.192  1.00 37.18  ? 210  HIS A CB  1 
ATOM   1499  C CG  . HIS A 1 210 ? 6.109   -12.171 26.689  1.00 38.59  ? 210  HIS A CG  1 
ATOM   1500  N ND1 . HIS A 1 210 ? 7.060   -12.176 27.703  1.00 39.29  ? 210  HIS A ND1 1 
ATOM   1501  C CD2 . HIS A 1 210 ? 5.859   -10.885 26.339  1.00 38.85  ? 210  HIS A CD2 1 
ATOM   1502  C CE1 . HIS A 1 210 ? 7.386   -10.909 27.901  1.00 37.48  ? 210  HIS A CE1 1 
ATOM   1503  N NE2 . HIS A 1 210 ? 6.686   -10.094 27.113  1.00 37.64  ? 210  HIS A NE2 1 
ATOM   1504  N N   . LYS A 1 211 ? 8.463   -14.751 26.815  1.00 39.61  ? 211  LYS A N   1 
ATOM   1505  C CA  . LYS A 1 211 ? 9.360   -15.308 27.814  1.00 40.12  ? 211  LYS A CA  1 
ATOM   1506  C C   . LYS A 1 211 ? 8.765   -15.059 29.190  1.00 45.06  ? 211  LYS A C   1 
ATOM   1507  O O   . LYS A 1 211 ? 8.218   -13.983 29.450  1.00 43.90  ? 211  LYS A O   1 
ATOM   1508  C CB  . LYS A 1 211 ? 10.766  -14.704 27.657  1.00 42.39  ? 211  LYS A CB  1 
ATOM   1509  C CG  . LYS A 1 211 ? 11.460  -15.179 26.373  1.00 53.91  ? 211  LYS A CG  1 
ATOM   1510  C CD  . LYS A 1 211 ? 12.123  -16.550 26.490  1.00 62.05  ? 211  LYS A CD  1 
ATOM   1511  C CE  . LYS A 1 211 ? 12.774  -16.946 25.195  1.00 68.62  ? 211  LYS A CE  1 
ATOM   1512  N NZ  . LYS A 1 211 ? 13.484  -18.238 25.332  1.00 81.60  ? 211  LYS A NZ  1 
ATOM   1513  N N   . ALA A 1 212 ? 8.783   -16.096 30.034  1.00 44.60  ? 212  ALA A N   1 
ATOM   1514  C CA  . ALA A 1 212 ? 8.211   -16.056 31.381  1.00 46.17  ? 212  ALA A CA  1 
ATOM   1515  C C   . ALA A 1 212 ? 9.008   -15.144 32.304  1.00 49.86  ? 212  ALA A C   1 
ATOM   1516  O O   . ALA A 1 212 ? 10.209  -14.958 32.096  1.00 48.86  ? 212  ALA A O   1 
ATOM   1517  C CB  . ALA A 1 212 ? 8.156   -17.461 31.968  1.00 48.45  ? 212  ALA A CB  1 
ATOM   1518  N N   . TYR A 1 213 ? 8.331   -14.561 33.313  1.00 47.16  ? 213  TYR A N   1 
ATOM   1519  C CA  . TYR A 1 213 ? 8.954   -13.667 34.286  1.00 46.68  ? 213  TYR A CA  1 
ATOM   1520  C C   . TYR A 1 213 ? 9.962   -14.469 35.106  1.00 53.67  ? 213  TYR A C   1 
ATOM   1521  O O   . TYR A 1 213 ? 9.579   -15.273 35.957  1.00 55.68  ? 213  TYR A O   1 
ATOM   1522  C CB  . TYR A 1 213 ? 7.893   -12.965 35.150  1.00 47.17  ? 213  TYR A CB  1 
ATOM   1523  C CG  . TYR A 1 213 ? 8.466   -11.956 36.118  1.00 46.81  ? 213  TYR A CG  1 
ATOM   1524  C CD1 . TYR A 1 213 ? 8.775   -10.661 35.706  1.00 47.20  ? 213  TYR A CD1 1 
ATOM   1525  C CD2 . TYR A 1 213 ? 8.684   -12.287 37.451  1.00 47.78  ? 213  TYR A CD2 1 
ATOM   1526  C CE1 . TYR A 1 213 ? 9.303   -9.727  36.594  1.00 46.61  ? 213  TYR A CE1 1 
ATOM   1527  C CE2 . TYR A 1 213 ? 9.203   -11.357 38.350  1.00 48.15  ? 213  TYR A CE2 1 
ATOM   1528  C CZ  . TYR A 1 213 ? 9.513   -10.079 37.914  1.00 52.05  ? 213  TYR A CZ  1 
ATOM   1529  O OH  . TYR A 1 213 ? 10.021  -9.144  38.773  1.00 49.38  ? 213  TYR A OH  1 
ATOM   1530  N N   . ALA A 1 214 ? 11.238  -14.353 34.696  1.00 50.37  ? 214  ALA A N   1 
ATOM   1531  C CA  . ALA A 1 214 ? 12.406  -15.049 35.232  1.00 51.80  ? 214  ALA A CA  1 
ATOM   1532  C C   . ALA A 1 214 ? 13.658  -14.716 34.422  1.00 57.88  ? 214  ALA A C   1 
ATOM   1533  O O   . ALA A 1 214 ? 13.575  -14.148 33.330  1.00 55.74  ? 214  ALA A O   1 
ATOM   1534  C CB  . ALA A 1 214 ? 12.180  -16.560 35.218  1.00 53.66  ? 214  ALA A CB  1 
ATOM   1535  N N   . ALA A 1 215 ? 14.817  -15.107 34.963  1.00 57.84  ? 215  ALA A N   1 
ATOM   1536  C CA  . ALA A 1 215 ? 16.134  -14.923 34.379  1.00 58.45  ? 215  ALA A CA  1 
ATOM   1537  C C   . ALA A 1 215 ? 16.326  -15.787 33.157  1.00 64.85  ? 215  ALA A C   1 
ATOM   1538  O O   . ALA A 1 215 ? 15.808  -16.904 33.104  1.00 64.99  ? 215  ALA A O   1 
ATOM   1539  C CB  . ALA A 1 215 ? 17.190  -15.278 35.413  1.00 60.43  ? 215  ALA A CB  1 
ATOM   1540  N N   . ASP A 1 216 ? 17.087  -15.278 32.181  1.00 63.53  ? 216  ASP A N   1 
ATOM   1541  C CA  . ASP A 1 216 ? 17.455  -16.025 30.982  1.00 64.44  ? 216  ASP A CA  1 
ATOM   1542  C C   . ASP A 1 216 ? 18.909  -16.480 31.157  1.00 71.07  ? 216  ASP A C   1 
ATOM   1543  O O   . ASP A 1 216 ? 19.778  -15.625 31.359  1.00 69.99  ? 216  ASP A O   1 
ATOM   1544  C CB  . ASP A 1 216 ? 17.258  -15.196 29.708  1.00 65.42  ? 216  ASP A CB  1 
ATOM   1545  C CG  . ASP A 1 216 ? 17.221  -16.048 28.455  1.00 78.27  ? 216  ASP A CG  1 
ATOM   1546  O OD1 . ASP A 1 216 ? 16.125  -16.209 27.879  1.00 78.86  ? 216  ASP A OD1 1 
ATOM   1547  O OD2 . ASP A 1 216 ? 18.286  -16.571 28.061  1.00 85.68  ? 216  ASP A OD2 1 
ATOM   1548  N N   . PRO A 1 217 ? 19.195  -17.808 31.152  1.00 70.84  ? 217  PRO A N   1 
ATOM   1549  C CA  . PRO A 1 217 ? 20.578  -18.265 31.409  1.00 71.91  ? 217  PRO A CA  1 
ATOM   1550  C C   . PRO A 1 217 ? 21.582  -17.883 30.319  1.00 74.27  ? 217  PRO A C   1 
ATOM   1551  O O   . PRO A 1 217 ? 22.756  -17.686 30.632  1.00 74.29  ? 217  PRO A O   1 
ATOM   1552  C CB  . PRO A 1 217 ? 20.444  -19.790 31.520  1.00 75.20  ? 217  PRO A CB  1 
ATOM   1553  C CG  . PRO A 1 217 ? 18.981  -20.050 31.717  1.00 79.53  ? 217  PRO A CG  1 
ATOM   1554  C CD  . PRO A 1 217 ? 18.278  -18.953 30.981  1.00 73.36  ? 217  PRO A CD  1 
ATOM   1555  N N   . LYS A 1 218 ? 21.123  -17.766 29.061  1.00 69.43  ? 218  LYS A N   1 
ATOM   1556  C CA  . LYS A 1 218 ? 21.957  -17.386 27.919  1.00 68.65  ? 218  LYS A CA  1 
ATOM   1557  C C   . LYS A 1 218 ? 22.315  -15.887 27.946  1.00 72.12  ? 218  LYS A C   1 
ATOM   1558  O O   . LYS A 1 218 ? 23.366  -15.510 27.423  1.00 71.66  ? 218  LYS A O   1 
ATOM   1559  C CB  . LYS A 1 218 ? 21.246  -17.737 26.606  1.00 70.47  ? 218  LYS A CB  1 
ATOM   1560  N N   . ARG A 1 219 ? 21.447  -15.041 28.557  1.00 68.25  ? 219  ARG A N   1 
ATOM   1561  C CA  . ARG A 1 219 ? 21.640  -13.593 28.651  1.00 67.26  ? 219  ARG A CA  1 
ATOM   1562  C C   . ARG A 1 219 ? 22.413  -13.210 29.909  1.00 73.05  ? 219  ARG A C   1 
ATOM   1563  O O   . ARG A 1 219 ? 22.049  -13.614 31.017  1.00 73.40  ? 219  ARG A O   1 
ATOM   1564  C CB  . ARG A 1 219 ? 20.298  -12.841 28.608  1.00 65.28  ? 219  ARG A CB  1 
ATOM   1565  C CG  . ARG A 1 219 ? 20.486  -11.328 28.603  1.00 67.42  ? 219  ARG A CG  1 
ATOM   1566  C CD  . ARG A 1 219 ? 19.200  -10.559 28.501  1.00 59.97  ? 219  ARG A CD  1 
ATOM   1567  N NE  . ARG A 1 219 ? 19.426  -9.137  28.760  1.00 56.67  ? 219  ARG A NE  1 
ATOM   1568  C CZ  . ARG A 1 219 ? 19.710  -8.238  27.825  1.00 70.47  ? 219  ARG A CZ  1 
ATOM   1569  N NH1 . ARG A 1 219 ? 19.801  -8.600  26.552  1.00 56.79  ? 219  ARG A NH1 1 
ATOM   1570  N NH2 . ARG A 1 219 ? 19.909  -6.971  28.154  1.00 60.93  ? 219  ARG A NH2 1 
ATOM   1571  N N   . CYS A 1 220 ? 23.453  -12.376 29.727  1.00 70.48  ? 220  CYS A N   1 
ATOM   1572  C CA  . CYS A 1 220 ? 24.328  -11.910 30.803  1.00 71.26  ? 220  CYS A CA  1 
ATOM   1573  C C   . CYS A 1 220 ? 24.187  -10.402 31.025  1.00 71.21  ? 220  CYS A C   1 
ATOM   1574  O O   . CYS A 1 220 ? 24.388  -9.938  32.150  1.00 72.02  ? 220  CYS A O   1 
ATOM   1575  C CB  . CYS A 1 220 ? 25.779  -12.286 30.511  1.00 73.09  ? 220  CYS A CB  1 
ATOM   1576  S SG  . CYS A 1 220 ? 26.019  -14.015 30.014  1.00 78.15  ? 220  CYS A SG  1 
ATOM   1577  N N   . HIS A 1 221 ? 23.860  -9.645  29.960  1.00 63.28  ? 221  HIS A N   1 
ATOM   1578  C CA  . HIS A 1 221 ? 23.743  -8.185  29.991  1.00 61.28  ? 221  HIS A CA  1 
ATOM   1579  C C   . HIS A 1 221 ? 22.533  -7.668  30.798  1.00 61.25  ? 221  HIS A C   1 
ATOM   1580  O O   . HIS A 1 221 ? 21.438  -8.238  30.743  1.00 60.61  ? 221  HIS A O   1 
ATOM   1581  C CB  . HIS A 1 221 ? 23.680  -7.626  28.562  1.00 61.17  ? 221  HIS A CB  1 
ATOM   1582  C CG  . HIS A 1 221 ? 23.984  -6.161  28.455  1.00 64.12  ? 221  HIS A CG  1 
ATOM   1583  N ND1 . HIS A 1 221 ? 25.103  -5.605  29.056  1.00 66.38  ? 221  HIS A ND1 1 
ATOM   1584  C CD2 . HIS A 1 221 ? 23.336  -5.195  27.761  1.00 65.25  ? 221  HIS A CD2 1 
ATOM   1585  C CE1 . HIS A 1 221 ? 25.083  -4.322  28.735  1.00 65.64  ? 221  HIS A CE1 1 
ATOM   1586  N NE2 . HIS A 1 221 ? 24.049  -4.032  27.941  1.00 65.26  ? 221  HIS A NE2 1 
ATOM   1587  N N   . ASP A 1 222 ? 22.754  -6.550  31.517  1.00 54.71  ? 222  ASP A N   1 
ATOM   1588  C CA  . ASP A 1 222 ? 21.762  -5.850  32.338  1.00 52.72  ? 222  ASP A CA  1 
ATOM   1589  C C   . ASP A 1 222 ? 21.574  -4.381  31.873  1.00 49.36  ? 222  ASP A C   1 
ATOM   1590  O O   . ASP A 1 222 ? 21.050  -3.570  32.634  1.00 47.97  ? 222  ASP A O   1 
ATOM   1591  C CB  . ASP A 1 222 ? 22.182  -5.883  33.830  1.00 56.16  ? 222  ASP A CB  1 
ATOM   1592  C CG  . ASP A 1 222 ? 22.647  -7.227  34.357  1.00 70.21  ? 222  ASP A CG  1 
ATOM   1593  O OD1 . ASP A 1 222 ? 21.918  -8.228  34.164  1.00 71.37  ? 222  ASP A OD1 1 
ATOM   1594  O OD2 . ASP A 1 222 ? 23.716  -7.271  35.002  1.00 77.80  ? 222  ASP A OD2 1 
ATOM   1595  N N   . GLY A 1 223 ? 21.992  -4.068  30.641  1.00 41.32  ? 223  GLY A N   1 
ATOM   1596  C CA  . GLY A 1 223 ? 21.916  -2.729  30.060  1.00 38.74  ? 223  GLY A CA  1 
ATOM   1597  C C   . GLY A 1 223 ? 22.977  -1.797  30.620  1.00 40.17  ? 223  GLY A C   1 
ATOM   1598  O O   . GLY A 1 223 ? 24.056  -2.249  31.015  1.00 40.43  ? 223  GLY A O   1 
ATOM   1599  N N   . THR A 1 224 ? 22.693  -0.480  30.604  1.00 33.99  ? 224  THR A N   1 
ATOM   1600  C CA  . THR A 1 224 ? 23.524  0.599   31.148  1.00 32.60  ? 224  THR A CA  1 
ATOM   1601  C C   . THR A 1 224 ? 22.871  0.971   32.474  1.00 34.80  ? 224  THR A C   1 
ATOM   1602  O O   . THR A 1 224 ? 21.711  1.391   32.490  1.00 33.17  ? 224  THR A O   1 
ATOM   1603  C CB  . THR A 1 224 ? 23.650  1.758   30.135  1.00 35.22  ? 224  THR A CB  1 
ATOM   1604  O OG1 . THR A 1 224 ? 24.261  1.267   28.941  1.00 31.86  ? 224  THR A OG1 1 
ATOM   1605  C CG2 . THR A 1 224 ? 24.469  2.911   30.658  1.00 29.02  ? 224  THR A CG2 1 
ATOM   1606  N N   . ILE A 1 225 ? 23.617  0.780   33.579  1.00 31.19  ? 225  ILE A N   1 
ATOM   1607  C CA  . ILE A 1 225 ? 23.186  0.925   34.967  1.00 31.23  ? 225  ILE A CA  1 
ATOM   1608  C C   . ILE A 1 225 ? 22.280  2.161   35.258  1.00 32.46  ? 225  ILE A C   1 
ATOM   1609  O O   . ILE A 1 225 ? 21.240  1.975   35.887  1.00 31.11  ? 225  ILE A O   1 
ATOM   1610  C CB  . ILE A 1 225 ? 24.401  0.849   35.945  1.00 35.93  ? 225  ILE A CB  1 
ATOM   1611  C CG1 . ILE A 1 225 ? 23.971  0.521   37.405  1.00 36.75  ? 225  ILE A CG1 1 
ATOM   1612  C CG2 . ILE A 1 225 ? 25.370  2.050   35.848  1.00 37.15  ? 225  ILE A CG2 1 
ATOM   1613  C CD1 . ILE A 1 225 ? 23.552  -0.910  37.615  1.00 45.14  ? 225  ILE A CD1 1 
ATOM   1614  N N   . GLU A 1 226 ? 22.643  3.377   34.808  1.00 28.57  ? 226  GLU A N   1 
ATOM   1615  C CA  . GLU A 1 226 ? 21.850  4.579   35.106  1.00 28.12  ? 226  GLU A CA  1 
ATOM   1616  C C   . GLU A 1 226 ? 20.500  4.610   34.383  1.00 30.85  ? 226  GLU A C   1 
ATOM   1617  O O   . GLU A 1 226 ? 19.568  5.235   34.898  1.00 30.97  ? 226  GLU A O   1 
ATOM   1618  C CB  . GLU A 1 226 ? 22.628  5.879   34.810  1.00 30.05  ? 226  GLU A CB  1 
ATOM   1619  C CG  . GLU A 1 226 ? 23.130  6.023   33.378  1.00 35.31  ? 226  GLU A CG  1 
ATOM   1620  C CD  . GLU A 1 226 ? 24.587  5.667   33.174  1.00 51.85  ? 226  GLU A CD  1 
ATOM   1621  O OE1 . GLU A 1 226 ? 24.987  4.545   33.559  1.00 39.23  ? 226  GLU A OE1 1 
ATOM   1622  O OE2 . GLU A 1 226 ? 25.331  6.515   32.630  1.00 51.20  ? 226  GLU A OE2 1 
ATOM   1623  N N   . PHE A 1 227 ? 20.386  3.944   33.212  1.00 25.86  ? 227  PHE A N   1 
ATOM   1624  C CA  . PHE A 1 227 ? 19.161  3.954   32.418  1.00 24.29  ? 227  PHE A CA  1 
ATOM   1625  C C   . PHE A 1 227 ? 18.392  2.638   32.428  1.00 28.69  ? 227  PHE A C   1 
ATOM   1626  O O   . PHE A 1 227 ? 17.243  2.634   31.987  1.00 28.24  ? 227  PHE A O   1 
ATOM   1627  C CB  . PHE A 1 227 ? 19.475  4.320   30.944  1.00 25.17  ? 227  PHE A CB  1 
ATOM   1628  C CG  . PHE A 1 227 ? 20.323  5.554   30.740  1.00 26.15  ? 227  PHE A CG  1 
ATOM   1629  C CD1 . PHE A 1 227 ? 19.901  6.799   31.210  1.00 29.05  ? 227  PHE A CD1 1 
ATOM   1630  C CD2 . PHE A 1 227 ? 21.533  5.477   30.067  1.00 26.83  ? 227  PHE A CD2 1 
ATOM   1631  C CE1 . PHE A 1 227 ? 20.697  7.936   31.042  1.00 30.00  ? 227  PHE A CE1 1 
ATOM   1632  C CE2 . PHE A 1 227 ? 22.327  6.617   29.893  1.00 30.20  ? 227  PHE A CE2 1 
ATOM   1633  C CZ  . PHE A 1 227 ? 21.904  7.837   30.388  1.00 28.93  ? 227  PHE A CZ  1 
ATOM   1634  N N   . THR A 1 228 ? 19.002  1.527   32.886  1.00 26.07  ? 228  THR A N   1 
ATOM   1635  C CA  . THR A 1 228 ? 18.379  0.195   32.801  1.00 25.49  ? 228  THR A CA  1 
ATOM   1636  C C   . THR A 1 228 ? 17.066  0.095   33.608  1.00 29.43  ? 228  THR A C   1 
ATOM   1637  O O   . THR A 1 228 ? 16.813  0.902   34.504  1.00 30.26  ? 228  THR A O   1 
ATOM   1638  C CB  . THR A 1 228 ? 19.376  -0.930  33.115  1.00 30.04  ? 228  THR A CB  1 
ATOM   1639  O OG1 . THR A 1 228 ? 18.849  -2.147  32.618  1.00 30.56  ? 228  THR A OG1 1 
ATOM   1640  C CG2 . THR A 1 228 ? 19.694  -1.078  34.584  1.00 29.51  ? 228  THR A CG2 1 
ATOM   1641  N N   . SER A 1 229 ? 16.210  -0.865  33.220  1.00 24.31  ? 229  SER A N   1 
ATOM   1642  C CA  . SER A 1 229 ? 14.904  -1.072  33.831  1.00 24.01  ? 229  SER A CA  1 
ATOM   1643  C C   . SER A 1 229 ? 14.998  -1.774  35.187  1.00 27.93  ? 229  SER A C   1 
ATOM   1644  O O   . SER A 1 229 ? 15.994  -2.447  35.458  1.00 28.85  ? 229  SER A O   1 
ATOM   1645  C CB  . SER A 1 229 ? 14.017  -1.885  32.889  1.00 25.42  ? 229  SER A CB  1 
ATOM   1646  O OG  . SER A 1 229 ? 14.406  -3.249  32.803  1.00 31.50  ? 229  SER A OG  1 
ATOM   1647  N N   . ILE A 1 230 ? 13.933  -1.655  36.009  1.00 24.13  ? 230  ILE A N   1 
ATOM   1648  C CA  . ILE A 1 230 ? 13.801  -2.329  37.316  1.00 24.13  ? 230  ILE A CA  1 
ATOM   1649  C C   . ILE A 1 230 ? 13.829  -3.855  37.083  1.00 29.16  ? 230  ILE A C   1 
ATOM   1650  O O   . ILE A 1 230 ? 14.490  -4.572  37.834  1.00 29.93  ? 230  ILE A O   1 
ATOM   1651  C CB  . ILE A 1 230 ? 12.517  -1.843  38.060  1.00 26.84  ? 230  ILE A CB  1 
ATOM   1652  C CG1 . ILE A 1 230 ? 12.732  -0.396  38.574  1.00 27.20  ? 230  ILE A CG1 1 
ATOM   1653  C CG2 . ILE A 1 230 ? 12.114  -2.796  39.217  1.00 26.95  ? 230  ILE A CG2 1 
ATOM   1654  C CD1 . ILE A 1 230 ? 11.500  0.403   38.875  1.00 31.56  ? 230  ILE A CD1 1 
ATOM   1655  N N   . ASP A 1 231 ? 13.154  -4.331  36.010  1.00 26.21  ? 231  ASP A N   1 
ATOM   1656  C CA  . ASP A 1 231 ? 13.145  -5.741  35.603  1.00 26.71  ? 231  ASP A CA  1 
ATOM   1657  C C   . ASP A 1 231 ? 14.579  -6.275  35.436  1.00 31.75  ? 231  ASP A C   1 
ATOM   1658  O O   . ASP A 1 231 ? 14.905  -7.302  36.031  1.00 32.97  ? 231  ASP A O   1 
ATOM   1659  C CB  . ASP A 1 231 ? 12.360  -5.924  34.295  1.00 27.98  ? 231  ASP A CB  1 
ATOM   1660  C CG  . ASP A 1 231 ? 10.855  -5.860  34.437  1.00 34.05  ? 231  ASP A CG  1 
ATOM   1661  O OD1 . ASP A 1 231 ? 10.336  -6.278  35.497  1.00 35.07  ? 231  ASP A OD1 1 
ATOM   1662  O OD2 . ASP A 1 231 ? 10.192  -5.421  33.484  1.00 34.76  ? 231  ASP A OD2 1 
ATOM   1663  N N   . ALA A 1 232 ? 15.444  -5.541  34.682  1.00 27.47  ? 232  ALA A N   1 
ATOM   1664  C CA  . ALA A 1 232 ? 16.860  -5.901  34.475  1.00 26.68  ? 232  ALA A CA  1 
ATOM   1665  C C   . ALA A 1 232 ? 17.613  -5.915  35.805  1.00 30.05  ? 232  ALA A C   1 
ATOM   1666  O O   . ALA A 1 232 ? 18.340  -6.870  36.071  1.00 30.97  ? 232  ALA A O   1 
ATOM   1667  C CB  . ALA A 1 232 ? 17.520  -4.947  33.494  1.00 26.52  ? 232  ALA A CB  1 
ATOM   1668  N N   . HIS A 1 233 ? 17.363  -4.924  36.680  1.00 25.73  ? 233  HIS A N   1 
ATOM   1669  C CA  . HIS A 1 233 ? 17.957  -4.863  38.030  1.00 25.78  ? 233  HIS A CA  1 
ATOM   1670  C C   . HIS A 1 233 ? 17.541  -6.057  38.886  1.00 31.74  ? 233  HIS A C   1 
ATOM   1671  O O   . HIS A 1 233 ? 18.301  -6.489  39.761  1.00 32.97  ? 233  HIS A O   1 
ATOM   1672  C CB  . HIS A 1 233 ? 17.541  -3.585  38.757  1.00 25.97  ? 233  HIS A CB  1 
ATOM   1673  C CG  . HIS A 1 233 ? 18.233  -2.338  38.314  1.00 28.06  ? 233  HIS A CG  1 
ATOM   1674  N ND1 . HIS A 1 233 ? 19.605  -2.211  38.382  1.00 30.10  ? 233  HIS A ND1 1 
ATOM   1675  C CD2 . HIS A 1 233 ? 17.706  -1.167  37.900  1.00 28.84  ? 233  HIS A CD2 1 
ATOM   1676  C CE1 . HIS A 1 233 ? 19.872  -0.977  37.992  1.00 28.96  ? 233  HIS A CE1 1 
ATOM   1677  N NE2 . HIS A 1 233 ? 18.760  -0.312  37.696  1.00 28.74  ? 233  HIS A NE2 1 
ATOM   1678  N N   . ASN A 1 234 ? 16.328  -6.585  38.641  1.00 28.57  ? 234  ASN A N   1 
ATOM   1679  C CA  . ASN A 1 234 ? 15.779  -7.730  39.370  1.00 29.77  ? 234  ASN A CA  1 
ATOM   1680  C C   . ASN A 1 234 ? 16.248  -9.070  38.786  1.00 34.40  ? 234  ASN A C   1 
ATOM   1681  O O   . ASN A 1 234 ? 15.874  -10.132 39.297  1.00 34.85  ? 234  ASN A O   1 
ATOM   1682  C CB  . ASN A 1 234 ? 14.258  -7.654  39.424  1.00 29.10  ? 234  ASN A CB  1 
ATOM   1683  C CG  . ASN A 1 234 ? 13.739  -6.751  40.530  1.00 35.05  ? 234  ASN A CG  1 
ATOM   1684  O OD1 . ASN A 1 234 ? 14.360  -6.572  41.572  1.00 25.25  ? 234  ASN A OD1 1 
ATOM   1685  N ND2 . ASN A 1 234 ? 12.552  -6.208  40.367  1.00 27.97  ? 234  ASN A ND2 1 
ATOM   1686  N N   . GLY A 1 235 ? 17.126  -8.998  37.788  1.00 31.18  ? 235  GLY A N   1 
ATOM   1687  C CA  . GLY A 1 235 ? 17.712  -10.165 37.141  1.00 31.70  ? 235  GLY A CA  1 
ATOM   1688  C C   . GLY A 1 235 ? 16.763  -10.904 36.220  1.00 35.49  ? 235  GLY A C   1 
ATOM   1689  O O   . GLY A 1 235 ? 16.970  -12.080 35.938  1.00 36.00  ? 235  GLY A O   1 
ATOM   1690  N N   . VAL A 1 236 ? 15.722  -10.225 35.756  1.00 31.37  ? 236  VAL A N   1 
ATOM   1691  C CA  . VAL A 1 236 ? 14.710  -10.782 34.864  1.00 30.31  ? 236  VAL A CA  1 
ATOM   1692  C C   . VAL A 1 236 ? 15.078  -10.357 33.428  1.00 35.57  ? 236  VAL A C   1 
ATOM   1693  O O   . VAL A 1 236 ? 15.695  -9.307  33.238  1.00 35.06  ? 236  VAL A O   1 
ATOM   1694  C CB  . VAL A 1 236 ? 13.305  -10.307 35.339  1.00 33.12  ? 236  VAL A CB  1 
ATOM   1695  C CG1 . VAL A 1 236 ? 12.229  -10.580 34.311  1.00 32.36  ? 236  VAL A CG1 1 
ATOM   1696  C CG2 . VAL A 1 236 ? 12.930  -10.968 36.669  1.00 34.20  ? 236  VAL A CG2 1 
ATOM   1697  N N   . ALA A 1 237 ? 14.752  -11.204 32.432  1.00 33.11  ? 237  ALA A N   1 
ATOM   1698  C CA  . ALA A 1 237 ? 14.982  -10.942 31.015  1.00 32.00  ? 237  ALA A CA  1 
ATOM   1699  C C   . ALA A 1 237 ? 14.217  -9.664  30.582  1.00 34.53  ? 237  ALA A C   1 
ATOM   1700  O O   . ALA A 1 237 ? 13.120  -9.424  31.114  1.00 32.47  ? 237  ALA A O   1 
ATOM   1701  C CB  . ALA A 1 237 ? 14.538  -12.140 30.192  1.00 32.80  ? 237  ALA A CB  1 
ATOM   1702  N N   . PRO A 1 238 ? 14.802  -8.787  29.719  1.00 29.34  ? 238  PRO A N   1 
ATOM   1703  C CA  . PRO A 1 238 ? 14.094  -7.554  29.357  1.00 28.63  ? 238  PRO A CA  1 
ATOM   1704  C C   . PRO A 1 238 ? 12.827  -7.813  28.533  1.00 32.41  ? 238  PRO A C   1 
ATOM   1705  O O   . PRO A 1 238 ? 12.791  -8.733  27.714  1.00 33.39  ? 238  PRO A O   1 
ATOM   1706  C CB  . PRO A 1 238 ? 15.143  -6.784  28.533  1.00 29.54  ? 238  PRO A CB  1 
ATOM   1707  C CG  . PRO A 1 238 ? 16.036  -7.809  27.985  1.00 33.00  ? 238  PRO A CG  1 
ATOM   1708  C CD  . PRO A 1 238 ? 16.105  -8.875  29.029  1.00 29.61  ? 238  PRO A CD  1 
ATOM   1709  N N   . SER A 1 239 ? 11.784  -7.010  28.764  1.00 28.51  ? 239  SER A N   1 
ATOM   1710  C CA  . SER A 1 239 ? 10.540  -7.074  27.988  1.00 28.12  ? 239  SER A CA  1 
ATOM   1711  C C   . SER A 1 239 ? 10.196  -5.653  27.502  1.00 30.54  ? 239  SER A C   1 
ATOM   1712  O O   . SER A 1 239 ? 11.022  -4.738  27.629  1.00 28.66  ? 239  SER A O   1 
ATOM   1713  C CB  . SER A 1 239 ? 9.404   -7.731  28.775  1.00 32.20  ? 239  SER A CB  1 
ATOM   1714  O OG  . SER A 1 239 ? 8.867   -6.907  29.796  1.00 37.75  ? 239  SER A OG  1 
ATOM   1715  N N   . ARG A 1 240 ? 9.022   -5.488  26.886  1.00 27.68  ? 240  ARG A N   1 
ATOM   1716  C CA  . ARG A 1 240 ? 8.602   -4.232  26.268  1.00 27.03  ? 240  ARG A CA  1 
ATOM   1717  C C   . ARG A 1 240 ? 8.512   -3.067  27.247  1.00 31.16  ? 240  ARG A C   1 
ATOM   1718  O O   . ARG A 1 240 ? 9.024   -1.988  26.925  1.00 32.29  ? 240  ARG A O   1 
ATOM   1719  C CB  . ARG A 1 240 ? 7.280   -4.424  25.531  1.00 25.79  ? 240  ARG A CB  1 
ATOM   1720  C CG  . ARG A 1 240 ? 7.443   -5.330  24.309  1.00 25.56  ? 240  ARG A CG  1 
ATOM   1721  C CD  . ARG A 1 240 ? 6.114   -5.612  23.654  1.00 26.27  ? 240  ARG A CD  1 
ATOM   1722  N NE  . ARG A 1 240 ? 5.367   -6.643  24.371  1.00 23.87  ? 240  ARG A NE  1 
ATOM   1723  C CZ  . ARG A 1 240 ? 4.292   -7.244  23.885  1.00 38.91  ? 240  ARG A CZ  1 
ATOM   1724  N NH1 . ARG A 1 240 ? 3.827   -6.918  22.687  1.00 28.09  ? 240  ARG A NH1 1 
ATOM   1725  N NH2 . ARG A 1 240 ? 3.667   -8.172  24.594  1.00 30.97  ? 240  ARG A NH2 1 
ATOM   1726  N N   . ARG A 1 241 ? 7.920   -3.279  28.446  1.00 26.08  ? 241  ARG A N   1 
ATOM   1727  C CA  . ARG A 1 241 ? 7.785   -2.228  29.458  1.00 24.86  ? 241  ARG A CA  1 
ATOM   1728  C C   . ARG A 1 241 ? 9.156   -1.679  29.878  1.00 26.82  ? 241  ARG A C   1 
ATOM   1729  O O   . ARG A 1 241 ? 9.284   -0.476  30.095  1.00 26.81  ? 241  ARG A O   1 
ATOM   1730  C CB  . ARG A 1 241 ? 6.958   -2.701  30.674  1.00 26.12  ? 241  ARG A CB  1 
ATOM   1731  C CG  . ARG A 1 241 ? 7.578   -3.792  31.523  1.00 25.24  ? 241  ARG A CG  1 
ATOM   1732  C CD  . ARG A 1 241 ? 6.710   -4.065  32.708  1.00 25.08  ? 241  ARG A CD  1 
ATOM   1733  N NE  . ARG A 1 241 ? 7.401   -4.898  33.687  1.00 25.66  ? 241  ARG A NE  1 
ATOM   1734  C CZ  . ARG A 1 241 ? 6.881   -5.267  34.849  1.00 38.34  ? 241  ARG A CZ  1 
ATOM   1735  N NH1 . ARG A 1 241 ? 5.653   -4.889  35.186  1.00 27.26  ? 241  ARG A NH1 1 
ATOM   1736  N NH2 . ARG A 1 241 ? 7.583   -6.018  35.686  1.00 25.54  ? 241  ARG A NH2 1 
ATOM   1737  N N   . GLY A 1 242 ? 10.163  -2.548  29.930  1.00 23.20  ? 242  GLY A N   1 
ATOM   1738  C CA  . GLY A 1 242 ? 11.540  -2.184  30.253  1.00 22.73  ? 242  GLY A CA  1 
ATOM   1739  C C   . GLY A 1 242 ? 12.141  -1.169  29.295  1.00 25.34  ? 242  GLY A C   1 
ATOM   1740  O O   . GLY A 1 242 ? 12.741  -0.195  29.743  1.00 26.49  ? 242  GLY A O   1 
ATOM   1741  N N   . ASP A 1 243 ? 11.949  -1.358  27.977  1.00 21.17  ? 243  ASP A N   1 
ATOM   1742  C CA  . ASP A 1 243 ? 12.435  -0.447  26.923  1.00 20.83  ? 243  ASP A CA  1 
ATOM   1743  C C   . ASP A 1 243 ? 11.825  0.940   27.072  1.00 26.83  ? 243  ASP A C   1 
ATOM   1744  O O   . ASP A 1 243 ? 12.510  1.939   26.858  1.00 26.93  ? 243  ASP A O   1 
ATOM   1745  C CB  . ASP A 1 243 ? 12.110  -1.004  25.519  1.00 21.90  ? 243  ASP A CB  1 
ATOM   1746  C CG  . ASP A 1 243 ? 13.145  -1.959  24.931  1.00 29.48  ? 243  ASP A CG  1 
ATOM   1747  O OD1 . ASP A 1 243 ? 14.128  -2.283  25.632  1.00 28.10  ? 243  ASP A OD1 1 
ATOM   1748  O OD2 . ASP A 1 243 ? 12.976  -2.367  23.765  1.00 34.59  ? 243  ASP A OD2 1 
ATOM   1749  N N   . LEU A 1 244 ? 10.529  0.994   27.435  1.00 24.47  ? 244  LEU A N   1 
ATOM   1750  C CA  . LEU A 1 244 ? 9.778   2.232   27.622  1.00 25.04  ? 244  LEU A CA  1 
ATOM   1751  C C   . LEU A 1 244 ? 10.203  2.950   28.890  1.00 27.33  ? 244  LEU A C   1 
ATOM   1752  O O   . LEU A 1 244 ? 10.226  4.181   28.924  1.00 27.49  ? 244  LEU A O   1 
ATOM   1753  C CB  . LEU A 1 244 ? 8.273   1.936   27.641  1.00 26.03  ? 244  LEU A CB  1 
ATOM   1754  C CG  . LEU A 1 244 ? 7.695   1.333   26.343  1.00 30.64  ? 244  LEU A CG  1 
ATOM   1755  C CD1 . LEU A 1 244 ? 6.246   1.048   26.515  1.00 31.28  ? 244  LEU A CD1 1 
ATOM   1756  C CD2 . LEU A 1 244 ? 7.889   2.255   25.150  1.00 30.13  ? 244  LEU A CD2 1 
ATOM   1757  N N   . GLU A 1 245 ? 10.578  2.179   29.918  1.00 23.39  ? 245  GLU A N   1 
ATOM   1758  C CA  . GLU A 1 245 ? 11.083  2.687   31.194  1.00 23.22  ? 245  GLU A CA  1 
ATOM   1759  C C   . GLU A 1 245 ? 12.452  3.344   30.971  1.00 27.51  ? 245  GLU A C   1 
ATOM   1760  O O   . GLU A 1 245 ? 12.665  4.473   31.412  1.00 28.96  ? 245  GLU A O   1 
ATOM   1761  C CB  . GLU A 1 245 ? 11.169  1.538   32.216  1.00 24.53  ? 245  GLU A CB  1 
ATOM   1762  C CG  . GLU A 1 245 ? 11.420  2.010   33.625  1.00 32.91  ? 245  GLU A CG  1 
ATOM   1763  C CD  . GLU A 1 245 ? 11.784  0.953   34.641  1.00 51.86  ? 245  GLU A CD  1 
ATOM   1764  O OE1 . GLU A 1 245 ? 11.524  -0.252  34.433  1.00 41.23  ? 245  GLU A OE1 1 
ATOM   1765  O OE2 . GLU A 1 245 ? 12.330  1.359   35.687  1.00 52.09  ? 245  GLU A OE2 1 
ATOM   1766  N N   . ILE A 1 246 ? 13.354  2.650   30.239  1.00 23.46  ? 246  ILE A N   1 
ATOM   1767  C CA  . ILE A 1 246 ? 14.692  3.133   29.861  1.00 23.28  ? 246  ILE A CA  1 
ATOM   1768  C C   . ILE A 1 246 ? 14.565  4.498   29.153  1.00 27.51  ? 246  ILE A C   1 
ATOM   1769  O O   . ILE A 1 246 ? 15.268  5.444   29.538  1.00 27.75  ? 246  ILE A O   1 
ATOM   1770  C CB  . ILE A 1 246 ? 15.460  2.085   28.995  1.00 25.54  ? 246  ILE A CB  1 
ATOM   1771  C CG1 . ILE A 1 246 ? 15.737  0.780   29.803  1.00 25.16  ? 246  ILE A CG1 1 
ATOM   1772  C CG2 . ILE A 1 246 ? 16.755  2.676   28.446  1.00 26.48  ? 246  ILE A CG2 1 
ATOM   1773  C CD1 . ILE A 1 246 ? 16.061  -0.451  28.968  1.00 21.39  ? 246  ILE A CD1 1 
ATOM   1774  N N   . LEU A 1 247 ? 13.620  4.615   28.182  1.00 23.39  ? 247  LEU A N   1 
ATOM   1775  C CA  . LEU A 1 247 ? 13.356  5.866   27.464  1.00 23.58  ? 247  LEU A CA  1 
ATOM   1776  C C   . LEU A 1 247 ? 12.933  6.986   28.448  1.00 29.15  ? 247  LEU A C   1 
ATOM   1777  O O   . LEU A 1 247 ? 13.411  8.114   28.309  1.00 30.03  ? 247  LEU A O   1 
ATOM   1778  C CB  . LEU A 1 247 ? 12.306  5.678   26.348  1.00 23.47  ? 247  LEU A CB  1 
ATOM   1779  C CG  . LEU A 1 247 ? 11.868  6.935   25.563  1.00 27.31  ? 247  LEU A CG  1 
ATOM   1780  C CD1 . LEU A 1 247 ? 13.050  7.648   24.909  1.00 26.86  ? 247  LEU A CD1 1 
ATOM   1781  C CD2 . LEU A 1 247 ? 10.819  6.590   24.543  1.00 28.31  ? 247  LEU A CD2 1 
ATOM   1782  N N   . GLY A 1 248 ? 12.089  6.650   29.429  1.00 24.59  ? 248  GLY A N   1 
ATOM   1783  C CA  . GLY A 1 248 ? 11.663  7.568   30.475  1.00 24.13  ? 248  GLY A CA  1 
ATOM   1784  C C   . GLY A 1 248 ? 12.830  8.205   31.206  1.00 27.98  ? 248  GLY A C   1 
ATOM   1785  O O   . GLY A 1 248 ? 12.890  9.431   31.327  1.00 29.96  ? 248  GLY A O   1 
ATOM   1786  N N   . TYR A 1 249 ? 13.790  7.384   31.652  1.00 23.79  ? 249  TYR A N   1 
ATOM   1787  C CA  . TYR A 1 249 ? 15.013  7.845   32.342  1.00 24.41  ? 249  TYR A CA  1 
ATOM   1788  C C   . TYR A 1 249 ? 15.888  8.693   31.422  1.00 30.05  ? 249  TYR A C   1 
ATOM   1789  O O   . TYR A 1 249 ? 16.481  9.665   31.891  1.00 31.93  ? 249  TYR A O   1 
ATOM   1790  C CB  . TYR A 1 249 ? 15.834  6.667   32.893  1.00 24.64  ? 249  TYR A CB  1 
ATOM   1791  C CG  . TYR A 1 249 ? 15.094  5.804   33.895  1.00 24.71  ? 249  TYR A CG  1 
ATOM   1792  C CD1 . TYR A 1 249 ? 14.238  6.372   34.837  1.00 26.93  ? 249  TYR A CD1 1 
ATOM   1793  C CD2 . TYR A 1 249 ? 15.288  4.427   33.935  1.00 24.86  ? 249  TYR A CD2 1 
ATOM   1794  C CE1 . TYR A 1 249 ? 13.551  5.586   35.758  1.00 25.94  ? 249  TYR A CE1 1 
ATOM   1795  C CE2 . TYR A 1 249 ? 14.617  3.631   34.860  1.00 26.31  ? 249  TYR A CE2 1 
ATOM   1796  C CZ  . TYR A 1 249 ? 13.753  4.217   35.772  1.00 32.13  ? 249  TYR A CZ  1 
ATOM   1797  O OH  . TYR A 1 249 ? 13.090  3.441   36.683  1.00 30.96  ? 249  TYR A OH  1 
ATOM   1798  N N   . CYS A 1 250 ? 15.956  8.331   30.118  1.00 24.98  ? 250  CYS A N   1 
ATOM   1799  C CA  . CYS A 1 250 ? 16.686  9.066   29.075  1.00 24.79  ? 250  CYS A CA  1 
ATOM   1800  C C   . CYS A 1 250 ? 16.129  10.479  28.959  1.00 32.09  ? 250  CYS A C   1 
ATOM   1801  O O   . CYS A 1 250 ? 16.903  11.435  28.943  1.00 32.44  ? 250  CYS A O   1 
ATOM   1802  C CB  . CYS A 1 250 ? 16.611  8.337   27.733  1.00 23.78  ? 250  CYS A CB  1 
ATOM   1803  S SG  . CYS A 1 250 ? 17.811  6.999   27.532  1.00 26.87  ? 250  CYS A SG  1 
ATOM   1804  N N   . MET A 1 251 ? 14.782  10.605  28.895  1.00 30.08  ? 251  MET A N   1 
ATOM   1805  C CA  . MET A 1 251 ? 14.064  11.872  28.777  1.00 30.77  ? 251  MET A CA  1 
ATOM   1806  C C   . MET A 1 251 ? 14.410  12.821  29.914  1.00 35.01  ? 251  MET A C   1 
ATOM   1807  O O   . MET A 1 251 ? 14.715  13.980  29.645  1.00 35.44  ? 251  MET A O   1 
ATOM   1808  C CB  . MET A 1 251 ? 12.542  11.655  28.703  1.00 33.41  ? 251  MET A CB  1 
ATOM   1809  C CG  . MET A 1 251 ? 12.087  10.996  27.410  1.00 36.90  ? 251  MET A CG  1 
ATOM   1810  S SD  . MET A 1 251 ? 10.286  10.942  27.148  1.00 42.05  ? 251  MET A SD  1 
ATOM   1811  C CE  . MET A 1 251 ? 9.756   10.165  28.583  1.00 38.00  ? 251  MET A CE  1 
ATOM   1812  N N   . ILE A 1 252 ? 14.416  12.326  31.169  1.00 31.89  ? 252  ILE A N   1 
ATOM   1813  C CA  . ILE A 1 252 ? 14.744  13.118  32.367  1.00 32.00  ? 252  ILE A CA  1 
ATOM   1814  C C   . ILE A 1 252 ? 16.208  13.584  32.284  1.00 37.19  ? 252  ILE A C   1 
ATOM   1815  O O   . ILE A 1 252 ? 16.477  14.773  32.471  1.00 39.89  ? 252  ILE A O   1 
ATOM   1816  C CB  . ILE A 1 252 ? 14.434  12.327  33.672  1.00 34.28  ? 252  ILE A CB  1 
ATOM   1817  C CG1 . ILE A 1 252 ? 12.911  12.173  33.874  1.00 34.51  ? 252  ILE A CG1 1 
ATOM   1818  C CG2 . ILE A 1 252 ? 15.077  12.987  34.890  1.00 35.77  ? 252  ILE A CG2 1 
ATOM   1819  C CD1 . ILE A 1 252 ? 12.479  11.032  34.814  1.00 42.59  ? 252  ILE A CD1 1 
ATOM   1820  N N   . GLN A 1 253 ? 17.131  12.657  31.976  1.00 31.63  ? 253  GLN A N   1 
ATOM   1821  C CA  . GLN A 1 253 ? 18.567  12.911  31.829  1.00 31.65  ? 253  GLN A CA  1 
ATOM   1822  C C   . GLN A 1 253 ? 18.826  14.000  30.768  1.00 34.60  ? 253  GLN A C   1 
ATOM   1823  O O   . GLN A 1 253 ? 19.638  14.887  30.997  1.00 35.37  ? 253  GLN A O   1 
ATOM   1824  C CB  . GLN A 1 253 ? 19.282  11.594  31.451  1.00 32.79  ? 253  GLN A CB  1 
ATOM   1825  C CG  . GLN A 1 253 ? 20.754  11.715  31.029  1.00 46.28  ? 253  GLN A CG  1 
ATOM   1826  C CD  . GLN A 1 253 ? 21.685  11.915  32.187  1.00 59.16  ? 253  GLN A CD  1 
ATOM   1827  O OE1 . GLN A 1 253 ? 21.630  11.209  33.193  1.00 56.87  ? 253  GLN A OE1 1 
ATOM   1828  N NE2 . GLN A 1 253 ? 22.585  12.868  32.055  1.00 53.93  ? 253  GLN A NE2 1 
ATOM   1829  N N   . TRP A 1 254 ? 18.128  13.937  29.631  1.00 30.12  ? 254  TRP A N   1 
ATOM   1830  C CA  . TRP A 1 254 ? 18.300  14.891  28.533  1.00 30.35  ? 254  TRP A CA  1 
ATOM   1831  C C   . TRP A 1 254 ? 17.746  16.263  28.892  1.00 34.17  ? 254  TRP A C   1 
ATOM   1832  O O   . TRP A 1 254 ? 18.353  17.276  28.544  1.00 33.75  ? 254  TRP A O   1 
ATOM   1833  C CB  . TRP A 1 254 ? 17.644  14.362  27.241  1.00 28.16  ? 254  TRP A CB  1 
ATOM   1834  C CG  . TRP A 1 254 ? 18.217  13.073  26.726  1.00 28.11  ? 254  TRP A CG  1 
ATOM   1835  C CD1 . TRP A 1 254 ? 19.456  12.555  26.988  1.00 31.05  ? 254  TRP A CD1 1 
ATOM   1836  C CD2 . TRP A 1 254 ? 17.572  12.142  25.843  1.00 27.11  ? 254  TRP A CD2 1 
ATOM   1837  N NE1 . TRP A 1 254 ? 19.601  11.336  26.362  1.00 29.81  ? 254  TRP A NE1 1 
ATOM   1838  C CE2 . TRP A 1 254 ? 18.474  11.075  25.624  1.00 30.21  ? 254  TRP A CE2 1 
ATOM   1839  C CE3 . TRP A 1 254 ? 16.303  12.090  25.237  1.00 28.10  ? 254  TRP A CE3 1 
ATOM   1840  C CZ2 . TRP A 1 254 ? 18.163  9.989   24.799  1.00 28.42  ? 254  TRP A CZ2 1 
ATOM   1841  C CZ3 . TRP A 1 254 ? 15.991  11.003  24.434  1.00 28.42  ? 254  TRP A CZ3 1 
ATOM   1842  C CH2 . TRP A 1 254 ? 16.914  9.970   24.220  1.00 28.20  ? 254  TRP A CH2 1 
ATOM   1843  N N   . LEU A 1 255 ? 16.608  16.295  29.602  1.00 31.12  ? 255  LEU A N   1 
ATOM   1844  C CA  . LEU A 1 255 ? 15.952  17.534  30.006  1.00 31.37  ? 255  LEU A CA  1 
ATOM   1845  C C   . LEU A 1 255 ? 16.672  18.263  31.145  1.00 35.63  ? 255  LEU A C   1 
ATOM   1846  O O   . LEU A 1 255 ? 16.730  19.491  31.131  1.00 36.41  ? 255  LEU A O   1 
ATOM   1847  C CB  . LEU A 1 255 ? 14.501  17.258  30.434  1.00 31.08  ? 255  LEU A CB  1 
ATOM   1848  C CG  . LEU A 1 255 ? 13.476  16.999  29.326  1.00 34.80  ? 255  LEU A CG  1 
ATOM   1849  C CD1 . LEU A 1 255 ? 12.204  16.427  29.904  1.00 34.38  ? 255  LEU A CD1 1 
ATOM   1850  C CD2 . LEU A 1 255 ? 13.158  18.257  28.565  1.00 37.47  ? 255  LEU A CD2 1 
ATOM   1851  N N   . THR A 1 256 ? 17.197  17.521  32.131  1.00 32.31  ? 256  THR A N   1 
ATOM   1852  C CA  . THR A 1 256 ? 17.797  18.092  33.345  1.00 33.14  ? 256  THR A CA  1 
ATOM   1853  C C   . THR A 1 256 ? 19.330  18.000  33.442  1.00 38.99  ? 256  THR A C   1 
ATOM   1854  O O   . THR A 1 256 ? 19.919  18.678  34.287  1.00 40.39  ? 256  THR A O   1 
ATOM   1855  C CB  . THR A 1 256 ? 17.207  17.383  34.568  1.00 34.67  ? 256  THR A CB  1 
ATOM   1856  O OG1 . THR A 1 256 ? 17.679  16.032  34.604  1.00 34.03  ? 256  THR A OG1 1 
ATOM   1857  C CG2 . THR A 1 256 ? 15.697  17.397  34.575  1.00 31.93  ? 256  THR A CG2 1 
ATOM   1858  N N   . GLY A 1 257 ? 19.943  17.130  32.647  1.00 35.00  ? 257  GLY A N   1 
ATOM   1859  C CA  . GLY A 1 257 ? 21.382  16.892  32.692  1.00 35.14  ? 257  GLY A CA  1 
ATOM   1860  C C   . GLY A 1 257 ? 21.799  15.976  33.830  1.00 38.80  ? 257  GLY A C   1 
ATOM   1861  O O   . GLY A 1 257 ? 22.996  15.795  34.067  1.00 38.91  ? 257  GLY A O   1 
ATOM   1862  N N   . HIS A 1 258 ? 20.812  15.413  34.573  1.00 34.53  ? 258  HIS A N   1 
ATOM   1863  C CA  . HIS A 1 258 ? 21.066  14.535  35.720  1.00 34.35  ? 258  HIS A CA  1 
ATOM   1864  C C   . HIS A 1 258 ? 19.996  13.453  35.905  1.00 37.70  ? 258  HIS A C   1 
ATOM   1865  O O   . HIS A 1 258 ? 18.922  13.515  35.309  1.00 37.98  ? 258  HIS A O   1 
ATOM   1866  C CB  . HIS A 1 258 ? 21.140  15.367  37.029  1.00 36.22  ? 258  HIS A CB  1 
ATOM   1867  C CG  . HIS A 1 258 ? 22.071  16.539  36.976  1.00 41.18  ? 258  HIS A CG  1 
ATOM   1868  N ND1 . HIS A 1 258 ? 23.421  16.399  37.231  1.00 43.87  ? 258  HIS A ND1 1 
ATOM   1869  C CD2 . HIS A 1 258 ? 21.817  17.833  36.669  1.00 43.96  ? 258  HIS A CD2 1 
ATOM   1870  C CE1 . HIS A 1 258 ? 23.944  17.607  37.078  1.00 44.50  ? 258  HIS A CE1 1 
ATOM   1871  N NE2 . HIS A 1 258 ? 23.019  18.501  36.732  1.00 44.93  ? 258  HIS A NE2 1 
ATOM   1872  N N   . LEU A 1 259 ? 20.300  12.482  36.768  1.00 34.14  ? 259  LEU A N   1 
ATOM   1873  C CA  . LEU A 1 259 ? 19.411  11.424  37.257  1.00 33.13  ? 259  LEU A CA  1 
ATOM   1874  C C   . LEU A 1 259 ? 19.650  11.330  38.764  1.00 36.93  ? 259  LEU A C   1 
ATOM   1875  O O   . LEU A 1 259 ? 20.793  11.527  39.182  1.00 37.01  ? 259  LEU A O   1 
ATOM   1876  C CB  . LEU A 1 259 ? 19.598  10.070  36.536  1.00 32.10  ? 259  LEU A CB  1 
ATOM   1877  C CG  . LEU A 1 259 ? 18.970  9.952   35.134  1.00 34.31  ? 259  LEU A CG  1 
ATOM   1878  C CD1 . LEU A 1 259 ? 19.450  8.703   34.426  1.00 33.26  ? 259  LEU A CD1 1 
ATOM   1879  C CD2 . LEU A 1 259 ? 17.450  9.979   35.189  1.00 33.20  ? 259  LEU A CD2 1 
ATOM   1880  N N   . PRO A 1 260 ? 18.605  11.131  39.610  1.00 33.67  ? 260  PRO A N   1 
ATOM   1881  C CA  . PRO A 1 260 ? 18.825  11.161  41.076  1.00 34.08  ? 260  PRO A CA  1 
ATOM   1882  C C   . PRO A 1 260 ? 19.898  10.208  41.626  1.00 38.28  ? 260  PRO A C   1 
ATOM   1883  O O   . PRO A 1 260 ? 20.575  10.561  42.591  1.00 39.79  ? 260  PRO A O   1 
ATOM   1884  C CB  . PRO A 1 260 ? 17.455  10.799  41.652  1.00 35.34  ? 260  PRO A CB  1 
ATOM   1885  C CG  . PRO A 1 260 ? 16.485  11.179  40.593  1.00 39.15  ? 260  PRO A CG  1 
ATOM   1886  C CD  . PRO A 1 260 ? 17.174  10.945  39.285  1.00 34.19  ? 260  PRO A CD  1 
ATOM   1887  N N   . TRP A 1 261 ? 20.063  9.035   41.007  1.00 33.87  ? 261  TRP A N   1 
ATOM   1888  C CA  . TRP A 1 261 ? 20.976  7.968   41.430  1.00 34.05  ? 261  TRP A CA  1 
ATOM   1889  C C   . TRP A 1 261 ? 22.368  8.000   40.760  1.00 39.77  ? 261  TRP A C   1 
ATOM   1890  O O   . TRP A 1 261 ? 23.153  7.073   40.979  1.00 40.47  ? 261  TRP A O   1 
ATOM   1891  C CB  . TRP A 1 261 ? 20.316  6.608   41.132  1.00 31.51  ? 261  TRP A CB  1 
ATOM   1892  C CG  . TRP A 1 261 ? 19.707  6.525   39.759  1.00 30.91  ? 261  TRP A CG  1 
ATOM   1893  C CD1 . TRP A 1 261 ? 20.344  6.201   38.597  1.00 32.92  ? 261  TRP A CD1 1 
ATOM   1894  C CD2 . TRP A 1 261 ? 18.338  6.786   39.410  1.00 30.19  ? 261  TRP A CD2 1 
ATOM   1895  N NE1 . TRP A 1 261 ? 19.462  6.246   37.546  1.00 31.38  ? 261  TRP A NE1 1 
ATOM   1896  C CE2 . TRP A 1 261 ? 18.223  6.605   38.015  1.00 32.99  ? 261  TRP A CE2 1 
ATOM   1897  C CE3 . TRP A 1 261 ? 17.195  7.167   40.144  1.00 31.77  ? 261  TRP A CE3 1 
ATOM   1898  C CZ2 . TRP A 1 261 ? 17.013  6.783   37.337  1.00 31.73  ? 261  TRP A CZ2 1 
ATOM   1899  C CZ3 . TRP A 1 261 ? 15.993  7.331   39.471  1.00 32.53  ? 261  TRP A CZ3 1 
ATOM   1900  C CH2 . TRP A 1 261 ? 15.911  7.143   38.084  1.00 32.33  ? 261  TRP A CH2 1 
ATOM   1901  N N   . GLU A 1 262 ? 22.692  9.049   39.986  1.00 37.39  ? 262  GLU A N   1 
ATOM   1902  C CA  . GLU A 1 262 ? 23.958  9.140   39.230  1.00 38.38  ? 262  GLU A CA  1 
ATOM   1903  C C   . GLU A 1 262 ? 25.243  9.228   40.101  1.00 46.42  ? 262  GLU A C   1 
ATOM   1904  O O   . GLU A 1 262 ? 26.336  8.960   39.594  1.00 46.63  ? 262  GLU A O   1 
ATOM   1905  C CB  . GLU A 1 262 ? 23.925  10.310  38.237  1.00 39.20  ? 262  GLU A CB  1 
ATOM   1906  C CG  . GLU A 1 262 ? 23.974  11.695  38.865  1.00 46.55  ? 262  GLU A CG  1 
ATOM   1907  C CD  . GLU A 1 262 ? 23.906  12.858  37.895  1.00 61.16  ? 262  GLU A CD  1 
ATOM   1908  O OE1 . GLU A 1 262 ? 24.167  13.998  38.337  1.00 63.72  ? 262  GLU A OE1 1 
ATOM   1909  O OE2 . GLU A 1 262 ? 23.609  12.637  36.698  1.00 55.95  ? 262  GLU A OE2 1 
ATOM   1910  N N   . ASP A 1 263 ? 25.122  9.591   41.379  1.00 45.50  ? 263  ASP A N   1 
ATOM   1911  C CA  . ASP A 1 263 ? 26.288  9.703   42.259  1.00 47.79  ? 263  ASP A CA  1 
ATOM   1912  C C   . ASP A 1 263 ? 26.710  8.350   42.874  1.00 51.77  ? 263  ASP A C   1 
ATOM   1913  O O   . ASP A 1 263 ? 27.729  8.301   43.571  1.00 52.61  ? 263  ASP A O   1 
ATOM   1914  C CB  . ASP A 1 263 ? 26.015  10.716  43.386  1.00 50.81  ? 263  ASP A CB  1 
ATOM   1915  N N   . ASN A 1 264 ? 25.932  7.262   42.619  1.00 46.45  ? 264  ASN A N   1 
ATOM   1916  C CA  . ASN A 1 264 ? 26.185  5.930   43.185  1.00 46.22  ? 264  ASN A CA  1 
ATOM   1917  C C   . ASN A 1 264 ? 25.976  4.805   42.172  1.00 46.66  ? 264  ASN A C   1 
ATOM   1918  O O   . ASN A 1 264 ? 25.367  3.782   42.511  1.00 45.62  ? 264  ASN A O   1 
ATOM   1919  C CB  . ASN A 1 264 ? 25.272  5.686   44.387  1.00 48.99  ? 264  ASN A CB  1 
ATOM   1920  C CG  . ASN A 1 264 ? 25.476  6.594   45.561  1.00 78.89  ? 264  ASN A CG  1 
ATOM   1921  O OD1 . ASN A 1 264 ? 26.089  6.212   46.559  1.00 74.73  ? 264  ASN A OD1 1 
ATOM   1922  N ND2 . ASN A 1 264 ? 24.892  7.785   45.500  1.00 73.91  ? 264  ASN A ND2 1 
ATOM   1923  N N   . LEU A 1 265 ? 26.534  4.962   40.954  1.00 40.87  ? 265  LEU A N   1 
ATOM   1924  C CA  . LEU A 1 265 ? 26.394  3.989   39.871  1.00 38.53  ? 265  LEU A CA  1 
ATOM   1925  C C   . LEU A 1 265 ? 27.265  2.737   40.066  1.00 43.84  ? 265  LEU A C   1 
ATOM   1926  O O   . LEU A 1 265 ? 26.995  1.722   39.430  1.00 43.51  ? 265  LEU A O   1 
ATOM   1927  C CB  . LEU A 1 265 ? 26.664  4.623   38.495  1.00 37.07  ? 265  LEU A CB  1 
ATOM   1928  C CG  . LEU A 1 265 ? 25.762  5.804   38.101  1.00 39.39  ? 265  LEU A CG  1 
ATOM   1929  C CD1 . LEU A 1 265 ? 26.137  6.327   36.741  1.00 37.96  ? 265  LEU A CD1 1 
ATOM   1930  C CD2 . LEU A 1 265 ? 24.275  5.430   38.141  1.00 40.05  ? 265  LEU A CD2 1 
ATOM   1931  N N   . LYS A 1 266 ? 28.272  2.790   40.949  1.00 42.70  ? 266  LYS A N   1 
ATOM   1932  C CA  . LYS A 1 266 ? 29.122  1.644   41.285  1.00 43.40  ? 266  LYS A CA  1 
ATOM   1933  C C   . LYS A 1 266 ? 28.323  0.621   42.135  1.00 47.51  ? 266  LYS A C   1 
ATOM   1934  O O   . LYS A 1 266 ? 28.725  -0.537  42.224  1.00 48.26  ? 266  LYS A O   1 
ATOM   1935  C CB  . LYS A 1 266 ? 30.385  2.112   42.034  1.00 46.82  ? 266  LYS A CB  1 
ATOM   1936  N N   . ASP A 1 267 ? 27.182  1.053   42.734  1.00 42.52  ? 267  ASP A N   1 
ATOM   1937  C CA  . ASP A 1 267 ? 26.312  0.224   43.572  1.00 41.65  ? 267  ASP A CA  1 
ATOM   1938  C C   . ASP A 1 267 ? 24.943  -0.036  42.884  1.00 42.02  ? 267  ASP A C   1 
ATOM   1939  O O   . ASP A 1 267 ? 24.023  0.775   43.024  1.00 40.45  ? 267  ASP A O   1 
ATOM   1940  C CB  . ASP A 1 267 ? 26.116  0.874   44.961  1.00 44.35  ? 267  ASP A CB  1 
ATOM   1941  C CG  . ASP A 1 267 ? 25.516  -0.021  46.039  1.00 57.10  ? 267  ASP A CG  1 
ATOM   1942  O OD1 . ASP A 1 267 ? 24.970  -1.094  45.694  1.00 57.83  ? 267  ASP A OD1 1 
ATOM   1943  O OD2 . ASP A 1 267 ? 25.600  0.349   47.228  1.00 65.50  ? 267  ASP A OD2 1 
ATOM   1944  N N   . PRO A 1 268 ? 24.770  -1.198  42.198  1.00 37.10  ? 268  PRO A N   1 
ATOM   1945  C CA  . PRO A 1 268 ? 23.476  -1.492  41.544  1.00 35.09  ? 268  PRO A CA  1 
ATOM   1946  C C   . PRO A 1 268 ? 22.280  -1.593  42.508  1.00 36.91  ? 268  PRO A C   1 
ATOM   1947  O O   . PRO A 1 268 ? 21.153  -1.301  42.094  1.00 36.51  ? 268  PRO A O   1 
ATOM   1948  C CB  . PRO A 1 268 ? 23.728  -2.838  40.850  1.00 36.33  ? 268  PRO A CB  1 
ATOM   1949  C CG  . PRO A 1 268 ? 25.189  -2.899  40.678  1.00 41.55  ? 268  PRO A CG  1 
ATOM   1950  C CD  . PRO A 1 268 ? 25.750  -2.265  41.916  1.00 38.36  ? 268  PRO A CD  1 
ATOM   1951  N N   . LYS A 1 269 ? 22.515  -1.989  43.769  1.00 33.07  ? 269  LYS A N   1 
ATOM   1952  C CA  . LYS A 1 269 ? 21.483  -2.105  44.806  1.00 32.93  ? 269  LYS A CA  1 
ATOM   1953  C C   . LYS A 1 269 ? 20.854  -0.765  45.088  1.00 37.35  ? 269  LYS A C   1 
ATOM   1954  O O   . LYS A 1 269 ? 19.641  -0.691  45.297  1.00 36.99  ? 269  LYS A O   1 
ATOM   1955  C CB  . LYS A 1 269 ? 22.061  -2.648  46.111  1.00 36.43  ? 269  LYS A CB  1 
ATOM   1956  C CG  . LYS A 1 269 ? 22.522  -4.084  46.066  1.00 40.33  ? 269  LYS A CG  1 
ATOM   1957  C CD  . LYS A 1 269 ? 23.059  -4.527  47.414  1.00 40.74  ? 269  LYS A CD  1 
ATOM   1958  C CE  . LYS A 1 269 ? 24.518  -4.201  47.630  1.00 44.33  ? 269  LYS A CE  1 
ATOM   1959  N NZ  . LYS A 1 269 ? 24.702  -2.823  48.145  1.00 46.53  ? 269  LYS A NZ  1 
ATOM   1960  N N   . TYR A 1 270 ? 21.692  0.296   45.113  1.00 33.89  ? 270  TYR A N   1 
ATOM   1961  C CA  . TYR A 1 270 ? 21.285  1.680   45.338  1.00 32.89  ? 270  TYR A CA  1 
ATOM   1962  C C   . TYR A 1 270 ? 20.446  2.186   44.148  1.00 33.90  ? 270  TYR A C   1 
ATOM   1963  O O   . TYR A 1 270 ? 19.393  2.797   44.341  1.00 32.82  ? 270  TYR A O   1 
ATOM   1964  C CB  . TYR A 1 270 ? 22.531  2.565   45.550  1.00 34.82  ? 270  TYR A CB  1 
ATOM   1965  C CG  . TYR A 1 270 ? 22.197  4.017   45.792  1.00 38.10  ? 270  TYR A CG  1 
ATOM   1966  C CD1 . TYR A 1 270 ? 22.060  4.514   47.081  1.00 42.42  ? 270  TYR A CD1 1 
ATOM   1967  C CD2 . TYR A 1 270 ? 21.994  4.891   44.730  1.00 38.52  ? 270  TYR A CD2 1 
ATOM   1968  C CE1 . TYR A 1 270 ? 21.707  5.842   47.308  1.00 45.48  ? 270  TYR A CE1 1 
ATOM   1969  C CE2 . TYR A 1 270 ? 21.643  6.220   44.944  1.00 40.01  ? 270  TYR A CE2 1 
ATOM   1970  C CZ  . TYR A 1 270 ? 21.503  6.693   46.234  1.00 50.58  ? 270  TYR A CZ  1 
ATOM   1971  O OH  . TYR A 1 270 ? 21.184  8.011   46.445  1.00 55.74  ? 270  TYR A OH  1 
ATOM   1972  N N   . VAL A 1 271 ? 20.941  1.951   42.926  1.00 29.03  ? 271  VAL A N   1 
ATOM   1973  C CA  . VAL A 1 271 ? 20.308  2.381   41.677  1.00 27.20  ? 271  VAL A CA  1 
ATOM   1974  C C   . VAL A 1 271 ? 18.906  1.744   41.560  1.00 31.77  ? 271  VAL A C   1 
ATOM   1975  O O   . VAL A 1 271 ? 17.946  2.457   41.242  1.00 31.53  ? 271  VAL A O   1 
ATOM   1976  C CB  . VAL A 1 271 ? 21.210  2.080   40.457  1.00 28.89  ? 271  VAL A CB  1 
ATOM   1977  C CG1 . VAL A 1 271 ? 20.521  2.453   39.157  1.00 26.98  ? 271  VAL A CG1 1 
ATOM   1978  C CG2 . VAL A 1 271 ? 22.560  2.792   40.581  1.00 28.84  ? 271  VAL A CG2 1 
ATOM   1979  N N   . ARG A 1 272 ? 18.786  0.438   41.885  1.00 28.41  ? 272  ARG A N   1 
ATOM   1980  C CA  . ARG A 1 272 ? 17.504  -0.265  41.874  1.00 27.97  ? 272  ARG A CA  1 
ATOM   1981  C C   . ARG A 1 272 ? 16.576  0.302   42.975  1.00 31.64  ? 272  ARG A C   1 
ATOM   1982  O O   . ARG A 1 272 ? 15.389  0.522   42.724  1.00 32.03  ? 272  ARG A O   1 
ATOM   1983  C CB  . ARG A 1 272 ? 17.688  -1.791  42.049  1.00 27.45  ? 272  ARG A CB  1 
ATOM   1984  C CG  . ARG A 1 272 ? 16.346  -2.522  42.233  1.00 29.46  ? 272  ARG A CG  1 
ATOM   1985  C CD  . ARG A 1 272 ? 16.443  -4.019  42.291  1.00 30.30  ? 272  ARG A CD  1 
ATOM   1986  N NE  . ARG A 1 272 ? 17.058  -4.492  43.528  1.00 35.70  ? 272  ARG A NE  1 
ATOM   1987  C CZ  . ARG A 1 272 ? 17.102  -5.766  43.885  1.00 41.83  ? 272  ARG A CZ  1 
ATOM   1988  N NH1 . ARG A 1 272 ? 16.550  -6.696  43.119  1.00 26.32  ? 272  ARG A NH1 1 
ATOM   1989  N NH2 . ARG A 1 272 ? 17.694  -6.122  45.009  1.00 34.27  ? 272  ARG A NH2 1 
ATOM   1990  N N   . ASP A 1 273 ? 17.118  0.531   44.170  1.00 26.79  ? 273  ASP A N   1 
ATOM   1991  C CA  . ASP A 1 273 ? 16.350  1.067   45.287  1.00 27.48  ? 273  ASP A CA  1 
ATOM   1992  C C   . ASP A 1 273 ? 15.727  2.441   44.950  1.00 33.15  ? 273  ASP A C   1 
ATOM   1993  O O   . ASP A 1 273 ? 14.530  2.643   45.187  1.00 33.10  ? 273  ASP A O   1 
ATOM   1994  C CB  . ASP A 1 273 ? 17.214  1.168   46.544  1.00 29.16  ? 273  ASP A CB  1 
ATOM   1995  C CG  . ASP A 1 273 ? 16.378  1.519   47.729  1.00 34.57  ? 273  ASP A CG  1 
ATOM   1996  O OD1 . ASP A 1 273 ? 15.628  0.634   48.202  1.00 34.58  ? 273  ASP A OD1 1 
ATOM   1997  O OD2 . ASP A 1 273 ? 16.395  2.713   48.135  1.00 36.51  ? 273  ASP A OD2 1 
ATOM   1998  N N   . SER A 1 274 ? 16.542  3.366   44.395  1.00 29.21  ? 274  SER A N   1 
ATOM   1999  C CA  . SER A 1 274 ? 16.108  4.693   43.982  1.00 28.89  ? 274  SER A CA  1 
ATOM   2000  C C   . SER A 1 274 ? 15.036  4.593   42.879  1.00 31.95  ? 274  SER A C   1 
ATOM   2001  O O   . SER A 1 274 ? 14.034  5.305   42.932  1.00 31.48  ? 274  SER A O   1 
ATOM   2002  C CB  . SER A 1 274 ? 17.300  5.504   43.492  1.00 33.29  ? 274  SER A CB  1 
ATOM   2003  O OG  . SER A 1 274 ? 17.674  6.500   44.425  1.00 46.63  ? 274  SER A OG  1 
ATOM   2004  N N   . LYS A 1 275 ? 15.225  3.678   41.915  1.00 27.22  ? 275  LYS A N   1 
ATOM   2005  C CA  . LYS A 1 275 ? 14.276  3.467   40.824  1.00 25.96  ? 275  LYS A CA  1 
ATOM   2006  C C   . LYS A 1 275 ? 12.934  2.932   41.331  1.00 30.69  ? 275  LYS A C   1 
ATOM   2007  O O   . LYS A 1 275 ? 11.898  3.434   40.908  1.00 31.30  ? 275  LYS A O   1 
ATOM   2008  C CB  . LYS A 1 275 ? 14.861  2.529   39.757  1.00 26.89  ? 275  LYS A CB  1 
ATOM   2009  C CG  . LYS A 1 275 ? 15.770  3.260   38.795  1.00 28.78  ? 275  LYS A CG  1 
ATOM   2010  C CD  . LYS A 1 275 ? 16.600  2.320   37.947  1.00 32.42  ? 275  LYS A CD  1 
ATOM   2011  C CE  . LYS A 1 275 ? 17.462  3.112   37.003  1.00 23.92  ? 275  LYS A CE  1 
ATOM   2012  N NZ  . LYS A 1 275 ? 18.467  2.259   36.359  1.00 23.88  ? 275  LYS A NZ  1 
ATOM   2013  N N   . ILE A 1 276 ? 12.951  1.930   42.224  1.00 28.26  ? 276  ILE A N   1 
ATOM   2014  C CA  . ILE A 1 276 ? 11.745  1.295   42.773  1.00 28.62  ? 276  ILE A CA  1 
ATOM   2015  C C   . ILE A 1 276 ? 10.935  2.318   43.589  1.00 34.53  ? 276  ILE A C   1 
ATOM   2016  O O   . ILE A 1 276 ? 9.715   2.390   43.416  1.00 35.35  ? 276  ILE A O   1 
ATOM   2017  C CB  . ILE A 1 276 ? 12.100  0.006   43.579  1.00 31.52  ? 276  ILE A CB  1 
ATOM   2018  C CG1 . ILE A 1 276 ? 12.459  -1.131  42.588  1.00 30.98  ? 276  ILE A CG1 1 
ATOM   2019  C CG2 . ILE A 1 276 ? 10.969  -0.414  44.555  1.00 31.60  ? 276  ILE A CG2 1 
ATOM   2020  C CD1 . ILE A 1 276 ? 12.782  -2.520  43.157  1.00 32.40  ? 276  ILE A CD1 1 
ATOM   2021  N N   . ARG A 1 277 ? 11.620  3.132   44.418  1.00 30.73  ? 277  ARG A N   1 
ATOM   2022  C CA  . ARG A 1 277 ? 11.010  4.166   45.260  1.00 30.77  ? 277  ARG A CA  1 
ATOM   2023  C C   . ARG A 1 277 ? 10.403  5.313   44.424  1.00 35.05  ? 277  ARG A C   1 
ATOM   2024  O O   . ARG A 1 277 ? 9.286   5.734   44.725  1.00 35.82  ? 277  ARG A O   1 
ATOM   2025  C CB  . ARG A 1 277 ? 12.021  4.717   46.269  1.00 29.14  ? 277  ARG A CB  1 
ATOM   2026  C CG  . ARG A 1 277 ? 12.358  3.723   47.372  1.00 35.02  ? 277  ARG A CG  1 
ATOM   2027  C CD  . ARG A 1 277 ? 13.369  4.283   48.348  1.00 31.30  ? 277  ARG A CD  1 
ATOM   2028  N NE  . ARG A 1 277 ? 13.769  3.302   49.359  1.00 26.50  ? 277  ARG A NE  1 
ATOM   2029  C CZ  . ARG A 1 277 ? 13.116  3.089   50.500  1.00 43.92  ? 277  ARG A CZ  1 
ATOM   2030  N NH1 . ARG A 1 277 ? 12.008  3.764   50.774  1.00 35.47  ? 277  ARG A NH1 1 
ATOM   2031  N NH2 . ARG A 1 277 ? 13.554  2.181   51.364  1.00 27.11  ? 277  ARG A NH2 1 
ATOM   2032  N N   . TYR A 1 278 ? 11.121  5.801   43.385  1.00 30.62  ? 278  TYR A N   1 
ATOM   2033  C CA  . TYR A 1 278 ? 10.675  6.871   42.487  1.00 29.92  ? 278  TYR A CA  1 
ATOM   2034  C C   . TYR A 1 278 ? 9.576   6.388   41.525  1.00 36.01  ? 278  TYR A C   1 
ATOM   2035  O O   . TYR A 1 278 ? 8.841   7.229   41.025  1.00 38.25  ? 278  TYR A O   1 
ATOM   2036  C CB  . TYR A 1 278 ? 11.854  7.475   41.714  1.00 29.75  ? 278  TYR A CB  1 
ATOM   2037  C CG  . TYR A 1 278 ? 12.700  8.416   42.546  1.00 30.21  ? 278  TYR A CG  1 
ATOM   2038  C CD1 . TYR A 1 278 ? 12.134  9.519   43.182  1.00 32.23  ? 278  TYR A CD1 1 
ATOM   2039  C CD2 . TYR A 1 278 ? 14.078  8.244   42.644  1.00 30.90  ? 278  TYR A CD2 1 
ATOM   2040  C CE1 . TYR A 1 278 ? 12.912  10.406  43.926  1.00 31.88  ? 278  TYR A CE1 1 
ATOM   2041  C CE2 . TYR A 1 278 ? 14.863  9.106   43.408  1.00 31.86  ? 278  TYR A CE2 1 
ATOM   2042  C CZ  . TYR A 1 278 ? 14.278  10.197  44.031  1.00 38.38  ? 278  TYR A CZ  1 
ATOM   2043  O OH  . TYR A 1 278 ? 15.058  11.060  44.757  1.00 41.30  ? 278  TYR A OH  1 
ATOM   2044  N N   . ARG A 1 279 ? 9.445   5.058   41.279  1.00 31.10  ? 279  ARG A N   1 
ATOM   2045  C CA  . ARG A 1 279 ? 8.363   4.473   40.479  1.00 30.41  ? 279  ARG A CA  1 
ATOM   2046  C C   . ARG A 1 279 ? 7.080   4.487   41.321  1.00 36.58  ? 279  ARG A C   1 
ATOM   2047  O O   . ARG A 1 279 ? 6.005   4.806   40.814  1.00 36.32  ? 279  ARG A O   1 
ATOM   2048  C CB  . ARG A 1 279 ? 8.712   3.043   40.040  1.00 30.81  ? 279  ARG A CB  1 
ATOM   2049  C CG  . ARG A 1 279 ? 7.630   2.335   39.216  1.00 35.72  ? 279  ARG A CG  1 
ATOM   2050  C CD  . ARG A 1 279 ? 7.937   0.868   39.097  1.00 47.38  ? 279  ARG A CD  1 
ATOM   2051  N NE  . ARG A 1 279 ? 7.028   0.166   38.189  1.00 68.35  ? 279  ARG A NE  1 
ATOM   2052  C CZ  . ARG A 1 279 ? 5.977   -0.544  38.588  1.00 87.31  ? 279  ARG A CZ  1 
ATOM   2053  N NH1 . ARG A 1 279 ? 5.672   -0.625  39.881  1.00 72.12  ? 279  ARG A NH1 1 
ATOM   2054  N NH2 . ARG A 1 279 ? 5.212   -1.168  37.697  1.00 77.11  ? 279  ARG A NH2 1 
ATOM   2055  N N   . GLU A 1 280 ? 7.214   4.164   42.623  1.00 33.63  ? 280  GLU A N   1 
ATOM   2056  C CA  . GLU A 1 280 ? 6.135   4.137   43.605  1.00 34.36  ? 280  GLU A CA  1 
ATOM   2057  C C   . GLU A 1 280 ? 5.560   5.552   43.836  1.00 39.36  ? 280  GLU A C   1 
ATOM   2058  O O   . GLU A 1 280 ? 4.365   5.701   44.099  1.00 38.38  ? 280  GLU A O   1 
ATOM   2059  C CB  . GLU A 1 280 ? 6.652   3.527   44.928  1.00 36.17  ? 280  GLU A CB  1 
ATOM   2060  C CG  . GLU A 1 280 ? 5.569   3.167   45.932  1.00 47.46  ? 280  GLU A CG  1 
ATOM   2061  C CD  . GLU A 1 280 ? 4.500   2.169   45.524  1.00 74.75  ? 280  GLU A CD  1 
ATOM   2062  O OE1 . GLU A 1 280 ? 4.769   1.305   44.655  1.00 58.00  ? 280  GLU A OE1 1 
ATOM   2063  O OE2 . GLU A 1 280 ? 3.405   2.217   46.131  1.00 81.02  ? 280  GLU A OE2 1 
ATOM   2064  N N   . ASN A 1 281 ? 6.415   6.581   43.721  1.00 37.46  ? 281  ASN A N   1 
ATOM   2065  C CA  . ASN A 1 281 ? 6.042   7.985   43.900  1.00 37.77  ? 281  ASN A CA  1 
ATOM   2066  C C   . ASN A 1 281 ? 6.730   8.820   42.810  1.00 39.50  ? 281  ASN A C   1 
ATOM   2067  O O   . ASN A 1 281 ? 7.828   9.345   43.004  1.00 38.68  ? 281  ASN A O   1 
ATOM   2068  C CB  . ASN A 1 281 ? 6.395   8.468   45.329  1.00 40.34  ? 281  ASN A CB  1 
ATOM   2069  C CG  . ASN A 1 281 ? 5.834   9.833   45.713  1.00 71.92  ? 281  ASN A CG  1 
ATOM   2070  O OD1 . ASN A 1 281 ? 5.061   10.475  44.982  1.00 58.95  ? 281  ASN A OD1 1 
ATOM   2071  N ND2 . ASN A 1 281 ? 6.204   10.307  46.895  1.00 68.62  ? 281  ASN A ND2 1 
ATOM   2072  N N   . ILE A 1 282 ? 6.071   8.900   41.642  1.00 35.73  ? 282  ILE A N   1 
ATOM   2073  C CA  . ILE A 1 282 ? 6.542   9.618   40.457  1.00 35.37  ? 282  ILE A CA  1 
ATOM   2074  C C   . ILE A 1 282 ? 6.551   11.152  40.719  1.00 39.29  ? 282  ILE A C   1 
ATOM   2075  O O   . ILE A 1 282 ? 7.442   11.838  40.220  1.00 39.03  ? 282  ILE A O   1 
ATOM   2076  C CB  . ILE A 1 282 ? 5.712   9.178   39.212  1.00 38.87  ? 282  ILE A CB  1 
ATOM   2077  C CG1 . ILE A 1 282 ? 6.102   7.715   38.819  1.00 38.29  ? 282  ILE A CG1 1 
ATOM   2078  C CG2 . ILE A 1 282 ? 5.904   10.125  38.016  1.00 39.87  ? 282  ILE A CG2 1 
ATOM   2079  C CD1 . ILE A 1 282 ? 5.117   6.929   37.936  1.00 42.32  ? 282  ILE A CD1 1 
ATOM   2080  N N   . ALA A 1 283 ? 5.632   11.660  41.555  1.00 36.84  ? 283  ALA A N   1 
ATOM   2081  C CA  . ALA A 1 283 ? 5.572   13.079  41.940  1.00 37.90  ? 283  ALA A CA  1 
ATOM   2082  C C   . ALA A 1 283 ? 6.859   13.508  42.684  1.00 41.62  ? 283  ALA A C   1 
ATOM   2083  O O   . ALA A 1 283 ? 7.340   14.620  42.465  1.00 41.87  ? 283  ALA A O   1 
ATOM   2084  C CB  . ALA A 1 283 ? 4.349   13.341  42.808  1.00 39.62  ? 283  ALA A CB  1 
ATOM   2085  N N   . SER A 1 284 ? 7.433   12.610  43.519  1.00 36.73  ? 284  SER A N   1 
ATOM   2086  C CA  . SER A 1 284 ? 8.684   12.881  44.231  1.00 36.68  ? 284  SER A CA  1 
ATOM   2087  C C   . SER A 1 284 ? 9.871   12.856  43.243  1.00 39.37  ? 284  SER A C   1 
ATOM   2088  O O   . SER A 1 284 ? 10.836  13.597  43.435  1.00 40.78  ? 284  SER A O   1 
ATOM   2089  C CB  . SER A 1 284 ? 8.892   11.908  45.390  1.00 40.88  ? 284  SER A CB  1 
ATOM   2090  O OG  . SER A 1 284 ? 9.140   10.580  44.962  1.00 54.20  ? 284  SER A OG  1 
ATOM   2091  N N   . LEU A 1 285 ? 9.774   12.045  42.169  1.00 32.82  ? 285  LEU A N   1 
ATOM   2092  C CA  . LEU A 1 285 ? 10.786  11.996  41.117  1.00 30.76  ? 285  LEU A CA  1 
ATOM   2093  C C   . LEU A 1 285 ? 10.780  13.319  40.351  1.00 34.14  ? 285  LEU A C   1 
ATOM   2094  O O   . LEU A 1 285 ? 11.847  13.865  40.080  1.00 32.86  ? 285  LEU A O   1 
ATOM   2095  C CB  . LEU A 1 285 ? 10.559  10.795  40.171  1.00 29.39  ? 285  LEU A CB  1 
ATOM   2096  C CG  . LEU A 1 285 ? 11.500  10.658  38.956  1.00 32.20  ? 285  LEU A CG  1 
ATOM   2097  C CD1 . LEU A 1 285 ? 12.926  10.332  39.370  1.00 31.45  ? 285  LEU A CD1 1 
ATOM   2098  C CD2 . LEU A 1 285 ? 11.002  9.611   37.998  1.00 31.98  ? 285  LEU A CD2 1 
ATOM   2099  N N   . MET A 1 286 ? 9.574   13.857  40.056  1.00 31.58  ? 286  MET A N   1 
ATOM   2100  C CA  . MET A 1 286 ? 9.402   15.133  39.355  1.00 31.60  ? 286  MET A CA  1 
ATOM   2101  C C   . MET A 1 286 ? 9.929   16.279  40.212  1.00 39.46  ? 286  MET A C   1 
ATOM   2102  O O   . MET A 1 286 ? 10.616  17.153  39.687  1.00 40.86  ? 286  MET A O   1 
ATOM   2103  C CB  . MET A 1 286 ? 7.931   15.368  38.948  1.00 33.36  ? 286  MET A CB  1 
ATOM   2104  C CG  . MET A 1 286 ? 7.393   14.346  37.942  1.00 35.38  ? 286  MET A CG  1 
ATOM   2105  S SD  . MET A 1 286 ? 8.351   14.203  36.394  1.00 38.03  ? 286  MET A SD  1 
ATOM   2106  C CE  . MET A 1 286 ? 9.002   12.593  36.566  1.00 33.84  ? 286  MET A CE  1 
ATOM   2107  N N   . ASP A 1 287 ? 9.668   16.238  41.533  1.00 37.75  ? 287  ASP A N   1 
ATOM   2108  C CA  . ASP A 1 287 ? 10.133  17.244  42.491  1.00 39.47  ? 287  ASP A CA  1 
ATOM   2109  C C   . ASP A 1 287 ? 11.655  17.228  42.636  1.00 42.59  ? 287  ASP A C   1 
ATOM   2110  O O   . ASP A 1 287 ? 12.259  18.286  42.796  1.00 43.62  ? 287  ASP A O   1 
ATOM   2111  C CB  . ASP A 1 287 ? 9.477   17.041  43.871  1.00 43.01  ? 287  ASP A CB  1 
ATOM   2112  C CG  . ASP A 1 287 ? 7.974   17.279  43.930  1.00 62.45  ? 287  ASP A CG  1 
ATOM   2113  O OD1 . ASP A 1 287 ? 7.455   18.055  43.085  1.00 65.10  ? 287  ASP A OD1 1 
ATOM   2114  O OD2 . ASP A 1 287 ? 7.315   16.705  44.834  1.00 70.65  ? 287  ASP A OD2 1 
ATOM   2115  N N   . LYS A 1 288 ? 12.270  16.038  42.573  1.00 37.66  ? 288  LYS A N   1 
ATOM   2116  C CA  . LYS A 1 288 ? 13.716  15.862  42.690  1.00 36.80  ? 288  LYS A CA  1 
ATOM   2117  C C   . LYS A 1 288 ? 14.457  16.355  41.428  1.00 40.91  ? 288  LYS A C   1 
ATOM   2118  O O   . LYS A 1 288 ? 15.486  17.028  41.549  1.00 40.59  ? 288  LYS A O   1 
ATOM   2119  C CB  . LYS A 1 288 ? 14.045  14.376  42.971  1.00 37.15  ? 288  LYS A CB  1 
ATOM   2120  C CG  . LYS A 1 288 ? 15.532  13.985  42.920  1.00 42.34  ? 288  LYS A CG  1 
ATOM   2121  C CD  . LYS A 1 288 ? 16.330  14.398  44.151  1.00 51.12  ? 288  LYS A CD  1 
ATOM   2122  C CE  . LYS A 1 288 ? 17.784  14.020  43.994  1.00 65.88  ? 288  LYS A CE  1 
ATOM   2123  N NZ  . LYS A 1 288 ? 18.567  14.312  45.223  1.00 84.23  ? 288  LYS A NZ  1 
ATOM   2124  N N   . CYS A 1 289 ? 13.941  16.014  40.235  1.00 37.24  ? 289  CYS A N   1 
ATOM   2125  C CA  . CYS A 1 289 ? 14.581  16.307  38.955  1.00 37.85  ? 289  CYS A CA  1 
ATOM   2126  C C   . CYS A 1 289 ? 14.283  17.698  38.410  1.00 42.38  ? 289  CYS A C   1 
ATOM   2127  O O   . CYS A 1 289 ? 15.121  18.254  37.701  1.00 42.15  ? 289  CYS A O   1 
ATOM   2128  C CB  . CYS A 1 289 ? 14.199  15.241  37.936  1.00 37.42  ? 289  CYS A CB  1 
ATOM   2129  S SG  . CYS A 1 289 ? 14.657  13.565  38.438  1.00 40.61  ? 289  CYS A SG  1 
ATOM   2130  N N   . PHE A 1 290 ? 13.098  18.235  38.681  1.00 39.76  ? 290  PHE A N   1 
ATOM   2131  C CA  . PHE A 1 290 ? 12.704  19.521  38.122  1.00 40.76  ? 290  PHE A CA  1 
ATOM   2132  C C   . PHE A 1 290 ? 12.478  20.573  39.208  1.00 51.62  ? 290  PHE A C   1 
ATOM   2133  O O   . PHE A 1 290 ? 12.050  20.214  40.305  1.00 51.27  ? 290  PHE A O   1 
ATOM   2134  C CB  . PHE A 1 290 ? 11.443  19.347  37.261  1.00 40.94  ? 290  PHE A CB  1 
ATOM   2135  C CG  . PHE A 1 290 ? 11.636  18.405  36.096  1.00 40.35  ? 290  PHE A CG  1 
ATOM   2136  C CD1 . PHE A 1 290 ? 12.184  18.853  34.900  1.00 42.74  ? 290  PHE A CD1 1 
ATOM   2137  C CD2 . PHE A 1 290 ? 11.284  17.064  36.199  1.00 40.80  ? 290  PHE A CD2 1 
ATOM   2138  C CE1 . PHE A 1 290 ? 12.374  17.979  33.831  1.00 42.40  ? 290  PHE A CE1 1 
ATOM   2139  C CE2 . PHE A 1 290 ? 11.496  16.184  35.134  1.00 42.22  ? 290  PHE A CE2 1 
ATOM   2140  C CZ  . PHE A 1 290 ? 12.036  16.648  33.958  1.00 40.58  ? 290  PHE A CZ  1 
ATOM   2141  N N   . PRO A 1 291 ? 12.754  21.882  38.936  1.00 54.38  ? 291  PRO A N   1 
ATOM   2142  C CA  . PRO A 1 291 ? 12.482  22.916  39.959  1.00 56.94  ? 291  PRO A CA  1 
ATOM   2143  C C   . PRO A 1 291 ? 10.992  22.963  40.267  1.00 64.76  ? 291  PRO A C   1 
ATOM   2144  O O   . PRO A 1 291 ? 10.178  22.674  39.372  1.00 64.36  ? 291  PRO A O   1 
ATOM   2145  C CB  . PRO A 1 291 ? 12.972  24.221  39.312  1.00 59.44  ? 291  PRO A CB  1 
ATOM   2146  C CG  . PRO A 1 291 ? 13.777  23.808  38.127  1.00 62.76  ? 291  PRO A CG  1 
ATOM   2147  C CD  . PRO A 1 291 ? 13.242  22.491  37.679  1.00 56.54  ? 291  PRO A CD  1 
ATOM   2148  N N   . ALA A 1 292 ? 10.638  23.257  41.534  1.00 64.11  ? 292  ALA A N   1 
ATOM   2149  C CA  . ALA A 1 292 ? 9.254   23.251  42.013  1.00 65.71  ? 292  ALA A CA  1 
ATOM   2150  C C   . ALA A 1 292 ? 8.298   23.943  41.037  1.00 73.33  ? 292  ALA A C   1 
ATOM   2151  O O   . ALA A 1 292 ? 8.608   25.034  40.539  1.00 74.74  ? 292  ALA A O   1 
ATOM   2152  C CB  . ALA A 1 292 ? 9.174   23.891  43.379  1.00 67.72  ? 292  ALA A CB  1 
ATOM   2153  N N   . ALA A 1 293 ? 7.192   23.228  40.690  1.00 70.31  ? 293  ALA A N   1 
ATOM   2154  C CA  . ALA A 1 293 ? 6.099   23.614  39.777  1.00 70.72  ? 293  ALA A CA  1 
ATOM   2155  C C   . ALA A 1 293 ? 6.558   23.845  38.306  1.00 73.72  ? 293  ALA A C   1 
ATOM   2156  O O   . ALA A 1 293 ? 5.747   24.307  37.490  1.00 75.42  ? 293  ALA A O   1 
ATOM   2157  C CB  . ALA A 1 293 ? 5.375   24.851  40.309  1.00 73.14  ? 293  ALA A CB  1 
ATOM   2158  N N   . ASN A 1 294 ? 7.817   23.486  37.957  1.00 67.12  ? 294  ASN A N   1 
ATOM   2159  C CA  . ASN A 1 294 ? 8.332   23.675  36.592  1.00 66.04  ? 294  ASN A CA  1 
ATOM   2160  C C   . ASN A 1 294 ? 8.516   22.330  35.830  1.00 65.19  ? 294  ASN A C   1 
ATOM   2161  O O   . ASN A 1 294 ? 9.078   22.319  34.725  1.00 66.59  ? 294  ASN A O   1 
ATOM   2162  C CB  . ASN A 1 294 ? 9.644   24.474  36.615  1.00 68.85  ? 294  ASN A CB  1 
ATOM   2163  N N   . ALA A 1 295 ? 8.005   21.219  36.396  1.00 55.69  ? 295  ALA A N   1 
ATOM   2164  C CA  . ALA A 1 295 ? 8.074   19.876  35.813  1.00 51.92  ? 295  ALA A CA  1 
ATOM   2165  C C   . ALA A 1 295 ? 7.153   19.711  34.576  1.00 52.90  ? 295  ALA A C   1 
ATOM   2166  O O   . ALA A 1 295 ? 5.991   20.119  34.651  1.00 52.72  ? 295  ALA A O   1 
ATOM   2167  C CB  . ALA A 1 295 ? 7.698   18.855  36.870  1.00 51.67  ? 295  ALA A CB  1 
ATOM   2168  N N   . PRO A 1 296 ? 7.630   19.102  33.444  1.00 46.98  ? 296  PRO A N   1 
ATOM   2169  C CA  . PRO A 1 296 ? 6.741   18.902  32.284  1.00 46.04  ? 296  PRO A CA  1 
ATOM   2170  C C   . PRO A 1 296 ? 5.773   17.753  32.552  1.00 48.28  ? 296  PRO A C   1 
ATOM   2171  O O   . PRO A 1 296 ? 6.193   16.632  32.855  1.00 47.10  ? 296  PRO A O   1 
ATOM   2172  C CB  . PRO A 1 296 ? 7.707   18.597  31.127  1.00 46.95  ? 296  PRO A CB  1 
ATOM   2173  C CG  . PRO A 1 296 ? 9.094   18.698  31.695  1.00 51.00  ? 296  PRO A CG  1 
ATOM   2174  C CD  . PRO A 1 296 ? 8.968   18.549  33.171  1.00 47.00  ? 296  PRO A CD  1 
ATOM   2175  N N   . GLY A 1 297 ? 4.484   18.078  32.510  1.00 44.98  ? 297  GLY A N   1 
ATOM   2176  C CA  . GLY A 1 297 ? 3.383   17.161  32.788  1.00 44.52  ? 297  GLY A CA  1 
ATOM   2177  C C   . GLY A 1 297 ? 3.356   15.873  31.989  1.00 46.91  ? 297  GLY A C   1 
ATOM   2178  O O   . GLY A 1 297 ? 2.958   14.831  32.519  1.00 47.22  ? 297  GLY A O   1 
ATOM   2179  N N   . GLU A 1 298 ? 3.793   15.927  30.717  1.00 41.06  ? 298  GLU A N   1 
ATOM   2180  C CA  . GLU A 1 298 ? 3.821   14.759  29.840  1.00 39.24  ? 298  GLU A CA  1 
ATOM   2181  C C   . GLU A 1 298 ? 4.832   13.706  30.327  1.00 41.21  ? 298  GLU A C   1 
ATOM   2182  O O   . GLU A 1 298 ? 4.587   12.517  30.134  1.00 40.23  ? 298  GLU A O   1 
ATOM   2183  C CB  . GLU A 1 298 ? 4.096   15.152  28.375  1.00 40.41  ? 298  GLU A CB  1 
ATOM   2184  C CG  . GLU A 1 298 ? 5.483   15.701  28.073  1.00 42.72  ? 298  GLU A CG  1 
ATOM   2185  C CD  . GLU A 1 298 ? 5.731   17.172  28.342  1.00 54.29  ? 298  GLU A CD  1 
ATOM   2186  O OE1 . GLU A 1 298 ? 4.861   17.845  28.943  1.00 50.52  ? 298  GLU A OE1 1 
ATOM   2187  O OE2 . GLU A 1 298 ? 6.817   17.652  27.946  1.00 40.87  ? 298  GLU A OE2 1 
ATOM   2188  N N   . ILE A 1 299 ? 5.933   14.134  30.986  1.00 36.72  ? 299  ILE A N   1 
ATOM   2189  C CA  . ILE A 1 299 ? 6.953   13.221  31.500  1.00 35.76  ? 299  ILE A CA  1 
ATOM   2190  C C   . ILE A 1 299 ? 6.342   12.369  32.625  1.00 38.74  ? 299  ILE A C   1 
ATOM   2191  O O   . ILE A 1 299 ? 6.476   11.147  32.603  1.00 37.99  ? 299  ILE A O   1 
ATOM   2192  C CB  . ILE A 1 299 ? 8.246   13.985  31.939  1.00 39.36  ? 299  ILE A CB  1 
ATOM   2193  C CG1 . ILE A 1 299 ? 8.908   14.752  30.761  1.00 39.65  ? 299  ILE A CG1 1 
ATOM   2194  C CG2 . ILE A 1 299 ? 9.254   13.066  32.647  1.00 40.02  ? 299  ILE A CG2 1 
ATOM   2195  C CD1 . ILE A 1 299 ? 9.296   13.923  29.493  1.00 45.69  ? 299  ILE A CD1 1 
ATOM   2196  N N   . ALA A 1 300 ? 5.624   13.010  33.559  1.00 35.50  ? 300  ALA A N   1 
ATOM   2197  C CA  . ALA A 1 300 ? 4.946   12.338  34.668  1.00 34.93  ? 300  ALA A CA  1 
ATOM   2198  C C   . ALA A 1 300 ? 3.855   11.389  34.146  1.00 38.22  ? 300  ALA A C   1 
ATOM   2199  O O   . ALA A 1 300 ? 3.792   10.239  34.571  1.00 36.57  ? 300  ALA A O   1 
ATOM   2200  C CB  . ALA A 1 300 ? 4.351   13.367  35.618  1.00 36.40  ? 300  ALA A CB  1 
ATOM   2201  N N   . LYS A 1 301 ? 3.044   11.856  33.181  1.00 35.81  ? 301  LYS A N   1 
ATOM   2202  C CA  . LYS A 1 301 ? 1.975   11.074  32.556  1.00 35.70  ? 301  LYS A CA  1 
ATOM   2203  C C   . LYS A 1 301 ? 2.555   9.844   31.835  1.00 37.90  ? 301  LYS A C   1 
ATOM   2204  O O   . LYS A 1 301 ? 2.003   8.746   31.956  1.00 38.16  ? 301  LYS A O   1 
ATOM   2205  C CB  . LYS A 1 301 ? 1.162   11.942  31.587  1.00 38.85  ? 301  LYS A CB  1 
ATOM   2206  C CG  . LYS A 1 301 ? 0.198   12.884  32.267  1.00 52.08  ? 301  LYS A CG  1 
ATOM   2207  C CD  . LYS A 1 301 ? -0.532  13.718  31.235  1.00 66.32  ? 301  LYS A CD  1 
ATOM   2208  C CE  . LYS A 1 301 ? -1.588  14.607  31.840  1.00 79.21  ? 301  LYS A CE  1 
ATOM   2209  N N   . TYR A 1 302 ? 3.689   10.025  31.126  1.00 32.12  ? 302  TYR A N   1 
ATOM   2210  C CA  . TYR A 1 302 ? 4.401   8.946   30.443  1.00 30.52  ? 302  TYR A CA  1 
ATOM   2211  C C   . TYR A 1 302 ? 4.871   7.882   31.461  1.00 36.71  ? 302  TYR A C   1 
ATOM   2212  O O   . TYR A 1 302 ? 4.660   6.688   31.229  1.00 35.64  ? 302  TYR A O   1 
ATOM   2213  C CB  . TYR A 1 302 ? 5.605   9.513   29.653  1.00 29.97  ? 302  TYR A CB  1 
ATOM   2214  C CG  . TYR A 1 302 ? 6.468   8.453   29.009  1.00 28.07  ? 302  TYR A CG  1 
ATOM   2215  C CD1 . TYR A 1 302 ? 7.476   7.816   29.725  1.00 27.99  ? 302  TYR A CD1 1 
ATOM   2216  C CD2 . TYR A 1 302 ? 6.259   8.064   27.692  1.00 29.13  ? 302  TYR A CD2 1 
ATOM   2217  C CE1 . TYR A 1 302 ? 8.252   6.814   29.148  1.00 27.27  ? 302  TYR A CE1 1 
ATOM   2218  C CE2 . TYR A 1 302 ? 7.038   7.072   27.097  1.00 29.35  ? 302  TYR A CE2 1 
ATOM   2219  C CZ  . TYR A 1 302 ? 8.030   6.444   27.832  1.00 33.64  ? 302  TYR A CZ  1 
ATOM   2220  O OH  . TYR A 1 302 ? 8.803   5.472   27.250  1.00 29.73  ? 302  TYR A OH  1 
ATOM   2221  N N   . MET A 1 303 ? 5.524   8.323   32.569  1.00 35.61  ? 303  MET A N   1 
ATOM   2222  C CA  . MET A 1 303 ? 6.044   7.436   33.616  1.00 36.46  ? 303  MET A CA  1 
ATOM   2223  C C   . MET A 1 303 ? 4.905   6.657   34.283  1.00 37.74  ? 303  MET A C   1 
ATOM   2224  O O   . MET A 1 303 ? 5.059   5.462   34.530  1.00 36.79  ? 303  MET A O   1 
ATOM   2225  C CB  . MET A 1 303 ? 6.864   8.215   34.677  1.00 40.74  ? 303  MET A CB  1 
ATOM   2226  C CG  . MET A 1 303 ? 8.133   8.886   34.157  1.00 46.56  ? 303  MET A CG  1 
ATOM   2227  S SD  . MET A 1 303 ? 9.319   7.752   33.416  1.00 53.03  ? 303  MET A SD  1 
ATOM   2228  C CE  . MET A 1 303 ? 10.410  7.523   34.798  1.00 50.38  ? 303  MET A CE  1 
ATOM   2229  N N   . GLU A 1 304 ? 3.760   7.324   34.537  1.00 34.09  ? 304  GLU A N   1 
ATOM   2230  C CA  . GLU A 1 304 ? 2.563   6.726   35.151  1.00 33.81  ? 304  GLU A CA  1 
ATOM   2231  C C   . GLU A 1 304 ? 1.934   5.662   34.249  1.00 35.68  ? 304  GLU A C   1 
ATOM   2232  O O   . GLU A 1 304 ? 1.420   4.667   34.756  1.00 34.94  ? 304  GLU A O   1 
ATOM   2233  C CB  . GLU A 1 304 ? 1.505   7.795   35.492  1.00 36.18  ? 304  GLU A CB  1 
ATOM   2234  C CG  . GLU A 1 304 ? 1.860   8.716   36.650  1.00 46.79  ? 304  GLU A CG  1 
ATOM   2235  C CD  . GLU A 1 304 ? 1.688   8.203   38.064  1.00 73.55  ? 304  GLU A CD  1 
ATOM   2236  O OE1 . GLU A 1 304 ? 1.416   6.994   38.239  1.00 68.62  ? 304  GLU A OE1 1 
ATOM   2237  O OE2 . GLU A 1 304 ? 1.841   9.016   39.005  1.00 74.03  ? 304  GLU A OE2 1 
ATOM   2238  N N   . THR A 1 305 ? 1.976   5.868   32.922  1.00 31.32  ? 305  THR A N   1 
ATOM   2239  C CA  . THR A 1 305 ? 1.400   4.936   31.952  1.00 31.03  ? 305  THR A CA  1 
ATOM   2240  C C   . THR A 1 305 ? 2.273   3.671   31.848  1.00 35.33  ? 305  THR A C   1 
ATOM   2241  O O   . THR A 1 305 ? 1.729   2.563   31.824  1.00 36.29  ? 305  THR A O   1 
ATOM   2242  C CB  . THR A 1 305 ? 1.201   5.636   30.592  1.00 34.44  ? 305  THR A CB  1 
ATOM   2243  O OG1 . THR A 1 305 ? 0.438   6.832   30.797  1.00 34.77  ? 305  THR A OG1 1 
ATOM   2244  C CG2 . THR A 1 305 ? 0.489   4.747   29.574  1.00 25.95  ? 305  THR A CG2 1 
ATOM   2245  N N   . VAL A 1 306 ? 3.609   3.839   31.802  1.00 30.62  ? 306  VAL A N   1 
ATOM   2246  C CA  . VAL A 1 306 ? 4.576   2.739   31.717  1.00 29.58  ? 306  VAL A CA  1 
ATOM   2247  C C   . VAL A 1 306 ? 4.513   1.911   33.023  1.00 34.51  ? 306  VAL A C   1 
ATOM   2248  O O   . VAL A 1 306 ? 4.620   0.681   32.970  1.00 34.22  ? 306  VAL A O   1 
ATOM   2249  C CB  . VAL A 1 306 ? 6.011   3.260   31.393  1.00 31.32  ? 306  VAL A CB  1 
ATOM   2250  C CG1 . VAL A 1 306 ? 7.058   2.151   31.493  1.00 29.80  ? 306  VAL A CG1 1 
ATOM   2251  C CG2 . VAL A 1 306 ? 6.056   3.903   30.006  1.00 30.48  ? 306  VAL A CG2 1 
ATOM   2252  N N   . LYS A 1 307 ? 4.283   2.588   34.176  1.00 31.56  ? 307  LYS A N   1 
ATOM   2253  C CA  . LYS A 1 307 ? 4.154   1.982   35.506  1.00 31.18  ? 307  LYS A CA  1 
ATOM   2254  C C   . LYS A 1 307 ? 2.993   0.966   35.527  1.00 36.28  ? 307  LYS A C   1 
ATOM   2255  O O   . LYS A 1 307 ? 3.095   -0.067  36.184  1.00 35.86  ? 307  LYS A O   1 
ATOM   2256  C CB  . LYS A 1 307 ? 3.937   3.086   36.561  1.00 33.32  ? 307  LYS A CB  1 
ATOM   2257  C CG  . LYS A 1 307 ? 3.935   2.602   37.996  1.00 37.32  ? 307  LYS A CG  1 
ATOM   2258  C CD  . LYS A 1 307 ? 3.471   3.677   38.931  1.00 38.11  ? 307  LYS A CD  1 
ATOM   2259  C CE  . LYS A 1 307 ? 3.260   3.146   40.325  1.00 39.69  ? 307  LYS A CE  1 
ATOM   2260  N NZ  . LYS A 1 307 ? 3.021   4.255   41.278  1.00 45.70  ? 307  LYS A NZ  1 
ATOM   2261  N N   . LEU A 1 308 ? 1.918   1.251   34.770  1.00 34.17  ? 308  LEU A N   1 
ATOM   2262  C CA  . LEU A 1 308 ? 0.716   0.411   34.690  1.00 34.76  ? 308  LEU A CA  1 
ATOM   2263  C C   . LEU A 1 308 ? 0.901   -0.856  33.842  1.00 36.81  ? 308  LEU A C   1 
ATOM   2264  O O   . LEU A 1 308 ? 0.043   -1.744  33.878  1.00 37.46  ? 308  LEU A O   1 
ATOM   2265  C CB  . LEU A 1 308 ? -0.460  1.222   34.134  1.00 35.78  ? 308  LEU A CB  1 
ATOM   2266  C CG  . LEU A 1 308 ? -1.117  2.193   35.106  1.00 41.80  ? 308  LEU A CG  1 
ATOM   2267  C CD1 . LEU A 1 308 ? -2.024  3.142   34.367  1.00 42.63  ? 308  LEU A CD1 1 
ATOM   2268  C CD2 . LEU A 1 308 ? -1.853  1.469   36.215  1.00 45.76  ? 308  LEU A CD2 1 
ATOM   2269  N N   . LEU A 1 309 ? 2.004   -0.949  33.093  1.00 30.94  ? 309  LEU A N   1 
ATOM   2270  C CA  . LEU A 1 309 ? 2.271   -2.098  32.245  1.00 29.24  ? 309  LEU A CA  1 
ATOM   2271  C C   . LEU A 1 309 ? 2.722   -3.314  33.027  1.00 32.81  ? 309  LEU A C   1 
ATOM   2272  O O   . LEU A 1 309 ? 3.582   -3.217  33.909  1.00 32.01  ? 309  LEU A O   1 
ATOM   2273  C CB  . LEU A 1 309 ? 3.341   -1.773  31.186  1.00 28.05  ? 309  LEU A CB  1 
ATOM   2274  C CG  . LEU A 1 309 ? 2.944   -0.855  30.033  1.00 31.45  ? 309  LEU A CG  1 
ATOM   2275  C CD1 . LEU A 1 309 ? 4.175   -0.430  29.245  1.00 29.35  ? 309  LEU A CD1 1 
ATOM   2276  C CD2 . LEU A 1 309 ? 1.926   -1.528  29.119  1.00 33.99  ? 309  LEU A CD2 1 
ATOM   2277  N N   . ASP A 1 310 ? 2.160   -4.475  32.667  1.00 30.34  ? 310  ASP A N   1 
ATOM   2278  C CA  . ASP A 1 310 ? 2.557   -5.773  33.207  1.00 30.79  ? 310  ASP A CA  1 
ATOM   2279  C C   . ASP A 1 310 ? 3.748   -6.260  32.386  1.00 35.62  ? 310  ASP A C   1 
ATOM   2280  O O   . ASP A 1 310 ? 3.991   -5.739  31.289  1.00 33.28  ? 310  ASP A O   1 
ATOM   2281  C CB  . ASP A 1 310 ? 1.395   -6.779  33.171  1.00 33.63  ? 310  ASP A CB  1 
ATOM   2282  C CG  . ASP A 1 310 ? 0.445   -6.733  34.365  1.00 47.46  ? 310  ASP A CG  1 
ATOM   2283  O OD1 . ASP A 1 310 ? 0.774   -6.050  35.370  1.00 47.23  ? 310  ASP A OD1 1 
ATOM   2284  O OD2 . ASP A 1 310 ? -0.610  -7.407  34.310  1.00 55.03  ? 310  ASP A OD2 1 
ATOM   2285  N N   . TYR A 1 311 ? 4.502   -7.238  32.915  1.00 33.10  ? 311  TYR A N   1 
ATOM   2286  C CA  . TYR A 1 311 ? 5.716   -7.764  32.286  1.00 31.02  ? 311  TYR A CA  1 
ATOM   2287  C C   . TYR A 1 311 ? 5.487   -8.261  30.849  1.00 34.98  ? 311  TYR A C   1 
ATOM   2288  O O   . TYR A 1 311 ? 6.311   -7.957  29.986  1.00 35.86  ? 311  TYR A O   1 
ATOM   2289  C CB  . TYR A 1 311 ? 6.329   -8.890  33.148  1.00 31.73  ? 311  TYR A CB  1 
ATOM   2290  C CG  . TYR A 1 311 ? 7.600   -9.477  32.564  1.00 31.58  ? 311  TYR A CG  1 
ATOM   2291  C CD1 . TYR A 1 311 ? 8.794   -8.762  32.581  1.00 31.62  ? 311  TYR A CD1 1 
ATOM   2292  C CD2 . TYR A 1 311 ? 7.612   -10.753 32.004  1.00 32.37  ? 311  TYR A CD2 1 
ATOM   2293  C CE1 . TYR A 1 311 ? 9.963   -9.290  32.039  1.00 30.14  ? 311  TYR A CE1 1 
ATOM   2294  C CE2 . TYR A 1 311 ? 8.777   -11.288 31.450  1.00 32.27  ? 311  TYR A CE2 1 
ATOM   2295  C CZ  . TYR A 1 311 ? 9.953   -10.555 31.484  1.00 34.92  ? 311  TYR A CZ  1 
ATOM   2296  O OH  . TYR A 1 311 ? 11.114  -11.070 30.970  1.00 33.97  ? 311  TYR A OH  1 
ATOM   2297  N N   . THR A 1 312 ? 4.385   -8.996  30.591  1.00 30.29  ? 312  THR A N   1 
ATOM   2298  C CA  . THR A 1 312 ? 4.086   -9.578  29.270  1.00 29.07  ? 312  THR A CA  1 
ATOM   2299  C C   . THR A 1 312 ? 3.091   -8.726  28.446  1.00 31.76  ? 312  THR A C   1 
ATOM   2300  O O   . THR A 1 312 ? 2.793   -9.071  27.295  1.00 30.16  ? 312  THR A O   1 
ATOM   2301  C CB  . THR A 1 312 ? 3.534   -11.022 29.422  1.00 32.59  ? 312  THR A CB  1 
ATOM   2302  O OG1 . THR A 1 312 ? 2.283   -10.971 30.107  1.00 35.14  ? 312  THR A OG1 1 
ATOM   2303  C CG2 . THR A 1 312 ? 4.510   -11.981 30.132  1.00 26.69  ? 312  THR A CG2 1 
ATOM   2304  N N   . GLU A 1 313 ? 2.593   -7.616  29.028  1.00 29.31  ? 313  GLU A N   1 
ATOM   2305  C CA  . GLU A 1 313 ? 1.605   -6.726  28.409  1.00 29.17  ? 313  GLU A CA  1 
ATOM   2306  C C   . GLU A 1 313 ? 2.131   -5.971  27.184  1.00 32.73  ? 313  GLU A C   1 
ATOM   2307  O O   . GLU A 1 313 ? 3.230   -5.405  27.198  1.00 31.54  ? 313  GLU A O   1 
ATOM   2308  C CB  . GLU A 1 313 ? 1.102   -5.706  29.436  1.00 30.79  ? 313  GLU A CB  1 
ATOM   2309  C CG  . GLU A 1 313 ? -0.155  -4.954  29.028  1.00 39.15  ? 313  GLU A CG  1 
ATOM   2310  C CD  . GLU A 1 313 ? -0.694  -3.972  30.051  1.00 53.71  ? 313  GLU A CD  1 
ATOM   2311  O OE1 . GLU A 1 313 ? -0.300  -4.064  31.234  1.00 41.25  ? 313  GLU A OE1 1 
ATOM   2312  O OE2 . GLU A 1 313 ? -1.549  -3.139  29.679  1.00 47.52  ? 313  GLU A OE2 1 
ATOM   2313  N N   . LYS A 1 314 ? 1.295   -5.919  26.145  1.00 29.87  ? 314  LYS A N   1 
ATOM   2314  C CA  . LYS A 1 314 ? 1.570   -5.150  24.947  1.00 29.29  ? 314  LYS A CA  1 
ATOM   2315  C C   . LYS A 1 314 ? 1.263   -3.675  25.232  1.00 35.17  ? 314  LYS A C   1 
ATOM   2316  O O   . LYS A 1 314 ? 0.124   -3.342  25.581  1.00 37.47  ? 314  LYS A O   1 
ATOM   2317  C CB  . LYS A 1 314 ? 0.750   -5.665  23.755  1.00 31.34  ? 314  LYS A CB  1 
ATOM   2318  C CG  . LYS A 1 314 ? 0.961   -4.853  22.483  1.00 38.69  ? 314  LYS A CG  1 
ATOM   2319  C CD  . LYS A 1 314 ? 0.108   -5.378  21.355  1.00 43.34  ? 314  LYS A CD  1 
ATOM   2320  C CE  . LYS A 1 314 ? 0.288   -4.581  20.096  1.00 51.92  ? 314  LYS A CE  1 
ATOM   2321  N NZ  . LYS A 1 314 ? -0.407  -5.216  18.942  1.00 66.60  ? 314  LYS A NZ  1 
ATOM   2322  N N   . PRO A 1 315 ? 2.249   -2.774  25.101  1.00 30.64  ? 315  PRO A N   1 
ATOM   2323  C CA  . PRO A 1 315 ? 1.973   -1.348  25.347  1.00 30.29  ? 315  PRO A CA  1 
ATOM   2324  C C   . PRO A 1 315 ? 1.017   -0.732  24.324  1.00 35.92  ? 315  PRO A C   1 
ATOM   2325  O O   . PRO A 1 315 ? 0.947   -1.175  23.176  1.00 35.07  ? 315  PRO A O   1 
ATOM   2326  C CB  . PRO A 1 315 ? 3.361   -0.696  25.217  1.00 30.18  ? 315  PRO A CB  1 
ATOM   2327  C CG  . PRO A 1 315 ? 4.337   -1.822  25.322  1.00 33.47  ? 315  PRO A CG  1 
ATOM   2328  C CD  . PRO A 1 315 ? 3.658   -2.986  24.718  1.00 30.31  ? 315  PRO A CD  1 
ATOM   2329  N N   . LEU A 1 316 ? 0.291   0.301   24.755  1.00 35.16  ? 316  LEU A N   1 
ATOM   2330  C CA  . LEU A 1 316 ? -0.581  1.088   23.899  1.00 36.75  ? 316  LEU A CA  1 
ATOM   2331  C C   . LEU A 1 316 ? 0.254   2.279   23.440  1.00 38.79  ? 316  LEU A C   1 
ATOM   2332  O O   . LEU A 1 316 ? 0.197   3.358   24.025  1.00 38.75  ? 316  LEU A O   1 
ATOM   2333  C CB  . LEU A 1 316 ? -1.887  1.500   24.617  1.00 38.71  ? 316  LEU A CB  1 
ATOM   2334  C CG  . LEU A 1 316 ? -2.988  0.439   24.704  1.00 45.41  ? 316  LEU A CG  1 
ATOM   2335  C CD1 . LEU A 1 316 ? -4.047  0.851   25.697  1.00 47.76  ? 316  LEU A CD1 1 
ATOM   2336  C CD2 . LEU A 1 316 ? -3.628  0.184   23.342  1.00 49.06  ? 316  LEU A CD2 1 
ATOM   2337  N N   . TYR A 1 317 ? 1.090   2.033   22.433  1.00 34.08  ? 317  TYR A N   1 
ATOM   2338  C CA  . TYR A 1 317 ? 2.048   2.960   21.834  1.00 33.50  ? 317  TYR A CA  1 
ATOM   2339  C C   . TYR A 1 317 ? 1.410   4.283   21.368  1.00 39.98  ? 317  TYR A C   1 
ATOM   2340  O O   . TYR A 1 317 ? 2.030   5.338   21.538  1.00 38.63  ? 317  TYR A O   1 
ATOM   2341  C CB  . TYR A 1 317 ? 2.760   2.278   20.647  1.00 33.29  ? 317  TYR A CB  1 
ATOM   2342  C CG  . TYR A 1 317 ? 3.515   1.018   21.020  1.00 32.65  ? 317  TYR A CG  1 
ATOM   2343  C CD1 . TYR A 1 317 ? 4.777   1.084   21.608  1.00 33.63  ? 317  TYR A CD1 1 
ATOM   2344  C CD2 . TYR A 1 317 ? 2.971   -0.243  20.783  1.00 33.23  ? 317  TYR A CD2 1 
ATOM   2345  C CE1 . TYR A 1 317 ? 5.476   -0.076  21.963  1.00 32.53  ? 317  TYR A CE1 1 
ATOM   2346  C CE2 . TYR A 1 317 ? 3.666   -1.411  21.121  1.00 33.27  ? 317  TYR A CE2 1 
ATOM   2347  C CZ  . TYR A 1 317 ? 4.918   -1.322  21.712  1.00 38.74  ? 317  TYR A CZ  1 
ATOM   2348  O OH  . TYR A 1 317 ? 5.600   -2.466  22.047  1.00 35.35  ? 317  TYR A OH  1 
ATOM   2349  N N   . GLU A 1 318 ? 0.183   4.228   20.796  1.00 38.72  ? 318  GLU A N   1 
ATOM   2350  C CA  . GLU A 1 318 ? -0.519  5.419   20.327  1.00 40.35  ? 318  GLU A CA  1 
ATOM   2351  C C   . GLU A 1 318 ? -0.865  6.356   21.486  1.00 45.64  ? 318  GLU A C   1 
ATOM   2352  O O   . GLU A 1 318 ? -0.756  7.578   21.334  1.00 45.54  ? 318  GLU A O   1 
ATOM   2353  C CB  . GLU A 1 318 ? -1.792  5.049   19.553  1.00 43.45  ? 318  GLU A CB  1 
ATOM   2354  C CG  . GLU A 1 318 ? -1.901  5.625   18.149  1.00 57.10  ? 318  GLU A CG  1 
ATOM   2355  C CD  . GLU A 1 318 ? -1.111  6.874   17.805  1.00 79.42  ? 318  GLU A CD  1 
ATOM   2356  O OE1 . GLU A 1 318 ? -0.153  6.769   17.006  1.00 68.98  ? 318  GLU A OE1 1 
ATOM   2357  O OE2 . GLU A 1 318 ? -1.478  7.966   18.297  1.00 77.47  ? 318  GLU A OE2 1 
ATOM   2358  N N   . ASN A 1 319 ? -1.257  5.778   22.643  1.00 42.54  ? 319  ASN A N   1 
ATOM   2359  C CA  . ASN A 1 319 ? -1.596  6.515   23.858  1.00 42.74  ? 319  ASN A CA  1 
ATOM   2360  C C   . ASN A 1 319 ? -0.358  7.235   24.400  1.00 44.26  ? 319  ASN A C   1 
ATOM   2361  O O   . ASN A 1 319 ? -0.473  8.379   24.836  1.00 45.01  ? 319  ASN A O   1 
ATOM   2362  C CB  . ASN A 1 319 ? -2.205  5.576   24.916  1.00 45.63  ? 319  ASN A CB  1 
ATOM   2363  C CG  . ASN A 1 319 ? -3.707  5.446   24.886  1.00 75.37  ? 319  ASN A CG  1 
ATOM   2364  O OD1 . ASN A 1 319 ? -4.351  5.481   23.828  1.00 70.53  ? 319  ASN A OD1 1 
ATOM   2365  N ND2 . ASN A 1 319 ? -4.281  5.220   26.053  1.00 72.56  ? 319  ASN A ND2 1 
ATOM   2366  N N   . LEU A 1 320 ? 0.824   6.583   24.333  1.00 37.86  ? 320  LEU A N   1 
ATOM   2367  C CA  . LEU A 1 320 ? 2.100   7.161   24.779  1.00 36.03  ? 320  LEU A CA  1 
ATOM   2368  C C   . LEU A 1 320 ? 2.513   8.321   23.863  1.00 40.03  ? 320  LEU A C   1 
ATOM   2369  O O   . LEU A 1 320 ? 3.053   9.320   24.345  1.00 39.21  ? 320  LEU A O   1 
ATOM   2370  C CB  . LEU A 1 320 ? 3.214   6.103   24.828  1.00 34.25  ? 320  LEU A CB  1 
ATOM   2371  C CG  . LEU A 1 320 ? 3.140   5.054   25.924  1.00 37.75  ? 320  LEU A CG  1 
ATOM   2372  C CD1 . LEU A 1 320 ? 4.068   3.908   25.618  1.00 37.03  ? 320  LEU A CD1 1 
ATOM   2373  C CD2 . LEU A 1 320 ? 3.476   5.644   27.275  1.00 38.37  ? 320  LEU A CD2 1 
ATOM   2374  N N   . ARG A 1 321 ? 2.238   8.188   22.549  1.00 36.26  ? 321  ARG A N   1 
ATOM   2375  C CA  . ARG A 1 321 ? 2.500   9.222   21.554  1.00 36.08  ? 321  ARG A CA  1 
ATOM   2376  C C   . ARG A 1 321 ? 1.628   10.448  21.808  1.00 41.75  ? 321  ARG A C   1 
ATOM   2377  O O   . ARG A 1 321 ? 2.147   11.557  21.746  1.00 42.81  ? 321  ARG A O   1 
ATOM   2378  C CB  . ARG A 1 321 ? 2.271   8.693   20.137  1.00 35.57  ? 321  ARG A CB  1 
ATOM   2379  C CG  . ARG A 1 321 ? 3.521   8.091   19.537  1.00 38.81  ? 321  ARG A CG  1 
ATOM   2380  C CD  . ARG A 1 321 ? 3.278   7.577   18.133  1.00 38.77  ? 321  ARG A CD  1 
ATOM   2381  N NE  . ARG A 1 321 ? 4.151   6.440   17.885  1.00 34.23  ? 321  ARG A NE  1 
ATOM   2382  C CZ  . ARG A 1 321 ? 3.747   5.183   17.748  1.00 51.49  ? 321  ARG A CZ  1 
ATOM   2383  N NH1 . ARG A 1 321 ? 2.458   4.888   17.754  1.00 29.15  ? 321  ARG A NH1 1 
ATOM   2384  N NH2 . ARG A 1 321 ? 4.630   4.215   17.563  1.00 55.84  ? 321  ARG A NH2 1 
ATOM   2385  N N   . ASP A 1 322 ? 0.328   10.252  22.138  1.00 38.31  ? 322  ASP A N   1 
ATOM   2386  C CA  . ASP A 1 322 ? -0.613  11.340  22.436  1.00 39.60  ? 322  ASP A CA  1 
ATOM   2387  C C   . ASP A 1 322 ? -0.162  12.146  23.652  1.00 42.29  ? 322  ASP A C   1 
ATOM   2388  O O   . ASP A 1 322 ? -0.304  13.373  23.663  1.00 43.16  ? 322  ASP A O   1 
ATOM   2389  C CB  . ASP A 1 322 ? -2.047  10.811  22.656  1.00 42.98  ? 322  ASP A CB  1 
ATOM   2390  C CG  . ASP A 1 322 ? -2.712  10.157  21.453  1.00 58.10  ? 322  ASP A CG  1 
ATOM   2391  O OD1 . ASP A 1 322 ? -2.400  10.558  20.300  1.00 58.80  ? 322  ASP A OD1 1 
ATOM   2392  O OD2 . ASP A 1 322 ? -3.574  9.274   21.663  1.00 66.75  ? 322  ASP A OD2 1 
ATOM   2393  N N   . ILE A 1 323 ? 0.394   11.456  24.666  1.00 37.25  ? 323  ILE A N   1 
ATOM   2394  C CA  . ILE A 1 323 ? 0.932   12.064  25.883  1.00 35.78  ? 323  ILE A CA  1 
ATOM   2395  C C   . ILE A 1 323 ? 2.057   13.042  25.491  1.00 40.42  ? 323  ILE A C   1 
ATOM   2396  O O   . ILE A 1 323 ? 2.022   14.200  25.914  1.00 41.08  ? 323  ILE A O   1 
ATOM   2397  C CB  . ILE A 1 323 ? 1.402   10.988  26.897  1.00 37.12  ? 323  ILE A CB  1 
ATOM   2398  C CG1 . ILE A 1 323 ? 0.190   10.277  27.541  1.00 38.42  ? 323  ILE A CG1 1 
ATOM   2399  C CG2 . ILE A 1 323 ? 2.327   11.596  27.966  1.00 37.45  ? 323  ILE A CG2 1 
ATOM   2400  C CD1 . ILE A 1 323 ? 0.505   8.987   28.270  1.00 48.47  ? 323  ILE A CD1 1 
ATOM   2401  N N   . LEU A 1 324 ? 3.008   12.591  24.641  1.00 35.99  ? 324  LEU A N   1 
ATOM   2402  C CA  . LEU A 1 324 ? 4.130   13.414  24.189  1.00 35.69  ? 324  LEU A CA  1 
ATOM   2403  C C   . LEU A 1 324 ? 3.674   14.540  23.258  1.00 42.05  ? 324  LEU A C   1 
ATOM   2404  O O   . LEU A 1 324 ? 4.227   15.637  23.335  1.00 42.52  ? 324  LEU A O   1 
ATOM   2405  C CB  . LEU A 1 324 ? 5.216   12.561  23.512  1.00 34.44  ? 324  LEU A CB  1 
ATOM   2406  C CG  . LEU A 1 324 ? 5.853   11.447  24.364  1.00 36.93  ? 324  LEU A CG  1 
ATOM   2407  C CD1 . LEU A 1 324 ? 6.859   10.690  23.565  1.00 35.49  ? 324  LEU A CD1 1 
ATOM   2408  C CD2 . LEU A 1 324 ? 6.512   11.986  25.630  1.00 37.95  ? 324  LEU A CD2 1 
ATOM   2409  N N   . LEU A 1 325 ? 2.646   14.288  22.420  1.00 40.15  ? 325  LEU A N   1 
ATOM   2410  C CA  . LEU A 1 325 ? 2.065   15.284  21.511  1.00 41.77  ? 325  LEU A CA  1 
ATOM   2411  C C   . LEU A 1 325 ? 1.385   16.414  22.298  1.00 46.67  ? 325  LEU A C   1 
ATOM   2412  O O   . LEU A 1 325 ? 1.401   17.559  21.841  1.00 47.96  ? 325  LEU A O   1 
ATOM   2413  C CB  . LEU A 1 325 ? 1.069   14.643  20.530  1.00 42.49  ? 325  LEU A CB  1 
ATOM   2414  C CG  . LEU A 1 325 ? 1.666   13.771  19.420  1.00 47.02  ? 325  LEU A CG  1 
ATOM   2415  C CD1 . LEU A 1 325 ? 0.595   12.930  18.748  1.00 48.37  ? 325  LEU A CD1 1 
ATOM   2416  C CD2 . LEU A 1 325 ? 2.400   14.596  18.394  1.00 48.85  ? 325  LEU A CD2 1 
ATOM   2417  N N   . GLN A 1 326 ? 0.813   16.098  23.485  1.00 42.22  ? 326  GLN A N   1 
ATOM   2418  C CA  . GLN A 1 326 ? 0.183   17.084  24.375  1.00 42.97  ? 326  GLN A CA  1 
ATOM   2419  C C   . GLN A 1 326 ? 1.252   18.051  24.924  1.00 46.59  ? 326  GLN A C   1 
ATOM   2420  O O   . GLN A 1 326 ? 0.984   19.243  25.081  1.00 48.28  ? 326  GLN A O   1 
ATOM   2421  C CB  . GLN A 1 326 ? -0.587  16.399  25.517  1.00 44.02  ? 326  GLN A CB  1 
ATOM   2422  C CG  . GLN A 1 326 ? -1.985  15.937  25.119  1.00 57.89  ? 326  GLN A CG  1 
ATOM   2423  N N   . GLY A 1 327 ? 2.458   17.526  25.165  1.00 40.22  ? 327  GLY A N   1 
ATOM   2424  C CA  . GLY A 1 327 ? 3.627   18.279  25.606  1.00 38.74  ? 327  GLY A CA  1 
ATOM   2425  C C   . GLY A 1 327 ? 4.106   19.278  24.568  1.00 42.04  ? 327  GLY A C   1 
ATOM   2426  O O   . GLY A 1 327 ? 4.552   20.365  24.939  1.00 43.25  ? 327  GLY A O   1 
ATOM   2427  N N   . LEU A 1 328 ? 4.022   18.917  23.254  1.00 36.55  ? 328  LEU A N   1 
ATOM   2428  C CA  . LEU A 1 328 ? 4.389   19.795  22.136  1.00 36.57  ? 328  LEU A CA  1 
ATOM   2429  C C   . LEU A 1 328 ? 3.370   20.905  21.982  1.00 45.24  ? 328  LEU A C   1 
ATOM   2430  O O   . LEU A 1 328 ? 3.749   22.038  21.685  1.00 46.12  ? 328  LEU A O   1 
ATOM   2431  C CB  . LEU A 1 328 ? 4.524   19.033  20.802  1.00 35.48  ? 328  LEU A CB  1 
ATOM   2432  C CG  . LEU A 1 328 ? 5.772   18.176  20.585  1.00 36.89  ? 328  LEU A CG  1 
ATOM   2433  C CD1 . LEU A 1 328 ? 5.592   17.278  19.387  1.00 35.83  ? 328  LEU A CD1 1 
ATOM   2434  C CD2 . LEU A 1 328 ? 7.025   19.027  20.425  1.00 36.38  ? 328  LEU A CD2 1 
ATOM   2435  N N   . LYS A 1 329 ? 2.070   20.583  22.184  1.00 44.42  ? 329  LYS A N   1 
ATOM   2436  C CA  . LYS A 1 329 ? 0.966   21.542  22.116  1.00 46.38  ? 329  LYS A CA  1 
ATOM   2437  C C   . LYS A 1 329 ? 1.100   22.557  23.248  1.00 50.91  ? 329  LYS A C   1 
ATOM   2438  O O   . LYS A 1 329 ? 0.841   23.740  23.038  1.00 51.74  ? 329  LYS A O   1 
ATOM   2439  C CB  . LYS A 1 329 ? -0.386  20.808  22.188  1.00 49.76  ? 329  LYS A CB  1 
ATOM   2440  C CG  . LYS A 1 329 ? -1.589  21.660  21.791  1.00 66.59  ? 329  LYS A CG  1 
ATOM   2441  C CD  . LYS A 1 329 ? -2.892  20.900  21.956  1.00 77.37  ? 329  LYS A CD  1 
ATOM   2442  N N   . ALA A 1 330 ? 1.545   22.092  24.434  1.00 47.67  ? 330  ALA A N   1 
ATOM   2443  C CA  . ALA A 1 330 ? 1.743   22.916  25.631  1.00 48.30  ? 330  ALA A CA  1 
ATOM   2444  C C   . ALA A 1 330 ? 2.833   23.988  25.428  1.00 53.84  ? 330  ALA A C   1 
ATOM   2445  O O   . ALA A 1 330 ? 2.694   25.100  25.949  1.00 55.70  ? 330  ALA A O   1 
ATOM   2446  C CB  . ALA A 1 330 ? 2.090   22.037  26.816  1.00 47.55  ? 330  ALA A CB  1 
ATOM   2447  N N   . ILE A 1 331 ? 3.887   23.670  24.640  1.00 49.07  ? 331  ILE A N   1 
ATOM   2448  C CA  . ILE A 1 331 ? 4.997   24.590  24.343  1.00 48.82  ? 331  ILE A CA  1 
ATOM   2449  C C   . ILE A 1 331 ? 4.741   25.392  23.031  1.00 52.68  ? 331  ILE A C   1 
ATOM   2450  O O   . ILE A 1 331 ? 5.640   26.083  22.540  1.00 52.63  ? 331  ILE A O   1 
ATOM   2451  C CB  . ILE A 1 331 ? 6.385   23.875  24.334  1.00 50.43  ? 331  ILE A CB  1 
ATOM   2452  C CG1 . ILE A 1 331 ? 6.485   22.770  23.253  1.00 49.87  ? 331  ILE A CG1 1 
ATOM   2453  C CG2 . ILE A 1 331 ? 6.729   23.344  25.725  1.00 50.57  ? 331  ILE A CG2 1 
ATOM   2454  C CD1 . ILE A 1 331 ? 7.881   22.490  22.724  1.00 51.64  ? 331  ILE A CD1 1 
ATOM   2455  N N   . GLY A 1 332 ? 3.510   25.325  22.519  1.00 49.32  ? 332  GLY A N   1 
ATOM   2456  C CA  . GLY A 1 332 ? 3.082   26.046  21.323  1.00 50.33  ? 332  GLY A CA  1 
ATOM   2457  C C   . GLY A 1 332 ? 3.625   25.510  20.013  1.00 53.81  ? 332  GLY A C   1 
ATOM   2458  O O   . GLY A 1 332 ? 3.594   26.209  18.995  1.00 55.55  ? 332  GLY A O   1 
ATOM   2459  N N   . SER A 1 333 ? 4.106   24.264  20.021  1.00 47.85  ? 333  SER A N   1 
ATOM   2460  C CA  . SER A 1 333 ? 4.657   23.594  18.849  1.00 46.84  ? 333  SER A CA  1 
ATOM   2461  C C   . SER A 1 333 ? 3.718   22.468  18.373  1.00 50.77  ? 333  SER A C   1 
ATOM   2462  O O   . SER A 1 333 ? 2.568   22.381  18.813  1.00 51.44  ? 333  SER A O   1 
ATOM   2463  C CB  . SER A 1 333 ? 6.039   23.036  19.181  1.00 48.26  ? 333  SER A CB  1 
ATOM   2464  O OG  . SER A 1 333 ? 6.704   22.602  18.009  1.00 52.19  ? 333  SER A OG  1 
ATOM   2465  N N   . LYS A 1 334 ? 4.214   21.624  17.460  1.00 46.15  ? 334  LYS A N   1 
ATOM   2466  C CA  . LYS A 1 334 ? 3.526   20.461  16.896  1.00 45.02  ? 334  LYS A CA  1 
ATOM   2467  C C   . LYS A 1 334 ? 4.573   19.455  16.424  1.00 47.04  ? 334  LYS A C   1 
ATOM   2468  O O   . LYS A 1 334 ? 5.761   19.784  16.404  1.00 46.36  ? 334  LYS A O   1 
ATOM   2469  C CB  . LYS A 1 334 ? 2.570   20.868  15.753  1.00 48.89  ? 334  LYS A CB  1 
ATOM   2470  C CG  . LYS A 1 334 ? 3.226   21.585  14.565  1.00 62.66  ? 334  LYS A CG  1 
ATOM   2471  N N   . ASP A 1 335 ? 4.151   18.232  16.064  1.00 42.34  ? 335  ASP A N   1 
ATOM   2472  C CA  . ASP A 1 335 ? 5.083   17.240  15.540  1.00 40.39  ? 335  ASP A CA  1 
ATOM   2473  C C   . ASP A 1 335 ? 5.359   17.572  14.064  1.00 45.09  ? 335  ASP A C   1 
ATOM   2474  O O   . ASP A 1 335 ? 4.632   17.132  13.167  1.00 44.73  ? 335  ASP A O   1 
ATOM   2475  C CB  . ASP A 1 335 ? 4.547   15.813  15.724  1.00 40.82  ? 335  ASP A CB  1 
ATOM   2476  C CG  . ASP A 1 335 ? 5.428   14.677  15.205  1.00 44.57  ? 335  ASP A CG  1 
ATOM   2477  O OD1 . ASP A 1 335 ? 6.600   14.943  14.833  1.00 42.82  ? 335  ASP A OD1 1 
ATOM   2478  O OD2 . ASP A 1 335 ? 4.959   13.518  15.207  1.00 48.14  ? 335  ASP A OD2 1 
ATOM   2479  N N   . ASP A 1 336 ? 6.387   18.404  13.843  1.00 41.75  ? 336  ASP A N   1 
ATOM   2480  C CA  . ASP A 1 336 ? 6.838   18.835  12.523  1.00 42.24  ? 336  ASP A CA  1 
ATOM   2481  C C   . ASP A 1 336 ? 8.107   18.062  12.123  1.00 46.47  ? 336  ASP A C   1 
ATOM   2482  O O   . ASP A 1 336 ? 8.683   18.327  11.069  1.00 47.58  ? 336  ASP A O   1 
ATOM   2483  C CB  . ASP A 1 336 ? 7.078   20.361  12.501  1.00 44.91  ? 336  ASP A CB  1 
ATOM   2484  C CG  . ASP A 1 336 ? 7.993   20.927  13.577  1.00 53.55  ? 336  ASP A CG  1 
ATOM   2485  O OD1 . ASP A 1 336 ? 8.598   20.128  14.334  1.00 52.02  ? 336  ASP A OD1 1 
ATOM   2486  O OD2 . ASP A 1 336 ? 8.094   22.172  13.673  1.00 60.00  ? 336  ASP A OD2 1 
ATOM   2487  N N   . GLY A 1 337 ? 8.520   17.128  12.981  1.00 41.43  ? 337  GLY A N   1 
ATOM   2488  C CA  . GLY A 1 337 ? 9.702   16.301  12.792  1.00 40.08  ? 337  GLY A CA  1 
ATOM   2489  C C   . GLY A 1 337 ? 11.011  17.051  12.899  1.00 45.00  ? 337  GLY A C   1 
ATOM   2490  O O   . GLY A 1 337 ? 12.033  16.539  12.450  1.00 44.32  ? 337  GLY A O   1 
ATOM   2491  N N   . LYS A 1 338 ? 11.003  18.266  13.490  1.00 43.13  ? 338  LYS A N   1 
ATOM   2492  C CA  . LYS A 1 338 ? 12.210  19.083  13.647  1.00 42.90  ? 338  LYS A CA  1 
ATOM   2493  C C   . LYS A 1 338 ? 12.865  18.786  14.991  1.00 43.39  ? 338  LYS A C   1 
ATOM   2494  O O   . LYS A 1 338 ? 12.269  19.048  16.026  1.00 42.54  ? 338  LYS A O   1 
ATOM   2495  C CB  . LYS A 1 338 ? 11.885  20.577  13.492  1.00 47.11  ? 338  LYS A CB  1 
ATOM   2496  N N   . LEU A 1 339 ? 14.068  18.200  14.971  1.00 39.12  ? 339  LEU A N   1 
ATOM   2497  C CA  . LEU A 1 339 ? 14.787  17.807  16.179  1.00 38.57  ? 339  LEU A CA  1 
ATOM   2498  C C   . LEU A 1 339 ? 15.447  18.983  16.904  1.00 45.78  ? 339  LEU A C   1 
ATOM   2499  O O   . LEU A 1 339 ? 15.706  18.858  18.102  1.00 43.67  ? 339  LEU A O   1 
ATOM   2500  C CB  . LEU A 1 339 ? 15.827  16.704  15.908  1.00 37.15  ? 339  LEU A CB  1 
ATOM   2501  C CG  . LEU A 1 339 ? 15.306  15.337  15.432  1.00 39.86  ? 339  LEU A CG  1 
ATOM   2502  C CD1 . LEU A 1 339 ? 16.433  14.348  15.322  1.00 38.60  ? 339  LEU A CD1 1 
ATOM   2503  C CD2 . LEU A 1 339 ? 14.261  14.759  16.364  1.00 40.78  ? 339  LEU A CD2 1 
ATOM   2504  N N   . ASP A 1 340 ? 15.723  20.108  16.201  1.00 46.89  ? 340  ASP A N   1 
ATOM   2505  C CA  . ASP A 1 340 ? 16.348  21.324  16.754  1.00 49.21  ? 340  ASP A CA  1 
ATOM   2506  C C   . ASP A 1 340 ? 17.652  21.008  17.538  1.00 53.88  ? 340  ASP A C   1 
ATOM   2507  O O   . ASP A 1 340 ? 17.916  21.654  18.553  1.00 54.49  ? 340  ASP A O   1 
ATOM   2508  C CB  . ASP A 1 340 ? 15.349  22.092  17.664  1.00 52.45  ? 340  ASP A CB  1 
ATOM   2509  C CG  . ASP A 1 340 ? 14.234  22.868  16.968  1.00 71.31  ? 340  ASP A CG  1 
ATOM   2510  O OD1 . ASP A 1 340 ? 14.116  22.768  15.721  1.00 73.55  ? 340  ASP A OD1 1 
ATOM   2511  O OD2 . ASP A 1 340 ? 13.478  23.573  17.670  1.00 81.38  ? 340  ASP A OD2 1 
ATOM   2512  N N   . LEU A 1 341 ? 18.410  19.960  17.099  1.00 49.78  ? 341  LEU A N   1 
ATOM   2513  C CA  . LEU A 1 341 ? 19.661  19.412  17.668  1.00 75.05  ? 341  LEU A CA  1 
ATOM   2514  C C   . LEU A 1 341 ? 20.110  18.169  16.883  1.00 99.18  ? 341  LEU A C   1 
ATOM   2515  O O   . LEU A 1 341 ? 19.637  17.053  17.130  1.00 55.80  ? 341  LEU A O   1 
ATOM   2516  C CB  . LEU A 1 341 ? 19.520  19.053  19.162  1.00 74.40  ? 341  LEU A CB  1 
ATOM   2517  N N   . GLU B 1 21  ? 18.269  -23.351 57.784  1.00 68.24  ? 21   GLU B N   1 
ATOM   2518  C CA  . GLU B 1 21  ? 16.962  -23.812 58.247  1.00 68.01  ? 21   GLU B CA  1 
ATOM   2519  C C   . GLU B 1 21  ? 15.830  -23.041 57.553  1.00 69.55  ? 21   GLU B C   1 
ATOM   2520  O O   . GLU B 1 21  ? 14.959  -23.655 56.932  1.00 70.45  ? 21   GLU B O   1 
ATOM   2521  C CB  . GLU B 1 21  ? 16.848  -23.681 59.779  1.00 69.00  ? 21   GLU B CB  1 
ATOM   2522  N N   . GLN B 1 22  ? 15.855  -21.702 57.655  1.00 62.67  ? 22   GLN B N   1 
ATOM   2523  C CA  . GLN B 1 22  ? 14.855  -20.802 57.084  1.00 60.05  ? 22   GLN B CA  1 
ATOM   2524  C C   . GLN B 1 22  ? 14.862  -20.839 55.563  1.00 61.48  ? 22   GLN B C   1 
ATOM   2525  O O   . GLN B 1 22  ? 13.791  -20.944 54.968  1.00 61.31  ? 22   GLN B O   1 
ATOM   2526  C CB  . GLN B 1 22  ? 15.068  -19.359 57.582  1.00 59.17  ? 22   GLN B CB  1 
ATOM   2527  C CG  . GLN B 1 22  ? 13.880  -18.439 57.325  1.00 65.11  ? 22   GLN B CG  1 
ATOM   2528  C CD  . GLN B 1 22  ? 12.616  -18.888 58.023  1.00 77.98  ? 22   GLN B CD  1 
ATOM   2529  O OE1 . GLN B 1 22  ? 12.619  -19.335 59.179  1.00 70.73  ? 22   GLN B OE1 1 
ATOM   2530  N NE2 . GLN B 1 22  ? 11.506  -18.785 57.320  1.00 70.16  ? 22   GLN B NE2 1 
ATOM   2531  N N   . PHE B 1 23  ? 16.044  -20.742 54.937  1.00 56.32  ? 23   PHE B N   1 
ATOM   2532  C CA  . PHE B 1 23  ? 16.118  -20.783 53.478  1.00 55.74  ? 23   PHE B CA  1 
ATOM   2533  C C   . PHE B 1 23  ? 17.134  -21.785 52.966  1.00 61.16  ? 23   PHE B C   1 
ATOM   2534  O O   . PHE B 1 23  ? 18.052  -22.196 53.677  1.00 61.79  ? 23   PHE B O   1 
ATOM   2535  C CB  . PHE B 1 23  ? 16.481  -19.411 52.881  1.00 55.61  ? 23   PHE B CB  1 
ATOM   2536  C CG  . PHE B 1 23  ? 15.808  -18.172 53.417  1.00 54.68  ? 23   PHE B CG  1 
ATOM   2537  C CD1 . PHE B 1 23  ? 14.530  -17.820 53.000  1.00 56.06  ? 23   PHE B CD1 1 
ATOM   2538  C CD2 . PHE B 1 23  ? 16.494  -17.297 54.249  1.00 55.60  ? 23   PHE B CD2 1 
ATOM   2539  C CE1 . PHE B 1 23  ? 13.922  -16.655 53.467  1.00 55.41  ? 23   PHE B CE1 1 
ATOM   2540  C CE2 . PHE B 1 23  ? 15.892  -16.120 54.699  1.00 56.67  ? 23   PHE B CE2 1 
ATOM   2541  C CZ  . PHE B 1 23  ? 14.604  -15.812 54.317  1.00 53.78  ? 23   PHE B CZ  1 
ATOM   2542  N N   . ALA B 1 24  ? 16.972  -22.141 51.697  1.00 58.20  ? 24   ALA B N   1 
ATOM   2543  C CA  . ALA B 1 24  ? 17.885  -22.951 50.912  1.00 59.36  ? 24   ALA B CA  1 
ATOM   2544  C C   . ALA B 1 24  ? 18.970  -22.028 50.342  1.00 63.52  ? 24   ALA B C   1 
ATOM   2545  O O   . ALA B 1 24  ? 18.687  -20.859 50.054  1.00 61.55  ? 24   ALA B O   1 
ATOM   2546  C CB  . ALA B 1 24  ? 17.125  -23.638 49.796  1.00 60.75  ? 24   ALA B CB  1 
ATOM   2547  N N   . VAL B 1 25  ? 20.211  -22.532 50.201  1.00 61.76  ? 25   VAL B N   1 
ATOM   2548  C CA  . VAL B 1 25  ? 21.307  -21.746 49.622  1.00 61.05  ? 25   VAL B CA  1 
ATOM   2549  C C   . VAL B 1 25  ? 21.025  -21.659 48.119  1.00 63.46  ? 25   VAL B C   1 
ATOM   2550  O O   . VAL B 1 25  ? 21.024  -22.679 47.430  1.00 65.69  ? 25   VAL B O   1 
ATOM   2551  C CB  . VAL B 1 25  ? 22.722  -22.305 49.955  1.00 66.63  ? 25   VAL B CB  1 
ATOM   2552  C CG1 . VAL B 1 25  ? 23.811  -21.454 49.313  1.00 66.21  ? 25   VAL B CG1 1 
ATOM   2553  C CG2 . VAL B 1 25  ? 22.944  -22.385 51.463  1.00 66.15  ? 25   VAL B CG2 1 
ATOM   2554  N N   . GLY B 1 26  ? 20.686  -20.460 47.661  1.00 56.27  ? 26   GLY B N   1 
ATOM   2555  C CA  . GLY B 1 26  ? 20.318  -20.205 46.271  1.00 55.40  ? 26   GLY B CA  1 
ATOM   2556  C C   . GLY B 1 26  ? 18.850  -19.860 46.085  1.00 55.58  ? 26   GLY B C   1 
ATOM   2557  O O   . GLY B 1 26  ? 18.420  -19.613 44.957  1.00 54.66  ? 26   GLY B O   1 
ATOM   2558  N N   . GLU B 1 27  ? 18.067  -19.849 47.192  1.00 49.72  ? 27   GLU B N   1 
ATOM   2559  C CA  . GLU B 1 27  ? 16.637  -19.526 47.192  1.00 47.72  ? 27   GLU B CA  1 
ATOM   2560  C C   . GLU B 1 27  ? 16.443  -18.058 46.818  1.00 49.02  ? 27   GLU B C   1 
ATOM   2561  O O   . GLU B 1 27  ? 17.198  -17.201 47.283  1.00 47.83  ? 27   GLU B O   1 
ATOM   2562  C CB  . GLU B 1 27  ? 15.996  -19.830 48.570  1.00 48.41  ? 27   GLU B CB  1 
ATOM   2563  C CG  . GLU B 1 27  ? 14.484  -19.642 48.639  1.00 54.91  ? 27   GLU B CG  1 
ATOM   2564  C CD  . GLU B 1 27  ? 13.774  -20.161 49.878  1.00 69.70  ? 27   GLU B CD  1 
ATOM   2565  O OE1 . GLU B 1 27  ? 14.385  -20.931 50.652  1.00 63.63  ? 27   GLU B OE1 1 
ATOM   2566  O OE2 . GLU B 1 27  ? 12.584  -19.819 50.057  1.00 60.30  ? 27   GLU B OE2 1 
ATOM   2567  N N   . ILE B 1 28  ? 15.446  -17.779 45.962  1.00 44.16  ? 28   ILE B N   1 
ATOM   2568  C CA  . ILE B 1 28  ? 15.125  -16.420 45.540  1.00 41.95  ? 28   ILE B CA  1 
ATOM   2569  C C   . ILE B 1 28  ? 13.944  -15.928 46.363  1.00 45.54  ? 28   ILE B C   1 
ATOM   2570  O O   . ILE B 1 28  ? 12.871  -16.539 46.337  1.00 45.79  ? 28   ILE B O   1 
ATOM   2571  C CB  . ILE B 1 28  ? 14.873  -16.306 44.013  1.00 44.42  ? 28   ILE B CB  1 
ATOM   2572  C CG1 . ILE B 1 28  ? 16.085  -16.843 43.219  1.00 46.19  ? 28   ILE B CG1 1 
ATOM   2573  C CG2 . ILE B 1 28  ? 14.507  -14.854 43.606  1.00 40.96  ? 28   ILE B CG2 1 
ATOM   2574  C CD1 . ILE B 1 28  ? 15.745  -17.330 41.781  1.00 54.67  ? 28   ILE B CD1 1 
ATOM   2575  N N   . ILE B 1 29  ? 14.159  -14.830 47.093  1.00 41.43  ? 29   ILE B N   1 
ATOM   2576  C CA  . ILE B 1 29  ? 13.147  -14.186 47.924  1.00 41.13  ? 29   ILE B CA  1 
ATOM   2577  C C   . ILE B 1 29  ? 12.827  -12.804 47.336  1.00 43.42  ? 29   ILE B C   1 
ATOM   2578  O O   . ILE B 1 29  ? 13.709  -12.130 46.795  1.00 42.21  ? 29   ILE B O   1 
ATOM   2579  C CB  . ILE B 1 29  ? 13.548  -14.123 49.431  1.00 44.07  ? 29   ILE B CB  1 
ATOM   2580  C CG1 . ILE B 1 29  ? 14.884  -13.369 49.659  1.00 44.31  ? 29   ILE B CG1 1 
ATOM   2581  C CG2 . ILE B 1 29  ? 13.565  -15.527 50.038  1.00 45.90  ? 29   ILE B CG2 1 
ATOM   2582  C CD1 . ILE B 1 29  ? 15.239  -13.048 51.123  1.00 46.66  ? 29   ILE B CD1 1 
ATOM   2583  N N   . THR B 1 30  ? 11.553  -12.408 47.423  1.00 39.55  ? 30   THR B N   1 
ATOM   2584  C CA  . THR B 1 30  ? 11.058  -11.124 46.943  1.00 38.57  ? 30   THR B CA  1 
ATOM   2585  C C   . THR B 1 30  ? 10.540  -10.332 48.162  1.00 41.77  ? 30   THR B C   1 
ATOM   2586  O O   . THR B 1 30  ? 9.756   -10.862 48.968  1.00 42.78  ? 30   THR B O   1 
ATOM   2587  C CB  . THR B 1 30  ? 10.004  -11.351 45.847  1.00 47.59  ? 30   THR B CB  1 
ATOM   2588  O OG1 . THR B 1 30  ? 10.580  -12.153 44.818  1.00 48.74  ? 30   THR B OG1 1 
ATOM   2589  C CG2 . THR B 1 30  ? 9.515   -10.072 45.229  1.00 46.15  ? 30   THR B CG2 1 
ATOM   2590  N N   . ASP B 1 31  ? 11.007  -9.082  48.309  1.00 36.08  ? 31   ASP B N   1 
ATOM   2591  C CA  . ASP B 1 31  ? 10.607  -8.232  49.429  1.00 34.99  ? 31   ASP B CA  1 
ATOM   2592  C C   . ASP B 1 31  ? 9.257   -7.533  49.137  1.00 38.74  ? 31   ASP B C   1 
ATOM   2593  O O   . ASP B 1 31  ? 8.670   -7.754  48.074  1.00 38.92  ? 31   ASP B O   1 
ATOM   2594  C CB  . ASP B 1 31  ? 11.728  -7.223  49.791  1.00 36.01  ? 31   ASP B CB  1 
ATOM   2595  C CG  . ASP B 1 31  ? 12.146  -6.193  48.752  1.00 40.38  ? 31   ASP B CG  1 
ATOM   2596  O OD1 . ASP B 1 31  ? 11.294  -5.799  47.924  1.00 40.67  ? 31   ASP B OD1 1 
ATOM   2597  O OD2 . ASP B 1 31  ? 13.305  -5.721  48.818  1.00 43.48  ? 31   ASP B OD2 1 
ATOM   2598  N N   . MET B 1 32  ? 8.766   -6.709  50.080  1.00 36.04  ? 32   MET B N   1 
ATOM   2599  C CA  . MET B 1 32  ? 7.497   -5.967  49.975  1.00 36.03  ? 32   MET B CA  1 
ATOM   2600  C C   . MET B 1 32  ? 7.454   -5.024  48.765  1.00 37.65  ? 32   MET B C   1 
ATOM   2601  O O   . MET B 1 32  ? 6.368   -4.780  48.247  1.00 36.86  ? 32   MET B O   1 
ATOM   2602  C CB  . MET B 1 32  ? 7.267   -5.108  51.222  1.00 38.13  ? 32   MET B CB  1 
ATOM   2603  C CG  . MET B 1 32  ? 7.087   -5.835  52.486  1.00 42.88  ? 32   MET B CG  1 
ATOM   2604  S SD  . MET B 1 32  ? 7.153   -4.536  53.744  1.00 46.99  ? 32   MET B SD  1 
ATOM   2605  C CE  . MET B 1 32  ? 5.453   -3.984  53.686  1.00 44.10  ? 32   MET B CE  1 
ATOM   2606  N N   . ALA B 1 33  ? 8.634   -4.459  48.363  1.00 33.51  ? 33   ALA B N   1 
ATOM   2607  C CA  . ALA B 1 33  ? 8.804   -3.539  47.231  1.00 33.35  ? 33   ALA B CA  1 
ATOM   2608  C C   . ALA B 1 33  ? 8.996   -4.288  45.912  1.00 37.48  ? 33   ALA B C   1 
ATOM   2609  O O   . ALA B 1 33  ? 9.273   -3.657  44.896  1.00 38.79  ? 33   ALA B O   1 
ATOM   2610  C CB  . ALA B 1 33  ? 9.985   -2.622  47.481  1.00 33.79  ? 33   ALA B CB  1 
ATOM   2611  N N   . ALA B 1 34  ? 8.822   -5.629  45.925  1.00 32.71  ? 34   ALA B N   1 
ATOM   2612  C CA  . ALA B 1 34  ? 8.943   -6.553  44.791  1.00 32.43  ? 34   ALA B CA  1 
ATOM   2613  C C   . ALA B 1 34  ? 10.395  -6.656  44.259  1.00 36.53  ? 34   ALA B C   1 
ATOM   2614  O O   . ALA B 1 34  ? 10.604  -7.137  43.149  1.00 38.20  ? 34   ALA B O   1 
ATOM   2615  C CB  . ALA B 1 34  ? 7.965   -6.200  43.669  1.00 32.98  ? 34   ALA B CB  1 
ATOM   2616  N N   . ALA B 1 35  ? 11.394  -6.285  45.080  1.00 31.99  ? 35   ALA B N   1 
ATOM   2617  C CA  . ALA B 1 35  ? 12.812  -6.429  44.731  1.00 31.20  ? 35   ALA B CA  1 
ATOM   2618  C C   . ALA B 1 35  ? 13.269  -7.878  44.997  1.00 33.96  ? 35   ALA B C   1 
ATOM   2619  O O   . ALA B 1 35  ? 12.990  -8.411  46.073  1.00 32.33  ? 35   ALA B O   1 
ATOM   2620  C CB  . ALA B 1 35  ? 13.655  -5.447  45.528  1.00 30.76  ? 35   ALA B CB  1 
ATOM   2621  N N   . ALA B 1 36  ? 13.927  -8.523  44.003  1.00 31.03  ? 36   ALA B N   1 
ATOM   2622  C CA  . ALA B 1 36  ? 14.378  -9.914  44.110  1.00 31.41  ? 36   ALA B CA  1 
ATOM   2623  C C   . ALA B 1 36  ? 15.787  -10.041 44.706  1.00 34.70  ? 36   ALA B C   1 
ATOM   2624  O O   . ALA B 1 36  ? 16.702  -9.303  44.330  1.00 32.74  ? 36   ALA B O   1 
ATOM   2625  C CB  . ALA B 1 36  ? 14.329  -10.585 42.758  1.00 33.11  ? 36   ALA B CB  1 
ATOM   2626  N N   . TRP B 1 37  ? 15.943  -10.989 45.649  1.00 32.11  ? 37   TRP B N   1 
ATOM   2627  C CA  . TRP B 1 37  ? 17.197  -11.272 46.344  1.00 32.48  ? 37   TRP B CA  1 
ATOM   2628  C C   . TRP B 1 37  ? 17.502  -12.763 46.329  1.00 40.90  ? 37   TRP B C   1 
ATOM   2629  O O   . TRP B 1 37  ? 16.583  -13.580 46.404  1.00 41.94  ? 37   TRP B O   1 
ATOM   2630  C CB  . TRP B 1 37  ? 17.137  -10.779 47.801  1.00 29.91  ? 37   TRP B CB  1 
ATOM   2631  C CG  . TRP B 1 37  ? 16.815  -9.320  47.961  1.00 29.46  ? 37   TRP B CG  1 
ATOM   2632  C CD1 . TRP B 1 37  ? 15.578  -8.766  48.136  1.00 31.30  ? 37   TRP B CD1 1 
ATOM   2633  C CD2 . TRP B 1 37  ? 17.750  -8.231  47.965  1.00 29.17  ? 37   TRP B CD2 1 
ATOM   2634  N NE1 . TRP B 1 37  ? 15.684  -7.397  48.268  1.00 29.82  ? 37   TRP B NE1 1 
ATOM   2635  C CE2 . TRP B 1 37  ? 17.006  -7.040  48.161  1.00 31.76  ? 37   TRP B CE2 1 
ATOM   2636  C CE3 . TRP B 1 37  ? 19.157  -8.149  47.849  1.00 30.96  ? 37   TRP B CE3 1 
ATOM   2637  C CZ2 . TRP B 1 37  ? 17.616  -5.779  48.205  1.00 30.59  ? 37   TRP B CZ2 1 
ATOM   2638  C CZ3 . TRP B 1 37  ? 19.758  -6.899  47.880  1.00 31.98  ? 37   TRP B CZ3 1 
ATOM   2639  C CH2 . TRP B 1 37  ? 18.993  -5.732  48.044  1.00 31.68  ? 37   TRP B CH2 1 
ATOM   2640  N N   . LYS B 1 38  ? 18.791  -13.123 46.249  1.00 39.53  ? 38   LYS B N   1 
ATOM   2641  C CA  . LYS B 1 38  ? 19.230  -14.523 46.285  1.00 40.55  ? 38   LYS B CA  1 
ATOM   2642  C C   . LYS B 1 38  ? 19.907  -14.789 47.639  1.00 45.60  ? 38   LYS B C   1 
ATOM   2643  O O   . LYS B 1 38  ? 20.738  -13.991 48.080  1.00 44.24  ? 38   LYS B O   1 
ATOM   2644  C CB  . LYS B 1 38  ? 20.148  -14.851 45.102  1.00 43.01  ? 38   LYS B CB  1 
ATOM   2645  C CG  . LYS B 1 38  ? 20.396  -16.344 44.937  1.00 50.00  ? 38   LYS B CG  1 
ATOM   2646  C CD  . LYS B 1 38  ? 21.362  -16.634 43.819  1.00 50.37  ? 38   LYS B CD  1 
ATOM   2647  C CE  . LYS B 1 38  ? 20.665  -17.207 42.623  1.00 53.60  ? 38   LYS B CE  1 
ATOM   2648  N NZ  . LYS B 1 38  ? 21.627  -17.534 41.551  1.00 57.49  ? 38   LYS B NZ  1 
ATOM   2649  N N   . VAL B 1 39  ? 19.521  -15.887 48.304  1.00 42.93  ? 39   VAL B N   1 
ATOM   2650  C CA  . VAL B 1 39  ? 20.031  -16.274 49.631  1.00 42.31  ? 39   VAL B CA  1 
ATOM   2651  C C   . VAL B 1 39  ? 21.296  -17.142 49.469  1.00 47.75  ? 39   VAL B C   1 
ATOM   2652  O O   . VAL B 1 39  ? 21.354  -18.005 48.597  1.00 48.69  ? 39   VAL B O   1 
ATOM   2653  C CB  . VAL B 1 39  ? 18.926  -16.990 50.470  1.00 45.67  ? 39   VAL B CB  1 
ATOM   2654  C CG1 . VAL B 1 39  ? 19.398  -17.322 51.888  1.00 45.69  ? 39   VAL B CG1 1 
ATOM   2655  C CG2 . VAL B 1 39  ? 17.649  -16.154 50.526  1.00 43.67  ? 39   VAL B CG2 1 
ATOM   2656  N N   . GLY B 1 40  ? 22.292  -16.875 50.304  1.00 45.15  ? 40   GLY B N   1 
ATOM   2657  C CA  . GLY B 1 40  ? 23.547  -17.611 50.358  1.00 47.43  ? 40   GLY B CA  1 
ATOM   2658  C C   . GLY B 1 40  ? 23.670  -18.484 51.597  1.00 54.14  ? 40   GLY B C   1 
ATOM   2659  O O   . GLY B 1 40  ? 22.670  -19.003 52.106  1.00 53.46  ? 40   GLY B O   1 
ATOM   2660  N N   . LEU B 1 41  ? 24.905  -18.640 52.096  1.00 53.68  ? 41   LEU B N   1 
ATOM   2661  C CA  . LEU B 1 41  ? 25.226  -19.473 53.255  1.00 55.46  ? 41   LEU B CA  1 
ATOM   2662  C C   . LEU B 1 41  ? 24.841  -18.827 54.596  1.00 59.20  ? 41   LEU B C   1 
ATOM   2663  O O   . LEU B 1 41  ? 24.977  -17.608 54.745  1.00 56.17  ? 41   LEU B O   1 
ATOM   2664  C CB  . LEU B 1 41  ? 26.733  -19.789 53.290  1.00 57.33  ? 41   LEU B CB  1 
ATOM   2665  C CG  . LEU B 1 41  ? 27.312  -20.739 52.260  1.00 64.91  ? 41   LEU B CG  1 
ATOM   2666  C CD1 . LEU B 1 41  ? 28.820  -20.758 52.394  1.00 66.79  ? 41   LEU B CD1 1 
ATOM   2667  C CD2 . LEU B 1 41  ? 26.786  -22.170 52.433  1.00 69.66  ? 41   LEU B CD2 1 
ATOM   2668  N N   . PRO B 1 42  ? 24.433  -19.640 55.607  1.00 58.25  ? 42   PRO B N   1 
ATOM   2669  C CA  . PRO B 1 42  ? 24.154  -19.071 56.937  1.00 57.63  ? 42   PRO B CA  1 
ATOM   2670  C C   . PRO B 1 42  ? 25.440  -18.620 57.621  1.00 64.50  ? 42   PRO B C   1 
ATOM   2671  O O   . PRO B 1 42  ? 26.459  -19.302 57.521  1.00 66.26  ? 42   PRO B O   1 
ATOM   2672  C CB  . PRO B 1 42  ? 23.500  -20.227 57.705  1.00 60.17  ? 42   PRO B CB  1 
ATOM   2673  C CG  . PRO B 1 42  ? 23.324  -21.338 56.724  1.00 65.86  ? 42   PRO B CG  1 
ATOM   2674  C CD  . PRO B 1 42  ? 24.268  -21.107 55.610  1.00 61.80  ? 42   PRO B CD  1 
ATOM   2675  N N   . ILE B 1 43  ? 25.404  -17.458 58.283  1.00 61.91  ? 43   ILE B N   1 
