data_3OPY
# 
_entry.id   3OPY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OPY         
RCSB  RCSB061426   
WWPDB D_1000061426 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OPY 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Strater, N.'     1 
'Marek, S.'       2 
'Kuettner, E.B.'  3 
'Kloos, M.'       4 
'Keim, A.'        5 
'Bruser, A.'      6 
'Kirchberger, J.' 7 
'Schoneberg, T.'  8 
# 
_citation.id                        primary 
_citation.title                     
'Molecular architecture and structural basis of allosteric regulation of eukaryotic phosphofructokinases.' 
_citation.journal_abbrev            'Faseb J.' 
_citation.journal_volume            25 
_citation.page_first                89 
_citation.page_last                 98 
_citation.year                      2011 
_citation.journal_id_ASTM           FAJOEC 
_citation.country                   US 
_citation.journal_id_ISSN           0892-6638 
_citation.journal_id_CSD            2074 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20833871 
_citation.pdbx_database_id_DOI      10.1096/fj.10-163865 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Strater, N.'     1 
primary 'Marek, S.'       2 
primary 'Kuettner, E.B.'  3 
primary 'Kloos, M.'       4 
primary 'Keim, A.'        5 
primary 'Bruser, A.'      6 
primary 'Kirchberger, J.' 7 
primary 'Schoneberg, T.'  8 
# 
_cell.entry_id           3OPY 
_cell.length_a           161.658 
_cell.length_b           188.303 
_cell.length_c           231.560 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.85 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OPY 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat '6-phosphofructo-1-kinase alpha-subunit' 108929.781 4  2.7.1.11 ? ? ? 
2 polymer     nat '6-phosphofructo-1-kinase beta-subunit'  103853.766 4  2.7.1.11 ? ? ? 
3 polymer     nat '6-phosphofructo-1-kinase gamma-subunit' 40845.262  4  2.7.1.11 ? ? ? 
4 non-polymer syn 'SULFATE ION'                            96.063     65 ?        ? ? ? 
5 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"              507.181    4  ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIKEIWLESFPLSEVVEASGGREL
RKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLEKNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFST
RDPMGDVISFSSYPSLNSKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAGIFYG
CKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGA
DLFRKEWPELIKELLGEDKITKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVV
EVMGRHCGWLGLMSGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITSEEVKDVLV
EIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVISILENKIVRQPLVESVAQTKTVSAAIEAK
DFDKALQLRDQEFATSYENFLSVSKYDDGSYLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAG
LIRHGAVRELNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELDAARAQYPIFNIP
MCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTFVVEVQGGYSGYLASYAGLITGALAVYTPENPIN
LQTVQEDIELLTRTYEEDDGKNRSGKIFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNAC
RLAIKCCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSEVTFTPVKQLWENETHH
KWRKGKNVHWEQLNIVSDLLSGRLSIRTT
;
;MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIKEIWLESFPLSEVVEASGGREL
RKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLEKNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFST
RDPMGDVISFSSYPSLNSKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAGIFYG
CKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGA
DLFRKEWPELIKELLGEDKITKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVV
EVMGRHCGWLGLMSGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITSEEVKDVLV
EIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVISILENKIVRQPLVESVAQTKTVSAAIEAK
DFDKALQLRDQEFATSYENFLSVSKYDDGSYLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAG
LIRHGAVRELNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELDAARAQYPIFNIP
MCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTFVVEVQGGYSGYLASYAGLITGALAVYTPENPIN
LQTVQEDIELLTRTYEEDDGKNRSGKIFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNAC
RLAIKCCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSEVTFTPVKQLWENETHH
KWRKGKNVHWEQLNIVSDLLSGRLSIRTT
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVSIQLILDPEHAASVSQIDQNIR
NLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHPVQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPK
VSEEKAYRAEDDSEKLLNPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDV
RGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWPSLIEELLQTEQISQQQFNTH
QNLNICGAVGSIDNDMSSTDATIGAFSSLDRICRAIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEK
PASSREWQDQMCDIVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTAVAFDRIY
ATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKKAISLRDSEFVEHMKNFISTNSAD
HVPPSLPLEKRKKIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIG
TNRTLPNDADIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLN
SFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISYVPEEGISLAQLEMDINSLKESFANDQGKTKSGR
LILKSENASKVLTTEVISTIIDDEASGRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISF
RQTDEITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
;
;MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVSIQLILDPEHAASVSQIDQNIR
NLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHPVQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPK
VSEEKAYRAEDDSEKLLNPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDV
RGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWPSLIEELLQTEQISQQQFNTH
QNLNICGAVGSIDNDMSSTDATIGAFSSLDRICRAIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEK
PASSREWQDQMCDIVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTAVAFDRIY
ATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKKAISLRDSEFVEHMKNFISTNSAD
HVPPSLPLEKRKKIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIG
TNRTLPNDADIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLN
SFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISYVPEEGISLAQLEMDINSLKESFANDQGKTKSGR
LILKSENASKVLTTEVISTIIDDEASGRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISF
RQTDEITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
;
B,D,F,H ? 
3 'polypeptide(L)' no no 
;MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFSRKNDNAPVDKLLTNYYNNYEV
NVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDLPLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPE
QYRSSRWEDKVKGPALANRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGTTKKI
DLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEGIPAFRRHEIANFLKKRKTPKNADEL
IFKYVGRWNICYQKKFHQGNISIHQISGYLD
;
;MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFSRKNDNAPVDKLLTNYYNNYEV
NVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDLPLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPE
QYRSSRWEDKVKGPALANRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGTTKKI
DLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEGIPAFRRHEIANFLKKRKTPKNADEL
IFKYVGRWNICYQKKFHQGNISIHQISGYLD
;
I,J,K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLU n 
1 4   PRO n 
1 5   SER n 
1 6   ILE n 
1 7   SER n 
1 8   ASP n 
1 9   LEU n 
1 10  SER n 
1 11  PHE n 
1 12  THR n 
1 13  SER n 
1 14  PHE n 
1 15  VAL n 
1 16  THR n 
1 17  ASN n 
1 18  ASP n 
1 19  ASP n 
1 20  ASN n 
1 21  LEU n 
1 22  PHE n 
1 23  GLU n 
1 24  GLU n 
1 25  THR n 
1 26  PHE n 
1 27  ASN n 
1 28  PHE n 
1 29  TYR n 
1 30  THR n 
1 31  LYS n 
1 32  LEU n 
1 33  GLY n 
1 34  PHE n 
1 35  HIS n 
1 36  ALA n 
1 37  THR n 
1 38  ARG n 
1 39  SER n 
1 40  TYR n 
1 41  VAL n 
1 42  LYS n 
1 43  ASP n 
1 44  ASN n 
1 45  ARG n 
1 46  SER n 
1 47  ASP n 
1 48  PHE n 
1 49  GLU n 
1 50  LEU n 
1 51  THR n 
1 52  GLY n 
1 53  ILE n 
1 54  SER n 
1 55  THR n 
1 56  ASP n 
1 57  SER n 
1 58  ILE n 
1 59  LYS n 
1 60  GLU n 
1 61  ILE n 
1 62  TRP n 
1 63  LEU n 
1 64  GLU n 
1 65  SER n 
1 66  PHE n 
1 67  PRO n 
1 68  LEU n 
1 69  SER n 
1 70  GLU n 
1 71  VAL n 
1 72  VAL n 
1 73  GLU n 
1 74  ALA n 
1 75  SER n 
1 76  GLY n 
1 77  GLY n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ARG n 
1 82  LYS n 
1 83  PRO n 
1 84  LEU n 
1 85  GLN n 
1 86  GLU n 
1 87  SER n 
1 88  VAL n 
1 89  GLY n 
1 90  TYR n 
1 91  GLU n 
1 92  SER n 
1 93  GLU n 
1 94  ALA n 
1 95  LEU n 
1 96  LEU n 
1 97  GLY n 
1 98  TYR n 
1 99  SER n 
1 100 PRO n 
1 101 TYR n 
1 102 GLN n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 VAL n 
1 107 VAL n 
1 108 ILE n 
1 109 LYS n 
1 110 LEU n 
1 111 ARG n 
1 112 LEU n 
1 113 SER n 
1 114 ASN n 
1 115 HIS n 
1 116 ASP n 
1 117 LEU n 
1 118 GLU n 
1 119 LYS n 
1 120 ASN n 
1 121 ASN n 
1 122 ASP n 
1 123 LEU n 
1 124 PRO n 
1 125 GLY n 
1 126 GLU n 
1 127 VAL n 
1 128 THR n 
1 129 PHE n 
1 130 PHE n 
1 131 THR n 
1 132 ALA n 
1 133 SER n 
1 134 ILE n 
1 135 ASP n 
1 136 LYS n 
1 137 LEU n 
1 138 LYS n 
1 139 ALA n 
1 140 LYS n 
1 141 LEU n 
1 142 ILE n 
1 143 GLU n 
1 144 ILE n 
1 145 GLY n 
1 146 ALA n 
1 147 GLU n 
1 148 ILE n 
1 149 ILE n 
1 150 PRO n 
1 151 SER n 
1 152 LYS n 
1 153 ILE n 
1 154 ASP n 
1 155 LEU n 
1 156 VAL n 
1 157 GLU n 
1 158 PHE n 
1 159 SER n 
1 160 THR n 
1 161 ARG n 
1 162 ASP n 
1 163 PRO n 
1 164 MET n 
1 165 GLY n 
1 166 ASP n 
1 167 VAL n 
1 168 ILE n 
1 169 SER n 
1 170 PHE n 
1 171 SER n 
1 172 SER n 
1 173 TYR n 
1 174 PRO n 
1 175 SER n 
1 176 LEU n 
1 177 ASN n 
1 178 SER n 
1 179 LYS n 
1 180 LYS n 
1 181 ILE n 
1 182 THR n 
1 183 SER n 
1 184 PRO n 
1 185 ASP n 
1 186 PHE n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 PRO n 
1 191 LYS n 
1 192 LYS n 
1 193 GLU n 
1 194 VAL n 
1 195 ARG n 
1 196 SER n 
1 197 GLU n 
1 198 GLU n 
1 199 SER n 
1 200 ILE n 
1 201 VAL n 
1 202 GLU n 
1 203 GLN n 
1 204 VAL n 
1 205 LYS n 
1 206 SER n 
1 207 GLU n 
1 208 GLU n 
1 209 GLY n 
1 210 LYS n 
1 211 LYS n 
1 212 LYS n 
1 213 ILE n 
1 214 ALA n 
1 215 ILE n 
1 216 ILE n 
1 217 THR n 
1 218 SER n 
1 219 GLY n 
1 220 GLY n 
1 221 ASP n 
1 222 ALA n 
1 223 PRO n 
1 224 GLY n 
1 225 MET n 
1 226 ASN n 
1 227 ALA n 
1 228 ALA n 
1 229 VAL n 
1 230 ARG n 
1 231 ALA n 
1 232 VAL n 
1 233 THR n 
1 234 ARG n 
1 235 ALA n 
1 236 GLY n 
1 237 ILE n 
1 238 PHE n 
1 239 TYR n 
1 240 GLY n 
1 241 CYS n 
1 242 LYS n 
1 243 VAL n 
1 244 TYR n 
1 245 ALA n 
1 246 CYS n 
1 247 TYR n 
1 248 GLU n 
1 249 GLY n 
1 250 TYR n 
1 251 THR n 
1 252 GLY n 
1 253 LEU n 
1 254 VAL n 
1 255 LYS n 
1 256 GLY n 
1 257 GLY n 
1 258 ASP n 
1 259 MET n 
1 260 LEU n 
1 261 LYS n 
1 262 GLU n 
1 263 LEU n 
1 264 GLN n 
1 265 TRP n 
1 266 GLN n 
1 267 ASP n 
1 268 VAL n 
1 269 ARG n 
1 270 GLY n 
1 271 LEU n 
1 272 LEU n 
1 273 SER n 
1 274 ILE n 
1 275 GLY n 
1 276 GLY n 
1 277 THR n 
1 278 ILE n 
1 279 ILE n 
1 280 GLY n 
1 281 THR n 
1 282 ALA n 
1 283 ARG n 
1 284 CYS n 
1 285 LYS n 
1 286 GLU n 
1 287 PHE n 
1 288 ARG n 
1 289 GLU n 
1 290 ARG n 
1 291 TRP n 
1 292 GLY n 
1 293 ARG n 
1 294 LEU n 
1 295 GLN n 
1 296 ALA n 
1 297 CYS n 
1 298 TYR n 
1 299 ASN n 
1 300 MET n 
1 301 VAL n 
1 302 SER n 
1 303 ASN n 
1 304 GLY n 
1 305 ILE n 
1 306 ASP n 
1 307 ALA n 
1 308 LEU n 
1 309 VAL n 
1 310 VAL n 
1 311 CYS n 
1 312 GLY n 
1 313 GLY n 
1 314 ASP n 
1 315 GLY n 
1 316 SER n 
1 317 LEU n 
1 318 THR n 
1 319 GLY n 
1 320 ALA n 
1 321 ASP n 
1 322 LEU n 
1 323 PHE n 
1 324 ARG n 
1 325 LYS n 
1 326 GLU n 
1 327 TRP n 
1 328 PRO n 
1 329 GLU n 
1 330 LEU n 
1 331 ILE n 
1 332 LYS n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 GLY n 
1 337 GLU n 
1 338 ASP n 
1 339 LYS n 
1 340 ILE n 
1 341 THR n 
1 342 LYS n 
1 343 GLU n 
1 344 GLN n 
1 345 TYR n 
1 346 GLU n 
1 347 THR n 
1 348 HIS n 
1 349 ARG n 
1 350 ASN n 
1 351 LEU n 
1 352 THR n 
1 353 ILE n 
1 354 VAL n 
1 355 GLY n 
1 356 LEU n 
1 357 VAL n 
1 358 GLY n 
1 359 SER n 
1 360 ILE n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 MET n 
1 365 CYS n 
1 366 GLY n 
1 367 THR n 
1 368 ASP n 
1 369 SER n 
1 370 THR n 
1 371 ILE n 
1 372 GLY n 
1 373 ALA n 
1 374 TYR n 
1 375 SER n 
1 376 SER n 
1 377 LEU n 
1 378 GLU n 
1 379 ARG n 
1 380 ILE n 
1 381 ILE n 
1 382 GLU n 
1 383 LEU n 
1 384 VAL n 
1 385 ASP n 
1 386 TYR n 
1 387 ILE n 
1 388 ASP n 
1 389 ALA n 
1 390 THR n 
1 391 ALA n 
1 392 ALA n 
1 393 SER n 
1 394 HIS n 
1 395 SER n 
1 396 ARG n 
1 397 ALA n 
1 398 PHE n 
1 399 VAL n 
1 400 VAL n 
1 401 GLU n 
1 402 VAL n 
1 403 MET n 
1 404 GLY n 
1 405 ARG n 
1 406 HIS n 
1 407 CYS n 
1 408 GLY n 
1 409 TRP n 
1 410 LEU n 
1 411 GLY n 
1 412 LEU n 
1 413 MET n 
1 414 SER n 
1 415 GLY n 
1 416 ILE n 
1 417 ALA n 
1 418 THR n 
1 419 GLY n 
1 420 ALA n 
1 421 ASP n 
1 422 TYR n 
1 423 ILE n 
1 424 PHE n 
1 425 ILE n 
1 426 PRO n 
1 427 GLU n 
1 428 ARG n 
1 429 PRO n 
1 430 PRO n 
1 431 SER n 
1 432 GLU n 
1 433 SER n 
1 434 ASN n 
1 435 TRP n 
1 436 LYS n 
1 437 ASP n 
1 438 ASP n 
1 439 LEU n 
1 440 LYS n 
1 441 LYS n 
1 442 VAL n 
1 443 CYS n 
1 444 LEU n 
1 445 ARG n 
1 446 HIS n 
1 447 ARG n 
1 448 GLU n 
1 449 LYS n 
1 450 GLY n 
1 451 ARG n 
1 452 ARG n 
1 453 LYS n 
1 454 THR n 
1 455 THR n 
1 456 VAL n 
1 457 ILE n 
1 458 VAL n 
1 459 ALA n 
1 460 GLU n 
1 461 GLY n 
1 462 ALA n 
1 463 ILE n 
1 464 ASP n 
1 465 ASP n 
1 466 GLN n 
1 467 LEU n 
1 468 ASN n 
1 469 PRO n 
1 470 ILE n 
1 471 THR n 
1 472 SER n 
1 473 GLU n 
1 474 GLU n 
1 475 VAL n 
1 476 LYS n 
1 477 ASP n 
1 478 VAL n 
1 479 LEU n 
1 480 VAL n 
1 481 GLU n 
1 482 ILE n 
1 483 GLY n 
1 484 LEU n 
1 485 ASP n 
1 486 THR n 
1 487 ARG n 
1 488 ILE n 
1 489 THR n 
1 490 ARG n 
1 491 LEU n 
1 492 GLY n 
1 493 HIS n 
1 494 VAL n 
1 495 GLN n 
1 496 ARG n 
1 497 GLY n 
1 498 GLY n 
1 499 ALA n 
1 500 PRO n 
1 501 CYS n 
1 502 ALA n 
1 503 PHE n 
1 504 ASP n 
1 505 ARG n 
1 506 PHE n 
1 507 LEU n 
1 508 ALA n 
1 509 THR n 
1 510 VAL n 
1 511 GLN n 
1 512 GLY n 
1 513 VAL n 
1 514 ASP n 
1 515 ALA n 
1 516 VAL n 
1 517 ARG n 
1 518 ALA n 
1 519 VAL n 
1 520 LEU n 
1 521 GLU n 
1 522 SER n 
1 523 THR n 
1 524 PRO n 
1 525 ALA n 
1 526 ILE n 
1 527 PRO n 
1 528 SER n 
1 529 PRO n 
1 530 VAL n 
1 531 ILE n 
1 532 SER n 
1 533 ILE n 
1 534 LEU n 
1 535 GLU n 
1 536 ASN n 
1 537 LYS n 
1 538 ILE n 
1 539 VAL n 
1 540 ARG n 
1 541 GLN n 
1 542 PRO n 
1 543 LEU n 
1 544 VAL n 
1 545 GLU n 
1 546 SER n 
1 547 VAL n 
1 548 ALA n 
1 549 GLN n 
1 550 THR n 
1 551 LYS n 
1 552 THR n 
1 553 VAL n 
1 554 SER n 
1 555 ALA n 
1 556 ALA n 
1 557 ILE n 
1 558 GLU n 
1 559 ALA n 
1 560 LYS n 
1 561 ASP n 
1 562 PHE n 
1 563 ASP n 
1 564 LYS n 
1 565 ALA n 
1 566 LEU n 
1 567 GLN n 
1 568 LEU n 
1 569 ARG n 
1 570 ASP n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 ALA n 
1 575 THR n 
1 576 SER n 
1 577 TYR n 
1 578 GLU n 
1 579 ASN n 
1 580 PHE n 
1 581 LEU n 
1 582 SER n 
1 583 VAL n 
1 584 SER n 
1 585 LYS n 
1 586 TYR n 
1 587 ASP n 
1 588 ASP n 
1 589 GLY n 
1 590 SER n 
1 591 TYR n 
1 592 LEU n 
1 593 VAL n 
1 594 PRO n 
1 595 GLU n 
1 596 SER n 
1 597 SER n 
1 598 ARG n 
1 599 LEU n 
1 600 ASN n 
1 601 ILE n 
1 602 ALA n 
1 603 ILE n 
1 604 ILE n 
1 605 HIS n 
1 606 VAL n 
1 607 GLY n 
1 608 ALA n 
1 609 PRO n 
1 610 THR n 
1 611 SER n 
1 612 ALA n 
1 613 LEU n 
1 614 ASN n 
1 615 PRO n 
1 616 ALA n 
1 617 THR n 
1 618 ARG n 
1 619 VAL n 
1 620 ALA n 
1 621 THR n 
1 622 LEU n 
1 623 ASN n 
1 624 SER n 
1 625 LEU n 
1 626 ALA n 
1 627 LYS n 
1 628 GLY n 
1 629 HIS n 
1 630 ARG n 
1 631 VAL n 
1 632 PHE n 
1 633 ALA n 
1 634 ILE n 
1 635 ARG n 
1 636 ASN n 
1 637 GLY n 
1 638 PHE n 
1 639 ALA n 
1 640 GLY n 
1 641 LEU n 
1 642 ILE n 
1 643 ARG n 
1 644 HIS n 
1 645 GLY n 
1 646 ALA n 
1 647 VAL n 
1 648 ARG n 
1 649 GLU n 
1 650 LEU n 
1 651 ASN n 
1 652 TRP n 
1 653 ILE n 
1 654 ASP n 
1 655 VAL n 
1 656 GLU n 
1 657 ASP n 
1 658 TRP n 
1 659 HIS n 
1 660 ASN n 
1 661 THR n 
1 662 GLY n 
1 663 GLY n 
1 664 SER n 
1 665 GLU n 
1 666 ILE n 
1 667 GLY n 
1 668 THR n 
1 669 ASN n 
1 670 ARG n 
1 671 SER n 
1 672 LEU n 
1 673 PRO n 
1 674 SER n 
1 675 ASP n 
1 676 ASP n 
1 677 MET n 
1 678 GLY n 
1 679 THR n 
1 680 VAL n 
1 681 ALA n 
1 682 TYR n 
1 683 TYR n 
1 684 PHE n 
1 685 GLN n 
1 686 GLN n 
1 687 TYR n 
1 688 LYS n 
1 689 PHE n 
1 690 ASP n 
1 691 GLY n 
1 692 LEU n 
1 693 ILE n 
1 694 ILE n 
1 695 ILE n 
1 696 GLY n 
1 697 GLY n 
1 698 PHE n 
1 699 GLU n 
1 700 ALA n 
1 701 PHE n 
1 702 THR n 
1 703 ALA n 
1 704 LEU n 
1 705 TYR n 
1 706 GLU n 
1 707 LEU n 
1 708 ASP n 
1 709 ALA n 
1 710 ALA n 
1 711 ARG n 
1 712 ALA n 
1 713 GLN n 
1 714 TYR n 
1 715 PRO n 
1 716 ILE n 
1 717 PHE n 
1 718 ASN n 
1 719 ILE n 
1 720 PRO n 
1 721 MET n 
1 722 CYS n 
1 723 CYS n 
1 724 LEU n 
1 725 PRO n 
1 726 ALA n 
1 727 THR n 
1 728 VAL n 
1 729 SER n 
1 730 ASN n 
1 731 ASN n 
1 732 VAL n 
1 733 PRO n 
1 734 GLY n 
1 735 THR n 
1 736 GLU n 
1 737 TYR n 
1 738 SER n 
1 739 LEU n 
1 740 GLY n 
1 741 SER n 
1 742 ASP n 
1 743 THR n 
1 744 CYS n 
1 745 LEU n 
1 746 ASN n 
1 747 THR n 
1 748 LEU n 
1 749 SER n 
1 750 GLY n 
1 751 TYR n 
1 752 CYS n 
1 753 ASP n 
1 754 ALA n 
1 755 VAL n 
1 756 LYS n 
1 757 GLN n 
1 758 SER n 
1 759 ALA n 
1 760 SER n 
1 761 ALA n 
1 762 SER n 
1 763 ARG n 
1 764 ARG n 
1 765 ARG n 
1 766 THR n 
1 767 PHE n 
1 768 VAL n 
1 769 VAL n 
1 770 GLU n 
1 771 VAL n 
1 772 GLN n 
1 773 GLY n 
1 774 GLY n 
1 775 TYR n 
1 776 SER n 
1 777 GLY n 
1 778 TYR n 
1 779 LEU n 
1 780 ALA n 
1 781 SER n 
1 782 TYR n 
1 783 ALA n 
1 784 GLY n 
1 785 LEU n 
1 786 ILE n 
1 787 THR n 
1 788 GLY n 
1 789 ALA n 
1 790 LEU n 
1 791 ALA n 
1 792 VAL n 
1 793 TYR n 
1 794 THR n 
1 795 PRO n 
1 796 GLU n 
1 797 ASN n 
1 798 PRO n 
1 799 ILE n 
1 800 ASN n 
1 801 LEU n 
1 802 GLN n 
1 803 THR n 
1 804 VAL n 
1 805 GLN n 
1 806 GLU n 
1 807 ASP n 
1 808 ILE n 
1 809 GLU n 
1 810 LEU n 
1 811 LEU n 
1 812 THR n 
1 813 ARG n 
1 814 THR n 
1 815 TYR n 
1 816 GLU n 
1 817 GLU n 
1 818 ASP n 
1 819 ASP n 
1 820 GLY n 
1 821 LYS n 
1 822 ASN n 
1 823 ARG n 
1 824 SER n 
1 825 GLY n 
1 826 LYS n 
1 827 ILE n 
1 828 PHE n 
1 829 ILE n 
1 830 HIS n 
1 831 ASN n 
1 832 GLU n 
1 833 LYS n 
1 834 ALA n 
1 835 SER n 
1 836 LYS n 
1 837 VAL n 
1 838 TYR n 
1 839 THR n 
1 840 THR n 
1 841 ASP n 
1 842 LEU n 
1 843 ILE n 
1 844 ALA n 
1 845 ALA n 
1 846 ILE n 
1 847 ILE n 
1 848 GLY n 
1 849 GLU n 
1 850 ALA n 
1 851 GLY n 
1 852 LYS n 
1 853 GLY n 
1 854 ARG n 
1 855 PHE n 
1 856 GLU n 
1 857 SER n 
1 858 ARG n 
1 859 THR n 
1 860 ALA n 
1 861 VAL n 
1 862 PRO n 
1 863 GLY n 
1 864 HIS n 
1 865 VAL n 
1 866 GLN n 
1 867 GLN n 
1 868 GLY n 
1 869 LYS n 
1 870 SER n 
1 871 PRO n 
1 872 SER n 
1 873 SER n 
1 874 ILE n 
1 875 ASP n 
1 876 ARG n 
1 877 VAL n 
1 878 ASN n 
1 879 ALA n 
1 880 CYS n 
1 881 ARG n 
1 882 LEU n 
1 883 ALA n 
1 884 ILE n 
1 885 LYS n 
1 886 CYS n 
1 887 CYS n 
1 888 ASN n 
1 889 PHE n 
1 890 ILE n 
1 891 GLU n 
1 892 ASP n 
1 893 ALA n 
1 894 ASN n 
1 895 PHE n 
1 896 GLN n 
1 897 VAL n 
1 898 LYS n 
1 899 HIS n 
1 900 ASN n 
1 901 ALA n 
1 902 ASN n 
1 903 LEU n 
1 904 SER n 
1 905 ALA n 
1 906 ASP n 
1 907 GLU n 
1 908 ARG n 
1 909 HIS n 
1 910 LEU n 
1 911 ARG n 
1 912 PHE n 
1 913 PHE n 
1 914 TYR n 
1 915 ASP n 
1 916 ASP n 
1 917 GLY n 
1 918 VAL n 
1 919 LYS n 
1 920 THR n 
1 921 SER n 
1 922 ALA n 
1 923 VAL n 
1 924 SER n 
1 925 GLY n 
1 926 LYS n 
1 927 SER n 
1 928 SER n 
1 929 VAL n 
1 930 ILE n 
1 931 ASP n 
1 932 ASP n 
1 933 ASN n 
1 934 THR n 
1 935 SER n 
1 936 VAL n 
1 937 VAL n 
1 938 ILE n 
1 939 GLY n 
1 940 ILE n 
1 941 GLN n 
1 942 GLY n 
1 943 SER n 
1 944 GLU n 
1 945 VAL n 
1 946 THR n 
1 947 PHE n 
1 948 THR n 
1 949 PRO n 
1 950 VAL n 
1 951 LYS n 
1 952 GLN n 
1 953 LEU n 
1 954 TRP n 
1 955 GLU n 
1 956 ASN n 
1 957 GLU n 
1 958 THR n 
1 959 HIS n 
1 960 HIS n 
1 961 LYS n 
1 962 TRP n 
1 963 ARG n 
1 964 LYS n 
1 965 GLY n 
1 966 LYS n 
1 967 ASN n 
1 968 VAL n 
1 969 HIS n 
1 970 TRP n 
1 971 GLU n 
1 972 GLN n 
1 973 LEU n 
1 974 ASN n 
1 975 ILE n 
1 976 VAL n 
1 977 SER n 
1 978 ASP n 
1 979 LEU n 
1 980 LEU n 
1 981 SER n 
1 982 GLY n 
1 983 ARG n 
1 984 LEU n 
1 985 SER n 
1 986 ILE n 
1 987 ARG n 
1 988 THR n 
1 989 THR n 
2 1   MET n 
2 2   PRO n 
2 3   ASP n 
2 4   ALA n 
2 5   SER n 
2 6   LEU n 
2 7   PHE n 
2 8   ASN n 
2 9   GLY n 
2 10  THR n 
2 11  SER n 
2 12  PHE n 
2 13  ILE n 
2 14  THR n 
2 15  LEU n 
2 16  PHE n 
2 17  ALA n 
2 18  PRO n 
2 19  ASN n 
2 20  ILE n 
2 21  SER n 
2 22  LEU n 
2 23  LEU n 
2 24  GLN n 
2 25  ALA n 
2 26  SER n 
2 27  ILE n 
2 28  ASP n 
2 29  PHE n 
2 30  TYR n 
2 31  THR n 
2 32  ASN n 
2 33  PHE n 
2 34  LEU n 
2 35  GLY n 
2 36  PHE n 
2 37  ALA n 
2 38  ILE n 
2 39  ARG n 
2 40  LYS n 
2 41  ASN n 
2 42  SER n 
2 43  ASN n 
2 44  GLN n 
2 45  LYS n 
2 46  LEU n 
2 47  PHE n 
2 48  TRP n 
2 49  LEU n 
2 50  GLN n 
2 51  LEU n 
2 52  GLU n 
2 53  GLU n 
2 54  ASP n 
2 55  GLN n 
2 56  ASN n 
2 57  ASN n 
2 58  VAL n 
2 59  SER n 
2 60  ILE n 
2 61  GLN n 
2 62  LEU n 
2 63  ILE n 
2 64  LEU n 
2 65  ASP n 
2 66  PRO n 
2 67  GLU n 
2 68  HIS n 
2 69  ALA n 
2 70  ALA n 
2 71  SER n 
2 72  VAL n 
2 73  SER n 
2 74  GLN n 
2 75  ILE n 
2 76  ASP n 
2 77  GLN n 
2 78  ASN n 
2 79  ILE n 
2 80  ARG n 
2 81  ASN n 
2 82  LEU n 
2 83  THR n 
2 84  ARG n 
2 85  SER n 
2 86  LEU n 
2 87  TYR n 
2 88  ARG n 
2 89  LYS n 
2 90  ASP n 
2 91  TRP n 
2 92  ARG n 
2 93  SER n 
2 94  ILE n 
2 95  GLN n 
2 96  SER n 
2 97  ASN n 
2 98  ILE n 
2 99  ALA n 
2 100 PHE n 
2 101 LYS n 
2 102 SER n 
2 103 SER n 
2 104 SER n 
2 105 LEU n 
2 106 SER n 
2 107 LYS n 
2 108 LEU n 
2 109 VAL n 
2 110 LYS n 
2 111 LEU n 
2 112 LEU n 
2 113 LYS n 
2 114 ASP n 
2 115 GLY n 
2 116 GLY n 
2 117 HIS n 
2 118 PRO n 
2 119 VAL n 
2 120 GLN n 
2 121 GLN n 
2 122 SER n 
2 123 PRO n 
2 124 ASN n 
2 125 GLU n 
2 126 ILE n 
2 127 SER n 
2 128 PRO n 
2 129 PHE n 
2 130 GLU n 
2 131 VAL n 
2 132 TYR n 
2 133 THR n 
2 134 VAL n 
2 135 ASP n 
2 136 PRO n 
2 137 LEU n 
2 138 GLY n 
2 139 SER n 
2 140 LEU n 
2 141 ILE n 
2 142 GLY n 
2 143 PHE n 
2 144 SER n 
2 145 GLY n 
2 146 PHE n 
2 147 LYS n 
2 148 ASN n 
2 149 PRO n 
2 150 PHE n 
2 151 ALA n 
2 152 VAL n 
2 153 ASN n 
2 154 GLU n 
2 155 ARG n 
2 156 SER n 
2 157 LEU n 
2 158 LEU n 
2 159 PRO n 
2 160 LYS n 
2 161 VAL n 
2 162 SER n 
2 163 GLU n 
2 164 GLU n 
2 165 LYS n 
2 166 ALA n 
2 167 TYR n 
2 168 ARG n 
2 169 ALA n 
2 170 GLU n 
2 171 ASP n 
2 172 ASP n 
2 173 SER n 
2 174 GLU n 
2 175 LYS n 
2 176 LEU n 
2 177 LEU n 
2 178 ASN n 
2 179 PRO n 
2 180 VAL n 
2 181 ARG n 
2 182 LYS n 
2 183 THR n 
2 184 ILE n 
2 185 GLY n 
2 186 VAL n 
2 187 MET n 
2 188 THR n 
2 189 SER n 
2 190 GLY n 
2 191 GLY n 
2 192 ASP n 
2 193 SER n 
2 194 PRO n 
2 195 GLY n 
2 196 MET n 
2 197 ASN n 
2 198 PRO n 
2 199 PHE n 
2 200 VAL n 
2 201 ARG n 
2 202 ALA n 
2 203 VAL n 
2 204 VAL n 
2 205 ARG n 
2 206 ALA n 
2 207 GLY n 
2 208 ILE n 
2 209 TYR n 
2 210 LYS n 
2 211 GLY n 
2 212 CYS n 
2 213 LYS n 
2 214 VAL n 
2 215 PHE n 
2 216 CYS n 
2 217 ILE n 
2 218 HIS n 
2 219 GLU n 
2 220 GLY n 
2 221 TYR n 
2 222 GLU n 
2 223 GLY n 
2 224 LEU n 
2 225 VAL n 
2 226 ARG n 
2 227 GLY n 
2 228 GLY n 
2 229 GLU n 
2 230 LYS n 
2 231 TYR n 
2 232 ILE n 
2 233 LYS n 
2 234 GLU n 
2 235 THR n 
2 236 GLN n 
2 237 TRP n 
2 238 HIS n 
2 239 ASP n 
2 240 VAL n 
2 241 ARG n 
2 242 GLY n 
2 243 TRP n 
2 244 LEU n 
2 245 VAL n 
2 246 GLU n 
2 247 GLY n 
2 248 GLY n 
2 249 THR n 
2 250 ASN n 
2 251 ILE n 
2 252 GLY n 
2 253 THR n 
2 254 ALA n 
2 255 ARG n 
2 256 CYS n 
2 257 LYS n 
2 258 GLU n 
2 259 PHE n 
2 260 ARG n 
2 261 GLU n 
2 262 ARG n 
2 263 SER n 
2 264 GLY n 
2 265 ARG n 
2 266 LEU n 
2 267 LYS n 
2 268 ALA n 
2 269 CYS n 
2 270 LYS n 
2 271 ASN n 
2 272 MET n 
2 273 ILE n 
2 274 ASP n 
2 275 MET n 
2 276 GLY n 
2 277 ILE n 
2 278 ASP n 
2 279 ALA n 
2 280 LEU n 
2 281 ILE n 
2 282 VAL n 
2 283 CYS n 
2 284 GLY n 
2 285 GLY n 
2 286 ASP n 
2 287 GLY n 
2 288 SER n 
2 289 LEU n 
2 290 THR n 
2 291 GLY n 
2 292 ALA n 
2 293 ASP n 
2 294 ARG n 
2 295 PHE n 
2 296 ARG n 
2 297 SER n 
2 298 GLU n 
2 299 TRP n 
2 300 PRO n 
2 301 SER n 
2 302 LEU n 
2 303 ILE n 
2 304 GLU n 
2 305 GLU n 
2 306 LEU n 
2 307 LEU n 
2 308 GLN n 
2 309 THR n 
2 310 GLU n 
2 311 GLN n 
2 312 ILE n 
2 313 SER n 
2 314 GLN n 
2 315 GLN n 
2 316 GLN n 
2 317 PHE n 
2 318 ASN n 
2 319 THR n 
2 320 HIS n 
2 321 GLN n 
2 322 ASN n 
2 323 LEU n 
2 324 ASN n 
2 325 ILE n 
2 326 CYS n 
2 327 GLY n 
2 328 ALA n 
2 329 VAL n 
2 330 GLY n 
2 331 SER n 
2 332 ILE n 
2 333 ASP n 
2 334 ASN n 
2 335 ASP n 
2 336 MET n 
2 337 SER n 
2 338 SER n 
2 339 THR n 
2 340 ASP n 
2 341 ALA n 
2 342 THR n 
2 343 ILE n 
2 344 GLY n 
2 345 ALA n 
2 346 PHE n 
2 347 SER n 
2 348 SER n 
2 349 LEU n 
2 350 ASP n 
2 351 ARG n 
2 352 ILE n 
2 353 CYS n 
2 354 ARG n 
2 355 ALA n 
2 356 ILE n 
2 357 ASP n 
2 358 TYR n 
2 359 ILE n 
2 360 ASP n 
2 361 ALA n 
2 362 THR n 
2 363 ALA n 
2 364 ASN n 
2 365 SER n 
2 366 HIS n 
2 367 SER n 
2 368 ARG n 
2 369 ALA n 
2 370 PHE n 
2 371 ILE n 
2 372 VAL n 
2 373 GLU n 
2 374 VAL n 
2 375 MET n 
2 376 GLY n 
2 377 ARG n 
2 378 HIS n 
2 379 CYS n 
2 380 GLY n 
2 381 TRP n 
2 382 LEU n 
2 383 GLY n 
2 384 LEU n 
2 385 LEU n 
2 386 ALA n 
2 387 GLY n 
2 388 LEU n 
2 389 ALA n 
2 390 THR n 
2 391 SER n 
2 392 ALA n 
2 393 ASP n 
2 394 TYR n 
2 395 ILE n 
2 396 LEU n 
2 397 ILE n 
2 398 PRO n 
2 399 GLU n 
2 400 LYS n 
2 401 PRO n 
2 402 ALA n 
2 403 SER n 
2 404 SER n 
2 405 ARG n 
2 406 GLU n 
2 407 TRP n 
2 408 GLN n 
2 409 ASP n 
2 410 GLN n 
2 411 MET n 
2 412 CYS n 
2 413 ASP n 
2 414 ILE n 
2 415 VAL n 
2 416 GLY n 
2 417 LYS n 
2 418 HIS n 
2 419 ARG n 
2 420 ALA n 
2 421 ARG n 
2 422 GLY n 
2 423 LYS n 
2 424 ARG n 
2 425 LYS n 
2 426 THR n 
2 427 ILE n 
2 428 VAL n 
2 429 ILE n 
2 430 VAL n 
2 431 ALA n 
2 432 GLU n 
2 433 GLY n 
2 434 ALA n 
2 435 ILE n 
2 436 SER n 
2 437 ASN n 
2 438 ASP n 
2 439 LEU n 
2 440 SER n 
2 441 PRO n 
2 442 ILE n 
2 443 SER n 
2 444 CYS n 
2 445 ASP n 
2 446 GLN n 
2 447 VAL n 
2 448 LYS n 
2 449 ASP n 
2 450 VAL n 
2 451 LEU n 
2 452 VAL n 
2 453 ASN n 
2 454 ARG n 
2 455 LEU n 
2 456 GLY n 
2 457 LEU n 
2 458 ASP n 
2 459 THR n 
2 460 ARG n 
2 461 VAL n 
2 462 THR n 
2 463 THR n 
2 464 LEU n 
2 465 GLY n 
2 466 HIS n 
2 467 VAL n 
2 468 GLN n 
2 469 ARG n 
2 470 GLY n 
2 471 GLY n 
2 472 THR n 
2 473 ALA n 
2 474 VAL n 
2 475 ALA n 
2 476 PHE n 
2 477 ASP n 
2 478 ARG n 
2 479 ILE n 
2 480 TYR n 
2 481 ALA n 
2 482 THR n 
2 483 LEU n 
2 484 GLN n 
2 485 GLY n 
2 486 VAL n 
2 487 GLU n 
2 488 ALA n 
2 489 VAL n 
2 490 ASN n 
2 491 ALA n 
2 492 VAL n 
2 493 LEU n 
2 494 GLU n 
2 495 CYS n 
2 496 ASP n 
2 497 ALA n 
2 498 ASP n 
2 499 THR n 
2 500 PRO n 
2 501 SER n 
2 502 PRO n 
2 503 MET n 
2 504 ILE n 
2 505 ALA n 
2 506 ILE n 
2 507 LYS n 
2 508 GLU n 
2 509 ASP n 
2 510 GLN n 
2 511 ILE n 
2 512 THR n 
2 513 ARG n 
2 514 VAL n 
2 515 PRO n 
2 516 LEU n 
2 517 VAL n 
2 518 ASP n 
2 519 ALA n 
2 520 VAL n 
2 521 GLU n 
2 522 LEU n 
2 523 THR n 
2 524 GLN n 
2 525 GLN n 
2 526 VAL n 
2 527 ALA n 
2 528 LYS n 
2 529 SER n 
2 530 ILE n 
2 531 GLU n 
2 532 SER n 
2 533 ARG n 
2 534 ASN n 
2 535 PHE n 
2 536 LYS n 
2 537 LYS n 
2 538 ALA n 
2 539 ILE n 
2 540 SER n 
2 541 LEU n 
2 542 ARG n 
2 543 ASP n 
2 544 SER n 
2 545 GLU n 
2 546 PHE n 
2 547 VAL n 
2 548 GLU n 
2 549 HIS n 
2 550 MET n 
2 551 LYS n 
2 552 ASN n 
2 553 PHE n 
2 554 ILE n 
2 555 SER n 
2 556 THR n 
2 557 ASN n 
2 558 SER n 
2 559 ALA n 
2 560 ASP n 
2 561 HIS n 
2 562 VAL n 
2 563 PRO n 
2 564 PRO n 
2 565 SER n 
2 566 LEU n 
2 567 PRO n 
2 568 LEU n 
2 569 GLU n 
2 570 LYS n 
2 571 ARG n 
2 572 LYS n 
2 573 LYS n 
2 574 ILE n 
2 575 ALA n 
2 576 ILE n 
2 577 ILE n 
2 578 ASN n 
2 579 VAL n 
2 580 GLY n 
2 581 ALA n 
2 582 PRO n 
2 583 ALA n 
2 584 GLY n 
2 585 GLY n 
2 586 MET n 
2 587 ASN n 
2 588 SER n 
2 589 ALA n 
2 590 VAL n 
2 591 TYR n 
2 592 SER n 
2 593 MET n 
2 594 ALA n 
2 595 THR n 
2 596 TYR n 
2 597 CYS n 
2 598 MET n 
2 599 SER n 
2 600 ARG n 
2 601 GLY n 
2 602 HIS n 
2 603 VAL n 
2 604 PRO n 
2 605 TYR n 
2 606 ALA n 
2 607 ILE n 
2 608 HIS n 
2 609 ASN n 
2 610 GLY n 
2 611 PHE n 
2 612 SER n 
2 613 GLY n 
2 614 LEU n 
2 615 ALA n 
2 616 ARG n 
2 617 HIS n 
2 618 GLU n 
2 619 SER n 
2 620 VAL n 
2 621 ARG n 
2 622 SER n 
2 623 ILE n 
2 624 ASN n 
2 625 TRP n 
2 626 LEU n 
2 627 ASP n 
2 628 ILE n 
2 629 GLU n 
2 630 GLY n 
2 631 TRP n 
2 632 GLY n 
2 633 SER n 
2 634 LEU n 
2 635 GLY n 
2 636 GLY n 
2 637 SER n 
2 638 GLU n 
2 639 ILE n 
2 640 GLY n 
2 641 THR n 
2 642 ASN n 
2 643 ARG n 
2 644 THR n 
2 645 LEU n 
2 646 PRO n 
2 647 ASN n 
2 648 ASP n 
2 649 ALA n 
2 650 ASP n 
2 651 ILE n 
2 652 GLY n 
2 653 MET n 
2 654 ILE n 
2 655 ALA n 
2 656 TYR n 
2 657 PHE n 
2 658 PHE n 
2 659 GLU n 
2 660 LYS n 
2 661 TYR n 
2 662 GLY n 
2 663 PHE n 
2 664 ASP n 
2 665 GLY n 
2 666 LEU n 
2 667 ILE n 
2 668 LEU n 
2 669 VAL n 
2 670 GLY n 
2 671 GLY n 
2 672 PHE n 
2 673 GLU n 
2 674 ALA n 
2 675 PHE n 
2 676 ILE n 
2 677 SER n 
2 678 LEU n 
2 679 HIS n 
2 680 GLN n 
2 681 LEU n 
2 682 GLU n 
2 683 ARG n 
2 684 ALA n 
2 685 ARG n 
2 686 ILE n 
2 687 ASN n 
2 688 TYR n 
2 689 PRO n 
2 690 SER n 
2 691 LEU n 
2 692 ARG n 
2 693 ILE n 
2 694 PRO n 
2 695 LEU n 
2 696 VAL n 
2 697 LEU n 
2 698 ILE n 
2 699 PRO n 
2 700 ALA n 
2 701 THR n 
2 702 ILE n 
2 703 SER n 
2 704 ASN n 
2 705 ASN n 
2 706 VAL n 
2 707 PRO n 
2 708 GLY n 
2 709 THR n 
2 710 GLU n 
2 711 TYR n 
2 712 SER n 
2 713 LEU n 
2 714 GLY n 
2 715 SER n 
2 716 ASP n 
2 717 THR n 
2 718 CYS n 
2 719 LEU n 
2 720 ASN n 
2 721 SER n 
2 722 PHE n 
2 723 MET n 
2 724 GLU n 
2 725 TYR n 
2 726 CYS n 
2 727 ASP n 
2 728 VAL n 
2 729 ILE n 
2 730 LYS n 
2 731 GLN n 
2 732 SER n 
2 733 ALA n 
2 734 ALA n 
2 735 ALA n 
2 736 THR n 
2 737 ARG n 
2 738 ASN n 
2 739 ARG n 
2 740 VAL n 
2 741 PHE n 
2 742 VAL n 
2 743 VAL n 
2 744 GLU n 
2 745 VAL n 
2 746 GLN n 
2 747 GLY n 
2 748 GLY n 
2 749 ASN n 
2 750 SER n 
2 751 GLY n 
2 752 TYR n 
2 753 ILE n 
2 754 ALA n 
2 755 THR n 
2 756 HIS n 
2 757 ALA n 
2 758 GLN n 
2 759 LEU n 
2 760 ALA n 
2 761 CYS n 
2 762 GLY n 
2 763 ALA n 
2 764 GLN n 
2 765 ILE n 
2 766 SER n 
2 767 TYR n 
2 768 VAL n 
2 769 PRO n 
2 770 GLU n 
2 771 GLU n 
2 772 GLY n 
2 773 ILE n 
2 774 SER n 
2 775 LEU n 
2 776 ALA n 
2 777 GLN n 
2 778 LEU n 
2 779 GLU n 
2 780 MET n 
2 781 ASP n 
2 782 ILE n 
2 783 ASN n 
2 784 SER n 
2 785 LEU n 
2 786 LYS n 
2 787 GLU n 
2 788 SER n 
2 789 PHE n 
2 790 ALA n 
2 791 ASN n 
2 792 ASP n 
2 793 GLN n 
2 794 GLY n 
2 795 LYS n 
2 796 THR n 
2 797 LYS n 
2 798 SER n 
2 799 GLY n 
2 800 ARG n 
2 801 LEU n 
2 802 ILE n 
2 803 LEU n 
2 804 LYS n 
2 805 SER n 
2 806 GLU n 
2 807 ASN n 
2 808 ALA n 
2 809 SER n 
2 810 LYS n 
2 811 VAL n 
2 812 LEU n 
2 813 THR n 
2 814 THR n 
2 815 GLU n 
2 816 VAL n 
2 817 ILE n 
2 818 SER n 
2 819 THR n 
2 820 ILE n 
2 821 ILE n 
2 822 ASP n 
2 823 ASP n 
2 824 GLU n 
2 825 ALA n 
2 826 SER n 
2 827 GLY n 
2 828 ARG n 
2 829 PHE n 
2 830 ASP n 
2 831 SER n 
2 832 LYS n 
2 833 THR n 
2 834 ALA n 
2 835 ILE n 
2 836 PRO n 
2 837 GLY n 
2 838 HIS n 
2 839 VAL n 
2 840 GLN n 
2 841 GLN n 
2 842 GLY n 
2 843 GLY n 
2 844 ILE n 
2 845 PRO n 
2 846 SER n 
2 847 PRO n 
2 848 MET n 
2 849 ASP n 
2 850 ARG n 
2 851 VAL n 
2 852 ARG n 
2 853 ALA n 
2 854 SER n 
2 855 ARG n 
2 856 PHE n 
2 857 ALA n 
2 858 ILE n 
2 859 ARG n 
2 860 ALA n 
2 861 VAL n 
2 862 SER n 
2 863 PHE n 
2 864 ILE n 
2 865 GLU n 
2 866 ARG n 
2 867 HIS n 
2 868 SER n 
2 869 ASP n 
2 870 ARG n 
2 871 CYS n 
2 872 GLN n 
2 873 THR n 
2 874 PHE n 
2 875 LYS n 
2 876 ASN n 
2 877 SER n 
2 878 ILE n 
2 879 SER n 
2 880 PHE n 
2 881 ARG n 
2 882 GLN n 
2 883 THR n 
2 884 ASP n 
2 885 GLU n 
2 886 ILE n 
2 887 THR n 
2 888 SER n 
2 889 THR n 
2 890 ALA n 
2 891 VAL n 
2 892 VAL n 
2 893 LEU n 
2 894 GLY n 
2 895 ILE n 
2 896 HIS n 
2 897 LYS n 
2 898 SER n 
2 899 GLN n 
2 900 LEU n 
2 901 ARG n 
2 902 PHE n 
2 903 THR n 
2 904 PRO n 
2 905 ILE n 
2 906 ARG n 
2 907 GLN n 
2 908 LEU n 
2 909 TYR n 
2 910 ASP n 
2 911 PHE n 
2 912 GLU n 
2 913 SER n 
2 914 ASP n 
2 915 VAL n 
2 916 PRO n 
2 917 ARG n 
2 918 ARG n 
2 919 MET n 
2 920 ARG n 
2 921 LYS n 
2 922 ASN n 
2 923 ILE n 
2 924 PHE n 
2 925 TRP n 
2 926 SER n 
2 927 ASN n 
2 928 VAL n 
2 929 ARG n 
2 930 GLU n 
2 931 ILE n 
2 932 SER n 
2 933 ASP n 
2 934 MET n 
2 935 LEU n 
2 936 SER n 
2 937 GLY n 
2 938 ARG n 
2 939 THR n 
2 940 SER n 
2 941 LEU n 
3 1   MET n 
3 2   VAL n 
3 3   THR n 
3 4   LYS n 
3 5   ASP n 
3 6   SER n 
3 7   ILE n 
3 8   ILE n 
3 9   ARG n 
3 10  ASP n 
3 11  LEU n 
3 12  GLU n 
3 13  ARG n 
3 14  GLU n 
3 15  ASN n 
3 16  VAL n 
3 17  GLY n 
3 18  PRO n 
3 19  GLU n 
3 20  PHE n 
3 21  GLY n 
3 22  GLU n 
3 23  PHE n 
3 24  LEU n 
3 25  ASN n 
3 26  THR n 
3 27  LEU n 
3 28  GLN n 
3 29  THR n 
3 30  ASP n 
3 31  LEU n 
3 32  ASN n 
3 33  SER n 
3 34  GLU n 
3 35  LYS n 
3 36  PRO n 
3 37  PRO n 
3 38  ILE n 
3 39  GLU n 
3 40  GLN n 
3 41  VAL n 
3 42  LYS n 
3 43  SER n 
3 44  GLN n 
3 45  LEU n 
3 46  GLU n 
3 47  THR n 
3 48  HIS n 
3 49  PHE n 
3 50  ASN n 
3 51  LEU n 
3 52  ALA n 
3 53  HIS n 
3 54  GLU n 
3 55  THR n 
3 56  GLN n 
3 57  GLU n 
3 58  PHE n 
3 59  SER n 
3 60  ARG n 
3 61  LYS n 
3 62  ASN n 
3 63  ASP n 
3 64  ASN n 
3 65  ALA n 
3 66  PRO n 
3 67  VAL n 
3 68  ASP n 
3 69  LYS n 
3 70  LEU n 
3 71  LEU n 
3 72  THR n 
3 73  ASN n 
3 74  TYR n 
3 75  TYR n 
3 76  ASN n 
3 77  ASN n 
3 78  TYR n 
3 79  GLU n 
3 80  VAL n 
3 81  ASN n 
3 82  VAL n 
3 83  LEU n 
3 84  GLU n 
3 85  PHE n 
3 86  VAL n 
3 87  LEU n 
3 88  GLN n 
3 89  MET n 
3 90  GLY n 
3 91  PHE n 
3 92  SER n 
3 93  ARG n 
3 94  ASP n 
3 95  LEU n 
3 96  SER n 
3 97  ILE n 
3 98  PRO n 
3 99  LEU n 
3 100 ASN n 
3 101 VAL n 
3 102 TRP n 
3 103 PHE n 
3 104 VAL n 
3 105 LEU n 
3 106 ASP n 
3 107 MET n 
3 108 ILE n 
3 109 SER n 
3 110 GLN n 
3 111 LEU n 
3 112 SER n 
3 113 THR n 
3 114 SER n 
3 115 LYS n 
3 116 GLN n 
3 117 ASP n 
3 118 LEU n 
3 119 PRO n 
3 120 LEU n 
3 121 ASP n 
3 122 TYR n 
3 123 TYR n 
3 124 LEU n 
3 125 VAL n 
3 126 LEU n 
3 127 ASN n 
3 128 ASN n 
3 129 SER n 
3 130 GLN n 
3 131 THR n 
3 132 GLY n 
3 133 LYS n 
3 134 TYR n 
3 135 SER n 
3 136 ASP n 
3 137 PHE n 
3 138 VAL n 
3 139 ARG n 
3 140 TYR n 
3 141 LEU n 
3 142 ILE n 
3 143 TYR n 
3 144 GLU n 
3 145 ALA n 
3 146 VAL n 
3 147 GLY n 
3 148 ALA n 
3 149 GLU n 
3 150 ILE n 
3 151 HIS n 
3 152 CYS n 
3 153 PHE n 
3 154 GLU n 
3 155 GLN n 
3 156 GLY n 
3 157 SER n 
3 158 MET n 
3 159 PRO n 
3 160 GLU n 
3 161 GLN n 
3 162 TYR n 
3 163 ARG n 
3 164 SER n 
3 165 SER n 
3 166 ARG n 
3 167 TRP n 
3 168 GLU n 
3 169 ASP n 
3 170 LYS n 
3 171 VAL n 
3 172 LYS n 
3 173 GLY n 
3 174 PRO n 
3 175 ALA n 
3 176 LEU n 
3 177 ALA n 
3 178 ASN n 
3 179 ARG n 
3 180 GLY n 
3 181 PRO n 
3 182 ILE n 
3 183 ARG n 
3 184 GLY n 
3 185 ASN n 
3 186 VAL n 
3 187 GLY n 
3 188 ALA n 
3 189 GLY n 
3 190 ASP n 
3 191 ARG n 
3 192 LYS n 
3 193 ILE n 
3 194 THR n 
3 195 PHE n 
3 196 HIS n 
3 197 LEU n 
3 198 LEU n 
3 199 CYS n 
3 200 LYS n 
3 201 LYS n 
3 202 THR n 
3 203 ALA n 
3 204 ARG n 
3 205 MET n 
3 206 ILE n 
3 207 LEU n 
3 208 VAL n 
3 209 GLY n 
3 210 ASP n 
3 211 ASP n 
3 212 ARG n 
3 213 GLU n 
3 214 THR n 
3 215 ASP n 
3 216 PHE n 
3 217 GLU n 
3 218 MET n 
3 219 SER n 
3 220 ASP n 
3 221 ARG n 
3 222 SER n 
3 223 PHE n 
3 224 VAL n 
3 225 THR n 
3 226 LEU n 
3 227 LEU n 
3 228 LEU n 
3 229 ASP n 
3 230 TYR n 
3 231 TYR n 
3 232 GLN n 
3 233 ARG n 
3 234 VAL n 
3 235 GLY n 
3 236 THR n 
3 237 THR n 
3 238 LYS n 
3 239 LYS n 
3 240 ILE n 
3 241 ASP n 
3 242 LEU n 
3 243 LEU n 
3 244 LEU n 
3 245 LEU n 
3 246 THR n 
3 247 ASN n 
3 248 ASN n 
3 249 PHE n 
3 250 ASP n 
3 251 THR n 
3 252 ASN n 
3 253 MET n 
3 254 ASN n 
3 255 ASN n 
3 256 LYS n 
3 257 LEU n 
3 258 GLN n 
3 259 GLN n 
3 260 LEU n 
3 261 LYS n 
3 262 ILE n 
3 263 LEU n 
3 264 GLU n 
3 265 SER n 
3 266 LEU n 
3 267 ASN n 
3 268 MET n 
3 269 LEU n 
3 270 LYS n 
3 271 SER n 
3 272 ASN n 
3 273 CYS n 
3 274 TYR n 
3 275 VAL n 
3 276 LEU n 
3 277 ASP n 
3 278 TYR n 
3 279 GLN n 
3 280 ILE n 
3 281 THR n 
3 282 VAL n 
3 283 ASP n 
3 284 GLN n 
3 285 VAL n 
3 286 THR n 
3 287 ALA n 
3 288 ASN n 
3 289 PHE n 
3 290 ASN n 
3 291 SER n 
3 292 TYR n 
3 293 VAL n 
3 294 GLU n 
3 295 GLY n 
3 296 ILE n 
3 297 PRO n 
3 298 ALA n 
3 299 PHE n 
3 300 ARG n 
3 301 ARG n 
3 302 HIS n 
3 303 GLU n 
3 304 ILE n 
3 305 ALA n 
3 306 ASN n 
3 307 PHE n 
3 308 LEU n 
3 309 LYS n 
3 310 LYS n 
3 311 ARG n 
3 312 LYS n 
3 313 THR n 
3 314 PRO n 
3 315 LYS n 
3 316 ASN n 
3 317 ALA n 
3 318 ASP n 
3 319 GLU n 
3 320 LEU n 
3 321 ILE n 
3 322 PHE n 
3 323 LYS n 
3 324 TYR n 
3 325 VAL n 
3 326 GLY n 
3 327 ARG n 
3 328 TRP n 
3 329 ASN n 
3 330 ILE n 
3 331 CYS n 
3 332 TYR n 
3 333 GLN n 
3 334 LYS n 
3 335 LYS n 
3 336 PHE n 
3 337 HIS n 
3 338 GLN n 
3 339 GLY n 
3 340 ASN n 
3 341 ILE n 
3 342 SER n 
3 343 ILE n 
3 344 HIS n 
3 345 GLN n 
3 346 ILE n 
3 347 SER n 
3 348 GLY n 
3 349 TYR n 
3 350 LEU n 
3 351 ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? yeast 'Pichia pastoris' 638632 ? ? 'DSMZ 70382' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? yeast 'Pichia pastoris' 638632 ? ? 'DSMZ 70382' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? yeast 'Pichia pastoris' 638632 ? ? 'DSMZ 70382' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8NJU8_PICPA Q8NJU8 1 
;MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIKEIWLESFPLSEVVEASGGREL
RKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLEKNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFST
RDPMGDVISFSSYPSLNSKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAGIFYG
CKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGA
DLFRKEWPELIKELLGEDKITKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVV
EVMGRHCGWLGLMSGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITSEEVKDVLV
EIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVISILENKIVRQPLVESVAQTKTVSAAIEAK
DFDKALQLRDQEFATSYENFLSVSKYDDGSYLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAG
LIRHGAVRELNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELDAARAQYPIFNIP
MCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTFVVEVQGGYSGYLASYAGLITGALAVYTPENPIN
LQTVQEDIELLTRTYEEDDGKNRSGKIFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNAC
RLAIKCCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSEVTFTPVKQLWENETHH
KWRKGKNVHWEQLNIVSDLLSGRLSIRTT
;
1 ? 
2 UNP Q8TGA0_PICPA Q8TGA0 2 
;MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVSIQLILDPEHAASVSQIDQNIR
NLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHPVQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPK
VSEEKAYRAEDDSEKLLNPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDV
RGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWPSLIEELLQTEQISQQQFNTH
QNLNICGAVGSIDNDMSSTDATIGAFSSLDRICRAIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEK
PASSREWQDQMCDIVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTAVAFDRIY
ATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKKAISLRDSEFVEHMKNFISTNSAD
HVPPSLPLEKRKKIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIG
TNRTLPNDADIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLN
SFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISYVPEEGISLAQLEMDINSLKESFANDQGKTKSGR
LILKSENASKVLTTEVISTIIDDEASGRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISF
RQTDEITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
;
1 ? 
3 UNP A7MAS3_PICPA A7MAS3 3 
;MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFSRKNDNAPVDKLLTNYYNNYEV
NVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDLPLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPE
QYRSSRWEDKVKGPALANRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGTTKKI
DLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEGIPAFRRHEIANFLKKRKTPKNADEL
IFKYVGRWNICYQKKFHQGNISIHQISGYLD
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3OPY A 1 ? 989 ? Q8NJU8 1 ? 989 ? 1 989 
2  2 3OPY B 1 ? 941 ? Q8TGA0 1 ? 941 ? 1 941 
3  1 3OPY C 1 ? 989 ? Q8NJU8 1 ? 989 ? 1 989 
4  2 3OPY D 1 ? 941 ? Q8TGA0 1 ? 941 ? 1 941 
5  1 3OPY E 1 ? 989 ? Q8NJU8 1 ? 989 ? 1 989 
6  2 3OPY F 1 ? 941 ? Q8TGA0 1 ? 941 ? 1 941 
7  1 3OPY G 1 ? 989 ? Q8NJU8 1 ? 989 ? 1 989 
8  2 3OPY H 1 ? 941 ? Q8TGA0 1 ? 941 ? 1 941 
9  3 3OPY I 1 ? 351 ? A7MAS3 1 ? 351 ? 1 351 
10 3 3OPY J 1 ? 351 ? A7MAS3 1 ? 351 ? 1 351 
11 3 3OPY K 1 ? 351 ? A7MAS3 1 ? 351 ? 1 351 
12 3 3OPY L 1 ? 351 ? A7MAS3 1 ? 351 ? 1 351 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'               ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OPY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.47 
_exptl_crystal.density_percent_sol   64.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
;1 microliter of protein + 1 microliter of reservoir using streak seading, protein: 1mg/mL PFK, 10mM imidazol, 5mM mercaptoethanol, 10% glycerol, 10mM ATP, pH 7.0; reservoir: 0.7M ammonia sulfate, 0.1M sodium citrate pH 4.6, VAPOR DIFFUSION, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2009-03-13 
_diffrn_detector.details                'Double crystal monochromator with 2 sets of mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
;Double crystal,  
Si(111)
;
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.2' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918 
# 
_reflns.entry_id                     3OPY 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             29.8 
_reflns.d_resolution_high            3.05 
_reflns.number_obs                   262877 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         53.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        75.78 
_reflns.pdbx_redundancy              97.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3OPY 
_refine.ls_number_reflns_obs                     255838 
_refine.ls_number_reflns_all                     617625 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.8 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2019 
_refine.ls_R_factor_all                          0.247 
_refine.ls_R_factor_R_work                       0.2003 
_refine.ls_R_factor_R_free                       0.2318 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.03 
_refine.ls_number_reflns_R_free                  12864 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8802 
_refine.correlation_coeff_Fo_to_Fc_free          0.8458 
_refine.B_iso_mean                               68.17 
_refine.aniso_B[1][1]                            -13.4997 
_refine.aniso_B[2][2]                            9.7517 
_refine.aniso_B[3][3]                            3.7480 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -1.0224 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3OPY 
_refine_analyze.Luzzati_coordinate_error_obs    0.529 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        64576 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         449 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               65025 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        29.8 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' t_dihedral_angle_d        22308 ?      ? 2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' t_trig_c_planes           1608  ?      ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_gen_planes              9720  ?      ? 5.000  HARMONIC     
'X-RAY DIFFRACTION' t_it                      66060 ?      ? 20.000 HARMONIC     
'X-RAY DIFFRACTION' t_nbd                     ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_improper_torsion        16    ?      ? 0.000  HARMONIC     
'X-RAY DIFFRACTION' t_pseud_angle             ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_chiral_improper_torsion 8988  ?      ? 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_sum_occupancies         ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_distance        ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_angle           ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_torsion         ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_ideal_dist_contact      76198 ?      ? 4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_bond_d                  66060 0.010  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_angle_deg               89582 1.240  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_omega_torsion           ?     2.580  ? ?      ?            