ATOM   2676  C CA  . ILE B 1 43  ? 26.566  -16.891 58.978  1.00 62.84  ? 43   ILE B CA  1 
ATOM   2677  C C   . ILE B 1 43  ? 26.203  -16.457 60.418  1.00 69.39  ? 43   ILE B C   1 
ATOM   2678  O O   . ILE B 1 43  ? 27.089  -16.049 61.175  1.00 69.01  ? 43   ILE B O   1 
ATOM   2679  C CB  . ILE B 1 43  ? 27.212  -15.726 58.174  1.00 64.79  ? 43   ILE B CB  1 
ATOM   2680  C CG1 . ILE B 1 43  ? 26.174  -14.650 57.765  1.00 63.13  ? 43   ILE B CG1 1 
ATOM   2681  C CG2 . ILE B 1 43  ? 28.005  -16.266 56.970  1.00 66.72  ? 43   ILE B CG2 1 
ATOM   2682  C CD1 . ILE B 1 43  ? 26.749  -13.287 57.505  1.00 69.42  ? 43   ILE B CD1 1 
ATOM   2683  N N   . GLY B 1 44  ? 24.916  -16.549 60.763  1.00 68.03  ? 44   GLY B N   1 
ATOM   2684  C CA  . GLY B 1 44  ? 24.389  -16.186 62.073  1.00 68.46  ? 44   GLY B CA  1 
ATOM   2685  C C   . GLY B 1 44  ? 24.669  -17.237 63.129  1.00 77.43  ? 44   GLY B C   1 
ATOM   2686  N N   . GLN B 1 45  ? 25.140  -16.822 64.320  1.00 76.20  ? 45   GLN B N   1 
ATOM   2687  C CA  . GLN B 1 45  ? 26.564  -16.853 64.676  1.00 77.63  ? 45   GLN B CA  1 
ATOM   2688  C C   . GLN B 1 45  ? 27.199  -18.230 64.394  1.00 85.42  ? 45   GLN B C   1 
ATOM   2689  O O   . GLN B 1 45  ? 26.607  -19.273 64.677  1.00 86.64  ? 45   GLN B O   1 
ATOM   2690  C CB  . GLN B 1 45  ? 26.759  -16.471 66.151  1.00 78.32  ? 45   GLN B CB  1 
ATOM   2691  N N   . PHE B 1 48  ? 22.980  -12.780 67.806  1.00 69.96  ? 48   PHE B N   1 
ATOM   2692  C CA  . PHE B 1 48  ? 23.165  -14.191 67.483  1.00 71.54  ? 48   PHE B CA  1 
ATOM   2693  C C   . PHE B 1 48  ? 21.842  -14.825 66.968  1.00 76.28  ? 48   PHE B C   1 
ATOM   2694  O O   . PHE B 1 48  ? 21.431  -15.891 67.446  1.00 78.13  ? 48   PHE B O   1 
ATOM   2695  C CB  . PHE B 1 48  ? 23.714  -14.953 68.704  1.00 74.44  ? 48   PHE B CB  1 
ATOM   2696  N N   . GLY B 1 49  ? 21.218  -14.170 65.979  1.00 69.97  ? 49   GLY B N   1 
ATOM   2697  C CA  . GLY B 1 49  ? 19.969  -14.616 65.362  1.00 68.42  ? 49   GLY B CA  1 
ATOM   2698  C C   . GLY B 1 49  ? 20.141  -15.329 64.032  1.00 69.17  ? 49   GLY B C   1 
ATOM   2699  O O   . GLY B 1 49  ? 21.268  -15.630 63.628  1.00 69.71  ? 49   GLY B O   1 
ATOM   2700  N N   . CYS B 1 50  ? 19.012  -15.607 63.343  1.00 62.55  ? 50   CYS B N   1 
ATOM   2701  C CA  . CYS B 1 50  ? 18.961  -16.284 62.035  1.00 61.71  ? 50   CYS B CA  1 
ATOM   2702  C C   . CYS B 1 50  ? 19.427  -15.320 60.907  1.00 58.79  ? 50   CYS B C   1 
ATOM   2703  O O   . CYS B 1 50  ? 18.669  -14.442 60.493  1.00 56.74  ? 50   CYS B O   1 
ATOM   2704  C CB  . CYS B 1 50  ? 17.553  -16.821 61.779  1.00 62.74  ? 50   CYS B CB  1 
ATOM   2705  S SG  . CYS B 1 50  ? 17.423  -17.950 60.367  1.00 68.32  ? 50   CYS B SG  1 
ATOM   2706  N N   . ILE B 1 51  ? 20.695  -15.468 60.446  1.00 52.20  ? 51   ILE B N   1 
ATOM   2707  C CA  . ILE B 1 51  ? 21.318  -14.613 59.423  1.00 49.61  ? 51   ILE B CA  1 
ATOM   2708  C C   . ILE B 1 51  ? 21.999  -15.461 58.323  1.00 54.81  ? 51   ILE B C   1 
ATOM   2709  O O   . ILE B 1 51  ? 22.738  -16.409 58.621  1.00 55.51  ? 51   ILE B O   1 
ATOM   2710  C CB  . ILE B 1 51  ? 22.334  -13.599 60.056  1.00 50.80  ? 51   ILE B CB  1 
ATOM   2711  C CG1 . ILE B 1 51  ? 21.665  -12.685 61.102  1.00 49.25  ? 51   ILE B CG1 1 
ATOM   2712  C CG2 . ILE B 1 51  ? 23.064  -12.762 58.986  1.00 50.27  ? 51   ILE B CG2 1 
ATOM   2713  C CD1 . ILE B 1 51  ? 22.607  -12.067 62.121  1.00 52.70  ? 51   ILE B CD1 1 
ATOM   2714  N N   . TYR B 1 52  ? 21.747  -15.088 57.052  1.00 50.61  ? 52   TYR B N   1 
ATOM   2715  C CA  . TYR B 1 52  ? 22.354  -15.683 55.856  1.00 50.97  ? 52   TYR B CA  1 
ATOM   2716  C C   . TYR B 1 52  ? 23.008  -14.599 55.018  1.00 51.77  ? 52   TYR B C   1 
ATOM   2717  O O   . TYR B 1 52  ? 22.587  -13.444 55.078  1.00 48.99  ? 52   TYR B O   1 
ATOM   2718  C CB  . TYR B 1 52  ? 21.303  -16.395 54.972  1.00 52.99  ? 52   TYR B CB  1 
ATOM   2719  C CG  . TYR B 1 52  ? 20.489  -17.486 55.629  1.00 56.62  ? 52   TYR B CG  1 
ATOM   2720  C CD1 . TYR B 1 52  ? 19.391  -17.180 56.427  1.00 58.45  ? 52   TYR B CD1 1 
ATOM   2721  C CD2 . TYR B 1 52  ? 20.746  -18.828 55.366  1.00 59.22  ? 52   TYR B CD2 1 
ATOM   2722  C CE1 . TYR B 1 52  ? 18.626  -18.181 57.020  1.00 61.26  ? 52   TYR B CE1 1 
ATOM   2723  C CE2 . TYR B 1 52  ? 19.982  -19.840 55.944  1.00 61.17  ? 52   TYR B CE2 1 
ATOM   2724  C CZ  . TYR B 1 52  ? 18.916  -19.511 56.765  1.00 70.48  ? 52   TYR B CZ  1 
ATOM   2725  O OH  . TYR B 1 52  ? 18.176  -20.507 57.354  1.00 75.03  ? 52   TYR B OH  1 
ATOM   2726  N N   . LEU B 1 53  ? 23.977  -14.976 54.177  1.00 48.54  ? 53   LEU B N   1 
ATOM   2727  C CA  . LEU B 1 53  ? 24.570  -14.054 53.211  1.00 47.05  ? 53   LEU B CA  1 
ATOM   2728  C C   . LEU B 1 53  ? 23.538  -13.833 52.101  1.00 48.39  ? 53   LEU B C   1 
ATOM   2729  O O   . LEU B 1 53  ? 22.717  -14.717 51.850  1.00 47.70  ? 53   LEU B O   1 
ATOM   2730  C CB  . LEU B 1 53  ? 25.893  -14.599 52.636  1.00 48.49  ? 53   LEU B CB  1 
ATOM   2731  C CG  . LEU B 1 53  ? 27.104  -14.630 53.563  1.00 52.78  ? 53   LEU B CG  1 
ATOM   2732  C CD1 . LEU B 1 53  ? 28.179  -15.516 52.993  1.00 54.94  ? 53   LEU B CD1 1 
ATOM   2733  C CD2 . LEU B 1 53  ? 27.657  -13.246 53.797  1.00 53.24  ? 53   LEU B CD2 1 
ATOM   2734  N N   . ALA B 1 54  ? 23.530  -12.653 51.484  1.00 42.84  ? 54   ALA B N   1 
ATOM   2735  C CA  . ALA B 1 54  ? 22.559  -12.342 50.440  1.00 41.55  ? 54   ALA B CA  1 
ATOM   2736  C C   . ALA B 1 54  ? 23.131  -11.397 49.399  1.00 44.88  ? 54   ALA B C   1 
ATOM   2737  O O   . ALA B 1 54  ? 24.147  -10.748 49.639  1.00 45.19  ? 54   ALA B O   1 
ATOM   2738  C CB  . ALA B 1 54  ? 21.299  -11.739 51.053  1.00 40.74  ? 54   ALA B CB  1 
ATOM   2739  N N   . ASP B 1 55  ? 22.475  -11.323 48.239  1.00 40.38  ? 55   ASP B N   1 
ATOM   2740  C CA  . ASP B 1 55  ? 22.831  -10.439 47.129  1.00 40.05  ? 55   ASP B CA  1 
ATOM   2741  C C   . ASP B 1 55  ? 21.626  -10.272 46.228  1.00 43.25  ? 55   ASP B C   1 
ATOM   2742  O O   . ASP B 1 55  ? 20.641  -11.003 46.382  1.00 42.15  ? 55   ASP B O   1 
ATOM   2743  C CB  . ASP B 1 55  ? 24.041  -11.011 46.333  1.00 43.18  ? 55   ASP B CB  1 
ATOM   2744  C CG  . ASP B 1 55  ? 24.848  -10.002 45.521  1.00 49.39  ? 55   ASP B CG  1 
ATOM   2745  O OD1 . ASP B 1 55  ? 24.416  -8.824  45.421  1.00 46.95  ? 55   ASP B OD1 1 
ATOM   2746  O OD2 . ASP B 1 55  ? 25.928  -10.380 45.013  1.00 57.57  ? 55   ASP B OD2 1 
ATOM   2747  N N   . MET B 1 56  ? 21.707  -9.330  45.271  1.00 40.46  ? 56   MET B N   1 
ATOM   2748  C CA  . MET B 1 56  ? 20.697  -9.131  44.234  1.00 39.19  ? 56   MET B CA  1 
ATOM   2749  C C   . MET B 1 56  ? 20.594  -10.407 43.415  1.00 44.58  ? 56   MET B C   1 
ATOM   2750  O O   . MET B 1 56  ? 21.613  -11.062 43.183  1.00 46.73  ? 56   MET B O   1 
ATOM   2751  C CB  . MET B 1 56  ? 21.102  -7.969  43.319  1.00 41.08  ? 56   MET B CB  1 
ATOM   2752  C CG  . MET B 1 56  ? 20.966  -6.605  43.930  1.00 42.70  ? 56   MET B CG  1 
ATOM   2753  S SD  . MET B 1 56  ? 21.640  -5.443  42.712  1.00 46.49  ? 56   MET B SD  1 
ATOM   2754  C CE  . MET B 1 56  ? 20.153  -4.921  41.916  1.00 41.56  ? 56   MET B CE  1 
ATOM   2755  N N   . ASN B 1 57  ? 19.384  -10.759 42.981  1.00 40.50  ? 57   ASN B N   1 
ATOM   2756  C CA  . ASN B 1 57  ? 19.111  -11.948 42.186  1.00 41.37  ? 57   ASN B CA  1 
ATOM   2757  C C   . ASN B 1 57  ? 19.843  -11.896 40.841  1.00 49.26  ? 57   ASN B C   1 
ATOM   2758  O O   . ASN B 1 57  ? 19.760  -10.898 40.124  1.00 48.79  ? 57   ASN B O   1 
ATOM   2759  C CB  . ASN B 1 57  ? 17.601  -12.088 41.982  1.00 40.44  ? 57   ASN B CB  1 
ATOM   2760  C CG  . ASN B 1 57  ? 17.166  -13.292 41.193  1.00 57.11  ? 57   ASN B CG  1 
ATOM   2761  O OD1 . ASN B 1 57  ? 17.560  -14.424 41.477  1.00 54.07  ? 57   ASN B OD1 1 
ATOM   2762  N ND2 . ASN B 1 57  ? 16.325  -13.069 40.189  1.00 47.02  ? 57   ASN B ND2 1 
ATOM   2763  N N   . SER B 1 58  ? 20.589  -12.974 40.528  1.00 50.00  ? 58   SER B N   1 
ATOM   2764  C CA  . SER B 1 58  ? 21.342  -13.146 39.283  1.00 52.20  ? 58   SER B CA  1 
ATOM   2765  C C   . SER B 1 58  ? 21.506  -14.628 38.952  1.00 60.74  ? 58   SER B C   1 
ATOM   2766  O O   . SER B 1 58  ? 21.115  -15.482 39.748  1.00 60.75  ? 58   SER B O   1 
ATOM   2767  C CB  . SER B 1 58  ? 22.704  -12.458 39.356  1.00 56.26  ? 58   SER B CB  1 
ATOM   2768  O OG  . SER B 1 58  ? 23.574  -13.067 40.294  1.00 68.34  ? 58   SER B OG  1 
ATOM   2769  N N   . SER B 1 59  ? 22.074  -14.928 37.769  1.00 61.26  ? 59   SER B N   1 
ATOM   2770  C CA  . SER B 1 59  ? 22.346  -16.282 37.283  1.00 63.52  ? 59   SER B CA  1 
ATOM   2771  C C   . SER B 1 59  ? 23.404  -16.970 38.154  1.00 69.74  ? 59   SER B C   1 
ATOM   2772  O O   . SER B 1 59  ? 23.339  -18.185 38.341  1.00 71.46  ? 59   SER B O   1 
ATOM   2773  C CB  . SER B 1 59  ? 22.803  -16.241 35.826  1.00 67.69  ? 59   SER B CB  1 
ATOM   2774  N N   . GLU B 1 60  ? 24.356  -16.185 38.699  1.00 65.73  ? 60   GLU B N   1 
ATOM   2775  C CA  . GLU B 1 60  ? 25.440  -16.660 39.559  1.00 66.65  ? 60   GLU B CA  1 
ATOM   2776  C C   . GLU B 1 60  ? 24.962  -16.882 40.998  1.00 70.38  ? 60   GLU B C   1 
ATOM   2777  O O   . GLU B 1 60  ? 24.079  -16.163 41.480  1.00 68.43  ? 60   GLU B O   1 
ATOM   2778  C CB  . GLU B 1 60  ? 26.610  -15.659 39.545  1.00 68.12  ? 60   GLU B CB  1 
ATOM   2779  C CG  . GLU B 1 60  ? 27.497  -15.761 38.316  1.00 80.30  ? 60   GLU B CG  1 
ATOM   2780  N N   . SER B 1 61  ? 25.569  -17.861 41.693  1.00 68.23  ? 61   SER B N   1 
ATOM   2781  C CA  . SER B 1 61  ? 25.258  -18.161 43.094  1.00 67.49  ? 61   SER B CA  1 
ATOM   2782  C C   . SER B 1 61  ? 25.809  -17.059 44.027  1.00 69.47  ? 61   SER B C   1 
ATOM   2783  O O   . SER B 1 61  ? 26.697  -16.305 43.622  1.00 69.90  ? 61   SER B O   1 
ATOM   2784  C CB  . SER B 1 61  ? 25.831  -19.521 43.485  1.00 72.95  ? 61   SER B CB  1 
ATOM   2785  O OG  . SER B 1 61  ? 27.247  -19.521 43.412  1.00 83.89  ? 61   SER B OG  1 
ATOM   2786  N N   . VAL B 1 62  ? 25.289  -16.967 45.264  1.00 63.40  ? 62   VAL B N   1 
ATOM   2787  C CA  . VAL B 1 62  ? 25.757  -15.976 46.240  1.00 61.76  ? 62   VAL B CA  1 
ATOM   2788  C C   . VAL B 1 62  ? 27.071  -16.492 46.842  1.00 68.02  ? 62   VAL B C   1 
ATOM   2789  O O   . VAL B 1 62  ? 27.102  -17.587 47.410  1.00 68.53  ? 62   VAL B O   1 
ATOM   2790  C CB  . VAL B 1 62  ? 24.682  -15.648 47.315  1.00 62.82  ? 62   VAL B CB  1 
ATOM   2791  C CG1 . VAL B 1 62  ? 25.245  -14.783 48.435  1.00 61.10  ? 62   VAL B CG1 1 
ATOM   2792  C CG2 . VAL B 1 62  ? 23.484  -14.967 46.680  1.00 61.26  ? 62   VAL B CG2 1 
ATOM   2793  N N   . GLY B 1 63  ? 28.135  -15.705 46.684  1.00 65.29  ? 63   GLY B N   1 
ATOM   2794  C CA  . GLY B 1 63  ? 29.468  -16.054 47.159  1.00 66.80  ? 63   GLY B CA  1 
ATOM   2795  C C   . GLY B 1 63  ? 29.791  -15.672 48.589  1.00 71.07  ? 63   GLY B C   1 
ATOM   2796  O O   . GLY B 1 63  ? 28.939  -15.160 49.323  1.00 68.80  ? 63   GLY B O   1 
ATOM   2797  N N   . SER B 1 64  ? 31.050  -15.923 48.991  1.00 69.71  ? 64   SER B N   1 
ATOM   2798  C CA  . SER B 1 64  ? 31.571  -15.590 50.319  1.00 69.15  ? 64   SER B CA  1 
ATOM   2799  C C   . SER B 1 64  ? 31.799  -14.079 50.447  1.00 70.94  ? 64   SER B C   1 
ATOM   2800  O O   . SER B 1 64  ? 31.852  -13.561 51.562  1.00 68.94  ? 64   SER B O   1 
ATOM   2801  C CB  . SER B 1 64  ? 32.870  -16.347 50.584  1.00 74.95  ? 64   SER B CB  1 
ATOM   2802  N N   . ASP B 1 65  ? 31.929  -13.384 49.294  1.00 67.73  ? 65   ASP B N   1 
ATOM   2803  C CA  . ASP B 1 65  ? 32.147  -11.938 49.166  1.00 66.40  ? 65   ASP B CA  1 
ATOM   2804  C C   . ASP B 1 65  ? 30.809  -11.146 49.046  1.00 65.83  ? 65   ASP B C   1 
ATOM   2805  O O   . ASP B 1 65  ? 30.830  -9.970  48.661  1.00 64.92  ? 65   ASP B O   1 
ATOM   2806  C CB  . ASP B 1 65  ? 33.032  -11.664 47.930  1.00 70.21  ? 65   ASP B CB  1 
ATOM   2807  C CG  . ASP B 1 65  ? 32.387  -12.068 46.626  1.00 86.93  ? 65   ASP B CG  1 
ATOM   2808  O OD1 . ASP B 1 65  ? 32.394  -13.277 46.312  1.00 90.29  ? 65   ASP B OD1 1 
ATOM   2809  O OD2 . ASP B 1 65  ? 31.847  -11.178 45.930  1.00 94.63  ? 65   ASP B OD2 1 
ATOM   2810  N N   . ALA B 1 66  ? 29.662  -11.788 49.380  1.00 58.70  ? 66   ALA B N   1 
ATOM   2811  C CA  . ALA B 1 66  ? 28.314  -11.214 49.306  1.00 55.16  ? 66   ALA B CA  1 
ATOM   2812  C C   . ALA B 1 66  ? 28.225  -9.826  49.979  1.00 54.49  ? 66   ALA B C   1 
ATOM   2813  O O   . ALA B 1 66  ? 28.749  -9.666  51.075  1.00 54.11  ? 66   ALA B O   1 
ATOM   2814  C CB  . ALA B 1 66  ? 27.319  -12.160 49.947  1.00 55.24  ? 66   ALA B CB  1 
ATOM   2815  N N   . PRO B 1 67  ? 27.606  -8.813  49.329  1.00 47.37  ? 67   PRO B N   1 
ATOM   2816  C CA  . PRO B 1 67  ? 27.558  -7.469  49.932  1.00 45.08  ? 67   PRO B CA  1 
ATOM   2817  C C   . PRO B 1 67  ? 26.394  -7.244  50.905  1.00 45.83  ? 67   PRO B C   1 
ATOM   2818  O O   . PRO B 1 67  ? 26.358  -6.209  51.585  1.00 43.45  ? 67   PRO B O   1 
ATOM   2819  C CB  . PRO B 1 67  ? 27.414  -6.549  48.719  1.00 46.80  ? 67   PRO B CB  1 
ATOM   2820  C CG  . PRO B 1 67  ? 26.682  -7.371  47.710  1.00 51.94  ? 67   PRO B CG  1 
ATOM   2821  C CD  . PRO B 1 67  ? 26.965  -8.827  47.998  1.00 48.77  ? 67   PRO B CD  1 
ATOM   2822  N N   . CYS B 1 68  ? 25.459  -8.198  50.988  1.00 41.85  ? 68   CYS B N   1 
ATOM   2823  C CA  . CYS B 1 68  ? 24.286  -8.096  51.863  1.00 40.31  ? 68   CYS B CA  1 
ATOM   2824  C C   . CYS B 1 68  ? 24.151  -9.308  52.778  1.00 44.87  ? 68   CYS B C   1 
ATOM   2825  O O   . CYS B 1 68  ? 24.775  -10.346 52.546  1.00 46.06  ? 68   CYS B O   1 
ATOM   2826  C CB  . CYS B 1 68  ? 23.012  -7.914  51.036  1.00 39.69  ? 68   CYS B CB  1 
ATOM   2827  S SG  . CYS B 1 68  ? 22.902  -6.337  50.178  1.00 43.07  ? 68   CYS B SG  1 
ATOM   2828  N N   . VAL B 1 69  ? 23.325  -9.159  53.828  1.00 39.52  ? 69   VAL B N   1 
ATOM   2829  C CA  . VAL B 1 69  ? 22.924  -10.225 54.743  1.00 39.45  ? 69   VAL B CA  1 
ATOM   2830  C C   . VAL B 1 69  ? 21.394  -10.154 54.888  1.00 42.51  ? 69   VAL B C   1 
ATOM   2831  O O   . VAL B 1 69  ? 20.819  -9.060  54.785  1.00 41.07  ? 69   VAL B O   1 
ATOM   2832  C CB  . VAL B 1 69  ? 23.641  -10.263 56.129  1.00 43.39  ? 69   VAL B CB  1 
ATOM   2833  C CG1 . VAL B 1 69  ? 25.154  -10.383 55.985  1.00 44.16  ? 69   VAL B CG1 1 
ATOM   2834  C CG2 . VAL B 1 69  ? 23.251  -9.084  57.025  1.00 41.72  ? 69   VAL B CG2 1 
ATOM   2835  N N   . VAL B 1 70  ? 20.739  -11.311 55.098  1.00 39.24  ? 70   VAL B N   1 
ATOM   2836  C CA  . VAL B 1 70  ? 19.292  -11.355 55.316  1.00 38.26  ? 70   VAL B CA  1 
ATOM   2837  C C   . VAL B 1 70  ? 19.049  -11.867 56.752  1.00 41.80  ? 70   VAL B C   1 
ATOM   2838  O O   . VAL B 1 70  ? 19.495  -12.959 57.105  1.00 42.05  ? 70   VAL B O   1 
ATOM   2839  C CB  . VAL B 1 70  ? 18.470  -12.108 54.215  1.00 42.65  ? 70   VAL B CB  1 
ATOM   2840  C CG1 . VAL B 1 70  ? 18.951  -13.545 53.984  1.00 43.98  ? 70   VAL B CG1 1 
ATOM   2841  C CG2 . VAL B 1 70  ? 16.964  -12.057 54.485  1.00 41.46  ? 70   VAL B CG2 1 
ATOM   2842  N N   . LYS B 1 71  ? 18.388  -11.027 57.579  1.00 37.60  ? 71   LYS B N   1 
ATOM   2843  C CA  . LYS B 1 71  ? 18.037  -11.280 58.985  1.00 37.57  ? 71   LYS B CA  1 
ATOM   2844  C C   . LYS B 1 71  ? 16.565  -11.739 59.066  1.00 40.70  ? 71   LYS B C   1 
ATOM   2845  O O   . LYS B 1 71  ? 15.673  -11.032 58.592  1.00 39.44  ? 71   LYS B O   1 
ATOM   2846  C CB  . LYS B 1 71  ? 18.294  -10.006 59.828  1.00 39.17  ? 71   LYS B CB  1 
ATOM   2847  C CG  . LYS B 1 71  ? 18.266  -10.206 61.328  1.00 64.52  ? 71   LYS B CG  1 
ATOM   2848  C CD  . LYS B 1 71  ? 18.601  -8.919  62.101  1.00 77.14  ? 71   LYS B CD  1 
ATOM   2849  C CE  . LYS B 1 71  ? 18.419  -9.092  63.598  1.00 89.44  ? 71   LYS B CE  1 
ATOM   2850  N NZ  . LYS B 1 71  ? 19.531  -9.855  64.231  1.00 101.31 ? 71   LYS B NZ  1 
ATOM   2851  N N   . VAL B 1 72  ? 16.334  -12.958 59.600  1.00 37.36  ? 72   VAL B N   1 
ATOM   2852  C CA  . VAL B 1 72  ? 15.003  -13.562 59.767  1.00 37.11  ? 72   VAL B CA  1 
ATOM   2853  C C   . VAL B 1 72  ? 14.705  -13.795 61.247  1.00 42.08  ? 72   VAL B C   1 
ATOM   2854  O O   . VAL B 1 72  ? 15.587  -14.187 62.007  1.00 42.73  ? 72   VAL B O   1 
ATOM   2855  C CB  . VAL B 1 72  ? 14.801  -14.887 58.979  1.00 41.90  ? 72   VAL B CB  1 
ATOM   2856  C CG1 . VAL B 1 72  ? 13.340  -15.081 58.599  1.00 41.29  ? 72   VAL B CG1 1 
ATOM   2857  C CG2 . VAL B 1 72  ? 15.674  -14.935 57.739  1.00 42.09  ? 72   VAL B CG2 1 
ATOM   2858  N N   . GLU B 1 73  ? 13.458  -13.515 61.640  1.00 38.36  ? 73   GLU B N   1 
ATOM   2859  C CA  . GLU B 1 73  ? 12.856  -13.718 62.958  1.00 38.27  ? 73   GLU B CA  1 
ATOM   2860  C C   . GLU B 1 73  ? 11.373  -14.024 62.759  1.00 41.76  ? 73   GLU B C   1 
ATOM   2861  O O   . GLU B 1 73  ? 10.824  -13.601 61.734  1.00 40.57  ? 73   GLU B O   1 
ATOM   2862  C CB  . GLU B 1 73  ? 13.021  -12.476 63.879  1.00 38.57  ? 73   GLU B CB  1 
ATOM   2863  C CG  . GLU B 1 73  ? 14.414  -12.209 64.437  1.00 47.41  ? 73   GLU B CG  1 
ATOM   2864  C CD  . GLU B 1 73  ? 15.065  -13.283 65.291  1.00 67.26  ? 73   GLU B CD  1 
ATOM   2865  O OE1 . GLU B 1 73  ? 14.339  -14.123 65.871  1.00 60.31  ? 73   GLU B OE1 1 
ATOM   2866  O OE2 . GLU B 1 73  ? 16.312  -13.263 65.404  1.00 63.78  ? 73   GLU B OE2 1 
ATOM   2867  N N   . PRO B 1 74  ? 10.667  -14.694 63.705  1.00 39.76  ? 74   PRO B N   1 
ATOM   2868  C CA  . PRO B 1 74  ? 9.214   -14.856 63.532  1.00 40.60  ? 74   PRO B CA  1 
ATOM   2869  C C   . PRO B 1 74  ? 8.545   -13.477 63.423  1.00 45.37  ? 74   PRO B C   1 
ATOM   2870  O O   . PRO B 1 74  ? 9.000   -12.528 64.064  1.00 43.26  ? 74   PRO B O   1 
ATOM   2871  C CB  . PRO B 1 74  ? 8.780   -15.619 64.795  1.00 43.06  ? 74   PRO B CB  1 
ATOM   2872  C CG  . PRO B 1 74  ? 10.015  -16.232 65.321  1.00 47.46  ? 74   PRO B CG  1 
ATOM   2873  C CD  . PRO B 1 74  ? 11.106  -15.261 64.995  1.00 41.88  ? 74   PRO B CD  1 
ATOM   2874  N N   . SER B 1 75  ? 7.498   -13.357 62.590  1.00 44.91  ? 75   SER B N   1 
ATOM   2875  C CA  . SER B 1 75  ? 6.773   -12.103 62.335  1.00 45.23  ? 75   SER B CA  1 
ATOM   2876  C C   . SER B 1 75  ? 6.291   -11.373 63.629  1.00 51.92  ? 75   SER B C   1 
ATOM   2877  O O   . SER B 1 75  ? 6.159   -10.143 63.608  1.00 51.40  ? 75   SER B O   1 
ATOM   2878  C CB  . SER B 1 75  ? 5.586   -12.357 61.410  1.00 49.17  ? 75   SER B CB  1 
ATOM   2879  O OG  . SER B 1 75  ? 4.678   -13.286 61.978  1.00 60.80  ? 75   SER B OG  1 
ATOM   2880  N N   . ASP B 1 76  ? 6.086   -12.116 64.744  1.00 50.36  ? 76   ASP B N   1 
ATOM   2881  C CA  . ASP B 1 76  ? 5.617   -11.595 66.029  1.00 50.86  ? 76   ASP B CA  1 
ATOM   2882  C C   . ASP B 1 76  ? 6.767   -11.087 66.949  1.00 54.37  ? 76   ASP B C   1 
ATOM   2883  O O   . ASP B 1 76  ? 6.486   -10.622 68.063  1.00 54.22  ? 76   ASP B O   1 
ATOM   2884  C CB  . ASP B 1 76  ? 4.781   -12.670 66.767  1.00 54.92  ? 76   ASP B CB  1 
ATOM   2885  C CG  . ASP B 1 76  ? 5.444   -14.032 66.924  1.00 71.63  ? 76   ASP B CG  1 
ATOM   2886  O OD1 . ASP B 1 76  ? 6.366   -14.157 67.765  1.00 72.49  ? 76   ASP B OD1 1 
ATOM   2887  O OD2 . ASP B 1 76  ? 5.010   -14.984 66.241  1.00 82.56  ? 76   ASP B OD2 1 
ATOM   2888  N N   . ASN B 1 77  ? 8.046   -11.171 66.496  1.00 48.88  ? 77   ASN B N   1 
ATOM   2889  C CA  . ASN B 1 77  ? 9.212   -10.743 67.285  1.00 46.25  ? 77   ASN B CA  1 
ATOM   2890  C C   . ASN B 1 77  ? 9.205   -9.224  67.474  1.00 46.52  ? 77   ASN B C   1 
ATOM   2891  O O   . ASN B 1 77  ? 9.098   -8.473  66.498  1.00 46.22  ? 77   ASN B O   1 
ATOM   2892  C CB  . ASN B 1 77  ? 10.516  -11.208 66.619  1.00 44.28  ? 77   ASN B CB  1 
ATOM   2893  C CG  . ASN B 1 77  ? 11.762  -10.997 67.432  1.00 52.63  ? 77   ASN B CG  1 
ATOM   2894  O OD1 . ASN B 1 77  ? 12.538  -10.064 67.201  1.00 42.90  ? 77   ASN B OD1 1 
ATOM   2895  N ND2 . ASN B 1 77  ? 12.016  -11.895 68.362  1.00 44.55  ? 77   ASN B ND2 1 
ATOM   2896  N N   . GLY B 1 78  ? 9.282   -8.806  68.732  1.00 40.76  ? 78   GLY B N   1 
ATOM   2897  C CA  . GLY B 1 78  ? 9.305   -7.404  69.140  1.00 38.66  ? 78   GLY B CA  1 
ATOM   2898  C C   . GLY B 1 78  ? 10.543  -6.649  68.688  1.00 39.24  ? 78   GLY B C   1 
ATOM   2899  O O   . GLY B 1 78  ? 10.397  -5.651  67.984  1.00 37.42  ? 78   GLY B O   1 
ATOM   2900  N N   . PRO B 1 79  ? 11.786  -7.094  69.037  1.00 35.63  ? 79   PRO B N   1 
ATOM   2901  C CA  . PRO B 1 79  ? 12.981  -6.340  68.605  1.00 34.64  ? 79   PRO B CA  1 
ATOM   2902  C C   . PRO B 1 79  ? 13.153  -6.231  67.075  1.00 38.35  ? 79   PRO B C   1 
ATOM   2903  O O   . PRO B 1 79  ? 13.642  -5.199  66.620  1.00 36.08  ? 79   PRO B O   1 
ATOM   2904  C CB  . PRO B 1 79  ? 14.141  -7.111  69.249  1.00 36.58  ? 79   PRO B CB  1 
ATOM   2905  C CG  . PRO B 1 79  ? 13.529  -7.814  70.403  1.00 40.90  ? 79   PRO B CG  1 
ATOM   2906  C CD  . PRO B 1 79  ? 12.168  -8.214  69.925  1.00 37.18  ? 79   PRO B CD  1 
ATOM   2907  N N   . LEU B 1 80  ? 12.736  -7.251  66.278  1.00 37.14  ? 80   LEU B N   1 
ATOM   2908  C CA  . LEU B 1 80  ? 12.856  -7.144  64.817  1.00 37.02  ? 80   LEU B CA  1 
ATOM   2909  C C   . LEU B 1 80  ? 11.923  -6.047  64.290  1.00 37.25  ? 80   LEU B C   1 
ATOM   2910  O O   . LEU B 1 80  ? 12.319  -5.348  63.367  1.00 36.43  ? 80   LEU B O   1 
ATOM   2911  C CB  . LEU B 1 80  ? 12.629  -8.464  64.060  1.00 38.64  ? 80   LEU B CB  1 
ATOM   2912  C CG  . LEU B 1 80  ? 13.253  -8.507  62.626  1.00 44.81  ? 80   LEU B CG  1 
ATOM   2913  C CD1 . LEU B 1 80  ? 14.775  -8.824  62.651  1.00 46.65  ? 80   LEU B CD1 1 
ATOM   2914  C CD2 . LEU B 1 80  ? 12.537  -9.469  61.717  1.00 46.04  ? 80   LEU B CD2 1 
ATOM   2915  N N   . PHE B 1 81  ? 10.736  -5.862  64.908  1.00 31.70  ? 81   PHE B N   1 
ATOM   2916  C CA  . PHE B 1 81  ? 9.790   -4.803  64.554  1.00 30.29  ? 81   PHE B CA  1 
ATOM   2917  C C   . PHE B 1 81  ? 10.383  -3.420  64.873  1.00 34.79  ? 81   PHE B C   1 
ATOM   2918  O O   . PHE B 1 81  ? 10.245  -2.506  64.055  1.00 35.36  ? 81   PHE B O   1 
ATOM   2919  C CB  . PHE B 1 81  ? 8.424   -4.972  65.261  1.00 31.80  ? 81   PHE B CB  1 
ATOM   2920  C CG  . PHE B 1 81  ? 7.448   -3.857  64.928  1.00 32.39  ? 81   PHE B CG  1 
ATOM   2921  C CD1 . PHE B 1 81  ? 6.708   -3.884  63.748  1.00 35.03  ? 81   PHE B CD1 1 
ATOM   2922  C CD2 . PHE B 1 81  ? 7.321   -2.745  65.761  1.00 33.60  ? 81   PHE B CD2 1 
ATOM   2923  C CE1 . PHE B 1 81  ? 5.844   -2.829  63.420  1.00 36.28  ? 81   PHE B CE1 1 
ATOM   2924  C CE2 . PHE B 1 81  ? 6.452   -1.694  65.436  1.00 36.32  ? 81   PHE B CE2 1 
ATOM   2925  C CZ  . PHE B 1 81  ? 5.735   -1.733  64.255  1.00 34.77  ? 81   PHE B CZ  1 
ATOM   2926  N N   . THR B 1 82  ? 11.009  -3.263  66.065  1.00 29.54  ? 82   THR B N   1 
ATOM   2927  C CA  . THR B 1 82  ? 11.657  -2.031  66.511  1.00 27.60  ? 82   THR B CA  1 
ATOM   2928  C C   . THR B 1 82  ? 12.804  -1.690  65.551  1.00 31.89  ? 82   THR B C   1 
ATOM   2929  O O   . THR B 1 82  ? 12.909  -0.543  65.115  1.00 31.47  ? 82   THR B O   1 
ATOM   2930  C CB  . THR B 1 82  ? 12.148  -2.186  67.970  1.00 28.03  ? 82   THR B CB  1 
ATOM   2931  O OG1 . THR B 1 82  ? 11.035  -2.487  68.808  1.00 30.53  ? 82   THR B OG1 1 
ATOM   2932  C CG2 . THR B 1 82  ? 12.885  -0.931  68.516  1.00 18.76  ? 82   THR B CG2 1 
ATOM   2933  N N   . GLU B 1 83  ? 13.641  -2.700  65.213  1.00 27.75  ? 83   GLU B N   1 
ATOM   2934  C CA  . GLU B 1 83  ? 14.796  -2.551  64.342  1.00 26.25  ? 83   GLU B CA  1 
ATOM   2935  C C   . GLU B 1 83  ? 14.363  -2.212  62.913  1.00 29.96  ? 83   GLU B C   1 
ATOM   2936  O O   . GLU B 1 83  ? 14.962  -1.332  62.302  1.00 29.15  ? 83   GLU B O   1 
ATOM   2937  C CB  . GLU B 1 83  ? 15.644  -3.820  64.363  1.00 27.93  ? 83   GLU B CB  1 
ATOM   2938  C CG  . GLU B 1 83  ? 17.006  -3.613  63.728  1.00 34.91  ? 83   GLU B CG  1 
ATOM   2939  C CD  . GLU B 1 83  ? 18.021  -4.689  64.017  1.00 42.62  ? 83   GLU B CD  1 
ATOM   2940  O OE1 . GLU B 1 83  ? 17.663  -5.880  63.884  1.00 38.36  ? 83   GLU B OE1 1 
ATOM   2941  O OE2 . GLU B 1 83  ? 19.178  -4.343  64.345  1.00 41.48  ? 83   GLU B OE2 1 
ATOM   2942  N N   . LEU B 1 84  ? 13.318  -2.900  62.388  1.00 25.37  ? 84   LEU B N   1 
ATOM   2943  C CA  . LEU B 1 84  ? 12.790  -2.660  61.058  1.00 23.54  ? 84   LEU B CA  1 
ATOM   2944  C C   . LEU B 1 84  ? 12.241  -1.239  60.947  1.00 28.29  ? 84   LEU B C   1 
ATOM   2945  O O   . LEU B 1 84  ? 12.496  -0.578  59.941  1.00 29.27  ? 84   LEU B O   1 
ATOM   2946  C CB  . LEU B 1 84  ? 11.703  -3.691  60.695  1.00 23.51  ? 84   LEU B CB  1 
ATOM   2947  C CG  . LEU B 1 84  ? 11.100  -3.630  59.270  1.00 26.28  ? 84   LEU B CG  1 
ATOM   2948  C CD1 . LEU B 1 84  ? 12.178  -3.520  58.180  1.00 23.77  ? 84   LEU B CD1 1 
ATOM   2949  C CD2 . LEU B 1 84  ? 10.213  -4.815  59.015  1.00 28.53  ? 84   LEU B CD2 1 
ATOM   2950  N N   . LYS B 1 85  ? 11.517  -0.765  61.981  1.00 23.62  ? 85   LYS B N   1 
ATOM   2951  C CA  . LYS B 1 85  ? 10.949  0.576   62.016  1.00 22.51  ? 85   LYS B CA  1 
ATOM   2952  C C   . LYS B 1 85  ? 12.048  1.628   61.979  1.00 25.91  ? 85   LYS B C   1 
ATOM   2953  O O   . LYS B 1 85  ? 11.912  2.593   61.234  1.00 25.89  ? 85   LYS B O   1 
ATOM   2954  C CB  . LYS B 1 85  ? 10.031  0.780   63.239  1.00 24.50  ? 85   LYS B CB  1 
ATOM   2955  C CG  . LYS B 1 85  ? 8.591   0.229   63.088  1.00 25.41  ? 85   LYS B CG  1 
ATOM   2956  C CD  . LYS B 1 85  ? 7.925   0.440   61.718  1.00 27.90  ? 85   LYS B CD  1 
ATOM   2957  C CE  . LYS B 1 85  ? 7.612   1.875   61.361  1.00 37.58  ? 85   LYS B CE  1 
ATOM   2958  N NZ  . LYS B 1 85  ? 7.465   2.037   59.888  1.00 47.33  ? 85   LYS B NZ  1 
ATOM   2959  N N   . PHE B 1 86  ? 13.160  1.416   62.716  1.00 22.70  ? 86   PHE B N   1 
ATOM   2960  C CA  . PHE B 1 86  ? 14.303  2.342   62.718  1.00 22.25  ? 86   PHE B CA  1 
ATOM   2961  C C   . PHE B 1 86  ? 14.897  2.464   61.302  1.00 26.83  ? 86   PHE B C   1 
ATOM   2962  O O   . PHE B 1 86  ? 15.095  3.579   60.822  1.00 27.65  ? 86   PHE B O   1 
ATOM   2963  C CB  . PHE B 1 86  ? 15.412  1.912   63.721  1.00 23.52  ? 86   PHE B CB  1 
ATOM   2964  C CG  . PHE B 1 86  ? 16.741  2.570   63.419  1.00 24.34  ? 86   PHE B CG  1 
ATOM   2965  C CD1 . PHE B 1 86  ? 16.999  3.869   63.839  1.00 26.12  ? 86   PHE B CD1 1 
ATOM   2966  C CD2 . PHE B 1 86  ? 17.704  1.917   62.655  1.00 24.94  ? 86   PHE B CD2 1 
ATOM   2967  C CE1 . PHE B 1 86  ? 18.181  4.510   63.486  1.00 26.11  ? 86   PHE B CE1 1 
ATOM   2968  C CE2 . PHE B 1 86  ? 18.894  2.559   62.313  1.00 27.50  ? 86   PHE B CE2 1 
ATOM   2969  C CZ  . PHE B 1 86  ? 19.123  3.849   62.734  1.00 25.09  ? 86   PHE B CZ  1 
ATOM   2970  N N   . TYR B 1 87  ? 15.203  1.316   60.668  1.00 23.43  ? 87   TYR B N   1 
ATOM   2971  C CA  . TYR B 1 87  ? 15.815  1.238   59.351  1.00 24.98  ? 87   TYR B CA  1 
ATOM   2972  C C   . TYR B 1 87  ? 14.913  1.830   58.260  1.00 29.34  ? 87   TYR B C   1 
ATOM   2973  O O   . TYR B 1 87  ? 15.410  2.525   57.376  1.00 28.28  ? 87   TYR B O   1 
ATOM   2974  C CB  . TYR B 1 87  ? 16.214  -0.212  59.019  1.00 27.55  ? 87   TYR B CB  1 
ATOM   2975  C CG  . TYR B 1 87  ? 17.550  -0.618  59.611  1.00 30.78  ? 87   TYR B CG  1 
ATOM   2976  C CD1 . TYR B 1 87  ? 18.730  -0.026  59.186  1.00 33.49  ? 87   TYR B CD1 1 
ATOM   2977  C CD2 . TYR B 1 87  ? 17.637  -1.629  60.563  1.00 31.93  ? 87   TYR B CD2 1 
ATOM   2978  C CE1 . TYR B 1 87  ? 19.960  -0.383  59.734  1.00 34.91  ? 87   TYR B CE1 1 
ATOM   2979  C CE2 . TYR B 1 87  ? 18.868  -2.000  61.118  1.00 33.04  ? 87   TYR B CE2 1 
ATOM   2980  C CZ  . TYR B 1 87  ? 20.026  -1.367  60.705  1.00 39.38  ? 87   TYR B CZ  1 
ATOM   2981  O OH  . TYR B 1 87  ? 21.248  -1.727  61.225  1.00 38.88  ? 87   TYR B OH  1 
ATOM   2982  N N   . GLN B 1 88  ? 13.588  1.591   58.343  1.00 27.56  ? 88   GLN B N   1 
ATOM   2983  C CA  . GLN B 1 88  ? 12.612  2.125   57.382  1.00 26.26  ? 88   GLN B CA  1 
ATOM   2984  C C   . GLN B 1 88  ? 12.508  3.631   57.472  1.00 29.65  ? 88   GLN B C   1 
ATOM   2985  O O   . GLN B 1 88  ? 12.381  4.302   56.451  1.00 30.25  ? 88   GLN B O   1 
ATOM   2986  C CB  . GLN B 1 88  ? 11.233  1.507   57.604  1.00 26.60  ? 88   GLN B CB  1 
ATOM   2987  C CG  . GLN B 1 88  ? 11.093  0.124   56.991  1.00 24.12  ? 88   GLN B CG  1 
ATOM   2988  C CD  . GLN B 1 88  ? 9.682   -0.417  57.062  1.00 36.68  ? 88   GLN B CD  1 
ATOM   2989  O OE1 . GLN B 1 88  ? 8.848   0.033   57.843  1.00 38.09  ? 88   GLN B OE1 1 
ATOM   2990  N NE2 . GLN B 1 88  ? 9.390   -1.409  56.259  1.00 26.12  ? 88   GLN B NE2 1 
ATOM   2991  N N   . ARG B 1 89  ? 12.594  4.160   58.683  1.00 26.42  ? 89   ARG B N   1 
ATOM   2992  C CA  . ARG B 1 89  ? 12.469  5.582   58.942  1.00 26.01  ? 89   ARG B CA  1 
ATOM   2993  C C   . ARG B 1 89  ? 13.736  6.355   58.730  1.00 30.40  ? 89   ARG B C   1 
ATOM   2994  O O   . ARG B 1 89  ? 13.687  7.448   58.193  1.00 31.38  ? 89   ARG B O   1 
ATOM   2995  C CB  . ARG B 1 89  ? 12.037  5.814   60.392  1.00 21.24  ? 89   ARG B CB  1 
ATOM   2996  C CG  . ARG B 1 89  ? 10.584  5.553   60.651  1.00 22.22  ? 89   ARG B CG  1 
ATOM   2997  C CD  . ARG B 1 89  ? 10.355  5.356   62.132  1.00 23.57  ? 89   ARG B CD  1 
ATOM   2998  N NE  . ARG B 1 89  ? 8.932   5.210   62.411  1.00 27.76  ? 89   ARG B NE  1 
ATOM   2999  C CZ  . ARG B 1 89  ? 8.437   4.712   63.535  1.00 35.26  ? 89   ARG B CZ  1 
ATOM   3000  N NH1 . ARG B 1 89  ? 9.248   4.287   64.494  1.00 18.14  ? 89   ARG B NH1 1 
ATOM   3001  N NH2 . ARG B 1 89  ? 7.128   4.618   63.702  1.00 23.92  ? 89   ARG B NH2 1 
ATOM   3002  N N   . ALA B 1 90  ? 14.840  5.856   59.256  1.00 26.66  ? 90   ALA B N   1 
ATOM   3003  C CA  . ALA B 1 90  ? 16.079  6.608   59.317  1.00 26.54  ? 90   ALA B CA  1 
ATOM   3004  C C   . ALA B 1 90  ? 17.227  6.079   58.455  1.00 30.59  ? 90   ALA B C   1 
ATOM   3005  O O   . ALA B 1 90  ? 18.208  6.801   58.310  1.00 28.46  ? 90   ALA B O   1 
ATOM   3006  C CB  . ALA B 1 90  ? 16.538  6.664   60.768  1.00 26.38  ? 90   ALA B CB  1 
ATOM   3007  N N   . ALA B 1 91  ? 17.144  4.859   57.893  1.00 28.11  ? 91   ALA B N   1 
ATOM   3008  C CA  . ALA B 1 91  ? 18.281  4.325   57.159  1.00 28.06  ? 91   ALA B CA  1 
ATOM   3009  C C   . ALA B 1 91  ? 17.986  3.960   55.693  1.00 33.55  ? 91   ALA B C   1 
ATOM   3010  O O   . ALA B 1 91  ? 18.561  3.001   55.161  1.00 33.20  ? 91   ALA B O   1 
ATOM   3011  C CB  . ALA B 1 91  ? 18.844  3.131   57.896  1.00 28.64  ? 91   ALA B CB  1 
ATOM   3012  N N   . LYS B 1 92  ? 17.155  4.765   55.015  1.00 30.49  ? 92   LYS B N   1 
ATOM   3013  C CA  . LYS B 1 92  ? 16.886  4.567   53.589  1.00 30.12  ? 92   LYS B CA  1 
ATOM   3014  C C   . LYS B 1 92  ? 18.158  4.965   52.817  1.00 33.72  ? 92   LYS B C   1 
ATOM   3015  O O   . LYS B 1 92  ? 18.773  5.964   53.194  1.00 33.76  ? 92   LYS B O   1 
ATOM   3016  C CB  . LYS B 1 92  ? 15.663  5.374   53.134  1.00 31.98  ? 92   LYS B CB  1 
ATOM   3017  C CG  . LYS B 1 92  ? 14.351  4.891   53.745  1.00 39.59  ? 92   LYS B CG  1 
ATOM   3018  C CD  . LYS B 1 92  ? 13.158  5.722   53.271  1.00 42.21  ? 92   LYS B CD  1 
ATOM   3019  C CE  . LYS B 1 92  ? 12.979  7.048   53.968  1.00 44.67  ? 92   LYS B CE  1 
ATOM   3020  N NZ  . LYS B 1 92  ? 12.528  6.887   55.381  1.00 56.10  ? 92   LYS B NZ  1 
ATOM   3021  N N   . PRO B 1 93  ? 18.614  4.187   51.799  1.00 29.00  ? 93   PRO B N   1 
ATOM   3022  C CA  . PRO B 1 93  ? 19.895  4.505   51.142  1.00 29.54  ? 93   PRO B CA  1 
ATOM   3023  C C   . PRO B 1 93  ? 20.061  5.964   50.678  1.00 35.96  ? 93   PRO B C   1 
ATOM   3024  O O   . PRO B 1 93  ? 21.147  6.527   50.888  1.00 35.99  ? 93   PRO B O   1 
ATOM   3025  C CB  . PRO B 1 93  ? 19.929  3.535   49.958  1.00 31.30  ? 93   PRO B CB  1 
ATOM   3026  C CG  . PRO B 1 93  ? 19.135  2.370   50.425  1.00 34.36  ? 93   PRO B CG  1 
ATOM   3027  C CD  . PRO B 1 93  ? 18.031  2.939   51.260  1.00 29.37  ? 93   PRO B CD  1 
ATOM   3028  N N   . GLU B 1 94  ? 19.014  6.578   50.079  1.00 33.15  ? 94   GLU B N   1 
ATOM   3029  C CA  . GLU B 1 94  ? 19.060  7.960   49.588  1.00 34.57  ? 94   GLU B CA  1 
ATOM   3030  C C   . GLU B 1 94  ? 19.119  8.960   50.746  1.00 39.46  ? 94   GLU B C   1 
ATOM   3031  O O   . GLU B 1 94  ? 19.760  9.994   50.592  1.00 41.24  ? 94   GLU B O   1 
ATOM   3032  C CB  . GLU B 1 94  ? 17.862  8.255   48.682  1.00 36.61  ? 94   GLU B CB  1 
ATOM   3033  C CG  . GLU B 1 94  ? 18.060  9.408   47.717  1.00 49.55  ? 94   GLU B CG  1 
ATOM   3034  C CD  . GLU B 1 94  ? 17.211  9.311   46.459  1.00 79.33  ? 94   GLU B CD  1 
ATOM   3035  O OE1 . GLU B 1 94  ? 16.053  8.838   46.551  1.00 72.57  ? 94   GLU B OE1 1 
ATOM   3036  O OE2 . GLU B 1 94  ? 17.714  9.689   45.373  1.00 76.83  ? 94   GLU B OE2 1 
ATOM   3037  N N   . GLN B 1 95  ? 18.480  8.644   51.902  1.00 34.99  ? 95   GLN B N   1 
ATOM   3038  C CA  . GLN B 1 95  ? 18.475  9.442   53.139  1.00 34.42  ? 95   GLN B CA  1 
ATOM   3039  C C   . GLN B 1 95  ? 19.900  9.605   53.667  1.00 38.09  ? 95   GLN B C   1 
ATOM   3040  O O   . GLN B 1 95  ? 20.301  10.712  54.023  1.00 39.23  ? 95   GLN B O   1 
ATOM   3041  C CB  . GLN B 1 95  ? 17.606  8.720   54.191  1.00 34.66  ? 95   GLN B CB  1 
ATOM   3042  C CG  . GLN B 1 95  ? 16.942  9.585   55.241  1.00 37.50  ? 95   GLN B CG  1 
ATOM   3043  C CD  . GLN B 1 95  ? 15.904  8.798   55.998  1.00 42.15  ? 95   GLN B CD  1 
ATOM   3044  O OE1 . GLN B 1 95  ? 15.771  7.574   55.864  1.00 34.03  ? 95   GLN B OE1 1 
ATOM   3045  N NE2 . GLN B 1 95  ? 15.142  9.492   56.815  1.00 37.93  ? 95   GLN B NE2 1 
ATOM   3046  N N   . ILE B 1 96  ? 20.660  8.493   53.708  1.00 33.39  ? 96   ILE B N   1 
ATOM   3047  C CA  . ILE B 1 96  ? 22.038  8.421   54.198  1.00 33.18  ? 96   ILE B CA  1 
ATOM   3048  C C   . ILE B 1 96  ? 22.982  9.162   53.220  1.00 40.16  ? 96   ILE B C   1 
ATOM   3049  O O   . ILE B 1 96  ? 23.809  9.960   53.674  1.00 41.10  ? 96   ILE B O   1 
ATOM   3050  C CB  . ILE B 1 96  ? 22.438  6.933   54.443  1.00 34.92  ? 96   ILE B CB  1 
ATOM   3051  C CG1 . ILE B 1 96  ? 21.696  6.372   55.687  1.00 33.22  ? 96   ILE B CG1 1 
ATOM   3052  C CG2 . ILE B 1 96  ? 23.950  6.758   54.595  1.00 36.62  ? 96   ILE B CG2 1 
ATOM   3053  C CD1 . ILE B 1 96  ? 21.779  4.863   55.916  1.00 32.09  ? 96   ILE B CD1 1 
ATOM   3054  N N   . GLN B 1 97  ? 22.843  8.916   51.898  1.00 37.56  ? 97   GLN B N   1 
ATOM   3055  C CA  . GLN B 1 97  ? 23.679  9.535   50.864  1.00 38.88  ? 97   GLN B CA  1 
ATOM   3056  C C   . GLN B 1 97  ? 23.507  11.058  50.798  1.00 42.60  ? 97   GLN B C   1 
ATOM   3057  O O   . GLN B 1 97  ? 24.506  11.763  50.623  1.00 42.72  ? 97   GLN B O   1 
ATOM   3058  C CB  . GLN B 1 97  ? 23.423  8.911   49.480  1.00 40.98  ? 97   GLN B CB  1 
ATOM   3059  C CG  . GLN B 1 97  ? 24.069  7.529   49.284  1.00 58.50  ? 97   GLN B CG  1 
ATOM   3060  C CD  . GLN B 1 97  ? 25.543  7.442   49.634  1.00 78.13  ? 97   GLN B CD  1 
ATOM   3061  O OE1 . GLN B 1 97  ? 25.970  6.570   50.409  1.00 73.05  ? 97   GLN B OE1 1 
ATOM   3062  N NE2 . GLN B 1 97  ? 26.355  8.332   49.069  1.00 68.15  ? 97   GLN B NE2 1 
ATOM   3063  N N   . LYS B 1 98  ? 22.264  11.556  50.974  1.00 38.60  ? 98   LYS B N   1 
ATOM   3064  C CA  . LYS B 1 98  ? 21.966  12.988  51.003  1.00 39.52  ? 98   LYS B CA  1 
ATOM   3065  C C   . LYS B 1 98  ? 22.702  13.641  52.187  1.00 43.59  ? 98   LYS B C   1 
ATOM   3066  O O   . LYS B 1 98  ? 23.318  14.686  51.999  1.00 44.89  ? 98   LYS B O   1 
ATOM   3067  C CB  . LYS B 1 98  ? 20.449  13.235  51.068  1.00 41.97  ? 98   LYS B CB  1 
ATOM   3068  C CG  . LYS B 1 98  ? 20.047  14.685  50.807  1.00 55.57  ? 98   LYS B CG  1 
ATOM   3069  C CD  . LYS B 1 98  ? 18.544  14.827  50.630  1.00 67.57  ? 98   LYS B CD  1 
ATOM   3070  C CE  . LYS B 1 98  ? 18.054  16.235  50.901  1.00 83.53  ? 98   LYS B CE  1 
ATOM   3071  N NZ  . LYS B 1 98  ? 17.833  16.496  52.354  1.00 93.03  ? 98   LYS B NZ  1 
ATOM   3072  N N   . TRP B 1 99  ? 22.691  12.983  53.369  1.00 39.02  ? 99   TRP B N   1 
ATOM   3073  C CA  . TRP B 1 99  ? 23.368  13.424  54.594  1.00 39.10  ? 99   TRP B CA  1 
ATOM   3074  C C   . TRP B 1 99  ? 24.887  13.442  54.403  1.00 43.98  ? 99   TRP B C   1 
ATOM   3075  O O   . TRP B 1 99  ? 25.523  14.412  54.809  1.00 44.23  ? 99   TRP B O   1 
ATOM   3076  C CB  . TRP B 1 99  ? 22.990  12.521  55.778  1.00 36.35  ? 99   TRP B CB  1 
ATOM   3077  C CG  . TRP B 1 99  ? 23.561  12.950  57.097  1.00 37.27  ? 99   TRP B CG  1 
ATOM   3078  C CD1 . TRP B 1 99  ? 24.778  12.612  57.610  1.00 40.22  ? 99   TRP B CD1 1 
ATOM   3079  C CD2 . TRP B 1 99  ? 22.892  13.708  58.119  1.00 36.86  ? 99   TRP B CD2 1 
ATOM   3080  N NE1 . TRP B 1 99  ? 24.928  13.147  58.867  1.00 39.33  ? 99   TRP B NE1 1 
ATOM   3081  C CE2 . TRP B 1 99  ? 23.777  13.801  59.217  1.00 40.14  ? 99   TRP B CE2 1 
ATOM   3082  C CE3 . TRP B 1 99  ? 21.616  14.294  58.226  1.00 37.77  ? 99   TRP B CE3 1 
ATOM   3083  C CZ2 . TRP B 1 99  ? 23.446  14.490  60.392  1.00 39.15  ? 99   TRP B CZ2 1 
ATOM   3084  C CZ3 . TRP B 1 99  ? 21.284  14.962  59.404  1.00 38.57  ? 99   TRP B CZ3 1 
ATOM   3085  C CH2 . TRP B 1 99  ? 22.189  15.047  60.469  1.00 38.94  ? 99   TRP B CH2 1 
ATOM   3086  N N   . ILE B 1 100 ? 25.467  12.372  53.813  1.00 40.31  ? 100  ILE B N   1 
ATOM   3087  C CA  . ILE B 1 100 ? 26.910  12.252  53.570  1.00 41.20  ? 100  ILE B CA  1 
ATOM   3088  C C   . ILE B 1 100 ? 27.369  13.432  52.707  1.00 47.61  ? 100  ILE B C   1 
ATOM   3089  O O   . ILE B 1 100 ? 28.341  14.098  53.054  1.00 48.09  ? 100  ILE B O   1 
ATOM   3090  C CB  . ILE B 1 100 ? 27.251  10.871  52.931  1.00 43.71  ? 100  ILE B CB  1 
ATOM   3091  C CG1 . ILE B 1 100 ? 27.198  9.755   53.992  1.00 42.32  ? 100  ILE B CG1 1 
ATOM   3092  C CG2 . ILE B 1 100 ? 28.607  10.880  52.196  1.00 44.75  ? 100  ILE B CG2 1 
ATOM   3093  C CD1 . ILE B 1 100 ? 27.047  8.356   53.436  1.00 44.70  ? 100  ILE B CD1 1 
ATOM   3094  N N   . ARG B 1 101 ? 26.623  13.711  51.629  1.00 45.86  ? 101  ARG B N   1 
ATOM   3095  C CA  . ARG B 1 101 ? 26.864  14.784  50.671  1.00 47.68  ? 101  ARG B CA  1 
ATOM   3096  C C   . ARG B 1 101 ? 26.814  16.166  51.343  1.00 53.63  ? 101  ARG B C   1 
ATOM   3097  O O   . ARG B 1 101 ? 27.788  16.913  51.258  1.00 55.18  ? 101  ARG B O   1 
ATOM   3098  C CB  . ARG B 1 101 ? 25.816  14.693  49.562  1.00 48.42  ? 101  ARG B CB  1 
ATOM   3099  C CG  . ARG B 1 101 ? 26.291  15.168  48.196  1.00 64.95  ? 101  ARG B CG  1 
ATOM   3100  C CD  . ARG B 1 101 ? 25.410  14.701  47.058  1.00 76.97  ? 101  ARG B CD  1 
ATOM   3101  N NE  . ARG B 1 101 ? 23.976  14.891  47.300  1.00 87.31  ? 101  ARG B NE  1 
ATOM   3102  C CZ  . ARG B 1 101 ? 23.074  13.915  47.318  1.00 99.49  ? 101  ARG B CZ  1 
ATOM   3103  N NH1 . ARG B 1 101 ? 23.438  12.658  47.097  1.00 84.89  ? 101  ARG B NH1 1 
ATOM   3104  N NH2 . ARG B 1 101 ? 21.797  14.192  47.537  1.00 84.77  ? 101  ARG B NH2 1 
ATOM   3105  N N   . THR B 1 102 ? 25.689  16.484  52.028  1.00 49.78  ? 102  THR B N   1 
ATOM   3106  C CA  . THR B 1 102 ? 25.416  17.753  52.718  1.00 50.60  ? 102  THR B CA  1 
ATOM   3107  C C   . THR B 1 102 ? 26.435  18.041  53.837  1.00 55.84  ? 102  THR B C   1 
ATOM   3108  O O   . THR B 1 102 ? 26.947  19.163  53.896  1.00 57.08  ? 102  THR B O   1 
ATOM   3109  C CB  . THR B 1 102 ? 23.976  17.751  53.272  1.00 60.52  ? 102  THR B CB  1 
ATOM   3110  O OG1 . THR B 1 102 ? 23.067  17.429  52.223  1.00 63.04  ? 102  THR B OG1 1 
ATOM   3111  C CG2 . THR B 1 102 ? 23.577  19.065  53.908  1.00 60.78  ? 102  THR B CG2 1 
ATOM   3112  N N   A ARG B 1 103 ? 26.719  17.048  54.710  0.54 51.39  ? 103  ARG B N   1 
ATOM   3113  N N   B ARG B 1 103 ? 26.715  17.050  54.712  0.46 51.39  ? 103  ARG B N   1 
ATOM   3114  C CA  A ARG B 1 103 ? 27.657  17.190  55.832  0.54 51.25  ? 103  ARG B CA  1 
ATOM   3115  C CA  B ARG B 1 103 ? 27.650  17.202  55.834  0.46 51.29  ? 103  ARG B CA  1 
ATOM   3116  C C   A ARG B 1 103 ? 29.131  16.987  55.394  0.54 57.61  ? 103  ARG B C   1 
ATOM   3117  C C   B ARG B 1 103 ? 29.127  16.987  55.397  0.46 57.58  ? 103  ARG B C   1 
ATOM   3118  O O   A ARG B 1 103 ? 30.032  17.129  56.222  0.54 58.18  ? 103  ARG B O   1 
ATOM   3119  O O   B ARG B 1 103 ? 30.026  17.126  56.229  0.46 58.05  ? 103  ARG B O   1 
ATOM   3120  C CB  A ARG B 1 103 ? 27.296  16.226  56.991  0.54 48.19  ? 103  ARG B CB  1 
ATOM   3121  C CB  B ARG B 1 103 ? 27.276  16.264  57.012  0.46 48.33  ? 103  ARG B CB  1 
ATOM   3122  C CG  A ARG B 1 103 ? 25.872  16.360  57.560  0.54 53.08  ? 103  ARG B CG  1 
ATOM   3123  C CG  B ARG B 1 103 ? 25.841  16.405  57.572  0.46 53.54  ? 103  ARG B CG  1 
ATOM   3124  C CD  A ARG B 1 103 ? 25.534  17.779  57.982  0.54 58.05  ? 103  ARG B CD  1 
ATOM   3125  C CD  B ARG B 1 103 ? 25.442  17.842  57.879  0.46 58.93  ? 103  ARG B CD  1 
ATOM   3126  N NE  A ARG B 1 103 ? 24.417  17.856  58.923  0.54 55.38  ? 103  ARG B NE  1 
ATOM   3127  N NE  B ARG B 1 103 ? 24.246  17.969  58.718  0.46 57.42  ? 103  ARG B NE  1 
ATOM   3128  C CZ  A ARG B 1 103 ? 24.550  17.857  60.245  0.54 56.53  ? 103  ARG B CZ  1 
ATOM   3129  C CZ  B ARG B 1 103 ? 22.996  17.991  58.263  0.46 59.13  ? 103  ARG B CZ  1 
ATOM   3130  N NH1 A ARG B 1 103 ? 25.752  17.735  60.799  0.54 37.19  ? 103  ARG B NH1 1 
ATOM   3131  N NH1 B ARG B 1 103 ? 22.749  17.826  56.971  0.46 38.15  ? 103  ARG B NH1 1 
ATOM   3132  N NH2 A ARG B 1 103 ? 23.482  17.958  61.025  0.54 38.47  ? 103  ARG B NH2 1 
ATOM   3133  N NH2 B ARG B 1 103 ? 21.981  18.157  59.101  0.46 41.75  ? 103  ARG B NH2 1 
ATOM   3134  N N   . LYS B 1 104 ? 29.368  16.696  54.094  1.00 55.46  ? 104  LYS B N   1 
ATOM   3135  C CA  . LYS B 1 104 ? 30.697  16.483  53.467  1.00 57.24  ? 104  LYS B CA  1 
ATOM   3136  C C   . LYS B 1 104 ? 31.518  15.380  54.194  1.00 59.94  ? 104  LYS B C   1 
ATOM   3137  O O   . LYS B 1 104 ? 32.706  15.548  54.457  1.00 61.49  ? 104  LYS B O   1 
ATOM   3138  C CB  . LYS B 1 104 ? 31.499  17.803  53.339  1.00 61.83  ? 104  LYS B CB  1 
ATOM   3139  N N   . LEU B 1 105 ? 30.861  14.254  54.504  1.00 53.09  ? 105  LEU B N   1 
ATOM   3140  C CA  . LEU B 1 105 ? 31.469  13.091  55.157  1.00 50.72  ? 105  LEU B CA  1 
ATOM   3141  C C   . LEU B 1 105 ? 32.068  12.133  54.125  1.00 54.20  ? 105  LEU B C   1 
ATOM   3142  O O   . LEU B 1 105 ? 31.626  12.116  52.970  1.00 54.34  ? 105  LEU B O   1 
ATOM   3143  C CB  . LEU B 1 105 ? 30.420  12.336  55.993  1.00 48.33  ? 105  LEU B CB  1 
ATOM   3144  C CG  . LEU B 1 105 ? 29.598  13.121  57.018  1.00 51.52  ? 105  LEU B CG  1 
ATOM   3145  C CD1 . LEU B 1 105 ? 28.482  12.262  57.566  1.00 49.70  ? 105  LEU B CD1 1 
ATOM   3146  C CD2 . LEU B 1 105 ? 30.458  13.629  58.164  1.00 53.82  ? 105  LEU B CD2 1 
ATOM   3147  N N   . LYS B 1 106 ? 33.062  11.324  54.540  1.00 49.17  ? 106  LYS B N   1 
ATOM   3148  C CA  . LYS B 1 106 ? 33.668  10.316  53.666  1.00 48.53  ? 106  LYS B CA  1 
ATOM   3149  C C   . LYS B 1 106 ? 32.701  9.135   53.538  1.00 47.11  ? 106  LYS B C   1 
ATOM   3150  O O   . LYS B 1 106 ? 32.551  8.566   52.454  1.00 46.72  ? 106  LYS B O   1 
ATOM   3151  C CB  . LYS B 1 106 ? 35.039  9.873   54.200  1.00 52.30  ? 106  LYS B CB  1 
ATOM   3152  C CG  . LYS B 1 106 ? 36.152  10.860  53.863  1.00 74.46  ? 106  LYS B CG  1 
ATOM   3153  C CD  . LYS B 1 106 ? 37.503  10.366  54.328  1.00 88.13  ? 106  LYS B CD  1 
ATOM   3154  N N   . TYR B 1 107 ? 32.008  8.818   54.652  1.00 38.50  ? 107  TYR B N   1 
ATOM   3155  C CA  . TYR B 1 107 ? 31.007  7.764   54.782  1.00 35.55  ? 107  TYR B CA  1 
ATOM   3156  C C   . TYR B 1 107 ? 30.184  8.029   56.063  1.00 37.66  ? 107  TYR B C   1 
ATOM   3157  O O   . TYR B 1 107 ? 30.482  8.960   56.810  1.00 35.73  ? 107  TYR B O   1 
ATOM   3158  C CB  . TYR B 1 107 ? 31.695  6.367   54.814  1.00 36.36  ? 107  TYR B CB  1 
ATOM   3159  C CG  . TYR B 1 107 ? 32.098  5.909   56.206  1.00 36.53  ? 107  TYR B CG  1 
ATOM   3160  C CD1 . TYR B 1 107 ? 33.221  6.435   56.839  1.00 37.81  ? 107  TYR B CD1 1 
ATOM   3161  C CD2 . TYR B 1 107 ? 31.340  4.966   56.897  1.00 35.98  ? 107  TYR B CD2 1 
ATOM   3162  C CE1 . TYR B 1 107 ? 33.567  6.052   58.130  1.00 37.45  ? 107  TYR B CE1 1 
ATOM   3163  C CE2 . TYR B 1 107 ? 31.666  4.591   58.197  1.00 36.68  ? 107  TYR B CE2 1 
ATOM   3164  C CZ  . TYR B 1 107 ? 32.781  5.135   58.810  1.00 42.59  ? 107  TYR B CZ  1 
ATOM   3165  O OH  . TYR B 1 107 ? 33.112  4.743   60.079  1.00 40.09  ? 107  TYR B OH  1 
ATOM   3166  N N   . LEU B 1 108 ? 29.148  7.205   56.309  1.00 34.00  ? 108  LEU B N   1 
ATOM   3167  C CA  . LEU B 1 108 ? 28.330  7.258   57.515  1.00 32.16  ? 108  LEU B CA  1 
ATOM   3168  C C   . LEU B 1 108 ? 28.117  5.837   58.000  1.00 33.86  ? 108  LEU B C   1 
ATOM   3169  O O   . LEU B 1 108 ? 27.608  5.010   57.256  1.00 32.40  ? 108  LEU B O   1 
ATOM   3170  C CB  . LEU B 1 108 ? 26.999  7.998   57.289  1.00 31.58  ? 108  LEU B CB  1 
ATOM   3171  C CG  . LEU B 1 108 ? 26.071  8.102   58.513  1.00 34.76  ? 108  LEU B CG  1 
ATOM   3172  C CD1 . LEU B 1 108 ? 26.581  9.112   59.545  1.00 34.02  ? 108  LEU B CD1 1 
ATOM   3173  C CD2 . LEU B 1 108 ? 24.679  8.431   58.082  1.00 35.46  ? 108  LEU B CD2 1 
ATOM   3174  N N   . GLY B 1 109 ? 28.528  5.570   59.236  1.00 31.00  ? 109  GLY B N   1 
ATOM   3175  C CA  . GLY B 1 109 ? 28.445  4.255   59.864  1.00 30.15  ? 109  GLY B CA  1 
ATOM   3176  C C   . GLY B 1 109 ? 27.069  3.757   60.273  1.00 32.46  ? 109  GLY B C   1 
ATOM   3177  O O   . GLY B 1 109 ? 26.932  3.057   61.279  1.00 29.67  ? 109  GLY B O   1 
ATOM   3178  N N   . VAL B 1 110 ? 26.040  4.103   59.495  1.00 31.09  ? 110  VAL B N   1 
ATOM   3179  C CA  . VAL B 1 110 ? 24.674  3.616   59.697  1.00 29.88  ? 110  VAL B CA  1 
ATOM   3180  C C   . VAL B 1 110 ? 24.446  2.555   58.610  1.00 33.62  ? 110  VAL B C   1 
ATOM   3181  O O   . VAL B 1 110 ? 24.624  2.875   57.431  1.00 34.55  ? 110  VAL B O   1 
ATOM   3182  C CB  . VAL B 1 110 ? 23.610  4.742   59.674  1.00 32.18  ? 110  VAL B CB  1 
ATOM   3183  C CG1 . VAL B 1 110 ? 22.203  4.167   59.795  1.00 30.99  ? 110  VAL B CG1 1 
ATOM   3184  C CG2 . VAL B 1 110 ? 23.864  5.752   60.779  1.00 31.40  ? 110  VAL B CG2 1 
ATOM   3185  N N   . PRO B 1 111 ? 24.141  1.280   58.960  1.00 28.42  ? 111  PRO B N   1 
ATOM   3186  C CA  . PRO B 1 111 ? 23.946  0.258   57.902  1.00 27.56  ? 111  PRO B CA  1 
ATOM   3187  C C   . PRO B 1 111 ? 22.734  0.595   57.025  1.00 31.55  ? 111  PRO B C   1 
ATOM   3188  O O   . PRO B 1 111 ? 21.747  1.142   57.528  1.00 31.86  ? 111  PRO B O   1 
ATOM   3189  C CB  . PRO B 1 111 ? 23.747  -1.041  58.699  1.00 28.76  ? 111  PRO B CB  1 
ATOM   3190  C CG  . PRO B 1 111 ? 24.260  -0.731  60.111  1.00 32.72  ? 111  PRO B CG  1 
ATOM   3191  C CD  . PRO B 1 111 ? 23.928  0.710   60.307  1.00 28.14  ? 111  PRO B CD  1 
ATOM   3192  N N   . LYS B 1 112 ? 22.825  0.401   55.715  1.00 27.61  ? 112  LYS B N   1 
ATOM   3193  C CA  . LYS B 1 112 ? 21.694  0.773   54.866  1.00 26.30  ? 112  LYS B CA  1 
ATOM   3194  C C   . LYS B 1 112 ? 20.592  -0.299  54.887  1.00 28.26  ? 112  LYS B C   1 
ATOM   3195  O O   . LYS B 1 112 ? 20.869  -1.481  55.069  1.00 26.74  ? 112  LYS B O   1 
ATOM   3196  C CB  . LYS B 1 112 ? 22.148  1.071   53.429  1.00 29.61  ? 112  LYS B CB  1 
ATOM   3197  C CG  . LYS B 1 112 ? 22.935  2.375   53.312  1.00 38.28  ? 112  LYS B CG  1 
ATOM   3198  C CD  . LYS B 1 112 ? 23.469  2.613   51.893  1.00 44.56  ? 112  LYS B CD  1 
ATOM   3199  C CE  . LYS B 1 112 ? 24.352  3.840   51.804  1.00 50.70  ? 112  LYS B CE  1 
ATOM   3200  N NZ  . LYS B 1 112 ? 25.665  3.631   52.477  1.00 61.30  ? 112  LYS B NZ  1 
ATOM   3201  N N   . TYR B 1 113 ? 19.338  0.145   54.731  1.00 25.15  ? 113  TYR B N   1 
ATOM   3202  C CA  . TYR B 1 113 ? 18.149  -0.694  54.665  1.00 24.51  ? 113  TYR B CA  1 
ATOM   3203  C C   . TYR B 1 113 ? 17.851  -0.987  53.200  1.00 29.19  ? 113  TYR B C   1 
ATOM   3204  O O   . TYR B 1 113 ? 17.627  -0.075  52.404  1.00 29.30  ? 113  TYR B O   1 
ATOM   3205  C CB  . TYR B 1 113 ? 16.968  -0.010  55.372  1.00 24.01  ? 113  TYR B CB  1 
ATOM   3206  C CG  . TYR B 1 113 ? 15.620  -0.651  55.100  1.00 24.46  ? 113  TYR B CG  1 
ATOM   3207  C CD1 . TYR B 1 113 ? 15.275  -1.872  55.676  1.00 25.13  ? 113  TYR B CD1 1 
ATOM   3208  C CD2 . TYR B 1 113 ? 14.681  -0.026  54.281  1.00 24.86  ? 113  TYR B CD2 1 
ATOM   3209  C CE1 . TYR B 1 113 ? 14.035  -2.455  55.440  1.00 25.16  ? 113  TYR B CE1 1 
ATOM   3210  C CE2 . TYR B 1 113 ? 13.436  -0.604  54.038  1.00 25.80  ? 113  TYR B CE2 1 
ATOM   3211  C CZ  . TYR B 1 113 ? 13.116  -1.819  54.622  1.00 31.35  ? 113  TYR B CZ  1 
ATOM   3212  O OH  . TYR B 1 113 ? 11.887  -2.400  54.387  1.00 30.50  ? 113  TYR B OH  1 
ATOM   3213  N N   . TRP B 1 114 ? 17.853  -2.261  52.858  1.00 26.59  ? 114  TRP B N   1 
ATOM   3214  C CA  . TRP B 1 114 ? 17.687  -2.704  51.493  1.00 27.30  ? 114  TRP B CA  1 
ATOM   3215  C C   . TRP B 1 114 ? 16.341  -3.326  51.200  1.00 31.80  ? 114  TRP B C   1 
ATOM   3216  O O   . TRP B 1 114 ? 16.012  -3.510  50.032  1.00 32.88  ? 114  TRP B O   1 
ATOM   3217  C CB  . TRP B 1 114 ? 18.803  -3.683  51.166  1.00 26.84  ? 114  TRP B CB  1 
ATOM   3218  C CG  . TRP B 1 114 ? 20.135  -3.002  51.108  1.00 27.78  ? 114  TRP B CG  1 
ATOM   3219  C CD1 . TRP B 1 114 ? 21.205  -3.213  51.926  1.00 30.52  ? 114  TRP B CD1 1 
ATOM   3220  C CD2 . TRP B 1 114 ? 20.508  -1.935  50.219  1.00 27.63  ? 114  TRP B CD2 1 
ATOM   3221  N NE1 . TRP B 1 114 ? 22.246  -2.385  51.564  1.00 30.29  ? 114  TRP B NE1 1 
ATOM   3222  C CE2 . TRP B 1 114 ? 21.835  -1.571  50.536  1.00 31.71  ? 114  TRP B CE2 1 
ATOM   3223  C CE3 . TRP B 1 114 ? 19.851  -1.263  49.168  1.00 28.54  ? 114  TRP B CE3 1 
ATOM   3224  C CZ2 . TRP B 1 114 ? 22.528  -0.581  49.826  1.00 31.45  ? 114  TRP B CZ2 1 
ATOM   3225  C CZ3 . TRP B 1 114 ? 20.529  -0.270  48.484  1.00 30.38  ? 114  TRP B CZ3 1 
ATOM   3226  C CH2 . TRP B 1 114 ? 21.854  0.058   48.807  1.00 31.54  ? 114  TRP B CH2 1 
ATOM   3227  N N   . GLY B 1 115 ? 15.558  -3.608  52.228  1.00 27.48  ? 115  GLY B N   1 
ATOM   3228  C CA  . GLY B 1 115 ? 14.252  -4.211  52.021  1.00 27.18  ? 115  GLY B CA  1 
ATOM   3229  C C   . GLY B 1 115 ? 13.822  -5.161  53.109  1.00 31.38  ? 115  GLY B C   1 
ATOM   3230  O O   . GLY B 1 115 ? 14.583  -5.496  54.027  1.00 29.41  ? 115  GLY B O   1 
ATOM   3231  N N   . SER B 1 116 ? 12.580  -5.604  52.990  1.00 30.36  ? 116  SER B N   1 
ATOM   3232  C CA  . SER B 1 116 ? 11.940  -6.452  53.979  1.00 31.04  ? 116  SER B CA  1 
ATOM   3233  C C   . SER B 1 116 ? 10.748  -7.185  53.383  1.00 36.82  ? 116  SER B C   1 
ATOM   3234  O O   . SER B 1 116 ? 10.117  -6.690  52.459  1.00 35.05  ? 116  SER B O   1 
ATOM   3235  C CB  . SER B 1 116 ? 11.484  -5.594  55.155  1.00 33.79  ? 116  SER B CB  1 
ATOM   3236  O OG  . SER B 1 116 ? 10.938  -6.403  56.180  1.00 47.85  ? 116  SER B OG  1 
ATOM   3237  N N   . GLY B 1 117 ? 10.430  -8.340  53.938  1.00 37.39  ? 117  GLY B N   1 
ATOM   3238  C CA  . GLY B 1 117 ? 9.293   -9.118  53.474  1.00 39.51  ? 117  GLY B CA  1 
ATOM   3239  C C   . GLY B 1 117 ? 8.892   -10.240 54.400  1.00 46.52  ? 117  GLY B C   1 
ATOM   3240  O O   . GLY B 1 117 ? 9.400   -10.344 55.519  1.00 47.42  ? 117  GLY B O   1 
ATOM   3241  N N   . LEU B 1 118 ? 8.001   -11.108 53.915  1.00 44.22  ? 118  LEU B N   1 
ATOM   3242  C CA  . LEU B 1 118 ? 7.511   -12.254 54.683  1.00 44.75  ? 118  LEU B CA  1 
ATOM   3243  C C   . LEU B 1 118 ? 7.855   -13.558 53.983  1.00 51.20  ? 118  LEU B C   1 
ATOM   3244  O O   . LEU B 1 118 ? 7.860   -13.626 52.749  1.00 51.57  ? 118  LEU B O   1 
ATOM   3245  C CB  . LEU B 1 118 ? 5.997   -12.171 54.927  1.00 44.70  ? 118  LEU B CB  1 
ATOM   3246  C CG  . LEU B 1 118 ? 5.473   -11.010 55.760  1.00 47.58  ? 118  LEU B CG  1 
ATOM   3247  C CD1 . LEU B 1 118 ? 3.980   -10.935 55.656  1.00 48.41  ? 118  LEU B CD1 1 
ATOM   3248  C CD2 . LEU B 1 118 ? 5.893   -11.124 57.211  1.00 49.75  ? 118  LEU B CD2 1 
ATOM   3249  N N   . HIS B 1 119 ? 8.152   -14.588 54.779  1.00 48.83  ? 119  HIS B N   1 
ATOM   3250  C CA  . HIS B 1 119 ? 8.530   -15.919 54.314  1.00 50.16  ? 119  HIS B CA  1 
ATOM   3251  C C   . HIS B 1 119 ? 7.981   -16.952 55.290  1.00 55.61  ? 119  HIS B C   1 
ATOM   3252  O O   . HIS B 1 119 ? 8.140   -16.801 56.503  1.00 54.09  ? 119  HIS B O   1 
ATOM   3253  C CB  . HIS B 1 119 ? 10.065  -16.010 54.194  1.00 51.12  ? 119  HIS B CB  1 
ATOM   3254  C CG  . HIS B 1 119 ? 10.572  -17.292 53.610  1.00 56.41  ? 119  HIS B CG  1 
ATOM   3255  N ND1 . HIS B 1 119 ? 10.955  -18.349 54.419  1.00 59.53  ? 119  HIS B ND1 1 
ATOM   3256  C CD2 . HIS B 1 119 ? 10.780  -17.634 52.318  1.00 58.99  ? 119  HIS B CD2 1 
ATOM   3257  C CE1 . HIS B 1 119 ? 11.365  -19.301 53.597  1.00 60.27  ? 119  HIS B CE1 1 
ATOM   3258  N NE2 . HIS B 1 119 ? 11.281  -18.916 52.322  1.00 60.33  ? 119  HIS B NE2 1 
ATOM   3259  N N   . ASP B 1 120 ? 7.288   -17.971 54.765  1.00 54.94  ? 120  ASP B N   1 
ATOM   3260  C CA  . ASP B 1 120 ? 6.706   -19.036 55.586  1.00 56.71  ? 120  ASP B CA  1 
ATOM   3261  C C   . ASP B 1 120 ? 7.606   -20.258 55.610  1.00 61.85  ? 120  ASP B C   1 
ATOM   3262  O O   . ASP B 1 120 ? 8.236   -20.578 54.605  1.00 62.39  ? 120  ASP B O   1 
ATOM   3263  C CB  . ASP B 1 120 ? 5.306   -19.432 55.081  1.00 59.86  ? 120  ASP B CB  1 
ATOM   3264  C CG  . ASP B 1 120 ? 4.265   -18.328 55.146  1.00 73.07  ? 120  ASP B CG  1 
ATOM   3265  O OD1 . ASP B 1 120 ? 4.083   -17.738 56.244  1.00 72.26  ? 120  ASP B OD1 1 
ATOM   3266  O OD2 . ASP B 1 120 ? 3.600   -18.078 54.109  1.00 82.64  ? 120  ASP B OD2 1 
ATOM   3267  N N   . LYS B 1 121 ? 7.669   -20.934 56.757  1.00 59.28  ? 121  LYS B N   1 
ATOM   3268  C CA  . LYS B 1 121 ? 8.441   -22.159 56.939  1.00 61.17  ? 121  LYS B CA  1 
ATOM   3269  C C   . LYS B 1 121 ? 7.743   -23.010 57.992  1.00 68.69  ? 121  LYS B C   1 
ATOM   3270  O O   . LYS B 1 121 ? 7.595   -22.577 59.145  1.00 68.21  ? 121  LYS B O   1 
ATOM   3271  C CB  . LYS B 1 121 ? 9.918   -21.864 57.308  1.00 62.86  ? 121  LYS B CB  1 
ATOM   3272  C CG  . LYS B 1 121 ? 10.917  -22.980 56.975  1.00 73.85  ? 121  LYS B CG  1 
ATOM   3273  C CD  . LYS B 1 121 ? 11.229  -23.103 55.479  1.00 83.20  ? 121  LYS B CD  1 
ATOM   3274  C CE  . LYS B 1 121 ? 12.074  -24.312 55.172  1.00 93.33  ? 121  LYS B CE  1 
ATOM   3275  N N   . ASN B 1 122 ? 7.259   -24.199 57.570  1.00 68.21  ? 122  ASN B N   1 
ATOM   3276  C CA  . ASN B 1 122 ? 6.545   -25.196 58.383  1.00 70.37  ? 122  ASN B CA  1 
ATOM   3277  C C   . ASN B 1 122 ? 5.266   -24.597 59.029  1.00 73.66  ? 122  ASN B C   1 
ATOM   3278  O O   . ASN B 1 122 ? 5.005   -24.811 60.217  1.00 74.23  ? 122  ASN B O   1 
ATOM   3279  C CB  . ASN B 1 122 ? 7.474   -25.826 59.456  1.00 73.71  ? 122  ASN B CB  1 
ATOM   3280  C CG  . ASN B 1 122 ? 8.764   -26.419 58.926  1.00 102.94 ? 122  ASN B CG  1 
ATOM   3281  O OD1 . ASN B 1 122 ? 8.789   -27.173 57.942  1.00 102.63 ? 122  ASN B OD1 1 
ATOM   3282  N ND2 . ASN B 1 122 ? 9.867   -26.108 59.589  1.00 93.70  ? 122  ASN B ND2 1 
ATOM   3283  N N   . GLY B 1 123 ? 4.499   -23.844 58.237  1.00 68.72  ? 123  GLY B N   1 
ATOM   3284  C CA  . GLY B 1 123 ? 3.257   -23.221 58.688  1.00 68.04  ? 123  GLY B CA  1 
ATOM   3285  C C   . GLY B 1 123 ? 3.413   -21.866 59.357  1.00 69.30  ? 123  GLY B C   1 
ATOM   3286  O O   . GLY B 1 123 ? 2.556   -20.997 59.175  1.00 69.42  ? 123  GLY B O   1 
ATOM   3287  N N   . LYS B 1 124 ? 4.496   -21.674 60.143  1.00 62.42  ? 124  LYS B N   1 
ATOM   3288  C CA  . LYS B 1 124 ? 4.782   -20.423 60.844  1.00 59.42  ? 124  LYS B CA  1 
ATOM   3289  C C   . LYS B 1 124 ? 5.223   -19.311 59.866  1.00 59.46  ? 124  LYS B C   1 
ATOM   3290  O O   . LYS B 1 124 ? 5.837   -19.602 58.834  1.00 59.09  ? 124  LYS B O   1 
ATOM   3291  C CB  . LYS B 1 124 ? 5.859   -20.651 61.916  1.00 61.80  ? 124  LYS B CB  1 
ATOM   3292  N N   . SER B 1 125 ? 4.906   -18.037 60.204  1.00 52.71  ? 125  SER B N   1 
ATOM   3293  C CA  . SER B 1 125 ? 5.257   -16.852 59.413  1.00 49.98  ? 125  SER B CA  1 
ATOM   3294  C C   . SER B 1 125 ? 6.488   -16.132 59.991  1.00 49.68  ? 125  SER B C   1 
ATOM   3295  O O   . SER B 1 125 ? 6.589   -15.935 61.203  1.00 48.07  ? 125  SER B O   1 
ATOM   3296  C CB  . SER B 1 125 ? 4.081   -15.882 59.324  1.00 53.69  ? 125  SER B CB  1 
ATOM   3297  O OG  . SER B 1 125 ? 4.367   -14.821 58.421  1.00 63.99  ? 125  SER B OG  1 
ATOM   3298  N N   . TYR B 1 126 ? 7.417   -15.740 59.103  1.00 44.49  ? 126  TYR B N   1 
ATOM   3299  C CA  . TYR B 1 126 ? 8.666   -15.070 59.458  1.00 42.70  ? 126  TYR B CA  1 
ATOM   3300  C C   . TYR B 1 126 ? 8.851   -13.771 58.686  1.00 45.63  ? 126  TYR B C   1 
ATOM   3301  O O   . TYR B 1 126 ? 8.551   -13.707 57.492  1.00 45.25  ? 126  TYR B O   1 
ATOM   3302  C CB  . TYR B 1 126 ? 9.866   -16.001 59.184  1.00 43.64  ? 126  TYR B CB  1 
ATOM   3303  C CG  . TYR B 1 126 ? 9.871   -17.256 60.026  1.00 45.12  ? 126  TYR B CG  1 
ATOM   3304  C CD1 . TYR B 1 126 ? 10.530  -17.295 61.249  1.00 46.39  ? 126  TYR B CD1 1 
ATOM   3305  C CD2 . TYR B 1 126 ? 9.209   -18.404 59.604  1.00 46.86  ? 126  TYR B CD2 1 
ATOM   3306  C CE1 . TYR B 1 126 ? 10.511  -18.436 62.044  1.00 48.63  ? 126  TYR B CE1 1 
ATOM   3307  C CE2 . TYR B 1 126 ? 9.182   -19.553 60.393  1.00 49.46  ? 126  TYR B CE2 1 
ATOM   3308  C CZ  . TYR B 1 126 ? 9.835   -19.565 61.613  1.00 57.08  ? 126  TYR B CZ  1 
ATOM   3309  O OH  . TYR B 1 126 ? 9.812   -20.689 62.402  1.00 60.94  ? 126  TYR B OH  1 
ATOM   3310  N N   . ARG B 1 127 ? 9.399   -12.760 59.364  1.00 40.82  ? 127  ARG B N   1 
ATOM   3311  C CA  . ARG B 1 127 ? 9.715   -11.454 58.791  1.00 39.37  ? 127  ARG B CA  1 
ATOM   3312  C C   . ARG B 1 127 ? 11.227  -11.415 58.498  1.00 40.66  ? 127  ARG B C   1 
ATOM   3313  O O   . ARG B 1 127 ? 12.040  -11.797 59.346  1.00 39.51  ? 127  ARG B O   1 
ATOM   3314  C CB  . ARG B 1 127 ? 9.260   -10.339 59.768  1.00 40.36  ? 127  ARG B CB  1 
ATOM   3315  C CG  . ARG B 1 127 ? 9.636   -8.881  59.444  1.00 50.36  ? 127  ARG B CG  1 
ATOM   3316  C CD  . ARG B 1 127 ? 9.197   -8.337  58.093  1.00 59.53  ? 127  ARG B CD  1 
ATOM   3317  N NE  . ARG B 1 127 ? 7.748   -8.212  57.932  1.00 67.69  ? 127  ARG B NE  1 
ATOM   3318  C CZ  . ARG B 1 127 ? 7.163   -7.533  56.948  1.00 81.41  ? 127  ARG B CZ  1 
ATOM   3319  N NH1 . ARG B 1 127 ? 7.897   -6.872  56.059  1.00 67.37  ? 127  ARG B NH1 1 
ATOM   3320  N NH2 . ARG B 1 127 ? 5.840   -7.487  56.860  1.00 68.77  ? 127  ARG B NH2 1 
ATOM   3321  N N   . PHE B 1 128 ? 11.591  -11.019 57.270  1.00 36.19  ? 128  PHE B N   1 
ATOM   3322  C CA  . PHE B 1 128 ? 12.996  -10.941 56.870  1.00 35.07  ? 128  PHE B CA  1 
ATOM   3323  C C   . PHE B 1 128 ? 13.370  -9.507  56.554  1.00 36.66  ? 128  PHE B C   1 
ATOM   3324  O O   . PHE B 1 128 ? 12.514  -8.714  56.159  1.00 34.76  ? 128  PHE B O   1 
ATOM   3325  C CB  . PHE B 1 128 ? 13.348  -11.898 55.712  1.00 37.44  ? 128  PHE B CB  1 
ATOM   3326  C CG  . PHE B 1 128 ? 12.826  -11.568 54.333  1.00 38.77  ? 128  PHE B CG  1 
ATOM   3327  C CD1 . PHE B 1 128 ? 13.524  -10.705 53.494  1.00 40.40  ? 128  PHE B CD1 1 
ATOM   3328  C CD2 . PHE B 1 128 ? 11.691  -12.195 53.835  1.00 42.13  ? 128  PHE B CD2 1 
ATOM   3329  C CE1 . PHE B 1 128 ? 13.048  -10.413 52.215  1.00 41.57  ? 128  PHE B CE1 1 
ATOM   3330  C CE2 . PHE B 1 128 ? 11.243  -11.938 52.534  1.00 44.86  ? 128  PHE B CE2 1 
ATOM   3331  C CZ  . PHE B 1 128 ? 11.918  -11.040 51.738  1.00 42.07  ? 128  PHE B CZ  1 
ATOM   3332  N N   . MET B 1 129 ? 14.653  -9.187  56.730  1.00 33.62  ? 129  MET B N   1 
ATOM   3333  C CA  . MET B 1 129 ? 15.217  -7.854  56.538  1.00 32.71  ? 129  MET B CA  1 
ATOM   3334  C C   . MET B 1 129 ? 16.541  -7.955  55.808  1.00 36.57  ? 129  MET B C   1 
ATOM   3335  O O   . MET B 1 129 ? 17.361  -8.786  56.184  1.00 36.80  ? 129  MET B O   1 
ATOM   3336  C CB  . MET B 1 129 ? 15.431  -7.233  57.921  1.00 34.66  ? 129  MET B CB  1 
ATOM   3337  C CG  . MET B 1 129 ? 15.308  -5.736  57.966  1.00 37.90  ? 129  MET B CG  1 
ATOM   3338  S SD  . MET B 1 129 ? 15.854  -5.114  59.582  1.00 41.68  ? 129  MET B SD  1 
ATOM   3339  C CE  . MET B 1 129 ? 14.700  -5.829  60.604  1.00 38.59  ? 129  MET B CE  1 
ATOM   3340  N N   . ILE B 1 130 ? 16.766  -7.118  54.780  1.00 33.54  ? 130  ILE B N   1 
ATOM   3341  C CA  . ILE B 1 130 ? 18.027  -7.120  54.022  1.00 34.06  ? 130  ILE B CA  1 
ATOM   3342  C C   . ILE B 1 130 ? 18.808  -5.845  54.392  1.00 37.70  ? 130  ILE B C   1 
ATOM   3343  O O   . ILE B 1 130 ? 18.244  -4.753  54.383  1.00 35.17  ? 130  ILE B O   1 
ATOM   3344  C CB  . ILE B 1 130 ? 17.800  -7.266  52.475  1.00 37.70  ? 130  ILE B CB  1 
ATOM   3345  C CG1 . ILE B 1 130 ? 16.931  -8.488  52.132  1.00 38.80  ? 130  ILE B CG1 1 
ATOM   3346  C CG2 . ILE B 1 130 ? 19.118  -7.331  51.685  1.00 39.29  ? 130  ILE B CG2 1 
ATOM   3347  C CD1 . ILE B 1 130 ? 15.631  -8.114  51.620  1.00 46.89  ? 130  ILE B CD1 1 
ATOM   3348  N N   . MET B 1 131 ? 20.094  -6.003  54.749  1.00 37.12  ? 131  MET B N   1 
ATOM   3349  C CA  . MET B 1 131 ? 21.010  -4.909  55.108  1.00 37.96  ? 131  MET B CA  1 
ATOM   3350  C C   . MET B 1 131 ? 22.409  -5.183  54.588  1.00 40.40  ? 131  MET B C   1 
ATOM   3351  O O   . MET B 1 131 ? 22.649  -6.228  53.987  1.00 40.88  ? 131  MET B O   1 
ATOM   3352  C CB  . MET B 1 131 ? 21.082  -4.687  56.625  1.00 41.04  ? 131  MET B CB  1 
ATOM   3353  C CG  . MET B 1 131 ? 19.806  -4.167  57.244  1.00 45.55  ? 131  MET B CG  1 
ATOM   3354  S SD  . MET B 1 131 ? 19.688  -4.881  58.878  1.00 51.76  ? 131  MET B SD  1 
ATOM   3355  C CE  . MET B 1 131 ? 19.549  -6.677  58.452  1.00 49.87  ? 131  MET B CE  1 
ATOM   3356  N N   . ASP B 1 132 ? 23.335  -4.251  54.843  1.00 35.53  ? 132  ASP B N   1 
ATOM   3357  C CA  . ASP B 1 132 ? 24.732  -4.364  54.454  1.00 36.05  ? 132  ASP B CA  1 
ATOM   3358  C C   . ASP B 1 132 ? 25.446  -5.492  55.201  1.00 41.19  ? 132  ASP B C   1 
ATOM   3359  O O   . ASP B 1 132 ? 25.185  -5.731  56.389  1.00 40.05  ? 132  ASP B O   1 
ATOM   3360  C CB  . ASP B 1 132 ? 25.469  -3.042  54.744  1.00 37.30  ? 132  ASP B CB  1 
ATOM   3361  C CG  . ASP B 1 132 ? 25.018  -1.837  53.950  1.00 40.51  ? 132  ASP B CG  1 
ATOM   3362  O OD1 . ASP B 1 132 ? 24.746  -1.991  52.728  1.00 41.96  ? 132  ASP B OD1 1 
ATOM   3363  O OD2 . ASP B 1 132 ? 25.037  -0.719  54.514  1.00 36.68  ? 132  ASP B OD2 1 
ATOM   3364  N N   . ARG B 1 133 ? 26.363  -6.163  54.498  1.00 39.09  ? 133  ARG B N   1 
ATOM   3365  C CA  . ARG B 1 133 ? 27.235  -7.195  55.054  1.00 40.08  ? 133  ARG B CA  1 
ATOM   3366  C C   . ARG B 1 133 ? 28.464  -6.503  55.622  1.00 43.66  ? 133  ARG B C   1 
ATOM   3367  O O   . ARG B 1 133 ? 29.027  -5.614  54.965  1.00 43.02  ? 133  ARG B O   1 
ATOM   3368  C CB  . ARG B 1 133 ? 27.626  -8.225  53.967  1.00 41.42  ? 133  ARG B CB  1 
ATOM   3369  C CG  . ARG B 1 133 ? 29.106  -8.688  53.941  1.00 50.52  ? 133  ARG B CG  1 
ATOM   3370  C CD  . ARG B 1 133 ? 29.203  -9.881  54.815  1.00 53.11  ? 133  ARG B CD  1 
ATOM   3371  N NE  . ARG B 1 133 ? 30.447  -10.656 54.869  1.00 58.83  ? 133  ARG B NE  1 
ATOM   3372  C CZ  . ARG B 1 133 ? 30.914  -11.495 53.948  1.00 72.90  ? 133  ARG B CZ  1 
ATOM   3373  N NH1 . ARG B 1 133 ? 30.498  -11.415 52.689  1.00 59.50  ? 133  ARG B NH1 1 
ATOM   3374  N NH2 . ARG B 1 133 ? 31.907  -12.315 54.242  1.00 66.52  ? 133  ARG B NH2 1 
ATOM   3375  N N   . PHE B 1 134 ? 28.893  -6.913  56.818  1.00 39.21  ? 134  PHE B N   1 
ATOM   3376  C CA  . PHE B 1 134 ? 30.078  -6.331  57.426  1.00 38.23  ? 134  PHE B CA  1 
ATOM   3377  C C   . PHE B 1 134 ? 31.139  -7.386  57.712  1.00 43.02  ? 134  PHE B C   1 
ATOM   3378  O O   . PHE B 1 134 ? 30.890  -8.595  57.595  1.00 41.84  ? 134  PHE B O   1 
ATOM   3379  C CB  . PHE B 1 134 ? 29.712  -5.565  58.710  1.00 38.01  ? 134  PHE B CB  1 
ATOM   3380  C CG  . PHE B 1 134 ? 28.771  -4.408  58.482  1.00 37.33  ? 134  PHE B CG  1 
ATOM   3381  C CD1 . PHE B 1 134 ? 29.126  -3.358  57.642  1.00 39.47  ? 134  PHE B CD1 1 
ATOM   3382  C CD2 . PHE B 1 134 ? 27.523  -4.375  59.092  1.00 37.44  ? 134  PHE B CD2 1 
ATOM   3383  C CE1 . PHE B 1 134 ? 28.239  -2.318  57.389  1.00 38.92  ? 134  PHE B CE1 1 
ATOM   3384  C CE2 . PHE B 1 134 ? 26.644  -3.320  58.854  1.00 38.72  ? 134  PHE B CE2 1 
ATOM   3385  C CZ  . PHE B 1 134 ? 27.009  -2.301  58.000  1.00 36.68  ? 134  PHE B CZ  1 
ATOM   3386  N N   . GLY B 1 135 ? 32.322  -6.888  58.053  1.00 41.31  ? 135  GLY B N   1 
ATOM   3387  C CA  . GLY B 1 135 ? 33.469  -7.682  58.451  1.00 42.81  ? 135  GLY B CA  1 
ATOM   3388  C C   . GLY B 1 135 ? 33.428  -7.959  59.937  1.00 45.80  ? 135  GLY B C   1 
ATOM   3389  O O   . GLY B 1 135 ? 32.352  -8.152  60.510  1.00 44.15  ? 135  GLY B O   1 
ATOM   3390  N N   . SER B 1 136 ? 34.595  -7.959  60.569  1.00 43.79  ? 136  SER B N   1 
ATOM   3391  C CA  . SER B 1 136 ? 34.742  -8.249  61.989  1.00 43.66  ? 136  SER B CA  1 
ATOM   3392  C C   . SER B 1 136 ? 34.154  -7.141  62.881  1.00 46.78  ? 136  SER B C   1 
ATOM   3393  O O   . SER B 1 136 ? 34.116  -5.964  62.492  1.00 44.40  ? 136  SER B O   1 
ATOM   3394  C CB  . SER B 1 136 ? 36.218  -8.451  62.329  1.00 47.84  ? 136  SER B CB  1 
ATOM   3395  O OG  . SER B 1 136 ? 36.405  -8.768  63.701  1.00 59.02  ? 136  SER B OG  1 
ATOM   3396  N N   . ASP B 1 137 ? 33.704  -7.540  64.088  1.00 43.96  ? 137  ASP B N   1 
ATOM   3397  C CA  . ASP B 1 137 ? 33.251  -6.608  65.109  1.00 42.75  ? 137  ASP B CA  1 
ATOM   3398  C C   . ASP B 1 137 ? 34.511  -6.136  65.853  1.00 46.38  ? 137  ASP B C   1 
ATOM   3399  O O   . ASP B 1 137 ? 35.548  -6.811  65.779  1.00 47.47  ? 137  ASP B O   1 
ATOM   3400  C CB  . ASP B 1 137 ? 32.189  -7.222  66.042  1.00 44.28  ? 137  ASP B CB  1 
ATOM   3401  C CG  . ASP B 1 137 ? 32.655  -8.387  66.882  1.00 62.20  ? 137  ASP B CG  1 
ATOM   3402  O OD1 . ASP B 1 137 ? 32.282  -9.526  66.565  1.00 66.41  ? 137  ASP B OD1 1 
ATOM   3403  O OD2 . ASP B 1 137 ? 33.338  -8.153  67.889  1.00 68.60  ? 137  ASP B OD2 1 
ATOM   3404  N N   . LEU B 1 138 ? 34.442  -4.981  66.536  1.00 40.81  ? 138  LEU B N   1 
ATOM   3405  C CA  . LEU B 1 138 ? 35.608  -4.433  67.226  1.00 40.88  ? 138  LEU B CA  1 
ATOM   3406  C C   . LEU B 1 138 ? 36.008  -5.218  68.470  1.00 45.32  ? 138  LEU B C   1 
ATOM   3407  O O   . LEU B 1 138 ? 37.178  -5.160  68.833  1.00 46.97  ? 138  LEU B O   1 
ATOM   3408  C CB  . LEU B 1 138 ? 35.400  -2.964  67.596  1.00 39.70  ? 138  LEU B CB  1 
ATOM   3409  C CG  . LEU B 1 138 ? 35.504  -1.930  66.476  1.00 43.73  ? 138  LEU B CG  1 
ATOM   3410  C CD1 . LEU B 1 138 ? 35.323  -0.566  67.041  1.00 43.09  ? 138  LEU B CD1 1 
ATOM   3411  C CD2 . LEU B 1 138 ? 36.858  -1.983  65.773  1.00 47.08  ? 138  LEU B CD2 1 
ATOM   3412  N N   . GLN B 1 139 ? 35.069  -5.943  69.120  1.00 41.04  ? 139  GLN B N   1 
ATOM   3413  C CA  . GLN B 1 139 ? 35.351  -6.730  70.332  1.00 41.02  ? 139  GLN B CA  1 
ATOM   3414  C C   . GLN B 1 139 ? 36.393  -7.824  70.049  1.00 47.65  ? 139  GLN B C   1 
ATOM   3415  O O   . GLN B 1 139 ? 37.309  -7.995  70.852  1.00 49.31  ? 139  GLN B O   1 
ATOM   3416  C CB  . GLN B 1 139 ? 34.060  -7.328  70.931  1.00 40.65  ? 139  GLN B CB  1 
ATOM   3417  C CG  . GLN B 1 139 ? 34.223  -7.997  72.300  1.00 43.11  ? 139  GLN B CG  1 
ATOM   3418  C CD  . GLN B 1 139 ? 34.774  -7.103  73.392  1.00 46.77  ? 139  GLN B CD  1 
ATOM   3419  O OE1 . GLN B 1 139 ? 34.487  -5.904  73.489  1.00 36.49  ? 139  GLN B OE1 1 
ATOM   3420  N NE2 . GLN B 1 139 ? 35.544  -7.695  74.272  1.00 39.49  ? 139  GLN B NE2 1 
ATOM   3421  N N   . LYS B 1 140 ? 36.283  -8.513  68.894  1.00 44.46  ? 140  LYS B N   1 
ATOM   3422  C CA  . LYS B 1 140 ? 37.224  -9.553  68.463  1.00 45.68  ? 140  LYS B CA  1 
ATOM   3423  C C   . LYS B 1 140 ? 38.622  -8.965  68.256  1.00 49.83  ? 140  LYS B C   1 
ATOM   3424  O O   . LYS B 1 140 ? 39.599  -9.550  68.731  1.00 51.99  ? 140  LYS B O   1 
ATOM   3425  C CB  . LYS B 1 140 ? 36.751  -10.247 67.170  1.00 48.52  ? 140  LYS B CB  1 
ATOM   3426  C CG  . LYS B 1 140 ? 35.480  -11.081 67.307  1.00 67.00  ? 140  LYS B CG  1 
ATOM   3427  C CD  . LYS B 1 140 ? 35.247  -11.928 66.061  1.00 80.40  ? 140  LYS B CD  1 
ATOM   3428  C CE  . LYS B 1 140 ? 33.834  -12.455 65.976  1.00 89.61  ? 140  LYS B CE  1 
ATOM   3429  N NZ  . LYS B 1 140 ? 33.000  -11.628 65.062  1.00 94.92  ? 140  LYS B NZ  1 
ATOM   3430  N N   . ILE B 1 141 ? 38.709  -7.807  67.567  1.00 44.36  ? 141  ILE B N   1 
ATOM   3431  C CA  . ILE B 1 141 ? 39.957  -7.089  67.271  1.00 45.26  ? 141  ILE B CA  1 
ATOM   3432  C C   . ILE B 1 141 ? 40.575  -6.568  68.579  1.00 49.09  ? 141  ILE B C   1 
ATOM   3433  O O   . ILE B 1 141 ? 41.792  -6.673  68.769  1.00 50.23  ? 141  ILE B O   1 
ATOM   3434  C CB  . ILE B 1 141 ? 39.705  -5.955  66.233  1.00 47.79  ? 141  ILE B CB  1 
ATOM   3435  C CG1 . ILE B 1 141 ? 39.204  -6.554  64.887  1.00 48.42  ? 141  ILE B CG1 1 
ATOM   3436  C CG2 . ILE B 1 141 ? 40.970  -5.096  66.011  1.00 50.00  ? 141  ILE B CG2 1 
ATOM   3437  C CD1 . ILE B 1 141 ? 38.322  -5.672  64.081  1.00 54.07  ? 141  ILE B CD1 1 
ATOM   3438  N N   . TYR B 1 142 ? 39.715  -6.055  69.485  1.00 43.61  ? 142  TYR B N   1 
ATOM   3439  C CA  . TYR B 1 142 ? 40.076  -5.530  70.802  1.00 43.06  ? 142  TYR B CA  1 
ATOM   3440  C C   . TYR B 1 142 ? 40.739  -6.620  71.642  1.00 50.80  ? 142  TYR B C   1 
ATOM   3441  O O   . TYR B 1 142 ? 41.847  -6.413  72.138  1.00 52.71  ? 142  TYR B O   1 
ATOM   3442  C CB  . TYR B 1 142 ? 38.815  -4.985  71.497  1.00 40.90  ? 142  TYR B CB  1 
ATOM   3443  C CG  . TYR B 1 142 ? 39.006  -4.478  72.907  1.00 39.73  ? 142  TYR B CG  1 
ATOM   3444  C CD1 . TYR B 1 142 ? 39.719  -3.309  73.158  1.00 41.13  ? 142  TYR B CD1 1 
ATOM   3445  C CD2 . TYR B 1 142 ? 38.396  -5.116  73.984  1.00 39.06  ? 142  TYR B CD2 1 
ATOM   3446  C CE1 . TYR B 1 142 ? 39.841  -2.802  74.449  1.00 40.12  ? 142  TYR B CE1 1 
ATOM   3447  C CE2 . TYR B 1 142 ? 38.514  -4.620  75.278  1.00 39.00  ? 142  TYR B CE2 1 
ATOM   3448  C CZ  . TYR B 1 142 ? 39.237  -3.461  75.506  1.00 44.14  ? 142  TYR B CZ  1 
ATOM   3449  O OH  . TYR B 1 142 ? 39.342  -2.960  76.777  1.00 41.52  ? 142  TYR B OH  1 
ATOM   3450  N N   . GLU B 1 143 ? 40.081  -7.794  71.754  1.00 47.86  ? 143  GLU B N   1 
ATOM   3451  C CA  . GLU B 1 143 ? 40.570  -8.955  72.502  1.00 49.01  ? 143  GLU B CA  1 
ATOM   3452  C C   . GLU B 1 143 ? 41.872  -9.500  71.893  1.00 55.80  ? 143  GLU B C   1 
ATOM   3453  O O   . GLU B 1 143 ? 42.758  -9.918  72.636  1.00 57.33  ? 143  GLU B O   1 
ATOM   3454  C CB  . GLU B 1 143 ? 39.495  -10.051 72.556  1.00 49.96  ? 143  GLU B CB  1 
ATOM   3455  C CG  . GLU B 1 143 ? 38.393  -9.765  73.567  1.00 57.56  ? 143  GLU B CG  1 
ATOM   3456  C CD  . GLU B 1 143 ? 37.143  -10.626 73.509  1.00 77.67  ? 143  GLU B CD  1 
ATOM   3457  O OE1 . GLU B 1 143 ? 36.975  -11.396 72.536  1.00 83.59  ? 143  GLU B OE1 1 
ATOM   3458  O OE2 . GLU B 1 143 ? 36.311  -10.509 74.435  1.00 72.32  ? 143  GLU B OE2 1 
ATOM   3459  N N   . ALA B 1 144 ? 42.000  -9.452  70.553  1.00 53.35  ? 144  ALA B N   1 
ATOM   3460  C CA  . ALA B 1 144 ? 43.193  -9.893  69.822  1.00 55.73  ? 144  ALA B CA  1 
ATOM   3461  C C   . ALA B 1 144 ? 44.382  -8.937  70.028  1.00 61.33  ? 144  ALA B C   1 
ATOM   3462  O O   . ALA B 1 144 ? 45.532  -9.348  69.840  1.00 63.29  ? 144  ALA B O   1 
ATOM   3463  C CB  . ALA B 1 144 ? 42.882  -10.013 68.337  1.00 56.25  ? 144  ALA B CB  1 
ATOM   3464  N N   . ASN B 1 145 ? 44.105  -7.670  70.403  1.00 56.37  ? 145  ASN B N   1 
ATOM   3465  C CA  . ASN B 1 145 ? 45.129  -6.656  70.635  1.00 56.95  ? 145  ASN B CA  1 
ATOM   3466  C C   . ASN B 1 145 ? 45.378  -6.472  72.152  1.00 59.96  ? 145  ASN B C   1 
ATOM   3467  O O   . ASN B 1 145 ? 45.771  -5.391  72.597  1.00 59.65  ? 145  ASN B O   1 
ATOM   3468  C CB  . ASN B 1 145 ? 44.733  -5.338  69.950  1.00 59.19  ? 145  ASN B CB  1 
ATOM   3469  C CG  . ASN B 1 145 ? 45.875  -4.367  69.697  1.00 94.12  ? 145  ASN B CG  1 
ATOM   3470  O OD1 . ASN B 1 145 ? 47.049  -4.740  69.529  1.00 92.18  ? 145  ASN B OD1 1 
ATOM   3471  N ND2 . ASN B 1 145 ? 45.552  -3.081  69.678  1.00 87.11  ? 145  ASN B ND2 1 
ATOM   3472  N N   . ALA B 1 146 ? 45.188  -7.566  72.930  1.00 56.01  ? 146  ALA B N   1 
ATOM   3473  C CA  . ALA B 1 146 ? 45.372  -7.681  74.388  1.00 55.61  ? 146  ALA B CA  1 
ATOM   3474  C C   . ALA B 1 146 ? 44.521  -6.663  75.173  1.00 57.47  ? 146  ALA B C   1 
ATOM   3475  O O   . ALA B 1 146 ? 44.987  -6.085  76.163  1.00 57.49  ? 146  ALA B O   1 
ATOM   3476  C CB  . ALA B 1 146 ? 46.851  -7.551  74.759  1.00 58.35  ? 146  ALA B CB  1 
ATOM   3477  N N   . LYS B 1 147 ? 43.253  -6.485  74.737  1.00 51.91  ? 147  LYS B N   1 
ATOM   3478  C CA  . LYS B 1 147 ? 42.244  -5.596  75.332  1.00 49.34  ? 147  LYS B CA  1 
ATOM   3479  C C   . LYS B 1 147 ? 42.733  -4.124  75.406  1.00 52.96  ? 147  LYS B C   1 
ATOM   3480  O O   . LYS B 1 147 ? 42.542  -3.447  76.421  1.00 51.82  ? 147  LYS B O   1 
ATOM   3481  C CB  . LYS B 1 147 ? 41.789  -6.107  76.720  1.00 50.65  ? 147  LYS B CB  1 
ATOM   3482  C CG  . LYS B 1 147 ? 40.871  -7.330  76.652  1.00 50.63  ? 147  LYS B CG  1 
ATOM   3483  C CD  . LYS B 1 147 ? 40.221  -7.672  77.994  1.00 59.29  ? 147  LYS B CD  1 
ATOM   3484  C CE  . LYS B 1 147 ? 38.916  -6.935  78.285  1.00 73.75  ? 147  LYS B CE  1 
ATOM   3485  N NZ  . LYS B 1 147 ? 38.106  -7.582  79.361  1.00 85.94  ? 147  LYS B NZ  1 
ATOM   3486  N N   . ARG B 1 148 ? 43.340  -3.631  74.310  1.00 49.88  ? 148  ARG B N   1 
ATOM   3487  C CA  . ARG B 1 148 ? 43.809  -2.245  74.184  1.00 49.00  ? 148  ARG B CA  1 
ATOM   3488  C C   . ARG B 1 148 ? 43.660  -1.727  72.771  1.00 52.69  ? 148  ARG B C   1 
ATOM   3489  O O   . ARG B 1 148 ? 43.876  -2.467  71.812  1.00 53.75  ? 148  ARG B O   1 
ATOM   3490  C CB  . ARG B 1 148 ? 45.295  -2.076  74.584  1.00 49.09  ? 148  ARG B CB  1 
ATOM   3491  C CG  . ARG B 1 148 ? 45.710  -2.426  76.004  1.00 53.98  ? 148  ARG B CG  1 
ATOM   3492  C CD  . ARG B 1 148 ? 45.170  -1.498  77.089  1.00 54.97  ? 148  ARG B CD  1 
ATOM   3493  N NE  . ARG B 1 148 ? 45.747  -1.827  78.398  1.00 57.16  ? 148  ARG B NE  1 
ATOM   3494  C CZ  . ARG B 1 148 ? 45.404  -2.882  79.140  1.00 72.71  ? 148  ARG B CZ  1 
ATOM   3495  N NH1 . ARG B 1 148 ? 44.475  -3.733  78.715  1.00 59.75  ? 148  ARG B NH1 1 
ATOM   3496  N NH2 . ARG B 1 148 ? 45.985  -3.090  80.313  1.00 61.67  ? 148  ARG B NH2 1 
ATOM   3497  N N   . PHE B 1 149 ? 43.332  -0.439  72.653  1.00 48.28  ? 149  PHE B N   1 
ATOM   3498  C CA  . PHE B 1 149 ? 43.284  0.339   71.414  1.00 48.02  ? 149  PHE B CA  1 
ATOM   3499  C C   . PHE B 1 149 ? 44.127  1.584   71.655  1.00 51.47  ? 149  PHE B C   1 
ATOM   3500  O O   . PHE B 1 149 ? 44.078  2.140   72.753  1.00 49.93  ? 149  PHE B O   1 
ATOM   3501  C CB  . PHE B 1 149 ? 41.841  0.721   70.993  1.00 47.62  ? 149  PHE B CB  1 
ATOM   3502  C CG  . PHE B 1 149 ? 40.968  -0.329  70.340  1.00 48.31  ? 149  PHE B CG  1 
ATOM   3503  C CD1 . PHE B 1 149 ? 41.514  -1.285  69.490  1.00 51.91  ? 149  PHE B CD1 1 
ATOM   3504  C CD2 . PHE B 1 149 ? 39.587  -0.313  70.513  1.00 48.71  ? 149  PHE B CD2 1 
ATOM   3505  C CE1 . PHE B 1 149 ? 40.701  -2.253  68.889  1.00 52.45  ? 149  PHE B CE1 1 
ATOM   3506  C CE2 . PHE B 1 149 ? 38.772  -1.268  69.893  1.00 50.95  ? 149  PHE B CE2 1 
ATOM   3507  C CZ  . PHE B 1 149 ? 39.333  -2.226  69.079  1.00 50.33  ? 149  PHE B CZ  1 
ATOM   3508  N N   . SER B 1 150 ? 44.902  2.020   70.657  1.00 48.55  ? 150  SER B N   1 
ATOM   3509  C CA  . SER B 1 150 ? 45.734  3.220   70.775  1.00 48.27  ? 150  SER B CA  1 
ATOM   3510  C C   . SER B 1 150 ? 44.874  4.489   70.845  1.00 50.55  ? 150  SER B C   1 
ATOM   3511  O O   . SER B 1 150 ? 43.716  4.476   70.420  1.00 48.49  ? 150  SER B O   1 
ATOM   3512  C CB  . SER B 1 150 ? 46.696  3.313   69.594  1.00 51.53  ? 150  SER B CB  1 
ATOM   3513  O OG  . SER B 1 150 ? 45.993  3.395   68.366  1.00 54.48  ? 150  SER B OG  1 
ATOM   3514  N N   . ARG B 1 151 ? 45.458  5.589   71.359  1.00 48.22  ? 151  ARG B N   1 
ATOM   3515  C CA  . ARG B 1 151 ? 44.822  6.910   71.453  1.00 47.05  ? 151  ARG B CA  1 
ATOM   3516  C C   . ARG B 1 151 ? 44.322  7.339   70.065  1.00 50.70  ? 151  ARG B C   1 
ATOM   3517  O O   . ARG B 1 151 ? 43.189  7.810   69.949  1.00 48.79  ? 151  ARG B O   1 
ATOM   3518  C CB  . ARG B 1 151 ? 45.813  7.936   72.031  1.00 47.99  ? 151  ARG B CB  1 
ATOM   3519  C CG  . ARG B 1 151 ? 45.185  9.243   72.479  1.00 53.45  ? 151  ARG B CG  1 
ATOM   3520  C CD  . ARG B 1 151 ? 46.149  9.990   73.362  1.00 64.43  ? 151  ARG B CD  1 
ATOM   3521  N NE  . ARG B 1 151 ? 45.738  11.372  73.600  1.00 72.14  ? 151  ARG B NE  1 
ATOM   3522  C CZ  . ARG B 1 151 ? 46.499  12.280  74.201  1.00 85.04  ? 151  ARG B CZ  1 
ATOM   3523  N NH1 . ARG B 1 151 ? 47.721  11.967  74.611  1.00 75.50  ? 151  ARG B NH1 1 
ATOM   3524  N NH2 . ARG B 1 151 ? 46.047  13.513  74.386  1.00 67.07  ? 151  ARG B NH2 1 
ATOM   3525  N N   . LYS B 1 152 ? 45.145  7.096   69.015  1.00 48.10  ? 152  LYS B N   1 
ATOM   3526  C CA  . LYS B 1 152 ? 44.826  7.372   67.616  1.00 47.57  ? 152  LYS B CA  1 
ATOM   3527  C C   . LYS B 1 152 ? 43.582  6.585   67.190  1.00 49.61  ? 152  LYS B C   1 
ATOM   3528  O O   . LYS B 1 152 ? 42.668  7.187   66.638  1.00 48.70  ? 152  LYS B O   1 
ATOM   3529  C CB  . LYS B 1 152 ? 46.032  7.041   66.712  1.00 51.41  ? 152  LYS B CB  1 
ATOM   3530  C CG  . LYS B 1 152 ? 45.753  7.015   65.207  1.00 53.28  ? 152  LYS B CG  1 
ATOM   3531  C CD  . LYS B 1 152 ? 45.588  8.401   64.588  1.00 57.89  ? 152  LYS B CD  1 
ATOM   3532  C CE  . LYS B 1 152 ? 45.290  8.325   63.110  1.00 62.22  ? 152  LYS B CE  1 
ATOM   3533  N NZ  . LYS B 1 152 ? 44.926  9.650   62.547  1.00 60.05  ? 152  LYS B NZ  1 
ATOM   3534  N N   . THR B 1 153 ? 43.534  5.264   67.482  1.00 45.36  ? 153  THR B N   1 
ATOM   3535  C CA  . THR B 1 153 ? 42.410  4.377   67.152  1.00 43.37  ? 153  THR B CA  1 
ATOM   3536  C C   . THR B 1 153 ? 41.123  4.836   67.854  1.00 44.90  ? 153  THR B C   1 
ATOM   3537  O O   . THR B 1 153 ? 40.091  4.970   67.198  1.00 44.26  ? 153  THR B O   1 
ATOM   3538  C CB  . THR B 1 153 ? 42.759  2.912   67.502  1.00 50.43  ? 153  THR B CB  1 
ATOM   3539  O OG1 . THR B 1 153 ? 43.877  2.498   66.707  1.00 51.84  ? 153  THR B OG1 1 
ATOM   3540  C CG2 . THR B 1 153 ? 41.587  1.948   67.279  1.00 44.68  ? 153  THR B CG2 1 
ATOM   3541  N N   . VAL B 1 154 ? 41.189  5.080   69.174  1.00 40.13  ? 154  VAL B N   1 
ATOM   3542  C CA  . VAL B 1 154 ? 40.037  5.486   69.986  1.00 37.48  ? 154  VAL B CA  1 
ATOM   3543  C C   . VAL B 1 154 ? 39.470  6.835   69.502  1.00 40.85  ? 154  VAL B C   1 
ATOM   3544  O O   . VAL B 1 154 ? 38.250  6.956   69.380  1.00 38.36  ? 154  VAL B O   1 
ATOM   3545  C CB  . VAL B 1 154 ? 40.373  5.506   71.496  1.00 40.16  ? 154  VAL B CB  1 
ATOM   3546  C CG1 . VAL B 1 154 ? 39.224  6.080   72.323  1.00 37.76  ? 154  VAL B CG1 1 
ATOM   3547  C CG2 . VAL B 1 154 ? 40.723  4.107   71.984  1.00 40.25  ? 154  VAL B CG2 1 
ATOM   3548  N N   . LEU B 1 155 ? 40.344  7.822   69.202  1.00 39.04  ? 155  LEU B N   1 
ATOM   3549  C CA  . LEU B 1 155 ? 39.911  9.138   68.718  1.00 38.54  ? 155  LEU B CA  1 
ATOM   3550  C C   . LEU B 1 155 ? 39.272  9.031   67.333  1.00 42.72  ? 155  LEU B C   1 
ATOM   3551  O O   . LEU B 1 155 ? 38.223  9.638   67.100  1.00 40.93  ? 155  LEU B O   1 
ATOM   3552  C CB  . LEU B 1 155 ? 41.076  10.148  68.701  1.00 39.93  ? 155  LEU B CB  1 
ATOM   3553  C CG  . LEU B 1 155 ? 41.602  10.580  70.071  1.00 43.43  ? 155  LEU B CG  1 
ATOM   3554  C CD1 . LEU B 1 155 ? 42.952  11.225  69.958  1.00 44.85  ? 155  LEU B CD1 1 
ATOM   3555  C CD2 . LEU B 1 155 ? 40.634  11.494  70.777  1.00 44.72  ? 155  LEU B CD2 1 
ATOM   3556  N N   . GLN B 1 156 ? 39.873  8.212   66.445  1.00 40.53  ? 156  GLN B N   1 
ATOM   3557  C CA  . GLN B 1 156 ? 39.373  7.991   65.086  1.00 40.40  ? 156  GLN B CA  1 
ATOM   3558  C C   . GLN B 1 156 ? 38.026  7.281   65.113  1.00 43.16  ? 156  GLN B C   1 
ATOM   3559  O O   . GLN B 1 156 ? 37.136  7.680   64.362  1.00 41.85  ? 156  GLN B O   1 
ATOM   3560  C CB  . GLN B 1 156 ? 40.387  7.218   64.222  1.00 42.71  ? 156  GLN B CB  1 
ATOM   3561  C CG  . GLN B 1 156 ? 41.608  8.055   63.808  1.00 51.04  ? 156  GLN B CG  1 
ATOM   3562  C CD  . GLN B 1 156 ? 41.316  9.248   62.926  1.00 60.70  ? 156  GLN B CD  1 
ATOM   3563  O OE1 . GLN B 1 156 ? 41.958  10.286  63.030  1.00 54.74  ? 156  GLN B OE1 1 
ATOM   3564  N NE2 . GLN B 1 156 ? 40.356  9.138   62.034  1.00 53.50  ? 156  GLN B NE2 1 
ATOM   3565  N N   . LEU B 1 157 ? 37.866  6.260   65.990  1.00 39.97  ? 157  LEU B N   1 
ATOM   3566  C CA  . LEU B 1 157 ? 36.605  5.523   66.160  1.00 38.71  ? 157  LEU B CA  1 
ATOM   3567  C C   . LEU B 1 157 ? 35.518  6.447   66.665  1.00 41.60  ? 157  LEU B C   1 
ATOM   3568  O O   . LEU B 1 157 ? 34.437  6.474   66.089  1.00 40.60  ? 157  LEU B O   1 
ATOM   3569  C CB  . LEU B 1 157 ? 36.749  4.337   67.143  1.00 38.58  ? 157  LEU B CB  1 
ATOM   3570  C CG  . LEU B 1 157 ? 37.511  3.101   66.679  1.00 44.40  ? 157  LEU B CG  1 
ATOM   3571  C CD1 . LEU B 1 157 ? 37.754  2.154   67.839  1.00 44.19  ? 157  LEU B CD1 1 
ATOM   3572  C CD2 . LEU B 1 157 ? 36.797  2.395   65.527  1.00 46.69  ? 157  LEU B CD2 1 
ATOM   3573  N N   . SER B 1 158 ? 35.824  7.229   67.723  1.00 38.63  ? 158  SER B N   1 
ATOM   3574  C CA  . SER B 1 158 ? 34.898  8.140   68.397  1.00 37.14  ? 158  SER B CA  1 
ATOM   3575  C C   . SER B 1 158 ? 34.410  9.258   67.498  1.00 42.16  ? 158  SER B C   1 
ATOM   3576  O O   . SER B 1 158 ? 33.243  9.625   67.614  1.00 41.11  ? 158  SER B O   1 
ATOM   3577  C CB  . SER B 1 158 ? 35.531  8.720   69.649  1.00 39.90  ? 158  SER B CB  1 
ATOM   3578  O OG  . SER B 1 158 ? 35.888  7.653   70.509  1.00 44.78  ? 158  SER B OG  1 
ATOM   3579  N N   . LEU B 1 159 ? 35.266  9.780   66.587  1.00 40.25  ? 159  LEU B N   1 
ATOM   3580  C CA  . LEU B 1 159 ? 34.855  10.816  65.633  1.00 39.70  ? 159  LEU B CA  1 
ATOM   3581  C C   . LEU B 1 159 ? 33.760  10.273  64.712  1.00 43.32  ? 159  LEU B C   1 
ATOM   3582  O O   . LEU B 1 159 ? 32.800  10.986  64.433  1.00 43.92  ? 159  LEU B O   1 
ATOM   3583  C CB  . LEU B 1 159 ? 36.048  11.340  64.800  1.00 41.16  ? 159  LEU B CB  1 
ATOM   3584  C CG  . LEU B 1 159 ? 37.035  12.285  65.491  1.00 46.00  ? 159  LEU B CG  1 
ATOM   3585  C CD1 . LEU B 1 159 ? 38.274  12.482  64.646  1.00 47.36  ? 159  LEU B CD1 1 
ATOM   3586  C CD2 . LEU B 1 159 ? 36.401  13.631  65.799  1.00 48.04  ? 159  LEU B CD2 1 
ATOM   3587  N N   . ARG B 1 160 ? 33.888  9.000   64.272  1.00 38.77  ? 160  ARG B N   1 
ATOM   3588  C CA  . ARG B 1 160 ? 32.925  8.312   63.403  1.00 37.00  ? 160  ARG B CA  1 
ATOM   3589  C C   . ARG B 1 160 ? 31.649  7.970   64.151  1.00 39.41  ? 160  ARG B C   1 
ATOM   3590  O O   . ARG B 1 160 ? 30.573  8.040   63.567  1.00 38.41  ? 160  ARG B O   1 
ATOM   3591  C CB  . ARG B 1 160 ? 33.515  7.021   62.808  1.00 36.13  ? 160  ARG B CB  1 
ATOM   3592  C CG  . ARG B 1 160 ? 34.706  7.215   61.889  1.00 41.22  ? 160  ARG B CG  1 
ATOM   3593  C CD  . ARG B 1 160 ? 34.509  8.320   60.868  1.00 46.61  ? 160  ARG B CD  1 
ATOM   3594  N NE  . ARG B 1 160 ? 35.644  9.233   60.916  1.00 54.54  ? 160  ARG B NE  1 
ATOM   3595  C CZ  . ARG B 1 160 ? 35.554  10.548  61.027  1.00 56.71  ? 160  ARG B CZ  1 
ATOM   3596  N NH1 . ARG B 1 160 ? 34.371  11.138  61.065  1.00 37.40  ? 160  ARG B NH1 1 
ATOM   3597  N NH2 . ARG B 1 160 ? 36.644  11.286  61.083  1.00 45.51  ? 160  ARG B NH2 1 
ATOM   3598  N N   . ILE B 1 161 ? 31.763  7.574   65.433  1.00 35.50  ? 161  ILE B N   1 
ATOM   3599  C CA  . ILE B 1 161 ? 30.607  7.244   66.266  1.00 34.04  ? 161  ILE B CA  1 
ATOM   3600  C C   . ILE B 1 161 ? 29.805  8.538   66.513  1.00 37.43  ? 161  ILE B C   1 
ATOM   3601  O O   . ILE B 1 161 ? 28.576  8.500   66.429  1.00 37.48  ? 161  ILE B O   1 
ATOM   3602  C CB  . ILE B 1 161 ? 31.021  6.497   67.566  1.00 36.71  ? 161  ILE B CB  1 
ATOM   3603  C CG1 . ILE B 1 161 ? 31.607  5.104   67.219  1.00 36.47  ? 161  ILE B CG1 1 
ATOM   3604  C CG2 . ILE B 1 161 ? 29.836  6.363   68.551  1.00 36.26  ? 161  ILE B CG2 1 
ATOM   3605  C CD1 . ILE B 1 161 ? 32.493  4.491   68.304  1.00 43.04  ? 161  ILE B CD1 1 
ATOM   3606  N N   . LEU B 1 162 ? 30.490  9.689   66.702  1.00 33.76  ? 162  LEU B N   1 
ATOM   3607  C CA  . LEU B 1 162 ? 29.823  10.987  66.865  1.00 32.86  ? 162  LEU B CA  1 
ATOM   3608  C C   . LEU B 1 162 ? 28.999  11.342  65.627  1.00 34.23  ? 162  LEU B C   1 
ATOM   3609  O O   . LEU B 1 162 ? 27.916  11.904  65.774  1.00 32.78  ? 162  LEU B O   1 
ATOM   3610  C CB  . LEU B 1 162 ? 30.815  12.117  67.185  1.00 34.24  ? 162  LEU B CB  1 
ATOM   3611  C CG  . LEU B 1 162 ? 31.372  12.155  68.613  1.00 39.07  ? 162  LEU B CG  1 
ATOM   3612  C CD1 . LEU B 1 162 ? 32.286  13.341  68.801  1.00 40.00  ? 162  LEU B CD1 1 
ATOM   3613  C CD2 . LEU B 1 162 ? 30.254  12.194  69.649  1.00 40.78  ? 162  LEU B CD2 1 
ATOM   3614  N N   . ASP B 1 163 ? 29.486  10.967  64.422  1.00 30.77  ? 163  ASP B N   1 
ATOM   3615  C CA  . ASP B 1 163 ? 28.785  11.180  63.152  1.00 30.28  ? 163  ASP B CA  1 
ATOM   3616  C C   . ASP B 1 163 ? 27.517  10.344  63.112  1.00 32.48  ? 163  ASP B C   1 
ATOM   3617  O O   . ASP B 1 163 ? 26.465  10.861  62.733  1.00 31.62  ? 163  ASP B O   1 
ATOM   3618  C CB  . ASP B 1 163 ? 29.688  10.836  61.942  1.00 32.91  ? 163  ASP B CB  1 
ATOM   3619  C CG  . ASP B 1 163 ? 30.827  11.800  61.657  1.00 40.24  ? 163  ASP B CG  1 
ATOM   3620  O OD1 . ASP B 1 163 ? 30.753  12.961  62.106  1.00 37.99  ? 163  ASP B OD1 1 
ATOM   3621  O OD2 . ASP B 1 163 ? 31.741  11.424  60.905  1.00 48.02  ? 163  ASP B OD2 1 
ATOM   3622  N N   . ILE B 1 164 ? 27.620  9.051   63.504  1.00 29.73  ? 164  ILE B N   1 
ATOM   3623  C CA  . ILE B 1 164 ? 26.508  8.093   63.563  1.00 28.92  ? 164  ILE B CA  1 
ATOM   3624  C C   . ILE B 1 164 ? 25.453  8.591   64.544  1.00 31.56  ? 164  ILE B C   1 
ATOM   3625  O O   . ILE B 1 164 ? 24.270  8.633   64.195  1.00 30.92  ? 164  ILE B O   1 
ATOM   3626  C CB  . ILE B 1 164 ? 26.995  6.665   63.965  1.00 31.93  ? 164  ILE B CB  1 
ATOM   3627  C CG1 . ILE B 1 164 ? 27.954  6.083   62.917  1.00 32.70  ? 164  ILE B CG1 1 
ATOM   3628  C CG2 . ILE B 1 164 ? 25.807  5.714   64.226  1.00 31.56  ? 164  ILE B CG2 1 
ATOM   3629  C CD1 . ILE B 1 164 ? 28.890  4.963   63.450  1.00 35.31  ? 164  ILE B CD1 1 
ATOM   3630  N N   . LEU B 1 165 ? 25.890  8.945   65.771  1.00 27.30  ? 165  LEU B N   1 
ATOM   3631  C CA  . LEU B 1 165 ? 25.014  9.395   66.848  1.00 26.27  ? 165  LEU B CA  1 
ATOM   3632  C C   . LEU B 1 165 ? 24.310  10.679  66.468  1.00 29.87  ? 165  LEU B C   1 
ATOM   3633  O O   . LEU B 1 165 ? 23.097  10.727  66.613  1.00 29.25  ? 165  LEU B O   1 
ATOM   3634  C CB  . LEU B 1 165 ? 25.757  9.527   68.198  1.00 25.86  ? 165  LEU B CB  1 
ATOM   3635  C CG  . LEU B 1 165 ? 26.290  8.219   68.815  1.00 28.32  ? 165  LEU B CG  1 
ATOM   3636  C CD1 . LEU B 1 165 ? 27.016  8.484   70.124  1.00 27.48  ? 165  LEU B CD1 1 
ATOM   3637  C CD2 . LEU B 1 165 ? 25.188  7.169   68.993  1.00 28.05  ? 165  LEU B CD2 1 
ATOM   3638  N N   . GLU B 1 166 ? 25.018  11.675  65.900  1.00 27.19  ? 166  GLU B N   1 
ATOM   3639  C CA  . GLU B 1 166 ? 24.360  12.910  65.436  1.00 27.51  ? 166  GLU B CA  1 
ATOM   3640  C C   . GLU B 1 166 ? 23.239  12.602  64.420  1.00 31.86  ? 166  GLU B C   1 
ATOM   3641  O O   . GLU B 1 166 ? 22.133  13.136  64.553  1.00 32.40  ? 166  GLU B O   1 
ATOM   3642  C CB  . GLU B 1 166 ? 25.365  13.883  64.802  1.00 29.90  ? 166  GLU B CB  1 
ATOM   3643  C CG  . GLU B 1 166 ? 24.688  15.147  64.291  1.00 36.27  ? 166  GLU B CG  1 
ATOM   3644  C CD  . GLU B 1 166 ? 25.587  16.311  63.947  1.00 51.53  ? 166  GLU B CD  1 
ATOM   3645  O OE1 . GLU B 1 166 ? 26.791  16.082  63.701  1.00 37.53  ? 166  GLU B OE1 1 
ATOM   3646  O OE2 . GLU B 1 166 ? 25.079  17.455  63.904  1.00 51.30  ? 166  GLU B OE2 1 
ATOM   3647  N N   . TYR B 1 167 ? 23.532  11.730  63.433  1.00 27.14  ? 167  TYR B N   1 
ATOM   3648  C CA  . TYR B 1 167 ? 22.591  11.340  62.396  1.00 26.46  ? 167  TYR B CA  1 
ATOM   3649  C C   . TYR B 1 167 ? 21.328  10.696  62.989  1.00 31.33  ? 167  TYR B C   1 
ATOM   3650  O O   . TYR B 1 167 ? 20.235  11.168  62.696  1.00 33.06  ? 167  TYR B O   1 
ATOM   3651  C CB  . TYR B 1 167 ? 23.258  10.400  61.377  1.00 27.15  ? 167  TYR B CB  1 
ATOM   3652  C CG  . TYR B 1 167 ? 22.298  9.905   60.320  1.00 28.35  ? 167  TYR B CG  1 
ATOM   3653  C CD1 . TYR B 1 167 ? 21.567  8.739   60.509  1.00 29.24  ? 167  TYR B CD1 1 
ATOM   3654  C CD2 . TYR B 1 167 ? 22.081  10.632  59.147  1.00 28.89  ? 167  TYR B CD2 1 
ATOM   3655  C CE1 . TYR B 1 167 ? 20.650  8.307   59.558  1.00 28.42  ? 167  TYR B CE1 1 
ATOM   3656  C CE2 . TYR B 1 167 ? 21.191  10.190  58.175  1.00 29.18  ? 167  TYR B CE2 1 
ATOM   3657  C CZ  . TYR B 1 167 ? 20.465  9.042   58.392  1.00 33.55  ? 167  TYR B CZ  1 
ATOM   3658  O OH  . TYR B 1 167 ? 19.576  8.654   57.428  1.00 31.36  ? 167  TYR B OH  1 
ATOM   3659  N N   . ILE B 1 168 ? 21.469  9.636   63.813  1.00 27.46  ? 168  ILE B N   1 
ATOM   3660  C CA  . ILE B 1 168 ? 20.330  8.895   64.376  1.00 25.79  ? 168  ILE B CA  1 
ATOM   3661  C C   . ILE B 1 168 ? 19.529  9.780   65.347  1.00 29.94  ? 168  ILE B C   1 
ATOM   3662  O O   . ILE B 1 168 ? 18.298  9.706   65.341  1.00 29.29  ? 168  ILE B O   1 
ATOM   3663  C CB  . ILE B 1 168 ? 20.708  7.512   64.990  1.00 27.54  ? 168  ILE B CB  1 
ATOM   3664  C CG1 . ILE B 1 168 ? 21.581  7.614   66.270  1.00 27.88  ? 168  ILE B CG1 1 
ATOM   3665  C CG2 . ILE B 1 168 ? 21.333  6.593   63.946  1.00 26.02  ? 168  ILE B CG2 1 
ATOM   3666  C CD1 . ILE B 1 168 ? 21.531  6.406   67.199  1.00 22.71  ? 168  ILE B CD1 1 
ATOM   3667  N N   . HIS B 1 169 ? 20.214  10.640  66.136  1.00 26.29  ? 169  HIS B N   1 
ATOM   3668  C CA  . HIS B 1 169 ? 19.575  11.583  67.057  1.00 25.41  ? 169  HIS B CA  1 
ATOM   3669  C C   . HIS B 1 169 ? 18.730  12.593  66.281  1.00 30.06  ? 169  HIS B C   1 
ATOM   3670  O O   . HIS B 1 169 ? 17.612  12.886  66.702  1.00 29.92  ? 169  HIS B O   1 
ATOM   3671  C CB  . HIS B 1 169 ? 20.611  12.308  67.928  1.00 25.44  ? 169  HIS B CB  1 
ATOM   3672  C CG  . HIS B 1 169 ? 21.353  11.436  68.904  1.00 27.21  ? 169  HIS B CG  1 
ATOM   3673  N ND1 . HIS B 1 169 ? 22.420  11.932  69.645  1.00 28.08  ? 169  HIS B ND1 1 
ATOM   3674  C CD2 . HIS B 1 169 ? 21.187  10.130  69.213  1.00 26.91  ? 169  HIS B CD2 1 
ATOM   3675  C CE1 . HIS B 1 169 ? 22.856  10.920  70.369  1.00 25.81  ? 169  HIS B CE1 1 
ATOM   3676  N NE2 . HIS B 1 169 ? 22.144  9.819   70.149  1.00 25.74  ? 169  HIS B NE2 1 
ATOM   3677  N N   . GLU B 1 170 ? 19.240  13.082  65.125  1.00 27.32  ? 170  GLU B N   1 
ATOM   3678  C CA  . GLU B 1 170 ? 18.518  14.022  64.257  1.00 28.55  ? 170  GLU B CA  1 
ATOM   3679  C C   . GLU B 1 170 ? 17.331  13.336  63.558  1.00 31.55  ? 170  GLU B C   1 
ATOM   3680  O O   . GLU B 1 170 ? 16.452  14.020  63.042  1.00 31.76  ? 170  GLU B O   1 
ATOM   3681  C CB  . GLU B 1 170 ? 19.460  14.660  63.214  1.00 31.23  ? 170  GLU B CB  1 
ATOM   3682  C CG  . GLU B 1 170 ? 20.336  15.764  63.781  1.00 43.19  ? 170  GLU B CG  1 
ATOM   3683  C CD  . GLU B 1 170 ? 19.594  16.883  64.480  1.00 63.59  ? 170  GLU B CD  1 
ATOM   3684  O OE1 . GLU B 1 170 ? 18.836  17.618  63.804  1.00 61.47  ? 170  GLU B OE1 1 
ATOM   3685  O OE2 . GLU B 1 170 ? 19.769  17.017  65.713  1.00 56.34  ? 170  GLU B OE2 1 
ATOM   3686  N N   . HIS B 1 171 ? 17.310  11.989  63.557  1.00 26.99  ? 171  HIS B N   1 
ATOM   3687  C CA  . HIS B 1 171 ? 16.261  11.177  62.967  1.00 25.99  ? 171  HIS B CA  1 
ATOM   3688  C C   . HIS B 1 171 ? 15.410  10.501  64.070  1.00 31.19  ? 171  HIS B C   1 
ATOM   3689  O O   . HIS B 1 171 ? 14.838  9.432   63.851  1.00 32.40  ? 171  HIS B O   1 
ATOM   3690  C CB  . HIS B 1 171 ? 16.864  10.174  61.976  1.00 26.01  ? 171  HIS B CB  1 
ATOM   3691  C CG  . HIS B 1 171 ? 17.360  10.840  60.731  1.00 29.56  ? 171  HIS B CG  1 
ATOM   3692  N ND1 . HIS B 1 171 ? 18.574  11.494  60.699  1.00 31.51  ? 171  HIS B ND1 1 
ATOM   3693  C CD2 . HIS B 1 171 ? 16.754  10.995  59.536  1.00 31.85  ? 171  HIS B CD2 1 
ATOM   3694  C CE1 . HIS B 1 171 ? 18.676  12.009  59.488  1.00 31.79  ? 171  HIS B CE1 1 
ATOM   3695  N NE2 . HIS B 1 171 ? 17.615  11.717  58.745  1.00 32.32  ? 171  HIS B NE2 1 
ATOM   3696  N N   . GLU B 1 172 ? 15.296  11.186  65.242  1.00 27.87  ? 172  GLU B N   1 
ATOM   3697  C CA  . GLU B 1 172 ? 14.468  10.892  66.434  1.00 26.76  ? 172  GLU B CA  1 
ATOM   3698  C C   . GLU B 1 172 ? 14.852  9.621   67.229  1.00 29.39  ? 172  GLU B C   1 
ATOM   3699  O O   . GLU B 1 172 ? 14.074  9.205   68.088  1.00 29.39  ? 172  GLU B O   1 
ATOM   3700  C CB  . GLU B 1 172 ? 12.969  10.783  66.054  1.00 28.15  ? 172  GLU B CB  1 
ATOM   3701  C CG  . GLU B 1 172 ? 12.456  11.876  65.134  1.00 36.01  ? 172  GLU B CG  1 
ATOM   3702  C CD  . GLU B 1 172 ? 10.995  11.795  64.749  1.00 51.23  ? 172  GLU B CD  1 
ATOM   3703  O OE1 . GLU B 1 172 ? 10.477  10.671  64.536  1.00 40.83  ? 172  GLU B OE1 1 
ATOM   3704  O OE2 . GLU B 1 172 ? 10.382  12.877  64.604  1.00 46.06  ? 172  GLU B OE2 1 
ATOM   3705  N N   . TYR B 1 173 ? 16.032  9.032   66.991  1.00 25.09  ? 173  TYR B N   1 
ATOM   3706  C CA  . TYR B 1 173 ? 16.426  7.808   67.696  1.00 22.82  ? 173  TYR B CA  1 
ATOM   3707  C C   . TYR B 1 173 ? 17.691  7.915   68.504  1.00 26.22  ? 173  TYR B C   1 
ATOM   3708  O O   . TYR B 1 173 ? 18.600  8.654   68.147  1.00 26.87  ? 173  TYR B O   1 
ATOM   3709  C CB  . TYR B 1 173 ? 16.636  6.664   66.706  1.00 22.22  ? 173  TYR B CB  1 
ATOM   3710  C CG  . TYR B 1 173 ? 15.364  5.995   66.248  1.00 21.99  ? 173  TYR B CG  1 
ATOM   3711  C CD1 . TYR B 1 173 ? 14.693  6.436   65.114  1.00 23.30  ? 173  TYR B CD1 1 
ATOM   3712  C CD2 . TYR B 1 173 ? 14.861  4.880   66.911  1.00 21.58  ? 173  TYR B CD2 1 
ATOM   3713  C CE1 . TYR B 1 173 ? 13.520  5.821   64.685  1.00 23.17  ? 173  TYR B CE1 1 
ATOM   3714  C CE2 . TYR B 1 173 ? 13.711  4.232   66.466  1.00 22.05  ? 173  TYR B CE2 1 
ATOM   3715  C CZ  . TYR B 1 173 ? 13.041  4.709   65.356  1.00 27.20  ? 173  TYR B CZ  1 
ATOM   3716  O OH  . TYR B 1 173 ? 11.899  4.075   64.931  1.00 25.74  ? 173  TYR B OH  1 
ATOM   3717  N N   . VAL B 1 174 ? 17.771  7.101   69.571  1.00 21.92  ? 174  VAL B N   1 
ATOM   3718  C CA  . VAL B 1 174 ? 18.958  6.909   70.402  1.00 21.41  ? 174  VAL B CA  1 
ATOM   3719  C C   . VAL B 1 174 ? 19.260  5.400   70.378  1.00 25.53  ? 174  VAL B C   1 
ATOM   3720  O O   . VAL B 1 174 ? 18.333  4.581   70.286  1.00 23.96  ? 174  VAL B O   1 
ATOM   3721  C CB  . VAL B 1 174 ? 18.889  7.503   71.841  1.00 25.33  ? 174  VAL B CB  1 
ATOM   3722  C CG1 . VAL B 1 174 ? 18.847  9.026   71.802  1.00 24.92  ? 174  VAL B CG1 1 
ATOM   3723  C CG2 . VAL B 1 174 ? 17.732  6.931   72.667  1.00 25.00  ? 174  VAL B CG2 1 
ATOM   3724  N N   . HIS B 1 175 ? 20.543  5.037   70.405  1.00 23.34  ? 175  HIS B N   1 
ATOM   3725  C CA  . HIS B 1 175 ? 20.955  3.634   70.354  1.00 23.68  ? 175  HIS B CA  1 
ATOM   3726  C C   . HIS B 1 175 ? 20.868  2.979   71.757  1.00 28.29  ? 175  HIS B C   1 
ATOM   3727  O O   . HIS B 1 175 ? 20.277  1.900   71.899  1.00 28.35  ? 175  HIS B O   1 
ATOM   3728  C CB  . HIS B 1 175 ? 22.377  3.530   69.763  1.00 24.42  ? 175  HIS B CB  1 
ATOM   3729  C CG  . HIS B 1 175 ? 22.767  2.133   69.408  1.00 27.75  ? 175  HIS B CG  1 
ATOM   3730  N ND1 . HIS B 1 175 ? 23.325  1.284   70.348  1.00 29.29  ? 175  HIS B ND1 1 
ATOM   3731  C CD2 . HIS B 1 175 ? 22.632  1.469   68.233  1.00 29.39  ? 175  HIS B CD2 1 
ATOM   3732  C CE1 . HIS B 1 175 ? 23.538  0.147   69.713  1.00 29.12  ? 175  HIS B CE1 1 
ATOM   3733  N NE2 . HIS B 1 175 ? 23.150  0.220   68.428  1.00 29.54  ? 175  HIS B NE2 1 
ATOM   3734  N N   . GLY B 1 176 ? 21.489  3.623   72.754  1.00 24.68  ? 176  GLY B N   1 
ATOM   3735  C CA  . GLY B 1 176 ? 21.496  3.182   74.147  1.00 24.24  ? 176  GLY B CA  1 
ATOM   3736  C C   . GLY B 1 176 ? 22.328  1.958   74.473  1.00 28.75  ? 176  GLY B C   1 
ATOM   3737  O O   . GLY B 1 176 ? 22.336  1.508   75.623  1.00 27.95  ? 176  GLY B O   1 
ATOM   3738  N N   . ASP B 1 177 ? 23.057  1.412   73.483  1.00 26.42  ? 177  ASP B N   1 
ATOM   3739  C CA  . ASP B 1 177 ? 23.863  0.213   73.703  1.00 26.06  ? 177  ASP B CA  1 
ATOM   3740  C C   . ASP B 1 177 ? 25.125  0.192   72.818  1.00 29.24  ? 177  ASP B C   1 
ATOM   3741  O O   . ASP B 1 177 ? 25.456  -0.831  72.208  1.00 28.63  ? 177  ASP B O   1 
ATOM   3742  C CB  . ASP B 1 177 ? 23.001  -1.049  73.485  1.00 27.93  ? 177  ASP B CB  1 
ATOM   3743  C CG  . ASP B 1 177 ? 23.469  -2.275  74.243  1.00 39.31  ? 177  ASP B CG  1 
ATOM   3744  O OD1 . ASP B 1 177 ? 24.513  -2.187  74.947  1.00 40.68  ? 177  ASP B OD1 1 
ATOM   3745  O OD2 . ASP B 1 177 ? 22.806  -3.327  74.130  1.00 45.01  ? 177  ASP B OD2 1 
ATOM   3746  N N   . ILE B 1 178 ? 25.845  1.321   72.787  1.00 25.98  ? 178  ILE B N   1 
ATOM   3747  C CA  . ILE B 1 178 ? 27.100  1.452   72.042  1.00 26.82  ? 178  ILE B CA  1 
ATOM   3748  C C   . ILE B 1 178 ? 28.178  0.658   72.805  1.00 31.91  ? 178  ILE B C   1 
ATOM   3749  O O   . ILE B 1 178 ? 28.335  0.829   74.021  1.00 31.49  ? 178  ILE B O   1 
ATOM   3750  C CB  . ILE B 1 178 ? 27.504  2.956   71.834  1.00 29.56  ? 178  ILE B CB  1 
ATOM   3751  C CG1 . ILE B 1 178 ? 26.392  3.759   71.119  1.00 27.92  ? 178  ILE B CG1 1 
ATOM   3752  C CG2 . ILE B 1 178 ? 28.848  3.097   71.097  1.00 31.36  ? 178  ILE B CG2 1 
ATOM   3753  C CD1 . ILE B 1 178 ? 25.680  4.727   72.021  1.00 26.57  ? 178  ILE B CD1 1 
ATOM   3754  N N   . LYS B 1 179 ? 28.869  -0.241  72.090  1.00 28.44  ? 179  LYS B N   1 
ATOM   3755  C CA  . LYS B 1 179 ? 29.961  -1.093  72.583  1.00 28.65  ? 179  LYS B CA  1 
ATOM   3756  C C   . LYS B 1 179 ? 30.703  -1.683  71.379  1.00 32.77  ? 179  LYS B C   1 
ATOM   3757  O O   . LYS B 1 179 ? 30.173  -1.640  70.262  1.00 32.45  ? 179  LYS B O   1 
ATOM   3758  C CB  . LYS B 1 179 ? 29.469  -2.186  73.561  1.00 30.47  ? 179  LYS B CB  1 
ATOM   3759  C CG  . LYS B 1 179 ? 28.396  -3.120  73.013  1.00 32.64  ? 179  LYS B CG  1 
ATOM   3760  C CD  . LYS B 1 179 ? 27.805  -3.965  74.113  1.00 37.97  ? 179  LYS B CD  1 
ATOM   3761  C CE  . LYS B 1 179 ? 26.651  -4.768  73.595  1.00 36.66  ? 179  LYS B CE  1 
ATOM   3762  N NZ  . LYS B 1 179 ? 26.130  -5.691  74.625  1.00 38.82  ? 179  LYS B NZ  1 
ATOM   3763  N N   . ALA B 1 180 ? 31.924  -2.214  71.603  1.00 30.32  ? 180  ALA B N   1 
ATOM   3764  C CA  . ALA B 1 180 ? 32.800  -2.789  70.573  1.00 30.60  ? 180  ALA B CA  1 
ATOM   3765  C C   . ALA B 1 180 ? 32.141  -3.952  69.806  1.00 35.86  ? 180  ALA B C   1 
ATOM   3766  O O   . ALA B 1 180 ? 32.381  -4.079  68.605  1.00 36.96  ? 180  ALA B O   1 
ATOM   3767  C CB  . ALA B 1 180 ? 34.115  -3.247  71.196  1.00 32.25  ? 180  ALA B CB  1 
ATOM   3768  N N   . SER B 1 181 ? 31.287  -4.768  70.470  1.00 31.72  ? 181  SER B N   1 
ATOM   3769  C CA  . SER B 1 181 ? 30.602  -5.894  69.815  1.00 31.70  ? 181  SER B CA  1 
ATOM   3770  C C   . SER B 1 181 ? 29.474  -5.424  68.850  1.00 36.52  ? 181  SER B C   1 
ATOM   3771  O O   . SER B 1 181 ? 29.046  -6.204  67.996  1.00 37.94  ? 181  SER B O   1 
ATOM   3772  C CB  . SER B 1 181 ? 30.052  -6.875  70.846  1.00 33.10  ? 181  SER B CB  1 
ATOM   3773  O OG  . SER B 1 181 ? 28.939  -6.347  71.548  1.00 37.49  ? 181  SER B OG  1 
ATOM   3774  N N   . ASN B 1 182 ? 29.016  -4.162  68.977  1.00 31.78  ? 182  ASN B N   1 
ATOM   3775  C CA  . ASN B 1 182 ? 27.983  -3.568  68.116  1.00 30.15  ? 182  ASN B CA  1 
ATOM   3776  C C   . ASN B 1 182 ? 28.609  -2.649  67.064  1.00 34.61  ? 182  ASN B C   1 
ATOM   3777  O O   . ASN B 1 182 ? 27.896  -1.939  66.348  1.00 33.72  ? 182  ASN B O   1 
ATOM   3778  C CB  . ASN B 1 182 ? 26.942  -2.806  68.951  1.00 26.21  ? 182  ASN B CB  1 
ATOM   3779  C CG  . ASN B 1 182 ? 25.932  -3.700  69.638  1.00 38.21  ? 182  ASN B CG  1 
ATOM   3780  O OD1 . ASN B 1 182 ? 25.651  -4.821  69.195  1.00 27.34  ? 182  ASN B OD1 1 
ATOM   3781  N ND2 . ASN B 1 182 ? 25.349  -3.219  70.727  1.00 31.45  ? 182  ASN B ND2 1 
ATOM   3782  N N   . LEU B 1 183 ? 29.948  -2.678  66.964  1.00 32.45  ? 183  LEU B N   1 
ATOM   3783  C CA  . LEU B 1 183 ? 30.700  -1.891  65.990  1.00 32.27  ? 183  LEU B CA  1 
ATOM   3784  C C   . LEU B 1 183 ? 31.415  -2.837  65.040  1.00 38.27  ? 183  LEU B C   1 
ATOM   3785  O O   . LEU B 1 183 ? 32.313  -3.569  65.447  1.00 38.95  ? 183  LEU B O   1 
ATOM   3786  C CB  . LEU B 1 183 ? 31.672  -0.937  66.688  1.00 32.21  ? 183  LEU B CB  1 
ATOM   3787  C CG  . LEU B 1 183 ? 31.030  0.206   67.471  1.00 34.68  ? 183  LEU B CG  1 
ATOM   3788  C CD1 . LEU B 1 183 ? 31.991  0.748   68.503  1.00 34.80  ? 183  LEU B CD1 1 
ATOM   3789  C CD2 . LEU B 1 183 ? 30.521  1.305   66.538  1.00 34.56  ? 183  LEU B CD2 1 
ATOM   3790  N N   . LEU B 1 184 ? 30.955  -2.872  63.790  1.00 34.92  ? 184  LEU B N   1 
ATOM   3791  C CA  . LEU B 1 184 ? 31.465  -3.768  62.759  1.00 35.54  ? 184  LEU B CA  1 
ATOM   3792  C C   . LEU B 1 184 ? 32.157  -2.991  61.648  1.00 39.14  ? 184  LEU B C   1 
ATOM   3793  O O   . LEU B 1 184 ? 31.704  -1.912  61.267  1.00 38.48  ? 184  LEU B O   1 
ATOM   3794  C CB  . LEU B 1 184 ? 30.301  -4.604  62.195  1.00 35.05  ? 184  LEU B CB  1 
ATOM   3795  C CG  . LEU B 1 184 ? 29.934  -5.898  62.945  1.00 39.52  ? 184  LEU B CG  1 
ATOM   3796  C CD1 . LEU B 1 184 ? 29.287  -5.624  64.286  1.00 37.68  ? 184  LEU B CD1 1 
ATOM   3797  C CD2 . LEU B 1 184 ? 28.980  -6.752  62.119  1.00 42.26  ? 184  LEU B CD2 1 
ATOM   3798  N N   . LEU B 1 185 ? 33.273  -3.521  61.153  1.00 36.74  ? 185  LEU B N   1 
ATOM   3799  C CA  . LEU B 1 185 ? 34.026  -2.874  60.083  1.00 37.58  ? 185  LEU B CA  1 
ATOM   3800  C C   . LEU B 1 185 ? 33.424  -3.180  58.736  1.00 42.95  ? 185  LEU B C   1 
ATOM   3801  O O   . LEU B 1 185 ? 32.834  -4.246  58.549  1.00 41.86  ? 185  LEU B O   1 
ATOM   3802  C CB  . LEU B 1 185 ? 35.512  -3.308  60.077  1.00 39.21  ? 185  LEU B CB  1 
ATOM   3803  C CG  . LEU B 1 185 ? 36.385  -2.954  61.286  1.00 43.20  ? 185  LEU B CG  1 
ATOM   3804  C CD1 . LEU B 1 185 ? 37.774  -3.506  61.099  1.00 44.58  ? 185  LEU B CD1 1 
ATOM   3805  C CD2 . LEU B 1 185 ? 36.461  -1.444  61.512  1.00 44.42  ? 185  LEU B CD2 1 
ATOM   3806  N N   . ASN B 1 186 ? 33.588  -2.249  57.783  1.00 42.00  ? 186  ASN B N   1 
ATOM   3807  C CA  . ASN B 1 186 ? 33.157  -2.435  56.403  1.00 42.26  ? 186  ASN B CA  1 
ATOM   3808  C C   . ASN B 1 186 ? 33.943  -3.626  55.850  1.00 48.62  ? 186  ASN B C   1 
ATOM   3809  O O   . ASN B 1 186 ? 35.160  -3.700  56.055  1.00 48.93  ? 186  ASN B O   1 
ATOM   3810  C CB  . ASN B 1 186 ? 33.393  -1.153  55.596  1.00 44.40  ? 186  ASN B CB  1 
ATOM   3811  C CG  . ASN B 1 186 ? 32.947  -1.215  54.157  1.00 59.30  ? 186  ASN B CG  1 
ATOM   3812  O OD1 . ASN B 1 186 ? 33.615  -1.779  53.296  1.00 58.59  ? 186  ASN B OD1 1 
ATOM   3813  N ND2 . ASN B 1 186 ? 31.830  -0.594  53.862  1.00 49.34  ? 186  ASN B ND2 1 
ATOM   3814  N N   . TYR B 1 187 ? 33.241  -4.590  55.231  1.00 46.41  ? 187  TYR B N   1 
ATOM   3815  C CA  . TYR B 1 187 ? 33.840  -5.810  54.699  1.00 48.61  ? 187  TYR B CA  1 
ATOM   3816  C C   . TYR B 1 187 ? 34.977  -5.505  53.705  1.00 55.56  ? 187  TYR B C   1 
ATOM   3817  O O   . TYR B 1 187 ? 36.002  -6.194  53.732  1.00 57.01  ? 187  TYR B O   1 
ATOM   3818  C CB  . TYR B 1 187 ? 32.762  -6.697  54.059  1.00 50.01  ? 187  TYR B CB  1 
ATOM   3819  C CG  . TYR B 1 187 ? 33.259  -8.040  53.576  1.00 54.93  ? 187  TYR B CG  1 
ATOM   3820  C CD1 . TYR B 1 187 ? 33.806  -8.966  54.462  1.00 58.05  ? 187  TYR B CD1 1 
ATOM   3821  C CD2 . TYR B 1 187 ? 33.171  -8.392  52.236  1.00 56.84  ? 187  TYR B CD2 1 
ATOM   3822  C CE1 . TYR B 1 187 ? 34.276  -10.201 54.016  1.00 61.33  ? 187  TYR B CE1 1 
ATOM   3823  C CE2 . TYR B 1 187 ? 33.636  -9.623  51.780  1.00 59.48  ? 187  TYR B CE2 1 
ATOM   3824  C CZ  . TYR B 1 187 ? 34.181  -10.528 52.673  1.00 68.46  ? 187  TYR B CZ  1 
ATOM   3825  O OH  . TYR B 1 187 ? 34.604  -11.748 52.204  1.00 71.04  ? 187  TYR B OH  1 
ATOM   3826  N N   . LYS B 1 188 ? 34.817  -4.434  52.894  1.00 53.00  ? 188  LYS B N   1 
ATOM   3827  C CA  . LYS B 1 188 ? 35.781  -3.993  51.875  1.00 55.13  ? 188  LYS B CA  1 
ATOM   3828  C C   . LYS B 1 188 ? 36.777  -2.939  52.403  1.00 59.61  ? 188  LYS B C   1 
ATOM   3829  O O   . LYS B 1 188 ? 37.872  -2.829  51.844  1.00 62.13  ? 188  LYS B O   1 
ATOM   3830  C CB  . LYS B 1 188 ? 35.039  -3.428  50.649  1.00 57.34  ? 188  LYS B CB  1 
ATOM   3831  C CG  . LYS B 1 188 ? 34.424  -4.490  49.742  1.00 72.35  ? 188  LYS B CG  1 
ATOM   3832  N N   . ASN B 1 189 ? 36.399  -2.153  53.441  1.00 53.01  ? 189  ASN B N   1 
ATOM   3833  C CA  . ASN B 1 189 ? 37.256  -1.101  53.993  1.00 52.52  ? 189  ASN B CA  1 
ATOM   3834  C C   . ASN B 1 189 ? 37.423  -1.246  55.520  1.00 56.05  ? 189  ASN B C   1 
ATOM   3835  O O   . ASN B 1 189 ? 36.492  -0.952  56.273  1.00 54.30  ? 189  ASN B O   1 
ATOM   3836  C CB  . ASN B 1 189 ? 36.713  0.294   53.636  1.00 49.33  ? 189  ASN B CB  1 
ATOM   3837  C CG  . ASN B 1 189 ? 37.702  1.434   53.794  1.00 69.24  ? 189  ASN B CG  1 
ATOM   3838  O OD1 . ASN B 1 189 ? 38.676  1.377   54.556  1.00 60.40  ? 189  ASN B OD1 1 
ATOM   3839  N ND2 . ASN B 1 189 ? 37.457  2.524   53.085  1.00 63.00  ? 189  ASN B ND2 1 
ATOM   3840  N N   . PRO B 1 190 ? 38.630  -1.640  56.002  1.00 53.46  ? 190  PRO B N   1 
ATOM   3841  C CA  . PRO B 1 190 ? 38.821  -1.786  57.456  1.00 52.11  ? 190  PRO B CA  1 
ATOM   3842  C C   . PRO B 1 190 ? 38.984  -0.448  58.202  1.00 54.66  ? 190  PRO B C   1 
ATOM   3843  O O   . PRO B 1 190 ? 39.229  -0.462  59.413  1.00 54.76  ? 190  PRO B O   1 
ATOM   3844  C CB  . PRO B 1 190 ? 40.080  -2.647  57.558  1.00 55.77  ? 190  PRO B CB  1 
ATOM   3845  C CG  . PRO B 1 190 ? 40.843  -2.354  56.324  1.00 61.73  ? 190  PRO B CG  1 
ATOM   3846  C CD  . PRO B 1 190 ? 39.846  -2.027  55.253  1.00 56.69  ? 190  PRO B CD  1 
ATOM   3847  N N   . ASP B 1 191 ? 38.839  0.698   57.497  1.00 49.20  ? 191  ASP B N   1 
ATOM   3848  C CA  . ASP B 1 191 ? 38.929  2.031   58.101  1.00 47.87  ? 191  ASP B CA  1 
ATOM   3849  C C   . ASP B 1 191 ? 37.537  2.653   58.281  1.00 49.15  ? 191  ASP B C   1 
ATOM   3850  O O   . ASP B 1 191 ? 37.431  3.782   58.768  1.00 48.49  ? 191  ASP B O   1 
ATOM   3851  C CB  . ASP B 1 191 ? 39.844  2.964   57.288  1.00 50.95  ? 191  ASP B CB  1 
ATOM   3852  C CG  . ASP B 1 191 ? 41.324  2.691   57.463  1.00 61.79  ? 191  ASP B CG  1 
ATOM   3853  O OD1 . ASP B 1 191 ? 41.737  2.344   58.592  1.00 61.78  ? 191  ASP B OD1 1 
ATOM   3854  O OD2 . ASP B 1 191 ? 42.078  2.866   56.484  1.00 72.48  ? 191  ASP B OD2 1 
ATOM   3855  N N   . GLN B 1 192 ? 36.471  1.900   57.939  1.00 43.84  ? 192  GLN B N   1 
ATOM   3856  C CA  . GLN B 1 192 ? 35.087  2.356   58.079  1.00 40.93  ? 192  GLN B CA  1 
ATOM   3857  C C   . GLN B 1 192 ? 34.345  1.489   59.098  1.00 41.11  ? 192  GLN B C   1 
ATOM   3858  O O   . GLN B 1 192 ? 34.164  0.288   58.879  1.00 40.21  ? 192  GLN B O   1 
ATOM   3859  C CB  . GLN B 1 192 ? 34.366  2.354   56.722  1.00 41.89  ? 192  GLN B CB  1 
ATOM   3860  C CG  . GLN B 1 192 ? 34.964  3.333   55.715  1.00 46.93  ? 192  GLN B CG  1 
ATOM   3861  C CD  . GLN B 1 192 ? 34.176  3.463   54.433  1.00 56.26  ? 192  GLN B CD  1 
ATOM   3862  O OE1 . GLN B 1 192 ? 33.341  2.623   54.069  1.00 52.96  ? 192  GLN B OE1 1 
ATOM   3863  N NE2 . GLN B 1 192 ? 34.444  4.529   53.715  1.00 40.85  ? 192  GLN B NE2 1 
ATOM   3864  N N   . VAL B 1 193 ? 33.940  2.097   60.220  1.00 35.52  ? 193  VAL B N   1 
ATOM   3865  C CA  . VAL B 1 193 ? 33.224  1.410   61.295  1.00 33.35  ? 193  VAL B CA  1 
ATOM   3866  C C   . VAL B 1 193 ? 31.720  1.779   61.239  1.00 36.01  ? 193  VAL B C   1 
ATOM   3867  O O   . VAL B 1 193 ? 31.355  2.913   60.924  1.00 35.08  ? 193  VAL B O   1 
ATOM   3868  C CB  . VAL B 1 193 ? 33.877  1.658   62.688  1.00 36.10  ? 193  VAL B CB  1 
ATOM   3869  C CG1 . VAL B 1 193 ? 33.756  3.111   63.141  1.00 35.33  ? 193  VAL B CG1 1 
ATOM   3870  C CG2 . VAL B 1 193 ? 33.349  0.689   63.747  1.00 34.56  ? 193  VAL B CG2 1 
ATOM   3871  N N   . TYR B 1 194 ? 30.863  0.785   61.496  1.00 32.54  ? 194  TYR B N   1 
ATOM   3872  C CA  . TYR B 1 194 ? 29.405  0.895   61.461  1.00 31.12  ? 194  TYR B CA  1 
ATOM   3873  C C   . TYR B 1 194 ? 28.800  0.455   62.787  1.00 32.90  ? 194  TYR B C   1 
ATOM   3874  O O   . TYR B 1 194 ? 29.274  -0.514  63.381  1.00 32.38  ? 194  TYR B O   1 
ATOM   3875  C CB  . TYR B 1 194 ? 28.857  0.019   60.322  1.00 33.14  ? 194  TYR B CB  1 
ATOM   3876  C CG  . TYR B 1 194 ? 28.983  0.625   58.936  1.00 36.78  ? 194  TYR B CG  1 
ATOM   3877  C CD1 . TYR B 1 194 ? 30.203  0.641   58.265  1.00 40.18  ? 194  TYR B CD1 1 
ATOM   3878  C CD2 . TYR B 1 194 ? 27.863  1.082   58.253  1.00 37.41  ? 194  TYR B CD2 1 
ATOM   3879  C CE1 . TYR B 1 194 ? 30.320  1.187   56.987  1.00 43.70  ? 194  TYR B CE1 1 
ATOM   3880  C CE2 . TYR B 1 194 ? 27.963  1.611   56.966  1.00 39.47  ? 194  TYR B CE2 1 
ATOM   3881  C CZ  . TYR B 1 194 ? 29.195  1.671   56.340  1.00 52.15  ? 194  TYR B CZ  1 
ATOM   3882  O OH  . TYR B 1 194 ? 29.293  2.188   55.068  1.00 58.49  ? 194  TYR B OH  1 
ATOM   3883  N N   . LEU B 1 195 ? 27.744  1.149   63.243  1.00 28.09  ? 195  LEU B N   1 
ATOM   3884  C CA  . LEU B 1 195 ? 27.037  0.810   64.484  1.00 26.67  ? 195  LEU B CA  1 
ATOM   3885  C C   . LEU B 1 195 ? 25.810  -0.035  64.137  1.00 31.01  ? 195  LEU B C   1 
ATOM   3886  O O   . LEU B 1 195 ? 24.981  0.385   63.321  1.00 29.53  ? 195  LEU B O   1 
ATOM   3887  C CB  . LEU B 1 195 ? 26.649  2.084   65.269  1.00 25.67  ? 195  LEU B CB  1 
ATOM   3888  C CG  . LEU B 1 195 ? 25.887  1.911   66.601  1.00 28.87  ? 195  LEU B CG  1 
ATOM   3889  C CD1 . LEU B 1 195 ? 26.757  1.231   67.690  1.00 28.42  ? 195  LEU B CD1 1 
ATOM   3890  C CD2 . LEU B 1 195 ? 25.392  3.242   67.105  1.00 29.11  ? 195  LEU B CD2 1 
ATOM   3891  N N   . VAL B 1 196 ? 25.720  -1.241  64.726  1.00 28.37  ? 196  VAL B N   1 
ATOM   3892  C CA  . VAL B 1 196 ? 24.614  -2.176  64.463  1.00 27.54  ? 196  VAL B CA  1 
ATOM   3893  C C   . VAL B 1 196 ? 23.754  -2.373  65.728  1.00 32.23  ? 196  VAL B C   1 
ATOM   3894  O O   . VAL B 1 196 ? 24.080  -1.832  66.794  1.00 30.51  ? 196  VAL B O   1 
ATOM   3895  C CB  . VAL B 1 196 ? 25.098  -3.539  63.889  1.00 31.18  ? 196  VAL B CB  1 
ATOM   3896  C CG1 . VAL B 1 196 ? 25.872  -3.354  62.580  1.00 30.86  ? 196  VAL B CG1 1 
ATOM   3897  C CG2 . VAL B 1 196 ? 25.909  -4.331  64.918  1.00 31.73  ? 196  VAL B CG2 1 
ATOM   3898  N N   . ASP B 1 197 ? 22.649  -3.155  65.578  1.00 30.03  ? 197  ASP B N   1 
ATOM   3899  C CA  . ASP B 1 197 ? 21.670  -3.552  66.603  1.00 29.81  ? 197  ASP B CA  1 
ATOM   3900  C C   . ASP B 1 197 ? 20.782  -2.379  67.040  1.00 31.12  ? 197  ASP B C   1 
ATOM   3901  O O   . ASP B 1 197 ? 21.137  -1.602  67.934  1.00 30.02  ? 197  ASP B O   1 
ATOM   3902  C CB  . ASP B 1 197 ? 22.339  -4.209  67.833  1.00 32.06  ? 197  ASP B CB  1 
ATOM   3903  C CG  . ASP B 1 197 ? 21.416  -5.037  68.705  1.00 39.23  ? 197  ASP B CG  1 
ATOM   3904  O OD1 . ASP B 1 197 ? 20.171  -4.924  68.542  1.00 36.64  ? 197  ASP B OD1 1 
ATOM   3905  O OD2 . ASP B 1 197 ? 21.931  -5.804  69.547  1.00 50.15  ? 197  ASP B OD2 1 
ATOM   3906  N N   . TYR B 1 198 ? 19.600  -2.301  66.417  1.00 25.86  ? 198  TYR B N   1 
ATOM   3907  C CA  . TYR B 1 198 ? 18.615  -1.274  66.724  1.00 24.59  ? 198  TYR B CA  1 
ATOM   3908  C C   . TYR B 1 198 ? 17.320  -1.932  67.223  1.00 27.71  ? 198  TYR B C   1 
ATOM   3909  O O   . TYR B 1 198 ? 16.276  -1.282  67.259  1.00 27.43  ? 198  TYR B O   1 
ATOM   3910  C CB  . TYR B 1 198 ? 18.381  -0.355  65.504  1.00 25.20  ? 198  TYR B CB  1 
ATOM   3911  C CG  . TYR B 1 198 ? 19.631  0.393   65.096  1.00 26.23  ? 198  TYR B CG  1 
ATOM   3912  C CD1 . TYR B 1 198 ? 19.944  1.634   65.658  1.00 27.57  ? 198  TYR B CD1 1 
ATOM   3913  C CD2 . TYR B 1 198 ? 20.522  -0.154  64.181  1.00 27.28  ? 198  TYR B CD2 1 
ATOM   3914  C CE1 . TYR B 1 198 ? 21.101  2.319   65.295  1.00 27.09  ? 198  TYR B CE1 1 
ATOM   3915  C CE2 . TYR B 1 198 ? 21.683  0.519   63.815  1.00 28.67  ? 198  TYR B CE2 1 
ATOM   3916  C CZ  . TYR B 1 198 ? 21.968  1.756   64.372  1.00 33.52  ? 198  TYR B CZ  1 
ATOM   3917  O OH  . TYR B 1 198 ? 23.105  2.421   63.982  1.00 33.14  ? 198  TYR B OH  1 
ATOM   3918  N N   . GLY B 1 199 ? 17.433  -3.196  67.658  1.00 24.42  ? 199  GLY B N   1 
ATOM   3919  C CA  . GLY B 1 199 ? 16.330  -3.992  68.191  1.00 25.47  ? 199  GLY B CA  1 
ATOM   3920  C C   . GLY B 1 199 ? 15.772  -3.425  69.478  1.00 32.48  ? 199  GLY B C   1 
ATOM   3921  O O   . GLY B 1 199 ? 14.597  -3.624  69.787  1.00 32.58  ? 199  GLY B O   1 
ATOM   3922  N N   . LEU B 1 200 ? 16.632  -2.728  70.246  1.00 30.24  ? 200  LEU B N   1 
ATOM   3923  C CA  . LEU B 1 200 ? 16.262  -2.068  71.487  1.00 30.51  ? 200  LEU B CA  1 
ATOM   3924  C C   . LEU B 1 200 ? 16.593  -0.557  71.409  1.00 33.47  ? 200  LEU B C   1 
ATOM   3925  O O   . LEU B 1 200 ? 16.729  0.093   72.440  1.00 33.86  ? 200  LEU B O   1 
ATOM   3926  C CB  . LEU B 1 200 ? 16.911  -2.765  72.698  1.00 31.55  ? 200  LEU B CB  1 
ATOM   3927  C CG  . LEU B 1 200 ? 16.379  -4.192  72.973  1.00 37.16  ? 200  LEU B CG  1 
ATOM   3928  C CD1 . LEU B 1 200 ? 17.386  -5.023  73.713  1.00 37.55  ? 200  LEU B CD1 1 
ATOM   3929  C CD2 . LEU B 1 200 ? 15.025  -4.173  73.690  1.00 39.56  ? 200  LEU B CD2 1 
ATOM   3930  N N   . ALA B 1 201 ? 16.668  0.006   70.172  1.00 28.82  ? 201  ALA B N   1 
ATOM   3931  C CA  . ALA B 1 201 ? 16.846  1.444   69.936  1.00 27.47  ? 201  ALA B CA  1 
ATOM   3932  C C   . ALA B 1 201 ? 15.596  2.167   70.451  1.00 28.98  ? 201  ALA B C   1 
ATOM   3933  O O   . ALA B 1 201 ? 14.536  1.541   70.615  1.00 27.81  ? 201  ALA B O   1 
ATOM   3934  C CB  . ALA B 1 201 ? 17.065  1.730   68.452  1.00 27.87  ? 201  ALA B CB  1 
ATOM   3935  N N   . TYR B 1 202 ? 15.720  3.458   70.740  1.00 24.28  ? 202  TYR B N   1 
ATOM   3936  C CA  . TYR B 1 202 ? 14.599  4.166   71.316  1.00 23.69  ? 202  TYR B CA  1 
ATOM   3937  C C   . TYR B 1 202 ? 14.299  5.472   70.572  1.00 29.38  ? 202  TYR B C   1 
ATOM   3938  O O   . TYR B 1 202 ? 15.191  6.288   70.331  1.00 28.87  ? 202  TYR B O   1 
ATOM   3939  C CB  . TYR B 1 202 ? 14.866  4.414   72.815  1.00 23.09  ? 202  TYR B CB  1 
ATOM   3940  C CG  . TYR B 1 202 ? 13.726  5.096   73.531  1.00 23.54  ? 202  TYR B CG  1 
ATOM   3941  C CD1 . TYR B 1 202 ? 12.521  4.436   73.754  1.00 25.77  ? 202  TYR B CD1 1 
ATOM   3942  C CD2 . TYR B 1 202 ? 13.860  6.388   74.018  1.00 24.16  ? 202  TYR B CD2 1 
ATOM   3943  C CE1 . TYR B 1 202 ? 11.465  5.058   74.407  1.00 27.04  ? 202  TYR B CE1 1 
ATOM   3944  C CE2 . TYR B 1 202 ? 12.808  7.026   74.673  1.00 25.69  ? 202  TYR B CE2 1 
ATOM   3945  C CZ  . TYR B 1 202 ? 11.609  6.356   74.859  1.00 33.45  ? 202  TYR B CZ  1 
ATOM   3946  O OH  . TYR B 1 202 ? 10.562  6.961   75.503  1.00 34.50  ? 202  TYR B OH  1 
ATOM   3947  N N   . ARG B 1 203 ? 13.032  5.655   70.227  1.00 27.07  ? 203  ARG B N   1 
ATOM   3948  C CA  . ARG B 1 203 ? 12.539  6.841   69.558  1.00 27.40  ? 203  ARG B CA  1 
ATOM   3949  C C   . ARG B 1 203 ? 12.194  7.854   70.653  1.00 30.21  ? 203  ARG B C   1 
ATOM   3950  O O   . ARG B 1 203 ? 11.074  7.874   71.155  1.00 30.98  ? 203  ARG B O   1 
ATOM   3951  C CB  . ARG B 1 203 ? 11.351  6.479   68.654  1.00 25.87  ? 203  ARG B CB  1 
ATOM   3952  C CG  . ARG B 1 203 ? 11.074  7.494   67.577  1.00 27.62  ? 203  ARG B CG  1 
ATOM   3953  C CD  . ARG B 1 203 ? 9.868   7.047   66.800  1.00 32.54  ? 203  ARG B CD  1 
ATOM   3954  N NE  . ARG B 1 203 ? 9.444   8.061   65.846  1.00 40.90  ? 203  ARG B NE  1 
ATOM   3955  C CZ  . ARG B 1 203 ? 8.195   8.215   65.428  1.00 52.51  ? 203  ARG B CZ  1 
ATOM   3956  N NH1 . ARG B 1 203 ? 7.228   7.430   65.896  1.00 32.89  ? 203  ARG B NH1 1 
ATOM   3957  N NH2 . ARG B 1 203 ? 7.893   9.173   64.566  1.00 43.83  ? 203  ARG B NH2 1 
ATOM   3958  N N   . TYR B 1 204 ? 13.205  8.638   71.063  1.00 26.46  ? 204  TYR B N   1 
ATOM   3959  C CA  . TYR B 1 204 ? 13.152  9.608   72.167  1.00 26.44  ? 204  TYR B CA  1 
ATOM   3960  C C   . TYR B 1 204 ? 12.368  10.880  71.799  1.00 34.22  ? 204  TYR B C   1 
ATOM   3961  O O   . TYR B 1 204 ? 11.925  11.602  72.694  1.00 33.93  ? 204  TYR B O   1 
ATOM   3962  C CB  . TYR B 1 204 ? 14.590  9.980   72.620  1.00 25.78  ? 204  TYR B CB  1 
ATOM   3963  C CG  . TYR B 1 204 ? 15.276  10.978  71.709  1.00 26.08  ? 204  TYR B CG  1 
ATOM   3964  C CD1 . TYR B 1 204 ? 15.884  10.569  70.526  1.00 26.86  ? 204  TYR B CD1 1 
ATOM   3965  C CD2 . TYR B 1 204 ? 15.259  12.341  71.996  1.00 27.15  ? 204  TYR B CD2 1 
ATOM   3966  C CE1 . TYR B 1 204 ? 16.476  11.486  69.661  1.00 26.14  ? 204  TYR B CE1 1 
ATOM   3967  C CE2 . TYR B 1 204 ? 15.830  13.269  71.127  1.00 28.43  ? 204  TYR B CE2 1 
ATOM   3968  C CZ  . TYR B 1 204 ? 16.421  12.835  69.949  1.00 33.31  ? 204  TYR B CZ  1 
ATOM   3969  O OH  . TYR B 1 204 ? 16.982  13.728  69.075  1.00 37.29  ? 204  TYR B OH  1 
ATOM   3970  N N   . CYS B 1 205 ? 12.238  11.158  70.493  1.00 33.20  ? 205  CYS B N   1 
ATOM   3971  C CA  . CYS B 1 205 ? 11.649  12.374  69.958  1.00 34.78  ? 205  CYS B CA  1 
ATOM   3972  C C   . CYS B 1 205 ? 10.579  12.088  68.874  1.00 38.04  ? 205  CYS B C   1 
ATOM   3973  O O   . CYS B 1 205 ? 10.734  12.632  67.787  1.00 38.27  ? 205  CYS B O   1 
ATOM   3974  C CB  . CYS B 1 205 ? 12.780  13.220  69.384  1.00 36.48  ? 205  CYS B CB  1 
ATOM   3975  S SG  . CYS B 1 205 ? 12.468  14.993  69.421  1.00 42.71  ? 205  CYS B SG  1 
ATOM   3976  N N   . PRO B 1 206 ? 9.486   11.306  69.087  1.00 33.16  ? 206  PRO B N   1 
ATOM   3977  C CA  . PRO B 1 206 ? 8.545   11.083  67.977  1.00 33.19  ? 206  PRO B CA  1 
ATOM   3978  C C   . PRO B 1 206 ? 7.842   12.373  67.560  1.00 38.20  ? 206  PRO B C   1 
ATOM   3979  O O   . PRO B 1 206 ? 7.301   13.089  68.409  1.00 38.77  ? 206  PRO B O   1 
ATOM   3980  C CB  . PRO B 1 206 ? 7.559   10.051  68.543  1.00 34.87  ? 206  PRO B CB  1 
ATOM   3981  C CG  . PRO B 1 206 ? 7.635   10.218  70.020  1.00 38.20  ? 206  PRO B CG  1 
ATOM   3982  C CD  . PRO B 1 206 ? 9.061   10.580  70.303  1.00 33.59  ? 206  PRO B CD  1 
ATOM   3983  N N   . GLU B 1 207 ? 7.892   12.684  66.245  1.00 34.17  ? 207  GLU B N   1 
ATOM   3984  C CA  . GLU B 1 207 ? 7.289   13.872  65.616  1.00 35.16  ? 207  GLU B CA  1 
ATOM   3985  C C   . GLU B 1 207 ? 7.822   15.183  66.234  1.00 40.03  ? 207  GLU B C   1 
ATOM   3986  O O   . GLU B 1 207 ? 7.089   16.169  66.324  1.00 41.28  ? 207  GLU B O   1 
ATOM   3987  C CB  . GLU B 1 207 ? 5.733   13.834  65.676  1.00 37.15  ? 207  GLU B CB  1 
ATOM   3988  C CG  . GLU B 1 207 ? 5.076   12.510  65.294  1.00 41.83  ? 207  GLU B CG  1 
ATOM   3989  C CD  . GLU B 1 207 ? 5.290   11.957  63.898  1.00 59.17  ? 207  GLU B CD  1 
ATOM   3990  O OE1 . GLU B 1 207 ? 5.556   12.748  62.964  1.00 57.81  ? 207  GLU B OE1 1 
ATOM   3991  O OE2 . GLU B 1 207 ? 5.162   10.721  63.736  1.00 49.18  ? 207  GLU B OE2 1 
ATOM   3992  N N   . GLY B 1 208 ? 9.096   15.170  66.637  1.00 35.72  ? 208  GLY B N   1 
ATOM   3993  C CA  . GLY B 1 208 ? 9.780   16.314  67.230  1.00 35.53  ? 208  GLY B CA  1 
ATOM   3994  C C   . GLY B 1 208 ? 9.411   16.628  68.665  1.00 39.68  ? 208  GLY B C   1 
ATOM   3995  O O   . GLY B 1 208 ? 9.807   17.679  69.177  1.00 41.57  ? 208  GLY B O   1 
ATOM   3996  N N   . VAL B 1 209 ? 8.681   15.720  69.340  1.00 34.23  ? 209  VAL B N   1 
ATOM   3997  C CA  . VAL B 1 209 ? 8.285   15.899  70.742  1.00 33.81  ? 209  VAL B CA  1 
ATOM   3998  C C   . VAL B 1 209 ? 9.150   14.991  71.631  1.00 35.25  ? 209  VAL B C   1 
ATOM   3999  O O   . VAL B 1 209 ? 8.973   13.772  71.600  1.00 33.86  ? 209  VAL B O   1 
ATOM   4000  C CB  . VAL B 1 209 ? 6.764   15.661  70.982  1.00 37.85  ? 209  VAL B CB  1 
ATOM   4001  C CG1 . VAL B 1 209 ? 6.380   16.038  72.417  1.00 37.70  ? 209  VAL B CG1 1 
ATOM   4002  C CG2 . VAL B 1 209 ? 5.903   16.427  69.977  1.00 38.50  ? 209  VAL B CG2 1 
ATOM   4003  N N   . HIS B 1 210 ? 10.057  15.588  72.436  1.00 31.32  ? 210  HIS B N   1 
ATOM   4004  C CA  . HIS B 1 210 ? 10.948  14.848  73.332  1.00 29.72  ? 210  HIS B CA  1 
ATOM   4005  C C   . HIS B 1 210 ? 10.165  14.163  74.459  1.00 36.00  ? 210  HIS B C   1 
ATOM   4006  O O   . HIS B 1 210 ? 9.249   14.738  75.052  1.00 35.42  ? 210  HIS B O   1 
ATOM   4007  C CB  . HIS B 1 210 ? 12.052  15.757  73.928  1.00 29.74  ? 210  HIS B CB  1 
ATOM   4008  C CG  . HIS B 1 210 ? 13.301  15.028  74.375  1.00 31.49  ? 210  HIS B CG  1 
ATOM   4009  N ND1 . HIS B 1 210 ? 13.284  14.116  75.430  1.00 32.28  ? 210  HIS B ND1 1 
ATOM   4010  C CD2 . HIS B 1 210 ? 14.577  15.146  73.933  1.00 32.46  ? 210  HIS B CD2 1 
ATOM   4011  C CE1 . HIS B 1 210 ? 14.530  13.686  75.562  1.00 30.85  ? 210  HIS B CE1 1 
ATOM   4012  N NE2 . HIS B 1 210 ? 15.348  14.282  74.692  1.00 31.33  ? 210  HIS B NE2 1 
ATOM   4013  N N   . LYS B 1 211 ? 10.542  12.919  74.735  1.00 34.52  ? 211  LYS B N   1 
ATOM   4014  C CA  . LYS B 1 211 ? 9.983   12.116  75.814  1.00 34.99  ? 211  LYS B CA  1 
ATOM   4015  C C   . LYS B 1 211 ? 10.385  12.726  77.143  1.00 38.53  ? 211  LYS B C   1 
ATOM   4016  O O   . LYS B 1 211 ? 11.530  13.144  77.302  1.00 38.29  ? 211  LYS B O   1 
ATOM   4017  C CB  . LYS B 1 211 ? 10.452  10.653  75.692  1.00 36.97  ? 211  LYS B CB  1 
ATOM   4018  C CG  . LYS B 1 211 ? 9.830   9.954   74.484  1.00 48.73  ? 211  LYS B CG  1 
ATOM   4019  C CD  . LYS B 1 211 ? 8.416   9.428   74.717  1.00 59.10  ? 211  LYS B CD  1 
ATOM   4020  C CE  . LYS B 1 211 ? 7.894   8.741   73.479  1.00 60.84  ? 211  LYS B CE  1 
ATOM   4021  N N   . ALA B 1 212 ? 9.410   12.858  78.058  1.00 35.59  ? 212  ALA B N   1 
ATOM   4022  C CA  . ALA B 1 212 ? 9.587   13.450  79.385  1.00 35.63  ? 212  ALA B CA  1 
ATOM   4023  C C   . ALA B 1 212 ? 10.492  12.598  80.265  1.00 38.52  ? 212  ALA B C   1 
ATOM   4024  O O   . ALA B 1 212 ? 10.551  11.380  80.079  1.00 37.26  ? 212  ALA B O   1 
ATOM   4025  C CB  . ALA B 1 212 ? 8.234   13.612  80.059  1.00 37.35  ? 212  ALA B CB  1 
ATOM   4026  N N   . TYR B 1 213 ? 11.195  13.237  81.222  1.00 35.65  ? 213  TYR B N   1 
ATOM   4027  C CA  . TYR B 1 213 ? 12.096  12.548  82.146  1.00 34.90  ? 213  TYR B CA  1 
ATOM   4028  C C   . TYR B 1 213 ? 11.289  11.577  83.024  1.00 42.45  ? 213  TYR B C   1 
ATOM   4029  O O   . TYR B 1 213 ? 10.563  11.998  83.920  1.00 44.92  ? 213  TYR B O   1 
ATOM   4030  C CB  . TYR B 1 213 ? 12.912  13.563  82.956  1.00 35.52  ? 213  TYR B CB  1 
ATOM   4031  C CG  . TYR B 1 213 ? 13.941  12.944  83.873  1.00 35.67  ? 213  TYR B CG  1 
ATOM   4032  C CD1 . TYR B 1 213 ? 15.199  12.575  83.398  1.00 36.61  ? 213  TYR B CD1 1 
ATOM   4033  C CD2 . TYR B 1 213 ? 13.670  12.752  85.225  1.00 36.02  ? 213  TYR B CD2 1 
ATOM   4034  C CE1 . TYR B 1 213 ? 16.152  12.010  84.243  1.00 36.22  ? 213  TYR B CE1 1 
ATOM   4035  C CE2 . TYR B 1 213 ? 14.618  12.196  86.080  1.00 35.88  ? 213  TYR B CE2 1 
ATOM   4036  C CZ  . TYR B 1 213 ? 15.859  11.829  85.585  1.00 41.65  ? 213  TYR B CZ  1 
ATOM   4037  O OH  . TYR B 1 213 ? 16.806  11.295  86.422  1.00 40.09  ? 213  TYR B OH  1 
ATOM   4038  N N   . ALA B 1 214 ? 11.324  10.288  82.627  1.00 39.69  ? 214  ALA B N   1 
ATOM   4039  C CA  . ALA B 1 214 ? 10.615  9.141   83.216  1.00 41.45  ? 214  ALA B CA  1 
ATOM   4040  C C   . ALA B 1 214 ? 10.820  7.847   82.390  1.00 47.10  ? 214  ALA B C   1 
ATOM   4041  O O   . ALA B 1 214 ? 11.361  7.872   81.277  1.00 45.61  ? 214  ALA B O   1 
ATOM   4042  C CB  . ALA B 1 214 ? 9.115   9.432   83.324  1.00 43.42  ? 214  ALA B CB  1 
ATOM   4043  N N   . ALA B 1 215 ? 10.348  6.723   82.945  1.00 45.92  ? 215  ALA B N   1 
ATOM   4044  C CA  . ALA B 1 215 ? 10.402  5.413   82.312  1.00 46.20  ? 215  ALA B CA  1 
ATOM   4045  C C   . ALA B 1 215 ? 9.390   5.299   81.174  1.00 53.53  ? 215  ALA B C   1 
ATOM   4046  O O   . ALA B 1 215 ? 8.299   5.881   81.246  1.00 53.46  ? 215  ALA B O   1 
ATOM   4047  C CB  . ALA B 1 215 ? 10.116  4.336   83.348  1.00 47.34  ? 215  ALA B CB  1 
ATOM   4048  N N   . ASP B 1 216 ? 9.746   4.534   80.132  1.00 52.25  ? 216  ASP B N   1 
ATOM   4049  C CA  . ASP B 1 216 ? 8.828   4.240   79.045  1.00 53.84  ? 216  ASP B CA  1 
ATOM   4050  C C   . ASP B 1 216 ? 8.248   2.862   79.347  1.00 61.26  ? 216  ASP B C   1 
ATOM   4051  O O   . ASP B 1 216 ? 9.029   1.929   79.544  1.00 60.40  ? 216  ASP B O   1 
ATOM   4052  C CB  . ASP B 1 216 ? 9.507   4.309   77.670  1.00 55.31  ? 216  ASP B CB  1 
ATOM   4053  C CG  . ASP B 1 216 ? 8.511   4.344   76.519  1.00 66.55  ? 216  ASP B CG  1 
ATOM   4054  O OD1 . ASP B 1 216 ? 7.862   3.307   76.262  1.00 67.69  ? 216  ASP B OD1 1 
ATOM   4055  O OD2 . ASP B 1 216 ? 8.394   5.403   75.866  1.00 70.99  ? 216  ASP B OD2 1 
ATOM   4056  N N   . PRO B 1 217 ? 6.904   2.716   79.467  1.00 61.42  ? 217  PRO B N   1 
ATOM   4057  C CA  . PRO B 1 217 ? 6.335   1.406   79.847  1.00 62.88  ? 217  PRO B CA  1 
ATOM   4058  C C   . PRO B 1 217 ? 6.527   0.308   78.798  1.00 67.63  ? 217  PRO B C   1 
ATOM   4059  O O   . PRO B 1 217 ? 6.594   -0.867  79.162  1.00 67.75  ? 217  PRO B O   1 
ATOM   4060  C CB  . PRO B 1 217 ? 4.847   1.709   80.052  1.00 65.71  ? 217  PRO B CB  1 
ATOM   4061  C CG  . PRO B 1 217 ? 4.763   3.193   80.206  1.00 69.66  ? 217  PRO B CG  1 
ATOM   4062  C CD  . PRO B 1 217 ? 5.844   3.733   79.334  1.00 63.83  ? 217  PRO B CD  1 
ATOM   4063  N N   . LYS B 1 218 ? 6.627   0.686   77.514  1.00 64.65  ? 218  LYS B N   1 
ATOM   4064  C CA  . LYS B 1 218 ? 6.820   -0.241  76.399  1.00 65.04  ? 218  LYS B CA  1 
ATOM   4065  C C   . LYS B 1 218 ? 8.269   -0.779  76.364  1.00 70.32  ? 218  LYS B C   1 
ATOM   4066  O O   . LYS B 1 218 ? 8.491   -1.914  75.933  1.00 70.56  ? 218  LYS B O   1 
ATOM   4067  C CB  . LYS B 1 218 ? 6.456   0.440   75.069  1.00 66.56  ? 218  LYS B CB  1 
ATOM   4068  N N   . ARG B 1 219 ? 9.240   0.033   76.830  1.00 66.75  ? 219  ARG B N   1 
ATOM   4069  C CA  . ARG B 1 219 ? 10.664  -0.315  76.883  1.00 66.01  ? 219  ARG B CA  1 
ATOM   4070  C C   . ARG B 1 219 ? 11.025  -0.977  78.227  1.00 70.60  ? 219  ARG B C   1 
ATOM   4071  O O   . ARG B 1 219 ? 10.501  -0.575  79.268  1.00 70.84  ? 219  ARG B O   1 
ATOM   4072  C CB  . ARG B 1 219 ? 11.522  0.938   76.655  1.00 64.07  ? 219  ARG B CB  1 
ATOM   4073  C CG  . ARG B 1 219 ? 12.990  0.627   76.465  1.00 66.75  ? 219  ARG B CG  1 
ATOM   4074  C CD  . ARG B 1 219 ? 13.849  1.833   76.739  1.00 63.00  ? 219  ARG B CD  1 
ATOM   4075  N NE  . ARG B 1 219 ? 15.258  1.473   76.893  1.00 58.31  ? 219  ARG B NE  1 
ATOM   4076  C CZ  . ARG B 1 219 ? 16.095  1.265   75.883  1.00 68.79  ? 219  ARG B CZ  1 
ATOM   4077  N NH1 . ARG B 1 219 ? 15.666  1.347   74.628  1.00 52.78  ? 219  ARG B NH1 1 
ATOM   4078  N NH2 . ARG B 1 219 ? 17.361  0.950   76.118  1.00 55.77  ? 219  ARG B NH2 1 
ATOM   4079  N N   . CYS B 1 220 ? 11.945  -1.964  78.198  1.00 67.08  ? 220  CYS B N   1 
ATOM   4080  C CA  . CYS B 1 220 ? 12.380  -2.708  79.386  1.00 67.30  ? 220  CYS B CA  1 
ATOM   4081  C C   . CYS B 1 220 ? 13.918  -2.728  79.513  1.00 66.01  ? 220  CYS B C   1 
ATOM   4082  O O   . CYS B 1 220 ? 14.441  -2.811  80.630  1.00 65.49  ? 220  CYS B O   1 
ATOM   4083  C CB  . CYS B 1 220 ? 11.811  -4.126  79.349  1.00 69.63  ? 220  CYS B CB  1 
ATOM   4084  S SG  . CYS B 1 220 ? 12.016  -5.059  80.890  1.00 75.35  ? 220  CYS B SG  1 
ATOM   4085  N N   . HIS B 1 221 ? 14.626  -2.657  78.372  1.00 58.68  ? 221  HIS B N   1 
ATOM   4086  C CA  . HIS B 1 221 ? 16.088  -2.705  78.276  1.00 56.51  ? 221  HIS B CA  1 
ATOM   4087  C C   . HIS B 1 221 ? 16.804  -1.546  78.993  1.00 55.31  ? 221  HIS B C   1 
ATOM   4088  O O   . HIS B 1 221 ? 16.363  -0.388  78.927  1.00 54.77  ? 221  HIS B O   1 
ATOM   4089  C CB  . HIS B 1 221 ? 16.520  -2.724  76.805  1.00 56.62  ? 221  HIS B CB  1 
ATOM   4090  C CG  . HIS B 1 221 ? 17.944  -3.143  76.593  1.00 59.83  ? 221  HIS B CG  1 
ATOM   4091  N ND1 . HIS B 1 221 ? 18.446  -4.315  77.146  1.00 62.11  ? 221  HIS B ND1 1 
ATOM   4092  C CD2 . HIS B 1 221 ? 18.913  -2.559  75.849  1.00 60.79  ? 221  HIS B CD2 1 
ATOM   4093  C CE1 . HIS B 1 221 ? 19.702  -4.388  76.741  1.00 61.51  ? 221  HIS B CE1 1 
ATOM   4094  N NE2 . HIS B 1 221 ? 20.023  -3.363  75.946  1.00 61.09  ? 221  HIS B NE2 1 
ATOM   4095  N N   . ASP B 1 222 ? 17.945  -1.880  79.636  1.00 47.02  ? 222  ASP B N   1 
ATOM   4096  C CA  . ASP B 1 222 ? 18.785  -0.943  80.376  1.00 44.12  ? 222  ASP B CA  1 
ATOM   4097  C C   . ASP B 1 222 ? 20.209  -0.850  79.790  1.00 42.86  ? 222  ASP B C   1 
ATOM   4098  O O   . ASP B 1 222 ? 21.100  -0.306  80.444  1.00 41.34  ? 222  ASP B O   1 
ATOM   4099  C CB  . ASP B 1 222 ? 18.853  -1.358  81.856  1.00 46.50  ? 222  ASP B CB  1 
ATOM   4100  C CG  . ASP B 1 222 ? 17.522  -1.628  82.535  1.00 58.19  ? 222  ASP B CG  1 
ATOM   4101  O OD1 . ASP B 1 222 ? 16.626  -0.763  82.455  1.00 57.71  ? 222  ASP B OD1 1 
ATOM   4102  O OD2 . ASP B 1 222 ? 17.409  -2.665  83.222  1.00 68.07  ? 222  ASP B OD2 1 
ATOM   4103  N N   . GLY B 1 223 ? 20.400  -1.350  78.566  1.00 36.72  ? 223  GLY B N   1 
ATOM   4104  C CA  . GLY B 1 223 ? 21.700  -1.376  77.900  1.00 35.27  ? 223  GLY B CA  1 
ATOM   4105  C C   . GLY B 1 223 ? 22.622  -2.431  78.487  1.00 38.21  ? 223  GLY B C   1 
ATOM   4106  O O   . GLY B 1 223 ? 22.147  -3.408  79.071  1.00 38.80  ? 223  GLY B O   1 
ATOM   4107  N N   . THR B 1 224 ? 23.949  -2.239  78.342  1.00 33.08  ? 224  THR B N   1 
ATOM   4108  C CA  . THR B 1 224 ? 24.993  -3.124  78.873  1.00 32.91  ? 224  THR B CA  1 
ATOM   4109  C C   . THR B 1 224 ? 25.512  -2.453  80.144  1.00 36.36  ? 224  THR B C   1 
ATOM   4110  O O   . THR B 1 224 ? 26.026  -1.337  80.080  1.00 37.38  ? 224  THR B O   1 
ATOM   4111  C CB  . THR B 1 224 ? 26.054  -3.385  77.793  1.00 35.85  ? 224  THR B CB  1 
ATOM   4112  O OG1 . THR B 1 224 ? 25.417  -3.985  76.670  1.00 36.35  ? 224  THR B OG1 1 
ATOM   4113  C CG2 . THR B 1 224 ? 27.179  -4.282  78.274  1.00 29.06  ? 224  THR B CG2 1 
ATOM   4114  N N   . ILE B 1 225 ? 25.340  -3.124  81.288  1.00 32.21  ? 225  ILE B N   1 
ATOM   4115  C CA  . ILE B 1 225 ? 25.623  -2.639  82.647  1.00 31.99  ? 225  ILE B CA  1 
ATOM   4116  C C   . ILE B 1 225 ? 26.947  -1.829  82.796  1.00 34.85  ? 225  ILE B C   1 
ATOM   4117  O O   . ILE B 1 225 ? 26.892  -0.748  83.391  1.00 34.13  ? 225  ILE B O   1 
ATOM   4118  C CB  . ILE B 1 225 ? 25.520  -3.785  83.710  1.00 35.60  ? 225  ILE B CB  1 
ATOM   4119  C CG1 . ILE B 1 225 ? 25.335  -3.251  85.151  1.00 35.68  ? 225  ILE B CG1 1 
ATOM   4120  C CG2 . ILE B 1 225 ? 26.633  -4.845  83.604  1.00 36.79  ? 225  ILE B CG2 1 
ATOM   4121  C CD1 . ILE B 1 225 ? 23.989  -2.707  85.451  1.00 42.45  ? 225  ILE B CD1 1 
ATOM   4122  N N   . GLU B 1 226 ? 28.094  -2.316  82.274  1.00 30.13  ? 226  GLU B N   1 
ATOM   4123  C CA  . GLU B 1 226 ? 29.371  -1.607  82.440  1.00 30.07  ? 226  GLU B CA  1 
ATOM   4124  C C   . GLU B 1 226 ? 29.452  -0.297  81.640  1.00 33.66  ? 226  GLU B C   1 
ATOM   4125  O O   . GLU B 1 226 ? 30.181  0.604   82.060  1.00 33.85  ? 226  GLU B O   1 
ATOM   4126  C CB  . GLU B 1 226 ? 30.586  -2.494  82.103  1.00 32.38  ? 226  GLU B CB  1 
ATOM   4127  C CG  . GLU B 1 226 ? 30.591  -3.079  80.700  1.00 41.22  ? 226  GLU B CG  1 
ATOM   4128  C CD  . GLU B 1 226 ? 30.102  -4.509  80.596  1.00 58.75  ? 226  GLU B CD  1 
ATOM   4129  O OE1 . GLU B 1 226 ? 28.974  -4.802  81.062  1.00 40.30  ? 226  GLU B OE1 1 
ATOM   4130  O OE2 . GLU B 1 226 ? 30.856  -5.338  80.039  1.00 54.42  ? 226  GLU B OE2 1 
ATOM   4131  N N   . PHE B 1 227 ? 28.709  -0.181  80.515  1.00 28.42  ? 227  PHE B N   1 
ATOM   4132  C CA  . PHE B 1 227 ? 28.761  1.009   79.661  1.00 27.14  ? 227  PHE B CA  1 
ATOM   4133  C C   . PHE B 1 227 ? 27.520  1.878   79.724  1.00 29.53  ? 227  PHE B C   1 
ATOM   4134  O O   . PHE B 1 227 ? 27.580  3.006   79.231  1.00 28.00  ? 227  PHE B O   1 
ATOM   4135  C CB  . PHE B 1 227 ? 28.991  0.609   78.180  1.00 28.32  ? 227  PHE B CB  1 
ATOM   4136  C CG  . PHE B 1 227 ? 30.132  -0.352  77.942  1.00 30.82  ? 227  PHE B CG  1 
ATOM   4137  C CD1 . PHE B 1 227 ? 31.435  -0.017  78.307  1.00 33.76  ? 227  PHE B CD1 1 
ATOM   4138  C CD2 . PHE B 1 227 ? 29.909  -1.587  77.334  1.00 32.92  ? 227  PHE B CD2 1 
ATOM   4139  C CE1 . PHE B 1 227 ? 32.487  -0.911  78.101  1.00 35.68  ? 227  PHE B CE1 1 
ATOM   4140  C CE2 . PHE B 1 227 ? 30.965  -2.477  77.116  1.00 36.40  ? 227  PHE B CE2 1 
ATOM   4141  C CZ  . PHE B 1 227 ? 32.249  -2.131  77.497  1.00 35.24  ? 227  PHE B CZ  1 
ATOM   4142  N N   . THR B 1 228 ? 26.393  1.369   80.280  1.00 25.70  ? 228  THR B N   1 
ATOM   4143  C CA  . THR B 1 228 ? 25.115  2.095   80.264  1.00 24.90  ? 228  THR B CA  1 
ATOM   4144  C C   . THR B 1 228 ? 25.180  3.451   81.005  1.00 29.95  ? 228  THR B C   1 
ATOM   4145  O O   . THR B 1 228 ? 26.069  3.682   81.823  1.00 30.00  ? 228  THR B O   1 
ATOM   4146  C CB  . THR B 1 228 ? 23.949  1.214   80.720  1.00 28.35  ? 228  THR B CB  1 
ATOM   4147  O OG1 . THR B 1 228 ? 22.735  1.799   80.255  1.00 28.74  ? 228  THR B OG1 1 
ATOM   4148  C CG2 . THR B 1 228 ? 23.897  0.990   82.220  1.00 24.14  ? 228  THR B CG2 1 
ATOM   4149  N N   . SER B 1 229 ? 24.266  4.364   80.638  1.00 26.24  ? 229  SER B N   1 
ATOM   4150  C CA  . SER B 1 229 ? 24.205  5.710   81.197  1.00 25.28  ? 229  SER B CA  1 
ATOM   4151  C C   . SER B 1 229 ? 23.595  5.727   82.600  1.00 27.80  ? 229  SER B C   1 
ATOM   4152  O O   . SER B 1 229 ? 22.874  4.792   82.964  1.00 26.88  ? 229  SER B O   1 
ATOM   4153  C CB  . SER B 1 229 ? 23.391  6.611   80.274  1.00 27.36  ? 229  SER B CB  1 
ATOM   4154  O OG  . SER B 1 229 ? 22.004  6.315   80.294  1.00 31.73  ? 229  SER B OG  1 
ATOM   4155  N N   . ILE B 1 230 ? 23.850  6.817   83.365  1.00 23.35  ? 230  ILE B N   1 
ATOM   4156  C CA  . ILE B 1 230 ? 23.285  7.050   84.702  1.00 22.68  ? 230  ILE B CA  1 
ATOM   4157  C C   . ILE B 1 230 ? 21.744  7.115   84.574  1.00 26.60  ? 230  ILE B C   1 
ATOM   4158  O O   . ILE B 1 230 ? 21.035  6.543   85.408  1.00 25.51  ? 230  ILE B O   1 
ATOM   4159  C CB  . ILE B 1 230 ? 23.910  8.323   85.359  1.00 25.42  ? 230  ILE B CB  1 
ATOM   4160  C CG1 . ILE B 1 230 ? 25.372  8.041   85.794  1.00 25.59  ? 230  ILE B CG1 1 
ATOM   4161  C CG2 . ILE B 1 230 ? 23.078  8.838   86.542  1.00 25.32  ? 230  ILE B CG2 1 
ATOM   4162  C CD1 . ILE B 1 230 ? 26.264  9.253   85.948  1.00 23.18  ? 230  ILE B CD1 1 
ATOM   4163  N N   . ASP B 1 231 ? 21.238  7.758   83.487  1.00 23.21  ? 231  ASP B N   1 
ATOM   4164  C CA  . ASP B 1 231 ? 19.805  7.861   83.180  1.00 21.99  ? 231  ASP B CA  1 
ATOM   4165  C C   . ASP B 1 231 ? 19.173  6.474   83.125  1.00 24.85  ? 231  ASP B C   1 
ATOM   4166  O O   . ASP B 1 231 ? 18.188  6.243   83.823  1.00 24.38  ? 231  ASP B O   1 
ATOM   4167  C CB  . ASP B 1 231 ? 19.581  8.615   81.853  1.00 23.70  ? 231  ASP B CB  1 
ATOM   4168  C CG  . ASP B 1 231 ? 19.757  10.119  81.926  1.00 32.09  ? 231  ASP B CG  1 
ATOM   4169  O OD1 . ASP B 1 231 ? 19.457  10.707  82.992  1.00 35.64  ? 231  ASP B OD1 1 
ATOM   4170  O OD2 . ASP B 1 231 ? 20.174  10.711  80.918  1.00 34.60  ? 231  ASP B OD2 1 
ATOM   4171  N N   . ALA B 1 232 ? 19.775  5.536   82.353  1.00 22.96  ? 232  ALA B N   1 
ATOM   4172  C CA  . ALA B 1 232 ? 19.311  4.142   82.235  1.00 23.47  ? 232  ALA B CA  1 
ATOM   4173  C C   . ALA B 1 232 ? 19.344  3.436   83.587  1.00 28.53  ? 232  ALA B C   1 
ATOM   4174  O O   . ALA B 1 232 ? 18.358  2.792   83.952  1.00 30.43  ? 232  ALA B O   1 
ATOM   4175  C CB  . ALA B 1 232 ? 20.140  3.382   81.221  1.00 24.07  ? 232  ALA B CB  1 
ATOM   4176  N N   . HIS B 1 233 ? 20.426  3.626   84.370  1.00 23.58  ? 233  HIS B N   1 
ATOM   4177  C CA  . HIS B 1 233 ? 20.518  3.100   85.739  1.00 22.43  ? 233  HIS B CA  1 
ATOM   4178  C C   . HIS B 1 233 ? 19.390  3.615   86.613  1.00 27.12  ? 233  HIS B C   1 
ATOM   4179  O O   . HIS B 1 233 ? 18.895  2.880   87.454  1.00 29.18  ? 233  HIS B O   1 
ATOM   4180  C CB  . HIS B 1 233 ? 21.846  3.485   86.398  1.00 22.84  ? 233  HIS B CB  1 
ATOM   4181  C CG  . HIS B 1 233 ? 23.041  2.713   85.938  1.00 26.05  ? 233  HIS B CG  1 
ATOM   4182  N ND1 . HIS B 1 233 ? 23.048  1.325   85.914  1.00 28.14  ? 233  HIS B ND1 1 
ATOM   4183  C CD2 . HIS B 1 233 ? 24.269  3.161   85.590  1.00 26.60  ? 233  HIS B CD2 1 
ATOM   4184  C CE1 . HIS B 1 233 ? 24.271  0.982   85.552  1.00 27.11  ? 233  HIS B CE1 1 
ATOM   4185  N NE2 . HIS B 1 233 ? 25.034  2.056   85.336  1.00 26.88  ? 233  HIS B NE2 1 
ATOM   4186  N N   . ASN B 1 234 ? 18.979  4.875   86.420  1.00 24.23  ? 234  ASN B N   1 
ATOM   4187  C CA  . ASN B 1 234 ? 17.926  5.527   87.201  1.00 24.87  ? 234  ASN B CA  1 
ATOM   4188  C C   . ASN B 1 234 ? 16.507  5.147   86.736  1.00 28.18  ? 234  ASN B C   1 
ATOM   4189  O O   . ASN B 1 234 ? 15.527  5.616   87.322  1.00 26.68  ? 234  ASN B O   1 
ATOM   4190  C CB  . ASN B 1 234 ? 18.112  7.047   87.195  1.00 25.48  ? 234  ASN B CB  1 
ATOM   4191  C CG  . ASN B 1 234 ? 19.125  7.539   88.198  1.00 36.41  ? 234  ASN B CG  1 
ATOM   4192  O OD1 . ASN B 1 234 ? 19.349  6.929   89.246  1.00 30.33  ? 234  ASN B OD1 1 
ATOM   4193  N ND2 . ASN B 1 234 ? 19.724  8.684   87.926  1.00 27.26  ? 234  ASN B ND2 1 
ATOM   4194  N N   . GLY B 1 235 ? 16.424  4.257   85.748  1.00 25.30  ? 235  GLY B N   1 
ATOM   4195  C CA  . GLY B 1 235 ? 15.175  3.707   85.254  1.00 25.39  ? 235  GLY B CA  1 
ATOM   4196  C C   . GLY B 1 235 ? 14.384  4.621   84.358  1.00 32.28  ? 235  GLY B C   1 
ATOM   4197  O O   . GLY B 1 235 ? 13.167  4.457   84.248  1.00 34.10  ? 235  GLY B O   1 
ATOM   4198  N N   . VAL B 1 236 ? 15.049  5.590   83.710  1.00 27.82  ? 236  VAL B N   1 
ATOM   4199  C CA  . VAL B 1 236 ? 14.334  6.470   82.796  1.00 26.97  ? 236  VAL B CA  1 
ATOM   4200  C C   . VAL B 1 236 ? 14.692  6.055   81.367  1.00 32.64  ? 236  VAL B C   1 
ATOM   4201  O O   . VAL B 1 236 ? 15.710  5.377   81.156  1.00 32.34  ? 236  VAL B O   1 
ATOM   4202  C CB  . VAL B 1 236 ? 14.526  7.992   83.060  1.00 30.07  ? 236  VAL B CB  1 
ATOM   4203  C CG1 . VAL B 1 236 ? 14.116  8.373   84.480  1.00 30.27  ? 236  VAL B CG1 1 
ATOM   4204  C CG2 . VAL B 1 236 ? 15.940  8.462   82.751  1.00 29.53  ? 236  VAL B CG2 1 
ATOM   4205  N N   . ALA B 1 237 ? 13.843  6.442   80.393  1.00 29.35  ? 237  ALA B N   1 
ATOM   4206  C CA  . ALA B 1 237 ? 14.063  6.155   78.974  1.00 28.64  ? 237  ALA B CA  1 
ATOM   4207  C C   . ALA B 1 237 ? 15.370  6.830   78.488  1.00 31.44  ? 237  ALA B C   1 
ATOM   4208  O O   . ALA B 1 237 ? 15.686  7.921   78.964  1.00 30.72  ? 237  ALA B O   1 
ATOM   4209  C CB  . ALA B 1 237 ? 12.869  6.639   78.159  1.00 29.46  ? 237  ALA B CB  1 
ATOM   4210  N N   . PRO B 1 238 ? 16.153  6.197   77.582  1.00 28.09  ? 238  PRO B N   1 
ATOM   4211  C CA  . PRO B 1 238 ? 17.417  6.816   77.133  1.00 27.56  ? 238  PRO B CA  1 
ATOM   4212  C C   . PRO B 1 238 ? 17.221  8.062   76.259  1.00 31.96  ? 238  PRO B C   1 
ATOM   4213  O O   . PRO B 1 238 ? 16.261  8.138   75.487  1.00 32.51  ? 238  PRO B O   1 
ATOM   4214  C CB  . PRO B 1 238 ? 18.083  5.689   76.328  1.00 28.74  ? 238  PRO B CB  1 
ATOM   4215  C CG  . PRO B 1 238 ? 16.966  4.835   75.855  1.00 32.40  ? 238  PRO B CG  1 
ATOM   4216  C CD  . PRO B 1 238 ? 15.943  4.877   76.944  1.00 28.88  ? 238  PRO B CD  1 
ATOM   4217  N N   . SER B 1 239 ? 18.129  9.045   76.389  1.00 27.98  ? 239  SER B N   1 
ATOM   4218  C CA  . SER B 1 239 ? 18.104  10.254  75.553  1.00 27.34  ? 239  SER B CA  1 
ATOM   4219  C C   . SER B 1 239 ? 19.508  10.466  74.950  1.00 30.68  ? 239  SER B C   1 
ATOM   4220  O O   . SER B 1 239 ? 20.361  9.582   75.069  1.00 31.41  ? 239  SER B O   1 
ATOM   4221  C CB  . SER B 1 239 ? 17.597  11.473  76.324  1.00 28.67  ? 239  SER B CB  1 
ATOM   4222  O OG  . SER B 1 239 ? 18.528  11.982  77.266  1.00 34.76  ? 239  SER B OG  1 
ATOM   4223  N N   . ARG B 1 240 ? 19.717  11.585  74.254  1.00 25.41  ? 240  ARG B N   1 
ATOM   4224  C CA  . ARG B 1 240 ? 20.959  11.887  73.540  1.00 24.73  ? 240  ARG B CA  1 
ATOM   4225  C C   . ARG B 1 240 ? 22.188  11.938  74.445  1.00 28.15  ? 240  ARG B C   1 
ATOM   4226  O O   . ARG B 1 240 ? 23.193  11.329  74.087  1.00 28.40  ? 240  ARG B O   1 
ATOM   4227  C CB  . ARG B 1 240 ? 20.821  13.185  72.755  1.00 24.21  ? 240  ARG B CB  1 
ATOM   4228  C CG  . ARG B 1 240 ? 19.824  13.045  71.608  1.00 30.94  ? 240  ARG B CG  1 
ATOM   4229  C CD  . ARG B 1 240 ? 19.606  14.356  70.915  1.00 28.30  ? 240  ARG B CD  1 
ATOM   4230  N NE  . ARG B 1 240 ? 18.687  15.212  71.661  1.00 31.33  ? 240  ARG B NE  1 
ATOM   4231  C CZ  . ARG B 1 240 ? 18.107  16.298  71.158  1.00 39.86  ? 240  ARG B CZ  1 
ATOM   4232  N NH1 . ARG B 1 240 ? 18.351  16.671  69.907  1.00 24.80  ? 240  ARG B NH1 1 
ATOM   4233  N NH2 . ARG B 1 240 ? 17.284  17.023  71.902  1.00 22.22  ? 240  ARG B NH2 1 
ATOM   4234  N N   . ARG B 1 241 ? 22.103  12.600  75.620  1.00 24.53  ? 241  ARG B N   1 
ATOM   4235  C CA  . ARG B 1 241 ? 23.231  12.701  76.555  1.00 24.78  ? 241  ARG B CA  1 
ATOM   4236  C C   . ARG B 1 241 ? 23.710  11.303  77.017  1.00 28.89  ? 241  ARG B C   1 
ATOM   4237  O O   . ARG B 1 241 ? 24.911  11.093  77.151  1.00 28.33  ? 241  ARG B O   1 
ATOM   4238  C CB  . ARG B 1 241 ? 22.906  13.614  77.757  1.00 24.78  ? 241  ARG B CB  1 
ATOM   4239  C CG  . ARG B 1 241 ? 21.842  13.111  78.716  1.00 27.88  ? 241  ARG B CG  1 
ATOM   4240  C CD  . ARG B 1 241 ? 21.742  14.036  79.895  1.00 25.97  ? 241  ARG B CD  1 
ATOM   4241  N NE  . ARG B 1 241 ? 20.910  13.465  80.950  1.00 28.02  ? 241  ARG B NE  1 
ATOM   4242  C CZ  . ARG B 1 241 ? 20.648  14.073  82.100  1.00 35.76  ? 241  ARG B CZ  1 
ATOM   4243  N NH1 . ARG B 1 241 ? 21.121  15.288  82.337  1.00 21.65  ? 241  ARG B NH1 1 
ATOM   4244  N NH2 . ARG B 1 241 ? 19.891  13.478  83.016  1.00 22.28  ? 241  ARG B NH2 1 
ATOM   4245  N N   . GLY B 1 242 ? 22.772  10.367  77.181  1.00 26.39  ? 242  GLY B N   1 
ATOM   4246  C CA  . GLY B 1 242 ? 23.054  8.981   77.538  1.00 25.92  ? 242  GLY B CA  1 
ATOM   4247  C C   . GLY B 1 242 ? 23.959  8.272   76.542  1.00 29.42  ? 242  GLY B C   1 
ATOM   4248  O O   . GLY B 1 242 ? 24.927  7.642   76.950  1.00 29.61  ? 242  GLY B O   1 
ATOM   4249  N N   . ASP B 1 243 ? 23.672  8.400   75.229  1.00 24.86  ? 243  ASP B N   1 
ATOM   4250  C CA  . ASP B 1 243 ? 24.473  7.816   74.143  1.00 24.50  ? 243  ASP B CA  1 
ATOM   4251  C C   . ASP B 1 243 ? 25.918  8.329   74.163  1.00 27.30  ? 243  ASP B C   1 
ATOM   4252  O O   . ASP B 1 243 ? 26.844  7.561   73.921  1.00 27.00  ? 243  ASP B O   1 
ATOM   4253  C CB  . ASP B 1 243 ? 23.843  8.118   72.764  1.00 25.42  ? 243  ASP B CB  1 
ATOM   4254  C CG  . ASP B 1 243 ? 22.782  7.137   72.300  1.00 29.68  ? 243  ASP B CG  1 
ATOM   4255  O OD1 . ASP B 1 243 ? 22.439  6.222   73.073  1.00 29.53  ? 243  ASP B OD1 1 
ATOM   4256  O OD2 . ASP B 1 243 ? 22.298  7.285   71.158  1.00 34.55  ? 243  ASP B OD2 1 
ATOM   4257  N N   . LEU B 1 244 ? 26.092  9.624   74.438  1.00 23.63  ? 244  LEU B N   1 
ATOM   4258  C CA  . LEU B 1 244 ? 27.387  10.293  74.499  1.00 24.54  ? 244  LEU B CA  1 
ATOM   4259  C C   . LEU B 1 244 ? 28.173  9.875   75.758  1.00 30.36  ? 244  LEU B C   1 
ATOM   4260  O O   . LEU B 1 244 ? 29.404  9.763   75.719  1.00 30.37  ? 244  LEU B O   1 
ATOM   4261  C CB  . LEU B 1 244 ? 27.191  11.812  74.457  1.00 24.87  ? 244  LEU B CB  1 
ATOM   4262  C CG  . LEU B 1 244 ? 26.547  12.371  73.185  1.00 29.50  ? 244  LEU B CG  1 
ATOM   4263  C CD1 . LEU B 1 244 ? 26.377  13.841  73.289  1.00 30.50  ? 244  LEU B CD1 1 
ATOM   4264  C CD2 . LEU B 1 244 ? 27.370  12.052  71.940  1.00 29.63  ? 244  LEU B CD2 1 
ATOM   4265  N N   . GLU B 1 245 ? 27.449  9.604   76.849  1.00 26.35  ? 245  GLU B N   1 
ATOM   4266  C CA  . GLU B 1 245 ? 28.016  9.126   78.102  1.00 27.44  ? 245  GLU B CA  1 
ATOM   4267  C C   . GLU B 1 245 ? 28.550  7.693   77.906  1.00 31.34  ? 245  GLU B C   1 
ATOM   4268  O O   . GLU B 1 245 ? 29.693  7.411   78.272  1.00 31.72  ? 245  GLU B O   1 
ATOM   4269  C CB  . GLU B 1 245 ? 26.951  9.189   79.216  1.00 28.36  ? 245  GLU B CB  1 
ATOM   4270  C CG  . GLU B 1 245 ? 27.512  8.943   80.603  1.00 36.73  ? 245  GLU B CG  1 
ATOM   4271  C CD  . GLU B 1 245 ? 26.471  8.730   81.682  1.00 50.55  ? 245  GLU B CD  1 
ATOM   4272  O OE1 . GLU B 1 245 ? 26.719  7.928   82.609  1.00 43.02  ? 245  GLU B OE1 1 
ATOM   4273  O OE2 . GLU B 1 245 ? 25.390  9.348   81.583  1.00 40.59  ? 245  GLU B OE2 1 
ATOM   4274  N N   . ILE B 1 246 ? 27.730  6.816   77.283  1.00 27.60  ? 246  ILE B N   1 
ATOM   4275  C CA  . ILE B 1 246 ? 28.077  5.426   76.937  1.00 27.77  ? 246  ILE B CA  1 
ATOM   4276  C C   . ILE B 1 246 ? 29.391  5.409   76.114  1.00 30.91  ? 246  ILE B C   1 
ATOM   4277  O O   . ILE B 1 246 ? 30.302  4.652   76.461  1.00 32.45  ? 246  ILE B O   1 
ATOM   4278  C CB  . ILE B 1 246 ? 26.914  4.706   76.195  1.00 30.21  ? 246  ILE B CB  1 
ATOM   4279  C CG1 . ILE B 1 246 ? 25.669  4.567   77.109  1.00 29.45  ? 246  ILE B CG1 1 
ATOM   4280  C CG2 . ILE B 1 246 ? 27.355  3.337   75.672  1.00 32.31  ? 246  ILE B CG2 1 
ATOM   4281  C CD1 . ILE B 1 246 ? 24.348  4.297   76.375  1.00 31.00  ? 246  ILE B CD1 1 
ATOM   4282  N N   . LEU B 1 247 ? 29.506  6.294   75.097  1.00 25.03  ? 247  LEU B N   1 
ATOM   4283  C CA  . LEU B 1 247 ? 30.712  6.430   74.279  1.00 25.88  ? 247  LEU B CA  1 
ATOM   4284  C C   . LEU B 1 247 ? 31.927  6.803   75.147  1.00 30.39  ? 247  LEU B C   1 
ATOM   4285  O O   . LEU B 1 247 ? 33.000  6.231   74.945  1.00 29.85  ? 247  LEU B O   1 
ATOM   4286  C CB  . LEU B 1 247 ? 30.520  7.449   73.130  1.00 26.11  ? 247  LEU B CB  1 
ATOM   4287  C CG  . LEU B 1 247 ? 31.743  7.745   72.230  1.00 31.15  ? 247  LEU B CG  1 
ATOM   4288  C CD1 . LEU B 1 247 ? 32.312  6.470   71.590  1.00 31.82  ? 247  LEU B CD1 1 
ATOM   4289  C CD2 . LEU B 1 247 ? 31.394  8.762   71.174  1.00 32.63  ? 247  LEU B CD2 1 
ATOM   4290  N N   . GLY B 1 248 ? 31.729  7.713   76.112  1.00 27.17  ? 248  GLY B N   1 
ATOM   4291  C CA  . GLY B 1 248 ? 32.758  8.122   77.058  1.00 27.42  ? 248  GLY B CA  1 
ATOM   4292  C C   . GLY B 1 248 ? 33.361  6.938   77.799  1.00 31.58  ? 248  GLY B C   1 
ATOM   4293  O O   . GLY B 1 248 ? 34.585  6.790   77.834  1.00 33.48  ? 248  GLY B O   1 
ATOM   4294  N N   . TYR B 1 249 ? 32.505  6.056   78.351  1.00 26.86  ? 249  TYR B N   1 
ATOM   4295  C CA  . TYR B 1 249 ? 32.922  4.840   79.074  1.00 26.90  ? 249  TYR B CA  1 
ATOM   4296  C C   . TYR B 1 249 ? 33.630  3.859   78.147  1.00 33.04  ? 249  TYR B C   1 
ATOM   4297  O O   . TYR B 1 249 ? 34.586  3.218   78.574  1.00 34.77  ? 249  TYR B O   1 
ATOM   4298  C CB  . TYR B 1 249 ? 31.729  4.146   79.751  1.00 26.71  ? 249  TYR B CB  1 
ATOM   4299  C CG  . TYR B 1 249 ? 31.005  5.003   80.765  1.00 27.48  ? 249  TYR B CG  1 
ATOM   4300  C CD1 . TYR B 1 249 ? 31.707  5.855   81.619  1.00 30.14  ? 249  TYR B CD1 1 
ATOM   4301  C CD2 . TYR B 1 249 ? 29.626  4.918   80.920  1.00 26.67  ? 249  TYR B CD2 1 
ATOM   4302  C CE1 . TYR B 1 249 ? 31.048  6.638   82.563  1.00 29.61  ? 249  TYR B CE1 1 
ATOM   4303  C CE2 . TYR B 1 249 ? 28.957  5.691   81.866  1.00 27.15  ? 249  TYR B CE2 1 
ATOM   4304  C CZ  . TYR B 1 249 ? 29.673  6.552   82.687  1.00 34.34  ? 249  TYR B CZ  1 
ATOM   4305  O OH  . TYR B 1 249 ? 29.032  7.330   83.624  1.00 32.27  ? 249  TYR B OH  1 
ATOM   4306  N N   . CYS B 1 250 ? 33.163  3.752   76.882  1.00 29.48  ? 250  CYS B N   1 
ATOM   4307  C CA  . CYS B 1 250 ? 33.761  2.919   75.829  1.00 29.31  ? 250  CYS B CA  1 
ATOM   4308  C C   . CYS B 1 250 ? 35.197  3.362   75.572  1.00 36.58  ? 250  CYS B C   1 
ATOM   4309  O O   . CYS B 1 250 ? 36.091  2.518   75.534  1.00 38.67  ? 250  CYS B O   1 
ATOM   4310  C CB  . CYS B 1 250 ? 32.934  2.978   74.549  1.00 28.10  ? 250  CYS B CB  1 
ATOM   4311  S SG  . CYS B 1 250 ? 31.490  1.890   74.544  1.00 30.72  ? 250  CYS B SG  1 
ATOM   4312  N N   . MET B 1 251 ? 35.414  4.688   75.430  1.00 33.78  ? 251  MET B N   1 
ATOM   4313  C CA  . MET B 1 251 ? 36.722  5.300   75.188  1.00 35.87  ? 251  MET B CA  1 
ATOM   4314  C C   . MET B 1 251 ? 37.732  4.926   76.283  1.00 41.47  ? 251  MET B C   1 
ATOM   4315  O O   . MET B 1 251 ? 38.843  4.516   75.955  1.00 42.78  ? 251  MET B O   1 
ATOM   4316  C CB  . MET B 1 251 ? 36.612  6.834   75.060  1.00 38.21  ? 251  MET B CB  1 
ATOM   4317  C CG  . MET B 1 251 ? 35.896  7.285   73.802  1.00 41.43  ? 251  MET B CG  1 
ATOM   4318  S SD  . MET B 1 251 ? 35.947  9.066   73.440  1.00 46.07  ? 251  MET B SD  1 
ATOM   4319  C CE  . MET B 1 251 ? 35.304  9.738   74.881  1.00 41.21  ? 251  MET B CE  1 
ATOM   4320  N N   . ILE B 1 252 ? 37.334  5.022   77.565  1.00 37.44  ? 252  ILE B N   1 
ATOM   4321  C CA  . ILE B 1 252 ? 38.179  4.686   78.717  1.00 37.71  ? 252  ILE B CA  1 
ATOM   4322  C C   . ILE B 1 252 ? 38.526  3.183   78.682  1.00 41.74  ? 252  ILE B C   1 
ATOM   4323  O O   . ILE B 1 252 ? 39.697  2.824   78.813  1.00 43.35  ? 252  ILE B O   1 
ATOM   4324  C CB  . ILE B 1 252 ? 37.503  5.124   80.059  1.00 39.71  ? 252  ILE B CB  1 
ATOM   4325  C CG1 . ILE B 1 252 ? 37.479  6.679   80.176  1.00 39.91  ? 252  ILE B CG1 1 
ATOM   4326  C CG2 . ILE B 1 252 ? 38.205  4.489   81.275  1.00 40.29  ? 252  ILE B CG2 1 
ATOM   4327  C CD1 . ILE B 1 252 ? 36.457  7.269   81.136  1.00 46.16  ? 252  ILE B CD1 1 
ATOM   4328  N N   . GLN B 1 253 ? 37.511  2.324   78.485  1.00 36.77  ? 253  GLN B N   1 
ATOM   4329  C CA  . GLN B 1 253 ? 37.643  0.865   78.398  1.00 37.08  ? 253  GLN B CA  1 
ATOM   4330  C C   . GLN B 1 253 ? 38.630  0.470   77.280  1.00 42.76  ? 253  GLN B C   1 
ATOM   4331  O O   . GLN B 1 253 ? 39.468  -0.405  77.486  1.00 43.84  ? 253  GLN B O   1 
ATOM   4332  C CB  . GLN B 1 253 ? 36.248  0.242   78.142  1.00 37.14  ? 253  GLN B CB  1 
ATOM   4333  C CG  . GLN B 1 253 ? 36.222  -1.253  77.799  1.00 44.78  ? 253  GLN B CG  1 
ATOM   4334  C CD  . GLN B 1 253 ? 36.441  -2.145  78.989  1.00 64.25  ? 253  GLN B CD  1 
ATOM   4335  O OE1 . GLN B 1 253 ? 35.814  -1.993  80.043  1.00 60.75  ? 253  GLN B OE1 1 
ATOM   4336  N NE2 . GLN B 1 253 ? 37.315  -3.123  78.833  1.00 61.38  ? 253  GLN B NE2 1 
ATOM   4337  N N   . TRP B 1 254 ? 38.532  1.120   76.107  1.00 38.18  ? 254  TRP B N   1 
ATOM   4338  C CA  . TRP B 1 254 ? 39.387  0.821   74.964  1.00 38.37  ? 254  TRP B CA  1 
ATOM   4339  C C   . TRP B 1 254 ? 40.821  1.284   75.196  1.00 42.19  ? 254  TRP B C   1 
ATOM   4340  O O   . TRP B 1 254 ? 41.760  0.582   74.805  1.00 42.56  ? 254  TRP B O   1 
ATOM   4341  C CB  . TRP B 1 254 ? 38.819  1.447   73.678  1.00 36.17  ? 254  TRP B CB  1 
ATOM   4342  C CG  . TRP B 1 254 ? 37.450  0.952   73.286  1.00 35.60  ? 254  TRP B CG  1 
ATOM   4343  C CD1 . TRP B 1 254 ? 36.858  -0.226  73.654  1.00 38.10  ? 254  TRP B CD1 1 
ATOM   4344  C CD2 . TRP B 1 254 ? 36.507  1.629   72.442  1.00 34.13  ? 254  TRP B CD2 1 
ATOM   4345  N NE1 . TRP B 1 254 ? 35.597  -0.310  73.113  1.00 36.42  ? 254  TRP B NE1 1 
ATOM   4346  C CE2 . TRP B 1 254 ? 35.363  0.803   72.345  1.00 37.37  ? 254  TRP B CE2 1 
ATOM   4347  C CE3 . TRP B 1 254 ? 36.510  2.868   71.772  1.00 34.73  ? 254  TRP B CE3 1 
ATOM   4348  C CZ2 . TRP B 1 254 ? 34.240  1.165   71.587  1.00 35.50  ? 254  TRP B CZ2 1 
ATOM   4349  C CZ3 . TRP B 1 254 ? 35.393  3.231   71.034  1.00 35.02  ? 254  TRP B CZ3 1 
ATOM   4350  C CH2 . TRP B 1 254 ? 34.275  2.385   70.946  1.00 34.86  ? 254  TRP B CH2 1 
ATOM   4351  N N   . LEU B 1 255 ? 40.989  2.445   75.843  1.00 37.79  ? 255  LEU B N   1 
ATOM   4352  C CA  . LEU B 1 255 ? 42.307  3.018   76.124  1.00 39.17  ? 255  LEU B CA  1 
ATOM   4353  C C   . LEU B 1 255 ? 43.064  2.291   77.239  1.00 43.82  ? 255  LEU B C   1 
ATOM   4354  O O   . LEU B 1 255 ? 44.283  2.130   77.131  1.00 44.89  ? 255  LEU B O   1 
ATOM   4355  C CB  . LEU B 1 255 ? 42.181  4.507   76.501  1.00 38.74  ? 255  LEU B CB  1 
ATOM   4356  C CG  . LEU B 1 255 ? 41.913  5.501   75.365  1.00 43.77  ? 255  LEU B CG  1 
ATOM   4357  C CD1 . LEU B 1 255 ? 41.461  6.851   75.912  1.00 43.74  ? 255  LEU B CD1 1 
ATOM   4358  C CD2 . LEU B 1 255 ? 43.127  5.685   74.498  1.00 46.76  ? 255  LEU B CD2 1 
ATOM   4359  N N   . THR B 1 256 ? 42.360  1.879   78.312  1.00 39.82  ? 256  THR B N   1 
ATOM   4360  C CA  . THR B 1 256 ? 42.976  1.298   79.514  1.00 40.48  ? 256  THR B CA  1 
ATOM   4361  C C   . THR B 1 256 ? 42.777  -0.216  79.694  1.00 45.63  ? 256  THR B C   1 
ATOM   4362  O O   . THR B 1 256 ? 43.469  -0.820  80.521  1.00 46.41  ? 256  THR B O   1 
ATOM   4363  C CB  . THR B 1 256 ? 42.398  1.997   80.755  1.00 45.65  ? 256  THR B CB  1 
ATOM   4364  O OG1 . THR B 1 256 ? 41.024  1.630   80.908  1.00 46.65  ? 256  THR B OG1 1 
ATOM   4365  C CG2 . THR B 1 256 ? 42.521  3.497   80.692  1.00 42.66  ? 256  THR B CG2 1 
ATOM   4366  N N   . GLY B 1 257 ? 41.802  -0.789  78.991  1.00 41.59  ? 257  GLY B N   1 
ATOM   4367  C CA  . GLY B 1 257 ? 41.456  -2.199  79.125  1.00 41.79  ? 257  GLY B CA  1 
ATOM   4368  C C   . GLY B 1 257 ? 40.563  -2.489  80.320  1.00 44.49  ? 257  GLY B C   1 
ATOM   4369  O O   . GLY B 1 257 ? 40.245  -3.653  80.583  1.00 44.86  ? 257  GLY B O   1 
ATOM   4370  N N   . HIS B 1 258 ? 40.162  -1.436  81.068  1.00 39.42  ? 258  HIS B N   1 
ATOM   4371  C CA  . HIS B 1 258 ? 39.351  -1.572  82.284  1.00 37.88  ? 258  HIS B CA  1 
ATOM   4372  C C   . HIS B 1 258 ? 38.381  -0.405  82.496  1.00 39.85  ? 258  HIS B C   1 
ATOM   4373  O O   . HIS B 1 258 ? 38.480  0.635   81.842  1.00 39.66  ? 258  HIS B O   1 
ATOM   4374  C CB  . HIS B 1 258 ? 40.274  -1.667  83.533  1.00 39.44  ? 258  HIS B CB  1 
ATOM   4375  C CG  . HIS B 1 258 ? 41.354  -2.700  83.430  1.00 44.51  ? 258  HIS B CG  1 
ATOM   4376  N ND1 . HIS B 1 258 ? 41.110  -4.033  83.710  1.00 46.76  ? 258  HIS B ND1 1 
ATOM   4377  C CD2 . HIS B 1 258 ? 42.639  -2.568  83.033  1.00 47.56  ? 258  HIS B CD2 1 
ATOM   4378  C CE1 . HIS B 1 258 ? 42.245  -4.664  83.484  1.00 47.84  ? 258  HIS B CE1 1 
ATOM   4379  N NE2 . HIS B 1 258 ? 43.195  -3.826  83.072  1.00 48.84  ? 258  HIS B NE2 1 
ATOM   4380  N N   . LEU B 1 259 ? 37.458  -0.592  83.449  1.00 34.64  ? 259  LEU B N   1 
ATOM   4381  C CA  . LEU B 1 259 ? 36.512  0.397   83.965  1.00 32.66  ? 259  LEU B CA  1 
ATOM   4382  C C   . LEU B 1 259 ? 36.515  0.243   85.486  1.00 37.62  ? 259  LEU B C   1 
ATOM   4383  O O   . LEU B 1 259 ? 36.652  -0.887  85.955  1.00 38.09  ? 259  LEU B O   1 
ATOM   4384  C CB  . LEU B 1 259 ? 35.100  0.282   83.348  1.00 31.05  ? 259  LEU B CB  1 
ATOM   4385  C CG  . LEU B 1 259 ? 34.929  0.847   81.924  1.00 33.94  ? 259  LEU B CG  1 
ATOM   4386  C CD1 . LEU B 1 259 ? 33.600  0.448   81.341  1.00 32.83  ? 259  LEU B CD1 1 
ATOM   4387  C CD2 . LEU B 1 259 ? 35.071  2.371   81.894  1.00 34.44  ? 259  LEU B CD2 1 
ATOM   4388  N N   . PRO B 1 260 ? 36.463  1.340   86.287  1.00 34.73  ? 260  PRO B N   1 
ATOM   4389  C CA  . PRO B 1 260 ? 36.588  1.194   87.760  1.00 34.82  ? 260  PRO B CA  1 
ATOM   4390  C C   . PRO B 1 260 ? 35.600  0.221   88.420  1.00 38.70  ? 260  PRO B C   1 
ATOM   4391  O O   . PRO B 1 260 ? 35.982  -0.452  89.387  1.00 40.41  ? 260  PRO B O   1 
ATOM   4392  C CB  . PRO B 1 260 ? 36.358  2.618   88.285  1.00 35.71  ? 260  PRO B CB  1 
ATOM   4393  C CG  . PRO B 1 260 ? 36.718  3.508   87.148  1.00 40.07  ? 260  PRO B CG  1 
ATOM   4394  C CD  . PRO B 1 260 ? 36.350  2.763   85.896  1.00 35.34  ? 260  PRO B CD  1 
ATOM   4395  N N   . TRP B 1 261 ? 34.366  0.122   87.888  1.00 32.19  ? 261  TRP B N   1 
ATOM   4396  C CA  . TRP B 1 261 ? 33.270  -0.684  88.441  1.00 31.17  ? 261  TRP B CA  1 
ATOM   4397  C C   . TRP B 1 261 ? 33.151  -2.115  87.863  1.00 36.40  ? 261  TRP B C   1 
ATOM   4398  O O   . TRP B 1 261 ? 32.211  -2.827  88.224  1.00 35.13  ? 261  TRP B O   1 
ATOM   4399  C CB  . TRP B 1 261 ? 31.945  0.063   88.208  1.00 28.21  ? 261  TRP B CB  1 
ATOM   4400  C CG  . TRP B 1 261 ? 31.796  0.610   86.814  1.00 27.97  ? 261  TRP B CG  1 
ATOM   4401  C CD1 . TRP B 1 261 ? 31.340  -0.058  85.716  1.00 30.17  ? 261  TRP B CD1 1 
ATOM   4402  C CD2 . TRP B 1 261 ? 32.134  1.933   86.368  1.00 27.22  ? 261  TRP B CD2 1 
ATOM   4403  N NE1 . TRP B 1 261 ? 31.384  0.758   84.613  1.00 28.69  ? 261  TRP B NE1 1 
ATOM   4404  C CE2 . TRP B 1 261 ? 31.866  1.988   84.982  1.00 30.14  ? 261  TRP B CE2 1 
ATOM   4405  C CE3 . TRP B 1 261 ? 32.651  3.075   87.002  1.00 28.61  ? 261  TRP B CE3 1 
ATOM   4406  C CZ2 . TRP B 1 261 ? 32.079  3.146   84.221  1.00 29.10  ? 261  TRP B CZ2 1 
ATOM   4407  C CZ3 . TRP B 1 261 ? 32.867  4.220   86.245  1.00 30.06  ? 261  TRP B CZ3 1 
ATOM   4408  C CH2 . TRP B 1 261 ? 32.579  4.249   84.872  1.00 30.06  ? 261  TRP B CH2 1 
ATOM   4409  N N   . GLU B 1 262 ? 34.101  -2.548  87.012  1.00 35.79  ? 262  GLU B N   1 
ATOM   4410  C CA  . GLU B 1 262 ? 34.044  -3.849  86.323  1.00 37.20  ? 262  GLU B CA  1 
ATOM   4411  C C   . GLU B 1 262 ? 34.110  -5.103  87.239  1.00 45.70  ? 262  GLU B C   1 
ATOM   4412  O O   . GLU B 1 262 ? 33.723  -6.192  86.796  1.00 46.28  ? 262  GLU B O   1 
ATOM   4413  C CB  . GLU B 1 262 ? 35.139  -3.945  85.255  1.00 38.86  ? 262  GLU B CB  1 
ATOM   4414  C CG  . GLU B 1 262 ? 36.558  -4.071  85.781  1.00 46.20  ? 262  GLU B CG  1 
ATOM   4415  C CD  . GLU B 1 262 ? 37.644  -4.153  84.730  1.00 59.80  ? 262  GLU B CD  1 
ATOM   4416  O OE1 . GLU B 1 262 ? 38.793  -4.477  85.107  1.00 52.89  ? 262  GLU B OE1 1 
ATOM   4417  O OE2 . GLU B 1 262 ? 37.356  -3.904  83.537  1.00 54.24  ? 262  GLU B OE2 1 
ATOM   4418  N N   . ASP B 1 263 ? 34.587  -4.964  88.480  1.00 44.24  ? 263  ASP B N   1 
ATOM   4419  C CA  . ASP B 1 263 ? 34.708  -6.117  89.362  1.00 46.33  ? 263  ASP B CA  1 
ATOM   4420  C C   . ASP B 1 263 ? 33.403  -6.444  90.132  1.00 49.03  ? 263  ASP B C   1 
ATOM   4421  O O   . ASP B 1 263 ? 33.378  -7.442  90.861  1.00 50.03  ? 263  ASP B O   1 
ATOM   4422  C CB  . ASP B 1 263 ? 35.891  -5.933  90.328  1.00 50.20  ? 263  ASP B CB  1 
ATOM   4423  C CG  . ASP B 1 263 ? 37.251  -5.999  89.643  1.00 69.08  ? 263  ASP B CG  1 
ATOM   4424  O OD1 . ASP B 1 263 ? 37.404  -6.802  88.684  1.00 70.49  ? 263  ASP B OD1 1 
ATOM   4425  O OD2 . ASP B 1 263 ? 38.171  -5.268  90.077  1.00 79.16  ? 263  ASP B OD2 1 
ATOM   4426  N N   . ASN B 1 264 ? 32.320  -5.662  89.943  1.00 42.87  ? 264  ASN B N   1 
ATOM   4427  C CA  . ASN B 1 264 ? 31.052  -5.946  90.615  1.00 42.50  ? 264  ASN B CA  1 
ATOM   4428  C C   . ASN B 1 264 ? 29.877  -5.549  89.719  1.00 42.70  ? 264  ASN B C   1 
ATOM   4429  O O   . ASN B 1 264 ? 28.980  -4.804  90.118  1.00 40.61  ? 264  ASN B O   1 
ATOM   4430  C CB  . ASN B 1 264 ? 30.985  -5.265  91.999  1.00 48.85  ? 264  ASN B CB  1 
ATOM   4431  C CG  . ASN B 1 264 ? 30.306  -6.086  93.079  1.00 82.51  ? 264  ASN B CG  1 
ATOM   4432  O OD1 . ASN B 1 264 ? 30.095  -7.300  92.950  1.00 81.14  ? 264  ASN B OD1 1 
ATOM   4433  N ND2 . ASN B 1 264 ? 29.968  -5.441  94.188  1.00 76.75  ? 264  ASN B ND2 1 
ATOM   4434  N N   . LEU B 1 265 ? 29.863  -6.106  88.509  1.00 39.42  ? 265  LEU B N   1 
ATOM   4435  C CA  . LEU B 1 265 ? 28.813  -5.824  87.534  1.00 38.19  ? 265  LEU B CA  1 
ATOM   4436  C C   . LEU B 1 265 ? 27.496  -6.534  87.893  1.00 42.84  ? 265  LEU B C   1 
ATOM   4437  O O   . LEU B 1 265 ? 26.454  -6.177  87.348  1.00 40.30  ? 265  LEU B O   1 
ATOM   4438  C CB  . LEU B 1 265 ? 29.267  -6.173  86.117  1.00 37.71  ? 265  LEU B CB  1 
ATOM   4439  C CG  . LEU B 1 265 ? 30.486  -5.419  85.583  1.00 41.34  ? 265  LEU B CG  1 
ATOM   4440  C CD1 . LEU B 1 265 ? 30.863  -5.920  84.200  1.00 40.62  ? 265  LEU B CD1 1 
ATOM   4441  C CD2 . LEU B 1 265 ? 30.245  -3.922  85.555  1.00 42.01  ? 265  LEU B CD2 1 
ATOM   4442  N N   . LYS B 1 266 ? 27.533  -7.488  88.850  1.00 42.55  ? 266  LYS B N   1 
ATOM   4443  C CA  . LYS B 1 266 ? 26.339  -8.178  89.342  1.00 43.49  ? 266  LYS B CA  1 
ATOM   4444  C C   . LYS B 1 266 ? 25.665  -7.339  90.470  1.00 47.46  ? 266  LYS B C   1 
ATOM   4445  O O   . LYS B 1 266 ? 24.625  -7.736  90.998  1.00 48.35  ? 266  LYS B O   1 
ATOM   4446  C CB  . LYS B 1 266 ? 26.676  -9.613  89.796  1.00 48.32  ? 266  LYS B CB  1 
ATOM   4447  C CG  . LYS B 1 266 ? 27.073  -10.533 88.634  1.00 65.21  ? 266  LYS B CG  1 
ATOM   4448  C CD  . LYS B 1 266 ? 26.229  -11.819 88.519  1.00 80.66  ? 266  LYS B CD  1 
ATOM   4449  C CE  . LYS B 1 266 ? 26.480  -12.578 87.230  1.00 94.34  ? 266  LYS B CE  1 
ATOM   4450  N NZ  . LYS B 1 266 ? 25.947  -11.869 86.030  1.00 98.84  ? 266  LYS B NZ  1 
ATOM   4451  N N   . ASP B 1 267 ? 26.228  -6.137  90.766  1.00 42.26  ? 267  ASP B N   1 
ATOM   4452  C CA  . ASP B 1 267 ? 25.722  -5.167  91.734  1.00 40.73  ? 267  ASP B CA  1 
ATOM   4453  C C   . ASP B 1 267 ? 25.426  -3.827  91.015  1.00 41.07  ? 267  ASP B C   1 
ATOM   4454  O O   . ASP B 1 267 ? 26.283  -2.945  90.994  1.00 40.15  ? 267  ASP B O   1 
ATOM   4455  C CB  . ASP B 1 267 ? 26.726  -4.986  92.888  1.00 43.61  ? 267  ASP B CB  1 
ATOM   4456  C CG  . ASP B 1 267 ? 26.175  -4.263  94.104  1.00 56.49  ? 267  ASP B CG  1 
ATOM   4457  O OD1 . ASP B 1 267 ? 24.939  -4.052  94.166  1.00 57.41  ? 267  ASP B OD1 1 
ATOM   4458  O OD2 . ASP B 1 267 ? 26.970  -3.953  95.019  1.00 63.88  ? 267  ASP B OD2 1 
ATOM   4459  N N   . PRO B 1 268 ? 24.218  -3.650  90.422  1.00 36.47  ? 268  PRO B N   1 
ATOM   4460  C CA  . PRO B 1 268 ? 23.936  -2.421  89.657  1.00 34.72  ? 268  PRO B CA  1 
ATOM   4461  C C   . PRO B 1 268 ? 23.908  -1.118  90.479  1.00 37.13  ? 268  PRO B C   1 
ATOM   4462  O O   . PRO B 1 268 ? 24.363  -0.095  89.958  1.00 35.42  ? 268  PRO B O   1 
ATOM   4463  C CB  . PRO B 1 268 ? 22.572  -2.714  89.016  1.00 35.89  ? 268  PRO B CB  1 
ATOM   4464  C CG  . PRO B 1 268 ? 22.475  -4.189  88.979  1.00 40.62  ? 268  PRO B CG  1 
ATOM   4465  C CD  . PRO B 1 268 ? 23.108  -4.612  90.276  1.00 37.96  ? 268  PRO B CD  1 
ATOM   4466  N N   . LYS B 1 269 ? 23.419  -1.139  91.746  1.00 34.18  ? 269  LYS B N   1 
ATOM   4467  C CA  . LYS B 1 269 ? 23.401  0.068   92.600  1.00 33.09  ? 269  LYS B CA  1 
ATOM   4468  C C   . LYS B 1 269 ? 24.831  0.572   92.840  1.00 36.28  ? 269  LYS B C   1 
ATOM   4469  O O   . LYS B 1 269 ? 25.048  1.781   92.892  1.00 35.35  ? 269  LYS B O   1 
ATOM   4470  C CB  . LYS B 1 269 ? 22.637  -0.120  93.932  1.00 35.62  ? 269  LYS B CB  1 
ATOM   4471  C CG  . LYS B 1 269 ? 23.000  -1.337  94.771  1.00 41.92  ? 269  LYS B CG  1 
ATOM   4472  C CD  . LYS B 1 269 ? 23.918  -1.011  95.920  1.00 41.44  ? 269  LYS B CD  1 
ATOM   4473  C CE  . LYS B 1 269 ? 23.815  -2.003  97.066  1.00 44.26  ? 269  LYS B CE  1 
ATOM   4474  N NZ  . LYS B 1 269 ? 24.353  -3.353  96.749  1.00 46.98  ? 269  LYS B NZ  1 
ATOM   4475  N N   . TYR B 1 270 ? 25.799  -0.354  92.918  1.00 33.31  ? 270  TYR B N   1 
ATOM   4476  C CA  . TYR B 1 270 ? 27.221  -0.043  93.047  1.00 32.92  ? 270  TYR B CA  1 
ATOM   4477  C C   . TYR B 1 270 ? 27.735  0.600   91.759  1.00 34.68  ? 270  TYR B C   1 
ATOM   4478  O O   . TYR B 1 270 ? 28.443  1.605   91.830  1.00 33.26  ? 270  TYR B O   1 
ATOM   4479  C CB  . TYR B 1 270 ? 28.032  -1.306  93.382  1.00 35.71  ? 270  TYR B CB  1 
ATOM   4480  C CG  . TYR B 1 270 ? 29.515  -1.160  93.112  1.00 39.57  ? 270  TYR B CG  1 
ATOM   4481  C CD1 . TYR B 1 270 ? 30.100  -1.729  91.977  1.00 41.87  ? 270  TYR B CD1 1 
ATOM   4482  C CD2 . TYR B 1 270 ? 30.328  -0.419  93.964  1.00 40.60  ? 270  TYR B CD2 1 
ATOM   4483  C CE1 . TYR B 1 270 ? 31.464  -1.583  91.717  1.00 42.47  ? 270  TYR B CE1 1 
ATOM   4484  C CE2 . TYR B 1 270 ? 31.686  -0.255  93.707  1.00 41.91  ? 270  TYR B CE2 1 
ATOM   4485  C CZ  . TYR B 1 270 ? 32.252  -0.846  92.589  1.00 48.90  ? 270  TYR B CZ  1 
ATOM   4486  O OH  . TYR B 1 270 ? 33.594  -0.675  92.344  1.00 47.94  ? 270  TYR B OH  1 
ATOM   4487  N N   . VAL B 1 271 ? 27.402  -0.006  90.583  1.00 30.53  ? 271  VAL B N   1 
ATOM   4488  C CA  . VAL B 1 271 ? 27.802  0.472   89.253  1.00 29.55  ? 271  VAL B CA  1 
ATOM   4489  C C   . VAL B 1 271 ? 27.277  1.918   89.072  1.00 33.54  ? 271  VAL B C   1 
ATOM   4490  O O   . VAL B 1 271 ? 28.061  2.798   88.685  1.00 33.77  ? 271  VAL B O   1 
ATOM   4491  C CB  . VAL B 1 271 ? 27.360  -0.489  88.097  1.00 32.42  ? 271  VAL B CB  1 
ATOM   4492  C CG1 . VAL B 1 271 ? 27.672  0.106   86.719  1.00 31.03  ? 271  VAL B CG1 1 
ATOM   4493  C CG2 . VAL B 1 271 ? 28.019  -1.863  88.241  1.00 32.81  ? 271  VAL B CG2 1 
ATOM   4494  N N   . ARG B 1 272 ? 25.985  2.169   89.411  1.00 28.71  ? 272  ARG B N   1 
ATOM   4495  C CA  . ARG B 1 272 ? 25.385  3.508   89.338  1.00 27.30  ? 272  ARG B CA  1 
ATOM   4496  C C   . ARG B 1 272 ? 26.096  4.497   90.288  1.00 30.62  ? 272  ARG B C   1 
ATOM   4497  O O   . ARG B 1 272 ? 26.433  5.594   89.859  1.00 31.12  ? 272  ARG B O   1 
ATOM   4498  C CB  . ARG B 1 272 ? 23.878  3.484   89.646  1.00 24.72  ? 272  ARG B CB  1 
ATOM   4499  C CG  . ARG B 1 272 ? 23.266  4.879   89.491  1.00 24.58  ? 272  ARG B CG  1 
ATOM   4500  C CD  . ARG B 1 272 ? 21.817  5.016   89.881  1.00 19.84  ? 272  ARG B CD  1 
ATOM   4501  N NE  . ARG B 1 272 ? 21.532  4.521   91.227  1.00 20.74  ? 272  ARG B NE  1 
ATOM   4502  C CZ  . ARG B 1 272 ? 20.308  4.409   91.726  1.00 33.21  ? 272  ARG B CZ  1 
ATOM   4503  N NH1 . ARG B 1 272 ? 19.253  4.756   91.000  1.00 24.12  ? 272  ARG B NH1 1 
ATOM   4504  N NH2 . ARG B 1 272 ? 20.124  3.912   92.936  1.00 20.41  ? 272  ARG B NH2 1 
ATOM   4505  N N   . ASP B 1 273 ? 26.291  4.121   91.561  1.00 26.21  ? 273  ASP B N   1 
ATOM   4506  C CA  . ASP B 1 273 ? 26.955  4.945   92.574  1.00 26.32  ? 273  ASP B CA  1 
ATOM   4507  C C   . ASP B 1 273 ? 28.340  5.382   92.097  1.00 32.41  ? 273  ASP B C   1 
ATOM   4508  O O   . ASP B 1 273 ? 28.683  6.547   92.272  1.00 34.09  ? 273  ASP B O   1 
ATOM   4509  C CB  . ASP B 1 273 ? 27.069  4.160   93.895  1.00 28.22  ? 273  ASP B CB  1 
ATOM   4510  C CG  . ASP B 1 273 ? 27.775  4.877   95.019  1.00 32.79  ? 273  ASP B CG  1 
ATOM   4511  O OD1 . ASP B 1 273 ? 27.103  5.624   95.757  1.00 31.51  ? 273  ASP B OD1 1 
ATOM   4512  O OD2 . ASP B 1 273 ? 28.995  4.657   95.188  1.00 38.04  ? 273  ASP B OD2 1 
ATOM   4513  N N   . SER B 1 274 ? 29.131  4.462   91.507  1.00 28.84  ? 274  SER B N   1 
ATOM   4514  C CA  . SER B 1 274 ? 30.466  4.760   90.961  1.00 28.64  ? 274  SER B CA  1 
ATOM   4515  C C   . SER B 1 274 ? 30.383  5.773   89.825  1.00 31.10  ? 274  SER B C   1 
ATOM   4516  O O   . SER B 1 274 ? 31.156  6.726   89.796  1.00 31.06  ? 274  SER B O   1 
ATOM   4517  C CB  . SER B 1 274 ? 31.139  3.495   90.442  1.00 31.80  ? 274  SER B CB  1 
ATOM   4518  O OG  . SER B 1 274 ? 31.637  2.692   91.492  1.00 40.85  ? 274  SER B OG  1 
ATOM   4519  N N   . LYS B 1 275 ? 29.443  5.569   88.896  1.00 26.36  ? 275  LYS B N   1 
ATOM   4520  C CA  . LYS B 1 275 ? 29.268  6.445   87.738  1.00 25.47  ? 275  LYS B CA  1 
ATOM   4521  C C   . LYS B 1 275 ? 28.834  7.852   88.174  1.00 29.84  ? 275  LYS B C   1 
ATOM   4522  O O   . LYS B 1 275 ? 29.373  8.827   87.647  1.00 29.89  ? 275  LYS B O   1 
ATOM   4523  C CB  . LYS B 1 275 ? 28.274  5.842   86.734  1.00 26.46  ? 275  LYS B CB  1 
ATOM   4524  C CG  . LYS B 1 275 ? 28.840  4.646   85.980  1.00 25.11  ? 275  LYS B CG  1 
ATOM   4525  C CD  . LYS B 1 275 ? 27.824  4.076   85.004  1.00 28.15  ? 275  LYS B CD  1 
ATOM   4526  C CE  . LYS B 1 275 ? 28.389  2.904   84.243  1.00 27.99  ? 275  LYS B CE  1 
ATOM   4527  N NZ  . LYS B 1 275 ? 27.330  2.134   83.551  1.00 18.39  ? 275  LYS B NZ  1 
ATOM   4528  N N   . ILE B 1 276 ? 27.931  7.955   89.179  1.00 25.55  ? 276  ILE B N   1 
ATOM   4529  C CA  . ILE B 1 276 ? 27.446  9.241   89.707  1.00 24.71  ? 276  ILE B CA  1 
ATOM   4530  C C   . ILE B 1 276 ? 28.624  10.012  90.348  1.00 29.62  ? 276  ILE B C   1 
ATOM   4531  O O   . ILE B 1 276 ? 28.820  11.186  90.052  1.00 29.60  ? 276  ILE B O   1 
ATOM   4532  C CB  . ILE B 1 276 ? 26.245  9.044   90.686  1.00 26.72  ? 276  ILE B CB  1 
ATOM   4533  C CG1 . ILE B 1 276 ? 24.980  8.598   89.913  1.00 26.07  ? 276  ILE B CG1 1 
ATOM   4534  C CG2 . ILE B 1 276 ? 25.974  10.307  91.541  1.00 26.02  ? 276  ILE B CG2 1 
ATOM   4535  C CD1 . ILE B 1 276 ? 23.826  8.090   90.771  1.00 31.73  ? 276  ILE B CD1 1 
ATOM   4536  N N   . ARG B 1 277 ? 29.404  9.333   91.191  1.00 27.23  ? 277  ARG B N   1 
ATOM   4537  C CA  . ARG B 1 277 ? 30.569  9.870   91.885  1.00 28.15  ? 277  ARG B CA  1 
ATOM   4538  C C   . ARG B 1 277 ? 31.660  10.289  90.890  1.00 33.12  ? 277  ARG B C   1 
ATOM   4539  O O   . ARG B 1 277 ? 32.256  11.351  91.066  1.00 34.05  ? 277  ARG B O   1 
ATOM   4540  C CB  . ARG B 1 277 ? 31.110  8.830   92.879  1.00 28.68  ? 277  ARG B CB  1 
ATOM   4541  C CG  . ARG B 1 277 ? 32.391  9.251   93.620  1.00 41.42  ? 277  ARG B CG  1 
ATOM   4542  C CD  . ARG B 1 277 ? 32.820  8.290   94.715  1.00 40.06  ? 277  ARG B CD  1 
ATOM   4543  N NE  . ARG B 1 277 ? 32.836  6.892   94.272  1.00 44.87  ? 277  ARG B NE  1 
ATOM   4544  C CZ  . ARG B 1 277 ? 33.908  6.272   93.800  1.00 56.54  ? 277  ARG B CZ  1 
ATOM   4545  N NH1 . ARG B 1 277 ? 35.074  6.902   93.738  1.00 49.99  ? 277  ARG B NH1 1 
ATOM   4546  N NH2 . ARG B 1 277 ? 33.831  5.007   93.410  1.00 38.11  ? 277  ARG B NH2 1 
ATOM   4547  N N   . TYR B 1 278 ? 31.920  9.465   89.862  1.00 28.99  ? 278  TYR B N   1 
ATOM   4548  C CA  . TYR B 1 278 ? 32.944  9.761   88.870  1.00 29.21  ? 278  TYR B CA  1 
ATOM   4549  C C   . TYR B 1 278 ? 32.483  10.854  87.878  1.00 34.33  ? 278  TYR B C   1 
ATOM   4550  O O   . TYR B 1 278 ? 33.337  11.491  87.271  1.00 35.43  ? 278  TYR B O   1 
ATOM   4551  C CB  . TYR B 1 278 ? 33.414  8.489   88.141  1.00 29.89  ? 278  TYR B CB  1 
ATOM   4552  C CG  . TYR B 1 278 ? 34.336  7.615   88.972  1.00 30.63  ? 278  TYR B CG  1 
ATOM   4553  C CD1 . TYR B 1 278 ? 35.505  8.132   89.533  1.00 32.64  ? 278  TYR B CD1 1 
ATOM   4554  C CD2 . TYR B 1 278 ? 34.065  6.263   89.163  1.00 31.27  ? 278  TYR B CD2 1 
ATOM   4555  C CE1 . TYR B 1 278 ? 36.375  7.324   90.267  1.00 32.87  ? 278  TYR B CE1 1 
ATOM   4556  C CE2 . TYR B 1 278 ? 34.917  5.452   89.919  1.00 32.77  ? 278  TYR B CE2 1 
ATOM   4557  C CZ  . TYR B 1 278 ? 36.074  5.986   90.459  1.00 39.59  ? 278  TYR B CZ  1 
ATOM   4558  O OH  . TYR B 1 278 ? 36.904  5.189   91.204  1.00 43.63  ? 278  TYR B OH  1 
ATOM   4559  N N   . ARG B 1 279 ? 31.160  11.092  87.738  1.00 29.18  ? 279  ARG B N   1 
ATOM   4560  C CA  . ARG B 1 279 ? 30.607  12.192  86.936  1.00 28.30  ? 279  ARG B CA  1 
ATOM   4561  C C   . ARG B 1 279 ? 30.769  13.497  87.726  1.00 32.94  ? 279  ARG B C   1 
ATOM   4562  O O   . ARG B 1 279 ? 31.143  14.517  87.157  1.00 32.68  ? 279  ARG B O   1 
ATOM   4563  C CB  . ARG B 1 279 ? 29.126  11.939  86.593  1.00 27.09  ? 279  ARG B CB  1 
ATOM   4564  C CG  . ARG B 1 279 ? 28.440  13.057  85.807  1.00 34.07  ? 279  ARG B CG  1 
ATOM   4565  C CD  . ARG B 1 279 ? 26.948  12.844  85.810  1.00 47.16  ? 279  ARG B CD  1 
ATOM   4566  N NE  . ARG B 1 279 ? 26.256  13.791  84.941  1.00 66.37  ? 279  ARG B NE  1 
ATOM   4567  C CZ  . ARG B 1 279 ? 25.679  14.913  85.358  1.00 85.49  ? 279  ARG B CZ  1 
ATOM   4568  N NH1 . ARG B 1 279 ? 25.719  15.253  86.642  1.00 75.67  ? 279  ARG B NH1 1 
ATOM   4569  N NH2 . ARG B 1 279 ? 25.058  15.707  84.494  1.00 74.49  ? 279  ARG B NH2 1 
ATOM   4570  N N   . GLU B 1 280 ? 30.507  13.442  89.047  1.00 30.64  ? 280  GLU B N   1 
ATOM   4571  C CA  . GLU B 1 280 ? 30.629  14.553  89.987  1.00 31.57  ? 280  GLU B CA  1 
ATOM   4572  C C   . GLU B 1 280 ? 32.099  15.000  90.111  1.00 37.23  ? 280  GLU B C   1 
ATOM   4573  O O   . GLU B 1 280 ? 32.357  16.190  90.295  1.00 37.29  ? 280  GLU B O   1 
ATOM   4574  C CB  . GLU B 1 280 ? 30.059  14.139  91.361  1.00 33.15  ? 280  GLU B CB  1 
ATOM   4575  C CG  . GLU B 1 280 ? 29.883  15.274  92.361  1.00 45.34  ? 280  GLU B CG  1 
ATOM   4576  C CD  . GLU B 1 280 ? 28.933  16.405  91.994  1.00 66.05  ? 280  GLU B CD  1 
ATOM   4577  O OE1 . GLU B 1 280 ? 27.988  16.176  91.199  1.00 59.98  ? 280  GLU B OE1 1 
ATOM   4578  O OE2 . GLU B 1 280 ? 29.113  17.518  92.544  1.00 48.28  ? 280  GLU B OE2 1 
ATOM   4579  N N   . ASN B 1 281 ? 33.052  14.050  89.977  1.00 34.53  ? 281  ASN B N   1 
ATOM   4580  C CA  . ASN B 1 281 ? 34.491  14.314  90.057  1.00 35.24  ? 281  ASN B CA  1 
ATOM   4581  C C   . ASN B 1 281 ? 35.204  13.529  88.948  1.00 38.72  ? 281  ASN B C   1 
ATOM   4582  O O   . ASN B 1 281 ? 35.651  12.397  89.154  1.00 38.39  ? 281  ASN B O   1 
ATOM   4583  C CB  . ASN B 1 281 ? 35.025  13.964  91.457  1.00 35.96  ? 281  ASN B CB  1 
ATOM   4584  C CG  . ASN B 1 281 ? 36.444  14.418  91.754  1.00 65.61  ? 281  ASN B CG  1 
ATOM   4585  O OD1 . ASN B 1 281 ? 37.109  15.107  90.965  1.00 60.42  ? 281  ASN B OD1 1 
ATOM   4586  N ND2 . ASN B 1 281 ? 36.935  14.048  92.930  1.00 58.15  ? 281  ASN B ND2 1 
ATOM   4587  N N   . ILE B 1 282 ? 35.261  14.135  87.750  1.00 35.07  ? 282  ILE B N   1 
ATOM   4588  C CA  . ILE B 1 282 ? 35.866  13.561  86.540  1.00 34.40  ? 282  ILE B CA  1 
ATOM   4589  C C   . ILE B 1 282 ? 37.406  13.438  86.715  1.00 38.02  ? 282  ILE B C   1 
ATOM   4590  O O   . ILE B 1 282 ? 37.992  12.479  86.208  1.00 38.39  ? 282  ILE B O   1 
ATOM   4591  C CB  . ILE B 1 282 ? 35.421  14.380  85.289  1.00 36.88  ? 282  ILE B CB  1 
ATOM   4592  C CG1 . ILE B 1 282 ? 33.914  14.123  85.016  1.00 36.22  ? 282  ILE B CG1 1 
ATOM   4593  C CG2 . ILE B 1 282 ? 36.246  14.047  84.058  1.00 36.72  ? 282  ILE B CG2 1 
ATOM   4594  C CD1 . ILE B 1 282 ? 33.148  15.135  84.139  1.00 41.52  ? 282  ILE B CD1 1 
ATOM   4595  N N   . ALA B 1 283 ? 38.031  14.355  87.482  1.00 34.12  ? 283  ALA B N   1 
ATOM   4596  C CA  . ALA B 1 283 ? 39.470  14.326  87.779  1.00 34.71  ? 283  ALA B CA  1 
ATOM   4597  C C   . ALA B 1 283 ? 39.850  13.041  88.538  1.00 38.00  ? 283  ALA B C   1 
ATOM   4598  O O   . ALA B 1 283 ? 40.903  12.468  88.250  1.00 38.40  ? 283  ALA B O   1 
ATOM   4599  C CB  . ALA B 1 283 ? 39.872  15.550  88.586  1.00 35.95  ? 283  ALA B CB  1 
ATOM   4600  N N   . SER B 1 284 ? 38.975  12.568  89.461  1.00 32.52  ? 284  SER B N   1 
ATOM   4601  C CA  . SER B 1 284 ? 39.198  11.332  90.213  1.00 32.28  ? 284  SER B CA  1 
ATOM   4602  C C   . SER B 1 284 ? 39.022  10.118  89.293  1.00 37.08  ? 284  SER B C   1 
ATOM   4603  O O   . SER B 1 284 ? 39.704  9.108   89.496  1.00 37.56  ? 284  SER B O   1 
ATOM   4604  C CB  . SER B 1 284 ? 38.282  11.236  91.434  1.00 34.00  ? 284  SER B CB  1 
ATOM   4605  O OG  . SER B 1 284 ? 36.916  11.064  91.095  1.00 41.85  ? 284  SER B OG  1 
ATOM   4606  N N   . LEU B 1 285 ? 38.145  10.229  88.264  1.00 32.70  ? 285  LEU B N   1 
ATOM   4607  C CA  . LEU B 1 285 ? 37.957  9.172   87.267  1.00 32.50  ? 285  LEU B CA  1 
ATOM   4608  C C   . LEU B 1 285 ? 39.228  9.040   86.420  1.00 40.23  ? 285  LEU B C   1 
ATOM   4609  O O   . LEU B 1 285 ? 39.676  7.917   86.172  1.00 40.77  ? 285  LEU B O   1 
ATOM   4610  C CB  . LEU B 1 285 ? 36.720  9.441   86.383  1.00 31.04  ? 285  LEU B CB  1 
ATOM   4611  C CG  . LEU B 1 285 ? 36.447  8.450   85.233  1.00 35.35  ? 285  LEU B CG  1 
ATOM   4612  C CD1 . LEU B 1 285 ? 36.061  7.059   85.750  1.00 35.38  ? 285  LEU B CD1 1 
ATOM   4613  C CD2 . LEU B 1 285 ? 35.376  8.991   84.294  1.00 34.17  ? 285  LEU B CD2 1 
ATOM   4614  N N   . MET B 1 286 ? 39.825  10.189  86.018  1.00 37.64  ? 286  MET B N   1 
ATOM   4615  C CA  . MET B 1 286 ? 41.053  10.223  85.230  1.00 38.75  ? 286  MET B CA  1 
ATOM   4616  C C   . MET B 1 286 ? 42.220  9.651   86.047  1.00 44.21  ? 286  MET B C   1 
ATOM   4617  O O   . MET B 1 286 ? 43.009  8.870   85.510  1.00 44.92  ? 286  MET B O   1 
ATOM   4618  C CB  . MET B 1 286 ? 41.367  11.650  84.737  1.00 41.70  ? 286  MET B CB  1 
ATOM   4619  C CG  . MET B 1 286 ? 40.322  12.234  83.785  1.00 44.45  ? 286  MET B CG  1 
ATOM   4620  S SD  . MET B 1 286 ? 40.017  11.268  82.284  1.00 48.43  ? 286  MET B SD  1 
ATOM   4621  C CE  . MET B 1 286 ? 38.364  10.698  82.592  1.00 43.16  ? 286  MET B CE  1 
ATOM   4622  N N   . ASP B 1 287 ? 42.282  9.985   87.356  1.00 40.17  ? 287  ASP B N   1 
ATOM   4623  C CA  . ASP B 1 287 ? 43.320  9.503   88.265  1.00 41.47  ? 287  ASP B CA  1 
ATOM   4624  C C   . ASP B 1 287 ? 43.213  7.994   88.500  1.00 44.06  ? 287  ASP B C   1 
ATOM   4625  O O   . ASP B 1 287 ? 44.237  7.324   88.633  1.00 44.07  ? 287  ASP B O   1 
ATOM   4626  C CB  . ASP B 1 287 ? 43.260  10.248  89.614  1.00 44.00  ? 287  ASP B CB  1 
ATOM   4627  C CG  . ASP B 1 287 ? 43.613  11.731  89.570  1.00 59.85  ? 287  ASP B CG  1 
ATOM   4628  O OD1 . ASP B 1 287 ? 44.360  12.145  88.646  1.00 62.32  ? 287  ASP B OD1 1 
ATOM   4629  O OD2 . ASP B 1 287 ? 43.148  12.480  90.464  1.00 66.34  ? 287  ASP B OD2 1 
ATOM   4630  N N   . LYS B 1 288 ? 41.979  7.466   88.540  1.00 39.32  ? 288  LYS B N   1 
ATOM   4631  C CA  . LYS B 1 288 ? 41.704  6.048   88.763  1.00 39.18  ? 288  LYS B CA  1 
ATOM   4632  C C   . LYS B 1 288 ? 42.054  5.201   87.528  1.00 43.20  ? 288  LYS B C   1 
ATOM   4633  O O   . LYS B 1 288 ? 42.648  4.132   87.677  1.00 43.89  ? 288  LYS B O   1 
ATOM   4634  C CB  . LYS B 1 288 ? 40.214  5.850   89.157  1.00 40.49  ? 288  LYS B CB  1 
ATOM   4635  C CG  . LYS B 1 288 ? 39.717  4.400   89.235  1.00 48.38  ? 288  LYS B CG  1 
ATOM   4636  C CD  . LYS B 1 288 ? 40.141  3.672   90.510  1.00 52.19  ? 288  LYS B CD  1 
ATOM   4637  C CE  . LYS B 1 288 ? 39.634  2.248   90.508  1.00 63.62  ? 288  LYS B CE  1 
ATOM   4638  N NZ  . LYS B 1 288 ? 39.894  1.567   91.808  1.00 77.45  ? 288  LYS B NZ  1 
ATOM   4639  N N   . CYS B 1 289 ? 41.685  5.674   86.328  1.00 39.08  ? 289  CYS B N   1 
ATOM   4640  C CA  . CYS B 1 289 ? 41.833  4.937   85.073  1.00 39.41  ? 289  CYS B CA  1 
ATOM   4641  C C   . CYS B 1 289 ? 43.189  5.098   84.424  1.00 45.78  ? 289  CYS B C   1 
ATOM   4642  O O   . CYS B 1 289 ? 43.621  4.180   83.722  1.00 46.36  ? 289  CYS B O   1 
ATOM   4643  C CB  . CYS B 1 289 ? 40.728  5.335   84.100  1.00 38.31  ? 289  CYS B CB  1 
ATOM   4644  S SG  . CYS B 1 289 ? 39.066  5.043   84.732  1.00 40.20  ? 289  CYS B SG  1 
ATOM   4645  N N   . PHE B 1 290 ? 43.832  6.259   84.593  1.00 43.09  ? 290  PHE B N   1 
ATOM   4646  C CA  . PHE B 1 290 ? 45.097  6.518   83.929  1.00 44.60  ? 290  PHE B CA  1 
ATOM   4647  C C   . PHE B 1 290 ? 46.248  6.752   84.916  1.00 52.62  ? 290  PHE B C   1 
ATOM   4648  O O   . PHE B 1 290 ? 46.043  7.371   85.969  1.00 52.00  ? 290  PHE B O   1 
ATOM   4649  C CB  . PHE B 1 290 ? 44.949  7.719   82.983  1.00 45.70  ? 290  PHE B CB  1 
ATOM   4650  C CG  . PHE B 1 290 ? 43.900  7.537   81.906  1.00 45.27  ? 290  PHE B CG  1 
ATOM   4651  C CD1 . PHE B 1 290 ? 44.211  6.896   80.711  1.00 47.50  ? 290  PHE B CD1 1 
ATOM   4652  C CD2 . PHE B 1 290 ? 42.603  8.010   82.085  1.00 44.86  ? 290  PHE B CD2 1 
ATOM   4653  C CE1 . PHE B 1 290 ? 43.247  6.736   79.717  1.00 46.66  ? 290  PHE B CE1 1 
ATOM   4654  C CE2 . PHE B 1 290 ? 41.635  7.836   81.094  1.00 46.20  ? 290  PHE B CE2 1 
ATOM   4655  C CZ  . PHE B 1 290 ? 41.961  7.194   79.920  1.00 44.66  ? 290  PHE B CZ  1 
ATOM   4656  N N   . PRO B 1 291 ? 47.474  6.262   84.598  1.00 53.38  ? 291  PRO B N   1 
ATOM   4657  C CA  . PRO B 1 291 ? 48.614  6.543   85.493  1.00 55.23  ? 291  PRO B CA  1 
ATOM   4658  C C   . PRO B 1 291 ? 48.951  8.039   85.439  1.00 60.19  ? 291  PRO B C   1 
ATOM   4659  O O   . PRO B 1 291 ? 48.661  8.699   84.432  1.00 59.47  ? 291  PRO B O   1 
ATOM   4660  C CB  . PRO B 1 291 ? 49.755  5.661   84.942  1.00 58.59  ? 291  PRO B CB  1 
ATOM   4661  C CG  . PRO B 1 291 ? 49.180  4.875   83.803  1.00 62.50  ? 291  PRO B CG  1 
ATOM   4662  C CD  . PRO B 1 291 ? 47.909  5.543   83.377  1.00 56.11  ? 291  PRO B CD  1 
ATOM   4663  N N   . ALA B 1 292 ? 49.529  8.582   86.521  1.00 57.07  ? 292  ALA B N   1 
ATOM   4664  C CA  . ALA B 1 292 ? 49.903  9.996   86.604  1.00 57.45  ? 292  ALA B CA  1 
ATOM   4665  C C   . ALA B 1 292 ? 50.647  10.473  85.332  1.00 63.80  ? 292  ALA B C   1 
ATOM   4666  O O   . ALA B 1 292 ? 51.540  9.781   84.821  1.00 64.54  ? 292  ALA B O   1 
ATOM   4667  C CB  . ALA B 1 292 ? 50.758  10.237  87.837  1.00 59.24  ? 292  ALA B CB  1 
ATOM   4668  N N   . ALA B 1 293 ? 50.212  11.636  84.799  1.00 60.35  ? 293  ALA B N   1 
ATOM   4669  C CA  . ALA B 1 293 ? 50.701  12.323  83.588  1.00 61.28  ? 293  ALA B CA  1 
ATOM   4670  C C   . ALA B 1 293 ? 50.346  11.583  82.280  1.00 65.50  ? 293  ALA B C   1 
ATOM   4671  O O   . ALA B 1 293 ? 50.702  12.063  81.199  1.00 65.93  ? 293  ALA B O   1 
ATOM   4672  C CB  . ALA B 1 293 ? 52.205  12.594  83.654  1.00 64.33  ? 293  ALA B CB  1 
ATOM   4673  N N   . ASN B 1 294 ? 49.614  10.459  82.360  1.00 61.44  ? 294  ASN B N   1 
ATOM   4674  C CA  . ASN B 1 294 ? 49.221  9.701   81.170  1.00 60.91  ? 294  ASN B CA  1 
ATOM   4675  C C   . ASN B 1 294 ? 47.749  9.907   80.813  1.00 62.11  ? 294  ASN B C   1 
ATOM   4676  O O   . ASN B 1 294 ? 47.295  9.308   79.835  1.00 62.45  ? 294  ASN B O   1 
ATOM   4677  C CB  . ASN B 1 294 ? 49.503  8.198   81.348  1.00 64.30  ? 294  ASN B CB  1 
ATOM   4678  C CG  . ASN B 1 294 ? 50.860  7.704   80.888  1.00 103.00 ? 294  ASN B CG  1 
ATOM   4679  O OD1 . ASN B 1 294 ? 51.802  8.465   80.619  1.00 102.83 ? 294  ASN B OD1 1 
ATOM   4680  N ND2 . ASN B 1 294 ? 50.990  6.390   80.795  1.00 97.95  ? 294  ASN B ND2 1 
ATOM   4681  N N   . ALA B 1 295 ? 47.000  10.757  81.561  1.00 56.14  ? 295  ALA B N   1 
ATOM   4682  C CA  . ALA B 1 295 ? 45.570  10.939  81.251  1.00 53.20  ? 295  ALA B CA  1 
ATOM   4683  C C   . ALA B 1 295 ? 45.355  11.847  80.036  1.00 55.24  ? 295  ALA B C   1 
ATOM   4684  O O   . ALA B 1 295 ? 45.861  12.972  80.025  1.00 56.00  ? 295  ALA B O   1 
ATOM   4685  C CB  . ALA B 1 295 ? 44.804  11.473  82.448  1.00 52.68  ? 295  ALA B CB  1 
ATOM   4686  N N   . PRO B 1 296 ? 44.643  11.371  78.987  1.00 49.98  ? 296  PRO B N   1 
ATOM   4687  C CA  . PRO B 1 296 ? 44.441  12.218  77.799  1.00 49.74  ? 296  PRO B CA  1 
ATOM   4688  C C   . PRO B 1 296 ? 43.409  13.297  78.095  1.00 51.41  ? 296  PRO B C   1 
ATOM   4689  O O   . PRO B 1 296 ? 42.287  12.987  78.480  1.00 49.28  ? 296  PRO B O   1 
ATOM   4690  C CB  . PRO B 1 296 ? 43.985  11.232  76.711  1.00 50.73  ? 296  PRO B CB  1 
ATOM   4691  C CG  . PRO B 1 296 ? 44.014  9.864   77.337  1.00 54.76  ? 296  PRO B CG  1 
ATOM   4692  C CD  . PRO B 1 296 ? 43.985  10.063  78.818  1.00 50.18  ? 296  PRO B CD  1 
ATOM   4693  N N   . GLY B 1 297 ? 43.837  14.550  77.969  1.00 48.64  ? 297  GLY B N   1 
ATOM   4694  C CA  . GLY B 1 297 ? 43.050  15.747  78.249  1.00 47.71  ? 297  GLY B CA  1 
ATOM   4695  C C   . GLY B 1 297 ? 41.720  15.848  77.529  1.00 50.29  ? 297  GLY B C   1 
ATOM   4696  O O   . GLY B 1 297 ? 40.754  16.362  78.099  1.00 49.39  ? 297  GLY B O   1 
ATOM   4697  N N   . GLU B 1 298 ? 41.652  15.349  76.283  1.00 46.15  ? 298  GLU B N   1 
ATOM   4698  C CA  . GLU B 1 298 ? 40.428  15.376  75.483  1.00 44.03  ? 298  GLU B CA  1 
ATOM   4699  C C   . GLU B 1 298 ? 39.332  14.479  76.091  1.00 45.75  ? 298  GLU B C   1 
ATOM   4700  O O   . GLU B 1 298 ? 38.156  14.818  75.974  1.00 44.09  ? 298  GLU B O   1 
ATOM   4701  C CB  . GLU B 1 298 ? 40.700  15.007  74.014  1.00 45.53  ? 298  GLU B CB  1 
ATOM   4702  C CG  . GLU B 1 298 ? 41.110  13.565  73.748  1.00 51.12  ? 298  GLU B CG  1 
ATOM   4703  C CD  . GLU B 1 298 ? 42.567  13.199  73.933  1.00 60.40  ? 298  GLU B CD  1 
ATOM   4704  O OE1 . GLU B 1 298 ? 43.347  14.033  74.450  1.00 53.87  ? 298  GLU B OE1 1 
ATOM   4705  O OE2 . GLU B 1 298 ? 42.928  12.062  73.552  1.00 47.26  ? 298  GLU B OE2 1 
ATOM   4706  N N   . ILE B 1 299 ? 39.714  13.373  76.765  1.00 42.51  ? 299  ILE B N   1 
ATOM   4707  C CA  . ILE B 1 299 ? 38.760  12.454  77.397  1.00 41.41  ? 299  ILE B CA  1 
ATOM   4708  C C   . ILE B 1 299 ? 38.045  13.189  78.547  1.00 44.45  ? 299  ILE B C   1 
ATOM   4709  O O   . ILE B 1 299 ? 36.818  13.161  78.609  1.00 43.77  ? 299  ILE B O   1 
ATOM   4710  C CB  . ILE B 1 299 ? 39.445  11.121  77.854  1.00 44.91  ? 299  ILE B CB  1 
ATOM   4711  C CG1 . ILE B 1 299 ? 40.079  10.346  76.665  1.00 46.15  ? 299  ILE B CG1 1 
ATOM   4712  C CG2 . ILE B 1 299 ? 38.508  10.220  78.682  1.00 44.51  ? 299  ILE B CG2 1 
ATOM   4713  C CD1 . ILE B 1 299 ? 39.136  9.946   75.484  1.00 51.62  ? 299  ILE B CD1 1 
ATOM   4714  N N   . ALA B 1 300 ? 38.805  13.894  79.396  1.00 40.73  ? 300  ALA B N   1 
ATOM   4715  C CA  . ALA B 1 300 ? 38.276  14.677  80.512  1.00 39.80  ? 300  ALA B CA  1 
ATOM   4716  C C   . ALA B 1 300 ? 37.388  15.816  79.998  1.00 43.64  ? 300  ALA B C   1 
ATOM   4717  O O   . ALA B 1 300 ? 36.288  15.994  80.506  1.00 42.40  ? 300  ALA B O   1 
ATOM   4718  C CB  . ALA B 1 300 ? 39.421  15.228  81.354  1.00 41.50  ? 300  ALA B CB  1 
ATOM   4719  N N   . LYS B 1 301 ? 37.845  16.548  78.960  1.00 41.86  ? 301  LYS B N   1 
ATOM   4720  C CA  . LYS B 1 301 ? 37.108  17.653  78.338  1.00 41.88  ? 301  LYS B CA  1 
ATOM   4721  C C   . LYS B 1 301 ? 35.783  17.147  77.737  1.00 44.39  ? 301  LYS B C   1 
ATOM   4722  O O   . LYS B 1 301 ? 34.744  17.793  77.921  1.00 42.05  ? 301  LYS B O   1 
ATOM   4723  C CB  . LYS B 1 301 ? 37.966  18.343  77.277  1.00 46.22  ? 301  LYS B CB  1 
ATOM   4724  N N   . TYR B 1 302 ? 35.819  15.965  77.070  1.00 40.85  ? 302  TYR B N   1 
ATOM   4725  C CA  . TYR B 1 302 ? 34.641  15.305  76.508  1.00 38.88  ? 302  TYR B CA  1 
ATOM   4726  C C   . TYR B 1 302 ? 33.626  14.975  77.626  1.00 43.74  ? 302  TYR B C   1 
ATOM   4727  O O   . TYR B 1 302 ? 32.439  15.276  77.468  1.00 41.99  ? 302  TYR B O   1 
ATOM   4728  C CB  . TYR B 1 302 ? 35.051  14.024  75.754  1.00 38.37  ? 302  TYR B CB  1 
ATOM   4729  C CG  . TYR B 1 302 ? 33.884  13.209  75.242  1.00 35.86  ? 302  TYR B CG  1 
ATOM   4730  C CD1 . TYR B 1 302 ? 33.238  12.283  76.062  1.00 35.47  ? 302  TYR B CD1 1 
ATOM   4731  C CD2 . TYR B 1 302 ? 33.417  13.369  73.947  1.00 35.87  ? 302  TYR B CD2 1 
ATOM   4732  C CE1 . TYR B 1 302 ? 32.155  11.544  75.604  1.00 33.06  ? 302  TYR B CE1 1 
ATOM   4733  C CE2 . TYR B 1 302 ? 32.329  12.639  73.478  1.00 35.09  ? 302  TYR B CE2 1 
ATOM   4734  C CZ  . TYR B 1 302 ? 31.701  11.730  74.311  1.00 37.95  ? 302  TYR B CZ  1 
ATOM   4735  O OH  . TYR B 1 302 ? 30.641  11.001  73.848  1.00 35.37  ? 302  TYR B OH  1 
ATOM   4736  N N   . MET B 1 303 ? 34.098  14.341  78.735  1.00 42.31  ? 303  MET B N   1 
ATOM   4737  C CA  . MET B 1 303 ? 33.255  13.945  79.869  1.00 42.36  ? 303  MET B CA  1 
ATOM   4738  C C   . MET B 1 303 ? 32.620  15.182  80.524  1.00 43.37  ? 303  MET B C   1 
ATOM   4739  O O   . MET B 1 303 ? 31.438  15.139  80.861  1.00 42.17  ? 303  MET B O   1 
ATOM   4740  C CB  . MET B 1 303 ? 34.037  13.114  80.915  1.00 46.42  ? 303  MET B CB  1 
ATOM   4741  C CG  . MET B 1 303 ? 34.565  11.767  80.421  1.00 52.68  ? 303  MET B CG  1 
ATOM   4742  S SD  . MET B 1 303 ? 33.298  10.626  79.817  1.00 59.24  ? 303  MET B SD  1 
ATOM   4743  C CE  . MET B 1 303 ? 33.093  9.610   81.271  1.00 56.10  ? 303  MET B CE  1 
ATOM   4744  N N   . GLU B 1 304 ? 33.393  16.288  80.658  1.00 38.48  ? 304  GLU B N   1 
ATOM   4745  C CA  . GLU B 1 304 ? 32.941  17.557  81.245  1.00 37.88  ? 304  GLU B CA  1 
ATOM   4746  C C   . GLU B 1 304 ? 31.862  18.223  80.393  1.00 40.35  ? 304  GLU B C   1 
ATOM   4747  O O   . GLU B 1 304 ? 30.952  18.842  80.942  1.00 40.12  ? 304  GLU B O   1 
ATOM   4748  C CB  . GLU B 1 304 ? 34.119  18.535  81.455  1.00 40.62  ? 304  GLU B CB  1 
ATOM   4749  C CG  . GLU B 1 304 ? 35.085  18.151  82.569  1.00 50.90  ? 304  GLU B CG  1 
ATOM   4750  C CD  . GLU B 1 304 ? 34.698  18.429  84.009  1.00 72.94  ? 304  GLU B CD  1 
ATOM   4751  O OE1 . GLU B 1 304 ? 33.532  18.812  84.257  1.00 53.94  ? 304  GLU B OE1 1 
ATOM   4752  O OE2 . GLU B 1 304 ? 35.566  18.245  84.896  1.00 74.91  ? 304  GLU B OE2 1 
ATOM   4753  N N   . THR B 1 305 ? 31.962  18.098  79.058  1.00 36.32  ? 305  THR B N   1 
ATOM   4754  C CA  . THR B 1 305 ? 30.997  18.684  78.126  1.00 35.18  ? 305  THR B CA  1 
ATOM   4755  C C   . THR B 1 305 ? 29.664  17.904  78.168  1.00 36.75  ? 305  THR B C   1 
ATOM   4756  O O   . THR B 1 305 ? 28.599  18.524  78.184  1.00 36.55  ? 305  THR B O   1 
ATOM   4757  C CB  . THR B 1 305 ? 31.593  18.753  76.710  1.00 41.21  ? 305  THR B CB  1 
ATOM   4758  O OG1 . THR B 1 305 ? 32.846  19.422  76.768  1.00 45.46  ? 305  THR B OG1 1 
ATOM   4759  C CG2 . THR B 1 305 ? 30.691  19.493  75.737  1.00 36.94  ? 305  THR B CG2 1 
ATOM   4760  N N   . VAL B 1 306 ? 29.730  16.558  78.195  1.00 31.99  ? 306  VAL B N   1 
ATOM   4761  C CA  . VAL B 1 306 ? 28.559  15.667  78.249  1.00 29.64  ? 306  VAL B CA  1 
ATOM   4762  C C   . VAL B 1 306 ? 27.853  15.868  79.604  1.00 34.21  ? 306  VAL B C   1 
ATOM   4763  O O   . VAL B 1 306 ? 26.624  15.842  79.658  1.00 33.97  ? 306  VAL B O   1 
ATOM   4764  C CB  . VAL B 1 306 ? 28.950  14.177  77.972  1.00 31.70  ? 306  VAL B CB  1 
ATOM   4765  C CG1 . VAL B 1 306 ? 27.784  13.214  78.222  1.00 30.26  ? 306  VAL B CG1 1 
ATOM   4766  C CG2 . VAL B 1 306 ? 29.481  14.010  76.552  1.00 31.13  ? 306  VAL B CG2 1 
ATOM   4767  N N   . LYS B 1 307 ? 28.634  16.124  80.681  1.00 31.60  ? 307  LYS B N   1 
ATOM   4768  C CA  . LYS B 1 307 ? 28.135  16.374  82.043  1.00 30.63  ? 307  LYS B CA  1 
ATOM   4769  C C   . LYS B 1 307 ? 27.214  17.606  82.070  1.00 36.56  ? 307  LYS B C   1 
ATOM   4770  O O   . LYS B 1 307 ? 26.234  17.629  82.819  1.00 35.80  ? 307  LYS B O   1 
ATOM   4771  C CB  . LYS B 1 307 ? 29.324  16.566  83.003  1.00 31.73  ? 307  LYS B CB  1 
ATOM   4772  C CG  . LYS B 1 307 ? 28.935  16.682  84.458  1.00 31.93  ? 307  LYS B CG  1 
ATOM   4773  C CD  . LYS B 1 307 ? 30.110  17.094  85.288  1.00 35.04  ? 307  LYS B CD  1 
ATOM   4774  C CE  . LYS B 1 307 ? 29.700  17.397  86.701  1.00 32.66  ? 307  LYS B CE  1 
ATOM   4775  N NZ  . LYS B 1 307 ? 30.893  17.565  87.560  1.00 39.75  ? 307  LYS B NZ  1 
ATOM   4776  N N   . LEU B 1 308 ? 27.520  18.612  81.228  1.00 35.04  ? 308  LEU B N   1 
ATOM   4777  C CA  . LEU B 1 308 ? 26.759  19.859  81.137  1.00 36.10  ? 308  LEU B CA  1 
ATOM   4778  C C   . LEU B 1 308 ? 25.416  19.705  80.409  1.00 40.15  ? 308  LEU B C   1 
ATOM   4779  O O   . LEU B 1 308 ? 24.589  20.614  80.472  1.00 40.51  ? 308  LEU B O   1 
ATOM   4780  C CB  . LEU B 1 308 ? 27.601  20.937  80.448  1.00 37.57  ? 308  LEU B CB  1 
ATOM   4781  C CG  . LEU B 1 308 ? 28.687  21.575  81.319  1.00 43.24  ? 308  LEU B CG  1 
ATOM   4782  C CD1 . LEU B 1 308 ? 29.650  22.364  80.476  1.00 44.95  ? 308  LEU B CD1 1 
ATOM   4783  C CD2 . LEU B 1 308 ? 28.092  22.428  82.427  1.00 43.89  ? 308  LEU B CD2 1 
ATOM   4784  N N   . LEU B 1 309 ? 25.194  18.567  79.735  1.00 35.83  ? 309  LEU B N   1 
ATOM   4785  C CA  . LEU B 1 309 ? 23.960  18.313  79.003  1.00 34.93  ? 309  LEU B CA  1 
ATOM   4786  C C   . LEU B 1 309 ? 22.785  17.986  79.908  1.00 39.03  ? 309  LEU B C   1 
ATOM   4787  O O   . LEU B 1 309 ? 22.895  17.171  80.830  1.00 38.14  ? 309  LEU B O   1 
ATOM   4788  C CB  . LEU B 1 309 ? 24.126  17.170  77.987  1.00 34.02  ? 309  LEU B CB  1 
ATOM   4789  C CG  . LEU B 1 309 ? 24.979  17.437  76.756  1.00 38.79  ? 309  LEU B CG  1 
ATOM   4790  C CD1 . LEU B 1 309 ? 25.254  16.144  76.013  1.00 37.71  ? 309  LEU B CD1 1 
ATOM   4791  C CD2 . LEU B 1 309 ? 24.326  18.467  75.834  1.00 40.61  ? 309  LEU B CD2 1 
ATOM   4792  N N   . ASP B 1 310 ? 21.642  18.611  79.604  1.00 36.16  ? 310  ASP B N   1 
ATOM   4793  C CA  . ASP B 1 310 ? 20.367  18.344  80.258  1.00 35.65  ? 310  ASP B CA  1 
ATOM   4794  C C   . ASP B 1 310 ? 19.735  17.152  79.544  1.00 37.15  ? 310  ASP B C   1 
ATOM   4795  O O   . ASP B 1 310 ? 20.163  16.814  78.434  1.00 35.56  ? 310  ASP B O   1 
ATOM   4796  C CB  . ASP B 1 310 ? 19.450  19.580  80.219  1.00 38.91  ? 310  ASP B CB  1 
ATOM   4797  C CG  . ASP B 1 310 ? 19.634  20.578  81.349  1.00 55.90  ? 310  ASP B CG  1 
ATOM   4798  O OD1 . ASP B 1 310 ? 20.380  20.265  82.312  1.00 58.76  ? 310  ASP B OD1 1 
ATOM   4799  O OD2 . ASP B 1 310 ? 19.011  21.657  81.289  1.00 62.70  ? 310  ASP B OD2 1 
ATOM   4800  N N   . TYR B 1 311 ? 18.735  16.507  80.176  1.00 32.47  ? 311  TYR B N   1 
ATOM   4801  C CA  . TYR B 1 311 ? 18.081  15.304  79.651  1.00 30.14  ? 311  TYR B CA  1 
ATOM   4802  C C   . TYR B 1 311 ? 17.509  15.501  78.239  1.00 34.65  ? 311  TYR B C   1 
ATOM   4803  O O   . TYR B 1 311 ? 17.698  14.622  77.400  1.00 34.68  ? 311  TYR B O   1 
ATOM   4804  C CB  . TYR B 1 311 ? 16.974  14.815  80.613  1.00 29.96  ? 311  TYR B CB  1 
ATOM   4805  C CG  . TYR B 1 311 ? 16.262  13.564  80.133  1.00 28.94  ? 311  TYR B CG  1 
ATOM   4806  C CD1 . TYR B 1 311 ? 16.893  12.322  80.162  1.00 29.17  ? 311  TYR B CD1 1 
ATOM   4807  C CD2 . TYR B 1 311 ? 14.952  13.622  79.651  1.00 29.43  ? 311  TYR B CD2 1 
ATOM   4808  C CE1 . TYR B 1 311 ? 16.245  11.170  79.712  1.00 28.63  ? 311  TYR B CE1 1 
ATOM   4809  C CE2 . TYR B 1 311 ? 14.301  12.478  79.185  1.00 28.98  ? 311  TYR B CE2 1 
ATOM   4810  C CZ  . TYR B 1 311 ? 14.947  11.254  79.233  1.00 32.73  ? 311  TYR B CZ  1 
ATOM   4811  O OH  . TYR B 1 311 ? 14.302  10.120  78.811  1.00 34.88  ? 311  TYR B OH  1 
ATOM   4812  N N   . THR B 1 312 ? 16.838  16.644  77.976  1.00 30.59  ? 312  THR B N   1 
ATOM   4813  C CA  . THR B 1 312 ? 16.197  16.924  76.685  1.00 30.09  ? 312  THR B CA  1 
ATOM   4814  C C   . THR B 1 312 ? 17.067  17.805  75.754  1.00 34.04  ? 312  THR B C   1 
ATOM   4815  O O   . THR B 1 312 ? 16.669  18.070  74.618  1.00 34.14  ? 312  THR B O   1 
ATOM   4816  C CB  . THR B 1 312 ? 14.818  17.593  76.897  1.00 34.63  ? 312  THR B CB  1 
ATOM   4817  O OG1 . THR B 1 312 ? 15.001  18.880  77.483  1.00 35.98  ? 312  THR B OG1 1 
ATOM   4818  C CG2 . THR B 1 312 ? 13.840  16.729  77.726  1.00 31.11  ? 312  THR B CG2 1 
ATOM   4819  N N   . GLU B 1 313 ? 18.245  18.236  76.225  1.00 30.30  ? 313  GLU B N   1 
ATOM   4820  C CA  . GLU B 1 313 ? 19.144  19.124  75.492  1.00 30.71  ? 313  GLU B CA  1 
ATOM   4821  C C   . GLU B 1 313 ? 19.764  18.501  74.243  1.00 33.22  ? 313  GLU B C   1 
ATOM   4822  O O   . GLU B 1 313 ? 20.269  17.379  74.285  1.00 32.32  ? 313  GLU B O   1 
ATOM   4823  C CB  . GLU B 1 313 ? 20.269  19.601  76.418  1.00 32.49  ? 313  GLU B CB  1 
ATOM   4824  C CG  . GLU B 1 313 ? 21.062  20.788  75.886  1.00 42.25  ? 313  GLU B CG  1 
ATOM   4825  C CD  . GLU B 1 313 ? 22.156  21.302  76.796  1.00 51.30  ? 313  GLU B CD  1 
ATOM   4826  O OE1 . GLU B 1 313 ? 22.121  20.984  78.005  1.00 38.93  ? 313  GLU B OE1 1 
ATOM   4827  O OE2 . GLU B 1 313 ? 23.030  22.052  76.307  1.00 49.68  ? 313  GLU B OE2 1 
ATOM   4828  N N   . LYS B 1 314 ? 19.780  19.280  73.150  1.00 29.57  ? 314  LYS B N   1 
ATOM   4829  C CA  . LYS B 1 314 ? 20.444  18.896  71.912  1.00 28.67  ? 314  LYS B CA  1 
ATOM   4830  C C   . LYS B 1 314 ? 21.959  19.127  72.065  1.00 33.35  ? 314  LYS B C   1 
ATOM   4831  O O   . LYS B 1 314 ? 22.384  20.258  72.316  1.00 32.45  ? 314  LYS B O   1 
ATOM   4832  C CB  . LYS B 1 314 ? 19.894  19.678  70.718  1.00 30.68  ? 314  LYS B CB  1 
ATOM   4833  C CG  . LYS B 1 314 ? 20.592  19.352  69.403  1.00 40.82  ? 314  LYS B CG  1 
ATOM   4834  C CD  . LYS B 1 314 ? 20.062  20.240  68.290  1.00 52.85  ? 314  LYS B CD  1 
ATOM   4835  C CE  . LYS B 1 314 ? 20.761  19.981  66.986  1.00 68.32  ? 314  LYS B CE  1 
ATOM   4836  N NZ  . LYS B 1 314 ? 20.083  20.672  65.852  1.00 80.50  ? 314  LYS B NZ  1 
ATOM   4837  N N   . PRO B 1 315 ? 22.783  18.072  71.929  1.00 31.44  ? 315  PRO B N   1 
ATOM   4838  C CA  . PRO B 1 315 ? 24.241  18.259  72.060  1.00 32.37  ? 315  PRO B CA  1 
ATOM   4839  C C   . PRO B 1 315 ? 24.845  19.107  70.947  1.00 39.36  ? 315  PRO B C   1 
ATOM   4840  O O   . PRO B 1 315 ? 24.323  19.141  69.836  1.00 38.02  ? 315  PRO B O   1 
ATOM   4841  C CB  . PRO B 1 315 ? 24.791  16.825  71.973  1.00 33.13  ? 315  PRO B CB  1 
ATOM   4842  C CG  . PRO B 1 315 ? 23.599  15.921  72.209  1.00 35.93  ? 315  PRO B CG  1 
ATOM   4843  C CD  . PRO B 1 315 ? 22.444  16.662  71.643  1.00 31.79  ? 315  PRO B CD  1 
ATOM   4844  N N   . LEU B 1 316 ? 25.954  19.790  71.258  1.00 40.19  ? 316  LEU B N   1 
ATOM   4845  C CA  . LEU B 1 316 ? 26.729  20.553  70.281  1.00 42.33  ? 316  LEU B CA  1 
ATOM   4846  C C   . LEU B 1 316 ? 27.821  19.610  69.781  1.00 45.73  ? 316  LEU B C   1 
ATOM   4847  O O   . LEU B 1 316 ? 28.941  19.604  70.287  1.00 46.04  ? 316  LEU B O   1 
ATOM   4848  C CB  . LEU B 1 316 ? 27.295  21.862  70.879  1.00 44.35  ? 316  LEU B CB  1 
ATOM   4849  C CG  . LEU B 1 316 ? 26.318  23.041  70.991  1.00 50.21  ? 316  LEU B CG  1 
ATOM   4850  C CD1 . LEU B 1 316 ? 26.894  24.131  71.847  1.00 51.52  ? 316  LEU B CD1 1 
ATOM   4851  C CD2 . LEU B 1 316 ? 25.976  23.614  69.619  1.00 53.99  ? 316  LEU B CD2 1 
ATOM   4852  N N   . TYR B 1 317 ? 27.437  18.742  68.838  1.00 41.73  ? 317  TYR B N   1 
ATOM   4853  C CA  . TYR B 1 317 ? 28.254  17.682  68.245  1.00 40.57  ? 317  TYR B CA  1 
ATOM   4854  C C   . TYR B 1 317 ? 29.578  18.186  67.648  1.00 46.51  ? 317  TYR B C   1 
ATOM   4855  O O   . TYR B 1 317 ? 30.595  17.498  67.780  1.00 45.84  ? 317  TYR B O   1 
ATOM   4856  C CB  . TYR B 1 317 ? 27.449  16.945  67.166  1.00 39.89  ? 317  TYR B CB  1 
ATOM   4857  C CG  . TYR B 1 317 ? 26.170  16.309  67.675  1.00 38.10  ? 317  TYR B CG  1 
ATOM   4858  C CD1 . TYR B 1 317 ? 26.191  15.082  68.326  1.00 38.66  ? 317  TYR B CD1 1 
ATOM   4859  C CD2 . TYR B 1 317 ? 24.937  16.936  67.502  1.00 38.55  ? 317  TYR B CD2 1 
ATOM   4860  C CE1 . TYR B 1 317 ? 25.017  14.491  68.801  1.00 37.62  ? 317  TYR B CE1 1 
ATOM   4861  C CE2 . TYR B 1 317 ? 23.755  16.353  67.967  1.00 38.01  ? 317  TYR B CE2 1 
ATOM   4862  C CZ  . TYR B 1 317 ? 23.800  15.127  68.611  1.00 40.53  ? 317  TYR B CZ  1 
ATOM   4863  O OH  . TYR B 1 317 ? 22.643  14.543  69.063  1.00 33.95  ? 317  TYR B OH  1 
ATOM   4864  N N   . GLU B 1 318 ? 29.569  19.377  67.009  1.00 44.73  ? 318  GLU B N   1 
ATOM   4865  C CA  . GLU B 1 318 ? 30.769  19.960  66.416  1.00 45.94  ? 318  GLU B CA  1 
ATOM   4866  C C   . GLU B 1 318 ? 31.814  20.294  67.488  1.00 49.18  ? 318  GLU B C   1 
ATOM   4867  O O   . GLU B 1 318 ? 33.008  20.087  67.262  1.00 49.04  ? 318  GLU B O   1 
ATOM   4868  C CB  . GLU B 1 318 ? 30.429  21.212  65.594  1.00 48.83  ? 318  GLU B CB  1 
ATOM   4869  C CG  . GLU B 1 318 ? 30.899  21.194  64.146  1.00 62.48  ? 318  GLU B CG  1 
ATOM   4870  C CD  . GLU B 1 318 ? 32.066  20.302  63.764  1.00 87.40  ? 318  GLU B CD  1 
ATOM   4871  O OE1 . GLU B 1 318 ? 31.838  19.313  63.032  1.00 74.61  ? 318  GLU B OE1 1 
ATOM   4872  O OE2 . GLU B 1 318 ? 33.213  20.615  64.159  1.00 89.55  ? 318  GLU B OE2 1 
ATOM   4873  N N   . ASN B 1 319 ? 31.355  20.786  68.651  1.00 45.37  ? 319  ASN B N   1 
ATOM   4874  C CA  . ASN B 1 319 ? 32.202  21.132  69.790  1.00 46.46  ? 319  ASN B CA  1 
ATOM   4875  C C   . ASN B 1 319 ? 32.863  19.864  70.356  1.00 49.56  ? 319  ASN B C   1 
ATOM   4876  O O   . ASN B 1 319 ? 34.046  19.904  70.702  1.00 51.58  ? 319  ASN B O   1 
ATOM   4877  C CB  . ASN B 1 319 ? 31.391  21.877  70.871  1.00 48.64  ? 319  ASN B CB  1 
ATOM   4878  C CG  . ASN B 1 319 ? 31.372  23.389  70.759  1.00 84.33  ? 319  ASN B CG  1 
ATOM   4879  O OD1 . ASN B 1 319 ? 31.371  23.977  69.664  1.00 78.41  ? 319  ASN B OD1 1 
ATOM   4880  N ND2 . ASN B 1 319 ? 31.296  24.050  71.900  1.00 82.58  ? 319  ASN B ND2 1 
ATOM   4881  N N   . LEU B 1 320 ? 32.118  18.738  70.403  1.00 42.74  ? 320  LEU B N   1 
ATOM   4882  C CA  . LEU B 1 320 ? 32.633  17.446  70.878  1.00 41.48  ? 320  LEU B CA  1 
ATOM   4883  C C   . LEU B 1 320 ? 33.691  16.899  69.912  1.00 47.69  ? 320  LEU B C   1 
ATOM   4884  O O   . LEU B 1 320 ? 34.681  16.307  70.355  1.00 48.23  ? 320  LEU B O   1 
ATOM   4885  C CB  . LEU B 1 320 ? 31.501  16.418  71.063  1.00 39.24  ? 320  LEU B CB  1 
ATOM   4886  C CG  . LEU B 1 320 ? 30.540  16.626  72.228  1.00 41.74  ? 320  LEU B CG  1 
ATOM   4887  C CD1 . LEU B 1 320 ? 29.317  15.770  72.069  1.00 39.50  ? 320  LEU B CD1 1 
ATOM   4888  C CD2 . LEU B 1 320 ? 31.196  16.317  73.542  1.00 43.51  ? 320  LEU B CD2 1 
ATOM   4889  N N   . ARG B 1 321 ? 33.483  17.112  68.597  1.00 44.17  ? 321  ARG B N   1 
ATOM   4890  C CA  . ARG B 1 321 ? 34.421  16.715  67.550  1.00 44.19  ? 321  ARG B CA  1 
ATOM   4891  C C   . ARG B 1 321 ? 35.726  17.501  67.668  1.00 48.92  ? 321  ARG B C   1 
ATOM   4892  O O   . ARG B 1 321 ? 36.787  16.895  67.561  1.00 49.73  ? 321  ARG B O   1 
ATOM   4893  C CB  . ARG B 1 321 ? 33.807  16.912  66.163  1.00 43.44  ? 321  ARG B CB  1 
ATOM   4894  C CG  . ARG B 1 321 ? 33.078  15.687  65.676  1.00 47.62  ? 321  ARG B CG  1 
ATOM   4895  C CD  . ARG B 1 321 ? 32.490  15.895  64.299  1.00 45.17  ? 321  ARG B CD  1 
ATOM   4896  N NE  . ARG B 1 321 ? 31.277  15.101  64.179  1.00 46.55  ? 321  ARG B NE  1 
ATOM   4897  C CZ  . ARG B 1 321 ? 30.043  15.588  64.115  1.00 57.52  ? 321  ARG B CZ  1 
ATOM   4898  N NH1 . ARG B 1 321 ? 29.841  16.898  64.078  1.00 31.56  ? 321  ARG B NH1 1 
ATOM   4899  N NH2 . ARG B 1 321 ? 29.006  14.772  64.043  1.00 56.34  ? 321  ARG B NH2 1 
ATOM   4900  N N   . ASP B 1 322 ? 35.651  18.830  67.927  1.00 45.33  ? 322  ASP B N   1 
ATOM   4901  C CA  . ASP B 1 322 ? 36.823  19.695  68.087  1.00 47.09  ? 322  ASP B CA  1 
ATOM   4902  C C   . ASP B 1 322 ? 37.682  19.245  69.275  1.00 50.84  ? 322  ASP B C   1 
ATOM   4903  O O   . ASP B 1 322 ? 38.916  19.298  69.196  1.00 52.78  ? 322  ASP B O   1 
ATOM   4904  C CB  . ASP B 1 322 ? 36.416  21.172  68.256  1.00 50.08  ? 322  ASP B CB  1 
ATOM   4905  C CG  . ASP B 1 322 ? 35.731  21.821  67.064  1.00 63.30  ? 322  ASP B CG  1 
ATOM   4906  O OD1 . ASP B 1 322 ? 36.019  21.417  65.911  1.00 63.83  ? 322  ASP B OD1 1 
ATOM   4907  O OD2 . ASP B 1 322 ? 34.937  22.763  67.278  1.00 72.53  ? 322  ASP B OD2 1 
ATOM   4908  N N   . ILE B 1 323 ? 37.025  18.793  70.364  1.00 44.03  ? 323  ILE B N   1 
ATOM   4909  C CA  . ILE B 1 323 ? 37.686  18.279  71.565  1.00 42.47  ? 323  ILE B CA  1 
ATOM   4910  C C   . ILE B 1 323 ? 38.541  17.060  71.174  1.00 46.97  ? 323  ILE B C   1 
ATOM   4911  O O   . ILE B 1 323 ? 39.723  17.021  71.516  1.00 48.53  ? 323  ILE B O   1 
ATOM   4912  C CB  . ILE B 1 323 ? 36.655  17.952  72.684  1.00 42.66  ? 323  ILE B CB  1 
ATOM   4913  C CG1 . ILE B 1 323 ? 36.078  19.248  73.304  1.00 42.32  ? 323  ILE B CG1 1 
ATOM   4914  C CG2 . ILE B 1 323 ? 37.268  17.036  73.755  1.00 42.66  ? 323  ILE B CG2 1 
ATOM   4915  C CD1 . ILE B 1 323 ? 34.820  19.072  74.136  1.00 44.55  ? 323  ILE B CD1 1 
ATOM   4916  N N   . LEU B 1 324 ? 37.958  16.107  70.416  1.00 41.71  ? 324  LEU B N   1 
ATOM   4917  C CA  . LEU B 1 324 ? 38.661  14.897  69.982  1.00 41.74  ? 324  LEU B CA  1 
ATOM   4918  C C   . LEU B 1 324 ? 39.747  15.210  68.945  1.00 49.84  ? 324  LEU B C   1 
ATOM   4919  O O   . LEU B 1 324 ? 40.801  14.568  68.971  1.00 51.41  ? 324  LEU B O   1 
ATOM   4920  C CB  . LEU B 1 324 ? 37.693  13.835  69.448  1.00 39.71  ? 324  LEU B CB  1 
ATOM   4921  C CG  . LEU B 1 324 ? 36.595  13.339  70.402  1.00 40.57  ? 324  LEU B CG  1 
ATOM   4922  C CD1 . LEU B 1 324 ? 35.707  12.354  69.719  1.00 38.93  ? 324  LEU B CD1 1 
ATOM   4923  C CD2 . LEU B 1 324 ? 37.164  12.702  71.642  1.00 41.39  ? 324  LEU B CD2 1 
ATOM   4924  N N   . LEU B 1 325 ? 39.515  16.219  68.075  1.00 47.40  ? 325  LEU B N   1 
ATOM   4925  C CA  . LEU B 1 325 ? 40.484  16.675  67.068  1.00 48.90  ? 325  LEU B CA  1 
ATOM   4926  C C   . LEU B 1 325 ? 41.717  17.302  67.736  1.00 55.73  ? 325  LEU B C   1 
ATOM   4927  O O   . LEU B 1 325 ? 42.825  17.163  67.210  1.00 56.95  ? 325  LEU B O   1 
ATOM   4928  C CB  . LEU B 1 325 ? 39.846  17.667  66.075  1.00 49.02  ? 325  LEU B CB  1 
ATOM   4929  C CG  . LEU B 1 325 ? 38.860  17.076  65.066  1.00 52.16  ? 325  LEU B CG  1 
ATOM   4930  C CD1 . LEU B 1 325 ? 38.044  18.157  64.387  1.00 52.55  ? 325  LEU B CD1 1 
ATOM   4931  C CD2 . LEU B 1 325 ? 39.562  16.240  64.037  1.00 54.68  ? 325  LEU B CD2 1 
ATOM   4932  N N   . GLN B 1 326 ? 41.530  17.959  68.910  1.00 52.85  ? 326  GLN B N   1 
ATOM   4933  C CA  . GLN B 1 326 ? 42.620  18.552  69.694  1.00 54.52  ? 326  GLN B CA  1 
ATOM   4934  C C   . GLN B 1 326 ? 43.534  17.435  70.231  1.00 59.28  ? 326  GLN B C   1 
ATOM   4935  O O   . GLN B 1 326 ? 44.752  17.622  70.317  1.00 61.31  ? 326  GLN B O   1 
ATOM   4936  C CB  . GLN B 1 326 ? 42.079  19.427  70.837  1.00 55.10  ? 326  GLN B CB  1 
ATOM   4937  N N   . GLY B 1 327 ? 42.931  16.275  70.522  1.00 53.29  ? 327  GLY B N   1 
ATOM   4938  C CA  . GLY B 1 327 ? 43.626  15.074  70.974  1.00 52.75  ? 327  GLY B CA  1 
ATOM   4939  C C   . GLY B 1 327 ? 44.532  14.494  69.903  1.00 57.96  ? 327  GLY B C   1 
ATOM   4940  O O   . GLY B 1 327 ? 45.636  14.035  70.212  1.00 58.96  ? 327  GLY B O   1 
ATOM   4941  N N   . LEU B 1 328 ? 44.080  14.516  68.629  1.00 54.18  ? 328  LEU B N   1 
ATOM   4942  C CA  . LEU B 1 328 ? 44.875  14.028  67.496  1.00 55.57  ? 328  LEU B CA  1 
ATOM   4943  C C   . LEU B 1 328 ? 46.043  14.973  67.215  1.00 63.10  ? 328  LEU B C   1 
ATOM   4944  O O   . LEU B 1 328 ? 47.131  14.515  66.865  1.00 64.11  ? 328  LEU B O   1 
ATOM   4945  C CB  . LEU B 1 328 ? 44.029  13.853  66.228  1.00 54.67  ? 328  LEU B CB  1 
ATOM   4946  C CG  . LEU B 1 328 ? 43.082  12.669  66.189  1.00 56.88  ? 328  LEU B CG  1 
ATOM   4947  C CD1 . LEU B 1 328 ? 41.989  12.908  65.184  1.00 55.80  ? 328  LEU B CD1 1 
ATOM   4948  C CD2 . LEU B 1 328 ? 43.817  11.373  65.887  1.00 58.84  ? 328  LEU B CD2 1 
ATOM   4949  N N   . LYS B 1 329 ? 45.815  16.293  67.375  1.00 60.74  ? 329  LYS B N   1 
ATOM   4950  C CA  . LYS B 1 329 ? 46.843  17.317  67.191  1.00 62.90  ? 329  LYS B CA  1 
ATOM   4951  C C   . LYS B 1 329 ? 47.921  17.153  68.266  1.00 68.25  ? 329  LYS B C   1 
ATOM   4952  O O   . LYS B 1 329 ? 49.106  17.301  67.967  1.00 70.97  ? 329  LYS B O   1 
ATOM   4953  C CB  . LYS B 1 329 ? 46.216  18.722  67.246  1.00 65.21  ? 329  LYS B CB  1 
ATOM   4954  C CG  . LYS B 1 329 ? 47.125  19.835  66.739  1.00 79.41  ? 329  LYS B CG  1 
ATOM   4955  C CD  . LYS B 1 329 ? 46.484  21.204  66.916  1.00 87.75  ? 329  LYS B CD  1 
ATOM   4956  N N   . ALA B 1 330 ? 47.503  16.808  69.503  1.00 62.54  ? 330  ALA B N   1 
ATOM   4957  C CA  . ALA B 1 330 ? 48.377  16.595  70.657  1.00 62.57  ? 330  ALA B CA  1 
ATOM   4958  C C   . ALA B 1 330 ? 49.349  15.420  70.444  1.00 66.91  ? 330  ALA B C   1 
ATOM   4959  O O   . ALA B 1 330 ? 50.492  15.496  70.902  1.00 68.84  ? 330  ALA B O   1 
ATOM   4960  C CB  . ALA B 1 330 ? 47.543  16.362  71.903  1.00 60.90  ? 330  ALA B CB  1 
ATOM   4961  N N   . ILE B 1 331 ? 48.907  14.359  69.734  1.00 61.36  ? 331  ILE B N   1 
ATOM   4962  C CA  . ILE B 1 331 ? 49.720  13.166  69.449  1.00 61.59  ? 331  ILE B CA  1 
ATOM   4963  C C   . ILE B 1 331 ? 50.457  13.291  68.081  1.00 68.69  ? 331  ILE B C   1 
ATOM   4964  O O   . ILE B 1 331 ? 51.051  12.317  67.604  1.00 69.30  ? 331  ILE B O   1 
ATOM   4965  C CB  . ILE B 1 331 ? 48.898  11.838  69.562  1.00 62.09  ? 331  ILE B CB  1 
ATOM   4966  C CG1 . ILE B 1 331 ? 47.714  11.766  68.561  1.00 60.64  ? 331  ILE B CG1 1 
ATOM   4967  C CG2 . ILE B 1 331 ? 48.438  11.606  71.005  1.00 60.63  ? 331  ILE B CG2 1 
ATOM   4968  C CD1 . ILE B 1 331 ? 47.291  10.364  68.131  1.00 64.10  ? 331  ILE B CD1 1 
ATOM   4969  N N   . GLY B 1 332 ? 50.434  14.490  67.497  1.00 66.62  ? 332  GLY B N   1 
ATOM   4970  C CA  . GLY B 1 332 ? 51.091  14.794  66.229  1.00 68.39  ? 332  GLY B CA  1 
ATOM   4971  C C   . GLY B 1 332 ? 50.418  14.226  64.995  1.00 71.63  ? 332  GLY B C   1 
ATOM   4972  O O   . GLY B 1 332 ? 51.034  14.164  63.925  1.00 73.40  ? 332  GLY B O   1 
ATOM   4973  N N   . SER B 1 333 ? 49.143  13.828  65.123  1.00 65.21  ? 333  SER B N   1 
ATOM   4974  C CA  . SER B 1 333 ? 48.351  13.267  64.028  1.00 63.75  ? 333  SER B CA  1 
ATOM   4975  C C   . SER B 1 333 ? 47.261  14.257  63.571  1.00 66.36  ? 333  SER B C   1 
ATOM   4976  O O   . SER B 1 333 ? 47.287  15.433  63.944  1.00 67.24  ? 333  SER B O   1 
ATOM   4977  C CB  . SER B 1 333 ? 47.733  11.940  64.460  1.00 64.36  ? 333  SER B CB  1 
ATOM   4978  O OG  . SER B 1 333 ? 47.155  11.260  63.359  1.00 69.35  ? 333  SER B OG  1 
ATOM   4979  N N   . LYS B 1 334 ? 46.333  13.779  62.733  1.00 60.81  ? 334  LYS B N   1 
ATOM   4980  C CA  . LYS B 1 334 ? 45.204  14.528  62.181  1.00 59.30  ? 334  LYS B CA  1 
ATOM   4981  C C   . LYS B 1 334 ? 44.080  13.555  61.842  1.00 60.66  ? 334  LYS B C   1 
ATOM   4982  O O   . LYS B 1 334 ? 44.297  12.338  61.867  1.00 59.95  ? 334  LYS B O   1 
ATOM   4983  C CB  . LYS B 1 334 ? 45.641  15.323  60.928  1.00 63.57  ? 334  LYS B CB  1 
ATOM   4984  N N   . ASP B 1 335 ? 42.879  14.073  61.538  1.00 55.55  ? 335  ASP B N   1 
ATOM   4985  C CA  . ASP B 1 335 ? 41.770  13.210  61.145  1.00 53.55  ? 335  ASP B CA  1 
ATOM   4986  C C   . ASP B 1 335 ? 41.956  12.816  59.678  1.00 60.41  ? 335  ASP B C   1 
ATOM   4987  O O   . ASP B 1 335 ? 41.508  13.526  58.770  1.00 60.56  ? 335  ASP B O   1 
ATOM   4988  C CB  . ASP B 1 335 ? 40.411  13.887  61.392  1.00 52.92  ? 335  ASP B CB  1 
ATOM   4989  C CG  . ASP B 1 335 ? 39.175  13.063  61.055  1.00 53.06  ? 335  ASP B CG  1 
ATOM   4990  O OD1 . ASP B 1 335 ? 39.322  11.854  60.742  1.00 51.19  ? 335  ASP B OD1 1 
ATOM   4991  O OD2 . ASP B 1 335 ? 38.060  13.624  61.110  1.00 56.15  ? 335  ASP B OD2 1 
ATOM   4992  N N   . ASP B 1 336 ? 42.669  11.700  59.461  1.00 58.41  ? 336  ASP B N   1 
ATOM   4993  C CA  . ASP B 1 336 ? 42.945  11.146  58.134  1.00 59.29  ? 336  ASP B CA  1 
ATOM   4994  C C   . ASP B 1 336 ? 42.033  9.934   57.870  1.00 61.28  ? 336  ASP B C   1 
ATOM   4995  O O   . ASP B 1 336 ? 42.166  9.275   56.839  1.00 61.54  ? 336  ASP B O   1 
ATOM   4996  C CB  . ASP B 1 336 ? 44.441  10.767  58.004  1.00 63.07  ? 336  ASP B CB  1 
ATOM   4997  C CG  . ASP B 1 336 ? 45.015  9.870   59.093  1.00 72.01  ? 336  ASP B CG  1 
ATOM   4998  O OD1 . ASP B 1 336 ? 44.229  9.377   59.948  1.00 70.23  ? 336  ASP B OD1 1 
ATOM   4999  O OD2 . ASP B 1 336 ? 46.251  9.666   59.100  1.00 77.97  ? 336  ASP B OD2 1 
ATOM   5000  N N   . GLY B 1 337 ? 41.142  9.652   58.823  1.00 55.94  ? 337  GLY B N   1 
ATOM   5001  C CA  . GLY B 1 337 ? 40.204  8.539   58.769  1.00 54.21  ? 337  GLY B CA  1 
ATOM   5002  C C   . GLY B 1 337 ? 40.850  7.172   58.889  1.00 59.73  ? 337  GLY B C   1 
ATOM   5003  O O   . GLY B 1 337 ? 40.228  6.174   58.525  1.00 59.43  ? 337  GLY B O   1 
ATOM   5004  N N   . LYS B 1 338 ? 42.106  7.108   59.385  1.00 57.41  ? 338  LYS B N   1 
ATOM   5005  C CA  . LYS B 1 338 ? 42.831  5.847   59.545  1.00 57.60  ? 338  LYS B CA  1 
ATOM   5006  C C   . LYS B 1 338 ? 42.588  5.296   60.949  1.00 59.61  ? 338  LYS B C   1 
ATOM   5007  O O   . LYS B 1 338 ? 42.967  5.932   61.927  1.00 58.82  ? 338  LYS B O   1 
ATOM   5008  C CB  . LYS B 1 338 ? 44.328  6.023   59.251  1.00 62.28  ? 338  LYS B CB  1 
ATOM   5009  C CG  . LYS B 1 338 ? 44.666  5.960   57.769  1.00 72.84  ? 338  LYS B CG  1 
ATOM   5010  N N   . LEU B 1 339 ? 41.917  4.134   61.038  1.00 54.64  ? 339  LEU B N   1 
ATOM   5011  C CA  . LEU B 1 339 ? 41.572  3.502   62.308  1.00 52.83  ? 339  LEU B CA  1 
ATOM   5012  C C   . LEU B 1 339 ? 42.755  2.789   62.967  1.00 59.14  ? 339  LEU B C   1 
ATOM   5013  O O   . LEU B 1 339 ? 42.716  2.604   64.185  1.00 58.11  ? 339  LEU B O   1 
ATOM   5014  C CB  . LEU B 1 339 ? 40.386  2.535   62.171  1.00 51.05  ? 339  LEU B CB  1 
ATOM   5015  C CG  . LEU B 1 339 ? 39.030  3.133   61.758  1.00 53.57  ? 339  LEU B CG  1 
ATOM   5016  C CD1 . LEU B 1 339 ? 37.958  2.078   61.772  1.00 52.39  ? 339  LEU B CD1 1 
ATOM   5017  C CD2 . LEU B 1 339 ? 38.598  4.284   62.661  1.00 54.10  ? 339  LEU B CD2 1 
ATOM   5018  N N   . ASP B 1 340 ? 43.793  2.401   62.191  1.00 58.35  ? 340  ASP B N   1 
ATOM   5019  C CA  . ASP B 1 340 ? 45.020  1.738   62.664  1.00 60.44  ? 340  ASP B CA  1 
ATOM   5020  C C   . ASP B 1 340 ? 44.725  0.446   63.465  1.00 63.56  ? 340  ASP B C   1 
ATOM   5021  O O   . ASP B 1 340 ? 45.320  0.209   64.524  1.00 63.83  ? 340  ASP B O   1 
ATOM   5022  C CB  . ASP B 1 340 ? 45.915  2.708   63.482  1.00 63.49  ? 340  ASP B CB  1 
ATOM   5023  C CG  . ASP B 1 340 ? 46.722  3.724   62.675  1.00 79.15  ? 340  ASP B CG  1 
ATOM   5024  O OD1 . ASP B 1 340 ? 46.525  3.805   61.434  1.00 80.05  ? 340  ASP B OD1 1 
ATOM   5025  O OD2 . ASP B 1 340 ? 47.550  4.435   63.281  1.00 88.23  ? 340  ASP B OD2 1 
ATOM   5026  N N   . LEU B 1 341 ? 43.867  -0.420  62.894  1.00 58.80  ? 341  LEU B N   1 
ATOM   5027  C CA  . LEU B 1 341 ? 43.477  -1.713  63.468  1.00 74.28  ? 341  LEU B CA  1 
ATOM   5028  C C   . LEU B 1 341 ? 44.213  -2.857  62.768  1.00 113.84 ? 341  LEU B C   1 
ATOM   5029  O O   . LEU B 1 341 ? 45.354  -3.162  63.108  1.00 85.48  ? 341  LEU B O   1 
ATOM   5030  C CB  . LEU B 1 341 ? 41.953  -1.928  63.356  1.00 71.84  ? 341  LEU B CB  1 