'X-RAY DIFFRACTION' t_other_torsion           ?     22.510 ? ?      ?            
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.05 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             18092 
_refine_ls_shell.R_factor_R_work                  0.2266 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2664 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.97 
_refine_ls_shell.number_reflns_R_free             947 
_refine_ls_shell.number_reflns_all                19039 
_refine_ls_shell.R_factor_all                     0.2286 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OPY 
_struct.title                     'Crystal structure of Pichia pastoris phosphofructokinase in the T-state' 
_struct.pdbx_descriptor           
;6-phosphofructo-1-kinase alpha-subunit (E.C.2.7.1.11), 6-phosphofructo-1-kinase beta-subunit (E.C.2.7.1.11), 6-phosphofructo-1-kinase gamma-subunit (E.C.2.7.1.11)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OPY 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;phosphofructokinase, ATP Binding, Fructose-6-phosphate Binding, Magnesium Binding, Citrate Binding, ADP Binding, Fructose-2, 6-bisphosphate Binding, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 5 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 5 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 4 ? 
CB N N 4 ? 
DB N N 4 ? 
EB N N 4 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 4 ? 
IB N N 4 ? 
JB N N 4 ? 
KB N N 5 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 4 ? 
OB N N 4 ? 
PB N N 4 ? 
QB N N 4 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 4 ? 
UB N N 4 ? 
VB N N 4 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 4 ? 
AC N N 4 ? 
BC N N 4 ? 
CC N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'Asymmetric unit contains a complete biological assembly' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 18  ? LEU A 32  ? ASP A 18  LEU A 32  1 ? 15 
HELX_P HELX_P2   2   SER A 133 ? ILE A 144 ? SER A 133 ILE A 144 1 ? 12 
HELX_P HELX_P3   3   GLY A 224 ? TYR A 239 ? GLY A 224 TYR A 239 1 ? 16 
HELX_P HELX_P4   4   GLU A 248 ? LYS A 255 ? GLU A 248 LYS A 255 1 ? 8  
HELX_P HELX_P5   5   GLY A 270 ? ILE A 274 ? GLY A 270 ILE A 274 5 ? 5  
HELX_P HELX_P6   6   GLU A 289 ? ASN A 303 ? GLU A 289 ASN A 303 1 ? 15 
HELX_P HELX_P7   7   GLY A 313 ? TRP A 327 ? GLY A 313 TRP A 327 1 ? 15 
HELX_P HELX_P8   8   LYS A 342 ? HIS A 348 ? LYS A 342 HIS A 348 1 ? 7  
HELX_P HELX_P9   9   ALA A 373 ? ALA A 389 ? ALA A 373 ALA A 389 1 ? 17 
HELX_P HELX_P10  10  GLY A 408 ? GLY A 419 ? GLY A 408 GLY A 419 1 ? 12 
HELX_P HELX_P11  11  ASN A 434 ? LYS A 449 ? ASN A 434 LYS A 449 1 ? 16 
HELX_P HELX_P12  12  THR A 471 ? GLU A 481 ? THR A 471 GLU A 481 1 ? 11 
HELX_P HELX_P13  13  GLY A 492 ? GLY A 497 ? GLY A 492 GLY A 497 5 ? 6  
HELX_P HELX_P14  14  CYS A 501 ? GLU A 521 ? CYS A 501 GLU A 521 1 ? 21 
HELX_P HELX_P15  15  LEU A 543 ? ALA A 559 ? LEU A 543 ALA A 559 1 ? 17 
HELX_P HELX_P16  16  ASP A 561 ? LEU A 568 ? ASP A 561 LEU A 568 1 ? 8  
HELX_P HELX_P17  17  ASP A 570 ? LYS A 585 ? ASP A 570 LYS A 585 1 ? 16 
HELX_P HELX_P18  18  TYR A 586 ? GLY A 589 ? TYR A 586 GLY A 589 5 ? 4  
HELX_P HELX_P19  19  PRO A 594 ? ARG A 598 ? PRO A 594 ARG A 598 5 ? 5  
HELX_P HELX_P20  20  ALA A 612 ? LYS A 627 ? ALA A 612 LYS A 627 1 ? 16 
HELX_P HELX_P21  21  ASN A 636 ? GLY A 645 ? ASN A 636 GLY A 645 1 ? 10 
HELX_P HELX_P22  22  LEU A 672 ? ASP A 675 ? LEU A 672 ASP A 675 5 ? 4  
HELX_P HELX_P23  23  ASP A 676 ? LYS A 688 ? ASP A 676 LYS A 688 1 ? 13 
HELX_P HELX_P24  24  GLY A 697 ? ARG A 711 ? GLY A 697 ARG A 711 1 ? 15 
HELX_P HELX_P25  25  TYR A 714 ? ASN A 718 ? TYR A 714 ASN A 718 5 ? 5  
HELX_P HELX_P26  26  GLY A 740 ? ALA A 759 ? GLY A 740 ALA A 759 1 ? 20 
HELX_P HELX_P27  27  GLY A 777 ? GLY A 788 ? GLY A 777 GLY A 788 1 ? 12 
HELX_P HELX_P28  28  ASN A 800 ? GLU A 816 ? ASN A 800 GLU A 816 1 ? 17 
HELX_P HELX_P29  29  THR A 839 ? ALA A 850 ? THR A 839 ALA A 850 1 ? 12 
HELX_P HELX_P30  30  PRO A 862 ? GLY A 868 ? PRO A 862 GLY A 868 5 ? 7  
HELX_P HELX_P31  31  SER A 872 ? GLU A 891 ? SER A 872 GLU A 891 1 ? 20 
HELX_P HELX_P32  32  ASP A 892 ? GLN A 896 ? ASP A 892 GLN A 896 5 ? 5  
HELX_P HELX_P33  33  SER A 904 ? ARG A 911 ? SER A 904 ARG A 911 1 ? 8  
HELX_P HELX_P34  34  ASP A 931 ? ASN A 933 ? ASP A 931 ASN A 933 5 ? 3  
HELX_P HELX_P35  35  VAL A 950 ? GLU A 957 ? VAL A 950 GLU A 957 1 ? 8  
HELX_P HELX_P36  36  TRP A 970 ? SER A 981 ? TRP A 970 SER A 981 1 ? 12 
HELX_P HELX_P37  37  GLY A 982 ? ARG A 987 ? GLY A 982 ARG A 987 1 ? 6  
HELX_P HELX_P38  38  LEU B 23  ? PHE B 33  ? LEU B 23  PHE B 33  1 ? 11 
HELX_P HELX_P39  39  ALA B 69  ? ASN B 81  ? ALA B 69  ASN B 81  1 ? 13 
HELX_P HELX_P40  40  SER B 104 ? ASP B 114 ? SER B 104 ASP B 114 1 ? 11 
HELX_P HELX_P41  41  GLY B 195 ? LYS B 210 ? GLY B 195 LYS B 210 1 ? 16 
HELX_P HELX_P42  42  GLU B 219 ? GLY B 227 ? GLU B 219 GLY B 227 1 ? 9  
HELX_P HELX_P43  43  GLN B 236 ? ARG B 241 ? GLN B 236 ARG B 241 5 ? 6  
HELX_P HELX_P44  44  LYS B 257 ? ARG B 260 ? LYS B 257 ARG B 260 5 ? 4  
HELX_P HELX_P45  45  GLU B 261 ? GLY B 276 ? GLU B 261 GLY B 276 1 ? 16 
HELX_P HELX_P46  46  GLY B 285 ? GLU B 298 ? GLY B 285 GLU B 298 1 ? 14 
HELX_P HELX_P47  47  GLN B 314 ? HIS B 320 ? GLN B 314 HIS B 320 1 ? 7  
HELX_P HELX_P48  48  ALA B 345 ? ALA B 361 ? ALA B 345 ALA B 361 1 ? 17 
HELX_P HELX_P49  49  GLY B 380 ? THR B 390 ? GLY B 380 THR B 390 1 ? 11 
HELX_P HELX_P50  50  GLU B 406 ? GLY B 422 ? GLU B 406 GLY B 422 1 ? 17 
HELX_P HELX_P51  51  SER B 443 ? ARG B 454 ? SER B 443 ARG B 454 1 ? 12 
HELX_P HELX_P52  52  GLY B 465 ? ARG B 469 ? GLY B 465 ARG B 469 5 ? 5  
HELX_P HELX_P53  53  VAL B 474 ? CYS B 495 ? VAL B 474 CYS B 495 1 ? 22 
HELX_P HELX_P54  54  LEU B 516 ? SER B 532 ? LEU B 516 SER B 532 1 ? 17 
HELX_P HELX_P55  55  ASN B 534 ? ARG B 542 ? ASN B 534 ARG B 542 1 ? 9  
HELX_P HELX_P56  56  ASP B 543 ? SER B 558 ? ASP B 543 SER B 558 1 ? 16 
HELX_P HELX_P57  57  PRO B 567 ? ARG B 571 ? PRO B 567 ARG B 571 5 ? 5  
HELX_P HELX_P58  58  GLY B 585 ? GLY B 601 ? GLY B 585 GLY B 601 1 ? 17 
HELX_P HELX_P59  59  ASN B 609 ? GLU B 618 ? ASN B 609 GLU B 618 1 ? 10 
HELX_P HELX_P60  60  GLY B 630 ? LEU B 634 ? GLY B 630 LEU B 634 5 ? 5  
HELX_P HELX_P61  61  ASP B 650 ? TYR B 661 ? ASP B 650 TYR B 661 1 ? 12 
HELX_P HELX_P62  62  GLY B 671 ? ALA B 684 ? GLY B 671 ALA B 684 1 ? 14 
HELX_P HELX_P63  63  ARG B 685 ? ASN B 687 ? ARG B 685 ASN B 687 5 ? 3  
HELX_P HELX_P64  64  TYR B 688 ? ARG B 692 ? TYR B 688 ARG B 692 5 ? 5  
HELX_P HELX_P65  65  GLY B 714 ? THR B 736 ? GLY B 714 THR B 736 1 ? 23 
HELX_P HELX_P66  66  GLY B 751 ? GLY B 762 ? GLY B 751 GLY B 762 1 ? 12 
HELX_P HELX_P67  67  SER B 774 ? ASN B 791 ? SER B 774 ASN B 791 1 ? 18 
HELX_P HELX_P68  68  ASN B 807 ? SER B 809 ? ASN B 807 SER B 809 5 ? 3  
HELX_P HELX_P69  69  THR B 813 ? SER B 826 ? THR B 813 SER B 826 1 ? 14 
HELX_P HELX_P70  70  SER B 846 ? ASN B 876 ? SER B 846 ASN B 876 1 ? 31 
HELX_P HELX_P71  71  THR B 883 ? SER B 888 ? THR B 883 SER B 888 1 ? 6  
HELX_P HELX_P72  72  ILE B 905 ? PHE B 911 ? ILE B 905 PHE B 911 1 ? 7  
HELX_P HELX_P73  73  TRP B 925 ? GLY B 937 ? TRP B 925 GLY B 937 1 ? 13 
HELX_P HELX_P74  74  ASP C 18  ? LEU C 32  ? ASP C 18  LEU C 32  1 ? 15 
HELX_P HELX_P75  75  SER C 133 ? ILE C 144 ? SER C 133 ILE C 144 1 ? 12 
HELX_P HELX_P76  76  GLY C 224 ? TYR C 239 ? GLY C 224 TYR C 239 1 ? 16 
HELX_P HELX_P77  77  GLU C 248 ? LYS C 255 ? GLU C 248 LYS C 255 1 ? 8  
HELX_P HELX_P78  78  GLY C 270 ? ILE C 274 ? GLY C 270 ILE C 274 5 ? 5  
HELX_P HELX_P79  79  GLU C 289 ? ASN C 303 ? GLU C 289 ASN C 303 1 ? 15 
HELX_P HELX_P80  80  GLY C 313 ? TRP C 327 ? GLY C 313 TRP C 327 1 ? 15 
HELX_P HELX_P81  81  LYS C 342 ? HIS C 348 ? LYS C 342 HIS C 348 1 ? 7  
HELX_P HELX_P82  82  ALA C 373 ? ALA C 389 ? ALA C 373 ALA C 389 1 ? 17 
HELX_P HELX_P83  83  GLY C 408 ? GLY C 419 ? GLY C 408 GLY C 419 1 ? 12 
HELX_P HELX_P84  84  ASN C 434 ? LYS C 449 ? ASN C 434 LYS C 449 1 ? 16 
HELX_P HELX_P85  85  THR C 471 ? GLU C 481 ? THR C 471 GLU C 481 1 ? 11 
HELX_P HELX_P86  86  GLY C 492 ? GLY C 497 ? GLY C 492 GLY C 497 5 ? 6  
HELX_P HELX_P87  87  CYS C 501 ? GLU C 521 ? CYS C 501 GLU C 521 1 ? 21 
HELX_P HELX_P88  88  LEU C 543 ? ALA C 559 ? LEU C 543 ALA C 559 1 ? 17 
HELX_P HELX_P89  89  ASP C 561 ? LEU C 568 ? ASP C 561 LEU C 568 1 ? 8  
HELX_P HELX_P90  90  ASP C 570 ? LYS C 585 ? ASP C 570 LYS C 585 1 ? 16 
HELX_P HELX_P91  91  TYR C 586 ? GLY C 589 ? TYR C 586 GLY C 589 5 ? 4  
HELX_P HELX_P92  92  PRO C 594 ? ARG C 598 ? PRO C 594 ARG C 598 5 ? 5  
HELX_P HELX_P93  93  ALA C 612 ? LYS C 627 ? ALA C 612 LYS C 627 1 ? 16 
HELX_P HELX_P94  94  ASN C 636 ? GLY C 645 ? ASN C 636 GLY C 645 1 ? 10 
HELX_P HELX_P95  95  LEU C 672 ? ASP C 675 ? LEU C 672 ASP C 675 5 ? 4  
HELX_P HELX_P96  96  ASP C 676 ? LYS C 688 ? ASP C 676 LYS C 688 1 ? 13 
HELX_P HELX_P97  97  GLY C 697 ? ARG C 711 ? GLY C 697 ARG C 711 1 ? 15 
HELX_P HELX_P98  98  TYR C 714 ? ASN C 718 ? TYR C 714 ASN C 718 5 ? 5  
HELX_P HELX_P99  99  GLY C 740 ? ALA C 759 ? GLY C 740 ALA C 759 1 ? 20 
HELX_P HELX_P100 100 GLY C 777 ? GLY C 788 ? GLY C 777 GLY C 788 1 ? 12 
HELX_P HELX_P101 101 ASN C 800 ? GLU C 816 ? ASN C 800 GLU C 816 1 ? 17 
HELX_P HELX_P102 102 THR C 839 ? ALA C 850 ? THR C 839 ALA C 850 1 ? 12 
HELX_P HELX_P103 103 PRO C 862 ? GLY C 868 ? PRO C 862 GLY C 868 5 ? 7  
HELX_P HELX_P104 104 SER C 872 ? GLU C 891 ? SER C 872 GLU C 891 1 ? 20 
HELX_P HELX_P105 105 ASP C 892 ? GLN C 896 ? ASP C 892 GLN C 896 5 ? 5  
HELX_P HELX_P106 106 SER C 904 ? ARG C 911 ? SER C 904 ARG C 911 1 ? 8  
HELX_P HELX_P107 107 ASP C 931 ? ASN C 933 ? ASP C 931 ASN C 933 5 ? 3  
HELX_P HELX_P108 108 VAL C 950 ? GLU C 957 ? VAL C 950 GLU C 957 1 ? 8  
HELX_P HELX_P109 109 TRP C 970 ? SER C 981 ? TRP C 970 SER C 981 1 ? 12 
HELX_P HELX_P110 110 GLY C 982 ? THR C 989 ? GLY C 982 THR C 989 1 ? 8  
HELX_P HELX_P111 111 LEU D 23  ? PHE D 33  ? LEU D 23  PHE D 33  1 ? 11 
HELX_P HELX_P112 112 ALA D 69  ? ASN D 81  ? ALA D 69  ASN D 81  1 ? 13 
HELX_P HELX_P113 113 SER D 104 ? ASP D 114 ? SER D 104 ASP D 114 1 ? 11 
HELX_P HELX_P114 114 GLY D 195 ? LYS D 210 ? GLY D 195 LYS D 210 1 ? 16 
HELX_P HELX_P115 115 GLU D 219 ? GLY D 227 ? GLU D 219 GLY D 227 1 ? 9  
HELX_P HELX_P116 116 GLN D 236 ? ARG D 241 ? GLN D 236 ARG D 241 5 ? 6  
HELX_P HELX_P117 117 LYS D 257 ? ARG D 260 ? LYS D 257 ARG D 260 5 ? 4  
HELX_P HELX_P118 118 GLU D 261 ? GLY D 276 ? GLU D 261 GLY D 276 1 ? 16 
HELX_P HELX_P119 119 GLY D 285 ? GLU D 298 ? GLY D 285 GLU D 298 1 ? 14 
HELX_P HELX_P120 120 GLN D 314 ? HIS D 320 ? GLN D 314 HIS D 320 1 ? 7  
HELX_P HELX_P121 121 ALA D 345 ? ALA D 361 ? ALA D 345 ALA D 361 1 ? 17 
HELX_P HELX_P122 122 GLY D 380 ? THR D 390 ? GLY D 380 THR D 390 1 ? 11 
HELX_P HELX_P123 123 GLU D 406 ? GLY D 422 ? GLU D 406 GLY D 422 1 ? 17 
HELX_P HELX_P124 124 SER D 443 ? ARG D 454 ? SER D 443 ARG D 454 1 ? 12 
HELX_P HELX_P125 125 GLY D 465 ? ARG D 469 ? GLY D 465 ARG D 469 5 ? 5  
HELX_P HELX_P126 126 VAL D 474 ? CYS D 495 ? VAL D 474 CYS D 495 1 ? 22 
HELX_P HELX_P127 127 LEU D 516 ? SER D 532 ? LEU D 516 SER D 532 1 ? 17 
HELX_P HELX_P128 128 ASN D 534 ? ARG D 542 ? ASN D 534 ARG D 542 1 ? 9  
HELX_P HELX_P129 129 ASP D 543 ? SER D 558 ? ASP D 543 SER D 558 1 ? 16 
HELX_P HELX_P130 130 PRO D 567 ? ARG D 571 ? PRO D 567 ARG D 571 5 ? 5  
HELX_P HELX_P131 131 GLY D 585 ? GLY D 601 ? GLY D 585 GLY D 601 1 ? 17 
HELX_P HELX_P132 132 ASN D 609 ? GLU D 618 ? ASN D 609 GLU D 618 1 ? 10 
HELX_P HELX_P133 133 GLY D 630 ? LEU D 634 ? GLY D 630 LEU D 634 5 ? 5  
HELX_P HELX_P134 134 ASP D 650 ? TYR D 661 ? ASP D 650 TYR D 661 1 ? 12 
HELX_P HELX_P135 135 GLY D 671 ? ALA D 684 ? GLY D 671 ALA D 684 1 ? 14 
HELX_P HELX_P136 136 ARG D 685 ? ASN D 687 ? ARG D 685 ASN D 687 5 ? 3  
HELX_P HELX_P137 137 TYR D 688 ? ARG D 692 ? TYR D 688 ARG D 692 5 ? 5  
HELX_P HELX_P138 138 GLY D 714 ? THR D 736 ? GLY D 714 THR D 736 1 ? 23 
HELX_P HELX_P139 139 GLY D 751 ? GLY D 762 ? GLY D 751 GLY D 762 1 ? 12 
HELX_P HELX_P140 140 SER D 774 ? ASN D 791 ? SER D 774 ASN D 791 1 ? 18 
HELX_P HELX_P141 141 ASN D 807 ? SER D 809 ? ASN D 807 SER D 809 5 ? 3  
HELX_P HELX_P142 142 THR D 813 ? SER D 826 ? THR D 813 SER D 826 1 ? 14 
HELX_P HELX_P143 143 SER D 846 ? ASN D 876 ? SER D 846 ASN D 876 1 ? 31 
HELX_P HELX_P144 144 THR D 883 ? SER D 888 ? THR D 883 SER D 888 1 ? 6  
HELX_P HELX_P145 145 ILE D 905 ? PHE D 911 ? ILE D 905 PHE D 911 1 ? 7  
HELX_P HELX_P146 146 TRP D 925 ? GLY D 937 ? TRP D 925 GLY D 937 1 ? 13 
HELX_P HELX_P147 147 ASP E 18  ? LEU E 32  ? ASP E 18  LEU E 32  1 ? 15 
HELX_P HELX_P148 148 SER E 133 ? ILE E 144 ? SER E 133 ILE E 144 1 ? 12 
HELX_P HELX_P149 149 GLY E 224 ? TYR E 239 ? GLY E 224 TYR E 239 1 ? 16 
HELX_P HELX_P150 150 GLU E 248 ? LYS E 255 ? GLU E 248 LYS E 255 1 ? 8  
HELX_P HELX_P151 151 GLY E 270 ? ILE E 274 ? GLY E 270 ILE E 274 5 ? 5  
HELX_P HELX_P152 152 GLU E 289 ? ASN E 303 ? GLU E 289 ASN E 303 1 ? 15 
HELX_P HELX_P153 153 GLY E 313 ? TRP E 327 ? GLY E 313 TRP E 327 1 ? 15 
HELX_P HELX_P154 154 LYS E 342 ? HIS E 348 ? LYS E 342 HIS E 348 1 ? 7  
HELX_P HELX_P155 155 ALA E 373 ? ALA E 389 ? ALA E 373 ALA E 389 1 ? 17 
HELX_P HELX_P156 156 GLY E 408 ? GLY E 419 ? GLY E 408 GLY E 419 1 ? 12 
HELX_P HELX_P157 157 ASN E 434 ? LYS E 449 ? ASN E 434 LYS E 449 1 ? 16 
HELX_P HELX_P158 158 THR E 471 ? GLU E 481 ? THR E 471 GLU E 481 1 ? 11 
HELX_P HELX_P159 159 GLY E 492 ? GLY E 497 ? GLY E 492 GLY E 497 5 ? 6  
HELX_P HELX_P160 160 CYS E 501 ? GLU E 521 ? CYS E 501 GLU E 521 1 ? 21 
HELX_P HELX_P161 161 LEU E 543 ? ALA E 559 ? LEU E 543 ALA E 559 1 ? 17 
HELX_P HELX_P162 162 ASP E 561 ? LEU E 568 ? ASP E 561 LEU E 568 1 ? 8  
HELX_P HELX_P163 163 ASP E 570 ? LYS E 585 ? ASP E 570 LYS E 585 1 ? 16 
HELX_P HELX_P164 164 TYR E 586 ? GLY E 589 ? TYR E 586 GLY E 589 5 ? 4  
HELX_P HELX_P165 165 PRO E 594 ? ARG E 598 ? PRO E 594 ARG E 598 5 ? 5  
HELX_P HELX_P166 166 ALA E 612 ? LYS E 627 ? ALA E 612 LYS E 627 1 ? 16 
HELX_P HELX_P167 167 ASN E 636 ? GLY E 645 ? ASN E 636 GLY E 645 1 ? 10 
HELX_P HELX_P168 168 LEU E 672 ? ASP E 675 ? LEU E 672 ASP E 675 5 ? 4  
HELX_P HELX_P169 169 ASP E 676 ? LYS E 688 ? ASP E 676 LYS E 688 1 ? 13 
HELX_P HELX_P170 170 GLY E 697 ? ARG E 711 ? GLY E 697 ARG E 711 1 ? 15 
HELX_P HELX_P171 171 TYR E 714 ? ASN E 718 ? TYR E 714 ASN E 718 5 ? 5  
HELX_P HELX_P172 172 GLY E 740 ? ALA E 759 ? GLY E 740 ALA E 759 1 ? 20 
HELX_P HELX_P173 173 GLY E 777 ? GLY E 788 ? GLY E 777 GLY E 788 1 ? 12 
HELX_P HELX_P174 174 ASN E 800 ? GLU E 816 ? ASN E 800 GLU E 816 1 ? 17 
HELX_P HELX_P175 175 THR E 839 ? ALA E 850 ? THR E 839 ALA E 850 1 ? 12 
HELX_P HELX_P176 176 PRO E 862 ? GLY E 868 ? PRO E 862 GLY E 868 5 ? 7  
HELX_P HELX_P177 177 SER E 872 ? GLU E 891 ? SER E 872 GLU E 891 1 ? 20 
HELX_P HELX_P178 178 ASP E 892 ? GLN E 896 ? ASP E 892 GLN E 896 5 ? 5  
HELX_P HELX_P179 179 SER E 904 ? ARG E 911 ? SER E 904 ARG E 911 1 ? 8  
HELX_P HELX_P180 180 ASP E 931 ? ASN E 933 ? ASP E 931 ASN E 933 5 ? 3  
HELX_P HELX_P181 181 VAL E 950 ? GLU E 957 ? VAL E 950 GLU E 957 1 ? 8  
HELX_P HELX_P182 182 TRP E 970 ? SER E 981 ? TRP E 970 SER E 981 1 ? 12 
HELX_P HELX_P183 183 GLY E 982 ? ARG E 987 ? GLY E 982 ARG E 987 1 ? 6  
HELX_P HELX_P184 184 LEU F 23  ? PHE F 33  ? LEU F 23  PHE F 33  1 ? 11 
HELX_P HELX_P185 185 ALA F 69  ? ASN F 81  ? ALA F 69  ASN F 81  1 ? 13 
HELX_P HELX_P186 186 SER F 104 ? ASP F 114 ? SER F 104 ASP F 114 1 ? 11 
HELX_P HELX_P187 187 GLY F 195 ? LYS F 210 ? GLY F 195 LYS F 210 1 ? 16 
HELX_P HELX_P188 188 GLU F 219 ? GLY F 227 ? GLU F 219 GLY F 227 1 ? 9  
HELX_P HELX_P189 189 GLN F 236 ? ARG F 241 ? GLN F 236 ARG F 241 5 ? 6  
HELX_P HELX_P190 190 LYS F 257 ? ARG F 260 ? LYS F 257 ARG F 260 5 ? 4  
HELX_P HELX_P191 191 GLU F 261 ? GLY F 276 ? GLU F 261 GLY F 276 1 ? 16 
HELX_P HELX_P192 192 GLY F 285 ? GLU F 298 ? GLY F 285 GLU F 298 1 ? 14 
HELX_P HELX_P193 193 GLN F 314 ? HIS F 320 ? GLN F 314 HIS F 320 1 ? 7  
HELX_P HELX_P194 194 ALA F 345 ? ALA F 361 ? ALA F 345 ALA F 361 1 ? 17 
HELX_P HELX_P195 195 GLY F 380 ? THR F 390 ? GLY F 380 THR F 390 1 ? 11 
HELX_P HELX_P196 196 GLU F 406 ? GLY F 422 ? GLU F 406 GLY F 422 1 ? 17 
HELX_P HELX_P197 197 SER F 443 ? ARG F 454 ? SER F 443 ARG F 454 1 ? 12 
HELX_P HELX_P198 198 GLY F 465 ? ARG F 469 ? GLY F 465 ARG F 469 5 ? 5  
HELX_P HELX_P199 199 VAL F 474 ? CYS F 495 ? VAL F 474 CYS F 495 1 ? 22 
HELX_P HELX_P200 200 LEU F 516 ? SER F 532 ? LEU F 516 SER F 532 1 ? 17 
HELX_P HELX_P201 201 ASN F 534 ? ARG F 542 ? ASN F 534 ARG F 542 1 ? 9  
HELX_P HELX_P202 202 ASP F 543 ? SER F 558 ? ASP F 543 SER F 558 1 ? 16 
HELX_P HELX_P203 203 PRO F 567 ? ARG F 571 ? PRO F 567 ARG F 571 5 ? 5  
HELX_P HELX_P204 204 GLY F 585 ? GLY F 601 ? GLY F 585 GLY F 601 1 ? 17 
HELX_P HELX_P205 205 ASN F 609 ? GLU F 618 ? ASN F 609 GLU F 618 1 ? 10 
HELX_P HELX_P206 206 GLY F 630 ? LEU F 634 ? GLY F 630 LEU F 634 5 ? 5  
HELX_P HELX_P207 207 ASP F 650 ? TYR F 661 ? ASP F 650 TYR F 661 1 ? 12 
HELX_P HELX_P208 208 GLY F 671 ? ALA F 684 ? GLY F 671 ALA F 684 1 ? 14 
HELX_P HELX_P209 209 ARG F 685 ? ASN F 687 ? ARG F 685 ASN F 687 5 ? 3  
HELX_P HELX_P210 210 TYR F 688 ? ARG F 692 ? TYR F 688 ARG F 692 5 ? 5  
HELX_P HELX_P211 211 GLY F 714 ? THR F 736 ? GLY F 714 THR F 736 1 ? 23 
HELX_P HELX_P212 212 GLY F 751 ? GLY F 762 ? GLY F 751 GLY F 762 1 ? 12 
HELX_P HELX_P213 213 SER F 774 ? ASN F 791 ? SER F 774 ASN F 791 1 ? 18 
HELX_P HELX_P214 214 ASN F 807 ? SER F 809 ? ASN F 807 SER F 809 5 ? 3  
HELX_P HELX_P215 215 THR F 813 ? SER F 826 ? THR F 813 SER F 826 1 ? 14 
HELX_P HELX_P216 216 SER F 846 ? ASN F 876 ? SER F 846 ASN F 876 1 ? 31 
HELX_P HELX_P217 217 THR F 883 ? SER F 888 ? THR F 883 SER F 888 1 ? 6  
HELX_P HELX_P218 218 ILE F 905 ? PHE F 911 ? ILE F 905 PHE F 911 1 ? 7  
HELX_P HELX_P219 219 TRP F 925 ? GLY F 937 ? TRP F 925 GLY F 937 1 ? 13 
HELX_P HELX_P220 220 ASP G 18  ? LEU G 32  ? ASP G 18  LEU G 32  1 ? 15 
HELX_P HELX_P221 221 SER G 133 ? ILE G 144 ? SER G 133 ILE G 144 1 ? 12 
HELX_P HELX_P222 222 GLY G 224 ? TYR G 239 ? GLY G 224 TYR G 239 1 ? 16 
HELX_P HELX_P223 223 GLU G 248 ? LYS G 255 ? GLU G 248 LYS G 255 1 ? 8  
HELX_P HELX_P224 224 GLY G 270 ? ILE G 274 ? GLY G 270 ILE G 274 5 ? 5  
HELX_P HELX_P225 225 GLU G 289 ? ASN G 303 ? GLU G 289 ASN G 303 1 ? 15 
HELX_P HELX_P226 226 GLY G 313 ? TRP G 327 ? GLY G 313 TRP G 327 1 ? 15 
HELX_P HELX_P227 227 LYS G 342 ? HIS G 348 ? LYS G 342 HIS G 348 1 ? 7  
HELX_P HELX_P228 228 ALA G 373 ? ALA G 389 ? ALA G 373 ALA G 389 1 ? 17 
HELX_P HELX_P229 229 GLY G 408 ? GLY G 419 ? GLY G 408 GLY G 419 1 ? 12 
HELX_P HELX_P230 230 ASN G 434 ? LYS G 449 ? ASN G 434 LYS G 449 1 ? 16 
HELX_P HELX_P231 231 THR G 471 ? GLU G 481 ? THR G 471 GLU G 481 1 ? 11 
HELX_P HELX_P232 232 GLY G 492 ? GLY G 497 ? GLY G 492 GLY G 497 5 ? 6  
HELX_P HELX_P233 233 CYS G 501 ? GLU G 521 ? CYS G 501 GLU G 521 1 ? 21 
HELX_P HELX_P234 234 LEU G 543 ? ALA G 559 ? LEU G 543 ALA G 559 1 ? 17 
HELX_P HELX_P235 235 ASP G 561 ? LEU G 568 ? ASP G 561 LEU G 568 1 ? 8  
HELX_P HELX_P236 236 ASP G 570 ? LYS G 585 ? ASP G 570 LYS G 585 1 ? 16 
HELX_P HELX_P237 237 TYR G 586 ? GLY G 589 ? TYR G 586 GLY G 589 5 ? 4  
HELX_P HELX_P238 238 PRO G 594 ? ARG G 598 ? PRO G 594 ARG G 598 5 ? 5  
HELX_P HELX_P239 239 ALA G 612 ? LYS G 627 ? ALA G 612 LYS G 627 1 ? 16 
HELX_P HELX_P240 240 ASN G 636 ? GLY G 645 ? ASN G 636 GLY G 645 1 ? 10 
HELX_P HELX_P241 241 LEU G 672 ? ASP G 675 ? LEU G 672 ASP G 675 5 ? 4  
HELX_P HELX_P242 242 ASP G 676 ? LYS G 688 ? ASP G 676 LYS G 688 1 ? 13 
HELX_P HELX_P243 243 GLY G 697 ? ARG G 711 ? GLY G 697 ARG G 711 1 ? 15 
HELX_P HELX_P244 244 TYR G 714 ? ASN G 718 ? TYR G 714 ASN G 718 5 ? 5  
HELX_P HELX_P245 245 GLY G 740 ? ALA G 759 ? GLY G 740 ALA G 759 1 ? 20 
HELX_P HELX_P246 246 GLY G 777 ? GLY G 788 ? GLY G 777 GLY G 788 1 ? 12 
HELX_P HELX_P247 247 ASN G 800 ? GLU G 816 ? ASN G 800 GLU G 816 1 ? 17 
HELX_P HELX_P248 248 THR G 839 ? ALA G 850 ? THR G 839 ALA G 850 1 ? 12 
HELX_P HELX_P249 249 PRO G 862 ? GLY G 868 ? PRO G 862 GLY G 868 5 ? 7  
HELX_P HELX_P250 250 SER G 872 ? GLU G 891 ? SER G 872 GLU G 891 1 ? 20 
HELX_P HELX_P251 251 ASP G 892 ? GLN G 896 ? ASP G 892 GLN G 896 5 ? 5  
HELX_P HELX_P252 252 SER G 904 ? ARG G 911 ? SER G 904 ARG G 911 1 ? 8  
HELX_P HELX_P253 253 ASP G 931 ? ASN G 933 ? ASP G 931 ASN G 933 5 ? 3  
HELX_P HELX_P254 254 VAL G 950 ? GLU G 957 ? VAL G 950 GLU G 957 1 ? 8  
HELX_P HELX_P255 255 TRP G 970 ? SER G 981 ? TRP G 970 SER G 981 1 ? 12 
HELX_P HELX_P256 256 GLY G 982 ? ARG G 987 ? GLY G 982 ARG G 987 1 ? 6  
HELX_P HELX_P257 257 LEU H 23  ? PHE H 33  ? LEU H 23  PHE H 33  1 ? 11 
HELX_P HELX_P258 258 ALA H 69  ? ARG H 80  ? ALA H 69  ARG H 80  1 ? 12 
HELX_P HELX_P259 259 SER H 104 ? ASP H 114 ? SER H 104 ASP H 114 1 ? 11 
HELX_P HELX_P260 260 GLY H 195 ? LYS H 210 ? GLY H 195 LYS H 210 1 ? 16 
HELX_P HELX_P261 261 GLU H 219 ? GLY H 227 ? GLU H 219 GLY H 227 1 ? 9  
HELX_P HELX_P262 262 GLN H 236 ? ARG H 241 ? GLN H 236 ARG H 241 5 ? 6  
HELX_P HELX_P263 263 LYS H 257 ? ARG H 260 ? LYS H 257 ARG H 260 5 ? 4  
HELX_P HELX_P264 264 GLU H 261 ? MET H 275 ? GLU H 261 MET H 275 1 ? 15 
HELX_P HELX_P265 265 GLY H 285 ? GLU H 298 ? GLY H 285 GLU H 298 1 ? 14 
HELX_P HELX_P266 266 GLN H 314 ? HIS H 320 ? GLN H 314 HIS H 320 1 ? 7  
HELX_P HELX_P267 267 ALA H 345 ? ALA H 361 ? ALA H 345 ALA H 361 1 ? 17 
HELX_P HELX_P268 268 GLY H 380 ? THR H 390 ? GLY H 380 THR H 390 1 ? 11 
HELX_P HELX_P269 269 GLU H 406 ? GLY H 422 ? GLU H 406 GLY H 422 1 ? 17 
HELX_P HELX_P270 270 SER H 443 ? ARG H 454 ? SER H 443 ARG H 454 1 ? 12 
HELX_P HELX_P271 271 GLY H 465 ? ARG H 469 ? GLY H 465 ARG H 469 5 ? 5  
HELX_P HELX_P272 272 VAL H 474 ? CYS H 495 ? VAL H 474 CYS H 495 1 ? 22 
HELX_P HELX_P273 273 LEU H 516 ? SER H 532 ? LEU H 516 SER H 532 1 ? 17 
HELX_P HELX_P274 274 ASN H 534 ? ARG H 542 ? ASN H 534 ARG H 542 1 ? 9  
HELX_P HELX_P275 275 ASP H 543 ? SER H 558 ? ASP H 543 SER H 558 1 ? 16 
HELX_P HELX_P276 276 PRO H 567 ? ARG H 571 ? PRO H 567 ARG H 571 5 ? 5  
HELX_P HELX_P277 277 GLY H 585 ? GLY H 601 ? GLY H 585 GLY H 601 1 ? 17 
HELX_P HELX_P278 278 ASN H 609 ? GLU H 618 ? ASN H 609 GLU H 618 1 ? 10 
HELX_P HELX_P279 279 GLY H 630 ? LEU H 634 ? GLY H 630 LEU H 634 5 ? 5  
HELX_P HELX_P280 280 ASP H 650 ? TYR H 661 ? ASP H 650 TYR H 661 1 ? 12 
HELX_P HELX_P281 281 GLY H 671 ? ALA H 684 ? GLY H 671 ALA H 684 1 ? 14 
HELX_P HELX_P282 282 ARG H 685 ? ASN H 687 ? ARG H 685 ASN H 687 5 ? 3  
HELX_P HELX_P283 283 TYR H 688 ? ARG H 692 ? TYR H 688 ARG H 692 5 ? 5  
HELX_P HELX_P284 284 GLY H 714 ? THR H 736 ? GLY H 714 THR H 736 1 ? 23 
HELX_P HELX_P285 285 GLY H 751 ? GLY H 762 ? GLY H 751 GLY H 762 1 ? 12 
HELX_P HELX_P286 286 SER H 774 ? ASN H 791 ? SER H 774 ASN H 791 1 ? 18 
HELX_P HELX_P287 287 ASN H 807 ? SER H 809 ? ASN H 807 SER H 809 5 ? 3  
HELX_P HELX_P288 288 THR H 813 ? SER H 826 ? THR H 813 SER H 826 1 ? 14 
HELX_P HELX_P289 289 SER H 846 ? ASN H 876 ? SER H 846 ASN H 876 1 ? 31 
HELX_P HELX_P290 290 THR H 883 ? SER H 888 ? THR H 883 SER H 888 1 ? 6  
HELX_P HELX_P291 291 ILE H 905 ? PHE H 911 ? ILE H 905 PHE H 911 1 ? 7  
HELX_P HELX_P292 292 TRP H 925 ? GLY H 937 ? TRP H 925 GLY H 937 1 ? 13 
HELX_P HELX_P293 293 ASP I 5   ? GLU I 14  ? ASP I 5   GLU I 14  1 ? 10 
HELX_P HELX_P294 294 GLY I 17  ? LEU I 27  ? GLY I 17  LEU I 27  1 ? 11 
HELX_P HELX_P295 295 PRO I 36  ? ASN I 50  ? PRO I 36  ASN I 50  1 ? 15 
HELX_P HELX_P296 296 ASN I 50  ? LYS I 61  ? ASN I 50  LYS I 61  1 ? 12 
HELX_P HELX_P297 297 PRO I 66  ? ASP I 68  ? PRO I 66  ASP I 68  5 ? 3  
HELX_P HELX_P298 298 LYS I 69  ? TYR I 75  ? LYS I 69  TYR I 75  1 ? 7  
HELX_P HELX_P299 299 ASN I 76  ? LEU I 83  ? ASN I 76  LEU I 83  1 ? 8  
HELX_P HELX_P300 300 SER I 96  ? SER I 112 ? SER I 96  SER I 112 1 ? 17 
HELX_P HELX_P301 301 ASN I 128 ? LYS I 133 ? ASN I 128 LYS I 133 1 ? 6  
HELX_P HELX_P302 302 TYR I 134 ? VAL I 146 ? TYR I 134 VAL I 146 1 ? 13 
HELX_P HELX_P303 303 LYS I 200 ? VAL I 208 ? LYS I 200 VAL I 208 1 ? 9  
HELX_P HELX_P304 304 SER I 219 ? VAL I 234 ? SER I 219 VAL I 234 1 ? 16 
HELX_P HELX_P305 305 ASP I 250 ? ASN I 255 ? ASP I 250 ASN I 255 1 ? 6  
HELX_P HELX_P306 306 ASN I 255 ? LEU I 266 ? ASN I 255 LEU I 266 1 ? 12 
HELX_P HELX_P307 307 ASP I 283 ? GLU I 294 ? ASP I 283 GLU I 294 1 ? 12 
HELX_P HELX_P308 308 ILE I 296 ? LYS I 312 ? ILE I 296 LYS I 312 1 ? 17 
HELX_P HELX_P309 309 LYS I 315 ? ASP I 318 ? LYS I 315 ASP I 318 5 ? 4  
HELX_P HELX_P310 310 GLU I 319 ? TYR I 324 ? GLU I 319 TYR I 324 1 ? 6  
HELX_P HELX_P311 311 ASP J 5   ? GLU J 14  ? ASP J 5   GLU J 14  1 ? 10 
HELX_P HELX_P312 312 GLY J 17  ? LEU J 27  ? GLY J 17  LEU J 27  1 ? 11 
HELX_P HELX_P313 313 PRO J 36  ? ASN J 50  ? PRO J 36  ASN J 50  1 ? 15 
HELX_P HELX_P314 314 LEU J 51  ? LYS J 61  ? LEU J 51  LYS J 61  1 ? 11 
HELX_P HELX_P315 315 LYS J 69  ? TYR J 75  ? LYS J 69  TYR J 75  1 ? 7  
HELX_P HELX_P316 316 ASN J 76  ? LEU J 83  ? ASN J 76  LEU J 83  1 ? 8  
HELX_P HELX_P317 317 SER J 96  ? LEU J 111 ? SER J 96  LEU J 111 1 ? 16 
HELX_P HELX_P318 318 ASN J 128 ? LYS J 133 ? ASN J 128 LYS J 133 1 ? 6  
HELX_P HELX_P319 319 TYR J 134 ? GLY J 147 ? TYR J 134 GLY J 147 1 ? 14 
HELX_P HELX_P320 320 CYS J 199 ? VAL J 208 ? CYS J 199 VAL J 208 1 ? 10 
HELX_P HELX_P321 321 SER J 219 ? GLY J 235 ? SER J 219 GLY J 235 1 ? 17 
HELX_P HELX_P322 322 ASP J 250 ? ASN J 255 ? ASP J 250 ASN J 255 1 ? 6  
HELX_P HELX_P323 323 ASN J 255 ? LEU J 266 ? ASN J 255 LEU J 266 1 ? 12 
HELX_P HELX_P324 324 ASP J 283 ? GLU J 294 ? ASP J 283 GLU J 294 1 ? 12 
HELX_P HELX_P325 325 ILE J 296 ? LYS J 312 ? ILE J 296 LYS J 312 1 ? 17 
HELX_P HELX_P326 326 GLU J 319 ? LYS J 323 ? GLU J 319 LYS J 323 5 ? 5  
HELX_P HELX_P327 327 ASP K 5   ? GLU K 14  ? ASP K 5   GLU K 14  1 ? 10 
HELX_P HELX_P328 328 GLY K 17  ? LEU K 27  ? GLY K 17  LEU K 27  1 ? 11 
HELX_P HELX_P329 329 PRO K 36  ? PHE K 49  ? PRO K 36  PHE K 49  1 ? 14 
HELX_P HELX_P330 330 LEU K 51  ? LYS K 61  ? LEU K 51  LYS K 61  1 ? 11 
HELX_P HELX_P331 331 LYS K 69  ? TYR K 75  ? LYS K 69  TYR K 75  1 ? 7  
HELX_P HELX_P332 332 ASN K 76  ? LEU K 83  ? ASN K 76  LEU K 83  1 ? 8  
HELX_P HELX_P333 333 SER K 96  ? LEU K 111 ? SER K 96  LEU K 111 1 ? 16 
HELX_P HELX_P334 334 ASN K 128 ? LYS K 133 ? ASN K 128 LYS K 133 1 ? 6  
HELX_P HELX_P335 335 TYR K 134 ? GLY K 147 ? TYR K 134 GLY K 147 1 ? 14 
HELX_P HELX_P336 336 LYS K 200 ? GLY K 209 ? LYS K 200 GLY K 209 1 ? 10 
HELX_P HELX_P337 337 SER K 219 ? GLY K 235 ? SER K 219 GLY K 235 1 ? 17 
HELX_P HELX_P338 338 ASN K 255 ? LEU K 266 ? ASN K 255 LEU K 266 1 ? 12 
HELX_P HELX_P339 339 ASP K 283 ? GLU K 294 ? ASP K 283 GLU K 294 1 ? 12 
HELX_P HELX_P340 340 ILE K 296 ? LYS K 312 ? ILE K 296 LYS K 312 1 ? 17 
HELX_P HELX_P341 341 GLU K 319 ? LYS K 323 ? GLU K 319 LYS K 323 5 ? 5  
HELX_P HELX_P342 342 ASP L 5   ? GLU L 14  ? ASP L 5   GLU L 14  1 ? 10 
HELX_P HELX_P343 343 PHE L 20  ? LEU L 27  ? PHE L 20  LEU L 27  1 ? 8  
HELX_P HELX_P344 344 PRO L 36  ? PHE L 49  ? PRO L 36  PHE L 49  1 ? 14 
HELX_P HELX_P345 345 LEU L 51  ? LYS L 61  ? LEU L 51  LYS L 61  1 ? 11 
HELX_P HELX_P346 346 LYS L 69  ? TYR L 75  ? LYS L 69  TYR L 75  1 ? 7  
HELX_P HELX_P347 347 ASN L 76  ? LEU L 83  ? ASN L 76  LEU L 83  1 ? 8  
HELX_P HELX_P348 348 SER L 96  ? LEU L 111 ? SER L 96  LEU L 111 1 ? 16 
HELX_P HELX_P349 349 ASN L 128 ? LYS L 133 ? ASN L 128 LYS L 133 1 ? 6  
HELX_P HELX_P350 350 TYR L 134 ? VAL L 146 ? TYR L 134 VAL L 146 1 ? 13 
HELX_P HELX_P351 351 LYS L 200 ? VAL L 208 ? LYS L 200 VAL L 208 1 ? 9  
HELX_P HELX_P352 352 SER L 219 ? VAL L 234 ? SER L 219 VAL L 234 1 ? 16 
HELX_P HELX_P353 353 ASN L 255 ? LEU L 266 ? ASN L 255 LEU L 266 1 ? 12 
HELX_P HELX_P354 354 ASP L 283 ? GLY L 295 ? ASP L 283 GLY L 295 1 ? 13 
HELX_P HELX_P355 355 ILE L 296 ? LYS L 312 ? ILE L 296 LYS L 312 1 ? 17 
HELX_P HELX_P356 356 GLU L 319 ? LYS L 323 ? GLU L 319 LYS L 323 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ILE 53  A . ? ILE 53  A SER 54  A ? SER 54  A 1 1.85  
2  GLY 275 A . ? GLY 275 A GLY 276 A ? GLY 276 A 1 1.30  
3  GLU 125 B . ? GLU 125 B ILE 126 B ? ILE 126 B 1 3.04  
4  ILE 53  C . ? ILE 53  C SER 54  C ? SER 54  C 1 2.56  
5  GLY 275 C . ? GLY 275 C GLY 276 C ? GLY 276 C 1 -0.07 
6  GLU 125 D . ? GLU 125 D ILE 126 D ? ILE 126 D 1 0.30  
7  ILE 53  E . ? ILE 53  E SER 54  E ? SER 54  E 1 2.24  
8  GLY 275 E . ? GLY 275 E GLY 276 E ? GLY 276 E 1 0.43  
9  GLU 125 F . ? GLU 125 F ILE 126 F ? ILE 126 F 1 1.39  
10 ILE 53  G . ? ILE 53  G SER 54  G ? SER 54  G 1 1.71  
11 GLY 275 G . ? GLY 275 G GLY 276 G ? GLY 276 G 1 0.23  
12 GLU 125 H . ? GLU 125 H ILE 126 H ? ILE 126 H 1 2.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 7 ? 
C  ? 6 ? 
D  ? 7 ? 
E  ? 4 ? 
F  ? 7 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 7 ? 
J  ? 7 ? 
K  ? 6 ? 
L  ? 7 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 7 ? 
P  ? 4 ? 
Q  ? 6 ? 
R  ? 7 ? 
S  ? 4 ? 
T  ? 7 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 6 ? 
X  ? 7 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 7 ? 
AB ? 4 ? 
AC ? 7 ? 
AD ? 7 ? 
AE ? 6 ? 
AF ? 7 ? 
AG ? 4 ? 
AH ? 7 ? 
AI ? 4 ? 
AJ ? 2 ? 
AK ? 7 ? 
AL ? 7 ? 
AM ? 6 ? 
AN ? 7 ? 
AO ? 4 ? 
AP ? 4 ? 
AQ ? 7 ? 
AR ? 4 ? 
AS ? 6 ? 
AT ? 7 ? 
AU ? 4 ? 
AV ? 7 ? 
AW ? 4 ? 
AX ? 2 ? 
AY ? 6 ? 
AZ ? 7 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 7 ? 
BD ? 4 ? 
BE ? 8 ? 
BF ? 8 ? 
BG ? 8 ? 
BH ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? parallel      
A  4 5 ? anti-parallel 
A  5 6 ? parallel      
A  6 7 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? parallel      
B  3 4 ? anti-parallel 
B  4 5 ? parallel      
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? parallel      
C  3 4 ? parallel      
C  4 5 ? parallel      
C  5 6 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? parallel      
D  3 4 ? parallel      
D  4 5 ? parallel      
D  5 6 ? parallel      
D  6 7 ? anti-parallel 
E  1 2 ? parallel      
E  2 3 ? parallel      
E  3 4 ? parallel      
F  1 2 ? anti-parallel 
F  2 3 ? parallel      
F  3 4 ? parallel      
F  4 5 ? parallel      
F  5 6 ? parallel      
F  6 7 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? parallel      
I  4 5 ? anti-parallel 
I  5 6 ? parallel      
I  6 7 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? parallel      
J  3 4 ? anti-parallel 
J  4 5 ? parallel      
J  5 6 ? anti-parallel 
J  6 7 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? parallel      
K  3 4 ? parallel      
K  4 5 ? parallel      
K  5 6 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? parallel      
L  3 4 ? parallel      
L  4 5 ? parallel      
L  5 6 ? parallel      
L  6 7 ? anti-parallel 
M  1 2 ? parallel      
M  2 3 ? parallel      
M  3 4 ? parallel      
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? parallel      
O  1 2 ? anti-parallel 
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? parallel      
O  5 6 ? parallel      
O  6 7 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? parallel      
Q  3 4 ? parallel      
Q  4 5 ? parallel      
Q  5 6 ? parallel      
R  1 2 ? anti-parallel 
R  2 3 ? parallel      
R  3 4 ? parallel      
R  4 5 ? parallel      
R  5 6 ? parallel      
R  6 7 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
T  1 2 ? anti-parallel 
T  2 3 ? parallel      
T  3 4 ? parallel      
T  4 5 ? parallel      
T  5 6 ? parallel      
T  6 7 ? anti-parallel 
U  1 2 ? parallel      
U  2 3 ? parallel      
U  3 4 ? parallel      
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? parallel      
W  3 4 ? parallel      
W  4 5 ? parallel      
W  5 6 ? parallel      
X  1 2 ? anti-parallel 
X  2 3 ? parallel      
X  3 4 ? parallel      
X  4 5 ? parallel      
X  5 6 ? parallel      
X  6 7 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Z  1 2 ? anti-parallel 
Z  2 3 ? parallel      
Z  3 4 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? anti-parallel 
AC 5 6 ? parallel      
AC 6 7 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? parallel      
AD 3 4 ? anti-parallel 
AD 4 5 ? parallel      
AD 5 6 ? anti-parallel 
AD 6 7 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AE 5 6 ? parallel      
AF 1 2 ? anti-parallel 
AF 2 3 ? parallel      
AF 3 4 ? parallel      
AF 4 5 ? parallel      
AF 5 6 ? parallel      
AF 6 7 ? anti-parallel 
AG 1 2 ? parallel      
AG 2 3 ? parallel      
AG 3 4 ? parallel      
AH 1 2 ? anti-parallel 
AH 2 3 ? parallel      
AH 3 4 ? parallel      
AH 4 5 ? parallel      
AH 5 6 ? parallel      
AH 6 7 ? anti-parallel 
AI 1 2 ? parallel      
AI 2 3 ? parallel      
AI 3 4 ? parallel      
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? parallel      
AK 4 5 ? anti-parallel 
AK 5 6 ? parallel      
AK 6 7 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? anti-parallel 
AL 4 5 ? parallel      
AL 5 6 ? anti-parallel 
AL 6 7 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? parallel      
AM 3 4 ? parallel      
AM 4 5 ? parallel      
AM 5 6 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? parallel      
AN 3 4 ? parallel      
AN 4 5 ? parallel      
AN 5 6 ? parallel      
AN 6 7 ? anti-parallel 
AO 1 2 ? parallel      
AO 2 3 ? parallel      
AO 3 4 ? parallel      
AP 1 2 ? anti-parallel 
AP 2 3 ? parallel      
AP 3 4 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? parallel      
AQ 3 4 ? parallel      
AQ 4 5 ? parallel      
AQ 5 6 ? parallel      
AQ 6 7 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? parallel      
AR 3 4 ? parallel      
AS 1 2 ? anti-parallel 
AS 2 3 ? parallel      
AS 3 4 ? parallel      
AS 4 5 ? parallel      
AS 5 6 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? parallel      
AT 3 4 ? parallel      
AT 4 5 ? parallel      
AT 5 6 ? parallel      
AT 6 7 ? anti-parallel 
AU 1 2 ? parallel      
AU 2 3 ? parallel      
AU 3 4 ? parallel      
AV 1 2 ? anti-parallel 
AV 2 3 ? parallel      
AV 3 4 ? parallel      
AV 4 5 ? parallel      
AV 5 6 ? parallel      
AV 6 7 ? anti-parallel 
AW 1 2 ? parallel      
AW 2 3 ? parallel      
AW 3 4 ? parallel      
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? parallel      
AY 3 4 ? parallel      
AY 4 5 ? parallel      
AY 5 6 ? parallel      
AZ 1 2 ? anti-parallel 
AZ 2 3 ? parallel      
AZ 3 4 ? parallel      
AZ 4 5 ? parallel      
AZ 5 6 ? parallel      
AZ 6 7 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? parallel      
BB 3 4 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? parallel      
BC 3 4 ? parallel      
BC 4 5 ? parallel      
BC 5 6 ? parallel      
BC 6 7 ? anti-parallel 
BD 1 2 ? parallel      
BD 2 3 ? parallel      
BD 3 4 ? parallel      
BE 1 2 ? anti-parallel 
BE 2 3 ? parallel      
BE 3 4 ? parallel      
BE 4 5 ? parallel      
BE 5 6 ? parallel      
BE 6 7 ? anti-parallel 
BE 7 8 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? parallel      
BF 3 4 ? parallel      
BF 4 5 ? parallel      
BF 5 6 ? parallel      
BF 6 7 ? anti-parallel 
BF 7 8 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? parallel      
BG 3 4 ? parallel      
BG 4 5 ? parallel      
BG 5 6 ? parallel      
BG 6 7 ? anti-parallel 
BG 7 8 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? parallel      
BH 3 4 ? parallel      
BH 4 5 ? parallel      
BH 5 6 ? parallel      
BH 6 7 ? anti-parallel 
BH 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 HIS A 35  ? VAL A 41  ? HIS A 35  VAL A 41  
A  2 LYS A 59  ? GLU A 64  ? LYS A 59  GLU A 64  
A  3 GLY A 105 ? LEU A 110 ? GLY A 105 LEU A 110 
A  4 ILE A 6   ? THR A 16  ? ILE A 6   THR A 16  
A  5 ASN D 97  ? SER D 102 ? ASN D 97  SER D 102 
A  6 GLY D 138 ? ILE D 141 ? GLY D 138 ILE D 141 
A  7 PHE D 129 ? VAL D 131 ? PHE D 129 VAL D 131 
B  1 PHE A 158 ? ARG A 161 ? PHE A 158 ARG A 161 
B  2 GLY A 165 ? SER A 169 ? GLY A 165 SER A 169 
B  3 GLU A 126 ? PHE A 130 ? GLU A 126 PHE A 130 
B  4 GLY D 9   ? PHE D 16  ? GLY D 9   PHE D 16  
B  5 SER D 59  ? ILE D 63  ? SER D 59  ILE D 63  
B  6 GLN D 50  ? LEU D 51  ? GLN D 50  LEU D 51  
B  7 ALA D 37  ? ILE D 38  ? ALA D 37  ILE D 38  
C  1 LEU A 260 ? LEU A 263 ? LEU A 260 LEU A 263 
C  2 CYS A 241 ? CYS A 246 ? CYS A 241 CYS A 246 
C  3 LYS A 211 ? THR A 217 ? LYS A 211 THR A 217 
C  4 ALA A 307 ? GLY A 312 ? ALA A 307 GLY A 312 
C  5 THR A 352 ? SER A 359 ? THR A 352 SER A 359 
C  6 ILE A 371 ? GLY A 372 ? ILE A 371 GLY A 372 
D  1 LEU A 260 ? LEU A 263 ? LEU A 260 LEU A 263 
D  2 CYS A 241 ? CYS A 246 ? CYS A 241 CYS A 246 
D  3 LYS A 211 ? THR A 217 ? LYS A 211 THR A 217 
D  4 ALA A 307 ? GLY A 312 ? ALA A 307 GLY A 312 
D  5 THR A 352 ? SER A 359 ? THR A 352 SER A 359 
D  6 PRO A 529 ? ILE A 533 ? PRO A 529 ILE A 533 
D  7 ILE A 538 ? PRO A 542 ? ILE A 538 PRO A 542 
E  1 TYR A 422 ? PHE A 424 ? TYR A 422 PHE A 424 
E  2 LYS A 453 ? VAL A 458 ? LYS A 453 VAL A 458 
E  3 ARG A 396 ? GLU A 401 ? ARG A 396 GLU A 401 
E  4 ASP A 485 ? ARG A 490 ? ASP A 485 ARG A 490 
F  1 VAL A 647 ? LEU A 650 ? VAL A 647 LEU A 650 
F  2 ARG A 630 ? ILE A 634 ? ARG A 630 ILE A 634 
F  3 ASN A 600 ? VAL A 606 ? ASN A 600 VAL A 606 
F  4 GLY A 691 ? GLY A 696 ? GLY A 691 GLY A 696 
F  5 MET A 721 ? PRO A 725 ? MET A 721 PRO A 725 
F  6 SER A 935 ? GLN A 941 ? SER A 935 GLN A 941 
F  7 GLU A 944 ? PRO A 949 ? GLU A 944 PRO A 949 
G  1 VAL A 792 ? TYR A 793 ? VAL A 792 TYR A 793 
G  2 LYS A 826 ? ASN A 831 ? LYS A 826 ASN A 831 
G  3 THR A 766 ? VAL A 771 ? THR A 766 VAL A 771 
G  4 SER A 857 ? ALA A 860 ? SER A 857 ALA A 860 
H  1 PHE A 912 ? ASP A 915 ? PHE A 912 ASP A 915 
H  2 VAL A 918 ? SER A 921 ? VAL A 918 SER A 921 
I  1 ALA B 37  ? ILE B 38  ? ALA B 37  ILE B 38  
I  2 GLN B 50  ? LEU B 51  ? GLN B 50  LEU B 51  
I  3 SER B 59  ? ILE B 63  ? SER B 59  ILE B 63  
I  4 GLY B 9   ? PHE B 16  ? GLY B 9   PHE B 16  
I  5 GLU C 126 ? PHE C 130 ? GLU C 126 PHE C 130 
I  6 ASP C 166 ? SER C 169 ? ASP C 166 SER C 169 
I  7 PHE C 158 ? THR C 160 ? PHE C 158 THR C 160 
J  1 PHE B 129 ? VAL B 131 ? PHE B 129 VAL B 131 
J  2 GLY B 138 ? ILE B 141 ? GLY B 138 ILE B 141 
J  3 ASN B 97  ? SER B 102 ? ASN B 97  SER B 102 
J  4 ILE C 6   ? THR C 16  ? ILE C 6   THR C 16  
J  5 GLY C 105 ? LEU C 110 ? GLY C 105 LEU C 110 
J  6 LYS C 59  ? GLU C 64  ? LYS C 59  GLU C 64  
J  7 HIS C 35  ? VAL C 41  ? HIS C 35  VAL C 41  
K  1 ILE B 232 ? THR B 235 ? ILE B 232 THR B 235 
K  2 VAL B 214 ? ILE B 217 ? VAL B 214 ILE B 217 
K  3 ILE B 184 ? THR B 188 ? ILE B 184 THR B 188 
K  4 ALA B 279 ? GLY B 284 ? ALA B 279 GLY B 284 
K  5 ASN B 324 ? SER B 331 ? ASN B 324 SER B 331 
K  6 ILE B 343 ? GLY B 344 ? ILE B 343 GLY B 344 
L  1 ILE B 232 ? THR B 235 ? ILE B 232 THR B 235 
L  2 VAL B 214 ? ILE B 217 ? VAL B 214 ILE B 217 
L  3 ILE B 184 ? THR B 188 ? ILE B 184 THR B 188 
L  4 ALA B 279 ? GLY B 284 ? ALA B 279 GLY B 284 
L  5 ASN B 324 ? SER B 331 ? ASN B 324 SER B 331 
L  6 PRO B 502 ? ILE B 506 ? PRO B 502 ILE B 506 
L  7 ILE B 511 ? PRO B 515 ? ILE B 511 PRO B 515 
M  1 TYR B 394 ? LEU B 396 ? TYR B 394 LEU B 396 
M  2 THR B 426 ? VAL B 430 ? THR B 426 VAL B 430 
M  3 ARG B 368 ? GLU B 373 ? ARG B 368 GLU B 373 
M  4 ASP B 458 ? THR B 463 ? ASP B 458 THR B 463 
N  1 VAL B 620 ? SER B 622 ? VAL B 620 SER B 622 
N  2 VAL B 603 ? ILE B 607 ? VAL B 603 ILE B 607 
N  3 LYS B 573 ? VAL B 579 ? LYS B 573 VAL B 579 
N  4 THR B 641 ? ASN B 642 ? THR B 641 ASN B 642 
O  1 VAL B 620 ? SER B 622 ? VAL B 620 SER B 622 
O  2 VAL B 603 ? ILE B 607 ? VAL B 603 ILE B 607 
O  3 LYS B 573 ? VAL B 579 ? LYS B 573 VAL B 579 
O  4 GLY B 665 ? GLY B 670 ? GLY B 665 GLY B 670 
O  5 LEU B 695 ? PRO B 699 ? LEU B 695 PRO B 699 
O  6 ALA B 890 ? ILE B 895 ? ALA B 890 ILE B 895 
O  7 LEU B 900 ? PRO B 904 ? LEU B 900 PRO B 904 
P  1 ILE B 765 ? TYR B 767 ? ILE B 765 TYR B 767 
P  2 ARG B 800 ? SER B 805 ? ARG B 800 SER B 805 
P  3 ARG B 739 ? VAL B 745 ? ARG B 739 VAL B 745 
P  4 ASP B 830 ? ALA B 834 ? ASP B 830 ALA B 834 
Q  1 LEU C 260 ? LEU C 263 ? LEU C 260 LEU C 263 
Q  2 CYS C 241 ? CYS C 246 ? CYS C 241 CYS C 246 
Q  3 LYS C 211 ? THR C 217 ? LYS C 211 THR C 217 
Q  4 ALA C 307 ? GLY C 312 ? ALA C 307 GLY C 312 
Q  5 THR C 352 ? SER C 359 ? THR C 352 SER C 359 
Q  6 ILE C 371 ? GLY C 372 ? ILE C 371 GLY C 372 
R  1 LEU C 260 ? LEU C 263 ? LEU C 260 LEU C 263 
R  2 CYS C 241 ? CYS C 246 ? CYS C 241 CYS C 246 
R  3 LYS C 211 ? THR C 217 ? LYS C 211 THR C 217 
R  4 ALA C 307 ? GLY C 312 ? ALA C 307 GLY C 312 
R  5 THR C 352 ? SER C 359 ? THR C 352 SER C 359 
R  6 PRO C 529 ? ILE C 533 ? PRO C 529 ILE C 533 
R  7 ILE C 538 ? PRO C 542 ? ILE C 538 PRO C 542 
S  1 TYR C 422 ? PHE C 424 ? TYR C 422 PHE C 424 
S  2 LYS C 453 ? VAL C 458 ? LYS C 453 VAL C 458 
S  3 ARG C 396 ? GLU C 401 ? ARG C 396 GLU C 401 
S  4 ASP C 485 ? ARG C 490 ? ASP C 485 ARG C 490 
T  1 VAL C 647 ? LEU C 650 ? VAL C 647 LEU C 650 
T  2 ARG C 630 ? ILE C 634 ? ARG C 630 ILE C 634 
T  3 ASN C 600 ? VAL C 606 ? ASN C 600 VAL C 606 
T  4 GLY C 691 ? GLY C 696 ? GLY C 691 GLY C 696 
T  5 MET C 721 ? PRO C 725 ? MET C 721 PRO C 725 
T  6 SER C 935 ? GLN C 941 ? SER C 935 GLN C 941 
T  7 GLU C 944 ? PRO C 949 ? GLU C 944 PRO C 949 
U  1 VAL C 792 ? TYR C 793 ? VAL C 792 TYR C 793 
U  2 LYS C 826 ? ASN C 831 ? LYS C 826 ASN C 831 
U  3 THR C 766 ? VAL C 771 ? THR C 766 VAL C 771 
U  4 SER C 857 ? ALA C 860 ? SER C 857 ALA C 860 
V  1 PHE C 912 ? ASP C 915 ? PHE C 912 ASP C 915 
V  2 VAL C 918 ? SER C 921 ? VAL C 918 SER C 921 
W  1 ILE D 232 ? THR D 235 ? ILE D 232 THR D 235 
W  2 VAL D 214 ? ILE D 217 ? VAL D 214 ILE D 217 
W  3 ILE D 184 ? THR D 188 ? ILE D 184 THR D 188 
W  4 ALA D 279 ? GLY D 284 ? ALA D 279 GLY D 284 
W  5 ASN D 324 ? SER D 331 ? ASN D 324 SER D 331 
W  6 ILE D 343 ? GLY D 344 ? ILE D 343 GLY D 344 
X  1 ILE D 232 ? THR D 235 ? ILE D 232 THR D 235 
X  2 VAL D 214 ? ILE D 217 ? VAL D 214 ILE D 217 
X  3 ILE D 184 ? THR D 188 ? ILE D 184 THR D 188 
X  4 ALA D 279 ? GLY D 284 ? ALA D 279 GLY D 284 
X  5 ASN D 324 ? SER D 331 ? ASN D 324 SER D 331 
X  6 PRO D 502 ? ILE D 506 ? PRO D 502 ILE D 506 
X  7 ILE D 511 ? PRO D 515 ? ILE D 511 PRO D 515 
Y  1 TYR D 394 ? LEU D 396 ? TYR D 394 LEU D 396 
Y  2 THR D 426 ? VAL D 430 ? THR D 426 VAL D 430 
Y  3 ARG D 368 ? GLU D 373 ? ARG D 368 GLU D 373 
Y  4 ASP D 458 ? THR D 463 ? ASP D 458 THR D 463 
Z  1 VAL D 620 ? SER D 622 ? VAL D 620 SER D 622 
Z  2 VAL D 603 ? ILE D 607 ? VAL D 603 ILE D 607 
Z  3 LYS D 573 ? VAL D 579 ? LYS D 573 VAL D 579 
Z  4 THR D 641 ? ASN D 642 ? THR D 641 ASN D 642 
AA 1 VAL D 620 ? SER D 622 ? VAL D 620 SER D 622 
AA 2 VAL D 603 ? ILE D 607 ? VAL D 603 ILE D 607 
AA 3 LYS D 573 ? VAL D 579 ? LYS D 573 VAL D 579 
AA 4 GLY D 665 ? GLY D 670 ? GLY D 665 GLY D 670 
AA 5 LEU D 695 ? PRO D 699 ? LEU D 695 PRO D 699 
AA 6 ALA D 890 ? ILE D 895 ? ALA D 890 ILE D 895 
AA 7 LEU D 900 ? PRO D 904 ? LEU D 900 PRO D 904 
AB 1 ILE D 765 ? TYR D 767 ? ILE D 765 TYR D 767 
AB 2 ARG D 800 ? SER D 805 ? ARG D 800 SER D 805 
AB 3 ARG D 739 ? VAL D 745 ? ARG D 739 VAL D 745 
AB 4 ASP D 830 ? ALA D 834 ? ASP D 830 ALA D 834 
AC 1 HIS E 35  ? VAL E 41  ? HIS E 35  VAL E 41  
AC 2 LYS E 59  ? GLU E 64  ? LYS E 59  GLU E 64  
AC 3 GLY E 105 ? LEU E 110 ? GLY E 105 LEU E 110 
AC 4 ILE E 6   ? THR E 16  ? ILE E 6   THR E 16  
AC 5 ASN H 97  ? SER H 102 ? ASN H 97  SER H 102 
AC 6 GLY H 138 ? ILE H 141 ? GLY H 138 ILE H 141 
AC 7 PHE H 129 ? VAL H 131 ? PHE H 129 VAL H 131 
AD 1 PHE E 158 ? ARG E 161 ? PHE E 158 ARG E 161 
AD 2 GLY E 165 ? SER E 169 ? GLY E 165 SER E 169 
AD 3 GLU E 126 ? PHE E 130 ? GLU E 126 PHE E 130 
AD 4 PHE H 12  ? PHE H 16  ? PHE H 12  PHE H 16  
AD 5 SER H 59  ? ILE H 63  ? SER H 59  ILE H 63  
AD 6 GLN H 50  ? LEU H 51  ? GLN H 50  LEU H 51  
AD 7 ALA H 37  ? ILE H 38  ? ALA H 37  ILE H 38  
AE 1 LEU E 260 ? LEU E 263 ? LEU E 260 LEU E 263 
AE 2 CYS E 241 ? CYS E 246 ? CYS E 241 CYS E 246 
AE 3 LYS E 211 ? THR E 217 ? LYS E 211 THR E 217 
AE 4 ALA E 307 ? GLY E 312 ? ALA E 307 GLY E 312 
AE 5 THR E 352 ? SER E 359 ? THR E 352 SER E 359 
AE 6 ILE E 371 ? GLY E 372 ? ILE E 371 GLY E 372 
AF 1 LEU E 260 ? LEU E 263 ? LEU E 260 LEU E 263 
AF 2 CYS E 241 ? CYS E 246 ? CYS E 241 CYS E 246 
AF 3 LYS E 211 ? THR E 217 ? LYS E 211 THR E 217 
AF 4 ALA E 307 ? GLY E 312 ? ALA E 307 GLY E 312 
AF 5 THR E 352 ? SER E 359 ? THR E 352 SER E 359 
AF 6 PRO E 529 ? ILE E 533 ? PRO E 529 ILE E 533 
AF 7 ILE E 538 ? PRO E 542 ? ILE E 538 PRO E 542 
AG 1 TYR E 422 ? PHE E 424 ? TYR E 422 PHE E 424 
AG 2 LYS E 453 ? VAL E 458 ? LYS E 453 VAL E 458 
AG 3 ARG E 396 ? GLU E 401 ? ARG E 396 GLU E 401 
AG 4 ASP E 485 ? ARG E 490 ? ASP E 485 ARG E 490 
AH 1 VAL E 647 ? LEU E 650 ? VAL E 647 LEU E 650 
AH 2 ARG E 630 ? ILE E 634 ? ARG E 630 ILE E 634 
AH 3 ASN E 600 ? VAL E 606 ? ASN E 600 VAL E 606 
AH 4 GLY E 691 ? GLY E 696 ? GLY E 691 GLY E 696 
AH 5 MET E 721 ? PRO E 725 ? MET E 721 PRO E 725 
AH 6 SER E 935 ? GLN E 941 ? SER E 935 GLN E 941 
AH 7 GLU E 944 ? PRO E 949 ? GLU E 944 PRO E 949 
AI 1 VAL E 792 ? TYR E 793 ? VAL E 792 TYR E 793 
AI 2 LYS E 826 ? ASN E 831 ? LYS E 826 ASN E 831 
AI 3 THR E 766 ? VAL E 771 ? THR E 766 VAL E 771 
AI 4 SER E 857 ? ALA E 860 ? SER E 857 ALA E 860 
AJ 1 PHE E 912 ? ASP E 915 ? PHE E 912 ASP E 915 
AJ 2 VAL E 918 ? SER E 921 ? VAL E 918 SER E 921 
AK 1 ALA F 37  ? ILE F 38  ? ALA F 37  ILE F 38  
AK 2 GLN F 50  ? LEU F 51  ? GLN F 50  LEU F 51  
AK 3 SER F 59  ? ILE F 63  ? SER F 59  ILE F 63  
AK 4 GLY F 9   ? PHE F 16  ? GLY F 9   PHE F 16  
AK 5 GLU G 126 ? PHE G 130 ? GLU G 126 PHE G 130 
AK 6 ASP G 166 ? SER G 169 ? ASP G 166 SER G 169 
AK 7 PHE G 158 ? THR G 160 ? PHE G 158 THR G 160 
AL 1 PHE F 129 ? VAL F 131 ? PHE F 129 VAL F 131 
AL 2 GLY F 138 ? ILE F 141 ? GLY F 138 ILE F 141 
AL 3 ASN F 97  ? SER F 102 ? ASN F 97  SER F 102 
AL 4 ILE G 6   ? THR G 16  ? ILE G 6   THR G 16  
AL 5 GLY G 105 ? LEU G 110 ? GLY G 105 LEU G 110 
AL 6 LYS G 59  ? GLU G 64  ? LYS G 59  GLU G 64  
AL 7 HIS G 35  ? VAL G 41  ? HIS G 35  VAL G 41  
AM 1 ILE F 232 ? THR F 235 ? ILE F 232 THR F 235 
AM 2 VAL F 214 ? ILE F 217 ? VAL F 214 ILE F 217 
AM 3 ILE F 184 ? THR F 188 ? ILE F 184 THR F 188 
AM 4 ALA F 279 ? GLY F 284 ? ALA F 279 GLY F 284 
AM 5 ASN F 324 ? SER F 331 ? ASN F 324 SER F 331 
AM 6 ILE F 343 ? GLY F 344 ? ILE F 343 GLY F 344 
AN 1 ILE F 232 ? THR F 235 ? ILE F 232 THR F 235 
AN 2 VAL F 214 ? ILE F 217 ? VAL F 214 ILE F 217 
AN 3 ILE F 184 ? THR F 188 ? ILE F 184 THR F 188 
AN 4 ALA F 279 ? GLY F 284 ? ALA F 279 GLY F 284 
AN 5 ASN F 324 ? SER F 331 ? ASN F 324 SER F 331 
AN 6 PRO F 502 ? ILE F 506 ? PRO F 502 ILE F 506 
AN 7 ILE F 511 ? PRO F 515 ? ILE F 511 PRO F 515 
AO 1 TYR F 394 ? LEU F 396 ? TYR F 394 LEU F 396 
AO 2 THR F 426 ? ALA F 431 ? THR F 426 ALA F 431 
AO 3 ARG F 368 ? VAL F 374 ? ARG F 368 VAL F 374 
AO 4 ASP F 458 ? THR F 463 ? ASP F 458 THR F 463 
AP 1 VAL F 620 ? SER F 622 ? VAL F 620 SER F 622 
AP 2 VAL F 603 ? ILE F 607 ? VAL F 603 ILE F 607 
AP 3 LYS F 573 ? VAL F 579 ? LYS F 573 VAL F 579 
AP 4 THR F 641 ? ASN F 642 ? THR F 641 ASN F 642 
AQ 1 VAL F 620 ? SER F 622 ? VAL F 620 SER F 622 
AQ 2 VAL F 603 ? ILE F 607 ? VAL F 603 ILE F 607 
AQ 3 LYS F 573 ? VAL F 579 ? LYS F 573 VAL F 579 
AQ 4 GLY F 665 ? GLY F 670 ? GLY F 665 GLY F 670 
AQ 5 LEU F 695 ? PRO F 699 ? LEU F 695 PRO F 699 
AQ 6 ALA F 890 ? ILE F 895 ? ALA F 890 ILE F 895 
AQ 7 LEU F 900 ? PRO F 904 ? LEU F 900 PRO F 904 
AR 1 ILE F 765 ? TYR F 767 ? ILE F 765 TYR F 767 
AR 2 ARG F 800 ? SER F 805 ? ARG F 800 SER F 805 
AR 3 ARG F 739 ? VAL F 745 ? ARG F 739 VAL F 745 
AR 4 ASP F 830 ? ALA F 834 ? ASP F 830 ALA F 834 
AS 1 LEU G 260 ? LEU G 263 ? LEU G 260 LEU G 263 
AS 2 CYS G 241 ? CYS G 246 ? CYS G 241 CYS G 246 
AS 3 LYS G 211 ? THR G 217 ? LYS G 211 THR G 217 
AS 4 ALA G 307 ? GLY G 312 ? ALA G 307 GLY G 312 
AS 5 THR G 352 ? SER G 359 ? THR G 352 SER G 359 
AS 6 ILE G 371 ? GLY G 372 ? ILE G 371 GLY G 372 
AT 1 LEU G 260 ? LEU G 263 ? LEU G 260 LEU G 263 
AT 2 CYS G 241 ? CYS G 246 ? CYS G 241 CYS G 246 
AT 3 LYS G 211 ? THR G 217 ? LYS G 211 THR G 217 
AT 4 ALA G 307 ? GLY G 312 ? ALA G 307 GLY G 312 
AT 5 THR G 352 ? SER G 359 ? THR G 352 SER G 359 
AT 6 PRO G 529 ? ILE G 533 ? PRO G 529 ILE G 533 
AT 7 ILE G 538 ? PRO G 542 ? ILE G 538 PRO G 542 
AU 1 TYR G 422 ? PHE G 424 ? TYR G 422 PHE G 424 
AU 2 LYS G 453 ? VAL G 458 ? LYS G 453 VAL G 458 
AU 3 ARG G 396 ? GLU G 401 ? ARG G 396 GLU G 401 
AU 4 ASP G 485 ? ARG G 490 ? ASP G 485 ARG G 490 
AV 1 VAL G 647 ? LEU G 650 ? VAL G 647 LEU G 650 
AV 2 ARG G 630 ? ILE G 634 ? ARG G 630 ILE G 634 
AV 3 ASN G 600 ? VAL G 606 ? ASN G 600 VAL G 606 
AV 4 GLY G 691 ? GLY G 696 ? GLY G 691 GLY G 696 
AV 5 MET G 721 ? PRO G 725 ? MET G 721 PRO G 725 
AV 6 SER G 935 ? GLN G 941 ? SER G 935 GLN G 941 
AV 7 GLU G 944 ? PRO G 949 ? GLU G 944 PRO G 949 
AW 1 VAL G 792 ? TYR G 793 ? VAL G 792 TYR G 793 
AW 2 LYS G 826 ? ASN G 831 ? LYS G 826 ASN G 831 
AW 3 THR G 766 ? VAL G 771 ? THR G 766 VAL G 771 
AW 4 SER G 857 ? ALA G 860 ? SER G 857 ALA G 860 
AX 1 PHE G 912 ? ASP G 915 ? PHE G 912 ASP G 915 
AX 2 VAL G 918 ? SER G 921 ? VAL G 918 SER G 921 
AY 1 ILE H 232 ? THR H 235 ? ILE H 232 THR H 235 
AY 2 VAL H 214 ? ILE H 217 ? VAL H 214 ILE H 217 
AY 3 ILE H 184 ? THR H 188 ? ILE H 184 THR H 188 
AY 4 ALA H 279 ? GLY H 284 ? ALA H 279 GLY H 284 
AY 5 ASN H 324 ? SER H 331 ? ASN H 324 SER H 331 
AY 6 ILE H 343 ? GLY H 344 ? ILE H 343 GLY H 344 
AZ 1 ILE H 232 ? THR H 235 ? ILE H 232 THR H 235 
AZ 2 VAL H 214 ? ILE H 217 ? VAL H 214 ILE H 217 
AZ 3 ILE H 184 ? THR H 188 ? ILE H 184 THR H 188 
AZ 4 ALA H 279 ? GLY H 284 ? ALA H 279 GLY H 284 
AZ 5 ASN H 324 ? SER H 331 ? ASN H 324 SER H 331 
AZ 6 PRO H 502 ? ILE H 506 ? PRO H 502 ILE H 506 
AZ 7 ILE H 511 ? PRO H 515 ? ILE H 511 PRO H 515 
BA 1 TYR H 394 ? LEU H 396 ? TYR H 394 LEU H 396 
BA 2 THR H 426 ? ALA H 431 ? THR H 426 ALA H 431 
BA 3 ARG H 368 ? VAL H 374 ? ARG H 368 VAL H 374 
BA 4 ASP H 458 ? THR H 463 ? ASP H 458 THR H 463 
BB 1 VAL H 620 ? SER H 622 ? VAL H 620 SER H 622 
BB 2 VAL H 603 ? ILE H 607 ? VAL H 603 ILE H 607 
BB 3 LYS H 573 ? VAL H 579 ? LYS H 573 VAL H 579 
BB 4 THR H 641 ? ASN H 642 ? THR H 641 ASN H 642 
BC 1 VAL H 620 ? SER H 622 ? VAL H 620 SER H 622 
BC 2 VAL H 603 ? ILE H 607 ? VAL H 603 ILE H 607 
BC 3 LYS H 573 ? VAL H 579 ? LYS H 573 VAL H 579 
BC 4 GLY H 665 ? GLY H 670 ? GLY H 665 GLY H 670 
BC 5 LEU H 695 ? PRO H 699 ? LEU H 695 PRO H 699 
BC 6 ALA H 890 ? ILE H 895 ? ALA H 890 ILE H 895 
BC 7 LEU H 900 ? PRO H 904 ? LEU H 900 PRO H 904 
BD 1 ILE H 765 ? TYR H 767 ? ILE H 765 TYR H 767 
BD 2 ARG H 800 ? SER H 805 ? ARG H 800 SER H 805 
BD 3 ARG H 739 ? VAL H 745 ? ARG H 739 VAL H 745 
BD 4 ASP H 830 ? ALA H 834 ? ASP H 830 ALA H 834 
BE 1 ILE I 182 ? VAL I 186 ? ILE I 182 VAL I 186 
BE 2 ARG I 191 ? CYS I 199 ? ARG I 191 CYS I 199 
BE 3 LEU I 120 ? LEU I 126 ? LEU I 120 LEU I 126 
BE 4 PHE I 85  ? MET I 89  ? PHE I 85  MET I 89  
BE 5 ILE I 240 ? THR I 246 ? ILE I 240 THR I 246 
BE 6 LEU I 269 ? TYR I 278 ? LEU I 269 TYR I 278 
BE 7 ILE I 341 ? TYR I 349 ? ILE I 341 TYR I 349 
BE 8 ILE I 330 ? GLN I 338 ? ILE I 330 GLN I 338 
BF 1 ILE J 182 ? VAL J 186 ? ILE J 182 VAL J 186 
BF 2 ARG J 191 ? LEU J 198 ? ARG J 191 LEU J 198 
BF 3 LEU J 120 ? VAL J 125 ? LEU J 120 VAL J 125 
BF 4 PHE J 85  ? MET J 89  ? PHE J 85  MET J 89  
BF 5 ILE J 240 ? LEU J 245 ? ILE J 240 LEU J 245 
BF 6 LEU J 269 ? ASP J 277 ? LEU J 269 ASP J 277 
BF 7 ILE J 341 ? TYR J 349 ? ILE J 341 TYR J 349 
BF 8 ILE J 330 ? GLN J 338 ? ILE J 330 GLN J 338 
BG 1 ILE K 182 ? VAL K 186 ? ILE K 182 VAL K 186 
BG 2 ARG K 191 ? CYS K 199 ? ARG K 191 CYS K 199 
BG 3 ASP K 121 ? LEU K 126 ? ASP K 121 LEU K 126 
BG 4 PHE K 85  ? MET K 89  ? PHE K 85  MET K 89  
BG 5 ILE K 240 ? LEU K 245 ? ILE K 240 LEU K 245 
BG 6 LEU K 269 ? ASP K 277 ? LEU K 269 ASP K 277 
BG 7 SER K 342 ? TYR K 349 ? SER K 342 TYR K 349 
BG 8 ILE K 330 ? HIS K 337 ? ILE K 330 HIS K 337 
BH 1 ILE L 182 ? VAL L 186 ? ILE L 182 VAL L 186 
BH 2 ARG L 191 ? CYS L 199 ? ARG L 191 CYS L 199 
BH 3 LEU L 120 ? LEU L 126 ? LEU L 120 LEU L 126 
BH 4 PHE L 85  ? MET L 89  ? PHE L 85  MET L 89  
BH 5 ILE L 240 ? LEU L 245 ? ILE L 240 LEU L 245 
BH 6 LEU L 269 ? ASP L 277 ? LEU L 269 ASP L 277 
BH 7 SER L 342 ? TYR L 349 ? SER L 342 TYR L 349 
BH 8 ILE L 330 ? HIS L 337 ? ILE L 330 HIS L 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 38  ? N ARG A 38  O TRP A 62  ? O TRP A 62  
A  2 3 N ILE A 61  ? N ILE A 61  O ILE A 108 ? O ILE A 108 
A  3 4 O LYS A 109 ? O LYS A 109 N PHE A 14  ? N PHE A 14  
A  4 5 N SER A 13  ? N SER A 13  O ASN D 97  ? O ASN D 97  
A  5 6 N PHE D 100 ? N PHE D 100 O ILE D 141 ? O ILE D 141 
A  6 7 O GLY D 138 ? O GLY D 138 N VAL D 131 ? N VAL D 131 
B  1 2 N THR A 160 ? N THR A 160 O ASP A 166 ? O ASP A 166 
B  2 3 O SER A 169 ? O SER A 169 N PHE A 129 ? N PHE A 129 
B  3 4 N GLU A 126 ? N GLU A 126 O THR D 14  ? O THR D 14  
B  4 5 N LEU D 15  ? N LEU D 15  O GLN D 61  ? O GLN D 61  
B  5 6 O ILE D 60  ? O ILE D 60  N GLN D 50  ? N GLN D 50  
B  6 7 O LEU D 51  ? O LEU D 51  N ALA D 37  ? N ALA D 37  
C  1 2 O LYS A 261 ? O LYS A 261 N ALA A 245 ? N ALA A 245 
C  2 3 O LYS A 242 ? O LYS A 242 N LYS A 211 ? N LYS A 211 
C  3 4 N ILE A 216 ? N ILE A 216 O CYS A 311 ? O CYS A 311 
C  4 5 N VAL A 310 ? N VAL A 310 O LEU A 356 ? O LEU A 356 
C  5 6 N VAL A 357 ? N VAL A 357 O ILE A 371 ? O ILE A 371 
D  1 2 O LYS A 261 ? O LYS A 261 N ALA A 245 ? N ALA A 245 
D  2 3 O LYS A 242 ? O LYS A 242 N LYS A 211 ? N LYS A 211 
D  3 4 N ILE A 216 ? N ILE A 216 O CYS A 311 ? O CYS A 311 
D  4 5 N VAL A 310 ? N VAL A 310 O LEU A 356 ? O LEU A 356 
D  5 6 N GLY A 355 ? N GLY A 355 O ILE A 531 ? O ILE A 531 
D  6 7 N SER A 532 ? N SER A 532 O VAL A 539 ? O VAL A 539 
E  1 2 N PHE A 424 ? N PHE A 424 O ILE A 457 ? O ILE A 457 
E  2 3 O VAL A 456 ? O VAL A 456 N VAL A 400 ? N VAL A 400 
E  3 4 N VAL A 399 ? N VAL A 399 O THR A 489 ? O THR A 489 
F  1 2 O ARG A 648 ? O ARG A 648 N ALA A 633 ? N ALA A 633 
F  2 3 O ARG A 630 ? O ARG A 630 N ILE A 601 ? N ILE A 601 
F  3 4 N ILE A 604 ? N ILE A 604 O ILE A 695 ? O ILE A 695 
F  4 5 N ILE A 694 ? N ILE A 694 O CYS A 722 ? O CYS A 722 
F  5 6 N MET A 721 ? N MET A 721 O VAL A 936 ? O VAL A 936 
F  6 7 N GLY A 939 ? N GLY A 939 O THR A 946 ? O THR A 946 
G  1 2 N TYR A 793 ? N TYR A 793 O ILE A 829 ? O ILE A 829 
G  2 3 O HIS A 830 ? O HIS A 830 N VAL A 769 ? N VAL A 769 
G  3 4 N VAL A 768 ? N VAL A 768 O ARG A 858 ? O ARG A 858 
H  1 2 N PHE A 913 ? N PHE A 913 O THR A 920 ? O THR A 920 
I  1 2 N ALA B 37  ? N ALA B 37  O LEU B 51  ? O LEU B 51  
I  2 3 N GLN B 50  ? N GLN B 50  O ILE B 60  ? O ILE B 60  
I  3 4 O GLN B 61  ? O GLN B 61  N LEU B 15  ? N LEU B 15  
I  4 5 N THR B 14  ? N THR B 14  O GLU C 126 ? O GLU C 126 
I  5 6 N PHE C 129 ? N PHE C 129 O SER C 169 ? O SER C 169 
I  6 7 O ASP C 166 ? O ASP C 166 N THR C 160 ? N THR C 160 
J  1 2 N VAL B 131 ? N VAL B 131 O GLY B 138 ? O GLY B 138 
J  2 3 O ILE B 141 ? O ILE B 141 N PHE B 100 ? N PHE B 100 
J  3 4 N ASN B 97  ? N ASN B 97  O SER C 13  ? O SER C 13  
J  4 5 N PHE C 14  ? N PHE C 14  O LYS C 109 ? O LYS C 109 
J  5 6 O ILE C 108 ? O ILE C 108 N ILE C 61  ? N ILE C 61  
J  6 7 O TRP C 62  ? O TRP C 62  N ARG C 38  ? N ARG C 38  
K  1 2 O THR B 235 ? O THR B 235 N VAL B 214 ? N VAL B 214 
K  2 3 O ILE B 217 ? O ILE B 217 N VAL B 186 ? N VAL B 186 
K  3 4 N GLY B 185 ? N GLY B 185 O ILE B 281 ? O ILE B 281 
K  4 5 N LEU B 280 ? N LEU B 280 O ASN B 324 ? O ASN B 324 
K  5 6 N VAL B 329 ? N VAL B 329 O ILE B 343 ? O ILE B 343 
L  1 2 O THR B 235 ? O THR B 235 N VAL B 214 ? N VAL B 214 
L  2 3 O ILE B 217 ? O ILE B 217 N VAL B 186 ? N VAL B 186 
L  3 4 N GLY B 185 ? N GLY B 185 O ILE B 281 ? O ILE B 281 
L  4 5 N LEU B 280 ? N LEU B 280 O ASN B 324 ? O ASN B 324 
L  5 6 N GLY B 327 ? N GLY B 327 O ILE B 504 ? O ILE B 504 
L  6 7 N ALA B 505 ? N ALA B 505 O THR B 512 ? O THR B 512 
M  1 2 N LEU B 396 ? N LEU B 396 O ILE B 429 ? O ILE B 429 
M  2 3 O THR B 426 ? O THR B 426 N PHE B 370 ? N PHE B 370 
M  3 4 N ILE B 371 ? N ILE B 371 O THR B 462 ? O THR B 462 
N  1 2 O ARG B 621 ? O ARG B 621 N ALA B 606 ? N ALA B 606 
N  2 3 O ILE B 607 ? O ILE B 607 N ILE B 576 ? N ILE B 576 
N  3 4 N ASN B 578 ? N ASN B 578 O ASN B 642 ? O ASN B 642 
O  1 2 O ARG B 621 ? O ARG B 621 N ALA B 606 ? N ALA B 606 
O  2 3 O ILE B 607 ? O ILE B 607 N ILE B 576 ? N ILE B 576 
O  3 4 N ALA B 575 ? N ALA B 575 O ILE B 667 ? O ILE B 667 
O  4 5 N LEU B 668 ? N LEU B 668 O VAL B 696 ? O VAL B 696 
O  5 6 N LEU B 695 ? N LEU B 695 O VAL B 891 ? O VAL B 891 
O  6 7 N GLY B 894 ? N GLY B 894 O ARG B 901 ? O ARG B 901 
P  1 2 N TYR B 767 ? N TYR B 767 O LEU B 803 ? O LEU B 803 
P  2 3 O ILE B 802 ? O ILE B 802 N VAL B 743 ? N VAL B 743 
P  3 4 N VAL B 742 ? N VAL B 742 O LYS B 832 ? O LYS B 832 
Q  1 2 O LYS C 261 ? O LYS C 261 N ALA C 245 ? N ALA C 245 
Q  2 3 O LYS C 242 ? O LYS C 242 N LYS C 211 ? N LYS C 211 
Q  3 4 N ILE C 216 ? N ILE C 216 O CYS C 311 ? O CYS C 311 
Q  4 5 N VAL C 310 ? N VAL C 310 O LEU C 356 ? O LEU C 356 
Q  5 6 N VAL C 357 ? N VAL C 357 O ILE C 371 ? O ILE C 371 
R  1 2 O LYS C 261 ? O LYS C 261 N ALA C 245 ? N ALA C 245 
R  2 3 O LYS C 242 ? O LYS C 242 N LYS C 211 ? N LYS C 211 
R  3 4 N ILE C 216 ? N ILE C 216 O CYS C 311 ? O CYS C 311 
R  4 5 N VAL C 310 ? N VAL C 310 O LEU C 356 ? O LEU C 356 
R  5 6 N GLY C 355 ? N GLY C 355 O ILE C 531 ? O ILE C 531 
R  6 7 N SER C 532 ? N SER C 532 O VAL C 539 ? O VAL C 539 
S  1 2 N PHE C 424 ? N PHE C 424 O ILE C 457 ? O ILE C 457 
S  2 3 O VAL C 456 ? O VAL C 456 N VAL C 400 ? N VAL C 400 
S  3 4 N VAL C 399 ? N VAL C 399 O THR C 489 ? O THR C 489 
T  1 2 O ARG C 648 ? O ARG C 648 N ALA C 633 ? N ALA C 633 
T  2 3 O ARG C 630 ? O ARG C 630 N ILE C 601 ? N ILE C 601 
T  3 4 N ILE C 604 ? N ILE C 604 O ILE C 695 ? O ILE C 695 
T  4 5 N ILE C 694 ? N ILE C 694 O CYS C 722 ? O CYS C 722 
T  5 6 N MET C 721 ? N MET C 721 O VAL C 936 ? O VAL C 936 
T  6 7 N GLY C 939 ? N GLY C 939 O THR C 946 ? O THR C 946 
U  1 2 N TYR C 793 ? N TYR C 793 O ILE C 829 ? O ILE C 829 
U  2 3 O HIS C 830 ? O HIS C 830 N VAL C 769 ? N VAL C 769 
U  3 4 N VAL C 768 ? N VAL C 768 O ARG C 858 ? O ARG C 858 
V  1 2 N ASP C 915 ? N ASP C 915 O VAL C 918 ? O VAL C 918 
W  1 2 O LYS D 233 ? O LYS D 233 N CYS D 216 ? N CYS D 216 
W  2 3 O ILE D 217 ? O ILE D 217 N VAL D 186 ? N VAL D 186 
W  3 4 N GLY D 185 ? N GLY D 185 O ILE D 281 ? O ILE D 281 
W  4 5 N LEU D 280 ? N LEU D 280 O ASN D 324 ? O ASN D 324 
W  5 6 N VAL D 329 ? N VAL D 329 O ILE D 343 ? O ILE D 343 
X  1 2 O LYS D 233 ? O LYS D 233 N CYS D 216 ? N CYS D 216 
X  2 3 O ILE D 217 ? O ILE D 217 N VAL D 186 ? N VAL D 186 
X  3 4 N GLY D 185 ? N GLY D 185 O ILE D 281 ? O ILE D 281 
X  4 5 N LEU D 280 ? N LEU D 280 O ASN D 324 ? O ASN D 324 
X  5 6 N GLY D 327 ? N GLY D 327 O ILE D 504 ? O ILE D 504 
X  6 7 N ALA D 505 ? N ALA D 505 O THR D 512 ? O THR D 512 
Y  1 2 N LEU D 396 ? N LEU D 396 O ILE D 429 ? O ILE D 429 
Y  2 3 O THR D 426 ? O THR D 426 N PHE D 370 ? N PHE D 370 
Y  3 4 N ILE D 371 ? N ILE D 371 O THR D 462 ? O THR D 462 
Z  1 2 O ARG D 621 ? O ARG D 621 N ALA D 606 ? N ALA D 606 
Z  2 3 O ILE D 607 ? O ILE D 607 N ILE D 576 ? N ILE D 576 
Z  3 4 N ASN D 578 ? N ASN D 578 O ASN D 642 ? O ASN D 642 
AA 1 2 O ARG D 621 ? O ARG D 621 N ALA D 606 ? N ALA D 606 
AA 2 3 O ILE D 607 ? O ILE D 607 N ILE D 576 ? N ILE D 576 
AA 3 4 N ALA D 575 ? N ALA D 575 O ILE D 667 ? O ILE D 667 
AA 4 5 N LEU D 668 ? N LEU D 668 O VAL D 696 ? O VAL D 696 
AA 5 6 N LEU D 695 ? N LEU D 695 O VAL D 891 ? O VAL D 891 
AA 6 7 N GLY D 894 ? N GLY D 894 O ARG D 901 ? O ARG D 901 
AB 1 2 N TYR D 767 ? N TYR D 767 O LEU D 803 ? O LEU D 803 
AB 2 3 O ILE D 802 ? O ILE D 802 N VAL D 743 ? N VAL D 743 
AB 3 4 N VAL D 740 ? N VAL D 740 O LYS D 832 ? O LYS D 832 
AC 1 2 N ARG E 38  ? N ARG E 38  O TRP E 62  ? O TRP E 62  
AC 2 3 N ILE E 61  ? N ILE E 61  O ILE E 108 ? O ILE E 108 
AC 3 4 O LYS E 109 ? O LYS E 109 N PHE E 14  ? N PHE E 14  
AC 4 5 N SER E 13  ? N SER E 13  O ASN H 97  ? O ASN H 97  
AC 5 6 N PHE H 100 ? N PHE H 100 O ILE H 141 ? O ILE H 141 
AC 6 7 O GLY H 138 ? O GLY H 138 N VAL H 131 ? N VAL H 131 
AD 1 2 N THR E 160 ? N THR E 160 O ASP E 166 ? O ASP E 166 
AD 2 3 O SER E 169 ? O SER E 169 N PHE E 129 ? N PHE E 129 
AD 3 4 N GLU E 126 ? N GLU E 126 O THR H 14  ? O THR H 14  
AD 4 5 N LEU H 15  ? N LEU H 15  O GLN H 61  ? O GLN H 61  
AD 5 6 O ILE H 60  ? O ILE H 60  N GLN H 50  ? N GLN H 50  
AD 6 7 O LEU H 51  ? O LEU H 51  N ALA H 37  ? N ALA H 37  
AE 1 2 O LYS E 261 ? O LYS E 261 N ALA E 245 ? N ALA E 245 
AE 2 3 O LYS E 242 ? O LYS E 242 N LYS E 211 ? N LYS E 211 
AE 3 4 N ILE E 216 ? N ILE E 216 O CYS E 311 ? O CYS E 311 
AE 4 5 N VAL E 310 ? N VAL E 310 O LEU E 356 ? O LEU E 356 
AE 5 6 N VAL E 357 ? N VAL E 357 O ILE E 371 ? O ILE E 371 
AF 1 2 O LYS E 261 ? O LYS E 261 N ALA E 245 ? N ALA E 245 
AF 2 3 O LYS E 242 ? O LYS E 242 N LYS E 211 ? N LYS E 211 
AF 3 4 N ILE E 216 ? N ILE E 216 O CYS E 311 ? O CYS E 311 
AF 4 5 N VAL E 310 ? N VAL E 310 O LEU E 356 ? O LEU E 356 
AF 5 6 N GLY E 355 ? N GLY E 355 O ILE E 531 ? O ILE E 531 
AF 6 7 N SER E 532 ? N SER E 532 O VAL E 539 ? O VAL E 539 
AG 1 2 N PHE E 424 ? N PHE E 424 O ILE E 457 ? O ILE E 457 
AG 2 3 O VAL E 456 ? O VAL E 456 N VAL E 400 ? N VAL E 400 
AG 3 4 N VAL E 399 ? N VAL E 399 O THR E 489 ? O THR E 489 
AH 1 2 O ARG E 648 ? O ARG E 648 N ALA E 633 ? N ALA E 633 
AH 2 3 O ARG E 630 ? O ARG E 630 N ILE E 601 ? N ILE E 601 
AH 3 4 N ILE E 604 ? N ILE E 604 O ILE E 695 ? O ILE E 695 
AH 4 5 N ILE E 694 ? N ILE E 694 O CYS E 722 ? O CYS E 722 
AH 5 6 N MET E 721 ? N MET E 721 O VAL E 936 ? O VAL E 936 
AH 6 7 N GLY E 939 ? N GLY E 939 O THR E 946 ? O THR E 946 
AI 1 2 N TYR E 793 ? N TYR E 793 O ILE E 829 ? O ILE E 829 
AI 2 3 O HIS E 830 ? O HIS E 830 N VAL E 769 ? N VAL E 769 
AI 3 4 N VAL E 768 ? N VAL E 768 O ARG E 858 ? O ARG E 858 
AJ 1 2 N ASP E 915 ? N ASP E 915 O VAL E 918 ? O VAL E 918 
AK 1 2 N ALA F 37  ? N ALA F 37  O LEU F 51  ? O LEU F 51  
AK 2 3 N GLN F 50  ? N GLN F 50  O ILE F 60  ? O ILE F 60  
AK 3 4 O GLN F 61  ? O GLN F 61  N LEU F 15  ? N LEU F 15  
AK 4 5 N THR F 14  ? N THR F 14  O GLU G 126 ? O GLU G 126 
AK 5 6 N PHE G 129 ? N PHE G 129 O SER G 169 ? O SER G 169 
AK 6 7 O ASP G 166 ? O ASP G 166 N THR G 160 ? N THR G 160 
AL 1 2 N VAL F 131 ? N VAL F 131 O GLY F 138 ? O GLY F 138 
AL 2 3 O ILE F 141 ? O ILE F 141 N PHE F 100 ? N PHE F 100 
AL 3 4 N ASN F 97  ? N ASN F 97  O SER G 13  ? O SER G 13  
AL 4 5 N PHE G 14  ? N PHE G 14  O LYS G 109 ? O LYS G 109 
AL 5 6 O ILE G 108 ? O ILE G 108 N ILE G 61  ? N ILE G 61  
AL 6 7 O TRP G 62  ? O TRP G 62  N ARG G 38  ? N ARG G 38  
AM 1 2 O THR F 235 ? O THR F 235 N VAL F 214 ? N VAL F 214 
AM 2 3 O ILE F 217 ? O ILE F 217 N VAL F 186 ? N VAL F 186 
AM 3 4 N GLY F 185 ? N GLY F 185 O ILE F 281 ? O ILE F 281 
AM 4 5 N LEU F 280 ? N LEU F 280 O ASN F 324 ? O ASN F 324 
AM 5 6 N VAL F 329 ? N VAL F 329 O ILE F 343 ? O ILE F 343 
AN 1 2 O THR F 235 ? O THR F 235 N VAL F 214 ? N VAL F 214 
AN 2 3 O ILE F 217 ? O ILE F 217 N VAL F 186 ? N VAL F 186 
AN 3 4 N GLY F 185 ? N GLY F 185 O ILE F 281 ? O ILE F 281 
AN 4 5 N LEU F 280 ? N LEU F 280 O ASN F 324 ? O ASN F 324 
AN 5 6 N GLY F 327 ? N GLY F 327 O ILE F 504 ? O ILE F 504 
AN 6 7 N ALA F 505 ? N ALA F 505 O THR F 512 ? O THR F 512 
AO 1 2 N LEU F 396 ? N LEU F 396 O ILE F 429 ? O ILE F 429 
AO 2 3 O VAL F 430 ? O VAL F 430 N VAL F 374 ? N VAL F 374 
AO 3 4 N ILE F 371 ? N ILE F 371 O THR F 462 ? O THR F 462 
AP 1 2 O ARG F 621 ? O ARG F 621 N ALA F 606 ? N ALA F 606 
AP 2 3 O ILE F 607 ? O ILE F 607 N ILE F 576 ? N ILE F 576 
AP 3 4 N ASN F 578 ? N ASN F 578 O ASN F 642 ? O ASN F 642 
AQ 1 2 O ARG F 621 ? O ARG F 621 N ALA F 606 ? N ALA F 606 
AQ 2 3 O ILE F 607 ? O ILE F 607 N ILE F 576 ? N ILE F 576 
AQ 3 4 N ALA F 575 ? N ALA F 575 O ILE F 667 ? O ILE F 667 
AQ 4 5 N LEU F 668 ? N LEU F 668 O VAL F 696 ? O VAL F 696 
AQ 5 6 N LEU F 695 ? N LEU F 695 O VAL F 891 ? O VAL F 891 
AQ 6 7 N GLY F 894 ? N GLY F 894 O ARG F 901 ? O ARG F 901 
AR 1 2 N TYR F 767 ? N TYR F 767 O LEU F 803 ? O LEU F 803 
AR 2 3 O ILE F 802 ? O ILE F 802 N VAL F 743 ? N VAL F 743 
AR 3 4 N VAL F 742 ? N VAL F 742 O LYS F 832 ? O LYS F 832 
AS 1 2 O LYS G 261 ? O LYS G 261 N ALA G 245 ? N ALA G 245 
AS 2 3 O LYS G 242 ? O LYS G 242 N LYS G 211 ? N LYS G 211 
AS 3 4 N ILE G 216 ? N ILE G 216 O CYS G 311 ? O CYS G 311 
AS 4 5 N VAL G 310 ? N VAL G 310 O LEU G 356 ? O LEU G 356 
AS 5 6 N VAL G 357 ? N VAL G 357 O ILE G 371 ? O ILE G 371 
AT 1 2 O LYS G 261 ? O LYS G 261 N ALA G 245 ? N ALA G 245 
AT 2 3 O LYS G 242 ? O LYS G 242 N LYS G 211 ? N LYS G 211 
AT 3 4 N ILE G 216 ? N ILE G 216 O CYS G 311 ? O CYS G 311 
AT 4 5 N VAL G 310 ? N VAL G 310 O LEU G 356 ? O LEU G 356 
AT 5 6 N GLY G 355 ? N GLY G 355 O ILE G 531 ? O ILE G 531 
AT 6 7 N SER G 532 ? N SER G 532 O VAL G 539 ? O VAL G 539 
AU 1 2 N PHE G 424 ? N PHE G 424 O ILE G 457 ? O ILE G 457 
AU 2 3 O VAL G 456 ? O VAL G 456 N VAL G 400 ? N VAL G 400 
AU 3 4 N VAL G 399 ? N VAL G 399 O THR G 489 ? O THR G 489 
AV 1 2 O ARG G 648 ? O ARG G 648 N ALA G 633 ? N ALA G 633 
AV 2 3 O ARG G 630 ? O ARG G 630 N ILE G 601 ? N ILE G 601 
AV 3 4 N ILE G 604 ? N ILE G 604 O ILE G 695 ? O ILE G 695 
AV 4 5 N ILE G 694 ? N ILE G 694 O CYS G 722 ? O CYS G 722 
AV 5 6 N MET G 721 ? N MET G 721 O VAL G 936 ? O VAL G 936 
AV 6 7 N GLY G 939 ? N GLY G 939 O THR G 946 ? O THR G 946 
AW 1 2 N TYR G 793 ? N TYR G 793 O ILE G 829 ? O ILE G 829 
AW 2 3 O HIS G 830 ? O HIS G 830 N VAL G 769 ? N VAL G 769 
AW 3 4 N VAL G 768 ? N VAL G 768 O ARG G 858 ? O ARG G 858 
AX 1 2 N ASP G 915 ? N ASP G 915 O VAL G 918 ? O VAL G 918 
AY 1 2 O THR H 235 ? O THR H 235 N VAL H 214 ? N VAL H 214 
AY 2 3 O ILE H 217 ? O ILE H 217 N VAL H 186 ? N VAL H 186 
AY 3 4 N GLY H 185 ? N GLY H 185 O ILE H 281 ? O ILE H 281 
AY 4 5 N LEU H 280 ? N LEU H 280 O ASN H 324 ? O ASN H 324 
AY 5 6 N VAL H 329 ? N VAL H 329 O ILE H 343 ? O ILE H 343 
AZ 1 2 O THR H 235 ? O THR H 235 N VAL H 214 ? N VAL H 214 
AZ 2 3 O ILE H 217 ? O ILE H 217 N VAL H 186 ? N VAL H 186 
AZ 3 4 N GLY H 185 ? N GLY H 185 O ILE H 281 ? O ILE H 281 
AZ 4 5 N LEU H 280 ? N LEU H 280 O ASN H 324 ? O ASN H 324 
AZ 5 6 N GLY H 327 ? N GLY H 327 O ILE H 504 ? O ILE H 504 
AZ 6 7 N ALA H 505 ? N ALA H 505 O THR H 512 ? O THR H 512 
BA 1 2 N LEU H 396 ? N LEU H 396 O ILE H 429 ? O ILE H 429 
BA 2 3 O VAL H 430 ? O VAL H 430 N VAL H 374 ? N VAL H 374 
BA 3 4 N ILE H 371 ? N ILE H 371 O THR H 462 ? O THR H 462 
BB 1 2 O ARG H 621 ? O ARG H 621 N ALA H 606 ? N ALA H 606 
BB 2 3 O ILE H 607 ? O ILE H 607 N ILE H 576 ? N ILE H 576 
BB 3 4 N ASN H 578 ? N ASN H 578 O ASN H 642 ? O ASN H 642 
BC 1 2 O ARG H 621 ? O ARG H 621 N ALA H 606 ? N ALA H 606 
BC 2 3 O ILE H 607 ? O ILE H 607 N ILE H 576 ? N ILE H 576 
BC 3 4 N ALA H 575 ? N ALA H 575 O ILE H 667 ? O ILE H 667 
BC 4 5 N LEU H 668 ? N LEU H 668 O VAL H 696 ? O VAL H 696 
BC 5 6 N LEU H 695 ? N LEU H 695 O VAL H 891 ? O VAL H 891 
BC 6 7 N GLY H 894 ? N GLY H 894 O ARG H 901 ? O ARG H 901 
BD 1 2 N TYR H 767 ? N TYR H 767 O LEU H 803 ? O LEU H 803 
BD 2 3 O ILE H 802 ? O ILE H 802 N VAL H 743 ? N VAL H 743 
BD 3 4 N VAL H 742 ? N VAL H 742 O LYS H 832 ? O LYS H 832 
BE 1 2 N GLY I 184 ? N GLY I 184 O ILE I 193 ? O ILE I 193 
BE 2 3 O LYS I 192 ? O LYS I 192 N LEU I 120 ? N LEU I 120 
BE 3 4 O ASP I 121 ? O ASP I 121 N VAL I 86  ? N VAL I 86  
BE 4 5 N PHE I 85  ? N PHE I 85  O ASP I 241 ? O ASP I 241 
BE 5 6 N LEU I 245 ? N LEU I 245 O LEU I 276 ? O LEU I 276 
BE 6 7 N VAL I 275 ? N VAL I 275 O HIS I 344 ? O HIS I 344 
BE 7 8 O ILE I 343 ? O ILE I 343 N LYS I 335 ? N LYS I 335 
BF 1 2 N GLY J 184 ? N GLY J 184 O ILE J 193 ? O ILE J 193 
BF 2 3 O HIS J 196 ? O HIS J 196 N TYR J 122 ? N TYR J 122 
BF 3 4 O TYR J 123 ? O TYR J 123 N GLN J 88  ? N GLN J 88  
BF 4 5 N LEU J 87  ? N LEU J 87  O LEU J 244 ? O LEU J 244 
BF 5 6 N LEU J 245 ? N LEU J 245 O LEU J 276 ? O LEU J 276 
BF 6 7 N VAL J 275 ? N VAL J 275 O HIS J 344 ? O HIS J 344 
BF 7 8 O SER J 347 ? O SER J 347 N CYS J 331 ? N CYS J 331 
BG 1 2 N GLY K 184 ? N GLY K 184 O ILE K 193 ? O ILE K 193 
BG 2 3 O HIS K 196 ? O HIS K 196 N TYR K 122 ? N TYR K 122 
BG 3 4 O VAL K 125 ? O VAL K 125 N GLN K 88  ? N GLN K 88  
BG 4 5 N LEU K 87  ? N LEU K 87  O LEU K 244 ? O LEU K 244 
BG 5 6 N LEU K 243 ? N LEU K 243 O TYR K 274 ? O TYR K 274 
BG 6 7 N VAL K 275 ? N VAL K 275 O HIS K 344 ? O HIS K 344 
BG 7 8 O ILE K 343 ? O ILE K 343 N LYS K 335 ? N LYS K 335 
BH 1 2 N GLY L 184 ? N GLY L 184 O ILE L 193 ? O ILE L 193 
BH 2 3 O HIS L 196 ? O HIS L 196 N TYR L 122 ? N TYR L 122 
BH 3 4 O VAL L 125 ? O VAL L 125 N GLN L 88  ? N GLN L 88  
BH 4 5 N MET L 89  ? N MET L 89  O LEU L 244 ? O LEU L 244 
BH 5 6 N LEU L 245 ? N LEU L 245 O LEU L 276 ? O LEU L 276 
BH 6 7 N VAL L 275 ? N VAL L 275 O HIS L 344 ? O HIS L 344 
BH 7 8 O GLY L 348 ? O GLY L 348 N CYS L 331 ? N CYS L 331 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ATP F 942'  
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ATP D 942'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ATP B 942'  
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ATP H 942'  
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 990'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 991'  
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 943'  
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 992'  
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 993'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 994'  
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 995'  
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 990'  
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 I 352'  
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 I 353'  
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 990'  
BC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 B 944'  
BC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 996'  
BC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 D 943'  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 991'  
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 G 990'  
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 J 352'  
CC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 944'  
CC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 C 992'  
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 945'  
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 G 991'  
CC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 H 943'  
CC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 993'  
DC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 F 943'  
DC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 G 992'  
DC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 944'  
DC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 991'  
DC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 H 945'  
DC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 K 352'  
DC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 992'  
DC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 997'  
DC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 J 353'  
EC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 F 944'  
EC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 998'  
EC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 E 993'  
EC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 K 353'  
EC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 993'  
EC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 G 994'  
EC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 994'  
EC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 995'  
EC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 945'  
FC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 E 994'  
FC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 946'  
FC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 999'  
FC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 1000' 
FC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 1001' 
FC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1002' 
FC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 996'  
FC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 997'  
FC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 C 998'  
GC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 999'  
GC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 995'  
GC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 996'  
GC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 E 997'  
GC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 G 995'  
GC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 996'  
GC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 997'  
GC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 I 354'  
GC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 I 355'  
HC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 I 356'  
HC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 J 354'  
HC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 K 354'  
HC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 L 352'  
HC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 L 353'  
HC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 L 354'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 ASP F  393 ? ASP F 393 . ? 1_555 ? 