ATOM   5031  C CG  . LEU B 1 341 ? 41.044  -0.935  64.072  1.00 73.75  ? 341  LEU B CG  1 
ATOM   5032  C CD1 . LEU B 1 341 ? 39.687  -0.905  63.437  1.00 71.99  ? 341  LEU B CD1 1 
ATOM   5033  C CD2 . LEU B 1 341 ? 40.892  -1.287  65.512  1.00 75.70  ? 341  LEU B CD2 1 
ATOM   5034  N N   . GLN C 1 22  ? -10.882 -15.892 95.054  1.00 97.51  ? 22   GLN C N   1 
ATOM   5035  C CA  . GLN C 1 22  ? -9.660  -16.684 95.143  1.00 100.18 ? 22   GLN C CA  1 
ATOM   5036  C C   . GLN C 1 22  ? -9.189  -16.804 96.593  1.00 105.64 ? 22   GLN C C   1 
ATOM   5037  O O   . GLN C 1 22  ? -8.929  -17.924 97.035  1.00 108.75 ? 22   GLN C O   1 
ATOM   5038  C CB  . GLN C 1 22  ? -8.547  -16.091 94.263  1.00 101.07 ? 22   GLN C CB  1 
ATOM   5039  N N   . PHE C 1 23  ? -9.083  -15.662 97.330  1.00 99.65  ? 23   PHE C N   1 
ATOM   5040  C CA  . PHE C 1 23  ? -8.654  -15.591 98.740  1.00 100.13 ? 23   PHE C CA  1 
ATOM   5041  C C   . PHE C 1 23  ? -9.536  -16.490 99.601  1.00 104.39 ? 23   PHE C C   1 
ATOM   5042  O O   . PHE C 1 23  ? -10.760 -16.483 99.428  1.00 102.83 ? 23   PHE C O   1 
ATOM   5043  C CB  . PHE C 1 23  ? -8.690  -14.138 99.259  1.00 99.37  ? 23   PHE C CB  1 
ATOM   5044  C CG  . PHE C 1 23  ? -7.526  -13.227 98.914  1.00 100.37 ? 23   PHE C CG  1 
ATOM   5045  C CD1 . PHE C 1 23  ? -6.638  -13.554 97.891  1.00 105.04 ? 23   PHE C CD1 1 
ATOM   5046  C CD2 . PHE C 1 23  ? -7.339  -12.027 99.590  1.00 100.78 ? 23   PHE C CD2 1 
ATOM   5047  C CE1 . PHE C 1 23  ? -5.571  -12.707 97.570  1.00 105.40 ? 23   PHE C CE1 1 
ATOM   5048  C CE2 . PHE C 1 23  ? -6.274  -11.178 99.264  1.00 103.00 ? 23   PHE C CE2 1 
ATOM   5049  C CZ  . PHE C 1 23  ? -5.400  -11.522 98.255  1.00 102.44 ? 23   PHE C CZ  1 
ATOM   5050  N N   . ALA C 1 24  ? -8.918  -17.293 100.496 1.00 102.76 ? 24   ALA C N   1 
ATOM   5051  C CA  . ALA C 1 24  ? -9.661  -18.275 101.281 1.00 104.12 ? 24   ALA C CA  1 
ATOM   5052  C C   . ALA C 1 24  ? -10.473 -17.617 102.381 1.00 105.19 ? 24   ALA C C   1 
ATOM   5053  O O   . ALA C 1 24  ? -10.034 -16.618 102.955 1.00 102.78 ? 24   ALA C O   1 
ATOM   5054  C CB  . ALA C 1 24  ? -8.714  -19.312 101.870 1.00 108.52 ? 24   ALA C CB  1 
ATOM   5055  N N   . VAL C 1 25  ? -11.680 -18.156 102.649 1.00 102.13 ? 25   VAL C N   1 
ATOM   5056  C CA  . VAL C 1 25  ? -12.538 -17.639 103.712 1.00 100.69 ? 25   VAL C CA  1 
ATOM   5057  C C   . VAL C 1 25  ? -11.902 -18.063 105.036 1.00 106.20 ? 25   VAL C C   1 
ATOM   5058  O O   . VAL C 1 25  ? -11.809 -19.257 105.324 1.00 108.79 ? 25   VAL C O   1 
ATOM   5059  C CB  . VAL C 1 25  ? -14.012 -18.089 103.573 1.00 104.46 ? 25   VAL C CB  1 
ATOM   5060  N N   . GLY C 1 26  ? -11.380 -17.085 105.768 1.00 100.83 ? 26   GLY C N   1 
ATOM   5061  C CA  . GLY C 1 26  ? -10.672 -17.317 107.022 1.00 102.50 ? 26   GLY C CA  1 
ATOM   5062  C C   . GLY C 1 26  ? -9.185  -17.022 106.938 1.00 105.76 ? 26   GLY C C   1 
ATOM   5063  O O   . GLY C 1 26  ? -8.477  -17.144 107.942 1.00 107.64 ? 26   GLY C O   1 
ATOM   5064  N N   . GLU C 1 27  ? -8.697  -16.630 105.737 1.00 99.49  ? 27   GLU C N   1 
ATOM   5065  C CA  . GLU C 1 27  ? -7.291  -16.285 105.487 1.00 98.94  ? 27   GLU C CA  1 
ATOM   5066  C C   . GLU C 1 27  ? -6.909  -15.018 106.253 1.00 98.80  ? 27   GLU C C   1 
ATOM   5067  O O   . GLU C 1 27  ? -7.693  -14.067 106.300 1.00 95.45  ? 27   GLU C O   1 
ATOM   5068  C CB  . GLU C 1 27  ? -7.024  -16.107 103.973 1.00 98.92  ? 27   GLU C CB  1 
ATOM   5069  C CG  . GLU C 1 27  ? -5.563  -15.887 103.599 1.00 109.93 ? 27   GLU C CG  1 
ATOM   5070  C CD  . GLU C 1 27  ? -5.134  -16.310 102.207 1.00 130.73 ? 27   GLU C CD  1 
ATOM   5071  O OE1 . GLU C 1 27  ? -6.010  -16.521 101.336 1.00 125.27 ? 27   GLU C OE1 1 
ATOM   5072  O OE2 . GLU C 1 27  ? -3.909  -16.461 101.996 1.00 125.58 ? 27   GLU C OE2 1 
ATOM   5073  N N   . ILE C 1 28  ? -5.716  -15.024 106.872 1.00 95.48  ? 28   ILE C N   1 
ATOM   5074  C CA  . ILE C 1 28  ? -5.217  -13.882 107.625 1.00 93.40  ? 28   ILE C CA  1 
ATOM   5075  C C   . ILE C 1 28  ? -4.243  -13.074 106.751 1.00 93.84  ? 28   ILE C C   1 
ATOM   5076  O O   . ILE C 1 28  ? -3.264  -13.617 106.232 1.00 94.45  ? 28   ILE C O   1 
ATOM   5077  C CB  . ILE C 1 28  ? -4.577  -14.312 108.965 1.00 99.40  ? 28   ILE C CB  1 
ATOM   5078  N N   . ILE C 1 29  ? -4.552  -11.779 106.562 1.00 86.51  ? 29   ILE C N   1 
ATOM   5079  C CA  . ILE C 1 29  ? -3.733  -10.823 105.803 1.00 83.76  ? 29   ILE C CA  1 
ATOM   5080  C C   . ILE C 1 29  ? -3.212  -9.741  106.756 1.00 84.76  ? 29   ILE C C   1 
ATOM   5081  O O   . ILE C 1 29  ? -3.916  -9.369  107.699 1.00 83.56  ? 29   ILE C O   1 
ATOM   5082  C CB  . ILE C 1 29  ? -4.508  -10.216 104.606 1.00 83.61  ? 29   ILE C CB  1 
ATOM   5083  N N   . THR C 1 30  ? -1.970  -9.266  106.530 1.00 80.53  ? 30   THR C N   1 
ATOM   5084  C CA  . THR C 1 30  ? -1.312  -8.245  107.360 1.00 79.54  ? 30   THR C CA  1 
ATOM   5085  C C   . THR C 1 30  ? -1.051  -6.981  106.527 1.00 79.57  ? 30   THR C C   1 
ATOM   5086  O O   . THR C 1 30  ? -0.522  -7.072  105.425 1.00 77.92  ? 30   THR C O   1 
ATOM   5087  C CB  . THR C 1 30  ? -0.030  -8.815  107.979 1.00 88.34  ? 30   THR C CB  1 
ATOM   5088  N N   . ASP C 1 31  ? -1.443  -5.808  107.050 1.00 74.92  ? 31   ASP C N   1 
ATOM   5089  C CA  . ASP C 1 31  ? -1.288  -4.534  106.349 1.00 72.67  ? 31   ASP C CA  1 
ATOM   5090  C C   . ASP C 1 31  ? 0.094   -3.895  106.614 1.00 78.10  ? 31   ASP C C   1 
ATOM   5091  O O   . ASP C 1 31  ? 0.921   -4.494  107.301 1.00 80.54  ? 31   ASP C O   1 
ATOM   5092  C CB  . ASP C 1 31  ? -2.443  -3.561  106.709 1.00 72.06  ? 31   ASP C CB  1 
ATOM   5093  C CG  . ASP C 1 31  ? -2.578  -3.104  108.160 1.00 81.60  ? 31   ASP C CG  1 
ATOM   5094  O OD1 . ASP C 1 31  ? -1.548  -3.047  108.873 1.00 83.16  ? 31   ASP C OD1 1 
ATOM   5095  O OD2 . ASP C 1 31  ? -3.695  -2.723  108.555 1.00 84.83  ? 31   ASP C OD2 1 
ATOM   5096  N N   . MET C 1 32  ? 0.329   -2.676  106.069 1.00 73.16  ? 32   MET C N   1 
ATOM   5097  C CA  . MET C 1 32  ? 1.573   -1.899  106.194 1.00 73.97  ? 32   MET C CA  1 
ATOM   5098  C C   . MET C 1 32  ? 1.917   -1.555  107.655 1.00 81.28  ? 32   MET C C   1 
ATOM   5099  O O   . MET C 1 32  ? 3.097   -1.450  107.991 1.00 82.74  ? 32   MET C O   1 
ATOM   5100  C CB  . MET C 1 32  ? 1.503   -0.592  105.379 1.00 73.31  ? 32   MET C CB  1 
ATOM   5101  C CG  . MET C 1 32  ? 1.310   -0.770  103.881 1.00 75.45  ? 32   MET C CG  1 
ATOM   5102  S SD  . MET C 1 32  ? 2.738   -1.346  102.926 1.00 81.81  ? 32   MET C SD  1 
ATOM   5103  C CE  . MET C 1 32  ? 3.690   0.173   102.780 1.00 77.49  ? 32   MET C CE  1 
ATOM   5104  N N   . ALA C 1 33  ? 0.889   -1.375  108.508 1.00 78.33  ? 33   ALA C N   1 
ATOM   5105  C CA  . ALA C 1 33  ? 1.034   -1.052  109.931 1.00 79.94  ? 33   ALA C CA  1 
ATOM   5106  C C   . ALA C 1 33  ? 1.165   -2.321  110.801 1.00 88.45  ? 33   ALA C C   1 
ATOM   5107  O O   . ALA C 1 33  ? 1.136   -2.227  112.032 1.00 90.03  ? 33   ALA C O   1 
ATOM   5108  C CB  . ALA C 1 33  ? -0.158  -0.226  110.390 1.00 78.54  ? 33   ALA C CB  1 
ATOM   5109  N N   . ALA C 1 34  ? 1.326   -3.501  110.153 1.00 86.55  ? 34   ALA C N   1 
ATOM   5110  C CA  . ALA C 1 34  ? 1.461   -4.841  110.743 1.00 89.35  ? 34   ALA C CA  1 
ATOM   5111  C C   . ALA C 1 34  ? 0.173   -5.302  111.481 1.00 93.76  ? 34   ALA C C   1 
ATOM   5112  O O   . ALA C 1 34  ? 0.226   -6.245  112.274 1.00 96.48  ? 34   ALA C O   1 
ATOM   5113  C CB  . ALA C 1 34  ? 2.674   -4.911  111.668 1.00 93.08  ? 34   ALA C CB  1 
ATOM   5114  N N   . ALA C 1 35  ? -0.986  -4.682  111.162 1.00 87.54  ? 35   ALA C N   1 
ATOM   5115  C CA  . ALA C 1 35  ? -2.288  -5.054  111.723 1.00 86.86  ? 35   ALA C CA  1 
ATOM   5116  C C   . ALA C 1 35  ? -2.839  -6.268  110.970 1.00 90.49  ? 35   ALA C C   1 
ATOM   5117  O O   . ALA C 1 35  ? -2.833  -6.287  109.737 1.00 88.49  ? 35   ALA C O   1 
ATOM   5118  C CB  . ALA C 1 35  ? -3.265  -3.881  111.645 1.00 84.55  ? 35   ALA C CB  1 
ATOM   5119  N N   . ALA C 1 36  ? -3.275  -7.294  111.711 1.00 89.16  ? 36   ALA C N   1 
ATOM   5120  C CA  . ALA C 1 36  ? -3.814  -8.524  111.136 1.00 89.79  ? 36   ALA C CA  1 
ATOM   5121  C C   . ALA C 1 36  ? -5.335  -8.427  110.894 1.00 91.65  ? 36   ALA C C   1 
ATOM   5122  O O   . ALA C 1 36  ? -6.088  -7.907  111.726 1.00 90.84  ? 36   ALA C O   1 
ATOM   5123  C CB  . ALA C 1 36  ? -3.492  -9.706  112.034 1.00 94.22  ? 36   ALA C CB  1 
ATOM   5124  N N   . TRP C 1 37  ? -5.764  -8.910  109.725 1.00 87.17  ? 37   TRP C N   1 
ATOM   5125  C CA  . TRP C 1 37  ? -7.161  -8.921  109.290 1.00 84.98  ? 37   TRP C CA  1 
ATOM   5126  C C   . TRP C 1 37  ? -7.550  -10.305 108.814 1.00 90.14  ? 37   TRP C C   1 
ATOM   5127  O O   . TRP C 1 37  ? -6.733  -10.994 108.197 1.00 90.98  ? 37   TRP C O   1 
ATOM   5128  C CB  . TRP C 1 37  ? -7.395  -7.904  108.162 1.00 80.37  ? 37   TRP C CB  1 
ATOM   5129  C CG  . TRP C 1 37  ? -7.038  -6.494  108.519 1.00 79.78  ? 37   TRP C CG  1 
ATOM   5130  C CD1 . TRP C 1 37  ? -5.837  -5.879  108.334 1.00 82.58  ? 37   TRP C CD1 1 
ATOM   5131  C CD2 . TRP C 1 37  ? -7.906  -5.512  109.093 1.00 78.06  ? 37   TRP C CD2 1 
ATOM   5132  N NE1 . TRP C 1 37  ? -5.897  -4.578  108.776 1.00 80.40  ? 37   TRP C NE1 1 
ATOM   5133  C CE2 . TRP C 1 37  ? -7.156  -4.327  109.251 1.00 80.91  ? 37   TRP C CE2 1 
ATOM   5134  C CE3 . TRP C 1 37  ? -9.256  -5.513  109.481 1.00 78.75  ? 37   TRP C CE3 1 
ATOM   5135  C CZ2 . TRP C 1 37  ? -7.715  -3.146  109.760 1.00 78.60  ? 37   TRP C CZ2 1 
ATOM   5136  C CZ3 . TRP C 1 37  ? -9.805  -4.348  109.998 1.00 78.63  ? 37   TRP C CZ3 1 
ATOM   5137  C CH2 . TRP C 1 37  ? -9.043  -3.179  110.120 1.00 78.30  ? 37   TRP C CH2 1 
ATOM   5138  N N   . LYS C 1 38  ? -8.800  -10.703 109.081 1.00 86.36  ? 38   LYS C N   1 
ATOM   5139  C CA  . LYS C 1 38  ? -9.327  -11.992 108.650 1.00 87.26  ? 38   LYS C CA  1 
ATOM   5140  C C   . LYS C 1 38  ? -10.318 -11.770 107.516 1.00 86.96  ? 38   LYS C C   1 
ATOM   5141  O O   . LYS C 1 38  ? -11.195 -10.908 107.614 1.00 83.70  ? 38   LYS C O   1 
ATOM   5142  C CB  . LYS C 1 38  ? -9.972  -12.748 109.819 1.00 92.34  ? 38   LYS C CB  1 
ATOM   5143  N N   . VAL C 1 39  ? -10.149 -12.540 106.432 1.00 83.70  ? 39   VAL C N   1 
ATOM   5144  C CA  . VAL C 1 39  ? -10.960 -12.466 105.218 1.00 81.50  ? 39   VAL C CA  1 
ATOM   5145  C C   . VAL C 1 39  ? -12.203 -13.369 105.364 1.00 85.84  ? 39   VAL C C   1 
ATOM   5146  O O   . VAL C 1 39  ? -12.108 -14.484 105.875 1.00 88.02  ? 39   VAL C O   1 
ATOM   5147  C CB  . VAL C 1 39  ? -10.109 -12.833 103.960 1.00 85.65  ? 39   VAL C CB  1 
ATOM   5148  C CG1 . VAL C 1 39  ? -10.904 -12.681 102.667 1.00 83.59  ? 39   VAL C CG1 1 
ATOM   5149  C CG2 . VAL C 1 39  ? -8.839  -11.990 103.882 1.00 84.70  ? 39   VAL C CG2 1 
ATOM   5150  N N   . GLY C 1 40  ? -13.348 -12.851 104.927 1.00 79.81  ? 40   GLY C N   1 
ATOM   5151  C CA  . GLY C 1 40  ? -14.624 -13.555 104.912 1.00 79.68  ? 40   GLY C CA  1 
ATOM   5152  C C   . GLY C 1 40  ? -15.046 -13.931 103.501 1.00 82.06  ? 40   GLY C C   1 
ATOM   5153  O O   . GLY C 1 40  ? -14.201 -14.206 102.643 1.00 81.34  ? 40   GLY C O   1 
ATOM   5154  N N   . LEU C 1 41  ? -16.360 -13.931 103.248 1.00 78.17  ? 41   LEU C N   1 
ATOM   5155  C CA  . LEU C 1 41  ? -16.945 -14.296 101.956 1.00 77.51  ? 41   LEU C CA  1 
ATOM   5156  C C   . LEU C 1 41  ? -16.815 -13.194 100.893 1.00 78.35  ? 41   LEU C C   1 
ATOM   5157  O O   . LEU C 1 41  ? -16.938 -12.012 101.233 1.00 75.72  ? 41   LEU C O   1 
ATOM   5158  C CB  . LEU C 1 41  ? -18.439 -14.639 102.126 1.00 77.80  ? 41   LEU C CB  1 
ATOM   5159  C CG  . LEU C 1 41  ? -18.791 -15.937 102.852 1.00 85.14  ? 41   LEU C CG  1 
ATOM   5160  C CD1 . LEU C 1 41  ? -20.247 -15.947 103.248 1.00 85.21  ? 41   LEU C CD1 1 
ATOM   5161  C CD2 . LEU C 1 41  ? -18.456 -17.161 102.007 1.00 88.88  ? 41   LEU C CD2 1 
ATOM   5162  N N   . PRO C 1 42  ? -16.645 -13.563 99.591  1.00 75.03  ? 42   PRO C N   1 
ATOM   5163  C CA  . PRO C 1 42  ? -16.617 -12.533 98.532  1.00 72.54  ? 42   PRO C CA  1 
ATOM   5164  C C   . PRO C 1 42  ? -18.003 -11.925 98.331  1.00 75.56  ? 42   PRO C C   1 
ATOM   5165  O O   . PRO C 1 42  ? -19.001 -12.648 98.367  1.00 76.43  ? 42   PRO C O   1 
ATOM   5166  C CB  . PRO C 1 42  ? -16.153 -13.297 97.278  1.00 75.29  ? 42   PRO C CB  1 
ATOM   5167  C CG  . PRO C 1 42  ? -15.792 -14.673 97.741  1.00 82.64  ? 42   PRO C CG  1 
ATOM   5168  C CD  . PRO C 1 42  ? -16.518 -14.915 99.017  1.00 78.88  ? 42   PRO C CD  1 
ATOM   5169  N N   . ILE C 1 43  ? -18.067 -10.597 98.157  1.00 70.08  ? 43   ILE C N   1 
ATOM   5170  C CA  . ILE C 1 43  ? -19.332 -9.874  97.983  1.00 68.36  ? 43   ILE C CA  1 
ATOM   5171  C C   . ILE C 1 43  ? -19.289 -8.955  96.731  1.00 72.39  ? 43   ILE C C   1 
ATOM   5172  O O   . ILE C 1 43  ? -20.268 -8.263  96.446  1.00 70.92  ? 43   ILE C O   1 
ATOM   5173  C CB  . ILE C 1 43  ? -19.750 -9.101  99.277  1.00 69.91  ? 43   ILE C CB  1 
ATOM   5174  C CG1 . ILE C 1 43  ? -18.614 -8.206  99.820  1.00 68.73  ? 43   ILE C CG1 1 
ATOM   5175  C CG2 . ILE C 1 43  ? -20.280 -10.072 100.350 1.00 72.33  ? 43   ILE C CG2 1 
ATOM   5176  C CD1 . ILE C 1 43  ? -19.065 -7.061  100.675 1.00 70.17  ? 43   ILE C CD1 1 
ATOM   5177  N N   . GLY C 1 44  ? -18.196 -9.022  95.969  1.00 70.55  ? 44   GLY C N   1 
ATOM   5178  C CA  . GLY C 1 44  ? -18.011 -8.240  94.749  1.00 69.60  ? 44   GLY C CA  1 
ATOM   5179  C C   . GLY C 1 44  ? -16.857 -8.710  93.886  1.00 76.75  ? 44   GLY C C   1 
ATOM   5180  O O   . GLY C 1 44  ? -15.829 -9.139  94.412  1.00 77.48  ? 44   GLY C O   1 
ATOM   5181  N N   . GLN C 1 45  ? -17.024 -8.632  92.548  1.00 74.80  ? 45   GLN C N   1 
ATOM   5182  C CA  . GLN C 1 45  ? -16.023 -9.050  91.555  1.00 76.40  ? 45   GLN C CA  1 
ATOM   5183  C C   . GLN C 1 45  ? -16.114 -8.204  90.273  1.00 80.61  ? 45   GLN C C   1 
ATOM   5184  O O   . GLN C 1 45  ? -17.210 -7.801  89.874  1.00 79.59  ? 45   GLN C O   1 
ATOM   5185  C CB  . GLN C 1 45  ? -16.189 -10.541 91.212  1.00 80.30  ? 45   GLN C CB  1 
ATOM   5186  N N   . GLY C 1 46  ? -14.960 -7.963  89.644  1.00 77.77  ? 46   GLY C N   1 
ATOM   5187  C CA  . GLY C 1 46  ? -14.842 -7.179  88.418  1.00 76.52  ? 46   GLY C CA  1 
ATOM   5188  C C   . GLY C 1 46  ? -13.418 -6.757  88.113  1.00 80.36  ? 46   GLY C C   1 
ATOM   5189  O O   . GLY C 1 46  ? -13.189 -5.772  87.407  1.00 78.68  ? 46   GLY C O   1 
ATOM   5190  N N   . GLY C 1 49  ? -11.486 -4.783  91.098  1.00 63.70  ? 49   GLY C N   1 
ATOM   5191  C CA  . GLY C 1 49  ? -10.970 -6.142  91.232  1.00 66.10  ? 49   GLY C CA  1 
ATOM   5192  C C   . GLY C 1 49  ? -11.930 -7.109  91.905  1.00 71.12  ? 49   GLY C C   1 
ATOM   5193  O O   . GLY C 1 49  ? -12.869 -7.589  91.266  1.00 71.47  ? 49   GLY C O   1 
ATOM   5194  N N   . CYS C 1 50  ? -11.693 -7.419  93.201  1.00 67.67  ? 50   CYS C N   1 
ATOM   5195  C CA  . CYS C 1 50  ? -12.530 -8.330  93.992  1.00 68.18  ? 50   CYS C CA  1 
ATOM   5196  C C   . CYS C 1 50  ? -12.649 -7.838  95.441  1.00 69.64  ? 50   CYS C C   1 
ATOM   5197  O O   . CYS C 1 50  ? -11.648 -7.486  96.059  1.00 68.88  ? 50   CYS C O   1 
ATOM   5198  C CB  . CYS C 1 50  ? -12.001 -9.760  93.933  1.00 71.57  ? 50   CYS C CB  1 
ATOM   5199  S SG  . CYS C 1 50  ? -13.092 -10.988 94.701  1.00 77.28  ? 50   CYS C SG  1 
ATOM   5200  N N   . ILE C 1 51  ? -13.885 -7.819  95.970  1.00 64.75  ? 51   ILE C N   1 
ATOM   5201  C CA  . ILE C 1 51  ? -14.194 -7.353  97.325  1.00 63.38  ? 51   ILE C CA  1 
ATOM   5202  C C   . ILE C 1 51  ? -14.708 -8.533  98.174  1.00 69.94  ? 51   ILE C C   1 
ATOM   5203  O O   . ILE C 1 51  ? -15.571 -9.298  97.729  1.00 70.19  ? 51   ILE C O   1 
ATOM   5204  C CB  . ILE C 1 51  ? -15.194 -6.141  97.287  1.00 63.25  ? 51   ILE C CB  1 
ATOM   5205  C CG1 . ILE C 1 51  ? -14.561 -4.938  96.541  1.00 61.66  ? 51   ILE C CG1 1 
ATOM   5206  C CG2 . ILE C 1 51  ? -15.664 -5.713  98.694  1.00 62.57  ? 51   ILE C CG2 1 
ATOM   5207  C CD1 . ILE C 1 51  ? -15.509 -3.984  95.880  1.00 66.72  ? 51   ILE C CD1 1 
ATOM   5208  N N   . TYR C 1 52  ? -14.141 -8.683  99.385  1.00 67.80  ? 52   TYR C N   1 
ATOM   5209  C CA  . TYR C 1 52  ? -14.526 -9.702  100.373 1.00 69.89  ? 52   TYR C CA  1 
ATOM   5210  C C   . TYR C 1 52  ? -14.947 -9.032  101.661 1.00 72.63  ? 52   TYR C C   1 
ATOM   5211  O O   . TYR C 1 52  ? -14.520 -7.909  101.917 1.00 69.88  ? 52   TYR C O   1 
ATOM   5212  C CB  . TYR C 1 52  ? -13.359 -10.666 100.700 1.00 73.82  ? 52   TYR C CB  1 
ATOM   5213  C CG  . TYR C 1 52  ? -12.687 -11.336 99.527  1.00 76.90  ? 52   TYR C CG  1 
ATOM   5214  C CD1 . TYR C 1 52  ? -13.168 -12.535 99.017  1.00 81.08  ? 52   TYR C CD1 1 
ATOM   5215  C CD2 . TYR C 1 52  ? -11.499 -10.837 99.003  1.00 77.11  ? 52   TYR C CD2 1 
ATOM   5216  C CE1 . TYR C 1 52  ? -12.544 -13.168 97.944  1.00 83.77  ? 52   TYR C CE1 1 
ATOM   5217  C CE2 . TYR C 1 52  ? -10.861 -11.463 97.934  1.00 79.21  ? 52   TYR C CE2 1 
ATOM   5218  C CZ  . TYR C 1 52  ? -11.390 -12.629 97.405  1.00 89.22  ? 52   TYR C CZ  1 
ATOM   5219  O OH  . TYR C 1 52  ? -10.759 -13.261 96.363  1.00 92.27  ? 52   TYR C OH  1 
ATOM   5220  N N   . LEU C 1 53  ? -15.723 -9.734  102.505 1.00 71.14  ? 53   LEU C N   1 
ATOM   5221  C CA  . LEU C 1 53  ? -16.055 -9.241  103.840 1.00 71.01  ? 53   LEU C CA  1 
ATOM   5222  C C   . LEU C 1 53  ? -14.804 -9.395  104.697 1.00 76.97  ? 53   LEU C C   1 
ATOM   5223  O O   . LEU C 1 53  ? -13.996 -10.289 104.434 1.00 77.56  ? 53   LEU C O   1 
ATOM   5224  C CB  . LEU C 1 53  ? -17.243 -9.996  104.456 1.00 72.39  ? 53   LEU C CB  1 
ATOM   5225  C CG  . LEU C 1 53  ? -18.626 -9.732  103.871 1.00 75.74  ? 53   LEU C CG  1 
ATOM   5226  C CD1 . LEU C 1 53  ? -19.589 -10.808 104.307 1.00 78.09  ? 53   LEU C CD1 1 
ATOM   5227  C CD2 . LEU C 1 53  ? -19.158 -8.352  104.276 1.00 75.29  ? 53   LEU C CD2 1 
ATOM   5228  N N   . ALA C 1 54  ? -14.602 -8.498  105.667 1.00 74.21  ? 54   ALA C N   1 
ATOM   5229  C CA  . ALA C 1 54  ? -13.408 -8.541  106.505 1.00 75.95  ? 54   ALA C CA  1 
ATOM   5230  C C   . ALA C 1 54  ? -13.678 -8.010  107.901 1.00 80.94  ? 54   ALA C C   1 
ATOM   5231  O O   . ALA C 1 54  ? -14.677 -7.327  108.137 1.00 78.45  ? 54   ALA C O   1 
ATOM   5232  C CB  . ALA C 1 54  ? -12.281 -7.735  105.857 1.00 75.48  ? 54   ALA C CB  1 
ATOM   5233  N N   . ASP C 1 55  ? -12.767 -8.344  108.829 1.00 81.12  ? 55   ASP C N   1 
ATOM   5234  C CA  . ASP C 1 55  ? -12.775 -7.915  110.227 1.00 82.58  ? 55   ASP C CA  1 
ATOM   5235  C C   . ASP C 1 55  ? -11.385 -8.123  110.826 1.00 90.08  ? 55   ASP C C   1 
ATOM   5236  O O   . ASP C 1 55  ? -10.524 -8.746  110.194 1.00 90.44  ? 55   ASP C O   1 
ATOM   5237  C CB  . ASP C 1 55  ? -13.838 -8.696  111.039 1.00 86.19  ? 55   ASP C CB  1 
ATOM   5238  C CG  . ASP C 1 55  ? -14.351 -8.017  112.304 1.00 95.19  ? 55   ASP C CG  1 
ATOM   5239  O OD1 . ASP C 1 55  ? -13.802 -6.953  112.681 1.00 93.91  ? 55   ASP C OD1 1 
ATOM   5240  O OD2 . ASP C 1 55  ? -15.315 -8.536  112.903 1.00 102.88 ? 55   ASP C OD2 1 
ATOM   5241  N N   . MET C 1 56  ? -11.163 -7.593  112.044 1.00 88.68  ? 56   MET C N   1 
ATOM   5242  C CA  . MET C 1 56  ? -9.925  -7.776  112.801 1.00 91.12  ? 56   MET C CA  1 
ATOM   5243  C C   . MET C 1 56  ? -9.734  -9.263  113.060 1.00 99.16  ? 56   MET C C   1 
ATOM   5244  O O   . MET C 1 56  ? -10.724 -9.973  113.269 1.00 99.98  ? 56   MET C O   1 
ATOM   5245  C CB  . MET C 1 56  ? -9.976  -7.009  114.135 1.00 94.05  ? 56   MET C CB  1 
ATOM   5246  C CG  . MET C 1 56  ? -9.811  -5.520  114.000 1.00 95.14  ? 56   MET C CG  1 
ATOM   5247  N N   . ASN C 1 57  ? -8.480  -9.738  113.026 1.00 97.88  ? 57   ASN C N   1 
ATOM   5248  C CA  . ASN C 1 57  ? -8.133  -11.146 113.248 1.00 101.09 ? 57   ASN C CA  1 
ATOM   5249  C C   . ASN C 1 57  ? -8.517  -11.597 114.665 1.00 108.10 ? 57   ASN C C   1 
ATOM   5250  O O   . ASN C 1 57  ? -8.163  -10.936 115.644 1.00 108.35 ? 57   ASN C O   1 
ATOM   5251  C CB  . ASN C 1 57  ? -6.640  -11.366 113.001 1.00 102.41 ? 57   ASN C CB  1 
ATOM   5252  C CG  . ASN C 1 57  ? -6.163  -12.787 113.154 1.00 124.12 ? 57   ASN C CG  1 
ATOM   5253  O OD1 . ASN C 1 57  ? -6.721  -13.732 112.584 1.00 115.64 ? 57   ASN C OD1 1 
ATOM   5254  N ND2 . ASN C 1 57  ? -5.087  -12.959 113.903 1.00 119.70 ? 57   ASN C ND2 1 
ATOM   5255  N N   . SER C 1 58  ? -9.273  -12.705 114.754 1.00 106.51 ? 58   SER C N   1 
ATOM   5256  C CA  . SER C 1 58  ? -9.749  -13.295 116.007 1.00 109.17 ? 58   SER C CA  1 
ATOM   5257  C C   . SER C 1 58  ? -10.032 -14.791 115.830 1.00 116.13 ? 58   SER C C   1 
ATOM   5258  O O   . SER C 1 58  ? -9.916  -15.312 114.716 1.00 115.05 ? 58   SER C O   1 
ATOM   5259  C CB  . SER C 1 58  ? -11.003 -12.575 116.503 1.00 110.92 ? 58   SER C CB  1 
ATOM   5260  N N   . SER C 1 59  ? -10.402 -15.476 116.937 1.00 116.20 ? 59   SER C N   1 
ATOM   5261  C CA  . SER C 1 59  ? -10.746 -16.901 116.962 1.00 119.22 ? 59   SER C CA  1 
ATOM   5262  C C   . SER C 1 59  ? -12.041 -17.165 116.183 1.00 121.98 ? 59   SER C C   1 
ATOM   5263  O O   . SER C 1 59  ? -12.188 -18.237 115.592 1.00 123.17 ? 59   SER C O   1 
ATOM   5264  C CB  . SER C 1 59  ? -10.891 -17.392 118.400 1.00 126.12 ? 59   SER C CB  1 
ATOM   5265  N N   . GLU C 1 60  ? -12.966 -16.179 116.179 1.00 115.50 ? 60   GLU C N   1 
ATOM   5266  C CA  . GLU C 1 60  ? -14.252 -16.239 115.484 1.00 113.25 ? 60   GLU C CA  1 
ATOM   5267  C C   . GLU C 1 60  ? -14.083 -15.973 113.988 1.00 114.12 ? 60   GLU C C   1 
ATOM   5268  O O   . GLU C 1 60  ? -13.226 -15.188 113.586 1.00 111.98 ? 60   GLU C O   1 
ATOM   5269  C CB  . GLU C 1 60  ? -15.235 -15.231 116.095 1.00 112.86 ? 60   GLU C CB  1 
ATOM   5270  N N   . SER C 1 64  ? -23.738 -12.449 107.607 1.00 87.76  ? 64   SER C N   1 
ATOM   5271  C CA  . SER C 1 64  ? -22.578 -11.591 107.383 1.00 85.76  ? 64   SER C CA  1 
ATOM   5272  C C   . SER C 1 64  ? -22.228 -10.790 108.662 1.00 89.35  ? 64   SER C C   1 
ATOM   5273  O O   . SER C 1 64  ? -21.520 -11.312 109.529 1.00 90.90  ? 64   SER C O   1 
ATOM   5274  C CB  . SER C 1 64  ? -22.831 -10.663 106.197 1.00 86.27  ? 64   SER C CB  1 
ATOM   5275  N N   . ASP C 1 65  ? -22.725 -9.525  108.758 1.00 83.29  ? 65   ASP C N   1 
ATOM   5276  C CA  . ASP C 1 65  ? -22.591 -8.527  109.840 1.00 82.33  ? 65   ASP C CA  1 
ATOM   5277  C C   . ASP C 1 65  ? -21.164 -7.914  109.980 1.00 84.13  ? 65   ASP C C   1 
ATOM   5278  O O   . ASP C 1 65  ? -21.019 -6.960  110.749 1.00 83.46  ? 65   ASP C O   1 
ATOM   5279  C CB  . ASP C 1 65  ? -23.094 -9.051  111.197 1.00 86.68  ? 65   ASP C CB  1 
ATOM   5280  N N   . ALA C 1 66  ? -20.145 -8.409  109.207 1.00 78.91  ? 66   ALA C N   1 
ATOM   5281  C CA  . ALA C 1 66  ? -18.748 -7.918  109.198 1.00 77.10  ? 66   ALA C CA  1 
ATOM   5282  C C   . ALA C 1 66  ? -18.694 -6.378  109.031 1.00 76.16  ? 66   ALA C C   1 
ATOM   5283  O O   . ALA C 1 66  ? -19.439 -5.825  108.206 1.00 74.35  ? 66   ALA C O   1 
ATOM   5284  C CB  . ALA C 1 66  ? -17.960 -8.594  108.087 1.00 77.76  ? 66   ALA C CB  1 
ATOM   5285  N N   . PRO C 1 67  ? -17.877 -5.663  109.842 1.00 70.36  ? 67   PRO C N   1 
ATOM   5286  C CA  . PRO C 1 67  ? -17.866 -4.189  109.750 1.00 67.21  ? 67   PRO C CA  1 
ATOM   5287  C C   . PRO C 1 67  ? -16.954 -3.622  108.658 1.00 66.43  ? 67   PRO C C   1 
ATOM   5288  O O   . PRO C 1 67  ? -17.025 -2.423  108.369 1.00 63.64  ? 67   PRO C O   1 
ATOM   5289  C CB  . PRO C 1 67  ? -17.384 -3.757  111.135 1.00 70.45  ? 67   PRO C CB  1 
ATOM   5290  C CG  . PRO C 1 67  ? -16.536 -4.890  111.611 1.00 77.37  ? 67   PRO C CG  1 
ATOM   5291  C CD  . PRO C 1 67  ? -16.966 -6.150  110.900 1.00 73.76  ? 67   PRO C CD  1 
ATOM   5292  N N   . CYS C 1 68  ? -16.098 -4.478  108.063 1.00 62.27  ? 68   CYS C N   1 
ATOM   5293  C CA  . CYS C 1 68  ? -15.138 -4.074  107.043 1.00 60.35  ? 68   CYS C CA  1 
ATOM   5294  C C   . CYS C 1 68  ? -15.268 -4.901  105.781 1.00 62.38  ? 68   CYS C C   1 
ATOM   5295  O O   . CYS C 1 68  ? -15.921 -5.950  105.759 1.00 62.91  ? 68   CYS C O   1 
ATOM   5296  C CB  . CYS C 1 68  ? -13.712 -4.150  107.588 1.00 62.01  ? 68   CYS C CB  1 
ATOM   5297  S SG  . CYS C 1 68  ? -13.334 -2.933  108.875 1.00 65.72  ? 68   CYS C SG  1 
ATOM   5298  N N   . VAL C 1 69  ? -14.573 -4.437  104.742 1.00 56.71  ? 69   VAL C N   1 
ATOM   5299  C CA  . VAL C 1 69  ? -14.448 -5.076  103.438 1.00 56.19  ? 69   VAL C CA  1 
ATOM   5300  C C   . VAL C 1 69  ? -12.975 -5.014  103.022 1.00 60.46  ? 69   VAL C C   1 
ATOM   5301  O O   . VAL C 1 69  ? -12.245 -4.137  103.489 1.00 59.87  ? 69   VAL C O   1 
ATOM   5302  C CB  . VAL C 1 69  ? -15.387 -4.474  102.347 1.00 57.54  ? 69   VAL C CB  1 
ATOM   5303  C CG1 . VAL C 1 69  ? -16.847 -4.812  102.616 1.00 57.38  ? 69   VAL C CG1 1 
ATOM   5304  C CG2 . VAL C 1 69  ? -15.191 -2.968  102.191 1.00 55.14  ? 69   VAL C CG2 1 
ATOM   5305  N N   . VAL C 1 70  ? -12.538 -5.936  102.159 1.00 57.93  ? 70   VAL C N   1 
ATOM   5306  C CA  . VAL C 1 70  ? -11.173 -5.928  101.642 1.00 58.17  ? 70   VAL C CA  1 
ATOM   5307  C C   . VAL C 1 70  ? -11.269 -5.838  100.097 1.00 61.87  ? 70   VAL C C   1 
ATOM   5308  O O   . VAL C 1 70  ? -11.812 -6.742  99.444  1.00 61.88  ? 70   VAL C O   1 
ATOM   5309  C CB  . VAL C 1 70  ? -10.272 -7.089  102.177 1.00 64.62  ? 70   VAL C CB  1 
ATOM   5310  C CG1 . VAL C 1 70  ? -10.906 -8.468  101.995 1.00 66.09  ? 70   VAL C CG1 1 
ATOM   5311  C CG2 . VAL C 1 70  ? -8.862  -7.041  101.590 1.00 64.80  ? 70   VAL C CG2 1 
ATOM   5312  N N   . LYS C 1 71  ? -10.819 -4.687  99.544  1.00 56.83  ? 71   LYS C N   1 
ATOM   5313  C CA  . LYS C 1 71  ? -10.807 -4.405  98.104  1.00 55.27  ? 71   LYS C CA  1 
ATOM   5314  C C   . LYS C 1 71  ? -9.474  -4.886  97.511  1.00 60.97  ? 71   LYS C C   1 
ATOM   5315  O O   . LYS C 1 71  ? -8.466  -4.184  97.609  1.00 60.50  ? 71   LYS C O   1 
ATOM   5316  C CB  . LYS C 1 71  ? -11.026 -2.905  97.814  1.00 54.70  ? 71   LYS C CB  1 
ATOM   5317  C CG  . LYS C 1 71  ? -12.380 -2.340  98.214  1.00 58.22  ? 71   LYS C CG  1 
ATOM   5318  C CD  . LYS C 1 71  ? -12.441 -0.843  97.946  1.00 58.94  ? 71   LYS C CD  1 
ATOM   5319  N N   . VAL C 1 72  ? -9.477  -6.087  96.908  1.00 59.08  ? 72   VAL C N   1 
ATOM   5320  C CA  . VAL C 1 72  ? -8.308  -6.729  96.299  1.00 60.65  ? 72   VAL C CA  1 
ATOM   5321  C C   . VAL C 1 72  ? -8.245  -6.409  94.781  1.00 64.17  ? 72   VAL C C   1 
ATOM   5322  O O   . VAL C 1 72  ? -9.267  -6.468  94.099  1.00 62.58  ? 72   VAL C O   1 
ATOM   5323  C CB  . VAL C 1 72  ? -8.332  -8.261  96.564  1.00 67.22  ? 72   VAL C CB  1 
ATOM   5324  C CG1 . VAL C 1 72  ? -7.042  -8.929  96.101  1.00 69.39  ? 72   VAL C CG1 1 
ATOM   5325  C CG2 . VAL C 1 72  ? -8.582  -8.562  98.041  1.00 67.87  ? 72   VAL C CG2 1 
ATOM   5326  N N   . GLU C 1 73  ? -7.037  -6.081  94.265  1.00 62.02  ? 73   GLU C N   1 
ATOM   5327  C CA  . GLU C 1 73  ? -6.789  -5.786  92.846  1.00 61.51  ? 73   GLU C CA  1 
ATOM   5328  C C   . GLU C 1 73  ? -5.625  -6.636  92.314  1.00 68.01  ? 73   GLU C C   1 
ATOM   5329  O O   . GLU C 1 73  ? -5.738  -7.278  91.268  1.00 68.45  ? 73   GLU C O   1 
ATOM   5330  C CB  . GLU C 1 73  ? -6.499  -4.294  92.639  1.00 60.75  ? 73   GLU C CB  1 
ATOM   5331  N N   . LEU C 1 80  ? -5.773  1.965   92.184  1.00 82.93  ? 80   LEU C N   1 
ATOM   5332  C CA  . LEU C 1 80  ? -5.664  1.703   93.616  1.00 83.02  ? 80   LEU C CA  1 
ATOM   5333  C C   . LEU C 1 80  ? -4.685  2.678   94.288  1.00 84.93  ? 80   LEU C C   1 
ATOM   5334  O O   . LEU C 1 80  ? -4.923  3.077   95.428  1.00 84.27  ? 80   LEU C O   1 
ATOM   5335  C CB  . LEU C 1 80  ? -5.248  0.251   93.874  1.00 85.37  ? 80   LEU C CB  1 
ATOM   5336  N N   . PHE C 1 81  ? -3.601  3.074   93.577  1.00 79.64  ? 81   PHE C N   1 
ATOM   5337  C CA  . PHE C 1 81  ? -2.602  4.039   94.066  1.00 77.93  ? 81   PHE C CA  1 
ATOM   5338  C C   . PHE C 1 81  ? -3.229  5.443   94.216  1.00 74.70  ? 81   PHE C C   1 
ATOM   5339  O O   . PHE C 1 81  ? -2.987  6.135   95.211  1.00 73.62  ? 81   PHE C O   1 
ATOM   5340  C CB  . PHE C 1 81  ? -1.392  4.096   93.116  1.00 80.97  ? 81   PHE C CB  1 
ATOM   5341  C CG  . PHE C 1 81  ? -0.127  4.562   93.783  1.00 83.80  ? 81   PHE C CG  1 
ATOM   5342  C CD1 . PHE C 1 81  ? 0.841   3.651   94.179  1.00 89.08  ? 81   PHE C CD1 1 
ATOM   5343  C CD2 . PHE C 1 81  ? 0.102   5.915   94.013  1.00 85.65  ? 81   PHE C CD2 1 
ATOM   5344  C CE1 . PHE C 1 81  ? 2.022   4.080   94.782  1.00 91.49  ? 81   PHE C CE1 1 
ATOM   5345  C CE2 . PHE C 1 81  ? 1.270   6.343   94.645  1.00 89.92  ? 81   PHE C CE2 1 
ATOM   5346  C CZ  . PHE C 1 81  ? 2.229   5.423   95.017  1.00 90.09  ? 81   PHE C CZ  1 
ATOM   5347  N N   . THR C 1 82  ? -4.047  5.845   93.220  1.00 66.14  ? 82   THR C N   1 
ATOM   5348  C CA  . THR C 1 82  ? -4.777  7.116   93.184  1.00 62.37  ? 82   THR C CA  1 
ATOM   5349  C C   . THR C 1 82  ? -5.789  7.156   94.346  1.00 61.23  ? 82   THR C C   1 
ATOM   5350  O O   . THR C 1 82  ? -5.872  8.162   95.058  1.00 59.79  ? 82   THR C O   1 
ATOM   5351  C CB  . THR C 1 82  ? -5.466  7.277   91.804  1.00 69.21  ? 82   THR C CB  1 
ATOM   5352  O OG1 . THR C 1 82  ? -4.486  7.257   90.768  1.00 71.08  ? 82   THR C OG1 1 
ATOM   5353  C CG2 . THR C 1 82  ? -6.271  8.548   91.690  1.00 64.82  ? 82   THR C CG2 1 
ATOM   5354  N N   . GLU C 1 83  ? -6.542  6.049   94.527  1.00 55.43  ? 83   GLU C N   1 
ATOM   5355  C CA  . GLU C 1 83  ? -7.553  5.882   95.571  1.00 52.88  ? 83   GLU C CA  1 
ATOM   5356  C C   . GLU C 1 83  ? -6.920  5.888   96.961  1.00 54.02  ? 83   GLU C C   1 
ATOM   5357  O O   . GLU C 1 83  ? -7.450  6.544   97.855  1.00 52.73  ? 83   GLU C O   1 
ATOM   5358  C CB  . GLU C 1 83  ? -8.352  4.595   95.352  1.00 54.52  ? 83   GLU C CB  1 
ATOM   5359  C CG  . GLU C 1 83  ? -9.590  4.513   96.221  1.00 63.28  ? 83   GLU C CG  1 
ATOM   5360  C CD  . GLU C 1 83  ? -10.587 3.449   95.822  1.00 75.68  ? 83   GLU C CD  1 
ATOM   5361  O OE1 . GLU C 1 83  ? -10.180 2.291   95.577  1.00 61.62  ? 83   GLU C OE1 1 
ATOM   5362  O OE2 . GLU C 1 83  ? -11.794 3.770   95.790  1.00 66.03  ? 83   GLU C OE2 1 
ATOM   5363  N N   . LEU C 1 84  ? -5.787  5.181   97.128  1.00 50.78  ? 84   LEU C N   1 
ATOM   5364  C CA  . LEU C 1 84  ? -5.060  5.118   98.392  1.00 51.52  ? 84   LEU C CA  1 
ATOM   5365  C C   . LEU C 1 84  ? -4.565  6.511   98.795  1.00 53.18  ? 84   LEU C C   1 
ATOM   5366  O O   . LEU C 1 84  ? -4.708  6.883   99.963  1.00 52.77  ? 84   LEU C O   1 
ATOM   5367  C CB  . LEU C 1 84  ? -3.883  4.111   98.308  1.00 53.60  ? 84   LEU C CB  1 
ATOM   5368  C CG  . LEU C 1 84  ? -3.027  3.906   99.569  1.00 60.12  ? 84   LEU C CG  1 
ATOM   5369  C CD1 . LEU C 1 84  ? -3.881  3.608   100.763 1.00 60.48  ? 84   LEU C CD1 1 
ATOM   5370  C CD2 . LEU C 1 84  ? -2.010  2.808   99.369  1.00 65.04  ? 84   LEU C CD2 1 
ATOM   5371  N N   . LYS C 1 85  ? -4.020  7.276   97.820  1.00 47.93  ? 85   LYS C N   1 
ATOM   5372  C CA  . LYS C 1 85  ? -3.502  8.624   98.047  1.00 46.63  ? 85   LYS C CA  1 
ATOM   5373  C C   . LYS C 1 85  ? -4.630  9.548   98.510  1.00 46.47  ? 85   LYS C C   1 
ATOM   5374  O O   . LYS C 1 85  ? -4.418  10.300  99.461  1.00 45.39  ? 85   LYS C O   1 
ATOM   5375  C CB  . LYS C 1 85  ? -2.803  9.169   96.788  1.00 49.25  ? 85   LYS C CB  1 
ATOM   5376  N N   . PHE C 1 86  ? -5.840  9.450   97.890  1.00 40.10  ? 86   PHE C N   1 
ATOM   5377  C CA  . PHE C 1 86  ? -7.012  10.252  98.281  1.00 36.89  ? 86   PHE C CA  1 
ATOM   5378  C C   . PHE C 1 86  ? -7.402  9.988   99.739  1.00 39.25  ? 86   PHE C C   1 
ATOM   5379  O O   . PHE C 1 86  ? -7.575  10.935  100.501 1.00 38.53  ? 86   PHE C O   1 
ATOM   5380  C CB  . PHE C 1 86  ? -8.234  10.011  97.368  1.00 36.74  ? 86   PHE C CB  1 
ATOM   5381  C CG  . PHE C 1 86  ? -9.534  10.483  97.999  1.00 36.64  ? 86   PHE C CG  1 
ATOM   5382  C CD1 . PHE C 1 86  ? -9.910  11.820  97.939  1.00 36.92  ? 86   PHE C CD1 1 
ATOM   5383  C CD2 . PHE C 1 86  ? -10.354 9.596   98.702  1.00 38.38  ? 86   PHE C CD2 1 
ATOM   5384  C CE1 . PHE C 1 86  ? -11.073 12.263  98.572  1.00 37.05  ? 86   PHE C CE1 1 
ATOM   5385  C CE2 . PHE C 1 86  ? -11.514 10.044  99.338  1.00 39.98  ? 86   PHE C CE2 1 
ATOM   5386  C CZ  . PHE C 1 86  ? -11.866 11.376  99.269  1.00 37.14  ? 86   PHE C CZ  1 
ATOM   5387  N N   . TYR C 1 87  ? -7.570  8.710   100.102 1.00 35.98  ? 87   TYR C N   1 
ATOM   5388  C CA  . TYR C 1 87  ? -7.988  8.282   101.436 1.00 36.14  ? 87   TYR C CA  1 
ATOM   5389  C C   . TYR C 1 87  ? -6.967  8.671   102.505 1.00 42.66  ? 87   TYR C C   1 
ATOM   5390  O O   . TYR C 1 87  ? -7.356  9.152   103.571 1.00 41.87  ? 87   TYR C O   1 
ATOM   5391  C CB  . TYR C 1 87  ? -8.285  6.778   101.454 1.00 37.02  ? 87   TYR C CB  1 
ATOM   5392  C CG  . TYR C 1 87  ? -9.681  6.435   100.968 1.00 36.29  ? 87   TYR C CG  1 
ATOM   5393  C CD1 . TYR C 1 87  ? -10.810 6.821   101.691 1.00 37.30  ? 87   TYR C CD1 1 
ATOM   5394  C CD2 . TYR C 1 87  ? -9.873  5.672   99.823  1.00 36.72  ? 87   TYR C CD2 1 
ATOM   5395  C CE1 . TYR C 1 87  ? -12.095 6.507   101.256 1.00 37.04  ? 87   TYR C CE1 1 
ATOM   5396  C CE2 . TYR C 1 87  ? -11.155 5.335   99.387  1.00 36.89  ? 87   TYR C CE2 1 
ATOM   5397  C CZ  . TYR C 1 87  ? -12.265 5.753   100.109 1.00 41.59  ? 87   TYR C CZ  1 
ATOM   5398  O OH  . TYR C 1 87  ? -13.530 5.418   99.689  1.00 39.72  ? 87   TYR C OH  1 
ATOM   5399  N N   . GLN C 1 88  ? -5.670  8.523   102.196 1.00 42.98  ? 88   GLN C N   1 
ATOM   5400  C CA  . GLN C 1 88  ? -4.598  8.882   103.125 1.00 45.25  ? 88   GLN C CA  1 
ATOM   5401  C C   . GLN C 1 88  ? -4.534  10.400  103.353 1.00 51.21  ? 88   GLN C C   1 
ATOM   5402  O O   . GLN C 1 88  ? -4.282  10.834  104.480 1.00 52.52  ? 88   GLN C O   1 
ATOM   5403  C CB  . GLN C 1 88  ? -3.242  8.387   102.602 1.00 47.70  ? 88   GLN C CB  1 
ATOM   5404  C CG  . GLN C 1 88  ? -2.976  6.907   102.807 1.00 64.29  ? 88   GLN C CG  1 
ATOM   5405  C CD  . GLN C 1 88  ? -1.564  6.529   102.419 1.00 84.26  ? 88   GLN C CD  1 
ATOM   5406  O OE1 . GLN C 1 88  ? -0.857  7.247   101.697 1.00 78.15  ? 88   GLN C OE1 1 
ATOM   5407  N NE2 . GLN C 1 88  ? -1.122  5.373   102.873 1.00 80.76  ? 88   GLN C NE2 1 
ATOM   5408  N N   . ARG C 1 89  ? -4.765  11.200  102.289 1.00 47.37  ? 89   ARG C N   1 
ATOM   5409  C CA  . ARG C 1 89  ? -4.665  12.658  102.340 1.00 46.61  ? 89   ARG C CA  1 
ATOM   5410  C C   . ARG C 1 89  ? -5.967  13.392  102.773 1.00 50.55  ? 89   ARG C C   1 
ATOM   5411  O O   . ARG C 1 89  ? -5.849  14.447  103.403 1.00 51.88  ? 89   ARG C O   1 
ATOM   5412  C CB  . ARG C 1 89  ? -4.204  13.191  100.976 1.00 45.76  ? 89   ARG C CB  1 
ATOM   5413  C CG  . ARG C 1 89  ? -3.333  14.429  101.080 1.00 61.94  ? 89   ARG C CG  1 
ATOM   5414  C CD  . ARG C 1 89  ? -2.664  14.818  99.774  1.00 74.77  ? 89   ARG C CD  1 
ATOM   5415  N NE  . ARG C 1 89  ? -1.841  16.020  99.950  1.00 88.77  ? 89   ARG C NE  1 
ATOM   5416  C CZ  . ARG C 1 89  ? -0.542  16.018  100.243 1.00 105.46 ? 89   ARG C CZ  1 
ATOM   5417  N NH1 . ARG C 1 89  ? 0.116   14.872  100.382 1.00 94.80  ? 89   ARG C NH1 1 
ATOM   5418  N NH2 . ARG C 1 89  ? 0.112   17.163  100.393 1.00 92.87  ? 89   ARG C NH2 1 
ATOM   5419  N N   . ALA C 1 90  ? -7.181  12.862  102.453 1.00 44.69  ? 90   ALA C N   1 
ATOM   5420  C CA  . ALA C 1 90  ? -8.454  13.545  102.740 1.00 42.81  ? 90   ALA C CA  1 
ATOM   5421  C C   . ALA C 1 90  ? -9.467  12.748  103.571 1.00 48.27  ? 90   ALA C C   1 
ATOM   5422  O O   . ALA C 1 90  ? -10.464 13.340  103.985 1.00 48.86  ? 90   ALA C O   1 
ATOM   5423  C CB  . ALA C 1 90  ? -9.118  13.937  101.432 1.00 41.94  ? 90   ALA C CB  1 
ATOM   5424  N N   . ALA C 1 91  ? -9.270  11.438  103.793 1.00 45.63  ? 91   ALA C N   1 
ATOM   5425  C CA  . ALA C 1 91  ? -10.283 10.669  104.522 1.00 45.84  ? 91   ALA C CA  1 
ATOM   5426  C C   . ALA C 1 91  ? -9.773  10.017  105.813 1.00 52.95  ? 91   ALA C C   1 
ATOM   5427  O O   . ALA C 1 91  ? -10.227 8.919   106.167 1.00 54.44  ? 91   ALA C O   1 
ATOM   5428  C CB  . ALA C 1 91  ? -10.889 9.621   103.615 1.00 45.97  ? 91   ALA C CB  1 
ATOM   5429  N N   . LYS C 1 92  ? -8.876  10.714  106.545 1.00 50.53  ? 92   LYS C N   1 
ATOM   5430  C CA  . LYS C 1 92  ? -8.395  10.240  107.842 1.00 52.69  ? 92   LYS C CA  1 
ATOM   5431  C C   . LYS C 1 92  ? -9.550  10.375  108.840 1.00 58.84  ? 92   LYS C C   1 
ATOM   5432  O O   . LYS C 1 92  ? -10.253 11.381  108.788 1.00 56.62  ? 92   LYS C O   1 
ATOM   5433  C CB  . LYS C 1 92  ? -7.157  11.016  108.295 1.00 56.11  ? 92   LYS C CB  1 
ATOM   5434  C CG  . LYS C 1 92  ? -5.922  10.763  107.432 1.00 67.03  ? 92   LYS C CG  1 
ATOM   5435  C CD  . LYS C 1 92  ? -4.693  11.523  107.937 1.00 76.55  ? 92   LYS C CD  1 
ATOM   5436  C CE  . LYS C 1 92  ? -4.653  12.978  107.534 1.00 84.26  ? 92   LYS C CE  1 
ATOM   5437  N NZ  . LYS C 1 92  ? -4.399  13.146  106.082 1.00 94.42  ? 92   LYS C NZ  1 
ATOM   5438  N N   . PRO C 1 93  ? -9.823  9.367   109.700 1.00 59.69  ? 93   PRO C N   1 
ATOM   5439  C CA  . PRO C 1 93  ? -10.994 9.451   110.595 1.00 60.21  ? 93   PRO C CA  1 
ATOM   5440  C C   . PRO C 1 93  ? -11.149 10.769  111.369 1.00 63.67  ? 93   PRO C C   1 
ATOM   5441  O O   . PRO C 1 93  ? -12.274 11.265  111.448 1.00 61.91  ? 93   PRO C O   1 
ATOM   5442  C CB  . PRO C 1 93  ? -10.788 8.271   111.544 1.00 64.39  ? 93   PRO C CB  1 
ATOM   5443  C CG  . PRO C 1 93  ? -10.079 7.263   110.705 1.00 68.99  ? 93   PRO C CG  1 
ATOM   5444  C CD  . PRO C 1 93  ? -9.130  8.069   109.855 1.00 63.43  ? 93   PRO C CD  1 
ATOM   5445  N N   . GLU C 1 94  ? -10.047 11.345  111.909 1.00 61.71  ? 94   GLU C N   1 
ATOM   5446  C CA  . GLU C 1 94  ? -10.092 12.595  112.691 1.00 62.27  ? 94   GLU C CA  1 
ATOM   5447  C C   . GLU C 1 94  ? -10.406 13.816  111.800 1.00 62.59  ? 94   GLU C C   1 
ATOM   5448  O O   . GLU C 1 94  ? -11.058 14.764  112.248 1.00 63.27  ? 94   GLU C O   1 
ATOM   5449  C CB  . GLU C 1 94  ? -8.793  12.812  113.514 1.00 65.76  ? 94   GLU C CB  1 
ATOM   5450  C CG  . GLU C 1 94  ? -7.525  13.180  112.745 1.00 77.59  ? 94   GLU C CG  1 
ATOM   5451  C CD  . GLU C 1 94  ? -6.802  12.092  111.968 1.00 100.19 ? 94   GLU C CD  1 
ATOM   5452  O OE1 . GLU C 1 94  ? -7.218  10.911  112.021 1.00 103.34 ? 94   GLU C OE1 1 
ATOM   5453  O OE2 . GLU C 1 94  ? -5.780  12.426  111.328 1.00 89.99  ? 94   GLU C OE2 1 
ATOM   5454  N N   . GLN C 1 95  ? -9.950  13.775  110.545 1.00 55.00  ? 95   GLN C N   1 
ATOM   5455  C CA  . GLN C 1 95  ? -10.172 14.797  109.525 1.00 51.49  ? 95   GLN C CA  1 
ATOM   5456  C C   . GLN C 1 95  ? -11.680 14.935  109.222 1.00 52.01  ? 95   GLN C C   1 
ATOM   5457  O O   . GLN C 1 95  ? -12.211 16.049  109.166 1.00 50.62  ? 95   GLN C O   1 
ATOM   5458  C CB  . GLN C 1 95  ? -9.408  14.362  108.270 1.00 51.75  ? 95   GLN C CB  1 
ATOM   5459  C CG  . GLN C 1 95  ? -8.884  15.469  107.406 1.00 52.67  ? 95   GLN C CG  1 
ATOM   5460  C CD  . GLN C 1 95  ? -7.908  14.943  106.373 1.00 57.95  ? 95   GLN C CD  1 
ATOM   5461  O OE1 . GLN C 1 95  ? -7.701  13.731  106.193 1.00 51.07  ? 95   GLN C OE1 1 
ATOM   5462  N NE2 . GLN C 1 95  ? -7.262  15.846  105.669 1.00 43.45  ? 95   GLN C NE2 1 
ATOM   5463  N N   . ILE C 1 96  ? -12.366 13.780  109.067 1.00 47.05  ? 96   ILE C N   1 
ATOM   5464  C CA  . ILE C 1 96  ? -13.799 13.667  108.780 1.00 45.17  ? 96   ILE C CA  1 
ATOM   5465  C C   . ILE C 1 96  ? -14.619 14.108  110.004 1.00 50.22  ? 96   ILE C C   1 
ATOM   5466  O O   . ILE C 1 96  ? -15.553 14.892  109.842 1.00 49.00  ? 96   ILE C O   1 
ATOM   5467  C CB  . ILE C 1 96  ? -14.157 12.224  108.283 1.00 47.11  ? 96   ILE C CB  1 
ATOM   5468  C CG1 . ILE C 1 96  ? -13.580 11.998  106.863 1.00 45.72  ? 96   ILE C CG1 1 
ATOM   5469  C CG2 . ILE C 1 96  ? -15.684 11.953  108.304 1.00 46.71  ? 96   ILE C CG2 1 
ATOM   5470  C CD1 . ILE C 1 96  ? -13.602 10.542  106.324 1.00 52.42  ? 96   ILE C CD1 1 
ATOM   5471  N N   . GLN C 1 97  ? -14.252 13.635  111.212 1.00 49.92  ? 97   GLN C N   1 
ATOM   5472  C CA  . GLN C 1 97  ? -14.948 13.951  112.466 1.00 51.12  ? 97   GLN C CA  1 
ATOM   5473  C C   . GLN C 1 97  ? -14.882 15.441  112.812 1.00 53.73  ? 97   GLN C C   1 
ATOM   5474  O O   . GLN C 1 97  ? -15.879 15.988  113.289 1.00 54.16  ? 97   GLN C O   1 
ATOM   5475  C CB  . GLN C 1 97  ? -14.433 13.106  113.638 1.00 54.55  ? 97   GLN C CB  1 
ATOM   5476  C CG  . GLN C 1 97  ? -14.961 11.657  113.634 1.00 77.42  ? 97   GLN C CG  1 
ATOM   5477  C CD  . GLN C 1 97  ? -16.472 11.483  113.451 1.00 89.25  ? 97   GLN C CD  1 
ATOM   5478  O OE1 . GLN C 1 97  ? -16.919 10.710  112.592 1.00 80.98  ? 97   GLN C OE1 1 
ATOM   5479  N NE2 . GLN C 1 97  ? -17.294 12.183  114.243 1.00 73.88  ? 97   GLN C NE2 1 
ATOM   5480  N N   . LYS C 1 98  ? -13.736 16.099  112.544 1.00 48.47  ? 98   LYS C N   1 
ATOM   5481  C CA  . LYS C 1 98  ? -13.570 17.536  112.772 1.00 48.24  ? 98   LYS C CA  1 
ATOM   5482  C C   . LYS C 1 98  ? -14.558 18.308  111.876 1.00 48.68  ? 98   LYS C C   1 
ATOM   5483  O O   . LYS C 1 98  ? -15.228 19.230  112.340 1.00 49.24  ? 98   LYS C O   1 
ATOM   5484  C CB  . LYS C 1 98  ? -12.111 17.965  112.510 1.00 51.42  ? 98   LYS C CB  1 
ATOM   5485  C CG  . LYS C 1 98  ? -11.779 19.387  112.964 1.00 69.27  ? 98   LYS C CG  1 
ATOM   5486  N N   . TRP C 1 99  ? -14.693 17.876  110.619 1.00 41.58  ? 99   TRP C N   1 
ATOM   5487  C CA  . TRP C 1 99  ? -15.617 18.464  109.658 1.00 38.48  ? 99   TRP C CA  1 
ATOM   5488  C C   . TRP C 1 99  ? -17.095 18.237  110.046 1.00 44.15  ? 99   TRP C C   1 
ATOM   5489  O O   . TRP C 1 99  ? -17.883 19.179  109.948 1.00 44.11  ? 99   TRP C O   1 
ATOM   5490  C CB  . TRP C 1 99  ? -15.355 17.889  108.281 1.00 34.62  ? 99   TRP C CB  1 
ATOM   5491  C CG  . TRP C 1 99  ? -16.141 18.558  107.207 1.00 33.69  ? 99   TRP C CG  1 
ATOM   5492  C CD1 . TRP C 1 99  ? -17.403 18.247  106.786 1.00 35.70  ? 99   TRP C CD1 1 
ATOM   5493  C CD2 . TRP C 1 99  ? -15.681 19.608  106.361 1.00 32.63  ? 99   TRP C CD2 1 
ATOM   5494  N NE1 . TRP C 1 99  ? -17.764 19.060  105.742 1.00 33.37  ? 99   TRP C NE1 1 
ATOM   5495  C CE2 . TRP C 1 99  ? -16.718 19.896  105.451 1.00 34.85  ? 99   TRP C CE2 1 
ATOM   5496  C CE3 . TRP C 1 99  ? -14.474 20.321  106.269 1.00 34.11  ? 99   TRP C CE3 1 
ATOM   5497  C CZ2 . TRP C 1 99  ? -16.590 20.873  104.471 1.00 33.41  ? 99   TRP C CZ2 1 
ATOM   5498  C CZ3 . TRP C 1 99  ? -14.348 21.283  105.294 1.00 34.49  ? 99   TRP C CZ3 1 
ATOM   5499  C CH2 . TRP C 1 99  ? -15.390 21.539  104.398 1.00 34.03  ? 99   TRP C CH2 1 
ATOM   5500  N N   . ILE C 1 100 ? -17.471 16.992  110.463 1.00 41.69  ? 100  ILE C N   1 
ATOM   5501  C CA  . ILE C 1 100 ? -18.835 16.635  110.902 1.00 41.72  ? 100  ILE C CA  1 
ATOM   5502  C C   . ILE C 1 100 ? -19.258 17.572  112.046 1.00 46.66  ? 100  ILE C C   1 
ATOM   5503  O O   . ILE C 1 100 ? -20.372 18.102  112.025 1.00 46.61  ? 100  ILE C O   1 
ATOM   5504  C CB  . ILE C 1 100 ? -18.935 15.129  111.310 1.00 45.19  ? 100  ILE C CB  1 
ATOM   5505  C CG1 . ILE C 1 100 ? -18.800 14.215  110.081 1.00 43.96  ? 100  ILE C CG1 1 
ATOM   5506  C CG2 . ILE C 1 100 ? -20.236 14.812  112.083 1.00 45.87  ? 100  ILE C CG2 1 
ATOM   5507  C CD1 . ILE C 1 100 ? -18.616 12.729  110.418 1.00 51.29  ? 100  ILE C CD1 1 
ATOM   5508  N N   . ARG C 1 101 ? -18.339 17.802  113.003 1.00 45.15  ? 101  ARG C N   1 
ATOM   5509  C CA  . ARG C 1 101 ? -18.503 18.653  114.184 1.00 46.97  ? 101  ARG C CA  1 
ATOM   5510  C C   . ARG C 1 101 ? -18.718 20.130  113.806 1.00 50.27  ? 101  ARG C C   1 
ATOM   5511  O O   . ARG C 1 101 ? -19.757 20.690  114.154 1.00 50.59  ? 101  ARG C O   1 
ATOM   5512  C CB  . ARG C 1 101 ? -17.265 18.522  115.086 1.00 47.80  ? 101  ARG C CB  1 
ATOM   5513  C CG  . ARG C 1 101 ? -17.574 18.494  116.571 1.00 62.84  ? 101  ARG C CG  1 
ATOM   5514  C CD  . ARG C 1 101 ? -16.378 18.866  117.442 1.00 75.32  ? 101  ARG C CD  1 
ATOM   5515  N NE  . ARG C 1 101 ? -15.136 18.198  117.043 1.00 84.49  ? 101  ARG C NE  1 
ATOM   5516  C CZ  . ARG C 1 101 ? -14.028 18.833  116.671 1.00 97.69  ? 101  ARG C CZ  1 
ATOM   5517  N NH1 . ARG C 1 101 ? -13.990 20.162  116.647 1.00 78.29  ? 101  ARG C NH1 1 
ATOM   5518  N NH2 . ARG C 1 101 ? -12.947 18.145  116.325 1.00 87.68  ? 101  ARG C NH2 1 
ATOM   5519  N N   . THR C 1 102 ? -17.746 20.745  113.084 1.00 45.35  ? 102  THR C N   1 
ATOM   5520  C CA  . THR C 1 102 ? -17.758 22.158  112.687 1.00 44.61  ? 102  THR C CA  1 
ATOM   5521  C C   . THR C 1 102 ? -18.911 22.497  111.734 1.00 47.43  ? 102  THR C C   1 
ATOM   5522  O O   . THR C 1 102 ? -19.486 23.583  111.846 1.00 48.70  ? 102  THR C O   1 
ATOM   5523  C CB  . THR C 1 102 ? -16.417 22.589  112.061 1.00 48.69  ? 102  THR C CB  1 
ATOM   5524  O OG1 . THR C 1 102 ? -16.195 21.885  110.845 1.00 47.89  ? 102  THR C OG1 1 
ATOM   5525  C CG2 . THR C 1 102 ? -15.229 22.427  113.005 1.00 46.72  ? 102  THR C CG2 1 
ATOM   5526  N N   . ARG C 1 103 ? -19.252 21.594  110.807 1.00 41.07  ? 103  ARG C N   1 
ATOM   5527  C CA  . ARG C 1 103 ? -20.328 21.876  109.860 1.00 39.24  ? 103  ARG C CA  1 
ATOM   5528  C C   . ARG C 1 103 ? -21.699 21.459  110.406 1.00 44.92  ? 103  ARG C C   1 
ATOM   5529  O O   . ARG C 1 103 ? -22.710 21.648  109.719 1.00 44.94  ? 103  ARG C O   1 
ATOM   5530  C CB  . ARG C 1 103 ? -20.060 21.224  108.495 1.00 36.06  ? 103  ARG C CB  1 
ATOM   5531  C CG  . ARG C 1 103 ? -18.749 21.622  107.792 1.00 39.58  ? 103  ARG C CG  1 
ATOM   5532  C CD  . ARG C 1 103 ? -18.425 23.090  107.834 1.00 48.91  ? 103  ARG C CD  1 
ATOM   5533  N NE  . ARG C 1 103 ? -17.387 23.529  106.899 1.00 57.08  ? 103  ARG C NE  1 
ATOM   5534  C CZ  . ARG C 1 103 ? -16.118 23.776  107.226 1.00 68.42  ? 103  ARG C CZ  1 
ATOM   5535  N NH1 . ARG C 1 103 ? -15.677 23.521  108.454 1.00 42.91  ? 103  ARG C NH1 1 
ATOM   5536  N NH2 . ARG C 1 103 ? -15.276 24.255  106.323 1.00 63.07  ? 103  ARG C NH2 1 
ATOM   5537  N N   . LYS C 1 104 ? -21.732 20.920  111.652 1.00 42.99  ? 104  LYS C N   1 
ATOM   5538  C CA  . LYS C 1 104 ? -22.932 20.478  112.387 1.00 43.87  ? 104  LYS C CA  1 
ATOM   5539  C C   . LYS C 1 104 ? -23.787 19.514  111.536 1.00 47.43  ? 104  LYS C C   1 
ATOM   5540  O O   . LYS C 1 104 ? -25.015 19.671  111.422 1.00 47.72  ? 104  LYS C O   1 
ATOM   5541  C CB  . LYS C 1 104 ? -23.787 21.678  112.860 1.00 46.38  ? 104  LYS C CB  1 
ATOM   5542  C CG  . LYS C 1 104 ? -23.037 22.808  113.562 1.00 53.01  ? 104  LYS C CG  1 
ATOM   5543  C CD  . LYS C 1 104 ? -23.831 24.120  113.486 1.00 61.35  ? 104  LYS C CD  1 
ATOM   5544  C CE  . LYS C 1 104 ? -23.542 24.971  112.258 1.00 62.40  ? 104  LYS C CE  1 
ATOM   5545  N NZ  . LYS C 1 104 ? -24.676 25.877  111.929 1.00 66.97  ? 104  LYS C NZ  1 
ATOM   5546  N N   . LEU C 1 105 ? -23.110 18.528  110.922 1.00 42.45  ? 105  LEU C N   1 
ATOM   5547  C CA  . LEU C 1 105 ? -23.722 17.501  110.080 1.00 40.52  ? 105  LEU C CA  1 
ATOM   5548  C C   . LEU C 1 105 ? -24.133 16.319  110.928 1.00 44.11  ? 105  LEU C C   1 
ATOM   5549  O O   . LEU C 1 105 ? -23.489 16.057  111.944 1.00 43.59  ? 105  LEU C O   1 
ATOM   5550  C CB  . LEU C 1 105 ? -22.724 17.019  109.004 1.00 38.82  ? 105  LEU C CB  1 
ATOM   5551  C CG  . LEU C 1 105 ? -22.135 18.033  108.038 1.00 42.00  ? 105  LEU C CG  1 
ATOM   5552  C CD1 . LEU C 1 105 ? -20.923 17.454  107.347 1.00 41.33  ? 105  LEU C CD1 1 
ATOM   5553  C CD2 . LEU C 1 105 ? -23.157 18.484  107.008 1.00 42.23  ? 105  LEU C CD2 1 
ATOM   5554  N N   . LYS C 1 106 ? -25.158 15.565  110.490 1.00 40.95  ? 106  LYS C N   1 
ATOM   5555  C CA  . LYS C 1 106 ? -25.580 14.343  111.182 1.00 41.97  ? 106  LYS C CA  1 
ATOM   5556  C C   . LYS C 1 106 ? -24.530 13.255  110.910 1.00 43.42  ? 106  LYS C C   1 
ATOM   5557  O O   . LYS C 1 106 ? -24.192 12.472  111.793 1.00 42.80  ? 106  LYS C O   1 
ATOM   5558  C CB  . LYS C 1 106 ? -26.981 13.910  110.715 1.00 45.19  ? 106  LYS C CB  1 
ATOM   5559  C CG  . LYS C 1 106 ? -28.122 14.675  111.377 1.00 61.86  ? 106  LYS C CG  1 
ATOM   5560  C CD  . LYS C 1 106 ? -29.476 14.322  110.750 1.00 73.90  ? 106  LYS C CD  1 
ATOM   5561  N N   . TYR C 1 107 ? -23.978 13.262  109.678 1.00 38.34  ? 107  TYR C N   1 
ATOM   5562  C CA  . TYR C 1 107 ? -22.946 12.345  109.192 1.00 36.99  ? 107  TYR C CA  1 
ATOM   5563  C C   . TYR C 1 107 ? -22.291 12.957  107.934 1.00 38.49  ? 107  TYR C C   1 
ATOM   5564  O O   . TYR C 1 107 ? -22.739 14.003  107.449 1.00 36.89  ? 107  TYR C O   1 
ATOM   5565  C CB  . TYR C 1 107 ? -23.581 10.954  108.898 1.00 38.05  ? 107  TYR C CB  1 
ATOM   5566  C CG  . TYR C 1 107 ? -24.126 10.801  107.494 1.00 37.82  ? 107  TYR C CG  1 
ATOM   5567  C CD1 . TYR C 1 107 ? -25.336 11.389  107.122 1.00 38.89  ? 107  TYR C CD1 1 
ATOM   5568  C CD2 . TYR C 1 107 ? -23.418 10.096  106.527 1.00 38.19  ? 107  TYR C CD2 1 
ATOM   5569  C CE1 . TYR C 1 107 ? -25.808 11.304  105.817 1.00 38.06  ? 107  TYR C CE1 1 
ATOM   5570  C CE2 . TYR C 1 107 ? -23.878 10.009  105.217 1.00 37.99  ? 107  TYR C CE2 1 
ATOM   5571  C CZ  . TYR C 1 107 ? -25.071 10.617  104.865 1.00 45.53  ? 107  TYR C CZ  1 
ATOM   5572  O OH  . TYR C 1 107 ? -25.537 10.507  103.580 1.00 45.91  ? 107  TYR C OH  1 
ATOM   5573  N N   . LEU C 1 108 ? -21.238 12.302  107.413 1.00 34.38  ? 108  LEU C N   1 
ATOM   5574  C CA  . LEU C 1 108 ? -20.572 12.688  106.172 1.00 32.37  ? 108  LEU C CA  1 
ATOM   5575  C C   . LEU C 1 108 ? -20.350 11.426  105.352 1.00 35.60  ? 108  LEU C C   1 
ATOM   5576  O O   . LEU C 1 108 ? -19.712 10.492  105.822 1.00 36.86  ? 108  LEU C O   1 
ATOM   5577  C CB  . LEU C 1 108 ? -19.253 13.465  106.406 1.00 32.14  ? 108  LEU C CB  1 
ATOM   5578  C CG  . LEU C 1 108 ? -18.504 13.919  105.136 1.00 34.73  ? 108  LEU C CG  1 
ATOM   5579  C CD1 . LEU C 1 108 ? -19.218 15.090  104.420 1.00 33.54  ? 108  LEU C CD1 1 
ATOM   5580  C CD2 . LEU C 1 108 ? -17.073 14.242  105.448 1.00 36.68  ? 108  LEU C CD2 1 
ATOM   5581  N N   . GLY C 1 109 ? -20.893 11.413  104.143 1.00 31.26  ? 109  GLY C N   1 
ATOM   5582  C CA  . GLY C 1 109 ? -20.830 10.273  103.240 1.00 30.91  ? 109  GLY C CA  1 
ATOM   5583  C C   . GLY C 1 109 ? -19.499 9.983   102.585 1.00 33.92  ? 109  GLY C C   1 
ATOM   5584  O O   . GLY C 1 109 ? -19.474 9.532   101.440 1.00 31.77  ? 109  GLY C O   1 
ATOM   5585  N N   . VAL C 1 110 ? -18.386 10.207  103.312 1.00 31.62  ? 110  VAL C N   1 
ATOM   5586  C CA  . VAL C 1 110 ? -17.033 9.888   102.853 1.00 31.09  ? 110  VAL C CA  1 
ATOM   5587  C C   . VAL C 1 110 ? -16.616 8.629   103.633 1.00 38.99  ? 110  VAL C C   1 
ATOM   5588  O O   . VAL C 1 110 ? -16.656 8.659   104.866 1.00 40.22  ? 110  VAL C O   1 
ATOM   5589  C CB  . VAL C 1 110 ? -16.021 11.072  102.991 1.00 33.64  ? 110  VAL C CB  1 
ATOM   5590  C CG1 . VAL C 1 110 ? -14.599 10.652  102.588 1.00 33.36  ? 110  VAL C CG1 1 
ATOM   5591  C CG2 . VAL C 1 110 ? -16.470 12.293  102.179 1.00 32.02  ? 110  VAL C CG2 1 
ATOM   5592  N N   . PRO C 1 111 ? -16.298 7.494   102.957 1.00 37.73  ? 111  PRO C N   1 
ATOM   5593  C CA  . PRO C 1 111 ? -15.924 6.279   103.696 1.00 39.70  ? 111  PRO C CA  1 
ATOM   5594  C C   . PRO C 1 111 ? -14.597 6.411   104.441 1.00 46.06  ? 111  PRO C C   1 
ATOM   5595  O O   . PRO C 1 111 ? -13.700 7.182   104.053 1.00 46.42  ? 111  PRO C O   1 
ATOM   5596  C CB  . PRO C 1 111 ? -15.804 5.207   102.599 1.00 41.62  ? 111  PRO C CB  1 
ATOM   5597  C CG  . PRO C 1 111 ? -16.483 5.790   101.392 1.00 44.22  ? 111  PRO C CG  1 
ATOM   5598  C CD  . PRO C 1 111 ? -16.234 7.260   101.502 1.00 38.82  ? 111  PRO C CD  1 
ATOM   5599  N N   . LYS C 1 112 ? -14.452 5.552   105.462 1.00 44.10  ? 112  LYS C N   1 
ATOM   5600  C CA  . LYS C 1 112 ? -13.266 5.444   106.305 1.00 45.56  ? 112  LYS C CA  1 
ATOM   5601  C C   . LYS C 1 112 ? -12.280 4.432   105.746 1.00 48.94  ? 112  LYS C C   1 
ATOM   5602  O O   . LYS C 1 112 ? -12.653 3.320   105.347 1.00 47.25  ? 112  LYS C O   1 
ATOM   5603  C CB  . LYS C 1 112 ? -13.633 5.061   107.750 1.00 49.61  ? 112  LYS C CB  1 
ATOM   5604  N N   . TYR C 1 113 ? -11.011 4.850   105.724 1.00 46.52  ? 113  TYR C N   1 
ATOM   5605  C CA  . TYR C 1 113 ? -9.865  4.059   105.303 1.00 47.64  ? 113  TYR C CA  1 
ATOM   5606  C C   . TYR C 1 113 ? -9.214  3.490   106.577 1.00 54.64  ? 113  TYR C C   1 
ATOM   5607  O O   . TYR C 1 113 ? -8.815  4.249   107.469 1.00 53.06  ? 113  TYR C O   1 
ATOM   5608  C CB  . TYR C 1 113 ? -8.909  4.922   104.452 1.00 47.67  ? 113  TYR C CB  1 
ATOM   5609  C CG  . TYR C 1 113 ? -7.509  4.378   104.303 1.00 50.62  ? 113  TYR C CG  1 
ATOM   5610  C CD1 . TYR C 1 113 ? -7.249  3.275   103.492 1.00 53.06  ? 113  TYR C CD1 1 
ATOM   5611  C CD2 . TYR C 1 113 ? -6.433  4.995   104.929 1.00 52.42  ? 113  TYR C CD2 1 
ATOM   5612  C CE1 . TYR C 1 113 ? -5.961  2.754   103.373 1.00 54.66  ? 113  TYR C CE1 1 
ATOM   5613  C CE2 . TYR C 1 113 ? -5.139  4.495   104.802 1.00 54.96  ? 113  TYR C CE2 1 
ATOM   5614  C CZ  . TYR C 1 113 ? -4.909  3.360   104.041 1.00 62.04  ? 113  TYR C CZ  1 
ATOM   5615  O OH  . TYR C 1 113 ? -3.624  2.890   103.898 1.00 65.32  ? 113  TYR C OH  1 
ATOM   5616  N N   . TRP C 1 114 ? -9.205  2.151   106.684 1.00 55.55  ? 114  TRP C N   1 
ATOM   5617  C CA  . TRP C 1 114 ? -8.687  1.405   107.830 1.00 59.43  ? 114  TRP C CA  1 
ATOM   5618  C C   . TRP C 1 114 ? -7.210  1.009   107.663 1.00 65.14  ? 114  TRP C C   1 
ATOM   5619  O O   . TRP C 1 114 ? -6.457  1.030   108.644 1.00 66.16  ? 114  TRP C O   1 
ATOM   5620  C CB  . TRP C 1 114 ? -9.536  0.149   108.077 1.00 60.29  ? 114  TRP C CB  1 
ATOM   5621  C CG  . TRP C 1 114 ? -10.958 0.429   108.475 1.00 61.28  ? 114  TRP C CG  1 
ATOM   5622  C CD1 . TRP C 1 114 ? -12.008 0.685   107.641 1.00 62.46  ? 114  TRP C CD1 1 
ATOM   5623  C CD2 . TRP C 1 114 ? -11.494 0.426   109.807 1.00 62.68  ? 114  TRP C CD2 1 
ATOM   5624  N NE1 . TRP C 1 114 ? -13.160 0.874   108.371 1.00 62.13  ? 114  TRP C NE1 1 
ATOM   5625  C CE2 . TRP C 1 114 ? -12.876 0.715   109.704 1.00 65.58  ? 114  TRP C CE2 1 
ATOM   5626  C CE3 . TRP C 1 114 ? -10.938 0.217   111.084 1.00 66.13  ? 114  TRP C CE3 1 
ATOM   5627  C CZ2 . TRP C 1 114 ? -13.710 0.805   110.829 1.00 65.78  ? 114  TRP C CZ2 1 
ATOM   5628  C CZ3 . TRP C 1 114 ? -11.765 0.310   112.197 1.00 68.58  ? 114  TRP C CZ3 1 
ATOM   5629  C CH2 . TRP C 1 114 ? -13.132 0.601   112.065 1.00 68.00  ? 114  TRP C CH2 1 
ATOM   5630  N N   . GLY C 1 115 ? -6.821  0.634   106.444 1.00 61.11  ? 115  GLY C N   1 
ATOM   5631  C CA  . GLY C 1 115 ? -5.457  0.214   106.140 1.00 62.40  ? 115  GLY C CA  1 
ATOM   5632  C C   . GLY C 1 115 ? -5.293  -0.421  104.775 1.00 66.51  ? 115  GLY C C   1 
ATOM   5633  O O   . GLY C 1 115 ? -6.278  -0.750  104.110 1.00 65.23  ? 115  GLY C O   1 
ATOM   5634  N N   . SER C 1 116 ? -4.036  -0.593  104.347 1.00 64.50  ? 116  SER C N   1 
ATOM   5635  C CA  . SER C 1 116 ? -3.686  -1.165  103.047 1.00 64.49  ? 116  SER C CA  1 
ATOM   5636  C C   . SER C 1 116 ? -2.425  -2.033  103.149 1.00 71.65  ? 116  SER C C   1 
ATOM   5637  O O   . SER C 1 116 ? -1.722  -1.968  104.155 1.00 72.76  ? 116  SER C O   1 
ATOM   5638  C CB  . SER C 1 116 ? -3.485  -0.050  102.019 1.00 65.32  ? 116  SER C CB  1 
ATOM   5639  O OG  . SER C 1 116 ? -2.256  0.634   102.210 1.00 72.08  ? 116  SER C OG  1 
ATOM   5640  N N   . GLY C 1 117 ? -2.150  -2.811  102.103 1.00 69.30  ? 117  GLY C N   1 
ATOM   5641  C CA  . GLY C 1 117 ? -0.982  -3.679  102.022 1.00 72.17  ? 117  GLY C CA  1 
ATOM   5642  C C   . GLY C 1 117 ? -0.967  -4.555  100.788 1.00 77.94  ? 117  GLY C C   1 
ATOM   5643  O O   . GLY C 1 117 ? -1.755  -4.346  99.863  1.00 75.16  ? 117  GLY C O   1 
ATOM   5644  N N   . LEU C 1 118 ? -0.053  -5.538  100.769 1.00 79.27  ? 118  LEU C N   1 
ATOM   5645  C CA  . LEU C 1 118 ? 0.095   -6.503  99.680  1.00 80.97  ? 118  LEU C CA  1 
ATOM   5646  C C   . LEU C 1 118 ? -0.072  -7.931  100.183 1.00 88.59  ? 118  LEU C C   1 
ATOM   5647  O O   . LEU C 1 118 ? 0.284   -8.224  101.327 1.00 89.41  ? 118  LEU C O   1 
ATOM   5648  C CB  . LEU C 1 118 ? 1.465   -6.370  98.997  1.00 82.27  ? 118  LEU C CB  1 
ATOM   5649  C CG  . LEU C 1 118 ? 1.799   -5.103  98.221  1.00 84.76  ? 118  LEU C CG  1 
ATOM   5650  C CD1 . LEU C 1 118 ? 3.159   -5.242  97.628  1.00 87.11  ? 118  LEU C CD1 1 
ATOM   5651  C CD2 . LEU C 1 118 ? 0.844   -4.873  97.056  1.00 85.18  ? 118  LEU C CD2 1 
ATOM   5652  N N   . HIS C 1 119 ? -0.576  -8.824  99.311  1.00 87.27  ? 119  HIS C N   1 
ATOM   5653  C CA  . HIS C 1 119 ? -0.771  -10.240 99.613  1.00 90.37  ? 119  HIS C CA  1 
ATOM   5654  C C   . HIS C 1 119 ? -0.428  -11.095 98.394  1.00 96.46  ? 119  HIS C C   1 
ATOM   5655  O O   . HIS C 1 119 ? -1.034  -10.930 97.333  1.00 94.23  ? 119  HIS C O   1 
ATOM   5656  C CB  . HIS C 1 119 ? -2.212  -10.510 100.081 1.00 90.27  ? 119  HIS C CB  1 
ATOM   5657  C CG  . HIS C 1 119 ? -2.329  -11.742 100.919 1.00 96.61  ? 119  HIS C CG  1 
ATOM   5658  N ND1 . HIS C 1 119 ? -2.311  -11.676 102.300 1.00 99.26  ? 119  HIS C ND1 1 
ATOM   5659  C CD2 . HIS C 1 119 ? -2.416  -13.039 100.544 1.00 100.74 ? 119  HIS C CD2 1 
ATOM   5660  C CE1 . HIS C 1 119 ? -2.404  -12.928 102.721 1.00 101.37 ? 119  HIS C CE1 1 
ATOM   5661  N NE2 . HIS C 1 119 ? -2.470  -13.783 101.700 1.00 102.71 ? 119  HIS C NE2 1 
ATOM   5662  N N   . ASP C 1 120 ? 0.554   -11.997 98.538  1.00 97.22  ? 120  ASP C N   1 
ATOM   5663  C CA  . ASP C 1 120 ? 0.954   -12.880 97.447  1.00 99.47  ? 120  ASP C CA  1 
ATOM   5664  C C   . ASP C 1 120 ? 0.188   -14.197 97.510  1.00 105.46 ? 120  ASP C C   1 
ATOM   5665  O O   . ASP C 1 120 ? 0.072   -14.804 98.582  1.00 106.26 ? 120  ASP C O   1 
ATOM   5666  C CB  . ASP C 1 120 ? 2.470   -13.143 97.453  1.00 104.27 ? 120  ASP C CB  1 
ATOM   5667  C CG  . ASP C 1 120 ? 3.342   -11.925 97.223  1.00 114.71 ? 120  ASP C CG  1 
ATOM   5668  O OD1 . ASP C 1 120 ? 3.062   -11.161 96.269  1.00 113.05 ? 120  ASP C OD1 1 
ATOM   5669  O OD2 . ASP C 1 120 ? 4.345   -11.774 97.947  1.00 122.95 ? 120  ASP C OD2 1 
ATOM   5670  N N   . LYS C 1 121 ? -0.338  -14.627 96.351  1.00 102.59 ? 121  LYS C N   1 
ATOM   5671  C CA  . LYS C 1 121 ? -1.081  -15.876 96.179  1.00 104.33 ? 121  LYS C CA  1 
ATOM   5672  C C   . LYS C 1 121 ? -0.671  -16.520 94.848  1.00 110.36 ? 121  LYS C C   1 
ATOM   5673  O O   . LYS C 1 121 ? -0.818  -15.894 93.791  1.00 108.67 ? 121  LYS C O   1 
ATOM   5674  C CB  . LYS C 1 121 ? -2.601  -15.635 96.252  1.00 104.12 ? 121  LYS C CB  1 
ATOM   5675  C CG  . LYS C 1 121 ? -3.379  -16.868 96.684  1.00 116.76 ? 121  LYS C CG  1 
ATOM   5676  C CD  . LYS C 1 121 ? -4.867  -16.600 96.810  1.00 119.83 ? 121  LYS C CD  1 
ATOM   5677  C CE  . LYS C 1 121 ? -5.600  -17.788 97.385  1.00 129.24 ? 121  LYS C CE  1 
ATOM   5678  N NZ  . LYS C 1 121 ? -5.348  -17.957 98.843  1.00 137.41 ? 121  LYS C NZ  1 
ATOM   5679  N N   . ASN C 1 122 ? -0.123  -17.756 94.918  1.00 110.00 ? 122  ASN C N   1 
ATOM   5680  C CA  . ASN C 1 122 ? 0.373   -18.559 93.792  1.00 112.11 ? 122  ASN C CA  1 
ATOM   5681  C C   . ASN C 1 122 ? 1.444   -17.795 93.004  1.00 114.86 ? 122  ASN C C   1 
ATOM   5682  O O   . ASN C 1 122 ? 2.380   -17.260 93.596  1.00 114.20 ? 122  ASN C O   1 
ATOM   5683  C CB  . ASN C 1 122 ? -0.768  -19.010 92.869  1.00 112.57 ? 122  ASN C CB  1 
ATOM   5684  N N   . LYS C 1 124 ? 1.712   -14.638 92.153  1.00 107.78 ? 124  LYS C N   1 
ATOM   5685  C CA  . LYS C 1 124 ? 1.092   -13.375 91.761  1.00 103.98 ? 124  LYS C CA  1 
ATOM   5686  C C   . LYS C 1 124 ? 0.923   -12.435 92.963  1.00 106.09 ? 124  LYS C C   1 
ATOM   5687  O O   . LYS C 1 124 ? 0.679   -12.903 94.077  1.00 106.22 ? 124  LYS C O   1 
ATOM   5688  C CB  . LYS C 1 124 ? -0.264  -13.623 91.084  1.00 104.83 ? 124  LYS C CB  1 
ATOM   5689  N N   . SER C 1 125 ? 1.060   -11.111 92.731  1.00 100.54 ? 125  SER C N   1 
ATOM   5690  C CA  . SER C 1 125 ? 0.928   -10.071 93.759  1.00 98.26  ? 125  SER C CA  1 
ATOM   5691  C C   . SER C 1 125 ? -0.444  -9.399  93.697  1.00 98.71  ? 125  SER C C   1 
ATOM   5692  O O   . SER C 1 125 ? -0.926  -9.071  92.608  1.00 97.37  ? 125  SER C O   1 
ATOM   5693  C CB  . SER C 1 125 ? 2.029   -9.023  93.618  1.00 101.57 ? 125  SER C CB  1 
ATOM   5694  O OG  . SER C 1 125 ? 1.997   -8.089  94.684  1.00 108.11 ? 125  SER C OG  1 
ATOM   5695  N N   . TYR C 1 126 ? -1.062  -9.191  94.874  1.00 93.58  ? 126  TYR C N   1 
ATOM   5696  C CA  . TYR C 1 126 ? -2.385  -8.577  95.019  1.00 90.04  ? 126  TYR C CA  1 
ATOM   5697  C C   . TYR C 1 126 ? -2.329  -7.416  96.006  1.00 88.96  ? 126  TYR C C   1 
ATOM   5698  O O   . TYR C 1 126 ? -1.795  -7.567  97.105  1.00 89.80  ? 126  TYR C O   1 
ATOM   5699  C CB  . TYR C 1 126 ? -3.416  -9.625  95.489  1.00 92.65  ? 126  TYR C CB  1 
ATOM   5700  C CG  . TYR C 1 126 ? -3.615  -10.775 94.526  1.00 97.28  ? 126  TYR C CG  1 
ATOM   5701  C CD1 . TYR C 1 126 ? -4.603  -10.727 93.546  1.00 98.44  ? 126  TYR C CD1 1 
ATOM   5702  C CD2 . TYR C 1 126 ? -2.818  -11.917 94.596  1.00 101.17 ? 126  TYR C CD2 1 
ATOM   5703  C CE1 . TYR C 1 126 ? -4.789  -11.781 92.654  1.00 101.74 ? 126  TYR C CE1 1 
ATOM   5704  C CE2 . TYR C 1 126 ? -2.984  -12.970 93.698  1.00 104.02 ? 126  TYR C CE2 1 
ATOM   5705  C CZ  . TYR C 1 126 ? -3.979  -12.902 92.735  1.00 111.25 ? 126  TYR C CZ  1 
ATOM   5706  O OH  . TYR C 1 126 ? -4.163  -13.945 91.859  1.00 115.31 ? 126  TYR C OH  1 
ATOM   5707  N N   . ARG C 1 127 ? -2.813  -6.245  95.602  1.00 80.59  ? 127  ARG C N   1 
ATOM   5708  C CA  . ARG C 1 127 ? -2.848  -5.089  96.495  1.00 77.68  ? 127  ARG C CA  1 
ATOM   5709  C C   . ARG C 1 127 ? -4.215  -5.055  97.165  1.00 78.18  ? 127  ARG C C   1 
ATOM   5710  O O   . ARG C 1 127 ? -5.199  -5.460  96.538  1.00 77.12  ? 127  ARG C O   1 
ATOM   5711  C CB  . ARG C 1 127 ? -2.554  -3.783  95.739  1.00 75.10  ? 127  ARG C CB  1 
ATOM   5712  N N   . PHE C 1 128 ? -4.287  -4.629  98.440  1.00 72.63  ? 128  PHE C N   1 
ATOM   5713  C CA  . PHE C 1 128 ? -5.573  -4.580  99.130  1.00 70.62  ? 128  PHE C CA  1 
ATOM   5714  C C   . PHE C 1 128 ? -5.777  -3.279  99.911  1.00 73.35  ? 128  PHE C C   1 
ATOM   5715  O O   . PHE C 1 128 ? -4.814  -2.585  100.230 1.00 72.97  ? 128  PHE C O   1 
ATOM   5716  C CB  . PHE C 1 128 ? -5.776  -5.797  100.047 1.00 73.94  ? 128  PHE C CB  1 
ATOM   5717  C CG  . PHE C 1 128 ? -4.825  -5.968  101.206 1.00 76.69  ? 128  PHE C CG  1 
ATOM   5718  C CD1 . PHE C 1 128 ? -5.028  -5.284  102.400 1.00 78.57  ? 128  PHE C CD1 1 
ATOM   5719  C CD2 . PHE C 1 128 ? -3.787  -6.889  101.143 1.00 81.15  ? 128  PHE C CD2 1 
ATOM   5720  C CE1 . PHE C 1 128 ? -4.165  -5.471  103.485 1.00 81.44  ? 128  PHE C CE1 1 
ATOM   5721  C CE2 . PHE C 1 128 ? -2.930  -7.080  102.231 1.00 85.53  ? 128  PHE C CE2 1 
ATOM   5722  C CZ  . PHE C 1 128 ? -3.125  -6.369  103.394 1.00 82.89  ? 128  PHE C CZ  1 
ATOM   5723  N N   . MET C 1 129 ? -7.051  -2.970  100.215 1.00 68.81  ? 129  MET C N   1 
ATOM   5724  C CA  . MET C 1 129 ? -7.487  -1.813  100.989 1.00 67.18  ? 129  MET C CA  1 
ATOM   5725  C C   . MET C 1 129 ? -8.625  -2.226  101.915 1.00 68.82  ? 129  MET C C   1 
ATOM   5726  O O   . MET C 1 129 ? -9.607  -2.815  101.451 1.00 68.63  ? 129  MET C O   1 
ATOM   5727  C CB  . MET C 1 129 ? -7.927  -0.677  100.057 1.00 67.83  ? 129  MET C CB  1 
ATOM   5728  C CG  . MET C 1 129 ? -6.865  0.374   99.840  1.00 72.24  ? 129  MET C CG  1 
ATOM   5729  S SD  . MET C 1 129 ? -7.432  1.742   98.784  1.00 75.10  ? 129  MET C SD  1 
ATOM   5730  C CE  . MET C 1 129 ? -7.174  1.022   97.139  1.00 72.52  ? 129  MET C CE  1 
ATOM   5731  N N   . ILE C 1 130 ? -8.486  -1.959  103.221 1.00 63.82  ? 130  ILE C N   1 
ATOM   5732  C CA  . ILE C 1 130 ? -9.528  -2.284  104.199 1.00 63.23  ? 130  ILE C CA  1 
ATOM   5733  C C   . ILE C 1 130 ? -10.358 -1.019  104.384 1.00 65.07  ? 130  ILE C C   1 
ATOM   5734  O O   . ILE C 1 130 ? -9.819  0.044   104.705 1.00 63.99  ? 130  ILE C O   1 
ATOM   5735  C CB  . ILE C 1 130 ? -8.991  -2.883  105.530 1.00 68.16  ? 130  ILE C CB  1 
ATOM   5736  C CG1 . ILE C 1 130 ? -8.150  -4.144  105.267 1.00 70.89  ? 130  ILE C CG1 1 
ATOM   5737  C CG2 . ILE C 1 130 ? -10.128 -3.215  106.494 1.00 68.47  ? 130  ILE C CG2 1 
ATOM   5738  C CD1 . ILE C 1 130 ? -6.685  -3.941  105.434 1.00 79.73  ? 130  ILE C CD1 1 
ATOM   5739  N N   . MET C 1 131 ? -11.664 -1.134  104.106 1.00 60.79  ? 131  MET C N   1 
ATOM   5740  C CA  . MET C 1 131 ? -12.632 -0.033  104.133 1.00 58.64  ? 131  MET C CA  1 
ATOM   5741  C C   . MET C 1 131 ? -13.861 -0.353  104.975 1.00 61.30  ? 131  MET C C   1 
ATOM   5742  O O   . MET C 1 131 ? -14.045 -1.496  105.390 1.00 62.28  ? 131  MET C O   1 
ATOM   5743  C CB  . MET C 1 131 ? -13.107 0.258   102.690 1.00 59.57  ? 131  MET C CB  1 
ATOM   5744  C CG  . MET C 1 131 ? -12.013 0.642   101.733 1.00 63.08  ? 131  MET C CG  1 
ATOM   5745  S SD  . MET C 1 131 ? -11.298 2.218   102.203 1.00 66.93  ? 131  MET C SD  1 
ATOM   5746  C CE  . MET C 1 131 ? -9.929  2.236   101.177 1.00 64.08  ? 131  MET C CE  1 
ATOM   5747  N N   . ASP C 1 132 ? -14.731 0.649   105.175 1.00 55.85  ? 132  ASP C N   1 
ATOM   5748  C CA  . ASP C 1 132 ? -16.010 0.478   105.855 1.00 55.95  ? 132  ASP C CA  1 
ATOM   5749  C C   . ASP C 1 132 ? -16.932 -0.404  105.026 1.00 58.18  ? 132  ASP C C   1 
ATOM   5750  O O   . ASP C 1 132 ? -16.968 -0.278  103.793 1.00 57.17  ? 132  ASP C O   1 
ATOM   5751  C CB  . ASP C 1 132 ? -16.698 1.836   106.074 1.00 56.56  ? 132  ASP C CB  1 
ATOM   5752  C CG  . ASP C 1 132 ? -16.354 2.551   107.359 1.00 70.21  ? 132  ASP C CG  1 
ATOM   5753  O OD1 . ASP C 1 132 ? -15.820 1.891   108.289 1.00 71.50  ? 132  ASP C OD1 1 
ATOM   5754  O OD2 . ASP C 1 132 ? -16.655 3.764   107.457 1.00 77.39  ? 132  ASP C OD2 1 
ATOM   5755  N N   . ARG C 1 133 ? -17.683 -1.283  105.696 1.00 53.30  ? 133  ARG C N   1 
ATOM   5756  C CA  . ARG C 1 133 ? -18.648 -2.126  105.018 1.00 52.02  ? 133  ARG C CA  1 
ATOM   5757  C C   . ARG C 1 133 ? -19.948 -1.323  104.842 1.00 51.54  ? 133  ARG C C   1 
ATOM   5758  O O   . ARG C 1 133 ? -20.404 -0.644  105.766 1.00 51.06  ? 133  ARG C O   1 
ATOM   5759  C CB  . ARG C 1 133 ? -18.871 -3.441  105.790 1.00 54.42  ? 133  ARG C CB  1 
ATOM   5760  C CG  . ARG C 1 133 ? -19.672 -4.497  105.041 1.00 64.15  ? 133  ARG C CG  1 
ATOM   5761  C CD  . ARG C 1 133 ? -21.139 -4.466  105.405 1.00 70.71  ? 133  ARG C CD  1 
ATOM   5762  N NE  . ARG C 1 133 ? -21.870 -5.551  104.762 1.00 77.60  ? 133  ARG C NE  1 
ATOM   5763  C CZ  . ARG C 1 133 ? -22.221 -6.678  105.371 1.00 93.49  ? 133  ARG C CZ  1 
ATOM   5764  N NH1 . ARG C 1 133 ? -22.865 -7.625  104.704 1.00 80.65  ? 133  ARG C NH1 1 
ATOM   5765  N NH2 . ARG C 1 133 ? -21.935 -6.866  106.654 1.00 80.41  ? 133  ARG C NH2 1 
ATOM   5766  N N   . PHE C 1 134 ? -20.534 -1.405  103.647 1.00 44.57  ? 134  PHE C N   1 
ATOM   5767  C CA  . PHE C 1 134 ? -21.787 -0.728  103.346 1.00 41.98  ? 134  PHE C CA  1 
ATOM   5768  C C   . PHE C 1 134 ? -22.868 -1.729  102.933 1.00 46.58  ? 134  PHE C C   1 
ATOM   5769  O O   . PHE C 1 134 ? -22.594 -2.918  102.726 1.00 46.38  ? 134  PHE C O   1 
ATOM   5770  C CB  . PHE C 1 134 ? -21.595 0.344   102.258 1.00 40.43  ? 134  PHE C CB  1 
ATOM   5771  C CG  . PHE C 1 134 ? -20.665 1.465   102.655 1.00 39.75  ? 134  PHE C CG  1 
ATOM   5772  C CD1 . PHE C 1 134 ? -20.941 2.260   103.761 1.00 40.88  ? 134  PHE C CD1 1 
ATOM   5773  C CD2 . PHE C 1 134 ? -19.509 1.726   101.925 1.00 40.45  ? 134  PHE C CD2 1 
ATOM   5774  C CE1 . PHE C 1 134 ? -20.064 3.271   104.148 1.00 40.68  ? 134  PHE C CE1 1 
ATOM   5775  C CE2 . PHE C 1 134 ? -18.642 2.759   102.299 1.00 41.92  ? 134  PHE C CE2 1 
ATOM   5776  C CZ  . PHE C 1 134 ? -18.928 3.526   103.405 1.00 39.72  ? 134  PHE C CZ  1 
ATOM   5777  N N   . GLY C 1 135 ? -24.094 -1.223  102.844 1.00 43.02  ? 135  GLY C N   1 
ATOM   5778  C CA  . GLY C 1 135 ? -25.253 -1.975  102.394 1.00 43.82  ? 135  GLY C CA  1 
ATOM   5779  C C   . GLY C 1 135 ? -25.369 -1.906  100.883 1.00 46.90  ? 135  GLY C C   1 
ATOM   5780  O O   . GLY C 1 135 ? -24.355 -1.902  100.170 1.00 46.80  ? 135  GLY C O   1 
ATOM   5781  N N   . SER C 1 136 ? -26.605 -1.828  100.387 1.00 42.53  ? 136  SER C N   1 
ATOM   5782  C CA  . SER C 1 136 ? -26.901 -1.786  98.957  1.00 41.47  ? 136  SER C CA  1 
ATOM   5783  C C   . SER C 1 136 ? -26.449 -0.487  98.290  1.00 43.70  ? 136  SER C C   1 
ATOM   5784  O O   . SER C 1 136 ? -26.401 0.565   98.933  1.00 43.17  ? 136  SER C O   1 
ATOM   5785  C CB  . SER C 1 136 ? -28.400 -1.968  98.731  1.00 45.52  ? 136  SER C CB  1 
ATOM   5786  O OG  . SER C 1 136 ? -28.725 -2.003  97.351  1.00 55.13  ? 136  SER C OG  1 
ATOM   5787  N N   . ASP C 1 137 ? -26.116 -0.571  96.994  1.00 39.17  ? 137  ASP C N   1 
ATOM   5788  C CA  . ASP C 1 137 ? -25.804 0.592   96.176  1.00 37.03  ? 137  ASP C CA  1 
ATOM   5789  C C   . ASP C 1 137 ? -27.155 1.132   95.678  1.00 40.07  ? 137  ASP C C   1 
ATOM   5790  O O   . ASP C 1 137 ? -28.153 0.390   95.689  1.00 40.17  ? 137  ASP C O   1 
ATOM   5791  C CB  . ASP C 1 137 ? -24.822 0.263   95.032  1.00 38.88  ? 137  ASP C CB  1 
ATOM   5792  C CG  . ASP C 1 137 ? -25.317 -0.715  93.994  1.00 52.53  ? 137  ASP C CG  1 
ATOM   5793  O OD1 . ASP C 1 137 ? -24.869 -1.871  94.015  1.00 57.44  ? 137  ASP C OD1 1 
ATOM   5794  O OD2 . ASP C 1 137 ? -26.105 -0.308  93.129  1.00 55.60  ? 137  ASP C OD2 1 
ATOM   5795  N N   . LEU C 1 138 ? -27.206 2.406   95.273  1.00 34.69  ? 138  LEU C N   1 
ATOM   5796  C CA  . LEU C 1 138 ? -28.457 3.014   94.833  1.00 34.21  ? 138  LEU C CA  1 
ATOM   5797  C C   . LEU C 1 138 ? -28.954 2.497   93.480  1.00 38.74  ? 138  LEU C C   1 
ATOM   5798  O O   . LEU C 1 138 ? -30.156 2.563   93.243  1.00 39.29  ? 138  LEU C O   1 
ATOM   5799  C CB  . LEU C 1 138 ? -28.350 4.540   94.786  1.00 33.06  ? 138  LEU C CB  1 
ATOM   5800  C CG  . LEU C 1 138 ? -28.387 5.286   96.114  1.00 38.17  ? 138  LEU C CG  1 
ATOM   5801  C CD1 . LEU C 1 138 ? -28.334 6.746   95.859  1.00 38.25  ? 138  LEU C CD1 1 
ATOM   5802  C CD2 . LEU C 1 138 ? -29.659 4.995   96.899  1.00 41.33  ? 138  LEU C CD2 1 
ATOM   5803  N N   . GLN C 1 139 ? -28.058 1.998   92.599  1.00 35.65  ? 139  GLN C N   1 
ATOM   5804  C CA  . GLN C 1 139 ? -28.431 1.479   91.275  1.00 35.48  ? 139  GLN C CA  1 
ATOM   5805  C C   . GLN C 1 139 ? -29.383 0.287   91.401  1.00 40.18  ? 139  GLN C C   1 
ATOM   5806  O O   . GLN C 1 139 ? -30.375 0.238   90.670  1.00 40.92  ? 139  GLN C O   1 
ATOM   5807  C CB  . GLN C 1 139 ? -27.192 1.114   90.443  1.00 36.56  ? 139  GLN C CB  1 
ATOM   5808  C CG  . GLN C 1 139 ? -27.491 0.768   88.970  1.00 44.23  ? 139  GLN C CG  1 
ATOM   5809  C CD  . GLN C 1 139 ? -28.184 1.861   88.171  1.00 51.77  ? 139  GLN C CD  1 
ATOM   5810  O OE1 . GLN C 1 139 ? -27.934 3.060   88.329  1.00 43.88  ? 139  GLN C OE1 1 
ATOM   5811  N NE2 . GLN C 1 139 ? -29.051 1.462   87.256  1.00 43.13  ? 139  GLN C NE2 1 
ATOM   5812  N N   . LYS C 1 140 ? -29.120 -0.629  92.356  1.00 36.78  ? 140  LYS C N   1 
ATOM   5813  C CA  . LYS C 1 140 ? -29.964 -1.802  92.628  1.00 38.54  ? 140  LYS C CA  1 
ATOM   5814  C C   . LYS C 1 140 ? -31.363 -1.375  93.088  1.00 41.69  ? 140  LYS C C   1 
ATOM   5815  O O   . LYS C 1 140 ? -32.352 -1.908  92.591  1.00 42.28  ? 140  LYS C O   1 
ATOM   5816  C CB  . LYS C 1 140 ? -29.330 -2.724  93.689  1.00 42.52  ? 140  LYS C CB  1 
ATOM   5817  C CG  . LYS C 1 140 ? -28.053 -3.431  93.252  1.00 59.87  ? 140  LYS C CG  1 
ATOM   5818  C CD  . LYS C 1 140 ? -27.662 -4.511  94.255  1.00 69.82  ? 140  LYS C CD  1 
ATOM   5819  C CE  . LYS C 1 140 ? -26.232 -4.959  94.092  1.00 80.27  ? 140  LYS C CE  1 
ATOM   5820  N NZ  . LYS C 1 140 ? -25.340 -4.289  95.071  1.00 87.23  ? 140  LYS C NZ  1 
ATOM   5821  N N   . ILE C 1 141 ? -31.433 -0.394  94.012  1.00 37.11  ? 141  ILE C N   1 
ATOM   5822  C CA  . ILE C 1 141 ? -32.675 0.149   94.571  1.00 37.01  ? 141  ILE C CA  1 
ATOM   5823  C C   . ILE C 1 141 ? -33.456 0.887   93.466  1.00 40.69  ? 141  ILE C C   1 
ATOM   5824  O O   . ILE C 1 141 ? -34.671 0.726   93.366  1.00 41.10  ? 141  ILE C O   1 
ATOM   5825  C CB  . ILE C 1 141 ? -32.373 1.050   95.809  1.00 38.91  ? 141  ILE C CB  1 
ATOM   5826  C CG1 . ILE C 1 141 ? -31.713 0.220   96.935  1.00 39.66  ? 141  ILE C CG1 1 
ATOM   5827  C CG2 . ILE C 1 141 ? -33.653 1.746   96.328  1.00 40.51  ? 141  ILE C CG2 1 
ATOM   5828  C CD1 . ILE C 1 141 ? -30.785 0.965   97.843  1.00 45.55  ? 141  ILE C CD1 1 
ATOM   5829  N N   . TYR C 1 142 ? -32.739 1.652   92.624  1.00 36.52  ? 142  TYR C N   1 
ATOM   5830  C CA  . TYR C 1 142 ? -33.257 2.417   91.495  1.00 36.33  ? 142  TYR C CA  1 
ATOM   5831  C C   . TYR C 1 142 ? -33.933 1.489   90.486  1.00 43.64  ? 142  TYR C C   1 
ATOM   5832  O O   . TYR C 1 142 ? -35.083 1.725   90.110  1.00 44.64  ? 142  TYR C O   1 
ATOM   5833  C CB  . TYR C 1 142 ? -32.090 3.179   90.842  1.00 35.77  ? 142  TYR C CB  1 
ATOM   5834  C CG  . TYR C 1 142 ? -32.409 3.924   89.569  1.00 35.59  ? 142  TYR C CG  1 
ATOM   5835  C CD1 . TYR C 1 142 ? -33.104 5.128   89.600  1.00 36.93  ? 142  TYR C CD1 1 
ATOM   5836  C CD2 . TYR C 1 142 ? -31.927 3.480   88.341  1.00 36.07  ? 142  TYR C CD2 1 
ATOM   5837  C CE1 . TYR C 1 142 ? -33.354 5.849   88.434  1.00 37.22  ? 142  TYR C CE1 1 
ATOM   5838  C CE2 . TYR C 1 142 ? -32.174 4.188   87.168  1.00 36.48  ? 142  TYR C CE2 1 
ATOM   5839  C CZ  . TYR C 1 142 ? -32.881 5.378   87.220  1.00 40.46  ? 142  TYR C CZ  1 
ATOM   5840  O OH  . TYR C 1 142 ? -33.087 6.110   86.081  1.00 37.40  ? 142  TYR C OH  1 
ATOM   5841  N N   . GLU C 1 143 ? -33.227 0.413   90.085  1.00 41.33  ? 143  GLU C N   1 
ATOM   5842  C CA  . GLU C 1 143 ? -33.725 -0.590  89.141  1.00 42.46  ? 143  GLU C CA  1 
ATOM   5843  C C   . GLU C 1 143 ? -34.936 -1.348  89.713  1.00 48.75  ? 143  GLU C C   1 
ATOM   5844  O O   . GLU C 1 143 ? -35.870 -1.646  88.970  1.00 49.52  ? 143  GLU C O   1 
ATOM   5845  C CB  . GLU C 1 143 ? -32.606 -1.558  88.754  1.00 43.76  ? 143  GLU C CB  1 
ATOM   5846  C CG  . GLU C 1 143 ? -31.659 -0.949  87.740  1.00 47.39  ? 143  GLU C CG  1 
ATOM   5847  C CD  . GLU C 1 143 ? -30.365 -1.678  87.451  1.00 67.54  ? 143  GLU C CD  1 
ATOM   5848  O OE1 . GLU C 1 143 ? -29.624 -1.183  86.575  1.00 47.30  ? 143  GLU C OE1 1 
ATOM   5849  O OE2 . GLU C 1 143 ? -30.055 -2.688  88.123  1.00 73.21  ? 143  GLU C OE2 1 
ATOM   5850  N N   . ALA C 1 144 ? -34.935 -1.604  91.036  1.00 46.33  ? 144  ALA C N   1 
ATOM   5851  C CA  . ALA C 1 144 ? -36.024 -2.274  91.748  1.00 47.81  ? 144  ALA C CA  1 
ATOM   5852  C C   . ALA C 1 144 ? -37.265 -1.373  91.868  1.00 52.90  ? 144  ALA C C   1 
ATOM   5853  O O   . ALA C 1 144 ? -38.371 -1.885  92.046  1.00 55.78  ? 144  ALA C O   1 
ATOM   5854  C CB  . ALA C 1 144 ? -35.557 -2.703  93.132  1.00 48.79  ? 144  ALA C CB  1 
ATOM   5855  N N   . ASN C 1 145 ? -37.085 -0.044  91.765  1.00 47.80  ? 145  ASN C N   1 
ATOM   5856  C CA  . ASN C 1 145 ? -38.167 0.939   91.862  1.00 47.55  ? 145  ASN C CA  1 
ATOM   5857  C C   . ASN C 1 145 ? -38.577 1.436   90.457  1.00 49.88  ? 145  ASN C C   1 
ATOM   5858  O O   . ASN C 1 145 ? -39.052 2.564   90.307  1.00 49.33  ? 145  ASN C O   1 
ATOM   5859  C CB  . ASN C 1 145 ? -37.741 2.101   92.782  1.00 50.26  ? 145  ASN C CB  1 
ATOM   5860  C CG  . ASN C 1 145 ? -38.872 2.918   93.360  1.00 89.56  ? 145  ASN C CG  1 
ATOM   5861  O OD1 . ASN C 1 145 ? -39.975 2.427   93.615  1.00 92.94  ? 145  ASN C OD1 1 
ATOM   5862  N ND2 . ASN C 1 145 ? -38.608 4.188   93.616  1.00 84.96  ? 145  ASN C ND2 1 
ATOM   5863  N N   . ALA C 1 146 ? -38.434 0.552   89.440  1.00 46.41  ? 146  ALA C N   1 
ATOM   5864  C CA  . ALA C 1 146 ? -38.766 0.746   88.017  1.00 46.21  ? 146  ALA C CA  1 
ATOM   5865  C C   . ALA C 1 146 ? -38.041 1.959   87.397  1.00 48.03  ? 146  ALA C C   1 
ATOM   5866  O O   . ALA C 1 146 ? -38.628 2.698   86.596  1.00 48.07  ? 146  ALA C O   1 
ATOM   5867  C CB  . ALA C 1 146 ? -40.280 0.865   87.829  1.00 48.44  ? 146  ALA C CB  1 
ATOM   5868  N N   . LYS C 1 147 ? -36.741 2.118   87.744  1.00 43.11  ? 147  LYS C N   1 
ATOM   5869  C CA  . LYS C 1 147 ? -35.824 3.166   87.269  1.00 41.59  ? 147  LYS C CA  1 
ATOM   5870  C C   . LYS C 1 147 ? -36.371 4.585   87.563  1.00 45.57  ? 147  LYS C C   1 
ATOM   5871  O O   . LYS C 1 147 ? -36.297 5.473   86.714  1.00 45.26  ? 147  LYS C O   1 
ATOM   5872  C CB  . LYS C 1 147 ? -35.466 2.996   85.772  1.00 43.98  ? 147  LYS C CB  1 
ATOM   5873  C CG  . LYS C 1 147 ? -34.541 1.823   85.489  1.00 49.65  ? 147  LYS C CG  1 
ATOM   5874  C CD  . LYS C 1 147 ? -34.040 1.823   84.058  1.00 55.48  ? 147  LYS C CD  1 
ATOM   5875  C CE  . LYS C 1 147 ? -33.136 0.646   83.799  1.00 67.15  ? 147  LYS C CE  1 
ATOM   5876  N NZ  . LYS C 1 147 ? -33.109 0.278   82.355  1.00 76.99  ? 147  LYS C NZ  1 
ATOM   5877  N N   . ARG C 1 148 ? -36.887 4.793   88.787  1.00 41.75  ? 148  ARG C N   1 
ATOM   5878  C CA  . ARG C 1 148 ? -37.392 6.090   89.252  1.00 40.39  ? 148  ARG C CA  1 
ATOM   5879  C C   . ARG C 1 148 ? -37.120 6.298   90.731  1.00 43.39  ? 148  ARG C C   1 
ATOM   5880  O O   . ARG C 1 148 ? -37.201 5.353   91.520  1.00 44.55  ? 148  ARG C O   1 
ATOM   5881  C CB  . ARG C 1 148 ? -38.914 6.264   89.029  1.00 38.76  ? 148  ARG C CB  1 
ATOM   5882  C CG  . ARG C 1 148 ? -39.450 6.201   87.600  1.00 45.15  ? 148  ARG C CG  1 
ATOM   5883  C CD  . ARG C 1 148 ? -39.052 7.359   86.690  1.00 43.37  ? 148  ARG C CD  1 
ATOM   5884  N NE  . ARG C 1 148 ? -39.723 7.280   85.384  1.00 45.50  ? 148  ARG C NE  1 
ATOM   5885  C CZ  . ARG C 1 148 ? -39.393 6.435   84.407  1.00 49.79  ? 148  ARG C CZ  1 
ATOM   5886  N NH1 . ARG C 1 148 ? -38.399 5.576   84.571  1.00 37.52  ? 148  ARG C NH1 1 
ATOM   5887  N NH2 . ARG C 1 148 ? -40.054 6.449   83.260  1.00 34.87  ? 148  ARG C NH2 1 
ATOM   5888  N N   . PHE C 1 149 ? -36.825 7.553   91.097  1.00 36.31  ? 149  PHE C N   1 
ATOM   5889  C CA  . PHE C 1 149 ? -36.691 8.043   92.464  1.00 34.21  ? 149  PHE C CA  1 
ATOM   5890  C C   . PHE C 1 149 ? -37.614 9.237   92.586  1.00 37.10  ? 149  PHE C C   1 
ATOM   5891  O O   . PHE C 1 149 ? -37.722 10.014  91.638  1.00 36.88  ? 149  PHE C O   1 
ATOM   5892  C CB  . PHE C 1 149 ? -35.243 8.423   92.829  1.00 33.87  ? 149  PHE C CB  1 
ATOM   5893  C CG  . PHE C 1 149 ? -34.259 7.323   93.164  1.00 34.09  ? 149  PHE C CG  1 
ATOM   5894  C CD1 . PHE C 1 149 ? -34.671 6.170   93.822  1.00 37.97  ? 149  PHE C CD1 1 
ATOM   5895  C CD2 . PHE C 1 149 ? -32.908 7.467   92.875  1.00 33.38  ? 149  PHE C CD2 1 
ATOM   5896  C CE1 . PHE C 1 149 ? -33.757 5.158   94.133  1.00 38.28  ? 149  PHE C CE1 1 
ATOM   5897  C CE2 . PHE C 1 149 ? -31.996 6.459   93.195  1.00 35.61  ? 149  PHE C CE2 1 
ATOM   5898  C CZ  . PHE C 1 149 ? -32.426 5.311   93.819  1.00 34.93  ? 149  PHE C CZ  1 
ATOM   5899  N N   . SER C 1 150 ? -38.299 9.379   93.722  1.00 33.90  ? 150  SER C N   1 
ATOM   5900  C CA  . SER C 1 150 ? -39.205 10.506  93.946  1.00 34.04  ? 150  SER C CA  1 
ATOM   5901  C C   . SER C 1 150 ? -38.426 11.823  94.083  1.00 37.87  ? 150  SER C C   1 
ATOM   5902  O O   . SER C 1 150 ? -37.237 11.803  94.401  1.00 36.78  ? 150  SER C O   1 
ATOM   5903  C CB  . SER C 1 150 ? -40.045 10.268  95.197  1.00 36.90  ? 150  SER C CB  1 
ATOM   5904  O OG  . SER C 1 150 ? -39.230 10.121  96.345  1.00 41.56  ? 150  SER C OG  1 
ATOM   5905  N N   . ARG C 1 151 ? -39.106 12.957  93.859  1.00 35.94  ? 151  ARG C N   1 
ATOM   5906  C CA  . ARG C 1 151 ? -38.558 14.306  94.007  1.00 35.16  ? 151  ARG C CA  1 
ATOM   5907  C C   . ARG C 1 151 ? -37.946 14.466  95.414  1.00 39.27  ? 151  ARG C C   1 
ATOM   5908  O O   . ARG C 1 151 ? -36.837 14.982  95.539  1.00 38.39  ? 151  ARG C O   1 
ATOM   5909  C CB  . ARG C 1 151 ? -39.662 15.346  93.748  1.00 34.98  ? 151  ARG C CB  1 
ATOM   5910  C CG  . ARG C 1 151 ? -39.153 16.762  93.526  1.00 38.94  ? 151  ARG C CG  1 
ATOM   5911  C CD  . ARG C 1 151 ? -40.249 17.602  92.921  1.00 41.22  ? 151  ARG C CD  1 
ATOM   5912  N NE  . ARG C 1 151 ? -39.943 19.032  92.946  1.00 42.54  ? 151  ARG C NE  1 
ATOM   5913  C CZ  . ARG C 1 151 ? -40.815 19.985  92.636  1.00 50.91  ? 151  ARG C CZ  1 
ATOM   5914  N NH1 . ARG C 1 151 ? -42.056 19.672  92.297  1.00 40.68  ? 151  ARG C NH1 1 
ATOM   5915  N NH2 . ARG C 1 151 ? -40.457 21.260  92.676  1.00 38.57  ? 151  ARG C NH2 1 
ATOM   5916  N N   . LYS C 1 152 ? -38.642 13.947  96.447  1.00 36.64  ? 152  LYS C N   1 
ATOM   5917  C CA  . LYS C 1 152 ? -38.206 13.937  97.849  1.00 35.56  ? 152  LYS C CA  1 
ATOM   5918  C C   . LYS C 1 152 ? -36.883 13.167  97.981  1.00 37.24  ? 152  LYS C C   1 
ATOM   5919  O O   . LYS C 1 152 ? -35.950 13.700  98.573  1.00 36.87  ? 152  LYS C O   1 
ATOM   5920  C CB  . LYS C 1 152 ? -39.308 13.324  98.752  1.00 38.00  ? 152  LYS C CB  1 
ATOM   5921  C CG  . LYS C 1 152 ? -38.879 12.966  100.178 1.00 41.88  ? 152  LYS C CG  1 
ATOM   5922  C CD  . LYS C 1 152 ? -38.709 14.180  101.088 1.00 43.07  ? 152  LYS C CD  1 
ATOM   5923  C CE  . LYS C 1 152 ? -38.276 13.776  102.481 1.00 41.56  ? 152  LYS C CE  1 
ATOM   5924  N NZ  . LYS C 1 152 ? -37.953 14.959  103.310 1.00 40.76  ? 152  LYS C NZ  1 
ATOM   5925  N N   . THR C 1 153 ? -36.801 11.940  97.411  1.00 33.07  ? 153  THR C N   1 
ATOM   5926  C CA  . THR C 1 153 ? -35.604 11.088  97.442  1.00 31.89  ? 153  THR C CA  1 
ATOM   5927  C C   . THR C 1 153 ? -34.415 11.774  96.748  1.00 33.16  ? 153  THR C C   1 
ATOM   5928  O O   . THR C 1 153 ? -33.331 11.830  97.335  1.00 32.44  ? 153  THR C O   1 
ATOM   5929  C CB  . THR C 1 153 ? -35.904 9.717   96.806  1.00 37.34  ? 153  THR C CB  1 
ATOM   5930  O OG1 . THR C 1 153 ? -36.894 9.070   97.590  1.00 37.36  ? 153  THR C OG1 1 
ATOM   5931  C CG2 . THR C 1 153 ? -34.669 8.813   96.714  1.00 34.33  ? 153  THR C CG2 1 
ATOM   5932  N N   . VAL C 1 154 ? -34.626 12.294  95.519  1.00 27.72  ? 154  VAL C N   1 
ATOM   5933  C CA  . VAL C 1 154 ? -33.588 12.945  94.722  1.00 26.74  ? 154  VAL C CA  1 
ATOM   5934  C C   . VAL C 1 154 ? -33.035 14.182  95.456  1.00 32.21  ? 154  VAL C C   1 
ATOM   5935  O O   . VAL C 1 154 ? -31.813 14.353  95.489  1.00 31.75  ? 154  VAL C O   1 
ATOM   5936  C CB  . VAL C 1 154 ? -34.085 13.282  93.284  1.00 29.88  ? 154  VAL C CB  1 
ATOM   5937  C CG1 . VAL C 1 154 ? -33.073 14.121  92.510  1.00 27.73  ? 154  VAL C CG1 1 
ATOM   5938  C CG2 . VAL C 1 154 ? -34.411 12.009  92.519  1.00 30.01  ? 154  VAL C CG2 1 
ATOM   5939  N N   . LEU C 1 155 ? -33.920 15.015  96.059  1.00 29.53  ? 155  LEU C N   1 
ATOM   5940  C CA  . LEU C 1 155 ? -33.504 16.227  96.766  1.00 29.08  ? 155  LEU C CA  1 
ATOM   5941  C C   . LEU C 1 155 ? -32.716 15.877  98.034  1.00 33.64  ? 155  LEU C C   1 
ATOM   5942  O O   . LEU C 1 155 ? -31.682 16.498  98.283  1.00 32.89  ? 155  LEU C O   1 
ATOM   5943  C CB  . LEU C 1 155 ? -34.704 17.137  97.081  1.00 30.22  ? 155  LEU C CB  1 
ATOM   5944  C CG  . LEU C 1 155 ? -35.388 17.805  95.862  1.00 34.76  ? 155  LEU C CG  1 
ATOM   5945  C CD1 . LEU C 1 155 ? -36.776 18.316  96.213  1.00 35.63  ? 155  LEU C CD1 1 
ATOM   5946  C CD2 . LEU C 1 155 ? -34.530 18.904  95.261  1.00 35.46  ? 155  LEU C CD2 1 
ATOM   5947  N N   . GLN C 1 156 ? -33.155 14.844  98.785  1.00 31.13  ? 156  GLN C N   1 
ATOM   5948  C CA  . GLN C 1 156 ? -32.498 14.386  100.009 1.00 31.20  ? 156  GLN C CA  1 
ATOM   5949  C C   . GLN C 1 156 ? -31.135 13.769  99.694  1.00 34.43  ? 156  GLN C C   1 
ATOM   5950  O O   . GLN C 1 156 ? -30.166 14.025  100.423 1.00 33.98  ? 156  GLN C O   1 
ATOM   5951  C CB  . GLN C 1 156 ? -33.375 13.387  100.799 1.00 33.56  ? 156  GLN C CB  1 
ATOM   5952  C CG  . GLN C 1 156 ? -34.612 13.973  101.491 1.00 31.52  ? 156  GLN C CG  1 
ATOM   5953  C CD  . GLN C 1 156 ? -34.389 15.057  102.534 1.00 47.06  ? 156  GLN C CD  1 
ATOM   5954  O OE1 . GLN C 1 156 ? -35.259 15.903  102.743 1.00 46.52  ? 156  GLN C OE1 1 
ATOM   5955  N NE2 . GLN C 1 156 ? -33.254 15.068  103.229 1.00 31.01  ? 156  GLN C NE2 1 
ATOM   5956  N N   . LEU C 1 157 ? -31.051 12.970  98.611  1.00 30.77  ? 157  LEU C N   1 
ATOM   5957  C CA  . LEU C 1 157 ? -29.782 12.383  98.166  1.00 29.37  ? 157  LEU C CA  1 
ATOM   5958  C C   . LEU C 1 157 ? -28.792 13.473  97.785  1.00 30.98  ? 157  LEU C C   1 
ATOM   5959  O O   . LEU C 1 157 ? -27.659 13.454  98.257  1.00 30.55  ? 157  LEU C O   1 
ATOM   5960  C CB  . LEU C 1 157 ? -29.975 11.441  96.958  1.00 29.23  ? 157  LEU C CB  1 
ATOM   5961  C CG  . LEU C 1 157 ? -30.618 10.084  97.201  1.00 35.14  ? 157  LEU C CG  1 
ATOM   5962  C CD1 . LEU C 1 157 ? -30.934 9.404   95.869  1.00 35.76  ? 157  LEU C CD1 1 
ATOM   5963  C CD2 . LEU C 1 157 ? -29.756 9.186   98.109  1.00 36.33  ? 157  LEU C CD2 1 
ATOM   5964  N N   . SER C 1 158 ? -29.244 14.440  96.958  1.00 26.59  ? 158  SER C N   1 
ATOM   5965  C CA  . SER C 1 158 ? -28.439 15.540  96.427  1.00 25.32  ? 158  SER C CA  1 
ATOM   5966  C C   . SER C 1 158 ? -27.915 16.464  97.510  1.00 30.05  ? 158  SER C C   1 
ATOM   5967  O O   . SER C 1 158 ? -26.788 16.929  97.378  1.00 30.29  ? 158  SER C O   1 
ATOM   5968  C CB  . SER C 1 158 ? -29.225 16.334  95.394  1.00 27.45  ? 158  SER C CB  1 
ATOM   5969  O OG  . SER C 1 158 ? -29.624 15.463  94.350  1.00 37.25  ? 158  SER C OG  1 
ATOM   5970  N N   . LEU C 1 159 ? -28.694 16.716  98.583  1.00 27.32  ? 159  LEU C N   1 
ATOM   5971  C CA  . LEU C 1 159 ? -28.232 17.555  99.697  1.00 27.08  ? 159  LEU C CA  1 
ATOM   5972  C C   . LEU C 1 159 ? -27.031 16.912  100.390 1.00 29.67  ? 159  LEU C C   1 
ATOM   5973  O O   . LEU C 1 159 ? -26.101 17.626  100.754 1.00 29.84  ? 159  LEU C O   1 
ATOM   5974  C CB  . LEU C 1 159 ? -29.350 17.822  100.722 1.00 28.61  ? 159  LEU C CB  1 
ATOM   5975  C CG  . LEU C 1 159 ? -30.444 18.828  100.322 1.00 33.34  ? 159  LEU C CG  1 
ATOM   5976  C CD1 . LEU C 1 159 ? -31.613 18.737  101.269 1.00 35.22  ? 159  LEU C CD1 1 
ATOM   5977  C CD2 . LEU C 1 159 ? -29.909 20.265  100.239 1.00 33.13  ? 159  LEU C CD2 1 
ATOM   5978  N N   . ARG C 1 160 ? -27.044 15.566  100.549 1.00 26.61  ? 160  ARG C N   1 
ATOM   5979  C CA  . ARG C 1 160 ? -25.962 14.764  101.150 1.00 25.94  ? 160  ARG C CA  1 
ATOM   5980  C C   . ARG C 1 160 ? -24.756 14.689  100.240 1.00 28.60  ? 160  ARG C C   1 
ATOM   5981  O O   . ARG C 1 160 ? -23.632 14.707  100.732 1.00 29.30  ? 160  ARG C O   1 
ATOM   5982  C CB  . ARG C 1 160 ? -26.420 13.328  101.480 1.00 24.75  ? 160  ARG C CB  1 
ATOM   5983  C CG  . ARG C 1 160 ? -27.484 13.212  102.551 1.00 31.03  ? 160  ARG C CG  1 
ATOM   5984  C CD  . ARG C 1 160 ? -27.233 14.088  103.768 1.00 32.23  ? 160  ARG C CD  1 
ATOM   5985  N NE  . ARG C 1 160 ? -28.428 14.891  104.016 1.00 45.51  ? 160  ARG C NE  1 
ATOM   5986  C CZ  . ARG C 1 160 ? -28.446 16.209  104.166 1.00 49.39  ? 160  ARG C CZ  1 
ATOM   5987  N NH1 . ARG C 1 160 ? -27.318 16.898  104.171 1.00 30.52  ? 160  ARG C NH1 1 
ATOM   5988  N NH2 . ARG C 1 160 ? -29.591 16.842  104.353 1.00 37.31  ? 160  ARG C NH2 1 
ATOM   5989  N N   . ILE C 1 161 ? -24.982 14.574  98.927  1.00 23.99  ? 161  ILE C N   1 
ATOM   5990  C CA  . ILE C 1 161 ? -23.909 14.527  97.935  1.00 23.78  ? 161  ILE C CA  1 
ATOM   5991  C C   . ILE C 1 161 ? -23.217 15.906  97.915  1.00 29.57  ? 161  ILE C C   1 
ATOM   5992  O O   . ILE C 1 161 ? -21.987 15.940  97.889  1.00 30.59  ? 161  ILE C O   1 
ATOM   5993  C CB  . ILE C 1 161 ? -24.412 14.045  96.538  1.00 25.85  ? 161  ILE C CB  1 
ATOM   5994  C CG1 . ILE C 1 161 ? -24.889 12.568  96.619  1.00 26.19  ? 161  ILE C CG1 1 
ATOM   5995  C CG2 . ILE C 1 161 ? -23.340 14.219  95.443  1.00 24.61  ? 161  ILE C CG2 1 
ATOM   5996  C CD1 . ILE C 1 161 ? -25.843 12.135  95.498  1.00 28.31  ? 161  ILE C CD1 1 
ATOM   5997  N N   . LEU C 1 162 ? -23.982 17.017  98.044  1.00 26.60  ? 162  LEU C N   1 
ATOM   5998  C CA  . LEU C 1 162 ? -23.413 18.372  98.113  1.00 26.74  ? 162  LEU C CA  1 
ATOM   5999  C C   . LEU C 1 162 ? -22.484 18.517  99.313  1.00 31.02  ? 162  LEU C C   1 
ATOM   6000  O O   . LEU C 1 162 ? -21.455 19.193  99.191  1.00 31.33  ? 162  LEU C O   1 
ATOM   6001  C CB  . LEU C 1 162 ? -24.486 19.480  98.134  1.00 27.22  ? 162  LEU C CB  1 
ATOM   6002  C CG  . LEU C 1 162 ? -25.187 19.785  96.781  1.00 32.27  ? 162  LEU C CG  1 
ATOM   6003  C CD1 . LEU C 1 162 ? -26.156 20.925  96.920  1.00 33.18  ? 162  LEU C CD1 1 
ATOM   6004  C CD2 . LEU C 1 162 ? -24.196 20.110  95.669  1.00 33.56  ? 162  LEU C CD2 1 
ATOM   6005  N N   . ASP C 1 163 ? -22.815 17.860  100.448 1.00 26.46  ? 163  ASP C N   1 
ATOM   6006  C CA  . ASP C 1 163 ? -21.982 17.847  101.654 1.00 26.87  ? 163  ASP C CA  1 
ATOM   6007  C C   . ASP C 1 163 ? -20.665 17.100  101.390 1.00 31.21  ? 163  ASP C C   1 
ATOM   6008  O O   . ASP C 1 163 ? -19.602 17.593  101.767 1.00 31.18  ? 163  ASP C O   1 
ATOM   6009  C CB  . ASP C 1 163 ? -22.718 17.197  102.838 1.00 29.68  ? 163  ASP C CB  1 
ATOM   6010  C CG  . ASP C 1 163 ? -23.875 17.977  103.445 1.00 34.20  ? 163  ASP C CG  1 
ATOM   6011  O OD1 . ASP C 1 163 ? -23.941 19.217  103.245 1.00 35.76  ? 163  ASP C OD1 1 
ATOM   6012  O OD2 . ASP C 1 163 ? -24.673 17.362  104.173 1.00 36.20  ? 163  ASP C OD2 1 
ATOM   6013  N N   . ILE C 1 164 ? -20.742 15.925  100.715 1.00 27.87  ? 164  ILE C N   1 
ATOM   6014  C CA  . ILE C 1 164 ? -19.593 15.082  100.330 1.00 27.04  ? 164  ILE C CA  1 
ATOM   6015  C C   . ILE C 1 164 ? -18.682 15.864  99.383  1.00 30.70  ? 164  ILE C C   1 
ATOM   6016  O O   . ILE C 1 164 ? -17.470 15.928  99.613  1.00 31.80  ? 164  ILE C O   1 
ATOM   6017  C CB  . ILE C 1 164 ? -20.040 13.731  99.682  1.00 29.05  ? 164  ILE C CB  1 
ATOM   6018  C CG1 . ILE C 1 164 ? -20.825 12.856  100.670 1.00 29.46  ? 164  ILE C CG1 1 
ATOM   6019  C CG2 . ILE C 1 164 ? -18.826 12.957  99.103  1.00 29.06  ? 164  ILE C CG2 1 
ATOM   6020  C CD1 . ILE C 1 164 ? -21.754 11.802  99.998  1.00 32.92  ? 164  ILE C CD1 1 
ATOM   6021  N N   . LEU C 1 165 ? -19.278 16.456  98.322  1.00 25.62  ? 165  LEU C N   1 
ATOM   6022  C CA  . LEU C 1 165 ? -18.564 17.205  97.296  1.00 23.53  ? 165  LEU C CA  1 
ATOM   6023  C C   . LEU C 1 165 ? -17.902 18.439  97.882  1.00 27.14  ? 165  LEU C C   1 
ATOM   6024  O O   . LEU C 1 165 ? -16.714 18.612  97.638  1.00 27.46  ? 165  LEU C O   1 
ATOM   6025  C CB  . LEU C 1 165 ? -19.465 17.563  96.105  1.00 22.48  ? 165  LEU C CB  1 
ATOM   6026  C CG  . LEU C 1 165 ? -19.975 16.385  95.256  1.00 26.06  ? 165  LEU C CG  1 
ATOM   6027  C CD1 . LEU C 1 165 ? -20.867 16.881  94.108  1.00 26.10  ? 165  LEU C CD1 1 
ATOM   6028  C CD2 . LEU C 1 165 ? -18.827 15.492  94.740  1.00 22.80  ? 165  LEU C CD2 1 
ATOM   6029  N N   . GLU C 1 166 ? -18.602 19.234  98.723  1.00 23.47  ? 166  GLU C N   1 
ATOM   6030  C CA  . GLU C 1 166 ? -17.976 20.387  99.373  1.00 24.12  ? 166  GLU C CA  1 
ATOM   6031  C C   . GLU C 1 166 ? -16.727 19.956  100.177 1.00 29.11  ? 166  GLU C C   1 
ATOM   6032  O O   . GLU C 1 166 ? -15.683 20.595  100.060 1.00 29.21  ? 166  GLU C O   1 
ATOM   6033  C CB  . GLU C 1 166 ? -18.955 21.117  100.288 1.00 26.13  ? 166  GLU C CB  1 
ATOM   6034  C CG  . GLU C 1 166 ? -18.305 22.319  100.960 1.00 33.07  ? 166  GLU C CG  1 
ATOM   6035  C CD  . GLU C 1 166 ? -19.213 23.309  101.648 1.00 39.96  ? 166  GLU C CD  1 
ATOM   6036  O OE1 . GLU C 1 166 ? -20.367 22.948  101.964 1.00 34.29  ? 166  GLU C OE1 1 
ATOM   6037  O OE2 . GLU C 1 166 ? -18.762 24.452  101.878 1.00 38.30  ? 166  GLU C OE2 1 
ATOM   6038  N N   . TYR C 1 167 ? -16.838 18.865  100.964 1.00 25.33  ? 167  TYR C N   1 
ATOM   6039  C CA  . TYR C 1 167 ? -15.753 18.311  101.774 1.00 24.40  ? 167  TYR C CA  1 
ATOM   6040  C C   . TYR C 1 167 ? -14.529 17.938  100.924 1.00 30.24  ? 167  TYR C C   1 
ATOM   6041  O O   . TYR C 1 167 ? -13.437 18.420  101.210 1.00 30.87  ? 167  TYR C O   1 
ATOM   6042  C CB  . TYR C 1 167 ? -16.225 17.069  102.586 1.00 24.17  ? 167  TYR C CB  1 
ATOM   6043  C CG  . TYR C 1 167 ? -15.102 16.416  103.368 1.00 25.55  ? 167  TYR C CG  1 
ATOM   6044  C CD1 . TYR C 1 167 ? -14.339 15.386  102.810 1.00 27.05  ? 167  TYR C CD1 1 
ATOM   6045  C CD2 . TYR C 1 167 ? -14.751 16.872  104.629 1.00 26.77  ? 167  TYR C CD2 1 
ATOM   6046  C CE1 . TYR C 1 167 ? -13.257 14.832  103.492 1.00 27.77  ? 167  TYR C CE1 1 
ATOM   6047  C CE2 . TYR C 1 167 ? -13.694 16.308  105.333 1.00 28.16  ? 167  TYR C CE2 1 
ATOM   6048  C CZ  . TYR C 1 167 ? -12.937 15.297  104.755 1.00 34.98  ? 167  TYR C CZ  1 
ATOM   6049  O OH  . TYR C 1 167 ? -11.868 14.766  105.435 1.00 36.77  ? 167  TYR C OH  1 
ATOM   6050  N N   . ILE C 1 168 ? -14.702 17.068  99.907  1.00 26.83  ? 168  ILE C N   1 
ATOM   6051  C CA  . ILE C 1 168 ? -13.586 16.593  99.083  1.00 26.81  ? 168  ILE C CA  1 
ATOM   6052  C C   . ILE C 1 168 ? -12.970 17.761  98.280  1.00 30.95  ? 168  ILE C C   1 
ATOM   6053  O O   . ILE C 1 168 ? -11.745 17.815  98.164  1.00 31.91  ? 168  ILE C O   1 
ATOM   6054  C CB  . ILE C 1 168 ? -13.937 15.352  98.196  1.00 29.47  ? 168  ILE C CB  1 
ATOM   6055  C CG1 . ILE C 1 168 ? -14.967 15.661  97.098  1.00 28.66  ? 168  ILE C CG1 1 
ATOM   6056  C CG2 . ILE C 1 168 ? -14.369 14.143  99.066  1.00 31.23  ? 168  ILE C CG2 1 
ATOM   6057  C CD1 . ILE C 1 168 ? -14.957 14.684  95.959  1.00 29.03  ? 168  ILE C CD1 1 
ATOM   6058  N N   . HIS C 1 169 ? -13.802 18.709  97.788  1.00 25.75  ? 169  HIS C N   1 
ATOM   6059  C CA  . HIS C 1 169 ? -13.341 19.898  97.053  1.00 24.73  ? 169  HIS C CA  1 
ATOM   6060  C C   . HIS C 1 169 ? -12.486 20.789  97.958  1.00 28.99  ? 169  HIS C C   1 
ATOM   6061  O O   . HIS C 1 169 ? -11.454 21.284  97.514  1.00 30.14  ? 169  HIS C O   1 
ATOM   6062  C CB  . HIS C 1 169 ? -14.519 20.700  96.469  1.00 24.01  ? 169  HIS C CB  1 
ATOM   6063  C CG  . HIS C 1 169 ? -15.312 19.985  95.403  1.00 26.10  ? 169  HIS C CG  1 
ATOM   6064  N ND1 . HIS C 1 169 ? -16.488 20.519  94.905  1.00 27.14  ? 169  HIS C ND1 1 
ATOM   6065  C CD2 . HIS C 1 169 ? -15.088 18.796  94.796  1.00 27.05  ? 169  HIS C CD2 1 
ATOM   6066  C CE1 . HIS C 1 169 ? -16.933 19.651  94.014  1.00 25.92  ? 169  HIS C CE1 1 
ATOM   6067  N NE2 . HIS C 1 169 ? -16.122 18.599  93.912  1.00 26.41  ? 169  HIS C NE2 1 
ATOM   6068  N N   . GLU C 1 170 ? -12.884 20.944  99.234  1.00 23.69  ? 170  GLU C N   1 
ATOM   6069  C CA  . GLU C 1 170 ? -12.142 21.728  100.218 1.00 24.61  ? 170  GLU C CA  1 
ATOM   6070  C C   . GLU C 1 170 ? -10.860 21.016  100.654 1.00 31.98  ? 170  GLU C C   1 
ATOM   6071  O O   . GLU C 1 170 ? -9.995  21.647  101.260 1.00 33.89  ? 170  GLU C O   1 
ATOM   6072  C CB  . GLU C 1 170 ? -13.005 22.050  101.442 1.00 26.28  ? 170  GLU C CB  1 
ATOM   6073  C CG  . GLU C 1 170 ? -13.993 23.184  101.211 1.00 31.46  ? 170  GLU C CG  1 
ATOM   6074  C CD  . GLU C 1 170 ? -13.419 24.492  100.694 1.00 44.97  ? 170  GLU C CD  1 
ATOM   6075  O OE1 . GLU C 1 170 ? -12.645 25.144  101.430 1.00 44.51  ? 170  GLU C OE1 1 
ATOM   6076  O OE2 . GLU C 1 170 ? -13.759 24.871  99.551  1.00 38.32  ? 170  GLU C OE2 1 
ATOM   6077  N N   . HIS C 1 171 ? -10.733 19.719  100.327 1.00 29.19  ? 171  HIS C N   1 
ATOM   6078  C CA  . HIS C 1 171 ? -9.554  18.898  100.593 1.00 29.64  ? 171  HIS C CA  1 
ATOM   6079  C C   . HIS C 1 171 ? -8.779  18.602  99.292  1.00 34.67  ? 171  HIS C C   1 
ATOM   6080  O O   . HIS C 1 171 ? -8.068  17.591  99.198  1.00 35.17  ? 171  HIS C O   1 
ATOM   6081  C CB  . HIS C 1 171 ? -9.946  17.616  101.319 1.00 30.22  ? 171  HIS C CB  1 
ATOM   6082  C CG  . HIS C 1 171 ? -10.320 17.895  102.724 1.00 34.39  ? 171  HIS C CG  1 
ATOM   6083  N ND1 . HIS C 1 171 ? -11.560 18.413  103.051 1.00 35.83  ? 171  HIS C ND1 1 
ATOM   6084  C CD2 . HIS C 1 171 ? -9.571  17.809  103.842 1.00 36.98  ? 171  HIS C CD2 1 
ATOM   6085  C CE1 . HIS C 1 171 ? -11.530 18.615  104.352 1.00 35.96  ? 171  HIS C CE1 1 
ATOM   6086  N NE2 . HIS C 1 171 ? -10.360 18.248  104.873 1.00 37.20  ? 171  HIS C NE2 1 
ATOM   6087  N N   . GLU C 1 172 ? -8.889  19.534  98.313  1.00 30.18  ? 172  GLU C N   1 
ATOM   6088  C CA  . GLU C 1 172 ? -8.174  19.599  97.029  1.00 30.07  ? 172  GLU C CA  1 
ATOM   6089  C C   . GLU C 1 172 ? -8.527  18.493  96.024  1.00 34.41  ? 172  GLU C C   1 
ATOM   6090  O O   . GLU C 1 172 ? -7.814  18.356  95.034  1.00 35.46  ? 172  GLU C O   1 
ATOM   6091  C CB  . GLU C 1 172 ? -6.643  19.596  97.251  1.00 32.34  ? 172  GLU C CB  1 
ATOM   6092  C CG  . GLU C 1 172 ? -6.161  20.542  98.338  1.00 39.12  ? 172  GLU C CG  1 
ATOM   6093  C CD  . GLU C 1 172 ? -4.674  20.562  98.601  1.00 55.12  ? 172  GLU C CD  1 
ATOM   6094  O OE1 . GLU C 1 172 ? -4.017  19.500  98.494  1.00 37.65  ? 172  GLU C OE1 1 
ATOM   6095  O OE2 . GLU C 1 172 ? -4.176  21.650  98.965  1.00 61.26  ? 172  GLU C OE2 1 
ATOM   6096  N N   . TYR C 1 173 ? -9.624  17.759  96.219  1.00 31.48  ? 173  TYR C N   1 
ATOM   6097  C CA  . TYR C 1 173 ? -10.001 16.672  95.306  1.00 30.93  ? 173  TYR C CA  1 
ATOM   6098  C C   . TYR C 1 173 ? -11.363 16.826  94.663  1.00 31.42  ? 173  TYR C C   1 
ATOM   6099  O O   . TYR C 1 173 ? -12.275 17.393  95.249  1.00 30.16  ? 173  TYR C O   1 
ATOM   6100  C CB  . TYR C 1 173 ? -10.001 15.323  96.043  1.00 32.99  ? 173  TYR C CB  1 
ATOM   6101  C CG  . TYR C 1 173 ? -8.638  14.694  96.198  1.00 36.62  ? 173  TYR C CG  1 
ATOM   6102  C CD1 . TYR C 1 173 ? -8.090  13.910  95.184  1.00 39.08  ? 173  TYR C CD1 1 
ATOM   6103  C CD2 . TYR C 1 173 ? -7.912  14.838  97.375  1.00 38.08  ? 173  TYR C CD2 1 
ATOM   6104  C CE1 . TYR C 1 173 ? -6.839  13.313  95.326  1.00 40.65  ? 173  TYR C CE1 1 
ATOM   6105  C CE2 . TYR C 1 173 ? -6.663  14.234  97.533  1.00 40.35  ? 173  TYR C CE2 1 
ATOM   6106  C CZ  . TYR C 1 173 ? -6.132  13.469  96.506  1.00 48.44  ? 173  TYR C CZ  1 
ATOM   6107  O OH  . TYR C 1 173 ? -4.899  12.876  96.636  1.00 51.02  ? 173  TYR C OH  1 
ATOM   6108  N N   . VAL C 1 174 ? -11.513 16.224  93.481  1.00 26.87  ? 174  VAL C N   1 
ATOM   6109  C CA  . VAL C 1 174 ? -12.785 16.092  92.760  1.00 24.79  ? 174  VAL C CA  1 
ATOM   6110  C C   . VAL C 1 174 ? -12.996 14.591  92.486  1.00 28.25  ? 174  VAL C C   1 
ATOM   6111  O O   . VAL C 1 174 ? -12.019 13.868  92.314  1.00 28.28  ? 174  VAL C O   1 
ATOM   6112  C CB  . VAL C 1 174 ? -12.910 16.970  91.485  1.00 26.87  ? 174  VAL C CB  1 
ATOM   6113  C CG1 . VAL C 1 174 ? -12.978 18.451  91.845  1.00 26.13  ? 174  VAL C CG1 1 
ATOM   6114  C CG2 . VAL C 1 174 ? -11.790 16.693  90.477  1.00 26.72  ? 174  VAL C CG2 1 
ATOM   6115  N N   . HIS C 1 175 ? -14.257 14.122  92.498  1.00 25.20  ? 175  HIS C N   1 
ATOM   6116  C CA  . HIS C 1 175 ? -14.603 12.708  92.280  1.00 25.38  ? 175  HIS C CA  1 
ATOM   6117  C C   . HIS C 1 175 ? -14.631 12.366  90.777  1.00 32.04  ? 175  HIS C C   1 
ATOM   6118  O O   . HIS C 1 175 ? -13.996 11.398  90.369  1.00 34.24  ? 175  HIS C O   1 
ATOM   6119  C CB  . HIS C 1 175 ? -15.952 12.365  92.947  1.00 24.99  ? 175  HIS C CB  1 
ATOM   6120  C CG  . HIS C 1 175 ? -16.247 10.899  93.012  1.00 28.03  ? 175  HIS C CG  1 
ATOM   6121  N ND1 . HIS C 1 175 ? -16.865 10.241  91.975  1.00 29.23  ? 175  HIS C ND1 1 
ATOM   6122  C CD2 . HIS C 1 175 ? -15.984 10.006  93.989  1.00 29.59  ? 175  HIS C CD2 1 
ATOM   6123  C CE1 . HIS C 1 175 ? -16.975 8.978   92.356  1.00 28.88  ? 175  HIS C CE1 1 
ATOM   6124  N NE2 . HIS C 1 175 ? -16.478 8.794   93.566  1.00 29.57  ? 175  HIS C NE2 1 
ATOM   6125  N N   . GLY C 1 176 ? -15.375 13.143  89.988  1.00 27.72  ? 176  GLY C N   1 
ATOM   6126  C CA  . GLY C 1 176 ? -15.487 12.980  88.543  1.00 27.10  ? 176  GLY C CA  1 
ATOM   6127  C C   . GLY C 1 176 ? -16.265 11.776  88.044  1.00 30.31  ? 176  GLY C C   1 
ATOM   6128  O O   . GLY C 1 176 ? -16.319 11.554  86.830  1.00 30.22  ? 176  GLY C O   1 
ATOM   6129  N N   . ASP C 1 177 ? -16.890 10.994  88.954  1.00 25.43  ? 177  ASP C N   1 
ATOM   6130  C CA  . ASP C 1 177 ? -17.650 9.806   88.547  1.00 25.50  ? 177  ASP C CA  1 
ATOM   6131  C C   . ASP C 1 177 ? -18.829 9.504   89.508  1.00 28.63  ? 177  ASP C C   1 
ATOM   6132  O O   . ASP C 1 177 ? -19.056 8.354   89.902  1.00 29.28  ? 177  ASP C O   1 
ATOM   6133  C CB  . ASP C 1 177 ? -16.711 8.589   88.406  1.00 28.13  ? 177  ASP C CB  1 
ATOM   6134  C CG  . ASP C 1 177 ? -17.213 7.486   87.492  1.00 38.14  ? 177  ASP C CG  1 
ATOM   6135  O OD1 . ASP C 1 177 ? -18.315 7.642   86.913  1.00 38.81  ? 177  ASP C OD1 1 
ATOM   6136  O OD2 . ASP C 1 177 ? -16.512 6.461   87.363  1.00 43.82  ? 177  ASP C OD2 1 
ATOM   6137  N N   . ILE C 1 178 ? -19.595 10.543  89.857  1.00 24.75  ? 178  ILE C N   1 
ATOM   6138  C CA  . ILE C 1 178 ? -20.785 10.419  90.707  1.00 24.71  ? 178  ILE C CA  1 
ATOM   6139  C C   . ILE C 1 178 ? -21.898 9.720   89.886  1.00 29.73  ? 178  ILE C C   1 
ATOM   6140  O O   . ILE C 1 178 ? -22.172 10.115  88.752  1.00 28.17  ? 178  ILE C O   1 
ATOM   6141  C CB  . ILE C 1 178 ? -21.246 11.801  91.266  1.00 26.87  ? 178  ILE C CB  1 
ATOM   6142  C CG1 . ILE C 1 178 ? -20.115 12.542  92.023  1.00 26.90  ? 178  ILE C CG1 1 
ATOM   6143  C CG2 . ILE C 1 178 ? -22.493 11.672  92.143  1.00 26.79  ? 178  ILE C CG2 1 
ATOM   6144  C CD1 . ILE C 1 178 ? -19.533 13.720  91.300  1.00 25.19  ? 178  ILE C CD1 1 
ATOM   6145  N N   . LYS C 1 179 ? -22.475 8.645   90.449  1.00 27.25  ? 179  LYS C N   1 
ATOM   6146  C CA  . LYS C 1 179 ? -23.562 7.839   89.870  1.00 27.52  ? 179  LYS C CA  1 
ATOM   6147  C C   . LYS C 1 179 ? -24.148 6.946   90.972  1.00 33.12  ? 179  LYS C C   1 
ATOM   6148  O O   . LYS C 1 179 ? -23.510 6.778   92.013  1.00 33.51  ? 179  LYS C O   1 
ATOM   6149  C CB  . LYS C 1 179 ? -23.115 7.020   88.630  1.00 28.98  ? 179  LYS C CB  1 
ATOM   6150  C CG  . LYS C 1 179 ? -21.957 6.071   88.859  1.00 26.25  ? 179  LYS C CG  1 
ATOM   6151  C CD  . LYS C 1 179 ? -21.440 5.518   87.551  1.00 24.85  ? 179  LYS C CD  1 
ATOM   6152  C CE  . LYS C 1 179 ? -20.214 4.692   87.787  1.00 28.57  ? 179  LYS C CE  1 
ATOM   6153  N NZ  . LYS C 1 179 ? -19.751 4.029   86.551  1.00 34.41  ? 179  LYS C NZ  1 
ATOM   6154  N N   . ALA C 1 180 ? -25.361 6.397   90.749  1.00 29.98  ? 180  ALA C N   1 
ATOM   6155  C CA  . ALA C 1 180 ? -26.092 5.547   91.703  1.00 30.06  ? 180  ALA C CA  1 
ATOM   6156  C C   . ALA C 1 180 ? -25.304 4.287   92.120  1.00 33.07  ? 180  ALA C C   1 
ATOM   6157  O O   . ALA C 1 180 ? -25.406 3.881   93.278  1.00 33.07  ? 180  ALA C O   1 
ATOM   6158  C CB  . ALA C 1 180 ? -27.446 5.151   91.124  1.00 31.31  ? 180  ALA C CB  1 
ATOM   6159  N N   . SER C 1 181 ? -24.498 3.699   91.207  1.00 28.70  ? 181  SER C N   1 
ATOM   6160  C CA  . SER C 1 181 ? -23.704 2.502   91.523  1.00 29.18  ? 181  SER C CA  1 
ATOM   6161  C C   . SER C 1 181 ? -22.501 2.819   92.456  1.00 33.34  ? 181  SER C C   1 
ATOM   6162  O O   . SER C 1 181 ? -21.952 1.897   93.059  1.00 33.77  ? 181  SER C O   1 
ATOM   6163  C CB  . SER C 1 181 ? -23.230 1.804   90.251  1.00 31.37  ? 181  SER C CB  1 
ATOM   6164  O OG  . SER C 1 181 ? -22.240 2.551   89.565  1.00 40.63  ? 181  SER C OG  1 
ATOM   6165  N N   . ASN C 1 182 ? -22.110 4.110   92.578  1.00 29.61  ? 182  ASN C N   1 
ATOM   6166  C CA  . ASN C 1 182 ? -21.017 4.575   93.448  1.00 29.28  ? 182  ASN C CA  1 
ATOM   6167  C C   . ASN C 1 182 ? -21.561 5.180   94.738  1.00 34.49  ? 182  ASN C C   1 
ATOM   6168  O O   . ASN C 1 182 ? -20.800 5.755   95.520  1.00 35.19  ? 182  ASN C O   1 
ATOM   6169  C CB  . ASN C 1 182 ? -20.122 5.589   92.726  1.00 26.81  ? 182  ASN C CB  1 
ATOM   6170  C CG  . ASN C 1 182 ? -19.163 4.950   91.761  1.00 40.70  ? 182  ASN C CG  1 
ATOM   6171  O OD1 . ASN C 1 182 ? -18.789 3.776   91.887  1.00 35.64  ? 182  ASN C OD1 1 
ATOM   6172  N ND2 . ASN C 1 182 ? -18.727 5.720   90.778  1.00 25.43  ? 182  ASN C ND2 1 
ATOM   6173  N N   . LEU C 1 183 ? -22.879 5.035   94.961  1.00 31.44  ? 183  LEU C N   1 
ATOM   6174  C CA  . LEU C 1 183 ? -23.560 5.533   96.151  1.00 30.88  ? 183  LEU C CA  1 
ATOM   6175  C C   . LEU C 1 183 ? -24.124 4.355   96.923  1.00 35.84  ? 183  LEU C C   1 
ATOM   6176  O O   . LEU C 1 183 ? -25.034 3.678   96.458  1.00 35.60  ? 183  LEU C O   1 
ATOM   6177  C CB  . LEU C 1 183 ? -24.645 6.551   95.783  1.00 29.81  ? 183  LEU C CB  1 
ATOM   6178  C CG  . LEU C 1 183 ? -24.135 7.881   95.217  1.00 32.72  ? 183  LEU C CG  1 
ATOM   6179  C CD1 . LEU C 1 183 ? -25.231 8.573   94.421  1.00 33.12  ? 183  LEU C CD1 1 
ATOM   6180  C CD2 . LEU C 1 183 ? -23.572 8.783   96.319  1.00 30.63  ? 183  LEU C CD2 1 
ATOM   6181  N N   . LEU C 1 184 ? -23.509 4.064   98.068  1.00 33.66  ? 184  LEU C N   1 
ATOM   6182  C CA  . LEU C 1 184 ? -23.856 2.925   98.915  1.00 35.22  ? 184  LEU C CA  1 
ATOM   6183  C C   . LEU C 1 184 ? -24.445 3.389   100.239 1.00 40.23  ? 184  LEU C C   1 
ATOM   6184  O O   . LEU C 1 184 ? -23.992 4.383   100.805 1.00 39.07  ? 184  LEU C O   1 
ATOM   6185  C CB  . LEU C 1 184 ? -22.607 2.054   99.156  1.00 35.79  ? 184  LEU C CB  1 
ATOM   6186  C CG  . LEU C 1 184 ? -22.286 0.993   98.096  1.00 40.60  ? 184  LEU C CG  1 
ATOM   6187  C CD1 . LEU C 1 184 ? -21.792 1.613   96.791  1.00 39.22  ? 184  LEU C CD1 1 
ATOM   6188  C CD2 . LEU C 1 184 ? -21.217 0.042   98.591  1.00 44.44  ? 184  LEU C CD2 1 
ATOM   6189  N N   . LEU C 1 185 ? -25.488 2.693   100.704 1.00 38.64  ? 185  LEU C N   1 
ATOM   6190  C CA  . LEU C 1 185 ? -26.140 3.029   101.962 1.00 39.70  ? 185  LEU C CA  1 
ATOM   6191  C C   . LEU C 1 185 ? -25.370 2.462   103.141 1.00 45.85  ? 185  LEU C C   1 
ATOM   6192  O O   . LEU C 1 185 ? -24.717 1.423   103.018 1.00 45.93  ? 185  LEU C O   1 
ATOM   6193  C CB  . LEU C 1 185 ? -27.596 2.522   102.011 1.00 40.51  ? 185  LEU C CB  1 
ATOM   6194  C CG  . LEU C 1 185 ? -28.610 3.082   100.996 1.00 43.95  ? 185  LEU C CG  1 
ATOM   6195  C CD1 . LEU C 1 185 ? -29.957 2.431   101.180 1.00 44.44  ? 185  LEU C CD1 1 
ATOM   6196  C CD2 . LEU C 1 185 ? -28.763 4.593   101.112 1.00 45.39  ? 185  LEU C CD2 1 
ATOM   6197  N N   . ASN C 1 186 ? -25.465 3.139   104.294 1.00 44.25  ? 186  ASN C N   1 
ATOM   6198  C CA  . ASN C 1 186 ? -24.868 2.675   105.541 1.00 46.17  ? 186  ASN C CA  1 
ATOM   6199  C C   . ASN C 1 186 ? -25.535 1.341   105.888 1.00 53.39  ? 186  ASN C C   1 
ATOM   6200  O O   . ASN C 1 186 ? -26.767 1.230   105.798 1.00 52.62  ? 186  ASN C O   1 
ATOM   6201  C CB  . ASN C 1 186 ? -25.062 3.732   106.636 1.00 48.12  ? 186  ASN C CB  1 
ATOM   6202  C CG  . ASN C 1 186 ? -24.453 3.389   107.967 1.00 66.31  ? 186  ASN C CG  1 
ATOM   6203  O OD1 . ASN C 1 186 ? -24.995 2.606   108.741 1.00 63.28  ? 186  ASN C OD1 1 
ATOM   6204  N ND2 . ASN C 1 186 ? -23.335 4.010   108.285 1.00 59.10  ? 186  ASN C ND2 1 
ATOM   6205  N N   . TYR C 1 187 ? -24.719 0.312   106.204 1.00 53.32  ? 187  TYR C N   1 
ATOM   6206  C CA  . TYR C 1 187 ? -25.194 -1.040  106.517 1.00 55.77  ? 187  TYR C CA  1 
ATOM   6207  C C   . TYR C 1 187 ? -26.221 -1.033  107.671 1.00 60.33  ? 187  TYR C C   1 
ATOM   6208  O O   . TYR C 1 187 ? -27.200 -1.783  107.617 1.00 60.88  ? 187  TYR C O   1 