2   AC1 14 TYR F  394 ? TYR F 394 . ? 1_555 ? 
3   AC1 14 ILE F  395 ? ILE F 395 . ? 1_555 ? 
4   AC1 14 LYS F  400 ? LYS F 400 . ? 1_555 ? 
5   AC1 14 ALA F  402 ? ALA F 402 . ? 1_555 ? 
6   AC1 14 SER F  403 ? SER F 403 . ? 1_555 ? 
7   AC1 14 SER F  404 ? SER F 404 . ? 1_555 ? 
8   AC1 14 ARG F  405 ? ARG F 405 . ? 1_555 ? 
9   AC1 14 GLN F  410 ? GLN F 410 . ? 1_555 ? 
10  AC1 14 ILE F  414 ? ILE F 414 . ? 1_555 ? 
11  AC1 14 PHE F  553 ? PHE F 553 . ? 1_555 ? 
12  AC1 14 ILE F  554 ? ILE F 554 . ? 1_555 ? 
13  AC1 14 ASN F  557 ? ASN F 557 . ? 1_555 ? 
14  AC1 14 SER F  558 ? SER F 558 . ? 1_555 ? 
15  AC2 13 ASP D  393 ? ASP D 393 . ? 1_555 ? 
16  AC2 13 TYR D  394 ? TYR D 394 . ? 1_555 ? 
17  AC2 13 ILE D  395 ? ILE D 395 . ? 1_555 ? 
18  AC2 13 LYS D  400 ? LYS D 400 . ? 1_555 ? 
19  AC2 13 SER D  403 ? SER D 403 . ? 1_555 ? 
20  AC2 13 SER D  404 ? SER D 404 . ? 1_555 ? 
21  AC2 13 ARG D  405 ? ARG D 405 . ? 1_555 ? 
22  AC2 13 GLN D  410 ? GLN D 410 . ? 1_555 ? 
23  AC2 13 ILE D  414 ? ILE D 414 . ? 1_555 ? 
24  AC2 13 PHE D  553 ? PHE D 553 . ? 1_555 ? 
25  AC2 13 ILE D  554 ? ILE D 554 . ? 1_555 ? 
26  AC2 13 ASN D  557 ? ASN D 557 . ? 1_555 ? 
27  AC2 13 SER D  558 ? SER D 558 . ? 1_555 ? 
28  AC3 13 ASP B  393 ? ASP B 393 . ? 1_555 ? 
29  AC3 13 TYR B  394 ? TYR B 394 . ? 1_555 ? 
30  AC3 13 ILE B  395 ? ILE B 395 . ? 1_555 ? 
31  AC3 13 LYS B  400 ? LYS B 400 . ? 1_555 ? 
32  AC3 13 SER B  403 ? SER B 403 . ? 1_555 ? 
33  AC3 13 SER B  404 ? SER B 404 . ? 1_555 ? 
34  AC3 13 ARG B  405 ? ARG B 405 . ? 1_555 ? 
35  AC3 13 GLN B  410 ? GLN B 410 . ? 1_555 ? 
36  AC3 13 ILE B  414 ? ILE B 414 . ? 1_555 ? 
37  AC3 13 PHE B  553 ? PHE B 553 . ? 1_555 ? 
38  AC3 13 ILE B  554 ? ILE B 554 . ? 1_555 ? 
39  AC3 13 ASN B  557 ? ASN B 557 . ? 1_555 ? 
40  AC3 13 SER B  558 ? SER B 558 . ? 1_555 ? 
41  AC4 13 ASP H  393 ? ASP H 393 . ? 1_555 ? 
42  AC4 13 TYR H  394 ? TYR H 394 . ? 1_555 ? 
43  AC4 13 ILE H  395 ? ILE H 395 . ? 1_555 ? 
44  AC4 13 LYS H  400 ? LYS H 400 . ? 1_555 ? 
45  AC4 13 SER H  403 ? SER H 403 . ? 1_555 ? 
46  AC4 13 SER H  404 ? SER H 404 . ? 1_555 ? 
47  AC4 13 ARG H  405 ? ARG H 405 . ? 1_555 ? 
48  AC4 13 GLN H  410 ? GLN H 410 . ? 1_555 ? 
49  AC4 13 ILE H  414 ? ILE H 414 . ? 1_555 ? 
50  AC4 13 PHE H  553 ? PHE H 553 . ? 1_555 ? 
51  AC4 13 ILE H  554 ? ILE H 554 . ? 1_555 ? 
52  AC4 13 ASN H  557 ? ASN H 557 . ? 1_555 ? 
53  AC4 13 SER H  558 ? SER H 558 . ? 1_555 ? 
54  AC5 7  GLY A  219 ? GLY A 219 . ? 1_555 ? 
55  AC5 7  GLY A  220 ? GLY A 220 . ? 1_555 ? 
56  AC5 7  GLY A  313 ? GLY A 313 . ? 1_555 ? 
57  AC5 7  ASP A  314 ? ASP A 314 . ? 1_555 ? 
58  AC5 7  GLY A  315 ? GLY A 315 . ? 1_555 ? 
59  AC5 7  SER A  316 ? SER A 316 . ? 1_555 ? 
60  AC5 7  SO4 N  .   ? SO4 A 991 . ? 1_555 ? 
61  AC6 7  GLY A  220 ? GLY A 220 . ? 1_555 ? 
62  AC6 7  GLY A  358 ? GLY A 358 . ? 1_555 ? 
63  AC6 7  SER A  359 ? SER A 359 . ? 1_555 ? 
64  AC6 7  ILE A  360 ? ILE A 360 . ? 1_555 ? 
65  AC6 7  ASP A  361 ? ASP A 361 . ? 1_555 ? 
66  AC6 7  ARG A  496 ? ARG A 496 . ? 1_555 ? 
67  AC6 7  SO4 M  .   ? SO4 A 990 . ? 1_555 ? 
68  AC7 5  MET A  403 ? MET A 403 . ? 1_555 ? 
69  AC7 5  HIS A  493 ? HIS A 493 . ? 1_555 ? 
70  AC7 5  ARG A  496 ? ARG A 496 . ? 1_555 ? 
71  AC7 5  ARG B  368 ? ARG B 368 . ? 1_555 ? 
72  AC7 5  ARG B  460 ? ARG B 460 . ? 1_555 ? 
73  AC8 3  ARG A  635 ? ARG A 635 . ? 1_555 ? 
74  AC8 3  SO4 P  .   ? SO4 A 993 . ? 1_555 ? 
75  AC8 3  LYS B  797 ? LYS B 797 . ? 1_555 ? 
76  AC9 5  ARG A  635 ? ARG A 635 . ? 1_555 ? 
77  AC9 5  SO4 O  .   ? SO4 A 992 . ? 1_555 ? 
78  AC9 5  GLN B  793 ? GLN B 793 . ? 1_555 ? 
79  AC9 5  GLY B  794 ? GLY B 794 . ? 1_555 ? 
80  AC9 5  LYS B  797 ? LYS B 797 . ? 1_555 ? 
81  BC1 5  ALA A  608 ? ALA A 608 . ? 1_555 ? 
82  BC1 5  ARG A  670 ? ARG A 670 . ? 1_555 ? 
83  BC1 5  HIS A  864 ? HIS A 864 . ? 1_555 ? 
84  BC1 5  ARG B  739 ? ARG B 739 . ? 1_555 ? 
85  BC1 5  LYS B  832 ? LYS B 832 . ? 1_555 ? 
86  BC2 3  THR A  575 ? THR A 575 . ? 1_555 ? 
87  BC2 3  ARG A  881 ? ARG A 881 . ? 1_555 ? 
88  BC2 3  LYS A  885 ? LYS A 885 . ? 1_555 ? 
89  BC3 4  GLY A  917 ? GLY A 917 . ? 1_555 ? 
90  BC3 4  ARG E  643 ? ARG E 643 . ? 1_555 ? 
91  BC3 4  HIS E  644 ? HIS E 644 . ? 1_555 ? 
92  BC3 4  ARG F  828 ? ARG F 828 . ? 1_555 ? 
93  BC4 3  ARG I  93  ? ARG I 93  . ? 1_555 ? 
94  BC4 3  ASP I  250 ? ASP I 250 . ? 1_555 ? 
95  BC4 3  THR I  251 ? THR I 251 . ? 1_555 ? 
96  BC5 3  SER I  129 ? SER I 129 . ? 1_555 ? 
97  BC5 3  LYS I  200 ? LYS I 200 . ? 1_555 ? 
98  BC5 3  ARG I  204 ? ARG I 204 . ? 1_555 ? 
99  BC6 5  ARG C  230 ? ARG C 230 . ? 1_555 ? 
100 BC6 5  ARG C  234 ? ARG C 234 . ? 1_555 ? 
101 BC6 5  GLY C  270 ? GLY C 270 . ? 1_555 ? 
102 BC6 5  LEU C  272 ? LEU C 272 . ? 1_555 ? 
103 BC6 5  LYS C  756 ? LYS C 756 . ? 1_555 ? 
104 BC7 7  ARG B  201 ? ARG B 201 . ? 1_555 ? 
105 BC7 7  ARG B  205 ? ARG B 205 . ? 1_555 ? 
106 BC7 7  ARG B  241 ? ARG B 241 . ? 1_555 ? 
107 BC7 7  GLY B  242 ? GLY B 242 . ? 1_555 ? 
108 BC7 7  LYS B  730 ? LYS B 730 . ? 1_555 ? 
109 BC7 7  GLY B  762 ? GLY B 762 . ? 1_555 ? 
110 BC7 7  SER B  798 ? SER B 798 . ? 1_555 ? 
111 BC8 7  ARG A  230 ? ARG A 230 . ? 1_555 ? 
112 BC8 7  ARG A  234 ? ARG A 234 . ? 1_555 ? 
113 BC8 7  VAL A  268 ? VAL A 268 . ? 1_555 ? 
114 BC8 7  ARG A  269 ? ARG A 269 . ? 1_555 ? 
115 BC8 7  GLY A  270 ? GLY A 270 . ? 1_555 ? 
116 BC8 7  LEU A  272 ? LEU A 272 . ? 1_555 ? 
117 BC8 7  LYS A  756 ? LYS A 756 . ? 1_555 ? 
118 BC9 7  ARG D  201 ? ARG D 201 . ? 1_555 ? 
119 BC9 7  ARG D  205 ? ARG D 205 . ? 1_555 ? 
120 BC9 7  ARG D  241 ? ARG D 241 . ? 1_555 ? 
121 BC9 7  GLY D  242 ? GLY D 242 . ? 1_555 ? 
122 BC9 7  LYS D  730 ? LYS D 730 . ? 1_555 ? 
123 BC9 7  GLY D  762 ? GLY D 762 . ? 1_555 ? 
124 BC9 7  SER D  798 ? SER D 798 . ? 1_555 ? 
125 CC1 5  SER C  359 ? SER C 359 . ? 1_555 ? 
126 CC1 5  ILE C  360 ? ILE C 360 . ? 1_555 ? 
127 CC1 5  ASP C  361 ? ASP C 361 . ? 1_555 ? 
128 CC1 5  ARG C  496 ? ARG C 496 . ? 1_555 ? 
129 CC1 5  SO4 EA .   ? SO4 C 992 . ? 1_555 ? 
130 CC2 6  GLY G  358 ? GLY G 358 . ? 1_555 ? 
131 CC2 6  SER G  359 ? SER G 359 . ? 1_555 ? 
132 CC2 6  ILE G  360 ? ILE G 360 . ? 1_555 ? 
133 CC2 6  ASP G  361 ? ASP G 361 . ? 1_555 ? 
134 CC2 6  ARG G  496 ? ARG G 496 . ? 1_555 ? 
135 CC2 6  SO4 EB .   ? SO4 G 992 . ? 1_555 ? 
136 CC3 4  GLY J  180 ? GLY J 180 . ? 1_555 ? 
137 CC3 4  PRO J  181 ? PRO J 181 . ? 1_555 ? 
138 CC3 4  HIS J  196 ? HIS J 196 . ? 1_555 ? 
139 CC3 4  LEU J  198 ? LEU J 198 . ? 1_555 ? 
140 CC4 5  ARG C  635 ? ARG C 635 . ? 1_555 ? 
141 CC4 5  SO4 GA .   ? SO4 C 994 . ? 1_555 ? 
142 CC4 5  GLN D  793 ? GLN D 793 . ? 1_555 ? 
143 CC4 5  GLY D  794 ? GLY D 794 . ? 1_555 ? 
144 CC4 5  LYS D  797 ? LYS D 797 . ? 1_555 ? 
145 CC5 7  GLY C  219 ? GLY C 219 . ? 1_555 ? 
146 CC5 7  GLY C  220 ? GLY C 220 . ? 1_555 ? 
147 CC5 7  GLY C  313 ? GLY C 313 . ? 1_555 ? 
148 CC5 7  ASP C  314 ? ASP C 314 . ? 1_555 ? 
149 CC5 7  GLY C  315 ? GLY C 315 . ? 1_555 ? 
150 CC5 7  SER C  316 ? SER C 316 . ? 1_555 ? 
151 CC5 7  SO4 DA .   ? SO4 C 991 . ? 1_555 ? 
152 CC6 5  MET C  403 ? MET C 403 . ? 1_555 ? 
153 CC6 5  HIS C  493 ? HIS C 493 . ? 1_555 ? 
154 CC6 5  ARG C  496 ? ARG C 496 . ? 1_555 ? 
155 CC6 5  ARG D  368 ? ARG D 368 . ? 1_555 ? 
156 CC6 5  ARG D  460 ? ARG D 460 . ? 1_555 ? 
157 CC7 6  ARG G  230 ? ARG G 230 . ? 1_555 ? 
158 CC7 6  ARG G  234 ? ARG G 234 . ? 1_555 ? 
159 CC7 6  ARG G  269 ? ARG G 269 . ? 1_555 ? 
160 CC7 6  GLY G  270 ? GLY G 270 . ? 1_555 ? 
161 CC7 6  LYS G  756 ? LYS G 756 . ? 1_555 ? 
162 CC7 6  GLY G  788 ? GLY G 788 . ? 1_555 ? 
163 CC8 7  ARG H  201 ? ARG H 201 . ? 1_555 ? 
164 CC8 7  ARG H  205 ? ARG H 205 . ? 1_555 ? 
165 CC8 7  ARG H  241 ? ARG H 241 . ? 1_555 ? 
166 CC8 7  GLY H  242 ? GLY H 242 . ? 1_555 ? 
167 CC8 7  LYS H  730 ? LYS H 730 . ? 1_555 ? 
168 CC8 7  GLY H  762 ? GLY H 762 . ? 1_555 ? 
169 CC8 7  SER H  798 ? SER H 798 . ? 1_555 ? 
170 CC9 5  ALA C  608 ? ALA C 608 . ? 1_555 ? 
171 CC9 5  ARG C  670 ? ARG C 670 . ? 1_555 ? 
172 CC9 5  HIS C  864 ? HIS C 864 . ? 1_555 ? 
173 CC9 5  ARG D  739 ? ARG D 739 . ? 1_555 ? 
174 CC9 5  LYS D  832 ? LYS D 832 . ? 1_555 ? 
175 DC1 6  ARG F  201 ? ARG F 201 . ? 1_555 ? 
176 DC1 6  ARG F  205 ? ARG F 205 . ? 1_555 ? 
177 DC1 6  ARG F  241 ? ARG F 241 . ? 1_555 ? 
178 DC1 6  GLY F  242 ? GLY F 242 . ? 1_555 ? 
179 DC1 6  LYS F  730 ? LYS F 730 . ? 1_555 ? 
180 DC1 6  SER F  798 ? SER F 798 . ? 1_555 ? 
181 DC2 7  GLY G  219 ? GLY G 219 . ? 1_555 ? 
182 DC2 7  GLY G  220 ? GLY G 220 . ? 1_555 ? 
183 DC2 7  GLY G  313 ? GLY G 313 . ? 1_555 ? 
184 DC2 7  ASP G  314 ? ASP G 314 . ? 1_555 ? 
185 DC2 7  GLY G  315 ? GLY G 315 . ? 1_555 ? 
186 DC2 7  SER G  316 ? SER G 316 . ? 1_555 ? 
187 DC2 7  SO4 CB .   ? SO4 G 990 . ? 1_555 ? 
188 DC3 4  ARG G  635 ? ARG G 635 . ? 1_555 ? 
189 DC3 4  GLN H  793 ? GLN H 793 . ? 1_555 ? 
190 DC3 4  GLY H  794 ? GLY H 794 . ? 1_555 ? 
191 DC3 4  LYS H  797 ? LYS H 797 . ? 1_555 ? 
192 DC4 5  ALA E  608 ? ALA E 608 . ? 1_555 ? 
193 DC4 5  ARG E  670 ? ARG E 670 . ? 1_555 ? 
194 DC4 5  HIS E  864 ? HIS E 864 . ? 1_555 ? 
195 DC4 5  ARG F  739 ? ARG F 739 . ? 1_555 ? 
196 DC4 5  LYS F  832 ? LYS F 832 . ? 1_555 ? 
197 DC5 5  MET G  403 ? MET G 403 . ? 1_555 ? 
198 DC5 5  HIS G  493 ? HIS G 493 . ? 1_555 ? 
199 DC5 5  ARG G  496 ? ARG G 496 . ? 1_555 ? 
200 DC5 5  ARG H  368 ? ARG H 368 . ? 1_555 ? 
201 DC5 5  ARG H  460 ? ARG H 460 . ? 1_555 ? 
202 DC6 4  ARG K  93  ? ARG K 93  . ? 1_555 ? 
203 DC6 4  PHE K  249 ? PHE K 249 . ? 1_555 ? 
204 DC6 4  ASP K  250 ? ASP K 250 . ? 1_555 ? 
205 DC6 4  THR K  251 ? THR K 251 . ? 1_555 ? 
206 DC7 4  SER E  359 ? SER E 359 . ? 1_555 ? 
207 DC7 4  ILE E  360 ? ILE E 360 . ? 1_555 ? 
208 DC7 4  ASP E  361 ? ASP E 361 . ? 1_555 ? 
209 DC7 4  ARG E  496 ? ARG E 496 . ? 1_555 ? 
210 DC8 2  ARG A  324 ? ARG A 324 . ? 1_555 ? 
211 DC8 2  SER A  528 ? SER A 528 . ? 1_555 ? 
212 DC9 3  SER J  129 ? SER J 129 . ? 1_555 ? 
213 DC9 3  LYS J  200 ? LYS J 200 . ? 1_555 ? 
214 DC9 3  ARG J  204 ? ARG J 204 . ? 1_555 ? 
215 EC1 5  MET E  403 ? MET E 403 . ? 1_555 ? 
216 EC1 5  HIS E  493 ? HIS E 493 . ? 1_555 ? 
217 EC1 5  ARG E  496 ? ARG E 496 . ? 1_555 ? 
218 EC1 5  ARG F  368 ? ARG F 368 . ? 1_555 ? 
219 EC1 5  ARG F  460 ? ARG F 460 . ? 1_555 ? 
220 EC2 5  ARG A  670 ? ARG A 670 . ? 1_555 ? 
221 EC2 5  SER A  729 ? SER A 729 . ? 1_555 ? 
222 EC2 5  ASN A  731 ? ASN A 731 . ? 1_555 ? 
223 EC2 5  GLY A  774 ? GLY A 774 . ? 1_555 ? 
224 EC2 5  LYS A  961 ? LYS A 961 . ? 1_555 ? 
225 EC3 7  ARG E  230 ? ARG E 230 . ? 1_555 ? 
226 EC3 7  ARG E  234 ? ARG E 234 . ? 1_555 ? 
227 EC3 7  ARG E  269 ? ARG E 269 . ? 1_555 ? 
228 EC3 7  GLY E  270 ? GLY E 270 . ? 1_555 ? 
229 EC3 7  LEU E  272 ? LEU E 272 . ? 1_555 ? 
230 EC3 7  LYS E  756 ? LYS E 756 . ? 1_555 ? 
231 EC3 7  GLY E  788 ? GLY E 788 . ? 1_555 ? 
232 EC4 3  SER K  129 ? SER K 129 . ? 1_555 ? 
233 EC4 3  LYS K  200 ? LYS K 200 . ? 1_555 ? 
234 EC4 3  ARG K  204 ? ARG K 204 . ? 1_555 ? 
235 EC5 4  ARG G  670 ? ARG G 670 . ? 1_555 ? 
236 EC5 4  SER G  729 ? SER G 729 . ? 1_555 ? 
237 EC5 4  ASN G  731 ? ASN G 731 . ? 1_555 ? 
238 EC5 4  GLY G  774 ? GLY G 774 . ? 1_555 ? 
239 EC6 5  ALA G  608 ? ALA G 608 . ? 1_555 ? 
240 EC6 5  ARG G  670 ? ARG G 670 . ? 1_555 ? 
241 EC6 5  HIS G  864 ? HIS G 864 . ? 1_555 ? 
242 EC6 5  ARG H  739 ? ARG H 739 . ? 1_555 ? 
243 EC6 5  LYS H  832 ? LYS H 832 . ? 1_555 ? 
244 EC7 3  ARG C  635 ? ARG C 635 . ? 1_555 ? 
245 EC7 3  LYS D  797 ? LYS D 797 . ? 1_555 ? 
246 EC7 3  SO4 OA .   ? SO4 D 944 . ? 1_555 ? 
247 EC8 5  ARG C  324 ? ARG C 324 . ? 1_555 ? 
248 EC8 5  PRO C  524 ? PRO C 524 . ? 1_555 ? 
249 EC8 5  ILE C  526 ? ILE C 526 . ? 1_555 ? 
250 EC8 5  PRO C  527 ? PRO C 527 . ? 1_555 ? 
251 EC8 5  SER C  528 ? SER C 528 . ? 1_555 ? 
252 EC9 4  ARG E  635 ? ARG E 635 . ? 1_555 ? 
253 EC9 4  GLN F  793 ? GLN F 793 . ? 1_555 ? 
254 EC9 4  GLY F  794 ? GLY F 794 . ? 1_555 ? 
255 EC9 4  LYS F  797 ? LYS F 797 . ? 1_555 ? 
256 FC1 2  ARG E  324 ? ARG E 324 . ? 1_555 ? 
257 FC1 2  SER E  528 ? SER E 528 . ? 1_555 ? 
258 FC2 4  ARG G  643 ? ARG G 643 . ? 1_555 ? 
259 FC2 4  HIS G  644 ? HIS G 644 . ? 1_555 ? 
260 FC2 4  ASN H  738 ? ASN H 738 . ? 1_555 ? 
261 FC2 4  ARG H  828 ? ARG H 828 . ? 1_555 ? 
262 FC3 5  ARG A  396 ? ARG A 396 . ? 1_555 ? 
263 FC3 5  ARG A  487 ? ARG A 487 . ? 1_555 ? 
264 FC3 5  MET B  375 ? MET B 375 . ? 1_555 ? 
265 FC3 5  HIS B  466 ? HIS B 466 . ? 1_555 ? 
266 FC3 5  ARG B  469 ? ARG B 469 . ? 1_555 ? 
267 FC4 5  GLU A  401 ? GLU A 401 . ? 1_555 ? 
268 FC4 5  THR A  471 ? THR A 471 . ? 1_555 ? 
269 FC4 5  SER A  472 ? SER A 472 . ? 1_555 ? 
270 FC4 5  GLU A  473 ? GLU A 473 . ? 1_555 ? 
271 FC4 5  ARG A  490 ? ARG A 490 . ? 1_555 ? 
272 FC5 7  ARG A  451 ? ARG A 451 . ? 1_555 ? 
273 FC5 7  ARG A  618 ? ARG A 618 . ? 1_555 ? 
274 FC5 7  VAL A  655 ? VAL A 655 . ? 1_555 ? 
275 FC5 7  GLU A  656 ? GLU A 656 . ? 1_555 ? 
276 FC5 7  ASP A  657 ? ASP A 657 . ? 1_555 ? 
277 FC5 7  TRP A  658 ? TRP A 658 . ? 1_555 ? 
278 FC5 7  HIS A  659 ? HIS A 659 . ? 1_555 ? 
279 FC6 3  SER A  857 ? SER A 857 . ? 1_555 ? 
280 FC6 3  ARG A  858 ? ARG A 858 . ? 1_555 ? 
281 FC6 3  THR A  859 ? THR A 859 . ? 1_555 ? 
282 FC7 5  ARG C  396 ? ARG C 396 . ? 1_555 ? 
283 FC7 5  ARG C  487 ? ARG C 487 . ? 1_555 ? 
284 FC7 5  MET D  375 ? MET D 375 . ? 1_555 ? 
285 FC7 5  HIS D  466 ? HIS D 466 . ? 1_555 ? 
286 FC7 5  ARG D  469 ? ARG D 469 . ? 1_555 ? 
287 FC8 4  GLU C  401 ? GLU C 401 . ? 1_555 ? 
288 FC8 4  THR C  471 ? THR C 471 . ? 1_555 ? 
289 FC8 4  SER C  472 ? SER C 472 . ? 1_555 ? 
290 FC8 4  ARG C  490 ? ARG C 490 . ? 1_555 ? 
291 FC9 7  ARG C  451 ? ARG C 451 . ? 1_555 ? 
292 FC9 7  ARG C  618 ? ARG C 618 . ? 1_555 ? 
293 FC9 7  VAL C  655 ? VAL C 655 . ? 1_555 ? 
294 FC9 7  GLU C  656 ? GLU C 656 . ? 1_555 ? 
295 FC9 7  ASP C  657 ? ASP C 657 . ? 1_555 ? 
296 FC9 7  TRP C  658 ? TRP C 658 . ? 1_555 ? 
297 FC9 7  HIS C  659 ? HIS C 659 . ? 1_555 ? 
298 GC1 3  ARG C  858 ? ARG C 858 . ? 1_555 ? 
299 GC1 3  THR C  859 ? THR C 859 . ? 1_555 ? 
300 GC1 3  HIS D  838 ? HIS D 838 . ? 1_555 ? 
301 GC2 5  ARG E  396 ? ARG E 396 . ? 1_555 ? 
302 GC2 5  ARG E  487 ? ARG E 487 . ? 1_555 ? 
303 GC2 5  MET F  375 ? MET F 375 . ? 1_555 ? 
304 GC2 5  HIS F  466 ? HIS F 466 . ? 1_555 ? 
305 GC2 5  ARG F  469 ? ARG F 469 . ? 1_555 ? 
306 GC3 5  GLU E  401 ? GLU E 401 . ? 1_555 ? 
307 GC3 5  THR E  471 ? THR E 471 . ? 1_555 ? 
308 GC3 5  SER E  472 ? SER E 472 . ? 1_555 ? 
309 GC3 5  GLU E  473 ? GLU E 473 . ? 1_555 ? 
310 GC3 5  ARG E  490 ? ARG E 490 . ? 1_555 ? 
311 GC4 7  ARG E  451 ? ARG E 451 . ? 1_555 ? 
312 GC4 7  ARG E  618 ? ARG E 618 . ? 1_555 ? 
313 GC4 7  VAL E  655 ? VAL E 655 . ? 1_555 ? 
314 GC4 7  GLU E  656 ? GLU E 656 . ? 1_555 ? 
315 GC4 7  ASP E  657 ? ASP E 657 . ? 1_555 ? 
316 GC4 7  TRP E  658 ? TRP E 658 . ? 1_555 ? 
317 GC4 7  HIS E  659 ? HIS E 659 . ? 1_555 ? 
318 GC5 5  ARG G  396 ? ARG G 396 . ? 1_555 ? 
319 GC5 5  ARG G  487 ? ARG G 487 . ? 1_555 ? 
320 GC5 5  MET H  375 ? MET H 375 . ? 1_555 ? 
321 GC5 5  HIS H  466 ? HIS H 466 . ? 1_555 ? 
322 GC5 5  ARG H  469 ? ARG H 469 . ? 1_555 ? 
323 GC6 4  GLU G  401 ? GLU G 401 . ? 1_555 ? 
324 GC6 4  THR G  471 ? THR G 471 . ? 1_555 ? 
325 GC6 4  SER G  472 ? SER G 472 . ? 1_555 ? 
326 GC6 4  ARG G  490 ? ARG G 490 . ? 1_555 ? 
327 GC7 4  ARG G  451 ? ARG G 451 . ? 1_555 ? 
328 GC7 4  GLU G  656 ? GLU G 656 . ? 1_555 ? 
329 GC7 4  ASP G  657 ? ASP G 657 . ? 1_555 ? 
330 GC7 4  HIS G  659 ? HIS G 659 . ? 1_555 ? 
331 GC8 2  SER I  6   ? SER I 6   . ? 1_555 ? 
332 GC8 2  ARG I  9   ? ARG I 9   . ? 1_555 ? 
333 GC9 2  ASN I  76  ? ASN I 76  . ? 1_555 ? 
334 GC9 2  ASN I  77  ? ASN I 77  . ? 1_555 ? 
335 HC1 2  PRO I  181 ? PRO I 181 . ? 1_555 ? 
336 HC1 2  HIS I  196 ? HIS I 196 . ? 1_555 ? 
337 HC2 2  SER J  6   ? SER J 6   . ? 1_555 ? 
338 HC2 2  ARG J  9   ? ARG J 9   . ? 1_555 ? 
339 HC3 2  ASN K  76  ? ASN K 76  . ? 1_555 ? 
340 HC3 2  ASN K  77  ? ASN K 77  . ? 1_555 ? 
341 HC4 2  SER L  6   ? SER L 6   . ? 1_555 ? 
342 HC4 2  ARG L  9   ? ARG L 9   . ? 1_555 ? 
343 HC5 2  ASN L  76  ? ASN L 76  . ? 1_555 ? 
344 HC5 2  ASN L  77  ? ASN L 77  . ? 1_555 ? 
345 HC6 3  PRO L  181 ? PRO L 181 . ? 1_555 ? 
346 HC6 3  HIS L  196 ? HIS L 196 . ? 1_555 ? 
347 HC6 3  TYR L  230 ? TYR L 230 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OPY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OPY 
_atom_sites.fract_transf_matrix[1][1]   0.006186 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000308 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005311 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004324 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . SER A  1 5   ? -18.565  24.734  -26.559 1.00 98.45  ? 5    SER A N     1 
ATOM   2     C CA    . SER A  1 5   ? -17.587  23.860  -25.925 1.00 97.64  ? 5    SER A CA    1 
ATOM   3     C C     . SER A  1 5   ? -17.639  22.427  -26.504 1.00 99.92  ? 5    SER A C     1 
ATOM   4     O O     . SER A  1 5   ? -17.884  21.447  -25.783 1.00 97.94  ? 5    SER A O     1 
ATOM   5     C CB    . SER A  1 5   ? -17.732  23.880  -24.403 1.00 101.37 ? 5    SER A CB    1 
ATOM   6     O OG    . SER A  1 5   ? -18.980  23.346  -23.995 1.00 108.62 ? 5    SER A OG    1 
ATOM   7     N N     . ILE A  1 6   ? -17.406  22.326  -27.832 1.00 96.48  ? 6    ILE A N     1 
ATOM   8     C CA    . ILE A  1 6   ? -17.343  21.056  -28.570 1.00 94.72  ? 6    ILE A CA    1 
ATOM   9     C C     . ILE A  1 6   ? -15.929  20.460  -28.401 1.00 98.99  ? 6    ILE A C     1 
ATOM   10    O O     . ILE A  1 6   ? -14.948  21.131  -28.732 1.00 100.89 ? 6    ILE A O     1 
ATOM   11    C CB    . ILE A  1 6   ? -17.720  21.253  -30.066 1.00 97.60  ? 6    ILE A CB    1 
ATOM   12    N N     . SER A  1 7   ? -15.822  19.233  -27.844 1.00 93.22  ? 7    SER A N     1 
ATOM   13    C CA    . SER A  1 7   ? -14.548  18.539  -27.593 1.00 91.78  ? 7    SER A CA    1 
ATOM   14    C C     . SER A  1 7   ? -13.754  18.231  -28.891 1.00 94.27  ? 7    SER A C     1 
ATOM   15    O O     . SER A  1 7   ? -12.625  18.703  -29.054 1.00 94.86  ? 7    SER A O     1 
ATOM   16    C CB    . SER A  1 7   ? -14.775  17.271  -26.768 1.00 92.39  ? 7    SER A CB    1 
ATOM   17    N N     . ASP A  1 8   ? -14.365  17.465  -29.815 1.00 88.15  ? 8    ASP A N     1 
ATOM   18    C CA    . ASP A  1 8   ? -13.782  17.037  -31.090 1.00 86.52  ? 8    ASP A CA    1 
ATOM   19    C C     . ASP A  1 8   ? -14.925  16.697  -32.064 1.00 86.65  ? 8    ASP A C     1 
ATOM   20    O O     . ASP A  1 8   ? -16.005  17.286  -31.977 1.00 85.70  ? 8    ASP A O     1 
ATOM   21    C CB    . ASP A  1 8   ? -12.886  15.793  -30.852 1.00 87.69  ? 8    ASP A CB    1 
ATOM   22    C CG    . ASP A  1 8   ? -11.465  15.903  -31.370 1.00 101.52 ? 8    ASP A CG    1 
ATOM   23    O OD1   . ASP A  1 8   ? -11.291  16.214  -32.577 1.00 103.71 ? 8    ASP A OD1   1 
ATOM   24    O OD2   . ASP A  1 8   ? -10.528  15.618  -30.592 1.00 105.57 ? 8    ASP A OD2   1 
ATOM   25    N N     . LEU A  1 9   ? -14.682  15.759  -32.992 1.00 81.76  ? 9    LEU A N     1 
ATOM   26    C CA    . LEU A  1 9   ? -15.677  15.262  -33.943 1.00 80.61  ? 9    LEU A CA    1 
ATOM   27    C C     . LEU A  1 9   ? -16.024  13.840  -33.488 1.00 82.18  ? 9    LEU A C     1 
ATOM   28    O O     . LEU A  1 9   ? -15.109  13.058  -33.222 1.00 80.49  ? 9    LEU A O     1 
ATOM   29    C CB    . LEU A  1 9   ? -15.131  15.259  -35.387 1.00 80.70  ? 9    LEU A CB    1 
ATOM   30    N N     . SER A  1 10  ? -17.330  13.526  -33.336 1.00 77.85  ? 10   SER A N     1 
ATOM   31    C CA    . SER A  1 10  ? -17.784  12.200  -32.898 1.00 75.76  ? 10   SER A CA    1 
ATOM   32    C C     . SER A  1 10  ? -17.671  11.180  -34.029 1.00 79.38  ? 10   SER A C     1 
ATOM   33    O O     . SER A  1 10  ? -16.998  10.165  -33.855 1.00 78.11  ? 10   SER A O     1 
ATOM   34    C CB    . SER A  1 10  ? -19.207  12.249  -32.336 1.00 77.63  ? 10   SER A CB    1 
ATOM   35    O OG    . SER A  1 10  ? -19.400  11.341  -31.258 1.00 77.64  ? 10   SER A OG    1 
ATOM   36    N N     . PHE A  1 11  ? -18.298  11.459  -35.190 1.00 77.03  ? 11   PHE A N     1 
ATOM   37    C CA    . PHE A  1 11  ? -18.293  10.582  -36.363 1.00 76.72  ? 11   PHE A CA    1 
ATOM   38    C C     . PHE A  1 11  ? -18.769  11.304  -37.611 1.00 82.64  ? 11   PHE A C     1 
ATOM   39    O O     . PHE A  1 11  ? -19.353  12.382  -37.518 1.00 82.96  ? 11   PHE A O     1 
ATOM   40    C CB    . PHE A  1 11  ? -19.198  9.353   -36.114 1.00 77.38  ? 11   PHE A CB    1 
ATOM   41    C CG    . PHE A  1 11  ? -20.672  9.650   -35.960 1.00 78.80  ? 11   PHE A CG    1 
ATOM   42    C CD1   . PHE A  1 11  ? -21.515  9.669   -37.070 1.00 81.93  ? 11   PHE A CD1   1 
ATOM   43    C CD2   . PHE A  1 11  ? -21.220  9.891   -34.706 1.00 79.90  ? 11   PHE A CD2   1 
ATOM   44    C CE1   . PHE A  1 11  ? -22.873  9.944   -36.930 1.00 83.20  ? 11   PHE A CE1   1 
ATOM   45    C CE2   . PHE A  1 11  ? -22.579  10.160  -34.566 1.00 83.38  ? 11   PHE A CE2   1 
ATOM   46    C CZ    . PHE A  1 11  ? -23.396  10.186  -35.681 1.00 82.51  ? 11   PHE A CZ    1 
ATOM   47    N N     . THR A  1 12  ? -18.585  10.674  -38.772 1.00 80.79  ? 12   THR A N     1 
ATOM   48    C CA    . THR A  1 12  ? -19.099  11.204  -40.031 1.00 82.55  ? 12   THR A CA    1 
ATOM   49    C C     . THR A  1 12  ? -20.196  10.246  -40.490 1.00 85.77  ? 12   THR A C     1 
ATOM   50    O O     . THR A  1 12  ? -20.042  9.030   -40.347 1.00 84.21  ? 12   THR A O     1 
ATOM   51    C CB    . THR A  1 12  ? -17.993  11.426  -41.088 1.00 99.03  ? 12   THR A CB    1 
ATOM   52    O OG1   . THR A  1 12  ? -17.616  10.186  -41.693 1.00 103.54 ? 12   THR A OG1   1 
ATOM   53    C CG2   . THR A  1 12  ? -16.769  12.147  -40.537 1.00 98.16  ? 12   THR A CG2   1 
ATOM   54    N N     . SER A  1 13  ? -21.313  10.792  -40.990 1.00 83.34  ? 13   SER A N     1 
ATOM   55    C CA    . SER A  1 13  ? -22.445  10.000  -41.464 1.00 83.53  ? 13   SER A CA    1 
ATOM   56    C C     . SER A  1 13  ? -22.583  10.144  -42.973 1.00 90.11  ? 13   SER A C     1 
ATOM   57    O O     . SER A  1 13  ? -22.517  11.263  -43.479 1.00 90.55  ? 13   SER A O     1 
ATOM   58    C CB    . SER A  1 13  ? -23.736  10.430  -40.774 1.00 86.60  ? 13   SER A CB    1 
ATOM   59    O OG    . SER A  1 13  ? -24.857  9.725   -41.283 1.00 94.54  ? 13   SER A OG    1 
ATOM   60    N N     . PHE A  1 14  ? -22.747  9.016   -43.690 1.00 87.17  ? 14   PHE A N     1 
ATOM   61    C CA    . PHE A  1 14  ? -22.930  9.015   -45.140 1.00 88.18  ? 14   PHE A CA    1 
ATOM   62    C C     . PHE A  1 14  ? -24.237  8.318   -45.460 1.00 93.08  ? 14   PHE A C     1 
ATOM   63    O O     . PHE A  1 14  ? -24.362  7.120   -45.196 1.00 92.12  ? 14   PHE A O     1 
ATOM   64    C CB    . PHE A  1 14  ? -21.757  8.327   -45.872 1.00 89.55  ? 14   PHE A CB    1 
ATOM   65    C CG    . PHE A  1 14  ? -20.376  8.920   -45.706 1.00 90.51  ? 14   PHE A CG    1 
ATOM   66    C CD1   . PHE A  1 14  ? -20.195  10.296  -45.622 1.00 93.98  ? 14   PHE A CD1   1 
ATOM   67    C CD2   . PHE A  1 14  ? -19.247  8.106   -45.705 1.00 91.63  ? 14   PHE A CD2   1 
ATOM   68    C CE1   . PHE A  1 14  ? -18.918  10.838  -45.472 1.00 94.66  ? 14   PHE A CE1   1 
ATOM   69    C CE2   . PHE A  1 14  ? -17.970  8.651   -45.568 1.00 93.93  ? 14   PHE A CE2   1 
ATOM   70    C CZ    . PHE A  1 14  ? -17.814  10.012  -45.456 1.00 92.61  ? 14   PHE A CZ    1 
ATOM   71    N N     . VAL A  1 15  ? -25.221  9.062   -46.005 1.00 90.82  ? 15   VAL A N     1 
ATOM   72    C CA    . VAL A  1 15  ? -26.537  8.506   -46.333 1.00 91.28  ? 15   VAL A CA    1 
ATOM   73    C C     . VAL A  1 15  ? -26.670  8.250   -47.848 1.00 94.17  ? 15   VAL A C     1 
ATOM   74    O O     . VAL A  1 15  ? -26.275  9.103   -48.641 1.00 94.57  ? 15   VAL A O     1 
ATOM   75    C CB    . VAL A  1 15  ? -27.705  9.355   -45.741 1.00 96.99  ? 15   VAL A CB    1 
ATOM   76    C CG1   . VAL A  1 15  ? -29.045  8.631   -45.874 1.00 98.00  ? 15   VAL A CG1   1 
ATOM   77    C CG2   . VAL A  1 15  ? -27.449  9.714   -44.270 1.00 95.84  ? 15   VAL A CG2   1 
ATOM   78    N N     . THR A  1 16  ? -27.181  7.056   -48.237 1.00 89.59  ? 16   THR A N     1 
ATOM   79    C CA    . THR A  1 16  ? -27.398  6.635   -49.633 1.00 90.10  ? 16   THR A CA    1 
ATOM   80    C C     . THR A  1 16  ? -28.792  6.031   -49.838 1.00 96.08  ? 16   THR A C     1 
ATOM   81    O O     . THR A  1 16  ? -29.385  5.504   -48.898 1.00 95.58  ? 16   THR A O     1 
ATOM   82    C CB    . THR A  1 16  ? -26.300  5.672   -50.108 1.00 93.63  ? 16   THR A CB    1 
ATOM   83    N N     . ASN A  1 17  ? -29.316  6.124   -51.073 1.00 94.93  ? 17   ASN A N     1 
ATOM   84    C CA    . ASN A  1 17  ? -30.624  5.589   -51.468 1.00 95.62  ? 17   ASN A CA    1 
ATOM   85    C C     . ASN A  1 17  ? -30.431  4.197   -52.078 1.00 97.61  ? 17   ASN A C     1 
ATOM   86    O O     . ASN A  1 17  ? -31.238  3.296   -51.840 1.00 97.20  ? 17   ASN A O     1 
ATOM   87    C CB    . ASN A  1 17  ? -31.291  6.536   -52.477 1.00 97.43  ? 17   ASN A CB    1 
ATOM   88    C CG    . ASN A  1 17  ? -32.709  6.174   -52.836 1.00 127.58 ? 17   ASN A CG    1 
ATOM   89    O OD1   . ASN A  1 17  ? -32.967  5.398   -53.764 1.00 121.36 ? 17   ASN A OD1   1 
ATOM   90    N ND2   . ASN A  1 17  ? -33.663  6.765   -52.134 1.00 125.27 ? 17   ASN A ND2   1 
ATOM   91    N N     . ASP A  1 18  ? -29.336  4.029   -52.841 1.00 92.56  ? 18   ASP A N     1 
ATOM   92    C CA    . ASP A  1 18  ? -28.969  2.800   -53.528 1.00 92.45  ? 18   ASP A CA    1 
ATOM   93    C C     . ASP A  1 18  ? -28.307  1.817   -52.576 1.00 96.17  ? 18   ASP A C     1 
ATOM   94    O O     . ASP A  1 18  ? -27.286  2.150   -51.964 1.00 94.26  ? 18   ASP A O     1 
ATOM   95    C CB    . ASP A  1 18  ? -28.035  3.142   -54.701 1.00 94.78  ? 18   ASP A CB    1 
ATOM   96    C CG    . ASP A  1 18  ? -27.750  2.033   -55.698 1.00 107.43 ? 18   ASP A CG    1 
ATOM   97    O OD1   . ASP A  1 18  ? -26.848  2.219   -56.544 1.00 108.11 ? 18   ASP A OD1   1 
ATOM   98    O OD2   . ASP A  1 18  ? -28.456  0.993   -55.660 1.00 114.88 ? 18   ASP A OD2   1 
ATOM   99    N N     . ASP A  1 19  ? -28.898  0.609   -52.438 1.00 94.79  ? 19   ASP A N     1 
ATOM   100   C CA    . ASP A  1 19  ? -28.366  -0.460  -51.578 1.00 93.91  ? 19   ASP A CA    1 
ATOM   101   C C     . ASP A  1 19  ? -27.060  -1.011  -52.143 1.00 98.48  ? 19   ASP A C     1 
ATOM   102   O O     . ASP A  1 19  ? -26.147  -1.332  -51.381 1.00 95.60  ? 19   ASP A O     1 
ATOM   103   C CB    . ASP A  1 19  ? -29.387  -1.596  -51.384 1.00 96.73  ? 19   ASP A CB    1 
ATOM   104   C CG    . ASP A  1 19  ? -28.838  -2.798  -50.616 1.00 105.80 ? 19   ASP A CG    1 
ATOM   105   O OD1   . ASP A  1 19  ? -28.421  -3.783  -51.272 1.00 108.48 ? 19   ASP A OD1   1 
ATOM   106   O OD2   . ASP A  1 19  ? -28.788  -2.735  -49.364 1.00 103.71 ? 19   ASP A OD2   1 
ATOM   107   N N     . ASN A  1 20  ? -26.981  -1.123  -53.480 1.00 98.65  ? 20   ASN A N     1 
ATOM   108   C CA    . ASN A  1 20  ? -25.798  -1.610  -54.188 1.00 99.37  ? 20   ASN A CA    1 
ATOM   109   C C     . ASN A  1 20  ? -24.602  -0.685  -53.896 1.00 102.07 ? 20   ASN A C     1 
ATOM   110   O O     . ASN A  1 20  ? -23.501  -1.185  -53.641 1.00 101.54 ? 20   ASN A O     1 
ATOM   111   C CB    . ASN A  1 20  ? -26.080  -1.765  -55.694 1.00 105.76 ? 20   ASN A CB    1 
ATOM   112   C CG    . ASN A  1 20  ? -27.281  -2.645  -56.020 1.00 142.77 ? 20   ASN A CG    1 
ATOM   113   O OD1   . ASN A  1 20  ? -27.489  -3.720  -55.435 1.00 141.95 ? 20   ASN A OD1   1 
ATOM   114   N ND2   . ASN A  1 20  ? -28.105  -2.208  -56.967 1.00 136.96 ? 20   ASN A ND2   1 
ATOM   115   N N     . LEU A  1 21  ? -24.850  0.651   -53.834 1.00 96.75  ? 21   LEU A N     1 
ATOM   116   C CA    . LEU A  1 21  ? -23.846  1.657   -53.487 1.00 94.44  ? 21   LEU A CA    1 
ATOM   117   C C     . LEU A  1 21  ? -23.474  1.545   -52.016 1.00 95.85  ? 21   LEU A C     1 
ATOM   118   O O     . LEU A  1 21  ? -22.306  1.699   -51.679 1.00 94.22  ? 21   LEU A O     1 
ATOM   119   C CB    . LEU A  1 21  ? -24.367  3.068   -53.759 1.00 94.94  ? 21   LEU A CB    1 
ATOM   120   C CG    . LEU A  1 21  ? -24.071  3.675   -55.114 1.00 100.19 ? 21   LEU A CG    1 
ATOM   121   C CD1   . LEU A  1 21  ? -24.859  4.953   -55.302 1.00 100.86 ? 21   LEU A CD1   1 
ATOM   122   C CD2   . LEU A  1 21  ? -22.591  3.972   -55.272 1.00 101.66 ? 21   LEU A CD2   1 
ATOM   123   N N     . PHE A  1 22  ? -24.470  1.287   -51.148 1.00 92.42  ? 22   PHE A N     1 
ATOM   124   C CA    . PHE A  1 22  ? -24.305  1.145   -49.703 1.00 91.11  ? 22   PHE A CA    1 
ATOM   125   C C     . PHE A  1 22  ? -23.364  -0.016  -49.357 1.00 95.41  ? 22   PHE A C     1 
ATOM   126   O O     . PHE A  1 22  ? -22.398  0.194   -48.623 1.00 94.05  ? 22   PHE A O     1 
ATOM   127   C CB    . PHE A  1 22  ? -25.681  0.996   -49.021 1.00 92.98  ? 22   PHE A CB    1 
ATOM   128   C CG    . PHE A  1 22  ? -25.681  0.570   -47.571 1.00 93.02  ? 22   PHE A CG    1 
ATOM   129   C CD1   . PHE A  1 22  ? -25.581  1.511   -46.554 1.00 95.83  ? 22   PHE A CD1   1 
ATOM   130   C CD2   . PHE A  1 22  ? -25.835  -0.766  -47.222 1.00 94.85  ? 22   PHE A CD2   1 
ATOM   131   C CE1   . PHE A  1 22  ? -25.600  1.118   -45.210 1.00 95.67  ? 22   PHE A CE1   1 
ATOM   132   C CE2   . PHE A  1 22  ? -25.841  -1.161  -45.879 1.00 96.76  ? 22   PHE A CE2   1 
ATOM   133   C CZ    . PHE A  1 22  ? -25.724  -0.216  -44.882 1.00 94.15  ? 22   PHE A CZ    1 
ATOM   134   N N     . GLU A  1 23  ? -23.639  -1.225  -49.896 1.00 93.00  ? 23   GLU A N     1 
ATOM   135   C CA    . GLU A  1 23  ? -22.851  -2.434  -49.641 1.00 91.64  ? 23   GLU A CA    1 
ATOM   136   C C     . GLU A  1 23  ? -21.440  -2.327  -50.189 1.00 94.23  ? 23   GLU A C     1 
ATOM   137   O O     . GLU A  1 23  ? -20.507  -2.791  -49.531 1.00 93.42  ? 23   GLU A O     1 
ATOM   138   C CB    . GLU A  1 23  ? -23.554  -3.686  -50.180 1.00 94.00  ? 23   GLU A CB    1 
ATOM   139   C CG    . GLU A  1 23  ? -23.567  -4.844  -49.189 1.00 100.87 ? 23   GLU A CG    1 
ATOM   140   C CD    . GLU A  1 23  ? -24.575  -4.764  -48.055 1.00 109.86 ? 23   GLU A CD    1 
ATOM   141   O OE1   . GLU A  1 23  ? -24.182  -5.046  -46.901 1.00 90.52  ? 23   GLU A OE1   1 
ATOM   142   O OE2   . GLU A  1 23  ? -25.761  -4.455  -48.316 1.00 104.08 ? 23   GLU A OE2   1 
ATOM   143   N N     . GLU A  1 24  ? -21.277  -1.691  -51.375 1.00 89.86  ? 24   GLU A N     1 
ATOM   144   C CA    . GLU A  1 24  ? -19.967  -1.470  -52.003 1.00 88.69  ? 24   GLU A CA    1 
ATOM   145   C C     . GLU A  1 24  ? -19.114  -0.473  -51.202 1.00 90.00  ? 24   GLU A C     1 
ATOM   146   O O     . GLU A  1 24  ? -17.887  -0.584  -51.221 1.00 89.29  ? 24   GLU A O     1 
ATOM   147   C CB    . GLU A  1 24  ? -20.109  -1.034  -53.469 1.00 91.49  ? 24   GLU A CB    1 
ATOM   148   C CG    . GLU A  1 24  ? -20.339  -2.200  -54.411 1.00 102.16 ? 24   GLU A CG    1 
ATOM   149   C CD    . GLU A  1 24  ? -20.871  -1.836  -55.784 1.00 125.40 ? 24   GLU A CD    1 
ATOM   150   O OE1   . GLU A  1 24  ? -20.128  -1.203  -56.571 1.00 119.57 ? 24   GLU A OE1   1 
ATOM   151   O OE2   . GLU A  1 24  ? -22.024  -2.220  -56.088 1.00 120.74 ? 24   GLU A OE2   1 
ATOM   152   N N     . THR A  1 25  ? -19.766  0.481   -50.486 1.00 84.74  ? 25   THR A N     1 
ATOM   153   C CA    . THR A  1 25  ? -19.098  1.471   -49.632 1.00 82.83  ? 25   THR A CA    1 
ATOM   154   C C     . THR A  1 25  ? -18.605  0.780   -48.364 1.00 83.37  ? 25   THR A C     1 
ATOM   155   O O     . THR A  1 25  ? -17.487  1.039   -47.921 1.00 81.24  ? 25   THR A O     1 
ATOM   156   C CB    . THR A  1 25  ? -20.004  2.675   -49.348 1.00 92.06  ? 25   THR A CB    1 
ATOM   157   O OG1   . THR A  1 25  ? -20.483  3.202   -50.582 1.00 96.68  ? 25   THR A OG1   1 
ATOM   158   C CG2   . THR A  1 25  ? -19.290  3.777   -48.582 1.00 89.62  ? 25   THR A CG2   1 
ATOM   159   N N     . PHE A  1 26  ? -19.444  -0.108  -47.801 1.00 79.38  ? 26   PHE A N     1 
ATOM   160   C CA    . PHE A  1 26  ? -19.158  -0.911  -46.620 1.00 77.92  ? 26   PHE A CA    1 
ATOM   161   C C     . PHE A  1 26  ? -17.912  -1.757  -46.885 1.00 83.59  ? 26   PHE A C     1 
ATOM   162   O O     . PHE A  1 26  ? -16.947  -1.649  -46.132 1.00 82.30  ? 26   PHE A O     1 
ATOM   163   C CB    . PHE A  1 26  ? -20.381  -1.776  -46.261 1.00 79.61  ? 26   PHE A CB    1 
ATOM   164   C CG    . PHE A  1 26  ? -20.129  -2.968  -45.370 1.00 80.92  ? 26   PHE A CG    1 
ATOM   165   C CD1   . PHE A  1 26  ? -19.901  -2.805  -44.006 1.00 83.37  ? 26   PHE A CD1   1 
ATOM   166   C CD2   . PHE A  1 26  ? -20.147  -4.259  -45.886 1.00 84.58  ? 26   PHE A CD2   1 
ATOM   167   C CE1   . PHE A  1 26  ? -19.672  -3.912  -43.178 1.00 83.27  ? 26   PHE A CE1   1 
ATOM   168   C CE2   . PHE A  1 26  ? -19.925  -5.367  -45.054 1.00 86.61  ? 26   PHE A CE2   1 
ATOM   169   C CZ    . PHE A  1 26  ? -19.685  -5.183  -43.708 1.00 82.84  ? 26   PHE A CZ    1 
ATOM   170   N N     . ASN A  1 27  ? -17.903  -2.523  -48.001 1.00 83.07  ? 27   ASN A N     1 
ATOM   171   C CA    . ASN A  1 27  ? -16.777  -3.369  -48.408 1.00 83.51  ? 27   ASN A CA    1 
ATOM   172   C C     . ASN A  1 27  ? -15.499  -2.573  -48.683 1.00 88.46  ? 27   ASN A C     1 
ATOM   173   O O     . ASN A  1 27  ? -14.411  -3.098  -48.441 1.00 88.05  ? 27   ASN A O     1 
ATOM   174   C CB    . ASN A  1 27  ? -17.150  -4.268  -49.593 1.00 86.32  ? 27   ASN A CB    1 
ATOM   175   C CG    . ASN A  1 27  ? -18.192  -5.331  -49.284 1.00 118.77 ? 27   ASN A CG    1 
ATOM   176   O OD1   . ASN A  1 27  ? -19.111  -5.572  -50.078 1.00 116.93 ? 27   ASN A OD1   1 
ATOM   177   N ND2   . ASN A  1 27  ? -18.070  -6.015  -48.144 1.00 109.56 ? 27   ASN A ND2   1 
ATOM   178   N N     . PHE A  1 28  ? -15.635  -1.299  -49.134 1.00 85.90  ? 28   PHE A N     1 
ATOM   179   C CA    . PHE A  1 28  ? -14.530  -0.370  -49.410 1.00 86.13  ? 28   PHE A CA    1 
ATOM   180   C C     . PHE A  1 28  ? -13.768  -0.034  -48.134 1.00 89.15  ? 28   PHE A C     1 
ATOM   181   O O     . PHE A  1 28  ? -12.545  -0.173  -48.110 1.00 88.71  ? 28   PHE A O     1 
ATOM   182   C CB    . PHE A  1 28  ? -15.059  0.907   -50.082 1.00 88.91  ? 28   PHE A CB    1 
ATOM   183   C CG    . PHE A  1 28  ? -14.115  2.087   -50.193 1.00 90.58  ? 28   PHE A CG    1 
ATOM   184   C CD1   . PHE A  1 28  ? -13.222  2.185   -51.251 1.00 94.40  ? 28   PHE A CD1   1 
ATOM   185   C CD2   . PHE A  1 28  ? -14.185  3.141   -49.291 1.00 91.64  ? 28   PHE A CD2   1 
ATOM   186   C CE1   . PHE A  1 28  ? -12.377  3.290   -51.375 1.00 95.27  ? 28   PHE A CE1   1 
ATOM   187   C CE2   . PHE A  1 28  ? -13.342  4.248   -49.421 1.00 94.74  ? 28   PHE A CE2   1 
ATOM   188   C CZ    . PHE A  1 28  ? -12.441  4.311   -50.460 1.00 93.59  ? 28   PHE A CZ    1 
ATOM   189   N N     . TYR A  1 29  ? -14.483  0.402   -47.079 1.00 85.08  ? 29   TYR A N     1 
ATOM   190   C CA    . TYR A  1 29  ? -13.866  0.733   -45.798 1.00 83.85  ? 29   TYR A CA    1 
ATOM   191   C C     . TYR A  1 29  ? -13.441  -0.512  -45.030 1.00 86.72  ? 29   TYR A C     1 
ATOM   192   O O     . TYR A  1 29  ? -12.497  -0.428  -44.240 1.00 86.55  ? 29   TYR A O     1 
ATOM   193   C CB    . TYR A  1 29  ? -14.760  1.639   -44.950 1.00 85.01  ? 29   TYR A CB    1 
ATOM   194   C CG    . TYR A  1 29  ? -14.960  3.011   -45.548 1.00 88.36  ? 29   TYR A CG    1 
ATOM   195   C CD1   . TYR A  1 29  ? -13.937  3.954   -45.539 1.00 90.86  ? 29   TYR A CD1   1 
ATOM   196   C CD2   . TYR A  1 29  ? -16.180  3.375   -46.112 1.00 90.06  ? 29   TYR A CD2   1 
ATOM   197   C CE1   . TYR A  1 29  ? -14.113  5.217   -46.106 1.00 93.40  ? 29   TYR A CE1   1 
ATOM   198   C CE2   . TYR A  1 29  ? -16.374  4.639   -46.669 1.00 91.98  ? 29   TYR A CE2   1 
ATOM   199   C CZ    . TYR A  1 29  ? -15.335  5.553   -46.674 1.00 100.91 ? 29   TYR A CZ    1 
ATOM   200   O OH    . TYR A  1 29  ? -15.536  6.792   -47.234 1.00 103.46 ? 29   TYR A OH    1 
ATOM   201   N N     . THR A  1 30  ? -14.108  -1.671  -45.286 1.00 81.90  ? 30   THR A N     1 
ATOM   202   C CA    . THR A  1 30  ? -13.796  -2.979  -44.688 1.00 80.16  ? 30   THR A CA    1 
ATOM   203   C C     . THR A  1 30  ? -12.357  -3.367  -45.073 1.00 83.09  ? 30   THR A C     1 
ATOM   204   O O     . THR A  1 30  ? -11.572  -3.773  -44.212 1.00 81.53  ? 30   THR A O     1 
ATOM   205   C CB    . THR A  1 30  ? -14.858  -4.011  -45.110 1.00 86.89  ? 30   THR A CB    1 
ATOM   206   O OG1   . THR A  1 30  ? -16.115  -3.598  -44.580 1.00 88.32  ? 30   THR A OG1   1 
ATOM   207   C CG2   . THR A  1 30  ? -14.560  -5.414  -44.617 1.00 85.49  ? 30   THR A CG2   1 
ATOM   208   N N     . LYS A  1 31  ? -12.009  -3.162  -46.358 1.00 80.30  ? 31   LYS A N     1 
ATOM   209   C CA    . LYS A  1 31  ? -10.678  -3.418  -46.910 1.00 80.66  ? 31   LYS A CA    1 
ATOM   210   C C     . LYS A  1 31  ? -9.650   -2.407  -46.360 1.00 84.46  ? 31   LYS A C     1 
ATOM   211   O O     . LYS A  1 31  ? -8.460   -2.728  -46.278 1.00 85.21  ? 31   LYS A O     1 
ATOM   212   C CB    . LYS A  1 31  ? -10.713  -3.387  -48.455 1.00 83.96  ? 31   LYS A CB    1 
ATOM   213   C CG    . LYS A  1 31  ? -11.482  -4.550  -49.097 1.00 93.98  ? 31   LYS A CG    1 
ATOM   214   C CD    . LYS A  1 31  ? -11.975  -4.211  -50.503 1.00 105.74 ? 31   LYS A CD    1 
ATOM   215   C CE    . LYS A  1 31  ? -13.035  -5.162  -51.011 1.00 113.92 ? 31   LYS A CE    1 
ATOM   216   N NZ    . LYS A  1 31  ? -13.426  -4.857  -52.416 1.00 122.13 ? 31   LYS A NZ    1 
ATOM   217   N N     . LEU A  1 32  ? -10.125  -1.207  -45.951 1.00 79.01  ? 32   LEU A N     1 
ATOM   218   C CA    . LEU A  1 32  ? -9.303   -0.108  -45.427 1.00 77.67  ? 32   LEU A CA    1 
ATOM   219   C C     . LEU A  1 32  ? -9.063   -0.083  -43.901 1.00 77.39  ? 32   LEU A C     1 
ATOM   220   O O     . LEU A  1 32  ? -8.492   0.880   -43.373 1.00 76.11  ? 32   LEU A O     1 
ATOM   221   C CB    . LEU A  1 32  ? -9.809   1.253   -45.931 1.00 78.21  ? 32   LEU A CB    1 
ATOM   222   C CG    . LEU A  1 32  ? -9.640   1.540   -47.408 1.00 83.98  ? 32   LEU A CG    1 
ATOM   223   C CD1   . LEU A  1 32  ? -10.471  2.726   -47.809 1.00 84.88  ? 32   LEU A CD1   1 
ATOM   224   C CD2   . LEU A  1 32  ? -8.180   1.782   -47.768 1.00 87.48  ? 32   LEU A CD2   1 
ATOM   225   N N     . GLY A  1 33  ? -9.478   -1.136  -43.215 1.00 71.59  ? 33   GLY A N     1 
ATOM   226   C CA    . GLY A  1 33  ? -9.237   -1.254  -41.782 1.00 69.88  ? 33   GLY A CA    1 
ATOM   227   C C     . GLY A  1 33  ? -10.412  -0.997  -40.872 1.00 70.68  ? 33   GLY A C     1 
ATOM   228   O O     . GLY A  1 33  ? -10.226  -0.915  -39.654 1.00 69.57  ? 33   GLY A O     1 
ATOM   229   N N     . PHE A  1 34  ? -11.625  -0.875  -41.441 1.00 65.28  ? 34   PHE A N     1 
ATOM   230   C CA    . PHE A  1 34  ? -12.825  -0.653  -40.638 1.00 62.80  ? 34   PHE A CA    1 
ATOM   231   C C     . PHE A  1 34  ? -13.468  -1.949  -40.198 1.00 66.28  ? 34   PHE A C     1 
ATOM   232   O O     . PHE A  1 34  ? -13.387  -2.965  -40.895 1.00 64.84  ? 34   PHE A O     1 
ATOM   233   C CB    . PHE A  1 34  ? -13.825  0.259   -41.336 1.00 63.89  ? 34   PHE A CB    1 
ATOM   234   C CG    . PHE A  1 34  ? -13.477  1.718   -41.214 1.00 64.71  ? 34   PHE A CG    1 
ATOM   235   C CD1   . PHE A  1 34  ? -14.067  2.510   -40.238 1.00 66.81  ? 34   PHE A CD1   1 
ATOM   236   C CD2   . PHE A  1 34  ? -12.569  2.306   -42.083 1.00 67.14  ? 34   PHE A CD2   1 
ATOM   237   C CE1   . PHE A  1 34  ? -13.763  3.868   -40.139 1.00 68.04  ? 34   PHE A CE1   1 
ATOM   238   C CE2   . PHE A  1 34  ? -12.268  3.662   -41.987 1.00 70.58  ? 34   PHE A CE2   1 
ATOM   239   C CZ    . PHE A  1 34  ? -12.850  4.430   -41.002 1.00 68.45  ? 34   PHE A CZ    1 
ATOM   240   N N     . HIS A  1 35  ? -14.078  -1.903  -39.011 1.00 63.46  ? 35   HIS A N     1 
ATOM   241   C CA    . HIS A  1 35  ? -14.737  -3.023  -38.354 1.00 62.64  ? 35   HIS A CA    1 
ATOM   242   C C     . HIS A  1 35  ? -16.144  -2.603  -38.020 1.00 63.03  ? 35   HIS A C     1 
ATOM   243   O O     . HIS A  1 35  ? -16.338  -1.553  -37.409 1.00 62.77  ? 35   HIS A O     1 
ATOM   244   C CB    . HIS A  1 35  ? -13.987  -3.385  -37.053 1.00 63.74  ? 35   HIS A CB    1 
ATOM   245   C CG    . HIS A  1 35  ? -12.551  -3.758  -37.258 1.00 68.31  ? 35   HIS A CG    1 
ATOM   246   N ND1   . HIS A  1 35  ? -12.149  -5.082  -37.285 1.00 70.35  ? 35   HIS A ND1   1 
ATOM   247   C CD2   . HIS A  1 35  ? -11.467  -2.969  -37.454 1.00 71.05  ? 35   HIS A CD2   1 
ATOM   248   C CE1   . HIS A  1 35  ? -10.842  -5.057  -37.505 1.00 70.25  ? 35   HIS A CE1   1 
ATOM   249   N NE2   . HIS A  1 35  ? -10.386  -3.808  -37.610 1.00 71.06  ? 35   HIS A NE2   1 
ATOM   250   N N     . ALA A  1 36  ? -17.127  -3.413  -38.409 1.00 57.85  ? 36   ALA A N     1 
ATOM   251   C CA    . ALA A  1 36  ? -18.530  -3.118  -38.126 1.00 57.44  ? 36   ALA A CA    1 
ATOM   252   C C     . ALA A  1 36  ? -18.813  -3.456  -36.685 1.00 60.52  ? 36   ALA A C     1 
ATOM   253   O O     . ALA A  1 36  ? -18.762  -4.628  -36.305 1.00 59.43  ? 36   ALA A O     1 
ATOM   254   C CB    . ALA A  1 36  ? -19.443  -3.909  -39.052 1.00 58.85  ? 36   ALA A CB    1 
ATOM   255   N N     . THR A  1 37  ? -19.045  -2.417  -35.863 1.00 57.82  ? 37   THR A N     1 
ATOM   256   C CA    . THR A  1 37  ? -19.315  -2.563  -34.429 1.00 56.60  ? 37   THR A CA    1 
ATOM   257   C C     . THR A  1 37  ? -20.815  -2.651  -34.122 1.00 60.72  ? 37   THR A C     1 
ATOM   258   O O     . THR A  1 37  ? -21.189  -3.346  -33.179 1.00 60.71  ? 37   THR A O     1 
ATOM   259   C CB    . THR A  1 37  ? -18.523  -1.556  -33.591 1.00 63.74  ? 37   THR A CB    1 
ATOM   260   O OG1   . THR A  1 37  ? -17.241  -1.330  -34.190 1.00 62.25  ? 37   THR A OG1   1 
ATOM   261   C CG2   . THR A  1 37  ? -18.312  -2.042  -32.155 1.00 65.37  ? 37   THR A CG2   1 
ATOM   262   N N     . ARG A  1 38  ? -21.665  -1.991  -34.936 1.00 57.42  ? 38   ARG A N     1 
ATOM   263   C CA    . ARG A  1 38  ? -23.119  -2.035  -34.786 1.00 57.65  ? 38   ARG A CA    1 
ATOM   264   C C     . ARG A  1 38  ? -23.848  -2.130  -36.141 1.00 63.25  ? 38   ARG A C     1 
ATOM   265   O O     . ARG A  1 38  ? -23.438  -1.469  -37.093 1.00 63.38  ? 38   ARG A O     1 
ATOM   266   C CB    . ARG A  1 38  ? -23.637  -0.841  -33.964 1.00 56.93  ? 38   ARG A CB    1 
ATOM   267   C CG    . ARG A  1 38  ? -25.106  -0.990  -33.554 1.00 58.70  ? 38   ARG A CG    1 
ATOM   268   C CD    . ARG A  1 38  ? -25.659  0.276   -32.974 1.00 59.79  ? 38   ARG A CD    1 
ATOM   269   N NE    . ARG A  1 38  ? -27.086  0.172   -32.664 1.00 63.93  ? 38   ARG A NE    1 
ATOM   270   C CZ    . ARG A  1 38  ? -27.789  1.130   -32.056 1.00 78.99  ? 38   ARG A CZ    1 
ATOM   271   N NH1   . ARG A  1 38  ? -27.206  2.269   -31.700 1.00 56.03  ? 38   ARG A NH1   1 
ATOM   272   N NH2   . ARG A  1 38  ? -29.077  0.958   -31.806 1.00 70.12  ? 38   ARG A NH2   1 
ATOM   273   N N     . SER A  1 39  ? -24.940  -2.935  -36.206 1.00 60.83  ? 39   SER A N     1 
ATOM   274   C CA    . SER A  1 39  ? -25.775  -3.122  -37.394 1.00 62.75  ? 39   SER A CA    1 
ATOM   275   C C     . SER A  1 39  ? -27.283  -2.994  -37.115 1.00 69.23  ? 39   SER A C     1 
ATOM   276   O O     . SER A  1 39  ? -27.746  -3.334  -36.022 1.00 66.65  ? 39   SER A O     1 