ATOM   6209  C CB  . TYR C 1 187 ? -24.008 -1.980  106.829 1.00 58.95  ? 187  TYR C CB  1 
ATOM   6210  C CG  . TYR C 1 187 ? -24.391 -3.432  107.048 1.00 63.99  ? 187  TYR C CG  1 
ATOM   6211  C CD1 . TYR C 1 187 ? -25.051 -4.159  106.058 1.00 66.49  ? 187  TYR C CD1 1 
ATOM   6212  C CD2 . TYR C 1 187 ? -24.053 -4.092  108.229 1.00 67.08  ? 187  TYR C CD2 1 
ATOM   6213  C CE1 . TYR C 1 187 ? -25.424 -5.490  106.264 1.00 69.96  ? 187  TYR C CE1 1 
ATOM   6214  C CE2 . TYR C 1 187 ? -24.400 -5.431  108.437 1.00 70.06  ? 187  TYR C CE2 1 
ATOM   6215  C CZ  . TYR C 1 187 ? -25.092 -6.124  107.453 1.00 77.42  ? 187  TYR C CZ  1 
ATOM   6216  O OH  . TYR C 1 187 ? -25.454 -7.439  107.641 1.00 81.38  ? 187  TYR C OH  1 
ATOM   6217  N N   . LYS C 1 188 ? -26.023 -0.149  108.669 1.00 56.25  ? 188  LYS C N   1 
ATOM   6218  C CA  . LYS C 1 188 ? -26.886 0.000   109.844 1.00 57.44  ? 188  LYS C CA  1 
ATOM   6219  C C   . LYS C 1 188 ? -27.978 1.083   109.671 1.00 60.19  ? 188  LYS C C   1 
ATOM   6220  O O   . LYS C 1 188 ? -29.008 0.997   110.347 1.00 61.38  ? 188  LYS C O   1 
ATOM   6221  C CB  . LYS C 1 188 ? -26.037 0.323   111.084 1.00 60.85  ? 188  LYS C CB  1 
ATOM   6222  N N   . ASN C 1 189 ? -27.753 2.101   108.800 1.00 53.94  ? 189  ASN C N   1 
ATOM   6223  C CA  . ASN C 1 189 ? -28.718 3.184   108.578 1.00 52.09  ? 189  ASN C CA  1 
ATOM   6224  C C   . ASN C 1 189 ? -29.051 3.366   107.078 1.00 52.38  ? 189  ASN C C   1 
ATOM   6225  O O   . ASN C 1 189 ? -28.226 3.885   106.326 1.00 49.51  ? 189  ASN C O   1 
ATOM   6226  C CB  . ASN C 1 189 ? -28.209 4.502   109.183 1.00 50.39  ? 189  ASN C CB  1 
ATOM   6227  C CG  . ASN C 1 189 ? -29.263 5.584   109.378 1.00 68.08  ? 189  ASN C CG  1 
ATOM   6228  O OD1 . ASN C 1 189 ? -30.316 5.635   108.719 1.00 59.51  ? 189  ASN C OD1 1 
ATOM   6229  N ND2 . ASN C 1 189 ? -28.988 6.501   110.289 1.00 59.88  ? 189  ASN C ND2 1 
ATOM   6230  N N   . PRO C 1 190 ? -30.288 3.016   106.644 1.00 48.50  ? 190  PRO C N   1 
ATOM   6231  C CA  . PRO C 1 190 ? -30.642 3.187   105.221 1.00 46.63  ? 190  PRO C CA  1 
ATOM   6232  C C   . PRO C 1 190 ? -30.947 4.643   104.809 1.00 48.76  ? 190  PRO C C   1 
ATOM   6233  O O   . PRO C 1 190 ? -31.328 4.875   103.651 1.00 47.46  ? 190  PRO C O   1 
ATOM   6234  C CB  . PRO C 1 190 ? -31.872 2.295   105.053 1.00 49.68  ? 190  PRO C CB  1 
ATOM   6235  C CG  . PRO C 1 190 ? -32.497 2.257   106.407 1.00 55.80  ? 190  PRO C CG  1 
ATOM   6236  C CD  . PRO C 1 190 ? -31.393 2.401   107.411 1.00 51.53  ? 190  PRO C CD  1 
ATOM   6237  N N   . ASP C 1 191 ? -30.772 5.621   105.733 1.00 44.03  ? 191  ASP C N   1 
ATOM   6238  C CA  . ASP C 1 191 ? -30.988 7.042   105.445 1.00 41.64  ? 191  ASP C CA  1 
ATOM   6239  C C   . ASP C 1 191 ? -29.656 7.779   105.278 1.00 44.24  ? 191  ASP C C   1 
ATOM   6240  O O   . ASP C 1 191 ? -29.656 8.993   105.039 1.00 43.90  ? 191  ASP C O   1 
ATOM   6241  C CB  . ASP C 1 191 ? -31.861 7.719   106.512 1.00 44.19  ? 191  ASP C CB  1 
ATOM   6242  C CG  . ASP C 1 191 ? -33.342 7.382   106.430 1.00 54.98  ? 191  ASP C CG  1 
ATOM   6243  O OD1 . ASP C 1 191 ? -33.870 7.251   105.291 1.00 53.91  ? 191  ASP C OD1 1 
ATOM   6244  O OD2 . ASP C 1 191 ? -33.987 7.292   107.497 1.00 64.03  ? 191  ASP C OD2 1 
ATOM   6245  N N   . GLN C 1 192 ? -28.524 7.035   105.337 1.00 39.66  ? 192  GLN C N   1 
ATOM   6246  C CA  . GLN C 1 192 ? -27.180 7.595   105.173 1.00 37.99  ? 192  GLN C CA  1 
ATOM   6247  C C   . GLN C 1 192 ? -26.519 7.032   103.920 1.00 40.28  ? 192  GLN C C   1 
ATOM   6248  O O   . GLN C 1 192 ? -26.267 5.828   103.839 1.00 41.65  ? 192  GLN C O   1 
ATOM   6249  C CB  . GLN C 1 192 ? -26.309 7.330   106.412 1.00 40.08  ? 192  GLN C CB  1 
ATOM   6250  C CG  . GLN C 1 192 ? -26.827 8.016   107.671 1.00 51.61  ? 192  GLN C CG  1 
ATOM   6251  C CD  . GLN C 1 192 ? -25.899 7.907   108.862 1.00 55.96  ? 192  GLN C CD  1 
ATOM   6252  O OE1 . GLN C 1 192 ? -24.987 7.069   108.931 1.00 47.88  ? 192  GLN C OE1 1 
ATOM   6253  N NE2 . GLN C 1 192 ? -26.130 8.751   109.841 1.00 44.30  ? 192  GLN C NE2 1 
ATOM   6254  N N   . VAL C 1 193 ? -26.250 7.906   102.940 1.00 33.36  ? 193  VAL C N   1 
ATOM   6255  C CA  . VAL C 1 193 ? -25.637 7.524   101.672 1.00 31.99  ? 193  VAL C CA  1 
ATOM   6256  C C   . VAL C 1 193 ? -24.150 7.965   101.660 1.00 35.61  ? 193  VAL C C   1 
ATOM   6257  O O   . VAL C 1 193 ? -23.791 9.025   102.181 1.00 34.77  ? 193  VAL C O   1 
ATOM   6258  C CB  . VAL C 1 193 ? -26.465 8.031   100.449 1.00 34.71  ? 193  VAL C CB  1 
ATOM   6259  C CG1 . VAL C 1 193 ? -26.480 9.560   100.317 1.00 33.87  ? 193  VAL C CG1 1 
ATOM   6260  C CG2 . VAL C 1 193 ? -26.030 7.358   99.156  1.00 33.84  ? 193  VAL C CG2 1 
ATOM   6261  N N   . TYR C 1 194 ? -23.292 7.101   101.115 1.00 32.35  ? 194  TYR C N   1 
ATOM   6262  C CA  . TYR C 1 194 ? -21.845 7.293   101.027 1.00 31.64  ? 194  TYR C CA  1 
ATOM   6263  C C   . TYR C 1 194 ? -21.387 7.230   99.578  1.00 32.59  ? 194  TYR C C   1 
ATOM   6264  O O   . TYR C 1 194 ? -21.884 6.395   98.825  1.00 32.66  ? 194  TYR C O   1 
ATOM   6265  C CB  . TYR C 1 194 ? -21.120 6.211   101.858 1.00 34.53  ? 194  TYR C CB  1 
ATOM   6266  C CG  . TYR C 1 194 ? -21.104 6.479   103.348 1.00 38.47  ? 194  TYR C CG  1 
ATOM   6267  C CD1 . TYR C 1 194 ? -22.245 6.277   104.128 1.00 41.58  ? 194  TYR C CD1 1 
ATOM   6268  C CD2 . TYR C 1 194 ? -19.927 6.848   103.995 1.00 39.50  ? 194  TYR C CD2 1 
ATOM   6269  C CE1 . TYR C 1 194 ? -22.234 6.517   105.501 1.00 43.72  ? 194  TYR C CE1 1 
ATOM   6270  C CE2 . TYR C 1 194 ? -19.900 7.081   105.369 1.00 41.67  ? 194  TYR C CE2 1 
ATOM   6271  C CZ  . TYR C 1 194 ? -21.058 6.918   106.118 1.00 53.11  ? 194  TYR C CZ  1 
ATOM   6272  O OH  . TYR C 1 194 ? -21.037 7.136   107.475 1.00 59.93  ? 194  TYR C OH  1 
ATOM   6273  N N   . LEU C 1 195 ? -20.439 8.097   99.192  1.00 27.01  ? 195  LEU C N   1 
ATOM   6274  C CA  . LEU C 1 195 ? -19.863 8.112   97.846  1.00 25.13  ? 195  LEU C CA  1 
ATOM   6275  C C   . LEU C 1 195 ? -18.554 7.307   97.866  1.00 31.47  ? 195  LEU C C   1 
ATOM   6276  O O   . LEU C 1 195 ? -17.658 7.596   98.665  1.00 31.81  ? 195  LEU C O   1 
ATOM   6277  C CB  . LEU C 1 195 ? -19.647 9.560   97.358  1.00 23.05  ? 195  LEU C CB  1 
ATOM   6278  C CG  . LEU C 1 195 ? -19.040 9.757   95.960  1.00 26.10  ? 195  LEU C CG  1 
ATOM   6279  C CD1 . LEU C 1 195 ? -19.985 9.264   94.840  1.00 24.61  ? 195  LEU C CD1 1 
ATOM   6280  C CD2 . LEU C 1 195 ? -18.683 11.222  95.736  1.00 28.03  ? 195  LEU C CD2 1 
ATOM   6281  N N   . VAL C 1 196 ? -18.468 6.275   97.011  1.00 28.12  ? 196  VAL C N   1 
ATOM   6282  C CA  . VAL C 1 196 ? -17.293 5.390   96.933  1.00 27.90  ? 196  VAL C CA  1 
ATOM   6283  C C   . VAL C 1 196 ? -16.586 5.572   95.567  1.00 33.60  ? 196  VAL C C   1 
ATOM   6284  O O   . VAL C 1 196 ? -17.076 6.318   94.717  1.00 31.78  ? 196  VAL C O   1 
ATOM   6285  C CB  . VAL C 1 196 ? -17.649 3.887   97.220  1.00 30.68  ? 196  VAL C CB  1 
ATOM   6286  C CG1 . VAL C 1 196 ? -18.279 3.704   98.599  1.00 30.17  ? 196  VAL C CG1 1 
ATOM   6287  C CG2 . VAL C 1 196 ? -18.541 3.287   96.134  1.00 30.16  ? 196  VAL C CG2 1 
ATOM   6288  N N   . ASP C 1 197 ? -15.442 4.875   95.379  1.00 33.53  ? 197  ASP C N   1 
ATOM   6289  C CA  . ASP C 1 197 ? -14.590 4.823   94.178  1.00 34.76  ? 197  ASP C CA  1 
ATOM   6290  C C   . ASP C 1 197 ? -13.844 6.148   93.917  1.00 38.66  ? 197  ASP C C   1 
ATOM   6291  O O   . ASP C 1 197 ? -14.357 7.068   93.283  1.00 37.59  ? 197  ASP C O   1 
ATOM   6292  C CB  . ASP C 1 197 ? -15.381 4.388   92.925  1.00 37.29  ? 197  ASP C CB  1 
ATOM   6293  C CG  . ASP C 1 197 ? -14.546 3.849   91.771  1.00 51.38  ? 197  ASP C CG  1 
ATOM   6294  O OD1 . ASP C 1 197 ? -13.340 4.157   91.708  1.00 52.60  ? 197  ASP C OD1 1 
ATOM   6295  O OD2 . ASP C 1 197 ? -15.105 3.135   90.925  1.00 61.32  ? 197  ASP C OD2 1 
ATOM   6296  N N   . TYR C 1 198 ? -12.595 6.206   94.357  1.00 36.41  ? 198  TYR C N   1 
ATOM   6297  C CA  . TYR C 1 198 ? -11.731 7.369   94.182  1.00 35.61  ? 198  TYR C CA  1 
ATOM   6298  C C   . TYR C 1 198 ? -10.503 6.973   93.345  1.00 42.38  ? 198  TYR C C   1 
ATOM   6299  O O   . TYR C 1 198 ? -9.500  7.677   93.338  1.00 41.94  ? 198  TYR C O   1 
ATOM   6300  C CB  . TYR C 1 198 ? -11.355 7.968   95.557  1.00 35.67  ? 198  TYR C CB  1 
ATOM   6301  C CG  . TYR C 1 198 ? -12.561 8.494   96.308  1.00 35.03  ? 198  TYR C CG  1 
ATOM   6302  C CD1 . TYR C 1 198 ? -13.001 9.804   96.135  1.00 35.63  ? 198  TYR C CD1 1 
ATOM   6303  C CD2 . TYR C 1 198 ? -13.290 7.670   97.161  1.00 35.67  ? 198  TYR C CD2 1 
ATOM   6304  C CE1 . TYR C 1 198 ? -14.129 10.284  96.807  1.00 35.81  ? 198  TYR C CE1 1 
ATOM   6305  C CE2 . TYR C 1 198 ? -14.429 8.135   97.823  1.00 35.46  ? 198  TYR C CE2 1 
ATOM   6306  C CZ  . TYR C 1 198 ? -14.844 9.442   97.644  1.00 39.87  ? 198  TYR C CZ  1 
ATOM   6307  O OH  . TYR C 1 198 ? -15.958 9.901   98.304  1.00 39.99  ? 198  TYR C OH  1 
ATOM   6308  N N   . GLY C 1 199 ? -10.629 5.868   92.611  1.00 42.32  ? 199  GLY C N   1 
ATOM   6309  C CA  . GLY C 1 199 ? -9.592  5.346   91.728  1.00 44.43  ? 199  GLY C CA  1 
ATOM   6310  C C   . GLY C 1 199 ? -9.273  6.279   90.572  1.00 49.41  ? 199  GLY C C   1 
ATOM   6311  O O   . GLY C 1 199 ? -8.157  6.252   90.050  1.00 49.88  ? 199  GLY C O   1 
ATOM   6312  N N   . LEU C 1 200 ? -10.253 7.117   90.170  1.00 46.27  ? 200  LEU C N   1 
ATOM   6313  C CA  . LEU C 1 200 ? -10.088 8.123   89.119  1.00 46.53  ? 200  LEU C CA  1 
ATOM   6314  C C   . LEU C 1 200 ? -10.267 9.557   89.702  1.00 47.30  ? 200  LEU C C   1 
ATOM   6315  O O   . LEU C 1 200 ? -10.405 10.523  88.936  1.00 47.16  ? 200  LEU C O   1 
ATOM   6316  C CB  . LEU C 1 200 ? -11.018 7.868   87.899  1.00 47.29  ? 200  LEU C CB  1 
ATOM   6317  C CG  . LEU C 1 200 ? -12.541 8.033   88.068  1.00 51.92  ? 200  LEU C CG  1 
ATOM   6318  C CD1 . LEU C 1 200 ? -13.028 9.335   87.416  1.00 51.33  ? 200  LEU C CD1 1 
ATOM   6319  C CD2 . LEU C 1 200 ? -13.274 6.860   87.442  1.00 55.05  ? 200  LEU C CD2 1 
ATOM   6320  N N   . ALA C 1 201 ? -10.206 9.693   91.056  1.00 40.55  ? 201  ALA C N   1 
ATOM   6321  C CA  . ALA C 1 201 ? -10.318 10.995  91.728  1.00 37.74  ? 201  ALA C CA  1 
ATOM   6322  C C   . ALA C 1 201 ? -9.156  11.890  91.329  1.00 39.25  ? 201  ALA C C   1 
ATOM   6323  O O   . ALA C 1 201 ? -8.097  11.393  90.941  1.00 41.27  ? 201  ALA C O   1 
ATOM   6324  C CB  . ALA C 1 201 ? -10.379 10.834  93.230  1.00 38.13  ? 201  ALA C CB  1 
ATOM   6325  N N   . TYR C 1 202 ? -9.364  13.196  91.349  1.00 30.61  ? 202  TYR C N   1 
ATOM   6326  C CA  . TYR C 1 202 ? -8.317  14.085  90.878  1.00 29.17  ? 202  TYR C CA  1 
ATOM   6327  C C   . TYR C 1 202 ? -8.032  15.228  91.836  1.00 32.79  ? 202  TYR C C   1 
ATOM   6328  O O   . TYR C 1 202 ? -8.958  15.884  92.320  1.00 32.00  ? 202  TYR C O   1 
ATOM   6329  C CB  . TYR C 1 202 ? -8.705  14.614  89.500  1.00 28.79  ? 202  TYR C CB  1 
ATOM   6330  C CG  . TYR C 1 202 ? -7.690  15.531  88.855  1.00 30.25  ? 202  TYR C CG  1 
ATOM   6331  C CD1 . TYR C 1 202 ? -7.973  16.874  88.648  1.00 31.11  ? 202  TYR C CD1 1 
ATOM   6332  C CD2 . TYR C 1 202 ? -6.444  15.054  88.448  1.00 32.30  ? 202  TYR C CD2 1 
ATOM   6333  C CE1 . TYR C 1 202 ? -7.048  17.722  88.049  1.00 31.99  ? 202  TYR C CE1 1 
ATOM   6334  C CE2 . TYR C 1 202 ? -5.503  15.897  87.859  1.00 33.76  ? 202  TYR C CE2 1 
ATOM   6335  C CZ  . TYR C 1 202 ? -5.811  17.227  87.657  1.00 41.36  ? 202  TYR C CZ  1 
ATOM   6336  O OH  . TYR C 1 202 ? -4.839  18.017  87.106  1.00 43.27  ? 202  TYR C OH  1 
ATOM   6337  N N   . ARG C 1 203 ? -6.735  15.460  92.107  1.00 29.61  ? 203  ARG C N   1 
ATOM   6338  C CA  . ARG C 1 203 ? -6.240  16.545  92.964  1.00 29.46  ? 203  ARG C CA  1 
ATOM   6339  C C   . ARG C 1 203 ? -6.105  17.784  92.095  1.00 33.19  ? 203  ARG C C   1 
ATOM   6340  O O   . ARG C 1 203 ? -5.042  18.030  91.516  1.00 33.03  ? 203  ARG C O   1 
ATOM   6341  C CB  . ARG C 1 203 ? -4.912  16.160  93.636  1.00 27.17  ? 203  ARG C CB  1 
ATOM   6342  C CG  . ARG C 1 203 ? -4.633  16.936  94.900  1.00 33.49  ? 203  ARG C CG  1 
ATOM   6343  C CD  . ARG C 1 203 ? -3.305  16.515  95.468  1.00 38.25  ? 203  ARG C CD  1 
ATOM   6344  N NE  . ARG C 1 203 ? -2.895  17.382  96.572  1.00 41.90  ? 203  ARG C NE  1 
ATOM   6345  C CZ  . ARG C 1 203 ? -1.629  17.598  96.921  1.00 53.88  ? 203  ARG C CZ  1 
ATOM   6346  N NH1 . ARG C 1 203 ? -0.640  17.020  96.252  1.00 36.06  ? 203  ARG C NH1 1 
ATOM   6347  N NH2 . ARG C 1 203 ? -1.343  18.404  97.937  1.00 41.02  ? 203  ARG C NH2 1 
ATOM   6348  N N   . TYR C 1 204 ? -7.226  18.520  91.956  1.00 29.34  ? 204  TYR C N   1 
ATOM   6349  C CA  . TYR C 1 204 ? -7.372  19.700  91.094  1.00 29.05  ? 204  TYR C CA  1 
ATOM   6350  C C   . TYR C 1 204 ? -6.672  20.949  91.666  1.00 33.92  ? 204  TYR C C   1 
ATOM   6351  O O   . TYR C 1 204 ? -6.393  21.889  90.918  1.00 34.58  ? 204  TYR C O   1 
ATOM   6352  C CB  . TYR C 1 204 ? -8.885  19.988  90.865  1.00 27.84  ? 204  TYR C CB  1 
ATOM   6353  C CG  . TYR C 1 204 ? -9.552  20.707  92.015  1.00 26.27  ? 204  TYR C CG  1 
ATOM   6354  C CD1 . TYR C 1 204 ? -9.545  22.095  92.091  1.00 27.34  ? 204  TYR C CD1 1 
ATOM   6355  C CD2 . TYR C 1 204 ? -10.125 19.999  93.067  1.00 26.60  ? 204  TYR C CD2 1 
ATOM   6356  C CE1 . TYR C 1 204 ? -10.093 22.763  93.181  1.00 26.07  ? 204  TYR C CE1 1 
ATOM   6357  C CE2 . TYR C 1 204 ? -10.700 20.658  94.155  1.00 26.87  ? 204  TYR C CE2 1 
ATOM   6358  C CZ  . TYR C 1 204 ? -10.654 22.037  94.221  1.00 29.90  ? 204  TYR C CZ  1 
ATOM   6359  O OH  . TYR C 1 204 ? -11.183 22.676  95.307  1.00 26.70  ? 204  TYR C OH  1 
ATOM   6360  N N   . CYS C 1 205 ? -6.466  20.973  92.985  1.00 30.73  ? 205  CYS C N   1 
ATOM   6361  C CA  . CYS C 1 205 ? -5.937  22.109  93.718  1.00 31.93  ? 205  CYS C CA  1 
ATOM   6362  C C   . CYS C 1 205 ? -4.735  21.729  94.612  1.00 35.84  ? 205  CYS C C   1 
ATOM   6363  O O   . CYS C 1 205 ? -4.817  22.005  95.807  1.00 36.37  ? 205  CYS C O   1 
ATOM   6364  C CB  . CYS C 1 205 ? -7.064  22.693  94.566  1.00 32.42  ? 205  CYS C CB  1 
ATOM   6365  S SG  . CYS C 1 205 ? -7.068  24.493  94.655  1.00 37.28  ? 205  CYS C SG  1 
ATOM   6366  N N   . PRO C 1 206 ? -3.594  21.184  94.138  1.00 31.86  ? 206  PRO C N   1 
ATOM   6367  C CA  . PRO C 1 206 ? -2.514  20.872  95.096  1.00 32.53  ? 206  PRO C CA  1 
ATOM   6368  C C   . PRO C 1 206 ? -1.930  22.140  95.730  1.00 36.34  ? 206  PRO C C   1 
ATOM   6369  O O   . PRO C 1 206 ? -1.586  23.085  95.024  1.00 35.62  ? 206  PRO C O   1 
ATOM   6370  C CB  . PRO C 1 206 ? -1.489  20.116  94.253  1.00 34.95  ? 206  PRO C CB  1 
ATOM   6371  C CG  . PRO C 1 206 ? -1.756  20.545  92.853  1.00 38.98  ? 206  PRO C CG  1 
ATOM   6372  C CD  . PRO C 1 206 ? -3.230  20.780  92.765  1.00 33.26  ? 206  PRO C CD  1 
ATOM   6373  N N   . GLU C 1 207 ? -1.919  22.184  97.078  1.00 33.72  ? 207  GLU C N   1 
ATOM   6374  C CA  . GLU C 1 207 ? -1.411  23.294  97.912  1.00 33.75  ? 207  GLU C CA  1 
ATOM   6375  C C   . GLU C 1 207 ? -2.173  24.608  97.629  1.00 36.84  ? 207  GLU C C   1 
ATOM   6376  O O   . GLU C 1 207 ? -1.598  25.694  97.697  1.00 37.20  ? 207  GLU C O   1 
ATOM   6377  C CB  . GLU C 1 207 ? 0.107   23.473  97.737  1.00 36.51  ? 207  GLU C CB  1 
ATOM   6378  C CG  . GLU C 1 207 ? 0.872   22.190  97.984  1.00 48.45  ? 207  GLU C CG  1 
ATOM   6379  C CD  . GLU C 1 207 ? 2.367   22.351  98.070  1.00 72.30  ? 207  GLU C CD  1 
ATOM   6380  O OE1 . GLU C 1 207 ? 3.073   21.525  97.450  1.00 76.27  ? 207  GLU C OE1 1 
ATOM   6381  O OE2 . GLU C 1 207 ? 2.837   23.272  98.778  1.00 65.46  ? 207  GLU C OE2 1 
ATOM   6382  N N   . GLY C 1 208 ? -3.467  24.485  97.324  1.00 32.74  ? 208  GLY C N   1 
ATOM   6383  C CA  . GLY C 1 208 ? -4.352  25.608  97.035  1.00 31.92  ? 208  GLY C CA  1 
ATOM   6384  C C   . GLY C 1 208 ? -4.154  26.269  95.681  1.00 36.75  ? 208  GLY C C   1 
ATOM   6385  O O   . GLY C 1 208 ? -4.726  27.339  95.435  1.00 37.15  ? 208  GLY C O   1 
ATOM   6386  N N   . VAL C 1 209 ? -3.364  25.638  94.780  1.00 32.11  ? 209  VAL C N   1 
ATOM   6387  C CA  . VAL C 1 209 ? -3.093  26.165  93.438  1.00 31.73  ? 209  VAL C CA  1 
ATOM   6388  C C   . VAL C 1 209 ? -3.888  25.342  92.431  1.00 35.31  ? 209  VAL C C   1 
ATOM   6389  O O   . VAL C 1 209 ? -3.570  24.173  92.197  1.00 36.57  ? 209  VAL C O   1 
ATOM   6390  C CB  . VAL C 1 209 ? -1.576  26.214  93.089  1.00 36.12  ? 209  VAL C CB  1 
ATOM   6391  C CG1 . VAL C 1 209 ? -1.350  26.876  91.732  1.00 35.63  ? 209  VAL C CG1 1 
ATOM   6392  C CG2 . VAL C 1 209 ? -0.789  26.937  94.179  1.00 36.81  ? 209  VAL C CG2 1 
ATOM   6393  N N   . HIS C 1 210 ? -4.917  25.960  91.832  1.00 29.94  ? 210  HIS C N   1 
ATOM   6394  C CA  . HIS C 1 210 ? -5.801  25.286  90.891  1.00 28.38  ? 210  HIS C CA  1 
ATOM   6395  C C   . HIS C 1 210 ? -5.074  24.946  89.593  1.00 34.43  ? 210  HIS C C   1 
ATOM   6396  O O   . HIS C 1 210 ? -4.296  25.763  89.070  1.00 33.80  ? 210  HIS C O   1 
ATOM   6397  C CB  . HIS C 1 210 ? -7.025  26.157  90.591  1.00 27.71  ? 210  HIS C CB  1 
ATOM   6398  C CG  . HIS C 1 210 ? -8.224  25.393  90.117  1.00 29.69  ? 210  HIS C CG  1 
ATOM   6399  N ND1 . HIS C 1 210 ? -8.229  24.728  88.899  1.00 31.01  ? 210  HIS C ND1 1 
ATOM   6400  C CD2 . HIS C 1 210 ? -9.448  25.272  90.684  1.00 30.29  ? 210  HIS C CD2 1 
ATOM   6401  C CE1 . HIS C 1 210 ? -9.433  24.197  88.785  1.00 29.24  ? 210  HIS C CE1 1 
ATOM   6402  N NE2 . HIS C 1 210 ? -10.205 24.504  89.827  1.00 29.29  ? 210  HIS C NE2 1 
ATOM   6403  N N   . LYS C 1 211 ? -5.344  23.719  89.086  1.00 30.57  ? 211  LYS C N   1 
ATOM   6404  C CA  . LYS C 1 211 ? -4.824  23.206  87.826  1.00 30.48  ? 211  LYS C CA  1 
ATOM   6405  C C   . LYS C 1 211 ? -5.377  24.092  86.708  1.00 32.57  ? 211  LYS C C   1 
ATOM   6406  O O   . LYS C 1 211 ? -6.568  24.410  86.719  1.00 29.64  ? 211  LYS C O   1 
ATOM   6407  C CB  . LYS C 1 211 ? -5.224  21.724  87.670  1.00 31.65  ? 211  LYS C CB  1 
ATOM   6408  C CG  . LYS C 1 211 ? -5.252  21.139  86.257  1.00 37.47  ? 211  LYS C CG  1 
ATOM   6409  C CD  . LYS C 1 211 ? -3.878  20.855  85.708  1.00 45.07  ? 211  LYS C CD  1 
ATOM   6410  C CE  . LYS C 1 211 ? -3.956  20.022  84.459  1.00 50.96  ? 211  LYS C CE  1 
ATOM   6411  N NZ  . LYS C 1 211 ? -2.614  19.782  83.869  1.00 59.35  ? 211  LYS C NZ  1 
ATOM   6412  N N   . ALA C 1 212 ? -4.496  24.554  85.801  1.00 30.08  ? 212  ALA C N   1 
ATOM   6413  C CA  . ALA C 1 212 ? -4.868  25.441  84.703  1.00 29.68  ? 212  ALA C CA  1 
ATOM   6414  C C   . ALA C 1 212 ? -5.710  24.698  83.671  1.00 34.81  ? 212  ALA C C   1 
ATOM   6415  O O   . ALA C 1 212 ? -5.551  23.487  83.509  1.00 36.10  ? 212  ALA C O   1 
ATOM   6416  C CB  . ALA C 1 212 ? -3.622  26.027  84.064  1.00 31.62  ? 212  ALA C CB  1 
ATOM   6417  N N   . TYR C 1 213 ? -6.626  25.415  82.994  1.00 31.33  ? 213  TYR C N   1 
ATOM   6418  C CA  . TYR C 1 213 ? -7.478  24.830  81.960  1.00 31.15  ? 213  TYR C CA  1 
ATOM   6419  C C   . TYR C 1 213 ? -6.635  24.428  80.770  1.00 39.17  ? 213  TYR C C   1 
ATOM   6420  O O   . TYR C 1 213 ? -5.981  25.283  80.157  1.00 40.42  ? 213  TYR C O   1 
ATOM   6421  C CB  . TYR C 1 213 ? -8.540  25.835  81.501  1.00 31.30  ? 213  TYR C CB  1 
ATOM   6422  C CG  . TYR C 1 213 ? -9.547  25.259  80.530  1.00 31.69  ? 213  TYR C CG  1 
ATOM   6423  C CD1 . TYR C 1 213 ? -10.734 24.697  80.984  1.00 32.79  ? 213  TYR C CD1 1 
ATOM   6424  C CD2 . TYR C 1 213 ? -9.327  25.301  79.152  1.00 32.70  ? 213  TYR C CD2 1 
ATOM   6425  C CE1 . TYR C 1 213 ? -11.685 24.199  80.095  1.00 33.95  ? 213  TYR C CE1 1 
ATOM   6426  C CE2 . TYR C 1 213 ? -10.254 24.775  78.255  1.00 33.19  ? 213  TYR C CE2 1 
ATOM   6427  C CZ  . TYR C 1 213 ? -11.441 24.244  78.730  1.00 38.53  ? 213  TYR C CZ  1 
ATOM   6428  O OH  . TYR C 1 213 ? -12.359 23.734  77.849  1.00 38.08  ? 213  TYR C OH  1 
ATOM   6429  N N   . ALA C 1 214 ? -6.726  23.157  80.364  1.00 36.84  ? 214  ALA C N   1 
ATOM   6430  C CA  . ALA C 1 214 ? -6.031  22.642  79.176  1.00 37.25  ? 214  ALA C CA  1 
ATOM   6431  C C   . ALA C 1 214 ? -6.716  21.389  78.683  1.00 41.91  ? 214  ALA C C   1 
ATOM   6432  O O   . ALA C 1 214 ? -6.971  20.465  79.463  1.00 41.18  ? 214  ALA C O   1 
ATOM   6433  C CB  . ALA C 1 214 ? -4.562  22.359  79.477  1.00 38.39  ? 214  ALA C CB  1 
ATOM   6434  N N   . ALA C 1 215 ? -7.036  21.370  77.389  1.00 40.21  ? 215  ALA C N   1 
ATOM   6435  C CA  . ALA C 1 215 ? -7.648  20.226  76.729  1.00 40.06  ? 215  ALA C CA  1 
ATOM   6436  C C   . ALA C 1 215 ? -6.541  19.258  76.319  1.00 44.70  ? 215  ALA C C   1 
ATOM   6437  O O   . ALA C 1 215 ? -5.656  19.633  75.553  1.00 46.02  ? 215  ALA C O   1 
ATOM   6438  C CB  . ALA C 1 215 ? -8.456  20.687  75.521  1.00 41.33  ? 215  ALA C CB  1 
ATOM   6439  N N   . ASP C 1 216 ? -6.540  18.052  76.909  1.00 40.53  ? 216  ASP C N   1 
ATOM   6440  C CA  . ASP C 1 216 ? -5.565  16.978  76.665  1.00 41.08  ? 216  ASP C CA  1 
ATOM   6441  C C   . ASP C 1 216 ? -6.277  15.850  75.887  1.00 44.54  ? 216  ASP C C   1 
ATOM   6442  O O   . ASP C 1 216 ? -7.295  15.351  76.376  1.00 43.47  ? 216  ASP C O   1 
ATOM   6443  C CB  . ASP C 1 216 ? -4.966  16.483  78.014  1.00 41.88  ? 216  ASP C CB  1 
ATOM   6444  C CG  . ASP C 1 216 ? -4.048  15.258  78.002  1.00 52.37  ? 216  ASP C CG  1 
ATOM   6445  O OD1 . ASP C 1 216 ? -3.729  14.753  76.902  1.00 53.55  ? 216  ASP C OD1 1 
ATOM   6446  O OD2 . ASP C 1 216 ? -3.647  14.804  79.101  1.00 59.73  ? 216  ASP C OD2 1 
ATOM   6447  N N   . PRO C 1 217 ? -5.782  15.459  74.674  1.00 41.69  ? 217  PRO C N   1 
ATOM   6448  C CA  . PRO C 1 217 ? -6.456  14.395  73.896  1.00 41.78  ? 217  PRO C CA  1 
ATOM   6449  C C   . PRO C 1 217 ? -6.501  13.032  74.593  1.00 44.32  ? 217  PRO C C   1 
ATOM   6450  O O   . PRO C 1 217 ? -7.341  12.204  74.258  1.00 43.70  ? 217  PRO C O   1 
ATOM   6451  C CB  . PRO C 1 217 ? -5.612  14.294  72.618  1.00 45.99  ? 217  PRO C CB  1 
ATOM   6452  C CG  . PRO C 1 217 ? -4.786  15.527  72.567  1.00 50.61  ? 217  PRO C CG  1 
ATOM   6453  C CD  . PRO C 1 217 ? -4.577  15.955  73.970  1.00 44.64  ? 217  PRO C CD  1 
ATOM   6454  N N   . LYS C 1 218 ? -5.592  12.798  75.545  1.00 41.23  ? 218  LYS C N   1 
ATOM   6455  C CA  . LYS C 1 218 ? -5.504  11.553  76.309  1.00 41.14  ? 218  LYS C CA  1 
ATOM   6456  C C   . LYS C 1 218 ? -6.604  11.471  77.372  1.00 42.83  ? 218  LYS C C   1 
ATOM   6457  O O   . LYS C 1 218 ? -7.022  10.368  77.722  1.00 42.70  ? 218  LYS C O   1 
ATOM   6458  C CB  . LYS C 1 218 ? -4.118  11.428  76.968  1.00 45.23  ? 218  LYS C CB  1 
ATOM   6459  C CG  . LYS C 1 218 ? -2.955  11.290  75.974  1.00 59.28  ? 218  LYS C CG  1 
ATOM   6460  C CD  . LYS C 1 218 ? -1.608  11.506  76.651  1.00 69.68  ? 218  LYS C CD  1 
ATOM   6461  C CE  . LYS C 1 218 ? -0.456  11.357  75.687  1.00 83.76  ? 218  LYS C CE  1 
ATOM   6462  N N   . ARG C 1 219 ? -7.087  12.631  77.862  1.00 38.47  ? 219  ARG C N   1 
ATOM   6463  C CA  . ARG C 1 219 ? -8.120  12.755  78.908  1.00 37.05  ? 219  ARG C CA  1 
ATOM   6464  C C   . ARG C 1 219 ? -9.569  12.733  78.404  1.00 41.56  ? 219  ARG C C   1 
ATOM   6465  O O   . ARG C 1 219 ? -10.475 12.707  79.242  1.00 42.45  ? 219  ARG C O   1 
ATOM   6466  C CB  . ARG C 1 219 ? -7.938  14.075  79.678  1.00 35.12  ? 219  ARG C CB  1 
ATOM   6467  C CG  . ARG C 1 219 ? -6.809  14.066  80.657  1.00 42.74  ? 219  ARG C CG  1 
ATOM   6468  C CD  . ARG C 1 219 ? -6.939  15.183  81.667  1.00 46.27  ? 219  ARG C CD  1 
ATOM   6469  N NE  . ARG C 1 219 ? -5.879  15.079  82.673  1.00 52.65  ? 219  ARG C NE  1 
ATOM   6470  C CZ  . ARG C 1 219 ? -5.989  14.424  83.825  1.00 64.47  ? 219  ARG C CZ  1 
ATOM   6471  N NH1 . ARG C 1 219 ? -7.135  13.842  84.160  1.00 45.29  ? 219  ARG C NH1 1 
ATOM   6472  N NH2 . ARG C 1 219 ? -4.960  14.363  84.661  1.00 58.10  ? 219  ARG C NH2 1 
ATOM   6473  N N   . CYS C 1 220 ? -9.793  12.826  77.073  1.00 37.28  ? 220  CYS C N   1 
ATOM   6474  C CA  . CYS C 1 220 ? -11.109 12.927  76.440  1.00 36.01  ? 220  CYS C CA  1 
ATOM   6475  C C   . CYS C 1 220 ? -12.033 11.798  76.818  1.00 41.98  ? 220  CYS C C   1 
ATOM   6476  O O   . CYS C 1 220 ? -11.671 10.623  76.729  1.00 43.49  ? 220  CYS C O   1 
ATOM   6477  C CB  . CYS C 1 220 ? -10.987 13.041  74.925  1.00 37.45  ? 220  CYS C CB  1 
ATOM   6478  S SG  . CYS C 1 220 ? -10.473 14.673  74.338  1.00 41.12  ? 220  CYS C SG  1 
ATOM   6479  N N   . HIS C 1 221 ? -13.243 12.183  77.253  1.00 38.52  ? 221  HIS C N   1 
ATOM   6480  C CA  . HIS C 1 221 ? -14.368 11.323  77.626  1.00 37.78  ? 221  HIS C CA  1 
ATOM   6481  C C   . HIS C 1 221 ? -14.063 10.420  78.837  1.00 43.60  ? 221  HIS C C   1 
ATOM   6482  O O   . HIS C 1 221 ? -14.538 9.288   78.899  1.00 45.68  ? 221  HIS C O   1 
ATOM   6483  C CB  . HIS C 1 221 ? -14.874 10.502  76.413  1.00 39.33  ? 221  HIS C CB  1 
ATOM   6484  C CG  . HIS C 1 221 ? -15.042 11.325  75.176  1.00 42.70  ? 221  HIS C CG  1 
ATOM   6485  N ND1 . HIS C 1 221 ? -16.099 12.188  75.030  1.00 43.44  ? 221  HIS C ND1 1 
ATOM   6486  C CD2 . HIS C 1 221 ? -14.243 11.423  74.091  1.00 46.03  ? 221  HIS C CD2 1 
ATOM   6487  C CE1 . HIS C 1 221 ? -15.929 12.773  73.858  1.00 44.23  ? 221  HIS C CE1 1 
ATOM   6488  N NE2 . HIS C 1 221 ? -14.831 12.331  73.248  1.00 46.07  ? 221  HIS C NE2 1 
ATOM   6489  N N   . ASP C 1 222 ? -13.352 10.953  79.840  1.00 40.26  ? 222  ASP C N   1 
ATOM   6490  C CA  . ASP C 1 222 ? -13.119 10.249  81.100  1.00 40.26  ? 222  ASP C CA  1 
ATOM   6491  C C   . ASP C 1 222 ? -14.428 10.239  81.895  1.00 41.22  ? 222  ASP C C   1 
ATOM   6492  O O   . ASP C 1 222 ? -15.300 11.061  81.627  1.00 40.80  ? 222  ASP C O   1 
ATOM   6493  C CB  . ASP C 1 222 ? -11.995 10.924  81.910  1.00 43.21  ? 222  ASP C CB  1 
ATOM   6494  C CG  . ASP C 1 222 ? -10.581 10.512  81.546  1.00 63.28  ? 222  ASP C CG  1 
ATOM   6495  O OD1 . ASP C 1 222 ? -10.421 9.596   80.695  1.00 66.41  ? 222  ASP C OD1 1 
ATOM   6496  O OD2 . ASP C 1 222 ? -9.633  11.110  82.100  1.00 72.65  ? 222  ASP C OD2 1 
ATOM   6497  N N   . GLY C 1 223 ? -14.551 9.321   82.849  1.00 36.05  ? 223  GLY C N   1 
ATOM   6498  C CA  . GLY C 1 223 ? -15.749 9.160   83.668  1.00 34.17  ? 223  GLY C CA  1 
ATOM   6499  C C   . GLY C 1 223 ? -16.746 8.233   83.002  1.00 37.30  ? 223  GLY C C   1 
ATOM   6500  O O   . GLY C 1 223 ? -16.392 7.505   82.069  1.00 37.70  ? 223  GLY C O   1 
ATOM   6501  N N   . THR C 1 224 ? -18.001 8.239   83.488  1.00 31.88  ? 224  THR C N   1 
ATOM   6502  C CA  . THR C 1 224 ? -19.079 7.437   82.904  1.00 31.04  ? 224  THR C CA  1 
ATOM   6503  C C   . THR C 1 224 ? -19.744 8.326   81.859  1.00 33.58  ? 224  THR C C   1 
ATOM   6504  O O   . THR C 1 224 ? -20.293 9.369   82.204  1.00 32.17  ? 224  THR C O   1 
ATOM   6505  C CB  . THR C 1 224 ? -20.013 6.914   83.992  1.00 32.20  ? 224  THR C CB  1 
ATOM   6506  O OG1 . THR C 1 224 ? -19.233 6.147   84.918  1.00 33.64  ? 224  THR C OG1 1 
ATOM   6507  C CG2 . THR C 1 224 ? -21.140 6.064   83.432  1.00 22.69  ? 224  THR C CG2 1 
ATOM   6508  N N   . ILE C 1 225 ? -19.661 7.916   80.586  1.00 31.39  ? 225  ILE C N   1 
ATOM   6509  C CA  . ILE C 1 225 ? -20.077 8.647   79.385  1.00 31.81  ? 225  ILE C CA  1 
ATOM   6510  C C   . ILE C 1 225 ? -21.441 9.392   79.515  1.00 34.47  ? 225  ILE C C   1 
ATOM   6511  O O   . ILE C 1 225 ? -21.481 10.578  79.176  1.00 33.33  ? 225  ILE C O   1 
ATOM   6512  C CB  . ILE C 1 225 ? -20.022 7.742   78.106  1.00 36.48  ? 225  ILE C CB  1 
ATOM   6513  C CG1 . ILE C 1 225 ? -19.970 8.562   76.808  1.00 37.33  ? 225  ILE C CG1 1 
ATOM   6514  C CG2 . ILE C 1 225 ? -21.082 6.624   78.060  1.00 37.84  ? 225  ILE C CG2 1 
ATOM   6515  C CD1 . ILE C 1 225 ? -18.635 9.236   76.554  1.00 41.31  ? 225  ILE C CD1 1 
ATOM   6516  N N   . GLU C 1 226 ? -22.514 8.738   80.011  1.00 29.95  ? 226  GLU C N   1 
ATOM   6517  C CA  . GLU C 1 226 ? -23.832 9.384   80.109  1.00 29.27  ? 226  GLU C CA  1 
ATOM   6518  C C   . GLU C 1 226 ? -23.897 10.489  81.175  1.00 31.83  ? 226  GLU C C   1 
ATOM   6519  O O   . GLU C 1 226 ? -24.707 11.406  81.024  1.00 30.16  ? 226  GLU C O   1 
ATOM   6520  C CB  . GLU C 1 226 ? -24.963 8.362   80.348  1.00 31.03  ? 226  GLU C CB  1 
ATOM   6521  C CG  . GLU C 1 226 ? -24.802 7.497   81.585  1.00 37.24  ? 226  GLU C CG  1 
ATOM   6522  C CD  . GLU C 1 226 ? -24.245 6.111   81.341  1.00 54.97  ? 226  GLU C CD  1 
ATOM   6523  O OE1 . GLU C 1 226 ? -23.158 5.997   80.728  1.00 51.96  ? 226  GLU C OE1 1 
ATOM   6524  O OE2 . GLU C 1 226 ? -24.897 5.132   81.771  1.00 50.57  ? 226  GLU C OE2 1 
ATOM   6525  N N   . PHE C 1 227 ? -23.061 10.407  82.238  1.00 28.58  ? 227  PHE C N   1 
ATOM   6526  C CA  . PHE C 1 227 ? -23.084 11.382  83.339  1.00 27.86  ? 227  PHE C CA  1 
ATOM   6527  C C   . PHE C 1 227 ? -21.895 12.317  83.385  1.00 30.45  ? 227  PHE C C   1 
ATOM   6528  O O   . PHE C 1 227 ? -21.964 13.305  84.119  1.00 29.86  ? 227  PHE C O   1 
ATOM   6529  C CB  . PHE C 1 227 ? -23.171 10.672  84.708  1.00 29.46  ? 227  PHE C CB  1 
ATOM   6530  C CG  . PHE C 1 227 ? -24.242 9.616   84.814  1.00 31.68  ? 227  PHE C CG  1 
ATOM   6531  C CD1 . PHE C 1 227 ? -25.584 9.943   84.646  1.00 35.26  ? 227  PHE C CD1 1 
ATOM   6532  C CD2 . PHE C 1 227 ? -23.911 8.299   85.108  1.00 34.05  ? 227  PHE C CD2 1 
ATOM   6533  C CE1 . PHE C 1 227 ? -26.574 8.960   84.739  1.00 37.18  ? 227  PHE C CE1 1 
ATOM   6534  C CE2 . PHE C 1 227 ? -24.901 7.321   85.219  1.00 37.89  ? 227  PHE C CE2 1 
ATOM   6535  C CZ  . PHE C 1 227 ? -26.224 7.654   85.028  1.00 36.53  ? 227  PHE C CZ  1 
ATOM   6536  N N   . THR C 1 228 ? -20.808 12.021  82.643  1.00 27.04  ? 228  THR C N   1 
ATOM   6537  C CA  . THR C 1 228 ? -19.575 12.808  82.710  1.00 26.24  ? 228  THR C CA  1 
ATOM   6538  C C   . THR C 1 228 ? -19.786 14.279  82.273  1.00 30.91  ? 228  THR C C   1 
ATOM   6539  O O   . THR C 1 228 ? -20.767 14.607  81.595  1.00 30.50  ? 228  THR C O   1 
ATOM   6540  C CB  . THR C 1 228 ? -18.403 12.119  81.996  1.00 29.69  ? 228  THR C CB  1 
ATOM   6541  O OG1 . THR C 1 228 ? -17.197 12.694  82.486  1.00 29.83  ? 228  THR C OG1 1 
ATOM   6542  C CG2 . THR C 1 228 ? -18.462 12.193  80.473  1.00 23.45  ? 228  THR C CG2 1 
ATOM   6543  N N   . SER C 1 229 ? -18.889 15.164  82.745  1.00 27.21  ? 229  SER C N   1 
ATOM   6544  C CA  . SER C 1 229 ? -18.956 16.596  82.476  1.00 27.15  ? 229  SER C CA  1 
ATOM   6545  C C   . SER C 1 229 ? -18.488 16.934  81.057  1.00 31.29  ? 229  SER C C   1 
ATOM   6546  O O   . SER C 1 229 ? -17.762 16.145  80.444  1.00 31.00  ? 229  SER C O   1 
ATOM   6547  C CB  . SER C 1 229 ? -18.108 17.356  83.495  1.00 30.17  ? 229  SER C CB  1 
ATOM   6548  O OG  . SER C 1 229 ? -16.717 17.169  83.294  1.00 36.55  ? 229  SER C OG  1 
ATOM   6549  N N   . ILE C 1 230 ? -18.879 18.127  80.555  1.00 28.17  ? 230  ILE C N   1 
ATOM   6550  C CA  . ILE C 1 230 ? -18.458 18.661  79.252  1.00 28.73  ? 230  ILE C CA  1 
ATOM   6551  C C   . ILE C 1 230 ? -16.917 18.821  79.263  1.00 32.12  ? 230  ILE C C   1 
ATOM   6552  O O   . ILE C 1 230 ? -16.262 18.466  78.283  1.00 33.80  ? 230  ILE C O   1 
ATOM   6553  C CB  . ILE C 1 230 ? -19.218 19.979  78.927  1.00 31.83  ? 230  ILE C CB  1 
ATOM   6554  C CG1 . ILE C 1 230 ? -20.689 19.679  78.578  1.00 32.03  ? 230  ILE C CG1 1 
ATOM   6555  C CG2 . ILE C 1 230 ? -18.534 20.794  77.812  1.00 33.76  ? 230  ILE C CG2 1 
ATOM   6556  C CD1 . ILE C 1 230 ? -21.652 20.821  78.727  1.00 35.03  ? 230  ILE C CD1 1 
ATOM   6557  N N   . ASP C 1 231 ? -16.345 19.271  80.397  1.00 27.03  ? 231  ASP C N   1 
ATOM   6558  C CA  . ASP C 1 231 ? -14.897 19.416  80.600  1.00 26.10  ? 231  ASP C CA  1 
ATOM   6559  C C   . ASP C 1 231 ? -14.188 18.090  80.327  1.00 30.32  ? 231  ASP C C   1 
ATOM   6560  O O   . ASP C 1 231 ? -13.269 18.065  79.515  1.00 31.70  ? 231  ASP C O   1 
ATOM   6561  C CB  . ASP C 1 231 ? -14.576 19.925  82.021  1.00 26.43  ? 231  ASP C CB  1 
ATOM   6562  C CG  . ASP C 1 231 ? -14.862 21.400  82.271  1.00 33.47  ? 231  ASP C CG  1 
ATOM   6563  O OD1 . ASP C 1 231 ? -14.708 22.215  81.316  1.00 33.85  ? 231  ASP C OD1 1 
ATOM   6564  O OD2 . ASP C 1 231 ? -15.255 21.744  83.416  1.00 35.33  ? 231  ASP C OD2 1 
ATOM   6565  N N   . ALA C 1 232 ? -14.661 16.977  80.936  1.00 26.33  ? 232  ALA C N   1 
ATOM   6566  C CA  . ALA C 1 232 ? -14.110 15.630  80.721  1.00 26.82  ? 232  ALA C CA  1 
ATOM   6567  C C   . ALA C 1 232 ? -14.232 15.212  79.245  1.00 33.21  ? 232  ALA C C   1 
ATOM   6568  O O   . ALA C 1 232 ? -13.249 14.724  78.674  1.00 34.53  ? 232  ALA C O   1 
ATOM   6569  C CB  . ALA C 1 232 ? -14.800 14.619  81.617  1.00 26.87  ? 232  ALA C CB  1 
ATOM   6570  N N   . HIS C 1 233 ? -15.406 15.480  78.605  1.00 28.10  ? 233  HIS C N   1 
ATOM   6571  C CA  . HIS C 1 233 ? -15.613 15.217  77.179  1.00 28.02  ? 233  HIS C CA  1 
ATOM   6572  C C   . HIS C 1 233 ? -14.595 15.960  76.311  1.00 33.33  ? 233  HIS C C   1 
ATOM   6573  O O   . HIS C 1 233 ? -14.187 15.441  75.271  1.00 34.30  ? 233  HIS C O   1 
ATOM   6574  C CB  . HIS C 1 233 ? -17.019 15.636  76.741  1.00 27.59  ? 233  HIS C CB  1 
ATOM   6575  C CG  . HIS C 1 233 ? -18.105 14.691  77.124  1.00 30.18  ? 233  HIS C CG  1 
ATOM   6576  N ND1 . HIS C 1 233 ? -18.111 13.385  76.678  1.00 32.27  ? 233  HIS C ND1 1 
ATOM   6577  C CD2 . HIS C 1 233 ? -19.226 14.913  77.854  1.00 30.20  ? 233  HIS C CD2 1 
ATOM   6578  C CE1 . HIS C 1 233 ? -19.222 12.853  77.153  1.00 31.23  ? 233  HIS C CE1 1 
ATOM   6579  N NE2 . HIS C 1 233 ? -19.919 13.733  77.876  1.00 30.32  ? 233  HIS C NE2 1 
ATOM   6580  N N   . ASN C 1 234 ? -14.213 17.180  76.737  1.00 30.43  ? 234  ASN C N   1 
ATOM   6581  C CA  . ASN C 1 234 ? -13.278 18.057  76.030  1.00 31.15  ? 234  ASN C CA  1 
ATOM   6582  C C   . ASN C 1 234 ? -11.807 17.714  76.322  1.00 36.15  ? 234  ASN C C   1 
ATOM   6583  O O   . ASN C 1 234 ? -10.912 18.350  75.758  1.00 36.78  ? 234  ASN C O   1 
ATOM   6584  C CB  . ASN C 1 234 ? -13.560 19.522  76.374  1.00 29.92  ? 234  ASN C CB  1 
ATOM   6585  C CG  . ASN C 1 234 ? -14.714 20.127  75.608  1.00 39.61  ? 234  ASN C CG  1 
ATOM   6586  O OD1 . ASN C 1 234 ? -15.079 19.691  74.513  1.00 34.46  ? 234  ASN C OD1 1 
ATOM   6587  N ND2 . ASN C 1 234 ? -15.296 21.176  76.155  1.00 30.94  ? 234  ASN C ND2 1 
ATOM   6588  N N   . GLY C 1 235 ? -11.580 16.699  77.158  1.00 31.97  ? 235  GLY C N   1 
ATOM   6589  C CA  . GLY C 1 235 ? -10.248 16.247  77.545  1.00 32.38  ? 235  GLY C CA  1 
ATOM   6590  C C   . GLY C 1 235 ? -9.569  17.151  78.551  1.00 35.88  ? 235  GLY C C   1 
ATOM   6591  O O   . GLY C 1 235 ? -8.339  17.179  78.656  1.00 36.45  ? 235  GLY C O   1 
ATOM   6592  N N   . VAL C 1 236 ? -10.382 17.897  79.299  1.00 30.77  ? 236  VAL C N   1 
ATOM   6593  C CA  . VAL C 1 236 ? -9.950  18.844  80.327  1.00 29.22  ? 236  VAL C CA  1 
ATOM   6594  C C   . VAL C 1 236 ? -10.007 18.127  81.667  1.00 32.56  ? 236  VAL C C   1 
ATOM   6595  O O   . VAL C 1 236 ? -10.987 17.422  81.923  1.00 32.78  ? 236  VAL C O   1 
ATOM   6596  C CB  . VAL C 1 236 ? -10.825 20.126  80.305  1.00 31.33  ? 236  VAL C CB  1 
ATOM   6597  C CG1 . VAL C 1 236 ? -10.400 21.102  81.390  1.00 30.61  ? 236  VAL C CG1 1 
ATOM   6598  C CG2 . VAL C 1 236 ? -10.794 20.793  78.931  1.00 31.48  ? 236  VAL C CG2 1 
ATOM   6599  N N   . ALA C 1 237 ? -8.946  18.274  82.501  1.00 28.54  ? 237  ALA C N   1 
ATOM   6600  C CA  . ALA C 1 237 ? -8.838  17.671  83.834  1.00 27.78  ? 237  ALA C CA  1 
ATOM   6601  C C   . ALA C 1 237 ? -10.075 18.072  84.649  1.00 31.37  ? 237  ALA C C   1 
ATOM   6602  O O   . ALA C 1 237 ? -10.560 19.196  84.494  1.00 30.33  ? 237  ALA C O   1 
ATOM   6603  C CB  . ALA C 1 237 ? -7.547  18.117  84.519  1.00 29.12  ? 237  ALA C CB  1 
ATOM   6604  N N   . PRO C 1 238 ? -10.683 17.155  85.428  1.00 28.78  ? 238  PRO C N   1 
ATOM   6605  C CA  . PRO C 1 238 ? -11.930 17.519  86.128  1.00 27.84  ? 238  PRO C CA  1 
ATOM   6606  C C   . PRO C 1 238 ? -11.730 18.580  87.207  1.00 30.43  ? 238  PRO C C   1 
ATOM   6607  O O   . PRO C 1 238 ? -10.692 18.600  87.872  1.00 31.11  ? 238  PRO C O   1 
ATOM   6608  C CB  . PRO C 1 238 ? -12.395 16.190  86.738  1.00 29.33  ? 238  PRO C CB  1 
ATOM   6609  C CG  . PRO C 1 238 ? -11.176 15.381  86.867  1.00 34.40  ? 238  PRO C CG  1 
ATOM   6610  C CD  . PRO C 1 238 ? -10.285 15.761  85.720  1.00 30.71  ? 238  PRO C CD  1 
ATOM   6611  N N   . SER C 1 239 ? -12.712 19.476  87.357  1.00 24.13  ? 239  SER C N   1 
ATOM   6612  C CA  . SER C 1 239 ? -12.689 20.491  88.414  1.00 22.32  ? 239  SER C CA  1 
ATOM   6613  C C   . SER C 1 239 ? -14.037 20.449  89.174  1.00 25.14  ? 239  SER C C   1 
ATOM   6614  O O   . SER C 1 239 ? -14.828 19.529  88.969  1.00 24.55  ? 239  SER C O   1 
ATOM   6615  C CB  . SER C 1 239 ? -12.349 21.878  87.869  1.00 23.53  ? 239  SER C CB  1 
ATOM   6616  O OG  . SER C 1 239 ? -13.394 22.466  87.116  1.00 27.10  ? 239  SER C OG  1 
ATOM   6617  N N   . ARG C 1 240 ? -14.263 21.387  90.088  1.00 22.03  ? 240  ARG C N   1 
ATOM   6618  C CA  . ARG C 1 240 ? -15.436 21.421  90.950  1.00 22.19  ? 240  ARG C CA  1 
ATOM   6619  C C   . ARG C 1 240 ? -16.749 21.544  90.184  1.00 26.04  ? 240  ARG C C   1 
ATOM   6620  O O   . ARG C 1 240 ? -17.680 20.797  90.504  1.00 24.41  ? 240  ARG C O   1 
ATOM   6621  C CB  . ARG C 1 240 ? -15.317 22.538  91.982  1.00 22.30  ? 240  ARG C CB  1 
ATOM   6622  C CG  . ARG C 1 240 ? -14.206 22.258  92.985  1.00 24.19  ? 240  ARG C CG  1 
ATOM   6623  C CD  . ARG C 1 240 ? -13.989 23.424  93.913  1.00 27.08  ? 240  ARG C CD  1 
ATOM   6624  N NE  . ARG C 1 240 ? -13.232 24.504  93.273  1.00 24.03  ? 240  ARG C NE  1 
ATOM   6625  C CZ  . ARG C 1 240 ? -12.679 25.521  93.926  1.00 35.87  ? 240  ARG C CZ  1 
ATOM   6626  N NH1 . ARG C 1 240 ? -12.798 25.618  95.243  1.00 24.44  ? 240  ARG C NH1 1 
ATOM   6627  N NH2 . ARG C 1 240 ? -12.008 26.454  93.265  1.00 22.59  ? 240  ARG C NH2 1 
ATOM   6628  N N   . ARG C 1 241 ? -16.817 22.425  89.149  1.00 22.33  ? 241  ARG C N   1 
ATOM   6629  C CA  . ARG C 1 241 ? -18.029 22.596  88.342  1.00 21.51  ? 241  ARG C CA  1 
ATOM   6630  C C   . ARG C 1 241 ? -18.443 21.284  87.666  1.00 27.25  ? 241  ARG C C   1 
ATOM   6631  O O   . ARG C 1 241 ? -19.641 21.014  87.572  1.00 28.80  ? 241  ARG C O   1 
ATOM   6632  C CB  . ARG C 1 241 ? -17.901 23.730  87.312  1.00 19.29  ? 241  ARG C CB  1 
ATOM   6633  C CG  . ARG C 1 241 ? -16.895 23.521  86.195  1.00 20.97  ? 241  ARG C CG  1 
ATOM   6634  C CD  . ARG C 1 241 ? -16.979 24.651  85.209  1.00 20.02  ? 241  ARG C CD  1 
ATOM   6635  N NE  . ARG C 1 241 ? -16.226 24.357  83.994  1.00 27.22  ? 241  ARG C NE  1 
ATOM   6636  C CZ  . ARG C 1 241 ? -16.125 25.187  82.967  1.00 32.79  ? 241  ARG C CZ  1 
ATOM   6637  N NH1 . ARG C 1 241 ? -16.715 26.371  83.004  1.00 22.19  ? 241  ARG C NH1 1 
ATOM   6638  N NH2 . ARG C 1 241 ? -15.423 24.843  81.895  1.00 23.57  ? 241  ARG C NH2 1 
ATOM   6639  N N   . GLY C 1 242 ? -17.462 20.475  87.257  1.00 23.42  ? 242  GLY C N   1 
ATOM   6640  C CA  . GLY C 1 242 ? -17.678 19.174  86.635  1.00 23.67  ? 242  GLY C CA  1 
ATOM   6641  C C   . GLY C 1 242 ? -18.447 18.216  87.522  1.00 27.04  ? 242  GLY C C   1 
ATOM   6642  O O   . GLY C 1 242 ? -19.402 17.597  87.063  1.00 27.20  ? 242  GLY C O   1 
ATOM   6643  N N   . ASP C 1 243 ? -18.059 18.115  88.805  1.00 23.26  ? 243  ASP C N   1 
ATOM   6644  C CA  . ASP C 1 243 ? -18.709 17.257  89.807  1.00 21.95  ? 243  ASP C CA  1 
ATOM   6645  C C   . ASP C 1 243 ? -20.163 17.637  90.019  1.00 24.73  ? 243  ASP C C   1 
ATOM   6646  O O   . ASP C 1 243 ? -21.006 16.762  90.190  1.00 25.32  ? 243  ASP C O   1 
ATOM   6647  C CB  . ASP C 1 243 ? -17.963 17.326  91.161  1.00 22.72  ? 243  ASP C CB  1 
ATOM   6648  C CG  . ASP C 1 243 ? -16.799 16.369  91.309  1.00 29.22  ? 243  ASP C CG  1 
ATOM   6649  O OD1 . ASP C 1 243 ? -16.463 15.673  90.317  1.00 30.25  ? 243  ASP C OD1 1 
ATOM   6650  O OD2 . ASP C 1 243 ? -16.215 16.319  92.408  1.00 31.93  ? 243  ASP C OD2 1 
ATOM   6651  N N   . LEU C 1 244 ? -20.449 18.943  90.019  1.00 21.46  ? 244  LEU C N   1 
ATOM   6652  C CA  . LEU C 1 244 ? -21.781 19.503  90.218  1.00 20.82  ? 244  LEU C CA  1 
ATOM   6653  C C   . LEU C 1 244 ? -22.651 19.276  88.992  1.00 26.66  ? 244  LEU C C   1 
ATOM   6654  O O   . LEU C 1 244 ? -23.862 19.052  89.127  1.00 26.99  ? 244  LEU C O   1 
ATOM   6655  C CB  . LEU C 1 244 ? -21.690 20.991  90.563  1.00 20.40  ? 244  LEU C CB  1 
ATOM   6656  C CG  . LEU C 1 244 ? -20.964 21.334  91.874  1.00 24.24  ? 244  LEU C CG  1 
ATOM   6657  C CD1 . LEU C 1 244 ? -20.899 22.795  92.063  1.00 24.38  ? 244  LEU C CD1 1 
ATOM   6658  C CD2 . LEU C 1 244 ? -21.620 20.701  93.084  1.00 26.43  ? 244  LEU C CD2 1 
ATOM   6659  N N   . GLU C 1 245 ? -22.027 19.297  87.801  1.00 24.34  ? 245  GLU C N   1 
ATOM   6660  C CA  . GLU C 1 245 ? -22.675 19.041  86.516  1.00 24.48  ? 245  GLU C CA  1 
ATOM   6661  C C   . GLU C 1 245 ? -23.100 17.570  86.467  1.00 27.83  ? 245  GLU C C   1 
ATOM   6662  O O   . GLU C 1 245 ? -24.264 17.292  86.157  1.00 27.38  ? 245  GLU C O   1 
ATOM   6663  C CB  . GLU C 1 245 ? -21.725 19.397  85.365  1.00 26.06  ? 245  GLU C CB  1 
ATOM   6664  C CG  . GLU C 1 245 ? -22.373 19.383  83.996  1.00 37.73  ? 245  GLU C CG  1 
ATOM   6665  C CD  . GLU C 1 245 ? -21.421 19.474  82.821  1.00 51.02  ? 245  GLU C CD  1 
ATOM   6666  O OE1 . GLU C 1 245 ? -21.705 18.859  81.770  1.00 40.77  ? 245  GLU C OE1 1 
ATOM   6667  O OE2 . GLU C 1 245 ? -20.383 20.154  82.957  1.00 45.69  ? 245  GLU C OE2 1 
ATOM   6668  N N   . ILE C 1 246 ? -22.174 16.644  86.829  1.00 22.49  ? 246  ILE C N   1 
ATOM   6669  C CA  . ILE C 1 246 ? -22.414 15.200  86.895  1.00 22.54  ? 246  ILE C CA  1 
ATOM   6670  C C   . ILE C 1 246 ? -23.636 14.916  87.803  1.00 27.86  ? 246  ILE C C   1 
ATOM   6671  O O   . ILE C 1 246 ? -24.533 14.167  87.389  1.00 28.68  ? 246  ILE C O   1 
ATOM   6672  C CB  . ILE C 1 246 ? -21.143 14.436  87.361  1.00 24.84  ? 246  ILE C CB  1 
ATOM   6673  C CG1 . ILE C 1 246 ? -19.980 14.583  86.335  1.00 23.95  ? 246  ILE C CG1 1 
ATOM   6674  C CG2 . ILE C 1 246 ? -21.461 12.962  87.607  1.00 25.75  ? 246  ILE C CG2 1 
ATOM   6675  C CD1 . ILE C 1 246 ? -18.604 14.278  86.876  1.00 25.39  ? 246  ILE C CD1 1 
ATOM   6676  N N   . LEU C 1 247 ? -23.699 15.562  88.994  1.00 23.21  ? 247  LEU C N   1 
ATOM   6677  C CA  . LEU C 1 247 ? -24.821 15.431  89.929  1.00 23.27  ? 247  LEU C CA  1 
ATOM   6678  C C   . LEU C 1 247 ? -26.136 15.889  89.270  1.00 28.11  ? 247  LEU C C   1 
ATOM   6679  O O   . LEU C 1 247 ? -27.146 15.217  89.439  1.00 28.51  ? 247  LEU C O   1 
ATOM   6680  C CB  . LEU C 1 247 ? -24.564 16.192  91.256  1.00 22.78  ? 247  LEU C CB  1 
ATOM   6681  C CG  . LEU C 1 247 ? -25.703 16.195  92.312  1.00 26.05  ? 247  LEU C CG  1 
ATOM   6682  C CD1 . LEU C 1 247 ? -26.117 14.775  92.710  1.00 25.46  ? 247  LEU C CD1 1 
ATOM   6683  C CD2 . LEU C 1 247 ? -25.314 16.994  93.536  1.00 26.58  ? 247  LEU C CD2 1 
ATOM   6684  N N   . GLY C 1 248 ? -26.091 16.991  88.515  1.00 25.29  ? 248  GLY C N   1 
ATOM   6685  C CA  . GLY C 1 248 ? -27.225 17.518  87.761  1.00 24.77  ? 248  GLY C CA  1 
ATOM   6686  C C   . GLY C 1 248 ? -27.822 16.484  86.829  1.00 28.84  ? 248  GLY C C   1 
ATOM   6687  O O   . GLY C 1 248 ? -29.034 16.268  86.868  1.00 30.18  ? 248  GLY C O   1 
ATOM   6688  N N   . TYR C 1 249 ? -26.969 15.789  86.030  1.00 24.40  ? 249  TYR C N   1 
ATOM   6689  C CA  . TYR C 1 249 ? -27.383 14.724  85.098  1.00 23.74  ? 249  TYR C CA  1 
ATOM   6690  C C   . TYR C 1 249 ? -27.957 13.535  85.849  1.00 28.90  ? 249  TYR C C   1 
ATOM   6691  O O   . TYR C 1 249 ? -28.917 12.939  85.375  1.00 30.07  ? 249  TYR C O   1 
ATOM   6692  C CB  . TYR C 1 249 ? -26.218 14.261  84.202  1.00 23.18  ? 249  TYR C CB  1 
ATOM   6693  C CG  . TYR C 1 249 ? -25.640 15.345  83.325  1.00 23.65  ? 249  TYR C CG  1 
ATOM   6694  C CD1 . TYR C 1 249 ? -26.459 16.312  82.741  1.00 26.45  ? 249  TYR C CD1 1 
ATOM   6695  C CD2 . TYR C 1 249 ? -24.279 15.381  83.036  1.00 22.90  ? 249  TYR C CD2 1 
ATOM   6696  C CE1 . TYR C 1 249 ? -25.930 17.312  81.929  1.00 26.80  ? 249  TYR C CE1 1 
ATOM   6697  C CE2 . TYR C 1 249 ? -23.742 16.367  82.214  1.00 23.05  ? 249  TYR C CE2 1 
ATOM   6698  C CZ  . TYR C 1 249 ? -24.571 17.329  81.663  1.00 30.30  ? 249  TYR C CZ  1 
ATOM   6699  O OH  . TYR C 1 249 ? -24.047 18.306  80.859  1.00 32.29  ? 249  TYR C OH  1 
ATOM   6700  N N   . CYS C 1 250 ? -27.372 13.195  87.017  1.00 26.41  ? 250  CYS C N   1 
ATOM   6701  C CA  . CYS C 1 250 ? -27.825 12.132  87.911  1.00 26.44  ? 250  CYS C CA  1 
ATOM   6702  C C   . CYS C 1 250 ? -29.242 12.417  88.376  1.00 31.57  ? 250  CYS C C   1 
ATOM   6703  O O   . CYS C 1 250 ? -30.083 11.524  88.305  1.00 33.19  ? 250  CYS C O   1 
ATOM   6704  C CB  . CYS C 1 250 ? -26.879 11.980  89.099  1.00 26.38  ? 250  CYS C CB  1 
ATOM   6705  S SG  . CYS C 1 250 ? -25.396 11.010  88.739  1.00 30.43  ? 250  CYS C SG  1 
ATOM   6706  N N   . MET C 1 251 ? -29.515 13.671  88.816  1.00 27.47  ? 251  MET C N   1 
ATOM   6707  C CA  . MET C 1 251 ? -30.821 14.122  89.299  1.00 28.04  ? 251  MET C CA  1 
ATOM   6708  C C   . MET C 1 251 ? -31.904 13.928  88.240  1.00 32.68  ? 251  MET C C   1 
ATOM   6709  O O   . MET C 1 251 ? -32.952 13.382  88.568  1.00 34.54  ? 251  MET C O   1 
ATOM   6710  C CB  . MET C 1 251 ? -30.776 15.586  89.766  1.00 30.10  ? 251  MET C CB  1 
ATOM   6711  C CG  . MET C 1 251 ? -29.970 15.789  91.040  1.00 33.37  ? 251  MET C CG  1 
ATOM   6712  S SD  . MET C 1 251 ? -30.095 17.430  91.809  1.00 38.17  ? 251  MET C SD  1 
ATOM   6713  C CE  . MET C 1 251 ? -29.657 18.456  90.457  1.00 33.77  ? 251  MET C CE  1 
ATOM   6714  N N   . ILE C 1 252 ? -31.636 14.322  86.972  1.00 27.77  ? 252  ILE C N   1 
ATOM   6715  C CA  . ILE C 1 252 ? -32.569 14.178  85.843  1.00 27.68  ? 252  ILE C CA  1 
ATOM   6716  C C   . ILE C 1 252 ? -32.833 12.681  85.585  1.00 32.02  ? 252  ILE C C   1 
ATOM   6717  O O   . ILE C 1 252 ? -33.993 12.280  85.488  1.00 32.31  ? 252  ILE C O   1 
ATOM   6718  C CB  . ILE C 1 252 ? -32.046 14.923  84.576  1.00 30.32  ? 252  ILE C CB  1 
ATOM   6719  C CG1 . ILE C 1 252 ? -32.103 16.461  84.780  1.00 30.39  ? 252  ILE C CG1 1 
ATOM   6720  C CG2 . ILE C 1 252 ? -32.819 14.503  83.305  1.00 31.17  ? 252  ILE C CG2 1 
ATOM   6721  C CD1 . ILE C 1 252 ? -31.213 17.292  83.848  1.00 25.57  ? 252  ILE C CD1 1 
ATOM   6722  N N   . GLN C 1 253 ? -31.760 11.869  85.507  1.00 28.13  ? 253  GLN C N   1 
ATOM   6723  C CA  . GLN C 1 253 ? -31.814 10.420  85.294  1.00 28.84  ? 253  GLN C CA  1 
ATOM   6724  C C   . GLN C 1 253 ? -32.670 9.739   86.379  1.00 32.45  ? 253  GLN C C   1 
ATOM   6725  O O   . GLN C 1 253 ? -33.475 8.876   86.058  1.00 33.56  ? 253  GLN C O   1 
ATOM   6726  C CB  . GLN C 1 253 ? -30.376 9.850   85.289  1.00 29.83  ? 253  GLN C CB  1 
ATOM   6727  C CG  . GLN C 1 253 ? -30.245 8.315   85.315  1.00 38.18  ? 253  GLN C CG  1 
ATOM   6728  C CD  . GLN C 1 253 ? -30.531 7.679   83.980  1.00 52.41  ? 253  GLN C CD  1 
ATOM   6729  O OE1 . GLN C 1 253 ? -30.015 8.092   82.936  1.00 47.18  ? 253  GLN C OE1 1 
ATOM   6730  N NE2 . GLN C 1 253 ? -31.341 6.633   83.988  1.00 48.77  ? 253  GLN C NE2 1 
ATOM   6731  N N   . TRP C 1 254 ? -32.495 10.128  87.648  1.00 27.63  ? 254  TRP C N   1 
ATOM   6732  C CA  . TRP C 1 254 ? -33.220 9.539   88.777  1.00 27.51  ? 254  TRP C CA  1 
ATOM   6733  C C   . TRP C 1 254 ? -34.691 9.943   88.769  1.00 33.53  ? 254  TRP C C   1 
ATOM   6734  O O   . TRP C 1 254 ? -35.552 9.118   89.079  1.00 35.67  ? 254  TRP C O   1 
ATOM   6735  C CB  . TRP C 1 254 ? -32.561 9.929   90.114  1.00 24.79  ? 254  TRP C CB  1 
ATOM   6736  C CG  . TRP C 1 254 ? -31.144 9.458   90.276  1.00 24.97  ? 254  TRP C CG  1 
ATOM   6737  C CD1 . TRP C 1 254 ? -30.537 8.421   89.622  1.00 28.05  ? 254  TRP C CD1 1 
ATOM   6738  C CD2 . TRP C 1 254 ? -30.152 10.007  91.165  1.00 24.02  ? 254  TRP C CD2 1 
ATOM   6739  N NE1 . TRP C 1 254 ? -29.224 8.313   90.021  1.00 27.18  ? 254  TRP C NE1 1 
ATOM   6740  C CE2 . TRP C 1 254 ? -28.968 9.254   90.988  1.00 27.65  ? 254  TRP C CE2 1 
ATOM   6741  C CE3 . TRP C 1 254 ? -30.145 11.074  92.083  1.00 24.71  ? 254  TRP C CE3 1 
ATOM   6742  C CZ2 . TRP C 1 254 ? -27.795 9.520   91.710  1.00 26.04  ? 254  TRP C CZ2 1 
ATOM   6743  C CZ3 . TRP C 1 254 ? -28.980 11.336  92.797  1.00 25.41  ? 254  TRP C CZ3 1 
ATOM   6744  C CH2 . TRP C 1 254 ? -27.823 10.568  92.604  1.00 25.70  ? 254  TRP C CH2 1 
ATOM   6745  N N   . LEU C 1 255 ? -34.980 11.198  88.399  1.00 28.59  ? 255  LEU C N   1 
ATOM   6746  C CA  . LEU C 1 255 ? -36.337 11.729  88.356  1.00 28.40  ? 255  LEU C CA  1 
ATOM   6747  C C   . LEU C 1 255 ? -37.157 11.212  87.174  1.00 33.57  ? 255  LEU C C   1 
ATOM   6748  O O   . LEU C 1 255 ? -38.351 10.959  87.342  1.00 34.50  ? 255  LEU C O   1 
ATOM   6749  C CB  . LEU C 1 255 ? -36.308 13.268  88.307  1.00 27.34  ? 255  LEU C CB  1 
ATOM   6750  C CG  . LEU C 1 255 ? -35.998 14.008  89.613  1.00 30.82  ? 255  LEU C CG  1 
ATOM   6751  C CD1 . LEU C 1 255 ? -35.682 15.456  89.334  1.00 30.29  ? 255  LEU C CD1 1 
ATOM   6752  C CD2 . LEU C 1 255 ? -37.138 13.902  90.618  1.00 32.62  ? 255  LEU C CD2 1 
ATOM   6753  N N   . THR C 1 256 ? -36.536 11.082  85.983  1.00 30.00  ? 256  THR C N   1 
ATOM   6754  C CA  . THR C 1 256 ? -37.226 10.724  84.737  1.00 30.66  ? 256  THR C CA  1 
ATOM   6755  C C   . THR C 1 256 ? -36.969 9.303   84.220  1.00 36.05  ? 256  THR C C   1 
ATOM   6756  O O   . THR C 1 256 ? -37.705 8.839   83.341  1.00 37.82  ? 256  THR C O   1 
ATOM   6757  C CB  . THR C 1 256 ? -36.813 11.706  83.631  1.00 32.44  ? 256  THR C CB  1 
ATOM   6758  O OG1 . THR C 1 256 ? -35.453 11.468  83.274  1.00 29.00  ? 256  THR C OG1 1 
ATOM   6759  C CG2 . THR C 1 256 ? -37.001 13.160  84.038  1.00 27.38  ? 256  THR C CG2 1 
ATOM   6760  N N   . GLY C 1 257 ? -35.911 8.663   84.699  1.00 31.76  ? 257  GLY C N   1 
ATOM   6761  C CA  . GLY C 1 257 ? -35.515 7.336   84.242  1.00 32.20  ? 257  GLY C CA  1 
ATOM   6762  C C   . GLY C 1 257 ? -34.724 7.355   82.948  1.00 37.23  ? 257  GLY C C   1 
ATOM   6763  O O   . GLY C 1 257 ? -34.385 6.291   82.418  1.00 38.21  ? 257  GLY C O   1 
ATOM   6764  N N   . HIS C 1 258 ? -34.439 8.566   82.410  1.00 33.36  ? 258  HIS C N   1 
ATOM   6765  C CA  . HIS C 1 258 ? -33.734 8.736   81.130  1.00 32.94  ? 258  HIS C CA  1 
ATOM   6766  C C   . HIS C 1 258 ? -32.848 9.983   81.087  1.00 33.50  ? 258  HIS C C   1 
ATOM   6767  O O   . HIS C 1 258 ? -32.940 10.863  81.947  1.00 32.10  ? 258  HIS C O   1 
ATOM   6768  C CB  . HIS C 1 258 ? -34.759 8.837   79.970  1.00 35.54  ? 258  HIS C CB  1 
ATOM   6769  C CG  . HIS C 1 258 ? -35.771 7.740   79.941  1.00 41.06  ? 258  HIS C CG  1 
ATOM   6770  N ND1 . HIS C 1 258 ? -35.490 6.511   79.370  1.00 44.27  ? 258  HIS C ND1 1 
ATOM   6771  C CD2 . HIS C 1 258 ? -37.026 7.716   80.442  1.00 44.49  ? 258  HIS C CD2 1 
ATOM   6772  C CE1 . HIS C 1 258 ? -36.582 5.783   79.532  1.00 45.58  ? 258  HIS C CE1 1 
ATOM   6773  N NE2 . HIS C 1 258 ? -37.534 6.466   80.173  1.00 46.02  ? 258  HIS C NE2 1 
ATOM   6774  N N   . LEU C 1 259 ? -32.008 10.053  80.044  1.00 29.54  ? 259  LEU C N   1 
ATOM   6775  C CA  . LEU C 1 259 ? -31.162 11.185  79.665  1.00 28.47  ? 259  LEU C CA  1 
ATOM   6776  C C   . LEU C 1 259 ? -31.300 11.342  78.147  1.00 33.35  ? 259  LEU C C   1 
ATOM   6777  O O   . LEU C 1 259 ? -31.433 10.324  77.464  1.00 32.16  ? 259  LEU C O   1 
ATOM   6778  C CB  . LEU C 1 259 ? -29.696 11.042  80.120  1.00 27.34  ? 259  LEU C CB  1 
ATOM   6779  C CG  . LEU C 1 259 ? -29.427 11.311  81.617  1.00 30.04  ? 259  LEU C CG  1 
ATOM   6780  C CD1 . LEU C 1 259 ? -28.035 10.887  81.991  1.00 29.33  ? 259  LEU C CD1 1 
ATOM   6781  C CD2 . LEU C 1 259 ? -29.654 12.785  81.988  1.00 29.59  ? 259  LEU C CD2 1 
ATOM   6782  N N   . PRO C 1 260 ? -31.370 12.584  77.596  1.00 30.81  ? 260  PRO C N   1 
ATOM   6783  C CA  . PRO C 1 260 ? -31.633 12.732  76.145  1.00 31.69  ? 260  PRO C CA  1 
ATOM   6784  C C   . PRO C 1 260 ? -30.663 12.015  75.190  1.00 38.77  ? 260  PRO C C   1 
ATOM   6785  O O   . PRO C 1 260 ? -31.087 11.568  74.113  1.00 41.18  ? 260  PRO C O   1 
ATOM   6786  C CB  . PRO C 1 260 ? -31.547 14.234  75.923  1.00 32.47  ? 260  PRO C CB  1 
ATOM   6787  C CG  . PRO C 1 260 ? -31.834 14.834  77.246  1.00 36.00  ? 260  PRO C CG  1 
ATOM   6788  C CD  . PRO C 1 260 ? -31.299 13.900  78.269  1.00 30.61  ? 260  PRO C CD  1 
ATOM   6789  N N   . TRP C 1 261 ? -29.389 11.890  75.584  1.00 33.83  ? 261  TRP C N   1 
ATOM   6790  C CA  . TRP C 1 261 ? -28.313 11.302  74.781  1.00 34.61  ? 261  TRP C CA  1 
ATOM   6791  C C   . TRP C 1 261 ? -28.079 9.792   75.026  1.00 38.84  ? 261  TRP C C   1 
ATOM   6792  O O   . TRP C 1 261 ? -27.146 9.244   74.444  1.00 38.79  ? 261  TRP C O   1 
ATOM   6793  C CB  . TRP C 1 261 ? -27.002 12.070  75.072  1.00 32.17  ? 261  TRP C CB  1 
ATOM   6794  C CG  . TRP C 1 261 ? -26.760 12.310  76.537  1.00 31.36  ? 261  TRP C CG  1 
ATOM   6795  C CD1 . TRP C 1 261 ? -26.185 11.451  77.426  1.00 33.55  ? 261  TRP C CD1 1 
ATOM   6796  C CD2 . TRP C 1 261 ? -27.119 13.479  77.284  1.00 30.22  ? 261  TRP C CD2 1 
ATOM   6797  N NE1 . TRP C 1 261 ? -26.156 12.017  78.681  1.00 31.41  ? 261  TRP C NE1 1 
ATOM   6798  C CE2 . TRP C 1 261 ? -26.724 13.261  78.623  1.00 32.64  ? 261  TRP C CE2 1 
ATOM   6799  C CE3 . TRP C 1 261 ? -27.744 14.694  76.953  1.00 31.60  ? 261  TRP C CE3 1 
ATOM   6800  C CZ2 . TRP C 1 261 ? -26.927 14.217  79.630  1.00 31.07  ? 261  TRP C CZ2 1 
ATOM   6801  C CZ3 . TRP C 1 261 ? -27.937 15.643  77.949  1.00 31.66  ? 261  TRP C CZ3 1 
ATOM   6802  C CH2 . TRP C 1 261 ? -27.536 15.400  79.269  1.00 30.98  ? 261  TRP C CH2 1 
ATOM   6803  N N   . GLU C 1 262 ? -28.919 9.122   75.843  1.00 35.86  ? 262  GLU C N   1 
ATOM   6804  C CA  . GLU C 1 262 ? -28.743 7.710   76.222  1.00 36.38  ? 262  GLU C CA  1 
ATOM   6805  C C   . GLU C 1 262 ? -28.853 6.692   75.065  1.00 44.89  ? 262  GLU C C   1 
ATOM   6806  O O   . GLU C 1 262 ? -28.369 5.567   75.215  1.00 45.75  ? 262  GLU C O   1 
ATOM   6807  C CB  . GLU C 1 262 ? -29.710 7.315   77.341  1.00 36.90  ? 262  GLU C CB  1 
ATOM   6808  C CG  . GLU C 1 262 ? -31.174 7.202   76.942  1.00 45.43  ? 262  GLU C CG  1 
ATOM   6809  C CD  . GLU C 1 262 ? -32.128 6.821   78.058  1.00 57.47  ? 262  GLU C CD  1 
ATOM   6810  O OE1 . GLU C 1 262 ? -33.284 6.470   77.737  1.00 55.64  ? 262  GLU C OE1 1 
ATOM   6811  O OE2 . GLU C 1 262 ? -31.729 6.859   79.246  1.00 51.37  ? 262  GLU C OE2 1 
ATOM   6812  N N   . ASP C 1 263 ? -29.464 7.070   73.934  1.00 43.55  ? 263  ASP C N   1 
ATOM   6813  C CA  . ASP C 1 263 ? -29.620 6.143   72.818  1.00 46.32  ? 263  ASP C CA  1 
ATOM   6814  C C   . ASP C 1 263 ? -28.394 6.114   71.881  1.00 48.79  ? 263  ASP C C   1 
ATOM   6815  O O   . ASP C 1 263 ? -28.401 5.357   70.909  1.00 49.97  ? 263  ASP C O   1 
ATOM   6816  C CB  . ASP C 1 263 ? -30.912 6.444   72.035  1.00 50.53  ? 263  ASP C CB  1 
ATOM   6817  C CG  . ASP C 1 263 ? -32.181 6.113   72.816  1.00 68.82  ? 263  ASP C CG  1 
ATOM   6818  O OD1 . ASP C 1 263 ? -32.180 5.097   73.564  1.00 70.04  ? 263  ASP C OD1 1 
ATOM   6819  O OD2 . ASP C 1 263 ? -33.183 6.852   72.664  1.00 78.02  ? 263  ASP C OD2 1 
ATOM   6820  N N   . ASN C 1 264 ? -27.341 6.893   72.178  1.00 42.59  ? 264  ASN C N   1 
ATOM   6821  C CA  . ASN C 1 264 ? -26.151 6.880   71.338  1.00 42.89  ? 264  ASN C CA  1 
ATOM   6822  C C   . ASN C 1 264 ? -24.894 7.133   72.194  1.00 41.84  ? 264  ASN C C   1 
ATOM   6823  O O   . ASN C 1 264 ? -24.073 7.994   71.874  1.00 40.81  ? 264  ASN C O   1 
ATOM   6824  C CB  . ASN C 1 264 ? -26.280 7.872   70.150  1.00 46.17  ? 264  ASN C CB  1 
ATOM   6825  C CG  . ASN C 1 264 ? -25.527 7.461   68.890  1.00 76.34  ? 264  ASN C CG  1 
ATOM   6826  O OD1 . ASN C 1 264 ? -24.969 6.358   68.773  1.00 73.30  ? 264  ASN C OD1 1 
ATOM   6827  N ND2 . ASN C 1 264 ? -25.507 8.341   67.897  1.00 70.45  ? 264  ASN C ND2 1 
ATOM   6828  N N   . LEU C 1 265 ? -24.715 6.306   73.245  1.00 36.28  ? 265  LEU C N   1 
ATOM   6829  C CA  . LEU C 1 265 ? -23.576 6.392   74.175  1.00 34.20  ? 265  LEU C CA  1 
ATOM   6830  C C   . LEU C 1 265 ? -22.277 5.822   73.569  1.00 38.80  ? 265  LEU C C   1 
ATOM   6831  O O   . LEU C 1 265 ? -21.199 6.013   74.135  1.00 38.22  ? 265  LEU C O   1 
ATOM   6832  C CB  . LEU C 1 265 ? -23.900 5.691   75.505  1.00 32.95  ? 265  LEU C CB  1 
ATOM   6833  C CG  . LEU C 1 265 ? -25.080 6.249   76.312  1.00 35.67  ? 265  LEU C CG  1 
ATOM   6834  C CD1 . LEU C 1 265 ? -25.280 5.458   77.581  1.00 34.72  ? 265  LEU C CD1 1 
ATOM   6835  C CD2 . LEU C 1 265 ? -24.890 7.720   76.644  1.00 36.44  ? 265  LEU C CD2 1 
ATOM   6836  N N   . LYS C 1 266 ? -22.387 5.158   72.407  1.00 37.53  ? 266  LYS C N   1 
ATOM   6837  C CA  . LYS C 1 266 ? -21.271 4.577   71.664  1.00 39.25  ? 266  LYS C CA  1 
ATOM   6838  C C   . LYS C 1 266 ? -20.629 5.632   70.739  1.00 43.57  ? 266  LYS C C   1 
ATOM   6839  O O   . LYS C 1 266 ? -19.594 5.361   70.128  1.00 45.00  ? 266  LYS C O   1 
ATOM   6840  C CB  . LYS C 1 266 ? -21.718 3.336   70.871  1.00 44.23  ? 266  LYS C CB  1 
ATOM   6841  C CG  . LYS C 1 266 ? -21.977 2.139   71.774  1.00 59.04  ? 266  LYS C CG  1 
ATOM   6842  C CD  . LYS C 1 266 ? -22.518 0.948   71.021  1.00 72.05  ? 266  LYS C CD  1 
ATOM   6843  C CE  . LYS C 1 266 ? -22.782 -0.224  71.948  1.00 83.02  ? 266  LYS C CE  1 
ATOM   6844  N NZ  . LYS C 1 266 ? -23.938 0.011   72.860  1.00 91.52  ? 266  LYS C NZ  1 
ATOM   6845  N N   . ASP C 1 267 ? -21.247 6.830   70.646  1.00 38.04  ? 267  ASP C N   1 
ATOM   6846  C CA  . ASP C 1 267 ? -20.760 7.981   69.884  1.00 37.18  ? 267  ASP C CA  1 
ATOM   6847  C C   . ASP C 1 267 ? -20.436 9.067   70.914  1.00 38.44  ? 267  ASP C C   1 
ATOM   6848  O O   . ASP C 1 267 ? -21.334 9.819   71.311  1.00 36.47  ? 267  ASP C O   1 
ATOM   6849  C CB  . ASP C 1 267 ? -21.788 8.438   68.829  1.00 39.57  ? 267  ASP C CB  1 
ATOM   6850  C CG  . ASP C 1 267 ? -21.355 9.558   67.892  1.00 50.19  ? 267  ASP C CG  1 
ATOM   6851  O OD1 . ASP C 1 267 ? -22.086 9.827   66.918  1.00 54.01  ? 267  ASP C OD1 1 
ATOM   6852  O OD2 . ASP C 1 267 ? -20.301 10.194  68.155  1.00 53.17  ? 267  ASP C OD2 1 
ATOM   6853  N N   . PRO C 1 268 ? -19.167 9.099   71.402  1.00 33.66  ? 268  PRO C N   1 
ATOM   6854  C CA  . PRO C 1 268 ? -18.797 10.061  72.461  1.00 32.06  ? 268  PRO C CA  1 
ATOM   6855  C C   . PRO C 1 268 ? -18.985 11.537  72.083  1.00 38.07  ? 268  PRO C C   1 
ATOM   6856  O O   . PRO C 1 268 ? -19.383 12.332  72.936  1.00 36.77  ? 268  PRO C O   1 
ATOM   6857  C CB  . PRO C 1 268 ? -17.322 9.753   72.738  1.00 33.60  ? 268  PRO C CB  1 
ATOM   6858  C CG  . PRO C 1 268 ? -17.029 8.488   72.061  1.00 38.96  ? 268  PRO C CG  1 
ATOM   6859  C CD  . PRO C 1 268 ? -18.033 8.234   71.021  1.00 35.68  ? 268  PRO C CD  1 
ATOM   6860  N N   . LYS C 1 269 ? -18.703 11.892  70.815  1.00 36.85  ? 269  LYS C N   1 
ATOM   6861  C CA  . LYS C 1 269 ? -18.827 13.240  70.255  1.00 36.69  ? 269  LYS C CA  1 
ATOM   6862  C C   . LYS C 1 269 ? -20.290 13.698  70.258  1.00 39.34  ? 269  LYS C C   1 
ATOM   6863  O O   . LYS C 1 269 ? -20.556 14.853  70.596  1.00 38.42  ? 269  LYS C O   1 
ATOM   6864  C CB  . LYS C 1 269 ? -18.258 13.286  68.828  1.00 41.86  ? 269  LYS C CB  1 
ATOM   6865  C CG  . LYS C 1 269 ? -16.823 12.763  68.719  1.00 60.35  ? 269  LYS C CG  1 
ATOM   6866  C CD  . LYS C 1 269 ? -16.183 13.123  67.396  1.00 71.55  ? 269  LYS C CD  1 
ATOM   6867  C CE  . LYS C 1 269 ? -15.630 14.530  67.391  1.00 82.56  ? 269  LYS C CE  1 
ATOM   6868  N NZ  . LYS C 1 269 ? -16.490 15.470  66.630  1.00 92.98  ? 269  LYS C NZ  1 
ATOM   6869  N N   . TYR C 1 270 ? -21.236 12.792  69.914  1.00 36.07  ? 270  TYR C N   1 
ATOM   6870  C CA  . TYR C 1 270 ? -22.670 13.088  69.944  1.00 36.31  ? 270  TYR C CA  1 
ATOM   6871  C C   . TYR C 1 270 ? -23.100 13.411  71.375  1.00 39.38  ? 270  TYR C C   1 
ATOM   6872  O O   . TYR C 1 270 ? -23.821 14.381  71.576  1.00 39.12  ? 270  TYR C O   1 
ATOM   6873  C CB  . TYR C 1 270 ? -23.514 11.925  69.364  1.00 39.39  ? 270  TYR C CB  1 
ATOM   6874  C CG  . TYR C 1 270 ? -24.974 11.966  69.767  1.00 41.39  ? 270  TYR C CG  1 
ATOM   6875  C CD1 . TYR C 1 270 ? -25.897 12.724  69.050  1.00 44.02  ? 270  TYR C CD1 1 
ATOM   6876  C CD2 . TYR C 1 270 ? -25.423 11.294  70.903  1.00 41.41  ? 270  TYR C CD2 1 
ATOM   6877  C CE1 . TYR C 1 270 ? -27.232 12.812  69.454  1.00 44.18  ? 270  TYR C CE1 1 
ATOM   6878  C CE2 . TYR C 1 270 ? -26.756 11.359  71.304  1.00 42.53  ? 270  TYR C CE2 1 
ATOM   6879  C CZ  . TYR C 1 270 ? -27.660 12.111  70.572  1.00 52.26  ? 270  TYR C CZ  1 
ATOM   6880  O OH  . TYR C 1 270 ? -28.981 12.162  70.957  1.00 56.72  ? 270  TYR C OH  1 
ATOM   6881  N N   . VAL C 1 271 ? -22.658 12.597  72.357  1.00 35.50  ? 271  VAL C N   1 
ATOM   6882  C CA  . VAL C 1 271 ? -22.965 12.757  73.784  1.00 34.10  ? 271  VAL C CA  1 
ATOM   6883  C C   . VAL C 1 271 ? -22.444 14.132  74.259  1.00 38.90  ? 271  VAL C C   1 
ATOM   6884  O O   . VAL C 1 271 ? -23.197 14.858  74.907  1.00 38.61  ? 271  VAL C O   1 
ATOM   6885  C CB  . VAL C 1 271 ? -22.415 11.571  74.634  1.00 36.83  ? 271  VAL C CB  1 
ATOM   6886  C CG1 . VAL C 1 271 ? -22.583 11.816  76.130  1.00 34.50  ? 271  VAL C CG1 1 
ATOM   6887  C CG2 . VAL C 1 271 ? -23.078 10.254  74.234  1.00 37.79  ? 271  VAL C CG2 1 
ATOM   6888  N N   . ARG C 1 272 ? -21.191 14.501  73.886  1.00 35.67  ? 272  ARG C N   1 
ATOM   6889  C CA  . ARG C 1 272 ? -20.550 15.783  74.205  1.00 34.13  ? 272  ARG C CA  1 
ATOM   6890  C C   . ARG C 1 272 ? -21.355 16.957  73.631  1.00 38.83  ? 272  ARG C C   1 
ATOM   6891  O O   . ARG C 1 272 ? -21.766 17.831  74.402  1.00 38.44  ? 272  ARG C O   1 
ATOM   6892  C CB  . ARG C 1 272 ? -19.111 15.817  73.653  1.00 34.29  ? 272  ARG C CB  1 
ATOM   6893  C CG  . ARG C 1 272 ? -18.408 17.170  73.832  1.00 38.80  ? 272  ARG C CG  1 
ATOM   6894  C CD  . ARG C 1 272 ? -17.222 17.338  72.906  1.00 38.04  ? 272  ARG C CD  1 
ATOM   6895  N NE  . ARG C 1 272 ? -17.643 17.339  71.507  1.00 39.03  ? 272  ARG C NE  1 
ATOM   6896  C CZ  . ARG C 1 272 ? -16.843 17.082  70.481  1.00 53.63  ? 272  ARG C CZ  1 
ATOM   6897  N NH1 . ARG C 1 272 ? -15.562 16.798  70.683  1.00 43.00  ? 272  ARG C NH1 1 
ATOM   6898  N NH2 . ARG C 1 272 ? -17.318 17.090  69.245  1.00 46.11  ? 272  ARG C NH2 1 
ATOM   6899  N N   . ASP C 1 273 ? -21.578 16.972  72.282  1.00 35.17  ? 273  ASP C N   1 
ATOM   6900  C CA  . ASP C 1 273 ? -22.312 18.030  71.575  1.00 35.78  ? 273  ASP C CA  1 
ATOM   6901  C C   . ASP C 1 273 ? -23.771 18.170  72.068  1.00 40.10  ? 273  ASP C C   1 
ATOM   6902  O O   . ASP C 1 273 ? -24.318 19.275  72.043  1.00 40.25  ? 273  ASP C O   1 
ATOM   6903  C CB  . ASP C 1 273 ? -22.289 17.794  70.058  1.00 39.28  ? 273  ASP C CB  1 
ATOM   6904  C CG  . ASP C 1 273 ? -20.904 17.859  69.423  1.00 50.05  ? 273  ASP C CG  1 
ATOM   6905  O OD1 . ASP C 1 273 ? -19.958 18.341  70.095  1.00 48.26  ? 273  ASP C OD1 1 
ATOM   6906  O OD2 . ASP C 1 273 ? -20.770 17.444  68.240  1.00 56.47  ? 273  ASP C OD2 1 
ATOM   6907  N N   . SER C 1 274 ? -24.388 17.052  72.503  1.00 35.84  ? 274  SER C N   1 
ATOM   6908  C CA  . SER C 1 274 ? -25.743 17.005  73.043  1.00 34.55  ? 274  SER C CA  1 
ATOM   6909  C C   . SER C 1 274 ? -25.774 17.714  74.402  1.00 35.14  ? 274  SER C C   1 
ATOM   6910  O O   . SER C 1 274 ? -26.646 18.541  74.619  1.00 35.37  ? 274  SER C O   1 
ATOM   6911  C CB  . SER C 1 274 ? -26.227 15.563  73.151  1.00 38.50  ? 274  SER C CB  1 
ATOM   6912  O OG  . SER C 1 274 ? -27.536 15.499  73.686  1.00 51.14  ? 274  SER C OG  1 
ATOM   6913  N N   . LYS C 1 275 ? -24.791 17.451  75.281  1.00 30.21  ? 275  LYS C N   1 
ATOM   6914  C CA  . LYS C 1 275 ? -24.680 18.107  76.588  1.00 29.10  ? 275  LYS C CA  1 
ATOM   6915  C C   . LYS C 1 275 ? -24.363 19.614  76.445  1.00 34.91  ? 275  LYS C C   1 
ATOM   6916  O O   . LYS C 1 275 ? -24.877 20.400  77.233  1.00 34.45  ? 275  LYS C O   1 
ATOM   6917  C CB  . LYS C 1 275 ? -23.622 17.429  77.468  1.00 30.07  ? 275  LYS C CB  1 
ATOM   6918  C CG  . LYS C 1 275 ? -24.049 16.076  78.008  1.00 29.62  ? 275  LYS C CG  1 
ATOM   6919  C CD  . LYS C 1 275 ? -22.872 15.353  78.639  1.00 27.66  ? 275  LYS C CD  1 
ATOM   6920  C CE  . LYS C 1 275 ? -23.279 14.020  79.198  1.00 23.01  ? 275  LYS C CE  1 
ATOM   6921  N NZ  . LYS C 1 275 ? -22.126 13.301  79.764  1.00 25.39  ? 275  LYS C NZ  1 
ATOM   6922  N N   . ILE C 1 276 ? -23.541 20.008  75.436  1.00 32.96  ? 276  ILE C N   1 
ATOM   6923  C CA  . ILE C 1 276 ? -23.167 21.405  75.136  1.00 32.74  ? 276  ILE C CA  1 
ATOM   6924  C C   . ILE C 1 276 ? -24.431 22.205  74.732  1.00 37.79  ? 276  ILE C C   1 
ATOM   6925  O O   . ILE C 1 276 ? -24.653 23.302  75.256  1.00 37.37  ? 276  ILE C O   1 
ATOM   6926  C CB  . ILE C 1 276 ? -22.041 21.480  74.051  1.00 35.75  ? 276  ILE C CB  1 
ATOM   6927  C CG1 . ILE C 1 276 ? -20.689 21.039  74.649  1.00 34.87  ? 276  ILE C CG1 1 
ATOM   6928  C CG2 . ILE C 1 276 ? -21.923 22.881  73.425  1.00 36.15  ? 276  ILE C CG2 1 
ATOM   6929  C CD1 . ILE C 1 276 ? -19.549 20.806  73.652  1.00 39.56  ? 276  ILE C CD1 1 
ATOM   6930  N N   . ARG C 1 277 ? -25.251 21.635  73.829  1.00 34.91  ? 277  ARG C N   1 
ATOM   6931  C CA  . ARG C 1 277 ? -26.491 22.224  73.328  1.00 36.16  ? 277  ARG C CA  1 
ATOM   6932  C C   . ARG C 1 277 ? -27.521 22.403  74.458  1.00 39.03  ? 277  ARG C C   1 
ATOM   6933  O O   . ARG C 1 277 ? -28.185 23.438  74.525  1.00 38.50  ? 277  ARG C O   1 
ATOM   6934  C CB  . ARG C 1 277 ? -27.059 21.344  72.204  1.00 39.98  ? 277  ARG C CB  1 
ATOM   6935  C CG  . ARG C 1 277 ? -28.415 21.804  71.657  1.00 57.71  ? 277  ARG C CG  1 
ATOM   6936  C CD  . ARG C 1 277 ? -28.839 21.063  70.403  1.00 75.59  ? 277  ARG C CD  1 
ATOM   6937  N NE  . ARG C 1 277 ? -28.873 19.608  70.578  1.00 86.56  ? 277  ARG C NE  1 
ATOM   6938  C CZ  . ARG C 1 277 ? -29.934 18.916  70.989  1.00 96.75  ? 277  ARG C CZ  1 
ATOM   6939  N NH1 . ARG C 1 277 ? -31.071 19.539  71.284  1.00 76.68  ? 277  ARG C NH1 1 
ATOM   6940  N NH2 . ARG C 1 277 ? -29.868 17.595  71.101  1.00 82.44  ? 277  ARG C NH2 1 
ATOM   6941  N N   . TYR C 1 278 ? -27.643 21.395  75.341  1.00 34.95  ? 278  TYR C N   1 
ATOM   6942  C CA  . TYR C 1 278 ? -28.587 21.444  76.451  1.00 34.15  ? 278  TYR C CA  1 
ATOM   6943  C C   . TYR C 1 278 ? -28.096 22.352  77.594  1.00 36.90  ? 278  TYR C C   1 
ATOM   6944  O O   . TYR C 1 278 ? -28.918 22.808  78.384  1.00 36.53  ? 278  TYR C O   1 
ATOM   6945  C CB  . TYR C 1 278 ? -28.929 20.039  76.955  1.00 34.31  ? 278  TYR C CB  1 
ATOM   6946  C CG  . TYR C 1 278 ? -29.891 19.300  76.047  1.00 36.02  ? 278  TYR C CG  1 
ATOM   6947  C CD1 . TYR C 1 278 ? -31.137 19.835  75.730  1.00 38.10  ? 278  TYR C CD1 1 
ATOM   6948  C CD2 . TYR C 1 278 ? -29.571 18.052  75.530  1.00 37.06  ? 278  TYR C CD2 1 
ATOM   6949  C CE1 . TYR C 1 278 ? -32.039 19.144  74.921  1.00 37.89  ? 278  TYR C CE1 1 
ATOM   6950  C CE2 . TYR C 1 278 ? -30.455 17.364  74.698  1.00 38.75  ? 278  TYR C CE2 1 
ATOM   6951  C CZ  . TYR C 1 278 ? -31.696 17.905  74.410  1.00 41.24  ? 278  TYR C CZ  1 
ATOM   6952  O OH  . TYR C 1 278 ? -32.571 17.223  73.600  1.00 39.91  ? 278  TYR C OH  1 
ATOM   6953  N N   . ARG C 1 279 ? -26.780 22.642  77.662  1.00 33.19  ? 279  ARG C N   1 
ATOM   6954  C CA  . ARG C 1 279 ? -26.211 23.588  78.629  1.00 31.77  ? 279  ARG C CA  1 
ATOM   6955  C C   . ARG C 1 279 ? -26.504 25.001  78.133  1.00 37.09  ? 279  ARG C C   1 
ATOM   6956  O O   . ARG C 1 279 ? -26.887 25.867  78.920  1.00 36.36  ? 279  ARG C O   1 
ATOM   6957  C CB  . ARG C 1 279 ? -24.708 23.363  78.805  1.00 30.30  ? 279  ARG C CB  1 
ATOM   6958  C CG  . ARG C 1 279 ? -24.035 24.306  79.793  1.00 35.39  ? 279  ARG C CG  1 
ATOM   6959  C CD  . ARG C 1 279 ? -22.539 24.222  79.641  1.00 37.57  ? 279  ARG C CD  1 
ATOM   6960  N NE  . ARG C 1 279 ? -21.841 25.028  80.637  1.00 47.39  ? 279  ARG C NE  1 
ATOM   6961  C CZ  . ARG C 1 279 ? -21.372 26.250  80.413  1.00 64.32  ? 279  ARG C CZ  1 
ATOM   6962  N NH1 . ARG C 1 279 ? -21.514 26.817  79.223  1.00 61.80  ? 279  ARG C NH1 1 
ATOM   6963  N NH2 . ARG C 1 279 ? -20.743 26.909  81.372  1.00 47.95  ? 279  ARG C NH2 1 
ATOM   6964  N N   . GLU C 1 280 ? -26.359 25.210  76.810  1.00 35.53  ? 280  GLU C N   1 
ATOM   6965  C CA  . GLU C 1 280 ? -26.615 26.466  76.104  1.00 36.65  ? 280  GLU C CA  1 
ATOM   6966  C C   . GLU C 1 280 ? -28.108 26.838  76.174  1.00 41.37  ? 280  GLU C C   1 
ATOM   6967  O O   . GLU C 1 280 ? -28.437 28.023  76.216  1.00 41.91  ? 280  GLU C O   1 
ATOM   6968  C CB  . GLU C 1 280 ? -26.134 26.353  74.647  1.00 39.29  ? 280  GLU C CB  1 
ATOM   6969  C CG  . GLU C 1 280 ? -26.087 27.667  73.877  1.00 59.11  ? 280  GLU C CG  1 
ATOM   6970  C CD  . GLU C 1 280 ? -25.195 28.780  74.406  1.00 102.14 ? 280  GLU C CD  1 
ATOM   6971  O OE1 . GLU C 1 280 ? -24.185 28.482  75.089  1.00 106.07 ? 280  GLU C OE1 1 
ATOM   6972  O OE2 . GLU C 1 280 ? -25.496 29.958  74.101  1.00 104.40 ? 280  GLU C OE2 1 
ATOM   6973  N N   . ASN C 1 281 ? -28.996 25.831  76.219  1.00 38.04  ? 281  ASN C N   1 
ATOM   6974  C CA  . ASN C 1 281 ? -30.440 26.027  76.321  1.00 38.95  ? 281  ASN C CA  1 
ATOM   6975  C C   . ASN C 1 281 ? -31.011 25.014  77.329  1.00 40.95  ? 281  ASN C C   1 
ATOM   6976  O O   . ASN C 1 281 ? -31.427 23.916  76.945  1.00 40.43  ? 281  ASN C O   1 
ATOM   6977  C CB  . ASN C 1 281 ? -31.098 25.920  74.930  1.00 41.73  ? 281  ASN C CB  1 
ATOM   6978  C CG  . ASN C 1 281 ? -32.550 26.350  74.860  1.00 65.36  ? 281  ASN C CG  1 
ATOM   6979  O OD1 . ASN C 1 281 ? -33.154 26.843  75.824  1.00 59.30  ? 281  ASN C OD1 1 
ATOM   6980  N ND2 . ASN C 1 281 ? -33.141 26.189  73.690  1.00 61.43  ? 281  ASN C ND2 1 
ATOM   6981  N N   . ILE C 1 282 ? -30.986 25.382  78.632  1.00 35.85  ? 282  ILE C N   1 
ATOM   6982  C CA  . ILE C 1 282 ? -31.452 24.550  79.748  1.00 34.36  ? 282  ILE C CA  1 
ATOM   6983  C C   . ILE C 1 282 ? -32.988 24.368  79.676  1.00 40.80  ? 282  ILE C C   1 
ATOM   6984  O O   . ILE C 1 282 ? -33.486 23.297  80.040  1.00 41.15  ? 282  ILE C O   1 
ATOM   6985  C CB  . ILE C 1 282 ? -30.946 25.112  81.109  1.00 35.68  ? 282  ILE C CB  1 
ATOM   6986  C CG1 . ILE C 1 282 ? -29.412 24.874  81.209  1.00 35.12  ? 282  ILE C CG1 1 
ATOM   6987  C CG2 . ILE C 1 282 ? -31.699 24.502  82.347  1.00 33.79  ? 282  ILE C CG2 1 
ATOM   6988  C CD1 . ILE C 1 282 ? -28.662 25.703  82.240  1.00 37.01  ? 282  ILE C CD1 1 
ATOM   6989  N N   . ALA C 1 283 ? -33.716 25.376  79.156  1.00 38.22  ? 283  ALA C N   1 
ATOM   6990  C CA  . ALA C 1 283 ? -35.168 25.320  78.986  1.00 39.24  ? 283  ALA C CA  1 
ATOM   6991  C C   . ALA C 1 283 ? -35.562 24.178  78.030  1.00 42.82  ? 283  ALA C C   1 
ATOM   6992  O O   . ALA C 1 283 ? -36.559 23.496  78.281  1.00 42.73  ? 283  ALA C O   1 
ATOM   6993  C CB  . ALA C 1 283 ? -35.687 26.654  78.468  1.00 41.61  ? 283  ALA C CB  1 
ATOM   6994  N N   . SER C 1 284 ? -34.762 23.945  76.963  1.00 39.31  ? 284  SER C N   1 
ATOM   6995  C CA  . SER C 1 284 ? -35.003 22.861  76.007  1.00 39.77  ? 284  SER C CA  1 
ATOM   6996  C C   . SER C 1 284 ? -34.685 21.508  76.656  1.00 42.07  ? 284  SER C C   1 
ATOM   6997  O O   . SER C 1 284 ? -35.339 20.518  76.327  1.00 42.61  ? 284  SER C O   1 
ATOM   6998  C CB  . SER C 1 284 ? -34.213 23.060  74.716  1.00 43.52  ? 284  SER C CB  1 
ATOM   6999  O OG  . SER C 1 284 ? -32.813 22.918  74.892  1.00 50.69  ? 284  SER C OG  1 
ATOM   7000  N N   . LEU C 1 285 ? -33.723 21.473  77.608  1.00 36.85  ? 285  LEU C N   1 
ATOM   7001  C CA  . LEU C 1 285 ? -33.386 20.266  78.369  1.00 34.88  ? 285  LEU C CA  1 
ATOM   7002  C C   . LEU C 1 285 ? -34.560 19.906  79.283  1.00 37.54  ? 285  LEU C C   1 
ATOM   7003  O O   . LEU C 1 285 ? -34.929 18.733  79.352  1.00 37.78  ? 285  LEU C O   1 
ATOM   7004  C CB  . LEU C 1 285 ? -32.080 20.441  79.175  1.00 33.25  ? 285  LEU C CB  1 
ATOM   7005  C CG  . LEU C 1 285 ? -31.653 19.274  80.091  1.00 37.05  ? 285  LEU C CG  1 
ATOM   7006  C CD1 . LEU C 1 285 ? -31.243 18.042  79.282  1.00 38.01  ? 285  LEU C CD1 1 
ATOM   7007  C CD2 . LEU C 1 285 ? -30.529 19.688  81.008  1.00 37.74  ? 285  LEU C CD2 1 
ATOM   7008  N N   . MET C 1 286 ? -35.166 20.917  79.942  1.00 33.23  ? 286  MET C N   1 
ATOM   7009  C CA  . MET C 1 286 ? -36.314 20.726  80.834  1.00 34.04  ? 286  MET C CA  1 
ATOM   7010  C C   . MET C 1 286 ? -37.520 20.252  80.035  1.00 41.10  ? 286  MET C C   1 
ATOM   7011  O O   . MET C 1 286 ? -38.209 19.334  80.485  1.00 41.40  ? 286  MET C O   1 
ATOM   7012  C CB  . MET C 1 286 ? -36.646 22.008  81.624  1.00 36.40  ? 286  MET C CB  1 
ATOM   7013  C CG  . MET C 1 286 ? -35.555 22.449  82.593  1.00 38.44  ? 286  MET C CG  1 
ATOM   7014  S SD  . MET C 1 286 ? -35.105 21.214  83.854  1.00 41.41  ? 286  MET C SD  1 
ATOM   7015  C CE  . MET C 1 286 ? -33.448 20.810  83.294  1.00 37.40  ? 286  MET C CE  1 
ATOM   7016  N N   . ASP C 1 287 ? -37.732 20.824  78.827  1.00 39.55  ? 287  ASP C N   1 
ATOM   7017  C CA  . ASP C 1 287 ? -38.830 20.458  77.930  1.00 41.90  ? 287  ASP C CA  1 
ATOM   7018  C C   . ASP C 1 287 ? -38.676 19.032  77.400  1.00 45.23  ? 287  ASP C C   1 
ATOM   7019  O O   . ASP C 1 287 ? -39.675 18.339  77.223  1.00 46.87  ? 287  ASP C O   1 
ATOM   7020  C CB  . ASP C 1 287 ? -38.933 21.447  76.753  1.00 46.29  ? 287  ASP C CB  1 
ATOM   7021  C CG  . ASP C 1 287 ? -39.341 22.873  77.117  1.00 63.33  ? 287  ASP C CG  1 
ATOM   7022  O OD1 . ASP C 1 287 ? -40.010 23.059  78.170  1.00 65.00  ? 287  ASP C OD1 1 
ATOM   7023  O OD2 . ASP C 1 287 ? -39.003 23.804  76.344  1.00 69.21  ? 287  ASP C OD2 1 
ATOM   7024  N N   . LYS C 1 288 ? -37.436 18.600  77.148  1.00 40.49  ? 288  LYS C N   1 
ATOM   7025  C CA  . LYS C 1 288 ? -37.121 17.265  76.635  1.00 40.67  ? 288  LYS C CA  1 
ATOM   7026  C C   . LYS C 1 288 ? -37.319 16.183  77.720  1.00 44.43  ? 288  LYS C C   1 
ATOM   7027  O O   . LYS C 1 288 ? -37.886 15.129  77.433  1.00 46.02  ? 288  LYS C O   1 
ATOM   7028  C CB  . LYS C 1 288 ? -35.669 17.241  76.076  1.00 41.58  ? 288  LYS C CB  1 
ATOM   7029  C CG  . LYS C 1 288 ? -35.107 15.873  75.685  1.00 48.26  ? 288  LYS C CG  1 
ATOM   7030  C CD  . LYS C 1 288 ? -35.624 15.366  74.351  1.00 54.53  ? 288  LYS C CD  1 
ATOM   7031  C CE  . LYS C 1 288 ? -35.070 13.996  74.048  1.00 64.43  ? 288  LYS C CE  1 
ATOM   7032  N NZ  . LYS C 1 288 ? -35.491 13.515  72.708  1.00 80.33  ? 288  LYS C NZ  1 
ATOM   7033  N N   . CYS C 1 289 ? -36.851 16.444  78.945  1.00 39.32  ? 289  CYS C N   1 
ATOM   7034  C CA  . CYS C 1 289 ? -36.855 15.485  80.046  1.00 38.47  ? 289  CYS C CA  1 
ATOM   7035  C C   . CYS C 1 289 ? -38.156 15.454  80.842  1.00 43.15  ? 289  CYS C C   1 
ATOM   7036  O O   . CYS C 1 289 ? -38.514 14.392  81.365  1.00 42.55  ? 289  CYS C O   1 
ATOM   7037  C CB  . CYS C 1 289 ? -35.665 15.744  80.961  1.00 37.10  ? 289  CYS C CB  1 
ATOM   7038  S SG  . CYS C 1 289 ? -34.069 15.673  80.114  1.00 40.43  ? 289  CYS C SG  1 
ATOM   7039  N N   . PHE C 1 290 ? -38.847 16.591  80.964  1.00 40.97  ? 290  PHE C N   1 
ATOM   7040  C CA  . PHE C 1 290 ? -40.062 16.649  81.769  1.00 42.57  ? 290  PHE C CA  1 
ATOM   7041  C C   . PHE C 1 290 ? -41.296 17.036  80.949  1.00 53.71  ? 290  PHE C C   1 
ATOM   7042  O O   . PHE C 1 290 ? -41.158 17.801  80.000  1.00 52.06  ? 290  PHE C O   1 
ATOM   7043  C CB  . PHE C 1 290 ? -39.870 17.640  82.932  1.00 42.54  ? 290  PHE C CB  1 
ATOM   7044  C CG  . PHE C 1 290 ? -38.723 17.298  83.852  1.00 41.04  ? 290  PHE C CG  1 
ATOM   7045  C CD1 . PHE C 1 290 ? -38.890 16.389  84.893  1.00 42.42  ? 290  PHE C CD1 1 
ATOM   7046  C CD2 . PHE C 1 290 ? -37.464 17.863  83.660  1.00 40.58  ? 290  PHE C CD2 1 
ATOM   7047  C CE1 . PHE C 1 290 ? -37.820 16.063  85.737  1.00 41.28  ? 290  PHE C CE1 1 
ATOM   7048  C CE2 . PHE C 1 290 ? -36.394 17.525  84.492  1.00 40.58  ? 290  PHE C CE2 1 
ATOM   7049  C CZ  . PHE C 1 290 ? -36.581 16.629  85.526  1.00 38.51  ? 290  PHE C CZ  1 
ATOM   7050  N N   . PRO C 1 291 ? -42.518 16.539  81.294  1.00 58.55  ? 291  PRO C N   1 
ATOM   7051  C CA  . PRO C 1 291 ? -43.725 16.967  80.548  1.00 62.83  ? 291  PRO C CA  1 
ATOM   7052  C C   . PRO C 1 291 ? -43.971 18.459  80.754  1.00 73.61  ? 291  PRO C C   1 
ATOM   7053  O O   . PRO C 1 291 ? -43.634 18.982  81.821  1.00 73.00  ? 291  PRO C O   1 
ATOM   7054  C CB  . PRO C 1 291 ? -44.858 16.126  81.154  1.00 65.24  ? 291  PRO C CB  1 
ATOM   7055  C CG  . PRO C 1 291 ? -44.194 15.073  81.963  1.00 67.53  ? 291  PRO C CG  1 
ATOM   7056  C CD  . PRO C 1 291 ? -42.878 15.636  82.404  1.00 60.46  ? 291  PRO C CD  1 
ATOM   7057  N N   . ALA C 1 292 ? -44.503 19.145  79.729  1.00 75.27  ? 292  ALA C N   1 
ATOM   7058  C CA  . ALA C 1 292 ? -44.769 20.589  79.744  1.00 77.26  ? 292  ALA C CA  1 
ATOM   7059  C C   . ALA C 1 292 ? -45.399 21.049  81.067  1.00 83.43  ? 292  ALA C C   1 
ATOM   7060  O O   . ALA C 1 292 ? -46.348 20.418  81.553  1.00 84.58  ? 292  ALA C O   1 
ATOM   7061  C CB  . ALA C 1 292 ? -45.673 20.968  78.577  1.00 80.49  ? 292  ALA C CB  1 
ATOM   7062  N N   . ALA C 1 293 ? -44.796 22.102  81.679  1.00 79.81  ? 293  ALA C N   1 
ATOM   7063  C CA  . ALA C 1 293 ? -45.178 22.757  82.945  1.00 80.09  ? 293  ALA C CA  1 
ATOM   7064  C C   . ALA C 1 293 ? -45.088 21.825  84.193  1.00 82.91  ? 293  ALA C C   1 
ATOM   7065  O O   . ALA C 1 293 ? -45.505 22.227  85.288  1.00 84.13  ? 293  ALA C O   1 
ATOM   7066  C CB  . ALA C 1 293 ? -46.582 23.362  82.839  1.00 83.45  ? 293  ALA C CB  1 
ATOM   7067  N N   . ASN C 1 294 ? -44.509 20.616  84.046  1.00 76.41  ? 294  ASN C N   1 
ATOM   7068  C CA  . ASN C 1 294 ? -44.358 19.681  85.169  1.00 74.12  ? 294  ASN C CA  1 
ATOM   7069  C C   . ASN C 1 294 ? -42.875 19.536  85.606  1.00 70.83  ? 294  ASN C C   1 
ATOM   7070  O O   . ASN C 1 294 ? -42.582 18.707  86.471  1.00 69.90  ? 294  ASN C O   1 
ATOM   7071  C CB  . ASN C 1 294 ? -44.966 18.314  84.827  1.00 76.38  ? 294  ASN C CB  1 
ATOM   7072  N N   . ALA C 1 295 ? -41.961 20.364  85.035  1.00 62.50  ? 295  ALA C N   1 
ATOM   7073  C CA  . ALA C 1 295 ? -40.524 20.368  85.338  1.00 58.96  ? 295  ALA C CA  1 
ATOM   7074  C C   . ALA C 1 295 ? -40.255 20.944  86.749  1.00 57.41  ? 295  ALA C C   1 
ATOM   7075  O O   . ALA C 1 295 ? -40.800 22.004  87.068  1.00 57.14  ? 295  ALA C O   1 
ATOM   7076  C CB  . ALA C 1 295 ? -39.764 21.169  84.282  1.00 59.40  ? 295  ALA C CB  1 
ATOM   7077  N N   . PRO C 1 296 ? -39.439 20.280  87.611  1.00 49.94  ? 296  PRO C N   1 
ATOM   7078  C CA  . PRO C 1 296 ? -39.164 20.849  88.942  1.00 48.03  ? 296  PRO C CA  1 
ATOM   7079  C C   . PRO C 1 296 ? -38.219 22.034  88.810  1.00 47.51  ? 296  PRO C C   1 
ATOM   7080  O O   . PRO C 1 296 ? -37.130 21.892  88.256  1.00 46.74  ? 296  PRO C O   1 
ATOM   7081  C CB  . PRO C 1 296 ? -38.548 19.680  89.730  1.00 48.96  ? 296  PRO C CB  1 
ATOM   7082  C CG  . PRO C 1 296 ? -38.570 18.492  88.813  1.00 54.11  ? 296  PRO C CG  1 
ATOM   7083  C CD  . PRO C 1 296 ? -38.692 19.024  87.415  1.00 50.49  ? 296  PRO C CD  1 
ATOM   7084  N N   . GLY C 1 297 ? -38.689 23.195  89.256  1.00 42.30  ? 297  GLY C N   1 
ATOM   7085  C CA  . GLY C 1 297 ? -38.001 24.477  89.180  1.00 41.00  ? 297  GLY C CA  1 
ATOM   7086  C C   . GLY C 1 297 ? -36.603 24.510  89.751  1.00 41.59  ? 297  GLY C C   1 
ATOM   7087  O O   . GLY C 1 297 ? -35.740 25.200  89.202  1.00 41.23  ? 297  GLY C O   1 
ATOM   7088  N N   . GLU C 1 298 ? -36.366 23.752  90.842  1.00 35.47  ? 298  GLU C N   1 
ATOM   7089  C CA  . GLU C 1 298 ? -35.064 23.690  91.503  1.00 33.08  ? 298  GLU C CA  1 
ATOM   7090  C C   . GLU C 1 298 ? -34.013 23.031  90.604  1.00 35.26  ? 298  GLU C C   1 
ATOM   7091  O O   . GLU C 1 298 ? -32.856 23.419  90.680  1.00 34.49  ? 298  GLU C O   1 
ATOM   7092  C CB  . GLU C 1 298 ? -35.148 22.991  92.882  1.00 34.12  ? 298  GLU C CB  1 
ATOM   7093  C CG  . GLU C 1 298 ? -35.463 21.504  92.863  1.00 37.01  ? 298  GLU C CG  1 
ATOM   7094  C CD  . GLU C 1 298 ? -36.919 21.093  92.735  1.00 48.53  ? 298  GLU C CD  1 
ATOM   7095  O OE1 . GLU C 1 298 ? -37.787 21.965  92.500  1.00 41.67  ? 298  GLU C OE1 1 
ATOM   7096  O OE2 . GLU C 1 298 ? -37.190 19.881  92.880  1.00 38.44  ? 298  GLU C OE2 1 
ATOM   7097  N N   . ILE C 1 299 ? -34.414 22.076  89.734  1.00 32.30  ? 299  ILE C N   1 
ATOM   7098  C CA  . ILE C 1 299 ? -33.495 21.385  88.821  1.00 31.38  ? 299  ILE C CA  1 
ATOM   7099  C C   . ILE C 1 299 ? -32.950 22.387  87.799  1.00 33.28  ? 299  ILE C C   1 
ATOM   7100  O O   . ILE C 1 299 ? -31.738 22.446  87.610  1.00 31.05  ? 299  ILE C O   1 
ATOM   7101  C CB  . ILE C 1 299 ? -34.143 20.134  88.157  1.00 35.42  ? 299  ILE C CB  1 
ATOM   7102  C CG1 . ILE C 1 299 ? -34.588 19.079  89.211  1.00 35.78  ? 299  ILE C CG1 1 
ATOM   7103  C CG2 . ILE C 1 299 ? -33.237 19.505  87.062  1.00 35.94  ? 299  ILE C CG2 1 
ATOM   7104  C CD1 . ILE C 1 299 ? -33.504 18.528  90.186  1.00 38.80  ? 299  ILE C CD1 1 
ATOM   7105  N N   . ALA C 1 300 ? -33.832 23.204  87.197  1.00 30.81  ? 300  ALA C N   1 
ATOM   7106  C CA  . ALA C 1 300 ? -33.467 24.235  86.223  1.00 30.45  ? 300  ALA C CA  1 
ATOM   7107  C C   . ALA C 1 300 ? -32.579 25.295  86.878  1.00 33.38  ? 300  ALA C C   1 
ATOM   7108  O O   . ALA C 1 300 ? -31.548 25.650  86.305  1.00 34.14  ? 300  ALA C O   1 
ATOM   7109  C CB  . ALA C 1 300 ? -34.720 24.870  85.633  1.00 32.43  ? 300  ALA C CB  1 
ATOM   7110  N N   . LYS C 1 301 ? -32.947 25.747  88.098  1.00 27.69  ? 301  LYS C N   1 
ATOM   7111  C CA  . LYS C 1 301 ? -32.198 26.740  88.868  1.00 26.89  ? 301  LYS C CA  1 
ATOM   7112  C C   . LYS C 1 301 ? -30.813 26.215  89.209  1.00 30.93  ? 301  LYS C C   1 
ATOM   7113  O O   . LYS C 1 301 ? -29.841 26.950  89.071  1.00 31.15  ? 301  LYS C O   1 
ATOM   7114  C CB  . LYS C 1 301 ? -32.959 27.136  90.139  1.00 29.49  ? 301  LYS C CB  1 
ATOM   7115  C CG  . LYS C 1 301 ? -34.117 28.076  89.887  1.00 34.97  ? 301  LYS C CG  1 
ATOM   7116  C CD  . LYS C 1 301 ? -34.826 28.374  91.191  1.00 49.34  ? 301  LYS C CD  1 
ATOM   7117  C CE  . LYS C 1 301 ? -35.893 29.420  91.015  1.00 62.54  ? 301  LYS C CE  1 
ATOM   7118  N N   . TYR C 1 302 ? -30.716 24.931  89.612  1.00 27.56  ? 302  TYR C N   1 
ATOM   7119  C CA  . TYR C 1 302 ? -29.460 24.247  89.915  1.00 25.75  ? 302  TYR C CA  1 
ATOM   7120  C C   . TYR C 1 302 ? -28.559 24.207  88.659  1.00 29.90  ? 302  TYR C C   1 
ATOM   7121  O O   . TYR C 1 302 ? -27.376 24.544  88.755  1.00 27.33  ? 302  TYR C O   1 
ATOM   7122  C CB  . TYR C 1 302 ? -29.731 22.819  90.435  1.00 25.98  ? 302  TYR C CB  1 
ATOM   7123  C CG  . TYR C 1 302 ? -28.480 22.000  90.675  1.00 25.48  ? 302  TYR C CG  1 
ATOM   7124  C CD1 . TYR C 1 302 ? -27.869 21.302  89.633  1.00 25.57  ? 302  TYR C CD1 1 
ATOM   7125  C CD2 . TYR C 1 302 ? -27.891 21.941  91.941  1.00 25.43  ? 302  TYR C CD2 1 
ATOM   7126  C CE1 . TYR C 1 302 ? -26.706 20.567  89.842  1.00 24.64  ? 302  TYR C CE1 1 
ATOM   7127  C CE2 . TYR C 1 302 ? -26.728 21.206  92.161  1.00 25.53  ? 302  TYR C CE2 1 
ATOM   7128  C CZ  . TYR C 1 302 ? -26.138 20.523  91.106  1.00 31.10  ? 302  TYR C CZ  1 
ATOM   7129  O OH  . TYR C 1 302 ? -24.994 19.796  91.310  1.00 31.29  ? 302  TYR C OH  1 
ATOM   7130  N N   . MET C 1 303 ? -29.118 23.790  87.497  1.00 29.35  ? 303  MET C N   1 
ATOM   7131  C CA  . MET C 1 303 ? -28.384 23.693  86.222  1.00 29.79  ? 303  MET C CA  1 
ATOM   7132  C C   . MET C 1 303 ? -27.889 25.070  85.763  1.00 34.09  ? 303  MET C C   1 
ATOM   7133  O O   . MET C 1 303 ? -26.752 25.173  85.297  1.00 33.67  ? 303  MET C O   1 
ATOM   7134  C CB  . MET C 1 303 ? -29.231 23.043  85.110  1.00 33.32  ? 303  MET C CB  1 
ATOM   7135  C CG  . MET C 1 303 ? -29.599 21.589  85.363  1.00 37.20  ? 303  MET C CG  1 
ATOM   7136  S SD  . MET C 1 303 ? -28.214 20.456  85.633  1.00 41.34  ? 303  MET C SD  1 
ATOM   7137  C CE  . MET C 1 303 ? -27.974 19.814  83.961  1.00 38.69  ? 303  MET C CE  1 
ATOM   7138  N N   . GLU C 1 304 ? -28.723 26.123  85.929  1.00 30.85  ? 304  GLU C N   1 
ATOM   7139  C CA  . GLU C 1 304 ? -28.389 27.507  85.571  1.00 31.04  ? 304  GLU C CA  1 
ATOM   7140  C C   . GLU C 1 304 ? -27.268 28.062  86.440  1.00 34.38  ? 304  GLU C C   1 
ATOM   7141  O O   . GLU C 1 304 ? -26.444 28.834  85.938  1.00 35.09  ? 304  GLU C O   1 
ATOM   7142  C CB  . GLU C 1 304 ? -29.612 28.428  85.666  1.00 33.32  ? 304  GLU C CB  1 
ATOM   7143  C CG  . GLU C 1 304 ? -30.646 28.223  84.569  1.00 42.65  ? 304  GLU C CG  1 
ATOM   7144  C CD  . GLU C 1 304 ? -30.384 28.815  83.192  1.00 64.10  ? 304  GLU C CD  1 
ATOM   7145  O OE1 . GLU C 1 304 ? -29.267 29.320  82.934  1.00 57.53  ? 304  GLU C OE1 1 
ATOM   7146  O OE2 . GLU C 1 304 ? -31.316 28.763  82.358  1.00 62.93  ? 304  GLU C OE2 1 
ATOM   7147  N N   . THR C 1 305 ? -27.229 27.671  87.729  1.00 29.08  ? 305  THR C N   1 
ATOM   7148  C CA  . THR C 1 305 ? -26.210 28.119  88.682  1.00 28.32  ? 305  THR C CA  1 
ATOM   7149  C C   . THR C 1 305 ? -24.865 27.454  88.355  1.00 32.79  ? 305  THR C C   1 
ATOM   7150  O O   . THR C 1 305 ? -23.847 28.144  88.358  1.00 34.07  ? 305  THR C O   1 
ATOM   7151  C CB  . THR C 1 305 ? -26.662 27.865  90.128  1.00 31.21  ? 305  THR C CB  1 
ATOM   7152  O OG1 . THR C 1 305 ? -27.941 28.472  90.312  1.00 26.79  ? 305  THR C OG1 1 
ATOM   7153  C CG2 . THR C 1 305 ? -25.695 28.426  91.152  1.00 30.38  ? 305  THR C CG2 1 
ATOM   7154  N N   . VAL C 1 306 ? -24.867 26.137  88.052  1.00 27.22  ? 306  VAL C N   1 
ATOM   7155  C CA  . VAL C 1 306 ? -23.667 25.364  87.709  1.00 25.65  ? 306  VAL C CA  1 
ATOM   7156  C C   . VAL C 1 306 ? -23.109 25.875  86.364  1.00 29.05  ? 306  VAL C C   1 
ATOM   7157  O O   . VAL C 1 306 ? -21.889 25.956  86.206  1.00 29.20  ? 306  VAL C O   1 
ATOM   7158  C CB  . VAL C 1 306 ? -23.943 23.826  87.728  1.00 28.95  ? 306  VAL C CB  1 
ATOM   7159  C CG1 . VAL C 1 306 ? -22.754 23.030  87.198  1.00 28.54  ? 306  VAL C CG1 1 
ATOM   7160  C CG2 . VAL C 1 306 ? -24.299 23.353  89.144  1.00 28.29  ? 306  VAL C CG2 1 
ATOM   7161  N N   . LYS C 1 307 ? -23.996 26.286  85.434  1.00 25.32  ? 307  LYS C N   1 
ATOM   7162  C CA  . LYS C 1 307 ? -23.640 26.841  84.121  1.00 25.13  ? 307  LYS C CA  1 
ATOM   7163  C C   . LYS C 1 307 ? -22.819 28.130  84.270  1.00 29.99  ? 307  LYS C C   1 
ATOM   7164  O O   . LYS C 1 307 ? -21.913 28.370  83.468  1.00 30.04  ? 307  LYS C O   1 
ATOM   7165  C CB  . LYS C 1 307 ? -24.908 27.120  83.312  1.00 27.47  ? 307  LYS C CB  1 
ATOM   7166  C CG  . LYS C 1 307 ? -24.645 27.527  81.878  1.00 27.23  ? 307  LYS C CG  1 
ATOM   7167  C CD  . LYS C 1 307 ? -25.891 28.056  81.227  1.00 38.57  ? 307  LYS C CD  1 
ATOM   7168  C CE  . LYS C 1 307 ? -25.601 28.647  79.862  1.00 40.48  ? 307  LYS C CE  1 
ATOM   7169  N NZ  . LYS C 1 307 ? -26.855 28.945  79.134  1.00 46.04  ? 307  LYS C NZ  1 
ATOM   7170  N N   . LEU C 1 308 ? -23.110 28.930  85.323  1.00 26.31  ? 308  LEU C N   1 
ATOM   7171  C CA  . LEU C 1 308 ? -22.417 30.182  85.603  1.00 26.38  ? 308  LEU C CA  1 
ATOM   7172  C C   . LEU C 1 308 ? -21.000 29.982  86.150  1.00 28.27  ? 308  LEU C C   1 
ATOM   7173  O O   . LEU C 1 308 ? -20.231 30.945  86.197  1.00 27.58  ? 308  LEU C O   1 
ATOM   7174  C CB  . LEU C 1 308 ? -23.223 31.027  86.596  1.00 26.75  ? 308  LEU C CB  1 
ATOM   7175  C CG  . LEU C 1 308 ? -24.387 31.785  86.014  1.00 32.24  ? 308  LEU C CG  1 
ATOM   7176  C CD1 . LEU C 1 308 ? -25.275 32.318  87.117  1.00 33.13  ? 308  LEU C CD1 1 
ATOM   7177  C CD2 . LEU C 1 308 ? -23.915 32.930  85.136  1.00 34.65  ? 308  LEU C CD2 1 
ATOM   7178  N N   . LEU C 1 309 ? -20.659 28.758  86.576  1.00 23.51  ? 309  LEU C N   1 
ATOM   7179  C CA  . LEU C 1 309 ? -19.353 28.469  87.138  1.00 23.34  ? 309  LEU C CA  1 
ATOM   7180  C C   . LEU C 1 309 ? -18.265 28.416  86.095  1.00 29.57  ? 309  LEU C C   1 
ATOM   7181  O O   . LEU C 1 309 ? -18.407 27.781  85.045  1.00 30.51  ? 309  LEU C O   1 
ATOM   7182  C CB  . LEU C 1 309 ? -19.357 27.149  87.924  1.00 22.70  ? 309  LEU C CB  1 
ATOM   7183  C CG  . LEU C 1 309 ? -20.101 27.104  89.262  1.00 25.86  ? 309  LEU C CG  1 
ATOM   7184  C CD1 . LEU C 1 309 ? -20.209 25.670  89.754  1.00 25.31  ? 309  LEU C CD1 1 
ATOM   7185  C CD2 . LEU C 1 309 ? -19.433 27.985  90.315  1.00 23.51  ? 309  LEU C CD2 1 
ATOM   7186  N N   . ASP C 1 310 ? -17.164 29.085  86.400  1.00 26.93  ? 310  ASP C N   1 
ATOM   7187  C CA  . ASP C 1 310 ? -15.963 29.048  85.594  1.00 26.97  ? 310  ASP C CA  1 
ATOM   7188  C C   . ASP C 1 310 ? -15.190 27.807  86.012  1.00 29.92  ? 310  ASP C C   1 
ATOM   7189  O O   . ASP C 1 310 ? -15.466 27.239  87.074  1.00 30.12  ? 310  ASP C O   1 
ATOM   7190  C CB  . ASP C 1 310 ? -15.146 30.324  85.790  1.00 30.07  ? 310  ASP C CB  1 
ATOM   7191  C CG  . ASP C 1 310 ? -15.427 31.448  84.816  1.00 41.40  ? 310  ASP C CG  1 
ATOM   7192  O OD1 . ASP C 1 310 ? -16.236 31.251  83.889  1.00 40.46  ? 310  ASP C OD1 1 
ATOM   7193  O OD2 . ASP C 1 310 ? -14.793 32.495  84.944  1.00 50.79  ? 310  ASP C OD2 1 
ATOM   7194  N N   . TYR C 1 311 ? -14.240 27.377  85.185  1.00 25.23  ? 311  TYR C N   1 
ATOM   7195  C CA  . TYR C 1 311 ? -13.443 26.181  85.413  1.00 23.09  ? 311  TYR C CA  1 
ATOM   7196  C C   . TYR C 1 311 ? -12.760 26.174  86.784  1.00 25.03  ? 311  TYR C C   1 
ATOM   7197  O O   . TYR C 1 311 ? -12.798 25.140  87.442  1.00 26.10  ? 311  TYR C O   1 
ATOM   7198  C CB  . TYR C 1 311 ? -12.406 26.009  84.284  1.00 23.92  ? 311  TYR C CB  1 
ATOM   7199  C CG  . TYR C 1 311 ? -11.538 24.783  84.449  1.00 23.75  ? 311  TYR C CG  1 
ATOM   7200  C CD1 . TYR C 1 311 ? -12.052 23.510  84.234  1.00 24.93  ? 311  TYR C CD1 1 
ATOM   7201  C CD2 . TYR C 1 311 ? -10.200 24.897  84.815  1.00 24.34  ? 311  TYR C CD2 1 
ATOM   7202  C CE1 . TYR C 1 311 ? -11.266 22.379  84.407  1.00 24.93  ? 311  TYR C CE1 1 
ATOM   7203  C CE2 . TYR C 1 311 ? -9.395  23.772  84.965  1.00 24.91  ? 311  TYR C CE2 1 
ATOM   7204  C CZ  . TYR C 1 311 ? -9.932  22.514  84.754  1.00 30.90  ? 311  TYR C CZ  1 
ATOM   7205  O OH  . TYR C 1 311 ? -9.160  21.394  84.901  1.00 30.77  ? 311  TYR C OH  1 
ATOM   7206  N N   . THR C 1 312 ? -12.169 27.304  87.220  1.00 20.28  ? 312  THR C N   1 
ATOM   7207  C CA  . THR C 1 312 ? -11.421 27.403  88.481  1.00 19.80  ? 312  THR C CA  1 
ATOM   7208  C C   . THR C 1 312 ? -12.246 27.989  89.639  1.00 25.68  ? 312  THR C C   1 
ATOM   7209  O O   . THR C 1 312 ? -11.757 28.079  90.766  1.00 25.69  ? 312  THR C O   1 
ATOM   7210  C CB  . THR C 1 312 ? -10.135 28.247  88.289  1.00 24.74  ? 312  THR C CB  1 
ATOM   7211  O OG1 . THR C 1 312 ? -10.476 29.586  87.949  1.00 28.04  ? 312  THR C OG1 1 
ATOM   7212  C CG2 . THR C 1 312 ? -9.191  27.675  87.250  1.00 17.95  ? 312  THR C CG2 1 
ATOM   7213  N N   . GLU C 1 313 ? -13.489 28.378  89.366  1.00 23.33  ? 313  GLU C N   1 
ATOM   7214  C CA  . GLU C 1 313 ? -14.359 29.025  90.337  1.00 22.63  ? 313  GLU C CA  1 
ATOM   7215  C C   . GLU C 1 313 ? -14.790 28.123  91.491  1.00 27.59  ? 313  GLU C C   1 
ATOM   7216  O O   . GLU C 1 313 ? -15.200 26.974  91.278  1.00 27.96  ? 313  GLU C O   1 
ATOM   7217  C CB  . GLU C 1 313 ? -15.598 29.567  89.625  1.00 23.40  ? 313  GLU C CB  1 
ATOM   7218  C CG  . GLU C 1 313 ? -16.395 30.561  90.442  1.00 24.97  ? 313  GLU C CG  1 
ATOM   7219  C CD  . GLU C 1 313 ? -17.575 31.153  89.708  1.00 39.61  ? 313  GLU C CD  1 
ATOM   7220  O OE1 . GLU C 1 313 ? -17.612 31.070  88.459  1.00 30.94  ? 313  GLU C OE1 1 
ATOM   7221  O OE2 . GLU C 1 313 ? -18.459 31.720  90.387  1.00 35.22  ? 313  GLU C OE2 1 
ATOM   7222  N N   . LYS C 1 314 ? -14.743 28.682  92.715  1.00 23.66  ? 314  LYS C N   1 
ATOM   7223  C CA  . LYS C 1 314 ? -15.235 28.008  93.911  1.00 22.53  ? 314  LYS C CA  1 
ATOM   7224  C C   . LYS C 1 314 ? -16.760 28.112  93.926  1.00 26.37  ? 314  LYS C C   1 
ATOM   7225  O O   . LYS C 1 314 ? -17.291 29.231  93.909  1.00 25.53  ? 314  LYS C O   1 
ATOM   7226  C CB  . LYS C 1 314 ? -14.624 28.598  95.194  1.00 24.45  ? 314  LYS C CB  1 
ATOM   7227  C CG  . LYS C 1 314 ? -15.160 27.957  96.475  1.00 26.20  ? 314  LYS C CG  1 
ATOM   7228  C CD  . LYS C 1 314 ? -14.534 28.579  97.704  1.00 33.27  ? 314  LYS C CD  1 
ATOM   7229  C CE  . LYS C 1 314 ? -15.030 27.948  98.975  1.00 53.53  ? 314  LYS C CE  1 
ATOM   7230  N NZ  . LYS C 1 314 ? -14.277 28.446  100.162 1.00 70.51  ? 314  LYS C NZ  1 
ATOM   7231  N N   . PRO C 1 315 ? -17.485 26.967  93.943  1.00 23.37  ? 315  PRO C N   1 
ATOM   7232  C CA  . PRO C 1 315 ? -18.956 27.038  93.987  1.00 22.74  ? 315  PRO C CA  1 
ATOM   7233  C C   . PRO C 1 315 ? -19.463 27.609  95.300  1.00 26.86  ? 315  PRO C C   1 
ATOM   7234  O O   . PRO C 1 315 ? -18.817 27.455  96.339  1.00 27.72  ? 315  PRO C O   1 
ATOM   7235  C CB  . PRO C 1 315 ? -19.384 25.573  93.850  1.00 23.32  ? 315  PRO C CB  1 
ATOM   7236  C CG  . PRO C 1 315 ? -18.179 24.854  93.326  1.00 27.40  ? 315  PRO C CG  1 
ATOM   7237  C CD  . PRO C 1 315 ? -17.028 25.563  93.933  1.00 23.78  ? 315  PRO C CD  1 
ATOM   7238  N N   . LEU C 1 316 ? -20.607 28.287  95.251  1.00 24.16  ? 316  LEU C N   1 
ATOM   7239  C CA  . LEU C 1 316 ? -21.304 28.777  96.441  1.00 24.09  ? 316  LEU C CA  1 
ATOM   7240  C C   . LEU C 1 316 ? -22.262 27.659  96.834  1.00 28.22  ? 316  LEU C C   1 
ATOM   7241  O O   . LEU C 1 316 ? -23.425 27.656  96.416  1.00 27.94  ? 316  LEU C O   1 
ATOM   7242  C CB  . LEU C 1 316 ? -22.025 30.114  96.155  1.00 24.83  ? 316  LEU C CB  1 
ATOM   7243  C CG  . LEU C 1 316 ? -21.157 31.387  96.160  1.00 29.01  ? 316  LEU C CG  1 
ATOM   7244  C CD1 . LEU C 1 316 ? -21.923 32.569  95.651  1.00 28.44  ? 316  LEU C CD1 1 
ATOM   7245  C CD2 . LEU C 1 316 ? -20.638 31.722  97.565  1.00 30.07  ? 316  LEU C CD2 1 
ATOM   7246  N N   . TYR C 1 317 ? -21.722 26.648  97.549  1.00 25.13  ? 317  TYR C N   1 
ATOM   7247  C CA  . TYR C 1 317 ? -22.400 25.418  97.997  1.00 25.01  ? 317  TYR C CA  1 
ATOM   7248  C C   . TYR C 1 317 ? -23.676 25.689  98.789  1.00 30.86  ? 317  TYR C C   1 
ATOM   7249  O O   . TYR C 1 317 ? -24.660 24.962  98.605  1.00 32.09  ? 317  TYR C O   1 
ATOM   7250  C CB  . TYR C 1 317 ? -21.451 24.544  98.836  1.00 25.62  ? 317  TYR C CB  1 
ATOM   7251  C CG  . TYR C 1 317 ? -20.211 24.114  98.086  1.00 25.67  ? 317  TYR C CG  1 
ATOM   7252  C CD1 . TYR C 1 317 ? -20.242 23.032  97.205  1.00 27.44  ? 317  TYR C CD1 1 
ATOM   7253  C CD2 . TYR C 1 317 ? -19.005 24.782  98.259  1.00 25.55  ? 317  TYR C CD2 1 
ATOM   7254  C CE1 . TYR C 1 317 ? -19.102 22.636  96.508  1.00 27.75  ? 317  TYR C CE1 1 
ATOM   7255  C CE2 . TYR C 1 317 ? -17.859 24.394  97.571  1.00 25.14  ? 317  TYR C CE2 1 
ATOM   7256  C CZ  . TYR C 1 317 ? -17.912 23.320  96.701  1.00 30.27  ? 317  TYR C CZ  1 
ATOM   7257  O OH  . TYR C 1 317 ? -16.782 22.938  96.033  1.00 25.71  ? 317  TYR C OH  1 
ATOM   7258  N N   . GLU C 1 318 ? -23.676 26.731  99.639  1.00 26.69  ? 318  GLU C N   1 
ATOM   7259  C CA  . GLU C 1 318 ? -24.838 27.102  100.452 1.00 27.55  ? 318  GLU C CA  1 
ATOM   7260  C C   . GLU C 1 318 ? -26.006 27.564  99.564  1.00 32.44  ? 318  GLU C C   1 
ATOM   7261  O O   . GLU C 1 318 ? -27.155 27.234  99.846  1.00 32.31  ? 318  GLU C O   1 
ATOM   7262  C CB  . GLU C 1 318 ? -24.465 28.191  101.474 1.00 29.97  ? 318  GLU C CB  1 
ATOM   7263  C CG  . GLU C 1 318 ? -24.874 27.861  102.907 1.00 46.26  ? 318  GLU C CG  1 
ATOM   7264  C CD  . GLU C 1 318 ? -24.564 26.466  103.421 1.00 71.09  ? 318  GLU C CD  1 
ATOM   7265  O OE1 . GLU C 1 318 ? -25.518 25.699  103.691 1.00 69.09  ? 318  GLU C OE1 1 
ATOM   7266  O OE2 . GLU C 1 318 ? -23.363 26.124  103.515 1.00 64.49  ? 318  GLU C OE2 1 
ATOM   7267  N N   . ASN C 1 319 ? -25.706 28.308  98.480  1.00 29.45  ? 319  ASN C N   1 
ATOM   7268  C CA  . ASN C 1 319 ? -26.692 28.793  97.517  1.00 29.19  ? 319  ASN C CA  1 
ATOM   7269  C C   . ASN C 1 319 ? -27.312 27.608  96.753  1.00 32.97  ? 319  ASN C C   1 
ATOM   7270  O O   . ASN C 1 319 ? -28.522 27.613  96.531  1.00 34.61  ? 319  ASN C O   1 
ATOM   7271  C CB  . ASN C 1 319 ? -26.051 29.800  96.566  1.00 27.65  ? 319  ASN C CB  1 
ATOM   7272  C CG  . ASN C 1 319 ? -26.885 30.196  95.375  1.00 39.56  ? 319  ASN C CG  1 
ATOM   7273  O OD1 . ASN C 1 319 ? -28.015 30.680  95.493  1.00 33.47  ? 319  ASN C OD1 1 
ATOM   7274  N ND2 . ASN C 1 319 ? -26.322 30.043  94.188  1.00 29.10  ? 319  ASN C ND2 1 
ATOM   7275  N N   . LEU C 1 320 ? -26.507 26.579  96.411  1.00 27.83  ? 320  LEU C N   1 
ATOM   7276  C CA  . LEU C 1 320 ? -26.986 25.361  95.740  1.00 27.12  ? 320  LEU C CA  1 
ATOM   7277  C C   . LEU C 1 320 ? -27.893 24.549  96.673  1.00 32.60  ? 320  LEU C C   1 
ATOM   7278  O O   . LEU C 1 320 ? -28.880 23.974  96.219  1.00 33.50  ? 320  LEU C O   1 
ATOM   7279  C CB  . LEU C 1 320 ? -25.823 24.485  95.251  1.00 25.76  ? 320  LEU C CB  1 
ATOM   7280  C CG  . LEU C 1 320 ? -25.015 24.989  94.060  1.00 29.75  ? 320  LEU C CG  1 
ATOM   7281  C CD1 . LEU C 1 320 ? -23.746 24.199  93.938  1.00 29.43  ? 320  LEU C CD1 1 
ATOM   7282  C CD2 . LEU C 1 320 ? -25.802 24.901  92.734  1.00 30.89  ? 320  LEU C CD2 1 
ATOM   7283  N N   . ARG C 1 321 ? -27.560 24.522  97.976  1.00 30.20  ? 321  ARG C N   1 
ATOM   7284  C CA  . ARG C 1 321 ? -28.343 23.851  99.003  1.00 31.21  ? 321  ARG C CA  1 
ATOM   7285  C C   . ARG C 1 321 ? -29.697 24.525  99.166  1.00 35.40  ? 321  ARG C C   1 
ATOM   7286  O O   . ARG C 1 321 ? -30.697 23.813  99.235  1.00 36.92  ? 321  ARG C O   1 
ATOM   7287  C CB  . ARG C 1 321 ? -27.595 23.822  100.342 1.00 33.28  ? 321  ARG C CB  1 
ATOM   7288  C CG  . ARG C 1 321 ? -26.759 22.564  100.507 1.00 43.65  ? 321  ARG C CG  1 
ATOM   7289  C CD  . ARG C 1 321 ? -26.054 22.516  101.845 1.00 44.66  ? 321  ARG C CD  1 
ATOM   7290  N NE  . ARG C 1 321 ? -24.813 21.765  101.704 1.00 47.09  ? 321  ARG C NE  1 
ATOM   7291  C CZ  . ARG C 1 321 ? -23.609 22.317  101.749 1.00 53.76  ? 321  ARG C CZ  1 
ATOM   7292  N NH1 . ARG C 1 321 ? -23.473 23.616  102.014 1.00 36.15  ? 321  ARG C NH1 1 
ATOM   7293  N NH2 . ARG C 1 321 ? -22.527 21.571  101.567 1.00 35.78  ? 321  ARG C NH2 1 
ATOM   7294  N N   . ASP C 1 322 ? -29.738 25.883  99.179  1.00 30.63  ? 322  ASP C N   1 
ATOM   7295  C CA  . ASP C 1 322 ? -30.974 26.659  99.298  1.00 32.65  ? 322  ASP C CA  1 
ATOM   7296  C C   . ASP C 1 322 ? -31.913 26.381  98.128  1.00 36.18  ? 322  ASP C C   1 
ATOM   7297  O O   . ASP C 1 322 ? -33.121 26.310  98.337  1.00 37.46  ? 322  ASP C O   1 
ATOM   7298  C CB  . ASP C 1 322 ? -30.703 28.170  99.390  1.00 36.59  ? 322  ASP C CB  1 
ATOM   7299  C CG  . ASP C 1 322 ? -29.954 28.636  100.625 1.00 60.33  ? 322  ASP C CG  1 
ATOM   7300  O OD1 . ASP C 1 322 ? -30.113 27.999  101.701 1.00 62.62  ? 322  ASP C OD1 1 
ATOM   7301  O OD2 . ASP C 1 322 ? -29.248 29.668  100.534 1.00 72.37  ? 322  ASP C OD2 1 
ATOM   7302  N N   . ILE C 1 323 ? -31.355 26.218  96.906  1.00 31.07  ? 323  ILE C N   1 
ATOM   7303  C CA  . ILE C 1 323 ? -32.109 25.898  95.695  1.00 30.02  ? 323  ILE C CA  1 
ATOM   7304  C C   . ILE C 1 323 ? -32.842 24.560  95.916  1.00 33.99  ? 323  ILE C C   1 
ATOM   7305  O O   . ILE C 1 323 ? -34.046 24.491  95.693  1.00 35.08  ? 323  ILE C O   1 
ATOM   7306  C CB  . ILE C 1 323 ? -31.188 25.885  94.434  1.00 30.99  ? 323  ILE C CB  1 
ATOM   7307  C CG1 . ILE C 1 323 ? -30.775 27.317  94.031  1.00 30.76  ? 323  ILE C CG1 1 
ATOM   7308  C CG2 . ILE C 1 323 ? -31.854 25.167  93.251  1.00 31.02  ? 323  ILE C CG2 1 
ATOM   7309  C CD1 . ILE C 1 323 ? -29.573 27.403  93.056  1.00 28.72  ? 323  ILE C CD1 1 
ATOM   7310  N N   . LEU C 1 324 ? -32.125 23.526  96.398  1.00 29.96  ? 324  LEU C N   1 
ATOM   7311  C CA  . LEU C 1 324 ? -32.701 22.202  96.639  1.00 30.26  ? 324  LEU C CA  1 
ATOM   7312  C C   . LEU C 1 324 ? -33.685 22.215  97.810  1.00 35.10  ? 324  LEU C C   1 
ATOM   7313  O O   . LEU C 1 324 ? -34.706 21.538  97.726  1.00 35.34  ? 324  LEU C O   1 
ATOM   7314  C CB  . LEU C 1 324 ? -31.614 21.137  96.864  1.00 29.30  ? 324  LEU C CB  1 
ATOM   7315  C CG  . LEU C 1 324 ? -30.589 20.930  95.737  1.00 31.92  ? 324  LEU C CG  1 
ATOM   7316  C CD1 . LEU C 1 324 ? -29.583 19.889  96.136  1.00 31.10  ? 324  LEU C CD1 1 
ATOM   7317  C CD2 . LEU C 1 324 ? -31.264 20.538  94.403  1.00 32.08  ? 324  LEU C CD2 1 
ATOM   7318  N N   . LEU C 1 325 ? -33.404 23.016  98.864  1.00 32.32  ? 325  LEU C N   1 
ATOM   7319  C CA  . LEU C 1 325 ? -34.275 23.177  100.033 1.00 34.14  ? 325  LEU C CA  1 
ATOM   7320  C C   . LEU C 1 325 ? -35.598 23.856  99.653  1.00 40.35  ? 325  LEU C C   1 
ATOM   7321  O O   . LEU C 1 325 ? -36.628 23.527  100.242 1.00 41.92  ? 325  LEU C O   1 
ATOM   7322  C CB  . LEU C 1 325 ? -33.579 23.973  101.143 1.00 34.92  ? 325  LEU C CB  1 
ATOM   7323  C CG  . LEU C 1 325 ? -32.452 23.269  101.903 1.00 39.37  ? 325  LEU C CG  1 
ATOM   7324  C CD1 . LEU C 1 325 ? -31.637 24.270  102.709 1.00 40.19  ? 325  LEU C CD1 1 
ATOM   7325  C CD2 . LEU C 1 325 ? -32.986 22.157  102.799 1.00 42.55  ? 325  LEU C CD2 1 
ATOM   7326  N N   . GLN C 1 326 ? -35.573 24.781  98.657  1.00 37.05  ? 326  GLN C N   1 
ATOM   7327  C CA  . GLN C 1 326 ? -36.764 25.462  98.134  1.00 38.33  ? 326  GLN C CA  1 
ATOM   7328  C C   . GLN C 1 326 ? -37.667 24.449  97.425  1.00 41.94  ? 326  GLN C C   1 
ATOM   7329  O O   . GLN C 1 326 ? -38.889 24.560  97.528  1.00 43.31  ? 326  GLN C O   1 
ATOM   7330  C CB  . GLN C 1 326 ? -36.385 26.611  97.187  1.00 39.46  ? 326  GLN C CB  1 
ATOM   7331  N N   . GLY C 1 327 ? -37.050 23.455  96.770  1.00 36.18  ? 327  GLY C N   1 
ATOM   7332  C CA  . GLY C 1 327 ? -37.736 22.348  96.107  1.00 35.85  ? 327  GLY C CA  1 
ATOM   7333  C C   . GLY C 1 327 ? -38.467 21.455  97.092  1.00 40.87  ? 327  GLY C C   1 
ATOM   7334  O O   . GLY C 1 327 ? -39.592 21.022  96.819  1.00 42.98  ? 327  GLY C O   1 
ATOM   7335  N N   . LEU C 1 328 ? -37.851 21.207  98.272  1.00 35.25  ? 328  LEU C N   1 
ATOM   7336  C CA  . LEU C 1 328 ? -38.464 20.418  99.343  1.00 35.24  ? 328  LEU C CA  1 
ATOM   7337  C C   . LEU C 1 328 ? -39.671 21.163  99.945  1.00 40.93  ? 328  LEU C C   1 
ATOM   7338  O O   . LEU C 1 328 ? -40.684 20.535  100.249 1.00 41.26  ? 328  LEU C O   1 
ATOM   7339  C CB  . LEU C 1 328 ? -37.436 20.066  100.435 1.00 34.32  ? 328  LEU C CB  1 
ATOM   7340  C CG  . LEU C 1 328 ? -36.468 18.909  100.120 1.00 36.31  ? 328  LEU C CG  1 
ATOM   7341  C CD1 . LEU C 1 328 ? -35.315 18.897  101.087 1.00 35.19  ? 328  LEU C CD1 1 
ATOM   7342  C CD2 . LEU C 1 328 ? -37.172 17.556  100.135 1.00 36.93  ? 328  LEU C CD2 1 
ATOM   7343  N N   . LYS C 1 329 ? -39.558 22.500  100.111 1.00 38.30  ? 329  LYS C N   1 
ATOM   7344  C CA  . LYS C 1 329 ? -40.620 23.373  100.629 1.00 39.68  ? 329  LYS C CA  1 
ATOM   7345  C C   . LYS C 1 329 ? -41.787 23.398  99.649  1.00 43.96  ? 329  LYS C C   1 
ATOM   7346  O O   . LYS C 1 329 ? -42.937 23.394  100.073 1.00 45.54  ? 329  LYS C O   1 
ATOM   7347  C CB  . LYS C 1 329 ? -40.081 24.793  100.867 1.00 42.32  ? 329  LYS C CB  1 
ATOM   7348  C CG  . LYS C 1 329 ? -40.976 25.664  101.729 1.00 58.69  ? 329  LYS C CG  1 
ATOM   7349  C CD  . LYS C 1 329 ? -40.392 27.049  101.909 1.00 70.16  ? 329  LYS C CD  1 
ATOM   7350  C CE  . LYS C 1 329 ? -41.085 27.799  103.021 1.00 87.79  ? 329  LYS C CE  1 
ATOM   7351  N NZ  . LYS C 1 329 ? -40.515 29.159  103.204 1.00 99.79  ? 329  LYS C NZ  1 
ATOM   7352  N N   . ALA C 1 330 ? -41.479 23.376  98.338  1.00 39.75  ? 330  ALA C N   1 
ATOM   7353  C CA  . ALA C 1 330 ? -42.443 23.372  97.234  1.00 39.97  ? 330  ALA C CA  1 
ATOM   7354  C C   . ALA C 1 330 ? -43.327 22.120  97.259  1.00 44.66  ? 330  ALA C C   1 
ATOM   7355  O O   . ALA C 1 330 ? -44.498 22.225  96.913  1.00 45.46  ? 330  ALA C O   1 
ATOM   7356  C CB  . ALA C 1 330 ? -41.711 23.470  95.894  1.00 38.66  ? 330  ALA C CB  1 
ATOM   7357  N N   . ILE C 1 331 ? -42.767 20.949  97.659  1.00 40.67  ? 331  ILE C N   1 
ATOM   7358  C CA  . ILE C 1 331 ? -43.500 19.675  97.740  1.00 41.09  ? 331  ILE C CA  1 
ATOM   7359  C C   . ILE C 1 331 ? -44.125 19.456  99.159  1.00 45.50  ? 331  ILE C C   1 
ATOM   7360  O O   . ILE C 1 331 ? -44.665 18.383  99.446  1.00 45.69  ? 331  ILE C O   1 
ATOM   7361  C CB  . ILE C 1 331 ? -42.641 18.454  97.276  1.00 42.07  ? 331  ILE C CB  1 
ATOM   7362  C CG1 . ILE C 1 331 ? -41.364 18.240  98.126  1.00 40.55  ? 331  ILE C CG1 1 
ATOM   7363  C CG2 . ILE C 1 331 ? -42.331 18.561  95.792  1.00 41.84  ? 331  ILE C CG2 1 
ATOM   7364  C CD1 . ILE C 1 331 ? -40.850 16.795  98.204  1.00 42.69  ? 331  ILE C CD1 1 
ATOM   7365  N N   . GLY C 1 332 ? -44.082 20.489  99.994  1.00 42.80  ? 332  GLY C N   1 
ATOM   7366  C CA  . GLY C 1 332 ? -44.629 20.453  101.348 1.00 45.06  ? 332  GLY C CA  1 
ATOM   7367  C C   . GLY C 1 332 ? -43.822 19.668  102.362 1.00 49.84  ? 332  GLY C C   1 
ATOM   7368  O O   . GLY C 1 332 ? -44.334 19.346  103.436 1.00 52.32  ? 332  GLY C O   1 
ATOM   7369  N N   . SER C 1 333 ? -42.554 19.374  102.042 1.00 44.63  ? 333  SER C N   1 
ATOM   7370  C CA  . SER C 1 333 ? -41.640 18.629  102.911 1.00 43.89  ? 333  SER C CA  1 
ATOM   7371  C C   . SER C 1 333 ? -40.539 19.554  103.460 1.00 48.28  ? 333  SER C C   1 
ATOM   7372  O O   . SER C 1 333 ? -40.647 20.780  103.358 1.00 49.03  ? 333  SER C O   1 
ATOM   7373  C CB  . SER C 1 333 ? -41.033 17.451  102.151 1.00 44.91  ? 333  SER C CB  1 
ATOM   7374  O OG  . SER C 1 333 ? -40.294 16.602  103.016 1.00 52.93  ? 333  SER C OG  1 
ATOM   7375  N N   . LYS C 1 334 ? -39.503 18.961  104.071 1.00 43.83  ? 334  LYS C N   1 
ATOM   7376  C CA  . LYS C 1 334 ? -38.355 19.649  104.662 1.00 42.75  ? 334  LYS C CA  1 
ATOM   7377  C C   . LYS C 1 334 ? -37.169 18.696  104.687 1.00 44.58  ? 334  LYS C C   1 
ATOM   7378  O O   . LYS C 1 334 ? -37.342 17.502  104.432 1.00 43.45  ? 334  LYS C O   1 
ATOM   7379  C CB  . LYS C 1 334 ? -38.687 20.176  106.086 1.00 46.84  ? 334  LYS C CB  1 
ATOM   7380  C CG  . LYS C 1 334 ? -39.085 19.107  107.105 1.00 61.80  ? 334  LYS C CG  1 
ATOM   7381  C CD  . LYS C 1 334 ? -39.507 19.722  108.433 1.00 74.59  ? 334  LYS C CD  1 
ATOM   7382  C CE  . LYS C 1 334 ? -39.645 18.692  109.528 1.00 85.27  ? 334  LYS C CE  1 
ATOM   7383  N NZ  . LYS C 1 334 ? -38.325 18.316  110.107 1.00 94.44  ? 334  LYS C NZ  1 
ATOM   7384  N N   . ASP C 1 335 ? -35.970 19.213  104.993 1.00 40.67  ? 335  ASP C N   1 
ATOM   7385  C CA  . ASP C 1 335 ? -34.787 18.369  105.101 1.00 39.54  ? 335  ASP C CA  1 