ATOM   277   C CB    . SER A  1 39  ? -25.440  -4.426  -38.123 1.00 67.59  ? 39   SER A CB    1 
ATOM   278   O OG    . SER A  1 39  ? -25.815  -5.607  -37.435 1.00 80.95  ? 39   SER A OG    1 
ATOM   279   N N     . TYR A  1 40  ? -28.038  -2.472  -38.117 1.00 70.40  ? 40   TYR A N     1 
ATOM   280   C CA    . TYR A  1 40  ? -29.498  -2.288  -38.068 1.00 72.48  ? 40   TYR A CA    1 
ATOM   281   C C     . TYR A  1 40  ? -30.196  -2.673  -39.383 1.00 77.73  ? 40   TYR A C     1 
ATOM   282   O O     . TYR A  1 40  ? -29.615  -2.510  -40.449 1.00 77.49  ? 40   TYR A O     1 
ATOM   283   C CB    . TYR A  1 40  ? -29.885  -0.841  -37.657 1.00 75.20  ? 40   TYR A CB    1 
ATOM   284   C CG    . TYR A  1 40  ? -31.388  -0.607  -37.618 1.00 79.39  ? 40   TYR A CG    1 
ATOM   285   C CD1   . TYR A  1 40  ? -32.169  -1.144  -36.599 1.00 81.20  ? 40   TYR A CD1   1 
ATOM   286   C CD2   . TYR A  1 40  ? -32.041  0.053   -38.659 1.00 81.99  ? 40   TYR A CD2   1 
ATOM   287   C CE1   . TYR A  1 40  ? -33.556  -0.996  -36.594 1.00 83.53  ? 40   TYR A CE1   1 
ATOM   288   C CE2   . TYR A  1 40  ? -33.429  0.196   -38.671 1.00 84.30  ? 40   TYR A CE2   1 
ATOM   289   C CZ    . TYR A  1 40  ? -34.182  -0.324  -37.631 1.00 93.32  ? 40   TYR A CZ    1 
ATOM   290   O OH    . TYR A  1 40  ? -35.550  -0.161  -37.616 1.00 98.07  ? 40   TYR A OH    1 
ATOM   291   N N     . VAL A  1 41  ? -31.459  -3.157  -39.283 1.00 76.19  ? 41   VAL A N     1 
ATOM   292   C CA    . VAL A  1 41  ? -32.366  -3.530  -40.381 1.00 78.56  ? 41   VAL A CA    1 
ATOM   293   C C     . VAL A  1 41  ? -33.870  -3.392  -39.943 1.00 83.97  ? 41   VAL A C     1 
ATOM   294   O O     . VAL A  1 41  ? -34.154  -3.441  -38.737 1.00 82.80  ? 41   VAL A O     1 
ATOM   295   C CB    . VAL A  1 41  ? -32.005  -4.904  -41.034 1.00 82.39  ? 41   VAL A CB    1 
ATOM   296   C CG1   . VAL A  1 41  ? -32.516  -6.088  -40.213 1.00 81.41  ? 41   VAL A CG1   1 
ATOM   297   C CG2   . VAL A  1 41  ? -32.494  -4.982  -42.481 1.00 84.20  ? 41   VAL A CG2   1 
ATOM   298   N N     . LYS A  1 42  ? -34.806  -3.212  -40.924 1.00 81.00  ? 42   LYS A N     1 
ATOM   299   C CA    . LYS A  1 42  ? -36.254  -3.074  -40.714 1.00 82.78  ? 42   LYS A CA    1 
ATOM   300   C C     . LYS A  1 42  ? -36.895  -4.147  -39.792 1.00 111.47 ? 42   LYS A C     1 
ATOM   301   O O     . LYS A  1 42  ? -37.181  -5.283  -40.191 1.00 62.25  ? 42   LYS A O     1 
ATOM   302   C CB    . LYS A  1 42  ? -36.986  -2.992  -42.055 1.00 87.21  ? 42   LYS A CB    1 
ATOM   303   N N     . ASN A  1 44  ? -39.011  -7.570  -37.190 1.00 90.53  ? 44   ASN A N     1 
ATOM   304   C CA    . ASN A  1 44  ? -38.302  -7.737  -35.914 1.00 88.25  ? 44   ASN A CA    1 
ATOM   305   C C     . ASN A  1 44  ? -38.322  -6.492  -34.998 1.00 91.44  ? 44   ASN A C     1 
ATOM   306   O O     . ASN A  1 44  ? -37.826  -5.430  -35.374 1.00 90.02  ? 44   ASN A O     1 
ATOM   307   C CB    . ASN A  1 44  ? -36.850  -8.219  -36.141 1.00 86.48  ? 44   ASN A CB    1 
ATOM   308   C CG    . ASN A  1 44  ? -36.631  -9.727  -36.257 1.00 92.91  ? 44   ASN A CG    1 
ATOM   309   O OD1   . ASN A  1 44  ? -35.554  -10.177 -36.644 1.00 74.07  ? 44   ASN A OD1   1 
ATOM   310   N ND2   . ASN A  1 44  ? -37.608  -10.550 -35.882 1.00 86.60  ? 44   ASN A ND2   1 
ATOM   311   N N     . ARG A  1 45  ? -38.859  -6.650  -33.778 1.00 89.03  ? 45   ARG A N     1 
ATOM   312   C CA    . ARG A  1 45  ? -38.953  -5.585  -32.770 1.00 88.96  ? 45   ARG A CA    1 
ATOM   313   C C     . ARG A  1 45  ? -37.772  -5.560  -31.762 1.00 92.10  ? 45   ARG A C     1 
ATOM   314   O O     . ARG A  1 45  ? -37.639  -4.593  -31.005 1.00 91.14  ? 45   ARG A O     1 
ATOM   315   C CB    . ARG A  1 45  ? -40.307  -5.660  -32.035 1.00 88.96  ? 45   ARG A CB    1 
ATOM   316   N N     . SER A  1 46  ? -36.916  -6.605  -31.774 1.00 88.36  ? 46   SER A N     1 
ATOM   317   C CA    . SER A  1 46  ? -35.770  -6.769  -30.874 1.00 86.67  ? 46   SER A CA    1 
ATOM   318   C C     . SER A  1 46  ? -34.658  -5.711  -31.006 1.00 92.04  ? 46   SER A C     1 
ATOM   319   O O     . SER A  1 46  ? -34.057  -5.347  -29.990 1.00 91.43  ? 46   SER A O     1 
ATOM   320   C CB    . SER A  1 46  ? -35.193  -8.178  -30.980 1.00 88.26  ? 46   SER A CB    1 
ATOM   321   N N     . ASP A  1 47  ? -34.382  -5.227  -32.245 1.00 89.26  ? 47   ASP A N     1 
ATOM   322   C CA    . ASP A  1 47  ? -33.339  -4.227  -32.568 1.00 87.68  ? 47   ASP A CA    1 
ATOM   323   C C     . ASP A  1 47  ? -33.419  -2.965  -31.686 1.00 88.97  ? 47   ASP A C     1 
ATOM   324   O O     . ASP A  1 47  ? -34.518  -2.448  -31.452 1.00 91.02  ? 47   ASP A O     1 
ATOM   325   C CB    . ASP A  1 47  ? -33.390  -3.846  -34.070 1.00 90.50  ? 47   ASP A CB    1 
ATOM   326   C CG    . ASP A  1 47  ? -32.439  -4.601  -34.994 1.00 93.42  ? 47   ASP A CG    1 
ATOM   327   O OD1   . ASP A  1 47  ? -31.234  -4.274  -34.998 1.00 93.14  ? 47   ASP A OD1   1 
ATOM   328   O OD2   . ASP A  1 47  ? -32.921  -5.440  -35.793 1.00 93.59  ? 47   ASP A OD2   1 
ATOM   329   N N     . PHE A  1 48  ? -32.261  -2.500  -31.184 1.00 81.01  ? 48   PHE A N     1 
ATOM   330   C CA    . PHE A  1 48  ? -32.147  -1.300  -30.349 1.00 79.70  ? 48   PHE A CA    1 
ATOM   331   C C     . PHE A  1 48  ? -32.053  -0.086  -31.252 1.00 83.15  ? 48   PHE A C     1 
ATOM   332   O O     . PHE A  1 48  ? -31.388  -0.151  -32.287 1.00 82.48  ? 48   PHE A O     1 
ATOM   333   C CB    . PHE A  1 48  ? -30.916  -1.376  -29.425 1.00 79.89  ? 48   PHE A CB    1 
ATOM   334   N N     . GLU A  1 49  ? -32.720  1.015   -30.874 1.00 80.31  ? 49   GLU A N     1 
ATOM   335   C CA    . GLU A  1 49  ? -32.716  2.246   -31.669 1.00 80.89  ? 49   GLU A CA    1 
ATOM   336   C C     . GLU A  1 49  ? -32.058  3.406   -30.924 1.00 84.82  ? 49   GLU A C     1 
ATOM   337   O O     . GLU A  1 49  ? -32.487  3.757   -29.825 1.00 85.50  ? 49   GLU A O     1 
ATOM   338   C CB    . GLU A  1 49  ? -34.137  2.611   -32.132 1.00 83.49  ? 49   GLU A CB    1 
ATOM   339   N N     . LEU A  1 50  ? -30.978  3.952   -31.495 1.00 79.97  ? 50   LEU A N     1 
ATOM   340   C CA    . LEU A  1 50  ? -30.251  5.099   -30.957 1.00 79.37  ? 50   LEU A CA    1 
ATOM   341   C C     . LEU A  1 50  ? -30.122  6.136   -32.071 1.00 84.63  ? 50   LEU A C     1 
ATOM   342   O O     . LEU A  1 50  ? -30.175  7.341   -31.810 1.00 86.32  ? 50   LEU A O     1 
ATOM   343   C CB    . LEU A  1 50  ? -28.887  4.697   -30.431 1.00 78.00  ? 50   LEU A CB    1 
ATOM   344   N N     . THR A  1 51  ? -29.989  5.650   -33.319 1.00 79.20  ? 51   THR A N     1 
ATOM   345   C CA    . THR A  1 51  ? -29.944  6.434   -34.544 1.00 79.07  ? 51   THR A CA    1 
ATOM   346   C C     . THR A  1 51  ? -30.742  5.714   -35.646 1.00 83.82  ? 51   THR A C     1 
ATOM   347   O O     . THR A  1 51  ? -30.629  4.498   -35.799 1.00 81.49  ? 51   THR A O     1 
ATOM   348   C CB    . THR A  1 51  ? -28.512  6.759   -34.939 1.00 81.49  ? 51   THR A CB    1 
ATOM   349   N N     . GLY A  1 52  ? -31.566  6.482   -36.365 1.00 83.99  ? 52   GLY A N     1 
ATOM   350   C CA    . GLY A  1 52  ? -32.415  6.016   -37.461 1.00 85.82  ? 52   GLY A CA    1 
ATOM   351   C C     . GLY A  1 52  ? -33.125  7.100   -38.259 1.00 93.23  ? 52   GLY A C     1 
ATOM   352   O O     . GLY A  1 52  ? -34.049  6.795   -39.014 1.00 93.83  ? 52   GLY A O     1 
ATOM   353   N N     . ILE A  1 53  ? -32.712  8.383   -38.072 1.00 91.56  ? 53   ILE A N     1 
ATOM   354   C CA    . ILE A  1 53  ? -33.217  9.605   -38.733 1.00 93.19  ? 53   ILE A CA    1 
ATOM   355   C C     . ILE A  1 53  ? -32.182  10.770  -38.578 1.00 98.29  ? 53   ILE A C     1 
ATOM   356   O O     . ILE A  1 53  ? -31.670  10.954  -37.464 1.00 97.44  ? 53   ILE A O     1 
ATOM   357   C CB    . ILE A  1 53  ? -34.624  10.009  -38.210 1.00 96.86  ? 53   ILE A CB    1 
ATOM   358   N N     . SER A  1 54  ? -31.830  11.536  -39.667 1.00 94.85  ? 54   SER A N     1 
ATOM   359   C CA    . SER A  1 54  ? -32.332  11.456  -41.058 1.00 82.80  ? 54   SER A CA    1 
ATOM   360   C C     . SER A  1 54  ? -31.191  11.479  -42.076 1.00 82.08  ? 54   SER A C     1 
ATOM   361   O O     . SER A  1 54  ? -30.939  10.478  -42.740 1.00 39.10  ? 54   SER A O     1 
ATOM   362   C CB    . SER A  1 54  ? -33.325  12.583  -41.350 1.00 84.53  ? 54   SER A CB    1 
ATOM   363   O OG    . SER A  1 54  ? -32.738  13.864  -41.180 1.00 85.59  ? 54   SER A OG    1 
ATOM   364   N N     . ASP A  1 56  ? -36.776  7.922   -42.533 1.00 87.11  ? 56   ASP A N     1 
ATOM   365   C CA    . ASP A  1 56  ? -35.889  7.124   -41.673 1.00 84.12  ? 56   ASP A CA    1 
ATOM   366   C C     . ASP A  1 56  ? -34.865  6.292   -42.480 1.00 85.93  ? 56   ASP A C     1 
ATOM   367   O O     . ASP A  1 56  ? -34.559  6.666   -43.613 1.00 85.71  ? 56   ASP A O     1 
ATOM   368   C CB    . ASP A  1 56  ? -36.692  6.272   -40.665 1.00 85.31  ? 56   ASP A CB    1 
ATOM   369   N N     . SER A  1 57  ? -34.318  5.194   -41.893 1.00 80.86  ? 57   SER A N     1 
ATOM   370   C CA    . SER A  1 57  ? -33.307  4.322   -42.519 1.00 79.16  ? 57   SER A CA    1 
ATOM   371   C C     . SER A  1 57  ? -33.725  2.847   -42.485 1.00 81.76  ? 57   SER A C     1 
ATOM   372   O O     . SER A  1 57  ? -34.196  2.384   -41.447 1.00 81.71  ? 57   SER A O     1 
ATOM   373   C CB    . SER A  1 57  ? -31.953  4.492   -41.828 1.00 79.86  ? 57   SER A CB    1 
ATOM   374   N N     . ILE A  1 58  ? -33.562  2.113   -43.612 1.00 77.07  ? 58   ILE A N     1 
ATOM   375   C CA    . ILE A  1 58  ? -33.890  0.680   -43.721 1.00 76.62  ? 58   ILE A CA    1 
ATOM   376   C C     . ILE A  1 58  ? -32.770  -0.221  -43.174 1.00 79.65  ? 58   ILE A C     1 
ATOM   377   O O     . ILE A  1 58  ? -33.052  -1.242  -42.541 1.00 79.47  ? 58   ILE A O     1 
ATOM   378   C CB    . ILE A  1 58  ? -34.410  0.236   -45.106 1.00 81.86  ? 58   ILE A CB    1 
ATOM   379   C CG1   . ILE A  1 58  ? -33.442  0.628   -46.249 1.00 83.83  ? 58   ILE A CG1   1 
ATOM   380   C CG2   . ILE A  1 58  ? -35.817  0.766   -45.344 1.00 84.84  ? 58   ILE A CG2   1 
ATOM   381   C CD1   . ILE A  1 58  ? -33.568  -0.216  -47.546 1.00 99.81  ? 58   ILE A CD1   1 
ATOM   382   N N     . LYS A  1 59  ? -31.505  0.170   -43.413 1.00 74.28  ? 59   LYS A N     1 
ATOM   383   C CA    . LYS A  1 59  ? -30.296  -0.504  -42.933 1.00 71.02  ? 59   LYS A CA    1 
ATOM   384   C C     . LYS A  1 59  ? -29.288  0.551   -42.475 1.00 73.43  ? 59   LYS A C     1 
ATOM   385   O O     . LYS A  1 59  ? -29.300  1.680   -42.992 1.00 74.56  ? 59   LYS A O     1 
ATOM   386   C CB    . LYS A  1 59  ? -29.686  -1.412  -44.012 1.00 72.27  ? 59   LYS A CB    1 
ATOM   387   N N     . GLU A  1 60  ? -28.444  0.194   -41.485 1.00 66.38  ? 60   GLU A N     1 
ATOM   388   C CA    . GLU A  1 60  ? -27.400  1.065   -40.920 1.00 64.65  ? 60   GLU A CA    1 
ATOM   389   C C     . GLU A  1 60  ? -26.243  0.228   -40.383 1.00 68.05  ? 60   GLU A C     1 
ATOM   390   O O     . GLU A  1 60  ? -26.462  -0.670  -39.565 1.00 66.02  ? 60   GLU A O     1 
ATOM   391   C CB    . GLU A  1 60  ? -27.954  1.980   -39.798 1.00 65.22  ? 60   GLU A CB    1 
ATOM   392   C CG    . GLU A  1 60  ? -28.470  3.324   -40.269 1.00 71.63  ? 60   GLU A CG    1 
ATOM   393   C CD    . GLU A  1 60  ? -28.727  4.364   -39.200 1.00 88.71  ? 60   GLU A CD    1 
ATOM   394   O OE1   . GLU A  1 60  ? -29.834  4.951   -39.210 1.00 81.53  ? 60   GLU A OE1   1 
ATOM   395   O OE2   . GLU A  1 60  ? -27.804  4.643   -38.400 1.00 84.17  ? 60   GLU A OE2   1 
ATOM   396   N N     . ILE A  1 61  ? -25.018  0.519   -40.842 1.00 65.61  ? 61   ILE A N     1 
ATOM   397   C CA    . ILE A  1 61  ? -23.810  -0.170  -40.381 1.00 64.54  ? 61   ILE A CA    1 
ATOM   398   C C     . ILE A  1 61  ? -22.852  0.859   -39.786 1.00 69.73  ? 61   ILE A C     1 
ATOM   399   O O     . ILE A  1 61  ? -22.474  1.819   -40.462 1.00 70.39  ? 61   ILE A O     1 
ATOM   400   C CB    . ILE A  1 61  ? -23.142  -1.081  -41.472 1.00 67.76  ? 61   ILE A CB    1 
ATOM   401   C CG1   . ILE A  1 61  ? -24.025  -2.306  -41.811 1.00 67.94  ? 61   ILE A CG1   1 
ATOM   402   C CG2   . ILE A  1 61  ? -21.726  -1.540  -41.038 1.00 67.45  ? 61   ILE A CG2   1 
ATOM   403   C CD1   . ILE A  1 61  ? -23.681  -2.995  -43.140 1.00 68.81  ? 61   ILE A CD1   1 
ATOM   404   N N     . TRP A  1 62  ? -22.473  0.656   -38.523 1.00 66.79  ? 62   TRP A N     1 
ATOM   405   C CA    . TRP A  1 62  ? -21.544  1.529   -37.826 1.00 67.82  ? 62   TRP A CA    1 
ATOM   406   C C     . TRP A  1 62  ? -20.144  0.909   -37.813 1.00 72.34  ? 62   TRP A C     1 
ATOM   407   O O     . TRP A  1 62  ? -19.900  -0.084  -37.113 1.00 71.69  ? 62   TRP A O     1 
ATOM   408   C CB    . TRP A  1 62  ? -22.041  1.833   -36.412 1.00 66.87  ? 62   TRP A CB    1 
ATOM   409   C CG    . TRP A  1 62  ? -23.282  2.675   -36.352 1.00 69.44  ? 62   TRP A CG    1 
ATOM   410   C CD1   . TRP A  1 62  ? -24.076  3.053   -37.395 1.00 73.74  ? 62   TRP A CD1   1 
ATOM   411   C CD2   . TRP A  1 62  ? -23.893  3.205   -35.170 1.00 69.41  ? 62   TRP A CD2   1 
ATOM   412   N NE1   . TRP A  1 62  ? -25.135  3.799   -36.937 1.00 74.08  ? 62   TRP A NE1   1 
ATOM   413   C CE2   . TRP A  1 62  ? -25.045  3.911   -35.574 1.00 74.64  ? 62   TRP A CE2   1 
ATOM   414   C CE3   . TRP A  1 62  ? -23.590  3.134   -33.796 1.00 69.99  ? 62   TRP A CE3   1 
ATOM   415   C CZ2   . TRP A  1 62  ? -25.889  4.550   -34.660 1.00 74.28  ? 62   TRP A CZ2   1 
ATOM   416   C CZ3   . TRP A  1 62  ? -24.422  3.781   -32.891 1.00 71.64  ? 62   TRP A CZ3   1 
ATOM   417   C CH2   . TRP A  1 62  ? -25.544  4.497   -33.327 1.00 73.35  ? 62   TRP A CH2   1 
ATOM   418   N N     . LEU A  1 63  ? -19.235  1.481   -38.629 1.00 68.34  ? 63   LEU A N     1 
ATOM   419   C CA    . LEU A  1 63  ? -17.849  1.020   -38.752 1.00 66.78  ? 63   LEU A CA    1 
ATOM   420   C C     . LEU A  1 63  ? -16.913  1.847   -37.863 1.00 68.87  ? 63   LEU A C     1 
ATOM   421   O O     . LEU A  1 63  ? -17.101  3.061   -37.726 1.00 69.70  ? 63   LEU A O     1 
ATOM   422   C CB    . LEU A  1 63  ? -17.358  1.089   -40.218 1.00 67.38  ? 63   LEU A CB    1 
ATOM   423   C CG    . LEU A  1 63  ? -18.155  0.385   -41.325 1.00 71.29  ? 63   LEU A CG    1 
ATOM   424   C CD1   . LEU A  1 63  ? -17.693  0.860   -42.676 1.00 71.62  ? 63   LEU A CD1   1 
ATOM   425   C CD2   . LEU A  1 63  ? -17.982  -1.116  -41.272 1.00 72.23  ? 63   LEU A CD2   1 
ATOM   426   N N     . GLU A  1 64  ? -15.894  1.190   -37.285 1.00 62.59  ? 64   GLU A N     1 
ATOM   427   C CA    . GLU A  1 64  ? -14.885  1.830   -36.437 1.00 60.75  ? 64   GLU A CA    1 
ATOM   428   C C     . GLU A  1 64  ? -13.478  1.361   -36.815 1.00 61.95  ? 64   GLU A C     1 
ATOM   429   O O     . GLU A  1 64  ? -13.229  0.158   -36.915 1.00 59.65  ? 64   GLU A O     1 
ATOM   430   C CB    . GLU A  1 64  ? -15.180  1.590   -34.933 1.00 60.96  ? 64   GLU A CB    1 
ATOM   431   C CG    . GLU A  1 64  ? -14.006  1.799   -33.977 1.00 67.84  ? 64   GLU A CG    1 
ATOM   432   C CD    . GLU A  1 64  ? -13.794  3.175   -33.373 1.00 93.01  ? 64   GLU A CD    1 
ATOM   433   O OE1   . GLU A  1 64  ? -14.753  3.711   -32.776 1.00 87.35  ? 64   GLU A OE1   1 
ATOM   434   O OE2   . GLU A  1 64  ? -12.643  3.669   -33.394 1.00 95.48  ? 64   GLU A OE2   1 
ATOM   435   N N     . SER A  1 65  ? -12.578  2.332   -37.048 1.00 58.60  ? 65   SER A N     1 
ATOM   436   C CA    . SER A  1 65  ? -11.154  2.110   -37.267 1.00 58.53  ? 65   SER A CA    1 
ATOM   437   C C     . SER A  1 65  ? -10.606  2.519   -35.885 1.00 64.19  ? 65   SER A C     1 
ATOM   438   O O     . SER A  1 65  ? -10.532  3.710   -35.563 1.00 65.25  ? 65   SER A O     1 
ATOM   439   C CB    . SER A  1 65  ? -10.618  3.003   -38.384 1.00 60.97  ? 65   SER A CB    1 
ATOM   440   O OG    . SER A  1 65  ? -9.469   2.453   -39.011 1.00 63.00  ? 65   SER A OG    1 
ATOM   441   N N     . PHE A  1 66  ? -10.395  1.512   -35.023 1.00 60.89  ? 66   PHE A N     1 
ATOM   442   C CA    . PHE A  1 66  ? -9.990   1.656   -33.622 1.00 61.46  ? 66   PHE A CA    1 
ATOM   443   C C     . PHE A  1 66  ? -8.741   2.501   -33.380 1.00 66.95  ? 66   PHE A C     1 
ATOM   444   O O     . PHE A  1 66  ? -7.809   2.439   -34.192 1.00 68.34  ? 66   PHE A O     1 
ATOM   445   C CB    . PHE A  1 66  ? -9.904   0.289   -32.915 1.00 62.58  ? 66   PHE A CB    1 
ATOM   446   C CG    . PHE A  1 66  ? -11.247  -0.388  -32.756 1.00 63.58  ? 66   PHE A CG    1 
ATOM   447   C CD1   . PHE A  1 66  ? -12.015  -0.183  -31.616 1.00 66.40  ? 66   PHE A CD1   1 
ATOM   448   C CD2   . PHE A  1 66  ? -11.753  -1.215  -33.758 1.00 65.77  ? 66   PHE A CD2   1 
ATOM   449   C CE1   . PHE A  1 66  ? -13.264  -0.797  -31.480 1.00 67.05  ? 66   PHE A CE1   1 
ATOM   450   C CE2   . PHE A  1 66  ? -13.007  -1.821  -33.624 1.00 68.24  ? 66   PHE A CE2   1 
ATOM   451   C CZ    . PHE A  1 66  ? -13.754  -1.607  -32.486 1.00 66.02  ? 66   PHE A CZ    1 
ATOM   452   N N     . PRO A  1 67  ? -8.696   3.281   -32.260 1.00 61.69  ? 67   PRO A N     1 
ATOM   453   C CA    . PRO A  1 67  ? -7.513   4.129   -31.996 1.00 62.02  ? 67   PRO A CA    1 
ATOM   454   C C     . PRO A  1 67  ? -6.225   3.351   -31.823 1.00 66.50  ? 67   PRO A C     1 
ATOM   455   O O     . PRO A  1 67  ? -6.286   2.152   -31.605 1.00 65.37  ? 67   PRO A O     1 
ATOM   456   C CB    . PRO A  1 67  ? -7.891   4.875   -30.718 1.00 63.06  ? 67   PRO A CB    1 
ATOM   457   C CG    . PRO A  1 67  ? -9.388   4.831   -30.682 1.00 66.14  ? 67   PRO A CG    1 
ATOM   458   C CD    . PRO A  1 67  ? -9.727   3.479   -31.220 1.00 61.04  ? 67   PRO A CD    1 
ATOM   459   N N     . LEU A  1 68  ? -5.071   4.014   -31.929 1.00 66.13  ? 68   LEU A N     1 
ATOM   460   C CA    . LEU A  1 68  ? -3.793   3.321   -31.755 1.00 68.18  ? 68   LEU A CA    1 
ATOM   461   C C     . LEU A  1 68  ? -3.286   3.414   -30.311 1.00 75.68  ? 68   LEU A C     1 
ATOM   462   O O     . LEU A  1 68  ? -3.156   4.515   -29.783 1.00 76.41  ? 68   LEU A O     1 
ATOM   463   C CB    . LEU A  1 68  ? -2.710   3.784   -32.759 1.00 69.49  ? 68   LEU A CB    1 
ATOM   464   C CG    . LEU A  1 68  ? -2.986   3.636   -34.269 1.00 73.23  ? 68   LEU A CG    1 
ATOM   465   C CD1   . LEU A  1 68  ? -1.814   4.153   -35.050 1.00 74.81  ? 68   LEU A CD1   1 
ATOM   466   C CD2   . LEU A  1 68  ? -3.264   2.186   -34.679 1.00 73.43  ? 68   LEU A CD2   1 
ATOM   467   N N     . SER A  1 69  ? -3.037   2.257   -29.678 1.00 74.08  ? 69   SER A N     1 
ATOM   468   C CA    . SER A  1 69  ? -2.570   2.161   -28.295 1.00 76.30  ? 69   SER A CA    1 
ATOM   469   C C     . SER A  1 69  ? -1.179   1.513   -28.237 1.00 84.86  ? 69   SER A C     1 
ATOM   470   O O     . SER A  1 69  ? -0.716   1.018   -29.271 1.00 85.36  ? 69   SER A O     1 
ATOM   471   C CB    . SER A  1 69  ? -3.584   1.418   -27.425 1.00 79.70  ? 69   SER A CB    1 
ATOM   472   O OG    . SER A  1 69  ? -4.563   0.692   -28.153 1.00 89.69  ? 69   SER A OG    1 
ATOM   473   N N     . GLU A  1 70  ? -0.507   1.528   -27.051 1.00 83.16  ? 70   GLU A N     1 
ATOM   474   C CA    . GLU A  1 70  ? 0.853    0.991   -26.896 1.00 84.81  ? 70   GLU A CA    1 
ATOM   475   C C     . GLU A  1 70  ? 1.010    -0.533  -26.819 1.00 89.37  ? 70   GLU A C     1 
ATOM   476   O O     . GLU A  1 70  ? 1.109    -1.072  -25.731 1.00 89.87  ? 70   GLU A O     1 
ATOM   477   C CB    . GLU A  1 70  ? 1.686    1.774   -25.849 1.00 87.86  ? 70   GLU A CB    1 
ATOM   478   C CG    . GLU A  1 70  ? 1.304    1.586   -24.388 1.00 97.04  ? 70   GLU A CG    1 
ATOM   479   C CD    . GLU A  1 70  ? 2.433    1.106   -23.493 1.00 113.12 ? 70   GLU A CD    1 
ATOM   480   O OE1   . GLU A  1 70  ? 3.170    0.178   -23.901 1.00 111.32 ? 70   GLU A OE1   1 
ATOM   481   O OE2   . GLU A  1 70  ? 2.563    1.640   -22.367 1.00 100.16 ? 70   GLU A OE2   1 
ATOM   482   N N     . VAL A  1 71  ? 1.082    -1.219  -27.973 1.00 86.54  ? 71   VAL A N     1 
ATOM   483   C CA    . VAL A  1 71  ? 1.201    -2.683  -28.105 1.00 86.14  ? 71   VAL A CA    1 
ATOM   484   C C     . VAL A  1 71  ? 2.138    -3.436  -27.129 1.00 92.61  ? 71   VAL A C     1 
ATOM   485   O O     . VAL A  1 71  ? 3.263    -3.001  -26.869 1.00 93.31  ? 71   VAL A O     1 
ATOM   486   C CB    . VAL A  1 71  ? 1.327    -3.125  -29.585 1.00 89.81  ? 71   VAL A CB    1 
ATOM   487   C CG1   . VAL A  1 71  ? 2.307    -4.273  -29.769 1.00 89.72  ? 71   VAL A CG1   1 
ATOM   488   C CG2   . VAL A  1 71  ? -0.042   -3.480  -30.164 1.00 88.31  ? 71   VAL A CG2   1 
ATOM   489   N N     . VAL A  1 72  ? 1.627    -4.564  -26.589 1.00 90.24  ? 72   VAL A N     1 
ATOM   490   C CA    . VAL A  1 72  ? 2.284    -5.465  -25.633 1.00 91.21  ? 72   VAL A CA    1 
ATOM   491   C C     . VAL A  1 72  ? 3.066    -6.569  -26.367 1.00 97.49  ? 72   VAL A C     1 
ATOM   492   O O     . VAL A  1 72  ? 2.511    -7.268  -27.220 1.00 96.39  ? 72   VAL A O     1 
ATOM   493   C CB    . VAL A  1 72  ? 1.258    -6.018  -24.599 1.00 93.77  ? 72   VAL A CB    1 
ATOM   494   C CG1   . VAL A  1 72  ? 1.791    -7.229  -23.843 1.00 93.64  ? 72   VAL A CG1   1 
ATOM   495   C CG2   . VAL A  1 72  ? 0.828    -4.931  -23.623 1.00 93.72  ? 72   VAL A CG2   1 
ATOM   496   N N     . GLU A  1 73  ? 4.350    -6.719  -25.997 1.00 97.13  ? 73   GLU A N     1 
ATOM   497   C CA    . GLU A  1 73  ? 5.336    -7.656  -26.544 1.00 98.74  ? 73   GLU A CA    1 
ATOM   498   C C     . GLU A  1 73  ? 4.921    -9.140  -26.592 1.00 102.99 ? 73   GLU A C     1 
ATOM   499   O O     . GLU A  1 73  ? 4.774    -9.683  -27.692 1.00 102.89 ? 73   GLU A O     1 
ATOM   500   C CB    . GLU A  1 73  ? 6.705    -7.474  -25.848 1.00 102.02 ? 73   GLU A CB    1 
ATOM   501   C CG    . GLU A  1 73  ? 7.509    -6.279  -26.342 1.00 115.10 ? 73   GLU A CG    1 
ATOM   502   C CD    . GLU A  1 73  ? 7.059    -4.908  -25.871 1.00 136.79 ? 73   GLU A CD    1 
ATOM   503   O OE1   . GLU A  1 73  ? 6.839    -4.739  -24.648 1.00 118.82 ? 73   GLU A OE1   1 
ATOM   504   O OE2   . GLU A  1 73  ? 6.956    -3.995  -26.724 1.00 135.40 ? 73   GLU A OE2   1 
ATOM   505   N N     . ALA A  1 74  ? 4.753    -9.791  -25.413 1.00 98.77  ? 74   ALA A N     1 
ATOM   506   C CA    . ALA A  1 74  ? 4.397    -11.208 -25.296 1.00 122.92 ? 74   ALA A CA    1 
ATOM   507   C C     . ALA A  1 74  ? 2.910    -11.470 -25.554 1.00 134.01 ? 74   ALA A C     1 
ATOM   508   O O     . ALA A  1 74  ? 2.317    -10.909 -26.473 1.00 90.64  ? 74   ALA A O     1 
ATOM   509   C CB    . ALA A  1 74  ? 4.785    -11.722 -23.917 1.00 123.62 ? 74   ALA A CB    1 
ATOM   510   N N     . GLY A  1 77  ? 9.686    -14.849 -27.522 1.00 109.19 ? 77   GLY A N     1 
ATOM   511   C CA    . GLY A  1 77  ? 8.729    -13.774 -27.804 1.00 108.46 ? 77   GLY A CA    1 
ATOM   512   C C     . GLY A  1 77  ? 7.682    -14.188 -28.862 1.00 110.40 ? 77   GLY A C     1 
ATOM   513   O O     . GLY A  1 77  ? 8.039    -14.518 -29.999 1.00 110.23 ? 77   GLY A O     1 
ATOM   514   N N     . ARG A  1 78  ? 6.387    -14.168 -28.470 1.00 104.85 ? 78   ARG A N     1 
ATOM   515   C CA    . ARG A  1 78  ? 5.248    -14.545 -29.318 1.00 103.02 ? 78   ARG A CA    1 
ATOM   516   C C     . ARG A  1 78  ? 4.862    -13.410 -30.276 1.00 106.94 ? 78   ARG A C     1 
ATOM   517   O O     . ARG A  1 78  ? 5.747    -12.694 -30.743 1.00 107.72 ? 78   ARG A O     1 
ATOM   518   C CB    . ARG A  1 78  ? 4.055    -15.014 -28.445 1.00 99.91  ? 78   ARG A CB    1 
ATOM   519   C CG    . ARG A  1 78  ? 3.809    -16.522 -28.480 1.00 106.38 ? 78   ARG A CG    1 
ATOM   520   C CD    . ARG A  1 78  ? 4.819    -17.329 -27.665 1.00 109.43 ? 78   ARG A CD    1 
ATOM   521   N NE    . ARG A  1 78  ? 4.765    -18.757 -27.995 1.00 105.48 ? 78   ARG A NE    1 
ATOM   522   C CZ    . ARG A  1 78  ? 5.476    -19.708 -27.392 1.00 105.42 ? 78   ARG A CZ    1 
ATOM   523   N NH1   . ARG A  1 78  ? 6.329    -19.397 -26.423 1.00 95.64  ? 78   ARG A NH1   1 
ATOM   524   N NH2   . ARG A  1 78  ? 5.340    -20.976 -27.757 1.00 73.92  ? 78   ARG A NH2   1 
ATOM   525   N N     . GLU A  1 79  ? 3.563    -13.251 -30.594 1.00 102.39 ? 79   GLU A N     1 
ATOM   526   C CA    . GLU A  1 79  ? 3.110    -12.177 -31.477 1.00 102.21 ? 79   GLU A CA    1 
ATOM   527   C C     . GLU A  1 79  ? 2.392    -11.047 -30.734 1.00 101.73 ? 79   GLU A C     1 
ATOM   528   O O     . GLU A  1 79  ? 1.657    -11.286 -29.777 1.00 98.49  ? 79   GLU A O     1 
ATOM   529   C CB    . GLU A  1 79  ? 2.313    -12.705 -32.677 1.00 103.86 ? 79   GLU A CB    1 
ATOM   530   C CG    . GLU A  1 79  ? 3.010    -12.430 -34.005 1.00 120.66 ? 79   GLU A CG    1 
ATOM   531   C CD    . GLU A  1 79  ? 2.315    -11.477 -34.966 1.00 145.25 ? 79   GLU A CD    1 
ATOM   532   O OE1   . GLU A  1 79  ? 1.751    -10.453 -34.512 1.00 129.13 ? 79   GLU A OE1   1 
ATOM   533   O OE2   . GLU A  1 79  ? 2.374    -11.739 -36.190 1.00 143.45 ? 79   GLU A OE2   1 
ATOM   534   N N     . LEU A  1 80  ? 2.637    -9.815  -31.195 1.00 98.69  ? 80   LEU A N     1 
ATOM   535   C CA    . LEU A  1 80  ? 2.171    -8.540  -30.647 1.00 97.93  ? 80   LEU A CA    1 
ATOM   536   C C     . LEU A  1 80  ? 0.653    -8.362  -30.537 1.00 99.23  ? 80   LEU A C     1 
ATOM   537   O O     . LEU A  1 80  ? -0.062   -8.532  -31.532 1.00 99.57  ? 80   LEU A O     1 
ATOM   538   C CB    . LEU A  1 80  ? 2.811    -7.374  -31.422 1.00 99.27  ? 80   LEU A CB    1 
ATOM   539   C CG    . LEU A  1 80  ? 4.346    -7.384  -31.524 1.00 105.63 ? 80   LEU A CG    1 
ATOM   540   C CD1   . LEU A  1 80  ? 4.813    -6.708  -32.797 1.00 107.18 ? 80   LEU A CD1   1 
ATOM   541   C CD2   . LEU A  1 80  ? 5.012    -6.787  -30.284 1.00 107.71 ? 80   LEU A CD2   1 
ATOM   542   N N     . ARG A  1 81  ? 0.177    -7.992  -29.312 1.00 92.09  ? 81   ARG A N     1 
ATOM   543   C CA    . ARG A  1 81  ? -1.231   -7.737  -28.950 1.00 88.56  ? 81   ARG A CA    1 
ATOM   544   C C     . ARG A  1 81  ? -1.397   -6.360  -28.291 1.00 90.44  ? 81   ARG A C     1 
ATOM   545   O O     . ARG A  1 81  ? -0.448   -5.848  -27.700 1.00 90.45  ? 81   ARG A O     1 
ATOM   546   C CB    . ARG A  1 81  ? -1.764   -8.835  -28.022 1.00 84.50  ? 81   ARG A CB    1 
ATOM   547   N N     . LYS A  1 82  ? -2.608   -5.767  -28.397 1.00 85.56  ? 82   LYS A N     1 
ATOM   548   C CA    . LYS A  1 82  ? -2.970   -4.455  -27.832 1.00 85.26  ? 82   LYS A CA    1 
ATOM   549   C C     . LYS A  1 82  ? -2.806   -4.396  -26.296 1.00 89.74  ? 82   LYS A C     1 
ATOM   550   O O     . LYS A  1 82  ? -3.050   -5.406  -25.626 1.00 89.65  ? 82   LYS A O     1 
ATOM   551   C CB    . LYS A  1 82  ? -4.418   -4.089  -28.209 1.00 86.11  ? 82   LYS A CB    1 
ATOM   552   N N     . PRO A  1 83  ? -2.435   -3.235  -25.697 1.00 86.16  ? 83   PRO A N     1 
ATOM   553   C CA    . PRO A  1 83  ? -2.333   -3.178  -24.228 1.00 85.11  ? 83   PRO A CA    1 
ATOM   554   C C     . PRO A  1 83  ? -3.709   -2.945  -23.604 1.00 85.04  ? 83   PRO A C     1 
ATOM   555   O O     . PRO A  1 83  ? -4.721   -3.221  -24.224 1.00 85.76  ? 83   PRO A O     1 
ATOM   556   C CB    . PRO A  1 83  ? -1.458   -1.949  -24.015 1.00 88.95  ? 83   PRO A CB    1 
ATOM   557   C CG    . PRO A  1 83  ? -1.954   -0.997  -25.103 1.00 93.81  ? 83   PRO A CG    1 
ATOM   558   C CD    . PRO A  1 83  ? -2.141   -1.914  -26.303 1.00 88.89  ? 83   PRO A CD    1 
ATOM   559   N N     . LEU A  1 84  ? -3.739   -2.388  -22.407 1.00 77.55  ? 84   LEU A N     1 
ATOM   560   C CA    . LEU A  1 84  ? -4.954   -2.043  -21.692 1.00 74.31  ? 84   LEU A CA    1 
ATOM   561   C C     . LEU A  1 84  ? -4.814   -0.564  -21.383 1.00 75.60  ? 84   LEU A C     1 
ATOM   562   O O     . LEU A  1 84  ? -4.032   0.120   -22.040 1.00 76.52  ? 84   LEU A O     1 
ATOM   563   C CB    . LEU A  1 84  ? -4.992   -2.875  -20.388 1.00 73.47  ? 84   LEU A CB    1 
ATOM   564   C CG    . LEU A  1 84  ? -5.182   -4.390  -20.512 1.00 76.81  ? 84   LEU A CG    1 
ATOM   565   C CD1   . LEU A  1 84  ? -6.300   -4.722  -21.440 1.00 76.44  ? 84   LEU A CD1   1 
ATOM   566   C CD2   . LEU A  1 84  ? -3.913   -5.090  -20.945 1.00 79.57  ? 84   LEU A CD2   1 
ATOM   567   N N     . GLN A  1 85  ? -5.533   -0.053  -20.397 1.00 68.99  ? 85   GLN A N     1 
ATOM   568   C CA    . GLN A  1 85  ? -5.312   1.326   -19.994 1.00 68.41  ? 85   GLN A CA    1 
ATOM   569   C C     . GLN A  1 85  ? -4.571   1.287   -18.648 1.00 69.37  ? 85   GLN A C     1 
ATOM   570   O O     . GLN A  1 85  ? -5.041   1.711   -17.583 1.00 67.18  ? 85   GLN A O     1 
ATOM   571   C CB    . GLN A  1 85  ? -6.578   2.170   -20.050 1.00 69.78  ? 85   GLN A CB    1 
ATOM   572   C CG    . GLN A  1 85  ? -7.340   2.080   -21.396 1.00 90.13  ? 85   GLN A CG    1 
ATOM   573   C CD    . GLN A  1 85  ? -6.503   2.177   -22.658 1.00 97.91  ? 85   GLN A CD    1 
ATOM   574   O OE1   . GLN A  1 85  ? -6.438   1.232   -23.445 1.00 99.85  ? 85   GLN A OE1   1 
ATOM   575   N NE2   . GLN A  1 85  ? -5.880   3.321   -22.904 1.00 67.44  ? 85   GLN A NE2   1 
ATOM   576   N N     . GLU A  1 86  ? -3.428   0.599   -18.752 1.00 65.07  ? 86   GLU A N     1 
ATOM   577   C CA    . GLU A  1 86  ? -2.343   0.369   -17.826 1.00 65.84  ? 86   GLU A CA    1 
ATOM   578   C C     . GLU A  1 86  ? -1.155   0.937   -18.599 1.00 71.55  ? 86   GLU A C     1 
ATOM   579   O O     . GLU A  1 86  ? -0.019   0.893   -18.143 1.00 73.57  ? 86   GLU A O     1 
ATOM   580   C CB    . GLU A  1 86  ? -2.147   -1.144  -17.618 1.00 66.32  ? 86   GLU A CB    1 
ATOM   581   C CG    . GLU A  1 86  ? -3.374   -1.874  -17.088 1.00 75.71  ? 86   GLU A CG    1 
ATOM   582   C CD    . GLU A  1 86  ? -3.311   -3.390  -17.072 1.00 88.34  ? 86   GLU A CD    1 
ATOM   583   O OE1   . GLU A  1 86  ? -2.635   -3.985  -17.943 1.00 54.74  ? 86   GLU A OE1   1 
ATOM   584   O OE2   . GLU A  1 86  ? -3.957   -3.987  -16.183 1.00 90.92  ? 86   GLU A OE2   1 
ATOM   585   N N     . SER A  1 87  ? -1.458   1.464   -19.800 1.00 67.86  ? 87   SER A N     1 
ATOM   586   C CA    . SER A  1 87  ? -0.597   2.124   -20.786 1.00 68.36  ? 87   SER A CA    1 
ATOM   587   C C     . SER A  1 87  ? 0.147    3.338   -20.209 1.00 74.42  ? 87   SER A C     1 
ATOM   588   O O     . SER A  1 87  ? -0.164   3.799   -19.109 1.00 73.42  ? 87   SER A O     1 
ATOM   589   C CB    . SER A  1 87  ? -1.427   2.539   -21.997 1.00 69.12  ? 87   SER A CB    1 
ATOM   590   O OG    . SER A  1 87  ? -2.673   3.064   -21.571 1.00 74.61  ? 87   SER A OG    1 
ATOM   591   N N     . VAL A  1 88  ? 1.139    3.833   -20.970 1.00 74.07  ? 88   VAL A N     1 
ATOM   592   C CA    . VAL A  1 88  ? 2.063    4.925   -20.635 1.00 77.03  ? 88   VAL A CA    1 
ATOM   593   C C     . VAL A  1 88  ? 1.502    6.232   -20.069 1.00 83.70  ? 88   VAL A C     1 
ATOM   594   O O     . VAL A  1 88  ? 1.794    6.573   -18.918 1.00 85.39  ? 88   VAL A O     1 
ATOM   595   C CB    . VAL A  1 88  ? 3.160    5.173   -21.698 1.00 82.08  ? 88   VAL A CB    1 
ATOM   596   C CG1   . VAL A  1 88  ? 4.362    4.271   -21.453 1.00 82.54  ? 88   VAL A CG1   1 
ATOM   597   C CG2   . VAL A  1 88  ? 2.612    5.003   -23.113 1.00 80.81  ? 88   VAL A CG2   1 
ATOM   598   N N     . GLY A  1 89  ? 0.748    6.965   -20.875 1.00 80.12  ? 89   GLY A N     1 
ATOM   599   C CA    . GLY A  1 89  ? 0.204    8.253   -20.458 1.00 80.86  ? 89   GLY A CA    1 
ATOM   600   C C     . GLY A  1 89  ? -1.274   8.264   -20.145 1.00 82.54  ? 89   GLY A C     1 
ATOM   601   O O     . GLY A  1 89  ? -1.903   9.329   -20.193 1.00 82.88  ? 89   GLY A O     1 
ATOM   602   N N     . TYR A  1 90  ? -1.845   7.084   -19.815 1.00 75.61  ? 90   TYR A N     1 
ATOM   603   C CA    . TYR A  1 90  ? -3.259   7.001   -19.499 1.00 72.58  ? 90   TYR A CA    1 
ATOM   604   C C     . TYR A  1 90  ? -3.577   7.649   -18.154 1.00 79.44  ? 90   TYR A C     1 
ATOM   605   O O     . TYR A  1 90  ? -3.062   7.245   -17.108 1.00 77.48  ? 90   TYR A O     1 
ATOM   606   C CB    . TYR A  1 90  ? -3.812   5.580   -19.616 1.00 69.60  ? 90   TYR A CB    1 
ATOM   607   C CG    . TYR A  1 90  ? -5.311   5.545   -19.452 1.00 69.08  ? 90   TYR A CG    1 
ATOM   608   C CD1   . TYR A  1 90  ? -6.154   5.847   -20.517 1.00 69.77  ? 90   TYR A CD1   1 
ATOM   609   C CD2   . TYR A  1 90  ? -5.890   5.297   -18.210 1.00 69.39  ? 90   TYR A CD2   1 
ATOM   610   C CE1   . TYR A  1 90  ? -7.538   5.848   -20.362 1.00 68.34  ? 90   TYR A CE1   1 
ATOM   611   C CE2   . TYR A  1 90  ? -7.273   5.307   -18.042 1.00 68.98  ? 90   TYR A CE2   1 
ATOM   612   C CZ    . TYR A  1 90  ? -8.091   5.568   -19.124 1.00 74.54  ? 90   TYR A CZ    1 
ATOM   613   O OH    . TYR A  1 90  ? -9.450   5.547   -18.960 1.00 74.89  ? 90   TYR A OH    1 
ATOM   614   N N     . GLU A  1 91  ? -4.404   8.696   -18.210 1.00 80.11  ? 91   GLU A N     1 
ATOM   615   C CA    . GLU A  1 91  ? -4.849   9.431   -17.032 1.00 81.82  ? 91   GLU A CA    1 
ATOM   616   C C     . GLU A  1 91  ? -6.348   9.228   -16.956 1.00 82.79  ? 91   GLU A C     1 
ATOM   617   O O     . GLU A  1 91  ? -7.064   9.722   -17.816 1.00 82.07  ? 91   GLU A O     1 
ATOM   618   C CB    . GLU A  1 91  ? -4.515   10.933  -17.154 1.00 85.91  ? 91   GLU A CB    1 
ATOM   619   C CG    . GLU A  1 91  ? -3.033   11.286  -17.144 1.00 104.24 ? 91   GLU A CG    1 
ATOM   620   C CD    . GLU A  1 91  ? -2.727   12.756  -17.388 1.00 139.29 ? 91   GLU A CD    1 
ATOM   621   O OE1   . GLU A  1 91  ? -3.282   13.338  -18.350 1.00 138.05 ? 91   GLU A OE1   1 
ATOM   622   O OE2   . GLU A  1 91  ? -1.900   13.316  -16.633 1.00 140.32 ? 91   GLU A OE2   1 
ATOM   623   N N     . SER A  1 92  ? -6.812   8.477   -15.959 1.00 78.71  ? 92   SER A N     1 
ATOM   624   C CA    . SER A  1 92  ? -8.223   8.168   -15.736 1.00 77.59  ? 92   SER A CA    1 
ATOM   625   C C     . SER A  1 92  ? -9.013   9.424   -15.364 1.00 81.92  ? 92   SER A C     1 
ATOM   626   O O     . SER A  1 92  ? -8.564   10.188  -14.509 1.00 83.74  ? 92   SER A O     1 
ATOM   627   C CB    . SER A  1 92  ? -8.362   7.125   -14.631 1.00 81.54  ? 92   SER A CB    1 
ATOM   628   O OG    . SER A  1 92  ? -9.481   6.283   -14.855 1.00 91.56  ? 92   SER A OG    1 
ATOM   629   N N     . GLU A  1 93  ? -10.177  9.643   -16.017 1.00 76.25  ? 93   GLU A N     1 
ATOM   630   C CA    . GLU A  1 93  ? -11.059  10.793  -15.756 1.00 75.85  ? 93   GLU A CA    1 
ATOM   631   C C     . GLU A  1 93  ? -12.349  10.365  -15.012 1.00 76.58  ? 93   GLU A C     1 
ATOM   632   O O     . GLU A  1 93  ? -12.442  9.214   -14.559 1.00 74.85  ? 93   GLU A O     1 
ATOM   633   C CB    . GLU A  1 93  ? -11.394  11.534  -17.063 1.00 77.32  ? 93   GLU A CB    1 
ATOM   634   C CG    . GLU A  1 93  ? -10.200  12.211  -17.719 1.00 87.09  ? 93   GLU A CG    1 
ATOM   635   C CD    . GLU A  1 93  ? -10.487  13.044  -18.959 1.00 97.72  ? 93   GLU A CD    1 
ATOM   636   O OE1   . GLU A  1 93  ? -11.345  12.639  -19.779 1.00 72.67  ? 93   GLU A OE1   1 
ATOM   637   O OE2   . GLU A  1 93  ? -9.815   14.088  -19.128 1.00 92.92  ? 93   GLU A OE2   1 
ATOM   638   N N     . ALA A  1 94  ? -13.329  11.297  -14.872 1.00 72.30  ? 94   ALA A N     1 
ATOM   639   C CA    . ALA A  1 94  ? -14.634  11.031  -14.247 1.00 71.38  ? 94   ALA A CA    1 
ATOM   640   C C     . ALA A  1 94  ? -15.389  9.990   -15.103 1.00 73.70  ? 94   ALA A C     1 
ATOM   641   O O     . ALA A  1 94  ? -16.036  9.071   -14.574 1.00 71.02  ? 94   ALA A O     1 
ATOM   642   C CB    . ALA A  1 94  ? -15.435  12.315  -14.133 1.00 73.23  ? 94   ALA A CB    1 
ATOM   643   N N     . LEU A  1 95  ? -15.249  10.126  -16.435 1.00 71.48  ? 95   LEU A N     1 
ATOM   644   C CA    . LEU A  1 95  ? -15.758  9.178   -17.403 1.00 70.51  ? 95   LEU A CA    1 
ATOM   645   C C     . LEU A  1 95  ? -14.547  8.335   -17.804 1.00 79.60  ? 95   LEU A C     1 
ATOM   646   O O     . LEU A  1 95  ? -13.909  7.739   -16.940 1.00 81.08  ? 95   LEU A O     1 
ATOM   647   C CB    . LEU A  1 95  ? -16.386  9.877   -18.614 1.00 70.01  ? 95   LEU A CB    1 
ATOM   648   C CG    . LEU A  1 95  ? -17.848  9.527   -18.865 1.00 72.83  ? 95   LEU A CG    1 
ATOM   649   C CD1   . LEU A  1 95  ? -18.457  10.477  -19.850 1.00 74.31  ? 95   LEU A CD1   1 
ATOM   650   C CD2   . LEU A  1 95  ? -18.025  8.083   -19.322 1.00 71.25  ? 95   LEU A CD2   1 
ATOM   651   N N     . LEU A  1 96  ? -14.201  8.291   -19.067 1.00 78.42  ? 96   LEU A N     1 
ATOM   652   C CA    . LEU A  1 96  ? -13.032  7.526   -19.471 1.00 79.40  ? 96   LEU A CA    1 
ATOM   653   C C     . LEU A  1 96  ? -11.848  8.525   -19.537 1.00 89.60  ? 96   LEU A C     1 
ATOM   654   O O     . LEU A  1 96  ? -12.085  9.736   -19.647 1.00 93.73  ? 96   LEU A O     1 
ATOM   655   C CB    . LEU A  1 96  ? -13.334  6.838   -20.805 1.00 78.33  ? 96   LEU A CB    1 
ATOM   656   C CG    . LEU A  1 96  ? -14.685  6.103   -20.828 1.00 80.80  ? 96   LEU A CG    1 
ATOM   657   C CD1   . LEU A  1 96  ? -15.582  6.624   -21.918 1.00 80.03  ? 96   LEU A CD1   1 
ATOM   658   C CD2   . LEU A  1 96  ? -14.502  4.606   -20.879 1.00 82.26  ? 96   LEU A CD2   1 
ATOM   659   N N     . GLY A  1 97  ? -10.612  8.032   -19.441 1.00 84.65  ? 97   GLY A N     1 
ATOM   660   C CA    . GLY A  1 97  ? -9.413   8.876   -19.397 1.00 85.12  ? 97   GLY A CA    1 
ATOM   661   C C     . GLY A  1 97  ? -8.750   9.426   -20.656 1.00 86.22  ? 97   GLY A C     1 
ATOM   662   O O     . GLY A  1 97  ? -9.428   9.731   -21.646 1.00 83.73  ? 97   GLY A O     1 
ATOM   663   N N     . TYR A  1 98  ? -7.393   9.620   -20.570 1.00 83.16  ? 98   TYR A N     1 
ATOM   664   C CA    . TYR A  1 98  ? -6.485   10.147  -21.603 1.00 107.09 ? 98   TYR A CA    1 
ATOM   665   C C     . TYR A  1 98  ? -5.279   9.201   -21.804 1.00 127.43 ? 98   TYR A C     1 
ATOM   666   O O     . TYR A  1 98  ? -4.563   9.270   -22.816 1.00 81.02  ? 98   TYR A O     1 
ATOM   667   C CB    . TYR A  1 98  ? -5.992   11.563  -21.223 1.00 110.47 ? 98   TYR A CB    1 
ATOM   668   C CG    . TYR A  1 98  ? -5.252   12.268  -22.340 1.00 114.11 ? 98   TYR A CG    1 
ATOM   669   C CD1   . TYR A  1 98  ? -5.936   13.018  -23.290 1.00 116.03 ? 98   TYR A CD1   1 
ATOM   670   C CD2   . TYR A  1 98  ? -3.865   12.173  -22.456 1.00 116.35 ? 98   TYR A CD2   1 
ATOM   671   C CE1   . TYR A  1 98  ? -5.268   13.637  -24.343 1.00 117.69 ? 98   TYR A CE1   1 
ATOM   672   C CE2   . TYR A  1 98  ? -3.187   12.770  -23.516 1.00 118.48 ? 98   TYR A CE2   1 
ATOM   673   C CZ    . TYR A  1 98  ? -3.893   13.518  -24.449 1.00 127.61 ? 98   TYR A CZ    1 
ATOM   674   O OH    . TYR A  1 98  ? -3.250   14.145  -25.493 1.00 132.62 ? 98   TYR A OH    1 
ATOM   675   N N     . PRO A  1 100 ? -2.464   7.552   -27.231 1.00 51.75  ? 100  PRO A N     1 
ATOM   676   C CA    . PRO A  1 100 ? -3.687   6.973   -27.835 1.00 51.10  ? 100  PRO A CA    1 
ATOM   677   C C     . PRO A  1 100 ? -4.287   7.785   -28.989 1.00 58.57  ? 100  PRO A C     1 
ATOM   678   O O     . PRO A  1 100 ? -5.079   8.706   -28.785 1.00 57.71  ? 100  PRO A O     1 
ATOM   679   C CB    . PRO A  1 100 ? -4.662   6.836   -26.655 1.00 52.13  ? 100  PRO A CB    1 
ATOM   680   N N     . TYR A  1 101 ? -3.934   7.406   -30.213 1.00 59.04  ? 101  TYR A N     1 
ATOM   681   C CA    . TYR A  1 101 ? -4.371   8.118   -31.400 1.00 61.27  ? 101  TYR A CA    1 
ATOM   682   C C     . TYR A  1 101 ? -5.809   7.821   -31.766 1.00 66.71  ? 101  TYR A C     1 
ATOM   683   O O     . TYR A  1 101 ? -6.053   6.967   -32.615 1.00 67.18  ? 101  TYR A O     1 
ATOM   684   C CB    . TYR A  1 101 ? -3.405   7.872   -32.577 1.00 63.93  ? 101  TYR A CB    1 
ATOM   685   N N     . GLN A  1 102 ? -6.758   8.557   -31.145 1.00 63.22  ? 102  GLN A N     1 
ATOM   686   C CA    . GLN A  1 102 ? -8.214   8.469   -31.361 1.00 87.79  ? 102  GLN A CA    1 
ATOM   687   C C     . GLN A  1 102 ? -8.651   8.340   -32.834 1.00 93.38  ? 102  GLN A C     1 
ATOM   688   O O     . GLN A  1 102 ? -9.644   7.690   -33.154 1.00 40.21  ? 102  GLN A O     1 
ATOM   689   C CB    . GLN A  1 102 ? -8.895   9.690   -30.751 1.00 89.69  ? 102  GLN A CB    1 
ATOM   690   N N     . GLY A  1 104 ? -11.136  6.720   -35.281 1.00 91.29  ? 104  GLY A N     1 
ATOM   691   C CA    . GLY A  1 104 ? -12.041  7.308   -36.265 1.00 91.75  ? 104  GLY A CA    1 
ATOM   692   C C     . GLY A  1 104 ? -13.180  6.390   -36.686 1.00 94.77  ? 104  GLY A C     1 
ATOM   693   O O     . GLY A  1 104 ? -12.936  5.360   -37.319 1.00 95.64  ? 104  GLY A O     1 
ATOM   694   N N     . GLY A  1 105 ? -14.420  6.769   -36.338 1.00 87.84  ? 105  GLY A N     1 
ATOM   695   C CA    . GLY A  1 105 ? -15.641  6.028   -36.652 1.00 85.12  ? 105  GLY A CA    1 
ATOM   696   C C     . GLY A  1 105 ? -16.492  6.711   -37.707 1.00 85.30  ? 105  GLY A C     1 
ATOM   697   O O     . GLY A  1 105 ? -16.637  7.937   -37.677 1.00 85.32  ? 105  GLY A O     1 
ATOM   698   N N     . VAL A  1 106 ? -17.047  5.928   -38.665 1.00 78.71  ? 106  VAL A N     1 
ATOM   699   C CA    . VAL A  1 106 ? -17.905  6.431   -39.754 1.00 77.95  ? 106  VAL A CA    1 
ATOM   700   C C     . VAL A  1 106 ? -19.215  5.642   -39.843 1.00 78.45  ? 106  VAL A C     1 
ATOM   701   O O     . VAL A  1 106 ? -19.199  4.442   -40.111 1.00 76.77  ? 106  VAL A O     1 
ATOM   702   C CB    . VAL A  1 106 ? -17.171  6.501   -41.113 1.00 82.27  ? 106  VAL A CB    1 
ATOM   703   N N     . VAL A  1 107 ? -20.341  6.319   -39.580 1.00 74.40  ? 107  VAL A N     1 
ATOM   704   C CA    . VAL A  1 107 ? -21.689  5.738   -39.582 1.00 74.59  ? 107  VAL A CA    1 
ATOM   705   C C     . VAL A  1 107 ? -22.275  5.720   -41.020 1.00 79.40  ? 107  VAL A C     1 
ATOM   706   O O     . VAL A  1 107 ? -22.456  6.782   -41.628 1.00 80.75  ? 107  VAL A O     1 
ATOM   707   C CB    . VAL A  1 107 ? -22.605  6.476   -38.541 1.00 79.15  ? 107  VAL A CB    1 
ATOM   708   C CG1   . VAL A  1 107 ? -24.092  6.284   -38.820 1.00 79.54  ? 107  VAL A CG1   1 
ATOM   709   C CG2   . VAL A  1 107 ? -22.276  6.070   -37.107 1.00 78.09  ? 107  VAL A CG2   1 
ATOM   710   N N     . ILE A  1 108 ? -22.561  4.516   -41.562 1.00 73.88  ? 108  ILE A N     1 
ATOM   711   C CA    . ILE A  1 108 ? -23.154  4.404   -42.905 1.00 73.51  ? 108  ILE A CA    1 
ATOM   712   C C     . ILE A  1 108 ? -24.648  4.113   -42.761 1.00 77.15  ? 108  ILE A C     1 
ATOM   713   O O     . ILE A  1 108 ? -25.023  3.100   -42.158 1.00 76.84  ? 108  ILE A O     1 
ATOM   714   C CB    . ILE A  1 108 ? -22.454  3.407   -43.867 1.00 75.60  ? 108  ILE A CB    1 
ATOM   715   C CG1   . ILE A  1 108 ? -20.923  3.487   -43.814 1.00 74.13  ? 108  ILE A CG1   1 
ATOM   716   C CG2   . ILE A  1 108 ? -22.956  3.635   -45.285 1.00 78.25  ? 108  ILE A CG2   1 
ATOM   717   C CD1   . ILE A  1 108 ? -20.233  2.403   -44.658 1.00 77.94  ? 108  ILE A CD1   1 
ATOM   718   N N     . LYS A  1 109 ? -25.486  5.010   -43.310 1.00 73.26  ? 109  LYS A N     1 
ATOM   719   C CA    . LYS A  1 109 ? -26.957  4.968   -43.247 1.00 73.25  ? 109  LYS A CA    1 
ATOM   720   C C     . LYS A  1 109 ? -27.617  4.708   -44.628 1.00 79.75  ? 109  LYS A C     1 
ATOM   721   O O     . LYS A  1 109 ? -27.168  5.259   -45.636 1.00 80.31  ? 109  LYS A O     1 
ATOM   722   C CB    . LYS A  1 109 ? -27.508  6.266   -42.595 1.00 74.19  ? 109  LYS A CB    1 
ATOM   723   C CG    . LYS A  1 109 ? -26.892  6.620   -41.224 1.00 59.08  ? 109  LYS A CG    1 