ATOM   7386  C C   . ASP C 1 335 ? -34.808 17.669  106.463 1.00 45.55  ? 335  ASP C C   1 
ATOM   7387  O O   . ASP C 1 335 ? -34.303 18.202  107.457 1.00 46.85  ? 335  ASP C O   1 
ATOM   7388  C CB  . ASP C 1 335 ? -33.499 19.180  104.888 1.00 40.01  ? 335  ASP C CB  1 
ATOM   7389  C CG  . ASP C 1 335 ? -32.200 18.392  104.946 1.00 45.65  ? 335  ASP C CG  1 
ATOM   7390  O OD1 . ASP C 1 335 ? -32.258 17.128  104.967 1.00 43.54  ? 335  ASP C OD1 1 
ATOM   7391  O OD2 . ASP C 1 335 ? -31.121 19.033  104.945 1.00 50.99  ? 335  ASP C OD2 1 
ATOM   7392  N N   . ASP C 1 336 ? -35.438 16.488  106.502 1.00 42.14  ? 336  ASP C N   1 
ATOM   7393  C CA  . ASP C 1 336 ? -35.544 15.655  107.697 1.00 43.71  ? 336  ASP C CA  1 
ATOM   7394  C C   . ASP C 1 336 ? -34.546 14.480  107.620 1.00 48.40  ? 336  ASP C C   1 
ATOM   7395  O O   . ASP C 1 336 ? -34.517 13.621  108.501 1.00 49.25  ? 336  ASP C O   1 
ATOM   7396  C CB  . ASP C 1 336 ? -36.995 15.147  107.877 1.00 46.94  ? 336  ASP C CB  1 
ATOM   7397  C CG  . ASP C 1 336 ? -37.630 14.461  106.670 1.00 52.35  ? 336  ASP C CG  1 
ATOM   7398  O OD1 . ASP C 1 336 ? -36.909 14.213  105.670 1.00 49.37  ? 336  ASP C OD1 1 
ATOM   7399  O OD2 . ASP C 1 336 ? -38.846 14.185  106.720 1.00 58.17  ? 336  ASP C OD2 1 
ATOM   7400  N N   . GLY C 1 337 ? -33.749 14.462  106.557 1.00 45.01  ? 337  GLY C N   1 
ATOM   7401  C CA  . GLY C 1 337 ? -32.750 13.432  106.306 1.00 44.45  ? 337  GLY C CA  1 
ATOM   7402  C C   . GLY C 1 337 ? -33.330 12.073  105.961 1.00 50.05  ? 337  GLY C C   1 
ATOM   7403  O O   . GLY C 1 337 ? -32.628 11.064  106.066 1.00 50.76  ? 337  GLY C O   1 
ATOM   7404  N N   . LYS C 1 338 ? -34.618 12.027  105.556 1.00 46.68  ? 338  LYS C N   1 
ATOM   7405  C CA  . LYS C 1 338 ? -35.291 10.777  105.200 1.00 46.65  ? 338  LYS C CA  1 
ATOM   7406  C C   . LYS C 1 338 ? -35.161 10.559  103.700 1.00 48.55  ? 338  LYS C C   1 
ATOM   7407  O O   . LYS C 1 338 ? -35.673 11.364  102.910 1.00 47.05  ? 338  LYS C O   1 
ATOM   7408  C CB  . LYS C 1 338 ? -36.757 10.783  105.657 1.00 50.58  ? 338  LYS C CB  1 
ATOM   7409  N N   . LEU C 1 339 ? -34.422 9.499   103.308 1.00 44.68  ? 339  LEU C N   1 
ATOM   7410  C CA  . LEU C 1 339 ? -34.165 9.193   101.901 1.00 42.71  ? 339  LEU C CA  1 
ATOM   7411  C C   . LEU C 1 339 ? -35.375 8.578   101.191 1.00 49.14  ? 339  LEU C C   1 
ATOM   7412  O O   . LEU C 1 339 ? -35.456 8.700   99.970  1.00 48.04  ? 339  LEU C O   1 
ATOM   7413  C CB  . LEU C 1 339 ? -32.923 8.301   101.728 1.00 41.42  ? 339  LEU C CB  1 
ATOM   7414  C CG  . LEU C 1 339 ? -31.566 8.905   102.145 1.00 43.63  ? 339  LEU C CG  1 
ATOM   7415  C CD1 . LEU C 1 339 ? -30.441 7.967   101.807 1.00 42.30  ? 339  LEU C CD1 1 
ATOM   7416  C CD2 . LEU C 1 339 ? -31.310 10.256  101.477 1.00 44.06  ? 339  LEU C CD2 1 
ATOM   7417  N N   . ASP C 1 340 ? -36.315 7.958   101.940 1.00 49.65  ? 340  ASP C N   1 
ATOM   7418  C CA  . ASP C 1 340 ? -37.548 7.317   101.438 1.00 51.81  ? 340  ASP C CA  1 
ATOM   7419  C C   . ASP C 1 340 ? -37.237 6.269   100.342 1.00 55.87  ? 340  ASP C C   1 
ATOM   7420  O O   . ASP C 1 340 ? -37.934 6.214   99.324  1.00 54.90  ? 340  ASP C O   1 
ATOM   7421  C CB  . ASP C 1 340 ? -38.572 8.371   100.935 1.00 54.52  ? 340  ASP C CB  1 
ATOM   7422  C CG  . ASP C 1 340 ? -39.353 9.120   102.009 1.00 74.06  ? 340  ASP C CG  1 
ATOM   7423  O OD1 . ASP C 1 340 ? -39.045 8.941   103.215 1.00 76.50  ? 340  ASP C OD1 1 
ATOM   7424  O OD2 . ASP C 1 340 ? -40.281 9.878   101.647 1.00 83.17  ? 340  ASP C OD2 1 
ATOM   7425  N N   . LEU C 1 341 ? -36.194 5.422   100.598 1.00 53.63  ? 341  LEU C N   1 
ATOM   7426  C CA  . LEU C 1 341 ? -35.642 4.339   99.763  1.00 87.06  ? 341  LEU C CA  1 
ATOM   7427  C C   . LEU C 1 341 ? -34.764 4.911   98.648  1.00 94.63  ? 341  LEU C C   1 
ATOM   7428  O O   . LEU C 1 341 ? -33.601 5.234   98.884  1.00 52.66  ? 341  LEU C O   1 
ATOM   7429  C CB  . LEU C 1 341 ? -36.731 3.409   99.171  1.00 88.65  ? 341  LEU C CB  1 
ATOM   7430  C CG  . LEU C 1 341 ? -37.183 2.200   100.007 1.00 95.51  ? 341  LEU C CG  1 
ATOM   7431  C CD1 . LEU C 1 341 ? -38.145 2.609   101.128 1.00 96.95  ? 341  LEU C CD1 1 
ATOM   7432  C CD2 . LEU C 1 341 ? -37.865 1.168   99.123  1.00 99.28  ? 341  LEU C CD2 1 
ATOM   7433  N N   . VAL D 1 25  ? -43.987 13.756  46.988  1.00 114.70 ? 25   VAL D N   1 
ATOM   7434  C CA  . VAL D 1 25  ? -43.314 12.739  46.187  1.00 112.43 ? 25   VAL D CA  1 
ATOM   7435  C C   . VAL D 1 25  ? -43.971 12.653  44.786  1.00 118.56 ? 25   VAL D C   1 
ATOM   7436  O O   . VAL D 1 25  ? -44.931 11.905  44.600  1.00 120.48 ? 25   VAL D O   1 
ATOM   7437  C CB  . VAL D 1 25  ? -43.302 11.373  46.910  1.00 115.04 ? 25   VAL D CB  1 
ATOM   7438  N N   . GLY D 1 26  ? -43.475 13.427  43.818  1.00 114.63 ? 26   GLY D N   1 
ATOM   7439  C CA  . GLY D 1 26  ? -42.346 14.337  43.982  1.00 111.70 ? 26   GLY D CA  1 
ATOM   7440  C C   . GLY D 1 26  ? -42.355 15.537  43.056  1.00 116.50 ? 26   GLY D C   1 
ATOM   7441  O O   . GLY D 1 26  ? -42.935 15.492  41.964  1.00 118.15 ? 26   GLY D O   1 
ATOM   7442  N N   . GLU D 1 27  ? -41.694 16.621  43.505  1.00 111.29 ? 27   GLU D N   1 
ATOM   7443  C CA  . GLU D 1 27  ? -41.554 17.878  42.773  1.00 112.08 ? 27   GLU D CA  1 
ATOM   7444  C C   . GLU D 1 27  ? -40.365 17.801  41.829  1.00 112.23 ? 27   GLU D C   1 
ATOM   7445  O O   . GLU D 1 27  ? -39.355 17.190  42.176  1.00 108.39 ? 27   GLU D O   1 
ATOM   7446  C CB  . GLU D 1 27  ? -41.381 19.049  43.753  1.00 113.35 ? 27   GLU D CB  1 
ATOM   7447  N N   . ILE D 1 28  ? -40.480 18.417  40.639  1.00 109.76 ? 28   ILE D N   1 
ATOM   7448  C CA  . ILE D 1 28  ? -39.411 18.430  39.639  1.00 107.21 ? 28   ILE D CA  1 
ATOM   7449  C C   . ILE D 1 28  ? -38.278 19.341  40.117  1.00 107.30 ? 28   ILE D C   1 
ATOM   7450  O O   . ILE D 1 28  ? -38.509 20.529  40.355  1.00 107.99 ? 28   ILE D O   1 
ATOM   7451  C CB  . ILE D 1 28  ? -39.952 18.858  38.257  1.00 113.44 ? 28   ILE D CB  1 
ATOM   7452  N N   . ILE D 1 29  ? -37.066 18.773  40.299  1.00 99.59  ? 29   ILE D N   1 
ATOM   7453  C CA  . ILE D 1 29  ? -35.907 19.537  40.776  1.00 96.50  ? 29   ILE D CA  1 
ATOM   7454  C C   . ILE D 1 29  ? -34.893 19.733  39.635  1.00 99.07  ? 29   ILE D C   1 
ATOM   7455  O O   . ILE D 1 29  ? -34.752 18.852  38.786  1.00 98.57  ? 29   ILE D O   1 
ATOM   7456  C CB  . ILE D 1 29  ? -35.264 18.903  42.043  1.00 96.36  ? 29   ILE D CB  1 
ATOM   7457  C CG1 . ILE D 1 29  ? -34.805 17.437  41.811  1.00 94.75  ? 29   ILE D CG1 1 
ATOM   7458  C CG2 . ILE D 1 29  ? -36.213 19.018  43.246  1.00 98.11  ? 29   ILE D CG2 1 
ATOM   7459  C CD1 . ILE D 1 29  ? -33.925 16.843  42.910  1.00 96.71  ? 29   ILE D CD1 1 
ATOM   7460  N N   . THR D 1 30  ? -34.226 20.903  39.603  1.00 94.96  ? 30   THR D N   1 
ATOM   7461  C CA  . THR D 1 30  ? -33.238 21.260  38.579  1.00 93.81  ? 30   THR D CA  1 
ATOM   7462  C C   . THR D 1 30  ? -31.865 21.465  39.236  1.00 93.75  ? 30   THR D C   1 
ATOM   7463  O O   . THR D 1 30  ? -31.758 22.176  40.237  1.00 92.64  ? 30   THR D O   1 
ATOM   7464  C CB  . THR D 1 30  ? -33.705 22.497  37.793  1.00 103.95 ? 30   THR D CB  1 
ATOM   7465  N N   . ASP D 1 31  ? -30.823 20.824  38.683  1.00 88.06  ? 31   ASP D N   1 
ATOM   7466  C CA  . ASP D 1 31  ? -29.467 20.905  39.228  1.00 84.72  ? 31   ASP D CA  1 
ATOM   7467  C C   . ASP D 1 31  ? -28.687 22.119  38.660  1.00 90.15  ? 31   ASP D C   1 
ATOM   7468  O O   . ASP D 1 31  ? -29.250 22.896  37.884  1.00 92.29  ? 31   ASP D O   1 
ATOM   7469  C CB  . ASP D 1 31  ? -28.701 19.576  39.000  1.00 83.58  ? 31   ASP D CB  1 
ATOM   7470  C CG  . ASP D 1 31  ? -28.448 19.129  37.568  1.00 89.68  ? 31   ASP D CG  1 
ATOM   7471  O OD1 . ASP D 1 31  ? -28.327 19.998  36.681  1.00 90.26  ? 31   ASP D OD1 1 
ATOM   7472  O OD2 . ASP D 1 31  ? -28.279 17.915  37.352  1.00 94.89  ? 31   ASP D OD2 1 
ATOM   7473  N N   . MET D 1 32  ? -27.395 22.269  39.053  1.00 85.04  ? 32   MET D N   1 
ATOM   7474  C CA  . MET D 1 32  ? -26.479 23.342  38.625  1.00 85.04  ? 32   MET D CA  1 
ATOM   7475  C C   . MET D 1 32  ? -26.250 23.367  37.110  1.00 90.61  ? 32   MET D C   1 
ATOM   7476  O O   . MET D 1 32  ? -26.005 24.438  36.554  1.00 91.82  ? 32   MET D O   1 
ATOM   7477  C CB  . MET D 1 32  ? -25.120 23.211  39.307  1.00 84.27  ? 32   MET D CB  1 
ATOM   7478  C CG  . MET D 1 32  ? -25.144 23.452  40.776  1.00 87.33  ? 32   MET D CG  1 
ATOM   7479  S SD  . MET D 1 32  ? -23.588 22.874  41.471  1.00 88.45  ? 32   MET D SD  1 
ATOM   7480  C CE  . MET D 1 32  ? -22.591 24.250  41.160  1.00 85.41  ? 32   MET D CE  1 
ATOM   7481  N N   . ALA D 1 33  ? -26.315 22.192  36.447  1.00 86.64  ? 33   ALA D N   1 
ATOM   7482  C CA  . ALA D 1 33  ? -26.137 22.035  34.998  1.00 87.35  ? 33   ALA D CA  1 
ATOM   7483  C C   . ALA D 1 33  ? -27.466 22.205  34.234  1.00 94.67  ? 33   ALA D C   1 
ATOM   7484  O O   . ALA D 1 33  ? -27.517 21.946  33.028  1.00 95.72  ? 33   ALA D O   1 
ATOM   7485  C CB  . ALA D 1 33  ? -25.536 20.670  34.701  1.00 86.05  ? 33   ALA D CB  1 
ATOM   7486  N N   . ALA D 1 34  ? -28.532 22.652  34.941  1.00 92.84  ? 34   ALA D N   1 
ATOM   7487  C CA  . ALA D 1 34  ? -29.902 22.889  34.456  1.00 96.19  ? 34   ALA D CA  1 
ATOM   7488  C C   . ALA D 1 34  ? -30.612 21.586  34.005  1.00 100.34 ? 34   ALA D C   1 
ATOM   7489  O O   . ALA D 1 34  ? -31.615 21.648  33.290  1.00 102.56 ? 34   ALA D O   1 
ATOM   7490  C CB  . ALA D 1 34  ? -29.914 23.932  33.338  1.00 99.40  ? 34   ALA D CB  1 
ATOM   7491  N N   . ALA D 1 35  ? -30.125 20.417  34.477  1.00 94.51  ? 35   ALA D N   1 
ATOM   7492  C CA  . ALA D 1 35  ? -30.730 19.113  34.193  1.00 94.73  ? 35   ALA D CA  1 
ATOM   7493  C C   . ALA D 1 35  ? -31.912 18.886  35.134  1.00 99.38  ? 35   ALA D C   1 
ATOM   7494  O O   . ALA D 1 35  ? -31.787 19.093  36.343  1.00 96.99  ? 35   ALA D O   1 
ATOM   7495  C CB  . ALA D 1 35  ? -29.701 17.997  34.340  1.00 92.38  ? 35   ALA D CB  1 
ATOM   7496  N N   . ALA D 1 36  ? -33.066 18.498  34.574  1.00 99.52  ? 36   ALA D N   1 
ATOM   7497  C CA  . ALA D 1 36  ? -34.290 18.265  35.339  1.00 101.26 ? 36   ALA D CA  1 
ATOM   7498  C C   . ALA D 1 36  ? -34.391 16.816  35.831  1.00 104.83 ? 36   ALA D C   1 
ATOM   7499  O O   . ALA D 1 36  ? -34.098 15.872  35.090  1.00 104.61 ? 36   ALA D O   1 
ATOM   7500  C CB  . ALA D 1 36  ? -35.502 18.624  34.502  1.00 105.94 ? 36   ALA D CB  1 
ATOM   7501  N N   . TRP D 1 37  ? -34.790 16.656  37.098  1.00 100.83 ? 37   TRP D N   1 
ATOM   7502  C CA  . TRP D 1 37  ? -34.948 15.362  37.760  1.00 99.44  ? 37   TRP D CA  1 
ATOM   7503  C C   . TRP D 1 37  ? -36.301 15.272  38.433  1.00 105.57 ? 37   TRP D C   1 
ATOM   7504  O O   . TRP D 1 37  ? -36.786 16.270  38.971  1.00 106.07 ? 37   TRP D O   1 
ATOM   7505  C CB  . TRP D 1 37  ? -33.844 15.139  38.809  1.00 94.44  ? 37   TRP D CB  1 
ATOM   7506  C CG  . TRP D 1 37  ? -32.447 15.217  38.271  1.00 93.10  ? 37   TRP D CG  1 
ATOM   7507  C CD1 . TRP D 1 37  ? -31.650 16.322  38.221  1.00 95.18  ? 37   TRP D CD1 1 
ATOM   7508  C CD2 . TRP D 1 37  ? -31.670 14.137  37.739  1.00 91.26  ? 37   TRP D CD2 1 
ATOM   7509  N NE1 . TRP D 1 37  ? -30.428 16.000  37.678  1.00 92.52  ? 37   TRP D NE1 1 
ATOM   7510  C CE2 . TRP D 1 37  ? -30.411 14.664  37.376  1.00 93.35  ? 37   TRP D CE2 1 
ATOM   7511  C CE3 . TRP D 1 37  ? -31.913 12.770  37.532  1.00 92.44  ? 37   TRP D CE3 1 
ATOM   7512  C CZ2 . TRP D 1 37  ? -29.398 13.872  36.819  1.00 90.77  ? 37   TRP D CZ2 1 
ATOM   7513  C CZ3 . TRP D 1 37  ? -30.912 11.991  36.969  1.00 92.07  ? 37   TRP D CZ3 1 
ATOM   7514  C CH2 . TRP D 1 37  ? -29.672 12.542  36.620  1.00 90.90  ? 37   TRP D CH2 1 
ATOM   7515  N N   . LYS D 1 38  ? -36.898 14.070  38.422  1.00 103.25 ? 38   LYS D N   1 
ATOM   7516  C CA  . LYS D 1 38  ? -38.179 13.811  39.072  1.00 105.61 ? 38   LYS D CA  1 
ATOM   7517  C C   . LYS D 1 38  ? -37.943 12.976  40.323  1.00 107.80 ? 38   LYS D C   1 
ATOM   7518  O O   . LYS D 1 38  ? -37.226 11.970  40.276  1.00 105.36 ? 38   LYS D O   1 
ATOM   7519  C CB  . LYS D 1 38  ? -39.166 13.125  38.121  1.00 111.14 ? 38   LYS D CB  1 
ATOM   7520  N N   . VAL D 1 39  ? -38.523 13.422  41.447  1.00 105.22 ? 39   VAL D N   1 
ATOM   7521  C CA  . VAL D 1 39  ? -38.391 12.787  42.758  1.00 103.38 ? 39   VAL D CA  1 
ATOM   7522  C C   . VAL D 1 39  ? -39.479 11.705  42.912  1.00 110.18 ? 39   VAL D C   1 
ATOM   7523  O O   . VAL D 1 39  ? -40.634 11.922  42.535  1.00 113.39 ? 39   VAL D O   1 
ATOM   7524  C CB  . VAL D 1 39  ? -38.439 13.854  43.896  1.00 106.92 ? 39   VAL D CB  1 
ATOM   7525  C CG1 . VAL D 1 39  ? -38.251 13.226  45.272  1.00 104.72 ? 39   VAL D CG1 1 
ATOM   7526  C CG2 . VAL D 1 39  ? -37.397 14.953  43.673  1.00 105.14 ? 39   VAL D CG2 1 
ATOM   7527  N N   . GLY D 1 40  ? -39.076 10.552  43.440  1.00 104.88 ? 40   GLY D N   1 
ATOM   7528  C CA  . GLY D 1 40  ? -39.949 9.414   43.702  1.00 106.07 ? 40   GLY D CA  1 
ATOM   7529  C C   . GLY D 1 40  ? -40.225 9.224   45.179  1.00 108.97 ? 40   GLY D C   1 
ATOM   7530  O O   . GLY D 1 40  ? -40.282 10.201  45.933  1.00 108.66 ? 40   GLY D O   1 
ATOM   7531  N N   . LEU D 1 41  ? -40.386 7.958   45.602  1.00 104.44 ? 41   LEU D N   1 
ATOM   7532  C CA  . LEU D 1 41  ? -40.692 7.586   46.986  1.00 103.49 ? 41   LEU D CA  1 
ATOM   7533  C C   . LEU D 1 41  ? -39.479 7.686   47.926  1.00 102.79 ? 41   LEU D C   1 
ATOM   7534  O O   . LEU D 1 41  ? -38.361 7.364   47.511  1.00 99.56  ? 41   LEU D O   1 
ATOM   7535  C CB  . LEU D 1 41  ? -41.240 6.154   47.035  1.00 104.51 ? 41   LEU D CB  1 
ATOM   7536  N N   . PRO D 1 42  ? -39.695 8.069   49.215  1.00 98.79  ? 42   PRO D N   1 
ATOM   7537  C CA  . PRO D 1 42  ? -38.573 8.089   50.173  1.00 95.20  ? 42   PRO D CA  1 
ATOM   7538  C C   . PRO D 1 42  ? -38.127 6.670   50.512  1.00 96.60  ? 42   PRO D C   1 
ATOM   7539  O O   . PRO D 1 42  ? -38.973 5.775   50.645  1.00 98.37  ? 42   PRO D O   1 
ATOM   7540  C CB  . PRO D 1 42  ? -39.149 8.805   51.407  1.00 98.01  ? 42   PRO D CB  1 
ATOM   7541  C CG  . PRO D 1 42  ? -40.506 9.297   51.010  1.00 106.15 ? 42   PRO D CG  1 
ATOM   7542  C CD  . PRO D 1 42  ? -40.960 8.451   49.872  1.00 103.06 ? 42   PRO D CD  1 
ATOM   7543  N N   . ILE D 1 43  ? -36.803 6.458   50.613  1.00 88.73  ? 43   ILE D N   1 
ATOM   7544  C CA  . ILE D 1 43  ? -36.221 5.142   50.906  1.00 86.16  ? 43   ILE D CA  1 
ATOM   7545  C C   . ILE D 1 43  ? -35.181 5.219   52.040  1.00 85.38  ? 43   ILE D C   1 
ATOM   7546  O O   . ILE D 1 43  ? -34.560 6.253   52.268  1.00 82.98  ? 43   ILE D O   1 
ATOM   7547  C CB  . ILE D 1 43  ? -35.630 4.460   49.636  1.00 88.46  ? 43   ILE D CB  1 
ATOM   7548  C CG1 . ILE D 1 43  ? -34.663 5.387   48.848  1.00 87.05  ? 43   ILE D CG1 1 
ATOM   7549  C CG2 . ILE D 1 43  ? -36.757 3.919   48.734  1.00 92.12  ? 43   ILE D CG2 1 
ATOM   7550  C CD1 . ILE D 1 43  ? -33.663 4.674   47.990  1.00 90.44  ? 43   ILE D CD1 1 
ATOM   7551  N N   . CYS D 1 50  ? -32.949 13.247  54.184  1.00 78.68  ? 50   CYS D N   1 
ATOM   7552  C CA  . CYS D 1 50  ? -33.859 12.261  53.608  1.00 80.18  ? 50   CYS D CA  1 
ATOM   7553  C C   . CYS D 1 50  ? -33.425 11.867  52.182  1.00 84.11  ? 50   CYS D C   1 
ATOM   7554  O O   . CYS D 1 50  ? -33.142 12.740  51.359  1.00 83.79  ? 50   CYS D O   1 
ATOM   7555  C CB  . CYS D 1 50  ? -35.298 12.774  53.628  1.00 83.67  ? 50   CYS D CB  1 
ATOM   7556  N N   . ILE D 1 51  ? -33.388 10.548  51.901  1.00 80.56  ? 51   ILE D N   1 
ATOM   7557  C CA  . ILE D 1 51  ? -33.028 9.971   50.599  1.00 80.08  ? 51   ILE D CA  1 
ATOM   7558  C C   . ILE D 1 51  ? -34.305 9.452   49.915  1.00 88.32  ? 51   ILE D C   1 
ATOM   7559  O O   . ILE D 1 51  ? -35.055 8.677   50.511  1.00 89.53  ? 51   ILE D O   1 
ATOM   7560  C CB  . ILE D 1 51  ? -31.943 8.859   50.750  1.00 80.30  ? 51   ILE D CB  1 
ATOM   7561  C CG1 . ILE D 1 51  ? -30.621 9.442   51.292  1.00 77.97  ? 51   ILE D CG1 1 
ATOM   7562  C CG2 . ILE D 1 51  ? -31.706 8.101   49.429  1.00 80.79  ? 51   ILE D CG2 1 
ATOM   7563  C CD1 . ILE D 1 51  ? -29.919 8.569   52.292  1.00 82.24  ? 51   ILE D CD1 1 
ATOM   7564  N N   . TYR D 1 52  ? -34.538 9.887   48.666  1.00 86.55  ? 52   TYR D N   1 
ATOM   7565  C CA  . TYR D 1 52  ? -35.681 9.506   47.830  1.00 89.15  ? 52   TYR D CA  1 
ATOM   7566  C C   . TYR D 1 52  ? -35.207 8.834   46.557  1.00 91.90  ? 52   TYR D C   1 
ATOM   7567  O O   . TYR D 1 52  ? -34.076 9.077   46.136  1.00 89.59  ? 52   TYR D O   1 
ATOM   7568  C CB  . TYR D 1 52  ? -36.507 10.748  47.429  1.00 93.27  ? 52   TYR D CB  1 
ATOM   7569  C CG  . TYR D 1 52  ? -36.968 11.647  48.552  1.00 96.61  ? 52   TYR D CG  1 
ATOM   7570  C CD1 . TYR D 1 52  ? -38.170 11.413  49.207  1.00 101.05 ? 52   TYR D CD1 1 
ATOM   7571  C CD2 . TYR D 1 52  ? -36.264 12.802  48.879  1.00 96.55  ? 52   TYR D CD2 1 
ATOM   7572  C CE1 . TYR D 1 52  ? -38.610 12.246  50.234  1.00 103.28 ? 52   TYR D CE1 1 
ATOM   7573  C CE2 . TYR D 1 52  ? -36.695 13.646  49.902  1.00 98.67  ? 52   TYR D CE2 1 
ATOM   7574  C CZ  . TYR D 1 52  ? -37.871 13.363  50.577  1.00 109.18 ? 52   TYR D CZ  1 
ATOM   7575  O OH  . TYR D 1 52  ? -38.312 14.192  51.578  1.00 112.69 ? 52   TYR D OH  1 
ATOM   7576  N N   . LEU D 1 53  ? -36.085 8.057   45.897  1.00 90.06  ? 53   LEU D N   1 
ATOM   7577  C CA  . LEU D 1 53  ? -35.778 7.483   44.587  1.00 89.69  ? 53   LEU D CA  1 
ATOM   7578  C C   . LEU D 1 53  ? -35.857 8.616   43.570  1.00 94.60  ? 53   LEU D C   1 
ATOM   7579  O O   . LEU D 1 53  ? -36.600 9.575   43.791  1.00 95.75  ? 53   LEU D O   1 
ATOM   7580  C CB  . LEU D 1 53  ? -36.740 6.343   44.229  1.00 91.82  ? 53   LEU D CB  1 
ATOM   7581  N N   . ALA D 1 54  ? -35.056 8.556   42.503  1.00 90.68  ? 54   ALA D N   1 
ATOM   7582  C CA  . ALA D 1 54  ? -35.048 9.615   41.497  1.00 92.16  ? 54   ALA D CA  1 
ATOM   7583  C C   . ALA D 1 54  ? -34.734 9.075   40.108  1.00 98.01  ? 54   ALA D C   1 
ATOM   7584  O O   . ALA D 1 54  ? -34.197 7.975   39.967  1.00 96.64  ? 54   ALA D O   1 
ATOM   7585  C CB  . ALA D 1 54  ? -34.036 10.695  41.875  1.00 90.73  ? 54   ALA D CB  1 
ATOM   7586  N N   . ASP D 1 55  ? -35.075 9.871   39.085  1.00 97.56  ? 55   ASP D N   1 
ATOM   7587  C CA  . ASP D 1 55  ? -34.828 9.593   37.669  1.00 98.92  ? 55   ASP D CA  1 
ATOM   7588  C C   . ASP D 1 55  ? -34.938 10.890  36.873  1.00 106.04 ? 55   ASP D C   1 
ATOM   7589  O O   . ASP D 1 55  ? -35.352 11.918  37.419  1.00 106.27 ? 55   ASP D O   1 
ATOM   7590  C CB  . ASP D 1 55  ? -35.827 8.546   37.128  1.00 103.16 ? 55   ASP D CB  1 
ATOM   7591  C CG  . ASP D 1 55  ? -35.386 7.752   35.902  1.00 112.45 ? 55   ASP D CG  1 
ATOM   7592  O OD1 . ASP D 1 55  ? -35.783 6.584   35.788  1.00 113.83 ? 55   ASP D OD1 1 
ATOM   7593  O OD2 . ASP D 1 55  ? -34.658 8.311   35.044  1.00 117.08 ? 55   ASP D OD2 1 
ATOM   7594  N N   . MET D 1 56  ? -34.557 10.843  35.583  1.00 104.62 ? 56   MET D N   1 
ATOM   7595  C CA  . MET D 1 56  ? -34.673 11.962  34.648  1.00 106.90 ? 56   MET D CA  1 
ATOM   7596  C C   . MET D 1 56  ? -36.141 12.336  34.524  1.00 115.44 ? 56   MET D C   1 
ATOM   7597  O O   . MET D 1 56  ? -37.002 11.450  34.565  1.00 116.72 ? 56   MET D O   1 
ATOM   7598  C CB  . MET D 1 56  ? -34.101 11.592  33.267  1.00 109.70 ? 56   MET D CB  1 
ATOM   7599  C CG  . MET D 1 56  ? -32.590 11.517  33.217  1.00 110.39 ? 56   MET D CG  1 
ATOM   7600  S SD  . MET D 1 56  ? -31.794 13.144  33.184  1.00 113.96 ? 56   MET D SD  1 
ATOM   7601  C CE  . MET D 1 56  ? -30.084 12.661  32.960  1.00 107.28 ? 56   MET D CE  1 
ATOM   7602  N N   . ASN D 1 57  ? -36.425 13.639  34.396  1.00 113.94 ? 57   ASN D N   1 
ATOM   7603  C CA  . ASN D 1 57  ? -37.779 14.180  34.285  1.00 117.62 ? 57   ASN D CA  1 
ATOM   7604  C C   . ASN D 1 57  ? -38.508 13.647  33.047  1.00 124.70 ? 57   ASN D C   1 
ATOM   7605  O O   . ASN D 1 57  ? -37.968 13.689  31.941  1.00 124.61 ? 57   ASN D O   1 
ATOM   7606  C CB  . ASN D 1 57  ? -37.734 15.699  34.265  1.00 119.69 ? 57   ASN D CB  1 
ATOM   7607  N N   . SER D 1 58  ? -39.722 13.104  33.259  1.00 123.57 ? 58   SER D N   1 
ATOM   7608  C CA  . SER D 1 58  ? -40.583 12.537  32.221  1.00 126.64 ? 58   SER D CA  1 
ATOM   7609  C C   . SER D 1 58  ? -42.047 12.614  32.647  1.00 134.01 ? 58   SER D C   1 
ATOM   7610  O O   . SER D 1 58  ? -42.849 13.243  31.964  1.00 137.11 ? 58   SER D O   1 
ATOM   7611  C CB  . SER D 1 58  ? -40.192 11.093  31.918  1.00 128.92 ? 58   SER D CB  1 
ATOM   7612  O OG  . SER D 1 58  ? -40.460 10.229  33.011  1.00 137.13 ? 58   SER D OG  1 
ATOM   7613  N N   . SER D 1 64  ? -40.082 1.762   41.066  1.00 106.30 ? 64   SER D N   1 
ATOM   7614  C CA  . SER D 1 64  ? -39.325 0.937   42.006  1.00 103.57 ? 64   SER D CA  1 
ATOM   7615  C C   . SER D 1 64  ? -37.952 0.551   41.434  1.00 104.92 ? 64   SER D C   1 
ATOM   7616  O O   . SER D 1 64  ? -37.029 0.250   42.199  1.00 101.58 ? 64   SER D O   1 
ATOM   7617  C CB  . SER D 1 64  ? -40.114 -0.318  42.371  1.00 108.87 ? 64   SER D CB  1 
ATOM   7618  N N   . ASP D 1 65  ? -37.829 0.569   40.090  1.00 102.72 ? 65   ASP D N   1 
ATOM   7619  C CA  . ASP D 1 65  ? -36.610 0.240   39.349  1.00 100.66 ? 65   ASP D CA  1 
ATOM   7620  C C   . ASP D 1 65  ? -35.779 1.512   39.010  1.00 102.83 ? 65   ASP D C   1 
ATOM   7621  O O   . ASP D 1 65  ? -34.919 1.460   38.123  1.00 101.76 ? 65   ASP D O   1 
ATOM   7622  C CB  . ASP D 1 65  ? -36.984 -0.521  38.064  1.00 104.82 ? 65   ASP D CB  1 
ATOM   7623  N N   . ALA D 1 66  ? -36.016 2.632   39.746  1.00 98.34  ? 66   ALA D N   1 
ATOM   7624  C CA  . ALA D 1 66  ? -35.343 3.932   39.571  1.00 96.17  ? 66   ALA D CA  1 
ATOM   7625  C C   . ALA D 1 66  ? -33.812 3.788   39.573  1.00 95.36  ? 66   ALA D C   1 
ATOM   7626  O O   . ALA D 1 66  ? -33.286 3.089   40.435  1.00 93.34  ? 66   ALA D O   1 
ATOM   7627  C CB  . ALA D 1 66  ? -35.778 4.910   40.656  1.00 96.75  ? 66   ALA D CB  1 
ATOM   7628  N N   . PRO D 1 67  ? -33.087 4.389   38.597  1.00 89.73  ? 67   PRO D N   1 
ATOM   7629  C CA  . PRO D 1 67  ? -31.620 4.218   38.557  1.00 85.60  ? 67   PRO D CA  1 
ATOM   7630  C C   . PRO D 1 67  ? -30.850 5.203   39.442  1.00 83.92  ? 67   PRO D C   1 
ATOM   7631  O O   . PRO D 1 67  ? -29.642 5.025   39.632  1.00 80.38  ? 67   PRO D O   1 
ATOM   7632  C CB  . PRO D 1 67  ? -31.292 4.451   37.080  1.00 88.52  ? 67   PRO D CB  1 
ATOM   7633  C CG  . PRO D 1 67  ? -32.366 5.375   36.586  1.00 96.11  ? 67   PRO D CG  1 
ATOM   7634  C CD  . PRO D 1 67  ? -33.570 5.213   37.467  1.00 93.32  ? 67   PRO D CD  1 
ATOM   7635  N N   . CYS D 1 68  ? -31.538 6.230   39.979  1.00 79.58  ? 68   CYS D N   1 
ATOM   7636  C CA  . CYS D 1 68  ? -30.919 7.265   40.803  1.00 76.70  ? 68   CYS D CA  1 
ATOM   7637  C C   . CYS D 1 68  ? -31.613 7.424   42.147  1.00 77.52  ? 68   CYS D C   1 
ATOM   7638  O O   . CYS D 1 68  ? -32.718 6.920   42.360  1.00 78.67  ? 68   CYS D O   1 
ATOM   7639  C CB  . CYS D 1 68  ? -30.894 8.596   40.054  1.00 78.07  ? 68   CYS D CB  1 
ATOM   7640  S SG  . CYS D 1 68  ? -29.785 8.625   38.623  1.00 81.32  ? 68   CYS D SG  1 
ATOM   7641  N N   . VAL D 1 69  ? -30.959 8.178   43.037  1.00 70.15  ? 69   VAL D N   1 
ATOM   7642  C CA  . VAL D 1 69  ? -31.455 8.554   44.356  1.00 69.58  ? 69   VAL D CA  1 
ATOM   7643  C C   . VAL D 1 69  ? -31.124 10.032  44.583  1.00 72.91  ? 69   VAL D C   1 
ATOM   7644  O O   . VAL D 1 69  ? -30.098 10.511  44.089  1.00 70.79  ? 69   VAL D O   1 
ATOM   7645  C CB  . VAL D 1 69  ? -30.950 7.660   45.530  1.00 71.14  ? 69   VAL D CB  1 
ATOM   7646  C CG1 . VAL D 1 69  ? -31.457 6.228   45.408  1.00 71.61  ? 69   VAL D CG1 1 
ATOM   7647  C CG2 . VAL D 1 69  ? -29.429 7.697   45.678  1.00 67.98  ? 69   VAL D CG2 1 
ATOM   7648  N N   . VAL D 1 70  ? -31.981 10.755  45.317  1.00 70.92  ? 70   VAL D N   1 
ATOM   7649  C CA  . VAL D 1 70  ? -31.699 12.155  45.622  1.00 70.62  ? 70   VAL D CA  1 
ATOM   7650  C C   . VAL D 1 70  ? -31.482 12.308  47.142  1.00 74.14  ? 70   VAL D C   1 
ATOM   7651  O O   . VAL D 1 70  ? -32.398 12.066  47.938  1.00 75.32  ? 70   VAL D O   1 
ATOM   7652  C CB  . VAL D 1 70  ? -32.717 13.182  45.043  1.00 76.94  ? 70   VAL D CB  1 
ATOM   7653  C CG1 . VAL D 1 70  ? -34.160 12.859  45.423  1.00 79.22  ? 70   VAL D CG1 1 
ATOM   7654  C CG2 . VAL D 1 70  ? -32.351 14.609  45.440  1.00 76.40  ? 70   VAL D CG2 1 
ATOM   7655  N N   . LYS D 1 71  ? -30.251 12.680  47.527  1.00 68.46  ? 71   LYS D N   1 
ATOM   7656  C CA  . LYS D 1 71  ? -29.895 12.930  48.920  1.00 67.53  ? 71   LYS D CA  1 
ATOM   7657  C C   . LYS D 1 71  ? -30.172 14.405  49.200  1.00 74.89  ? 71   LYS D C   1 
ATOM   7658  O O   . LYS D 1 71  ? -29.663 15.262  48.480  1.00 74.07  ? 71   LYS D O   1 
ATOM   7659  C CB  . LYS D 1 71  ? -28.432 12.548  49.199  1.00 66.61  ? 71   LYS D CB  1 
ATOM   7660  N N   . VAL D 1 72  ? -31.058 14.696  50.175  1.00 75.11  ? 72   VAL D N   1 
ATOM   7661  C CA  . VAL D 1 72  ? -31.464 16.067  50.519  1.00 77.41  ? 72   VAL D CA  1 
ATOM   7662  C C   . VAL D 1 72  ? -31.150 16.362  51.999  1.00 83.01  ? 72   VAL D C   1 
ATOM   7663  O O   . VAL D 1 72  ? -31.343 15.505  52.864  1.00 82.53  ? 72   VAL D O   1 
ATOM   7664  C CB  . VAL D 1 72  ? -32.958 16.372  50.197  1.00 84.43  ? 72   VAL D CB  1 
ATOM   7665  C CG1 . VAL D 1 72  ? -33.207 17.877  50.124  1.00 86.06  ? 72   VAL D CG1 1 
ATOM   7666  C CG2 . VAL D 1 72  ? -33.409 15.705  48.898  1.00 85.28  ? 72   VAL D CG2 1 
ATOM   7667  N N   . GLU D 1 73  ? -30.666 17.588  52.265  1.00 80.95  ? 73   GLU D N   1 
ATOM   7668  C CA  . GLU D 1 73  ? -30.303 18.126  53.579  1.00 81.20  ? 73   GLU D CA  1 
ATOM   7669  C C   . GLU D 1 73  ? -30.312 19.674  53.511  1.00 89.38  ? 73   GLU D C   1 
ATOM   7670  O O   . GLU D 1 73  ? -30.104 20.196  52.414  1.00 90.20  ? 73   GLU D O   1 
ATOM   7671  C CB  . GLU D 1 73  ? -28.921 17.593  54.014  1.00 79.44  ? 73   GLU D CB  1 
ATOM   7672  N N   . PRO D 1 74  ? -30.550 20.442  54.616  1.00 88.01  ? 74   PRO D N   1 
ATOM   7673  C CA  . PRO D 1 74  ? -30.534 21.918  54.499  1.00 89.56  ? 74   PRO D CA  1 
ATOM   7674  C C   . PRO D 1 74  ? -29.134 22.485  54.215  1.00 91.76  ? 74   PRO D C   1 
ATOM   7675  O O   . PRO D 1 74  ? -28.122 21.839  54.512  1.00 88.82  ? 74   PRO D O   1 
ATOM   7676  C CB  . PRO D 1 74  ? -31.044 22.396  55.864  1.00 92.66  ? 74   PRO D CB  1 
ATOM   7677  C CG  . PRO D 1 74  ? -31.603 21.178  56.541  1.00 96.71  ? 74   PRO D CG  1 
ATOM   7678  C CD  . PRO D 1 74  ? -30.833 20.026  56.004  1.00 89.55  ? 74   PRO D CD  1 
ATOM   7679  N N   . SER D 1 75  ? -29.100 23.680  53.625  1.00 89.49  ? 75   SER D N   1 
ATOM   7680  C CA  . SER D 1 75  ? -27.866 24.373  53.276  1.00 87.77  ? 75   SER D CA  1 
ATOM   7681  C C   . SER D 1 75  ? -28.111 25.724  52.642  1.00 93.41  ? 75   SER D C   1 
ATOM   7682  O O   . SER D 1 75  ? -28.227 25.827  51.421  1.00 93.54  ? 75   SER D O   1 
ATOM   7683  N N   . PRO D 1 79  ? -21.963 18.296  56.589  1.00 78.78  ? 79   PRO D N   1 
ATOM   7684  C CA  . PRO D 1 79  ? -21.726 16.913  56.145  1.00 77.16  ? 79   PRO D CA  1 
ATOM   7685  C C   . PRO D 1 79  ? -21.926 16.753  54.634  1.00 81.31  ? 79   PRO D C   1 
ATOM   7686  O O   . PRO D 1 79  ? -21.045 16.217  53.958  1.00 79.74  ? 79   PRO D O   1 
ATOM   7687  C CB  . PRO D 1 79  ? -22.730 16.089  56.957  1.00 79.63  ? 79   PRO D CB  1 
ATOM   7688  C CG  . PRO D 1 79  ? -23.792 17.057  57.375  1.00 86.40  ? 79   PRO D CG  1 
ATOM   7689  C CD  . PRO D 1 79  ? -23.244 18.454  57.305  1.00 82.24  ? 79   PRO D CD  1 
ATOM   7690  N N   . LEU D 1 80  ? -23.062 17.250  54.105  1.00 79.07  ? 80   LEU D N   1 
ATOM   7691  C CA  . LEU D 1 80  ? -23.426 17.206  52.686  1.00 79.22  ? 80   LEU D CA  1 
ATOM   7692  C C   . LEU D 1 80  ? -22.459 18.040  51.835  1.00 81.88  ? 80   LEU D C   1 
ATOM   7693  O O   . LEU D 1 80  ? -22.180 17.652  50.700  1.00 81.38  ? 80   LEU D O   1 
ATOM   7694  C CB  . LEU D 1 80  ? -24.874 17.677  52.472  1.00 81.76  ? 80   LEU D CB  1 
ATOM   7695  C CG  . LEU D 1 80  ? -25.549 17.207  51.183  1.00 87.01  ? 80   LEU D CG  1 
ATOM   7696  C CD1 . LEU D 1 80  ? -26.007 15.761  51.294  1.00 86.69  ? 80   LEU D CD1 1 
ATOM   7697  C CD2 . LEU D 1 80  ? -26.744 18.045  50.885  1.00 91.54  ? 80   LEU D CD2 1 
ATOM   7698  N N   . PHE D 1 81  ? -21.926 19.155  52.392  1.00 77.58  ? 81   PHE D N   1 
ATOM   7699  C CA  . PHE D 1 81  ? -20.942 20.012  51.722  1.00 76.42  ? 81   PHE D CA  1 
ATOM   7700  C C   . PHE D 1 81  ? -19.612 19.259  51.560  1.00 76.54  ? 81   PHE D C   1 
ATOM   7701  O O   . PHE D 1 81  ? -18.994 19.348  50.496  1.00 75.42  ? 81   PHE D O   1 
ATOM   7702  C CB  . PHE D 1 81  ? -20.736 21.327  52.491  1.00 78.97  ? 81   PHE D CB  1 
ATOM   7703  N N   . THR D 1 82  ? -19.187 18.512  52.615  1.00 70.96  ? 82   THR D N   1 
ATOM   7704  C CA  . THR D 1 82  ? -17.965 17.696  52.624  1.00 68.08  ? 82   THR D CA  1 
ATOM   7705  C C   . THR D 1 82  ? -18.094 16.582  51.573  1.00 68.53  ? 82   THR D C   1 
ATOM   7706  O O   . THR D 1 82  ? -17.155 16.355  50.801  1.00 68.31  ? 82   THR D O   1 
ATOM   7707  C CB  . THR D 1 82  ? -17.710 17.126  54.038  1.00 79.12  ? 82   THR D CB  1 
ATOM   7708  O OG1 . THR D 1 82  ? -17.582 18.203  54.966  1.00 81.81  ? 82   THR D OG1 1 
ATOM   7709  C CG2 . THR D 1 82  ? -16.465 16.225  54.109  1.00 75.76  ? 82   THR D CG2 1 
ATOM   7710  N N   . GLU D 1 83  ? -19.263 15.901  51.552  1.00 62.11  ? 83   GLU D N   1 
ATOM   7711  C CA  . GLU D 1 83  ? -19.568 14.808  50.632  1.00 60.23  ? 83   GLU D CA  1 
ATOM   7712  C C   . GLU D 1 83  ? -19.619 15.303  49.192  1.00 61.55  ? 83   GLU D C   1 
ATOM   7713  O O   . GLU D 1 83  ? -19.062 14.646  48.316  1.00 60.36  ? 83   GLU D O   1 
ATOM   7714  C CB  . GLU D 1 83  ? -20.882 14.128  51.019  1.00 62.65  ? 83   GLU D CB  1 
ATOM   7715  C CG  . GLU D 1 83  ? -21.098 12.808  50.308  1.00 71.49  ? 83   GLU D CG  1 
ATOM   7716  C CD  . GLU D 1 83  ? -22.178 11.927  50.894  1.00 91.50  ? 83   GLU D CD  1 
ATOM   7717  O OE1 . GLU D 1 83  ? -23.284 12.441  51.179  1.00 96.09  ? 83   GLU D OE1 1 
ATOM   7718  O OE2 . GLU D 1 83  ? -21.930 10.710  51.042  1.00 81.87  ? 83   GLU D OE2 1 
ATOM   7719  N N   . LEU D 1 84  ? -20.262 16.465  48.954  1.00 57.51  ? 84   LEU D N   1 
ATOM   7720  C CA  . LEU D 1 84  ? -20.367 17.070  47.631  1.00 57.53  ? 84   LEU D CA  1 
ATOM   7721  C C   . LEU D 1 84  ? -18.978 17.440  47.096  1.00 58.30  ? 84   LEU D C   1 
ATOM   7722  O O   . LEU D 1 84  ? -18.692 17.168  45.929  1.00 57.67  ? 84   LEU D O   1 
ATOM   7723  C CB  . LEU D 1 84  ? -21.302 18.300  47.651  1.00 59.87  ? 84   LEU D CB  1 
ATOM   7724  C CG  . LEU D 1 84  ? -21.565 19.020  46.308  1.00 66.38  ? 84   LEU D CG  1 
ATOM   7725  C CD1 . LEU D 1 84  ? -21.970 18.051  45.216  1.00 66.98  ? 84   LEU D CD1 1 
ATOM   7726  C CD2 . LEU D 1 84  ? -22.607 20.100  46.465  1.00 70.74  ? 84   LEU D CD2 1 
ATOM   7727  N N   . LYS D 1 85  ? -18.113 18.019  47.954  1.00 53.05  ? 85   LYS D N   1 
ATOM   7728  C CA  . LYS D 1 85  ? -16.742 18.396  47.595  1.00 51.20  ? 85   LYS D CA  1 
ATOM   7729  C C   . LYS D 1 85  ? -15.931 17.159  47.187  1.00 52.58  ? 85   LYS D C   1 
ATOM   7730  O O   . LYS D 1 85  ? -15.230 17.228  46.178  1.00 53.75  ? 85   LYS D O   1 
ATOM   7731  C CB  . LYS D 1 85  ? -16.049 19.150  48.740  1.00 52.55  ? 85   LYS D CB  1 
ATOM   7732  N N   . PHE D 1 86  ? -16.070 16.023  47.921  1.00 45.24  ? 86   PHE D N   1 
ATOM   7733  C CA  . PHE D 1 86  ? -15.382 14.768  47.586  1.00 42.58  ? 86   PHE D CA  1 
ATOM   7734  C C   . PHE D 1 86  ? -15.786 14.282  46.193  1.00 47.78  ? 86   PHE D C   1 
ATOM   7735  O O   . PHE D 1 86  ? -14.913 13.970  45.388  1.00 46.83  ? 86   PHE D O   1 
ATOM   7736  C CB  . PHE D 1 86  ? -15.645 13.641  48.626  1.00 42.14  ? 86   PHE D CB  1 
ATOM   7737  C CG  . PHE D 1 86  ? -15.323 12.251  48.090  1.00 41.05  ? 86   PHE D CG  1 
ATOM   7738  C CD1 . PHE D 1 86  ? -14.015 11.780  48.066  1.00 41.46  ? 86   PHE D CD1 1 
ATOM   7739  C CD2 . PHE D 1 86  ? -16.320 11.449  47.543  1.00 41.87  ? 86   PHE D CD2 1 
ATOM   7740  C CE1 . PHE D 1 86  ? -13.712 10.529  47.509  1.00 41.21  ? 86   PHE D CE1 1 
ATOM   7741  C CE2 . PHE D 1 86  ? -16.016 10.202  46.989  1.00 43.83  ? 86   PHE D CE2 1 
ATOM   7742  C CZ  . PHE D 1 86  ? -14.714 9.750   46.976  1.00 40.81  ? 86   PHE D CZ  1 
ATOM   7743  N N   . TYR D 1 87  ? -17.105 14.169  45.948  1.00 46.71  ? 87   TYR D N   1 
ATOM   7744  C CA  . TYR D 1 87  ? -17.676 13.672  44.707  1.00 48.21  ? 87   TYR D CA  1 
ATOM   7745  C C   . TYR D 1 87  ? -17.309 14.567  43.524  1.00 54.58  ? 87   TYR D C   1 
ATOM   7746  O O   . TYR D 1 87  ? -16.974 14.038  42.469  1.00 54.62  ? 87   TYR D O   1 
ATOM   7747  C CB  . TYR D 1 87  ? -19.200 13.485  44.818  1.00 50.59  ? 87   TYR D CB  1 
ATOM   7748  C CG  . TYR D 1 87  ? -19.603 12.168  45.457  1.00 50.64  ? 87   TYR D CG  1 
ATOM   7749  C CD1 . TYR D 1 87  ? -20.218 12.135  46.701  1.00 52.75  ? 87   TYR D CD1 1 
ATOM   7750  C CD2 . TYR D 1 87  ? -19.404 10.956  44.797  1.00 50.46  ? 87   TYR D CD2 1 
ATOM   7751  C CE1 . TYR D 1 87  ? -20.593 10.926  47.293  1.00 53.35  ? 87   TYR D CE1 1 
ATOM   7752  C CE2 . TYR D 1 87  ? -19.776 9.743   45.377  1.00 50.90  ? 87   TYR D CE2 1 
ATOM   7753  C CZ  . TYR D 1 87  ? -20.368 9.731   46.628  1.00 57.31  ? 87   TYR D CZ  1 
ATOM   7754  O OH  . TYR D 1 87  ? -20.740 8.539   47.207  1.00 58.16  ? 87   TYR D OH  1 
ATOM   7755  N N   . GLN D 1 88  ? -17.313 15.899  43.710  1.00 52.73  ? 88   GLN D N   1 
ATOM   7756  C CA  . GLN D 1 88  ? -16.956 16.850  42.655  1.00 54.11  ? 88   GLN D CA  1 
ATOM   7757  C C   . GLN D 1 88  ? -15.477 16.752  42.291  1.00 59.28  ? 88   GLN D C   1 
ATOM   7758  O O   . GLN D 1 88  ? -15.135 16.853  41.112  1.00 60.03  ? 88   GLN D O   1 
ATOM   7759  C CB  . GLN D 1 88  ? -17.291 18.286  43.074  1.00 56.27  ? 88   GLN D CB  1 
ATOM   7760  C CG  . GLN D 1 88  ? -18.765 18.624  42.937  1.00 68.76  ? 88   GLN D CG  1 
ATOM   7761  C CD  . GLN D 1 88  ? -19.062 20.074  43.180  1.00 88.70  ? 88   GLN D CD  1 
ATOM   7762  O OE1 . GLN D 1 88  ? -19.551 20.768  42.296  1.00 87.18  ? 88   GLN D OE1 1 
ATOM   7763  N NE2 . GLN D 1 88  ? -18.807 20.563  44.383  1.00 80.91  ? 88   GLN D NE2 1 
ATOM   7764  N N   . ARG D 1 89  ? -14.607 16.538  43.296  1.00 55.30  ? 89   ARG D N   1 
ATOM   7765  C CA  . ARG D 1 89  ? -13.158 16.471  43.103  1.00 54.32  ? 89   ARG D CA  1 
ATOM   7766  C C   . ARG D 1 89  ? -12.620 15.099  42.682  1.00 57.73  ? 89   ARG D C   1 
ATOM   7767  O O   . ARG D 1 89  ? -11.682 15.053  41.881  1.00 57.28  ? 89   ARG D O   1 
ATOM   7768  C CB  . ARG D 1 89  ? -12.430 16.886  44.377  1.00 54.48  ? 89   ARG D CB  1 
ATOM   7769  C CG  . ARG D 1 89  ? -12.609 18.343  44.751  1.00 71.46  ? 89   ARG D CG  1 
ATOM   7770  C CD  . ARG D 1 89  ? -11.560 18.747  45.760  1.00 86.02  ? 89   ARG D CD  1 
ATOM   7771  N NE  . ARG D 1 89  ? -11.979 19.901  46.552  1.00 98.27  ? 89   ARG D NE  1 
ATOM   7772  C CZ  . ARG D 1 89  ? -11.366 21.082  46.538  1.00 112.21 ? 89   ARG D CZ  1 
ATOM   7773  N NH1 . ARG D 1 89  ? -10.287 21.272  45.783  1.00 95.78  ? 89   ARG D NH1 1 
ATOM   7774  N NH2 . ARG D 1 89  ? -11.817 22.079  47.287  1.00 100.32 ? 89   ARG D NH2 1 
ATOM   7775  N N   . ALA D 1 90  ? -13.171 14.000  43.229  1.00 53.75  ? 90   ALA D N   1 
ATOM   7776  C CA  . ALA D 1 90  ? -12.644 12.655  43.002  1.00 53.06  ? 90   ALA D CA  1 
ATOM   7777  C C   . ALA D 1 90  ? -13.603 11.650  42.347  1.00 60.10  ? 90   ALA D C   1 
ATOM   7778  O O   . ALA D 1 90  ? -13.138 10.578  41.975  1.00 60.32  ? 90   ALA D O   1 
ATOM   7779  C CB  . ALA D 1 90  ? -12.192 12.083  44.336  1.00 52.37  ? 90   ALA D CB  1 
ATOM   7780  N N   . ALA D 1 91  ? -14.906 11.936  42.233  1.00 59.01  ? 91   ALA D N   1 
ATOM   7781  C CA  . ALA D 1 91  ? -15.817 10.928  41.684  1.00 60.41  ? 91   ALA D CA  1 
ATOM   7782  C C   . ALA D 1 91  ? -16.587 11.375  40.439  1.00 66.29  ? 91   ALA D C   1 
ATOM   7783  O O   . ALA D 1 91  ? -17.744 10.961  40.246  1.00 67.59  ? 91   ALA D O   1 
ATOM   7784  C CB  . ALA D 1 91  ? -16.784 10.464  42.750  1.00 61.44  ? 91   ALA D CB  1 
ATOM   7785  N N   . LYS D 1 92  ? -15.922 12.145  39.555  1.00 62.65  ? 92   LYS D N   1 
ATOM   7786  C CA  . LYS D 1 92  ? -16.518 12.536  38.280  1.00 64.09  ? 92   LYS D CA  1 
ATOM   7787  C C   . LYS D 1 92  ? -16.590 11.277  37.402  1.00 68.10  ? 92   LYS D C   1 
ATOM   7788  O O   . LYS D 1 92  ? -15.634 10.501  37.415  1.00 66.44  ? 92   LYS D O   1 
ATOM   7789  C CB  . LYS D 1 92  ? -15.710 13.654  37.607  1.00 66.77  ? 92   LYS D CB  1 
ATOM   7790  C CG  . LYS D 1 92  ? -15.767 14.985  38.342  1.00 73.42  ? 92   LYS D CG  1 
ATOM   7791  C CD  . LYS D 1 92  ? -14.958 16.074  37.635  1.00 77.05  ? 92   LYS D CD  1 
ATOM   7792  C CE  . LYS D 1 92  ? -13.466 16.011  37.872  1.00 76.23  ? 92   LYS D CE  1 
ATOM   7793  N NZ  . LYS D 1 92  ? -13.102 16.392  39.260  1.00 80.16  ? 92   LYS D NZ  1 
ATOM   7794  N N   . PRO D 1 93  ? -17.710 11.006  36.691  1.00 66.71  ? 93   PRO D N   1 
ATOM   7795  C CA  . PRO D 1 93  ? -17.805 9.761   35.901  1.00 66.80  ? 93   PRO D CA  1 
ATOM   7796  C C   . PRO D 1 93  ? -16.589 9.450   35.017  1.00 67.57  ? 93   PRO D C   1 
ATOM   7797  O O   . PRO D 1 93  ? -16.171 8.294   34.978  1.00 65.73  ? 93   PRO D O   1 
ATOM   7798  C CB  . PRO D 1 93  ? -19.056 9.988   35.050  1.00 71.15  ? 93   PRO D CB  1 
ATOM   7799  C CG  . PRO D 1 93  ? -19.906 10.855  35.898  1.00 76.26  ? 93   PRO D CG  1 
ATOM   7800  C CD  . PRO D 1 93  ? -18.962 11.788  36.601  1.00 70.26  ? 93   PRO D CD  1 
ATOM   7801  N N   . GLU D 1 94  ? -16.001 10.486  34.370  1.00 63.79  ? 94   GLU D N   1 
ATOM   7802  C CA  . GLU D 1 94  ? -14.850 10.405  33.459  1.00 63.01  ? 94   GLU D CA  1 
ATOM   7803  C C   . GLU D 1 94  ? -13.571 10.005  34.187  1.00 63.12  ? 94   GLU D C   1 
ATOM   7804  O O   . GLU D 1 94  ? -12.725 9.295   33.648  1.00 63.29  ? 94   GLU D O   1 
ATOM   7805  C CB  . GLU D 1 94  ? -14.640 11.754  32.753  1.00 65.36  ? 94   GLU D CB  1 
ATOM   7806  N N   . GLN D 1 95  ? -13.439 10.482  35.407  1.00 56.18  ? 95   GLN D N   1 
ATOM   7807  C CA  . GLN D 1 95  ? -12.326 10.253  36.317  1.00 52.68  ? 95   GLN D CA  1 
ATOM   7808  C C   . GLN D 1 95  ? -12.259 8.776   36.753  1.00 53.65  ? 95   GLN D C   1 
ATOM   7809  O O   . GLN D 1 95  ? -11.181 8.172   36.741  1.00 52.42  ? 95   GLN D O   1 
ATOM   7810  C CB  . GLN D 1 95  ? -12.543 11.155  37.521  1.00 52.63  ? 95   GLN D CB  1 
ATOM   7811  C CG  . GLN D 1 95  ? -11.299 11.651  38.199  1.00 51.35  ? 95   GLN D CG  1 
ATOM   7812  C CD  . GLN D 1 95  ? -11.631 12.747  39.188  1.00 68.33  ? 95   GLN D CD  1 
ATOM   7813  O OE1 . GLN D 1 95  ? -12.802 13.065  39.465  1.00 63.40  ? 95   GLN D OE1 1 
ATOM   7814  N NE2 . GLN D 1 95  ? -10.600 13.364  39.735  1.00 62.58  ? 95   GLN D NE2 1 
ATOM   7815  N N   . ILE D 1 96  ? -13.428 8.199   37.096  1.00 48.49  ? 96   ILE D N   1 
ATOM   7816  C CA  . ILE D 1 96  ? -13.594 6.812   37.533  1.00 46.92  ? 96   ILE D CA  1 
ATOM   7817  C C   . ILE D 1 96  ? -13.363 5.848   36.353  1.00 52.47  ? 96   ILE D C   1 
ATOM   7818  O O   . ILE D 1 96  ? -12.633 4.867   36.515  1.00 51.48  ? 96   ILE D O   1 
ATOM   7819  C CB  . ILE D 1 96  ? -14.982 6.618   38.213  1.00 49.94  ? 96   ILE D CB  1 
ATOM   7820  C CG1 . ILE D 1 96  ? -15.002 7.338   39.577  1.00 48.63  ? 96   ILE D CG1 1 
ATOM   7821  C CG2 . ILE D 1 96  ? -15.360 5.127   38.362  1.00 50.76  ? 96   ILE D CG2 1 
ATOM   7822  C CD1 . ILE D 1 96  ? -16.375 7.485   40.248  1.00 56.22  ? 96   ILE D CD1 1 
ATOM   7823  N N   . GLN D 1 97  ? -13.960 6.140   35.173  1.00 51.29  ? 97   GLN D N   1 
ATOM   7824  C CA  . GLN D 1 97  ? -13.836 5.312   33.977  1.00 52.34  ? 97   GLN D CA  1 
ATOM   7825  C C   . GLN D 1 97  ? -12.403 5.246   33.464  1.00 55.82  ? 97   GLN D C   1 
ATOM   7826  O O   . GLN D 1 97  ? -11.983 4.174   33.034  1.00 56.99  ? 97   GLN D O   1 
ATOM   7827  C CB  . GLN D 1 97  ? -14.786 5.778   32.865  1.00 55.94  ? 97   GLN D CB  1 
ATOM   7828  C CG  . GLN D 1 97  ? -16.258 5.374   33.091  1.00 73.57  ? 97   GLN D CG  1 
ATOM   7829  C CD  . GLN D 1 97  ? -16.496 3.899   33.391  1.00 93.00  ? 97   GLN D CD  1 
ATOM   7830  O OE1 . GLN D 1 97  ? -15.814 3.001   32.873  1.00 86.44  ? 97   GLN D OE1 1 
ATOM   7831  N NE2 . GLN D 1 97  ? -17.512 3.614   34.203  1.00 85.63  ? 97   GLN D NE2 1 
ATOM   7832  N N   . LYS D 1 98  ? -11.647 6.365   33.535  1.00 50.97  ? 98   LYS D N   1 
ATOM   7833  C CA  . LYS D 1 98  ? -10.237 6.421   33.126  1.00 49.91  ? 98   LYS D CA  1 
ATOM   7834  C C   . LYS D 1 98  ? -9.422  5.476   34.018  1.00 51.76  ? 98   LYS D C   1 
ATOM   7835  O O   . LYS D 1 98  ? -8.611  4.715   33.504  1.00 53.21  ? 98   LYS D O   1 
ATOM   7836  C CB  . LYS D 1 98  ? -9.699  7.863   33.194  1.00 51.74  ? 98   LYS D CB  1 
ATOM   7837  C CG  . LYS D 1 98  ? -8.342  8.062   32.534  1.00 69.54  ? 98   LYS D CG  1 
ATOM   7838  C CD  . LYS D 1 98  ? -7.976  9.530   32.432  1.00 80.83  ? 98   LYS D CD  1 
ATOM   7839  N N   . TRP D 1 99  ? -9.698  5.480   35.334  1.00 44.11  ? 99   TRP D N   1 
ATOM   7840  C CA  . TRP D 1 99  ? -9.058  4.612   36.323  1.00 41.21  ? 99   TRP D CA  1 
ATOM   7841  C C   . TRP D 1 99  ? -9.381  3.135   36.085  1.00 45.74  ? 99   TRP D C   1 
ATOM   7842  O O   . TRP D 1 99  ? -8.473  2.310   36.137  1.00 44.05  ? 99   TRP D O   1 
ATOM   7843  C CB  . TRP D 1 99  ? -9.487  5.013   37.733  1.00 37.72  ? 99   TRP D CB  1 
ATOM   7844  C CG  . TRP D 1 99  ? -8.765  4.280   38.817  1.00 36.62  ? 99   TRP D CG  1 
ATOM   7845  C CD1 . TRP D 1 99  ? -9.116  3.084   39.375  1.00 39.16  ? 99   TRP D CD1 1 
ATOM   7846  C CD2 . TRP D 1 99  ? -7.614  4.740   39.535  1.00 34.71  ? 99   TRP D CD2 1 
ATOM   7847  N NE1 . TRP D 1 99  ? -8.237  2.756   40.379  1.00 36.70  ? 99   TRP D NE1 1 
ATOM   7848  C CE2 . TRP D 1 99  ? -7.306  3.759   40.504  1.00 37.23  ? 99   TRP D CE2 1 
ATOM   7849  C CE3 . TRP D 1 99  ? -6.813  5.895   39.459  1.00 35.07  ? 99   TRP D CE3 1 
ATOM   7850  C CZ2 . TRP D 1 99  ? -6.215  3.889   41.381  1.00 34.76  ? 99   TRP D CZ2 1 
ATOM   7851  C CZ3 . TRP D 1 99  ? -5.753  6.037   40.346  1.00 34.90  ? 99   TRP D CZ3 1 
ATOM   7852  C CH2 . TRP D 1 99  ? -5.467  5.046   41.297  1.00 34.63  ? 99   TRP D CH2 1 
ATOM   7853  N N   . ILE D 1 100 ? -10.670 2.803   35.856  1.00 44.85  ? 100  ILE D N   1 
ATOM   7854  C CA  . ILE D 1 100 ? -11.134 1.433   35.583  1.00 45.88  ? 100  ILE D CA  1 
ATOM   7855  C C   . ILE D 1 100 ? -10.357 0.868   34.377  1.00 51.46  ? 100  ILE D C   1 
ATOM   7856  O O   . ILE D 1 100 ? -9.804  -0.229  34.455  1.00 51.20  ? 100  ILE D O   1 
ATOM   7857  C CB  . ILE D 1 100 ? -12.681 1.398   35.364  1.00 49.68  ? 100  ILE D CB  1 
ATOM   7858  C CG1 . ILE D 1 100 ? -13.425 1.582   36.704  1.00 48.81  ? 100  ILE D CG1 1 
ATOM   7859  C CG2 . ILE D 1 100 ? -13.136 0.103   34.661  1.00 51.00  ? 100  ILE D CG2 1 
ATOM   7860  C CD1 . ILE D 1 100 ? -14.904 1.909   36.577  1.00 53.88  ? 100  ILE D CD1 1 
ATOM   7861  N N   . ARG D 1 101 ? -10.272 1.663   33.303  1.00 50.22  ? 101  ARG D N   1 
ATOM   7862  C CA  . ARG D 1 101 ? -9.591  1.348   32.053  1.00 52.31  ? 101  ARG D CA  1 
ATOM   7863  C C   . ARG D 1 101 ? -8.091  1.099   32.264  1.00 55.66  ? 101  ARG D C   1 
ATOM   7864  O O   . ARG D 1 101 ? -7.601  0.021   31.929  1.00 56.89  ? 101  ARG D O   1 
ATOM   7865  C CB  . ARG D 1 101 ? -9.794  2.502   31.061  1.00 54.22  ? 101  ARG D CB  1 
ATOM   7866  C CG  . ARG D 1 101 ? -10.036 2.064   29.629  1.00 66.80  ? 101  ARG D CG  1 
ATOM   7867  C CD  . ARG D 1 101 ? -9.740  3.161   28.604  1.00 77.10  ? 101  ARG D CD  1 
ATOM   7868  N NE  . ARG D 1 101 ? -10.284 4.472   28.974  1.00 81.58  ? 101  ARG D NE  1 
ATOM   7869  C CZ  . ARG D 1 101 ? -9.551  5.569   29.139  1.00 90.58  ? 101  ARG D CZ  1 
ATOM   7870  N NH1 . ARG D 1 101 ? -8.236  5.530   28.962  1.00 70.94  ? 101  ARG D NH1 1 
ATOM   7871  N NH2 . ARG D 1 101 ? -10.128 6.713   29.480  1.00 78.61  ? 101  ARG D NH2 1 
ATOM   7872  N N   . THR D 1 102 ? -7.384  2.090   32.836  1.00 49.84  ? 102  THR D N   1 
ATOM   7873  C CA  . THR D 1 102 ? -5.938  2.086   33.073  1.00 48.26  ? 102  THR D CA  1 
ATOM   7874  C C   . THR D 1 102 ? -5.508  0.964   34.030  1.00 50.44  ? 102  THR D C   1 
ATOM   7875  O O   . THR D 1 102 ? -4.513  0.292   33.755  1.00 50.36  ? 102  THR D O   1 
ATOM   7876  C CB  . THR D 1 102 ? -5.475  3.461   33.577  1.00 52.98  ? 102  THR D CB  1 
ATOM   7877  O OG1 . THR D 1 102 ? -6.292  3.877   34.669  1.00 55.64  ? 102  THR D OG1 1 
ATOM   7878  C CG2 . THR D 1 102 ? -5.489  4.520   32.488  1.00 48.76  ? 102  THR D CG2 1 
ATOM   7879  N N   . ARG D 1 103 ? -6.274  0.737   35.118  1.00 45.67  ? 103  ARG D N   1 
ATOM   7880  C CA  . ARG D 1 103 ? -5.977  -0.283  36.133  1.00 44.08  ? 103  ARG D CA  1 
ATOM   7881  C C   . ARG D 1 103 ? -6.504  -1.669  35.726  1.00 48.35  ? 103  ARG D C   1 
ATOM   7882  O O   . ARG D 1 103 ? -6.253  -2.640  36.445  1.00 47.51  ? 103  ARG D O   1 
ATOM   7883  C CB  . ARG D 1 103 ? -6.547  0.121   37.515  1.00 42.32  ? 103  ARG D CB  1 
ATOM   7884  C CG  . ARG D 1 103 ? -5.946  1.344   38.236  1.00 46.17  ? 103  ARG D CG  1 
ATOM   7885  C CD  . ARG D 1 103 ? -5.028  2.237   37.449  1.00 50.27  ? 103  ARG D CD  1 
ATOM   7886  N NE  . ARG D 1 103 ? -4.194  3.026   38.351  1.00 52.37  ? 103  ARG D NE  1 
ATOM   7887  C CZ  . ARG D 1 103 ? -3.764  4.248   38.078  1.00 64.52  ? 103  ARG D CZ  1 
ATOM   7888  N NH1 . ARG D 1 103 ? -4.071  4.825   36.919  1.00 43.21  ? 103  ARG D NH1 1 
ATOM   7889  N NH2 . ARG D 1 103 ? -3.016  4.904   38.957  1.00 52.85  ? 103  ARG D NH2 1 
ATOM   7890  N N   . LYS D 1 104 ? -7.207  -1.759  34.568  1.00 47.31  ? 104  LYS D N   1 
ATOM   7891  C CA  . LYS D 1 104 ? -7.787  -2.984  33.988  1.00 49.33  ? 104  LYS D CA  1 
ATOM   7892  C C   . LYS D 1 104 ? -8.743  -3.684  34.997  1.00 53.62  ? 104  LYS D C   1 
ATOM   7893  O O   . LYS D 1 104 ? -8.680  -4.904  35.196  1.00 54.35  ? 104  LYS D O   1 
ATOM   7894  C CB  . LYS D 1 104 ? -6.678  -3.952  33.501  1.00 52.50  ? 104  LYS D CB  1 
ATOM   7895  C CG  . LYS D 1 104 ? -5.657  -3.328  32.559  1.00 64.25  ? 104  LYS D CG  1 
ATOM   7896  C CD  . LYS D 1 104 ? -4.386  -4.162  32.499  1.00 74.91  ? 104  LYS D CD  1 
ATOM   7897  C CE  . LYS D 1 104 ? -3.326  -3.687  33.469  1.00 84.80  ? 104  LYS D CE  1 
ATOM   7898  N NZ  . LYS D 1 104 ? -2.200  -4.645  33.561  1.00 92.29  ? 104  LYS D NZ  1 
ATOM   7899  N N   . LEU D 1 105 ? -9.616  -2.887  35.645  1.00 48.45  ? 105  LEU D N   1 
ATOM   7900  C CA  . LEU D 1 105 ? -10.585 -3.373  36.620  1.00 47.68  ? 105  LEU D CA  1 
ATOM   7901  C C   . LEU D 1 105 ? -11.899 -3.730  35.934  1.00 54.19  ? 105  LEU D C   1 
ATOM   7902  O O   . LEU D 1 105 ? -12.212 -3.181  34.867  1.00 54.39  ? 105  LEU D O   1 
ATOM   7903  C CB  . LEU D 1 105 ? -10.847 -2.316  37.716  1.00 45.90  ? 105  LEU D CB  1 
ATOM   7904  C CG  . LEU D 1 105 ? -9.647  -1.720  38.476  1.00 47.90  ? 105  LEU D CG  1 
ATOM   7905  C CD1 . LEU D 1 105 ? -10.075 -0.531  39.305  1.00 46.71  ? 105  LEU D CD1 1 
ATOM   7906  C CD2 . LEU D 1 105 ? -8.958  -2.755  39.354  1.00 48.86  ? 105  LEU D CD2 1 
ATOM   7907  N N   . LYS D 1 106 ? -12.678 -4.639  36.554  1.00 50.84  ? 106  LYS D N   1 
ATOM   7908  C CA  . LYS D 1 106 ? -13.998 -5.027  36.053  1.00 51.81  ? 106  LYS D CA  1 
ATOM   7909  C C   . LYS D 1 106 ? -14.980 -3.887  36.339  1.00 53.70  ? 106  LYS D C   1 
ATOM   7910  O O   . LYS D 1 106 ? -15.840 -3.585  35.513  1.00 55.23  ? 106  LYS D O   1 
ATOM   7911  C CB  . LYS D 1 106 ? -14.467 -6.346  36.701  1.00 54.80  ? 106  LYS D CB  1 
ATOM   7912  C CG  . LYS D 1 106 ? -13.832 -7.592  36.110  1.00 72.04  ? 106  LYS D CG  1 
ATOM   7913  C CD  . LYS D 1 106 ? -14.220 -8.836  36.903  1.00 84.71  ? 106  LYS D CD  1 
ATOM   7914  C CE  . LYS D 1 106 ? -13.532 -10.073 36.378  1.00 99.92  ? 106  LYS D CE  1 
ATOM   7915  N NZ  . LYS D 1 106 ? -13.655 -11.216 37.324  1.00 110.08 ? 106  LYS D NZ  1 
ATOM   7916  N N   . TYR D 1 107 ? -14.800 -3.229  37.504  1.00 47.22  ? 107  TYR D N   1 
ATOM   7917  C CA  . TYR D 1 107 ? -15.585 -2.102  38.009  1.00 45.55  ? 107  TYR D CA  1 
ATOM   7918  C C   . TYR D 1 107 ? -14.792 -1.417  39.144  1.00 46.37  ? 107  TYR D C   1 
ATOM   7919  O O   . TYR D 1 107 ? -13.738 -1.912  39.545  1.00 44.89  ? 107  TYR D O   1 
ATOM   7920  C CB  . TYR D 1 107 ? -16.976 -2.616  38.496  1.00 46.69  ? 107  TYR D CB  1 
ATOM   7921  C CG  . TYR D 1 107 ? -17.017 -3.038  39.948  1.00 45.92  ? 107  TYR D CG  1 
ATOM   7922  C CD1 . TYR D 1 107 ? -16.494 -4.264  40.358  1.00 47.69  ? 107  TYR D CD1 1 
ATOM   7923  C CD2 . TYR D 1 107 ? -17.559 -2.206  40.918  1.00 45.15  ? 107  TYR D CD2 1 
ATOM   7924  C CE1 . TYR D 1 107 ? -16.490 -4.635  41.704  1.00 46.02  ? 107  TYR D CE1 1 
ATOM   7925  C CE2 . TYR D 1 107 ? -17.553 -2.563  42.262  1.00 44.52  ? 107  TYR D CE2 1 
ATOM   7926  C CZ  . TYR D 1 107 ? -17.016 -3.776  42.652  1.00 50.10  ? 107  TYR D CZ  1 
ATOM   7927  O OH  . TYR D 1 107 ? -17.028 -4.128  43.980  1.00 51.52  ? 107  TYR D OH  1 
ATOM   7928  N N   . LEU D 1 108 ? -15.303 -0.293  39.661  1.00 41.88  ? 108  LEU D N   1 
ATOM   7929  C CA  . LEU D 1 108 ? -14.733 0.413   40.811  1.00 39.01  ? 108  LEU D CA  1 
ATOM   7930  C C   . LEU D 1 108 ? -15.882 0.798   41.721  1.00 43.71  ? 108  LEU D C   1 
ATOM   7931  O O   . LEU D 1 108 ? -16.812 1.478   41.277  1.00 45.15  ? 108  LEU D O   1 
ATOM   7932  C CB  . LEU D 1 108 ? -13.887 1.641   40.409  1.00 37.78  ? 108  LEU D CB  1 
ATOM   7933  C CG  . LEU D 1 108 ? -13.259 2.453   41.561  1.00 39.59  ? 108  LEU D CG  1 
ATOM   7934  C CD1 . LEU D 1 108 ? -12.081 1.716   42.208  1.00 37.87  ? 108  LEU D CD1 1 
ATOM   7935  C CD2 . LEU D 1 108 ? -12.864 3.826   41.102  1.00 40.13  ? 108  LEU D CD2 1 
ATOM   7936  N N   . GLY D 1 109 ? -15.815 0.346   42.973  1.00 38.73  ? 109  GLY D N   1 
ATOM   7937  C CA  . GLY D 1 109 ? -16.849 0.578   43.970  1.00 38.34  ? 109  GLY D CA  1 
ATOM   7938  C C   . GLY D 1 109 ? -16.969 1.982   44.525  1.00 42.03  ? 109  GLY D C   1 
ATOM   7939  O O   . GLY D 1 109 ? -17.293 2.141   45.702  1.00 40.95  ? 109  GLY D O   1 
ATOM   7940  N N   . VAL D 1 110 ? -16.734 3.010   43.690  1.00 39.04  ? 110  VAL D N   1 
ATOM   7941  C CA  . VAL D 1 110 ? -16.908 4.421   44.053  1.00 39.06  ? 110  VAL D CA  1 
ATOM   7942  C C   . VAL D 1 110 ? -18.194 4.874   43.353  1.00 46.27  ? 110  VAL D C   1 
ATOM   7943  O O   . VAL D 1 110 ? -18.290 4.728   42.134  1.00 47.16  ? 110  VAL D O   1 
ATOM   7944  C CB  . VAL D 1 110 ? -15.678 5.321   43.728  1.00 41.74  ? 110  VAL D CB  1 
ATOM   7945  C CG1 . VAL D 1 110 ? -15.957 6.800   44.037  1.00 41.31  ? 110  VAL D CG1 1 
ATOM   7946  C CG2 . VAL D 1 110 ? -14.424 4.842   44.470  1.00 39.84  ? 110  VAL D CG2 1 
ATOM   7947  N N   . PRO D 1 111 ? -19.227 5.339   44.097  1.00 44.43  ? 111  PRO D N   1 
ATOM   7948  C CA  . PRO D 1 111 ? -20.481 5.745   43.444  1.00 46.04  ? 111  PRO D CA  1 
ATOM   7949  C C   . PRO D 1 111 ? -20.324 6.949   42.517  1.00 51.81  ? 111  PRO D C   1 
ATOM   7950  O O   . PRO D 1 111 ? -19.471 7.823   42.725  1.00 50.12  ? 111  PRO D O   1 
ATOM   7951  C CB  . PRO D 1 111 ? -21.397 6.091   44.625  1.00 47.74  ? 111  PRO D CB  1 
ATOM   7952  C CG  . PRO D 1 111 ? -20.771 5.445   45.813  1.00 50.36  ? 111  PRO D CG  1 
ATOM   7953  C CD  . PRO D 1 111 ? -19.310 5.548   45.553  1.00 44.51  ? 111  PRO D CD  1 
ATOM   7954  N N   . LYS D 1 112 ? -21.231 6.996   41.523  1.00 52.38  ? 112  LYS D N   1 
ATOM   7955  C CA  . LYS D 1 112 ? -21.336 8.017   40.484  1.00 53.74  ? 112  LYS D CA  1 
ATOM   7956  C C   . LYS D 1 112 ? -22.155 9.220   40.955  1.00 58.46  ? 112  LYS D C   1 
ATOM   7957  O O   . LYS D 1 112 ? -23.290 9.070   41.410  1.00 58.58  ? 112  LYS D O   1 
ATOM   7958  C CB  . LYS D 1 112 ? -21.966 7.413   39.202  1.00 57.96  ? 112  LYS D CB  1 
ATOM   7959  C CG  . LYS D 1 112 ? -22.201 8.411   38.060  1.00 74.05  ? 112  LYS D CG  1 
ATOM   7960  C CD  . LYS D 1 112 ? -22.786 7.760   36.817  1.00 81.22  ? 112  LYS D CD  1 
ATOM   7961  C CE  . LYS D 1 112 ? -23.032 8.775   35.729  1.00 87.00  ? 112  LYS D CE  1 
ATOM   7962  N NZ  . LYS D 1 112 ? -23.411 8.126   34.450  1.00 95.76  ? 112  LYS D NZ  1 
ATOM   7963  N N   . TYR D 1 113 ? -21.562 10.413  40.810  1.00 55.77  ? 113  TYR D N   1 
ATOM   7964  C CA  . TYR D 1 113 ? -22.176 11.709  41.063  1.00 57.57  ? 113  TYR D CA  1 
ATOM   7965  C C   . TYR D 1 113 ? -22.834 12.151  39.732  1.00 64.79  ? 113  TYR D C   1 
ATOM   7966  O O   . TYR D 1 113 ? -22.132 12.270  38.724  1.00 63.94  ? 113  TYR D O   1 
ATOM   7967  C CB  . TYR D 1 113 ? -21.107 12.702  41.592  1.00 57.70  ? 113  TYR D CB  1 
ATOM   7968  C CG  . TYR D 1 113 ? -21.475 14.169  41.499  1.00 61.88  ? 113  TYR D CG  1 
ATOM   7969  C CD1 . TYR D 1 113 ? -22.364 14.745  42.403  1.00 64.67  ? 113  TYR D CD1 1 
ATOM   7970  C CD2 . TYR D 1 113 ? -20.893 14.995  40.543  1.00 63.66  ? 113  TYR D CD2 1 
ATOM   7971  C CE1 . TYR D 1 113 ? -22.707 16.093  42.321  1.00 66.85  ? 113  TYR D CE1 1 
ATOM   7972  C CE2 . TYR D 1 113 ? -21.226 16.345  40.452  1.00 66.18  ? 113  TYR D CE2 1 
ATOM   7973  C CZ  . TYR D 1 113 ? -22.131 16.891  41.346  1.00 75.12  ? 113  TYR D CZ  1 
ATOM   7974  O OH  . TYR D 1 113 ? -22.458 18.223  41.260  1.00 79.36  ? 113  TYR D OH  1 
ATOM   7975  N N   . TRP D 1 114 ? -24.185 12.305  39.714  1.00 64.60  ? 114  TRP D N   1 
ATOM   7976  C CA  . TRP D 1 114 ? -24.972 12.679  38.521  1.00 67.56  ? 114  TRP D CA  1 
ATOM   7977  C C   . TRP D 1 114 ? -25.254 14.181  38.429  1.00 72.12  ? 114  TRP D C   1 
ATOM   7978  O O   . TRP D 1 114 ? -25.471 14.694  37.329  1.00 73.80  ? 114  TRP D O   1 
ATOM   7979  C CB  . TRP D 1 114 ? -26.318 11.932  38.489  1.00 68.93  ? 114  TRP D CB  1 
ATOM   7980  C CG  . TRP D 1 114 ? -26.213 10.457  38.250  1.00 70.19  ? 114  TRP D CG  1 
ATOM   7981  C CD1 . TRP D 1 114 ? -25.907 9.496   39.169  1.00 71.58  ? 114  TRP D CD1 1 
ATOM   7982  C CD2 . TRP D 1 114 ? -26.458 9.769   37.014  1.00 71.95  ? 114  TRP D CD2 1 
ATOM   7983  N NE1 . TRP D 1 114 ? -25.915 8.254   38.577  1.00 71.84  ? 114  TRP D NE1 1 
ATOM   7984  C CE2 . TRP D 1 114 ? -26.267 8.390   37.257  1.00 75.43  ? 114  TRP D CE2 1 
ATOM   7985  C CE3 . TRP D 1 114 ? -26.816 10.185  35.717  1.00 75.57  ? 114  TRP D CE3 1 
ATOM   7986  C CZ2 . TRP D 1 114 ? -26.418 7.423   36.251  1.00 76.03  ? 114  TRP D CZ2 1 
ATOM   7987  C CZ3 . TRP D 1 114 ? -26.958 9.229   34.721  1.00 78.30  ? 114  TRP D CZ3 1 
ATOM   7988  C CH2 . TRP D 1 114 ? -26.757 7.867   34.989  1.00 78.11  ? 114  TRP D CH2 1 
ATOM   7989  N N   . GLY D 1 115 ? -25.306 14.851  39.578  1.00 67.65  ? 115  GLY D N   1 
ATOM   7990  C CA  . GLY D 1 115 ? -25.587 16.281  39.672  1.00 68.32  ? 115  GLY D CA  1 
ATOM   7991  C C   . GLY D 1 115 ? -25.928 16.748  41.073  1.00 70.14  ? 115  GLY D C   1 
ATOM   7992  O O   . GLY D 1 115 ? -26.080 15.928  41.982  1.00 68.10  ? 115  GLY D O   1 
ATOM   7993  N N   . SER D 1 116 ? -26.038 18.082  41.256  1.00 67.10  ? 116  SER D N   1 
ATOM   7994  C CA  . SER D 1 116 ? -26.357 18.729  42.537  1.00 66.59  ? 116  SER D CA  1 
ATOM   7995  C C   . SER D 1 116 ? -26.962 20.126  42.337  1.00 72.99  ? 116  SER D C   1 
ATOM   7996  O O   . SER D 1 116 ? -26.862 20.686  41.249  1.00 74.13  ? 116  SER D O   1 
ATOM   7997  C CB  . SER D 1 116 ? -25.104 18.840  43.404  1.00 66.12  ? 116  SER D CB  1 
ATOM   7998  O OG  . SER D 1 116 ? -24.224 19.850  42.939  1.00 70.05  ? 116  SER D OG  1 
ATOM   7999  N N   . GLY D 1 117 ? -27.526 20.691  43.401  1.00 69.81  ? 117  GLY D N   1 
ATOM   8000  C CA  . GLY D 1 117 ? -28.089 22.035  43.386  1.00 71.85  ? 117  GLY D CA  1 
ATOM   8001  C C   . GLY D 1 117 ? -28.745 22.421  44.691  1.00 77.24  ? 117  GLY D C   1 
ATOM   8002  O O   . GLY D 1 117 ? -28.490 21.800  45.728  1.00 74.95  ? 117  GLY D O   1 
ATOM   8003  N N   . LEU D 1 118 ? -29.593 23.460  44.638  1.00 77.72  ? 118  LEU D N   1 
ATOM   8004  C CA  . LEU D 1 118 ? -30.401 23.959  45.753  1.00 79.51  ? 118  LEU D CA  1 
ATOM   8005  C C   . LEU D 1 118 ? -31.859 24.027  45.332  1.00 88.39  ? 118  LEU D C   1 
ATOM   8006  O O   . LEU D 1 118 ? -32.143 24.242  44.150  1.00 89.76  ? 118  LEU D O   1 
ATOM   8007  C CB  . LEU D 1 118 ? -29.937 25.342  46.241  1.00 80.08  ? 118  LEU D CB  1 
ATOM   8008  C CG  . LEU D 1 118 ? -28.557 25.455  46.887  1.00 82.38  ? 118  LEU D CG  1 
ATOM   8009  C CD1 . LEU D 1 118 ? -28.228 26.892  47.168  1.00 83.82  ? 118  LEU D CD1 1 
ATOM   8010  C CD2 . LEU D 1 118 ? -28.483 24.705  48.200  1.00 83.29  ? 118  LEU D CD2 1 
ATOM   8011  N N   . HIS D 1 119 ? -32.787 23.865  46.294  1.00 86.85  ? 119  HIS D N   1 
ATOM   8012  C CA  . HIS D 1 119 ? -34.222 23.914  46.018  1.00 89.99  ? 119  HIS D CA  1 
ATOM   8013  C C   . HIS D 1 119 ? -34.962 24.787  47.032  1.00 96.02  ? 119  HIS D C   1 
ATOM   8014  O O   . HIS D 1 119 ? -34.620 24.778  48.215  1.00 94.17  ? 119  HIS D O   1 
ATOM   8015  C CB  . HIS D 1 119 ? -34.818 22.502  45.998  1.00 90.41  ? 119  HIS D CB  1 
ATOM   8016  C CG  . HIS D 1 119 ? -36.130 22.435  45.287  1.00 97.08  ? 119  HIS D CG  1 
ATOM   8017  N ND1 . HIS D 1 119 ? -36.200 22.415  43.907  1.00 99.95  ? 119  HIS D ND1 1 
ATOM   8018  C CD2 . HIS D 1 119 ? -37.386 22.412  45.791  1.00 101.39 ? 119  HIS D CD2 1 
ATOM   8019  C CE1 . HIS D 1 119 ? -37.490 22.372  43.615  1.00 102.63 ? 119  HIS D CE1 1 
ATOM   8020  N NE2 . HIS D 1 119 ? -38.242 22.364  44.717  1.00 103.95 ? 119  HIS D NE2 1 
ATOM   8021  N N   . ASP D 1 120 ? -35.985 25.529  46.560  1.00 96.04  ? 120  ASP D N   1 
ATOM   8022  C CA  . ASP D 1 120 ? -36.809 26.420  47.378  1.00 98.52  ? 120  ASP D CA  1 
ATOM   8023  C C   . ASP D 1 120 ? -38.239 25.893  47.482  1.00 105.21 ? 120  ASP D C   1 
ATOM   8024  O O   . ASP D 1 120 ? -38.585 25.230  48.460  1.00 104.33 ? 120  ASP D O   1 
ATOM   8025  C CB  . ASP D 1 120 ? -36.805 27.841  46.796  1.00 102.55 ? 120  ASP D CB  1 
ATOM   8026  N N   . ASN D 1 122 ? -40.615 25.103  50.368  1.00 122.23 ? 122  ASN D N   1 
ATOM   8027  C CA  . ASN D 1 122 ? -41.201 26.437  50.494  1.00 125.29 ? 122  ASN D CA  1 
ATOM   8028  C C   . ASN D 1 122 ? -40.526 27.199  51.633  1.00 127.72 ? 122  ASN D C   1 
ATOM   8029  O O   . ASN D 1 122 ? -40.522 26.736  52.778  1.00 126.48 ? 122  ASN D O   1 
ATOM   8030  C CB  . ASN D 1 122 ? -42.716 26.358  50.706  1.00 129.20 ? 122  ASN D CB  1 
ATOM   8031  N N   . GLY D 1 123 ? -39.931 28.340  51.290  1.00 123.67 ? 123  GLY D N   1 
ATOM   8032  C CA  . GLY D 1 123 ? -39.205 29.203  52.216  1.00 122.15 ? 123  GLY D CA  1 
ATOM   8033  C C   . GLY D 1 123 ? -37.757 28.796  52.409  1.00 120.21 ? 123  GLY D C   1 
ATOM   8034  O O   . GLY D 1 123 ? -36.847 29.605  52.200  1.00 118.83 ? 123  GLY D O   1 
ATOM   8035  N N   . LYS D 1 124 ? -37.536 27.536  52.814  1.00 113.18 ? 124  LYS D N   1 
ATOM   8036  C CA  . LYS D 1 124 ? -36.205 26.982  53.065  1.00 108.60 ? 124  LYS D CA  1 
ATOM   8037  C C   . LYS D 1 124 ? -35.444 26.688  51.767  1.00 109.14 ? 124  LYS D C   1 
ATOM   8038  O O   . LYS D 1 124 ? -36.059 26.397  50.739  1.00 109.73 ? 124  LYS D O   1 
ATOM   8039  C CB  . LYS D 1 124 ? -36.316 25.698  53.902  1.00 109.47 ? 124  LYS D CB  1 
ATOM   8040  N N   . SER D 1 125 ? -34.098 26.758  51.829  1.00 102.02 ? 125  SER D N   1 
ATOM   8041  C CA  . SER D 1 125 ? -33.201 26.468  50.708  1.00 99.33  ? 125  SER D CA  1 
ATOM   8042  C C   . SER D 1 125 ? -32.458 25.154  50.986  1.00 98.55  ? 125  SER D C   1 
ATOM   8043  O O   . SER D 1 125 ? -31.399 25.157  51.625  1.00 96.04  ? 125  SER D O   1 
ATOM   8044  C CB  . SER D 1 125 ? -32.232 27.623  50.468  1.00 102.42 ? 125  SER D CB  1 
ATOM   8045  N N   . TYR D 1 126 ? -33.055 24.023  50.546  1.00 93.55  ? 126  TYR D N   1 
ATOM   8046  C CA  . TYR D 1 126 ? -32.524 22.672  50.751  1.00 89.69  ? 126  TYR D CA  1 
ATOM   8047  C C   . TYR D 1 126 ? -31.501 22.280  49.669  1.00 88.91  ? 126  TYR D C   1 
ATOM   8048  O O   . TYR D 1 126 ? -31.737 22.493  48.477  1.00 89.69  ? 126  TYR D O   1 
ATOM   8049  C CB  . TYR D 1 126 ? -33.667 21.649  50.797  1.00 91.98  ? 126  TYR D CB  1 
ATOM   8050  N N   . ARG D 1 127 ? -30.369 21.705  50.103  1.00 80.21  ? 127  ARG D N   1 
ATOM   8051  C CA  . ARG D 1 127 ? -29.269 21.242  49.249  1.00 77.07  ? 127  ARG D CA  1 
ATOM   8052  C C   . ARG D 1 127 ? -29.508 19.788  48.833  1.00 77.37  ? 127  ARG D C   1 
ATOM   8053  O O   . ARG D 1 127 ? -29.985 19.000  49.646  1.00 77.15  ? 127  ARG D O   1 
ATOM   8054  C CB  . ARG D 1 127 ? -27.932 21.386  49.999  1.00 75.97  ? 127  ARG D CB  1 
ATOM   8055  C CG  . ARG D 1 127 ? -26.697 21.388  49.103  1.00 88.35  ? 127  ARG D CG  1 
ATOM   8056  C CD  . ARG D 1 127 ? -25.409 21.496  49.904  1.00 100.74 ? 127  ARG D CD  1 
ATOM   8057  N NE  . ARG D 1 127 ? -25.275 22.787  50.587  1.00 116.18 ? 127  ARG D NE  1 
ATOM   8058  C CZ  . ARG D 1 127 ? -24.709 23.868  50.056  1.00 133.95 ? 127  ARG D CZ  1 
ATOM   8059  N NH1 . ARG D 1 127 ? -24.213 23.830  48.824  1.00 120.61 ? 127  ARG D NH1 1 
ATOM   8060  N NH2 . ARG D 1 127 ? -24.638 24.996  50.750  1.00 123.68 ? 127  ARG D NH2 1 
ATOM   8061  N N   . PHE D 1 128 ? -29.198 19.431  47.575  1.00 71.34  ? 128  PHE D N   1 
ATOM   8062  C CA  . PHE D 1 128 ? -29.421 18.063  47.110  1.00 69.78  ? 128  PHE D CA  1 
ATOM   8063  C C   . PHE D 1 128 ? -28.270 17.535  46.249  1.00 72.61  ? 128  PHE D C   1 
ATOM   8064  O O   . PHE D 1 128 ? -27.502 18.315  45.686  1.00 71.53  ? 128  PHE D O   1 
ATOM   8065  C CB  . PHE D 1 128 ? -30.756 17.935  46.350  1.00 73.72  ? 128  PHE D CB  1 
ATOM   8066  C CG  . PHE D 1 128 ? -30.845 18.642  45.016  1.00 76.13  ? 128  PHE D CG  1 
ATOM   8067  C CD1 . PHE D 1 128 ? -30.459 18.002  43.843  1.00 77.99  ? 128  PHE D CD1 1 
ATOM   8068  C CD2 . PHE D 1 128 ? -31.372 19.924  44.923  1.00 79.83  ? 128  PHE D CD2 1 
ATOM   8069  C CE1 . PHE D 1 128 ? -30.550 18.651  42.612  1.00 80.22  ? 128  PHE D CE1 1 
ATOM   8070  C CE2 . PHE D 1 128 ? -31.481 20.565  43.687  1.00 83.80  ? 128  PHE D CE2 1 
ATOM   8071  C CZ  . PHE D 1 128 ? -31.062 19.927  42.542  1.00 81.20  ? 128  PHE D CZ  1 
ATOM   8072  N N   . MET D 1 129 ? -28.185 16.195  46.143  1.00 68.89  ? 129  MET D N   1 
ATOM   8073  C CA  . MET D 1 129 ? -27.205 15.449  45.355  1.00 67.13  ? 129  MET D CA  1 
ATOM   8074  C C   . MET D 1 129 ? -27.896 14.303  44.627  1.00 72.01  ? 129  MET D C   1 
ATOM   8075  O O   . MET D 1 129 ? -28.649 13.556  45.253  1.00 72.33  ? 129  MET D O   1 
ATOM   8076  C CB  . MET D 1 129 ? -26.086 14.900  46.256  1.00 66.63  ? 129  MET D CB  1 
ATOM   8077  C CG  . MET D 1 129 ? -24.757 15.575  46.042  1.00 68.95  ? 129  MET D CG  1 
ATOM   8078  S SD  . MET D 1 129 ? -23.372 14.701  46.822  1.00 70.32  ? 129  MET D SD  1 
ATOM   8079  C CE  . MET D 1 129 ? -23.614 15.143  48.518  1.00 66.71  ? 129  MET D CE  1 
ATOM   8080  N N   . ILE D 1 130 ? -27.652 14.165  43.313  1.00 68.82  ? 130  ILE D N   1 
ATOM   8081  C CA  . ILE D 1 130 ? -28.221 13.082  42.512  1.00 69.41  ? 130  ILE D CA  1 
ATOM   8082  C C   . ILE D 1 130 ? -27.159 11.993  42.433  1.00 71.17  ? 130  ILE D C   1 
ATOM   8083  O O   . ILE D 1 130 ? -26.118 12.191  41.803  1.00 69.21  ? 130  ILE D O   1 
ATOM   8084  C CB  . ILE D 1 130 ? -28.740 13.537  41.109  1.00 74.55  ? 130  ILE D CB  1 
ATOM   8085  C CG1 . ILE D 1 130 ? -29.574 14.851  41.163  1.00 77.01  ? 130  ILE D CG1 1 
ATOM   8086  C CG2 . ILE D 1 130 ? -29.487 12.404  40.385  1.00 76.29  ? 130  ILE D CG2 1 
ATOM   8087  C CD1 . ILE D 1 130 ? -30.922 14.816  41.930  1.00 83.78  ? 130  ILE D CD1 1 
ATOM   8088  N N   . MET D 1 131 ? -27.410 10.867  43.122  1.00 68.32  ? 131  MET D N   1 
ATOM   8089  C CA  . MET D 1 131 ? -26.503 9.716   43.222  1.00 66.67  ? 131  MET D CA  1 
ATOM   8090  C C   . MET D 1 131 ? -27.090 8.454   42.579  1.00 72.47  ? 131  MET D C   1 
ATOM   8091  O O   . MET D 1 131 ? -28.288 8.401   42.313  1.00 74.05  ? 131  MET D O   1 
ATOM   8092  C CB  . MET D 1 131 ? -26.187 9.414   44.703  1.00 67.22  ? 131  MET D CB  1 
ATOM   8093  C CG  . MET D 1 131 ? -25.490 10.526  45.447  1.00 69.71  ? 131  MET D CG  1 
ATOM   8094  S SD  . MET D 1 131 ? -23.781 10.775  44.928  1.00 71.96  ? 131  MET D SD  1 
ATOM   8095  C CE  . MET D 1 131 ? -23.925 12.327  44.249  1.00 70.06  ? 131  MET D CE  1 
ATOM   8096  N N   . ASP D 1 132 ? -26.239 7.425   42.376  1.00 68.46  ? 132  ASP D N   1 
ATOM   8097  C CA  . ASP D 1 132 ? -26.607 6.105   41.850  1.00 69.37  ? 132  ASP D CA  1 
ATOM   8098  C C   . ASP D 1 132 ? -27.542 5.364   42.817  1.00 73.15  ? 132  ASP D C   1 
ATOM   8099  O O   . ASP D 1 132 ? -27.409 5.525   44.036  1.00 71.75  ? 132  ASP D O   1 
ATOM   8100  C CB  . ASP D 1 132 ? -25.331 5.247   41.667  1.00 69.60  ? 132  ASP D CB  1 
ATOM   8101  C CG  . ASP D 1 132 ? -24.681 5.221   40.296  1.00 82.87  ? 132  ASP D CG  1 
ATOM   8102  O OD1 . ASP D 1 132 ? -25.374 5.533   39.296  1.00 84.91  ? 132  ASP D OD1 1 
ATOM   8103  O OD2 . ASP D 1 132 ? -23.501 4.805   40.210  1.00 88.50  ? 132  ASP D OD2 1 
ATOM   8104  N N   . ARG D 1 133 ? -28.448 4.524   42.287  1.00 69.96  ? 133  ARG D N   1 
ATOM   8105  C CA  . ARG D 1 133 ? -29.314 3.687   43.119  1.00 69.68  ? 133  ARG D CA  1 
ATOM   8106  C C   . ARG D 1 133 ? -28.614 2.350   43.312  1.00 70.79  ? 133  ARG D C   1 
ATOM   8107  O O   . ARG D 1 133 ? -28.091 1.776   42.347  1.00 70.04  ? 133  ARG D O   1 
ATOM   8108  C CB  . ARG D 1 133 ? -30.725 3.524   42.512  1.00 73.01  ? 133  ARG D CB  1 
ATOM   8109  C CG  . ARG D 1 133 ? -31.365 2.129   42.641  1.00 84.63  ? 133  ARG D CG  1 
ATOM   8110  C CD  . ARG D 1 133 ? -32.264 1.980   43.852  1.00 94.11  ? 133  ARG D CD  1 
ATOM   8111  N N   . PHE D 1 134 ? -28.584 1.870   44.559  1.00 65.54  ? 134  PHE D N   1 
ATOM   8112  C CA  . PHE D 1 134 ? -27.954 0.599   44.895  1.00 63.57  ? 134  PHE D CA  1 
ATOM   8113  C C   . PHE D 1 134 ? -28.961 -0.370  45.496  1.00 68.65  ? 134  PHE D C   1 
ATOM   8114  O O   . PHE D 1 134 ? -30.116 -0.004  45.748  1.00 69.78  ? 134  PHE D O   1 
ATOM   8115  C CB  . PHE D 1 134 ? -26.778 0.814   45.864  1.00 62.06  ? 134  PHE D CB  1 
ATOM   8116  C CG  . PHE D 1 134 ? -25.632 1.612   45.300  1.00 61.45  ? 134  PHE D CG  1 
ATOM   8117  C CD1 . PHE D 1 134 ? -24.874 1.121   44.244  1.00 63.51  ? 134  PHE D CD1 1 
ATOM   8118  C CD2 . PHE D 1 134 ? -25.286 2.840   45.845  1.00 61.90  ? 134  PHE D CD2 1 
ATOM   8119  C CE1 . PHE D 1 134 ? -23.817 1.860   43.723  1.00 62.75  ? 134  PHE D CE1 1 
ATOM   8120  C CE2 . PHE D 1 134 ? -24.216 3.572   45.330  1.00 63.07  ? 134  PHE D CE2 1 
ATOM   8121  C CZ  . PHE D 1 134 ? -23.487 3.075   44.276  1.00 60.61  ? 134  PHE D CZ  1 
ATOM   8122  N N   . GLY D 1 135 ? -28.501 -1.602  45.713  1.00 63.71  ? 135  GLY D N   1 
ATOM   8123  C CA  . GLY D 1 135 ? -29.285 -2.659  46.329  1.00 63.67  ? 135  GLY D CA  1 
ATOM   8124  C C   . GLY D 1 135 ? -29.079 -2.659  47.828  1.00 63.81  ? 135  GLY D C   1 
ATOM   8125  O O   . GLY D 1 135 ? -28.919 -1.597  48.442  1.00 61.74  ? 135  GLY D O   1 
ATOM   8126  N N   . SER D 1 136 ? -29.056 -3.855  48.419  1.00 59.49  ? 136  SER D N   1 
ATOM   8127  C CA  . SER D 1 136 ? -28.894 -4.032  49.859  1.00 58.20  ? 136  SER D CA  1 
ATOM   8128  C C   . SER D 1 136 ? -27.498 -3.652  50.355  1.00 58.01  ? 136  SER D C   1 
ATOM   8129  O O   . SER D 1 136 ? -26.519 -3.747  49.611  1.00 56.00  ? 136  SER D O   1 
ATOM   8130  C CB  . SER D 1 136 ? -29.187 -5.479  50.243  1.00 63.34  ? 136  SER D CB  1 
ATOM   8131  O OG  . SER D 1 136 ? -29.108 -5.686  51.644  1.00 71.83  ? 136  SER D OG  1 
ATOM   8132  N N   . ASP D 1 137 ? -27.421 -3.222  51.624  1.00 53.62  ? 137  ASP D N   1 
ATOM   8133  C CA  . ASP D 1 137 ? -26.157 -2.959  52.296  1.00 50.88  ? 137  ASP D CA  1 
ATOM   8134  C C   . ASP D 1 137 ? -25.676 -4.306  52.846  1.00 53.32  ? 137  ASP D C   1 
ATOM   8135  O O   . ASP D 1 137 ? -26.492 -5.226  52.998  1.00 54.70  ? 137  ASP D O   1 
ATOM   8136  C CB  . ASP D 1 137 ? -26.289 -1.874  53.382  1.00 52.44  ? 137  ASP D CB  1 
ATOM   8137  C CG  . ASP D 1 137 ? -27.197 -2.212  54.549  1.00 66.58  ? 137  ASP D CG  1 
ATOM   8138  O OD1 . ASP D 1 137 ? -28.311 -1.655  54.612  1.00 69.35  ? 137  ASP D OD1 1 
ATOM   8139  O OD2 . ASP D 1 137 ? -26.767 -2.977  55.428  1.00 73.17  ? 137  ASP D OD2 1 
ATOM   8140  N N   . LEU D 1 138 ? -24.372 -4.444  53.118  1.00 47.62  ? 138  LEU D N   1 
ATOM   8141  C CA  . LEU D 1 138 ? -23.817 -5.711  53.600  1.00 46.91  ? 138  LEU D CA  1 
ATOM   8142  C C   . LEU D 1 138 ? -24.225 -6.060  55.036  1.00 48.19  ? 138  LEU D C   1 
ATOM   8143  O O   . LEU D 1 138 ? -24.232 -7.243  55.362  1.00 48.04  ? 138  LEU D O   1 
ATOM   8144  C CB  . LEU D 1 138 ? -22.291 -5.732  53.495  1.00 45.55  ? 138  LEU D CB  1 
ATOM   8145  C CG  . LEU D 1 138 ? -21.682 -5.929  52.115  1.00 51.41  ? 138  LEU D CG  1 
ATOM   8146  C CD1 . LEU D 1 138 ? -20.193 -5.968  52.232  1.00 50.40  ? 138  LEU D CD1 1 
ATOM   8147  C CD2 . LEU D 1 138 ? -22.157 -7.227  51.457  1.00 55.50  ? 138  LEU D CD2 1 
ATOM   8148  N N   . GLN D 1 139 ? -24.559 -5.060  55.882  1.00 43.11  ? 139  GLN D N   1 
ATOM   8149  C CA  . GLN D 1 139 ? -24.961 -5.294  57.275  1.00 43.26  ? 139  GLN D CA  1 
ATOM   8150  C C   . GLN D 1 139 ? -26.229 -6.153  57.347  1.00 49.97  ? 139  GLN D C   1 
ATOM   8151  O O   . GLN D 1 139 ? -26.274 -7.080  58.149  1.00 49.46  ? 139  GLN D O   1 
ATOM   8152  C CB  . GLN D 1 139 ? -25.140 -3.966  58.044  1.00 43.80  ? 139  GLN D CB  1 
ATOM   8153  C CG  . GLN D 1 139 ? -25.357 -4.114  59.562  1.00 45.13  ? 139  GLN D CG  1 
ATOM   8154  C CD  . GLN D 1 139 ? -24.246 -4.846  60.295  1.00 53.63  ? 139  GLN D CD  1 
ATOM   8155  O OE1 . GLN D 1 139 ? -23.060 -4.719  59.987  1.00 49.40  ? 139  GLN D OE1 1 
ATOM   8156  N NE2 . GLN D 1 139 ? -24.604 -5.618  61.302  1.00 42.11  ? 139  GLN D NE2 1 
ATOM   8157  N N   . LYS D 1 140 ? -27.223 -5.877  56.480  1.00 50.14  ? 140  LYS D N   1 
ATOM   8158  C CA  . LYS D 1 140 ? -28.477 -6.640  56.402  1.00 53.16  ? 140  LYS D CA  1 
ATOM   8159  C C   . LYS D 1 140 ? -28.203 -8.097  56.010  1.00 57.76  ? 140  LYS D C   1 
ATOM   8160  O O   . LYS D 1 140 ? -28.743 -9.004  56.640  1.00 59.05  ? 140  LYS D O   1 
ATOM   8161  C CB  . LYS D 1 140 ? -29.463 -6.006  55.400  1.00 58.18  ? 140  LYS D CB  1 
ATOM   8162  C CG  . LYS D 1 140 ? -30.011 -4.639  55.802  1.00 76.68  ? 140  LYS D CG  1 
ATOM   8163  C CD  . LYS D 1 140 ? -31.158 -4.219  54.885  1.00 86.84  ? 140  LYS D CD  1 
ATOM   8164  C CE  . LYS D 1 140 ? -31.475 -2.751  55.010  1.00 95.47  ? 140  LYS D CE  1 
ATOM   8165  N N   . ILE D 1 141 ? -27.340 -8.312  54.989  1.00 53.08  ? 141  ILE D N   1 
ATOM   8166  C CA  . ILE D 1 141 ? -26.957 -9.635  54.477  1.00 53.02  ? 141  ILE D CA  1 
ATOM   8167  C C   . ILE D 1 141 ? -26.159 -10.406 55.557  1.00 54.75  ? 141  ILE D C   1 
ATOM   8168  O O   . ILE D 1 141 ? -26.407 -11.599 55.758  1.00 56.00  ? 141  ILE D O   1 
ATOM   8169  C CB  . ILE D 1 141 ? -26.183 -9.495  53.134  1.00 55.25  ? 141  ILE D CB  1 
ATOM   8170  C CG1 . ILE D 1 141 ? -27.084 -8.841  52.060  1.00 56.65  ? 141  ILE D CG1 1 
ATOM   8171  C CG2 . ILE D 1 141 ? -25.638 -10.854 52.643  1.00 56.95  ? 141  ILE D CG2 1 
ATOM   8172  C CD1 . ILE D 1 141 ? -26.365 -8.039  51.013  1.00 62.22  ? 141  ILE D CD1 1 
ATOM   8173  N N   . TYR D 1 142 ? -25.235 -9.713  56.257  1.00 47.46  ? 142  TYR D N   1 
ATOM   8174  C CA  . TYR D 1 142 ? -24.393 -10.232 57.340  1.00 45.41  ? 142  TYR D CA  1 
ATOM   8175  C C   . TYR D 1 142 ? -25.266 -10.733 58.500  1.00 50.88  ? 142  TYR D C   1 
ATOM   8176  O O   . TYR D 1 142 ? -25.099 -11.874 58.932  1.00 51.44  ? 142  TYR D O   1 
ATOM   8177  C CB  . TYR D 1 142 ? -23.426 -9.119  57.800  1.00 43.66  ? 142  TYR D CB  1 
ATOM   8178  C CG  . TYR D 1 142 ? -22.616 -9.398  59.045  1.00 42.76  ? 142  TYR D CG  1 
ATOM   8179  C CD1 . TYR D 1 142 ? -21.550 -10.293 59.020  1.00 43.97  ? 142  TYR D CD1 1 
ATOM   8180  C CD2 . TYR D 1 142 ? -22.838 -8.682  60.217  1.00 42.61  ? 142  TYR D CD2 1 
ATOM   8181  C CE1 . TYR D 1 142 ? -20.751 -10.498 60.145  1.00 43.75  ? 142  TYR D CE1 1 
ATOM   8182  C CE2 . TYR D 1 142 ? -22.058 -8.890  61.352  1.00 42.30  ? 142  TYR D CE2 1 
ATOM   8183  C CZ  . TYR D 1 142 ? -21.020 -9.806  61.314  1.00 47.41  ? 142  TYR D CZ  1 
ATOM   8184  O OH  . TYR D 1 142 ? -20.264 -10.020 62.437  1.00 44.33  ? 142  TYR D OH  1 
ATOM   8185  N N   . GLU D 1 143 ? -26.234 -9.902  58.953  1.00 47.79  ? 143  GLU D N   1 
ATOM   8186  C CA  . GLU D 1 143 ? -27.172 -10.239 60.028  1.00 49.19  ? 143  GLU D CA  1 
ATOM   8187  C C   . GLU D 1 143 ? -28.076 -11.413 59.626  1.00 56.14  ? 143  GLU D C   1 
ATOM   8188  O O   . GLU D 1 143 ? -28.381 -12.258 60.468  1.00 57.59  ? 143  GLU D O   1 
ATOM   8189  C CB  . GLU D 1 143 ? -28.017 -9.015  60.425  1.00 50.54  ? 143  GLU D CB  1 
ATOM   8190  C CG  . GLU D 1 143 ? -27.247 -8.033  61.292  1.00 54.38  ? 143  GLU D CG  1 
ATOM   8191  C CD  . GLU D 1 143 ? -27.866 -6.670  61.531  1.00 74.78  ? 143  GLU D CD  1 
ATOM   8192  O OE1 . GLU D 1 143 ? -28.871 -6.334  60.863  1.00 78.73  ? 143  GLU D OE1 1 
ATOM   8193  O OE2 . GLU D 1 143 ? -27.322 -5.922  62.375  1.00 68.41  ? 143  GLU D OE2 1 
ATOM   8194  N N   . ALA D 1 144 ? -28.460 -11.487 58.332  1.00 53.14  ? 144  ALA D N   1 
ATOM   8195  C CA  . ALA D 1 144 ? -29.293 -12.559 57.787  1.00 55.30  ? 144  ALA D CA  1 
ATOM   8196  C C   . ALA D 1 144 ? -28.522 -13.885 57.684  1.00 59.39  ? 144  ALA D C   1 
ATOM   8197  O O   . ALA D 1 144 ? -29.140 -14.952 57.646  1.00 60.69  ? 144  ALA D O   1 
ATOM   8198  C CB  . ALA D 1 144 ? -29.829 -12.159 56.421  1.00 56.86  ? 144  ALA D CB  1 
ATOM   8199  N N   . ASN D 1 145 ? -27.177 -13.814 57.643  1.00 54.54  ? 145  ASN D N   1 
ATOM   8200  C CA  . ASN D 1 145 ? -26.305 -14.987 57.538  1.00 54.17  ? 145  ASN D CA  1 
ATOM   8201  C C   . ASN D 1 145 ? -25.709 -15.348 58.922  1.00 55.19  ? 145  ASN D C   1 
ATOM   8202  O O   . ASN D 1 145 ? -24.617 -15.915 59.007  1.00 54.41  ? 145  ASN D O   1 
ATOM   8203  C CB  . ASN D 1 145 ? -25.212 -14.733 56.480  1.00 56.37  ? 145  ASN D CB  1 
ATOM   8204  C CG  . ASN D 1 145 ? -24.555 -15.977 55.917  1.00 89.53  ? 145  ASN D CG  1 
ATOM   8205  O OD1 . ASN D 1 145 ? -25.163 -17.049 55.800  1.00 91.43  ? 145  ASN D OD1 1 
ATOM   8206  N ND2 . ASN D 1 145 ? -23.297 -15.850 55.521  1.00 79.33  ? 145  ASN D ND2 1 
ATOM   8207  N N   . ALA D 1 146 ? -26.470 -15.052 59.999  1.00 50.67  ? 146  ALA D N   1 
ATOM   8208  C CA  . ALA D 1 146 ? -26.160 -15.302 61.417  1.00 49.96  ? 146  ALA D CA  1 
ATOM   8209  C C   . ALA D 1 146 ? -24.839 -14.640 61.867  1.00 51.13  ? 146  ALA D C   1 
ATOM   8210  O O   . ALA D 1 146 ? -24.061 -15.227 62.628  1.00 49.93  ? 146  ALA D O   1 
ATOM   8211  C CB  . ALA D 1 146 ? -26.143 -16.801 61.716  1.00 52.22  ? 146  ALA D CB  1 
ATOM   8212  N N   . LYS D 1 147 ? -24.628 -13.388 61.424  1.00 46.31  ? 147  LYS D N   1 
ATOM   8213  C CA  . LYS D 1 147 ? -23.475 -12.536 61.728  1.00 43.98  ? 147  LYS D CA  1 
ATOM   8214  C C   . LYS D 1 147 ? -22.138 -13.212 61.328  1.00 47.15  ? 147  LYS D C   1 
ATOM   8215  O O   . LYS D 1 147 ? -21.157 -13.148 62.072  1.00 45.77  ? 147  LYS D O   1 
ATOM   8216  C CB  . LYS D 1 147 ? -23.473 -12.077 63.203  1.00 45.68  ? 147  LYS D CB  1 
ATOM   8217  C CG  . LYS D 1 147 ? -24.527 -11.026 63.517  1.00 58.47  ? 147  LYS D CG  1 
ATOM   8218  C CD  . LYS D 1 147 ? -24.357 -10.440 64.908  1.00 66.05  ? 147  LYS D CD  1 
ATOM   8219  C CE  . LYS D 1 147 ? -25.335 -9.323  65.147  1.00 77.53  ? 147  LYS D CE  1 
ATOM   8220  N NZ  . LYS D 1 147 ? -25.126 -8.689  66.472  1.00 87.19  ? 147  LYS D NZ  1 
ATOM   8221  N N   . ARG D 1 148 ? -22.095 -13.813 60.125  1.00 43.64  ? 148  ARG D N   1 
ATOM   8222  C CA  . ARG D 1 148 ? -20.891 -14.452 59.574  1.00 42.44  ? 148  ARG D CA  1 
ATOM   8223  C C   . ARG D 1 148 ? -20.818 -14.304 58.067  1.00 45.84  ? 148  ARG D C   1 
ATOM   8224  O O   . ARG D 1 148 ? -21.839 -14.372 57.380  1.00 45.98  ? 148  ARG D O   1 
ATOM   8225  C CB  . ARG D 1 148 ? -20.812 -15.971 59.895  1.00 42.51  ? 148  ARG D CB  1 
ATOM   8226  C CG  . ARG D 1 148 ? -20.770 -16.409 61.356  1.00 48.98  ? 148  ARG D CG  1 
ATOM   8227  C CD  . ARG D 1 148 ? -19.499 -16.050 62.121  1.00 50.56  ? 148  ARG D CD  1 
ATOM   8228  N NE  . ARG D 1 148 ? -19.496 -16.631 63.469  1.00 51.95  ? 148  ARG D NE  1 
ATOM   8229  C CZ  . ARG D 1 148 ? -20.214 -16.181 64.497  1.00 63.93  ? 148  ARG D CZ  1 
ATOM   8230  N NH1 . ARG D 1 148 ? -21.007 -15.128 64.352  1.00 53.91  ? 148  ARG D NH1 1 
ATOM   8231  N NH2 . ARG D 1 148 ? -20.145 -16.782 65.677  1.00 51.37  ? 148  ARG D NH2 1 
ATOM   8232  N N   . PHE D 1 149 ? -19.589 -14.146 57.561  1.00 41.51  ? 149  PHE D N   1 
ATOM   8233  C CA  . PHE D 1 149 ? -19.226 -14.157 56.140  1.00 41.25  ? 149  PHE D CA  1 
ATOM   8234  C C   . PHE D 1 149 ? -18.119 -15.181 55.983  1.00 44.29  ? 149  PHE D C   1 
ATOM   8235  O O   . PHE D 1 149 ? -17.258 -15.284 56.861  1.00 43.19  ? 149  PHE D O   1 
ATOM   8236  C CB  . PHE D 1 149 ? -18.771 -12.772 55.625  1.00 41.48  ? 149  PHE D CB  1 
ATOM   8237  C CG  . PHE D 1 149 ? -19.823 -11.729 55.316  1.00 43.05  ? 149  PHE D CG  1 
ATOM   8238  C CD1 . PHE D 1 149 ? -21.061 -12.093 54.793  1.00 47.97  ? 149  PHE D CD1 1 
ATOM   8239  C CD2 . PHE D 1 149 ? -19.549 -10.377 55.481  1.00 42.95  ? 149  PHE D CD2 1 
ATOM   8240  C CE1 . PHE D 1 149 ? -22.027 -11.126 54.507  1.00 49.12  ? 149  PHE D CE1 1 
ATOM   8241  C CE2 . PHE D 1 149 ? -20.511 -9.409  55.179  1.00 45.91  ? 149  PHE D CE2 1 
ATOM   8242  C CZ  . PHE D 1 149 ? -21.741 -9.790  54.690  1.00 46.14  ? 149  PHE D CZ  1 
ATOM   8243  N N   . SER D 1 150 ? -18.137 -15.947 54.896  1.00 42.29  ? 150  SER D N   1 
ATOM   8244  C CA  . SER D 1 150 ? -17.107 -16.955 54.644  1.00 42.76  ? 150  SER D CA  1 
ATOM   8245  C C   . SER D 1 150 ? -15.756 -16.303 54.326  1.00 44.68  ? 150  SER D C   1 
ATOM   8246  O O   . SER D 1 150 ? -15.712 -15.135 53.924  1.00 43.29  ? 150  SER D O   1 
ATOM   8247  C CB  . SER D 1 150 ? -17.529 -17.864 53.495  1.00 47.88  ? 150  SER D CB  1 
ATOM   8248  O OG  . SER D 1 150 ? -17.711 -17.128 52.297  1.00 55.90  ? 150  SER D OG  1 
ATOM   8249  N N   . ARG D 1 151 ? -14.661 -17.066 54.493  1.00 41.07  ? 151  ARG D N   1 
ATOM   8250  C CA  . ARG D 1 151 ? -13.296 -16.638 54.177  1.00 39.66  ? 151  ARG D CA  1 
ATOM   8251  C C   . ARG D 1 151 ? -13.229 -16.150 52.713  1.00 44.69  ? 151  ARG D C   1 
ATOM   8252  O O   . ARG D 1 151 ? -12.642 -15.100 52.453  1.00 43.07  ? 151  ARG D O   1 
ATOM   8253  C CB  . ARG D 1 151 ? -12.323 -17.797 54.432  1.00 39.61  ? 151  ARG D CB  1 
ATOM   8254  C CG  . ARG D 1 151 ? -10.857 -17.416 54.432  1.00 38.55  ? 151  ARG D CG  1 
ATOM   8255  C CD  . ARG D 1 151 ? -10.046 -18.537 55.024  1.00 37.18  ? 151  ARG D CD  1 
ATOM   8256  N NE  . ARG D 1 151 ? -8.610  -18.341 54.843  1.00 43.29  ? 151  ARG D NE  1 
ATOM   8257  C CZ  . ARG D 1 151 ? -7.693  -19.254 55.141  1.00 61.46  ? 151  ARG D CZ  1 
ATOM   8258  N NH1 . ARG D 1 151 ? -8.055  -20.437 55.622  1.00 52.32  ? 151  ARG D NH1 1 
ATOM   8259  N NH2 . ARG D 1 151 ? -6.406  -18.995 54.954  1.00 51.34  ? 151  ARG D NH2 1 
ATOM   8260  N N   . LYS D 1 152 ? -13.903 -16.872 51.789  1.00 43.66  ? 152  LYS D N   1 
ATOM   8261  C CA  . LYS D 1 152 ? -14.015 -16.532 50.369  1.00 44.46  ? 152  LYS D CA  1 
ATOM   8262  C C   . LYS D 1 152 ? -14.692 -15.163 50.203  1.00 48.41  ? 152  LYS D C   1 
ATOM   8263  O O   . LYS D 1 152 ? -14.152 -14.321 49.488  1.00 47.17  ? 152  LYS D O   1 
ATOM   8264  C CB  . LYS D 1 152 ? -14.795 -17.632 49.607  1.00 48.94  ? 152  LYS D CB  1 
ATOM   8265  C CG  . LYS D 1 152 ? -15.265 -17.270 48.189  1.00 55.03  ? 152  LYS D CG  1 
ATOM   8266  C CD  . LYS D 1 152 ? -14.148 -17.264 47.148  1.00 59.01  ? 152  LYS D CD  1 
ATOM   8267  C CE  . LYS D 1 152 ? -14.660 -16.899 45.772  1.00 64.14  ? 152  LYS D CE  1 
ATOM   8268  N NZ  . LYS D 1 152 ? -13.538 -16.729 44.808  1.00 72.43  ? 152  LYS D NZ  1 
ATOM   8269  N N   . THR D 1 153 ? -15.842 -14.938 50.885  1.00 45.54  ? 153  THR D N   1 
ATOM   8270  C CA  . THR D 1 153 ? -16.606 -13.684 50.830  1.00 44.69  ? 153  THR D CA  1 
ATOM   8271  C C   . THR D 1 153 ? -15.765 -12.511 51.353  1.00 46.36  ? 153  THR D C   1 
ATOM   8272  O O   . THR D 1 153 ? -15.675 -11.490 50.667  1.00 45.37  ? 153  THR D O   1 
ATOM   8273  C CB  . THR D 1 153 ? -17.928 -13.825 51.607  1.00 52.07  ? 153  THR D CB  1 
ATOM   8274  O OG1 . THR D 1 153 ? -18.721 -14.836 50.985  1.00 51.78  ? 153  THR D OG1 1 
ATOM   8275  C CG2 . THR D 1 153 ? -18.724 -12.524 51.671  1.00 49.31  ? 153  THR D CG2 1 
ATOM   8276  N N   . VAL D 1 154 ? -15.142 -12.671 52.543  1.00 41.50  ? 154  VAL D N   1 
ATOM   8277  C CA  . VAL D 1 154 ? -14.330 -11.637 53.194  1.00 38.69  ? 154  VAL D CA  1 
ATOM   8278  C C   . VAL D 1 154 ? -13.125 -11.249 52.311  1.00 41.21  ? 154  VAL D C   1 
ATOM   8279  O O   . VAL D 1 154 ? -12.862 -10.054 52.153  1.00 39.81  ? 154  VAL D O   1 
ATOM   8280  C CB  . VAL D 1 154 ? -13.899 -12.050 54.629  1.00 41.50  ? 154  VAL D CB  1 
ATOM   8281  C CG1 . VAL D 1 154 ? -12.916 -11.046 55.238  1.00 39.30  ? 154  VAL D CG1 1 
ATOM   8282  C CG2 . VAL D 1 154 ? -15.117 -12.216 55.531  1.00 41.69  ? 154  VAL D CG2 1 
ATOM   8283  N N   . LEU D 1 155 ? -12.425 -12.238 51.725  1.00 37.56  ? 155  LEU D N   1 
ATOM   8284  C CA  . LEU D 1 155 ? -11.268 -11.983 50.859  1.00 36.11  ? 155  LEU D CA  1 
ATOM   8285  C C   . LEU D 1 155 ? -11.685 -11.274 49.564  1.00 39.31  ? 155  LEU D C   1 
ATOM   8286  O O   . LEU D 1 155 ? -11.012 -10.321 49.163  1.00 38.24  ? 155  LEU D O   1 
ATOM   8287  C CB  . LEU D 1 155 ? -10.501 -13.285 50.548  1.00 36.99  ? 155  LEU D CB  1 
ATOM   8288  C CG  . LEU D 1 155 ? -9.769  -13.932 51.737  1.00 40.66  ? 155  LEU D CG  1 
ATOM   8289  C CD1 . LEU D 1 155 ? -9.402  -15.356 51.450  1.00 41.68  ? 155  LEU D CD1 1 
ATOM   8290  C CD2 . LEU D 1 155 ? -8.548  -13.140 52.142  1.00 42.92  ? 155  LEU D CD2 1 
ATOM   8291  N N   . GLN D 1 156 ? -12.820 -11.697 48.951  1.00 36.20  ? 156  GLN D N   1 
ATOM   8292  C CA  . GLN D 1 156 ? -13.354 -11.081 47.727  1.00 36.33  ? 156  GLN D CA  1 
ATOM   8293  C C   . GLN D 1 156 ? -13.808 -9.646  47.995  1.00 40.12  ? 156  GLN D C   1 
ATOM   8294  O O   . GLN D 1 156 ? -13.498 -8.762  47.196  1.00 40.22  ? 156  GLN D O   1 
ATOM   8295  C CB  . GLN D 1 156 ? -14.511 -11.897 47.110  1.00 39.49  ? 156  GLN D CB  1 
ATOM   8296  C CG  . GLN D 1 156 ? -14.105 -13.213 46.452  1.00 40.73  ? 156  GLN D CG  1 
ATOM   8297  C CD  . GLN D 1 156 ? -13.127 -13.119 45.307  1.00 58.86  ? 156  GLN D CD  1 
ATOM   8298  O OE1 . GLN D 1 156 ? -12.347 -14.040 45.081  1.00 55.46  ? 156  GLN D OE1 1 
ATOM   8299  N NE2 . GLN D 1 156 ? -13.164 -12.047 44.526  1.00 55.14  ? 156  GLN D NE2 1 
ATOM   8300  N N   . LEU D 1 157 ? -14.493 -9.405  49.135  1.00 35.97  ? 157  LEU D N   1 
ATOM   8301  C CA  . LEU D 1 157 ? -14.931 -8.062  49.529  1.00 34.32  ? 157  LEU D CA  1 
ATOM   8302  C C   . LEU D 1 157 ? -13.739 -7.143  49.733  1.00 37.24  ? 157  LEU D C   1 
ATOM   8303  O O   . LEU D 1 157 ? -13.718 -6.047  49.186  1.00 37.09  ? 157  LEU D O   1 
ATOM   8304  C CB  . LEU D 1 157 ? -15.770 -8.092  50.823  1.00 33.93  ? 157  LEU D CB  1 
ATOM   8305  C CG  . LEU D 1 157 ? -17.190 -8.635  50.760  1.00 39.37  ? 157  LEU D CG  1 
ATOM   8306  C CD1 . LEU D 1 157 ? -17.763 -8.790  52.170  1.00 39.15  ? 157  LEU D CD1 1 
ATOM   8307  C CD2 . LEU D 1 157 ? -18.103 -7.775  49.863  1.00 40.86  ? 157  LEU D CD2 1 
ATOM   8308  N N   . SER D 1 158 ? -12.730 -7.617  50.491  1.00 33.53  ? 158  SER D N   1 
ATOM   8309  C CA  . SER D 1 158 ? -11.531 -6.870  50.854  1.00 32.17  ? 158  SER D CA  1 
ATOM   8310  C C   . SER D 1 158 ? -10.678 -6.502  49.648  1.00 37.32  ? 158  SER D C   1 
ATOM   8311  O O   . SER D 1 158 ? -10.110 -5.403  49.648  1.00 36.79  ? 158  SER D O   1 
ATOM   8312  C CB  . SER D 1 158 ? -10.702 -7.636  51.876  1.00 35.12  ? 158  SER D CB  1 
ATOM   8313  O OG  . SER D 1 158 ? -11.490 -7.873  53.030  1.00 44.88  ? 158  SER D OG  1 
ATOM   8314  N N   . LEU D 1 159 ? -10.603 -7.378  48.616  1.00 34.10  ? 159  LEU D N   1 
ATOM   8315  C CA  . LEU D 1 159 ? -9.849  -7.072  47.392  1.00 33.72  ? 159  LEU D CA  1 
ATOM   8316  C C   . LEU D 1 159 ? -10.469 -5.872  46.674  1.00 38.70  ? 159  LEU D C   1 
ATOM   8317  O O   . LEU D 1 159 ? -9.727  -5.023  46.175  1.00 38.97  ? 159  LEU D O   1 
ATOM   8318  C CB  . LEU D 1 159 ? -9.779  -8.276  46.442  1.00 35.13  ? 159  LEU D CB  1 
ATOM   8319  C CG  . LEU D 1 159 ? -8.825  -9.422  46.823  1.00 39.83  ? 159  LEU D CG  1 
ATOM   8320  C CD1 . LEU D 1 159 ? -9.088  -10.632 45.963  1.00 41.61  ? 159  LEU D CD1 1 
ATOM   8321  C CD2 . LEU D 1 159 ? -7.348  -9.009  46.726  1.00 41.21  ? 159  LEU D CD2 1 
ATOM   8322  N N   . ARG D 1 160 ? -11.825 -5.787  46.656  1.00 35.07  ? 160  ARG D N   1 
ATOM   8323  C CA  . ARG D 1 160 ? -12.592 -4.691  46.049  1.00 34.55  ? 160  ARG D CA  1 
ATOM   8324  C C   . ARG D 1 160 ? -12.475 -3.414  46.861  1.00 38.02  ? 160  ARG D C   1 
ATOM   8325  O O   . ARG D 1 160 ? -12.427 -2.332  46.280  1.00 38.36  ? 160  ARG D O   1 
ATOM   8326  C CB  . ARG D 1 160 ? -14.087 -5.047  45.890  1.00 32.61  ? 160  ARG D CB  1 
ATOM   8327  C CG  . ARG D 1 160 ? -14.398 -6.183  44.935  1.00 36.02  ? 160  ARG D CG  1 
ATOM   8328  C CD  . ARG D 1 160 ? -13.643 -6.103  43.623  1.00 46.88  ? 160  ARG D CD  1 
ATOM   8329  N NE  . ARG D 1 160 ? -12.949 -7.367  43.396  1.00 53.30  ? 160  ARG D NE  1 
ATOM   8330  C CZ  . ARG D 1 160 ? -11.661 -7.489  43.097  1.00 57.54  ? 160  ARG D CZ  1 
ATOM   8331  N NH1 . ARG D 1 160 ? -10.906 -6.412  42.927  1.00 41.76  ? 160  ARG D NH1 1 
ATOM   8332  N NH2 . ARG D 1 160 ? -11.126 -8.685  42.933  1.00 40.02  ? 160  ARG D NH2 1 
ATOM   8333  N N   . ILE D 1 161 ? -12.468 -3.534  48.199  1.00 33.51  ? 161  ILE D N   1 
ATOM   8334  C CA  . ILE D 1 161 ? -12.336 -2.388  49.100  1.00 31.79  ? 161  ILE D CA  1 
ATOM   8335  C C   . ILE D 1 161 ? -10.909 -1.808  48.932  1.00 35.43  ? 161  ILE D C   1 
ATOM   8336  O O   . ILE D 1 161 ? -10.770 -0.588  48.855  1.00 35.37  ? 161  ILE D O   1 
ATOM   8337  C CB  . ILE D 1 161 ? -12.709 -2.746  50.567  1.00 33.10  ? 161  ILE D CB  1 
ATOM   8338  C CG1 . ILE D 1 161 ? -14.215 -3.099  50.660  1.00 33.62  ? 161  ILE D CG1 1 
ATOM   8339  C CG2 . ILE D 1 161 ? -12.347 -1.608  51.539  1.00 30.86  ? 161  ILE D CG2 1 
ATOM   8340  C CD1 . ILE D 1 161 ? -14.608 -3.945  51.892  1.00 37.15  ? 161  ILE D CD1 1 
ATOM   8341  N N   . LEU D 1 162 ? -9.883  -2.670  48.759  1.00 31.51  ? 162  LEU D N   1 
ATOM   8342  C CA  . LEU D 1 162 ? -8.508  -2.215  48.518  1.00 30.80  ? 162  LEU D CA  1 
ATOM   8343  C C   . LEU D 1 162 ? -8.417  -1.395  47.233  1.00 34.99  ? 162  LEU D C   1 
ATOM   8344  O O   . LEU D 1 162 ? -7.664  -0.424  47.201  1.00 35.88  ? 162  LEU D O   1 
ATOM   8345  C CB  . LEU D 1 162 ? -7.495  -3.378  48.483  1.00 31.26  ? 162  LEU D CB  1 
ATOM   8346  C CG  . LEU D 1 162 ? -7.115  -4.011  49.842  1.00 35.37  ? 162  LEU D CG  1 
ATOM   8347  C CD1 . LEU D 1 162 ? -6.078  -5.080  49.661  1.00 35.39  ? 162  LEU D CD1 1 
ATOM   8348  C CD2 . LEU D 1 162 ? -6.604  -2.978  50.847  1.00 36.74  ? 162  LEU D CD2 1 
ATOM   8349  N N   . ASP D 1 163 ? -9.215  -1.749  46.203  1.00 31.66  ? 163  ASP D N   1 
ATOM   8350  C CA  . ASP D 1 163 ? -9.289  -1.014  44.932  1.00 31.46  ? 163  ASP D CA  1 
ATOM   8351  C C   . ASP D 1 163 ? -9.898  0.375   45.161  1.00 34.19  ? 163  ASP D C   1 
ATOM   8352  O O   . ASP D 1 163 ? -9.363  1.358   44.657  1.00 33.71  ? 163  ASP D O   1 
ATOM   8353  C CB  . ASP D 1 163 ? -10.110 -1.785  43.886  1.00 33.99  ? 163  ASP D CB  1 
ATOM   8354  C CG  . ASP D 1 163 ? -9.476  -3.037  43.302  1.00 41.56  ? 163  ASP D CG  1 
ATOM   8355  O OD1 . ASP D 1 163 ? -8.228  -3.171  43.374  1.00 42.21  ? 163  ASP D OD1 1 
ATOM   8356  O OD2 . ASP D 1 163 ? -10.215 -3.844  42.704  1.00 45.22  ? 163  ASP D OD2 1 
ATOM   8357  N N   . ILE D 1 164 ? -10.997 0.447   45.944  1.00 30.37  ? 164  ILE D N   1 
ATOM   8358  C CA  . ILE D 1 164 ? -11.711 1.682   46.305  1.00 29.55  ? 164  ILE D CA  1 
ATOM   8359  C C   . ILE D 1 164 ? -10.777 2.598   47.096  1.00 31.47  ? 164  ILE D C   1 
ATOM   8360  O O   . ILE D 1 164 ? -10.656 3.781   46.768  1.00 30.93  ? 164  ILE D O   1 
ATOM   8361  C CB  . ILE D 1 164 ? -13.018 1.388   47.117  1.00 32.65  ? 164  ILE D CB  1 
ATOM   8362  C CG1 . ILE D 1 164 ? -14.044 0.593   46.290  1.00 33.70  ? 164  ILE D CG1 1 
ATOM   8363  C CG2 . ILE D 1 164 ? -13.644 2.693   47.669  1.00 32.86  ? 164  ILE D CG2 1 
ATOM   8364  C CD1 . ILE D 1 164 ? -15.096 -0.198  47.131  1.00 35.20  ? 164  ILE D CD1 1 
ATOM   8365  N N   . LEU D 1 165 ? -10.136 2.044   48.142  1.00 26.91  ? 165  LEU D N   1 
ATOM   8366  C CA  . LEU D 1 165 ? -9.237  2.775   49.029  1.00 25.32  ? 165  LEU D CA  1 
ATOM   8367  C C   . LEU D 1 165 ? -8.027  3.299   48.266  1.00 28.15  ? 165  LEU D C   1 
ATOM   8368  O O   . LEU D 1 165 ? -7.746  4.483   48.386  1.00 27.02  ? 165  LEU D O   1 
ATOM   8369  C CB  . LEU D 1 165 ? -8.815  1.941   50.261  1.00 24.63  ? 165  LEU D CB  1 
ATOM   8370  C CG  . LEU D 1 165 ? -9.933  1.588   51.244  1.00 29.15  ? 165  LEU D CG  1 
ATOM   8371  C CD1 . LEU D 1 165 ? -9.398  0.750   52.410  1.00 28.78  ? 165  LEU D CD1 1 
ATOM   8372  C CD2 . LEU D 1 165 ? -10.693 2.835   51.738  1.00 30.09  ? 165  LEU D CD2 1 
ATOM   8373  N N   . GLU D 1 166 ? -7.370  2.475   47.421  1.00 25.62  ? 166  GLU D N   1 
ATOM   8374  C CA  . GLU D 1 166 ? -6.250  2.956   46.613  1.00 25.33  ? 166  GLU D CA  1 
ATOM   8375  C C   . GLU D 1 166 ? -6.674  4.167   45.752  1.00 31.37  ? 166  GLU D C   1 
ATOM   8376  O O   . GLU D 1 166 ? -5.956  5.170   45.719  1.00 30.93  ? 166  GLU D O   1 
ATOM   8377  C CB  . GLU D 1 166 ? -5.687  1.851   45.721  1.00 26.89  ? 166  GLU D CB  1 
ATOM   8378  C CG  . GLU D 1 166 ? -4.528  2.342   44.866  1.00 29.71  ? 166  GLU D CG  1 
ATOM   8379  C CD  . GLU D 1 166 ? -3.678  1.299   44.180  1.00 50.32  ? 166  GLU D CD  1 
ATOM   8380  O OE1 . GLU D 1 166 ? -4.149  0.151   44.014  1.00 52.57  ? 166  GLU D OE1 1 
ATOM   8381  O OE2 . GLU D 1 166 ? -2.540  1.641   43.786  1.00 41.09  ? 166  GLU D OE2 1 
ATOM   8382  N N   . TYR D 1 167 ? -7.850  4.075   45.085  1.00 28.72  ? 167  TYR D N   1 
ATOM   8383  C CA  . TYR D 1 167 ? -8.403  5.136   44.242  1.00 29.37  ? 167  TYR D CA  1 
ATOM   8384  C C   . TYR D 1 167 ? -8.598  6.453   45.012  1.00 34.52  ? 167  TYR D C   1 
ATOM   8385  O O   . TYR D 1 167 ? -8.070  7.477   44.584  1.00 34.73  ? 167  TYR D O   1 
ATOM   8386  C CB  . TYR D 1 167 ? -9.740  4.705   43.594  1.00 31.58  ? 167  TYR D CB  1 
ATOM   8387  C CG  . TYR D 1 167 ? -10.377 5.809   42.773  1.00 34.08  ? 167  TYR D CG  1 
ATOM   8388  C CD1 . TYR D 1 167 ? -11.285 6.698   43.345  1.00 36.28  ? 167  TYR D CD1 1 
ATOM   8389  C CD2 . TYR D 1 167 ? -10.023 6.008   41.446  1.00 35.47  ? 167  TYR D CD2 1 
ATOM   8390  C CE1 . TYR D 1 167 ? -11.819 7.759   42.614  1.00 37.50  ? 167  TYR D CE1 1 
ATOM   8391  C CE2 . TYR D 1 167 ? -10.577 7.042   40.693  1.00 37.54  ? 167  TYR D CE2 1 
ATOM   8392  C CZ  . TYR D 1 167 ? -11.462 7.926   41.286  1.00 43.77  ? 167  TYR D CZ  1 
ATOM   8393  O OH  . TYR D 1 167 ? -11.970 8.956   40.539  1.00 41.05  ? 167  TYR D OH  1 
ATOM   8394  N N   . ILE D 1 168 ? -9.368  6.431   46.119  1.00 31.50  ? 168  ILE D N   1 
ATOM   8395  C CA  . ILE D 1 168 ? -9.684  7.635   46.893  1.00 30.96  ? 168  ILE D CA  1 
ATOM   8396  C C   . ILE D 1 168 ? -8.413  8.229   47.524  1.00 34.16  ? 168  ILE D C   1 
ATOM   8397  O O   . ILE D 1 168 ? -8.275  9.458   47.525  1.00 35.20  ? 168  ILE D O   1 
ATOM   8398  C CB  . ILE D 1 168 ? -10.849 7.448   47.921  1.00 33.83  ? 168  ILE D CB  1 
ATOM   8399  C CG1 . ILE D 1 168 ? -10.503 6.481   49.063  1.00 33.39  ? 168  ILE D CG1 1 
ATOM   8400  C CG2 . ILE D 1 168 ? -12.160 7.039   47.205  1.00 35.26  ? 168  ILE D CG2 1 
ATOM   8401  C CD1 . ILE D 1 168 ? -11.353 6.657   50.295  1.00 39.54  ? 168  ILE D CD1 1 
ATOM   8402  N N   . HIS D 1 169 ? -7.473  7.368   47.995  1.00 28.35  ? 169  HIS D N   1 
ATOM   8403  C CA  . HIS D 1 169 ? -6.196  7.787   48.580  1.00 26.61  ? 169  HIS D CA  1 
ATOM   8404  C C   . HIS D 1 169 ? -5.343  8.500   47.536  1.00 30.90  ? 169  HIS D C   1 
ATOM   8405  O O   . HIS D 1 169 ? -4.743  9.526   47.847  1.00 30.79  ? 169  HIS D O   1 
ATOM   8406  C CB  . HIS D 1 169 ? -5.426  6.595   49.181  1.00 26.31  ? 169  HIS D CB  1 
ATOM   8407  C CG  . HIS D 1 169 ? -6.073  5.947   50.372  1.00 28.84  ? 169  HIS D CG  1 
ATOM   8408  N ND1 . HIS D 1 169 ? -5.565  4.777   50.916  1.00 29.98  ? 169  HIS D ND1 1 
ATOM   8409  C CD2 . HIS D 1 169 ? -7.178  6.305   51.066  1.00 30.84  ? 169  HIS D CD2 1 
ATOM   8410  C CE1 . HIS D 1 169 ? -6.366  4.473   51.922  1.00 29.88  ? 169  HIS D CE1 1 
ATOM   8411  N NE2 . HIS D 1 169 ? -7.350  5.365   52.051  1.00 30.55  ? 169  HIS D NE2 1 
ATOM   8412  N N   . GLU D 1 170 ? -5.340  7.995   46.288  1.00 28.34  ? 170  GLU D N   1 
ATOM   8413  C CA  . GLU D 1 170 ? -4.605  8.600   45.168  1.00 28.35  ? 170  GLU D CA  1 
ATOM   8414  C C   . GLU D 1 170 ? -5.258  9.900   44.710  1.00 33.83  ? 170  GLU D C   1 
ATOM   8415  O O   . GLU D 1 170 ? -4.623  10.681  43.999  1.00 34.84  ? 170  GLU D O   1 
ATOM   8416  C CB  . GLU D 1 170 ? -4.471  7.624   43.989  1.00 29.88  ? 170  GLU D CB  1 
ATOM   8417  C CG  . GLU D 1 170 ? -3.400  6.557   44.197  1.00 33.87  ? 170  GLU D CG  1 
ATOM   8418  C CD  . GLU D 1 170 ? -2.014  7.065   44.551  1.00 42.78  ? 170  GLU D CD  1 
ATOM   8419  O OE1 . GLU D 1 170 ? -1.396  7.748   43.703  1.00 37.45  ? 170  GLU D OE1 1 
ATOM   8420  O OE2 . GLU D 1 170 ? -1.548  6.787   45.680  1.00 35.78  ? 170  GLU D OE2 1 
ATOM   8421  N N   . HIS D 1 171 ? -6.508  10.143  45.138  1.00 30.60  ? 171  HIS D N   1 
ATOM   8422  C CA  . HIS D 1 171 ? -7.257  11.359  44.842  1.00 31.26  ? 171  HIS D CA  1 
ATOM   8423  C C   . HIS D 1 171 ? -7.378  12.259  46.093  1.00 37.70  ? 171  HIS D C   1 
ATOM   8424  O O   . HIS D 1 171 ? -8.322  13.043  46.216  1.00 38.63  ? 171  HIS D O   1 
ATOM   8425  C CB  . HIS D 1 171 ? -8.618  11.010  44.246  1.00 32.18  ? 171  HIS D CB  1 
ATOM   8426  C CG  . HIS D 1 171 ? -8.489  10.503  42.855  1.00 36.18  ? 171  HIS D CG  1 
ATOM   8427  N ND1 . HIS D 1 171 ? -8.104  9.200   42.599  1.00 37.71  ? 171  HIS D ND1 1 
ATOM   8428  C CD2 . HIS D 1 171 ? -8.620  11.164  41.681  1.00 38.65  ? 171  HIS D CD2 1 
ATOM   8429  C CE1 . HIS D 1 171 ? -8.033  9.102   41.283  1.00 37.72  ? 171  HIS D CE1 1 
ATOM   8430  N NE2 . HIS D 1 171 ? -8.359  10.253  40.688  1.00 38.80  ? 171  HIS D NE2 1 
ATOM   8431  N N   . GLU D 1 172 ? -6.361  12.173  46.987  1.00 34.50  ? 172  GLU D N   1 
ATOM   8432  C CA  . GLU D 1 172 ? -6.121  12.973  48.201  1.00 33.65  ? 172  GLU D CA  1 
ATOM   8433  C C   . GLU D 1 172 ? -7.144  12.776  49.336  1.00 35.31  ? 172  GLU D C   1 
ATOM   8434  O O   . GLU D 1 172 ? -7.131  13.571  50.272  1.00 34.53  ? 172  GLU D O   1 
ATOM   8435  C CB  . GLU D 1 172 ? -6.045  14.485  47.864  1.00 36.02  ? 172  GLU D CB  1 
ATOM   8436  C CG  . GLU D 1 172 ? -5.205  14.842  46.644  1.00 43.09  ? 172  GLU D CG  1 
ATOM   8437  C CD  . GLU D 1 172 ? -5.117  16.316  46.294  1.00 55.17  ? 172  GLU D CD  1 
ATOM   8438  O OE1 . GLU D 1 172 ? -6.135  17.029  46.451  1.00 45.55  ? 172  GLU D OE1 1 
ATOM   8439  O OE2 . GLU D 1 172 ? -4.042  16.744  45.809  1.00 43.05  ? 172  GLU D OE2 1 
ATOM   8440  N N   . TYR D 1 173 ? -7.972  11.716  49.303  1.00 31.11  ? 173  TYR D N   1 
ATOM   8441  C CA  . TYR D 1 173 ? -8.983  11.491  50.343  1.00 30.20  ? 173  TYR D CA  1 
ATOM   8442  C C   . TYR D 1 173 ? -8.865  10.173  51.077  1.00 30.65  ? 173  TYR D C   1 
ATOM   8443  O O   . TYR D 1 173 ? -8.429  9.181   50.508  1.00 29.53  ? 173  TYR D O   1 
ATOM   8444  C CB  . TYR D 1 173 ? -10.393 11.537  49.734  1.00 32.78  ? 173  TYR D CB  1 
ATOM   8445  C CG  . TYR D 1 173 ? -10.936 12.930  49.530  1.00 36.11  ? 173  TYR D CG  1 
ATOM   8446  C CD1 . TYR D 1 173 ? -11.597 13.600  50.558  1.00 38.58  ? 173  TYR D CD1 1 
ATOM   8447  C CD2 . TYR D 1 173 ? -10.849 13.559  48.293  1.00 37.97  ? 173  TYR D CD2 1 
ATOM   8448  C CE1 . TYR D 1 173 ? -12.124 14.876  50.371  1.00 40.14  ? 173  TYR D CE1 1 
ATOM   8449  C CE2 . TYR D 1 173 ? -11.380 14.834  48.092  1.00 40.30  ? 173  TYR D CE2 1 
ATOM   8450  C CZ  . TYR D 1 173 ? -12.021 15.488  49.136  1.00 46.76  ? 173  TYR D CZ  1 
ATOM   8451  O OH  . TYR D 1 173 ? -12.549 16.747  48.977  1.00 47.99  ? 173  TYR D OH  1 
ATOM   8452  N N   . VAL D 1 174 ? -9.350  10.156  52.324  1.00 25.98  ? 174  VAL D N   1 
ATOM   8453  C CA  . VAL D 1 174 ? -9.486  8.963   53.164  1.00 25.51  ? 174  VAL D CA  1 
ATOM   8454  C C   . VAL D 1 174 ? -10.954 8.896   53.611  1.00 31.10  ? 174  VAL D C   1 
ATOM   8455  O O   . VAL D 1 174 ? -11.572 9.945   53.804  1.00 31.16  ? 174  VAL D O   1 
ATOM   8456  C CB  . VAL D 1 174 ? -8.493  8.856   54.358  1.00 27.85  ? 174  VAL D CB  1 
ATOM   8457  C CG1 . VAL D 1 174 ? -7.069  8.647   53.867  1.00 26.72  ? 174  VAL D CG1 1 
ATOM   8458  C CG2 . VAL D 1 174 ? -8.585  10.055  55.297  1.00 27.67  ? 174  VAL D CG2 1 
ATOM   8459  N N   . HIS D 1 175 ? -11.517 7.677   53.726  1.00 28.28  ? 175  HIS D N   1 
ATOM   8460  C CA  . HIS D 1 175 ? -12.920 7.462   54.107  1.00 29.15  ? 175  HIS D CA  1 
ATOM   8461  C C   . HIS D 1 175 ? -13.107 7.566   55.637  1.00 33.87  ? 175  HIS D C   1 
ATOM   8462  O O   . HIS D 1 175 ? -13.974 8.304   56.094  1.00 35.91  ? 175  HIS D O   1 
ATOM   8463  C CB  . HIS D 1 175 ? -13.421 6.101   53.574  1.00 30.04  ? 175  HIS D CB  1 
ATOM   8464  C CG  . HIS D 1 175 ? -14.902 5.919   53.662  1.00 34.31  ? 175  HIS D CG  1 
ATOM   8465  N ND1 . HIS D 1 175 ? -15.499 5.423   54.799  1.00 36.01  ? 175  HIS D ND1 1 
ATOM   8466  C CD2 . HIS D 1 175 ? -15.864 6.195   52.753  1.00 37.13  ? 175  HIS D CD2 1 
ATOM   8467  C CE1 . HIS D 1 175 ? -16.797 5.397   54.545  1.00 36.71  ? 175  HIS D CE1 1 
ATOM   8468  N NE2 . HIS D 1 175 ? -17.062 5.843   53.324  1.00 37.71  ? 175  HIS D NE2 1 
ATOM   8469  N N   . GLY D 1 176 ? -12.309 6.824   56.400  1.00 28.81  ? 176  GLY D N   1 
ATOM   8470  C CA  . GLY D 1 176 ? -12.327 6.818   57.859  1.00 27.96  ? 176  GLY D CA  1 
ATOM   8471  C C   . GLY D 1 176 ? -13.523 6.168   58.533  1.00 32.69  ? 176  GLY D C   1 
ATOM   8472  O O   . GLY D 1 176 ? -13.631 6.231   59.765  1.00 31.80  ? 176  GLY D O   1 
ATOM   8473  N N   . ASP D 1 177 ? -14.440 5.547   57.750  1.00 30.35  ? 177  ASP D N   1 
ATOM   8474  C CA  . ASP D 1 177 ? -15.639 4.928   58.312  1.00 31.18  ? 177  ASP D CA  1 
ATOM   8475  C C   . ASP D 1 177 ? -16.123 3.719   57.475  1.00 36.03  ? 177  ASP D C   1 
ATOM   8476  O O   . ASP D 1 177 ? -17.321 3.568   57.200  1.00 36.11  ? 177  ASP D O   1 
ATOM   8477  C CB  . ASP D 1 177 ? -16.757 5.973   58.482  1.00 33.74  ? 177  ASP D CB  1 
ATOM   8478  C CG  . ASP D 1 177 ? -17.794 5.640   59.540  1.00 43.64  ? 177  ASP D CG  1 
ATOM   8479  O OD1 . ASP D 1 177 ? -17.673 4.565   60.184  1.00 42.61  ? 177  ASP D OD1 1 
ATOM   8480  O OD2 . ASP D 1 177 ? -18.729 6.447   59.722  1.00 52.21  ? 177  ASP D OD2 1 
ATOM   8481  N N   . ILE D 1 178 ? -15.182 2.838   57.106  1.00 32.48  ? 178  ILE D N   1 
ATOM   8482  C CA  . ILE D 1 178 ? -15.490 1.605   56.372  1.00 32.76  ? 178  ILE D CA  1 
ATOM   8483  C C   . ILE D 1 178 ? -16.185 0.627   57.344  1.00 34.93  ? 178  ILE D C   1 
ATOM   8484  O O   . ILE D 1 178 ? -15.695 0.401   58.450  1.00 33.11  ? 178  ILE D O   1 
ATOM   8485  C CB  . ILE D 1 178 ? -14.207 0.987   55.724  1.00 35.66  ? 178  ILE D CB  1 
ATOM   8486  C CG1 . ILE D 1 178 ? -13.460 2.001   54.804  1.00 35.67  ? 178  ILE D CG1 1 
ATOM   8487  C CG2 . ILE D 1 178 ? -14.517 -0.314  54.977  1.00 36.35  ? 178  ILE D CG2 1 
ATOM   8488  C CD1 . ILE D 1 178 ? -12.180 2.537   55.377  1.00 35.56  ? 178  ILE D CD1 1 
ATOM   8489  N N   . LYS D 1 179 ? -17.349 0.095   56.937  1.00 32.09  ? 179  LYS D N   1 
ATOM   8490  C CA  . LYS D 1 179 ? -18.172 -0.878  57.678  1.00 32.31  ? 179  LYS D CA  1 
ATOM   8491  C C   . LYS D 1 179 ? -19.213 -1.467  56.719  1.00 39.96  ? 179  LYS D C   1 
ATOM   8492  O O   . LYS D 1 179 ? -19.436 -0.897  55.647  1.00 40.42  ? 179  LYS D O   1 
ATOM   8493  C CB  . LYS D 1 179 ? -18.829 -0.271  58.942  1.00 33.19  ? 179  LYS D CB  1 
ATOM   8494  C CG  . LYS D 1 179 ? -19.712 0.943   58.699  1.00 33.36  ? 179  LYS D CG  1 
ATOM   8495  C CD  . LYS D 1 179 ? -20.098 1.606   60.003  1.00 38.51  ? 179  LYS D CD  1 
ATOM   8496  C CE  . LYS D 1 179 ? -20.844 2.889   59.739  1.00 41.84  ? 179  LYS D CE  1 
ATOM   8497  N NZ  . LYS D 1 179 ? -21.331 3.523   60.988  1.00 40.16  ? 179  LYS D NZ  1 
ATOM   8498  N N   . ALA D 1 180 ? -19.832 -2.609  57.095  1.00 37.49  ? 180  ALA D N   1 
ATOM   8499  C CA  . ALA D 1 180 ? -20.811 -3.334  56.280  1.00 38.29  ? 180  ALA D CA  1 
ATOM   8500  C C   . ALA D 1 180 ? -22.045 -2.479  55.915  1.00 44.13  ? 180  ALA D C   1 
ATOM   8501  O O   . ALA D 1 180 ? -22.567 -2.641  54.815  1.00 45.21  ? 180  ALA D O   1 
ATOM   8502  C CB  . ALA D 1 180 ? -21.241 -4.607  56.989  1.00 39.62  ? 180  ALA D CB  1 
ATOM   8503  N N   . SER D 1 181 ? -22.483 -1.554  56.803  1.00 40.32  ? 181  SER D N   1 
ATOM   8504  C CA  . SER D 1 181 ? -23.636 -0.687  56.537  1.00 40.94  ? 181  SER D CA  1 
ATOM   8505  C C   . SER D 1 181 ? -23.321 0.411   55.487  1.00 44.67  ? 181  SER D C   1 
ATOM   8506  O O   . SER D 1 181 ? -24.260 0.990   54.931  1.00 45.66  ? 181  SER D O   1 
ATOM   8507  C CB  . SER D 1 181 ? -24.161 -0.060  57.825  1.00 44.17  ? 181  SER D CB  1 
ATOM   8508  O OG  . SER D 1 181 ? -23.292 0.937   58.333  1.00 50.91  ? 181  SER D OG  1 
ATOM   8509  N N   . ASN D 1 182 ? -22.022 0.681   55.213  1.00 39.45  ? 182  ASN D N   1 
ATOM   8510  C CA  . ASN D 1 182 ? -21.557 1.661   54.216  1.00 39.34  ? 182  ASN D CA  1 
ATOM   8511  C C   . ASN D 1 182 ? -21.115 0.970   52.927  1.00 44.46  ? 182  ASN D C   1 
ATOM   8512  O O   . ASN D 1 182 ? -20.556 1.615   52.033  1.00 44.07  ? 182  ASN D O   1 
ATOM   8513  C CB  . ASN D 1 182 ? -20.423 2.528   54.763  1.00 38.14  ? 182  ASN D CB  1 
ATOM   8514  C CG  . ASN D 1 182 ? -20.891 3.617   55.691  1.00 47.50  ? 182  ASN D CG  1 
ATOM   8515  O OD1 . ASN D 1 182 ? -22.037 4.084   55.631  1.00 40.44  ? 182  ASN D OD1 1 
ATOM   8516  N ND2 . ASN D 1 182 ? -20.005 4.054   56.566  1.00 30.99  ? 182  ASN D ND2 1 
ATOM   8517  N N   . LEU D 1 183 ? -21.391 -0.342  52.829  1.00 41.76  ? 183  LEU D N   1 
ATOM   8518  C CA  . LEU D 1 183 ? -21.071 -1.149  51.664  1.00 41.80  ? 183  LEU D CA  1 
ATOM   8519  C C   . LEU D 1 183 ? -22.360 -1.664  51.059  1.00 47.94  ? 183  LEU D C   1 
ATOM   8520  O O   . LEU D 1 183 ? -23.050 -2.483  51.656  1.00 49.09  ? 183  LEU D O   1 
ATOM   8521  C CB  . LEU D 1 183 ? -20.104 -2.285  52.027  1.00 40.84  ? 183  LEU D CB  1 
ATOM   8522  C CG  . LEU D 1 183 ? -18.688 -1.860  52.418  1.00 43.17  ? 183  LEU D CG  1 
ATOM   8523  C CD1 . LEU D 1 183 ? -18.014 -2.945  53.228  1.00 42.67  ? 183  LEU D CD1 1 
ATOM   8524  C CD2 . LEU D 1 183 ? -17.854 -1.467  51.196  1.00 44.05  ? 183  LEU D CD2 1 
ATOM   8525  N N   . LEU D 1 184 ? -22.717 -1.117  49.899  1.00 45.56  ? 184  LEU D N   1 
ATOM   8526  C CA  . LEU D 1 184 ? -23.960 -1.434  49.199  1.00 47.39  ? 184  LEU D CA  1 
ATOM   8527  C C   . LEU D 1 184 ? -23.675 -2.165  47.894  1.00 51.68  ? 184  LEU D C   1 
ATOM   8528  O O   . LEU D 1 184 ? -22.703 -1.845  47.200  1.00 49.52  ? 184  LEU D O   1 
ATOM   8529  C CB  . LEU D 1 184 ? -24.755 -0.138  48.934  1.00 48.06  ? 184  LEU D CB  1 
ATOM   8530  C CG  . LEU D 1 184 ? -25.674 0.354   50.065  1.00 53.33  ? 184  LEU D CG  1 
ATOM   8531  C CD1 . LEU D 1 184 ? -24.892 0.887   51.250  1.00 51.33  ? 184  LEU D CD1 1 
ATOM   8532  C CD2 . LEU D 1 184 ? -26.589 1.459   49.579  1.00 57.70  ? 184  LEU D CD2 1 
ATOM   8533  N N   . LEU D 1 185 ? -24.503 -3.173  47.583  1.00 50.02  ? 185  LEU D N   1 
ATOM   8534  C CA  . LEU D 1 185 ? -24.346 -3.947  46.361  1.00 51.22  ? 185  LEU D CA  1 
ATOM   8535  C C   . LEU D 1 185 ? -24.963 -3.220  45.178  1.00 57.67  ? 185  LEU D C   1 
ATOM   8536  O O   . LEU D 1 185 ? -25.928 -2.470  45.344  1.00 58.06  ? 185  LEU D O   1 
ATOM   8537  C CB  . LEU D 1 185 ? -24.980 -5.347  46.485  1.00 52.65  ? 185  LEU D CB  1 
ATOM   8538  C CG  . LEU D 1 185 ? -24.397 -6.326  47.513  1.00 56.02  ? 185  LEU D CG  1 
ATOM   8539  C CD1 . LEU D 1 185 ? -25.178 -7.618  47.507  1.00 57.55  ? 185  LEU D CD1 1 
ATOM   8540  C CD2 . LEU D 1 185 ? -22.913 -6.625  47.251  1.00 55.48  ? 185  LEU D CD2 1 
ATOM   8541  N N   . ASN D 1 186 ? -24.415 -3.462  43.980  1.00 55.58  ? 186  ASN D N   1 
ATOM   8542  C CA  . ASN D 1 186 ? -24.950 -2.920  42.739  1.00 57.81  ? 186  ASN D CA  1 
ATOM   8543  C C   . ASN D 1 186 ? -26.369 -3.488  42.573  1.00 66.33  ? 186  ASN D C   1 
ATOM   8544  O O   . ASN D 1 186 ? -26.575 -4.693  42.775  1.00 66.50  ? 186  ASN D O   1 
ATOM   8545  C CB  . ASN D 1 186 ? -24.032 -3.281  41.566  1.00 58.17  ? 186  ASN D CB  1 
ATOM   8546  C CG  . ASN D 1 186 ? -24.466 -2.743  40.228  1.00 78.11  ? 186  ASN D CG  1 
ATOM   8547  O OD1 . ASN D 1 186 ? -25.367 -3.276  39.578  1.00 75.29  ? 186  ASN D OD1 1 
ATOM   8548  N ND2 . ASN D 1 186 ? -23.801 -1.700  39.765  1.00 68.68  ? 186  ASN D ND2 1 
ATOM   8549  N N   . TYR D 1 187 ? -27.348 -2.606  42.293  1.00 65.65  ? 187  TYR D N   1 
ATOM   8550  C CA  . TYR D 1 187 ? -28.762 -2.959  42.152  1.00 68.86  ? 187  TYR D CA  1 
ATOM   8551  C C   . TYR D 1 187 ? -28.970 -4.057  41.097  1.00 74.78  ? 187  TYR D C   1 
ATOM   8552  O O   . TYR D 1 187 ? -29.823 -4.921  41.290  1.00 75.81  ? 187  TYR D O   1 
ATOM   8553  C CB  . TYR D 1 187 ? -29.598 -1.702  41.826  1.00 71.84  ? 187  TYR D CB  1 
ATOM   8554  C CG  . TYR D 1 187 ? -31.100 -1.912  41.815  1.00 76.98  ? 187  TYR D CG  1 
ATOM   8555  C CD1 . TYR D 1 187 ? -31.804 -1.981  40.618  1.00 81.56  ? 187  TYR D CD1 1 
ATOM   8556  C CD2 . TYR D 1 187 ? -31.828 -1.964  43.003  1.00 78.23  ? 187  TYR D CD2 1 
ATOM   8557  C CE1 . TYR D 1 187 ? -33.190 -2.151  40.601  1.00 85.76  ? 187  TYR D CE1 1 
ATOM   8558  C CE2 . TYR D 1 187 ? -33.212 -2.131  42.998  1.00 82.10  ? 187  TYR D CE2 1 
ATOM   8559  C CZ  . TYR D 1 187 ? -33.894 -2.208  41.795  1.00 92.76  ? 187  TYR D CZ  1 
ATOM   8560  O OH  . TYR D 1 187 ? -35.255 -2.415  41.814  1.00 96.89  ? 187  TYR D OH  1 
ATOM   8561  N N   . LYS D 1 188 ? -28.169 -4.039  40.013  1.00 71.50  ? 188  LYS D N   1 
ATOM   8562  C CA  . LYS D 1 188 ? -28.229 -5.001  38.909  1.00 73.33  ? 188  LYS D CA  1 
ATOM   8563  C C   . LYS D 1 188 ? -27.231 -6.174  39.072  1.00 75.75  ? 188  LYS D C   1 
ATOM   8564  O O   . LYS D 1 188 ? -27.473 -7.244  38.504  1.00 77.35  ? 188  LYS D O   1 
ATOM   8565  C CB  . LYS D 1 188 ? -27.967 -4.286  37.571  1.00 76.46  ? 188  LYS D CB  1 
ATOM   8566  N N   . ASN D 1 189 ? -26.113 -5.973  39.812  1.00 68.37  ? 189  ASN D N   1 
ATOM   8567  C CA  . ASN D 1 189 ? -25.083 -7.006  39.999  1.00 66.63  ? 189  ASN D CA  1 
ATOM   8568  C C   . ASN D 1 189 ? -24.766 -7.242  41.492  1.00 68.52  ? 189  ASN D C   1 
ATOM   8569  O O   . ASN D 1 189 ? -24.102 -6.408  42.117  1.00 65.85  ? 189  ASN D O   1 
ATOM   8570  C CB  . ASN D 1 189 ? -23.796 -6.651  39.227  1.00 63.27  ? 189  ASN D CB  1 
ATOM   8571  C CG  . ASN D 1 189 ? -22.830 -7.800  39.007  1.00 75.21  ? 189  ASN D CG  1 
ATOM   8572  O OD1 . ASN D 1 189 ? -22.797 -8.803  39.737  1.00 64.39  ? 189  ASN D OD1 1 
ATOM   8573  N ND2 . ASN D 1 189 ? -21.999 -7.663  37.989  1.00 65.70  ? 189  ASN D ND2 1 
ATOM   8574  N N   . PRO D 1 190 ? -25.155 -8.413  42.060  1.00 65.43  ? 190  PRO D N   1 
ATOM   8575  C CA  . PRO D 1 190 ? -24.865 -8.671  43.484  1.00 63.02  ? 190  PRO D CA  1 
ATOM   8576  C C   . PRO D 1 190 ? -23.404 -9.065  43.770  1.00 63.82  ? 190  PRO D C   1 
ATOM   8577  O O   . PRO D 1 190 ? -23.081 -9.370  44.919  1.00 62.40  ? 190  PRO D O   1 
ATOM   8578  C CB  . PRO D 1 190 ? -25.831 -9.800  43.843  1.00 66.84  ? 190  PRO D CB  1 
ATOM   8579  C CG  . PRO D 1 190 ? -26.062 -10.518 42.571  1.00 73.80  ? 190  PRO D CG  1 
ATOM   8580  C CD  . PRO D 1 190 ? -25.938 -9.515  41.458  1.00 69.58  ? 190  PRO D CD  1 
ATOM   8581  N N   . ASP D 1 191 ? -22.524 -9.044  42.747  1.00 58.98  ? 191  ASP D N   1 
ATOM   8582  C CA  . ASP D 1 191 ? -21.102 -9.360  42.905  1.00 55.97  ? 191  ASP D CA  1 
ATOM   8583  C C   . ASP D 1 191 ? -20.248 -8.089  42.894  1.00 55.96  ? 191  ASP D C   1 
ATOM   8584  O O   . ASP D 1 191 ? -19.021 -8.178  43.029  1.00 55.22  ? 191  ASP D O   1 
ATOM   8585  C CB  . ASP D 1 191 ? -20.612 -10.354 41.832  1.00 58.55  ? 191  ASP D CB  1 
ATOM   8586  C CG  . ASP D 1 191 ? -21.045 -11.790 42.050  1.00 66.35  ? 191  ASP D CG  1 
ATOM   8587  O OD1 . ASP D 1 191 ? -21.101 -12.227 43.224  1.00 64.45  ? 191  ASP D OD1 1 
ATOM   8588  O OD2 . ASP D 1 191 ? -21.279 -12.493 41.051  1.00 76.37  ? 191  ASP D OD2 1 
ATOM   8589  N N   . GLN D 1 192 ? -20.898 -6.908  42.801  1.00 49.57  ? 192  GLN D N   1 
ATOM   8590  C CA  . GLN D 1 192 ? -20.219 -5.607  42.805  1.00 45.76  ? 192  GLN D CA  1 
ATOM   8591  C C   . GLN D 1 192 ? -20.601 -4.812  44.050  1.00 47.58  ? 192  GLN D C   1 
ATOM   8592  O O   . GLN D 1 192 ? -21.769 -4.446  44.221  1.00 47.69  ? 192  GLN D O   1 
ATOM   8593  C CB  . GLN D 1 192 ? -20.538 -4.809  41.533  1.00 47.18  ? 192  GLN D CB  1 
ATOM   8594  C CG  . GLN D 1 192 ? -20.027 -5.474  40.264  1.00 51.02  ? 192  GLN D CG  1 
ATOM   8595  C CD  . GLN D 1 192 ? -20.176 -4.638  39.013  1.00 58.71  ? 192  GLN D CD  1 
ATOM   8596  O OE1 . GLN D 1 192 ? -20.940 -3.669  38.943  1.00 47.54  ? 192  GLN D OE1 1 
ATOM   8597  N NE2 . GLN D 1 192 ? -19.454 -5.020  37.978  1.00 52.99  ? 192  GLN D NE2 1 
ATOM   8598  N N   . VAL D 1 193 ? -19.614 -4.570  44.933  1.00 42.06  ? 193  VAL D N   1 
ATOM   8599  C CA  . VAL D 1 193 ? -19.814 -3.834  46.178  1.00 40.46  ? 193  VAL D CA  1 
ATOM   8600  C C   . VAL D 1 193 ? -19.247 -2.394  46.025  1.00 44.38  ? 193  VAL D C   1 
ATOM   8601  O O   . VAL D 1 193 ? -18.214 -2.179  45.382  1.00 43.35  ? 193  VAL D O   1 
ATOM   8602  C CB  . VAL D 1 193 ? -19.255 -4.609  47.406  1.00 42.79  ? 193  VAL D CB  1 
ATOM   8603  C CG1 . VAL D 1 193 ? -17.724 -4.734  47.391  1.00 41.27  ? 193  VAL D CG1 1 
ATOM   8604  C CG2 . VAL D 1 193 ? -19.763 -4.019  48.721  1.00 41.88  ? 193  VAL D CG2 1 
ATOM   8605  N N   . TYR D 1 194 ? -19.975 -1.420  46.580  1.00 41.23  ? 194  TYR D N   1 
ATOM   8606  C CA  . TYR D 1 194 ? -19.657 0.004   46.526  1.00 40.02  ? 194  TYR D CA  1 
ATOM   8607  C C   . TYR D 1 194 ? -19.557 0.588   47.919  1.00 41.65  ? 194  TYR D C   1 
ATOM   8608  O O   . TYR D 1 194 ? -20.363 0.235   48.782  1.00 42.20  ? 194  TYR D O   1 
ATOM   8609  C CB  . TYR D 1 194 ? -20.753 0.749   45.731  1.00 43.31  ? 194  TYR D CB  1 
ATOM   8610  C CG  . TYR D 1 194 ? -20.642 0.629   44.231  1.00 45.79  ? 194  TYR D CG  1 
ATOM   8611  C CD1 . TYR D 1 194 ? -21.020 -0.540  43.575  1.00 48.79  ? 194  TYR D CD1 1 
ATOM   8612  C CD2 . TYR D 1 194 ? -20.246 1.712   43.456  1.00 46.47  ? 194  TYR D CD2 1 
ATOM   8613  C CE1 . TYR D 1 194 ? -20.924 -0.655  42.191  1.00 50.69  ? 194  TYR D CE1 1 
ATOM   8614  C CE2 . TYR D 1 194 ? -20.155 1.613   42.071  1.00 48.60  ? 194  TYR D CE2 1 
ATOM   8615  C CZ  . TYR D 1 194 ? -20.493 0.426   41.441  1.00 59.74  ? 194  TYR D CZ  1 
ATOM   8616  O OH  . TYR D 1 194 ? -20.419 0.328   40.070  1.00 66.92  ? 194  TYR D OH  1 
ATOM   8617  N N   . LEU D 1 195 ? -18.590 1.493   48.139  1.00 36.64  ? 195  LEU D N   1 
ATOM   8618  C CA  . LEU D 1 195 ? -18.399 2.172   49.422  1.00 35.22  ? 195  LEU D CA  1 
ATOM   8619  C C   . LEU D 1 195 ? -19.104 3.539   49.360  1.00 40.98  ? 195  LEU D C   1 
ATOM   8620  O O   . LEU D 1 195 ? -18.820 4.346   48.467  1.00 40.50  ? 195  LEU D O   1 
ATOM   8621  C CB  . LEU D 1 195 ? -16.899 2.309   49.760  1.00 32.90  ? 195  LEU D CB  1 
ATOM   8622  C CG  . LEU D 1 195 ? -16.522 3.005   51.080  1.00 36.02  ? 195  LEU D CG  1 
ATOM   8623  C CD1 . LEU D 1 195 ? -16.971 2.195   52.311  1.00 35.27  ? 195  LEU D CD1 1 
ATOM   8624  C CD2 . LEU D 1 195 ? -15.023 3.259   51.138  1.00 36.73  ? 195  LEU D CD2 1 
ATOM   8625  N N   . VAL D 1 196 ? -20.042 3.776   50.296  1.00 37.27  ? 196  VAL D N   1 
ATOM   8626  C CA  . VAL D 1 196 ? -20.818 5.019   50.351  1.00 37.22  ? 196  VAL D CA  1 
ATOM   8627  C C   . VAL D 1 196 ? -20.446 5.821   51.616  1.00 41.70  ? 196  VAL D C   1 
ATOM   8628  O O   . VAL D 1 196 ? -19.661 5.343   52.440  1.00 38.81  ? 196  VAL D O   1 
ATOM   8629  C CB  . VAL D 1 196 ? -22.366 4.775   50.243  1.00 41.73  ? 196  VAL D CB  1 
ATOM   8630  C CG1 . VAL D 1 196 ? -22.734 4.051   48.948  1.00 42.12  ? 196  VAL D CG1 1 
ATOM   8631  C CG2 . VAL D 1 196 ? -22.920 4.027   51.459  1.00 41.41  ? 196  VAL D CG2 1 
ATOM   8632  N N   . ASP D 1 197 ? -21.034 7.038   51.751  1.00 41.01  ? 197  ASP D N   1 
ATOM   8633  C CA  . ASP D 1 197 ? -20.913 7.991   52.860  1.00 40.90  ? 197  ASP D CA  1 
ATOM   8634  C C   . ASP D 1 197 ? -19.528 8.654   52.912  1.00 44.87  ? 197  ASP D C   1 
ATOM   8635  O O   . ASP D 1 197 ? -18.584 8.121   53.499  1.00 43.38  ? 197  ASP D O   1 
ATOM   8636  C CB  . ASP D 1 197 ? -21.271 7.351   54.223  1.00 42.31  ? 197  ASP D CB  1 
ATOM   8637  C CG  . ASP D 1 197 ? -21.601 8.323   55.342  1.00 54.31  ? 197  ASP D CG  1 
ATOM   8638  O OD1 . ASP D 1 197 ? -21.272 9.523   55.212  1.00 53.71  ? 197  ASP D OD1 1 
ATOM   8639  O OD2 . ASP D 1 197 ? -22.188 7.885   56.351  1.00 65.84  ? 197  ASP D OD2 1 
ATOM   8640  N N   . TYR D 1 198 ? -19.443 9.859   52.344  1.00 42.45  ? 198  TYR D N   1 
ATOM   8641  C CA  . TYR D 1 198 ? -18.219 10.658  52.327  1.00 40.83  ? 198  TYR D CA  1 
ATOM   8642  C C   . TYR D 1 198 ? -18.459 11.994  53.042  1.00 47.63  ? 198  TYR D C   1 
ATOM   8643  O O   . TYR D 1 198 ? -17.687 12.940  52.887  1.00 46.79  ? 198  TYR D O   1 
ATOM   8644  C CB  . TYR D 1 198 ? -17.719 10.849  50.883  1.00 40.49  ? 198  TYR D CB  1 
ATOM   8645  C CG  . TYR D 1 198 ? -17.348 9.534   50.220  1.00 39.91  ? 198  TYR D CG  1 
ATOM   8646  C CD1 . TYR D 1 198 ? -16.060 9.007   50.334  1.00 39.82  ? 198  TYR D CD1 1 
ATOM   8647  C CD2 . TYR D 1 198 ? -18.293 8.797   49.515  1.00 41.12  ? 198  TYR D CD2 1 
ATOM   8648  C CE1 . TYR D 1 198 ? -15.722 7.789   49.744  1.00 38.51  ? 198  TYR D CE1 1 
ATOM   8649  C CE2 . TYR D 1 198 ? -17.972 7.568   48.943  1.00 41.41  ? 198  TYR D CE2 1 
ATOM   8650  C CZ  . TYR D 1 198 ? -16.685 7.069   49.057  1.00 46.08  ? 198  TYR D CZ  1 
ATOM   8651  O OH  . TYR D 1 198 ? -16.372 5.866   48.472  1.00 45.33  ? 198  TYR D OH  1 
ATOM   8652  N N   . GLY D 1 199 ? -19.504 12.024  53.864  1.00 47.73  ? 199  GLY D N   1 
ATOM   8653  C CA  . GLY D 1 199 ? -19.883 13.177  54.672  1.00 49.90  ? 199  GLY D CA  1 
ATOM   8654  C C   . GLY D 1 199 ? -18.839 13.533  55.713  1.00 55.55  ? 199  GLY D C   1 
ATOM   8655  O O   . GLY D 1 199 ? -18.734 14.697  56.112  1.00 57.03  ? 199  GLY D O   1 
ATOM   8656  N N   . LEU D 1 200 ? -18.058 12.524  56.154  1.00 50.68  ? 200  LEU D N   1 
ATOM   8657  C CA  . LEU D 1 200 ? -16.981 12.672  57.122  1.00 49.27  ? 200  LEU D CA  1 
ATOM   8658  C C   . LEU D 1 200 ? -15.620 12.309  56.493  1.00 49.80  ? 200  LEU D C   1 
ATOM   8659  O O   . LEU D 1 200 ? -14.641 12.115  57.226  1.00 48.76  ? 200  LEU D O   1 
ATOM   8660  C CB  . LEU D 1 200 ? -17.267 11.805  58.365  1.00 49.41  ? 200  LEU D CB  1 
ATOM   8661  N N   . ALA D 1 201 ? -15.554 12.224  55.137  1.00 43.93  ? 201  ALA D N   1 
ATOM   8662  C CA  . ALA D 1 201 ? -14.317 11.912  54.417  1.00 41.40  ? 201  ALA D CA  1 
ATOM   8663  C C   . ALA D 1 201 ? -13.301 13.030  54.642  1.00 42.99  ? 201  ALA D C   1 
ATOM   8664  O O   . ALA D 1 201 ? -13.689 14.167  54.949  1.00 44.27  ? 201  ALA D O   1 
ATOM   8665  C CB  . ALA D 1 201 ? -14.589 11.720  52.941  1.00 42.25  ? 201  ALA D CB  1 
ATOM   8666  N N   . TYR D 1 202 ? -12.009 12.708  54.551  1.00 34.69  ? 202  TYR D N   1 
ATOM   8667  C CA  . TYR D 1 202 ? -10.995 13.700  54.859  1.00 32.14  ? 202  TYR D CA  1 
ATOM   8668  C C   . TYR D 1 202 ? -9.935  13.811  53.777  1.00 36.35  ? 202  TYR D C   1 
ATOM   8669  O O   . TYR D 1 202 ? -9.404  12.804  53.315  1.00 35.48  ? 202  TYR D O   1 
ATOM   8670  C CB  . TYR D 1 202 ? -10.361 13.363  56.210  1.00 30.75  ? 202  TYR D CB  1 
ATOM   8671  C CG  . TYR D 1 202 ? -9.304  14.340  56.684  1.00 29.99  ? 202  TYR D CG  1 
ATOM   8672  C CD1 . TYR D 1 202 ? -9.644  15.636  57.074  1.00 31.70  ? 202  TYR D CD1 1 
ATOM   8673  C CD2 . TYR D 1 202 ? -7.971  13.959  56.781  1.00 29.61  ? 202  TYR D CD2 1 
ATOM   8674  C CE1 . TYR D 1 202 ? -8.673  16.542  57.498  1.00 31.18  ? 202  TYR D CE1 1 
ATOM   8675  C CE2 . TYR D 1 202 ? -6.992  14.856  57.205  1.00 30.59  ? 202  TYR D CE2 1 
ATOM   8676  C CZ  . TYR D 1 202 ? -7.350  16.148  57.562  1.00 38.15  ? 202  TYR D CZ  1 
ATOM   8677  O OH  . TYR D 1 202 ? -6.428  17.066  57.962  1.00 39.26  ? 202  TYR D OH  1 
ATOM   8678  N N   . ARG D 1 203 ? -9.637  15.058  53.377  1.00 33.23  ? 203  ARG D N   1 
ATOM   8679  C CA  . ARG D 1 203 ? -8.619  15.394  52.387  1.00 32.46  ? 203  ARG D CA  1 
ATOM   8680  C C   . ARG D 1 203 ? -7.281  15.494  53.123  1.00 35.74  ? 203  ARG D C   1 
ATOM   8681  O O   . ARG D 1 203 ? -6.899  16.570  53.594  1.00 36.23  ? 203  ARG D O   1 
ATOM   8682  C CB  . ARG D 1 203 ? -8.991  16.689  51.657  1.00 33.99  ? 203  ARG D CB  1 
ATOM   8683  C CG  . ARG D 1 203 ? -8.333  16.834  50.304  1.00 39.55  ? 203  ARG D CG  1 
ATOM   8684  C CD  . ARG D 1 203 ? -8.738  18.147  49.693  1.00 48.21  ? 203  ARG D CD  1 
ATOM   8685  N NE  . ARG D 1 203 ? -7.982  18.433  48.475  1.00 55.05  ? 203  ARG D NE  1 
ATOM   8686  C CZ  . ARG D 1 203 ? -7.733  19.656  48.017  1.00 71.04  ? 203  ARG D CZ  1 
ATOM   8687  N NH1 . ARG D 1 203 ? -8.165  20.724  48.680  1.00 60.93  ? 203  ARG D NH1 1 
ATOM   8688  N NH2 . ARG D 1 203 ? -7.030  19.824  46.905  1.00 57.85  ? 203  ARG D NH2 1 
ATOM   8689  N N   . TYR D 1 204 ? -6.617  14.330  53.288  1.00 31.16  ? 204  TYR D N   1 
ATOM   8690  C CA  . TYR D 1 204 ? -5.373  14.149  54.030  1.00 30.46  ? 204  TYR D CA  1 
ATOM   8691  C C   . TYR D 1 204 ? -4.143  14.737  53.304  1.00 37.72  ? 204  TYR D C   1 
ATOM   8692  O O   . TYR D 1 204 ? -3.141  15.005  53.972  1.00 35.99  ? 204  TYR D O   1 
ATOM   8693  C CB  . TYR D 1 204 ? -5.155  12.654  54.356  1.00 29.66  ? 204  TYR D CB  1 
ATOM   8694  C CG  . TYR D 1 204 ? -4.615  11.856  53.194  1.00 28.74  ? 204  TYR D CG  1 
ATOM   8695  C CD1 . TYR D 1 204 ? -5.460  11.396  52.185  1.00 29.91  ? 204  TYR D CD1 1 
ATOM   8696  C CD2 . TYR D 1 204 ? -3.253  11.623  53.060  1.00 27.99  ? 204  TYR D CD2 1 
ATOM   8697  C CE1 . TYR D 1 204 ? -4.965  10.702  51.090  1.00 28.02  ? 204  TYR D CE1 1 
ATOM   8698  C CE2 . TYR D 1 204 ? -2.742  10.955  51.951  1.00 28.11  ? 204  TYR D CE2 1 
ATOM   8699  C CZ  . TYR D 1 204 ? -3.604  10.502  50.965  1.00 31.49  ? 204  TYR D CZ  1 
ATOM   8700  O OH  . TYR D 1 204 ? -3.124  9.841   49.865  1.00 28.44  ? 204  TYR D OH  1 
ATOM   8701  N N   . CYS D 1 205 ? -4.167  14.870  51.961  1.00 38.73  ? 205  CYS D N   1 
ATOM   8702  C CA  . CYS D 1 205 ? -3.021  15.507  51.315  1.00 41.33  ? 205  CYS D CA  1 
ATOM   8703  C C   . CYS D 1 205 ? -3.459  16.470  50.185  1.00 46.06  ? 205  CYS D C   1 
ATOM   8704  O O   . CYS D 1 205 ? -3.280  16.197  48.989  1.00 44.87  ? 205  CYS D O   1 
ATOM   8705  C CB  . CYS D 1 205 ? -1.918  14.539  50.878  1.00 42.55  ? 205  CYS D CB  1 
ATOM   8706  S SG  . CYS D 1 205 ? -2.356  13.443  49.520  1.00 47.48  ? 205  CYS D SG  1 
ATOM   8707  N N   . PRO D 1 206 ? -3.990  17.656  50.591  1.00 43.51  ? 206  PRO D N   1 
ATOM   8708  C CA  . PRO D 1 206 ? -4.363  18.669  49.594  1.00 44.60  ? 206  PRO D CA  1 
ATOM   8709  C C   . PRO D 1 206 ? -3.138  19.146  48.807  1.00 50.16  ? 206  PRO D C   1 
ATOM   8710  O O   . PRO D 1 206 ? -2.114  19.490  49.400  1.00 49.60  ? 206  PRO D O   1 
ATOM   8711  C CB  . PRO D 1 206 ? -4.973  19.792  50.442  1.00 46.80  ? 206  PRO D CB  1 
ATOM   8712  C CG  . PRO D 1 206 ? -4.400  19.612  51.801  1.00 49.79  ? 206  PRO D CG  1 
ATOM   8713  C CD  . PRO D 1 206 ? -4.241  18.140  51.969  1.00 44.35  ? 206  PRO D CD  1 
ATOM   8714  N N   . GLU D 1 207 ? -3.239  19.115  47.460  1.00 48.15  ? 207  GLU D N   1 
ATOM   8715  C CA  . GLU D 1 207 ? -2.194  19.522  46.500  1.00 48.28  ? 207  GLU D CA  1 
ATOM   8716  C C   . GLU D 1 207 ? -0.887  18.709  46.696  1.00 49.45  ? 207  GLU D C   1 
ATOM   8717  O O   . GLU D 1 207 ? 0.213   19.236  46.508  1.00 49.30  ? 207  GLU D O   1 
ATOM   8718  C CB  . GLU D 1 207 ? -1.910  21.047  46.576  1.00 51.05  ? 207  GLU D CB  1 
ATOM   8719  C CG  . GLU D 1 207 ? -3.138  21.957  46.590  1.00 67.02  ? 207  GLU D CG  1 
ATOM   8720  C CD  . GLU D 1 207 ? -4.093  21.918  45.410  1.00 93.91  ? 207  GLU D CD  1 
ATOM   8721  O OE1 . GLU D 1 207 ? -3.648  21.603  44.282  1.00 90.55  ? 207  GLU D OE1 1 
ATOM   8722  O OE2 . GLU D 1 207 ? -5.287  22.240  45.611  1.00 93.49  ? 207  GLU D OE2 1 
ATOM   8723  N N   . GLY D 1 208 ? -1.032  17.440  47.080  1.00 43.82  ? 208  GLY D N   1 
ATOM   8724  C CA  . GLY D 1 208 ? 0.084   16.528  47.311  1.00 41.74  ? 208  GLY D CA  1 
ATOM   8725  C C   . GLY D 1 208 ? 0.878   16.758  48.584  1.00 42.31  ? 208  GLY D C   1 
ATOM   8726  O O   . GLY D 1 208 ? 1.938   16.154  48.758  1.00 41.75  ? 208  GLY D O   1 
ATOM   8727  N N   . VAL D 1 209 ? 0.370   17.603  49.497  1.00 37.34  ? 209  VAL D N   1 
ATOM   8728  C CA  . VAL D 1 209 ? 1.035   17.898  50.775  1.00 36.03  ? 209  VAL D CA  1 
ATOM   8729  C C   . VAL D 1 209 ? 0.275   17.177  51.896  1.00 38.12  ? 209  VAL D C   1 
ATOM   8730  O O   . VAL D 1 209 ? -0.850  17.571  52.223  1.00 38.93  ? 209  VAL D O   1 
ATOM   8731  C CB  . VAL D 1 209 ? 1.166   19.429  51.052  1.00 40.13  ? 209  VAL D CB  1 
ATOM   8732  C CG1 . VAL D 1 209 ? 1.955   19.695  52.333  1.00 39.61  ? 209  VAL D CG1 1 
ATOM   8733  C CG2 . VAL D 1 209 ? 1.785   20.166  49.867  1.00 40.31  ? 209  VAL D CG2 1 
ATOM   8734  N N   . HIS D 1 210 ? 0.894   16.132  52.485  1.00 31.20  ? 210  HIS D N   1 
ATOM   8735  C CA  . HIS D 1 210 ? 0.285   15.349  53.556  1.00 29.30  ? 210  HIS D CA  1 
ATOM   8736  C C   . HIS D 1 210 ? 0.136   16.177  54.827  1.00 32.64  ? 210  HIS D C   1 
ATOM   8737  O O   . HIS D 1 210 ? 1.046   16.925  55.202  1.00 32.87  ? 210  HIS D O   1 
ATOM   8738  C CB  . HIS D 1 210 ? 1.103   14.075  53.848  1.00 29.26  ? 210  HIS D CB  1 
ATOM   8739  C CG  . HIS D 1 210 ? 0.327   12.963  54.506  1.00 31.76  ? 210  HIS D CG  1 
ATOM   8740  N ND1 . HIS D 1 210 ? -0.202  13.095  55.791  1.00 32.94  ? 210  HIS D ND1 1 
ATOM   8741  C CD2 . HIS D 1 210 ? 0.075   11.709  54.066  1.00 32.32  ? 210  HIS D CD2 1 
ATOM   8742  C CE1 . HIS D 1 210 ? -0.792  11.942  56.060  1.00 31.38  ? 210  HIS D CE1 1 
ATOM   8743  N NE2 . HIS D 1 210 ? -0.643  11.072  55.064  1.00 31.47  ? 210  HIS D NE2 1 
ATOM   8744  N N   . LYS D 1 211 ? -1.024  16.031  55.481  1.00 27.78  ? 211  LYS D N   1 
ATOM   8745  C CA  . LYS D 1 211 ? -1.356  16.661  56.753  1.00 27.59  ? 211  LYS D CA  1 
ATOM   8746  C C   . LYS D 1 211 ? -0.392  16.122  57.815  1.00 30.36  ? 211  LYS D C   1 
ATOM   8747  O O   . LYS D 1 211 ? -0.154  14.917  57.866  1.00 28.80  ? 211  LYS D O   1 
ATOM   8748  C CB  . LYS D 1 211 ? -2.841  16.382  57.087  1.00 28.88  ? 211  LYS D CB  1 
ATOM   8749  C CG  . LYS D 1 211 ? -3.276  16.516  58.539  1.00 29.08  ? 211  LYS D CG  1 
ATOM   8750  C CD  . LYS D 1 211 ? -3.413  17.947  58.984  1.00 33.84  ? 211  LYS D CD  1 
ATOM   8751  C CE  . LYS D 1 211 ? -4.066  18.004  60.341  1.00 42.13  ? 211  LYS D CE  1 
ATOM   8752  N NZ  . LYS D 1 211 ? -4.133  19.392  60.866  1.00 53.51  ? 211  LYS D NZ  1 
ATOM   8753  N N   . ALA D 1 212 ? 0.227   17.014  58.590  1.00 28.63  ? 212  ALA D N   1 
ATOM   8754  C CA  . ALA D 1 212 ? 1.193   16.638  59.622  1.00 28.64  ? 212  ALA D CA  1 
ATOM   8755  C C   . ALA D 1 212 ? 0.499   15.928  60.790  1.00 32.89  ? 212  ALA D C   1 
ATOM   8756  O O   . ALA D 1 212 ? -0.676  16.194  61.064  1.00 32.66  ? 212  ALA D O   1 
ATOM   8757  C CB  . ALA D 1 212 ? 1.943   17.867  60.114  1.00 29.96  ? 212  ALA D CB  1 
ATOM   8758  N N   . TYR D 1 213 ? 1.229   15.016  61.470  1.00 28.79  ? 213  TYR D N   1 
ATOM   8759  C CA  . TYR D 1 213 ? 0.701   14.294  62.626  1.00 28.22  ? 213  TYR D CA  1 
ATOM   8760  C C   . TYR D 1 213 ? 0.497   15.268  63.780  1.00 34.58  ? 213  TYR D C   1 
ATOM   8761  O O   . TYR D 1 213 ? 1.463   15.891  64.236  1.00 34.88  ? 213  TYR D O   1 
ATOM   8762  C CB  . TYR D 1 213 ? 1.664   13.178  63.059  1.00 27.84  ? 213  TYR D CB  1 
ATOM   8763  C CG  . TYR D 1 213 ? 1.125   12.296  64.166  1.00 28.14  ? 213  TYR D CG  1 
ATOM   8764  C CD1 . TYR D 1 213 ? 1.294   12.639  65.506  1.00 29.54  ? 213  TYR D CD1 1 
ATOM   8765  C CD2 . TYR D 1 213 ? 0.477   11.101  63.876  1.00 28.89  ? 213  TYR D CD2 1 
ATOM   8766  C CE1 . TYR D 1 213 ? 0.791   11.830  66.530  1.00 27.68  ? 213  TYR D CE1 1 
ATOM   8767  C CE2 . TYR D 1 213 ? 0.003   10.269  64.889  1.00 30.39  ? 213  TYR D CE2 1 
ATOM   8768  C CZ  . TYR D 1 213 ? 0.165   10.633  66.217  1.00 34.94  ? 213  TYR D CZ  1 
ATOM   8769  O OH  . TYR D 1 213 ? -0.322  9.797   67.198  1.00 32.61  ? 213  TYR D OH  1 
ATOM   8770  N N   . ALA D 1 214 ? -0.734  15.359  64.290  1.00 32.10  ? 214  ALA D N   1 
ATOM   8771  C CA  . ALA D 1 214 ? -1.105  16.202  65.436  1.00 33.01  ? 214  ALA D CA  1 
ATOM   8772  C C   . ALA D 1 214 ? -2.296  15.609  66.144  1.00 38.21  ? 214  ALA D C   1 
ATOM   8773  O O   . ALA D 1 214 ? -3.260  15.224  65.484  1.00 37.69  ? 214  ALA D O   1 
ATOM   8774  C CB  . ALA D 1 214 ? -1.432  17.619  64.980  1.00 34.42  ? 214  ALA D CB  1 
ATOM   8775  N N   . ALA D 1 215 ? -2.240  15.526  67.479  1.00 36.51  ? 215  ALA D N   1 
ATOM   8776  C CA  . ALA D 1 215 ? -3.358  15.019  68.265  1.00 36.94  ? 215  ALA D CA  1 
ATOM   8777  C C   . ALA D 1 215 ? -4.260  16.189  68.656  1.00 42.94  ? 215  ALA D C   1 
ATOM   8778  O O   . ALA D 1 215 ? -3.807  17.105  69.344  1.00 43.68  ? 215  ALA D O   1 
ATOM   8779  C CB  . ALA D 1 215 ? -2.849  14.281  69.499  1.00 37.97  ? 215  ALA D CB  1 
ATOM   8780  N N   . ASP D 1 216 ? -5.521  16.186  68.171  1.00 39.88  ? 216  ASP D N   1 
ATOM   8781  C CA  . ASP D 1 216 ? -6.500  17.239  68.462  1.00 40.45  ? 216  ASP D CA  1 
ATOM   8782  C C   . ASP D 1 216 ? -7.603  16.670  69.378  1.00 44.16  ? 216  ASP D C   1 
ATOM   8783  O O   . ASP D 1 216 ? -8.257  15.702  68.990  1.00 42.75  ? 216  ASP D O   1 
ATOM   8784  C CB  . ASP D 1 216 ? -7.076  17.835  67.150  1.00 41.88  ? 216  ASP D CB  1 
ATOM   8785  C CG  . ASP D 1 216 ? -8.129  18.938  67.281  1.00 54.96  ? 216  ASP D CG  1 
ATOM   8786  O OD1 . ASP D 1 216 ? -8.266  19.516  68.386  1.00 56.18  ? 216  ASP D OD1 1 
ATOM   8787  O OD2 . ASP D 1 216 ? -8.783  19.254  66.269  1.00 63.82  ? 216  ASP D OD2 1 
ATOM   8788  N N   . PRO D 1 217 ? -7.813  17.241  70.600  1.00 42.47  ? 217  PRO D N   1 
ATOM   8789  C CA  . PRO D 1 217 ? -8.864  16.720  71.502  1.00 42.62  ? 217  PRO D CA  1 
ATOM   8790  C C   . PRO D 1 217 ? -10.278 16.784  70.918  1.00 47.02  ? 217  PRO D C   1 
ATOM   8791  O O   . PRO D 1 217 ? -11.152 16.027  71.340  1.00 46.78  ? 217  PRO D O   1 
ATOM   8792  C CB  . PRO D 1 217 ? -8.764  17.629  72.733  1.00 45.65  ? 217  PRO D CB  1 
ATOM   8793  C CG  . PRO D 1 217 ? -7.446  18.264  72.658  1.00 49.97  ? 217  PRO D CG  1 
ATOM   8794  C CD  . PRO D 1 217 ? -7.120  18.392  71.212  1.00 44.97  ? 217  PRO D CD  1 
ATOM   8795  N N   . LYS D 1 218 ? -10.500 17.686  69.957  1.00 44.48  ? 218  LYS D N   1 
ATOM   8796  C CA  . LYS D 1 218 ? -11.791 17.870  69.290  1.00 45.24  ? 218  LYS D CA  1 
ATOM   8797  C C   . LYS D 1 218 ? -12.077 16.721  68.300  1.00 47.50  ? 218  LYS D C   1 
ATOM   8798  O O   . LYS D 1 218 ? -13.236 16.460  68.008  1.00 48.23  ? 218  LYS D O   1 
ATOM   8799  C CB  . LYS D 1 218 ? -11.833 19.231  68.568  1.00 48.72  ? 218  LYS D CB  1 
ATOM   8800  C CG  . LYS D 1 218 ? -11.781 20.434  69.513  1.00 64.96  ? 218  LYS D CG  1 
ATOM   8801  C CD  . LYS D 1 218 ? -11.399 21.721  68.784  1.00 74.58  ? 218  LYS D CD  1 
ATOM   8802  N N   . ARG D 1 219 ? -11.032 16.019  67.825  1.00 42.10  ? 219  ARG D N   1 
ATOM   8803  C CA  . ARG D 1 219 ? -11.128 14.903  66.865  1.00 40.28  ? 219  ARG D CA  1 
ATOM   8804  C C   . ARG D 1 219 ? -11.156 13.515  67.518  1.00 44.58  ? 219  ARG D C   1 
ATOM   8805  O O   . ARG D 1 219 ? -11.212 12.520  66.794  1.00 44.98  ? 219  ARG D O   1 
ATOM   8806  C CB  . ARG D 1 219 ? -9.921  14.921  65.907  1.00 35.66  ? 219  ARG D CB  1 
ATOM   8807  C CG  . ARG D 1 219 ? -9.818  16.100  64.967  1.00 38.49  ? 219  ARG D CG  1 
ATOM   8808  C CD  . ARG D 1 219 ? -8.776  15.801  63.903  1.00 36.83  ? 219  ARG D CD  1 
ATOM   8809  N NE  . ARG D 1 219 ? -8.886  16.714  62.764  1.00 43.38  ? 219  ARG D NE  1 
ATOM   8810  C CZ  . ARG D 1 219 ? -9.611  16.473  61.676  1.00 55.76  ? 219  ARG D CZ  1 
ATOM   8811  N NH1 . ARG D 1 219 ? -10.298 15.341  61.565  1.00 41.64  ? 219  ARG D NH1 1 
ATOM   8812  N NH2 . ARG D 1 219 ? -9.654  17.358  60.691  1.00 44.76  ? 219  ARG D NH2 1 
ATOM   8813  N N   . CYS D 1 220 ? -11.033 13.429  68.850  1.00 41.08  ? 220  CYS D N   1 
ATOM   8814  C CA  . CYS D 1 220 ? -10.928 12.152  69.554  1.00 40.48  ? 220  CYS D CA  1 
ATOM   8815  C C   . CYS D 1 220 ? -12.160 11.281  69.389  1.00 46.08  ? 220  CYS D C   1 
ATOM   8816  O O   . CYS D 1 220 ? -13.287 11.712  69.660  1.00 48.19  ? 220  CYS D O   1 
ATOM   8817  C CB  . CYS D 1 220 ? -10.594 12.355  71.026  1.00 41.38  ? 220  CYS D CB  1 
ATOM   8818  S SG  . CYS D 1 220 ? -8.863  12.781  71.336  1.00 44.88  ? 220  CYS D SG  1 
ATOM   8819  N N   . HIS D 1 221 ? -11.915 10.039  68.934  1.00 40.50  ? 221  HIS D N   1 
ATOM   8820  C CA  . HIS D 1 221 ? -12.873 8.943   68.764  1.00 39.74  ? 221  HIS D CA  1 
ATOM   8821  C C   . HIS D 1 221 ? -13.853 9.186   67.593  1.00 44.55  ? 221  HIS D C   1 
ATOM   8822  O O   . HIS D 1 221 ? -15.015 8.775   67.656  1.00 46.31  ? 221  HIS D O   1 
ATOM   8823  C CB  . HIS D 1 221 ? -13.614 8.614   70.098  1.00 40.67  ? 221  HIS D CB  1 
ATOM   8824  C CG  . HIS D 1 221 ? -12.686 8.421   71.267  1.00 43.41  ? 221  HIS D CG  1 
ATOM   8825  N ND1 . HIS D 1 221 ? -11.900 7.294   71.387  1.00 44.04  ? 221  HIS D ND1 1 
ATOM   8826  C CD2 . HIS D 1 221 ? -12.432 9.237   72.316  1.00 45.82  ? 221  HIS D CD2 1 
ATOM   8827  C CE1 . HIS D 1 221 ? -11.196 7.456   72.496  1.00 43.65  ? 221  HIS D CE1 1 
ATOM   8828  N NE2 . HIS D 1 221 ? -11.491 8.606   73.096  1.00 45.03  ? 221  HIS D NE2 1 
ATOM   8829  N N   . ASP D 1 222 ? -13.346 9.783   66.498  1.00 40.15  ? 222  ASP D N   1 
ATOM   8830  C CA  . ASP D 1 222 ? -14.056 9.994   65.228  1.00 39.97  ? 222  ASP D CA  1 
ATOM   8831  C C   . ASP D 1 222 ? -14.264 8.633   64.559  1.00 40.56  ? 222  ASP D C   1 
ATOM   8832  O O   . ASP D 1 222 ? -13.457 7.739   64.778  1.00 38.66  ? 222  ASP D O   1 
ATOM   8833  C CB  . ASP D 1 222 ? -13.223 10.908  64.302  1.00 42.01  ? 222  ASP D CB  1 
ATOM   8834  C CG  . ASP D 1 222 ? -13.449 12.406  64.418  1.00 55.78  ? 222  ASP D CG  1 
ATOM   8835  O OD1 . ASP D 1 222 ? -13.700 12.881  65.534  1.00 56.54  ? 222  ASP D OD1 1 
ATOM   8836  O OD2 . ASP D 1 222 ? -13.278 13.114  63.399  1.00 64.90  ? 222  ASP D OD2 1 
ATOM   8837  N N   . GLY D 1 223 ? -15.308 8.494   63.747  1.00 36.85  ? 223  GLY D N   1 
ATOM   8838  C CA  . GLY D 1 223 ? -15.644 7.241   63.072  1.00 35.96  ? 223  GLY D CA  1 
ATOM   8839  C C   . GLY D 1 223 ? -16.537 6.351   63.915  1.00 40.13  ? 223  GLY D C   1 
ATOM   8840  O O   . GLY D 1 223 ? -17.086 6.807   64.924  1.00 40.67  ? 223  GLY D O   1 
ATOM   8841  N N   . THR D 1 224 ? -16.710 5.080   63.500  1.00 35.94  ? 224  THR D N   1 
ATOM   8842  C CA  . THR D 1 224 ? -17.525 4.104   64.239  1.00 36.21  ? 224  THR D CA  1 
ATOM   8843  C C   . THR D 1 224 ? -16.603 3.434   65.259  1.00 37.34  ? 224  THR D C   1 
ATOM   8844  O O   . THR D 1 224 ? -15.649 2.760   64.873  1.00 35.34  ? 224  THR D O   1 
ATOM   8845  C CB  . THR D 1 224 ? -18.222 3.132   63.276  1.00 42.55  ? 224  THR D CB  1 
ATOM   8846  O OG1 . THR D 1 224 ? -19.008 3.903   62.369  1.00 41.97  ? 224  THR D OG1 1 
ATOM   8847  C CG2 . THR D 1 224 ? -19.110 2.124   64.005  1.00 38.66  ? 224  THR D CG2 1 
ATOM   8848  N N   . ILE D 1 225 ? -16.884 3.654   66.556  1.00 33.80  ? 225  ILE D N   1 
ATOM   8849  C CA  . ILE D 1 225 ? -16.082 3.241   67.715  1.00 32.91  ? 225  ILE D CA  1 
ATOM   8850  C C   . ILE D 1 225 ? -15.477 1.818   67.609  1.00 34.33  ? 225  ILE D C   1 
ATOM   8851  O O   . ILE D 1 225 ? -14.283 1.691   67.858  1.00 32.50  ? 225  ILE D O   1 
ATOM   8852  C CB  . ILE D 1 225 ? -16.846 3.462   69.063  1.00 37.56  ? 225  ILE D CB  1 
ATOM   8853  C CG1 . ILE D 1 225 ? -15.897 3.535   70.278  1.00 37.39  ? 225  ILE D CG1 1 
ATOM   8854  C CG2 . ILE D 1 225 ? -18.038 2.511   69.288  1.00 39.81  ? 225  ILE D CG2 1 
ATOM   8855  C CD1 . ILE D 1 225 ? -15.057 4.796   70.355  1.00 43.38  ? 225  ILE D CD1 1 
ATOM   8856  N N   . GLU D 1 226 ? -16.266 0.786   67.221  1.00 31.61  ? 226  GLU D N   1 
ATOM   8857  C CA  . GLU D 1 226 ? -15.798 -0.612  67.089  1.00 31.06  ? 226  GLU D CA  1 
ATOM   8858  C C   . GLU D 1 226 ? -14.716 -0.797  66.049  1.00 32.13  ? 226  GLU D C   1 
ATOM   8859  O O   . GLU D 1 226 ? -13.841 -1.645  66.219  1.00 31.24  ? 226  GLU D O   1 
ATOM   8860  C CB  . GLU D 1 226 ? -16.934 -1.571  66.670  1.00 33.62  ? 226  GLU D CB  1 
ATOM   8861  C CG  . GLU D 1 226 ? -18.247 -1.377  67.363  1.00 44.41  ? 226  GLU D CG  1 
ATOM   8862  C CD  . GLU D 1 226 ? -19.251 -0.589  66.568  1.00 58.83  ? 226  GLU D CD  1 
ATOM   8863  O OE1 . GLU D 1 226 ? -19.434 0.614   66.864  1.00 64.40  ? 226  GLU D OE1 1 
ATOM   8864  O OE2 . GLU D 1 226 ? -19.919 -1.201  65.706  1.00 46.74  ? 226  GLU D OE2 1 
ATOM   8865  N N   . PHE D 1 227 ? -14.838 -0.076  64.931  1.00 27.42  ? 227  PHE D N   1 
ATOM   8866  C CA  . PHE D 1 227 ? -13.962 -0.258  63.778  1.00 25.99  ? 227  PHE D CA  1 
ATOM   8867  C C   . PHE D 1 227 ? -12.954 0.853   63.563  1.00 30.92  ? 227  PHE D C   1 
ATOM   8868  O O   . PHE D 1 227 ? -12.036 0.660   62.762  1.00 30.81  ? 227  PHE D O   1 
ATOM   8869  C CB  . PHE D 1 227 ? -14.809 -0.392  62.490  1.00 27.15  ? 227  PHE D CB  1 
ATOM   8870  C CG  . PHE D 1 227 ? -15.956 -1.373  62.565  1.00 28.50  ? 227  PHE D CG  1 
ATOM   8871  C CD1 . PHE D 1 227 ? -15.727 -2.721  62.821  1.00 30.27  ? 227  PHE D CD1 1 
ATOM   8872  C CD2 . PHE D 1 227 ? -17.262 -0.956  62.353  1.00 30.54  ? 227  PHE D CD2 1 
ATOM   8873  C CE1 . PHE D 1 227 ? -16.790 -3.625  62.896  1.00 32.03  ? 227  PHE D CE1 1 
ATOM   8874  C CE2 . PHE D 1 227 ? -18.326 -1.864  62.424  1.00 33.52  ? 227  PHE D CE2 1 
ATOM   8875  C CZ  . PHE D 1 227 ? -18.083 -3.188  62.700  1.00 31.52  ? 227  PHE D CZ  1 
ATOM   8876  N N   . THR D 1 228 ? -13.101 2.009   64.245  1.00 28.18  ? 228  THR D N   1 
ATOM   8877  C CA  . THR D 1 228 ? -12.230 3.163   64.010  1.00 27.12  ? 228  THR D CA  1 
ATOM   8878  C C   . THR D 1 228 ? -10.745 2.867   64.335  1.00 30.15  ? 228  THR D C   1 
ATOM   8879  O O   . THR D 1 228 ? -10.435 1.930   65.076  1.00 29.86  ? 228  THR D O   1 
ATOM   8880  C CB  . THR D 1 228 ? -12.761 4.431   64.691  1.00 31.10  ? 228  THR D CB  1 
ATOM   8881  O OG1 . THR D 1 228 ? -12.160 5.550   64.043  1.00 31.88  ? 228  THR D OG1 1 
ATOM   8882  C CG2 . THR D 1 228 ? -12.525 4.472   66.208  1.00 26.06  ? 228  THR D CG2 1 
ATOM   8883  N N   . SER D 1 229 ? -9.841  3.638   63.704  1.00 26.07  ? 229  SER D N   1 
ATOM   8884  C CA  . SER D 1 229 ? -8.398  3.482   63.840  1.00 25.35  ? 229  SER D CA  1 
ATOM   8885  C C   . SER D 1 229 ? -7.889  4.029   65.174  1.00 30.88  ? 229  SER D C   1 
ATOM   8886  O O   . SER D 1 229 ? -8.559  4.856   65.796  1.00 32.52  ? 229  SER D O   1 
ATOM   8887  C CB  . SER D 1 229 ? -7.683  4.180   62.684  1.00 27.79  ? 229  SER D CB  1 
ATOM   8888  O OG  . SER D 1 229 ? -7.736  5.595   62.777  1.00 32.99  ? 229  SER D OG  1 
ATOM   8889  N N   . ILE D 1 230 ? -6.679  3.588   65.595  1.00 26.91  ? 230  ILE D N   1 
ATOM   8890  C CA  . ILE D 1 230 ? -5.992  4.066   66.802  1.00 26.54  ? 230  ILE D CA  1 
ATOM   8891  C C   . ILE D 1 230 ? -5.728  5.586   66.641  1.00 31.04  ? 230  ILE D C   1 
ATOM   8892  O O   . ILE D 1 230 ? -5.943  6.345   67.590  1.00 31.82  ? 230  ILE D O   1 
ATOM   8893  C CB  . ILE D 1 230 ? -4.698  3.230   67.051  1.00 29.29  ? 230  ILE D CB  1 
ATOM   8894  C CG1 . ILE D 1 230 ? -5.085  1.827   67.584  1.00 29.62  ? 230  ILE D CG1 1 
ATOM   8895  C CG2 . ILE D 1 230 ? -3.704  3.941   68.001  1.00 30.83  ? 230  ILE D CG2 1 
ATOM   8896  C CD1 . ILE D 1 230 ? -4.066  0.757   67.423  1.00 32.23  ? 230  ILE D CD1 1 
ATOM   8897  N N   . ASP D 1 231 ? -5.336  6.023   65.420  1.00 26.73  ? 231  ASP D N   1 
ATOM   8898  C CA  . ASP D 1 231 ? -5.105  7.433   65.085  1.00 26.18  ? 231  ASP D CA  1 
ATOM   8899  C C   . ASP D 1 231 ? -6.349  8.265   65.424  1.00 31.46  ? 231  ASP D C   1 
ATOM   8900  O O   . ASP D 1 231 ? -6.221  9.252   66.146  1.00 32.07  ? 231  ASP D O   1 
ATOM   8901  C CB  . ASP D 1 231 ? -4.728  7.604   63.599  1.00 26.65  ? 231  ASP D CB  1 
ATOM   8902  C CG  . ASP D 1 231 ? -3.320  7.201   63.236  1.00 33.01  ? 231  ASP D CG  1 
ATOM   8903  O OD1 . ASP D 1 231 ? -2.413  7.374   64.086  1.00 35.60  ? 231  ASP D OD1 1 
ATOM   8904  O OD2 . ASP D 1 231 ? -3.117  6.722   62.098  1.00 33.76  ? 231  ASP D OD2 1 
ATOM   8905  N N   . ALA D 1 232 ? -7.550  7.833   64.956  1.00 28.34  ? 232  ALA D N   1 
ATOM   8906  C CA  . ALA D 1 232 ? -8.829  8.509   65.235  1.00 28.91  ? 232  ALA D CA  1 
ATOM   8907  C C   . ALA D 1 232 ? -9.114  8.547   66.743  1.00 32.12  ? 232  ALA D C   1 
ATOM   8908  O O   . ALA D 1 232 ? -9.474  9.605   67.249  1.00 33.71  ? 232  ALA D O   1 
ATOM   8909  C CB  . ALA D 1 232 ? -9.966  7.833   64.488  1.00 29.87  ? 232  ALA D CB  1 
ATOM   8910  N N   . HIS D 1 233 ? -8.872  7.434   67.466  1.00 27.13  ? 233  HIS D N   1 
ATOM   8911  C CA  . HIS D 1 233 ? -9.026  7.351   68.928  1.00 27.37  ? 233  HIS D CA  1 
ATOM   8912  C C   . HIS D 1 233 ? -8.120  8.353   69.632  1.00 32.43  ? 233  HIS D C   1 
ATOM   8913  O O   . HIS D 1 233 ? -8.479  8.855   70.703  1.00 32.99  ? 233  HIS D O   1 
ATOM   8914  C CB  . HIS D 1 233 ? -8.667  5.941   69.449  1.00 27.20  ? 233  HIS D CB  1 
ATOM   8915  C CG  . HIS D 1 233 ? -9.717  4.889   69.288  1.00 29.81  ? 233  HIS D CG  1 
ATOM   8916  N ND1 . HIS D 1 233 ? -10.932 4.976   69.940  1.00 32.15  ? 233  HIS D ND1 1 
ATOM   8917  C CD2 . HIS D 1 233 ? -9.656  3.708   68.637  1.00 30.26  ? 233  HIS D CD2 1 
ATOM   8918  C CE1 . HIS D 1 233 ? -11.588 3.876   69.623  1.00 31.39  ? 233  HIS D CE1 1 
ATOM   8919  N NE2 . HIS D 1 233 ? -10.860 3.085   68.834  1.00 30.81  ? 233  HIS D NE2 1 
ATOM   8920  N N   . ASN D 1 234 ? -6.929  8.620   69.036  1.00 29.00  ? 234  ASN D N   1 
ATOM   8921  C CA  . ASN D 1 234 ? -5.919  9.537   69.574  1.00 28.91  ? 234  ASN D CA  1 
ATOM   8922  C C   . ASN D 1 234 ? -6.183  11.004  69.190  1.00 33.16  ? 234  ASN D C   1 
ATOM   8923  O O   . ASN D 1 234 ? -5.474  11.885  69.670  1.00 32.97  ? 234  ASN D O   1 
ATOM   8924  C CB  . ASN D 1 234 ? -4.510  9.106   69.138  1.00 27.02  ? 234  ASN D CB  1 
ATOM   8925  C CG  . ASN D 1 234 ? -3.936  7.977   69.969  1.00 40.29  ? 234  ASN D CG  1 
ATOM   8926  O OD1 . ASN D 1 234 ? -4.316  7.748   71.129  1.00 37.34  ? 234  ASN D OD1 1 
ATOM   8927  N ND2 . ASN D 1 234 ? -2.995  7.251   69.400  1.00 29.09  ? 234  ASN D ND2 1 
ATOM   8928  N N   . GLY D 1 235 ? -7.216  11.245  68.373  1.00 30.57  ? 235  GLY D N   1 
ATOM   8929  C CA  . GLY D 1 235 ? -7.614  12.575  67.911  1.00 30.81  ? 235  GLY D CA  1 
ATOM   8930  C C   . GLY D 1 235 ? -6.777  13.073  66.751  1.00 33.49  ? 235  GLY D C   1 
ATOM   8931  O O   . GLY D 1 235 ? -6.719  14.274  66.465  1.00 33.64  ? 235  GLY D O   1 
ATOM   8932  N N   . VAL D 1 236 ? -6.114  12.143  66.085  1.00 28.59  ? 236  VAL D N   1 
ATOM   8933  C CA  . VAL D 1 236 ? -5.252  12.425  64.953  1.00 27.84  ? 236  VAL D CA  1 
ATOM   8934  C C   . VAL D 1 236 ? -6.099  12.345  63.685  1.00 31.79  ? 236  VAL D C   1 
ATOM   8935  O O   . VAL D 1 236 ? -6.842  11.376  63.511  1.00 31.00  ? 236  VAL D O   1 
ATOM   8936  C CB  . VAL D 1 236 ? -4.044  11.449  64.933  1.00 30.50  ? 236  VAL D CB  1 
ATOM   8937  C CG1 . VAL D 1 236 ? -3.145  11.711  63.741  1.00 29.61  ? 236  VAL D CG1 1 
ATOM   8938  C CG2 . VAL D 1 236 ? -3.248  11.536  66.236  1.00 30.57  ? 236  VAL D CG2 1 
ATOM   8939  N N   . ALA D 1 237 ? -6.007  13.379  62.814  1.00 28.73  ? 237  ALA D N   1 
ATOM   8940  C CA  . ALA D 1 237 ? -6.721  13.427  61.529  1.00 28.18  ? 237  ALA D CA  1 
ATOM   8941  C C   . ALA D 1 237 ? -6.501  12.097  60.780  1.00 31.25  ? 237  ALA D C   1 
ATOM   8942  O O   . ALA D 1 237 ? -5.404  11.538  60.864  1.00 30.61  ? 237  ALA D O   1 
ATOM   8943  C CB  . ALA D 1 237 ? -6.237  14.604  60.704  1.00 28.91  ? 237  ALA D CB  1 
ATOM   8944  N N   . PRO D 1 238 ? -7.542  11.488  60.177  1.00 27.95  ? 238  PRO D N   1 
ATOM   8945  C CA  . PRO D 1 238 ? -7.339  10.176  59.544  1.00 27.12  ? 238  PRO D CA  1 
ATOM   8946  C C   . PRO D 1 238 ? -6.383  10.210  58.353  1.00 31.00  ? 238  PRO D C   1 
ATOM   8947  O O   . PRO D 1 238 ? -6.355  11.189  57.602  1.00 31.09  ? 238  PRO D O   1 
ATOM   8948  C CB  . PRO D 1 238 ? -8.749  9.777   59.096  1.00 29.29  ? 238  PRO D CB  1 
ATOM   8949  C CG  . PRO D 1 238 ? -9.480  11.049  58.949  1.00 34.03  ? 238  PRO D CG  1 
ATOM   8950  C CD  . PRO D 1 238 ? -8.934  11.961  60.001  1.00 30.12  ? 238  PRO D CD  1 
ATOM   8951  N N   . SER D 1 239 ? -5.574  9.147   58.205  1.00 26.17  ? 239  SER D N   1 
ATOM   8952  C CA  . SER D 1 239 ? -4.670  9.008   57.062  1.00 25.11  ? 239  SER D CA  1 
ATOM   8953  C C   . SER D 1 239 ? -4.894  7.614   56.433  1.00 29.66  ? 239  SER D C   1 
ATOM   8954  O O   . SER D 1 239 ? -5.845  6.911   56.806  1.00 29.81  ? 239  SER D O   1 
ATOM   8955  C CB  . SER D 1 239 ? -3.213  9.279   57.436  1.00 25.74  ? 239  SER D CB  1 
ATOM   8956  O OG  . SER D 1 239 ? -2.617  8.237   58.186  1.00 29.19  ? 239  SER D OG  1 
ATOM   8957  N N   . ARG D 1 240 ? -4.075  7.256   55.445  1.00 25.84  ? 240  ARG D N   1 
ATOM   8958  C CA  . ARG D 1 240 ? -4.220  6.025   54.677  1.00 25.57  ? 240  ARG D CA  1 
ATOM   8959  C C   . ARG D 1 240 ? -4.120  4.764   55.533  1.00 29.13  ? 240  ARG D C   1 
ATOM   8960  O O   . ARG D 1 240 ? -4.967  3.884   55.364  1.00 29.55  ? 240  ARG D O   1 
ATOM   8961  C CB  . ARG D 1 240 ? -3.205  5.989   53.535  1.00 23.42  ? 240  ARG D CB  1 
ATOM   8962  C CG  . ARG D 1 240 ? -3.506  7.039   52.477  1.00 20.85  ? 240  ARG D CG  1 
ATOM   8963  C CD  . ARG D 1 240 ? -2.429  7.084   51.426  1.00 25.80  ? 240  ARG D CD  1 
ATOM   8964  N NE  . ARG D 1 240 ? -1.240  7.801   51.895  1.00 25.35  ? 240  ARG D NE  1 
ATOM   8965  C CZ  . ARG D 1 240 ? -0.260  8.218   51.109  1.00 36.93  ? 240  ARG D CZ  1 
ATOM   8966  N NH1 . ARG D 1 240 ? -0.309  7.995   49.804  1.00 27.18  ? 240  ARG D NH1 1 
ATOM   8967  N NH2 . ARG D 1 240 ? 0.780   8.860   51.620  1.00 31.09  ? 240  ARG D NH2 1 
ATOM   8968  N N   . ARG D 1 241 ? -3.143  4.694   56.476  1.00 24.09  ? 241  ARG D N   1 
ATOM   8969  C CA  . ARG D 1 241 ? -2.974  3.533   57.352  1.00 23.88  ? 241  ARG D CA  1 
ATOM   8970  C C   . ARG D 1 241 ? -4.239  3.264   58.184  1.00 27.15  ? 241  ARG D C   1 
ATOM   8971  O O   . ARG D 1 241 ? -4.586  2.096   58.381  1.00 27.97  ? 241  ARG D O   1 
ATOM   8972  C CB  . ARG D 1 241 ? -1.728  3.647   58.256  1.00 23.37  ? 241  ARG D CB  1 
ATOM   8973  C CG  . ARG D 1 241 ? -1.766  4.730   59.323  1.00 24.44  ? 241  ARG D CG  1 
ATOM   8974  C CD  . ARG D 1 241 ? -0.535  4.658   60.169  1.00 22.68  ? 241  ARG D CD  1 
ATOM   8975  N NE  . ARG D 1 241 ? -0.654  5.509   61.347  1.00 27.71  ? 241  ARG D NE  1 
ATOM   8976  C CZ  . ARG D 1 241 ? 0.280   5.612   62.283  1.00 35.15  ? 241  ARG D CZ  1 
ATOM   8977  N NH1 . ARG D 1 241 ? 1.415   4.939   62.171  1.00 21.66  ? 241  ARG D NH1 1 
ATOM   8978  N NH2 . ARG D 1 241 ? 0.094   6.401   63.331  1.00 20.60  ? 241  ARG D NH2 1 
ATOM   8979  N N   . GLY D 1 242 ? -4.920  4.328   58.610  1.00 22.65  ? 242  GLY D N   1 
ATOM   8980  C CA  . GLY D 1 242 ? -6.165  4.258   59.364  1.00 23.19  ? 242  GLY D CA  1 
ATOM   8981  C C   . GLY D 1 242 ? -7.265  3.511   58.627  1.00 29.28  ? 242  GLY D C   1 
ATOM   8982  O O   . GLY D 1 242 ? -7.900  2.639   59.214  1.00 30.80  ? 242  GLY D O   1 
ATOM   8983  N N   . ASP D 1 243 ? -7.471  3.818   57.323  1.00 24.86  ? 243  ASP D N   1 
ATOM   8984  C CA  . ASP D 1 243 ? -8.472  3.171   56.465  1.00 25.14  ? 243  ASP D CA  1 
ATOM   8985  C C   . ASP D 1 243 ? -8.222  1.670   56.336  1.00 28.96  ? 243  ASP D C   1 
ATOM   8986  O O   . ASP D 1 243 ? -9.168  0.889   56.330  1.00 29.37  ? 243  ASP D O   1 
ATOM   8987  C CB  . ASP D 1 243 ? -8.486  3.810   55.052  1.00 26.84  ? 243  ASP D CB  1 
ATOM   8988  C CG  . ASP D 1 243 ? -9.352  5.043   54.904  1.00 29.22  ? 243  ASP D CG  1 
ATOM   8989  O OD1 . ASP D 1 243 ? -9.927  5.489   55.913  1.00 31.30  ? 243  ASP D OD1 1 
ATOM   8990  O OD2 . ASP D 1 243 ? -9.455  5.558   53.781  1.00 31.04  ? 243  ASP D OD2 1 
ATOM   8991  N N   . LEU D 1 244 ? -6.949  1.282   56.230  1.00 25.14  ? 244  LEU D N   1 
ATOM   8992  C CA  . LEU D 1 244 ? -6.507  -0.105  56.100  1.00 24.78  ? 244  LEU D CA  1 
ATOM   8993  C C   . LEU D 1 244 ? -6.668  -0.859  57.414  1.00 29.55  ? 244  LEU D C   1 
ATOM   8994  O O   . LEU D 1 244 ? -6.994  -2.048  57.400  1.00 29.96  ? 244  LEU D O   1 
ATOM   8995  C CB  . LEU D 1 244 ? -5.052  -0.151  55.620  1.00 24.29  ? 244  LEU D CB  1 
ATOM   8996  C CG  . LEU D 1 244 ? -4.790  0.457   54.228  1.00 28.14  ? 244  LEU D CG  1 
ATOM   8997  C CD1 . LEU D 1 244 ? -3.347  0.384   53.896  1.00 27.27  ? 244  LEU D CD1 1 
ATOM   8998  C CD2 . LEU D 1 244 ? -5.597  -0.241  53.128  1.00 29.08  ? 244  LEU D CD2 1 
ATOM   8999  N N   . GLU D 1 245 ? -6.485  -0.150  58.549  1.00 26.00  ? 245  GLU D N   1 
ATOM   9000  C CA  . GLU D 1 245 ? -6.660  -0.682  59.895  1.00 25.55  ? 245  GLU D CA  1 
ATOM   9001  C C   . GLU D 1 245 ? -8.150  -0.981  60.123  1.00 30.66  ? 245  GLU D C   1 
ATOM   9002  O O   . GLU D 1 245 ? -8.493  -2.080  60.568  1.00 30.80  ? 245  GLU D O   1 
ATOM   9003  C CB  . GLU D 1 245 ? -6.122  0.316   60.929  1.00 26.36  ? 245  GLU D CB  1 
ATOM   9004  C CG  . GLU D 1 245 ? -6.034  -0.234  62.341  1.00 32.82  ? 245  GLU D CG  1 
ATOM   9005  C CD  . GLU D 1 245 ? -5.752  0.784   63.429  1.00 49.68  ? 245  GLU D CD  1 
ATOM   9006  O OE1 . GLU D 1 245 ? -6.285  0.620   64.549  1.00 46.13  ? 245  GLU D OE1 1 
ATOM   9007  O OE2 . GLU D 1 245 ? -5.004  1.752   63.162  1.00 37.19  ? 245  GLU D OE2 1 
ATOM   9008  N N   . ILE D 1 246 ? -9.030  -0.016  59.770  1.00 26.98  ? 246  ILE D N   1 
ATOM   9009  C CA  . ILE D 1 246 ? -10.491 -0.142  59.862  1.00 27.17  ? 246  ILE D CA  1 
ATOM   9010  C C   . ILE D 1 246 ? -10.953 -1.403  59.086  1.00 30.64  ? 246  ILE D C   1 
ATOM   9011  O O   . ILE D 1 246 ? -11.719 -2.196  59.635  1.00 31.93  ? 246  ILE D O   1 
ATOM   9012  C CB  . ILE D 1 246 ? -11.202 1.148   59.367  1.00 30.00  ? 246  ILE D CB  1 
ATOM   9013  C CG1 . ILE D 1 246 ? -10.873 2.360   60.274  1.00 29.50  ? 246  ILE D CG1 1 
ATOM   9014  C CG2 . ILE D 1 246 ? -12.709 0.935   59.285  1.00 30.97  ? 246  ILE D CG2 1 
ATOM   9015  C CD1 . ILE D 1 246 ? -11.119 3.735   59.650  1.00 30.31  ? 246  ILE D CD1 1 
ATOM   9016  N N   . LEU D 1 247 ? -10.430 -1.611  57.850  1.00 25.65  ? 247  LEU D N   1 
ATOM   9017  C CA  . LEU D 1 247 ? -10.735 -2.786  57.028  1.00 25.64  ? 247  LEU D CA  1 
ATOM   9018  C C   . LEU D 1 247 ? -10.313 -4.078  57.750  1.00 30.50  ? 247  LEU D C   1 
ATOM   9019  O O   . LEU D 1 247 ? -11.074 -5.048  57.737  1.00 31.97  ? 247  LEU D O   1 
ATOM   9020  C CB  . LEU D 1 247 ? -10.096 -2.694  55.628  1.00 24.90  ? 247  LEU D CB  1 
ATOM   9021  C CG  . LEU D 1 247 ? -10.278 -3.893  54.669  1.00 29.12  ? 247  LEU D CG  1 
ATOM   9022  C CD1 . LEU D 1 247 ? -11.750 -4.223  54.433  1.00 29.93  ? 247  LEU D CD1 1 
ATOM   9023  C CD2 . LEU D 1 247 ? -9.567  -3.649  53.341  1.00 29.16  ? 247  LEU D CD2 1 
ATOM   9024  N N   . GLY D 1 248 ? -9.146  -4.059  58.396  1.00 26.02  ? 248  GLY D N   1 
ATOM   9025  C CA  . GLY D 1 248 ? -8.639  -5.174  59.188  1.00 26.13  ? 248  GLY D CA  1 
ATOM   9026  C C   . GLY D 1 248 ? -9.623  -5.620  60.255  1.00 30.78  ? 248  GLY D C   1 
ATOM   9027  O O   . GLY D 1 248 ? -9.931  -6.806  60.339  1.00 31.51  ? 248  GLY D O   1 
ATOM   9028  N N   . TYR D 1 249 ? -10.163 -4.666  61.046  1.00 27.63  ? 249  TYR D N   1 
ATOM   9029  C CA  . TYR D 1 249 ? -11.159 -4.920  62.096  1.00 27.83  ? 249  TYR D CA  1 
ATOM   9030  C C   . TYR D 1 249 ? -12.460 -5.445  61.501  1.00 33.73  ? 249  TYR D C   1 
ATOM   9031  O O   . TYR D 1 249 ? -13.086 -6.317  62.109  1.00 35.05  ? 249  TYR D O   1 
ATOM   9032  C CB  . TYR D 1 249 ? -11.437 -3.663  62.928  1.00 27.65  ? 249  TYR D CB  1 
ATOM   9033  C CG  . TYR D 1 249 ? -10.229 -3.112  63.656  1.00 28.37  ? 249  TYR D CG  1 
ATOM   9034  C CD1 . TYR D 1 249 ? -9.276  -3.963  64.214  1.00 30.31  ? 249  TYR D CD1 1 
ATOM   9035  C CD2 . TYR D 1 249 ? -10.064 -1.742  63.835  1.00 27.50  ? 249  TYR D CD2 1 
ATOM   9036  C CE1 . TYR D 1 249 ? -8.167  -3.459  64.890  1.00 29.35  ? 249  TYR D CE1 1 
ATOM   9037  C CE2 . TYR D 1 249 ? -8.958  -1.230  64.504  1.00 27.06  ? 249  TYR D CE2 1 
ATOM   9038  C CZ  . TYR D 1 249 ? -8.014  -2.091  65.031  1.00 32.52  ? 249  TYR D CZ  1 
ATOM   9039  O OH  . TYR D 1 249 ? -6.926  -1.589  65.696  1.00 32.84  ? 249  TYR D OH  1 
ATOM   9040  N N   . CYS D 1 250 ? -12.859 -4.920  60.321  1.00 29.51  ? 250  CYS D N   1 
ATOM   9041  C CA  . CYS D 1 250 ? -14.045 -5.350  59.569  1.00 30.64  ? 250  CYS D CA  1 
ATOM   9042  C C   . CYS D 1 250 ? -13.913 -6.824  59.198  1.00 36.17  ? 250  CYS D C   1 
ATOM   9043  O O   . CYS D 1 250 ? -14.852 -7.585  59.410  1.00 37.03  ? 250  CYS D O   1 
ATOM   9044  C CB  . CYS D 1 250 ? -14.244 -4.490  58.322  1.00 30.41  ? 250  CYS D CB  1 
ATOM   9045  S SG  . CYS D 1 250 ? -15.041 -2.904  58.637  1.00 34.20  ? 250  CYS D SG  1 
ATOM   9046  N N   . MET D 1 251 ? -12.735 -7.222  58.670  1.00 32.88  ? 251  MET D N   1 
ATOM   9047  C CA  . MET D 1 251 ? -12.436 -8.595  58.253  1.00 34.14  ? 251  MET D CA  1 
ATOM   9048  C C   . MET D 1 251 ? -12.609 -9.581  59.406  1.00 38.30  ? 251  MET D C   1 
ATOM   9049  O O   . MET D 1 251 ? -13.256 -10.602 59.213  1.00 39.60  ? 251  MET D O   1 
ATOM   9050  C CB  . MET D 1 251 ? -11.018 -8.712  57.655  1.00 35.94  ? 251  MET D CB  1 
ATOM   9051  C CG  . MET D 1 251 ? -10.865 -8.005  56.307  1.00 39.21  ? 251  MET D CG  1 
ATOM   9052  S SD  . MET D 1 251 ? -9.310  -8.307  55.410  1.00 43.09  ? 251  MET D SD  1 
ATOM   9053  C CE  . MET D 1 251 ? -8.151  -7.874  56.618  1.00 38.54  ? 251  MET D CE  1 
ATOM   9054  N N   . ILE D 1 252 ? -12.075 -9.257  60.604  1.00 34.18  ? 252  ILE D N   1 
ATOM   9055  C CA  . ILE D 1 252 ? -12.175 -10.089 61.813  1.00 34.30  ? 252  ILE D CA  1 
ATOM   9056  C C   . ILE D 1 252 ? -13.659 -10.218 62.231  1.00 41.41  ? 252  ILE D C   1 
ATOM   9057  O O   . ILE D 1 252 ? -14.130 -11.333 62.463  1.00 42.21  ? 252  ILE D O   1 
ATOM   9058  C CB  . ILE D 1 252 ? -11.273 -9.531  62.957  1.00 35.33  ? 252  ILE D CB  1 
ATOM   9059  C CG1 . ILE D 1 252 ? -9.771  -9.730  62.620  1.00 34.18  ? 252  ILE D CG1 1 
ATOM   9060  C CG2 . ILE D 1 252 ? -11.623 -10.158 64.324  1.00 35.58  ? 252  ILE D CG2 1 
ATOM   9061  C CD1 . ILE D 1 252 ? -8.792  -8.850  63.398  1.00 34.47  ? 252  ILE D CD1 1 
ATOM   9062  N N   . GLN D 1 253 ? -14.380 -9.081  62.296  1.00 38.42  ? 253  GLN D N   1 
ATOM   9063  C CA  . GLN D 1 253 ? -15.798 -8.995  62.647  1.00 38.99  ? 253  GLN D CA  1 
ATOM   9064  C C   . GLN D 1 253 ? -16.642 -9.863  61.705  1.00 43.40  ? 253  GLN D C   1 
ATOM   9065  O O   . GLN D 1 253 ? -17.524 -10.579 62.171  1.00 44.73  ? 253  GLN D O   1 
ATOM   9066  C CB  . GLN D 1 253 ? -16.253 -7.520  62.588  1.00 39.43  ? 253  GLN D CB  1 
ATOM   9067  C CG  . GLN D 1 253 ? -17.768 -7.274  62.701  1.00 40.90  ? 253  GLN D CG  1 
ATOM   9068  C CD  . GLN D 1 253 ? -18.290 -7.410  64.098  1.00 51.65  ? 253  GLN D CD  1 
ATOM   9069  O OE1 . GLN D 1 253 ? -17.742 -6.859  65.050  1.00 50.43  ? 253  GLN D OE1 1 
ATOM   9070  N NE2 . GLN D 1 253 ? -19.386 -8.121  64.253  1.00 51.93  ? 253  GLN D NE2 1 
ATOM   9071  N N   . TRP D 1 254 ? -16.364 -9.809  60.391  1.00 38.33  ? 254  TRP D N   1 
ATOM   9072  C CA  . TRP D 1 254 ? -17.113 -10.564 59.380  1.00 38.11  ? 254  TRP D CA  1 
ATOM   9073  C C   . TRP D 1 254 ? -16.828 -12.056 59.470  1.00 41.23  ? 254  TRP D C   1 
ATOM   9074  O O   . TRP D 1 254 ? -17.748 -12.859 59.317  1.00 42.84  ? 254  TRP D O   1 
ATOM   9075  C CB  . TRP D 1 254 ? -16.810 -10.039 57.963  1.00 35.83  ? 254  TRP D CB  1 
ATOM   9076  C CG  . TRP D 1 254 ? -17.186 -8.597  57.733  1.00 35.82  ? 254  TRP D CG  1 
ATOM   9077  C CD1 . TRP D 1 254 ? -18.098 -7.859  58.434  1.00 38.89  ? 254  TRP D CD1 1 
ATOM   9078  C CD2 . TRP D 1 254 ? -16.660 -7.725  56.717  1.00 34.57  ? 254  TRP D CD2 1 
ATOM   9079  N NE1 . TRP D 1 254 ? -18.144 -6.573  57.945  1.00 37.69  ? 254  TRP D NE1 1 
ATOM   9080  C CE2 . TRP D 1 254 ? -17.292 -6.469  56.874  1.00 38.10  ? 254  TRP D CE2 1 
ATOM   9081  C CE3 . TRP D 1 254 ? -15.697 -7.876  55.700  1.00 35.03  ? 254  TRP D CE3 1 
ATOM   9082  C CZ2 . TRP D 1 254 ? -17.007 -5.377  56.041  1.00 36.24  ? 254  TRP D CZ2 1 
ATOM   9083  C CZ3 . TRP D 1 254 ? -15.402 -6.787  54.889  1.00 35.31  ? 254  TRP D CZ3 1 
ATOM   9084  C CH2 . TRP D 1 254 ? -16.058 -5.559  55.057  1.00 35.52  ? 254  TRP D CH2 1 
ATOM   9085  N N   . LEU D 1 255 ? -15.567 -12.425 59.736  1.00 35.86  ? 255  LEU D N   1 
ATOM   9086  C CA  . LEU D 1 255 ? -15.142 -13.818 59.840  1.00 36.13  ? 255  LEU D CA  1 
ATOM   9087  C C   . LEU D 1 255 ? -15.597 -14.507 61.130  1.00 42.93  ? 255  LEU D C   1 
ATOM   9088  O O   . LEU D 1 255 ? -15.947 -15.686 61.082  1.00 45.93  ? 255  LEU D O   1 
ATOM   9089  C CB  . LEU D 1 255 ? -13.611 -13.923 59.740  1.00 34.84  ? 255  LEU D CB  1 
ATOM   9090  C CG  . LEU D 1 255 ? -12.984 -13.752 58.349  1.00 38.68  ? 255  LEU D CG  1 
ATOM   9091  C CD1 . LEU D 1 255 ? -11.499 -13.528 58.460  1.00 37.95  ? 255  LEU D CD1 1 
ATOM   9092  C CD2 . LEU D 1 255 ? -13.259 -14.937 57.458  1.00 39.92  ? 255  LEU D CD2 1 
ATOM   9093  N N   . THR D 1 256 ? -15.566 -13.799 62.275  1.00 37.89  ? 256  THR D N   1 
ATOM   9094  C CA  . THR D 1 256 ? -15.845 -14.370 63.597  1.00 38.18  ? 256  THR D CA  1 
ATOM   9095  C C   . THR D 1 256 ? -17.179 -13.967 64.234  1.00 43.40  ? 256  THR D C   1 
ATOM   9096  O O   . THR D 1 256 ? -17.601 -14.593 65.213  1.00 43.49  ? 256  THR D O   1 
ATOM   9097  C CB  . THR D 1 256 ? -14.737 -13.945 64.569  1.00 43.73  ? 256  THR D CB  1 
ATOM   9098  O OG1 . THR D 1 256 ? -14.841 -12.539 64.823  1.00 39.16  ? 256  THR D OG1 1 
ATOM   9099  C CG2 . THR D 1 256 ? -13.347 -14.289 64.059  1.00 40.91  ? 256  THR D CG2 1 
ATOM   9100  N N   . GLY D 1 257 ? -17.786 -12.896 63.736  1.00 40.46  ? 257  GLY D N   1 
ATOM   9101  C CA  . GLY D 1 257 ? -19.026 -12.367 64.293  1.00 40.73  ? 257  GLY D CA  1 
ATOM   9102  C C   . GLY D 1 257 ? -18.817 -11.486 65.508  1.00 43.00  ? 257  GLY D C   1 
ATOM   9103  O O   . GLY D 1 257 ? -19.792 -11.018 66.098  1.00 43.53  ? 257  GLY D O   1 
ATOM   9104  N N   . HIS D 1 258 ? -17.543 -11.265 65.909  1.00 37.76  ? 258  HIS D N   1 
ATOM   9105  C CA  . HIS D 1 258 ? -17.199 -10.486 67.099  1.00 37.14  ? 258  HIS D CA  1 
ATOM   9106  C C   . HIS D 1 258 ? -15.893 -9.694  66.951  1.00 40.77  ? 258  HIS D C   1 
ATOM   9107  O O   . HIS D 1 258 ? -15.116 -9.917  66.024  1.00 41.03  ? 258  HIS D O   1 
ATOM   9108  C CB  . HIS D 1 258 ? -17.055 -11.423 68.328  1.00 38.70  ? 258  HIS D CB  1 
ATOM   9109  C CG  . HIS D 1 258 ? -18.214 -12.345 68.545  1.00 43.81  ? 258  HIS D CG  1 
ATOM   9110  N ND1 . HIS D 1 258 ? -19.350 -11.932 69.215  1.00 46.30  ? 258  HIS D ND1 1 
ATOM   9111  C CD2 . HIS D 1 258 ? -18.389 -13.623 68.134  1.00 46.68  ? 258  HIS D CD2 1 
ATOM   9112  C CE1 . HIS D 1 258 ? -20.174 -12.965 69.194  1.00 47.34  ? 258  HIS D CE1 1 
ATOM   9113  N NE2 . HIS D 1 258 ? -19.642 -14.005 68.552  1.00 47.96  ? 258  HIS D NE2 1 
ATOM   9114  N N   . LEU D 1 259 ? -15.665 -8.780  67.899  1.00 36.78  ? 259  LEU D N   1 
ATOM   9115  C CA  . LEU D 1 259 ? -14.453 -7.989  68.101  1.00 35.52  ? 259  LEU D CA  1 
ATOM   9116  C C   . LEU D 1 259 ? -14.166 -8.015  69.606  1.00 42.17  ? 259  LEU D C   1 
ATOM   9117  O O   . LEU D 1 259 ? -15.123 -8.003  70.380  1.00 44.13  ? 259  LEU D O   1 
ATOM   9118  C CB  . LEU D 1 259 ? -14.542 -6.558  67.537  1.00 33.91  ? 259  LEU D CB  1 
ATOM   9119  C CG  . LEU D 1 259 ? -14.381 -6.427  66.009  1.00 36.65  ? 259  LEU D CG  1 
ATOM   9120  C CD1 . LEU D 1 259 ? -14.726 -5.047  65.553  1.00 34.68  ? 259  LEU D CD1 1 
ATOM   9121  C CD2 . LEU D 1 259 ? -12.963 -6.797  65.538  1.00 38.05  ? 259  LEU D CD2 1 
ATOM   9122  N N   . PRO D 1 260 ? -12.893 -8.136  70.054  1.00 38.16  ? 260  PRO D N   1 
ATOM   9123  C CA  . PRO D 1 260 ? -12.632 -8.286  71.504  1.00 38.20  ? 260  PRO D CA  1 
ATOM   9124  C C   . PRO D 1 260 ? -13.190 -7.197  72.422  1.00 41.59  ? 260  PRO D C   1 
ATOM   9125  O O   . PRO D 1 260 ? -13.555 -7.493  73.565  1.00 43.17  ? 260  PRO D O   1 
ATOM   9126  C CB  . PRO D 1 260 ? -11.107 -8.284  71.586  1.00 39.24  ? 260  PRO D CB  1 
ATOM   9127  C CG  . PRO D 1 260 ? -10.648 -8.723  70.251  1.00 42.77  ? 260  PRO D CG  1 
ATOM   9128  C CD  . PRO D 1 260 ? -11.643 -8.212  69.265  1.00 37.91  ? 260  PRO D CD  1 
ATOM   9129  N N   . TRP D 1 261 ? -13.255 -5.956  71.935  1.00 36.39  ? 261  TRP D N   1 
ATOM   9130  C CA  . TRP D 1 261 ? -13.689 -4.777  72.698  1.00 36.22  ? 261  TRP D CA  1 
ATOM   9131  C C   . TRP D 1 261 ? -15.193 -4.451  72.570  1.00 39.77  ? 261  TRP D C   1 
ATOM   9132  O O   . TRP D 1 261 ? -15.614 -3.431  73.113  1.00 39.01  ? 261  TRP D O   1 
ATOM   9133  C CB  . TRP D 1 261 ? -12.867 -3.551  72.234  1.00 33.58  ? 261  TRP D CB  1 
ATOM   9134  C CG  . TRP D 1 261 ? -12.746 -3.438  70.739  1.00 33.40  ? 261  TRP D CG  1 
ATOM   9135  C CD1 . TRP D 1 261 ? -13.644 -2.875  69.881  1.00 36.03  ? 261  TRP D CD1 1 
ATOM   9136  C CD2 . TRP D 1 261 ? -11.677 -3.947  69.925  1.00 32.61  ? 261  TRP D CD2 1 
ATOM   9137  N NE1 . TRP D 1 261 ? -13.198 -2.993  68.584  1.00 34.54  ? 261  TRP D NE1 1 
ATOM   9138  C CE2 . TRP D 1 261 ? -11.993 -3.649  68.582  1.00 35.71  ? 261  TRP D CE2 1 
ATOM   9139  C CE3 . TRP D 1 261 ? -10.485 -4.638  70.202  1.00 33.75  ? 261  TRP D CE3 1 
ATOM   9140  C CZ2 . TRP D 1 261 ? -11.150 -4.004  67.518  1.00 34.43  ? 261  TRP D CZ2 1 
ATOM   9141  C CZ3 . TRP D 1 261 ? -9.653  -4.984  69.151  1.00 34.47  ? 261  TRP D CZ3 1 
ATOM   9142  C CH2 . TRP D 1 261 ? -9.986  -4.669  67.828  1.00 34.50  ? 261  TRP D CH2 1 
ATOM   9143  N N   . GLU D 1 262 ? -15.998 -5.306  71.895  1.00 37.24  ? 262  GLU D N   1 
ATOM   9144  C CA  . GLU D 1 262 ? -17.420 -5.042  71.624  1.00 38.93  ? 262  GLU D CA  1 
ATOM   9145  C C   . GLU D 1 262 ? -18.333 -4.978  72.875  1.00 46.07  ? 262  GLU D C   1 
ATOM   9146  O O   . GLU D 1 262 ? -19.437 -4.428  72.787  1.00 46.22  ? 262  GLU D O   1 
ATOM   9147  C CB  . GLU D 1 262 ? -17.988 -6.061  70.621  1.00 40.99  ? 262  GLU D CB  1 
ATOM   9148  C CG  . GLU D 1 262 ? -18.158 -7.476  71.156  1.00 53.04  ? 262  GLU D CG  1 
ATOM   9149  C CD  . GLU D 1 262 ? -18.702 -8.493  70.173  1.00 75.41  ? 262  GLU D CD  1 
ATOM   9150  O OE1 . GLU D 1 262 ? -19.071 -9.598  70.629  1.00 74.74  ? 262  GLU D OE1 1 
ATOM   9151  O OE2 . GLU D 1 262 ? -18.769 -8.194  68.957  1.00 66.16  ? 262  GLU D OE2 1 
ATOM   9152  N N   . ASP D 1 263 ? -17.893 -5.527  74.015  1.00 44.42  ? 263  ASP D N   1 
ATOM   9153  C CA  . ASP D 1 263 ? -18.730 -5.519  75.208  1.00 46.94  ? 263  ASP D CA  1 
ATOM   9154  C C   . ASP D 1 263 ? -18.575 -4.228  76.037  1.00 49.60  ? 263  ASP D C   1 
ATOM   9155  O O   . ASP D 1 263 ? -19.249 -4.090  77.060  1.00 50.75  ? 263  ASP D O   1 
ATOM   9156  C CB  . ASP D 1 263 ? -18.464 -6.765  76.071  1.00 50.78  ? 263  ASP D CB  1 
ATOM   9157  C CG  . ASP D 1 263 ? -18.947 -8.058  75.435  1.00 66.86  ? 263  ASP D CG  1 
ATOM   9158  O OD1 . ASP D 1 263 ? -20.020 -8.038  74.777  1.00 66.95  ? 263  ASP D OD1 1 
ATOM   9159  O OD2 . ASP D 1 263 ? -18.265 -9.097  75.609  1.00 77.37  ? 263  ASP D OD2 1 
ATOM   9160  N N   . ASN D 1 264 ? -17.735 -3.276  75.594  1.00 43.63  ? 264  ASN D N   1 
ATOM   9161  C CA  . ASN D 1 264 ? -17.573 -2.027  76.338  1.00 42.92  ? 264  ASN D CA  1 
ATOM   9162  C C   . ASN D 1 264 ? -17.306 -0.863  75.374  1.00 41.65  ? 264  ASN D C   1 
ATOM   9163  O O   . ASN D 1 264 ? -16.349 -0.107  75.549  1.00 39.84  ? 264  ASN D O   1 
ATOM   9164  C CB  . ASN D 1 264 ? -16.484 -2.154  77.438  1.00 45.29  ? 264  ASN D CB  1 
ATOM   9165  C CG  . ASN D 1 264 ? -16.726 -1.301  78.679  1.00 73.14  ? 264  ASN D CG  1 
ATOM   9166  O OD1 . ASN D 1 264 ? -17.775 -0.652  78.859  1.00 66.10  ? 264  ASN D OD1 1 
ATOM   9167  N ND2 . ASN D 1 264 ? -15.756 -1.295  79.580  1.00 65.17  ? 264  ASN D ND2 1 
ATOM   9168  N N   . LEU D 1 265 ? -18.210 -0.690  74.389  1.00 36.73  ? 265  LEU D N   1 
ATOM   9169  C CA  . LEU D 1 265 ? -18.126 0.359   73.367  1.00 35.40  ? 265  LEU D CA  1 
ATOM   9170  C C   . LEU D 1 265 ? -18.510 1.745   73.912  1.00 40.98  ? 265  LEU D C   1 
ATOM   9171  O O   . LEU D 1 265 ? -18.255 2.755   73.244  1.00 40.08  ? 265  LEU D O   1 
ATOM   9172  C CB  . LEU D 1 265 ? -18.986 0.007   72.148  1.00 35.50  ? 265  LEU D CB  1 
ATOM   9173  C CG  . LEU D 1 265 ? -18.620 -1.277  71.388  1.00 39.24  ? 265  LEU D CG  1 
ATOM   9174  C CD1 . LEU D 1 265 ? -19.587 -1.519  70.261  1.00 39.48  ? 265  LEU D CD1 1 
ATOM   9175  C CD2 . LEU D 1 265 ? -17.183 -1.246  70.881  1.00 38.76  ? 265  LEU D CD2 1 
ATOM   9176  N N   . LYS D 1 266 ? -19.075 1.788   75.136  1.00 39.58  ? 266  LYS D N   1 
ATOM   9177  C CA  . LYS D 1 266 ? -19.467 3.007   75.847  1.00 41.01  ? 266  LYS D CA  1 
ATOM   9178  C C   . LYS D 1 266 ? -18.262 3.613   76.600  1.00 45.80  ? 266  LYS D C   1 
ATOM   9179  O O   . LYS D 1 266 ? -18.366 4.718   77.138  1.00 45.66  ? 266  LYS D O   1 
ATOM   9180  C CB  . LYS D 1 266 ? -20.628 2.730   76.812  1.00 45.27  ? 266  LYS D CB  1 
ATOM   9181  C CG  . LYS D 1 266 ? -21.941 2.454   76.110  1.00 62.26  ? 266  LYS D CG  1 
ATOM   9182  C CD  . LYS D 1 266 ? -23.043 2.226   77.128  1.00 73.43  ? 266  LYS D CD  1 
ATOM   9183  N N   . ASP D 1 267 ? -17.127 2.880   76.644  1.00 42.45  ? 267  ASP D N   1 
ATOM   9184  C CA  . ASP D 1 267 ? -15.870 3.336   77.242  1.00 41.49  ? 267  ASP D CA  1 
ATOM   9185  C C   . ASP D 1 267 ? -14.860 3.515   76.093  1.00 42.94  ? 267  ASP D C   1 
ATOM   9186  O O   . ASP D 1 267 ? -14.242 2.538   75.657  1.00 41.41  ? 267  ASP D O   1 
ATOM   9187  C CB  . ASP D 1 267 ? -15.360 2.377   78.345  1.00 43.67  ? 267  ASP D CB  1 
ATOM   9188  C CG  . ASP D 1 267 ? -14.150 2.868   79.147  1.00 49.56  ? 267  ASP D CG  1 
ATOM   9189  O OD1 . ASP D 1 267 ? -13.548 3.905   78.760  1.00 48.94  ? 267  ASP D OD1 1 
ATOM   9190  O OD2 . ASP D 1 267 ? -13.778 2.191   80.133  1.00 52.89  ? 267  ASP D OD2 1 
ATOM   9191  N N   . PRO D 1 268 ? -14.734 4.760   75.569  1.00 38.39  ? 268  PRO D N   1 
ATOM   9192  C CA  . PRO D 1 268 ? -13.829 5.004   74.432  1.00 36.77  ? 268  PRO D CA  1 
ATOM   9193  C C   . PRO D 1 268 ? -12.351 4.731   74.732  1.00 40.43  ? 268  PRO D C   1 
ATOM   9194  O O   . PRO D 1 268 ? -11.649 4.221   73.861  1.00 40.53  ? 268  PRO D O   1 
ATOM   9195  C CB  . PRO D 1 268 ? -14.064 6.481   74.100  1.00 38.73  ? 268  PRO D CB  1 
ATOM   9196  C CG  . PRO D 1 268 ? -15.307 6.866   74.816  1.00 44.03  ? 268  PRO D CG  1 
ATOM   9197  C CD  . PRO D 1 268 ? -15.428 5.996   75.985  1.00 40.37  ? 268  PRO D CD  1 
ATOM   9198  N N   . LYS D 1 269 ? -11.881 5.069   75.939  1.00 37.13  ? 269  LYS D N   1 
ATOM   9199  C CA  . LYS D 1 269 ? -10.504 4.835   76.378  1.00 36.22  ? 269  LYS D CA  1 
ATOM   9200  C C   . LYS D 1 269 ? -10.196 3.329   76.374  1.00 38.50  ? 269  LYS D C   1 
ATOM   9201  O O   . LYS D 1 269 ? -9.145  2.942   75.870  1.00 37.03  ? 269  LYS D O   1 
ATOM   9202  C CB  . LYS D 1 269 ? -10.251 5.444   77.777  1.00 40.41  ? 269  LYS D CB  1 
ATOM   9203  C CG  . LYS D 1 269 ? -10.065 6.958   77.778  1.00 60.93  ? 269  LYS D CG  1 
ATOM   9204  N N   . TYR D 1 270 ? -11.126 2.485   76.892  1.00 36.26  ? 270  TYR D N   1 
ATOM   9205  C CA  . TYR D 1 270 ? -10.984 1.024   76.917  1.00 36.61  ? 270  TYR D CA  1 
ATOM   9206  C C   . TYR D 1 270 ? -10.823 0.477   75.496  1.00 39.06  ? 270  TYR D C   1 
ATOM   9207  O O   . TYR D 1 270 ? -9.919  -0.323  75.270  1.00 40.09  ? 270  TYR D O   1 
ATOM   9208  C CB  . TYR D 1 270 ? -12.169 0.332   77.643  1.00 39.56  ? 270  TYR D CB  1 
ATOM   9209  C CG  . TYR D 1 270 ? -12.286 -1.154  77.357  1.00 42.27  ? 270  TYR D CG  1 
ATOM   9210  C CD1 . TYR D 1 270 ? -11.548 -2.086  78.082  1.00 44.97  ? 270  TYR D CD1 1 
ATOM   9211  C CD2 . TYR D 1 270 ? -13.101 -1.625  76.332  1.00 43.06  ? 270  TYR D CD2 1 
ATOM   9212  C CE1 . TYR D 1 270 ? -11.606 -3.449  77.783  1.00 45.53  ? 270  TYR D CE1 1 
ATOM   9213  C CE2 . TYR D 1 270 ? -13.170 -2.983  76.025  1.00 44.19  ? 270  TYR D CE2 1 
ATOM   9214  C CZ  . TYR D 1 270 ? -12.428 -3.894  76.759  1.00 52.32  ? 270  TYR D CZ  1 
ATOM   9215  O OH  . TYR D 1 270 ? -12.527 -5.241  76.487  1.00 53.72  ? 270  TYR D OH  1 
ATOM   9216  N N   . VAL D 1 271 ? -11.700 0.898   74.555  1.00 33.29  ? 271  VAL D N   1 
ATOM   9217  C CA  . VAL D 1 271 ? -11.690 0.465   73.148  1.00 31.35  ? 271  VAL D CA  1 
ATOM   9218  C C   . VAL D 1 271 ? -10.326 0.819   72.518  1.00 34.32  ? 271  VAL D C   1 
ATOM   9219  O O   . VAL D 1 271 ? -9.711  -0.050  71.902  1.00 34.15  ? 271  VAL D O   1 
ATOM   9220  C CB  . VAL D 1 271 ? -12.888 1.046   72.333  1.00 34.24  ? 271  VAL D CB  1 
ATOM   9221  C CG1 . VAL D 1 271 ? -12.826 0.614   70.868  1.00 32.78  ? 271  VAL D CG1 1 
ATOM   9222  C CG2 . VAL D 1 271 ? -14.233 0.651   72.944  1.00 34.94  ? 271  VAL D CG2 1 
ATOM   9223  N N   . ARG D 1 272 ? -9.854  2.076   72.710  1.00 29.73  ? 272  ARG D N   1 
ATOM   9224  C CA  . ARG D 1 272 ? -8.563  2.599   72.251  1.00 28.41  ? 272  ARG D CA  1 
ATOM   9225  C C   . ARG D 1 272 ? -7.386  1.784   72.826  1.00 32.90  ? 272  ARG D C   1 
ATOM   9226  O O   . ARG D 1 272 ? -6.484  1.409   72.081  1.00 32.25  ? 272  ARG D O   1 
ATOM   9227  C CB  . ARG D 1 272 ? -8.427  4.080   72.671  1.00 29.71  ? 272  ARG D CB  1 
ATOM   9228  C CG  . ARG D 1 272 ? -7.029  4.670   72.456  1.00 36.88  ? 272  ARG D CG  1 
ATOM   9229  C CD  . ARG D 1 272 ? -6.877  6.103   72.922  1.00 40.99  ? 272  ARG D CD  1 
ATOM   9230  N NE  . ARG D 1 272 ? -7.119  6.295   74.358  1.00 50.18  ? 272  ARG D NE  1 
ATOM   9231  C CZ  . ARG D 1 272 ? -6.220  6.099   75.319  1.00 65.82  ? 272  ARG D CZ  1 
ATOM   9232  N NH1 . ARG D 1 272 ? -5.013  5.630   75.025  1.00 67.93  ? 272  ARG D NH1 1 
ATOM   9233  N NH2 . ARG D 1 272 ? -6.538  6.324   76.588  1.00 37.21  ? 272  ARG D NH2 1 
ATOM   9234  N N   . ASP D 1 273 ? -7.394  1.537   74.151  1.00 30.43  ? 273  ASP D N   1 
ATOM   9235  C CA  . ASP D 1 273 ? -6.342  0.798   74.862  1.00 30.53  ? 273  ASP D CA  1 
ATOM   9236  C C   . ASP D 1 273 ? -6.296  -0.682  74.431  1.00 36.43  ? 273  ASP D C   1 
ATOM   9237  O O   . ASP D 1 273 ? -5.207  -1.260  74.303  1.00 36.69  ? 273  ASP D O   1 
ATOM   9238  C CB  . ASP D 1 273 ? -6.529  0.926   76.379  1.00 32.39  ? 273  ASP D CB  1 
ATOM   9239  C CG  . ASP D 1 273 ? -6.171  2.293   76.946  1.00 40.33  ? 273  ASP D CG  1 
ATOM   9240  O OD1 . ASP D 1 273 ? -5.663  3.150   76.177  1.00 37.32  ? 273  ASP D OD1 1 
ATOM   9241  O OD2 . ASP D 1 273 ? -6.389  2.505   78.160  1.00 51.97  ? 273  ASP D OD2 1 
ATOM   9242  N N   . SER D 1 274 ? -7.477  -1.266  74.167  1.00 32.66  ? 274  SER D N   1 
ATOM   9243  C CA  . SER D 1 274 ? -7.623  -2.640  73.711  1.00 32.44  ? 274  SER D CA  1 
ATOM   9244  C C   . SER D 1 274 ? -6.977  -2.781  72.315  1.00 34.16  ? 274  SER D C   1 
ATOM   9245  O O   . SER D 1 274 ? -6.164  -3.682  72.110  1.00 33.87  ? 274  SER D O   1 
ATOM   9246  C CB  . SER D 1 274 ? -9.101  -3.031  73.709  1.00 37.10  ? 274  SER D CB  1 
ATOM   9247  O OG  . SER D 1 274 ? -9.313  -4.377  73.326  1.00 49.36  ? 274  SER D OG  1 
ATOM   9248  N N   . LYS D 1 275 ? -7.255  -1.825  71.405  1.00 29.10  ? 275  LYS D N   1 
ATOM   9249  C CA  . LYS D 1 275 ? -6.708  -1.799  70.048  1.00 27.25  ? 275  LYS D CA  1 
ATOM   9250  C C   . LYS D 1 275 ? -5.193  -1.591  70.034  1.00 31.46  ? 275  LYS D C   1 
ATOM   9251  O O   . LYS D 1 275 ? -4.531  -2.188  69.194  1.00 31.38  ? 275  LYS D O   1 
ATOM   9252  C CB  . LYS D 1 275 ? -7.389  -0.731  69.190  1.00 27.95  ? 275  LYS D CB  1 
ATOM   9253  C CG  . LYS D 1 275 ? -8.798  -1.102  68.782  1.00 29.09  ? 275  LYS D CG  1 
ATOM   9254  C CD  . LYS D 1 275 ? -9.450  -0.012  67.969  1.00 30.00  ? 275  LYS D CD  1 
ATOM   9255  C CE  . LYS D 1 275 ? -10.904 -0.329  67.809  1.00 26.48  ? 275  LYS D CE  1 
ATOM   9256  N NZ  . LYS D 1 275 ? -11.615 0.714   67.065  1.00 23.90  ? 275  LYS D NZ  1 
ATOM   9257  N N   . ILE D 1 276 ? -4.647  -0.756  70.939  1.00 29.27  ? 276  ILE D N   1 
ATOM   9258  C CA  . ILE D 1 276 ? -3.200  -0.484  71.049  1.00 29.11  ? 276  ILE D CA  1 
ATOM   9259  C C   . ILE D 1 276 ? -2.475  -1.778  71.469  1.00 35.33  ? 276  ILE D C   1 
ATOM   9260  O O   . ILE D 1 276 ? -1.473  -2.143  70.854  1.00 34.97  ? 276  ILE D O   1 
ATOM   9261  C CB  . ILE D 1 276 ? -2.914  0.717   72.018  1.00 31.80  ? 276  ILE D CB  1 
ATOM   9262  C CG1 . ILE D 1 276 ? -3.301  2.058   71.350  1.00 31.19  ? 276  ILE D CG1 1 
ATOM   9263  C CG2 . ILE D 1 276 ? -1.444  0.753   72.496  1.00 31.80  ? 276  ILE D CG2 1 
ATOM   9264  C CD1 . ILE D 1 276 ? -3.463  3.256   72.292  1.00 32.45  ? 276  ILE D CD1 1 
ATOM   9265  N N   . ARG D 1 277 ? -3.013  -2.471  72.486  1.00 34.19  ? 277  ARG D N   1 
ATOM   9266  C CA  . ARG D 1 277 ? -2.487  -3.726  73.031  1.00 35.41  ? 277  ARG D CA  1 
ATOM   9267  C C   . ARG D 1 277 ? -2.519  -4.849  71.975  1.00 38.66  ? 277  ARG D C   1 
ATOM   9268  O O   . ARG D 1 277 ? -1.556  -5.607  71.869  1.00 39.47  ? 277  ARG D O   1 
ATOM   9269  C CB  . ARG D 1 277 ? -3.302  -4.119  74.282  1.00 38.80  ? 277  ARG D CB  1 
ATOM   9270  C CG  . ARG D 1 277 ? -2.959  -5.474  74.906  1.00 53.20  ? 277  ARG D CG  1 
ATOM   9271  C CD  . ARG D 1 277 ? -3.825  -5.765  76.122  1.00 64.92  ? 277  ARG D CD  1 
ATOM   9272  N N   . TYR D 1 278 ? -3.617  -4.945  71.198  1.00 33.06  ? 278  TYR D N   1 
ATOM   9273  C CA  . TYR D 1 278 ? -3.757  -5.976  70.173  1.00 31.55  ? 278  TYR D CA  1 
ATOM   9274  C C   . TYR D 1 278 ? -2.934  -5.659  68.920  1.00 35.04  ? 278  TYR D C   1 
ATOM   9275  O O   . TYR D 1 278 ? -2.620  -6.582  68.167  1.00 35.54  ? 278  TYR D O   1 
ATOM   9276  C CB  . TYR D 1 278 ? -5.226  -6.232  69.826  1.00 31.40  ? 278  TYR D CB  1 
ATOM   9277  C CG  . TYR D 1 278 ? -5.951  -7.052  70.873  1.00 31.72  ? 278  TYR D CG  1 
ATOM   9278  C CD1 . TYR D 1 278 ? -5.477  -8.303  71.264  1.00 34.12  ? 278  TYR D CD1 1 
ATOM   9279  C CD2 . TYR D 1 278 ? -7.126  -6.592  71.456  1.00 32.02  ? 278  TYR D CD2 1 
ATOM   9280  C CE1 . TYR D 1 278 ? -6.152  -9.071  72.214  1.00 34.63  ? 278  TYR D CE1 1 
ATOM   9281  C CE2 . TYR D 1 278 ? -7.791  -7.335  72.432  1.00 33.14  ? 278  TYR D CE2 1 
ATOM   9282  C CZ  . TYR D 1 278 ? -7.314  -8.583  72.791  1.00 37.98  ? 278  TYR D CZ  1 
ATOM   9283  O OH  . TYR D 1 278 ? -7.986  -9.322  73.731  1.00 38.72  ? 278  TYR D OH  1 
ATOM   9284  N N   . ARG D 1 279 ? -2.559  -4.379  68.706  1.00 29.99  ? 279  ARG D N   1 
ATOM   9285  C CA  . ARG D 1 279 ? -1.666  -3.977  67.613  1.00 28.07  ? 279  ARG D CA  1 
ATOM   9286  C C   . ARG D 1 279 ? -0.234  -4.351  68.005  1.00 32.39  ? 279  ARG D C   1 
ATOM   9287  O O   . ARG D 1 279 ? 0.518   -4.856  67.179  1.00 32.49  ? 279  ARG D O   1 
ATOM   9288  C CB  . ARG D 1 279 ? -1.785  -2.476  67.325  1.00 25.47  ? 279  ARG D CB  1 
ATOM   9289  C CG  . ARG D 1 279 ? -0.874  -1.962  66.209  1.00 31.02  ? 279  ARG D CG  1 
ATOM   9290  C CD  . ARG D 1 279 ? -0.834  -0.457  66.225  1.00 37.56  ? 279  ARG D CD  1 
ATOM   9291  N NE  . ARG D 1 279 ? -0.084  0.097   65.105  1.00 46.39  ? 279  ARG D NE  1 
ATOM   9292  C CZ  . ARG D 1 279 ? 1.188   0.475   65.174  1.00 67.13  ? 279  ARG D CZ  1 
ATOM   9293  N NH1 . ARG D 1 279 ? 1.863   0.360   66.313  1.00 59.18  ? 279  ARG D NH1 1 
ATOM   9294  N NH2 . ARG D 1 279 ? 1.794   0.976   64.110  1.00 53.77  ? 279  ARG D NH2 1 
ATOM   9295  N N   . GLU D 1 280 ? 0.117   -4.127  69.288  1.00 30.06  ? 280  GLU D N   1 
ATOM   9296  C CA  . GLU D 1 280 ? 1.416   -4.439  69.883  1.00 31.51  ? 280  GLU D CA  1 
ATOM   9297  C C   . GLU D 1 280 ? 1.662   -5.960  69.890  1.00 38.49  ? 280  GLU D C   1 
ATOM   9298  O O   . GLU D 1 280 ? 2.808   -6.396  69.739  1.00 40.30  ? 280  GLU D O   1 
ATOM   9299  C CB  . GLU D 1 280 ? 1.496   -3.860  71.307  1.00 33.61  ? 280  GLU D CB  1 
ATOM   9300  C CG  . GLU D 1 280 ? 2.892   -3.854  71.913  1.00 46.88  ? 280  GLU D CG  1 
ATOM   9301  N N   . ASN D 1 281 ? 0.588   -6.760  70.030  1.00 34.72  ? 281  ASN D N   1 
ATOM   9302  C CA  . ASN D 1 281 ? 0.656   -8.220  70.032  1.00 34.84  ? 281  ASN D CA  1 
ATOM   9303  C C   . ASN D 1 281 ? -0.498  -8.772  69.185  1.00 38.03  ? 281  ASN D C   1 
ATOM   9304  O O   . ASN D 1 281 ? -1.575  -9.061  69.708  1.00 37.51  ? 281  ASN D O   1 
ATOM   9305  C CB  . ASN D 1 281 ? 0.632   -8.752  71.477  1.00 36.07  ? 281  ASN D CB  1 
ATOM   9306  C CG  . ASN D 1 281 ? 0.943   -10.225 71.643  1.00 57.40  ? 281  ASN D CG  1 
ATOM   9307  O OD1 . ASN D 1 281 ? 1.282   -10.955 70.697  1.00 50.46  ? 281  ASN D OD1 1 
ATOM   9308  N ND2 . ASN D 1 281 ? 0.849   -10.692 72.875  1.00 50.01  ? 281  ASN D ND2 1 
ATOM   9309  N N   . ILE D 1 282 ? -0.271  -8.877  67.862  1.00 34.80  ? 282  ILE D N   1 
ATOM   9310  C CA  . ILE D 1 282 ? -1.242  -9.351  66.865  1.00 34.40  ? 282  ILE D CA  1 
ATOM   9311  C C   . ILE D 1 282 ? -1.532  -10.855 67.081  1.00 40.32  ? 282  ILE D C   1 
ATOM   9312  O O   . ILE D 1 282 ? -2.673  -11.276 66.869  1.00 40.10  ? 282  ILE D O   1 
ATOM   9313  C CB  . ILE D 1 282 ? -0.778  -8.994  65.414  1.00 36.42  ? 282  ILE D CB  1 
ATOM   9314  C CG1 . ILE D 1 282 ? -0.894  -7.458  65.208  1.00 35.64  ? 282  ILE D CG1 1 
ATOM   9315  C CG2 . ILE D 1 282 ? -1.569  -9.771  64.311  1.00 36.10  ? 282  ILE D CG2 1 
ATOM   9316  C CD1 . ILE D 1 282 ? -0.113  -6.859  64.051  1.00 42.84  ? 282  ILE D CD1 1 
ATOM   9317  N N   . ALA D 1 283 ? -0.535  -11.635 67.570  1.00 37.67  ? 283  ALA D N   1 
ATOM   9318  C CA  . ALA D 1 283 ? -0.696  -13.064 67.878  1.00 38.82  ? 283  ALA D CA  1 
ATOM   9319  C C   . ALA D 1 283 ? -1.767  -13.279 68.955  1.00 41.02  ? 283  ALA D C   1 
ATOM   9320  O O   . ALA D 1 283 ? -2.552  -14.220 68.841  1.00 41.61  ? 283  ALA D O   1 
ATOM   9321  C CB  . ALA D 1 283 ? 0.631   -13.660 68.331  1.00 40.87  ? 283  ALA D CB  1 
ATOM   9322  N N   . SER D 1 284 ? -1.826  -12.382 69.971  1.00 35.95  ? 284  SER D N   1 
ATOM   9323  C CA  . SER D 1 284 ? -2.827  -12.446 71.040  1.00 35.49  ? 284  SER D CA  1 
ATOM   9324  C C   . SER D 1 284 ? -4.202  -12.057 70.494  1.00 38.07  ? 284  SER D C   1 
ATOM   9325  O O   . SER D 1 284 ? -5.199  -12.585 70.977  1.00 38.55  ? 284  SER D O   1 
ATOM   9326  C CB  . SER D 1 284 ? -2.439  -11.578 72.234  1.00 37.06  ? 284  SER D CB  1 
ATOM   9327  O OG  . SER D 1 284 ? -2.472  -10.189 71.948  1.00 41.46  ? 284  SER D OG  1 
ATOM   9328  N N   . LEU D 1 285 ? -4.251  -11.170 69.472  1.00 33.34  ? 285  LEU D N   1 
ATOM   9329  C CA  . LEU D 1 285 ? -5.496  -10.786 68.801  1.00 33.00  ? 285  LEU D CA  1 
ATOM   9330  C C   . LEU D 1 285 ? -6.047  -11.990 68.025  1.00 38.92  ? 285  LEU D C   1 
ATOM   9331  O O   . LEU D 1 285 ? -7.243  -12.260 68.107  1.00 38.80  ? 285  LEU D O   1 
ATOM   9332  C CB  . LEU D 1 285 ? -5.300  -9.567  67.870  1.00 31.40  ? 285  LEU D CB  1 
ATOM   9333  C CG  . LEU D 1 285 ? -6.515  -9.114  67.028  1.00 35.23  ? 285  LEU D CG  1 
ATOM   9334  C CD1 . LEU D 1 285 ? -7.610  -8.530  67.897  1.00 35.58  ? 285  LEU D CD1 1 
ATOM   9335  C CD2 . LEU D 1 285 ? -6.110  -8.115  65.982  1.00 35.93  ? 285  LEU D CD2 1 
ATOM   9336  N N   . MET D 1 286 ? -5.163  -12.737 67.325  1.00 36.70  ? 286  MET D N   1 
ATOM   9337  C CA  . MET D 1 286 ? -5.536  -13.930 66.566  1.00 37.87  ? 286  MET D CA  1 
ATOM   9338  C C   . MET D 1 286 ? -6.033  -15.022 67.517  1.00 44.61  ? 286  MET D C   1 
ATOM   9339  O O   . MET D 1 286 ? -7.044  -15.663 67.224  1.00 44.89  ? 286  MET D O   1 
ATOM   9340  C CB  . MET D 1 286 ? -4.367  -14.435 65.695  1.00 40.46  ? 286  MET D CB  1 
ATOM   9341  C CG  . MET D 1 286 ? -3.918  -13.452 64.605  1.00 42.76  ? 286  MET D CG  1 
ATOM   9342  S SD  . MET D 1 286 ? -5.200  -12.961 63.420  1.00 46.83  ? 286  MET D SD  1 
ATOM   9343  C CE  . MET D 1 286 ? -5.428  -11.290 63.860  1.00 41.65  ? 286  MET D CE  1 
ATOM   9344  N N   . ASP D 1 287 ? -5.365  -15.185 68.680  1.00 42.62  ? 287  ASP D N   1 
ATOM   9345  C CA  . ASP D 1 287 ? -5.734  -16.172 69.700  1.00 44.30  ? 287  ASP D CA  1 
ATOM   9346  C C   . ASP D 1 287 ? -7.080  -15.844 70.343  1.00 46.38  ? 287  ASP D C   1 
ATOM   9347  O O   . ASP D 1 287 ? -7.832  -16.756 70.665  1.00 48.45  ? 287  ASP D O   1 
ATOM   9348  C CB  . ASP D 1 287 ? -4.646  -16.276 70.790  1.00 47.55  ? 287  ASP D CB  1 
ATOM   9349  C CG  . ASP D 1 287 ? -3.303  -16.841 70.330  1.00 65.48  ? 287  ASP D CG  1 
ATOM   9350  O OD1 . ASP D 1 287 ? -3.283  -17.610 69.332  1.00 68.63  ? 287  ASP D OD1 1 
ATOM   9351  O OD2 . ASP D 1 287 ? -2.276  -16.534 70.980  1.00 71.05  ? 287  ASP D OD2 1 
ATOM   9352  N N   . LYS D 1 288 ? -7.379  -14.553 70.523  1.00 39.74  ? 288  LYS D N   1 
ATOM   9353  C CA  . LYS D 1 288 ? -8.621  -14.068 71.130  1.00 38.92  ? 288  LYS D CA  1 
ATOM   9354  C C   . LYS D 1 288 ? -9.824  -14.227 70.177  1.00 42.47  ? 288  LYS D C   1 
ATOM   9355  O O   . LYS D 1 288 ? -10.891 -14.658 70.615  1.00 42.65  ? 288  LYS D O   1 
ATOM   9356  C CB  . LYS D 1 288 ? -8.457  -12.593 71.563  1.00 39.01  ? 288  LYS D CB  1 
ATOM   9357  C CG  . LYS D 1 288 ? -9.723  -11.895 72.046  1.00 48.58  ? 288  LYS D CG  1 
ATOM   9358  C CD  . LYS D 1 288 ? -10.116 -12.258 73.479  1.00 57.48  ? 288  LYS D CD  1 
ATOM   9359  C CE  . LYS D 1 288 ? -11.381 -11.551 73.887  1.00 65.57  ? 288  LYS D CE  1 
ATOM   9360  N NZ  . LYS D 1 288 ? -11.693 -11.774 75.322  1.00 77.94  ? 288  LYS D NZ  1 
ATOM   9361  N N   . CYS D 1 289 ? -9.645  -13.883 68.892  1.00 38.68  ? 289  CYS D N   1 
ATOM   9362  C CA  . CYS D 1 289 ? -10.702 -13.897 67.878  1.00 39.03  ? 289  CYS D CA  1 
ATOM   9363  C C   . CYS D 1 289 ? -10.930 -15.270 67.243  1.00 45.56  ? 289  CYS D C   1 
ATOM   9364  O O   . CYS D 1 289 ? -12.048 -15.565 66.824  1.00 46.22  ? 289  CYS D O   1 
ATOM   9365  C CB  . CYS D 1 289 ? -10.411 -12.851 66.817  1.00 37.99  ? 289  CYS D CB  1 
ATOM   9366  S SG  . CYS D 1 289 ? -10.245 -11.178 67.481  1.00 40.63  ? 289  CYS D SG  1 
ATOM   9367  N N   . PHE D 1 290 ? -9.889  -16.105 67.179  1.00 42.97  ? 290  PHE D N   1 
ATOM   9368  C CA  . PHE D 1 290 ? -9.962  -17.462 66.639  1.00 44.03  ? 290  PHE D CA  1 
ATOM   9369  C C   . PHE D 1 290 ? -9.483  -18.394 67.767  1.00 53.75  ? 290  PHE D C   1 
ATOM   9370  O O   . PHE D 1 290 ? -8.322  -18.827 67.760  1.00 54.81  ? 290  PHE D O   1 
ATOM   9371  C CB  . PHE D 1 290 ? -9.124  -17.578 65.344  1.00 43.98  ? 290  PHE D CB  1 
ATOM   9372  C CG  . PHE D 1 290 ? -9.402  -16.495 64.323  1.00 42.79  ? 290  PHE D CG  1 
ATOM   9373  C CD1 . PHE D 1 290 ? -8.718  -15.283 64.363  1.00 42.96  ? 290  PHE D CD1 1 
ATOM   9374  C CD2 . PHE D 1 290 ? -10.333 -16.694 63.309  1.00 44.24  ? 290  PHE D CD2 1 
ATOM   9375  C CE1 . PHE D 1 290 ? -8.986  -14.280 63.430  1.00 41.88  ? 290  PHE D CE1 1 
ATOM   9376  C CE2 . PHE D 1 290 ? -10.601 -15.690 62.376  1.00 45.02  ? 290  PHE D CE2 1 
ATOM   9377  C CZ  . PHE D 1 290 ? -9.929  -14.487 62.447  1.00 41.57  ? 290  PHE D CZ  1 
ATOM   9378  N N   . PRO D 1 291 ? -10.337 -18.632 68.799  1.00 53.42  ? 291  PRO D N   1 
ATOM   9379  C CA  . PRO D 1 291 ? -9.901  -19.441 69.960  1.00 55.31  ? 291  PRO D CA  1 
ATOM   9380  C C   . PRO D 1 291 ? -9.518  -20.896 69.664  1.00 62.21  ? 291  PRO D C   1 
ATOM   9381  O O   . PRO D 1 291 ? -8.707  -21.450 70.410  1.00 62.44  ? 291  PRO D O   1 
ATOM   9382  C CB  . PRO D 1 291 ? -11.113 -19.412 70.895  1.00 57.76  ? 291  PRO D CB  1 
ATOM   9383  C CG  . PRO D 1 291 ? -11.931 -18.265 70.445  1.00 60.90  ? 291  PRO D CG  1 
ATOM   9384  C CD  . PRO D 1 291 ? -11.727 -18.165 68.977  1.00 55.41  ? 291  PRO D CD  1 
ATOM   9385  N N   . ALA D 1 292 ? -10.080 -21.517 68.605  1.00 60.48  ? 292  ALA D N   1 
ATOM   9386  C CA  . ALA D 1 292 ? -9.760  -22.913 68.285  1.00 62.89  ? 292  ALA D CA  1 
ATOM   9387  C C   . ALA D 1 292 ? -8.418  -23.033 67.534  1.00 67.10  ? 292  ALA D C   1 
ATOM   9388  O O   . ALA D 1 292 ? -8.162  -24.074 66.924  1.00 68.63  ? 292  ALA D O   1 
ATOM   9389  C CB  . ALA D 1 292 ? -10.889 -23.547 67.476  1.00 64.78  ? 292  ALA D CB  1 
ATOM   9390  N N   . ALA D 1 293 ? -7.552  -21.982 67.625  1.00 61.82  ? 293  ALA D N   1 
ATOM   9391  C CA  . ALA D 1 293 ? -6.215  -21.840 67.015  1.00 61.26  ? 293  ALA D CA  1 
ATOM   9392  C C   . ALA D 1 293 ? -6.227  -22.167 65.496  1.00 64.71  ? 293  ALA D C   1 
ATOM   9393  O O   . ALA D 1 293 ? -5.338  -22.854 64.979  1.00 66.26  ? 293  ALA D O   1 
ATOM   9394  C CB  . ALA D 1 293 ? -5.193  -22.704 67.752  1.00 63.52  ? 293  ALA D CB  1 
ATOM   9395  N N   . ASN D 1 294 ? -7.243  -21.653 64.796  1.00 58.59  ? 294  ASN D N   1 
ATOM   9396  C CA  . ASN D 1 294 ? -7.440  -21.872 63.364  1.00 58.16  ? 294  ASN D CA  1 
ATOM   9397  C C   . ASN D 1 294 ? -7.601  -20.517 62.647  1.00 57.60  ? 294  ASN D C   1 
ATOM   9398  O O   . ASN D 1 294 ? -8.552  -20.307 61.887  1.00 56.13  ? 294  ASN D O   1 
ATOM   9399  C CB  . ASN D 1 294 ? -8.651  -22.805 63.131  1.00 62.10  ? 294  ASN D CB  1 
ATOM   9400  C CG  . ASN D 1 294 ? -9.881  -22.537 63.987  1.00 80.87  ? 294  ASN D CG  1 
ATOM   9401  O OD1 . ASN D 1 294 ? -10.016 -21.505 64.664  1.00 67.86  ? 294  ASN D OD1 1 
ATOM   9402  N ND2 . ASN D 1 294 ? -10.817 -23.476 63.969  1.00 76.89  ? 294  ASN D ND2 1 
ATOM   9403  N N   . ALA D 1 295 ? -6.660  -19.590 62.921  1.00 51.73  ? 295  ALA D N   1 
ATOM   9404  C CA  . ALA D 1 295 ? -6.661  -18.243 62.363  1.00 48.77  ? 295  ALA D CA  1 
ATOM   9405  C C   . ALA D 1 295 ? -6.156  -18.247 60.921  1.00 50.72  ? 295  ALA D C   1 
ATOM   9406  O O   . ALA D 1 295 ? -5.153  -18.907 60.621  1.00 50.62  ? 295  ALA D O   1 
ATOM   9407  C CB  . ALA D 1 295 ? -5.812  -17.310 63.216  1.00 48.19  ? 295  ALA D CB  1 
ATOM   9408  N N   . PRO D 1 296 ? -6.867  -17.536 60.013  1.00 45.08  ? 296  PRO D N   1 
ATOM   9409  C CA  . PRO D 1 296 ? -6.397  -17.432 58.622  1.00 43.98  ? 296  PRO D CA  1 
ATOM   9410  C C   . PRO D 1 296 ? -5.131  -16.582 58.587  1.00 45.06  ? 296  PRO D C   1 
ATOM   9411  O O   . PRO D 1 296 ? -5.129  -15.447 59.085  1.00 43.89  ? 296  PRO D O   1 
ATOM   9412  C CB  . PRO D 1 296 ? -7.575  -16.774 57.885  1.00 45.06  ? 296  PRO D CB  1 
ATOM   9413  C CG  . PRO D 1 296 ? -8.687  -16.657 58.893  1.00 49.87  ? 296  PRO D CG  1 
ATOM   9414  C CD  . PRO D 1 296 ? -8.055  -16.695 60.235  1.00 45.48  ? 296  PRO D CD  1 
ATOM   9415  N N   . GLY D 1 297 ? -4.053  -17.178 58.075  1.00 40.55  ? 297  GLY D N   1 
ATOM   9416  C CA  . GLY D 1 297 ? -2.726  -16.579 58.012  1.00 39.22  ? 297  GLY D CA  1 
ATOM   9417  C C   . GLY D 1 297 ? -2.638  -15.231 57.331  1.00 42.29  ? 297  GLY D C   1 
ATOM   9418  O O   . GLY D 1 297 ? -1.833  -14.390 57.743  1.00 41.76  ? 297  GLY D O   1 
ATOM   9419  N N   . GLU D 1 298 ? -3.468  -15.011 56.291  1.00 38.23  ? 298  GLU D N   1 
ATOM   9420  C CA  . GLU D 1 298 ? -3.491  -13.760 55.541  1.00 36.91  ? 298  GLU D CA  1 
ATOM   9421  C C   . GLU D 1 298 ? -3.981  -12.591 56.422  1.00 41.15  ? 298  GLU D C   1 
ATOM   9422  O O   . GLU D 1 298 ? -3.516  -11.469 56.224  1.00 40.83  ? 298  GLU D O   1 
ATOM   9423  C CB  . GLU D 1 298 ? -4.325  -13.874 54.239  1.00 38.45  ? 298  GLU D CB  1 
ATOM   9424  C CG  . GLU D 1 298 ? -5.825  -14.059 54.419  1.00 42.98  ? 298  GLU D CG  1 
ATOM   9425  C CD  . GLU D 1 298 ? -6.322  -15.470 54.675  1.00 51.85  ? 298  GLU D CD  1 
ATOM   9426  O OE1 . GLU D 1 298 ? -5.497  -16.390 54.886  1.00 48.80  ? 298  GLU D OE1 1 
ATOM   9427  O OE2 . GLU D 1 298 ? -7.557  -15.657 54.643  1.00 38.16  ? 298  GLU D OE2 1 
ATOM   9428  N N   . ILE D 1 299 ? -4.873  -12.854 57.406  1.00 36.80  ? 299  ILE D N   1 
ATOM   9429  C CA  . ILE D 1 299 ? -5.402  -11.823 58.306  1.00 35.10  ? 299  ILE D CA  1 
ATOM   9430  C C   . ILE D 1 299 ? -4.264  -11.286 59.189  1.00 37.61  ? 299  ILE D C   1 
ATOM   9431  O O   . ILE D 1 299 ? -4.092  -10.072 59.268  1.00 35.85  ? 299  ILE D O   1 
ATOM   9432  C CB  . ILE D 1 299 ? -6.625  -12.328 59.133  1.00 38.33  ? 299  ILE D CB  1 
ATOM   9433  C CG1 . ILE D 1 299 ? -7.806  -12.748 58.209  1.00 39.05  ? 299  ILE D CG1 1 
ATOM   9434  C CG2 . ILE D 1 299 ? -7.067  -11.309 60.206  1.00 37.51  ? 299  ILE D CG2 1 
ATOM   9435  C CD1 . ILE D 1 299 ? -8.356  -11.690 57.166  1.00 43.50  ? 299  ILE D CD1 1 
ATOM   9436  N N   . ALA D 1 300 ? -3.462  -12.187 59.783  1.00 34.69  ? 300  ALA D N   1 
ATOM   9437  C CA  . ALA D 1 300 ? -2.322  -11.826 60.620  1.00 33.92  ? 300  ALA D CA  1 
ATOM   9438  C C   . ALA D 1 300 ? -1.261  -11.090 59.807  1.00 35.29  ? 300  ALA D C   1 
ATOM   9439  O O   . ALA D 1 300 ? -0.773  -10.051 60.255  1.00 33.16  ? 300  ALA D O   1 
ATOM   9440  C CB  . ALA D 1 300 ? -1.737  -13.066 61.265  1.00 36.24  ? 300  ALA D CB  1 
ATOM   9441  N N   . LYS D 1 301 ? -0.954  -11.592 58.593  1.00 33.16  ? 301  LYS D N   1 
ATOM   9442  C CA  . LYS D 1 301 ? 0.012   -10.992 57.662  1.00 32.59  ? 301  LYS D CA  1 
ATOM   9443  C C   . LYS D 1 301 ? -0.438  -9.587  57.257  1.00 34.46  ? 301  LYS D C   1 
ATOM   9444  O O   . LYS D 1 301 ? 0.386   -8.674  57.248  1.00 33.51  ? 301  LYS D O   1 
ATOM   9445  C CB  . LYS D 1 301 ? 0.204   -11.875 56.415  1.00 36.00  ? 301  LYS D CB  1 
ATOM   9446  C CG  . LYS D 1 301 ? 1.057   -13.104 56.650  1.00 49.30  ? 301  LYS D CG  1 
ATOM   9447  C CD  . LYS D 1 301 ? 1.166   -13.906 55.362  1.00 60.43  ? 301  LYS D CD  1 
ATOM   9448  C CE  . LYS D 1 301 ? 2.113   -15.071 55.470  1.00 73.88  ? 301  LYS D CE  1 
ATOM   9449  N NZ  . LYS D 1 301 ? 2.758   -15.362 54.162  1.00 83.77  ? 301  LYS D NZ  1 
ATOM   9450  N N   . TYR D 1 302 ? -1.747  -9.415  56.969  1.00 30.33  ? 302  TYR D N   1 
ATOM   9451  C CA  . TYR D 1 302 ? -2.350  -8.126  56.626  1.00 29.53  ? 302  TYR D CA  1 
ATOM   9452  C C   . TYR D 1 302 ? -2.193  -7.136  57.796  1.00 34.01  ? 302  TYR D C   1 
ATOM   9453  O O   . TYR D 1 302 ? -1.774  -6.002  57.570  1.00 33.22  ? 302  TYR D O   1 
ATOM   9454  C CB  . TYR D 1 302 ? -3.836  -8.305  56.259  1.00 31.26  ? 302  TYR D CB  1 
ATOM   9455  C CG  . TYR D 1 302 ? -4.568  -7.007  55.991  1.00 31.90  ? 302  TYR D CG  1 
ATOM   9456  C CD1 . TYR D 1 302 ? -5.120  -6.266  57.036  1.00 32.35  ? 302  TYR D CD1 1 
ATOM   9457  C CD2 . TYR D 1 302 ? -4.703  -6.513  54.689  1.00 32.33  ? 302  TYR D CD2 1 
ATOM   9458  C CE1 . TYR D 1 302 ? -5.778  -5.060  56.798  1.00 32.05  ? 302  TYR D CE1 1 
ATOM   9459  C CE2 . TYR D 1 302 ? -5.364  -5.309  54.440  1.00 32.51  ? 302  TYR D CE2 1 
ATOM   9460  C CZ  . TYR D 1 302 ? -5.896  -4.584  55.499  1.00 35.42  ? 302  TYR D CZ  1 
ATOM   9461  O OH  . TYR D 1 302 ? -6.552  -3.404  55.262  1.00 30.90  ? 302  TYR D OH  1 
ATOM   9462  N N   . MET D 1 303 ? -2.539  -7.560  59.032  1.00 32.40  ? 303  MET D N   1 
ATOM   9463  C CA  . MET D 1 303 ? -2.460  -6.726  60.244  1.00 32.36  ? 303  MET D CA  1 
ATOM   9464  C C   . MET D 1 303 ? -1.018  -6.307  60.532  1.00 35.68  ? 303  MET D C   1 
ATOM   9465  O O   . MET D 1 303 ? -0.788  -5.149  60.885  1.00 35.60  ? 303  MET D O   1 
ATOM   9466  C CB  . MET D 1 303 ? -3.060  -7.434  61.484  1.00 35.95  ? 303  MET D CB  1 
ATOM   9467  C CG  . MET D 1 303 ? -4.558  -7.707  61.389  1.00 40.93  ? 303  MET D CG  1 
ATOM   9468  S SD  . MET D 1 303 ? -5.598  -6.241  61.117  1.00 45.78  ? 303  MET D SD  1 
ATOM   9469  C CE  . MET D 1 303 ? -6.053  -5.863  62.819  1.00 42.43  ? 303  MET D CE  1 
ATOM   9470  N N   . GLU D 1 304 ? -0.053  -7.233  60.347  1.00 31.36  ? 304  GLU D N   1 
ATOM   9471  C CA  . GLU D 1 304 ? 1.378   -6.985  60.551  1.00 30.61  ? 304  GLU D CA  1 
ATOM   9472  C C   . GLU D 1 304 ? 1.931   -5.984  59.535  1.00 31.76  ? 304  GLU D C   1 
ATOM   9473  O O   . GLU D 1 304 ? 2.818   -5.197  59.877  1.00 30.38  ? 304  GLU D O   1 
ATOM   9474  C CB  . GLU D 1 304 ? 2.187   -8.295  60.482  1.00 33.37  ? 304  GLU D CB  1 
ATOM   9475  C CG  . GLU D 1 304 ? 2.000   -9.217  61.684  1.00 45.84  ? 304  GLU D CG  1 
ATOM   9476  C CD  . GLU D 1 304 ? 2.737   -8.900  62.978  1.00 69.37  ? 304  GLU D CD  1 
ATOM   9477  O OE1 . GLU D 1 304 ? 3.356   -7.817  63.083  1.00 60.51  ? 304  GLU D OE1 1 
ATOM   9478  O OE2 . GLU D 1 304 ? 2.692   -9.748  63.898  1.00 70.12  ? 304  GLU D OE2 1 
ATOM   9479  N N   . THR D 1 305 ? 1.412   -6.013  58.291  1.00 27.45  ? 305  THR D N   1 
ATOM   9480  C CA  . THR D 1 305 ? 1.849   -5.122  57.216  1.00 26.83  ? 305  THR D CA  1 
ATOM   9481  C C   . THR D 1 305 ? 1.325   -3.702  57.471  1.00 30.15  ? 305  THR D C   1 
ATOM   9482  O O   . THR D 1 305 ? 2.081   -2.751  57.304  1.00 29.75  ? 305  THR D O   1 
ATOM   9483  C CB  . THR D 1 305 ? 1.433   -5.683  55.836  1.00 32.62  ? 305  THR D CB  1 
ATOM   9484  O OG1 . THR D 1 305 ? 1.941   -7.013  55.714  1.00 30.62  ? 305  THR D OG1 1 
ATOM   9485  C CG2 . THR D 1 305 ? 1.967   -4.866  54.685  1.00 28.82  ? 305  THR D CG2 1 
ATOM   9486  N N   . VAL D 1 306 ? 0.055   -3.567  57.897  1.00 27.14  ? 306  VAL D N   1 
ATOM   9487  C CA  . VAL D 1 306 ? -0.582  -2.278  58.196  1.00 26.37  ? 306  VAL D CA  1 
ATOM   9488  C C   . VAL D 1 306 ? 0.096   -1.659  59.438  1.00 32.15  ? 306  VAL D C   1 
ATOM   9489  O O   . VAL D 1 306 ? 0.282   -0.441  59.488  1.00 33.05  ? 306  VAL D O   1 
ATOM   9490  C CB  . VAL D 1 306 ? -2.128  -2.423  58.341  1.00 29.44  ? 306  VAL D CB  1 
ATOM   9491  C CG1 . VAL D 1 306 ? -2.777  -1.138  58.850  1.00 28.73  ? 306  VAL D CG1 1 
ATOM   9492  C CG2 . VAL D 1 306 ? -2.763  -2.852  57.015  1.00 28.67  ? 306  VAL D CG2 1 
ATOM   9493  N N   . LYS D 1 307 ? 0.523   -2.505  60.402  1.00 28.31  ? 307  LYS D N   1 
ATOM   9494  C CA  . LYS D 1 307 ? 1.232   -2.097  61.625  1.00 26.60  ? 307  LYS D CA  1 
ATOM   9495  C C   . LYS D 1 307 ? 2.563   -1.397  61.281  1.00 28.31  ? 307  LYS D C   1 
ATOM   9496  O O   . LYS D 1 307 ? 2.961   -0.464  61.973  1.00 26.32  ? 307  LYS D O   1 
ATOM   9497  C CB  . LYS D 1 307 ? 1.488   -3.324  62.514  1.00 28.40  ? 307  LYS D CB  1 
ATOM   9498  C CG  . LYS D 1 307 ? 2.068   -2.995  63.877  1.00 24.22  ? 307  LYS D CG  1 
ATOM   9499  C CD  . LYS D 1 307 ? 2.542   -4.232  64.578  1.00 28.60  ? 307  LYS D CD  1 
ATOM   9500  C CE  . LYS D 1 307 ? 3.280   -3.897  65.855  1.00 28.52  ? 307  LYS D CE  1 
ATOM   9501  N NZ  . LYS D 1 307 ? 3.545   -5.115  66.653  1.00 34.70  ? 307  LYS D NZ  1 
ATOM   9502  N N   . LEU D 1 308 ? 3.221   -1.828  60.193  1.00 25.63  ? 308  LEU D N   1 
ATOM   9503  C CA  . LEU D 1 308 ? 4.492   -1.271  59.729  1.00 26.14  ? 308  LEU D CA  1 
ATOM   9504  C C   . LEU D 1 308 ? 4.352   0.098   59.071  1.00 29.79  ? 308  LEU D C   1 
ATOM   9505  O O   . LEU D 1 308 ? 5.367   0.758   58.846  1.00 30.11  ? 308  LEU D O   1 
ATOM   9506  C CB  . LEU D 1 308 ? 5.163   -2.228  58.739  1.00 27.02  ? 308  LEU D CB  1 
ATOM   9507  C CG  . LEU D 1 308 ? 5.882   -3.410  59.342  1.00 33.71  ? 308  LEU D CG  1 
ATOM   9508  C CD1 . LEU D 1 308 ? 6.224   -4.408  58.273  1.00 35.47  ? 308  LEU D CD1 1 
ATOM   9509  C CD2 . LEU D 1 308 ? 7.143   -2.976  60.065  1.00 36.19  ? 308  LEU D CD2 1 
ATOM   9510  N N   . LEU D 1 309 ? 3.117   0.524   58.754  1.00 24.95  ? 309  LEU D N   1 
ATOM   9511  C CA  . LEU D 1 309 ? 2.876   1.804   58.117  1.00 23.74  ? 309  LEU D CA  1 
ATOM   9512  C C   . LEU D 1 309 ? 3.013   2.966   59.069  1.00 27.74  ? 309  LEU D C   1 
ATOM   9513  O O   . LEU D 1 309 ? 2.457   2.959   60.174  1.00 26.95  ? 309  LEU D O   1 
ATOM   9514  C CB  . LEU D 1 309 ? 1.480   1.860   57.463  1.00 23.42  ? 309  LEU D CB  1 
ATOM   9515  C CG  . LEU D 1 309 ? 1.245   1.025   56.203  1.00 27.99  ? 309  LEU D CG  1 
ATOM   9516  C CD1 . LEU D 1 309 ? -0.225  1.000   55.859  1.00 28.45  ? 309  LEU D CD1 1 
ATOM   9517  C CD2 . LEU D 1 309 ? 2.052   1.535   55.019  1.00 26.79  ? 309  LEU D CD2 1 
ATOM   9518  N N   . ASP D 1 310 ? 3.738   3.990   58.609  1.00 25.23  ? 310  ASP D N   1 
ATOM   9519  C CA  . ASP D 1 310 ? 3.868   5.257   59.302  1.00 25.15  ? 310  ASP D CA  1 
ATOM   9520  C C   . ASP D 1 310 ? 2.647   6.105   58.940  1.00 29.03  ? 310  ASP D C   1 
ATOM   9521  O O   . ASP D 1 310 ? 1.945   5.799   57.963  1.00 29.18  ? 310  ASP D O   1 
ATOM   9522  C CB  . ASP D 1 310 ? 5.180   5.949   58.917  1.00 27.87  ? 310  ASP D CB  1 
ATOM   9523  C CG  . ASP D 1 310 ? 6.375   5.604   59.784  1.00 37.33  ? 310  ASP D CG  1 
ATOM   9524  O OD1 . ASP D 1 310 ? 6.197   4.894   60.799  1.00 35.90  ? 310  ASP D OD1 1 
ATOM   9525  O OD2 . ASP D 1 310 ? 7.479   6.065   59.466  1.00 49.62  ? 310  ASP D OD2 1 
ATOM   9526  N N   . TYR D 1 311 ? 2.391   7.155   59.719  1.00 24.85  ? 311  TYR D N   1 
ATOM   9527  C CA  . TYR D 1 311 ? 1.236   8.027   59.546  1.00 23.44  ? 311  TYR D CA  1 
ATOM   9528  C C   . TYR D 1 311 ? 1.133   8.620   58.135  1.00 27.83  ? 311  TYR D C   1 
ATOM   9529  O O   . TYR D 1 311 ? 0.024   8.629   57.585  1.00 27.99  ? 311  TYR D O   1 
ATOM   9530  C CB  . TYR D 1 311 ? 1.249   9.150   60.599  1.00 23.37  ? 311  TYR D CB  1 
ATOM   9531  C CG  . TYR D 1 311 ? 0.075   10.099  60.483  1.00 22.53  ? 311  TYR D CG  1 
ATOM   9532  C CD1 . TYR D 1 311 ? -1.207  9.703   60.859  1.00 23.59  ? 311  TYR D CD1 1 
ATOM   9533  C CD2 . TYR D 1 311 ? 0.246   11.395  59.997  1.00 21.93  ? 311  TYR D CD2 1 
ATOM   9534  C CE1 . TYR D 1 311 ? -2.288  10.570  60.750  1.00 23.19  ? 311  TYR D CE1 1 
ATOM   9535  C CE2 . TYR D 1 311 ? -0.829  12.271  59.885  1.00 22.12  ? 311  TYR D CE2 1 
ATOM   9536  C CZ  . TYR D 1 311 ? -2.091  11.860  60.280  1.00 28.94  ? 311  TYR D CZ  1 
ATOM   9537  O OH  . TYR D 1 311 ? -3.160  12.710  60.179  1.00 30.30  ? 311  TYR D OH  1 
ATOM   9538  N N   . THR D 1 312 ? 2.264   9.098   57.551  1.00 23.78  ? 312  THR D N   1 
ATOM   9539  C CA  . THR D 1 312 ? 2.280   9.731   56.219  1.00 23.01  ? 312  THR D CA  1 
ATOM   9540  C C   . THR D 1 312 ? 2.670   8.768   55.084  1.00 27.66  ? 312  THR D C   1 
ATOM   9541  O O   . THR D 1 312 ? 2.656   9.160   53.905  1.00 27.58  ? 312  THR D O   1 
ATOM   9542  C CB  . THR D 1 312 ? 3.225   10.947  56.208  1.00 26.01  ? 312  THR D CB  1 
ATOM   9543  O OG1 . THR D 1 312 ? 4.562   10.513  56.431  1.00 30.33  ? 312  THR D OG1 1 
ATOM   9544  C CG2 . THR D 1 312 ? 2.841   12.008  57.219  1.00 20.85  ? 312  THR D CG2 1 
ATOM   9545  N N   . GLU D 1 313 ? 2.996   7.516   55.427  1.00 25.25  ? 313  GLU D N   1 
ATOM   9546  C CA  . GLU D 1 313 ? 3.461   6.508   54.475  1.00 24.93  ? 313  GLU D CA  1 
ATOM   9547  C C   . GLU D 1 313 ? 2.407   6.064   53.458  1.00 27.81  ? 313  GLU D C   1 
ATOM   9548  O O   . GLU D 1 313 ? 1.262   5.780   53.817  1.00 27.72  ? 313  GLU D O   1 
ATOM   9549  C CB  . GLU D 1 313 ? 3.973   5.287   55.237  1.00 26.44  ? 313  GLU D CB  1 
ATOM   9550  C CG  . GLU D 1 313 ? 4.808   4.342   54.392  1.00 30.59  ? 313  GLU D CG  1 
ATOM   9551  C CD  . GLU D 1 313 ? 5.389   3.171   55.149  1.00 40.89  ? 313  GLU D CD  1 
ATOM   9552  O OE1 . GLU D 1 313 ? 5.459   3.235   56.400  1.00 35.95  ? 313  GLU D OE1 1 
ATOM   9553  O OE2 . GLU D 1 313 ? 5.814   2.201   54.479  1.00 29.46  ? 313  GLU D OE2 1 
ATOM   9554  N N   . LYS D 1 314 ? 2.832   5.962   52.188  1.00 24.34  ? 314  LYS D N   1 
ATOM   9555  C CA  . LYS D 1 314 ? 2.006   5.449   51.111  1.00 23.91  ? 314  LYS D CA  1 
ATOM   9556  C C   . LYS D 1 314 ? 1.999   3.926   51.212  1.00 29.43  ? 314  LYS D C   1 
ATOM   9557  O O   . LYS D 1 314 ? 3.064   3.301   51.153  1.00 29.12  ? 314  LYS D O   1 
ATOM   9558  C CB  . LYS D 1 314 ? 2.509   5.919   49.728  1.00 26.58  ? 314  LYS D CB  1 
ATOM   9559  C CG  . LYS D 1 314 ? 1.694   5.352   48.557  1.00 25.29  ? 314  LYS D CG  1 
ATOM   9560  C CD  . LYS D 1 314 ? 2.249   5.784   47.219  1.00 31.05  ? 314  LYS D CD  1 
ATOM   9561  C CE  . LYS D 1 314 ? 1.448   5.232   46.070  1.00 43.77  ? 314  LYS D CE  1 
ATOM   9562  N NZ  . LYS D 1 314 ? 1.831   5.843   44.768  1.00 57.55  ? 314  LYS D NZ  1 
ATOM   9563  N N   . PRO D 1 315 ? 0.815   3.299   51.363  1.00 27.60  ? 315  PRO D N   1 
ATOM   9564  C CA  . PRO D 1 315 ? 0.774   1.832   51.428  1.00 27.73  ? 315  PRO D CA  1 
ATOM   9565  C C   . PRO D 1 315 ? 1.176   1.163   50.119  1.00 31.49  ? 315  PRO D C   1 
ATOM   9566  O O   . PRO D 1 315 ? 0.978   1.721   49.045  1.00 31.95  ? 315  PRO D O   1 
ATOM   9567  C CB  . PRO D 1 315 ? -0.696  1.535   51.731  1.00 29.28  ? 315  PRO D CB  1 
ATOM   9568  C CG  . PRO D 1 315 ? -1.271  2.834   52.225  1.00 33.33  ? 315  PRO D CG  1 
ATOM   9569  C CD  . PRO D 1 315 ? -0.541  3.873   51.471  1.00 28.84  ? 315  PRO D CD  1 
ATOM   9570  N N   . LEU D 1 316 ? 1.755   -0.032  50.219  1.00 27.70  ? 316  LEU D N   1 
ATOM   9571  C CA  . LEU D 1 316 ? 2.081   -0.865  49.065  1.00 27.59  ? 316  LEU D CA  1 
ATOM   9572  C C   . LEU D 1 316 ? 0.863   -1.751  48.839  1.00 31.99  ? 316  LEU D C   1 
ATOM   9573  O O   . LEU D 1 316 ? 0.800   -2.868  49.358  1.00 31.97  ? 316  LEU D O   1 
ATOM   9574  C CB  . LEU D 1 316 ? 3.380   -1.673  49.300  1.00 27.56  ? 316  LEU D CB  1 
ATOM   9575  C CG  . LEU D 1 316 ? 4.693   -0.920  49.074  1.00 31.21  ? 316  LEU D CG  1 
ATOM   9576  C CD1 . LEU D 1 316 ? 5.865   -1.687  49.651  1.00 32.09  ? 316  LEU D CD1 1 
ATOM   9577  C CD2 . LEU D 1 316 ? 4.936   -0.670  47.610  1.00 31.96  ? 316  LEU D CD2 1 
ATOM   9578  N N   . TYR D 1 317 ? -0.157  -1.181  48.158  1.00 29.00  ? 317  TYR D N   1 
ATOM   9579  C CA  . TYR D 1 317 ? -1.472  -1.781  47.887  1.00 29.52  ? 317  TYR D CA  1 
ATOM   9580  C C   . TYR D 1 317 ? -1.373  -3.139  47.193  1.00 35.54  ? 317  TYR D C   1 
ATOM   9581  O O   . TYR D 1 317 ? -2.152  -4.038  47.520  1.00 36.23  ? 317  TYR D O   1 
ATOM   9582  C CB  . TYR D 1 317 ? -2.353  -0.825  47.056  1.00 29.94  ? 317  TYR D CB  1 
ATOM   9583  C CG  . TYR D 1 317 ? -2.610  0.506   47.733  1.00 29.75  ? 317  TYR D CG  1 
ATOM   9584  C CD1 . TYR D 1 317 ? -3.595  0.637   48.715  1.00 30.66  ? 317  TYR D CD1 1 
ATOM   9585  C CD2 . TYR D 1 317 ? -1.872  1.636   47.394  1.00 29.05  ? 317  TYR D CD2 1 
ATOM   9586  C CE1 . TYR D 1 317 ? -3.833  1.861   49.341  1.00 29.10  ? 317  TYR D CE1 1 
ATOM   9587  C CE2 . TYR D 1 317 ? -2.105  2.863   48.010  1.00 28.72  ? 317  TYR D CE2 1 
ATOM   9588  C CZ  . TYR D 1 317 ? -3.087  2.972   48.980  1.00 33.96  ? 317  TYR D CZ  1 
ATOM   9589  O OH  . TYR D 1 317 ? -3.306  4.189   49.575  1.00 33.78  ? 317  TYR D OH  1 
ATOM   9590  N N   . GLU D 1 318 ? -0.417  -3.292  46.261  1.00 32.78  ? 318  GLU D N   1 
ATOM   9591  C CA  . GLU D 1 318 ? -0.212  -4.538  45.510  1.00 33.88  ? 318  GLU D CA  1 
ATOM   9592  C C   . GLU D 1 318 ? 0.242   -5.670  46.443  1.00 36.65  ? 318  GLU D C   1 
ATOM   9593  O O   . GLU D 1 318 ? -0.208  -6.802  46.287  1.00 37.15  ? 318  GLU D O   1 
ATOM   9594  C CB  . GLU D 1 318 ? 0.803   -4.339  44.368  1.00 35.77  ? 318  GLU D CB  1 
ATOM   9595  C CG  . GLU D 1 318 ? 0.317   -4.821  43.008  1.00 51.78  ? 318  GLU D CG  1 
ATOM   9596  C CD  . GLU D 1 318 ? -1.085  -4.407  42.597  1.00 80.69  ? 318  GLU D CD  1 
ATOM   9597  O OE1 . GLU D 1 318 ? -1.956  -5.299  42.470  1.00 84.00  ? 318  GLU D OE1 1 
ATOM   9598  O OE2 . GLU D 1 318 ? -1.329  -3.185  42.453  1.00 73.27  ? 318  GLU D OE2 1 
ATOM   9599  N N   . ASN D 1 319 ? 1.109   -5.352  47.422  1.00 31.47  ? 319  ASN D N   1 
ATOM   9600  C CA  . ASN D 1 319 ? 1.607   -6.302  48.418  1.00 31.16  ? 319  ASN D CA  1 
ATOM   9601  C C   . ASN D 1 319 ? 0.454   -6.766  49.339  1.00 33.57  ? 319  ASN D C   1 
ATOM   9602  O O   . ASN D 1 319 ? 0.380   -7.946  49.657  1.00 34.27  ? 319  ASN D O   1 
ATOM   9603  C CB  . ASN D 1 319 ? 2.747   -5.678  49.214  1.00 30.84  ? 319  ASN D CB  1 
ATOM   9604  C CG  . ASN D 1 319 ? 3.195   -6.455  50.415  1.00 49.78  ? 319  ASN D CG  1 
ATOM   9605  O OD1 . ASN D 1 319 ? 3.591   -7.626  50.323  1.00 46.68  ? 319  ASN D OD1 1 
ATOM   9606  N ND2 . ASN D 1 319 ? 3.196   -5.799  51.574  1.00 34.67  ? 319  ASN D ND2 1 
ATOM   9607  N N   . LEU D 1 320 ? -0.464  -5.861  49.700  1.00 29.50  ? 320  LEU D N   1 
ATOM   9608  C CA  . LEU D 1 320 ? -1.644  -6.191  50.518  1.00 30.16  ? 320  LEU D CA  1 
ATOM   9609  C C   . LEU D 1 320 ? -2.610  -7.095  49.730  1.00 35.14  ? 320  LEU D C   1 
ATOM   9610  O O   . LEU D 1 320 ? -3.209  -7.999  50.310  1.00 34.60  ? 320  LEU D O   1 
ATOM   9611  C CB  . LEU D 1 320 ? -2.382  -4.928  51.001  1.00 28.73  ? 320  LEU D CB  1 
ATOM   9612  C CG  . LEU D 1 320 ? -1.700  -4.065  52.056  1.00 32.33  ? 320  LEU D CG  1 
ATOM   9613  C CD1 . LEU D 1 320 ? -2.370  -2.722  52.140  1.00 30.69  ? 320  LEU D CD1 1 
ATOM   9614  C CD2 . LEU D 1 320 ? -1.699  -4.738  53.448  1.00 36.70  ? 320  LEU D CD2 1 
ATOM   9615  N N   . ARG D 1 321 ? -2.736  -6.853  48.408  1.00 32.27  ? 321  ARG D N   1 
ATOM   9616  C CA  . ARG D 1 321 ? -3.558  -7.657  47.505  1.00 33.89  ? 321  ARG D CA  1 
ATOM   9617  C C   . ARG D 1 321 ? -3.002  -9.076  47.389  1.00 39.22  ? 321  ARG D C   1 
ATOM   9618  O O   . ARG D 1 321 ? -3.785  -10.020 47.455  1.00 40.33  ? 321  ARG D O   1 
ATOM   9619  C CB  . ARG D 1 321 ? -3.655  -7.008  46.116  1.00 34.02  ? 321  ARG D CB  1 
ATOM   9620  C CG  . ARG D 1 321 ? -4.858  -6.087  45.996  1.00 40.87  ? 321  ARG D CG  1 
ATOM   9621  C CD  . ARG D 1 321 ? -4.978  -5.461  44.622  1.00 42.55  ? 321  ARG D CD  1 
ATOM   9622  N NE  . ARG D 1 321 ? -5.619  -4.154  44.732  1.00 47.15  ? 321  ARG D NE  1 
ATOM   9623  C CZ  . ARG D 1 321 ? -4.982  -3.005  44.553  1.00 58.00  ? 321  ARG D CZ  1 
ATOM   9624  N NH1 . ARG D 1 321 ? -3.706  -2.993  44.177  1.00 40.41  ? 321  ARG D NH1 1 
ATOM   9625  N NH2 . ARG D 1 321 ? -5.625  -1.855  44.718  1.00 47.13  ? 321  ARG D NH2 1 
ATOM   9626  N N   . ASP D 1 322 ? -1.658  -9.226  47.276  1.00 34.92  ? 322  ASP D N   1 
ATOM   9627  C CA  . ASP D 1 322 ? -0.990  -10.526 47.192  1.00 36.39  ? 322  ASP D CA  1 
ATOM   9628  C C   . ASP D 1 322 ? -1.232  -11.352 48.448  1.00 39.67  ? 322  ASP D C   1 
ATOM   9629  O O   . ASP D 1 322 ? -1.416  -12.567 48.343  1.00 41.05  ? 322  ASP D O   1 
ATOM   9630  C CB  . ASP D 1 322 ? 0.526   -10.384 46.951  1.00 38.91  ? 322  ASP D CB  1 
ATOM   9631  C CG  . ASP D 1 322 ? 0.936   -9.760  45.631  1.00 56.46  ? 322  ASP D CG  1 
ATOM   9632  O OD1 . ASP D 1 322 ? 0.187   -9.929  44.621  1.00 59.06  ? 322  ASP D OD1 1 
ATOM   9633  O OD2 . ASP D 1 322 ? 2.022   -9.146  45.584  1.00 64.61  ? 322  ASP D OD2 1 
ATOM   9634  N N   . ILE D 1 323 ? -1.232  -10.699 49.631  1.00 34.11  ? 323  ILE D N   1 
ATOM   9635  C CA  . ILE D 1 323 ? -1.496  -11.327 50.928  1.00 33.42  ? 323  ILE D CA  1 
ATOM   9636  C C   . ILE D 1 323 ? -2.899  -11.964 50.884  1.00 37.88  ? 323  ILE D C   1 
ATOM   9637  O O   . ILE D 1 323 ? -3.034  -13.147 51.200  1.00 39.10  ? 323  ILE D O   1 
ATOM   9638  C CB  . ILE D 1 323 ? -1.325  -10.310 52.108  1.00 34.93  ? 323  ILE D CB  1 
ATOM   9639  C CG1 . ILE D 1 323 ? 0.158   -9.972  52.353  1.00 34.12  ? 323  ILE D CG1 1 
ATOM   9640  C CG2 . ILE D 1 323 ? -1.975  -10.819 53.406  1.00 36.46  ? 323  ILE D CG2 1 
ATOM   9641  C CD1 . ILE D 1 323 ? 0.426   -8.742  53.214  1.00 32.50  ? 323  ILE D CD1 1 
ATOM   9642  N N   . LEU D 1 324 ? -3.913  -11.203 50.427  1.00 34.27  ? 324  LEU D N   1 
ATOM   9643  C CA  . LEU D 1 324 ? -5.294  -11.680 50.343  1.00 35.81  ? 324  LEU D CA  1 
ATOM   9644  C C   . LEU D 1 324 ? -5.470  -12.745 49.257  1.00 43.25  ? 324  LEU D C   1 
ATOM   9645  O O   . LEU D 1 324 ? -6.229  -13.694 49.470  1.00 44.70  ? 324  LEU D O   1 
ATOM   9646  C CB  . LEU D 1 324 ? -6.280  -10.524 50.124  1.00 35.25  ? 324  LEU D CB  1 
ATOM   9647  C CG  . LEU D 1 324 ? -6.302  -9.407  51.198  1.00 38.21  ? 324  LEU D CG  1 
ATOM   9648  C CD1 . LEU D 1 324 ? -7.291  -8.348  50.821  1.00 37.93  ? 324  LEU D CD1 1 
ATOM   9649  C CD2 . LEU D 1 324 ? -6.611  -9.948  52.609  1.00 38.31  ? 324  LEU D CD2 1 
ATOM   9650  N N   . LEU D 1 325 ? -4.741  -12.615 48.120  1.00 40.01  ? 325  LEU D N   1 
ATOM   9651  C CA  . LEU D 1 325 ? -4.754  -13.582 47.016  1.00 40.71  ? 325  LEU D CA  1 
ATOM   9652  C C   . LEU D 1 325 ? -4.150  -14.926 47.440  1.00 45.12  ? 325  LEU D C   1 
ATOM   9653  O O   . LEU D 1 325 ? -4.588  -15.966 46.945  1.00 46.33  ? 325  LEU D O   1 
ATOM   9654  C CB  . LEU D 1 325 ? -4.014  -13.041 45.788  1.00 40.65  ? 325  LEU D CB  1 
ATOM   9655  C CG  . LEU D 1 325 ? -4.708  -11.917 44.995  1.00 44.09  ? 325  LEU D CG  1 
ATOM   9656  C CD1 . LEU D 1 325 ? -3.716  -11.241 44.040  1.00 43.64  ? 325  LEU D CD1 1 
ATOM   9657  C CD2 . LEU D 1 325 ? -5.963  -12.415 44.262  1.00 45.02  ? 325  LEU D CD2 1 
ATOM   9658  N N   . GLN D 1 326 ? -3.162  -14.908 48.372  1.00 41.26  ? 326  GLN D N   1 
ATOM   9659  C CA  . GLN D 1 326 ? -2.545  -16.118 48.933  1.00 42.16  ? 326  GLN D CA  1 
ATOM   9660  C C   . GLN D 1 326 ? -3.572  -16.880 49.769  1.00 45.55  ? 326  GLN D C   1 
ATOM   9661  O O   . GLN D 1 326 ? -3.566  -18.114 49.758  1.00 47.75  ? 326  GLN D O   1 
ATOM   9662  C CB  . GLN D 1 326 ? -1.313  -15.785 49.784  1.00 42.94  ? 326  GLN D CB  1 
ATOM   9663  C CG  . GLN D 1 326 ? -0.028  -15.578 48.995  1.00 68.85  ? 326  GLN D CG  1 
ATOM   9664  C CD  . GLN D 1 326 ? 1.156   -15.304 49.903  1.00 96.41  ? 326  GLN D CD  1 
ATOM   9665  O OE1 . GLN D 1 326 ? 1.115   -14.449 50.809  1.00 89.25  ? 326  GLN D OE1 1 
ATOM   9666  N NE2 . GLN D 1 326 ? 2.252   -16.014 49.663  1.00 93.80  ? 326  GLN D NE2 1 
ATOM   9667  N N   . GLY D 1 327 ? -4.452  -16.135 50.448  1.00 39.13  ? 327  GLY D N   1 
ATOM   9668  C CA  . GLY D 1 327 ? -5.550  -16.675 51.240  1.00 38.93  ? 327  GLY D CA  1 
ATOM   9669  C C   . GLY D 1 327 ? -6.556  -17.402 50.369  1.00 44.88  ? 327  GLY D C   1 
ATOM   9670  O O   . GLY D 1 327 ? -7.067  -18.449 50.768  1.00 46.66  ? 327  GLY D O   1 
ATOM   9671  N N   . LEU D 1 328 ? -6.822  -16.868 49.149  1.00 41.03  ? 328  LEU D N   1 
ATOM   9672  C CA  . LEU D 1 328 ? -7.739  -17.465 48.166  1.00 42.16  ? 328  LEU D CA  1 
ATOM   9673  C C   . LEU D 1 328 ? -7.169  -18.765 47.612  1.00 47.64  ? 328  LEU D C   1 
ATOM   9674  O O   . LEU D 1 328 ? -7.912  -19.726 47.428  1.00 48.91  ? 328  LEU D O   1 
ATOM   9675  C CB  . LEU D 1 328 ? -8.058  -16.494 47.011  1.00 41.51  ? 328  LEU D CB  1 
ATOM   9676  C CG  . LEU D 1 328 ? -8.989  -15.327 47.337  1.00 44.33  ? 328  LEU D CG  1 
ATOM   9677  C CD1 . LEU D 1 328 ? -8.914  -14.290 46.262  1.00 44.12  ? 328  LEU D CD1 1 
ATOM   9678  C CD2 . LEU D 1 328 ? -10.435 -15.785 47.556  1.00 45.39  ? 328  LEU D CD2 1 
ATOM   9679  N N   . LYS D 1 329 ? -5.848  -18.794 47.365  1.00 44.21  ? 329  LYS D N   1 
ATOM   9680  C CA  . LYS D 1 329 ? -5.122  -19.966 46.881  1.00 46.24  ? 329  LYS D CA  1 
ATOM   9681  C C   . LYS D 1 329 ? -5.121  -21.058 47.959  1.00 51.74  ? 329  LYS D C   1 
ATOM   9682  O O   . LYS D 1 329 ? -5.267  -22.236 47.628  1.00 53.59  ? 329  LYS D O   1 
ATOM   9683  C CB  . LYS D 1 329 ? -3.689  -19.572 46.500  1.00 48.69  ? 329  LYS D CB  1 
ATOM   9684  C CG  . LYS D 1 329 ? -2.944  -20.620 45.680  1.00 64.06  ? 329  LYS D CG  1 
ATOM   9685  C CD  . LYS D 1 329 ? -1.488  -20.213 45.456  1.00 77.03  ? 329  LYS D CD  1 
ATOM   9686  C CE  . LYS D 1 329 ? -0.703  -21.241 44.680  1.00 92.98  ? 329  LYS D CE  1 
ATOM   9687  N NZ  . LYS D 1 329 ? 0.745   -20.903 44.635  1.00 101.39 ? 329  LYS D NZ  1 
ATOM   9688  N N   . ALA D 1 330 ? -4.994  -20.652 49.247  1.00 47.57  ? 330  ALA D N   1 
ATOM   9689  C CA  . ALA D 1 330 ? -4.987  -21.533 50.418  1.00 48.42  ? 330  ALA D CA  1 
ATOM   9690  C C   . ALA D 1 330 ? -6.307  -22.293 50.576  1.00 54.63  ? 330  ALA D C   1 
ATOM   9691  O O   . ALA D 1 330 ? -6.281  -23.459 50.980  1.00 57.07  ? 330  ALA D O   1 
ATOM   9692  C CB  . ALA D 1 330 ? -4.700  -20.729 51.674  1.00 47.15  ? 330  ALA D CB  1 
ATOM   9693  N N   . ILE D 1 331 ? -7.450  -21.652 50.225  1.00 50.27  ? 331  ILE D N   1 
ATOM   9694  C CA  . ILE D 1 331 ? -8.787  -22.256 50.313  1.00 51.44  ? 331  ILE D CA  1 
ATOM   9695  C C   . ILE D 1 331 ? -9.205  -22.937 48.987  1.00 59.22  ? 331  ILE D C   1 
ATOM   9696  O O   . ILE D 1 331 ? -10.357 -23.363 48.850  1.00 60.84  ? 331  ILE D O   1 
ATOM   9697  C CB  . ILE D 1 331 ? -9.871  -21.264 50.828  1.00 52.60  ? 331  ILE D CB  1 
ATOM   9698  C CG1 . ILE D 1 331 ? -10.050 -20.034 49.904  1.00 51.16  ? 331  ILE D CG1 1 
ATOM   9699  C CG2 . ILE D 1 331 ? -9.585  -20.869 52.282  1.00 50.26  ? 331  ILE D CG2 1 
ATOM   9700  C CD1 . ILE D 1 331 ? -11.439 -19.398 49.934  1.00 54.14  ? 331  ILE D CD1 1 
ATOM   9701  N N   . GLY D 1 332 ? -8.257  -23.074 48.058  1.00 56.80  ? 332  GLY D N   1 
ATOM   9702  C CA  . GLY D 1 332 ? -8.472  -23.715 46.763  1.00 58.47  ? 332  GLY D CA  1 
ATOM   9703  C C   . GLY D 1 332 ? -9.284  -22.907 45.770  1.00 61.49  ? 332  GLY D C   1 
ATOM   9704  O O   . GLY D 1 332 ? -9.780  -23.460 44.789  1.00 64.31  ? 332  GLY D O   1 
ATOM   9705  N N   . SER D 1 333 ? -9.414  -21.595 46.004  1.00 54.52  ? 333  SER D N   1 
ATOM   9706  C CA  . SER D 1 333 ? -10.156 -20.680 45.140  1.00 53.30  ? 333  SER D CA  1 
ATOM   9707  C C   . SER D 1 333 ? -9.198  -19.711 44.428  1.00 54.93  ? 333  SER D C   1 
ATOM   9708  O O   . SER D 1 333 ? -7.981  -19.910 44.440  1.00 53.30  ? 333  SER D O   1 
ATOM   9709  C CB  . SER D 1 333 ? -11.201 -19.914 45.950  1.00 55.72  ? 333  SER D CB  1 
ATOM   9710  O OG  . SER D 1 333 ? -12.074 -19.181 45.105  1.00 65.92  ? 333  SER D OG  1 
ATOM   9711  N N   . LYS D 1 334 ? -9.763  -18.684 43.778  1.00 52.02  ? 334  LYS D N   1 
ATOM   9712  C CA  . LYS D 1 334 ? -9.052  -17.638 43.040  1.00 51.08  ? 334  LYS D CA  1 
ATOM   9713  C C   . LYS D 1 334 ? -9.918  -16.381 43.009  1.00 54.37  ? 334  LYS D C   1 
ATOM   9714  O O   . LYS D 1 334 ? -11.096 -16.436 43.381  1.00 54.40  ? 334  LYS D O   1 
ATOM   9715  C CB  . LYS D 1 334 ? -8.693  -18.111 41.604  1.00 55.47  ? 334  LYS D CB  1 
ATOM   9716  C CG  . LYS D 1 334 ? -9.889  -18.507 40.728  1.00 67.68  ? 334  LYS D CG  1 
ATOM   9717  C CD  . LYS D 1 334 ? -9.456  -19.069 39.385  1.00 78.15  ? 334  LYS D CD  1 
ATOM   9718  C CE  . LYS D 1 334 ? -10.641 -19.324 38.479  1.00 90.93  ? 334  LYS D CE  1 
ATOM   9719  N NZ  . LYS D 1 334 ? -10.256 -20.061 37.244  1.00 98.07  ? 334  LYS D NZ  1 
ATOM   9720  N N   . ASP D 1 335 ? -9.341  -15.253 42.581  1.00 49.95  ? 335  ASP D N   1 
ATOM   9721  C CA  . ASP D 1 335 ? -10.099 -14.017 42.461  1.00 48.70  ? 335  ASP D CA  1 
ATOM   9722  C C   . ASP D 1 335 ? -10.921 -14.070 41.163  1.00 55.61  ? 335  ASP D C   1 
ATOM   9723  O O   . ASP D 1 335 ? -10.442 -13.688 40.089  1.00 55.61  ? 335  ASP D O   1 
ATOM   9724  C CB  . ASP D 1 335 ? -9.173  -12.792 42.513  1.00 48.34  ? 335  ASP D CB  1 
ATOM   9725  C CG  . ASP D 1 335 ? -9.852  -11.435 42.402  1.00 52.82  ? 335  ASP D CG  1 
ATOM   9726  O OD1 . ASP D 1 335 ? -11.106 -11.379 42.473  1.00 51.83  ? 335  ASP D OD1 1 
ATOM   9727  O OD2 . ASP D 1 335 ? -9.129  -10.422 42.272  1.00 58.18  ? 335  ASP D OD2 1 
ATOM   9728  N N   . ASP D 1 336 ? -12.146 -14.600 41.274  1.00 53.74  ? 336  ASP D N   1 
ATOM   9729  C CA  . ASP D 1 336 ? -13.099 -14.718 40.175  1.00 55.43  ? 336  ASP D CA  1 
ATOM   9730  C C   . ASP D 1 336 ? -14.174 -13.623 40.293  1.00 60.85  ? 336  ASP D C   1 
ATOM   9731  O O   . ASP D 1 336 ? -15.108 -13.584 39.495  1.00 62.59  ? 336  ASP D O   1 
ATOM   9732  C CB  . ASP D 1 336 ? -13.732 -16.129 40.159  1.00 59.36  ? 336  ASP D CB  1 
ATOM   9733  C CG  . ASP D 1 336 ? -14.346 -16.630 41.467  1.00 67.71  ? 336  ASP D CG  1 
ATOM   9734  O OD1 . ASP D 1 336 ? -14.444 -15.831 42.432  1.00 66.33  ? 336  ASP D OD1 1 
ATOM   9735  O OD2 . ASP D 1 336 ? -14.727 -17.819 41.524  1.00 73.70  ? 336  ASP D OD2 1 
ATOM   9736  N N   . GLY D 1 337 ? -14.032 -12.765 41.304  1.00 57.28  ? 337  GLY D N   1 
ATOM   9737  C CA  . GLY D 1 337 ? -14.956 -11.674 41.593  1.00 57.39  ? 337  GLY D CA  1 
ATOM   9738  C C   . GLY D 1 337 ? -16.322 -12.120 42.087  1.00 64.39  ? 337  GLY D C   1 
ATOM   9739  O O   . GLY D 1 337 ? -17.291 -11.356 42.012  1.00 65.11  ? 337  GLY D O   1 
ATOM   9740  N N   . LYS D 1 338 ? -16.414 -13.359 42.593  1.00 62.04  ? 338  LYS D N   1 