ATOM   724   C CD    . LYS A  1 109 ? -27.500  7.864   -40.558 1.00 54.72  ? 109  LYS A CD    1 
ATOM   725   C CE    . LYS A  1 109 ? -27.450  7.865   -39.037 1.00 49.12  ? 109  LYS A CE    1 
ATOM   726   N NZ    . LYS A  1 109 ? -26.550  8.910   -38.464 1.00 48.12  ? 109  LYS A NZ    1 
ATOM   727   N N     . LEU A  1 110 ? -28.672  3.864   -44.669 1.00 77.16  ? 110  LEU A N     1 
ATOM   728   C CA    . LEU A  1 110 ? -29.368  3.530   -45.919 1.00 79.36  ? 110  LEU A CA    1 
ATOM   729   C C     . LEU A  1 110 ? -30.862  3.890   -45.901 1.00 87.90  ? 110  LEU A C     1 
ATOM   730   O O     . LEU A  1 110 ? -31.641  3.250   -45.194 1.00 88.85  ? 110  LEU A O     1 
ATOM   731   C CB    . LEU A  1 110 ? -29.152  2.044   -46.298 1.00 78.90  ? 110  LEU A CB    1 
ATOM   732   C CG    . LEU A  1 110 ? -29.880  1.498   -47.539 1.00 84.85  ? 110  LEU A CG    1 
ATOM   733   C CD1   . LEU A  1 110 ? -29.292  2.059   -48.824 1.00 86.10  ? 110  LEU A CD1   1 
ATOM   734   C CD2   . LEU A  1 110 ? -29.817  -0.005  -47.580 1.00 86.27  ? 110  LEU A CD2   1 
ATOM   735   N N     . ARG A  1 111 ? -31.253  4.901   -46.704 1.00 86.12  ? 111  ARG A N     1 
ATOM   736   C CA    . ARG A  1 111 ? -32.632  5.375   -46.845 1.00 87.56  ? 111  ARG A CA    1 
ATOM   737   C C     . ARG A  1 111 ? -33.447  4.437   -47.747 1.00 94.43  ? 111  ARG A C     1 
ATOM   738   O O     . ARG A  1 111 ? -32.867  3.588   -48.427 1.00 94.16  ? 111  ARG A O     1 
ATOM   739   C CB    . ARG A  1 111 ? -32.646  6.818   -47.379 1.00 87.33  ? 111  ARG A CB    1 
ATOM   740   N N     . LEU A  1 112 ? -34.791  4.596   -47.755 1.00 93.73  ? 112  LEU A N     1 
ATOM   741   C CA    . LEU A  1 112 ? -35.747  3.799   -48.538 1.00 96.13  ? 112  LEU A CA    1 
ATOM   742   C C     . LEU A  1 112 ? -35.573  3.968   -50.064 1.00 103.60 ? 112  LEU A C     1 
ATOM   743   O O     . LEU A  1 112 ? -34.613  4.599   -50.504 1.00 102.50 ? 112  LEU A O     1 
ATOM   744   C CB    . LEU A  1 112 ? -37.186  4.162   -48.110 1.00 97.60  ? 112  LEU A CB    1 
ATOM   745   C CG    . LEU A  1 112 ? -38.184  2.998   -47.990 1.00 103.04 ? 112  LEU A CG    1 
ATOM   746   C CD1   . LEU A  1 112 ? -38.690  2.850   -46.569 1.00 101.88 ? 112  LEU A CD1   1 
ATOM   747   C CD2   . LEU A  1 112 ? -39.354  3.171   -48.960 1.00 108.13 ? 112  LEU A CD2   1 
ATOM   748   N N     . SER A  1 113 ? -36.496  3.382   -50.861 1.00 104.51 ? 113  SER A N     1 
ATOM   749   C CA    . SER A  1 113 ? -36.547  3.437   -52.334 1.00 107.18 ? 113  SER A CA    1 
ATOM   750   C C     . SER A  1 113 ? -36.648  4.904   -52.832 1.00 111.26 ? 113  SER A C     1 
ATOM   751   O O     . SER A  1 113 ? -35.989  5.276   -53.811 1.00 110.25 ? 113  SER A O     1 
ATOM   752   C CB    . SER A  1 113 ? -37.741  2.633   -52.851 1.00 114.46 ? 113  SER A CB    1 
ATOM   753   O OG    . SER A  1 113 ? -37.917  1.398   -52.172 1.00 123.28 ? 113  SER A OG    1 
ATOM   754   N N     . ASN A  1 114 ? -37.463  5.725   -52.125 1.00 107.91 ? 114  ASN A N     1 
ATOM   755   C CA    . ASN A  1 114 ? -37.680  7.147   -52.384 1.00 122.03 ? 114  ASN A CA    1 
ATOM   756   C C     . ASN A  1 114 ? -36.981  8.004   -51.314 1.00 157.10 ? 114  ASN A C     1 
ATOM   757   O O     . ASN A  1 114 ? -37.082  7.736   -50.113 1.00 121.51 ? 114  ASN A O     1 
ATOM   758   C CB    . ASN A  1 114 ? -39.186  7.462   -52.449 1.00 123.61 ? 114  ASN A CB    1 
ATOM   759   C CG    . ASN A  1 114 ? -39.956  7.207   -51.164 1.00 138.96 ? 114  ASN A CG    1 
ATOM   760   O OD1   . ASN A  1 114 ? -39.922  6.113   -50.583 1.00 132.96 ? 114  ASN A OD1   1 
ATOM   761   N ND2   . ASN A  1 114 ? -40.674  8.216   -50.693 1.00 126.08 ? 114  ASN A ND2   1 
ATOM   762   N N     . GLU A  1 118 ? -37.896  13.124  -50.082 1.00 127.66 ? 118  GLU A N     1 
ATOM   763   C CA    . GLU A  1 118 ? -37.441  11.759  -50.317 1.00 126.62 ? 118  GLU A CA    1 
ATOM   764   C C     . GLU A  1 118 ? -35.986  11.574  -49.881 1.00 128.70 ? 118  GLU A C     1 
ATOM   765   O O     . GLU A  1 118 ? -35.731  10.762  -48.981 1.00 127.90 ? 118  GLU A O     1 
ATOM   766   C CB    . GLU A  1 118 ? -37.647  11.362  -51.784 1.00 129.73 ? 118  GLU A CB    1 
ATOM   767   N N     . LYS A  1 119 ? -35.041  12.346  -50.495 1.00 123.82 ? 119  LYS A N     1 
ATOM   768   C CA    . LYS A  1 119 ? -33.594  12.355  -50.204 1.00 121.32 ? 119  LYS A CA    1 
ATOM   769   C C     . LYS A  1 119 ? -32.882  13.521  -50.912 1.00 124.75 ? 119  LYS A C     1 
ATOM   770   O O     . LYS A  1 119 ? -33.102  13.741  -52.108 1.00 126.76 ? 119  LYS A O     1 
ATOM   771   C CB    . LYS A  1 119 ? -32.924  11.018  -50.573 1.00 122.96 ? 119  LYS A CB    1 
ATOM   772   N N     . ASN A  1 120 ? -32.020  14.254  -50.171 1.00 118.14 ? 120  ASN A N     1 
ATOM   773   C CA    . ASN A  1 120 ? -31.254  15.396  -50.679 1.00 117.20 ? 120  ASN A CA    1 
ATOM   774   C C     . ASN A  1 120 ? -30.073  14.972  -51.548 1.00 118.46 ? 120  ASN A C     1 
ATOM   775   O O     . ASN A  1 120 ? -29.635  13.824  -51.493 1.00 116.26 ? 120  ASN A O     1 
ATOM   776   C CB    . ASN A  1 120 ? -30.777  16.294  -49.521 1.00 115.45 ? 120  ASN A CB    1 
ATOM   777   C CG    . ASN A  1 120 ? -31.682  17.468  -49.182 1.00 132.58 ? 120  ASN A CG    1 
ATOM   778   O OD1   . ASN A  1 120 ? -31.206  18.586  -48.937 1.00 120.05 ? 120  ASN A OD1   1 
ATOM   779   N ND2   . ASN A  1 120 ? -32.999  17.248  -49.120 1.00 125.87 ? 120  ASN A ND2   1 
ATOM   780   N N     . ASN A  1 121 ? -29.569  15.907  -52.360 1.00 115.54 ? 121  ASN A N     1 
ATOM   781   C CA    . ASN A  1 121 ? -28.418  15.679  -53.222 1.00 115.06 ? 121  ASN A CA    1 
ATOM   782   C C     . ASN A  1 121 ? -27.145  15.905  -52.414 1.00 115.98 ? 121  ASN A C     1 
ATOM   783   O O     . ASN A  1 121 ? -27.155  16.705  -51.473 1.00 114.97 ? 121  ASN A O     1 
ATOM   784   C CB    . ASN A  1 121 ? -28.461  16.618  -54.420 1.00 119.45 ? 121  ASN A CB    1 
ATOM   785   C CG    . ASN A  1 121 ? -28.413  15.888  -55.728 1.00 148.44 ? 121  ASN A CG    1 
ATOM   786   O OD1   . ASN A  1 121 ? -29.436  15.425  -56.234 1.00 144.40 ? 121  ASN A OD1   1 
ATOM   787   N ND2   . ASN A  1 121 ? -27.223  15.753  -56.293 1.00 141.74 ? 121  ASN A ND2   1 
ATOM   788   N N     . ASP A  1 122 ? -26.050  15.203  -52.774 1.00 110.78 ? 122  ASP A N     1 
ATOM   789   C CA    . ASP A  1 122 ? -24.758  15.311  -52.077 1.00 108.56 ? 122  ASP A CA    1 
ATOM   790   C C     . ASP A  1 122 ? -24.088  16.668  -52.298 1.00 111.02 ? 122  ASP A C     1 
ATOM   791   O O     . ASP A  1 122 ? -23.921  17.086  -53.450 1.00 112.12 ? 122  ASP A O     1 
ATOM   792   C CB    . ASP A  1 122 ? -23.809  14.167  -52.478 1.00 109.61 ? 122  ASP A CB    1 
ATOM   793   N N     . LEU A  1 123 ? -23.722  17.353  -51.188 1.00 104.65 ? 123  LEU A N     1 
ATOM   794   C CA    . LEU A  1 123 ? -23.063  18.666  -51.176 1.00 104.18 ? 123  LEU A CA    1 
ATOM   795   C C     . LEU A  1 123 ? -21.527  18.528  -51.207 1.00 108.13 ? 123  LEU A C     1 
ATOM   796   O O     . LEU A  1 123 ? -21.000  17.496  -50.773 1.00 107.31 ? 123  LEU A O     1 
ATOM   797   C CB    . LEU A  1 123 ? -23.505  19.469  -49.935 1.00 103.56 ? 123  LEU A CB    1 
ATOM   798   C CG    . LEU A  1 123 ? -24.515  20.589  -50.168 1.00 108.57 ? 123  LEU A CG    1 
ATOM   799   C CD1   . LEU A  1 123 ? -25.890  20.189  -49.692 1.00 108.58 ? 123  LEU A CD1   1 
ATOM   800   C CD2   . LEU A  1 123 ? -24.083  21.864  -49.480 1.00 109.41 ? 123  LEU A CD2   1 
ATOM   801   N N     . PRO A  1 124 ? -20.815  19.665  -51.367 1.00 104.14 ? 124  PRO A N     1 
ATOM   802   C CA    . PRO A  1 124 ? -19.449  19.612  -51.915 1.00 102.67 ? 124  PRO A CA    1 
ATOM   803   C C     . PRO A  1 124 ? -18.366  19.342  -50.870 1.00 102.70 ? 124  PRO A C     1 
ATOM   804   O O     . PRO A  1 124 ? -17.286  18.891  -51.242 1.00 102.27 ? 124  PRO A O     1 
ATOM   805   C CB    . PRO A  1 124 ? -19.285  20.977  -52.581 1.00 105.68 ? 124  PRO A CB    1 
ATOM   806   N N     . GLY A  1 125 ? -18.677  19.583  -49.591 1.00 96.64  ? 125  GLY A N     1 
ATOM   807   C CA    . GLY A  1 125 ? -17.788  19.393  -48.439 1.00 94.46  ? 125  GLY A CA    1 
ATOM   808   C C     . GLY A  1 125 ? -17.124  18.035  -48.299 1.00 94.43  ? 125  GLY A C     1 
ATOM   809   O O     . GLY A  1 125 ? -17.621  17.044  -48.834 1.00 93.00  ? 125  GLY A O     1 
ATOM   810   N N     . GLU A  1 126 ? -15.977  17.990  -47.581 1.00 89.64  ? 126  GLU A N     1 
ATOM   811   C CA    . GLU A  1 126 ? -15.149  16.787  -47.354 1.00 87.57  ? 126  GLU A CA    1 
ATOM   812   C C     . GLU A  1 126 ? -14.551  16.711  -45.935 1.00 89.74  ? 126  GLU A C     1 
ATOM   813   O O     . GLU A  1 126 ? -14.473  17.723  -45.242 1.00 89.91  ? 126  GLU A O     1 
ATOM   814   C CB    . GLU A  1 126 ? -14.005  16.717  -48.379 1.00 88.96  ? 126  GLU A CB    1 
ATOM   815   C CG    . GLU A  1 126 ? -14.437  16.240  -49.744 1.00 99.03  ? 126  GLU A CG    1 
ATOM   816   C CD    . GLU A  1 126 ? -13.373  16.398  -50.807 1.00 119.27 ? 126  GLU A CD    1 
ATOM   817   O OE1   . GLU A  1 126 ? -13.436  17.385  -51.575 1.00 105.64 ? 126  GLU A OE1   1 
ATOM   818   O OE2   . GLU A  1 126 ? -12.456  15.549  -50.851 1.00 111.13 ? 126  GLU A OE2   1 
ATOM   819   N N     . VAL A  1 127 ? -14.101  15.504  -45.525 1.00 83.83  ? 127  VAL A N     1 
ATOM   820   C CA    . VAL A  1 127 ? -13.463  15.243  -44.230 1.00 82.04  ? 127  VAL A CA    1 
ATOM   821   C C     . VAL A  1 127 ? -12.019  14.796  -44.454 1.00 84.89  ? 127  VAL A C     1 
ATOM   822   O O     . VAL A  1 127 ? -11.759  14.005  -45.371 1.00 84.37  ? 127  VAL A O     1 
ATOM   823   C CB    . VAL A  1 127 ? -14.202  14.190  -43.363 1.00 84.33  ? 127  VAL A CB    1 
ATOM   824   C CG1   . VAL A  1 127 ? -14.097  14.531  -41.880 1.00 83.28  ? 127  VAL A CG1   1 
ATOM   825   C CG2   . VAL A  1 127 ? -15.655  14.017  -43.783 1.00 84.25  ? 127  VAL A CG2   1 
ATOM   826   N N     . THR A  1 128 ? -11.090  15.275  -43.599 1.00 80.43  ? 128  THR A N     1 
ATOM   827   C CA    . THR A  1 128 ? -9.680   14.897  -43.667 1.00 79.68  ? 128  THR A CA    1 
ATOM   828   C C     . THR A  1 128 ? -9.319   14.117  -42.422 1.00 80.42  ? 128  THR A C     1 
ATOM   829   O O     . THR A  1 128 ? -9.447   14.636  -41.316 1.00 80.35  ? 128  THR A O     1 
ATOM   830   C CB    . THR A  1 128 ? -8.768   16.103  -43.939 1.00 90.87  ? 128  THR A CB    1 
ATOM   831   O OG1   . THR A  1 128 ? -9.369   16.958  -44.926 1.00 89.90  ? 128  THR A OG1   1 
ATOM   832   C CG2   . THR A  1 128 ? -7.362   15.683  -44.372 1.00 88.35  ? 128  THR A CG2   1 
ATOM   833   N N     . PHE A  1 129 ? -8.901   12.859  -42.608 1.00 74.51  ? 129  PHE A N     1 
ATOM   834   C CA    . PHE A  1 129 ? -8.533   11.939  -41.532 1.00 72.42  ? 129  PHE A CA    1 
ATOM   835   C C     . PHE A  1 129 ? -7.026   11.842  -41.381 1.00 76.17  ? 129  PHE A C     1 
ATOM   836   O O     . PHE A  1 129 ? -6.294   12.068  -42.343 1.00 76.21  ? 129  PHE A O     1 
ATOM   837   C CB    . PHE A  1 129 ? -9.137   10.543  -41.778 1.00 72.95  ? 129  PHE A CB    1 
ATOM   838   C CG    . PHE A  1 129 ? -10.591  10.548  -42.201 1.00 74.43  ? 129  PHE A CG    1 
ATOM   839   C CD1   . PHE A  1 129 ? -11.566  11.105  -41.391 1.00 77.58  ? 129  PHE A CD1   1 
ATOM   840   C CD2   . PHE A  1 129 ? -10.981  10.001  -43.412 1.00 76.88  ? 129  PHE A CD2   1 
ATOM   841   C CE1   . PHE A  1 129 ? -12.907  11.115  -41.787 1.00 78.49  ? 129  PHE A CE1   1 
ATOM   842   C CE2   . PHE A  1 129 ? -12.325  10.004  -43.801 1.00 79.55  ? 129  PHE A CE2   1 
ATOM   843   C CZ    . PHE A  1 129 ? -13.278  10.565  -42.990 1.00 77.28  ? 129  PHE A CZ    1 
ATOM   844   N N     . PHE A  1 130 ? -6.559   11.515  -40.169 1.00 72.82  ? 130  PHE A N     1 
ATOM   845   C CA    . PHE A  1 130 ? -5.139   11.363  -39.870 1.00 72.97  ? 130  PHE A CA    1 
ATOM   846   C C     . PHE A  1 130 ? -4.668   9.908   -40.030 1.00 77.32  ? 130  PHE A C     1 
ATOM   847   O O     . PHE A  1 130 ? -5.338   8.979   -39.571 1.00 75.32  ? 130  PHE A O     1 
ATOM   848   C CB    . PHE A  1 130 ? -4.802   11.919  -38.471 1.00 74.75  ? 130  PHE A CB    1 
ATOM   849   C CG    . PHE A  1 130 ? -3.619   11.270  -37.779 1.00 76.49  ? 130  PHE A CG    1 
ATOM   850   C CD1   . PHE A  1 130 ? -2.320   11.487  -38.229 1.00 80.44  ? 130  PHE A CD1   1 
ATOM   851   C CD2   . PHE A  1 130 ? -3.804   10.434  -36.688 1.00 77.51  ? 130  PHE A CD2   1 
ATOM   852   C CE1   . PHE A  1 130 ? -1.237   10.867  -37.612 1.00 81.04  ? 130  PHE A CE1   1 
ATOM   853   C CE2   . PHE A  1 130 ? -2.718   9.827   -36.064 1.00 80.28  ? 130  PHE A CE2   1 
ATOM   854   C CZ    . PHE A  1 130 ? -1.443   10.044  -36.535 1.00 79.40  ? 130  PHE A CZ    1 
ATOM   855   N N     . THR A  1 131 ? -3.493   9.732   -40.662 1.00 76.26  ? 131  THR A N     1 
ATOM   856   C CA    . THR A  1 131 ? -2.823   8.448   -40.848 1.00 76.40  ? 131  THR A CA    1 
ATOM   857   C C     . THR A  1 131 ? -1.304   8.536   -40.617 1.00 84.25  ? 131  THR A C     1 
ATOM   858   O O     . THR A  1 131 ? -0.618   9.390   -41.204 1.00 85.69  ? 131  THR A O     1 
ATOM   859   C CB    . THR A  1 131 ? -3.245   7.724   -42.140 1.00 78.53  ? 131  THR A CB    1 
ATOM   860   O OG1   . THR A  1 131 ? -2.734   6.382   -42.114 1.00 76.62  ? 131  THR A OG1   1 
ATOM   861   C CG2   . THR A  1 131 ? -2.799   8.433   -43.407 1.00 74.86  ? 131  THR A CG2   1 
ATOM   862   N N     . ALA A  1 132 ? -0.795   7.638   -39.750 1.00 80.32  ? 132  ALA A N     1 
ATOM   863   C CA    . ALA A  1 132 ? 0.616    7.522   -39.413 1.00 80.85  ? 132  ALA A CA    1 
ATOM   864   C C     . ALA A  1 132 ? 1.305    6.517   -40.349 1.00 85.96  ? 132  ALA A C     1 
ATOM   865   O O     . ALA A  1 132 ? 2.456    6.123   -40.104 1.00 87.33  ? 132  ALA A O     1 
ATOM   866   C CB    . ALA A  1 132 ? 0.753    7.092   -37.967 1.00 80.94  ? 132  ALA A CB    1 
ATOM   867   N N     . SER A  1 133 ? 0.600    6.135   -41.440 1.00 81.67  ? 133  SER A N     1 
ATOM   868   C CA    . SER A  1 133 ? 1.037    5.179   -42.461 1.00 81.97  ? 133  SER A CA    1 
ATOM   869   C C     . SER A  1 133 ? 0.602    5.648   -43.874 1.00 86.27  ? 133  SER A C     1 
ATOM   870   O O     . SER A  1 133 ? 0.053    4.856   -44.647 1.00 85.28  ? 133  SER A O     1 
ATOM   871   C CB    . SER A  1 133 ? 0.474    3.791   -42.149 1.00 84.92  ? 133  SER A CB    1 
ATOM   872   O OG    . SER A  1 133 ? 0.622    3.403   -40.790 1.00 91.83  ? 133  SER A OG    1 
ATOM   873   N N     . ILE A  1 134 ? 0.864    6.942   -44.205 1.00 83.64  ? 134  ILE A N     1 
ATOM   874   C CA    . ILE A  1 134 ? 0.510    7.599   -45.484 1.00 83.57  ? 134  ILE A CA    1 
ATOM   875   C C     . ILE A  1 134 ? 0.774    6.790   -46.754 1.00 88.49  ? 134  ILE A C     1 
ATOM   876   O O     . ILE A  1 134 ? -0.047   6.817   -47.670 1.00 88.33  ? 134  ILE A O     1 
ATOM   877   C CB    . ILE A  1 134 ? 1.034    9.059   -45.623 1.00 87.50  ? 134  ILE A CB    1 
ATOM   878   C CG1   . ILE A  1 134 ? 2.566    9.175   -45.412 1.00 88.67  ? 134  ILE A CG1   1 
ATOM   879   C CG2   . ILE A  1 134 ? 0.260    10.028  -44.736 1.00 88.35  ? 134  ILE A CG2   1 
ATOM   880   C CD1   . ILE A  1 134 ? 3.398    9.310   -46.677 1.00 93.28  ? 134  ILE A CD1   1 
ATOM   881   N N     . ASP A  1 135 ? 1.926    6.099   -46.814 1.00 85.55  ? 135  ASP A N     1 
ATOM   882   C CA    . ASP A  1 135 ? 2.342    5.280   -47.956 1.00 85.66  ? 135  ASP A CA    1 
ATOM   883   C C     . ASP A  1 135 ? 1.651    3.919   -47.941 1.00 88.53  ? 135  ASP A C     1 
ATOM   884   O O     . ASP A  1 135 ? 1.315    3.409   -49.012 1.00 87.72  ? 135  ASP A O     1 
ATOM   885   C CB    . ASP A  1 135 ? 3.875    5.117   -48.014 1.00 88.71  ? 135  ASP A CB    1 
ATOM   886   C CG    . ASP A  1 135 ? 4.652    5.879   -46.952 1.00 99.85  ? 135  ASP A CG    1 
ATOM   887   O OD1   . ASP A  1 135 ? 4.417    5.625   -45.741 1.00 99.19  ? 135  ASP A OD1   1 
ATOM   888   O OD2   . ASP A  1 135 ? 5.513    6.710   -47.329 1.00 106.14 ? 135  ASP A OD2   1 
ATOM   889   N N     . LYS A  1 136 ? 1.437    3.332   -46.728 1.00 84.66  ? 136  LYS A N     1 
ATOM   890   C CA    . LYS A  1 136 ? 0.740    2.050   -46.546 1.00 83.17  ? 136  LYS A CA    1 
ATOM   891   C C     . LYS A  1 136 ? -0.728   2.168   -46.995 1.00 85.61  ? 136  LYS A C     1 
ATOM   892   O O     . LYS A  1 136 ? -1.260   1.239   -47.608 1.00 85.32  ? 136  LYS A O     1 
ATOM   893   C CB    . LYS A  1 136 ? 0.828    1.575   -45.093 1.00 84.56  ? 136  LYS A CB    1 
ATOM   894   C CG    . LYS A  1 136 ? 1.932    0.555   -44.848 1.00 104.26 ? 136  LYS A CG    1 
ATOM   895   C CD    . LYS A  1 136 ? 1.775    -0.124  -43.481 1.00 113.00 ? 136  LYS A CD    1 
ATOM   896   C CE    . LYS A  1 136 ? 2.457    -1.473  -43.425 1.00 124.39 ? 136  LYS A CE    1 
ATOM   897   N NZ    . LYS A  1 136 ? 2.047    -2.255  -42.230 1.00 134.21 ? 136  LYS A NZ    1 
ATOM   898   N N     . LEU A  1 137 ? -1.359   3.331   -46.724 1.00 80.44  ? 137  LEU A N     1 
ATOM   899   C CA    . LEU A  1 137 ? -2.728   3.643   -47.125 1.00 79.51  ? 137  LEU A CA    1 
ATOM   900   C C     . LEU A  1 137 ? -2.802   3.880   -48.642 1.00 88.40  ? 137  LEU A C     1 
ATOM   901   O O     . LEU A  1 137 ? -3.740   3.405   -49.293 1.00 89.26  ? 137  LEU A O     1 
ATOM   902   C CB    . LEU A  1 137 ? -3.236   4.874   -46.363 1.00 78.53  ? 137  LEU A CB    1 
ATOM   903   C CG    . LEU A  1 137 ? -4.646   5.354   -46.692 1.00 81.57  ? 137  LEU A CG    1 
ATOM   904   C CD1   . LEU A  1 137 ? -5.702   4.335   -46.286 1.00 79.98  ? 137  LEU A CD1   1 
ATOM   905   C CD2   . LEU A  1 137 ? -4.916   6.664   -46.034 1.00 83.16  ? 137  LEU A CD2   1 
ATOM   906   N N     . LYS A  1 138 ? -1.814   4.624   -49.193 1.00 86.43  ? 138  LYS A N     1 
ATOM   907   C CA    . LYS A  1 138 ? -1.651   4.936   -50.613 1.00 87.17  ? 138  LYS A CA    1 
ATOM   908   C C     . LYS A  1 138 ? -1.586   3.604   -51.395 1.00 91.81  ? 138  LYS A C     1 
ATOM   909   O O     . LYS A  1 138 ? -2.272   3.455   -52.407 1.00 91.58  ? 138  LYS A O     1 
ATOM   910   C CB    . LYS A  1 138 ? -0.344   5.732   -50.787 1.00 90.61  ? 138  LYS A CB    1 
ATOM   911   C CG    . LYS A  1 138 ? -0.257   6.674   -51.984 1.00 92.00  ? 138  LYS A CG    1 
ATOM   912   C CD    . LYS A  1 138 ? 0.999    7.564   -51.864 1.00 90.37  ? 138  LYS A CD    1 
ATOM   913   C CE    . LYS A  1 138 ? 1.108    8.640   -52.914 1.00 89.98  ? 138  LYS A CE    1 
ATOM   914   N NZ    . LYS A  1 138 ? 2.226    9.572   -52.629 1.00 90.38  ? 138  LYS A NZ    1 
ATOM   915   N N     . ALA A  1 139 ? -0.815   2.621   -50.871 1.00 88.88  ? 139  ALA A N     1 
ATOM   916   C CA    . ALA A  1 139 ? -0.638   1.288   -51.448 1.00 89.44  ? 139  ALA A CA    1 
ATOM   917   C C     . ALA A  1 139 ? -1.921   0.439   -51.481 1.00 93.76  ? 139  ALA A C     1 
ATOM   918   O O     . ALA A  1 139 ? -2.117   -0.303  -52.440 1.00 92.84  ? 139  ALA A O     1 
ATOM   919   C CB    . ALA A  1 139 ? 0.466    0.549   -50.721 1.00 90.32  ? 139  ALA A CB    1 
ATOM   920   N N     . LYS A  1 140 ? -2.779   0.526   -50.434 1.00 91.36  ? 140  LYS A N     1 
ATOM   921   C CA    . LYS A  1 140 ? -4.066   -0.196  -50.373 1.00 90.79  ? 140  LYS A CA    1 
ATOM   922   C C     . LYS A  1 140 ? -5.034   0.420   -51.358 1.00 93.08  ? 140  LYS A C     1 
ATOM   923   O O     . LYS A  1 140 ? -5.847   -0.291  -51.948 1.00 93.00  ? 140  LYS A O     1 
ATOM   924   C CB    . LYS A  1 140 ? -4.712   -0.096  -48.993 1.00 92.81  ? 140  LYS A CB    1 
ATOM   925   C CG    . LYS A  1 140 ? -4.235   -1.094  -47.963 1.00 117.28 ? 140  LYS A CG    1 
ATOM   926   C CD    . LYS A  1 140 ? -5.025   -0.899  -46.664 1.00 137.13 ? 140  LYS A CD    1 
ATOM   927   C CE    . LYS A  1 140 ? -4.955   0.525   -46.138 1.00 157.26 ? 140  LYS A CE    1 
ATOM   928   N NZ    . LYS A  1 140 ? -6.043   0.831   -45.169 1.00 167.95 ? 140  LYS A NZ    1 
ATOM   929   N N     . LEU A  1 141 ? -4.984   1.758   -51.483 1.00 88.18  ? 141  LEU A N     1 
ATOM   930   C CA    . LEU A  1 141 ? -5.833   2.510   -52.396 1.00 87.83  ? 141  LEU A CA    1 
ATOM   931   C C     . LEU A  1 141 ? -5.489   2.169   -53.850 1.00 91.96  ? 141  LEU A C     1 
ATOM   932   O O     . LEU A  1 141 ? -6.406   1.888   -54.616 1.00 91.49  ? 141  LEU A O     1 
ATOM   933   C CB    . LEU A  1 141 ? -5.804   4.016   -52.088 1.00 87.51  ? 141  LEU A CB    1 
ATOM   934   C CG    . LEU A  1 141 ? -6.589   4.434   -50.828 1.00 89.89  ? 141  LEU A CG    1 
ATOM   935   C CD1   . LEU A  1 141 ? -6.081   5.735   -50.270 1.00 89.77  ? 141  LEU A CD1   1 
ATOM   936   C CD2   . LEU A  1 141 ? -8.078   4.506   -51.095 1.00 91.27  ? 141  LEU A CD2   1 
ATOM   937   N N     . ILE A  1 142 ? -4.180   2.071   -54.202 1.00 89.29  ? 142  ILE A N     1 
ATOM   938   C CA    . ILE A  1 142 ? -3.778   1.625   -55.544 1.00 90.36  ? 142  ILE A CA    1 
ATOM   939   C C     . ILE A  1 142 ? -4.170   0.132   -55.730 1.00 94.68  ? 142  ILE A C     1 
ATOM   940   O O     . ILE A  1 142 ? -4.583   -0.257  -56.824 1.00 95.53  ? 142  ILE A O     1 
ATOM   941   C CB    . ILE A  1 142 ? -2.316   1.993   -55.979 1.00 94.50  ? 142  ILE A CB    1 
ATOM   942   C CG1   . ILE A  1 142 ? -2.094   1.725   -57.508 1.00 96.69  ? 142  ILE A CG1   1 
ATOM   943   C CG2   . ILE A  1 142 ? -1.263   1.286   -55.143 1.00 95.48  ? 142  ILE A CG2   1 
ATOM   944   C CD1   . ILE A  1 142 ? -0.753   2.272   -58.238 1.00 103.04 ? 142  ILE A CD1   1 
ATOM   945   N N     . GLU A  1 143 ? -4.137   -0.661  -54.628 1.00 90.33  ? 143  GLU A N     1 
ATOM   946   C CA    . GLU A  1 143 ? -4.539   -2.073  -54.619 1.00 90.04  ? 143  GLU A CA    1 
ATOM   947   C C     . GLU A  1 143 ? -6.070   -2.211  -54.715 1.00 95.55  ? 143  GLU A C     1 
ATOM   948   O O     . GLU A  1 143 ? -6.569   -3.288  -55.059 1.00 95.79  ? 143  GLU A O     1 
ATOM   949   C CB    . GLU A  1 143 ? -4.021   -2.779  -53.359 1.00 90.00  ? 143  GLU A CB    1 
ATOM   950   C CG    . GLU A  1 143 ? -3.798   -4.270  -53.546 1.00 99.41  ? 143  GLU A CG    1 
ATOM   951   C CD    . GLU A  1 143 ? -4.260   -5.150  -52.399 1.00 110.10 ? 143  GLU A CD    1 
ATOM   952   O OE1   . GLU A  1 143 ? -5.150   -6.000  -52.624 1.00 98.54  ? 143  GLU A OE1   1 
ATOM   953   O OE2   . GLU A  1 143 ? -3.712   -5.016  -51.282 1.00 99.29  ? 143  GLU A OE2   1 
ATOM   954   N N     . ILE A  1 144 ? -6.810   -1.127  -54.399 1.00 92.23  ? 144  ILE A N     1 
ATOM   955   C CA    . ILE A  1 144 ? -8.270   -1.111  -54.437 1.00 91.71  ? 144  ILE A CA    1 
ATOM   956   C C     . ILE A  1 144 ? -8.831   -0.092  -55.459 1.00 95.90  ? 144  ILE A C     1 
ATOM   957   O O     . ILE A  1 144 ? -9.018   -0.457  -56.616 1.00 95.78  ? 144  ILE A O     1 
ATOM   958   C CB    . ILE A  1 144 ? -8.890   -1.019  -53.008 1.00 93.05  ? 144  ILE A CB    1 
ATOM   959   N N     . GLY A  1 145 ? -9.041   1.163   -55.033 1.00 92.21  ? 145  GLY A N     1 
ATOM   960   C CA    . GLY A  1 145 ? -9.632   2.238   -55.829 1.00 92.01  ? 145  GLY A CA    1 
ATOM   961   C C     . GLY A  1 145 ? -8.713   3.272   -56.450 1.00 95.03  ? 145  GLY A C     1 
ATOM   962   O O     . GLY A  1 145 ? -7.722   2.918   -57.087 1.00 94.30  ? 145  GLY A O     1 
ATOM   963   N N     . ALA A  1 146 ? -9.077   4.567   -56.305 1.00 92.50  ? 146  ALA A N     1 
ATOM   964   C CA    . ALA A  1 146 ? -8.391   5.728   -56.894 1.00 93.56  ? 146  ALA A CA    1 
ATOM   965   C C     . ALA A  1 146 ? -7.675   6.640   -55.894 1.00 97.62  ? 146  ALA A C     1 
ATOM   966   O O     . ALA A  1 146 ? -8.078   6.712   -54.736 1.00 95.74  ? 146  ALA A O     1 
ATOM   967   C CB    . ALA A  1 146 ? -9.377   6.544   -57.717 1.00 95.24  ? 146  ALA A CB    1 
ATOM   968   N N     . GLU A  1 147 ? -6.624   7.357   -56.361 1.00 96.25  ? 147  GLU A N     1 
ATOM   969   C CA    . GLU A  1 147 ? -5.805   8.278   -55.558 1.00 96.22  ? 147  GLU A CA    1 
ATOM   970   C C     . GLU A  1 147 ? -5.736   9.702   -56.140 1.00 103.47 ? 147  GLU A C     1 
ATOM   971   O O     . GLU A  1 147 ? -4.883   9.996   -56.980 1.00 104.87 ? 147  GLU A O     1 
ATOM   972   C CB    . GLU A  1 147 ? -4.400   7.698   -55.321 1.00 97.38  ? 147  GLU A CB    1 
ATOM   973   N N     . ILE A  1 148 ? -6.647   10.582  -55.677 1.00 100.57 ? 148  ILE A N     1 
ATOM   974   C CA    . ILE A  1 148 ? -6.763   11.995  -56.068 1.00 101.40 ? 148  ILE A CA    1 
ATOM   975   C C     . ILE A  1 148 ? -5.546   12.779  -55.556 1.00 108.15 ? 148  ILE A C     1 
ATOM   976   O O     . ILE A  1 148 ? -5.025   12.486  -54.475 1.00 107.69 ? 148  ILE A O     1 
ATOM   977   C CB    . ILE A  1 148 ? -8.119   12.595  -55.579 1.00 103.59 ? 148  ILE A CB    1 
ATOM   978   C CG1   . ILE A  1 148 ? -9.323   11.824  -56.170 1.00 103.14 ? 148  ILE A CG1   1 
ATOM   979   C CG2   . ILE A  1 148 ? -8.232   14.111  -55.856 1.00 105.81 ? 148  ILE A CG2   1 
ATOM   980   C CD1   . ILE A  1 148 ? -10.615  11.913  -55.371 1.00 103.26 ? 148  ILE A CD1   1 
ATOM   981   N N     . ILE A  1 149 ? -5.102   13.763  -56.348 1.00 107.08 ? 149  ILE A N     1 
ATOM   982   C CA    . ILE A  1 149 ? -3.948   14.618  -56.068 1.00 108.87 ? 149  ILE A CA    1 
ATOM   983   C C     . ILE A  1 149 ? -4.328   15.724  -55.050 1.00 116.45 ? 149  ILE A C     1 
ATOM   984   O O     . ILE A  1 149 ? -5.479   16.173  -55.076 1.00 115.53 ? 149  ILE A O     1 
ATOM   985   C CB    . ILE A  1 149 ? -3.364   15.163  -57.397 1.00 113.53 ? 149  ILE A CB    1 
ATOM   986   C CG1   . ILE A  1 149 ? -3.534   14.162  -58.590 1.00 114.57 ? 149  ILE A CG1   1 
ATOM   987   C CG2   . ILE A  1 149 ? -1.914   15.631  -57.239 1.00 115.19 ? 149  ILE A CG2   1 
ATOM   988   C CD1   . ILE A  1 149 ? -2.880   12.688  -58.476 1.00 121.33 ? 149  ILE A CD1   1 
ATOM   989   N N     . PRO A  1 150 ? -3.410   16.168  -54.138 1.00 116.31 ? 150  PRO A N     1 
ATOM   990   C CA    . PRO A  1 150 ? -3.814   17.144  -53.110 1.00 117.18 ? 150  PRO A CA    1 
ATOM   991   C C     . PRO A  1 150 ? -3.672   18.642  -53.420 1.00 125.38 ? 150  PRO A C     1 
ATOM   992   O O     . PRO A  1 150 ? -2.938   19.054  -54.324 1.00 125.85 ? 150  PRO A O     1 
ATOM   993   C CB    . PRO A  1 150 ? -2.910   16.767  -51.939 1.00 118.16 ? 150  PRO A CB    1 
ATOM   994   C CG    . PRO A  1 150 ? -1.629   16.406  -52.606 1.00 122.71 ? 150  PRO A CG    1 
ATOM   995   C CD    . PRO A  1 150 ? -2.020   15.713  -53.897 1.00 118.09 ? 150  PRO A CD    1 
ATOM   996   N N     . SER A  1 151 ? -4.349   19.452  -52.578 1.00 123.78 ? 151  SER A N     1 
ATOM   997   C CA    . SER A  1 151 ? -4.346   20.916  -52.530 1.00 125.08 ? 151  SER A CA    1 
ATOM   998   C C     . SER A  1 151 ? -4.376   21.326  -51.042 1.00 128.91 ? 151  SER A C     1 
ATOM   999   O O     . SER A  1 151 ? -5.037   20.659  -50.236 1.00 127.11 ? 151  SER A O     1 
ATOM   1000  C CB    . SER A  1 151 ? -5.553   21.486  -53.267 1.00 129.34 ? 151  SER A CB    1 
ATOM   1001  N N     . LYS A  1 152 ? -3.635   22.402  -50.686 1.00 126.67 ? 152  LYS A N     1 
ATOM   1002  C CA    . LYS A  1 152 ? -3.474   22.959  -49.328 1.00 153.58 ? 152  LYS A CA    1 
ATOM   1003  C C     . LYS A  1 152 ? -2.613   22.088  -48.404 1.00 168.53 ? 152  LYS A C     1 
ATOM   1004  O O     . LYS A  1 152 ? -2.894   20.910  -48.203 1.00 123.91 ? 152  LYS A O     1 
ATOM   1005  C CB    . LYS A  1 152 ? -4.813   23.353  -48.668 1.00 155.36 ? 152  LYS A CB    1 
ATOM   1006  N N     . LEU A  1 155 ? -2.698   20.979  -45.373 1.00 98.28  ? 155  LEU A N     1 
ATOM   1007  C CA    . LEU A  1 155 ? -2.051   19.829  -44.730 1.00 97.13  ? 155  LEU A CA    1 
ATOM   1008  C C     . LEU A  1 155 ? -2.267   18.506  -45.492 1.00 100.71 ? 155  LEU A C     1 
ATOM   1009  O O     . LEU A  1 155 ? -1.454   17.589  -45.342 1.00 100.30 ? 155  LEU A O     1 
ATOM   1010  C CB    . LEU A  1 155 ? -2.509   19.693  -43.272 1.00 96.03  ? 155  LEU A CB    1 
ATOM   1011  N N     . VAL A  1 156 ? -3.351   18.421  -46.311 1.00 96.67  ? 156  VAL A N     1 
ATOM   1012  C CA    . VAL A  1 156 ? -3.768   17.254  -47.109 1.00 95.53  ? 156  VAL A CA    1 
ATOM   1013  C C     . VAL A  1 156 ? -2.666   16.635  -47.977 1.00 101.18 ? 156  VAL A C     1 
ATOM   1014  O O     . VAL A  1 156 ? -2.095   17.319  -48.826 1.00 103.09 ? 156  VAL A O     1 
ATOM   1015  C CB    . VAL A  1 156 ? -5.042   17.548  -47.925 1.00 98.98  ? 156  VAL A CB    1 
ATOM   1016  N N     . GLU A  1 157 ? -2.364   15.343  -47.739 1.00 97.03  ? 157  GLU A N     1 
ATOM   1017  C CA    . GLU A  1 157 ? -1.330   14.560  -48.436 1.00 97.18  ? 157  GLU A CA    1 
ATOM   1018  C C     . GLU A  1 157 ? -1.811   14.070  -49.794 1.00 101.92 ? 157  GLU A C     1 
ATOM   1019  O O     . GLU A  1 157 ? -1.030   14.048  -50.751 1.00 103.39 ? 157  GLU A O     1 
ATOM   1020  C CB    . GLU A  1 157 ? -0.858   13.365  -47.580 1.00 97.53  ? 157  GLU A CB    1 
ATOM   1021  C CG    . GLU A  1 157 ? -0.049   13.738  -46.347 1.00 104.15 ? 157  GLU A CG    1 
ATOM   1022  C CD    . GLU A  1 157 ? 1.221    14.522  -46.604 1.00 117.46 ? 157  GLU A CD    1 
ATOM   1023  O OE1   . GLU A  1 157 ? 1.453    15.517  -45.882 1.00 117.03 ? 157  GLU A OE1   1 
ATOM   1024  O OE2   . GLU A  1 157 ? 1.971    14.160  -47.540 1.00 103.79 ? 157  GLU A OE2   1 
ATOM   1025  N N     . PHE A  1 158 ? -3.081   13.629  -49.852 1.00 96.75  ? 158  PHE A N     1 
ATOM   1026  C CA    . PHE A  1 158 ? -3.807   13.169  -51.041 1.00 96.17  ? 158  PHE A CA    1 
ATOM   1027  C C     . PHE A  1 158 ? -5.296   13.061  -50.725 1.00 98.20  ? 158  PHE A C     1 
ATOM   1028  O O     . PHE A  1 158 ? -5.728   13.463  -49.641 1.00 96.83  ? 158  PHE A O     1 
ATOM   1029  C CB    . PHE A  1 158 ? -3.230   11.867  -51.665 1.00 97.76  ? 158  PHE A CB    1 
ATOM   1030  C CG    . PHE A  1 158 ? -3.117   10.640  -50.788 1.00 98.27  ? 158  PHE A CG    1 
ATOM   1031  C CD1   . PHE A  1 158 ? -4.246   9.900   -50.445 1.00 100.26 ? 158  PHE A CD1   1 
ATOM   1032  C CD2   . PHE A  1 158 ? -1.874   10.159  -50.398 1.00 101.00 ? 158  PHE A CD2   1 
ATOM   1033  C CE1   . PHE A  1 158 ? -4.139   8.753   -49.651 1.00 100.20 ? 158  PHE A CE1   1 
ATOM   1034  C CE2   . PHE A  1 158 ? -1.765   9.000   -49.615 1.00 103.01 ? 158  PHE A CE2   1 
ATOM   1035  C CZ    . PHE A  1 158 ? -2.899   8.303   -49.251 1.00 99.85  ? 158  PHE A CZ    1 
ATOM   1036  N N     . SER A  1 159 ? -6.075   12.539  -51.673 1.00 94.34  ? 159  SER A N     1 
ATOM   1037  C CA    . SER A  1 159 ? -7.511   12.362  -51.524 1.00 93.23  ? 159  SER A CA    1 
ATOM   1038  C C     . SER A  1 159 ? -7.961   11.087  -52.253 1.00 95.30  ? 159  SER A C     1 
ATOM   1039  O O     . SER A  1 159 ? -7.186   10.521  -53.023 1.00 94.81  ? 159  SER A O     1 
ATOM   1040  C CB    . SER A  1 159 ? -8.237   13.592  -52.054 1.00 98.39  ? 159  SER A CB    1 
ATOM   1041  O OG    . SER A  1 159 ? -9.451   13.797  -51.356 1.00 107.64 ? 159  SER A OG    1 
ATOM   1042  N N     . THR A  1 160 ? -9.187   10.610  -51.971 1.00 90.93  ? 160  THR A N     1 
ATOM   1043  C CA    . THR A  1 160 ? -9.770   9.410   -52.590 1.00 90.78  ? 160  THR A CA    1 
ATOM   1044  C C     . THR A  1 160 ? -11.292  9.507   -52.704 1.00 95.71  ? 160  THR A C     1 
ATOM   1045  O O     . THR A  1 160 ? -11.877  10.488  -52.241 1.00 95.39  ? 160  THR A O     1 
ATOM   1046  C CB    . THR A  1 160 ? -9.252   8.103   -51.950 1.00 97.91  ? 160  THR A CB    1 
ATOM   1047  O OG1   . THR A  1 160 ? -9.700   6.992   -52.733 1.00 95.07  ? 160  THR A OG1   1 
ATOM   1048  C CG2   . THR A  1 160 ? -9.672   7.938   -50.479 1.00 96.48  ? 160  THR A CG2   1 
ATOM   1049  N N     . ARG A  1 161 ? -11.928  8.501   -53.338 1.00 93.17  ? 161  ARG A N     1 
ATOM   1050  C CA    . ARG A  1 161 ? -13.371  8.480   -53.532 1.00 93.51  ? 161  ARG A CA    1 
ATOM   1051  C C     . ARG A  1 161 ? -14.007  7.081   -53.590 1.00 97.91  ? 161  ARG A C     1 
ATOM   1052  O O     . ARG A  1 161 ? -13.340  6.060   -53.774 1.00 96.53  ? 161  ARG A O     1 
ATOM   1053  C CB    . ARG A  1 161 ? -13.756  9.297   -54.785 1.00 94.95  ? 161  ARG A CB    1 
ATOM   1054  N N     . ASP A  1 162 ? -15.332  7.088   -53.409 1.00 95.98  ? 162  ASP A N     1 
ATOM   1055  C CA    . ASP A  1 162 ? -16.349  6.040   -53.511 1.00 96.41  ? 162  ASP A CA    1 
ATOM   1056  C C     . ASP A  1 162 ? -17.617  6.901   -53.845 1.00 103.16 ? 162  ASP A C     1 
ATOM   1057  O O     . ASP A  1 162 ? -17.357  8.015   -54.329 1.00 104.75 ? 162  ASP A O     1 
ATOM   1058  C CB    . ASP A  1 162 ? -16.445  5.320   -52.173 1.00 96.79  ? 162  ASP A CB    1 
ATOM   1059  C CG    . ASP A  1 162 ? -16.875  3.870   -52.274 1.00 109.33 ? 162  ASP A CG    1 
ATOM   1060  O OD1   . ASP A  1 162 ? -17.042  3.239   -51.223 1.00 112.34 ? 162  ASP A OD1   1 
ATOM   1061  O OD2   . ASP A  1 162 ? -17.122  3.392   -53.412 1.00 109.23 ? 162  ASP A OD2   1 
ATOM   1062  N N     . PRO A  1 163 ? -18.941  6.604   -53.607 1.00 99.19  ? 163  PRO A N     1 
ATOM   1063  C CA    . PRO A  1 163 ? -19.945  7.660   -53.882 1.00 99.60  ? 163  PRO A CA    1 
ATOM   1064  C C     . PRO A  1 163 ? -19.601  8.943   -53.089 1.00 103.01 ? 163  PRO A C     1 
ATOM   1065  O O     . PRO A  1 163 ? -20.057  10.030  -53.431 1.00 101.99 ? 163  PRO A O     1 
ATOM   1066  C CB    . PRO A  1 163 ? -21.264  7.029   -53.419 1.00 101.12 ? 163  PRO A CB    1 
ATOM   1067  C CG    . PRO A  1 163 ? -20.869  5.944   -52.484 1.00 104.20 ? 163  PRO A CG    1 
ATOM   1068  C CD    . PRO A  1 163 ? -19.599  5.403   -53.054 1.00 99.75  ? 163  PRO A CD    1 
ATOM   1069  N N     . MET A  1 164 ? -18.700  8.790   -52.077 1.00 100.57 ? 164  MET A N     1 
ATOM   1070  C CA    . MET A  1 164 ? -18.152  9.785   -51.154 1.00 100.35 ? 164  MET A CA    1 
ATOM   1071  C C     . MET A  1 164 ? -16.653  10.086  -51.336 1.00 104.15 ? 164  MET A C     1 
ATOM   1072  O O     . MET A  1 164 ? -15.822  9.174   -51.253 1.00 103.22 ? 164  MET A O     1 
ATOM   1073  C CB    . MET A  1 164 ? -18.380  9.322   -49.710 1.00 101.60 ? 164  MET A CB    1 
ATOM   1074  C CG    . MET A  1 164 ? -19.652  9.851   -49.100 1.00 105.88 ? 164  MET A CG    1 
ATOM   1075  S SD    . MET A  1 164 ? -19.931  11.645  -49.235 1.00 111.74 ? 164  MET A SD    1 
ATOM   1076  C CE    . MET A  1 164 ? -18.358  12.329  -48.522 1.00 107.92 ? 164  MET A CE    1 
ATOM   1077  N N     . GLY A  1 165 ? -16.332  11.368  -51.520 1.00 101.25 ? 165  GLY A N     1 
ATOM   1078  C CA    . GLY A  1 165 ? -14.965  11.860  -51.668 1.00 101.34 ? 165  GLY A CA    1 
ATOM   1079  C C     . GLY A  1 165 ? -14.360  12.246  -50.332 1.00 105.41 ? 165  GLY A C     1 
ATOM   1080  O O     . GLY A  1 165 ? -14.972  13.001  -49.572 1.00 104.01 ? 165  GLY A O     1 
ATOM   1081  N N     . ASP A  1 166 ? -13.165  11.713  -50.019 1.00 103.86 ? 166  ASP A N     1 
ATOM   1082  C CA    . ASP A  1 166 ? -12.488  11.973  -48.740 1.00 104.41 ? 166  ASP A CA    1 
ATOM   1083  C C     . ASP A  1 166 ? -11.021  12.338  -48.853 1.00 107.82 ? 166  ASP A C     1 
ATOM   1084  O O     . ASP A  1 166 ? -10.330  11.847  -49.747 1.00 108.45 ? 166  ASP A O     1 
ATOM   1085  C CB    . ASP A  1 166 ? -12.650  10.791  -47.777 1.00 106.54 ? 166  ASP A CB    1 
ATOM   1086  C CG    . ASP A  1 166 ? -14.040  10.682  -47.189 1.00 132.00 ? 166  ASP A CG    1 
ATOM   1087  O OD1   . ASP A  1 166 ? -14.498  11.664  -46.556 1.00 135.60 ? 166  ASP A OD1   1 
ATOM   1088  O OD2   . ASP A  1 166 ? -14.669  9.608   -47.347 1.00 142.57 ? 166  ASP A OD2   1 
ATOM   1089  N N     . VAL A  1 167 ? -10.546  13.182  -47.917 1.00 102.28 ? 167  VAL A N     1 
ATOM   1090  C CA    . VAL A  1 167 ? -9.162   13.663  -47.853 1.00 101.70 ? 167  VAL A CA    1 
ATOM   1091  C C     . VAL A  1 167 ? -8.389   12.962  -46.722 1.00 102.25 ? 167  VAL A C     1 
ATOM   1092  O O     . VAL A  1 167 ? -9.014   12.369  -45.845 1.00 101.52 ? 167  VAL A O     1 
ATOM   1093  C CB    . VAL A  1 167 ? -9.035   15.214  -47.815 1.00 106.81 ? 167  VAL A CB    1 
ATOM   1094  C CG1   . VAL A  1 167 ? -8.073   15.704  -48.888 1.00 107.88 ? 167  VAL A CG1   1 
ATOM   1095  C CG2   . VAL A  1 167 ? -10.389  15.908  -47.963 1.00 106.74 ? 167  VAL A CG2   1 
ATOM   1096  N N     . ILE A  1 168 ? -7.038   12.985  -46.768 1.00 96.59  ? 168  ILE A N     1 
ATOM   1097  C CA    . ILE A  1 168 ? -6.143   12.308  -45.816 1.00 94.70  ? 168  ILE A CA    1 
ATOM   1098  C C     . ILE A  1 168 ? -4.885   13.178  -45.509 1.00 101.04 ? 168  ILE A C     1 
ATOM   1099  O O     . ILE A  1 168 ? -4.339   13.769  -46.443 1.00 102.57 ? 168  ILE A O     1 
ATOM   1100  C CB    . ILE A  1 168 ? -5.791   10.910  -46.439 1.00 96.12  ? 168  ILE A CB    1 
ATOM   1101  C CG1   . ILE A  1 168 ? -6.904   9.871   -46.210 1.00 94.36  ? 168  ILE A CG1   1 
ATOM   1102  C CG2   . ILE A  1 168 ? -4.435   10.368  -46.006 1.00 96.40  ? 168  ILE A CG2   1 
ATOM   1103  C CD1   . ILE A  1 168 ? -7.446   9.257   -47.460 1.00 95.33  ? 168  ILE A CD1   1 
ATOM   1104  N N     . SER A  1 169 ? -4.426   13.249  -44.217 1.00 97.54  ? 169  SER A N     1 
ATOM   1105  C CA    . SER A  1 169 ? -3.223   14.001  -43.779 1.00 98.89  ? 169  SER A CA    1 
ATOM   1106  C C     . SER A  1 169 ? -2.687   13.537  -42.408 1.00 104.50 ? 169  SER A C     1 
ATOM   1107  O O     . SER A  1 169 ? -2.755   12.348  -42.101 1.00 103.27 ? 169  SER A O     1 
ATOM   1108  C CB    . SER A  1 169 ? -3.493   15.505  -43.761 1.00 103.10 ? 169  SER A CB    1 
ATOM   1109  O OG    . SER A  1 169 ? -4.363   15.884  -42.708 1.00 110.58 ? 169  SER A OG    1 
ATOM   1110  N N     . PHE A  1 170 ? -2.133   14.476  -41.603 1.00 103.49 ? 170  PHE A N     1 
ATOM   1111  C CA    . PHE A  1 170 ? -1.640   14.265  -40.228 1.00 103.47 ? 170  PHE A CA    1 
ATOM   1112  C C     . PHE A  1 170 ? -2.517   15.120  -39.266 1.00 109.76 ? 170  PHE A C     1 
ATOM   1113  O O     . PHE A  1 170 ? -2.977   16.184  -39.683 1.00 111.71 ? 170  PHE A O     1 
ATOM   1114  C CB    . PHE A  1 170 ? -0.147   14.622  -40.111 1.00 106.01 ? 170  PHE A CB    1 
ATOM   1115  C CG    . PHE A  1 170 ? 0.184    16.089  -40.260 1.00 108.61 ? 170  PHE A CG    1 
ATOM   1116  C CD1   . PHE A  1 170 ? 0.465    16.870  -39.147 1.00 112.30 ? 170  PHE A CD1   1 
ATOM   1117  C CD2   . PHE A  1 170 ? 0.231    16.686  -41.516 1.00 111.04 ? 170  PHE A CD2   1 
ATOM   1118  C CE1   . PHE A  1 170 ? 0.788    18.224  -39.289 1.00 114.48 ? 170  PHE A CE1   1 
ATOM   1119  C CE2   . PHE A  1 170 ? 0.557    18.038  -41.656 1.00 114.96 ? 170  PHE A CE2   1 
ATOM   1120  C CZ    . PHE A  1 170 ? 0.837    18.796  -40.542 1.00 113.76 ? 170  PHE A CZ    1 
ATOM   1121  N N     . SER A  1 171 ? -2.755   14.664  -38.011 1.00 105.01 ? 171  SER A N     1 
ATOM   1122  C CA    . SER A  1 171 ? -3.602   15.318  -36.986 1.00 104.62 ? 171  SER A CA    1 
ATOM   1123  C C     . SER A  1 171 ? -3.126   16.720  -36.533 1.00 113.28 ? 171  SER A C     1 
ATOM   1124  O O     . SER A  1 171 ? -2.217   17.276  -37.152 1.00 115.05 ? 171  SER A O     1 
ATOM   1125  C CB    . SER A  1 171 ? -3.776   14.398  -35.783 1.00 104.09 ? 171  SER A CB    1 
ATOM   1126  O OG    . SER A  1 171 ? -2.507   14.088  -35.233 1.00 106.93 ? 171  SER A OG    1 
ATOM   1127  N N     . SER A  1 172 ? -3.737   17.297  -35.458 1.00 111.01 ? 172  SER A N     1 
ATOM   1128  C CA    . SER A  1 172 ? -3.368   18.630  -34.931 1.00 113.10 ? 172  SER A CA    1 
ATOM   1129  C C     . SER A  1 172 ? -1.934   18.718  -34.333 1.00 118.43 ? 172  SER A C     1 
ATOM   1130  O O     . SER A  1 172 ? -1.407   19.823  -34.133 1.00 119.36 ? 172  SER A O     1 
ATOM   1131  C CB    . SER A  1 172 ? -4.393   19.120  -33.918 1.00 117.14 ? 172  SER A CB    1 
ATOM   1132  O OG    . SER A  1 172 ? -4.178   20.490  -33.615 1.00 129.74 ? 172  SER A OG    1 
ATOM   1133  N N     . TYR A  1 173 ? -1.321   17.546  -34.060 1.00 114.20 ? 173  TYR A N     1 
ATOM   1134  C CA    . TYR A  1 173 ? 0.040    17.372  -33.548 1.00 115.04 ? 173  TYR A CA    1 
ATOM   1135  C C     . TYR A  1 173 ? 1.086    17.640  -34.677 1.00 118.40 ? 173  TYR A C     1 
ATOM   1136  O O     . TYR A  1 173 ? 0.675    17.800  -35.827 1.00 116.78 ? 173  TYR A O     1 
ATOM   1137  C CB    . TYR A  1 173 ? 0.188    15.947  -32.973 1.00 115.36 ? 173  TYR A CB    1 
ATOM   1138  C CG    . TYR A  1 173 ? -0.233   15.804  -31.523 1.00 117.13 ? 173  TYR A CG    1 
ATOM   1139  C CD1   . TYR A  1 173 ? -1.521   15.391  -31.187 1.00 117.70 ? 173  TYR A CD1   1 
ATOM   1140  C CD2   . TYR A  1 173 ? 0.673    16.025  -30.486 1.00 119.18 ? 173  TYR A CD2   1 
ATOM   1141  C CE1   . TYR A  1 173 ? -1.902   15.215  -29.855 1.00 118.51 ? 173  TYR A CE1   1 
ATOM   1142  C CE2   . TYR A  1 173 ? 0.303    15.853  -29.150 1.00 119.78 ? 173  TYR A CE2   1 
ATOM   1143  C CZ    . TYR A  1 173 ? -0.985   15.446  -28.839 1.00 124.86 ? 173  TYR A CZ    1 
ATOM   1144  O OH    . TYR A  1 173 ? -1.362   15.285  -27.527 1.00 123.06 ? 173  TYR A OH    1 
ATOM   1145  N N     . PRO A  1 174 ? 2.421    17.693  -34.418 1.00 116.33 ? 174  PRO A N     1 
ATOM   1146  C CA    . PRO A  1 174 ? 3.351    17.994  -35.519 1.00 117.07 ? 174  PRO A CA    1 
ATOM   1147  C C     . PRO A  1 174 ? 3.547    16.941  -36.621 1.00 119.05 ? 174  PRO A C     1 
ATOM   1148  O O     . PRO A  1 174 ? 3.606    17.326  -37.792 1.00 118.83 ? 174  PRO A O     1 
ATOM   1149  C CB    . PRO A  1 174 ? 4.668    18.343  -34.802 1.00 120.92 ? 174  PRO A CB    1 
ATOM   1150  C CG    . PRO A  1 174 ? 4.350    18.410  -33.337 1.00 125.42 ? 174  PRO A CG    1 
ATOM   1151  C CD    . PRO A  1 174 ? 3.148    17.560  -33.135 1.00 118.83 ? 174  PRO A CD    1 
ATOM   1152  N N     . SER A  1 175 ? 3.679    15.638  -36.272 1.00 113.89 ? 175  SER A N     1 
ATOM   1153  C CA    . SER A  1 175 ? 3.983    14.593  -37.263 1.00 112.67 ? 175  SER A CA    1 
ATOM   1154  C C     . SER A  1 175 ? 3.228    13.257  -37.157 1.00 113.20 ? 175  SER A C     1 
ATOM   1155  O O     . SER A  1 175 ? 2.597    12.962  -36.137 1.00 111.77 ? 175  SER A O     1 
ATOM   1156  C CB    . SER A  1 175 ? 5.490    14.335  -37.296 1.00 117.62 ? 175  SER A CB    1 
ATOM   1157  O OG    . SER A  1 175 ? 5.981    13.883  -36.042 1.00 125.15 ? 175  SER A OG    1 
ATOM   1158  N N     . LEU A  1 176 ? 3.346    12.438  -38.223 1.00 108.46 ? 176  LEU A N     1 
ATOM   1159  C CA    . LEU A  1 176 ? 2.730    11.121  -38.358 1.00 133.23 ? 176  LEU A CA    1 
ATOM   1160  C C     . LEU A  1 176 ? 3.794    10.016  -38.417 1.00 127.02 ? 176  LEU A C     1 
ATOM   1161  O O     . LEU A  1 176 ? 4.655    9.998   -39.300 1.00 71.35  ? 176  LEU A O     1 
ATOM   1162  C CB    . LEU A  1 176 ? 1.843    11.086  -39.614 1.00 132.70 ? 176  LEU A CB    1 
ATOM   1163  N N     . SER A  1 178 ? 5.034    5.827   -36.949 1.00 76.22  ? 178  SER A N     1 
ATOM   1164  C CA    . SER A  1 178 ? 3.779    5.320   -36.379 1.00 74.36  ? 178  SER A CA    1 
ATOM   1165  C C     . SER A  1 178 ? 3.926    4.750   -34.923 1.00 80.66  ? 178  SER A C     1 
ATOM   1166  O O     . SER A  1 178 ? 3.287    3.749   -34.586 1.00 77.05  ? 178  SER A O     1 
ATOM   1167  C CB    . SER A  1 178 ? 3.139    4.312   -37.338 1.00 74.25  ? 178  SER A CB    1 
ATOM   1168  O OG    . SER A  1 178 ? 1.917    3.810   -36.828 1.00 75.55  ? 178  SER A OG    1 
ATOM   1169  N N     . LYS A  1 179 ? 4.750    5.423   -34.070 1.00 82.51  ? 179  LYS A N     1 
ATOM   1170  C CA    . LYS A  1 179 ? 5.048    5.055   -32.679 1.00 83.80  ? 179  LYS A CA    1 
ATOM   1171  C C     . LYS A  1 179 ? 3.809    4.938   -31.791 1.00 91.18  ? 179  LYS A C     1 
ATOM   1172  O O     . LYS A  1 179 ? 3.397    5.902   -31.123 1.00 90.63  ? 179  LYS A O     1 
ATOM   1173  C CB    . LYS A  1 179 ? 6.085    5.995   -32.056 1.00 87.82  ? 179  LYS A CB    1 
ATOM   1174  N N     . LYS A  1 180 ? 3.219    3.718   -31.822 1.00 89.36  ? 180  LYS A N     1 
ATOM   1175  C CA    . LYS A  1 180 ? 2.062    3.237   -31.063 1.00 87.87  ? 180  LYS A CA    1 
ATOM   1176  C C     . LYS A  1 180 ? 2.531    2.971   -29.650 1.00 92.25  ? 180  LYS A C     1 
ATOM   1177  O O     . LYS A  1 180 ? 1.838    3.363   -28.715 1.00 90.68  ? 180  LYS A O     1 
ATOM   1178  C CB    . LYS A  1 180 ? 1.516    1.930   -31.679 1.00 89.16  ? 180  LYS A CB    1 
ATOM   1179  N N     . ILE A  1 181 ? 3.728    2.326   -29.513 1.00 91.44  ? 181  ILE A N     1 
ATOM   1180  C CA    . ILE A  1 181 ? 4.444    2.010   -28.267 1.00 92.94  ? 181  ILE A CA    1 
ATOM   1181  C C     . ILE A  1 181 ? 5.248    3.262   -27.828 1.00 99.55  ? 181  ILE A C     1 
ATOM   1182  O O     . ILE A  1 181 ? 6.248    3.608   -28.474 1.00 100.61 ? 181  ILE A O     1 
ATOM   1183  C CB    . ILE A  1 181 ? 5.360    0.774   -28.482 1.00 96.31  ? 181  ILE A CB    1 
ATOM   1184  N N     . THR A  1 182 ? 4.783    3.957   -26.758 1.00 95.99  ? 182  THR A N     1 
ATOM   1185  C CA    . THR A  1 182 ? 5.399    5.203   -26.299 1.00 98.42  ? 182  THR A CA    1 
ATOM   1186  C C     . THR A  1 182 ? 6.516    5.077   -25.279 1.00 107.87 ? 182  THR A C     1 
ATOM   1187  O O     . THR A  1 182 ? 6.592    4.081   -24.567 1.00 106.94 ? 182  THR A O     1 
ATOM   1188  C CB    . THR A  1 182 ? 4.347    6.224   -25.894 1.00 103.29 ? 182  THR A CB    1 
ATOM   1189  N N     . SER A  1 183 ? 7.384    6.111   -25.209 1.00 109.44 ? 183  SER A N     1 
ATOM   1190  C CA    . SER A  1 183 ? 8.536    6.190   -24.302 1.00 112.22 ? 183  SER A CA    1 
ATOM   1191  C C     . SER A  1 183 ? 8.109    6.561   -22.862 1.00 117.57 ? 183  SER A C     1 
ATOM   1192  O O     . SER A  1 183 ? 7.624    7.677   -22.652 1.00 118.11 ? 183  SER A O     1 
ATOM   1193  C CB    . SER A  1 183 ? 9.566    7.186   -24.838 1.00 118.48 ? 183  SER A CB    1 
ATOM   1194  N N     . PRO A  1 184 ? 8.275    5.652   -21.862 1.00 114.53 ? 184  PRO A N     1 
ATOM   1195  C CA    . PRO A  1 184 ? 7.852    5.975   -20.478 1.00 114.46 ? 184  PRO A CA    1 
ATOM   1196  C C     . PRO A  1 184 ? 8.672    7.072   -19.813 1.00 119.72 ? 184  PRO A C     1 
ATOM   1197  O O     . PRO A  1 184 ? 9.898    7.077   -19.907 1.00 120.99 ? 184  PRO A O     1 
ATOM   1198  C CB    . PRO A  1 184 ? 7.958    4.637   -19.729 1.00 115.47 ? 184  PRO A CB    1 
ATOM   1199  C CG    . PRO A  1 184 ? 8.116    3.593   -20.797 1.00 119.29 ? 184  PRO A CG    1 
ATOM   1200  C CD    . PRO A  1 184 ? 8.812    4.281   -21.938 1.00 116.17 ? 184  PRO A CD    1 
ATOM   1201  N N     . ASP A  1 185 ? 7.969    8.001   -19.148 1.00 115.80 ? 185  ASP A N     1 
ATOM   1202  C CA    . ASP A  1 185 ? 8.513    9.194   -18.501 1.00 117.75 ? 185  ASP A CA    1 
ATOM   1203  C C     . ASP A  1 185 ? 9.521    8.966   -17.380 1.00 122.70 ? 185  ASP A C     1 
ATOM   1204  O O     . ASP A  1 185 ? 9.589    7.870   -16.821 1.00 121.45 ? 185  ASP A O     1 
ATOM   1205  C CB    . ASP A  1 185 ? 7.380    10.143  -18.074 1.00 118.93 ? 185  ASP A CB    1 
ATOM   1206  C CG    . ASP A  1 185 ? 7.163    11.311  -19.019 1.00 124.09 ? 185  ASP A CG    1 
ATOM   1207  O OD1   . ASP A  1 185 ? 6.948    11.068  -20.228 1.00 122.14 ? 185  ASP A OD1   1 
ATOM   1208  O OD2   . ASP A  1 185 ? 7.176    12.464  -18.546 1.00 129.18 ? 185  ASP A OD2   1 
ATOM   1209  N N     . PHE A  1 186 ? 10.320   10.021  -17.078 1.00 121.34 ? 186  PHE A N     1 
ATOM   1210  C CA    . PHE A  1 186 ? 11.359   10.047  -16.051 1.00 143.85 ? 186  PHE A CA    1 
ATOM   1211  C C     . PHE A  1 186 ? 10.895   10.854  -14.843 1.00 170.89 ? 186  PHE A C     1 
ATOM   1212  O O     . PHE A  1 186 ? 11.423   10.685  -13.747 1.00 134.64 ? 186  PHE A O     1 
ATOM   1213  C CB    . PHE A  1 186 ? 12.653   10.641  -16.625 1.00 148.22 ? 186  PHE A CB    1 
ATOM   1214  N N     . GLU A  1 208 ? 14.489   19.337  5.743   1.00 95.45  ? 208  GLU A N     1 
ATOM   1215  C CA    . GLU A  1 208 ? 13.320   18.544  6.138   1.00 93.08  ? 208  GLU A CA    1 
ATOM   1216  C C     . GLU A  1 208 ? 12.764   19.075  7.469   1.00 93.43  ? 208  GLU A C     1 
ATOM   1217  O O     . GLU A  1 208 ? 13.473   19.062  8.477   1.00 93.68  ? 208  GLU A O     1 
ATOM   1218  C CB    . GLU A  1 208 ? 13.649   17.026  6.214   1.00 93.61  ? 208  GLU A CB    1 
ATOM   1219  C CG    . GLU A  1 208 ? 14.094   16.401  4.894   1.00 104.24 ? 208  GLU A CG    1 
ATOM   1220  C CD    . GLU A  1 208 ? 15.563   16.579  4.548   1.00 120.55 ? 208  GLU A CD    1 
ATOM   1221  O OE1   . GLU A  1 208 ? 15.860   17.256  3.538   1.00 98.27  ? 208  GLU A OE1   1 
ATOM   1222  O OE2   . GLU A  1 208 ? 16.420   16.058  5.296   1.00 118.94 ? 208  GLU A OE2   1 
ATOM   1223  N N     . GLY A  1 209 ? 11.526   19.568  7.442   1.00 86.03  ? 209  GLY A N     1 
ATOM   1224  C CA    . GLY A  1 209 ? 10.864   20.155  8.605   1.00 83.75  ? 209  GLY A CA    1 
ATOM   1225  C C     . GLY A  1 209 ? 10.524   19.208  9.749   1.00 82.34  ? 209  GLY A C     1 
ATOM   1226  O O     . GLY A  1 209 ? 10.816   19.512  10.914  1.00 83.10  ? 209  GLY A O     1 
ATOM   1227  N N     . LYS A  1 210 ? 9.893    18.061  9.432   1.00 71.78  ? 210  LYS A N     1 
ATOM   1228  C CA    . LYS A  1 210 ? 9.428    17.076  10.414  1.00 67.03  ? 210  LYS A CA    1 
ATOM   1229  C C     . LYS A  1 210 ? 10.504   16.089  10.944  1.00 66.18  ? 210  LYS A C     1 
ATOM   1230  O O     . LYS A  1 210 ? 11.683   16.173  10.572  1.00 66.25  ? 210  LYS A O     1 
ATOM   1231  C CB    . LYS A  1 210 ? 8.168    16.349  9.882   1.00 66.92  ? 210  LYS A CB    1 
ATOM   1232  C CG    . LYS A  1 210 ? 6.946    17.254  9.795   1.00 64.10  ? 210  LYS A CG    1 
ATOM   1233  C CD    . LYS A  1 210 ? 5.864    16.680  8.921   1.00 64.21  ? 210  LYS A CD    1 
ATOM   1234  C CE    . LYS A  1 210 ? 4.659    17.592  8.900   1.00 68.60  ? 210  LYS A CE    1 
ATOM   1235  N NZ    . LYS A  1 210 ? 3.550    17.063  8.066   1.00 70.82  ? 210  LYS A NZ    1 
ATOM   1236  N N     . LYS A  1 211 ? 10.082   15.195  11.865  1.00 58.52  ? 211  LYS A N     1 
ATOM   1237  C CA    . LYS A  1 211 ? 10.891   14.149  12.484  1.00 56.94  ? 211  LYS A CA    1 
ATOM   1238  C C     . LYS A  1 211 ? 10.676   12.837  11.695  1.00 60.80  ? 211  LYS A C     1 
ATOM   1239  O O     . LYS A  1 211 ? 9.532    12.431  11.452  1.00 59.88  ? 211  LYS A O     1 
ATOM   1240  C CB    . LYS A  1 211 ? 10.466   13.974  13.956  1.00 57.22  ? 211  LYS A CB    1 
ATOM   1241  C CG    . LYS A  1 211 ? 11.617   13.705  14.923  1.00 62.48  ? 211  LYS A CG    1 
ATOM   1242  C CD    . LYS A  1 211 ? 11.192   13.883  16.376  1.00 66.98  ? 211  LYS A CD    1 
ATOM   1243  C CE    . LYS A  1 211 ? 12.215   14.609  17.238  1.00 79.96  ? 211  LYS A CE    1 
ATOM   1244  N NZ    . LYS A  1 211 ? 13.371   13.746  17.631  1.00 82.96  ? 211  LYS A NZ    1 
ATOM   1245  N N     . LYS A  1 212 ? 11.768   12.187  11.280  1.00 57.46  ? 212  LYS A N     1 
ATOM   1246  C CA    . LYS A  1 212 ? 11.685   10.941  10.518  1.00 56.08  ? 212  LYS A CA    1 
ATOM   1247  C C     . LYS A  1 212 ? 11.873   9.705   11.415  1.00 56.48  ? 212  LYS A C     1 
ATOM   1248  O O     . LYS A  1 212 ? 12.996   9.382   11.804  1.00 57.31  ? 212  LYS A O     1 
ATOM   1249  C CB    . LYS A  1 212 ? 12.659   10.949  9.317   1.00 59.82  ? 212  LYS A CB    1 
ATOM   1250  C CG    . LYS A  1 212 ? 12.367   12.019  8.270   1.00 65.19  ? 212  LYS A CG    1 
ATOM   1251  C CD    . LYS A  1 212 ? 13.355   11.925  7.108   1.00 71.59  ? 212  LYS A CD    1 
ATOM   1252  C CE    . LYS A  1 212 ? 13.035   12.886  5.985   1.00 76.60  ? 212  LYS A CE    1 
ATOM   1253  N NZ    . LYS A  1 212 ? 13.821   12.602  4.754   1.00 76.75  ? 212  LYS A NZ    1 
ATOM   1254  N N     . ILE A  1 213 ? 10.775   9.027   11.748  1.00 50.00  ? 213  ILE A N     1 
ATOM   1255  C CA    . ILE A  1 213 ? 10.836   7.826   12.578  1.00 49.19  ? 213  ILE A CA    1 
ATOM   1256  C C     . ILE A  1 213 ? 10.843   6.570   11.685  1.00 50.84  ? 213  ILE A C     1 
ATOM   1257  O O     . ILE A  1 213 ? 9.947    6.423   10.849  1.00 51.29  ? 213  ILE A O     1 
ATOM   1258  C CB    . ILE A  1 213 ? 9.706    7.802   13.661  1.00 51.44  ? 213  ILE A CB    1 
ATOM   1259  C CG1   . ILE A  1 213 ? 9.761    9.062   14.538  1.00 52.33  ? 213  ILE A CG1   1 
ATOM   1260  C CG2   . ILE A  1 213 ? 9.788    6.536   14.543  1.00 51.82  ? 213  ILE A CG2   1 
ATOM   1261  C CD1   . ILE A  1 213 ? 8.521    9.269   15.406  1.00 55.65  ? 213  ILE A CD1   1 
ATOM   1262  N N     . ALA A  1 214 ? 11.845   5.677   11.860  1.00 44.39  ? 214  ALA A N     1 
ATOM   1263  C CA    . ALA A  1 214 ? 11.922   4.431   11.101  1.00 43.66  ? 214  ALA A CA    1 
ATOM   1264  C C     . ALA A  1 214 ? 11.388   3.248   11.900  1.00 49.56  ? 214  ALA A C     1 
ATOM   1265  O O     . ALA A  1 214 ? 11.697   3.102   13.081  1.00 50.83  ? 214  ALA A O     1 
ATOM   1266  C CB    . ALA A  1 214 ? 13.334   4.151   10.645  1.00 45.24  ? 214  ALA A CB    1 
ATOM   1267  N N     . ILE A  1 215 ? 10.573   2.410   11.257  1.00 45.35  ? 215  ILE A N     1 
ATOM   1268  C CA    . ILE A  1 215 ? 9.978    1.236   11.884  1.00 43.48  ? 215  ILE A CA    1 
ATOM   1269  C C     . ILE A  1 215 ? 10.499   -0.019  11.198  1.00 46.92  ? 215  ILE A C     1 
ATOM   1270  O O     . ILE A  1 215 ? 10.467   -0.107  9.969   1.00 47.07  ? 215  ILE A O     1 
ATOM   1271  C CB    . ILE A  1 215 ? 8.409    1.331   11.963  1.00 45.37  ? 215  ILE A CB    1 
ATOM   1272  C CG1   . ILE A  1 215 ? 7.733    0.027   12.475  1.00 44.78  ? 215  ILE A CG1   1 
ATOM   1273  C CG2   . ILE A  1 215 ? 7.764    1.811   10.659  1.00 46.23  ? 215  ILE A CG2   1 
ATOM   1274  C CD1   . ILE A  1 215 ? 7.663    -0.134  13.974  1.00 48.85  ? 215  ILE A CD1   1 
ATOM   1275  N N     . ILE A  1 216 ? 11.033   -0.959  11.991  1.00 43.08  ? 216  ILE A N     1 
ATOM   1276  C CA    . ILE A  1 216 ? 11.531   -2.230  11.475  1.00 44.01  ? 216  ILE A CA    1 
ATOM   1277  C C     . ILE A  1 216 ? 10.874   -3.428  12.189  1.00 47.61  ? 216  ILE A C     1 
ATOM   1278  O O     . ILE A  1 216 ? 10.736   -3.415  13.415  1.00 47.39  ? 216  ILE A O     1 
ATOM   1279  C CB    . ILE A  1 216 ? 13.103   -2.349  11.422  1.00 48.79  ? 216  ILE A CB    1 
ATOM   1280  C CG1   . ILE A  1 216 ? 13.744   -2.704  12.768  1.00 49.17  ? 216  ILE A CG1   1 
ATOM   1281  C CG2   . ILE A  1 216 ? 13.792   -1.147  10.798  1.00 50.46  ? 216  ILE A CG2   1 
ATOM   1282  C CD1   . ILE A  1 216 ? 14.637   -3.835  12.691  1.00 57.70  ? 216  ILE A CD1   1 
ATOM   1283  N N     . THR A  1 217 ? 10.450   -4.440  11.418  1.00 43.61  ? 217  THR A N     1 
ATOM   1284  C CA    . THR A  1 217 ? 9.955    -5.712  11.969  1.00 42.71  ? 217  THR A CA    1 
ATOM   1285  C C     . THR A  1 217 ? 11.021   -6.754  11.607  1.00 46.29  ? 217  THR A C     1 
ATOM   1286  O O     . THR A  1 217 ? 11.238   -7.032  10.421  1.00 48.33  ? 217  THR A O     1 
ATOM   1287  C CB    . THR A  1 217 ? 8.520    -6.105  11.540  1.00 50.30  ? 217  THR A CB    1 
ATOM   1288  O OG1   . THR A  1 217 ? 8.388    -6.009  10.127  1.00 55.56  ? 217  THR A OG1   1 
ATOM   1289  C CG2   . THR A  1 217 ? 7.443    -5.305  12.248  1.00 44.24  ? 217  THR A CG2   1 
ATOM   1290  N N     . SER A  1 218 ? 11.759   -7.224  12.629  1.00 38.73  ? 218  SER A N     1 
ATOM   1291  C CA    . SER A  1 218 ? 12.860   -8.166  12.496  1.00 38.21  ? 218  SER A CA    1 
ATOM   1292  C C     . SER A  1 218 ? 12.546   -9.415  13.292  1.00 41.56  ? 218  SER A C     1 
ATOM   1293  O O     . SER A  1 218 ? 11.713   -9.382  14.197  1.00 39.88  ? 218  SER A O     1 
ATOM   1294  C CB    . SER A  1 218 ? 14.163   -7.527  12.985  1.00 42.07  ? 218  SER A CB    1 
ATOM   1295  O OG    . SER A  1 218 ? 15.287   -8.397  12.957  1.00 50.32  ? 218  SER A OG    1 
ATOM   1296  N N     . GLY A  1 219 ? 13.209   -10.506 12.947  1.00 39.94  ? 219  GLY A N     1 
ATOM   1297  C CA    . GLY A  1 219 ? 13.027   -11.767 13.637  1.00 40.44  ? 219  GLY A CA    1 
ATOM   1298  C C     . GLY A  1 219 ? 11.878   -12.576 13.095  1.00 46.33  ? 219  GLY A C     1 
ATOM   1299  O O     . GLY A  1 219 ? 11.347   -12.265 12.026  1.00 45.76  ? 219  GLY A O     1 
ATOM   1300  N N     . GLY A  1 220 ? 11.518   -13.633 13.823  1.00 44.45  ? 220  GLY A N     1 
ATOM   1301  C CA    . GLY A  1 220 ? 10.442   -14.535 13.426  1.00 43.86  ? 220  GLY A CA    1 
ATOM   1302  C C     . GLY A  1 220 ? 9.113    -13.837 13.473  1.00 46.97  ? 220  GLY A C     1 
ATOM   1303  O O     . GLY A  1 220 ? 8.959    -12.901 14.254  1.00 46.19  ? 220  GLY A O     1 
ATOM   1304  N N     . ASP A  1 221 ? 8.163    -14.261 12.618  1.00 45.56  ? 221  ASP A N     1 
ATOM   1305  C CA    . ASP A  1 221 ? 6.800    -13.689 12.561  1.00 45.02  ? 221  ASP A CA    1 
ATOM   1306  C C     . ASP A  1 221 ? 6.096    -13.837 13.910  1.00 48.36  ? 221  ASP A C     1 
ATOM   1307  O O     . ASP A  1 221 ? 6.349    -14.789 14.653  1.00 50.20  ? 221  ASP A O     1 
ATOM   1308  C CB    . ASP A  1 221 ? 5.933    -14.368 11.478  1.00 46.14  ? 221  ASP A CB    1 
ATOM   1309  C CG    . ASP A  1 221 ? 6.207    -13.943 10.051  1.00 55.16  ? 221  ASP A CG    1 
ATOM   1310  O OD1   . ASP A  1 221 ? 5.331    -13.287 9.455   1.00 54.19  ? 221  ASP A OD1   1 
ATOM   1311  O OD2   . ASP A  1 221 ? 7.259    -14.347 9.499   1.00 63.69  ? 221  ASP A OD2   1 
ATOM   1312  N N     . ALA A  1 222 ? 5.235    -12.880 14.224  1.00 41.51  ? 222  ALA A N     1 
ATOM   1313  C CA    . ALA A  1 222 ? 4.448    -12.845 15.450  1.00 39.13  ? 222  ALA A CA    1 
ATOM   1314  C C     . ALA A  1 222 ? 3.176    -12.072 15.106  1.00 38.65  ? 222  ALA A C     1 
ATOM   1315  O O     . ALA A  1 222 ? 3.277    -10.925 14.644  1.00 35.94  ? 222  ALA A O     1 
ATOM   1316  C CB    . ALA A  1 222 ? 5.226    -12.151 16.569  1.00 39.93  ? 222  ALA A CB    1 
ATOM   1317  N N     . PRO A  1 223 ? 1.982    -12.712 15.234  1.00 34.50  ? 223  PRO A N     1 
ATOM   1318  C CA    . PRO A  1 223 ? 0.733    -12.017 14.883  1.00 33.63  ? 223  PRO A CA    1 
ATOM   1319  C C     . PRO A  1 223 ? 0.476    -10.819 15.818  1.00 37.81  ? 223  PRO A C     1 
ATOM   1320  O O     . PRO A  1 223 ? 0.378    -10.969 17.043  1.00 37.56  ? 223  PRO A O     1 
ATOM   1321  C CB    . PRO A  1 223 ? -0.330   -13.130 14.981  1.00 34.36  ? 223  PRO A CB    1 
ATOM   1322  C CG    . PRO A  1 223 ? 0.427    -14.422 15.002  1.00 38.38  ? 223  PRO A CG    1 
ATOM   1323  C CD    . PRO A  1 223 ? 1.696    -14.075 15.728  1.00 35.03  ? 223  PRO A CD    1 
ATOM   1324  N N     . GLY A  1 224 ? 0.441    -9.633  15.220  1.00 33.39  ? 224  GLY A N     1 
ATOM   1325  C CA    . GLY A  1 224 ? 0.309    -8.369  15.928  1.00 31.91  ? 224  GLY A CA    1 
ATOM   1326  C C     . GLY A  1 224 ? 1.349    -7.373  15.444  1.00 36.57  ? 224  GLY A C     1 
ATOM   1327  O O     . GLY A  1 224 ? 1.227    -6.167  15.675  1.00 35.26  ? 224  GLY A O     1 
ATOM   1328  N N     . MET A  1 225 ? 2.378    -7.863  14.716  1.00 34.76  ? 225  MET A N     1 
ATOM   1329  C CA    . MET A  1 225 ? 3.408    -7.008  14.134  1.00 34.62  ? 225  MET A CA    1 
ATOM   1330  C C     . MET A  1 225 ? 2.773    -5.958  13.231  1.00 36.76  ? 225  MET A C     1 
ATOM   1331  O O     . MET A  1 225 ? 3.129    -4.799  13.343  1.00 37.05  ? 225  MET A O     1 
ATOM   1332  C CB    . MET A  1 225 ? 4.473    -7.831  13.411  1.00 37.71  ? 225  MET A CB    1 
ATOM   1333  C CG    . MET A  1 225 ? 5.504    -8.406  14.344  1.00 42.27  ? 225  MET A CG    1 
ATOM   1334  S SD    . MET A  1 225 ? 6.804    -9.297  13.451  1.00 48.67  ? 225  MET A SD    1 
ATOM   1335  C CE    . MET A  1 225 ? 8.093    -9.336  14.677  1.00 45.38  ? 225  MET A CE    1 
ATOM   1336  N N     . ASN A  1 226 ? 1.770    -6.337  12.416  1.00 33.29  ? 226  ASN A N     1 
ATOM   1337  C CA    . ASN A  1 226 ? 1.027    -5.400  11.553  1.00 33.43  ? 226  ASN A CA    1 
ATOM   1338  C C     . ASN A  1 226 ? 0.252    -4.352  12.369  1.00 40.47  ? 226  ASN A C     1 
ATOM   1339  O O     . ASN A  1 226 ? 0.352    -3.159  12.072  1.00 41.72  ? 226  ASN A O     1 
ATOM   1340  C CB    . ASN A  1 226 ? 0.144    -6.115  10.531  1.00 27.64  ? 226  ASN A CB    1 
ATOM   1341  C CG    . ASN A  1 226 ? 0.849    -6.424  9.219   1.00 41.37  ? 226  ASN A CG    1 
ATOM   1342  O OD1   . ASN A  1 226 ? 1.789    -5.734  8.789   1.00 36.13  ? 226  ASN A OD1   1 
ATOM   1343  N ND2   . ASN A  1 226 ? 0.409    -7.475  8.545   1.00 24.85  ? 226  ASN A ND2   1 
ATOM   1344  N N     . ALA A  1 227 ? -0.438   -4.779  13.447  1.00 37.12  ? 227  ALA A N     1 
ATOM   1345  C CA    . ALA A  1 227 ? -1.134   -3.871  14.367  1.00 36.16  ? 227  ALA A CA    1 
ATOM   1346  C C     . ALA A  1 227 ? -0.137   -2.870  14.971  1.00 40.46  ? 227  ALA A C     1 
ATOM   1347  O O     . ALA A  1 227 ? -0.464   -1.679  15.083  1.00 42.99  ? 227  ALA A O     1 
ATOM   1348  C CB    . ALA A  1 227 ? -1.815   -4.660  15.477  1.00 35.71  ? 227  ALA A CB    1 
ATOM   1349  N N     . ALA A  1 228 ? 1.083    -3.348  15.307  1.00 33.57  ? 228  ALA A N     1 
ATOM   1350  C CA    . ALA A  1 228 ? 2.155    -2.515  15.852  1.00 33.18  ? 228  ALA A CA    1 
ATOM   1351  C C     . ALA A  1 228 ? 2.607    -1.473  14.809  1.00 36.89  ? 228  ALA A C     1 
ATOM   1352  O O     . ALA A  1 228 ? 2.709    -0.293  15.132  1.00 37.31  ? 228  ALA A O     1 
ATOM   1353  C CB    . ALA A  1 228 ? 3.336    -3.377  16.292  1.00 34.06  ? 228  ALA A CB    1 
ATOM   1354  N N     . VAL A  1 229 ? 2.818    -1.901  13.548  1.00 31.91  ? 229  VAL A N     1 
ATOM   1355  C CA    . VAL A  1 229 ? 3.239    -1.036  12.436  1.00 30.70  ? 229  VAL A CA    1 
ATOM   1356  C C     . VAL A  1 229 ? 2.174    0.059   12.175  1.00 34.85  ? 229  VAL A C     1 
ATOM   1357  O O     . VAL A  1 229 ? 2.539    1.233   12.026  1.00 34.20  ? 229  VAL A O     1 
ATOM   1358  C CB    . VAL A  1 229 ? 3.579    -1.872  11.180  1.00 32.61  ? 229  VAL A CB    1 
ATOM   1359  C CG1   . VAL A  1 229 ? 3.750    -0.992  9.952   1.00 33.20  ? 229  VAL A CG1   1 
ATOM   1360  C CG2   . VAL A  1 229 ? 4.827    -2.704  11.414  1.00 32.39  ? 229  VAL A CG2   1 
ATOM   1361  N N     . ARG A  1 230 ? 0.865    -0.326  12.202  1.00 29.30  ? 230  ARG A N     1 
ATOM   1362  C CA    . ARG A  1 230 ? -0.270   0.582   12.006  1.00 27.25  ? 230  ARG A CA    1 
ATOM   1363  C C     . ARG A  1 230 ? -0.347   1.644   13.119  1.00 27.56  ? 230  ARG A C     1 
ATOM   1364  O O     . ARG A  1 230 ? -0.615   2.802   12.828  1.00 24.27  ? 230  ARG A O     1 
ATOM   1365  C CB    . ARG A  1 230 ? -1.578   -0.227  11.887  1.00 26.46  ? 230  ARG A CB    1 
ATOM   1366  C CG    . ARG A  1 230 ? -2.868   0.610   11.783  1.00 31.03  ? 230  ARG A CG    1 
ATOM   1367  C CD    . ARG A  1 230 ? -4.099   -0.235  11.982  1.00 32.96  ? 230  ARG A CD    1 
ATOM   1368  N NE    . ARG A  1 230 ? -5.283   0.566   12.312  1.00 40.35  ? 230  ARG A NE    1 
ATOM   1369  C CZ    . ARG A  1 230 ? -5.735   0.783   13.546  1.00 49.78  ? 230  ARG A CZ    1 
ATOM   1370  N NH1   . ARG A  1 230 ? -5.088   0.292   14.594  1.00 59.19  ? 230  ARG A NH1   1 
ATOM   1371  N NH2   . ARG A  1 230 ? -6.839   1.480   13.739  1.00 20.15  ? 230  ARG A NH2   1 
ATOM   1372  N N     . ALA A  1 231 ? -0.116   1.236   14.384  1.00 25.68  ? 231  ALA A N     1 
ATOM   1373  C CA    . ALA A  1 231 ? -0.117   2.121   15.547  1.00 26.57  ? 231  ALA A CA    1 
ATOM   1374  C C     . ALA A  1 231 ? 1.096    3.060   15.516  1.00 35.02  ? 231  ALA A C     1 
ATOM   1375  O O     . ALA A  1 231 ? 0.958    4.250   15.805  1.00 34.06  ? 231  ALA A O     1 
ATOM   1376  C CB    . ALA A  1 231 ? -0.106   1.298   16.824  1.00 26.89  ? 231  ALA A CB    1 
ATOM   1377  N N     . VAL A  1 232 ? 2.287    2.534   15.139  1.00 35.47  ? 232  VAL A N     1 
ATOM   1378  C CA    . VAL A  1 232 ? 3.512    3.347   15.051  1.00 36.52  ? 232  VAL A CA    1 
ATOM   1379  C C     . VAL A  1 232 ? 3.344    4.421   13.957  1.00 37.47  ? 232  VAL A C     1 
ATOM   1380  O O     . VAL A  1 232 ? 3.491    5.601   14.244  1.00 38.36  ? 232  VAL A O     1 
ATOM   1381  C CB    . VAL A  1 232 ? 4.839    2.520   14.944  1.00 40.55  ? 232  VAL A CB    1 
ATOM   1382  C CG1   . VAL A  1 232 ? 6.044    3.440   14.748  1.00 41.41  ? 232  VAL A CG1   1 
ATOM   1383  C CG2   . VAL A  1 232 ? 5.050    1.621   16.171  1.00 39.10  ? 232  VAL A CG2   1 
ATOM   1384  N N     . THR A  1 233 ? 2.951    4.007   12.753  1.00 30.42  ? 233  THR A N     1 
ATOM   1385  C CA    . THR A  1 233 ? 2.728    4.890   11.618  1.00 30.50  ? 233  THR A CA    1 
ATOM   1386  C C     . THR A  1 233 ? 1.734    5.997   11.929  1.00 34.34  ? 233  THR A C     1 
ATOM   1387  O O     . THR A  1 233 ? 2.116    7.163   11.925  1.00 36.44  ? 233  THR A O     1 
ATOM   1388  C CB    . THR A  1 233 ? 2.295    4.070   10.403  1.00 41.91  ? 233  THR A CB    1 
ATOM   1389  O OG1   . THR A  1 233 ? 3.248    3.028   10.203  1.00 49.46  ? 233  THR A OG1   1 
ATOM   1390  C CG2   . THR A  1 233 ? 2.135    4.908   9.146   1.00 38.88  ? 233  THR A CG2   1 
ATOM   1391  N N     . ARG A  1 234 ? 0.466    5.633   12.193  1.00 28.95  ? 234  ARG A N     1 
ATOM   1392  C CA    . ARG A  1 234 ? -0.630   6.563   12.443  1.00 28.15  ? 234  ARG A CA    1 
ATOM   1393  C C     . ARG A  1 234 ? -0.404   7.517   13.629  1.00 34.06  ? 234  ARG A C     1 
ATOM   1394  O O     . ARG A  1 234 ? -0.714   8.715   13.498  1.00 35.12  ? 234  ARG A O     1 
ATOM   1395  C CB    . ARG A  1 234 ? -1.987   5.837   12.455  1.00 24.30  ? 234  ARG A CB    1 
ATOM   1396  C CG    . ARG A  1 234 ? -2.569   5.630   11.055  1.00 27.02  ? 234  ARG A CG    1 
ATOM   1397  C CD    . ARG A  1 234 ? -3.520   4.465   11.055  1.00 31.72  ? 234  ARG A CD    1 
ATOM   1398  N NE    . ARG A  1 234 ? -4.883   4.747   10.588  1.00 13.48  ? 234  ARG A NE    1 
ATOM   1399  C CZ    . ARG A  1 234 ? -5.462   4.125   9.564   1.00 29.92  ? 234  ARG A CZ    1 
ATOM   1400  N NH1   . ARG A  1 234 ? -4.777   3.264   8.829   1.00 31.94  ? 234  ARG A NH1   1 
ATOM   1401  N NH2   . ARG A  1 234 ? -6.720   4.377   9.250   1.00 32.37  ? 234  ARG A NH2   1 
ATOM   1402  N N     . ALA A  1 235 ? 0.214    7.013   14.740  1.00 29.28  ? 235  ALA A N     1 
ATOM   1403  C CA    . ALA A  1 235 ? 0.566    7.857   15.892  1.00 29.18  ? 235  ALA A CA    1 
ATOM   1404  C C     . ALA A  1 235 ? 1.664    8.866   15.510  1.00 32.75  ? 235  ALA A C     1 
ATOM   1405  O O     . ALA A  1 235 ? 1.566    10.031  15.868  1.00 32.22  ? 235  ALA A O     1 
ATOM   1406  C CB    . ALA A  1 235 ? 1.006    7.010   17.078  1.00 29.19  ? 235  ALA A CB    1 
ATOM   1407  N N     . GLY A  1 236 ? 2.658    8.406   14.754  1.00 30.47  ? 236  GLY A N     1 
ATOM   1408  C CA    . GLY A  1 236 ? 3.755    9.224   14.259  1.00 32.79  ? 236  GLY A CA    1 
ATOM   1409  C C     . GLY A  1 236 ? 3.270    10.396  13.422  1.00 40.24  ? 236  GLY A C     1 
ATOM   1410  O O     . GLY A  1 236 ? 3.693    11.537  13.627  1.00 39.61  ? 236  GLY A O     1 
ATOM   1411  N N     . ILE A  1 237 ? 2.338    10.121  12.505  1.00 38.59  ? 237  ILE A N     1 
ATOM   1412  C CA    . ILE A  1 237 ? 1.735    11.120  11.621  1.00 39.22  ? 237  ILE A CA    1 
ATOM   1413  C C     . ILE A  1 237 ? 0.976    12.170  12.471  1.00 41.79  ? 237  ILE A C     1 
ATOM   1414  O O     . ILE A  1 237 ? 1.226    13.370  12.318  1.00 42.79  ? 237  ILE A O     1 
ATOM   1415  C CB    . ILE A  1 237 ? 0.843    10.382  10.569  1.00 41.67  ? 237  ILE A CB    1 
ATOM   1416  C CG1   . ILE A  1 237 ? 1.722    9.654   9.547   1.00 43.73  ? 237  ILE A CG1   1 
ATOM   1417  C CG2   . ILE A  1 237 ? -0.133   11.318  9.867   1.00 40.56  ? 237  ILE A CG2   1 
ATOM   1418  C CD1   . ILE A  1 237 ? 1.069    8.464   8.885   1.00 57.12  ? 237  ILE A CD1   1 
ATOM   1419  N N     . PHE A  1 238 ? 0.104    11.690  13.401  1.00 35.41  ? 238  PHE A N     1 
ATOM   1420  C CA    . PHE A  1 238 ? -0.698   12.490  14.321  1.00 34.65  ? 238  PHE A CA    1 
ATOM   1421  C C     . PHE A  1 238 ? 0.163    13.449  15.142  1.00 42.33  ? 238  PHE A C     1 
ATOM   1422  O O     . PHE A  1 238 ? -0.234   14.591  15.370  1.00 43.19  ? 238  PHE A O     1 
ATOM   1423  C CB    . PHE A  1 238 ? -1.493   11.591  15.286  1.00 34.80  ? 238  PHE A CB    1 
ATOM   1424  C CG    . PHE A  1 238 ? -2.332   12.381  16.276  1.00 37.00  ? 238  PHE A CG    1 
ATOM   1425  C CD1   . PHE A  1 238 ? -1.896   12.577  17.583  1.00 40.92  ? 238  PHE A CD1   1 
ATOM   1426  C CD2   . PHE A  1 238 ? -3.538   12.977  15.884  1.00 38.71  ? 238  PHE A CD2   1 
ATOM   1427  C CE1   . PHE A  1 238 ? -2.683   13.295  18.497  1.00 41.86  ? 238  PHE A CE1   1 
ATOM   1428  C CE2   . PHE A  1 238 ? -4.314   13.703  16.792  1.00 40.87  ? 238  PHE A CE2   1 
ATOM   1429  C CZ    . PHE A  1 238 ? -3.888   13.848  18.094  1.00 39.78  ? 238  PHE A CZ    1 
ATOM   1430  N N     . TYR A  1 239 ? 1.320    12.968  15.620  1.00 39.18  ? 239  TYR A N     1 
ATOM   1431  C CA    . TYR A  1 239 ? 2.215    13.776  16.409  1.00 39.68  ? 239  TYR A CA    1 
ATOM   1432  C C     . TYR A  1 239 ? 3.121    14.696  15.553  1.00 48.02  ? 239  TYR A C     1 
ATOM   1433  O O     . TYR A  1 239 ? 3.958    15.427  16.098  1.00 49.55  ? 239  TYR A O     1 
ATOM   1434  C CB    . TYR A  1 239 ? 2.931    12.925  17.480  1.00 39.44  ? 239  TYR A CB    1 
ATOM   1435  C CG    . TYR A  1 239 ? 2.031    12.555  18.646  1.00 39.43  ? 239  TYR A CG    1 
ATOM   1436  C CD1   . TYR A  1 239 ? 1.482    13.534  19.470  1.00 42.02  ? 239  TYR A CD1   1 
ATOM   1437  C CD2   . TYR A  1 239 ? 1.736    11.230  18.932  1.00 38.67  ? 239  TYR A CD2   1 
ATOM   1438  C CE1   . TYR A  1 239 ? 0.657    13.203  20.546  1.00 40.93  ? 239  TYR A CE1   1 
ATOM   1439  C CE2   . TYR A  1 239 ? 0.909    10.886  20.005  1.00 38.54  ? 239  TYR A CE2   1 
ATOM   1440  C CZ    . TYR A  1 239 ? 0.379    11.876  20.816  1.00 46.08  ? 239  TYR A CZ    1 
ATOM   1441  O OH    . TYR A  1 239 ? -0.426   11.554  21.886  1.00 45.71  ? 239  TYR A OH    1 
ATOM   1442  N N     . GLY A  1 240 ? 2.871    14.706  14.237  1.00 45.45  ? 240  GLY A N     1 
ATOM   1443  C CA    . GLY A  1 240 ? 3.577    15.542  13.272  1.00 47.63  ? 240  GLY A CA    1 
ATOM   1444  C C     . GLY A  1 240 ? 4.933    15.039  12.813  1.00 54.93  ? 240  GLY A C     1 
ATOM   1445  O O     . GLY A  1 240 ? 5.872    15.823  12.641  1.00 55.81  ? 240  GLY A O     1 
ATOM   1446  N N     . CYS A  1 241 ? 5.046    13.733  12.591  1.00 53.41  ? 241  CYS A N     1 
ATOM   1447  C CA    . CYS A  1 241 ? 6.284    13.120  12.096  1.00 54.82  ? 241  CYS A CA    1 
ATOM   1448  C C     . CYS A  1 241 ? 5.994    12.497  10.747  1.00 58.12  ? 241  CYS A C     1 
ATOM   1449  O O     . CYS A  1 241 ? 4.819    12.369  10.346  1.00 58.24  ? 241  CYS A O     1 
ATOM   1450  C CB    . CYS A  1 241 ? 6.828    12.068  13.066  1.00 54.87  ? 241  CYS A CB    1 
ATOM   1451  S SG    . CYS A  1 241 ? 6.992    12.622  14.779  1.00 59.21  ? 241  CYS A SG    1 
ATOM   1452  N N     . LYS A  1 242 ? 7.071    12.070  10.070  1.00 52.20  ? 242  LYS A N     1 
ATOM   1453  C CA    . LYS A  1 242 ? 6.994    11.336  8.822   1.00 51.29  ? 242  LYS A CA    1 
ATOM   1454  C C     . LYS A  1 242 ? 7.518    9.932   9.152   1.00 53.99  ? 242  LYS A C     1 
ATOM   1455  O O     . LYS A  1 242 ? 8.633    9.809   9.671   1.00 54.85  ? 242  LYS A O     1 
ATOM   1456  C CB    . LYS A  1 242 ? 7.808    12.016  7.722   1.00 55.49  ? 242  LYS A CB    1 
ATOM   1457  C CG    . LYS A  1 242 ? 7.172    13.314  7.201   1.00 68.96  ? 242  LYS A CG    1 
ATOM   1458  C CD    . LYS A  1 242 ? 7.940    13.890  6.001   1.00 79.56  ? 242  LYS A CD    1 
ATOM   1459  C CE    . LYS A  1 242 ? 7.493    13.297  4.682   1.00 87.93  ? 242  LYS A CE    1 
ATOM   1460  N NZ    . LYS A  1 242 ? 8.456    13.575  3.585   1.00 98.65  ? 242  LYS A NZ    1 
ATOM   1461  N N     . VAL A  1 243 ? 6.671    8.881   8.959   1.00 46.88  ? 243  VAL A N     1 
ATOM   1462  C CA    . VAL A  1 243 ? 7.051    7.508   9.306   1.00 44.24  ? 243  VAL A CA    1 
ATOM   1463  C C     . VAL A  1 243 ? 7.619    6.791   8.091   1.00 48.68  ? 243  VAL A C     1 
ATOM   1464  O O     . VAL A  1 243 ? 6.945    6.711   7.066   1.00 48.53  ? 243  VAL A O     1 
ATOM   1465  C CB    . VAL A  1 243 ? 5.903    6.725   10.008  1.00 45.16  ? 243  VAL A CB    1 
ATOM   1466  C CG1   . VAL A  1 243 ? 6.317    5.288   10.313  1.00 44.31  ? 243  VAL A CG1   1 
ATOM   1467  C CG2   . VAL A  1 243 ? 5.430    7.435   11.283  1.00 43.79  ? 243  VAL A CG2   1 
ATOM   1468  N N     . TYR A  1 244 ? 8.860    6.278   8.206   1.00 46.22  ? 244  TYR A N     1 
ATOM   1469  C CA    . TYR A  1 244 ? 9.541    5.552   7.127   1.00 47.10  ? 244  TYR A CA    1 
ATOM   1470  C C     . TYR A  1 244 ? 9.656    4.081   7.445   1.00 50.68  ? 244  TYR A C     1 
ATOM   1471  O O     . TYR A  1 244 ? 10.123   3.714   8.513   1.00 50.19  ? 244  TYR A O     1 
ATOM   1472  C CB    . TYR A  1 244 ? 10.937   6.153   6.828   1.00 50.45  ? 244  TYR A CB    1 
ATOM   1473  C CG    . TYR A  1 244 ? 10.901   7.449   6.042   1.00 54.27  ? 244  TYR A CG    1 
ATOM   1474  C CD1   . TYR A  1 244 ? 11.092   7.456   4.666   1.00 57.01  ? 244  TYR A CD1   1 
ATOM   1475  C CD2   . TYR A  1 244 ? 10.645   8.666   6.673   1.00 56.25  ? 244  TYR A CD2   1 
ATOM   1476  C CE1   . TYR A  1 244 ? 11.014   8.641   3.931   1.00 59.87  ? 244  TYR A CE1   1 
ATOM   1477  C CE2   . TYR A  1 244 ? 10.552   9.855   5.947   1.00 58.83  ? 244  TYR A CE2   1 
ATOM   1478  C CZ    . TYR A  1 244 ? 10.752   9.841   4.578   1.00 68.50  ? 244  TYR A CZ    1 
ATOM   1479  O OH    . TYR A  1 244 ? 10.671   11.018  3.871   1.00 71.39  ? 244  TYR A OH    1 
ATOM   1480  N N     . ALA A  1 245 ? 9.206    3.237   6.530   1.00 48.98  ? 245  ALA A N     1 
ATOM   1481  C CA    . ALA A  1 245 ? 9.314    1.785   6.667   1.00 49.33  ? 245  ALA A CA    1 
ATOM   1482  C C     . ALA A  1 245 ? 10.687   1.352   6.187   1.00 55.68  ? 245  ALA A C     1 
ATOM   1483  O O     . ALA A  1 245 ? 11.157   1.815   5.139   1.00 55.66  ? 245  ALA A O     1 
ATOM   1484  C CB    . ALA A  1 245 ? 8.258    1.089   5.824   1.00 49.60  ? 245  ALA A CB    1 
ATOM   1485  N N     . CYS A  1 246 ? 11.320   0.454   6.948   1.00 53.25  ? 246  CYS A N     1 
ATOM   1486  C CA    . CYS A  1 246 ? 12.597   -0.136  6.593   1.00 54.20  ? 246  CYS A CA    1 
ATOM   1487  C C     . CYS A  1 246 ? 12.302   -1.605  6.341   1.00 56.41  ? 246  CYS A C     1 
ATOM   1488  O O     . CYS A  1 246 ? 12.094   -2.373  7.287   1.00 55.98  ? 246  CYS A O     1 
ATOM   1489  C CB    . CYS A  1 246 ? 13.613   0.060   7.705   1.00 55.57  ? 246  CYS A CB    1 
ATOM   1490  S SG    . CYS A  1 246 ? 15.138   -0.880  7.472   1.00 61.19  ? 246  CYS A SG    1 
ATOM   1491  N N     . TYR A  1 247 ? 12.191   -1.964  5.048   1.00 51.51  ? 247  TYR A N     1 
ATOM   1492  C CA    . TYR A  1 247 ? 11.797   -3.288  4.567   1.00 49.75  ? 247  TYR A CA    1 
ATOM   1493  C C     . TYR A  1 247 ? 12.799   -4.417  4.835   1.00 52.78  ? 247  TYR A C     1 
ATOM   1494  O O     . TYR A  1 247 ? 14.001   -4.181  4.861   1.00 52.07  ? 247  TYR A O     1 
ATOM   1495  C CB    . TYR A  1 247 ? 11.351   -3.218  3.091   1.00 50.84  ? 247  TYR A CB    1 
ATOM   1496  C CG    . TYR A  1 247 ? 10.157   -2.315  2.863   1.00 51.34  ? 247  TYR A CG    1 
ATOM   1497  C CD1   . TYR A  1 247 ? 8.861    -2.817  2.896   1.00 51.75  ? 247  TYR A CD1   1 
ATOM   1498  C CD2   . TYR A  1 247 ? 10.323   -0.957  2.618   1.00 53.43  ? 247  TYR A CD2   1 
ATOM   1499  C CE1   . TYR A  1 247 ? 7.755    -1.984  2.722   1.00 52.16  ? 247  TYR A CE1   1 
ATOM   1500  C CE2   . TYR A  1 247 ? 9.228    -0.109  2.465   1.00 54.21  ? 247  TYR A CE2   1 
ATOM   1501  C CZ    . TYR A  1 247 ? 7.943    -0.627  2.509   1.00 61.63  ? 247  TYR A CZ    1 
ATOM   1502  O OH    . TYR A  1 247 ? 6.860    0.211   2.348   1.00 62.88  ? 247  TYR A OH    1 
ATOM   1503  N N     . GLU A  1 248 ? 12.283   -5.639  5.064   1.00 49.26  ? 248  GLU A N     1 
ATOM   1504  C CA    . GLU A  1 248 ? 13.044   -6.874  5.336   1.00 49.48  ? 248  GLU A CA    1 
ATOM   1505  C C     . GLU A  1 248 ? 14.076   -6.719  6.463   1.00 51.67  ? 248  GLU A C     1 
ATOM   1506  O O     . GLU A  1 248 ? 15.286   -6.795  6.216   1.00 50.09  ? 248  GLU A O     1 
ATOM   1507  C CB    . GLU A  1 248 ? 13.682   -7.458  4.054   1.00 52.59  ? 248  GLU A CB    1 
ATOM   1508  C CG    . GLU A  1 248 ? 12.741   -7.689  2.874   1.00 67.27  ? 248  GLU A CG    1 
ATOM   1509  C CD    . GLU A  1 248 ? 11.673   -8.762  3.003   1.00 104.66 ? 248  GLU A CD    1 
ATOM   1510  O OE1   . GLU A  1 248 ? 10.543   -8.521  2.521   1.00 113.63 ? 248  GLU A OE1   1 
ATOM   1511  O OE2   . GLU A  1 248 ? 11.967   -9.850  3.550   1.00 107.81 ? 248  GLU A OE2   1 
ATOM   1512  N N     . GLY A  1 249 ? 13.565   -6.473  7.678   1.00 48.07  ? 249  GLY A N     1 
ATOM   1513  C CA    . GLY A  1 249 ? 14.336   -6.294  8.913   1.00 47.61  ? 249  GLY A CA    1 
ATOM   1514  C C     . GLY A  1 249 ? 15.568   -5.410  8.818   1.00 49.19  ? 249  GLY A C     1 
ATOM   1515  O O     . GLY A  1 249 ? 15.538   -4.358  8.169   1.00 47.34  ? 249  GLY A O     1 
ATOM   1516  N N     . TYR A  1 250 ? 16.676   -5.856  9.443   1.00 46.06  ? 250  TYR A N     1 
ATOM   1517  C CA    . TYR A  1 250 ? 17.938   -5.107  9.412   1.00 47.25  ? 250  TYR A CA    1 
ATOM   1518  C C     . TYR A  1 250 ? 18.591   -5.020  8.039   1.00 55.62  ? 250  TYR A C     1 
ATOM   1519  O O     . TYR A  1 250 ? 19.348   -4.075  7.809   1.00 56.96  ? 250  TYR A O     1 
ATOM   1520  C CB    . TYR A  1 250 ? 18.930   -5.633  10.450  1.00 47.29  ? 250  TYR A CB    1 
ATOM   1521  C CG    . TYR A  1 250 ? 18.538   -5.303  11.871  1.00 46.53  ? 250  TYR A CG    1 
ATOM   1522  C CD1   . TYR A  1 250 ? 18.551   -3.991  12.334  1.00 47.83  ? 250  TYR A CD1   1 
ATOM   1523  C CD2   . TYR A  1 250 ? 18.181   -6.303  12.764  1.00 46.38  ? 250  TYR A CD2   1 
ATOM   1524  C CE1   . TYR A  1 250 ? 18.192   -3.682  13.643  1.00 46.24  ? 250  TYR A CE1   1 
ATOM   1525  C CE2   . TYR A  1 250 ? 17.838   -6.008  14.082  1.00 46.58  ? 250  TYR A CE2   1 
ATOM   1526  C CZ    . TYR A  1 250 ? 17.841   -4.695  14.518  1.00 50.56  ? 250  TYR A CZ    1 
ATOM   1527  O OH    . TYR A  1 250 ? 17.491   -4.413  15.821  1.00 48.63  ? 250  TYR A OH    1 
ATOM   1528  N N     . THR A  1 251 ? 18.294   -5.985  7.128   1.00 53.59  ? 251  THR A N     1 
ATOM   1529  C CA    . THR A  1 251 ? 18.840   -6.039  5.759   1.00 55.58  ? 251  THR A CA    1 
ATOM   1530  C C     . THR A  1 251 ? 18.512   -4.769  4.986   1.00 61.18  ? 251  THR A C     1 
ATOM   1531  O O     . THR A  1 251 ? 19.385   -4.208  4.328   1.00 63.97  ? 251  THR A O     1 
ATOM   1532  C CB    . THR A  1 251 ? 18.471   -7.346  4.992   1.00 66.70  ? 251  THR A CB    1 
ATOM   1533  O OG1   . THR A  1 251 ? 17.131   -7.285  4.476   1.00 61.35  ? 251  THR A OG1   1 
ATOM   1534  C CG2   . THR A  1 251 ? 18.731   -8.635  5.809   1.00 67.43  ? 251  THR A CG2   1 
ATOM   1535  N N     . GLY A  1 252 ? 17.284   -4.299  5.137   1.00 56.62  ? 252  GLY A N     1 
ATOM   1536  C CA    . GLY A  1 252 ? 16.822   -3.063  4.525   1.00 56.86  ? 252  GLY A CA    1 
ATOM   1537  C C     . GLY A  1 252 ? 17.463   -1.831  5.131   1.00 60.73  ? 252  GLY A C     1 
ATOM   1538  O O     . GLY A  1 252 ? 17.568   -0.807  4.461   1.00 59.11  ? 252  GLY A O     1 
ATOM   1539  N N     . LEU A  1 253 ? 17.882   -1.917  6.418   1.00 58.79  ? 253  LEU A N     1 
ATOM   1540  C CA    . LEU A  1 253 ? 18.585   -0.831  7.120   1.00 59.44  ? 253  LEU A CA    1 
ATOM   1541  C C     . LEU A  1 253 ? 20.057   -0.803  6.684   1.00 64.81  ? 253  LEU A C     1 
ATOM   1542  O O     . LEU A  1 253 ? 20.653   0.276   6.623   1.00 64.24  ? 253  LEU A O     1 
ATOM   1543  C CB    . LEU A  1 253 ? 18.473   -0.994  8.651   1.00 58.31  ? 253  LEU A CB    1 
ATOM   1544  C CG    . LEU A  1 253 ? 18.809   0.238   9.497   1.00 62.91  ? 253  LEU A CG    1 
ATOM   1545  C CD1   . LEU A  1 253 ? 17.756   1.333   9.345   1.00 62.29  ? 253  LEU A CD1   1 
ATOM   1546  C CD2   . LEU A  1 253 ? 18.940   -0.134  10.948  1.00 63.23  ? 253  LEU A CD2   1 
ATOM   1547  N N     . VAL A  1 254 ? 20.633   -1.986  6.371   1.00 61.62  ? 254  VAL A N     1 
ATOM   1548  C CA    . VAL A  1 254 ? 22.012   -2.086  5.915   1.00 63.49  ? 254  VAL A CA    1 
ATOM   1549  C C     . VAL A  1 254 ? 22.121   -1.677  4.436   1.00 73.26  ? 254  VAL A C     1 
ATOM   1550  O O     . VAL A  1 254 ? 23.010   -0.880  4.104   1.00 76.18  ? 254  VAL A O     1 
ATOM   1551  C CB    . VAL A  1 254 ? 22.673   -3.445  6.242   1.00 65.92  ? 254  VAL A CB    1 
ATOM   1552  C CG1   . VAL A  1 254 ? 24.112   -3.493  5.730   1.00 67.37  ? 254  VAL A CG1   1 
ATOM   1553  C CG2   . VAL A  1 254 ? 22.645   -3.705  7.742   1.00 64.35  ? 254  VAL A CG2   1 
ATOM   1554  N N     . LYS A  1 255 ? 21.208   -2.181  3.561   1.00 69.55  ? 255  LYS A N     1 
ATOM   1555  C CA    . LYS A  1 255 ? 21.194   -1.812  2.139   1.00 71.12  ? 255  LYS A CA    1 
ATOM   1556  C C     . LYS A  1 255 ? 20.232   -0.658  1.844   1.00 77.16  ? 255  LYS A C     1 
ATOM   1557  O O     . LYS A  1 255 ? 19.772   -0.490  0.709   1.00 76.55  ? 255  LYS A O     1 
ATOM   1558  C CB    . LYS A  1 255 ? 20.997   -3.032  1.214   1.00 74.17  ? 255  LYS A CB    1 
ATOM   1559  C CG    . LYS A  1 255 ? 19.616   -3.685  1.201   1.00 92.92  ? 255  LYS A CG    1 
ATOM   1560  C CD    . LYS A  1 255 ? 19.691   -5.162  0.764   1.00 105.68 ? 255  LYS A CD    1 
ATOM   1561  C CE    . LYS A  1 255 ? 19.583   -5.384  -0.728  1.00 115.52 ? 255  LYS A CE    1 
ATOM   1562  N NZ    . LYS A  1 255 ? 18.173   -5.333  -1.201  1.00 117.33 ? 255  LYS A NZ    1 
ATOM   1563  N N     . GLY A  1 256 ? 19.982   0.139   2.889   1.00 76.08  ? 256  GLY A N     1 
ATOM   1564  C CA    . GLY A  1 256 ? 19.074   1.283   2.923   1.00 75.96  ? 256  GLY A CA    1 
ATOM   1565  C C     . GLY A  1 256 ? 19.171   2.271   1.790   1.00 82.24  ? 256  GLY A C     1 
ATOM   1566  O O     . GLY A  1 256 ? 20.062   3.128   1.787   1.00 84.96  ? 256  GLY A O     1 
ATOM   1567  N N     . GLY A  1 257 ? 18.248   2.136   0.843   1.00 76.81  ? 257  GLY A N     1 
ATOM   1568  C CA    . GLY A  1 257 ? 18.140   3.015   -0.308  1.00 77.72  ? 257  GLY A CA    1 
ATOM   1569  C C     . GLY A  1 257 ? 16.687   3.094   -0.686  1.00 80.87  ? 257  GLY A C     1 
ATOM   1570  O O     . GLY A  1 257 ? 15.930   3.907   -0.144  1.00 79.64  ? 257  GLY A O     1 
ATOM   1571  N N     . ASP A  1 258 ? 16.286   2.175   -1.570  1.00 77.11  ? 258  ASP A N     1 
ATOM   1572  C CA    . ASP A  1 258 ? 14.909   2.001   -2.006  1.00 75.12  ? 258  ASP A CA    1 
ATOM   1573  C C     . ASP A  1 258 ? 14.216   1.144   -0.928  1.00 76.52  ? 258  ASP A C     1 
ATOM   1574  O O     . ASP A  1 258 ? 12.996   1.007   -0.935  1.00 75.62  ? 258  ASP A O     1 
ATOM   1575  C CB    . ASP A  1 258 ? 14.884   1.296   -3.372  1.00 77.85  ? 258  ASP A CB    1 
ATOM   1576  C CG    . ASP A  1 258 ? 13.597   1.505   -4.140  1.00 94.67  ? 258  ASP A CG    1 
ATOM   1577  O OD1   . ASP A  1 258 ? 12.707   0.620   -4.068  1.00 95.97  ? 258  ASP A OD1   1 
ATOM   1578  O OD2   . ASP A  1 258 ? 13.484   2.538   -4.832  1.00 103.19 ? 258  ASP A OD2   1 
ATOM   1579  N N     . MET A  1 259 ? 15.019   0.578   0.007   1.00 71.11  ? 259  MET A N     1 
ATOM   1580  C CA    . MET A  1 259 ? 14.596   -0.255  1.133   1.00 67.54  ? 259  MET A CA    1 
ATOM   1581  C C     . MET A  1 259 ? 13.987   0.596   2.250   1.00 64.29  ? 259  MET A C     1 
ATOM   1582  O O     . MET A  1 259 ? 13.319   0.054   3.127   1.00 61.83  ? 259  MET A O     1 
ATOM   1583  C CB    . MET A  1 259 ? 15.781   -1.080  1.643   1.00 70.72  ? 259  MET A CB    1 
ATOM   1584  C CG    . MET A  1 259 ? 16.163   -2.220  0.726   1.00 75.84  ? 259  MET A CG    1 
ATOM   1585  S SD    . MET A  1 259 ? 15.261   -3.778  1.045   1.00 79.21  ? 259  MET A SD    1 
ATOM   1586  C CE    . MET A  1 259 ? 13.915   -3.634  -0.145  1.00 75.51  ? 259  MET A CE    1 
ATOM   1587  N N     . LEU A  1 260 ? 14.235   1.926   2.208   1.00 58.06  ? 260  LEU A N     1 
ATOM   1588  C CA    . LEU A  1 260 ? 13.694   2.924   3.119   1.00 56.44  ? 260  LEU A CA    1 
ATOM   1589  C C     . LEU A  1 260 ? 12.632   3.704   2.351   1.00 61.31  ? 260  LEU A C     1 
ATOM   1590  O O     . LEU A  1 260 ? 12.972   4.516   1.486   1.00 62.66  ? 260  LEU A O     1 
ATOM   1591  C CB    . LEU A  1 260 ? 14.798   3.880   3.630   1.00 57.17  ? 260  LEU A CB    1 
ATOM   1592  C CG    . LEU A  1 260 ? 15.386   3.638   5.029   1.00 61.80  ? 260  LEU A CG    1 
ATOM   1593  C CD1   . LEU A  1 260 ? 14.313   3.487   6.099   1.00 59.71  ? 260  LEU A CD1   1 
ATOM   1594  C CD2   . LEU A  1 260 ? 16.294   2.430   5.057   1.00 68.18  ? 260  LEU A CD2   1 
ATOM   1595  N N     . LYS A  1 261 ? 11.351   3.406   2.613   1.00 56.48  ? 261  LYS A N     1 
ATOM   1596  C CA    . LYS A  1 261 ? 10.218   4.065   1.949   1.00 56.31  ? 261  LYS A CA    1 
ATOM   1597  C C     . LYS A  1 261 ? 9.236    4.625   2.987   1.00 57.19  ? 261  LYS A C     1 
ATOM   1598  O O     . LYS A  1 261 ? 8.990    3.969   3.998   1.00 56.83  ? 261  LYS A O     1 
ATOM   1599  C CB    . LYS A  1 261 ? 9.473    3.087   1.015   1.00 59.62  ? 261  LYS A CB    1 
ATOM   1600  C CG    . LYS A  1 261 ? 10.251   2.595   -0.214  1.00 78.47  ? 261  LYS A CG    1 
ATOM   1601  C CD    . LYS A  1 261 ? 9.600    1.336   -0.819  1.00 84.65  ? 261  LYS A CD    1 
ATOM   1602  C CE    . LYS A  1 261 ? 10.027   1.050   -2.236  1.00 89.86  ? 261  LYS A CE    1 
ATOM   1603  N NZ    . LYS A  1 261 ? 10.405   -0.377  -2.403  1.00 100.64 ? 261  LYS A NZ    1 
ATOM   1604  N N     . GLU A  1 262 ? 8.653    5.810   2.731   1.00 51.39  ? 262  GLU A N     1 
ATOM   1605  C CA    . GLU A  1 262 ? 7.685    6.423   3.650   1.00 49.58  ? 262  GLU A CA    1 
ATOM   1606  C C     . GLU A  1 262 ? 6.358    5.670   3.679   1.00 52.80  ? 262  GLU A C     1 
ATOM   1607  O O     . GLU A  1 262 ? 5.967    5.028   2.698   1.00 52.71  ? 262  GLU A O     1 
ATOM   1608  C CB    . GLU A  1 262 ? 7.440    7.894   3.295   1.00 51.65  ? 262  GLU A CB    1 
ATOM   1609  C CG    . GLU A  1 262 ? 7.263    8.794   4.505   1.00 62.63  ? 262  GLU A CG    1 
ATOM   1610  C CD    . GLU A  1 262 ? 6.189    9.864   4.408   1.00 81.20  ? 262  GLU A CD    1 
ATOM   1611  O OE1   . GLU A  1 262 ? 5.384    9.991   5.361   1.00 73.71  ? 262  GLU A OE1   1 
ATOM   1612  O OE2   . GLU A  1 262 ? 6.142    10.572  3.377   1.00 70.40  ? 262  GLU A OE2   1 
ATOM   1613  N N     . LEU A  1 263 ? 5.682    5.730   4.825   1.00 48.95  ? 263  LEU A N     1 
ATOM   1614  C CA    . LEU A  1 263 ? 4.355    5.132   5.034   1.00 47.10  ? 263  LEU A CA    1 
ATOM   1615  C C     . LEU A  1 263 ? 3.350    6.248   5.273   1.00 51.66  ? 263  LEU A C     1 
ATOM   1616  O O     . LEU A  1 263 ? 3.613    7.165   6.067   1.00 51.37  ? 263  LEU A O     1 
ATOM   1617  C CB    . LEU A  1 263 ? 4.331    4.167   6.235   1.00 45.12  ? 263  LEU A CB    1 