ATOM   9741  C CA  . LYS D 1 338 ? -17.670 -13.893 43.091  1.00 63.43  ? 338  LYS D CA  1 
ATOM   9742  C C   . LYS D 1 338 ? -17.764 -13.675 44.602  1.00 65.53  ? 338  LYS D C   1 
ATOM   9743  O O   . LYS D 1 338 ? -16.975 -14.240 45.361  1.00 64.41  ? 338  LYS D O   1 
ATOM   9744  C CB  . LYS D 1 338 ? -17.829 -15.388 42.721  1.00 68.42  ? 338  LYS D CB  1 
ATOM   9745  N N   . LEU D 1 339 ? -18.698 -12.801 45.027  1.00 61.70  ? 339  LEU D N   1 
ATOM   9746  C CA  . LEU D 1 339 ? -19.014 -12.534 46.440  1.00 60.65  ? 339  LEU D CA  1 
ATOM   9747  C C   . LEU D 1 339 ? -20.034 -13.621 46.805  1.00 71.07  ? 339  LEU D C   1 
ATOM   9748  O O   . LEU D 1 339 ? -21.051 -13.734 46.099  1.00 73.59  ? 339  LEU D O   1 
ATOM   9749  C CB  . LEU D 1 339 ? -19.624 -11.116 46.624  1.00 58.96  ? 339  LEU D CB  1 
ATOM   9750  C CG  . LEU D 1 339 ? -18.944 -9.869  46.041  1.00 61.41  ? 339  LEU D CG  1 
ATOM   9751  C CD1 . LEU D 1 339 ? -19.751 -8.631  46.370  1.00 60.48  ? 339  LEU D CD1 1 
ATOM   9752  C CD2 . LEU D 1 339 ? -17.532 -9.696  46.582  1.00 61.45  ? 339  LEU D CD2 1 
ATOM   9753  N N   . ASP D 1 340 ? -19.746 -14.521 47.754  1.00 68.73  ? 340  ASP D N   1 
ATOM   9754  C CA  . ASP D 1 340 ? -20.714 -15.603 47.988  1.00 70.71  ? 340  ASP D CA  1 
ATOM   9755  C C   . ASP D 1 340 ? -21.740 -15.199 49.061  1.00 74.46  ? 340  ASP D C   1 
ATOM   9756  O O   . ASP D 1 340 ? -21.661 -15.632 50.216  1.00 73.92  ? 340  ASP D O   1 
ATOM   9757  C CB  . ASP D 1 340 ? -20.006 -16.915 48.333  1.00 73.22  ? 340  ASP D CB  1 
ATOM   9758  N N   . LEU D 1 341 ? -22.714 -14.367 48.650  1.00 71.25  ? 341  LEU D N   1 
ATOM   9759  C CA  . LEU D 1 341 ? -23.767 -13.832 49.518  1.00 94.53  ? 341  LEU D CA  1 
ATOM   9760  C C   . LEU D 1 341 ? -25.123 -14.469 49.204  1.00 139.04 ? 341  LEU D C   1 
ATOM   9761  O O   . LEU D 1 341 ? -26.002 -14.522 50.066  1.00 105.31 ? 341  LEU D O   1 
ATOM   9762  C CB  . LEU D 1 341 ? -23.856 -12.298 49.362  1.00 92.96  ? 341  LEU D CB  1 
ATOM   9763  C CG  . LEU D 1 341 ? -22.555 -11.496 49.495  1.00 94.39  ? 341  LEU D CG  1 
ATOM   9764  C CD1 . LEU D 1 341 ? -22.657 -10.185 48.765  1.00 93.72  ? 341  LEU D CD1 1 
ATOM   9765  C CD2 . LEU D 1 341 ? -22.199 -11.253 50.940  1.00 94.86  ? 341  LEU D CD2 1 
HETATM 9766  C C10 . REB E 2 .   ? 28.445  3.735   12.581  0.86 25.57  ? 365  REB A C10 1 
HETATM 9767  N N12 . REB E 2 .   ? 28.898  5.366   11.288  0.86 27.04  ? 365  REB A N12 1 
HETATM 9768  C C15 . REB E 2 .   ? 31.820  4.696   13.410  0.86 26.41  ? 365  REB A C15 1 
HETATM 9769  C C20 . REB E 2 .   ? 29.670  1.495   17.184  0.86 26.03  ? 365  REB A C20 1 
HETATM 9770  C C21 . REB E 2 .   ? 29.599  2.912   17.189  0.86 28.77  ? 365  REB A C21 1 
HETATM 9771  C C22 . REB E 2 .   ? 28.482  3.623   16.499  0.86 27.11  ? 365  REB A C22 1 
HETATM 9772  C C24 . REB E 2 .   ? 30.738  3.564   17.968  0.86 32.54  ? 365  REB A C24 1 
HETATM 9773  C C02 . REB E 2 .   ? 24.707  1.018   11.604  0.86 25.17  ? 365  REB A C02 1 
HETATM 9774  C C03 . REB E 2 .   ? 24.360  -0.028  12.462  0.86 24.88  ? 365  REB A C03 1 
HETATM 9775  N N04 . REB E 2 .   ? 25.063  -0.223  13.679  0.86 25.96  ? 365  REB A N04 1 
HETATM 9776  C C05 . REB E 2 .   ? 26.059  0.532   14.040  0.86 23.97  ? 365  REB A C05 1 
HETATM 9777  N N06 . REB E 2 .   ? 26.423  1.538   13.155  0.86 24.99  ? 365  REB A N06 1 
HETATM 9778  C C07 . REB E 2 .   ? 25.807  1.817   11.979  0.86 24.82  ? 365  REB A C07 1 
HETATM 9779  N N08 . REB E 2 .   ? 26.392  2.967   11.282  0.86 23.89  ? 365  REB A N08 1 
HETATM 9780  C C09 . REB E 2 .   ? 27.471  3.824   11.499  0.86 25.71  ? 365  REB A C09 1 
HETATM 9781  C C11 . REB E 2 .   ? 29.299  4.766   12.349  0.86 26.60  ? 365  REB A C11 1 
HETATM 9782  N N13 . REB E 2 .   ? 27.798  4.807   10.749  0.86 26.67  ? 365  REB A N13 1 
HETATM 9783  C C14 . REB E 2 .   ? 30.490  5.217   13.073  0.86 26.72  ? 365  REB A C14 1 
HETATM 9784  C C16 . REB E 2 .   ? 30.811  4.927   14.488  0.86 26.41  ? 365  REB A C16 1 
HETATM 9785  N N17 . REB E 2 .   ? 26.784  0.450   15.178  0.86 23.30  ? 365  REB A N17 1 
HETATM 9786  C C18 . REB E 2 .   ? 27.667  1.330   15.849  0.86 23.69  ? 365  REB A C18 1 
HETATM 9787  C C19 . REB E 2 .   ? 28.713  0.717   16.524  0.86 24.71  ? 365  REB A C19 1 
HETATM 9788  C C23 . REB E 2 .   ? 27.507  2.772   15.813  0.86 25.17  ? 365  REB A C23 1 
HETATM 9789  C C25 . REB E 2 .   ? 31.977  3.333   17.201  0.86 35.28  ? 365  REB A C25 1 
HETATM 9790  N N26 . REB E 2 .   ? 32.901  2.957   16.638  0.86 37.54  ? 365  REB A N26 1 
HETATM 9791  C C1  . EDO F 3 .   ? 22.201  9.229   27.500  1.00 43.10  ? 366  EDO A C1  1 
HETATM 9792  O O1  . EDO F 3 .   ? 20.798  9.063   27.257  1.00 39.42  ? 366  EDO A O1  1 
HETATM 9793  C C2  . EDO F 3 .   ? 22.537  10.608  28.060  1.00 43.47  ? 366  EDO A C2  1 
HETATM 9794  O O2  . EDO F 3 .   ? 23.625  10.479  28.989  1.00 50.79  ? 366  EDO A O2  1 
HETATM 9795  C C1  . GOL G 4 .   ? 19.662  -15.920 18.625  1.00 73.92  ? 367  GOL A C1  1 
HETATM 9796  O O1  . GOL G 4 .   ? 19.995  -14.723 17.890  1.00 72.36  ? 367  GOL A O1  1 
HETATM 9797  C C2  . GOL G 4 .   ? 18.610  -16.804 17.941  1.00 73.71  ? 367  GOL A C2  1 
HETATM 9798  O O2  . GOL G 4 .   ? 17.343  -16.543 18.569  1.00 74.03  ? 367  GOL A O2  1 
HETATM 9799  C C3  . GOL G 4 .   ? 18.983  -18.292 18.036  1.00 74.02  ? 367  GOL A C3  1 
HETATM 9800  O O3  . GOL G 4 .   ? 17.897  -19.113 17.570  1.00 74.27  ? 367  GOL A O3  1 
HETATM 9801  C C10 . REB H 2 .   ? 26.129  -9.245  60.176  0.77 32.10  ? 365  REB B C10 1 
HETATM 9802  N N12 . REB H 2 .   ? 27.744  -9.829  58.900  0.77 31.52  ? 365  REB B N12 1 
HETATM 9803  C C15 . REB H 2 .   ? 26.647  -12.167 61.764  0.77 32.43  ? 365  REB B C15 1 
HETATM 9804  C C20 . REB H 2 .   ? 26.007  -9.278  64.304  0.77 26.92  ? 365  REB B C20 1 
HETATM 9805  C C21 . REB H 2 .   ? 25.284  -10.321 64.979  0.77 30.38  ? 365  REB B C21 1 
HETATM 9806  C C22 . REB H 2 .   ? 23.794  -10.317 64.984  0.77 30.58  ? 365  REB B C22 1 
HETATM 9807  C C24 . REB H 2 .   ? 26.142  -11.410 65.653  0.77 33.47  ? 365  REB B C24 1 
HETATM 9808  C C02 . REB H 2 .   ? 23.780  -5.202  59.305  0.77 30.85  ? 365  REB B C02 1 
HETATM 9809  C C03 . REB H 2 .   ? 22.817  -4.731  60.223  0.77 29.49  ? 365  REB B C03 1 
HETATM 9810  N N04 . REB H 2 .   ? 22.614  -5.361  61.462  0.77 28.98  ? 365  REB B N04 1 
HETATM 9811  C C05 . REB H 2 .   ? 23.312  -6.433  61.810  0.77 28.31  ? 365  REB B C05 1 
HETATM 9812  N N06 . REB H 2 .   ? 24.236  -6.921  60.901  0.77 30.74  ? 365  REB B N06 1 
HETATM 9813  C C07 . REB H 2 .   ? 24.498  -6.374  59.688  0.77 31.87  ? 365  REB B C07 1 
HETATM 9814  N N08 . REB H 2 .   ? 25.570  -7.097  59.004  0.77 31.82  ? 365  REB B N08 1 
HETATM 9815  C C09 . REB H 2 .   ? 26.344  -8.253  59.166  0.77 31.34  ? 365  REB B C09 1 
HETATM 9816  C C11 . REB H 2 .   ? 27.066  -10.199 59.924  0.77 32.55  ? 365  REB B C11 1 
HETATM 9817  N N13 . REB H 2 .   ? 27.308  -8.655  58.422  0.77 30.44  ? 365  REB B N13 1 
HETATM 9818  C C14 . REB H 2 .   ? 27.310  -11.427 60.664  0.77 32.55  ? 365  REB B C14 1 
HETATM 9819  C C16 . REB H 2 .   ? 27.942  -11.431 61.999  0.77 32.43  ? 365  REB B C16 1 
HETATM 9820  N N17 . REB H 2 .   ? 23.241  -7.141  62.966  0.77 25.70  ? 365  REB B N17 1 
HETATM 9821  C C18 . REB H 2 .   ? 23.918  -8.199  63.631  0.77 26.27  ? 365  REB B C18 1 
HETATM 9822  C C19 . REB H 2 .   ? 25.325  -8.234  63.641  0.77 25.06  ? 365  REB B C19 1 
HETATM 9823  C C23 . REB H 2 .   ? 23.117  -9.223  64.290  0.77 28.88  ? 365  REB B C23 1 
HETATM 9824  C C25 . REB H 2 .   ? 25.674  -12.716 65.116  0.77 35.19  ? 365  REB B C25 1 
HETATM 9825  N N26 . REB H 2 .   ? 25.208  -13.623 64.582  0.77 35.98  ? 365  REB B N26 1 
HETATM 9826  C C1  . GOL I 4 .   ? 6.911   3.518   66.713  1.00 86.03  ? 366  GOL B C1  1 
HETATM 9827  O O1  . GOL I 4 .   ? 6.710   2.375   65.872  1.00 85.04  ? 366  GOL B O1  1 
HETATM 9828  C C2  . GOL I 4 .   ? 7.746   3.200   67.954  1.00 85.89  ? 366  GOL B C2  1 
HETATM 9829  O O2  . GOL I 4 .   ? 7.975   4.425   68.668  1.00 87.03  ? 366  GOL B O2  1 
HETATM 9830  C C3  . GOL I 4 .   ? 9.088   2.536   67.610  1.00 85.90  ? 366  GOL B C3  1 
HETATM 9831  O O3  . GOL I 4 .   ? 8.935   1.251   66.987  1.00 85.63  ? 366  GOL B O3  1 
HETATM 9832  C C1  . EDO J 3 .   ? 23.205  11.217  82.060  1.00 46.72  ? 367  EDO B C1  1 
HETATM 9833  O O1  . EDO J 3 .   ? 22.864  9.837   81.901  1.00 45.51  ? 367  EDO B O1  1 
HETATM 9834  C C2  . EDO J 3 .   ? 23.294  11.550  83.540  1.00 46.78  ? 367  EDO B C2  1 
HETATM 9835  O O2  . EDO J 3 .   ? 23.690  12.916  83.657  1.00 56.82  ? 367  EDO B O2  1 
HETATM 9836  C C10 . REB K 2 .   ? -18.556 -2.440  99.301  0.84 42.67  ? 365  REB C C10 1 
HETATM 9837  N N12 . REB K 2 .   ? -19.835 -3.478  100.694 0.84 41.56  ? 365  REB C N12 1 
HETATM 9838  C C15 . REB K 2 .   ? -19.437 -4.919  97.193  0.84 44.12  ? 365  REB C C15 1 
HETATM 9839  C C20 . REB K 2 .   ? -16.832 -1.300  93.921  0.84 44.14  ? 365  REB C C20 1 
HETATM 9840  C C21 . REB K 2 .   ? -18.131 -1.782  94.247  0.84 44.88  ? 365  REB C C21 1 
HETATM 9841  C C22 . REB K 2 .   ? -18.726 -1.507  95.579  0.84 43.34  ? 365  REB C C22 1 
HETATM 9842  C C24 . REB K 2 .   ? -18.784 -2.584  93.120  0.84 45.63  ? 365  REB C C24 1 
HETATM 9843  C C02 . REB K 2 .   ? -15.954 1.212   101.033 0.84 36.31  ? 365  REB C C02 1 
HETATM 9844  C C03 . REB K 2 .   ? -15.109 2.023   100.258 0.84 35.55  ? 365  REB C C03 1 
HETATM 9845  N N04 . REB K 2 .   ? -15.018 1.803   98.880  0.84 36.67  ? 365  REB C N04 1 
HETATM 9846  C C05 . REB K 2 .   ? -15.741 0.835   98.282  0.84 38.83  ? 365  REB C C05 1 
HETATM 9847  N N06 . REB K 2 .   ? -16.567 0.040   99.072  0.84 37.79  ? 365  REB C N06 1 
HETATM 9848  C C07 . REB K 2 .   ? -16.693 0.183   100.379 0.84 37.82  ? 365  REB C C07 1 
HETATM 9849  N N08 . REB K 2 .   ? -17.635 -0.785  100.943 0.84 39.24  ? 365  REB C N08 1 
HETATM 9850  C C09 . REB K 2 .   ? -18.443 -1.852  100.596 0.84 40.90  ? 365  REB C C09 1 
HETATM 9851  C C11 . REB K 2 .   ? -19.453 -3.452  99.463  0.84 42.59  ? 365  REB C C11 1 
HETATM 9852  N N13 . REB K 2 .   ? -19.209 -2.511  101.401 0.84 41.63  ? 365  REB C N13 1 
HETATM 9853  C C14 . REB K 2 .   ? -19.937 -4.356  98.456  0.84 43.19  ? 365  REB C C14 1 
HETATM 9854  C C16 . REB K 2 .   ? -20.491 -3.870  97.185  0.84 43.90  ? 365  REB C C16 1 
HETATM 9855  N N17 . REB K 2 .   ? -15.784 0.499   96.947  0.84 39.55  ? 365  REB C N17 1 
HETATM 9856  C C18 . REB K 2 .   ? -16.616 -0.261  96.100  0.84 41.13  ? 365  REB C C18 1 
HETATM 9857  C C19 . REB K 2 .   ? -16.088 -0.548  94.847  0.84 42.70  ? 365  REB C C19 1 
HETATM 9858  C C23 . REB K 2 .   ? -17.929 -0.721  96.497  0.84 41.73  ? 365  REB C C23 1 
HETATM 9859  C C25 . REB K 2 .   ? -18.700 -3.984  93.549  0.84 47.23  ? 365  REB C C25 1 
HETATM 9860  N N26 . REB K 2 .   ? -18.600 -5.001  94.069  0.84 48.46  ? 365  REB C N26 1 
HETATM 9861  C C1  . EDO L 3 .   ? -18.938 23.061  81.806  1.00 36.48  ? 366  EDO C C1  1 
HETATM 9862  O O1  . EDO L 3 .   ? -18.870 23.863  80.615  1.00 42.22  ? 366  EDO C O1  1 
HETATM 9863  C C2  . EDO L 3 .   ? -18.073 21.839  81.547  1.00 32.80  ? 366  EDO C C2  1 
HETATM 9864  O O2  . EDO L 3 .   ? -18.048 20.888  82.621  1.00 30.56  ? 366  EDO C O2  1 
HETATM 9865  C C1  . EDO M 3 .   ? -16.481 34.332  86.953  1.00 54.23  ? 367  EDO C C1  1 
HETATM 9866  O O1  . EDO M 3 .   ? -17.390 33.241  87.135  1.00 55.68  ? 367  EDO C O1  1 
HETATM 9867  C C2  . EDO M 3 .   ? -15.183 34.144  87.718  1.00 52.93  ? 367  EDO C C2  1 
HETATM 9868  O O2  . EDO M 3 .   ? -15.349 34.634  89.057  1.00 61.26  ? 367  EDO C O2  1 
HETATM 9869  C C1  . EDO N 3 .   ? -12.141 32.241  88.821  1.00 56.85  ? 368  EDO C C1  1 
HETATM 9870  O O1  . EDO N 3 .   ? -13.235 31.506  88.265  1.00 56.05  ? 368  EDO C O1  1 
HETATM 9871  C C2  . EDO N 3 .   ? -12.384 32.463  90.308  1.00 56.10  ? 368  EDO C C2  1 
HETATM 9872  O O2  . EDO N 3 .   ? -13.595 33.208  90.504  1.00 60.09  ? 368  EDO C O2  1 
HETATM 9873  C C10 . REB O 2 .   ? -28.878 4.446   48.820  0.84 60.84  ? 365  REB D C10 1 
HETATM 9874  N N12 . REB O 2 .   ? -30.284 3.277   47.711  0.84 61.89  ? 365  REB D N12 1 
HETATM 9875  C C15 . REB O 2 .   ? -32.062 3.242   50.707  0.84 61.06  ? 365  REB D C15 1 
HETATM 9876  C C20 . REB O 2 .   ? -27.488 6.373   53.729  0.84 61.27  ? 365  REB D C20 1 
HETATM 9877  C C21 . REB O 2 .   ? -27.945 5.021   53.644  0.84 62.13  ? 365  REB D C21 1 
HETATM 9878  C C22 . REB O 2 .   ? -27.564 4.166   52.488  0.84 60.97  ? 365  REB D C22 1 
HETATM 9879  C C24 . REB O 2 .   ? -28.816 4.565   54.819  0.84 64.64  ? 365  REB D C24 1 
HETATM 9880  C C02 . REB O 2 .   ? -25.316 6.603   46.507  0.84 58.73  ? 365  REB D C02 1 
HETATM 9881  C C03 . REB O 2 .   ? -24.336 7.366   47.185  0.84 59.12  ? 365  REB D C03 1 
HETATM 9882  N N04 . REB O 2 .   ? -24.377 7.456   48.596  0.84 59.99  ? 365  REB D N04 1 
HETATM 9883  C C05 . REB O 2 .   ? -25.329 6.842   49.306  0.84 60.01  ? 365  REB D C05 1 
HETATM 9884  N N06 . REB O 2 .   ? -26.283 6.117   48.619  0.84 58.83  ? 365  REB D N06 1 
HETATM 9885  C C07 . REB O 2 .   ? -26.328 5.977   47.285  0.84 58.78  ? 365  REB D C07 1 
HETATM 9886  N N08 . REB O 2 .   ? -27.462 5.143   46.853  0.84 59.69  ? 365  REB D N08 1 
HETATM 9887  C C09 . REB O 2 .   ? -28.549 4.458   47.413  0.84 60.38  ? 365  REB D C09 1 
HETATM 9888  C C11 . REB O 2 .   ? -29.976 3.681   48.925  0.84 61.53  ? 365  REB D C11 1 
HETATM 9889  N N13 . REB O 2 .   ? -29.424 3.751   46.778  0.84 60.52  ? 365  REB D N13 1 
HETATM 9890  C C14 . REB O 2 .   ? -30.717 3.322   50.140  0.84 61.09  ? 365  REB D C14 1 
HETATM 9891  C C16 . REB O 2 .   ? -31.080 4.222   51.261  0.84 60.87  ? 365  REB D C16 1 
HETATM 9892  N N17 . REB O 2 .   ? -25.499 6.826   50.661  0.84 60.72  ? 365  REB D N17 1 
HETATM 9893  C C18 . REB O 2 .   ? -26.312 6.160   51.614  0.84 60.82  ? 365  REB D C18 1 
HETATM 9894  C C19 . REB O 2 .   ? -26.692 6.934   52.723  0.84 60.94  ? 365  REB D C19 1 
HETATM 9895  C C23 . REB O 2 .   ? -26.725 4.774   51.460  0.84 60.32  ? 365  REB D C23 1 
HETATM 9896  C C25 . REB O 2 .   ? -29.922 5.526   55.050  0.84 66.56  ? 365  REB D C25 1 
HETATM 9897  N N26 . REB O 2 .   ? -30.646 6.376   55.322  0.84 67.36  ? 365  REB D N26 1 
HETATM 9898  O O   . HOH P 5 .   ? 23.502  -1.686  15.154  1.00 20.11  ? 368  HOH A O   1 
HETATM 9899  O O   . HOH P 5 .   ? 43.766  -16.304 5.406   1.00 56.75  ? 369  HOH A O   1 
HETATM 9900  O O   . HOH P 5 .   ? 23.074  -4.292  22.411  1.00 26.91  ? 370  HOH A O   1 
HETATM 9901  O O   . HOH P 5 .   ? 14.346  20.764  41.895  1.00 57.04  ? 371  HOH A O   1 
HETATM 9902  O O   . HOH P 5 .   ? 7.831   0.412   35.423  1.00 46.96  ? 372  HOH A O   1 
HETATM 9903  O O   . HOH P 5 .   ? 20.314  -4.066  22.000  1.00 35.60  ? 373  HOH A O   1 
HETATM 9904  O O   . HOH P 5 .   ? 25.107  -0.310  23.779  1.00 43.90  ? 374  HOH A O   1 
HETATM 9905  O O   . HOH P 5 .   ? 0.798   5.567   40.234  1.00 60.49  ? 375  HOH A O   1 
HETATM 9906  O O   . HOH P 5 .   ? 20.428  -10.825 25.256  1.00 50.41  ? 376  HOH A O   1 
HETATM 9907  O O   . HOH P 5 .   ? 12.651  -15.658 31.069  1.00 37.27  ? 378  HOH A O   1 
HETATM 9908  O O   . HOH P 5 .   ? 11.975  8.514   47.012  1.00 49.72  ? 379  HOH A O   1 
HETATM 9909  O O   . HOH P 5 .   ? 25.631  -12.191 -8.819  1.00 41.84  ? 380  HOH A O   1 
HETATM 9910  O O   . HOH P 5 .   ? 0.208   4.844   37.208  1.00 51.14  ? 381  HOH A O   1 
HETATM 9911  O O   . HOH P 5 .   ? 38.774  6.832   13.066  1.00 52.03  ? 382  HOH A O   1 
HETATM 9912  O O   . HOH P 5 .   ? 21.516  13.712  43.472  1.00 56.33  ? 383  HOH A O   1 
HETATM 9913  O O   . HOH P 5 .   ? -1.809  -1.081  10.405  1.00 44.72  ? 384  HOH A O   1 
HETATM 9914  O O   . HOH P 5 .   ? 21.164  6.589   6.532   1.00 40.10  ? 385  HOH A O   1 
HETATM 9915  O O   . HOH P 5 .   ? 33.086  2.296   -4.704  1.00 55.56  ? 386  HOH A O   1 
HETATM 9916  O O   . HOH P 5 .   ? 17.494  15.548  37.384  1.00 43.69  ? 387  HOH A O   1 
HETATM 9917  O O   . HOH P 5 .   ? -0.409  14.300  28.108  1.00 59.33  ? 388  HOH A O   1 
HETATM 9918  O O   . HOH P 5 .   ? 21.575  -4.543  38.064  1.00 44.64  ? 389  HOH A O   1 
HETATM 9919  O O   . HOH P 5 .   ? 13.729  5.230   7.289   1.00 28.79  ? 390  HOH A O   1 
HETATM 9920  O O   . HOH P 5 .   ? 3.828   -8.234  35.527  1.00 38.21  ? 391  HOH A O   1 
HETATM 9921  O O   . HOH P 5 .   ? 1.612   -9.127  22.939  1.00 40.88  ? 392  HOH A O   1 
HETATM 9922  O O   . HOH P 5 .   ? -2.465  -4.165  25.123  1.00 53.02  ? 393  HOH A O   1 
HETATM 9923  O O   . HOH P 5 .   ? 0.967   0.287   45.565  1.00 49.45  ? 394  HOH A O   1 
HETATM 9924  O O   . HOH P 5 .   ? 6.403   -7.415  26.834  1.00 28.06  ? 395  HOH A O   1 
HETATM 9925  O O   . HOH P 5 .   ? -0.274  1.348   27.649  1.00 50.49  ? 396  HOH A O   1 
HETATM 9926  O O   . HOH P 5 .   ? 10.717  13.904  15.512  1.00 39.37  ? 397  HOH A O   1 
HETATM 9927  O O   . HOH P 5 .   ? 15.285  -15.416 23.489  1.00 50.86  ? 398  HOH A O   1 
HETATM 9928  O O   . HOH P 5 .   ? 5.360   -5.180  28.832  1.00 26.41  ? 399  HOH A O   1 
HETATM 9929  O O   . HOH P 5 .   ? -0.218  -3.452  36.314  1.00 55.21  ? 400  HOH A O   1 
HETATM 9930  O O   . HOH P 5 .   ? 41.442  2.457   13.779  1.00 58.46  ? 401  HOH A O   1 
HETATM 9931  O O   . HOH P 5 .   ? 2.462   -10.381 32.775  1.00 47.33  ? 402  HOH A O   1 
HETATM 9932  O O   . HOH P 5 .   ? 1.949   18.424  28.777  1.00 43.98  ? 403  HOH A O   1 
HETATM 9933  O O   . HOH P 5 .   ? 31.056  16.683  22.478  1.00 35.80  ? 404  HOH A O   1 
HETATM 9934  O O   . HOH P 5 .   ? 12.743  -1.067  50.422  1.00 31.29  ? 405  HOH A O   1 
HETATM 9935  O O   . HOH P 5 .   ? 24.081  21.232  36.163  1.00 49.61  ? 406  HOH A O   1 
HETATM 9936  O O   . HOH P 5 .   ? -0.853  1.319   19.901  1.00 41.70  ? 407  HOH A O   1 
HETATM 9937  O O   . HOH P 5 .   ? 38.298  -0.122  12.493  1.00 49.15  ? 408  HOH A O   1 
HETATM 9938  O O   . HOH P 5 .   ? 7.756   3.704   34.993  1.00 45.78  ? 409  HOH A O   1 
HETATM 9939  O O   . HOH P 5 .   ? 1.298   -2.307  17.845  1.00 53.16  ? 410  HOH A O   1 
HETATM 9940  O O   . HOH P 5 .   ? 29.783  9.054   22.406  1.00 45.79  ? 411  HOH A O   1 
HETATM 9941  O O   . HOH P 5 .   ? 25.936  11.965  30.002  1.00 44.39  ? 412  HOH A O   1 
HETATM 9942  O O   . HOH P 5 .   ? 4.835   8.387   14.693  1.00 46.01  ? 413  HOH A O   1 
HETATM 9943  O O   . HOH P 5 .   ? 18.269  -12.714 32.821  1.00 57.75  ? 414  HOH A O   1 
HETATM 9944  O O   . HOH P 5 .   ? 34.955  -11.486 0.828   1.00 40.40  ? 415  HOH A O   1 
HETATM 9945  O O   . HOH P 5 .   ? 7.359   -7.187  4.916   1.00 54.28  ? 416  HOH A O   1 
HETATM 9946  O O   . HOH P 5 .   ? 30.503  -13.141 14.759  1.00 42.35  ? 417  HOH A O   1 
HETATM 9947  O O   . HOH P 5 .   ? 20.885  -17.635 22.064  1.00 71.31  ? 418  HOH A O   1 
HETATM 9948  O O   . HOH P 5 .   ? -1.418  -1.624  27.257  1.00 51.01  ? 419  HOH A O   1 
HETATM 9949  O O   . HOH P 5 .   ? 5.188   -14.402 33.023  1.00 37.28  ? 420  HOH A O   1 
HETATM 9950  O O   . HOH P 5 .   ? 5.250   22.908  32.454  1.00 57.03  ? 421  HOH A O   1 
HETATM 9951  O O   . HOH P 5 .   ? 20.639  2.196   28.326  1.00 22.87  ? 422  HOH A O   1 
HETATM 9952  O O   . HOH P 5 .   ? 10.920  -2.753  34.844  1.00 28.20  ? 423  HOH A O   1 
HETATM 9953  O O   . HOH P 5 .   ? 19.987  0.032   29.794  1.00 24.18  ? 424  HOH A O   1 
HETATM 9954  O O   . HOH P 5 .   ? 4.405   -4.615  20.861  1.00 24.31  ? 425  HOH A O   1 
HETATM 9955  O O   . HOH P 5 .   ? 11.835  6.389   14.036  1.00 18.52  ? 426  HOH A O   1 
HETATM 9956  O O   . HOH P 5 .   ? 19.269  -12.022 17.680  1.00 24.12  ? 427  HOH A O   1 
HETATM 9957  O O   . HOH P 5 .   ? 17.922  20.943  22.138  1.00 34.63  ? 428  HOH A O   1 
HETATM 9958  O O   . HOH P 5 .   ? 28.319  -14.293 8.412   1.00 33.15  ? 429  HOH A O   1 
HETATM 9959  O O   . HOH P 5 .   ? 18.204  -2.896  45.787  1.00 30.17  ? 430  HOH A O   1 
HETATM 9960  O O   . HOH P 5 .   ? 20.455  -5.161  25.776  1.00 37.18  ? 431  HOH A O   1 
HETATM 9961  O O   . HOH P 5 .   ? 17.339  -13.514 22.161  1.00 32.71  ? 432  HOH A O   1 
HETATM 9962  O O   . HOH P 5 .   ? 10.818  -5.338  30.921  1.00 26.25  ? 433  HOH A O   1 
HETATM 9963  O O   . HOH P 5 .   ? 15.354  0.203   50.884  1.00 34.63  ? 434  HOH A O   1 
HETATM 9964  O O   . HOH P 5 .   ? 15.441  2.457   7.989   1.00 23.83  ? 435  HOH A O   1 
HETATM 9965  O O   . HOH P 5 .   ? 27.216  -5.338  21.431  1.00 56.56  ? 436  HOH A O   1 
HETATM 9966  O O   . HOH P 5 .   ? 30.265  -17.038 2.304   1.00 41.71  ? 437  HOH A O   1 
HETATM 9967  O O   . HOH P 5 .   ? 28.470  7.151   40.219  1.00 43.26  ? 438  HOH A O   1 
HETATM 9968  O O   . HOH P 5 .   ? -1.434  -7.549  25.997  1.00 37.48  ? 439  HOH A O   1 
HETATM 9969  O O   . HOH P 5 .   ? 17.210  3.714   6.473   1.00 28.48  ? 440  HOH A O   1 
HETATM 9970  O O   . HOH P 5 .   ? 18.267  18.438  14.129  1.00 42.31  ? 441  HOH A O   1 
HETATM 9971  O O   . HOH P 5 .   ? 6.560   2.205   14.174  1.00 26.52  ? 442  HOH A O   1 
HETATM 9972  O O   . HOH P 5 .   ? 24.206  -10.939 2.093   1.00 36.15  ? 443  HOH A O   1 
HETATM 9973  O O   . HOH P 5 .   ? 10.627  -18.718 29.340  1.00 53.84  ? 444  HOH A O   1 
HETATM 9974  O O   . HOH P 5 .   ? 0.220   2.158   17.444  1.00 42.54  ? 445  HOH A O   1 
HETATM 9975  O O   . HOH P 5 .   ? 28.514  16.117  16.402  1.00 39.92  ? 447  HOH A O   1 
HETATM 9976  O O   . HOH P 5 .   ? 8.913   10.987  11.352  1.00 53.07  ? 448  HOH A O   1 
HETATM 9977  O O   . HOH P 5 .   ? 31.760  7.017   -1.538  1.00 38.10  ? 449  HOH A O   1 
HETATM 9978  O O   . HOH P 5 .   ? 12.069  13.788  13.160  1.00 41.54  ? 450  HOH A O   1 
HETATM 9979  O O   . HOH P 5 .   ? 40.308  -6.621  -3.426  1.00 40.26  ? 451  HOH A O   1 
HETATM 9980  O O   . HOH P 5 .   ? 36.239  6.051   2.900   1.00 40.39  ? 452  HOH A O   1 
HETATM 9981  O O   . HOH P 5 .   ? 30.651  -14.437 2.155   1.00 27.01  ? 453  HOH A O   1 
HETATM 9982  O O   . HOH P 5 .   ? 8.125   -2.958  39.033  1.00 46.84  ? 454  HOH A O   1 
HETATM 9983  O O   . HOH P 5 .   ? 30.033  -11.282 -6.927  1.00 30.82  ? 455  HOH A O   1 
HETATM 9984  O O   . HOH P 5 .   ? 22.240  -15.007 19.918  1.00 33.94  ? 456  HOH A O   1 
HETATM 9985  O O   . HOH P 5 .   ? 28.083  5.367   19.429  1.00 38.67  ? 457  HOH A O   1 
HETATM 9986  O O   . HOH P 5 .   ? -0.355  1.441   30.290  1.00 39.11  ? 458  HOH A O   1 
HETATM 9987  O O   . HOH P 5 .   ? 1.821   2.897   43.283  1.00 34.67  ? 459  HOH A O   1 
HETATM 9988  O O   . HOH P 5 .   ? 10.543  6.147   49.373  1.00 52.28  ? 460  HOH A O   1 
HETATM 9989  O O   . HOH P 5 .   ? 8.631   19.639  40.210  1.00 49.32  ? 461  HOH A O   1 
HETATM 9990  O O   . HOH P 5 .   ? 24.907  7.707   26.169  1.00 35.86  ? 462  HOH A O   1 
HETATM 9991  O O   . HOH P 5 .   ? 11.592  4.978   38.340  1.00 37.61  ? 463  HOH A O   1 
HETATM 9992  O O   . HOH P 5 .   ? 3.304   7.515   41.538  1.00 39.95  ? 464  HOH A O   1 
HETATM 9993  O O   . HOH P 5 .   ? 9.034   -1.627  41.078  1.00 38.06  ? 465  HOH A O   1 
HETATM 9994  O O   . HOH P 5 .   ? 11.170  -11.020 28.141  1.00 37.85  ? 466  HOH A O   1 
HETATM 9995  O O   . HOH P 5 .   ? 16.440  20.286  36.217  1.00 44.95  ? 467  HOH A O   1 
HETATM 9996  O O   . HOH P 5 .   ? 31.877  18.943  23.927  1.00 43.39  ? 468  HOH A O   1 
HETATM 9997  O O   . HOH P 5 .   ? 9.817   -20.092 12.349  1.00 24.00  ? 470  HOH A O   1 
HETATM 9998  O O   . HOH P 5 .   ? 9.134   -19.388 27.212  1.00 51.21  ? 471  HOH A O   1 
HETATM 9999  O O   . HOH P 5 .   ? 8.659   5.732   47.575  1.00 52.86  ? 472  HOH A O   1 
HETATM 10000 O O   . HOH P 5 .   ? 8.866   -5.534  39.610  1.00 50.43  ? 473  HOH A O   1 
HETATM 10001 O O   . HOH P 5 .   ? 35.573  -10.526 -3.367  1.00 39.23  ? 474  HOH A O   1 
HETATM 10002 O O   . HOH P 5 .   ? 19.105  20.151  36.547  1.00 49.76  ? 475  HOH A O   1 
HETATM 10003 O O   . HOH P 5 .   ? 13.205  5.238   4.655   1.00 31.72  ? 476  HOH A O   1 
HETATM 10004 O O   . HOH P 5 .   ? 2.553   -3.496  36.577  1.00 40.34  ? 477  HOH A O   1 
HETATM 10005 O O   . HOH P 5 .   ? 7.846   0.372   42.636  1.00 37.17  ? 478  HOH A O   1 
HETATM 10006 O O   . HOH P 5 .   ? 22.170  -18.255 19.378  1.00 59.92  ? 479  HOH A O   1 
HETATM 10007 O O   . HOH P 5 .   ? 30.258  -6.996  18.320  1.00 44.53  ? 480  HOH A O   1 
HETATM 10008 O O   . HOH P 5 .   ? 27.769  -6.323  17.840  1.00 41.11  ? 481  HOH A O   1 
HETATM 10009 O O   . HOH P 5 .   ? 24.492  -11.519 22.356  1.00 23.89  ? 482  HOH A O   1 
HETATM 10010 O O   . HOH P 5 .   ? 23.461  -8.546  -0.211  1.00 36.85  ? 483  HOH A O   1 
HETATM 10011 O O   . HOH P 5 .   ? 4.325   3.532   14.867  1.00 37.91  ? 484  HOH A O   1 
HETATM 10012 O O   . HOH P 5 .   ? 25.684  9.170   2.732   1.00 45.39  ? 485  HOH A O   1 
HETATM 10013 O O   . HOH P 5 .   ? 6.792   -4.765  7.422   1.00 33.78  ? 486  HOH A O   1 
HETATM 10014 O O   . HOH P 5 .   ? 26.341  -1.898  16.654  1.00 47.90  ? 487  HOH A O   1 
HETATM 10015 O O   . HOH P 5 .   ? 26.607  -0.103  33.187  1.00 43.65  ? 488  HOH A O   1 
HETATM 10016 O O   . HOH P 5 .   ? 24.030  16.859  8.835   1.00 45.41  ? 489  HOH A O   1 
HETATM 10017 O O   . HOH P 5 .   ? 27.960  12.405  41.383  1.00 56.44  ? 490  HOH A O   1 
HETATM 10018 O O   . HOH P 5 .   ? 11.625  23.645  23.931  1.00 38.21  ? 491  HOH A O   1 
HETATM 10019 O O   . HOH P 5 .   ? 23.352  14.597  10.299  1.00 39.66  ? 492  HOH A O   1 
HETATM 10020 O O   . HOH P 5 .   ? 26.065  -15.509 22.756  1.00 46.03  ? 493  HOH A O   1 
HETATM 10021 O O   . HOH P 5 .   ? 21.527  14.735  40.779  1.00 56.42  ? 494  HOH A O   1 
HETATM 10022 O O   . HOH P 5 .   ? 39.404  4.102   13.570  1.00 66.01  ? 495  HOH A O   1 
HETATM 10023 O O   . HOH P 5 .   ? -0.319  -1.278  20.716  1.00 45.21  ? 496  HOH A O   1 
HETATM 10024 O O   . HOH P 5 .   ? 24.636  -16.718 -3.145  1.00 34.90  ? 497  HOH A O   1 
HETATM 10025 O O   . HOH P 5 .   ? 35.654  -12.637 19.563  1.00 53.29  ? 498  HOH A O   1 
HETATM 10026 O O   . HOH P 5 .   ? 32.592  -10.328 -6.403  1.00 44.12  ? 499  HOH A O   1 
HETATM 10027 O O   . HOH P 5 .   ? 9.611   22.491  31.322  1.00 66.98  ? 500  HOH A O   1 
HETATM 10028 O O   . HOH P 5 .   ? 42.625  -8.774  4.432   1.00 57.88  ? 501  HOH A O   1 
HETATM 10029 O O   . HOH P 5 .   ? 29.121  7.194   17.035  1.00 32.71  ? 502  HOH A O   1 
HETATM 10030 O O   . HOH P 5 .   ? 25.141  3.473   -3.146  1.00 46.57  ? 503  HOH A O   1 
HETATM 10031 O O   . HOH P 5 .   ? 7.472   -7.979  8.705   1.00 41.80  ? 504  HOH A O   1 
HETATM 10032 O O   . HOH P 5 .   ? 26.738  -12.835 23.128  1.00 42.91  ? 505  HOH A O   1 
HETATM 10033 O O   . HOH P 5 .   ? 25.417  14.167  11.900  1.00 41.65  ? 506  HOH A O   1 
HETATM 10034 O O   . HOH P 5 .   ? 27.244  0.671   25.058  1.00 42.68  ? 507  HOH A O   1 
HETATM 10035 O O   . HOH P 5 .   ? 18.187  -8.291  31.694  1.00 34.34  ? 508  HOH A O   1 
HETATM 10036 O O   . HOH P 5 .   ? 17.698  -12.263 5.766   1.00 60.16  ? 509  HOH A O   1 
HETATM 10037 O O   . HOH P 5 .   ? 7.041   14.148  11.973  1.00 47.26  ? 510  HOH A O   1 
HETATM 10038 O O   . HOH P 5 .   ? 11.562  7.662   4.271   1.00 39.45  ? 511  HOH A O   1 
HETATM 10039 O O   . HOH P 5 .   ? 26.484  14.540  9.068   1.00 60.14  ? 512  HOH A O   1 
HETATM 10040 O O   . HOH P 5 .   ? -2.952  8.704   26.179  1.00 54.98  ? 513  HOH A O   1 
HETATM 10041 O O   . HOH P 5 .   ? 0.591   -8.363  18.286  1.00 67.39  ? 514  HOH A O   1 
HETATM 10042 O O   . HOH P 5 .   ? 24.465  -10.656 -6.622  1.00 38.59  ? 515  HOH A O   1 
HETATM 10043 O O   . HOH P 5 .   ? 27.954  -0.702  38.092  1.00 45.09  ? 516  HOH A O   1 
HETATM 10044 O O   . HOH P 5 .   ? 27.284  2.323   19.794  1.00 44.10  ? 517  HOH A O   1 
HETATM 10045 O O   . HOH P 5 .   ? 13.070  -1.276  47.412  1.00 52.11  ? 518  HOH A O   1 
HETATM 10046 O O   . HOH P 5 .   ? 5.546   -9.898  37.749  1.00 53.22  ? 519  HOH A O   1 
HETATM 10047 O O   . HOH P 5 .   ? 12.016  -11.759 14.641  1.00 41.93  ? 520  HOH A O   1 
HETATM 10048 O O   . HOH P 5 .   ? 30.077  8.767   10.356  1.00 54.18  ? 521  HOH A O   1 
HETATM 10049 O O   . HOH P 5 .   ? 6.104   -7.058  38.035  1.00 52.64  ? 522  HOH A O   1 
HETATM 10050 O O   . HOH P 5 .   ? 24.936  -15.471 19.876  1.00 45.20  ? 523  HOH A O   1 
HETATM 10051 O O   . HOH P 5 .   ? -1.380  -0.958  31.098  1.00 37.01  ? 524  HOH A O   1 
HETATM 10052 O O   . HOH P 5 .   ? 9.592   7.612   12.691  1.00 28.76  ? 525  HOH A O   1 
HETATM 10053 O O   . HOH P 5 .   ? 14.516  5.910   1.809   1.00 49.63  ? 526  HOH A O   1 
HETATM 10054 O O   . HOH P 5 .   ? 15.356  20.932  13.156  1.00 55.07  ? 527  HOH A O   1 
HETATM 10055 O O   . HOH P 5 .   ? 28.611  17.958  18.365  1.00 46.97  ? 529  HOH A O   1 
HETATM 10056 O O   . HOH P 5 .   ? 0.589   19.255  18.955  1.00 48.87  ? 535  HOH A O   1 
HETATM 10057 O O   . HOH P 5 .   ? 1.554   17.351  16.486  1.00 47.78  ? 549  HOH A O   1 
HETATM 10058 O O   . HOH P 5 .   ? 26.300  -0.844  27.225  1.00 49.73  ? 554  HOH A O   1 
HETATM 10059 O O   . HOH P 5 .   ? 39.708  -20.290 8.075   1.00 44.88  ? 555  HOH A O   1 
HETATM 10060 O O   . HOH P 5 .   ? 4.196   16.361  37.145  1.00 37.91  ? 568  HOH A O   1 
HETATM 10061 O O   . HOH P 5 .   ? 38.758  -19.640 11.825  1.00 52.75  ? 572  HOH A O   1 
HETATM 10062 O O   . HOH P 5 .   ? 13.677  -4.094  27.969  1.00 25.17  ? 576  HOH A O   1 
HETATM 10063 O O   . HOH P 5 .   ? 17.830  -3.401  30.180  1.00 25.10  ? 581  HOH A O   1 
HETATM 10064 O O   . HOH P 5 .   ? 15.136  -3.749  30.317  1.00 29.43  ? 583  HOH A O   1 
HETATM 10065 O O   . HOH P 5 .   ? 18.654  -5.845  30.254  1.00 30.04  ? 584  HOH A O   1 
HETATM 10066 O O   . HOH P 5 .   ? 8.685   -2.344  36.519  1.00 44.78  ? 586  HOH A O   1 
HETATM 10067 O O   . HOH P 5 .   ? 21.244  -7.952  38.720  1.00 50.06  ? 592  HOH A O   1 
HETATM 10068 O O   . HOH P 5 .   ? 24.191  -3.283  24.655  1.00 32.08  ? 595  HOH A O   1 
HETATM 10069 O O   . HOH P 5 .   ? 27.147  3.047   23.054  1.00 47.02  ? 604  HOH A O   1 
HETATM 10070 O O   . HOH P 5 .   ? -2.876  10.463  30.763  1.00 36.43  ? 610  HOH A O   1 
HETATM 10071 O O   . HOH P 5 .   ? 25.000  2.344   48.839  1.00 44.10  ? 614  HOH A O   1 
HETATM 10072 O O   . HOH P 5 .   ? 4.286   -11.825 34.039  1.00 61.66  ? 633  HOH A O   1 
HETATM 10073 O O   . HOH P 5 .   ? -2.351  6.773   33.631  1.00 45.63  ? 637  HOH A O   1 
HETATM 10074 O O   . HOH P 5 .   ? 36.794  -21.060 8.439   1.00 47.97  ? 642  HOH A O   1 
HETATM 10075 O O   . HOH P 5 .   ? 3.164   20.508  31.937  1.00 61.67  ? 643  HOH A O   1 
HETATM 10076 O O   . HOH P 5 .   ? 24.061  -11.810 26.948  1.00 58.25  ? 649  HOH A O   1 
HETATM 10077 O O   . HOH P 5 .   ? 28.337  10.487  46.040  1.00 60.14  ? 669  HOH A O   1 
HETATM 10078 O O   . HOH P 5 .   ? 21.060  -14.031 33.651  1.00 59.53  ? 685  HOH A O   1 
HETATM 10079 O O   . HOH P 5 .   ? 27.035  -17.127 -4.214  1.00 42.02  ? 686  HOH A O   1 
HETATM 10080 O O   . HOH P 5 .   ? 2.705   -9.562  16.147  1.00 60.65  ? 691  HOH A O   1 
HETATM 10081 O O   . HOH P 5 .   ? 19.443  -13.361 36.656  1.00 57.22  ? 693  HOH A O   1 
HETATM 10082 O O   . HOH P 5 .   ? 30.592  17.411  28.411  1.00 47.31  ? 698  HOH A O   1 
HETATM 10083 O O   . HOH P 5 .   ? 19.020  6.523   4.972   1.00 61.97  ? 704  HOH A O   1 
HETATM 10084 O O   . HOH P 5 .   ? 5.034   25.633  34.831  1.00 57.55  ? 708  HOH A O   1 
HETATM 10085 O O   . HOH P 5 .   ? 38.543  -9.817  -0.180  1.00 54.45  ? 713  HOH A O   1 
HETATM 10086 O O   . HOH P 5 .   ? 33.297  7.703   14.122  1.00 54.88  ? 717  HOH A O   1 
HETATM 10087 O O   . HOH P 5 .   ? 18.133  22.927  32.424  1.00 63.72  ? 723  HOH A O   1 
HETATM 10088 O O   . HOH P 5 .   ? -1.146  9.150   32.339  1.00 53.35  ? 740  HOH A O   1 
HETATM 10089 O O   . HOH P 5 .   ? 27.937  3.610   33.280  1.00 51.67  ? 741  HOH A O   1 
HETATM 10090 O O   . HOH P 5 .   ? 0.302   16.646  29.773  1.00 59.91  ? 748  HOH A O   1 
HETATM 10091 O O   . HOH P 5 .   ? 0.137   14.709  15.562  1.00 51.94  ? 753  HOH A O   1 
HETATM 10092 O O   . HOH P 5 .   ? 4.011   -8.941  19.541  1.00 36.64  ? 757  HOH A O   1 
HETATM 10093 O O   . HOH P 5 .   ? 35.131  11.631  -1.562  1.00 55.85  ? 765  HOH A O   1 
HETATM 10094 O O   . HOH P 5 .   ? 31.249  -13.939 22.465  1.00 58.41  ? 767  HOH A O   1 
HETATM 10095 O O   . HOH P 5 .   ? 9.138   14.592  47.468  1.00 58.01  ? 776  HOH A O   1 
HETATM 10096 O O   . HOH P 5 .   ? 30.297  5.932   21.082  1.00 58.39  ? 777  HOH A O   1 
HETATM 10097 O O   . HOH P 5 .   ? 18.690  14.510  39.923  1.00 49.35  ? 785  HOH A O   1 
HETATM 10098 O O   . HOH P 5 .   ? 28.896  -11.981 24.899  1.00 57.92  ? 786  HOH A O   1 
HETATM 10099 O O   . HOH P 5 .   ? 1.281   -2.634  10.879  1.00 50.71  ? 787  HOH A O   1 
HETATM 10100 O O   . HOH P 5 .   ? 29.483  5.377   42.270  1.00 61.84  ? 793  HOH A O   1 
HETATM 10101 O O   . HOH P 5 .   ? 46.713  -11.349 5.549   1.00 61.25  ? 802  HOH A O   1 
HETATM 10102 O O   . HOH P 5 .   ? 26.927  5.682   27.241  1.00 57.79  ? 805  HOH A O   1 
HETATM 10103 O O   . HOH P 5 .   ? 27.008  17.543  14.666  1.00 49.66  ? 814  HOH A O   1 
HETATM 10104 O O   . HOH P 5 .   ? 10.183  23.562  14.858  1.00 55.39  ? 816  HOH A O   1 
HETATM 10105 O O   . HOH P 5 .   ? 2.269   13.239  45.645  1.00 56.18  ? 817  HOH A O   1 
HETATM 10106 O O   . HOH P 5 .   ? 45.178  1.524   0.132   1.00 54.83  ? 818  HOH A O   1 
HETATM 10107 O O   . HOH P 5 .   ? 28.926  7.553   46.690  1.00 53.43  ? 824  HOH A O   1 
HETATM 10108 O O   . HOH P 5 .   ? 28.199  -2.716  22.779  1.00 46.15  ? 825  HOH A O   1 
HETATM 10109 O O   . HOH P 5 .   ? 29.494  -15.892 -2.120  1.00 51.21  ? 828  HOH A O   1 
HETATM 10110 O O   . HOH P 5 .   ? 27.115  -7.922  29.061  1.00 49.04  ? 829  HOH A O   1 
HETATM 10111 O O   . HOH P 5 .   ? 40.292  4.187   17.297  1.00 57.89  ? 830  HOH A O   1 
HETATM 10112 O O   . HOH P 5 .   ? 42.810  -5.039  14.209  1.00 58.93  ? 831  HOH A O   1 
HETATM 10113 O O   . HOH P 5 .   ? 3.105   -12.166 23.500  1.00 35.62  ? 835  HOH A O   1 
HETATM 10114 O O   . HOH P 5 .   ? 16.592  4.533   3.928   1.00 63.93  ? 840  HOH A O   1 
HETATM 10115 O O   . HOH P 5 .   ? 34.028  -12.669 -6.464  1.00 61.47  ? 895  HOH A O   1 
HETATM 10116 O O   . HOH P 5 .   ? 3.011   -15.159 24.654  1.00 45.27  ? 900  HOH A O   1 
HETATM 10117 O O   . HOH P 5 .   ? 32.438  -8.129  21.263  1.00 62.24  ? 904  HOH A O   1 
HETATM 10118 O O   . HOH P 5 .   ? 1.706   -14.230 32.597  1.00 57.28  ? 909  HOH A O   1 
HETATM 10119 O O   . HOH P 5 .   ? 33.792  -14.773 -8.057  1.00 53.55  ? 919  HOH A O   1 
HETATM 10120 O O   . HOH P 5 .   ? 7.744   24.492  16.249  1.00 47.56  ? 960  HOH A O   1 
HETATM 10121 O O   . HOH P 5 .   ? 19.530  22.875  35.316  1.00 56.98  ? 961  HOH A O   1 
HETATM 10122 O O   . HOH P 5 .   ? 23.600  6.896   3.905   1.00 55.46  ? 975  HOH A O   1 
HETATM 10123 O O   . HOH P 5 .   ? 25.355  -4.678  32.080  1.00 54.93  ? 986  HOH A O   1 
HETATM 10124 O O   . HOH P 5 .   ? -2.972  12.690  25.676  1.00 63.95  ? 987  HOH A O   1 
HETATM 10125 O O   . HOH P 5 .   ? 19.038  -9.185  33.996  1.00 59.27  ? 1006 HOH A O   1 
HETATM 10126 O O   . HOH P 5 .   ? 7.636   1.516   -0.066  1.00 49.61  ? 1008 HOH A O   1 
HETATM 10127 O O   . HOH P 5 .   ? 12.228  21.396  31.916  1.00 66.74  ? 1024 HOH A O   1 
HETATM 10128 O O   . HOH Q 5 .   ? 10.110  -9.228  41.595  1.00 37.56  ? 368  HOH B O   1 
HETATM 10129 O O   . HOH Q 5 .   ? 21.357  -3.586  63.128  1.00 34.33  ? 369  HOH B O   1 
HETATM 10130 O O   . HOH Q 5 .   ? 11.701  1.682   66.132  1.00 29.74  ? 370  HOH B O   1 
HETATM 10131 O O   . HOH Q 5 .   ? 19.688  -2.394  70.450  1.00 33.76  ? 371  HOH B O   1 
HETATM 10132 O O   . HOH Q 5 .   ? 45.467  -5.966  82.514  1.00 46.08  ? 372  HOH B O   1 
HETATM 10133 O O   . HOH Q 5 .   ? 25.592  -11.765 92.335  1.00 54.26  ? 373  HOH B O   1 
HETATM 10134 O O   . HOH Q 5 .   ? 19.339  13.248  54.505  1.00 47.65  ? 374  HOH B O   1 
HETATM 10135 O O   . HOH Q 5 .   ? 23.307  -4.867  71.479  1.00 41.92  ? 375  HOH B O   1 
HETATM 10136 O O   . HOH Q 5 .   ? 36.033  2.541   92.117  1.00 48.91  ? 376  HOH B O   1 
HETATM 10137 O O   . HOH Q 5 .   ? 25.719  14.129  91.628  1.00 59.65  ? 377  HOH B O   1 
HETATM 10138 O O   . HOH Q 5 .   ? 13.299  9.645   61.018  1.00 45.68  ? 378  HOH B O   1 
HETATM 10139 O O   . HOH Q 5 .   ? 33.254  14.490  60.639  1.00 59.00  ? 379  HOH B O   1 
HETATM 10140 O O   . HOH Q 5 .   ? 30.691  -3.648  54.442  1.00 43.09  ? 380  HOH B O   1 
HETATM 10141 O O   . HOH Q 5 .   ? 24.310  21.836  73.898  1.00 49.18  ? 381  HOH B O   1 
HETATM 10142 O O   . HOH Q 5 .   ? 10.124  -1.809  52.019  1.00 54.79  ? 382  HOH B O   1 
HETATM 10143 O O   . HOH Q 5 .   ? 11.408  -18.137 47.935  1.00 47.28  ? 383  HOH B O   1 
HETATM 10144 O O   . HOH Q 5 .   ? 24.470  11.994  88.058  1.00 37.06  ? 384  HOH B O   1 
HETATM 10145 O O   . HOH Q 5 .   ? 13.239  -13.515 39.657  1.00 44.31  ? 385  HOH B O   1 
HETATM 10146 O O   . HOH Q 5 .   ? 36.726  -6.741  59.173  1.00 46.14  ? 386  HOH B O   1 
HETATM 10147 O O   . HOH Q 5 .   ? 23.302  3.743   93.540  1.00 25.53  ? 387  HOH B O   1 
HETATM 10148 O O   . HOH Q 5 .   ? 19.850  0.112   69.900  1.00 26.39  ? 388  HOH B O   1 
HETATM 10149 O O   . HOH Q 5 .   ? 36.825  16.962  88.280  1.00 44.65  ? 389  HOH B O   1 
HETATM 10150 O O   . HOH Q 5 .   ? 1.320   -18.493 58.256  1.00 49.51  ? 390  HOH B O   1 
HETATM 10151 O O   . HOH Q 5 .   ? 46.459  5.138   88.430  1.00 53.52  ? 391  HOH B O   1 
HETATM 10152 O O   . HOH Q 5 .   ? 6.869   -10.097 51.315  1.00 32.59  ? 392  HOH B O   1 
HETATM 10153 O O   . HOH Q 5 .   ? 27.018  12.907  93.950  1.00 30.70  ? 393  HOH B O   1 
HETATM 10154 O O   . HOH Q 5 .   ? 18.917  -4.752  80.729  1.00 68.95  ? 394  HOH B O   1 
HETATM 10155 O O   . HOH Q 5 .   ? 25.394  13.899  81.531  1.00 56.81  ? 395  HOH B O   1 
HETATM 10156 O O   . HOH Q 5 .   ? 4.680   -4.695  46.061  1.00 42.74  ? 396  HOH B O   1 
HETATM 10157 O O   . HOH Q 5 .   ? 35.742  10.036  93.661  1.00 56.33  ? 397  HOH B O   1 
HETATM 10158 O O   . HOH Q 5 .   ? 45.740  2.634   74.880  1.00 42.73  ? 398  HOH B O   1 
HETATM 10159 O O   . HOH Q 5 .   ? 46.023  10.316  85.660  1.00 43.06  ? 399  HOH B O   1 
HETATM 10160 O O   . HOH Q 5 .   ? 39.687  1.172   86.200  1.00 42.52  ? 400  HOH B O   1 
HETATM 10161 O O   . HOH Q 5 .   ? 16.023  18.720  80.130  1.00 33.93  ? 401  HOH B O   1 
HETATM 10162 O O   . HOH Q 5 .   ? 34.814  9.419   57.588  1.00 56.34  ? 402  HOH B O   1 
HETATM 10163 O O   . HOH Q 5 .   ? 26.567  20.686  66.201  1.00 35.71  ? 403  HOH B O   1 
HETATM 10164 O O   . HOH Q 5 .   ? 28.397  5.330   54.365  1.00 38.60  ? 404  HOH B O   1 
HETATM 10165 O O   . HOH Q 5 .   ? 26.672  -0.550  75.824  1.00 26.18  ? 405  HOH B O   1 
HETATM 10166 O O   . HOH Q 5 .   ? 8.870   6.011   71.773  1.00 45.44  ? 406  HOH B O   1 
HETATM 10167 O O   . HOH Q 5 .   ? 16.428  -7.697  66.471  1.00 51.38  ? 407  HOH B O   1 
HETATM 10168 O O   . HOH Q 5 .   ? 26.928  1.037   53.647  1.00 44.44  ? 408  HOH B O   1 
HETATM 10169 O O   . HOH Q 5 .   ? 17.909  15.206  85.203  1.00 49.61  ? 409  HOH B O   1 
HETATM 10170 O O   . HOH Q 5 .   ? 27.303  -7.209  81.179  1.00 39.47  ? 410  HOH B O   1 
HETATM 10171 O O   . HOH Q 5 .   ? 4.772   12.456  69.211  1.00 38.34  ? 411  HOH B O   1 
HETATM 10172 O O   . HOH Q 5 .   ? 28.999  -2.933  96.439  1.00 38.84  ? 412  HOH B O   1 
HETATM 10173 O O   . HOH Q 5 .   ? 14.240  17.297  81.557  1.00 42.92  ? 413  HOH B O   1 
HETATM 10174 O O   . HOH Q 5 .   ? 19.069  0.187   73.773  1.00 43.16  ? 414  HOH B O   1 
HETATM 10175 O O   . HOH Q 5 .   ? 21.432  22.877  71.490  1.00 58.47  ? 415  HOH B O   1 
HETATM 10176 O O   . HOH Q 5 .   ? 27.404  20.615  76.801  1.00 42.36  ? 416  HOH B O   1 
HETATM 10177 O O   . HOH Q 5 .   ? 18.060  -7.093  70.001  1.00 52.03  ? 417  HOH B O   1 
HETATM 10178 O O   . HOH Q 5 .   ? 4.061   9.762   68.357  1.00 42.79  ? 418  HOH B O   1 
HETATM 10179 O O   . HOH Q 5 .   ? 20.118  15.548  67.985  1.00 23.37  ? 419  HOH B O   1 
HETATM 10180 O O   . HOH Q 5 .   ? 24.735  0.273   77.413  1.00 23.04  ? 420  HOH B O   1 
HETATM 10181 O O   . HOH Q 5 .   ? 6.623   -8.689  46.633  1.00 45.91  ? 421  HOH B O   1 
HETATM 10182 O O   . HOH Q 5 .   ? 20.392  15.139  76.027  1.00 25.54  ? 422  HOH B O   1 
HETATM 10183 O O   . HOH Q 5 .   ? 11.059  -4.055  50.966  1.00 40.34  ? 423  HOH B O   1 
HETATM 10184 O O   . HOH Q 5 .   ? 18.107  14.232  74.280  1.00 25.59  ? 424  HOH B O   1 
HETATM 10185 O O   . HOH Q 5 .   ? 19.288  10.545  85.667  1.00 23.87  ? 425  HOH B O   1 
HETATM 10186 O O   . HOH Q 5 .   ? 13.336  0.207   73.254  1.00 48.32  ? 426  HOH B O   1 
HETATM 10187 O O   . HOH Q 5 .   ? 16.635  13.344  53.086  1.00 50.42  ? 427  HOH B O   1 
HETATM 10188 O O   . HOH Q 5 .   ? 19.245  -23.380 62.158  1.00 62.65  ? 428  HOH B O   1 
HETATM 10189 O O   . HOH Q 5 .   ? 33.314  -5.610  77.213  1.00 60.65  ? 429  HOH B O   1 
HETATM 10190 O O   . HOH Q 5 .   ? 37.875  8.146   61.386  1.00 38.01  ? 430  HOH B O   1 
HETATM 10191 O O   . HOH Q 5 .   ? 14.014  9.897   76.156  1.00 25.95  ? 431  HOH B O   1 
HETATM 10192 O O   . HOH Q 5 .   ? 41.242  -1.165  93.032  1.00 49.41  ? 432  HOH B O   1 
HETATM 10193 O O   . HOH Q 5 .   ? 19.978  9.908   78.366  1.00 20.15  ? 433  HOH B O   1 
HETATM 10194 O O   . HOH Q 5 .   ? 24.228  5.383   95.345  1.00 28.07  ? 434  HOH B O   1 
HETATM 10195 O O   . HOH Q 5 .   ? 30.213  7.633   60.837  1.00 29.14  ? 435  HOH B O   1 
HETATM 10196 O O   . HOH Q 5 .   ? 34.886  -2.861  90.642  1.00 38.93  ? 436  HOH B O   1 
HETATM 10197 O O   . HOH Q 5 .   ? 34.418  -3.844  74.943  1.00 34.16  ? 437  HOH B O   1 
HETATM 10198 O O   . HOH Q 5 .   ? 13.977  -20.131 44.604  1.00 53.89  ? 438  HOH B O   1 
HETATM 10199 O O   . HOH Q 5 .   ? 3.967   11.601  60.838  1.00 33.31  ? 439  HOH B O   1 
HETATM 10200 O O   . HOH Q 5 .   ? 22.691  18.358  83.833  1.00 54.98  ? 440  HOH B O   1 
HETATM 10201 O O   . HOH Q 5 .   ? 23.405  -13.627 42.919  1.00 47.63  ? 441  HOH B O   1 
HETATM 10202 O O   . HOH Q 5 .   ? 11.046  3.288   70.578  1.00 36.89  ? 442  HOH B O   1 
HETATM 10203 O O   . HOH Q 5 .   ? 25.001  -7.678  67.566  1.00 43.98  ? 443  HOH B O   1 
HETATM 10204 O O   . HOH Q 5 .   ? 16.306  -2.058  47.822  1.00 27.38  ? 444  HOH B O   1 
HETATM 10205 O O   . HOH Q 5 .   ? 31.510  9.331   59.229  1.00 31.33  ? 445  HOH B O   1 
HETATM 10206 O O   . HOH Q 5 .   ? 29.121  7.958   98.562  1.00 35.43  ? 446  HOH B O   1 
HETATM 10207 O O   . HOH Q 5 .   ? 8.682   -0.653  69.053  1.00 31.17  ? 447  HOH B O   1 
HETATM 10208 O O   . HOH Q 5 .   ? 24.123  -5.889  81.020  1.00 36.90  ? 448  HOH B O   1 
HETATM 10209 O O   . HOH Q 5 .   ? 16.716  3.171   79.804  1.00 39.89  ? 449  HOH B O   1 
HETATM 10210 O O   . HOH Q 5 .   ? 33.209  -1.436  74.228  1.00 31.69  ? 450  HOH B O   1 
HETATM 10211 O O   . HOH Q 5 .   ? 14.940  12.530  56.705  1.00 44.53  ? 451  HOH B O   1 
HETATM 10212 O O   . HOH Q 5 .   ? 25.752  3.946   55.315  1.00 35.88  ? 452  HOH B O   1 
HETATM 10213 O O   . HOH Q 5 .   ? 30.221  6.998   96.066  1.00 41.89  ? 453  HOH B O   1 
HETATM 10214 O O   . HOH Q 5 .   ? 8.200   -4.190  69.316  1.00 39.32  ? 454  HOH B O   1 
HETATM 10215 O O   . HOH Q 5 .   ? 26.771  12.902  89.118  1.00 39.39  ? 455  HOH B O   1 
HETATM 10216 O O   . HOH Q 5 .   ? 14.957  -5.854  77.205  1.00 49.96  ? 456  HOH B O   1 
HETATM 10217 O O   . HOH Q 5 .   ? 21.046  -0.594  85.013  1.00 44.04  ? 457  HOH B O   1 
HETATM 10218 O O   . HOH Q 5 .   ? 31.442  -5.286  73.498  1.00 36.90  ? 458  HOH B O   1 
HETATM 10219 O O   . HOH Q 5 .   ? 6.183   -17.800 63.750  1.00 58.60  ? 459  HOH B O   1 
HETATM 10220 O O   . HOH Q 5 .   ? 40.580  19.197  73.673  1.00 45.59  ? 460  HOH B O   1 
HETATM 10221 O O   . HOH Q 5 .   ? 29.531  12.000  94.656  1.00 54.00  ? 461  HOH B O   1 
HETATM 10222 O O   . HOH Q 5 .   ? 26.908  6.797   97.996  1.00 25.45  ? 462  HOH B O   1 
HETATM 10223 O O   . HOH Q 5 .   ? 7.861   12.163  58.602  1.00 61.19  ? 463  HOH B O   1 
HETATM 10224 O O   . HOH Q 5 .   ? 12.811  8.600   87.869  1.00 38.89  ? 464  HOH B O   1 
HETATM 10225 O O   . HOH Q 5 .   ? 17.983  -12.894 63.275  1.00 50.97  ? 465  HOH B O   1 
HETATM 10226 O O   . HOH Q 5 .   ? 3.860   8.730   65.298  1.00 47.07  ? 466  HOH B O   1 
HETATM 10227 O O   . HOH Q 5 .   ? 34.167  16.703  87.485  1.00 47.00  ? 467  HOH B O   1 
HETATM 10228 O O   . HOH Q 5 .   ? 17.838  17.538  83.093  1.00 37.75  ? 468  HOH B O   1 
HETATM 10229 O O   . HOH Q 5 .   ? 42.271  -0.236  60.005  1.00 47.83  ? 469  HOH B O   1 
HETATM 10230 O O   . HOH Q 5 .   ? 33.747  12.244  57.975  1.00 52.37  ? 470  HOH B O   1 
HETATM 10231 O O   . HOH Q 5 .   ? 18.573  21.899  73.151  1.00 41.68  ? 471  HOH B O   1 
HETATM 10232 O O   . HOH Q 5 .   ? 44.810  -0.131  67.933  1.00 43.70  ? 472  HOH B O   1 
HETATM 10233 O O   . HOH Q 5 .   ? 47.410  12.460  84.294  1.00 41.06  ? 473  HOH B O   1 
HETATM 10234 O O   . HOH Q 5 .   ? 27.288  19.183  63.881  1.00 41.44  ? 474  HOH B O   1 
HETATM 10235 O O   . HOH Q 5 .   ? 18.226  -8.781  41.462  1.00 39.44  ? 475  HOH B O   1 
HETATM 10236 O O   . HOH Q 5 .   ? 28.211  -20.074 60.503  1.00 52.66  ? 476  HOH B O   1 
HETATM 10237 O O   . HOH Q 5 .   ? 23.473  -19.041 46.282  1.00 53.19  ? 477  HOH B O   1 
HETATM 10238 O O   . HOH Q 5 .   ? 17.475  13.370  56.416  1.00 43.41  ? 478  HOH B O   1 
HETATM 10239 O O   . HOH Q 5 .   ? 10.257  18.577  72.512  1.00 46.60  ? 479  HOH B O   1 
HETATM 10240 O O   . HOH Q 5 .   ? 12.043  -22.100 52.330  1.00 56.81  ? 480  HOH B O   1 
HETATM 10241 O O   . HOH Q 5 .   ? 15.222  -16.831 64.280  1.00 56.10  ? 481  HOH B O   1 
HETATM 10242 O O   . HOH Q 5 .   ? 31.557  -0.676  97.027  1.00 31.17  ? 482  HOH B O   1 
HETATM 10243 O O   . HOH Q 5 .   ? 40.391  1.889   83.725  1.00 51.01  ? 483  HOH B O   1 
HETATM 10244 O O   . HOH Q 5 .   ? 20.072  -21.428 42.778  1.00 55.61  ? 484  HOH B O   1 
HETATM 10245 O O   . HOH Q 5 .   ? 32.120  -8.225  87.504  1.00 43.22  ? 485  HOH B O   1 
HETATM 10246 O O   . HOH Q 5 .   ? 25.350  21.998  77.733  1.00 36.15  ? 486  HOH B O   1 
HETATM 10247 O O   . HOH Q 5 .   ? 9.747   -14.360 48.868  1.00 49.32  ? 487  HOH B O   1 
HETATM 10248 O O   . HOH Q 5 .   ? 29.868  -10.151 64.959  1.00 42.88  ? 488  HOH B O   1 
HETATM 10249 O O   . HOH Q 5 .   ? 45.699  3.042   82.002  1.00 39.57  ? 489  HOH B O   1 
HETATM 10250 O O   . HOH Q 5 .   ? 16.112  -6.517  79.593  1.00 62.29  ? 490  HOH B O   1 
HETATM 10251 O O   . HOH Q 5 .   ? 52.263  17.694  69.526  1.00 51.21  ? 491  HOH B O   1 
HETATM 10252 O O   . HOH Q 5 .   ? 9.058   6.273   85.920  1.00 55.27  ? 492  HOH B O   1 
HETATM 10253 O O   . HOH Q 5 .   ? 23.039  -5.787  75.408  1.00 50.45  ? 493  HOH B O   1 
HETATM 10254 O O   . HOH Q 5 .   ? 32.227  12.649  93.510  1.00 50.54  ? 494  HOH B O   1 
HETATM 10255 O O   . HOH Q 5 .   ? 7.801   12.012  61.415  1.00 61.79  ? 495  HOH B O   1 
HETATM 10256 O O   . HOH Q 5 .   ? 10.549  11.059  86.844  1.00 51.06  ? 496  HOH B O   1 
HETATM 10257 O O   . HOH Q 5 .   ? 12.478  -3.991  76.057  1.00 52.46  ? 497  HOH B O   1 
HETATM 10258 O O   . HOH Q 5 .   ? 12.571  2.933   80.188  1.00 45.28  ? 498  HOH B O   1 
HETATM 10259 O O   . HOH Q 5 .   ? 43.834  17.173  74.142  1.00 36.74  ? 499  HOH B O   1 
HETATM 10260 O O   . HOH Q 5 .   ? 13.215  12.807  61.217  1.00 54.76  ? 500  HOH B O   1 
HETATM 10261 O O   . HOH Q 5 .   ? 36.938  -5.348  57.086  1.00 41.99  ? 501  HOH B O   1 
HETATM 10262 O O   . HOH Q 5 .   ? 27.104  20.121  73.795  1.00 49.66  ? 502  HOH B O   1 
HETATM 10263 O O   . HOH Q 5 .   ? 32.913  -10.315 69.751  1.00 54.63  ? 503  HOH B O   1 
HETATM 10264 O O   . HOH Q 5 .   ? 17.416  21.521  76.977  1.00 51.57  ? 504  HOH B O   1 
HETATM 10265 O O   . HOH Q 5 .   ? 22.827  -21.102 43.912  1.00 60.04  ? 505  HOH B O   1 
HETATM 10266 O O   . HOH Q 5 .   ? 20.065  -22.491 59.718  1.00 66.39  ? 506  HOH B O   1 
HETATM 10267 O O   . HOH Q 5 .   ? 53.779  14.805  69.052  1.00 40.97  ? 507  HOH B O   1 
HETATM 10268 O O   . HOH Q 5 .   ? 16.541  1.863   82.151  1.00 30.99  ? 508  HOH B O   1 
HETATM 10269 O O   . HOH Q 5 .   ? 31.147  -9.799  62.279  1.00 54.18  ? 509  HOH B O   1 
HETATM 10270 O O   . HOH Q 5 .   ? 23.914  21.028  56.656  1.00 55.70  ? 511  HOH B O   1 
HETATM 10271 O O   . HOH Q 5 .   ? 25.259  -6.046  44.295  1.00 48.10  ? 512  HOH B O   1 
HETATM 10272 O O   . HOH Q 5 .   ? 48.245  9.227   61.084  1.00 58.08  ? 518  HOH B O   1 
HETATM 10273 O O   . HOH Q 5 .   ? 16.391  21.468  71.407  1.00 54.62  ? 523  HOH B O   1 
HETATM 10274 O O   . HOH Q 5 .   ? 48.171  13.475  77.356  1.00 66.04  ? 536  HOH B O   1 
HETATM 10275 O O   . HOH Q 5 .   ? 20.525  -4.178  72.483  1.00 55.12  ? 537  HOH B O   1 
HETATM 10276 O O   . HOH Q 5 .   ? 39.836  15.032  92.730  1.00 64.87  ? 539  HOH B O   1 
HETATM 10277 O O   . HOH Q 5 .   ? 29.015  -1.548  53.605  1.00 44.38  ? 541  HOH B O   1 
HETATM 10278 O O   . HOH Q 5 .   ? 47.117  5.032   74.970  1.00 47.38  ? 553  HOH B O   1 
HETATM 10279 O O   . HOH Q 5 .   ? 29.575  22.444  73.740  1.00 49.80  ? 558  HOH B O   1 
HETATM 10280 O O   . HOH Q 5 .   ? 35.035  20.871  78.708  1.00 45.73  ? 559  HOH B O   1 
HETATM 10281 O O   . HOH Q 5 .   ? 34.918  12.684  94.639  1.00 50.11  ? 562  HOH B O   1 
HETATM 10282 O O   . HOH Q 5 .   ? 34.941  1.435   50.736  1.00 53.21  ? 565  HOH B O   1 
HETATM 10283 O O   . HOH Q 5 .   ? 26.726  -3.880  99.198  1.00 62.84  ? 569  HOH B O   1 
HETATM 10284 O O   . HOH Q 5 .   ? 46.162  6.920   77.054  1.00 53.64  ? 571  HOH B O   1 
HETATM 10285 O O   . HOH Q 5 .   ? 20.885  6.891   75.354  1.00 23.82  ? 573  HOH B O   1 
HETATM 10286 O O   . HOH Q 5 .   ? 21.395  2.775   77.928  1.00 22.01  ? 575  HOH B O   1 
HETATM 10287 O O   . HOH Q 5 .   ? 5.230   -7.960  68.109  1.00 53.30  ? 578  HOH B O   1 
HETATM 10288 O O   . HOH Q 5 .   ? 21.295  5.541   77.777  1.00 28.18  ? 579  HOH B O   1 
HETATM 10289 O O   . HOH Q 5 .   ? 30.536  8.891   85.264  1.00 36.95  ? 591  HOH B O   1 
HETATM 10290 O O   . HOH Q 5 .   ? 5.499   15.198  62.107  1.00 47.96  ? 599  HOH B O   1 
HETATM 10291 O O   . HOH Q 5 .   ? 12.152  2.177   84.967  1.00 31.49  ? 602  HOH B O   1 
HETATM 10292 O O   . HOH Q 5 .   ? 26.610  12.944  60.908  1.00 38.35  ? 605  HOH B O   1 
HETATM 10293 O O   . HOH Q 5 .   ? 12.259  -3.319  71.110  1.00 32.19  ? 612  HOH B O   1 
HETATM 10294 O O   . HOH Q 5 .   ? 23.356  -23.994 41.612  1.00 48.05  ? 619  HOH B O   1 
HETATM 10295 O O   . HOH Q 5 .   ? 37.456  6.308   59.561  1.00 44.65  ? 621  HOH B O   1 
HETATM 10296 O O   . HOH Q 5 .   ? 22.980  18.340  65.205  1.00 38.21  ? 623  HOH B O   1 
HETATM 10297 O O   . HOH Q 5 .   ? 19.409  -24.051 54.810  1.00 55.48  ? 630  HOH B O   1 
HETATM 10298 O O   . HOH Q 5 .   ? 44.542  2.059   59.251  1.00 55.36  ? 632  HOH B O   1 
HETATM 10299 O O   . HOH Q 5 .   ? 33.297  1.313   95.990  1.00 49.25  ? 636  HOH B O   1 
HETATM 10300 O O   . HOH Q 5 .   ? 32.759  19.328  86.720  1.00 40.31  ? 640  HOH B O   1 
HETATM 10301 O O   . HOH Q 5 .   ? 7.134   -13.930 44.268  1.00 55.11  ? 654  HOH B O   1 
HETATM 10302 O O   . HOH Q 5 .   ? 40.594  8.159   91.884  1.00 42.62  ? 660  HOH B O   1 
HETATM 10303 O O   . HOH Q 5 .   ? 15.925  14.899  60.235  1.00 63.08  ? 663  HOH B O   1 
HETATM 10304 O O   . HOH Q 5 .   ? 47.574  6.240   60.171  1.00 68.42  ? 668  HOH B O   1 
HETATM 10305 O O   . HOH Q 5 .   ? 7.531   -10.086 41.734  1.00 39.35  ? 672  HOH B O   1 
HETATM 10306 O O   . HOH Q 5 .   ? 33.711  25.887  72.991  1.00 53.73  ? 674  HOH B O   1 
HETATM 10307 O O   . HOH Q 5 .   ? 10.695  -5.951  72.085  1.00 40.60  ? 678  HOH B O   1 
HETATM 10308 O O   . HOH Q 5 .   ? 11.647  6.660   86.458  1.00 50.55  ? 681  HOH B O   1 
HETATM 10309 O O   . HOH Q 5 .   ? 24.270  -7.347  86.348  1.00 55.69  ? 689  HOH B O   1 
HETATM 10310 O O   . HOH Q 5 .   ? 34.639  8.332   50.647  1.00 57.64  ? 690  HOH B O   1 
HETATM 10311 O O   . HOH Q 5 .   ? 39.758  22.748  80.071  1.00 58.88  ? 697  HOH B O   1 
HETATM 10312 O O   . HOH Q 5 .   ? 17.723  -26.066 62.285  1.00 59.69  ? 700  HOH B O   1 
HETATM 10313 O O   . HOH Q 5 .   ? 8.271   14.941  62.345  1.00 48.32  ? 701  HOH B O   1 
HETATM 10314 O O   . HOH Q 5 .   ? 5.968   -2.446  44.537  1.00 60.67  ? 705  HOH B O   1 
HETATM 10315 O O   . HOH Q 5 .   ? 8.596   -0.745  81.638  1.00 63.56  ? 706  HOH B O   1 
HETATM 10316 O O   . HOH Q 5 .   ? 34.901  24.284  69.551  1.00 54.45  ? 715  HOH B O   1 
HETATM 10317 O O   . HOH Q 5 .   ? 36.002  6.656   54.490  1.00 58.24  ? 719  HOH B O   1 
HETATM 10318 O O   . HOH Q 5 .   ? 18.585  2.213   78.264  1.00 36.37  ? 727  HOH B O   1 
HETATM 10319 O O   . HOH Q 5 .   ? 28.627  15.068  61.207  1.00 56.46  ? 728  HOH B O   1 
HETATM 10320 O O   . HOH Q 5 .   ? 37.683  20.753  80.047  1.00 56.79  ? 731  HOH B O   1 
HETATM 10321 O O   . HOH Q 5 .   ? 8.580   17.593  63.216  1.00 58.41  ? 732  HOH B O   1 
HETATM 10322 O O   . HOH Q 5 .   ? 38.599  -1.720  89.645  1.00 59.12  ? 735  HOH B O   1 
HETATM 10323 O O   . HOH Q 5 .   ? 39.139  24.321  77.958  1.00 60.62  ? 736  HOH B O   1 
HETATM 10324 O O   . HOH Q 5 .   ? 33.024  -8.752  93.540  1.00 52.26  ? 743  HOH B O   1 
HETATM 10325 O O   . HOH Q 5 .   ? 25.600  18.121  87.758  1.00 61.33  ? 745  HOH B O   1 
HETATM 10326 O O   . HOH Q 5 .   ? 6.238   8.786   62.080  1.00 54.32  ? 747  HOH B O   1 
HETATM 10327 O O   . HOH Q 5 .   ? 25.356  -25.388 39.278  1.00 56.09  ? 754  HOH B O   1 
HETATM 10328 O O   . HOH Q 5 .   ? 16.397  5.546   49.319  1.00 40.77  ? 761  HOH B O   1 
HETATM 10329 O O   . HOH Q 5 .   ? 20.630  -6.563  64.620  1.00 34.98  ? 766  HOH B O   1 
HETATM 10330 O O   . HOH Q 5 .   ? 46.452  8.423   91.464  1.00 65.10  ? 770  HOH B O   1 
HETATM 10331 O O   . HOH Q 5 .   ? 9.658   -14.011 68.416  1.00 47.63  ? 774  HOH B O   1 
HETATM 10332 O O   . HOH Q 5 .   ? 14.418  19.566  73.312  1.00 43.21  ? 775  HOH B O   1 
HETATM 10333 O O   . HOH Q 5 .   ? 6.376   6.495   82.961  1.00 51.35  ? 781  HOH B O   1 
HETATM 10334 O O   . HOH Q 5 .   ? 16.440  19.093  70.006  1.00 51.51  ? 784  HOH B O   1 
HETATM 10335 O O   . HOH Q 5 .   ? 24.712  -6.071  97.720  1.00 48.01  ? 794  HOH B O   1 
HETATM 10336 O O   . HOH Q 5 .   ? 23.041  -7.090  78.638  1.00 62.63  ? 795  HOH B O   1 
HETATM 10337 O O   . HOH Q 5 .   ? 24.111  20.311  67.298  1.00 44.63  ? 796  HOH B O   1 
HETATM 10338 O O   . HOH Q 5 .   ? 29.347  17.978  60.539  1.00 52.68  ? 800  HOH B O   1 
HETATM 10339 O O   . HOH Q 5 .   ? 47.131  7.938   88.678  1.00 58.80  ? 803  HOH B O   1 
HETATM 10340 O O   . HOH Q 5 .   ? 39.412  11.964  95.197  1.00 60.87  ? 806  HOH B O   1 
HETATM 10341 O O   . HOH Q 5 .   ? 35.662  14.352  57.999  1.00 61.71  ? 807  HOH B O   1 
HETATM 10342 O O   . HOH Q 5 .   ? 13.527  18.084  70.384  1.00 53.91  ? 810  HOH B O   1 
HETATM 10343 O O   . HOH Q 5 .   ? 47.654  0.292   78.513  1.00 58.29  ? 819  HOH B O   1 
HETATM 10344 O O   . HOH Q 5 .   ? 41.456  11.557  92.949  1.00 51.99  ? 826  HOH B O   1 
HETATM 10345 O O   . HOH Q 5 .   ? 20.665  15.637  54.386  1.00 41.20  ? 827  HOH B O   1 
HETATM 10346 O O   . HOH Q 5 .   ? 6.696   -27.827 56.176  1.00 66.76  ? 833  HOH B O   1 
HETATM 10347 O O   . HOH Q 5 .   ? 15.694  16.218  66.644  1.00 45.73  ? 838  HOH B O   1 
HETATM 10348 O O   . HOH Q 5 .   ? 39.881  -1.259  87.217  1.00 46.17  ? 845  HOH B O   1 
HETATM 10349 O O   . HOH Q 5 .   ? 41.345  -5.199  60.709  1.00 59.93  ? 858  HOH B O   1 
HETATM 10350 O O   . HOH Q 5 .   ? 44.428  3.752   91.046  1.00 60.69  ? 891  HOH B O   1 
HETATM 10351 O O   . HOH Q 5 .   ? 23.320  23.353  67.588  1.00 58.53  ? 897  HOH B O   1 
HETATM 10352 O O   . HOH Q 5 .   ? 27.475  8.921   94.819  1.00 57.79  ? 902  HOH B O   1 
HETATM 10353 O O   . HOH Q 5 .   ? 10.226  -14.845 44.792  1.00 51.22  ? 903  HOH B O   1 
HETATM 10354 O O   . HOH Q 5 .   ? 24.090  13.331  43.970  1.00 69.86  ? 906  HOH B O   1 
HETATM 10355 O O   . HOH Q 5 .   ? 33.193  22.238  82.389  1.00 50.36  ? 910  HOH B O   1 
HETATM 10356 O O   . HOH Q 5 .   ? 19.275  -25.895 64.492  1.00 66.24  ? 920  HOH B O   1 
HETATM 10357 O O   . HOH Q 5 .   ? 15.935  17.295  63.201  1.00 47.90  ? 924  HOH B O   1 
HETATM 10358 O O   . HOH Q 5 .   ? 14.822  16.422  84.053  1.00 59.00  ? 939  HOH B O   1 
HETATM 10359 O O   . HOH Q 5 .   ? 25.473  -20.738 61.129  1.00 62.62  ? 942  HOH B O   1 
HETATM 10360 O O   . HOH Q 5 .   ? 48.484  4.988   72.556  1.00 40.96  ? 943  HOH B O   1 
HETATM 10361 O O   . HOH Q 5 .   ? 56.713  17.278  67.044  1.00 62.15  ? 951  HOH B O   1 
HETATM 10362 O O   . HOH Q 5 .   ? 56.369  19.606  68.626  1.00 69.03  ? 963  HOH B O   1 
HETATM 10363 O O   . HOH Q 5 .   ? 6.959   11.763  77.447  1.00 44.88  ? 972  HOH B O   1 
HETATM 10364 O O   . HOH Q 5 .   ? 34.088  13.665  50.550  1.00 50.96  ? 974  HOH B O   1 
HETATM 10365 O O   . HOH Q 5 .   ? 31.365  20.281  83.454  1.00 55.42  ? 982  HOH B O   1 
HETATM 10366 O O   . HOH Q 5 .   ? 21.584  -4.966  82.099  1.00 51.09  ? 984  HOH B O   1 
HETATM 10367 O O   . HOH Q 5 .   ? 53.773  16.939  67.410  1.00 82.42  ? 989  HOH B O   1 
HETATM 10368 O O   . HOH Q 5 .   ? 31.272  14.304  50.680  1.00 54.85  ? 1000 HOH B O   1 
HETATM 10369 O O   . HOH Q 5 .   ? 7.964   -12.993 41.479  1.00 56.42  ? 1002 HOH B O   1 
HETATM 10370 O O   . HOH Q 5 .   ? 33.581  -5.582  80.321  1.00 51.89  ? 1025 HOH B O   1 
HETATM 10371 O O   . HOH R 5 .   ? -13.896 3.837   97.545  1.00 34.94  ? 369  HOH C O   1 
HETATM 10372 O O   . HOH R 5 .   ? -29.488 14.541  72.333  1.00 43.56  ? 370  HOH C O   1 
HETATM 10373 O O   . HOH R 5 .   ? -39.303 23.066  103.723 1.00 55.52  ? 371  HOH C O   1 
HETATM 10374 O O   . HOH R 5 .   ? -39.441 10.142  81.699  1.00 37.83  ? 372  HOH C O   1 
HETATM 10375 O O   . HOH R 5 .   ? -6.446  19.151  102.565 1.00 51.28  ? 373  HOH C O   1 
HETATM 10376 O O   . HOH R 5 .   ? -3.388  15.564  81.735  1.00 71.55  ? 374  HOH C O   1 
HETATM 10377 O O   . HOH R 5 .   ? -19.601 1.307   89.999  1.00 51.44  ? 375  HOH C O   1 
HETATM 10378 O O   . HOH R 5 .   ? -11.233 20.491  73.495  1.00 42.71  ? 376  HOH C O   1 
HETATM 10379 O O   . HOH R 5 .   ? -22.837 -5.601  100.745 1.00 51.82  ? 377  HOH C O   1 
HETATM 10380 O O   . HOH R 5 .   ? -38.294 12.126  80.239  1.00 47.15  ? 378  HOH C O   1 
HETATM 10381 O O   . HOH R 5 .   ? -14.868 20.634  85.760  1.00 22.95  ? 379  HOH C O   1 
HETATM 10382 O O   . HOH R 5 .   ? -13.541 8.731   91.335  1.00 34.69  ? 380  HOH C O   1 
HETATM 10383 O O   . HOH R 5 .   ? -39.494 10.601  89.684  1.00 29.31  ? 381  HOH C O   1 
HETATM 10384 O O   . HOH R 5 .   ? -16.154 4.668   84.800  1.00 34.11  ? 382  HOH C O   1 
HETATM 10385 O O   . HOH R 5 .   ? -15.525 16.122  85.518  1.00 22.20  ? 383  HOH C O   1 
HETATM 10386 O O   . HOH R 5 .   ? -1.842  23.162  90.218  1.00 28.21  ? 384  HOH C O   1 
HETATM 10387 O O   . HOH R 5 .   ? -26.658 17.187  108.117 1.00 54.66  ? 385  HOH C O   1 
HETATM 10388 O O   . HOH R 5 .   ? -21.066 22.189  69.722  1.00 51.04  ? 386  HOH C O   1 
HETATM 10389 O O   . HOH R 5 .   ? -26.213 14.720  107.250 1.00 32.50  ? 387  HOH C O   1 
HETATM 10390 O O   . HOH R 5 .   ? -4.341  28.165  88.028  1.00 40.59  ? 388  HOH C O   1 
HETATM 10391 O O   . HOH R 5 .   ? -1.697  20.625  89.227  1.00 37.70  ? 389  HOH C O   1 
HETATM 10392 O O   . HOH R 5 .   ? -34.748 12.045  77.751  1.00 32.25  ? 390  HOH C O   1 
HETATM 10393 O O   . HOH R 5 .   ? -26.689 7.460   88.383  1.00 29.31  ? 391  HOH C O   1 
HETATM 10394 O O   . HOH R 5 .   ? -25.084 4.053   88.349  1.00 34.10  ? 392  HOH C O   1 
HETATM 10395 O O   . HOH R 5 .   ? -5.316  28.832  91.855  1.00 36.56  ? 393  HOH C O   1 
HETATM 10396 O O   . HOH R 5 .   ? -15.271 25.184  89.378  1.00 27.43  ? 394  HOH C O   1 
HETATM 10397 O O   . HOH R 5 .   ? -25.287 22.781  83.064  1.00 43.27  ? 395  HOH C O   1 
HETATM 10398 O O   . HOH R 5 .   ? -41.993 12.306  92.828  1.00 39.89  ? 396  HOH C O   1 
HETATM 10399 O O   . HOH R 5 .   ? -30.099 9.585   72.026  1.00 49.63  ? 397  HOH C O   1 
HETATM 10400 O O   . HOH R 5 .   ? -8.088  27.429  93.838  1.00 47.91  ? 398  HOH C O   1 
HETATM 10401 O O   . HOH R 5 .   ? -17.251 24.174  78.520  1.00 52.50  ? 399  HOH C O   1 
HETATM 10402 O O   . HOH R 5 .   ? -15.672 4.484   81.833  1.00 62.70  ? 400  HOH C O   1 
HETATM 10403 O O   . HOH R 5 .   ? -26.016 5.747   112.240 1.00 47.15  ? 401  HOH C O   1 
HETATM 10404 O O   . HOH R 5 .   ? -9.372  12.026  86.518  1.00 63.88  ? 402  HOH C O   1 
HETATM 10405 O O   . HOH R 5 .   ? -22.517 30.011  89.980  1.00 28.33  ? 403  HOH C O   1 
HETATM 10406 O O   . HOH R 5 .   ? -40.690 12.870  90.379  1.00 51.01  ? 404  HOH C O   1 
HETATM 10407 O O   . HOH R 5 .   ? -19.163 31.069  92.932  1.00 32.05  ? 405  HOH C O   1 
HETATM 10408 O O   . HOH R 5 .   ? -5.695  29.213  86.001  1.00 39.61  ? 406  HOH C O   1 
HETATM 10409 O O   . HOH R 5 .   ? -34.025 4.816   103.201 1.00 41.44  ? 407  HOH C O   1 
HETATM 10410 O O   . HOH R 5 .   ? -39.585 4.593   80.688  1.00 50.75  ? 408  HOH C O   1 
HETATM 10411 O O   . HOH R 5 .   ? -35.391 22.178  105.265 1.00 31.14  ? 409  HOH C O   1 
HETATM 10412 O O   . HOH R 5 .   ? -26.261 30.509  76.947  1.00 43.13  ? 410  HOH C O   1 
HETATM 10413 O O   . HOH R 5 .   ? -21.831 29.497  92.660  1.00 34.47  ? 411  HOH C O   1 
HETATM 10414 O O   . HOH R 5 .   ? -7.000  10.901  87.909  1.00 52.37  ? 412  HOH C O   1 
HETATM 10415 O O   . HOH R 5 .   ? -5.564  23.841  99.675  1.00 43.09  ? 413  HOH C O   1 
HETATM 10416 O O   . HOH R 5 .   ? -3.012  22.735  82.858  1.00 46.65  ? 414  HOH C O   1 
HETATM 10417 O O   . HOH R 5 .   ? -36.792 6.558   104.725 1.00 49.98  ? 415  HOH C O   1 
HETATM 10418 O O   . HOH R 5 .   ? -41.469 13.439  96.098  1.00 44.51  ? 416  HOH C O   1 
HETATM 10419 O O   . HOH R 5 .   ? -22.616 25.265  76.356  1.00 48.46  ? 417  HOH C O   1 
HETATM 10420 O O   . HOH R 5 .   ? -21.908 23.442  83.308  1.00 40.44  ? 418  HOH C O   1 
HETATM 10421 O O   . HOH R 5 .   ? -28.700 10.267  109.413 1.00 51.80  ? 419  HOH C O   1 
HETATM 10422 O O   . HOH R 5 .   ? -4.760  23.299  75.795  1.00 61.51  ? 420  HOH C O   1 
HETATM 10423 O O   . HOH R 5 .   ? -20.299 25.514  84.010  1.00 36.99  ? 421  HOH C O   1 
HETATM 10424 O O   . HOH R 5 .   ? -20.062 19.330  104.040 1.00 54.95  ? 422  HOH C O   1 
HETATM 10425 O O   . HOH R 5 .   ? -30.059 2.943   84.894  1.00 51.50  ? 423  HOH C O   1 
HETATM 10426 O O   . HOH R 5 .   ? -16.193 21.411  72.136  1.00 54.67  ? 424  HOH C O   1 
HETATM 10427 O O   . HOH R 5 .   ? -40.554 8.879   98.268  1.00 44.05  ? 425  HOH C O   1 
HETATM 10428 O O   . HOH R 5 .   ? -20.531 9.458   86.678  1.00 23.75  ? 426  HOH C O   1 
HETATM 10429 O O   . HOH R 5 .   ? -7.226  21.485  82.972  1.00 30.36  ? 427  HOH C O   1 
HETATM 10430 O O   . HOH R 5 .   ? -24.165 14.829  105.257 1.00 25.06  ? 428  HOH C O   1 
HETATM 10431 O O   . HOH R 5 .   ? -18.670 10.508  85.010  1.00 24.23  ? 429  HOH C O   1 
HETATM 10432 O O   . HOH R 5 .   ? -15.283 16.912  88.139  1.00 23.62  ? 430  HOH C O   1 
HETATM 10433 O O   . HOH R 5 .   ? -1.221  27.605  88.006  1.00 45.44  ? 431  HOH C O   1 
HETATM 10434 O O   . HOH R 5 .   ? -8.878  20.716  87.632  1.00 26.08  ? 432  HOH C O   1 
HETATM 10435 O O   . HOH R 5 .   ? -32.646 22.419  106.376 1.00 40.92  ? 433  HOH C O   1 
HETATM 10436 O O   . HOH R 5 .   ? -14.235 24.272  97.135  1.00 24.91  ? 434  HOH C O   1 
HETATM 10437 O O   . HOH R 5 .   ? -15.570 13.272  84.881  1.00 25.83  ? 435  HOH C O   1 
HETATM 10438 O O   . HOH R 5 .   ? -7.251  28.242  84.011  1.00 24.99  ? 436  HOH C O   1 
HETATM 10439 O O   . HOH R 5 .   ? -23.975 28.462  93.947  1.00 30.81  ? 437  HOH C O   1 
HETATM 10440 O O   . HOH R 5 .   ? -14.520 22.638  78.462  1.00 30.45  ? 438  HOH C O   1 
HETATM 10441 O O   . HOH R 5 .   ? -41.715 15.755  78.026  1.00 50.35  ? 439  HOH C O   1 
HETATM 10442 O O   . HOH R 5 .   ? -23.203 13.289  103.204 1.00 28.40  ? 440  HOH C O   1 
HETATM 10443 O O   . HOH R 5 .   ? -25.719 19.767  79.607  1.00 25.16  ? 441  HOH C O   1 
HETATM 10444 O O   . HOH R 5 .   ? -14.430 -4.195  91.406  1.00 61.90  ? 442  HOH C O   1 
HETATM 10445 O O   . HOH R 5 .   ? -28.305 5.383   86.955  1.00 40.06  ? 443  HOH C O   1 
HETATM 10446 O O   . HOH R 5 .   ? -32.452 -4.492  91.620  1.00 33.15  ? 444  HOH C O   1 
HETATM 10447 O O   . HOH R 5 .   ? -13.750 31.301  93.037  1.00 34.07  ? 445  HOH C O   1 
HETATM 10448 O O   . HOH R 5 .   ? -1.420  2.628   105.494 1.00 43.84  ? 446  HOH C O   1 
HETATM 10449 O O   . HOH R 5 .   ? -37.747 7.063   95.632  1.00 34.08  ? 447  HOH C O   1 
HETATM 10450 O O   . HOH R 5 .   ? -19.508 4.982   67.422  1.00 40.64  ? 448  HOH C O   1 
HETATM 10451 O O   . HOH R 5 .   ? -13.759 1.565   95.163  1.00 37.21  ? 449  HOH C O   1 
HETATM 10452 O O   . HOH R 5 .   ? -3.965  19.322  89.497  1.00 44.76  ? 450  HOH C O   1 
HETATM 10453 O O   . HOH R 5 .   ? -4.524  13.704  91.108  1.00 44.83  ? 451  HOH C O   1 
HETATM 10454 O O   . HOH R 5 .   ? -6.763  9.937   81.991  1.00 49.92  ? 452  HOH C O   1 
HETATM 10455 O O   . HOH R 5 .   ? -15.756 12.046  117.440 1.00 59.62  ? 453  HOH C O   1 
HETATM 10456 O O   . HOH R 5 .   ? -28.674 30.568  80.524  1.00 39.05  ? 454  HOH C O   1 
HETATM 10457 O O   . HOH R 5 .   ? -11.678 29.601  85.515  1.00 27.76  ? 455  HOH C O   1 
HETATM 10458 O O   . HOH R 5 .   ? -28.821 31.088  77.807  1.00 55.76  ? 456  HOH C O   1 
HETATM 10459 O O   . HOH R 5 .   ? -27.206 21.903  81.345  1.00 52.99  ? 457  HOH C O   1 
HETATM 10460 O O   . HOH R 5 .   ? -4.928  27.678  80.831  1.00 49.64  ? 458  HOH C O   1 
HETATM 10461 O O   . HOH R 5 .   ? -44.082 21.977  92.685  1.00 32.61  ? 459  HOH C O   1 
HETATM 10462 O O   . HOH R 5 .   ? -31.999 14.983  72.390  1.00 36.87  ? 460  HOH C O   1 
HETATM 10463 O O   . HOH R 5 .   ? -1.123  24.923  88.134  1.00 42.97  ? 461  HOH C O   1 
HETATM 10464 O O   . HOH R 5 .   ? 2.002   -5.608  103.805 1.00 47.08  ? 462  HOH C O   1 
HETATM 10465 O O   . HOH R 5 .   ? -16.582 4.407   89.273  1.00 38.46  ? 463  HOH C O   1 
HETATM 10466 O O   . HOH R 5 .   ? -34.248 9.446   76.331  1.00 50.64  ? 464  HOH C O   1 
HETATM 10467 O O   . HOH R 5 .   ? -30.194 28.234  78.947  1.00 56.35  ? 465  HOH C O   1 
HETATM 10468 O O   . HOH R 5 .   ? -25.222 3.384   84.586  1.00 54.33  ? 466  HOH C O   1 
HETATM 10469 O O   . HOH R 5 .   ? -11.219 14.705  82.451  1.00 39.06  ? 467  HOH C O   1 
HETATM 10470 O O   . HOH R 5 .   ? -14.107 28.869  82.619  1.00 26.34  ? 468  HOH C O   1 
HETATM 10471 O O   . HOH R 5 .   ? -19.513 29.833  82.870  1.00 38.48  ? 469  HOH C O   1 
HETATM 10472 O O   . HOH R 5 .   ? -34.358 28.890  95.422  1.00 48.34  ? 470  HOH C O   1 
HETATM 10473 O O   . HOH R 5 .   ? -2.051  0.083   106.326 1.00 50.26  ? 471  HOH C O   1 
HETATM 10474 O O   . HOH R 5 .   ? -20.207 9.850   108.977 1.00 51.38  ? 472  HOH C O   1 
HETATM 10475 O O   . HOH R 5 .   ? -20.909 31.937  89.050  1.00 25.37  ? 473  HOH C O   1 
HETATM 10476 O O   . HOH R 5 .   ? -39.672 -0.954  94.886  1.00 57.77  ? 474  HOH C O   1 
HETATM 10477 O O   . HOH R 5 .   ? -11.575 -12.599 112.716 1.00 67.75  ? 475  HOH C O   1 
HETATM 10478 O O   . HOH R 5 .   ? -27.103 30.510  84.005  1.00 45.36  ? 476  HOH C O   1 
HETATM 10479 O O   . HOH R 5 .   ? -9.725  29.101  92.292  1.00 40.58  ? 477  HOH C O   1 
HETATM 10480 O O   . HOH R 5 .   ? -38.715 24.947  93.570  1.00 30.91  ? 478  HOH C O   1 
HETATM 10481 O O   . HOH R 5 .   ? -2.801  15.782  104.313 1.00 56.68  ? 479  HOH C O   1 
HETATM 10482 O O   . HOH R 5 .   ? -7.884  18.572  107.203 1.00 55.44  ? 480  HOH C O   1 
HETATM 10483 O O   . HOH R 5 .   ? -12.845 24.135  90.559  1.00 23.31  ? 481  HOH C O   1 
HETATM 10484 O O   . HOH R 5 .   ? -28.131 31.144  91.737  1.00 31.23  ? 482  HOH C O   1 
HETATM 10485 O O   . HOH R 5 .   ? -12.832 13.159  84.612  1.00 36.80  ? 483  HOH C O   1 
HETATM 10486 O O   . HOH R 5 .   ? -27.878 4.455   84.216  1.00 58.02  ? 484  HOH C O   1 
HETATM 10487 O O   . HOH R 5 .   ? -25.451 -2.133  90.904  1.00 50.93  ? 485  HOH C O   1 
HETATM 10488 O O   . HOH R 5 .   ? -1.569  23.611  85.894  1.00 36.86  ? 486  HOH C O   1 
HETATM 10489 O O   . HOH R 5 .   ? -6.658  25.682  76.047  1.00 52.98  ? 487  HOH C O   1 
HETATM 10490 O O   . HOH R 5 .   ? -24.602 8.575   112.199 1.00 43.76  ? 488  HOH C O   1 
HETATM 10491 O O   . HOH R 5 .   ? -28.870 -0.294  104.056 1.00 44.39  ? 489  HOH C O   1 
HETATM 10492 O O   . HOH R 5 .   ? -25.839 20.104  105.251 1.00 39.71  ? 490  HOH C O   1 
HETATM 10493 O O   . HOH R 5 .   ? -36.700 22.836  103.038 1.00 42.46  ? 491  HOH C O   1 
HETATM 10494 O O   . HOH R 5 .   ? -22.429 15.600  66.859  1.00 53.47  ? 492  HOH C O   1 
HETATM 10495 O O   . HOH R 5 .   ? 0.774   23.512  93.796  1.00 53.89  ? 493  HOH C O   1 
HETATM 10496 O O   . HOH R 5 .   ? -10.127 22.067  104.509 1.00 69.69  ? 494  HOH C O   1 
HETATM 10497 O O   . HOH R 5 .   ? -28.551 6.157   80.858  1.00 58.78  ? 495  HOH C O   1 
HETATM 10498 O O   . HOH R 5 .   ? -33.339 20.445  108.354 1.00 59.41  ? 500  HOH C O   1 
HETATM 10499 O O   . HOH R 5 .   ? -40.058 27.236  97.166  1.00 51.52  ? 510  HOH C O   1 
HETATM 10500 O O   . HOH R 5 .   ? -16.817 28.671  81.487  1.00 46.21  ? 515  HOH C O   1 
HETATM 10501 O O   . HOH R 5 .   ? -40.009 15.222  88.594  1.00 48.93  ? 528  HOH C O   1 
HETATM 10502 O O   . HOH R 5 .   ? -17.774 26.981  79.448  1.00 57.24  ? 532  HOH C O   1 
HETATM 10503 O O   . HOH R 5 .   ? -4.977  10.924  94.276  1.00 51.76  ? 533  HOH C O   1 
HETATM 10504 O O   . HOH R 5 .   ? -37.518 26.020  74.814  1.00 47.03  ? 534  HOH C O   1 
HETATM 10505 O O   . HOH R 5 .   ? -32.435 8.266   109.841 1.00 58.58  ? 540  HOH C O   1 
HETATM 10506 O O   . HOH R 5 .   ? -2.138  15.711  90.372  1.00 56.86  ? 542  HOH C O   1 
HETATM 10507 O O   . HOH R 5 .   ? -40.865 21.019  81.083  1.00 50.38  ? 548  HOH C O   1 
HETATM 10508 O O   . HOH R 5 .   ? -19.957 23.371  67.051  1.00 59.65  ? 552  HOH C O   1 
HETATM 10509 O O   . HOH R 5 .   ? -14.193 27.420  103.193 1.00 60.87  ? 561  HOH C O   1 
HETATM 10510 O O   . HOH R 5 .   ? -5.729  17.079  100.982 1.00 49.60  ? 567  HOH C O   1 
HETATM 10511 O O   . HOH R 5 .   ? -30.771 13.725  103.300 1.00 34.63  ? 574  HOH C O   1 
HETATM 10512 O O   . HOH R 5 .   ? -14.257 -12.301 108.280 1.00 49.36  ? 582  HOH C O   1 
HETATM 10513 O O   . HOH R 5 .   ? -30.194 11.673  105.073 1.00 33.27  ? 590  HOH C O   1 
HETATM 10514 O O   . HOH R 5 .   ? -1.812  13.201  96.865  1.00 53.57  ? 596  HOH C O   1 
HETATM 10515 O O   . HOH R 5 .   ? -28.648 12.604  107.353 1.00 41.42  ? 597  HOH C O   1 
HETATM 10516 O O   . HOH R 5 .   ? -20.756 25.990  102.229 1.00 37.61  ? 607  HOH C O   1 
HETATM 10517 O O   . HOH R 5 .   ? -2.231  16.894  85.690  1.00 56.26  ? 615  HOH C O   1 
HETATM 10518 O O   . HOH R 5 .   ? -25.186 3.588   71.072  1.00 50.36  ? 616  HOH C O   1 
HETATM 10519 O O   . HOH R 5 .   ? -10.895 -15.671 111.230 1.00 65.42  ? 620  HOH C O   1 
HETATM 10520 O O   . HOH R 5 .   ? -18.607 1.046   92.631  1.00 53.19  ? 624  HOH C O   1 
HETATM 10521 O O   . HOH R 5 .   ? -11.077 28.253  95.224  1.00 41.96  ? 625  HOH C O   1 
HETATM 10522 O O   . HOH R 5 .   ? -35.200 12.209  80.478  1.00 43.96  ? 626  HOH C O   1 
HETATM 10523 O O   . HOH R 5 .   ? -36.420 19.934  73.789  1.00 41.23  ? 627  HOH C O   1 
HETATM 10524 O O   . HOH R 5 .   ? -26.810 17.691  69.587  1.00 44.76  ? 629  HOH C O   1 
HETATM 10525 O O   . HOH R 5 .   ? -20.250 -11.395 112.009 1.00 66.98  ? 638  HOH C O   1 
HETATM 10526 O O   . HOH R 5 .   ? -14.780 -20.181 116.652 1.00 59.35  ? 650  HOH C O   1 
HETATM 10527 O O   . HOH R 5 .   ? -26.565 3.823   73.658  1.00 50.56  ? 651  HOH C O   1 
HETATM 10528 O O   . HOH R 5 .   ? -17.997 10.232  65.814  1.00 57.22  ? 653  HOH C O   1 
HETATM 10529 O O   . HOH R 5 .   ? -17.431 9.008   107.334 1.00 46.89  ? 656  HOH C O   1 
HETATM 10530 O O   . HOH R 5 .   ? 0.350   -9.179  112.540 1.00 60.46  ? 657  HOH C O   1 
HETATM 10531 O O   . HOH R 5 .   ? -35.221 1.179   104.469 1.00 55.27  ? 658  HOH C O   1 
HETATM 10532 O O   . HOH R 5 .   ? -37.286 33.212  94.122  1.00 48.37  ? 664  HOH C O   1 
HETATM 10533 O O   . HOH R 5 .   ? -24.278 22.624  105.508 1.00 49.75  ? 665  HOH C O   1 
HETATM 10534 O O   . HOH R 5 .   ? -1.615  30.890  91.912  1.00 63.97  ? 666  HOH C O   1 
HETATM 10535 O O   . HOH R 5 .   ? -0.068  25.041  83.983  1.00 57.99  ? 673  HOH C O   1 
HETATM 10536 O O   . HOH R 5 .   ? -16.032 15.372  117.134 1.00 58.36  ? 676  HOH C O   1 
HETATM 10537 O O   . HOH R 5 .   ? -11.996 -3.733  112.338 1.00 56.39  ? 677  HOH C O   1 
HETATM 10538 O O   . HOH R 5 .   ? 0.588   27.044  97.347  1.00 38.00  ? 684  HOH C O   1 
HETATM 10539 O O   . HOH R 5 .   ? -28.007 26.749  102.783 1.00 53.04  ? 692  HOH C O   1 
HETATM 10540 O O   . HOH R 5 .   ? -39.997 32.460  95.599  1.00 59.37  ? 695  HOH C O   1 
HETATM 10541 O O   . HOH R 5 .   ? -9.145  24.867  74.640  1.00 50.92  ? 702  HOH C O   1 
HETATM 10542 O O   . HOH R 5 .   ? -21.436 10.228  112.371 1.00 57.91  ? 709  HOH C O   1 
HETATM 10543 O O   . HOH R 5 .   ? -41.096 24.060  92.587  1.00 73.28  ? 711  HOH C O   1 
HETATM 10544 O O   . HOH R 5 .   ? -6.160  -2.422  95.307  1.00 65.29  ? 714  HOH C O   1 
HETATM 10545 O O   . HOH R 5 .   ? -39.861 7.576   78.188  1.00 51.44  ? 720  HOH C O   1 
HETATM 10546 O O   . HOH R 5 .   ? -12.494 30.976  82.248  1.00 67.87  ? 730  HOH C O   1 
HETATM 10547 O O   . HOH R 5 .   ? -39.211 -2.250  97.199  1.00 69.66  ? 746  HOH C O   1 
HETATM 10548 O O   . HOH R 5 .   ? -12.374 24.395  104.417 1.00 73.06  ? 749  HOH C O   1 
HETATM 10549 O O   . HOH R 5 .   ? -23.651 21.680  70.203  1.00 42.26  ? 751  HOH C O   1 
HETATM 10550 O O   . HOH R 5 .   ? -24.124 25.284  71.607  1.00 53.40  ? 755  HOH C O   1 
HETATM 10551 O O   . HOH R 5 .   ? -7.328  20.726  105.416 1.00 56.26  ? 756  HOH C O   1 
HETATM 10552 O O   . HOH R 5 .   ? -19.152 28.160  99.716  1.00 34.94  ? 758  HOH C O   1 
HETATM 10553 O O   . HOH R 5 .   ? -8.940  27.668  75.358  1.00 53.52  ? 768  HOH C O   1 
HETATM 10554 O O   . HOH R 5 .   ? -0.717  13.530  92.536  1.00 59.83  ? 782  HOH C O   1 
HETATM 10555 O O   . HOH R 5 .   ? -31.845 5.115   81.388  1.00 45.49  ? 783  HOH C O   1 
HETATM 10556 O O   . HOH R 5 .   ? -47.766 20.175  84.935  1.00 80.74  ? 788  HOH C O   1 
HETATM 10557 O O   . HOH R 5 .   ? 1.706   18.967  98.312  1.00 50.38  ? 791  HOH C O   1 
HETATM 10558 O O   . HOH R 5 .   ? -4.765  11.932  86.112  1.00 56.94  ? 792  HOH C O   1 
HETATM 10559 O O   . HOH R 5 .   ? -18.555 5.600   73.620  1.00 45.32  ? 797  HOH C O   1 
HETATM 10560 O O   . HOH R 5 .   ? -25.673 19.963  68.531  1.00 60.08  ? 804  HOH C O   1 
HETATM 10561 O O   . HOH R 5 .   ? -39.191 18.345  73.683  1.00 51.99  ? 808  HOH C O   1 
HETATM 10562 O O   . HOH R 5 .   ? -17.650 21.368  119.392 1.00 52.16  ? 812  HOH C O   1 
HETATM 10563 O O   . HOH R 5 .   ? -13.529 32.216  96.355  1.00 52.21  ? 820  HOH C O   1 
HETATM 10564 O O   . HOH R 5 .   ? -33.931 10.334  73.631  1.00 59.82  ? 823  HOH C O   1 
HETATM 10565 O O   . HOH R 5 .   ? -11.965 27.776  76.184  1.00 46.84  ? 837  HOH C O   1 
HETATM 10566 O O   . HOH R 5 .   ? -15.735 -8.481  81.880  1.00 54.77  ? 839  HOH C O   1 
HETATM 10567 O O   . HOH R 5 .   ? -35.819 -1.587  97.029  1.00 55.67  ? 841  HOH C O   1 
HETATM 10568 O O   . HOH R 5 .   ? -30.235 29.943  74.558  1.00 57.38  ? 850  HOH C O   1 
HETATM 10569 O O   . HOH R 5 .   ? -48.627 20.880  87.682  1.00 56.11  ? 866  HOH C O   1 
HETATM 10570 O O   . HOH R 5 .   ? -35.141 -4.358  101.072 1.00 65.77  ? 869  HOH C O   1 
HETATM 10571 O O   . HOH R 5 .   ? -1.679  5.375   105.578 1.00 53.75  ? 876  HOH C O   1 
HETATM 10572 O O   . HOH R 5 .   ? -17.728 23.644  74.960  1.00 53.00  ? 882  HOH C O   1 
HETATM 10573 O O   . HOH R 5 .   ? -28.454 21.589  104.063 1.00 46.46  ? 896  HOH C O   1 
HETATM 10574 O O   . HOH R 5 .   ? -35.393 -1.124  99.679  1.00 64.52  ? 921  HOH C O   1 
HETATM 10575 O O   . HOH R 5 .   ? -33.970 22.865  70.759  1.00 55.49  ? 927  HOH C O   1 
HETATM 10576 O O   . HOH R 5 .   ? -34.346 18.890  72.407  1.00 47.90  ? 941  HOH C O   1 
HETATM 10577 O O   . HOH R 5 .   ? -39.986 -3.335  93.594  1.00 70.48  ? 946  HOH C O   1 
HETATM 10578 O O   . HOH R 5 .   ? -40.694 13.133  105.151 1.00 45.88  ? 947  HOH C O   1 
HETATM 10579 O O   . HOH R 5 .   ? -36.364 25.389  103.552 1.00 55.54  ? 948  HOH C O   1 
HETATM 10580 O O   . HOH R 5 .   ? -11.535 23.589  75.261  1.00 51.02  ? 952  HOH C O   1 
HETATM 10581 O O   . HOH R 5 .   ? -21.815 1.283   107.005 1.00 50.58  ? 962  HOH C O   1 
HETATM 10582 O O   . HOH R 5 .   ? -40.036 25.449  105.406 1.00 62.07  ? 966  HOH C O   1 
HETATM 10583 O O   . HOH R 5 .   ? -12.318 31.268  99.339  1.00 58.17  ? 970  HOH C O   1 
HETATM 10584 O O   . HOH R 5 .   ? -44.470 23.695  102.276 1.00 36.91  ? 981  HOH C O   1 
HETATM 10585 O O   . HOH R 5 .   ? -10.606 28.979  99.385  1.00 52.25  ? 992  HOH C O   1 
HETATM 10586 O O   . HOH R 5 .   ? -7.737  17.340  110.844 1.00 56.85  ? 999  HOH C O   1 
HETATM 10587 O O   . HOH R 5 .   ? -42.219 15.111  104.210 1.00 60.00  ? 1007 HOH C O   1 
HETATM 10588 O O   . HOH R 5 .   ? -0.609  -9.854  103.571 1.00 49.22  ? 1013 HOH C O   1 
HETATM 10589 O O   . HOH R 5 .   ? -7.762  31.728  86.197  1.00 49.24  ? 1014 HOH C O   1 
HETATM 10590 O O   . HOH R 5 .   ? -33.723 27.684  100.931 1.00 47.52  ? 1015 HOH C O   1 
HETATM 10591 O O   . HOH R 5 .   ? -21.707 -1.133  93.557  1.00 55.32  ? 1018 HOH C O   1 
HETATM 10592 O O   . HOH R 5 .   ? -11.474 18.697  107.965 1.00 59.83  ? 1021 HOH C O   1 
HETATM 10593 O O   . HOH S 5 .   ? -21.996 8.402   49.471  1.00 40.15  ? 366  HOH D O   1 
HETATM 10594 O O   . HOH S 5 .   ? -11.676 7.017   61.328  1.00 28.77  ? 367  HOH D O   1 
HETATM 10595 O O   . HOH S 5 .   ? 5.919   0.021   55.838  1.00 20.44  ? 368  HOH D O   1 
HETATM 10596 O O   . HOH S 5 .   ? -13.969 13.856  71.165  1.00 58.65  ? 369  HOH D O   1 
HETATM 10597 O O   . HOH S 5 .   ? -20.629 -4.901  60.901  1.00 37.30  ? 370  HOH D O   1 
HETATM 10598 O O   . HOH S 5 .   ? -13.708 -11.371 70.216  1.00 42.10  ? 371  HOH D O   1 
HETATM 10599 O O   . HOH S 5 .   ? -0.415  3.988   66.625  1.00 55.66  ? 372  HOH D O   1 
HETATM 10600 O O   . HOH S 5 .   ? -13.766 15.978  63.383  1.00 47.29  ? 373  HOH D O   1 
HETATM 10601 O O   . HOH S 5 .   ? 4.256   -7.572  54.118  1.00 32.62  ? 374  HOH D O   1 
HETATM 10602 O O   . HOH S 5 .   ? 4.709   -5.913  61.701  1.00 57.12  ? 375  HOH D O   1 
HETATM 10603 O O   . HOH S 5 .   ? -9.837  9.428   75.098  1.00 64.37  ? 376  HOH D O   1 
HETATM 10604 O O   . HOH S 5 .   ? 5.093   -0.977  68.863  1.00 56.26  ? 377  HOH D O   1 
HETATM 10605 O O   . HOH S 5 .   ? -26.287 0.086   41.282  1.00 52.03  ? 378  HOH D O   1 
HETATM 10606 O O   . HOH S 5 .   ? -20.979 -8.312  67.208  1.00 51.62  ? 379  HOH D O   1 
HETATM 10607 O O   . HOH S 5 .   ? -10.468 -6.067  74.808  1.00 53.88  ? 380  HOH D O   1 
HETATM 10608 O O   . HOH S 5 .   ? 0.345   1.417   61.549  1.00 42.52  ? 381  HOH D O   1 
HETATM 10609 O O   . HOH S 5 .   ? -3.555  11.526  71.786  1.00 34.76  ? 382  HOH D O   1 
HETATM 10610 O O   . HOH S 5 .   ? -7.646  0.576   42.197  1.00 56.53  ? 383  HOH D O   1 
HETATM 10611 O O   . HOH S 5 .   ? -5.458  -18.398 67.042  1.00 44.83  ? 384  HOH D O   1 
HETATM 10612 O O   . HOH S 5 .   ? -14.031 -1.699  43.793  1.00 31.18  ? 385  HOH D O   1 
HETATM 10613 O O   . HOH S 5 .   ? -9.078  -25.397 43.076  1.00 59.97  ? 386  HOH D O   1 
HETATM 10614 O O   . HOH S 5 .   ? -2.347  -3.219  62.585  1.00 40.80  ? 387  HOH D O   1 
HETATM 10615 O O   . HOH S 5 .   ? -20.288 7.661   64.920  1.00 53.33  ? 388  HOH D O   1 
HETATM 10616 O O   . HOH S 5 .   ? -11.716 -20.437 66.492  1.00 48.13  ? 389  HOH D O   1 
HETATM 10617 O O   . HOH S 5 .   ? 0.916   19.926  55.942  1.00 40.39  ? 390  HOH D O   1 
HETATM 10618 O O   . HOH S 5 .   ? 0.213   8.859   46.754  1.00 49.52  ? 391  HOH D O   1 
HETATM 10619 O O   . HOH S 5 .   ? -2.599  14.658  61.902  1.00 20.34  ? 392  HOH D O   1 
HETATM 10620 O O   . HOH S 5 .   ? -1.316  8.447   54.699  1.00 24.71  ? 393  HOH D O   1 
HETATM 10621 O O   . HOH S 5 .   ? -8.422  19.269  54.668  1.00 44.85  ? 394  HOH D O   1 
HETATM 10622 O O   . HOH S 5 .   ? -2.621  -17.211 53.480  1.00 43.71  ? 395  HOH D O   1 
HETATM 10623 O O   . HOH S 5 .   ? -12.729 -3.363  41.714  1.00 34.23  ? 396  HOH D O   1 
HETATM 10624 O O   . HOH S 5 .   ? 3.666   16.355  67.048  1.00 57.29  ? 397  HOH D O   1 
HETATM 10625 O O   . HOH S 5 .   ? -13.737 1.458   31.493  1.00 67.94  ? 398  HOH D O   1 
HETATM 10626 O O   . HOH S 5 .   ? 1.727   -12.327 63.978  1.00 56.93  ? 399  HOH D O   1 
HETATM 10627 O O   . HOH S 5 .   ? -1.481  -14.602 52.848  1.00 33.58  ? 400  HOH D O   1 
HETATM 10628 O O   . HOH S 5 .   ? -8.234  10.127  37.594  1.00 53.39  ? 401  HOH D O   1 
HETATM 10629 O O   . HOH S 5 .   ? -27.028 1.465   55.133  1.00 53.30  ? 402  HOH D O   1 
HETATM 10630 O O   . HOH S 5 .   ? -2.608  -0.355  75.765  1.00 39.32  ? 403  HOH D O   1 
HETATM 10631 O O   . HOH S 5 .   ? -14.600 -15.387 68.659  1.00 58.04  ? 404  HOH D O   1 
HETATM 10632 O O   . HOH S 5 .   ? -0.027  7.614   71.969  1.00 57.38  ? 405  HOH D O   1 
HETATM 10633 O O   . HOH S 5 .   ? -16.713 -16.597 66.776  1.00 49.31  ? 406  HOH D O   1 
HETATM 10634 O O   . HOH S 5 .   ? -18.227 3.001   39.247  1.00 60.43  ? 407  HOH D O   1 
HETATM 10635 O O   . HOH S 5 .   ? -21.553 -16.031 68.115  1.00 49.52  ? 408  HOH D O   1 
HETATM 10636 O O   . HOH S 5 .   ? -27.873 -1.139  58.052  1.00 58.95  ? 409  HOH D O   1 
HETATM 10637 O O   . HOH S 5 .   ? -2.476  6.705   73.547  1.00 48.38  ? 410  HOH D O   1 
HETATM 10638 O O   . HOH S 5 .   ? 4.114   1.970   67.062  1.00 62.32  ? 411  HOH D O   1 
HETATM 10639 O O   . HOH S 5 .   ? -18.866 -6.234  34.974  1.00 62.30  ? 412  HOH D O   1 
HETATM 10640 O O   . HOH S 5 .   ? -3.996  4.207   63.447  1.00 28.91  ? 413  HOH D O   1 
HETATM 10641 O O   . HOH S 5 .   ? -2.030  6.559   48.250  1.00 24.29  ? 414  HOH D O   1 
HETATM 10642 O O   . HOH S 5 .   ? -13.559 16.255  72.575  1.00 33.75  ? 415  HOH D O   1 
HETATM 10643 O O   . HOH S 5 .   ? -4.046  12.496  57.559  1.00 27.38  ? 416  HOH D O   1 
HETATM 10644 O O   . HOH S 5 .   ? -7.508  9.431   73.118  1.00 25.48  ? 417  HOH D O   1 
HETATM 10645 O O   . HOH S 5 .   ? -14.613 4.120   61.769  1.00 28.73  ? 418  HOH D O   1 
HETATM 10646 O O   . HOH S 5 .   ? -16.071 2.394   60.621  1.00 34.52  ? 419  HOH D O   1 
HETATM 10647 O O   . HOH S 5 .   ? -0.385  5.901   55.897  1.00 22.00  ? 420  HOH D O   1 
HETATM 10648 O O   . HOH S 5 .   ? -0.263  20.071  58.445  1.00 40.32  ? 421  HOH D O   1 
HETATM 10649 O O   . HOH S 5 .   ? -4.395  7.170   59.839  1.00 24.49  ? 422  HOH D O   1 
HETATM 10650 O O   . HOH S 5 .   ? -24.425 19.410  38.632  1.00 52.60  ? 423  HOH D O   1 
HETATM 10651 O O   . HOH S 5 .   ? 4.964   9.601   59.043  1.00 32.91  ? 424  HOH D O   1 
HETATM 10652 O O   . HOH S 5 .   ? -1.724  7.592   66.854  1.00 32.13  ? 425  HOH D O   1 
HETATM 10653 O O   . HOH S 5 .   ? 4.892   -7.177  65.246  1.00 32.90  ? 426  HOH D O   1 
HETATM 10654 O O   . HOH S 5 .   ? 5.741   6.897   51.619  1.00 24.69  ? 427  HOH D O   1 
HETATM 10655 O O   . HOH S 5 .   ? 3.692   15.511  52.140  1.00 39.58  ? 428  HOH D O   1 
HETATM 10656 O O   . HOH S 5 .   ? 3.754   14.363  60.358  1.00 25.09  ? 429  HOH D O   1 
HETATM 10657 O O   . HOH S 5 .   ? -20.185 7.616   62.154  1.00 46.44  ? 430  HOH D O   1 
HETATM 10658 O O   . HOH S 5 .   ? -1.288  19.802  53.944  1.00 39.98  ? 431  HOH D O   1 
HETATM 10659 O O   . HOH S 5 .   ? 2.464   -10.795 68.274  1.00 48.52  ? 432  HOH D O   1 
HETATM 10660 O O   . HOH S 5 .   ? 3.116   -1.178  52.778  1.00 26.24  ? 433  HOH D O   1 
HETATM 10661 O O   . HOH S 5 .   ? -8.653  0.570   79.601  1.00 38.14  ? 434  HOH D O   1 
HETATM 10662 O O   . HOH S 5 .   ? 4.119   7.160   62.236  1.00 37.89  ? 435  HOH D O   1 
HETATM 10663 O O   . HOH S 5 .   ? 2.592   -8.294  67.011  1.00 43.61  ? 436  HOH D O   1 
HETATM 10664 O O   . HOH S 5 .   ? 5.046   3.224   49.092  1.00 39.70  ? 437  HOH D O   1 
HETATM 10665 O O   . HOH S 5 .   ? -0.884  -0.503  43.283  1.00 40.10  ? 438  HOH D O   1 
HETATM 10666 O O   . HOH S 5 .   ? -16.188 -0.827  31.758  1.00 61.61  ? 439  HOH D O   1 
HETATM 10667 O O   . HOH S 5 .   ? -5.100  -16.382 44.090  1.00 38.96  ? 440  HOH D O   1 
HETATM 10668 O O   . HOH S 5 .   ? -4.694  18.635  55.395  1.00 41.11  ? 441  HOH D O   1 
HETATM 10669 O O   . HOH S 5 .   ? -21.007 -2.187  74.264  1.00 37.43  ? 442  HOH D O   1 
HETATM 10670 O O   . HOH S 5 .   ? -18.630 4.967   79.986  1.00 35.70  ? 443  HOH D O   1 
HETATM 10671 O O   . HOH S 5 .   ? -20.982 3.613   38.955  1.00 40.43  ? 444  HOH D O   1 
HETATM 10672 O O   . HOH S 5 .   ? -18.589 -4.169  59.359  1.00 30.79  ? 445  HOH D O   1 
HETATM 10673 O O   . HOH S 5 .   ? -5.229  -3.349  66.853  1.00 32.33  ? 446  HOH D O   1 
HETATM 10674 O O   . HOH S 5 .   ? 3.836   -1.712  55.373  1.00 27.32  ? 447  HOH D O   1 
HETATM 10675 O O   . HOH S 5 .   ? -1.533  11.257  46.949  1.00 46.09  ? 448  HOH D O   1 
HETATM 10676 O O   . HOH S 5 .   ? -1.364  21.927  50.129  1.00 45.59  ? 449  HOH D O   1 
HETATM 10677 O O   . HOH S 5 .   ? -14.379 -17.255 65.617  1.00 45.25  ? 450  HOH D O   1 
HETATM 10678 O O   . HOH S 5 .   ? -16.357 9.250   55.282  1.00 49.90  ? 451  HOH D O   1 
HETATM 10679 O O   . HOH S 5 .   ? 0.118   -0.369  69.500  1.00 45.58  ? 452  HOH D O   1 
HETATM 10680 O O   . HOH S 5 .   ? -20.571 -15.724 52.993  1.00 36.85  ? 453  HOH D O   1 
HETATM 10681 O O   . HOH S 5 .   ? -1.058  -7.955  42.913  1.00 60.75  ? 454  HOH D O   1 
HETATM 10682 O O   . HOH S 5 .   ? -3.902  -5.176  65.316  1.00 51.59  ? 455  HOH D O   1 
HETATM 10683 O O   . HOH S 5 .   ? -14.522 -19.818 52.339  1.00 44.16  ? 456  HOH D O   1 
HETATM 10684 O O   . HOH S 5 .   ? 4.934   15.432  57.960  1.00 45.02  ? 457  HOH D O   1 
HETATM 10685 O O   . HOH S 5 .   ? -16.525 -17.076 58.696  1.00 35.63  ? 458  HOH D O   1 
HETATM 10686 O O   . HOH S 5 .   ? -9.839  11.136  63.353  1.00 41.52  ? 459  HOH D O   1 
HETATM 10687 O O   . HOH S 5 .   ? 5.281   -4.400  68.790  1.00 38.53  ? 460  HOH D O   1 
HETATM 10688 O O   . HOH S 5 .   ? -0.941  3.838   44.070  1.00 39.67  ? 461  HOH D O   1 
HETATM 10689 O O   . HOH S 5 .   ? -16.353 9.289   60.446  1.00 45.14  ? 462  HOH D O   1 
HETATM 10690 O O   . HOH S 5 .   ? -13.700 -12.170 67.497  1.00 44.38  ? 463  HOH D O   1 
HETATM 10691 O O   . HOH S 5 .   ? -12.931 -5.495  39.887  1.00 38.42  ? 464  HOH D O   1 
HETATM 10692 O O   . HOH S 5 .   ? -22.068 -2.200  59.512  1.00 36.72  ? 465  HOH D O   1 
HETATM 10693 O O   . HOH S 5 .   ? 3.848   11.234  52.358  1.00 25.76  ? 466  HOH D O   1 
HETATM 10694 O O   . HOH S 5 .   ? -11.317 17.747  54.052  1.00 41.95  ? 467  HOH D O   1 
HETATM 10695 O O   . HOH S 5 .   ? -14.811 -9.706  44.384  1.00 52.77  ? 468  HOH D O   1 
HETATM 10696 O O   . HOH S 5 .   ? -7.802  -5.858  38.361  1.00 75.96  ? 469  HOH D O   1 
HETATM 10697 O O   . HOH S 5 .   ? -12.739 -1.521  31.722  1.00 76.97  ? 470  HOH D O   1 
HETATM 10698 O O   . HOH S 5 .   ? -0.076  -15.634 59.756  1.00 44.50  ? 472  HOH D O   1 
HETATM 10699 O O   . HOH S 5 .   ? -23.968 3.916   57.754  1.00 63.91  ? 474  HOH D O   1 
HETATM 10700 O O   . HOH S 5 .   ? 2.661   9.610   49.320  1.00 30.71  ? 485  HOH D O   1 
HETATM 10701 O O   . HOH S 5 .   ? -12.330 -9.711  39.742  1.00 63.86  ? 488  HOH D O   1 
HETATM 10702 O O   . HOH S 5 .   ? -8.877  15.705  44.883  1.00 50.19  ? 495  HOH D O   1 
HETATM 10703 O O   . HOH S 5 .   ? -1.314  4.152   41.236  1.00 80.09  ? 499  HOH D O   1 
HETATM 10704 O O   . HOH S 5 .   ? 1.306   12.689  70.343  1.00 43.16  ? 501  HOH D O   1 
HETATM 10705 O O   . HOH S 5 .   ? -18.617 14.661  59.080  1.00 43.68  ? 502  HOH D O   1 
HETATM 10706 O O   . HOH S 5 .   ? 1.134   0.391   41.694  1.00 43.55  ? 507  HOH D O   1 
HETATM 10707 O O   . HOH S 5 .   ? -28.853 1.066   39.450  1.00 59.76  ? 509  HOH D O   1 
HETATM 10708 O O   . HOH S 5 .   ? 4.043   2.841   69.626  1.00 82.30  ? 513  HOH D O   1 
HETATM 10709 O O   . HOH S 5 .   ? -4.297  -20.105 57.403  1.00 53.78  ? 514  HOH D O   1 
HETATM 10710 O O   . HOH S 5 .   ? 6.375   2.419   71.302  1.00 57.26  ? 516  HOH D O   1 
HETATM 10711 O O   . HOH S 5 .   ? -1.929  0.002   62.501  1.00 41.21  ? 519  HOH D O   1 
HETATM 10712 O O   . HOH S 5 .   ? -21.991 -12.523 66.589  1.00 41.75  ? 520  HOH D O   1 
HETATM 10713 O O   . HOH S 5 .   ? -28.451 -15.021 47.222  1.00 58.16  ? 525  HOH D O   1 
HETATM 10714 O O   . HOH S 5 .   ? 3.873   4.343   63.533  1.00 46.07  ? 531  HOH D O   1 
HETATM 10715 O O   . HOH S 5 .   ? -0.845  19.393  61.803  1.00 40.30  ? 538  HOH D O   1 
HETATM 10716 O O   . HOH S 5 .   ? -30.648 -14.091 61.385  1.00 61.58  ? 543  HOH D O   1 
HETATM 10717 O O   . HOH S 5 .   ? -24.317 4.721   36.801  1.00 71.89  ? 544  HOH D O   1 
HETATM 10718 O O   . HOH S 5 .   ? 4.321   -9.806  52.096  1.00 44.75  ? 545  HOH D O   1 
HETATM 10719 O O   . HOH S 5 .   ? 1.818   -3.378  51.963  1.00 32.58  ? 546  HOH D O   1 
HETATM 10720 O O   . HOH S 5 .   ? 1.920   14.865  68.460  1.00 39.42  ? 547  HOH D O   1 
HETATM 10721 O O   . HOH S 5 .   ? -27.434 -11.872 46.616  1.00 56.12  ? 550  HOH D O   1 
HETATM 10722 O O   . HOH S 5 .   ? -19.276 1.225   80.577  1.00 46.84  ? 551  HOH D O   1 
HETATM 10723 O O   . HOH S 5 .   ? 6.475   8.110   55.306  1.00 48.71  ? 557  HOH D O   1 
HETATM 10724 O O   . HOH S 5 .   ? 4.582   1.748   62.197  1.00 32.57  ? 577  HOH D O   1 
HETATM 10725 O O   . HOH S 5 .   ? -4.582  15.721  63.419  1.00 41.83  ? 587  HOH D O   1 
HETATM 10726 O O   . HOH S 5 .   ? 8.506   4.486   57.274  1.00 33.51  ? 588  HOH D O   1 
HETATM 10727 O O   . HOH S 5 .   ? -8.568  6.732   57.913  1.00 33.31  ? 589  HOH D O   1 
HETATM 10728 O O   . HOH S 5 .   ? -2.810  2.073   40.420  1.00 34.63  ? 594  HOH D O   1 
HETATM 10729 O O   . HOH S 5 .   ? -17.599 7.758   67.620  1.00 44.60  ? 598  HOH D O   1 
HETATM 10730 O O   . HOH S 5 .   ? -5.611  -13.319 73.594  1.00 53.61  ? 600  HOH D O   1 
HETATM 10731 O O   . HOH S 5 .   ? -41.594 7.247   40.915  1.00 49.70  ? 601  HOH D O   1 
HETATM 10732 O O   . HOH S 5 .   ? -39.210 8.736   40.582  1.00 62.74  ? 603  HOH D O   1 
HETATM 10733 O O   . HOH S 5 .   ? 7.163   -7.303  61.306  1.00 43.97  ? 608  HOH D O   1 
HETATM 10734 O O   . HOH S 5 .   ? -1.750  3.188   64.472  1.00 51.19  ? 609  HOH D O   1 
HETATM 10735 O O   . HOH S 5 .   ? -26.276 18.949  55.497  1.00 61.86  ? 613  HOH D O   1 
HETATM 10736 O O   . HOH S 5 .   ? -40.305 17.229  35.312  1.00 76.00  ? 617  HOH D O   1 
HETATM 10737 O O   . HOH S 5 .   ? -18.186 -11.769 39.229  1.00 50.98  ? 618  HOH D O   1 
HETATM 10738 O O   . HOH S 5 .   ? -1.200  13.008  72.733  1.00 49.00  ? 634  HOH D O   1 
HETATM 10739 O O   . HOH S 5 .   ? -18.777 -18.931 50.519  1.00 60.79  ? 644  HOH D O   1 
HETATM 10740 O O   . HOH S 5 .   ? -24.198 -16.862 51.838  1.00 67.90  ? 645  HOH D O   1 
HETATM 10741 O O   . HOH S 5 .   ? -10.004 -8.564  75.498  1.00 56.70  ? 646  HOH D O   1 
HETATM 10742 O O   . HOH S 5 .   ? -26.710 -17.115 48.317  1.00 63.64  ? 648  HOH D O   1 
HETATM 10743 O O   . HOH S 5 .   ? -10.647 -26.707 46.162  1.00 65.60  ? 655  HOH D O   1 
HETATM 10744 O O   . HOH S 5 .   ? -17.883 -1.137  35.100  1.00 53.07  ? 662  HOH D O   1 
HETATM 10745 O O   . HOH S 5 .   ? -11.171 -7.257  78.928  1.00 74.09  ? 670  HOH D O   1 
HETATM 10746 O O   . HOH S 5 .   ? -28.939 8.402   31.451  1.00 65.63  ? 671  HOH D O   1 
HETATM 10747 O O   . HOH S 5 .   ? -15.400 -6.404  75.537  1.00 54.97  ? 679  HOH D O   1 
HETATM 10748 O O   . HOH S 5 .   ? 3.498   16.642  56.011  1.00 41.43  ? 680  HOH D O   1 
HETATM 10749 O O   . HOH S 5 .   ? -8.107  12.791  38.209  1.00 44.60  ? 682  HOH D O   1 
HETATM 10750 O O   . HOH S 5 .   ? -3.413  0.776   31.212  1.00 44.09  ? 683  HOH D O   1 
HETATM 10751 O O   . HOH S 5 .   ? -30.236 7.439   33.581  1.00 57.93  ? 687  HOH D O   1 
HETATM 10752 O O   . HOH S 5 .   ? -16.102 1.086   81.434  1.00 57.58  ? 688  HOH D O   1 
HETATM 10753 O O   . HOH S 5 .   ? -10.609 -6.179  38.705  1.00 47.41  ? 707  HOH D O   1 
HETATM 10754 O O   . HOH S 5 .   ? -0.789  -19.088 49.435  1.00 65.17  ? 712  HOH D O   1 
HETATM 10755 O O   . HOH S 5 .   ? -8.872  11.394  35.157  1.00 48.63  ? 716  HOH D O   1 
HETATM 10756 O O   . HOH S 5 .   ? -18.538 -16.791 39.543  1.00 73.04  ? 724  HOH D O   1 
HETATM 10757 O O   . HOH S 5 .   ? 4.497   1.225   52.155  1.00 35.83  ? 726  HOH D O   1 
HETATM 10758 O O   . HOH S 5 .   ? -28.762 -17.274 55.622  1.00 66.98  ? 734  HOH D O   1 
HETATM 10759 O O   . HOH S 5 .   ? -16.427 14.158  34.137  1.00 55.55  ? 739  HOH D O   1 
HETATM 10760 O O   . HOH S 5 .   ? -29.870 24.347  41.597  1.00 55.73  ? 750  HOH D O   1 
HETATM 10761 O O   . HOH S 5 .   ? -19.852 -10.318 72.995  1.00 54.66  ? 752  HOH D O   1 
HETATM 10762 O O   . HOH S 5 .   ? -0.362  10.612  69.746  1.00 50.28  ? 764  HOH D O   1 
HETATM 10763 O O   . HOH S 5 .   ? 3.881   16.748  63.590  1.00 48.94  ? 773  HOH D O   1 
HETATM 10764 O O   . HOH S 5 .   ? -20.783 -1.054  76.749  1.00 57.20  ? 778  HOH D O   1 
HETATM 10765 O O   . HOH S 5 .   ? -9.136  -9.733  77.936  1.00 56.54  ? 780  HOH D O   1 
HETATM 10766 O O   . HOH S 5 .   ? -1.039  5.132   70.327  1.00 47.91  ? 789  HOH D O   1 
HETATM 10767 O O   . HOH S 5 .   ? -2.762  21.361  57.898  1.00 49.61  ? 790  HOH D O   1 
HETATM 10768 O O   . HOH S 5 .   ? -5.553  -0.919  41.396  1.00 51.93  ? 809  HOH D O   1 
HETATM 10769 O O   . HOH S 5 .   ? -21.721 -5.655  71.025  1.00 52.48  ? 813  HOH D O   1 
HETATM 10770 O O   . HOH S 5 .   ? 5.635   -7.387  70.693  1.00 63.32  ? 832  HOH D O   1 
HETATM 10771 O O   . HOH S 5 .   ? -5.010  0.805   29.147  1.00 53.12  ? 848  HOH D O   1 
HETATM 10772 O O   . HOH S 5 .   ? -14.604 -7.781  40.542  1.00 54.80  ? 851  HOH D O   1 
HETATM 10773 O O   . HOH S 5 .   ? -25.812 17.623  36.403  1.00 58.47  ? 861  HOH D O   1 
HETATM 10774 O O   . HOH S 5 .   ? -24.973 4.121   54.508  1.00 59.29  ? 867  HOH D O   1 
HETATM 10775 O O   . HOH S 5 .   ? -17.068 11.364  63.551  1.00 63.46  ? 871  HOH D O   1 
HETATM 10776 O O   . HOH S 5 .   ? -10.626 21.285  51.376  1.00 54.00  ? 890  HOH D O   1 
HETATM 10777 O O   . HOH S 5 .   ? -6.340  -22.638 44.015  1.00 63.22  ? 912  HOH D O   1 
HETATM 10778 O O   . HOH S 5 .   ? -8.550  -20.943 58.906  1.00 66.71  ? 913  HOH D O   1 
HETATM 10779 O O   . HOH S 5 .   ? -11.558 9.689   61.442  1.00 34.31  ? 934  HOH D O   1 
HETATM 10780 O O   . HOH S 5 .   ? -39.553 16.751  49.323  1.00 56.31  ? 935  HOH D O   1 
HETATM 10781 O O   . HOH S 5 .   ? -40.937 17.746  53.396  1.00 66.86  ? 936  HOH D O   1 
HETATM 10782 O O   . HOH S 5 .   ? -7.816  -5.432  41.460  1.00 64.83  ? 940  HOH D O   1 
HETATM 10783 O O   . HOH S 5 .   ? -40.818 15.562  51.435  1.00 75.08  ? 949  HOH D O   1 
HETATM 10784 O O   . HOH S 5 .   ? -22.267 8.035   60.461  1.00 53.34  ? 950  HOH D O   1 
HETATM 10785 O O   . HOH S 5 .   ? 0.068   2.380   39.105  1.00 61.25  ? 953  HOH D O   1 
HETATM 10786 O O   . HOH S 5 .   ? -0.562  -8.583  75.008  1.00 49.25  ? 955  HOH D O   1 
HETATM 10787 O O   . HOH S 5 .   ? -41.673 13.604  53.133  1.00 78.27  ? 958  HOH D O   1 
HETATM 10788 O O   . HOH S 5 .   ? -0.100  -12.904 43.817  1.00 44.37  ? 967  HOH D O   1 
HETATM 10789 O O   . HOH S 5 .   ? -18.363 -19.388 47.120  1.00 57.71  ? 969  HOH D O   1 
HETATM 10790 O O   . HOH S 5 .   ? -27.453 2.663   57.584  1.00 68.55  ? 973  HOH D O   1 
HETATM 10791 O O   . HOH S 5 .   ? 3.853   -9.434  47.837  1.00 49.75  ? 983  HOH D O   1 
HETATM 10792 O O   . HOH S 5 .   ? -32.130 -15.234 58.988  1.00 68.39  ? 988  HOH D O   1 
HETATM 10793 O O   . HOH S 5 .   ? -21.557 10.158  58.262  1.00 54.28  ? 994  HOH D O   1 
HETATM 10794 O O   . HOH S 5 .   ? -32.501 -3.801  49.275  1.00 50.20  ? 996  HOH D O   1 
HETATM 10795 O O   . HOH S 5 .   ? 0.459   -5.861  74.084  1.00 45.60  ? 1001 HOH D O   1 
HETATM 10796 O O   . HOH S 5 .   ? -9.028  6.616   60.746  1.00 27.21  ? 1004 HOH D O   1 
HETATM 10797 O O   . HOH S 5 .   ? -8.232  20.665  52.427  1.00 41.36  ? 1005 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 21  ? 0.5772 1.0247 0.8270 -0.0034 0.0704  -0.1192 21  GLU A N   
2    C CA  . GLU A 21  ? 0.5748 0.9850 0.8024 -0.0219 0.0813  -0.1135 21  GLU A CA  
3    C C   . GLU A 21  ? 0.5870 0.9681 0.7970 -0.0164 0.0905  -0.1046 21  GLU A C   
4    O O   . GLU A 21  ? 0.5809 0.9715 0.8015 -0.0191 0.1026  -0.1097 21  GLU A O   
5    C CB  . GLU A 21  ? 0.6014 1.0261 0.8432 -0.0455 0.0933  -0.1253 21  GLU A CB  
6    C CG  . GLU A 21  ? 0.7495 1.1378 0.9664 -0.0638 0.0985  -0.1202 21  GLU A CG  
7    C CD  . GLU A 21  ? 1.0124 1.3903 1.2176 -0.0644 0.0858  -0.1164 21  GLU A CD  
8    O OE1 . GLU A 21  ? 1.0487 1.3922 1.2299 -0.0753 0.0896  -0.1102 21  GLU A OE1 
9    O OE2 . GLU A 21  ? 0.8503 1.2533 1.0685 -0.0531 0.0721  -0.1195 21  GLU A OE2 
10   N N   . GLN A 22  ? 0.5151 0.8615 0.6980 -0.0093 0.0849  -0.0919 22  GLN A N   
11   C CA  . GLN A 22  ? 0.5024 0.8180 0.6641 -0.0028 0.0902  -0.0823 22  GLN A CA  
12   C C   . GLN A 22  ? 0.5264 0.8274 0.6818 -0.0167 0.1064  -0.0834 22  GLN A C   
13   O O   . GLN A 22  ? 0.5228 0.8192 0.6763 -0.0096 0.1135  -0.0823 22  GLN A O   
14   C CB  . GLN A 22  ? 0.5143 0.7969 0.6489 -0.0002 0.0821  -0.0708 22  GLN A CB  
15   N N   . PHE A 23  ? 0.4695 0.7617 0.6198 -0.0357 0.1130  -0.0859 23  PHE A N   
16   C CA  . PHE A 23  ? 0.4741 0.7476 0.6131 -0.0488 0.1286  -0.0861 23  PHE A CA  
17   C C   . PHE A 23  ? 0.5331 0.8227 0.6868 -0.0671 0.1401  -0.0972 23  PHE A C   
18   O O   . PHE A 23  ? 0.5393 0.8530 0.7107 -0.0728 0.1358  -0.1050 23  PHE A O   
19   C CB  . PHE A 23  ? 0.4990 0.7309 0.6050 -0.0549 0.1284  -0.0755 23  PHE A CB  
20   C CG  . PHE A 23  ? 0.5056 0.7176 0.5936 -0.0416 0.1181  -0.0649 23  PHE A CG  
21   C CD1 . PHE A 23  ? 0.5427 0.7478 0.6253 -0.0306 0.1203  -0.0613 23  PHE A CD1 
22   C CD2 . PHE A 23  ? 0.5295 0.7273 0.6042 -0.0415 0.1079  -0.0590 23  PHE A CD2 
23   C CE1 . PHE A 23  ? 0.5539 0.7396 0.6190 -0.0206 0.1122  -0.0526 23  PHE A CE1 
24   C CE2 . PHE A 23  ? 0.5597 0.7397 0.6180 -0.0311 0.1000  -0.0502 23  PHE A CE2 
25   C CZ  . PHE A 23  ? 0.5372 0.7115 0.5910 -0.0214 0.1023  -0.0473 23  PHE A CZ  
26   N N   . ALA A 24  ? 0.4914 0.7647 0.6347 -0.0774 0.1556  -0.0978 24  ALA A N   
27   C CA  . ALA A 24  ? 0.5019 0.7789 0.6503 -0.0976 0.1708  -0.1069 24  ALA A CA  
28   C C   . ALA A 24  ? 0.5738 0.8074 0.6879 -0.1105 0.1760  -0.0994 24  ALA A C   
29   O O   . ALA A 24  ? 0.5757 0.7788 0.6640 -0.1031 0.1720  -0.0881 24  ALA A O   
30   C CB  . ALA A 24  ? 0.5178 0.8052 0.6763 -0.0985 0.1856  -0.1128 24  ALA A CB  
31   N N   . VAL A 25  ? 0.5374 0.7677 0.6501 -0.1293 0.1849  -0.1059 25  VAL A N   
32   C CA  . VAL A 25  ? 0.5442 0.7309 0.6220 -0.1408 0.1910  -0.0991 25  VAL A CA  
33   C C   . VAL A 25  ? 0.5841 0.7470 0.6426 -0.1451 0.2060  -0.0964 25  VAL A C   
34   O O   . VAL A 25  ? 0.5941 0.7697 0.6647 -0.1562 0.2214  -0.1058 25  VAL A O   
35   C CB  . VAL A 25  ? 0.6046 0.7888 0.6819 -0.1597 0.1972  -0.1065 25  VAL A CB  
36   C CG1 . VAL A 25  ? 0.6248 0.7586 0.6610 -0.1674 0.2027  -0.0975 25  VAL A CG1 
37   C CG2 . VAL A 25  ? 0.5865 0.7952 0.6824 -0.1551 0.1818  -0.1097 25  VAL A CG2 
38   N N   . GLY A 26  ? 0.5162 0.6477 0.5465 -0.1356 0.2009  -0.0842 26  GLY A N   
39   C CA  . GLY A 26  ? 0.5224 0.6283 0.5298 -0.1372 0.2122  -0.0801 26  GLY A CA  
40   C C   . GLY A 26  ? 0.5344 0.6480 0.5467 -0.1214 0.2070  -0.0763 26  GLY A C   
41   O O   . GLY A 26  ? 0.5483 0.6410 0.5409 -0.1216 0.2153  -0.0729 26  GLY A O   
42   N N   . GLU A 27  ? 0.4465 0.5879 0.4825 -0.1076 0.1938  -0.0770 27  GLU A N   
43   C CA  . GLU A 27  ? 0.4239 0.5712 0.4639 -0.0917 0.1887  -0.0736 27  GLU A CA  
44   C C   . GLU A 27  ? 0.4753 0.5895 0.4840 -0.0855 0.1815  -0.0621 27  GLU A C   
45   O O   . GLU A 27  ? 0.4758 0.5758 0.4709 -0.0856 0.1719  -0.0562 27  GLU A O   
46   C CB  . GLU A 27  ? 0.4167 0.5972 0.4849 -0.0783 0.1759  -0.0765 27  GLU A CB  
47   C CG  . GLU A 27  ? 0.4499 0.6367 0.5231 -0.0617 0.1728  -0.0744 27  GLU A CG  
48   C CD  . GLU A 27  ? 0.6691 0.8889 0.7697 -0.0473 0.1631  -0.0784 27  GLU A CD  
49   O OE1 . GLU A 27  ? 0.7455 0.9912 0.8670 -0.0505 0.1587  -0.0849 27  GLU A OE1 
50   O OE2 . GLU A 27  ? 0.4931 0.7122 0.5929 -0.0325 0.1603  -0.0755 27  GLU A OE2 
51   N N   . ILE A 28  ? 0.4233 0.5263 0.4209 -0.0802 0.1863  -0.0596 28  ILE A N   
52   C CA  . ILE A 28  ? 0.4137 0.4890 0.3833 -0.0747 0.1800  -0.0504 28  ILE A CA  
53   C C   . ILE A 28  ? 0.4503 0.5358 0.4288 -0.0597 0.1690  -0.0478 28  ILE A C   
54   O O   . ILE A 28  ? 0.4500 0.5493 0.4424 -0.0526 0.1733  -0.0517 28  ILE A O   
55   C CB  . ILE A 28  ? 0.4626 0.5146 0.4089 -0.0803 0.1925  -0.0495 28  ILE A CB  
56   C CG1 . ILE A 28  ? 0.4830 0.5211 0.4171 -0.0955 0.2049  -0.0520 28  ILE A CG1 
57   C CG2 . ILE A 28  ? 0.4567 0.4836 0.3750 -0.0749 0.1847  -0.0413 28  ILE A CG2 
58   C CD1 . ILE A 28  ? 0.6152 0.6397 0.5359 -0.1024 0.2218  -0.0549 28  ILE A CD1 
59   N N   . ILE A 29  ? 0.3926 0.4699 0.3619 -0.0548 0.1559  -0.0415 29  ILE A N   
60   C CA  . ILE A 29  ? 0.3735 0.4548 0.3458 -0.0423 0.1458  -0.0383 29  ILE A CA  
61   C C   . ILE A 29  ? 0.4218 0.4779 0.3672 -0.0415 0.1423  -0.0320 29  ILE A C   
62   O O   . ILE A 29  ? 0.4277 0.4677 0.3549 -0.0481 0.1412  -0.0287 29  ILE A O   
63   C CB  . ILE A 29  ? 0.3893 0.4867 0.3768 -0.0370 0.1336  -0.0378 29  ILE A CB  
64   C CG1 . ILE A 29  ? 0.3852 0.4711 0.3606 -0.0439 0.1273  -0.0340 29  ILE A CG1 
65   C CG2 . ILE A 29  ? 0.3884 0.5158 0.4050 -0.0358 0.1363  -0.0457 29  ILE A CG2 
66   C CD1 . ILE A 29  ? 0.3917 0.4884 0.3767 -0.0388 0.1150  -0.0326 29  ILE A CD1 
67   N N   . THR A 30  ? 0.3705 0.4234 0.3127 -0.0335 0.1411  -0.0310 30  THR A N   
68   C CA  . THR A 30  ? 0.3728 0.4055 0.2919 -0.0335 0.1383  -0.0269 30  THR A CA  
69   C C   . THR A 30  ? 0.4144 0.4493 0.3354 -0.0259 0.1277  -0.0242 30  THR A C   
70   O O   . THR A 30  ? 0.4027 0.4476 0.3369 -0.0175 0.1271  -0.0256 30  THR A O   
71   C CB  . THR A 30  ? 0.4451 0.4671 0.3541 -0.0339 0.1493  -0.0294 30  THR A CB  
72   O OG1 . THR A 30  ? 0.5098 0.5302 0.4176 -0.0416 0.1601  -0.0323 30  THR A OG1 
73   C CG2 . THR A 30  ? 0.3956 0.3977 0.2797 -0.0362 0.1470  -0.0267 30  THR A CG2 
74   N N   . ASP A 31  ? 0.3765 0.4018 0.2834 -0.0284 0.1197  -0.0204 31  ASP A N   
75   C CA  . ASP A 31  ? 0.3620 0.3887 0.2694 -0.0231 0.1105  -0.0182 31  ASP A CA  
76   C C   . ASP A 31  ? 0.4432 0.4571 0.3369 -0.0220 0.1131  -0.0186 31  ASP A C   
77   O O   . ASP A 31  ? 0.4608 0.4657 0.3454 -0.0246 0.1215  -0.0207 31  ASP A O   
78   C CB  . ASP A 31  ? 0.3607 0.3867 0.2626 -0.0260 0.1010  -0.0151 31  ASP A CB  
79   C CG  . ASP A 31  ? 0.4051 0.4184 0.2869 -0.0315 0.0999  -0.0136 31  ASP A CG  
80   O OD1 . ASP A 31  ? 0.3949 0.3987 0.2639 -0.0334 0.1039  -0.0149 31  ASP A OD1 
81   O OD2 . ASP A 31  ? 0.4599 0.4725 0.3376 -0.0330 0.0944  -0.0114 31  ASP A OD2 
82   N N   . MET A 32  ? 0.4095 0.4217 0.3007 -0.0191 0.1069  -0.0173 32  MET A N   
83   C CA  . MET A 32  ? 0.4354 0.4345 0.3130 -0.0197 0.1099  -0.0186 32  MET A CA  
84   C C   . MET A 32  ? 0.4663 0.4556 0.3257 -0.0282 0.1105  -0.0199 32  MET A C   
85   O O   . MET A 32  ? 0.4640 0.4414 0.3112 -0.0307 0.1162  -0.0225 32  MET A O   
86   C CB  . MET A 32  ? 0.4766 0.4751 0.3548 -0.0161 0.1045  -0.0173 32  MET A CB  
87   C CG  . MET A 32  ? 0.5373 0.5432 0.4172 -0.0188 0.0947  -0.0155 32  MET A CG  
88   S SD  . MET A 32  ? 0.6083 0.6133 0.4910 -0.0130 0.0911  -0.0142 32  MET A SD  
89   C CE  . MET A 32  ? 0.5763 0.5798 0.4483 -0.0216 0.0861  -0.0156 32  MET A CE  
90   N N   . ALA A 33  ? 0.4136 0.4070 0.2699 -0.0322 0.1047  -0.0184 33  ALA A N   
91   C CA  . ALA A 33  ? 0.4197 0.4060 0.2581 -0.0384 0.1034  -0.0195 33  ALA A CA  
92   C C   . ALA A 33  ? 0.4976 0.4757 0.3275 -0.0412 0.1114  -0.0200 33  ALA A C   
93   O O   . ALA A 33  ? 0.5130 0.4840 0.3260 -0.0454 0.1102  -0.0203 33  ALA A O   
94   C CB  . ALA A 33  ? 0.4217 0.4151 0.2591 -0.0386 0.0929  -0.0171 33  ALA A CB  
95   N N   . ALA A 34  ? 0.4501 0.4298 0.2913 -0.0386 0.1197  -0.0206 34  ALA A N   
96   C CA  . ALA A 34  ? 0.4576 0.4314 0.2947 -0.0414 0.1299  -0.0220 34  ALA A CA  
97   C C   . ALA A 34  ? 0.5061 0.4787 0.3384 -0.0451 0.1286  -0.0197 34  ALA A C   
98   O O   . ALA A 34  ? 0.5278 0.4908 0.3494 -0.0494 0.1369  -0.0206 34  ALA A O   
99   C CB  . ALA A 34  ? 0.4846 0.4435 0.3021 -0.0454 0.1365  -0.0249 34  ALA A CB  
100  N N   . ALA A 35  ? 0.4323 0.4125 0.2713 -0.0434 0.1193  -0.0168 35  ALA A N   
101  C CA  . ALA A 35  ? 0.4250 0.4013 0.2586 -0.0461 0.1183  -0.0143 35  ALA A CA  
102  C C   . ALA A 35  ? 0.4684 0.4529 0.3197 -0.0477 0.1259  -0.0161 35  ALA A C   
103  O O   . ALA A 35  ? 0.4382 0.4382 0.3108 -0.0437 0.1241  -0.0175 35  ALA A O   
104  C CB  . ALA A 35  ? 0.4160 0.3965 0.2493 -0.0431 0.1060  -0.0111 35  ALA A CB  
105  N N   . ALA A 36  ? 0.4381 0.4126 0.2799 -0.0537 0.1349  -0.0167 36  ALA A N   
106  C CA  . ALA A 36  ? 0.4276 0.4109 0.2857 -0.0577 0.1438  -0.0200 36  ALA A CA  
107  C C   . ALA A 36  ? 0.4759 0.4604 0.3372 -0.0604 0.1398  -0.0184 36  ALA A C   
108  O O   . ALA A 36  ? 0.4819 0.4501 0.3227 -0.0617 0.1359  -0.0143 36  ALA A O   
109  C CB  . ALA A 36  ? 0.4512 0.4220 0.2969 -0.0647 0.1580  -0.0225 36  ALA A CB  
110  N N   . TRP A 37  ? 0.4151 0.4188 0.3014 -0.0607 0.1404  -0.0220 37  TRP A N   
111  C CA  . TRP A 37  ? 0.4166 0.4235 0.3088 -0.0643 0.1376  -0.0220 37  TRP A CA  
112  C C   . TRP A 37  ? 0.4678 0.4876 0.3778 -0.0721 0.1485  -0.0288 37  TRP A C   
113  O O   . TRP A 37  ? 0.4535 0.4918 0.3832 -0.0699 0.1530  -0.0337 37  TRP A O   
114  C CB  . TRP A 37  ? 0.3848 0.4066 0.2917 -0.0568 0.1245  -0.0206 37  TRP A CB  
115  C CG  . TRP A 37  ? 0.3921 0.4059 0.2858 -0.0500 0.1141  -0.0155 37  TRP A CG  
116  C CD1 . TRP A 37  ? 0.4223 0.4403 0.3179 -0.0439 0.1106  -0.0151 37  TRP A CD1 
117  C CD2 . TRP A 37  ? 0.3990 0.3997 0.2754 -0.0489 0.1066  -0.0108 37  TRP A CD2 
118  N NE1 . TRP A 37  ? 0.4196 0.4304 0.3021 -0.0406 0.1016  -0.0113 37  TRP A NE1 
119  C CE2 . TRP A 37  ? 0.4452 0.4469 0.3168 -0.0426 0.0983  -0.0086 37  TRP A CE2 
120  C CE3 . TRP A 37  ? 0.4264 0.4138 0.2901 -0.0523 0.1065  -0.0087 37  TRP A CE3 
121  C CZ2 . TRP A 37  ? 0.4352 0.4300 0.2933 -0.0391 0.0893  -0.0050 37  TRP A CZ2 
122  C CZ3 . TRP A 37  ? 0.4487 0.4258 0.2963 -0.0472 0.0975  -0.0041 37  TRP A CZ3 
123  C CH2 . TRP A 37  ? 0.4483 0.4315 0.2949 -0.0405 0.0887  -0.0026 37  TRP A CH2 
124  N N   . LYS A 38  ? 0.4425 0.4530 0.3458 -0.0810 0.1529  -0.0296 38  LYS A N   
125  C CA  . LYS A 38  ? 0.4395 0.4628 0.3595 -0.0913 0.1640  -0.0373 38  LYS A CA  
126  C C   . LYS A 38  ? 0.4676 0.5073 0.4054 -0.0919 0.1562  -0.0398 38  LYS A C   
127  O O   . LYS A 38  ? 0.4503 0.4762 0.3746 -0.0906 0.1484  -0.0350 38  LYS A O   
128  C CB  . LYS A 38  ? 0.4974 0.4947 0.3938 -0.1036 0.1780  -0.0377 38  LYS A CB  
129  C CG  . LYS A 38  ? 0.5849 0.5965 0.4991 -0.1164 0.1929  -0.0475 38  LYS A CG