ATOM   1618  C CG    . LEU A  1 263 ? 5.147    2.892   6.154   1.00 47.84  ? 263  LEU A CG    1 
ATOM   1619  C CD1   . LEU A  1 263 ? 5.180    2.180   7.510   1.00 46.12  ? 263  LEU A CD1   1 
ATOM   1620  C CD2   . LEU A  1 263 ? 4.626    1.981   5.066   1.00 47.92  ? 263  LEU A CD2   1 
ATOM   1621  N N     . GLN A  1 264 ? 2.207    6.171   4.576   1.00 48.50  ? 264  GLN A N     1 
ATOM   1622  C CA    . GLN A  1 264 ? 1.091    7.130   4.674   1.00 47.99  ? 264  GLN A CA    1 
ATOM   1623  C C     . GLN A  1 264 ? -0.035   6.570   5.587   1.00 47.79  ? 264  GLN A C     1 
ATOM   1624  O O     . GLN A  1 264 ? -0.188   5.355   5.739   1.00 44.76  ? 264  GLN A O     1 
ATOM   1625  C CB    . GLN A  1 264 ? 0.525    7.476   3.272   1.00 50.05  ? 264  GLN A CB    1 
ATOM   1626  C CG    . GLN A  1 264 ? 1.582    7.734   2.193   1.00 59.62  ? 264  GLN A CG    1 
ATOM   1627  C CD    . GLN A  1 264 ? 2.177    9.119   2.268   1.00 78.88  ? 264  GLN A CD    1 
ATOM   1628  O OE1   . GLN A  1 264 ? 1.698    10.056  1.633   1.00 75.96  ? 264  GLN A OE1   1 
ATOM   1629  N NE2   . GLN A  1 264 ? 3.270    9.267   2.992   1.00 70.46  ? 264  GLN A NE2   1 
ATOM   1630  N N     . TRP A  1 265 ? -0.833   7.456   6.163   1.00 43.91  ? 265  TRP A N     1 
ATOM   1631  C CA    . TRP A  1 265 ? -1.946   7.106   7.042   1.00 43.02  ? 265  TRP A CA    1 
ATOM   1632  C C     . TRP A  1 265 ? -2.876   6.022   6.446   1.00 50.78  ? 265  TRP A C     1 
ATOM   1633  O O     . TRP A  1 265 ? -3.426   5.209   7.192   1.00 51.78  ? 265  TRP A O     1 
ATOM   1634  C CB    . TRP A  1 265 ? -2.736   8.372   7.362   1.00 41.28  ? 265  TRP A CB    1 
ATOM   1635  C CG    . TRP A  1 265 ? -3.387   8.398   8.708   1.00 40.65  ? 265  TRP A CG    1 
ATOM   1636  C CD1   . TRP A  1 265 ? -2.857   8.861   9.882   1.00 43.51  ? 265  TRP A CD1   1 
ATOM   1637  C CD2   . TRP A  1 265 ? -4.737   8.081   8.978   1.00 39.04  ? 265  TRP A CD2   1 
ATOM   1638  N NE1   . TRP A  1 265 ? -3.803   8.819   10.878  1.00 41.00  ? 265  TRP A NE1   1 
ATOM   1639  C CE2   . TRP A  1 265 ? -4.963   8.329   10.354  1.00 41.62  ? 265  TRP A CE2   1 
ATOM   1640  C CE3   . TRP A  1 265 ? -5.786   7.592   8.190   1.00 40.22  ? 265  TRP A CE3   1 
ATOM   1641  C CZ2   . TRP A  1 265 ? -6.190   8.109   10.951  1.00 40.46  ? 265  TRP A CZ2   1 
ATOM   1642  C CZ3   . TRP A  1 265 ? -7.020   7.395   8.776   1.00 41.16  ? 265  TRP A CZ3   1 
ATOM   1643  C CH2   . TRP A  1 265 ? -7.204   7.615   10.147  1.00 41.43  ? 265  TRP A CH2   1 
ATOM   1644  N N     . GLN A  1 266 ? -3.006   5.986   5.110   1.00 47.96  ? 266  GLN A N     1 
ATOM   1645  C CA    . GLN A  1 266 ? -3.844   5.037   4.358   1.00 46.64  ? 266  GLN A CA    1 
ATOM   1646  C C     . GLN A  1 266 ? -3.123   3.692   4.085   1.00 44.77  ? 266  GLN A C     1 
ATOM   1647  O O     . GLN A  1 266 ? -3.783   2.681   3.872   1.00 42.32  ? 266  GLN A O     1 
ATOM   1648  C CB    . GLN A  1 266 ? -4.296   5.702   3.032   1.00 49.67  ? 266  GLN A CB    1 
ATOM   1649  C CG    . GLN A  1 266 ? -5.712   5.343   2.592   1.00 84.12  ? 266  GLN A CG    1 
ATOM   1650  C CD    . GLN A  1 266 ? -6.162   6.118   1.363   1.00 116.30 ? 266  GLN A CD    1 
ATOM   1651  O OE1   . GLN A  1 266 ? -6.737   7.207   1.471   1.00 111.50 ? 266  GLN A OE1   1 
ATOM   1652  N NE2   . GLN A  1 266 ? -5.960   5.553   0.166   1.00 114.10 ? 266  GLN A NE2   1 
ATOM   1653  N N     . ASP A  1 267 ? -1.769   3.692   4.090   1.00 39.09  ? 267  ASP A N     1 
ATOM   1654  C CA    . ASP A  1 267 ? -0.947   2.515   3.825   1.00 36.77  ? 267  ASP A CA    1 
ATOM   1655  C C     . ASP A  1 267 ? -1.141   1.428   4.867   1.00 38.41  ? 267  ASP A C     1 
ATOM   1656  O O     . ASP A  1 267 ? -1.086   0.245   4.540   1.00 39.56  ? 267  ASP A O     1 
ATOM   1657  C CB    . ASP A  1 267 ? 0.534    2.903   3.708   1.00 39.35  ? 267  ASP A CB    1 
ATOM   1658  C CG    . ASP A  1 267 ? 0.903    3.822   2.534   1.00 55.70  ? 267  ASP A CG    1 
ATOM   1659  O OD1   . ASP A  1 267 ? 0.044    4.023   1.627   1.00 57.90  ? 267  ASP A OD1   1 
ATOM   1660  O OD2   . ASP A  1 267 ? 2.060    4.321   2.507   1.00 60.76  ? 267  ASP A OD2   1 
ATOM   1661  N N     . VAL A  1 268 ? -1.406   1.824   6.108   1.00 32.34  ? 268  VAL A N     1 
ATOM   1662  C CA    . VAL A  1 268 ? -1.609   0.904   7.222   1.00 30.41  ? 268  VAL A CA    1 
ATOM   1663  C C     . VAL A  1 268 ? -3.101   0.545   7.483   1.00 34.19  ? 268  VAL A C     1 
ATOM   1664  O O     . VAL A  1 268 ? -3.444   0.056   8.566   1.00 31.50  ? 268  VAL A O     1 
ATOM   1665  C CB    . VAL A  1 268 ? -0.825   1.344   8.482   1.00 33.94  ? 268  VAL A CB    1 
ATOM   1666  C CG1   . VAL A  1 268 ? 0.686    1.150   8.290   1.00 35.11  ? 268  VAL A CG1   1 
ATOM   1667  C CG2   . VAL A  1 268 ? -1.139   2.788   8.864   1.00 33.44  ? 268  VAL A CG2   1 
ATOM   1668  N N     . ARG A  1 269 ? -3.979   0.759   6.473   1.00 32.61  ? 269  ARG A N     1 
ATOM   1669  C CA    . ARG A  1 269 ? -5.388   0.400   6.562   1.00 33.06  ? 269  ARG A CA    1 
ATOM   1670  C C     . ARG A  1 269 ? -5.530   -1.105  6.827   1.00 41.29  ? 269  ARG A C     1 
ATOM   1671  O O     . ARG A  1 269 ? -4.781   -1.899  6.257   1.00 42.21  ? 269  ARG A O     1 
ATOM   1672  C CB    . ARG A  1 269 ? -6.112   0.698   5.249   1.00 35.51  ? 269  ARG A CB    1 
ATOM   1673  C CG    . ARG A  1 269 ? -6.910   2.012   5.212   1.00 59.58  ? 269  ARG A CG    1 
ATOM   1674  C CD    . ARG A  1 269 ? -7.787   2.153   3.963   1.00 77.61  ? 269  ARG A CD    1 
ATOM   1675  N NE    . ARG A  1 269 ? -7.162   1.568   2.770   1.00 99.06  ? 269  ARG A NE    1 
ATOM   1676  C CZ    . ARG A  1 269 ? -7.623   1.692   1.531   1.00 121.87 ? 269  ARG A CZ    1 
ATOM   1677  N NH1   . ARG A  1 269 ? -8.721   2.401   1.291   1.00 113.15 ? 269  ARG A NH1   1 
ATOM   1678  N NH2   . ARG A  1 269 ? -6.981   1.123   0.518   1.00 112.02 ? 269  ARG A NH2   1 
ATOM   1679  N N     . GLY A  1 270 ? -6.477   -1.459  7.704   1.00 38.70  ? 270  GLY A N     1 
ATOM   1680  C CA    . GLY A  1 270 ? -6.862   -2.819  8.081   1.00 37.27  ? 270  GLY A CA    1 
ATOM   1681  C C     . GLY A  1 270 ? -5.803   -3.773  8.591   1.00 39.69  ? 270  GLY A C     1 
ATOM   1682  O O     . GLY A  1 270 ? -6.057   -4.978  8.634   1.00 39.19  ? 270  GLY A O     1 
ATOM   1683  N N     . LEU A  1 271 ? -4.633   -3.258  9.002   1.00 34.96  ? 271  LEU A N     1 
ATOM   1684  C CA    . LEU A  1 271 ? -3.521   -4.069  9.496   1.00 34.26  ? 271  LEU A CA    1 
ATOM   1685  C C     . LEU A  1 271 ? -3.785   -4.735  10.850  1.00 37.73  ? 271  LEU A C     1 
ATOM   1686  O O     . LEU A  1 271 ? -3.031   -5.633  11.252  1.00 38.96  ? 271  LEU A O     1 
ATOM   1687  C CB    . LEU A  1 271 ? -2.240   -3.229  9.595   1.00 35.19  ? 271  LEU A CB    1 
ATOM   1688  C CG    . LEU A  1 271 ? -1.507   -2.787  8.335   1.00 41.13  ? 271  LEU A CG    1 
ATOM   1689  C CD1   . LEU A  1 271 ? -0.057   -2.550  8.655   1.00 41.86  ? 271  LEU A CD1   1 
ATOM   1690  C CD2   . LEU A  1 271 ? -1.606   -3.808  7.219   1.00 45.67  ? 271  LEU A CD2   1 
ATOM   1691  N N     . LEU A  1 272 ? -4.818   -4.298  11.570  1.00 32.41  ? 272  LEU A N     1 
ATOM   1692  C CA    . LEU A  1 272 ? -5.116   -4.899  12.866  1.00 31.85  ? 272  LEU A CA    1 
ATOM   1693  C C     . LEU A  1 272 ? -5.739   -6.305  12.816  1.00 36.75  ? 272  LEU A C     1 
ATOM   1694  O O     . LEU A  1 272 ? -5.744   -7.017  13.819  1.00 35.86  ? 272  LEU A O     1 
ATOM   1695  C CB    . LEU A  1 272 ? -5.753   -3.920  13.890  1.00 31.71  ? 272  LEU A CB    1 
ATOM   1696  C CG    . LEU A  1 272 ? -7.158   -3.336  13.674  1.00 36.16  ? 272  LEU A CG    1 
ATOM   1697  C CD1   . LEU A  1 272 ? -7.485   -2.389  14.795  1.00 35.17  ? 272  LEU A CD1   1 
ATOM   1698  C CD2   . LEU A  1 272 ? -7.289   -2.574  12.329  1.00 41.47  ? 272  LEU A CD2   1 
ATOM   1699  N N     . SER A  1 273 ? -6.145   -6.742  11.614  1.00 36.82  ? 273  SER A N     1 
ATOM   1700  C CA    . SER A  1 273 ? -6.707   -8.070  11.353  1.00 38.28  ? 273  SER A CA    1 
ATOM   1701  C C     . SER A  1 273 ? -5.828   -8.867  10.362  1.00 47.07  ? 273  SER A C     1 
ATOM   1702  O O     . SER A  1 273 ? -6.282   -9.884  9.833   1.00 48.06  ? 273  SER A O     1 
ATOM   1703  C CB    . SER A  1 273 ? -8.130   -7.949  10.820  1.00 42.63  ? 273  SER A CB    1 
ATOM   1704  O OG    . SER A  1 273 ? -8.139   -7.374  9.523   1.00 57.71  ? 273  SER A OG    1 
ATOM   1705  N N     . ILE A  1 274 ? -4.566   -8.426  10.142  1.00 46.02  ? 274  ILE A N     1 
ATOM   1706  C CA    . ILE A  1 274 ? -3.638   -9.071  9.203   1.00 46.92  ? 274  ILE A CA    1 
ATOM   1707  C C     . ILE A  1 274 ? -2.588   -9.999  9.834   1.00 52.73  ? 274  ILE A C     1 
ATOM   1708  O O     . ILE A  1 274 ? -2.895   -11.161 10.067  1.00 53.35  ? 274  ILE A O     1 
ATOM   1709  C CB    . ILE A  1 274 ? -3.098   -8.143  8.054   1.00 50.42  ? 274  ILE A CB    1 
ATOM   1710  C CG1   . ILE A  1 274 ? -4.199   -7.318  7.354   1.00 50.16  ? 274  ILE A CG1   1 
ATOM   1711  C CG2   . ILE A  1 274 ? -2.260   -8.906  7.037   1.00 52.35  ? 274  ILE A CG2   1 
ATOM   1712  C CD1   . ILE A  1 274 ? -5.296   -8.089  6.654   1.00 58.45  ? 274  ILE A CD1   1 
ATOM   1713  N N     . GLY A  1 275 ? -1.358   -9.528  10.024  1.00 50.85  ? 275  GLY A N     1 
ATOM   1714  C CA    . GLY A  1 275 ? -0.247   -10.368 10.481  1.00 51.51  ? 275  GLY A CA    1 
ATOM   1715  C C     . GLY A  1 275 ? 0.271    -11.293 9.365   1.00 53.68  ? 275  GLY A C     1 
ATOM   1716  O O     . GLY A  1 275 ? -0.525   -11.750 8.552   1.00 54.74  ? 275  GLY A O     1 
ATOM   1717  N N     . GLY A  1 276 ? 1.575    -11.560 9.245   1.00 46.35  ? 276  GLY A N     1 
ATOM   1718  C CA    . GLY A  1 276 ? 2.651    -11.086 10.095  1.00 45.20  ? 276  GLY A CA    1 
ATOM   1719  C C     . GLY A  1 276 ? 3.000    -9.632  9.892   1.00 47.25  ? 276  GLY A C     1 
ATOM   1720  O O     . GLY A  1 276 ? 2.473    -8.780  10.615  1.00 48.64  ? 276  GLY A O     1 
ATOM   1721  N N     . THR A  1 277 ? 3.886    -9.328  8.929   1.00 40.46  ? 277  THR A N     1 
ATOM   1722  C CA    . THR A  1 277 ? 4.317    -7.948  8.684   1.00 39.26  ? 277  THR A CA    1 
ATOM   1723  C C     . THR A  1 277 ? 4.334    -7.548  7.223   1.00 39.66  ? 277  THR A C     1 
ATOM   1724  O O     . THR A  1 277 ? 4.829    -8.296  6.387   1.00 39.14  ? 277  THR A O     1 
ATOM   1725  C CB    . THR A  1 277 ? 5.659    -7.653  9.368   1.00 52.16  ? 277  THR A CB    1 
ATOM   1726  O OG1   . THR A  1 277 ? 6.112    -6.347  8.968   1.00 52.05  ? 277  THR A OG1   1 
ATOM   1727  C CG2   . THR A  1 277 ? 6.741    -8.718  9.056   1.00 53.28  ? 277  THR A CG2   1 
ATOM   1728  N N     . ILE A  1 278 ? 3.838    -6.341  6.927   1.00 34.33  ? 278  ILE A N     1 
ATOM   1729  C CA    . ILE A  1 278 ? 3.791    -5.796  5.557   1.00 33.75  ? 278  ILE A CA    1 
ATOM   1730  C C     . ILE A  1 278 ? 5.118    -5.159  5.142   1.00 39.33  ? 278  ILE A C     1 
ATOM   1731  O O     . ILE A  1 278 ? 5.376    -4.959  3.957   1.00 39.25  ? 278  ILE A O     1 
ATOM   1732  C CB    . ILE A  1 278 ? 2.527    -4.915  5.260   1.00 34.87  ? 278  ILE A CB    1 
ATOM   1733  C CG1   . ILE A  1 278 ? 2.467    -3.672  6.148   1.00 34.28  ? 278  ILE A CG1   1 
ATOM   1734  C CG2   . ILE A  1 278 ? 1.249    -5.743  5.386   1.00 33.96  ? 278  ILE A CG2   1 
ATOM   1735  C CD1   . ILE A  1 278 ? 1.890    -2.449  5.463   1.00 42.80  ? 278  ILE A CD1   1 
ATOM   1736  N N     . ILE A  1 279 ? 5.938    -4.831  6.142   1.00 38.48  ? 279  ILE A N     1 
ATOM   1737  C CA    . ILE A  1 279 ? 7.269    -4.261  6.027   1.00 41.65  ? 279  ILE A CA    1 
ATOM   1738  C C     . ILE A  1 279 ? 8.227    -5.417  5.683   1.00 51.02  ? 279  ILE A C     1 
ATOM   1739  O O     . ILE A  1 279 ? 9.280    -5.207  5.073   1.00 51.50  ? 279  ILE A O     1 
ATOM   1740  C CB    . ILE A  1 279 ? 7.595    -3.568  7.378   1.00 45.40  ? 279  ILE A CB    1 
ATOM   1741  C CG1   . ILE A  1 279 ? 7.204    -2.093  7.331   1.00 46.04  ? 279  ILE A CG1   1 
ATOM   1742  C CG2   . ILE A  1 279 ? 9.068    -3.736  7.832   1.00 49.97  ? 279  ILE A CG2   1 
ATOM   1743  C CD1   . ILE A  1 279 ? 7.335    -1.373  8.696   1.00 57.96  ? 279  ILE A CD1   1 
ATOM   1744  N N     . GLY A  1 280 ? 7.840    -6.628  6.085   1.00 50.13  ? 280  GLY A N     1 
ATOM   1745  C CA    . GLY A  1 280 ? 8.616    -7.837  5.858   1.00 50.78  ? 280  GLY A CA    1 
ATOM   1746  C C     . GLY A  1 280 ? 9.685    -7.979  6.907   1.00 57.38  ? 280  GLY A C     1 
ATOM   1747  O O     . GLY A  1 280 ? 10.169   -6.979  7.452   1.00 56.66  ? 280  GLY A O     1 
ATOM   1748  N N     . THR A  1 281 ? 10.049   -9.235  7.198   1.00 57.14  ? 281  THR A N     1 
ATOM   1749  C CA    . THR A  1 281 ? 11.080   -9.582  8.179   1.00 57.76  ? 281  THR A CA    1 
ATOM   1750  C C     . THR A  1 281 ? 12.299   -10.299 7.584   1.00 65.21  ? 281  THR A C     1 
ATOM   1751  O O     . THR A  1 281 ? 12.249   -10.794 6.453   1.00 64.70  ? 281  THR A O     1 
ATOM   1752  C CB    . THR A  1 281 ? 10.479   -10.237 9.425   1.00 58.83  ? 281  THR A CB    1 
ATOM   1753  O OG1   . THR A  1 281 ? 11.543   -10.528 10.329  1.00 56.68  ? 281  THR A OG1   1 
ATOM   1754  C CG2   . THR A  1 281 ? 9.687    -11.505 9.118   1.00 56.40  ? 281  THR A CG2   1 
ATOM   1755  N N     . ALA A  1 282 ? 13.403   -10.324 8.351   1.00 64.91  ? 282  ALA A N     1 
ATOM   1756  C CA    . ALA A  1 282 ? 14.666   -10.944 7.962   1.00 66.91  ? 282  ALA A CA    1 
ATOM   1757  C C     . ALA A  1 282 ? 15.488   -11.303 9.178   1.00 73.42  ? 282  ALA A C     1 
ATOM   1758  O O     . ALA A  1 282 ? 15.440   -10.600 10.195  1.00 71.79  ? 282  ALA A O     1 
ATOM   1759  C CB    . ALA A  1 282 ? 15.463   -10.003 7.071   1.00 68.98  ? 282  ALA A CB    1 
ATOM   1760  N N     . ARG A  1 283 ? 16.288   -12.382 9.042   1.00 73.92  ? 283  ARG A N     1 
ATOM   1761  C CA    . ARG A  1 283 ? 17.190   -12.878 10.081  1.00 75.60  ? 283  ARG A CA    1 
ATOM   1762  C C     . ARG A  1 283 ? 18.402   -11.941 10.279  1.00 83.40  ? 283  ARG A C     1 
ATOM   1763  O O     . ARG A  1 283 ? 18.942   -11.396 9.297   1.00 83.54  ? 283  ARG A O     1 
ATOM   1764  C CB    . ARG A  1 283 ? 17.649   -14.313 9.766   1.00 75.97  ? 283  ARG A CB    1 
ATOM   1765  N N     . CYS A  1 284 ? 18.804   -11.751 11.567  1.00 81.90  ? 284  CYS A N     1 
ATOM   1766  C CA    . CYS A  1 284 ? 19.942   -10.925 11.988  1.00 83.79  ? 284  CYS A CA    1 
ATOM   1767  C C     . CYS A  1 284 ? 21.200   -11.655 11.457  1.00 92.21  ? 284  CYS A C     1 
ATOM   1768  O O     . CYS A  1 284 ? 21.511   -12.761 11.935  1.00 92.89  ? 284  CYS A O     1 
ATOM   1769  C CB    . CYS A  1 284 ? 19.974   -10.761 13.515  1.00 83.49  ? 284  CYS A CB    1 
ATOM   1770  S SG    . CYS A  1 284 ? 18.345   -10.564 14.311  1.00 85.32  ? 284  CYS A SG    1 
ATOM   1771  N N     . LYS A  1 285 ? 21.851   -11.107 10.394  1.00 89.83  ? 285  LYS A N     1 
ATOM   1772  C CA    . LYS A  1 285 ? 23.003   -11.802 9.811   1.00 91.41  ? 285  LYS A CA    1 
ATOM   1773  C C     . LYS A  1 285 ? 24.181   -10.910 9.484   1.00 96.84  ? 285  LYS A C     1 
ATOM   1774  O O     . LYS A  1 285 ? 25.303   -11.200 9.904   1.00 97.27  ? 285  LYS A O     1 
ATOM   1775  C CB    . LYS A  1 285 ? 22.589   -12.638 8.593   1.00 94.38  ? 285  LYS A CB    1 
ATOM   1776  N N     . GLU A  1 286 ? 23.942   -9.850  8.699   1.00 93.87  ? 286  GLU A N     1 
ATOM   1777  C CA    . GLU A  1 286 ? 24.994   -8.894  8.315   1.00 94.72  ? 286  GLU A CA    1 
ATOM   1778  C C     . GLU A  1 286 ? 25.128   -7.826  9.408   1.00 94.14  ? 286  GLU A C     1 
ATOM   1779  O O     . GLU A  1 286 ? 26.182   -7.195  9.523   1.00 94.87  ? 286  GLU A O     1 
ATOM   1780  C CB    . GLU A  1 286 ? 24.713   -8.264  6.934   1.00 96.88  ? 286  GLU A CB    1 
ATOM   1781  C CG    . GLU A  1 286 ? 24.523   -9.295  5.828   1.00 111.36 ? 286  GLU A CG    1 
ATOM   1782  C CD    . GLU A  1 286 ? 23.684   -8.826  4.654   1.00 143.47 ? 286  GLU A CD    1 
ATOM   1783  O OE1   . GLU A  1 286 ? 22.436   -8.809  4.775   1.00 143.76 ? 286  GLU A OE1   1 
ATOM   1784  O OE2   . GLU A  1 286 ? 24.280   -8.503  3.600   1.00 143.19 ? 286  GLU A OE2   1 
ATOM   1785  N N     . PHE A  1 287 ? 24.062   -7.672  10.242  1.00 85.74  ? 287  PHE A N     1 
ATOM   1786  C CA    . PHE A  1 287 ? 23.973   -6.768  11.399  1.00 83.19  ? 287  PHE A CA    1 
ATOM   1787  C C     . PHE A  1 287 ? 24.664   -7.400  12.624  1.00 85.21  ? 287  PHE A C     1 
ATOM   1788  O O     . PHE A  1 287 ? 24.659   -6.818  13.708  1.00 84.29  ? 287  PHE A O     1 
ATOM   1789  C CB    . PHE A  1 287 ? 22.499   -6.438  11.705  1.00 82.46  ? 287  PHE A CB    1 
ATOM   1790  C CG    . PHE A  1 287 ? 22.249   -5.143  12.445  1.00 82.67  ? 287  PHE A CG    1 
ATOM   1791  C CD1   . PHE A  1 287 ? 21.922   -5.147  13.798  1.00 84.52  ? 287  PHE A CD1   1 
ATOM   1792  C CD2   . PHE A  1 287 ? 22.284   -3.925  11.778  1.00 83.69  ? 287  PHE A CD2   1 
ATOM   1793  C CE1   . PHE A  1 287 ? 21.672   -3.953  14.474  1.00 84.41  ? 287  PHE A CE1   1 
ATOM   1794  C CE2   . PHE A  1 287 ? 22.030   -2.735  12.453  1.00 85.38  ? 287  PHE A CE2   1 
ATOM   1795  C CZ    . PHE A  1 287 ? 21.721   -2.757  13.793  1.00 82.84  ? 287  PHE A CZ    1 
ATOM   1796  N N     . ARG A  1 288 ? 25.261   -8.594  12.437  1.00 81.09  ? 288  ARG A N     1 
ATOM   1797  C CA    . ARG A  1 288 ? 26.047   -9.321  13.437  1.00 80.93  ? 288  ARG A CA    1 
ATOM   1798  C C     . ARG A  1 288 ? 27.512   -8.838  13.333  1.00 85.64  ? 288  ARG A C     1 
ATOM   1799  O O     . ARG A  1 288 ? 28.282   -9.003  14.280  1.00 86.02  ? 288  ARG A O     1 
ATOM   1800  C CB    . ARG A  1 288 ? 25.973   -10.839 13.200  1.00 80.82  ? 288  ARG A CB    1 
ATOM   1801  C CG    . ARG A  1 288 ? 24.578   -11.429 13.320  1.00 89.55  ? 288  ARG A CG    1 
ATOM   1802  C CD    . ARG A  1 288 ? 24.596   -12.946 13.270  1.00 104.63 ? 288  ARG A CD    1 
ATOM   1803  N NE    . ARG A  1 288 ? 25.008   -13.533 14.545  1.00 117.32 ? 288  ARG A NE    1 
ATOM   1804  C CZ    . ARG A  1 288 ? 24.182   -13.807 15.549  1.00 128.66 ? 288  ARG A CZ    1 
ATOM   1805  N NH1   . ARG A  1 288 ? 22.881   -13.552 15.439  1.00 100.67 ? 288  ARG A NH1   1 
ATOM   1806  N NH2   . ARG A  1 288 ? 24.649   -14.340 16.672  1.00 122.51 ? 288  ARG A NH2   1 
ATOM   1807  N N     . GLU A  1 289 ? 27.867   -8.199  12.194  1.00 82.01  ? 289  GLU A N     1 
ATOM   1808  C CA    . GLU A  1 289 ? 29.183   -7.635  11.894  1.00 83.26  ? 289  GLU A CA    1 
ATOM   1809  C C     . GLU A  1 289 ? 29.170   -6.099  12.007  1.00 86.31  ? 289  GLU A C     1 
ATOM   1810  O O     . GLU A  1 289 ? 28.203   -5.465  11.577  1.00 85.65  ? 289  GLU A O     1 
ATOM   1811  C CB    . GLU A  1 289 ? 29.654   -8.076  10.499  1.00 85.58  ? 289  GLU A CB    1 
ATOM   1812  C CG    . GLU A  1 289 ? 30.229   -9.478  10.485  1.00 98.62  ? 289  GLU A CG    1 
ATOM   1813  C CD    . GLU A  1 289 ? 31.569   -9.602  9.781   1.00 126.40 ? 289  GLU A CD    1 
ATOM   1814  O OE1   . GLU A  1 289 ? 31.580   -9.956  8.579   1.00 123.32 ? 289  GLU A OE1   1 
ATOM   1815  O OE2   . GLU A  1 289 ? 32.610   -9.350  10.433  1.00 120.29 ? 289  GLU A OE2   1 
ATOM   1816  N N     . ARG A  1 290 ? 30.248   -5.511  12.585  1.00 81.76  ? 290  ARG A N     1 
ATOM   1817  C CA    . ARG A  1 290 ? 30.414   -4.067  12.814  1.00 80.28  ? 290  ARG A CA    1 
ATOM   1818  C C     . ARG A  1 290 ? 30.293   -3.207  11.561  1.00 80.12  ? 290  ARG A C     1 
ATOM   1819  O O     . ARG A  1 290 ? 29.655   -2.150  11.618  1.00 76.72  ? 290  ARG A O     1 
ATOM   1820  C CB    . ARG A  1 290 ? 31.723   -3.768  13.570  1.00 81.81  ? 290  ARG A CB    1 
ATOM   1821  N N     . TRP A  1 291 ? 30.876   -3.668  10.427  1.00 76.87  ? 291  TRP A N     1 
ATOM   1822  C CA    . TRP A  1 291 ? 30.843   -2.939  9.153   1.00 76.84  ? 291  TRP A CA    1 
ATOM   1823  C C     . TRP A  1 291 ? 29.449   -2.876  8.577   1.00 78.39  ? 291  TRP A C     1 
ATOM   1824  O O     . TRP A  1 291 ? 29.162   -1.990  7.764   1.00 79.53  ? 291  TRP A O     1 
ATOM   1825  C CB    . TRP A  1 291 ? 31.809   -3.534  8.136   1.00 77.29  ? 291  TRP A CB    1 
ATOM   1826  N N     . GLY A  1 292 ? 28.599   -3.809  9.018   1.00 70.74  ? 292  GLY A N     1 
ATOM   1827  C CA    . GLY A  1 292 ? 27.189   -3.898  8.655   1.00 66.92  ? 292  GLY A CA    1 
ATOM   1828  C C     . GLY A  1 292 ? 26.388   -2.885  9.443   1.00 65.16  ? 292  GLY A C     1 
ATOM   1829  O O     . GLY A  1 292 ? 25.522   -2.210  8.886   1.00 64.40  ? 292  GLY A O     1 
ATOM   1830  N N     . ARG A  1 293 ? 26.702   -2.757  10.746  1.00 58.11  ? 293  ARG A N     1 
ATOM   1831  C CA    . ARG A  1 293 ? 26.065   -1.813  11.662  1.00 55.86  ? 293  ARG A CA    1 
ATOM   1832  C C     . ARG A  1 293 ? 26.471   -0.384  11.323  1.00 62.88  ? 293  ARG A C     1 
ATOM   1833  O O     . ARG A  1 293 ? 25.659   0.534   11.492  1.00 61.11  ? 293  ARG A O     1 
ATOM   1834  C CB    . ARG A  1 293 ? 26.407   -2.151  13.113  1.00 51.92  ? 293  ARG A CB    1 
ATOM   1835  C CG    . ARG A  1 293 ? 25.868   -3.504  13.550  1.00 53.87  ? 293  ARG A CG    1 
ATOM   1836  C CD    . ARG A  1 293 ? 26.067   -3.751  15.038  1.00 59.72  ? 293  ARG A CD    1 
ATOM   1837  N NE    . ARG A  1 293 ? 27.458   -4.074  15.385  1.00 63.29  ? 293  ARG A NE    1 
ATOM   1838  C CZ    . ARG A  1 293 ? 27.986   -5.291  15.316  1.00 74.96  ? 293  ARG A CZ    1 
ATOM   1839  N NH1   . ARG A  1 293 ? 27.255   -6.316  14.908  1.00 66.80  ? 293  ARG A NH1   1 
ATOM   1840  N NH2   . ARG A  1 293 ? 29.241   -5.497  15.682  1.00 59.00  ? 293  ARG A NH2   1 
ATOM   1841  N N     . LEU A  1 294 ? 27.727   -0.207  10.816  1.00 63.13  ? 294  LEU A N     1 
ATOM   1842  C CA    . LEU A  1 294 ? 28.301   1.070   10.380  1.00 64.72  ? 294  LEU A CA    1 
ATOM   1843  C C     . LEU A  1 294 ? 27.504   1.589   9.189   1.00 70.93  ? 294  LEU A C     1 
ATOM   1844  O O     . LEU A  1 294 ? 27.139   2.768   9.165   1.00 71.14  ? 294  LEU A O     1 
ATOM   1845  C CB    . LEU A  1 294 ? 29.756   0.863   9.950   1.00 66.50  ? 294  LEU A CB    1 
ATOM   1846  C CG    . LEU A  1 294 ? 30.763   1.985   10.273  1.00 72.21  ? 294  LEU A CG    1 
ATOM   1847  C CD1   . LEU A  1 294 ? 32.174   1.495   10.055  1.00 74.47  ? 294  LEU A CD1   1 
ATOM   1848  C CD2   . LEU A  1 294 ? 30.509   3.246   9.452   1.00 73.54  ? 294  LEU A CD2   1 
ATOM   1849  N N     . GLN A  1 295 ? 27.239   0.702   8.208   1.00 68.47  ? 295  GLN A N     1 
ATOM   1850  C CA    . GLN A  1 295 ? 26.457   1.007   7.007   1.00 69.03  ? 295  GLN A CA    1 
ATOM   1851  C C     . GLN A  1 295 ? 24.995   1.350   7.372   1.00 72.16  ? 295  GLN A C     1 
ATOM   1852  O O     . GLN A  1 295 ? 24.441   2.312   6.832   1.00 72.96  ? 295  GLN A O     1 
ATOM   1853  C CB    . GLN A  1 295 ? 26.521   -0.153  5.993   1.00 70.83  ? 295  GLN A CB    1 
ATOM   1854  N N     . ALA A  1 296 ? 24.405   0.607   8.332   1.00 66.28  ? 296  ALA A N     1 
ATOM   1855  C CA    . ALA A  1 296 ? 23.049   0.831   8.838   1.00 64.49  ? 296  ALA A CA    1 
ATOM   1856  C C     . ALA A  1 296 ? 22.962   2.220   9.448   1.00 68.91  ? 296  ALA A C     1 
ATOM   1857  O O     . ALA A  1 296 ? 21.954   2.921   9.285   1.00 67.42  ? 296  ALA A O     1 
ATOM   1858  C CB    . ALA A  1 296 ? 22.703   -0.217  9.884   1.00 64.10  ? 296  ALA A CB    1 
ATOM   1859  N N     . CYS A  1 297 ? 24.052   2.632   10.114  1.00 67.06  ? 297  CYS A N     1 
ATOM   1860  C CA    . CYS A  1 297 ? 24.152   3.959   10.701  1.00 67.23  ? 297  CYS A CA    1 
ATOM   1861  C C     . CYS A  1 297 ? 24.204   5.039   9.618   1.00 72.61  ? 297  CYS A C     1 
ATOM   1862  O O     . CYS A  1 297 ? 23.418   5.986   9.676   1.00 71.89  ? 297  CYS A O     1 
ATOM   1863  C CB    . CYS A  1 297 ? 25.342   4.056   11.640  1.00 67.92  ? 297  CYS A CB    1 
ATOM   1864  S SG    . CYS A  1 297 ? 25.627   5.724   12.251  1.00 72.28  ? 297  CYS A SG    1 
ATOM   1865  N N     . TYR A  1 298 ? 25.109   4.883   8.629   1.00 70.21  ? 298  TYR A N     1 
ATOM   1866  C CA    . TYR A  1 298 ? 25.240   5.821   7.517   1.00 71.14  ? 298  TYR A CA    1 
ATOM   1867  C C     . TYR A  1 298 ? 23.885   6.120   6.885   1.00 72.82  ? 298  TYR A C     1 
ATOM   1868  O O     . TYR A  1 298 ? 23.487   7.283   6.821   1.00 72.97  ? 298  TYR A O     1 
ATOM   1869  C CB    . TYR A  1 298 ? 26.219   5.299   6.450   1.00 74.26  ? 298  TYR A CB    1 
ATOM   1870  C CG    . TYR A  1 298 ? 26.361   6.246   5.279   1.00 78.24  ? 298  TYR A CG    1 
ATOM   1871  C CD1   . TYR A  1 298 ? 27.071   7.440   5.403   1.00 82.26  ? 298  TYR A CD1   1 
ATOM   1872  C CD2   . TYR A  1 298 ? 25.771   5.960   4.051   1.00 78.93  ? 298  TYR A CD2   1 
ATOM   1873  C CE1   . TYR A  1 298 ? 27.193   8.327   4.335   1.00 85.35  ? 298  TYR A CE1   1 
ATOM   1874  C CE2   . TYR A  1 298 ? 25.899   6.833   2.968   1.00 81.33  ? 298  TYR A CE2   1 
ATOM   1875  C CZ    . TYR A  1 298 ? 26.607   8.020   3.118   1.00 91.23  ? 298  TYR A CZ    1 
ATOM   1876  O OH    . TYR A  1 298 ? 26.730   8.913   2.078   1.00 92.91  ? 298  TYR A OH    1 
ATOM   1877  N N     . ASN A  1 299 ? 23.165   5.060   6.484   1.00 66.40  ? 299  ASN A N     1 
ATOM   1878  C CA    . ASN A  1 299 ? 21.858   5.132   5.864   1.00 64.57  ? 299  ASN A CA    1 
ATOM   1879  C C     . ASN A  1 299 ? 20.867   5.957   6.679   1.00 68.80  ? 299  ASN A C     1 
ATOM   1880  O O     . ASN A  1 299 ? 20.097   6.727   6.096   1.00 68.03  ? 299  ASN A O     1 
ATOM   1881  C CB    . ASN A  1 299 ? 21.320   3.728   5.623   1.00 61.86  ? 299  ASN A CB    1 
ATOM   1882  C CG    . ASN A  1 299 ? 22.163   2.896   4.706   1.00 77.94  ? 299  ASN A CG    1 
ATOM   1883  O OD1   . ASN A  1 299 ? 22.985   3.408   3.939   1.00 83.18  ? 299  ASN A OD1   1 
ATOM   1884  N ND2   . ASN A  1 299 ? 21.998   1.590   4.790   1.00 60.59  ? 299  ASN A ND2   1 
ATOM   1885  N N     . MET A  1 300 ? 20.898   5.823   8.018   1.00 65.79  ? 300  MET A N     1 
ATOM   1886  C CA    . MET A  1 300 ? 20.004   6.589   8.890   1.00 65.37  ? 300  MET A CA    1 
ATOM   1887  C C     . MET A  1 300 ? 20.326   8.066   8.821   1.00 69.81  ? 300  MET A C     1 
ATOM   1888  O O     . MET A  1 300 ? 19.446   8.853   8.498   1.00 69.70  ? 300  MET A O     1 
ATOM   1889  C CB    . MET A  1 300 ? 20.052   6.071   10.329  1.00 67.40  ? 300  MET A CB    1 
ATOM   1890  C CG    . MET A  1 300 ? 19.298   4.777   10.502  1.00 70.13  ? 300  MET A CG    1 
ATOM   1891  S SD    . MET A  1 300 ? 19.376   4.215   12.194  1.00 74.17  ? 300  MET A SD    1 
ATOM   1892  C CE    . MET A  1 300 ? 18.128   5.261   12.950  1.00 69.71  ? 300  MET A CE    1 
ATOM   1893  N N     . VAL A  1 301 ? 21.605   8.427   9.027   1.00 67.09  ? 301  VAL A N     1 
ATOM   1894  C CA    . VAL A  1 301 ? 22.096   9.807   8.975   1.00 67.49  ? 301  VAL A CA    1 
ATOM   1895  C C     . VAL A  1 301 ? 21.814   10.439  7.598   1.00 70.11  ? 301  VAL A C     1 
ATOM   1896  O O     . VAL A  1 301 ? 21.216   11.521  7.547   1.00 69.06  ? 301  VAL A O     1 
ATOM   1897  C CB    . VAL A  1 301 ? 23.585   9.947   9.417   1.00 72.99  ? 301  VAL A CB    1 
ATOM   1898  C CG1   . VAL A  1 301 ? 23.925   11.398  9.746   1.00 73.73  ? 301  VAL A CG1   1 
ATOM   1899  C CG2   . VAL A  1 301 ? 23.895   9.063   10.621  1.00 72.40  ? 301  VAL A CG2   1 
ATOM   1900  N N     . SER A  1 302 ? 22.195   9.733   6.499   1.00 66.34  ? 302  SER A N     1 
ATOM   1901  C CA    . SER A  1 302 ? 22.014   10.147  5.097   1.00 66.52  ? 302  SER A CA    1 
ATOM   1902  C C     . SER A  1 302 ? 20.558   10.413  4.755   1.00 66.71  ? 302  SER A C     1 
ATOM   1903  O O     . SER A  1 302 ? 20.256   11.435  4.139   1.00 66.63  ? 302  SER A O     1 
ATOM   1904  C CB    . SER A  1 302 ? 22.548   9.082   4.141   1.00 71.73  ? 302  SER A CB    1 
ATOM   1905  O OG    . SER A  1 302 ? 23.811   8.593   4.554   1.00 84.95  ? 302  SER A OG    1 
ATOM   1906  N N     . ASN A  1 303 ? 19.657   9.493   5.153   1.00 60.29  ? 303  ASN A N     1 
ATOM   1907  C CA    . ASN A  1 303 ? 18.225   9.625   4.886   1.00 58.67  ? 303  ASN A CA    1 
ATOM   1908  C C     . ASN A  1 303 ? 17.503   10.501  5.938   1.00 60.81  ? 303  ASN A C     1 
ATOM   1909  O O     . ASN A  1 303 ? 16.275   10.605  5.934   1.00 59.70  ? 303  ASN A O     1 
ATOM   1910  C CB    . ASN A  1 303 ? 17.566   8.240   4.721   1.00 58.74  ? 303  ASN A CB    1 
ATOM   1911  C CG    . ASN A  1 303 ? 18.005   7.478   3.489   1.00 78.58  ? 303  ASN A CG    1 
ATOM   1912  O OD1   . ASN A  1 303 ? 19.175   7.104   3.345   1.00 69.46  ? 303  ASN A OD1   1 
ATOM   1913  N ND2   . ASN A  1 303 ? 17.065   7.203   2.579   1.00 70.50  ? 303  ASN A ND2   1 
ATOM   1914  N N     . GLY A  1 304 ? 18.280   11.122  6.813   1.00 57.17  ? 304  GLY A N     1 
ATOM   1915  C CA    . GLY A  1 304 ? 17.781   12.005  7.857   1.00 56.52  ? 304  GLY A CA    1 
ATOM   1916  C C     . GLY A  1 304 ? 16.908   11.341  8.895   1.00 57.55  ? 304  GLY A C     1 
ATOM   1917  O O     . GLY A  1 304 ? 16.044   11.993  9.498   1.00 56.75  ? 304  GLY A O     1 
ATOM   1918  N N     . ILE A  1 305 ? 17.117   10.035  9.095   1.00 52.44  ? 305  ILE A N     1 
ATOM   1919  C CA    . ILE A  1 305 ? 16.384   9.236   10.075  1.00 49.77  ? 305  ILE A CA    1 
ATOM   1920  C C     . ILE A  1 305 ? 16.991   9.525   11.443  1.00 58.66  ? 305  ILE A C     1 
ATOM   1921  O O     . ILE A  1 305 ? 18.190   9.314   11.664  1.00 58.74  ? 305  ILE A O     1 
ATOM   1922  C CB    . ILE A  1 305 ? 16.364   7.724   9.741   1.00 49.81  ? 305  ILE A CB    1 
ATOM   1923  C CG1   . ILE A  1 305 ? 15.969   7.416   8.269   1.00 47.87  ? 305  ILE A CG1   1 
ATOM   1924  C CG2   . ILE A  1 305 ? 15.528   6.971   10.756  1.00 48.48  ? 305  ILE A CG2   1 
ATOM   1925  C CD1   . ILE A  1 305 ? 14.626   7.948   7.750   1.00 47.75  ? 305  ILE A CD1   1 
ATOM   1926  N N     . ASP A  1 306 ? 16.154   10.057  12.337  1.00 58.49  ? 306  ASP A N     1 
ATOM   1927  C CA    . ASP A  1 306 ? 16.540   10.470  13.686  1.00 60.17  ? 306  ASP A CA    1 
ATOM   1928  C C     . ASP A  1 306 ? 16.064   9.503   14.781  1.00 60.12  ? 306  ASP A C     1 
ATOM   1929  O O     . ASP A  1 306 ? 16.562   9.556   15.916  1.00 60.71  ? 306  ASP A O     1 
ATOM   1930  C CB    . ASP A  1 306 ? 16.075   11.929  13.961  1.00 63.76  ? 306  ASP A CB    1 
ATOM   1931  C CG    . ASP A  1 306 ? 14.898   12.429  13.125  1.00 74.91  ? 306  ASP A CG    1 
ATOM   1932  O OD1   . ASP A  1 306 ? 13.834   11.768  13.137  1.00 72.30  ? 306  ASP A OD1   1 
ATOM   1933  O OD2   . ASP A  1 306 ? 15.033   13.502  12.493  1.00 85.77  ? 306  ASP A OD2   1 
ATOM   1934  N N     . ALA A  1 307 ? 15.122   8.610   14.427  1.00 51.41  ? 307  ALA A N     1 
ATOM   1935  C CA    . ALA A  1 307 ? 14.556   7.651   15.357  1.00 48.03  ? 307  ALA A CA    1 
ATOM   1936  C C     . ALA A  1 307 ? 14.337   6.309   14.720  1.00 48.42  ? 307  ALA A C     1 
ATOM   1937  O O     . ALA A  1 307 ? 13.956   6.230   13.553  1.00 47.97  ? 307  ALA A O     1 
ATOM   1938  C CB    . ALA A  1 307 ? 13.245   8.173   15.911  1.00 47.44  ? 307  ALA A CB    1 
ATOM   1939  N N     . LEU A  1 308 ? 14.532   5.248   15.515  1.00 42.41  ? 308  LEU A N     1 
ATOM   1940  C CA    . LEU A  1 308 ? 14.329   3.874   15.090  1.00 40.55  ? 308  LEU A CA    1 
ATOM   1941  C C     . LEU A  1 308 ? 13.435   3.109   16.061  1.00 38.24  ? 308  LEU A C     1 
ATOM   1942  O O     . LEU A  1 308 ? 13.597   3.201   17.275  1.00 35.50  ? 308  LEU A O     1 
ATOM   1943  C CB    . LEU A  1 308 ? 15.690   3.158   14.870  1.00 42.26  ? 308  LEU A CB    1 
ATOM   1944  C CG    . LEU A  1 308 ? 15.660   1.723   14.306  1.00 46.72  ? 308  LEU A CG    1 
ATOM   1945  C CD1   . LEU A  1 308 ? 15.106   1.694   12.895  1.00 46.48  ? 308  LEU A CD1   1 
ATOM   1946  C CD2   . LEU A  1 308 ? 17.034   1.129   14.318  1.00 50.82  ? 308  LEU A CD2   1 
ATOM   1947  N N     . VAL A  1 309 ? 12.485   2.371   15.512  1.00 35.26  ? 309  VAL A N     1 
ATOM   1948  C CA    . VAL A  1 309 ? 11.584   1.513   16.281  1.00 35.21  ? 309  VAL A CA    1 
ATOM   1949  C C     . VAL A  1 309 ? 11.745   0.100   15.758  1.00 42.88  ? 309  VAL A C     1 
ATOM   1950  O O     . VAL A  1 309 ? 11.469   -0.170  14.581  1.00 43.38  ? 309  VAL A O     1 
ATOM   1951  C CB    . VAL A  1 309 ? 10.111   1.973   16.368  1.00 36.79  ? 309  VAL A CB    1 
ATOM   1952  C CG1   . VAL A  1 309 ? 9.296    0.998   17.205  1.00 34.52  ? 309  VAL A CG1   1 
ATOM   1953  C CG2   . VAL A  1 309 ? 10.023   3.377   16.963  1.00 37.13  ? 309  VAL A CG2   1 
ATOM   1954  N N     . VAL A  1 310 ? 12.275   -0.774  16.631  1.00 39.72  ? 310  VAL A N     1 
ATOM   1955  C CA    . VAL A  1 310 ? 12.566   -2.169  16.343  1.00 39.10  ? 310  VAL A CA    1 
ATOM   1956  C C     . VAL A  1 310 ? 11.488   -3.064  16.990  1.00 44.97  ? 310  VAL A C     1 
ATOM   1957  O O     . VAL A  1 310 ? 11.376   -3.106  18.221  1.00 46.75  ? 310  VAL A O     1 
ATOM   1958  C CB    . VAL A  1 310 ? 13.988   -2.506  16.832  1.00 42.51  ? 310  VAL A CB    1 
ATOM   1959  C CG1   . VAL A  1 310 ? 14.290   -3.984  16.670  1.00 42.07  ? 310  VAL A CG1   1 
ATOM   1960  C CG2   . VAL A  1 310 ? 15.036   -1.651  16.118  1.00 43.60  ? 310  VAL A CG2   1 
ATOM   1961  N N     . CYS A  1 311 ? 10.669   -3.737  16.164  1.00 38.61  ? 311  CYS A N     1 
ATOM   1962  C CA    . CYS A  1 311 ? 9.673    -4.664  16.671  1.00 36.65  ? 311  CYS A CA    1 
ATOM   1963  C C     . CYS A  1 311 ? 10.156   -6.055  16.353  1.00 40.23  ? 311  CYS A C     1 
ATOM   1964  O O     . CYS A  1 311 ? 10.074   -6.501  15.205  1.00 40.54  ? 311  CYS A O     1 
ATOM   1965  C CB    . CYS A  1 311 ? 8.296    -4.400  16.075  1.00 36.74  ? 311  CYS A CB    1 
ATOM   1966  S SG    . CYS A  1 311 ? 7.045    -5.658  16.492  1.00 39.65  ? 311  CYS A SG    1 
ATOM   1967  N N     . GLY A  1 312 ? 10.699   -6.726  17.354  1.00 36.41  ? 312  GLY A N     1 
ATOM   1968  C CA    . GLY A  1 312 ? 11.226   -8.069  17.167  1.00 36.52  ? 312  GLY A CA    1 
ATOM   1969  C C     . GLY A  1 312 ? 11.397   -8.863  18.437  1.00 40.33  ? 312  GLY A C     1 
ATOM   1970  O O     . GLY A  1 312 ? 11.005   -8.410  19.514  1.00 40.58  ? 312  GLY A O     1 
ATOM   1971  N N     . GLY A  1 313 ? 11.972   -10.053 18.285  1.00 36.30  ? 313  GLY A N     1 
ATOM   1972  C CA    . GLY A  1 313 ? 12.257   -10.968 19.376  1.00 35.87  ? 313  GLY A CA    1 
ATOM   1973  C C     . GLY A  1 313 ? 13.582   -10.662 20.044  1.00 41.41  ? 313  GLY A C     1 
ATOM   1974  O O     . GLY A  1 313 ? 14.187   -9.613  19.791  1.00 40.84  ? 313  GLY A O     1 
ATOM   1975  N N     . ASP A  1 314 ? 14.045   -11.611 20.889  1.00 39.07  ? 314  ASP A N     1 
ATOM   1976  C CA    . ASP A  1 314 ? 15.279   -11.553 21.685  1.00 39.53  ? 314  ASP A CA    1 
ATOM   1977  C C     . ASP A  1 314 ? 16.496   -11.142 20.867  1.00 40.67  ? 314  ASP A C     1 
ATOM   1978  O O     . ASP A  1 314 ? 17.176   -10.173 21.247  1.00 40.06  ? 314  ASP A O     1 
ATOM   1979  C CB    . ASP A  1 314 ? 15.512   -12.887 22.412  1.00 42.64  ? 314  ASP A CB    1 
ATOM   1980  C CG    . ASP A  1 314 ? 14.272   -13.399 23.103  1.00 66.07  ? 314  ASP A CG    1 
ATOM   1981  O OD1   . ASP A  1 314 ? 13.392   -13.979 22.403  1.00 72.25  ? 314  ASP A OD1   1 
ATOM   1982  O OD2   . ASP A  1 314 ? 14.122   -13.135 24.313  1.00 70.70  ? 314  ASP A OD2   1 
ATOM   1983  N N     . GLY A  1 315 ? 16.706   -11.845 19.744  1.00 34.56  ? 315  GLY A N     1 
ATOM   1984  C CA    . GLY A  1 315 ? 17.799   -11.616 18.812  1.00 35.65  ? 315  GLY A CA    1 
ATOM   1985  C C     . GLY A  1 315 ? 17.790   -10.240 18.185  1.00 40.23  ? 315  GLY A C     1 
ATOM   1986  O O     . GLY A  1 315 ? 18.832   -9.602  18.085  1.00 40.08  ? 315  GLY A O     1 
ATOM   1987  N N     . SER A  1 316 ? 16.610   -9.763  17.790  1.00 38.45  ? 316  SER A N     1 
ATOM   1988  C CA    . SER A  1 316 ? 16.454   -8.456  17.157  1.00 39.79  ? 316  SER A CA    1 
ATOM   1989  C C     . SER A  1 316 ? 16.736   -7.340  18.136  1.00 47.71  ? 316  SER A C     1 
ATOM   1990  O O     . SER A  1 316 ? 17.310   -6.311  17.749  1.00 48.49  ? 316  SER A O     1 
ATOM   1991  C CB    . SER A  1 316 ? 15.058   -8.303  16.562  1.00 41.34  ? 316  SER A CB    1 
ATOM   1992  O OG    . SER A  1 316 ? 14.862   -9.268  15.542  1.00 50.08  ? 316  SER A OG    1 
ATOM   1993  N N     . LEU A  1 317 ? 16.355   -7.549  19.418  1.00 45.31  ? 317  LEU A N     1 
ATOM   1994  C CA    . LEU A  1 317 ? 16.542   -6.551  20.480  1.00 44.61  ? 317  LEU A CA    1 
ATOM   1995  C C     . LEU A  1 317 ? 17.962   -6.520  21.024  1.00 50.07  ? 317  LEU A C     1 
ATOM   1996  O O     . LEU A  1 317 ? 18.463   -5.447  21.375  1.00 49.56  ? 317  LEU A O     1 
ATOM   1997  C CB    . LEU A  1 317 ? 15.449   -6.639  21.554  1.00 42.60  ? 317  LEU A CB    1 
ATOM   1998  C CG    . LEU A  1 317 ? 14.021   -6.440  21.007  1.00 45.87  ? 317  LEU A CG    1 
ATOM   1999  C CD1   . LEU A  1 317 ? 12.979   -6.769  22.049  1.00 45.73  ? 317  LEU A CD1   1 
ATOM   2000  C CD2   . LEU A  1 317 ? 13.819   -5.041  20.365  1.00 45.66  ? 317  LEU A CD2   1 
ATOM   2001  N N     . THR A  1 318 ? 18.642   -7.678  20.982  1.00 47.75  ? 318  THR A N     1 
ATOM   2002  C CA    . THR A  1 318 ? 20.052   -7.809  21.353  1.00 49.72  ? 318  THR A CA    1 
ATOM   2003  C C     . THR A  1 318 ? 20.862   -6.981  20.333  1.00 56.45  ? 318  THR A C     1 
ATOM   2004  O O     . THR A  1 318 ? 21.787   -6.264  20.715  1.00 58.41  ? 318  THR A O     1 
ATOM   2005  C CB    . THR A  1 318 ? 20.436   -9.298  21.432  1.00 54.95  ? 318  THR A CB    1 
ATOM   2006  O OG1   . THR A  1 318 ? 19.633   -9.932  22.437  1.00 59.37  ? 318  THR A OG1   1 
ATOM   2007  C CG2   . THR A  1 318 ? 21.892   -9.522  21.741  1.00 48.98  ? 318  THR A CG2   1 
ATOM   2008  N N     . GLY A  1 319 ? 20.426   -7.016  19.077  1.00 52.91  ? 319  GLY A N     1 
ATOM   2009  C CA    . GLY A  1 319 ? 21.014   -6.254  17.980  1.00 54.31  ? 319  GLY A CA    1 
ATOM   2010  C C     . GLY A  1 319 ? 20.776   -4.765  18.125  1.00 59.92  ? 319  GLY A C     1 
ATOM   2011  O O     . GLY A  1 319 ? 21.710   -3.972  17.968  1.00 60.10  ? 319  GLY A O     1 
ATOM   2012  N N     . ALA A  1 320 ? 19.523   -4.383  18.469  1.00 56.39  ? 320  ALA A N     1 
ATOM   2013  C CA    . ALA A  1 320 ? 19.127   -2.989  18.674  1.00 56.41  ? 320  ALA A CA    1 
ATOM   2014  C C     . ALA A  1 320 ? 19.948   -2.374  19.830  1.00 62.01  ? 320  ALA A C     1 
ATOM   2015  O O     . ALA A  1 320 ? 20.456   -1.243  19.712  1.00 61.93  ? 320  ALA A O     1 
ATOM   2016  C CB    . ALA A  1 320 ? 17.634   -2.908  18.965  1.00 55.28  ? 320  ALA A CB    1 
ATOM   2017  N N     . ASP A  1 321 ? 20.123   -3.168  20.913  1.00 58.01  ? 321  ASP A N     1 
ATOM   2018  C CA    . ASP A  1 321 ? 20.899   -2.817  22.093  1.00 58.04  ? 321  ASP A CA    1 
ATOM   2019  C C     . ASP A  1 321 ? 22.378   -2.637  21.730  1.00 62.92  ? 321  ASP A C     1 
ATOM   2020  O O     . ASP A  1 321 ? 23.011   -1.700  22.219  1.00 65.03  ? 321  ASP A O     1 
ATOM   2021  C CB    . ASP A  1 321 ? 20.708   -3.887  23.173  1.00 59.10  ? 321  ASP A CB    1 
ATOM   2022  C CG    . ASP A  1 321 ? 21.689   -3.798  24.306  1.00 69.07  ? 321  ASP A CG    1 
ATOM   2023  O OD1   . ASP A  1 321 ? 22.693   -4.551  24.278  1.00 73.20  ? 321  ASP A OD1   1 
ATOM   2024  O OD2   . ASP A  1 321 ? 21.478   -2.954  25.203  1.00 70.66  ? 321  ASP A OD2   1 
ATOM   2025  N N     . LEU A  1 322 ? 22.925   -3.515  20.868  1.00 57.87  ? 322  LEU A N     1 
ATOM   2026  C CA    . LEU A  1 322 ? 24.327   -3.415  20.443  1.00 58.83  ? 322  LEU A CA    1 
ATOM   2027  C C     . LEU A  1 322 ? 24.560   -2.228  19.505  1.00 64.01  ? 322  LEU A C     1 
ATOM   2028  O O     . LEU A  1 322 ? 25.636   -1.633  19.539  1.00 64.68  ? 322  LEU A O     1 
ATOM   2029  C CB    . LEU A  1 322 ? 24.802   -4.711  19.790  1.00 58.70  ? 322  LEU A CB    1 
ATOM   2030  C CG    . LEU A  1 322 ? 26.297   -4.918  19.763  1.00 63.76  ? 322  LEU A CG    1 
ATOM   2031  C CD1   . LEU A  1 322 ? 26.712   -5.856  20.841  1.00 64.71  ? 322  LEU A CD1   1 
ATOM   2032  C CD2   . LEU A  1 322 ? 26.725   -5.474  18.460  1.00 64.75  ? 322  LEU A CD2   1 
ATOM   2033  N N     . PHE A  1 323 ? 23.545   -1.883  18.685  1.00 61.06  ? 323  PHE A N     1 
ATOM   2034  C CA    . PHE A  1 323 ? 23.570   -0.749  17.756  1.00 61.52  ? 323  PHE A CA    1 
ATOM   2035  C C     . PHE A  1 323 ? 23.581   0.543   18.564  1.00 66.21  ? 323  PHE A C     1 
ATOM   2036  O O     . PHE A  1 323 ? 24.322   1.461   18.220  1.00 66.25  ? 323  PHE A O     1 
ATOM   2037  C CB    . PHE A  1 323 ? 22.353   -0.796  16.809  1.00 62.04  ? 323  PHE A CB    1 
ATOM   2038  C CG    . PHE A  1 323 ? 22.360   0.145   15.625  1.00 64.27  ? 323  PHE A CG    1 
ATOM   2039  C CD1   . PHE A  1 323 ? 21.277   0.979   15.372  1.00 66.85  ? 323  PHE A CD1   1 
ATOM   2040  C CD2   . PHE A  1 323 ? 23.426   0.161   14.729  1.00 68.16  ? 323  PHE A CD2   1 
ATOM   2041  C CE1   . PHE A  1 323 ? 21.280   1.847   14.266  1.00 68.51  ? 323  PHE A CE1   1 
ATOM   2042  C CE2   . PHE A  1 323 ? 23.423   1.023   13.620  1.00 71.69  ? 323  PHE A CE2   1 
ATOM   2043  C CZ    . PHE A  1 323 ? 22.349   1.855   13.392  1.00 68.88  ? 323  PHE A CZ    1 
ATOM   2044  N N     . ARG A  1 324 ? 22.802   0.604   19.670  1.00 63.72  ? 324  ARG A N     1 
ATOM   2045  C CA    . ARG A  1 324 ? 22.812   1.807   20.505  1.00 64.90  ? 324  ARG A CA    1 
ATOM   2046  C C     . ARG A  1 324 ? 24.090   1.998   21.282  1.00 72.36  ? 324  ARG A C     1 
ATOM   2047  O O     . ARG A  1 324 ? 24.564   3.137   21.385  1.00 74.79  ? 324  ARG A O     1 
ATOM   2048  C CB    . ARG A  1 324 ? 21.532   2.045   21.328  1.00 64.61  ? 324  ARG A CB    1 
ATOM   2049  C CG    . ARG A  1 324 ? 21.126   0.971   22.311  1.00 72.59  ? 324  ARG A CG    1 
ATOM   2050  C CD    . ARG A  1 324 ? 21.417   1.393   23.722  1.00 75.34  ? 324  ARG A CD    1 
ATOM   2051  N NE    . ARG A  1 324 ? 22.726   0.903   24.142  1.00 84.10  ? 324  ARG A NE    1 
ATOM   2052  C CZ    . ARG A  1 324 ? 23.155   0.905   25.398  1.00 104.60 ? 324  ARG A CZ    1 
ATOM   2053  N NH1   . ARG A  1 324 ? 22.387   1.387   26.368  1.00 97.46  ? 324  ARG A NH1   1 
ATOM   2054  N NH2   . ARG A  1 324 ? 24.356   0.433   25.695  1.00 94.87  ? 324  ARG A NH2   1 
ATOM   2055  N N     . LYS A  1 325 ? 24.702   0.887   21.743  1.00 68.62  ? 325  LYS A N     1 
ATOM   2056  C CA    . LYS A  1 325 ? 25.988   0.906   22.442  1.00 69.79  ? 325  LYS A CA    1 
ATOM   2057  C C     . LYS A  1 325 ? 27.107   1.391   21.492  1.00 75.44  ? 325  LYS A C     1 
ATOM   2058  O O     . LYS A  1 325 ? 27.915   2.243   21.878  1.00 76.98  ? 325  LYS A O     1 
ATOM   2059  C CB    . LYS A  1 325 ? 26.310   -0.482  23.013  1.00 71.87  ? 325  LYS A CB    1 
ATOM   2060  N N     . GLU A  1 326 ? 27.096   0.903   20.232  1.00 71.16  ? 326  GLU A N     1 
ATOM   2061  C CA    . GLU A  1 326 ? 28.092   1.230   19.195  1.00 71.95  ? 326  GLU A CA    1 
ATOM   2062  C C     . GLU A  1 326 ? 27.819   2.504   18.363  1.00 77.49  ? 326  GLU A C     1 
ATOM   2063  O O     . GLU A  1 326 ? 28.661   2.891   17.537  1.00 77.59  ? 326  GLU A O     1 
ATOM   2064  C CB    . GLU A  1 326 ? 28.369   0.005   18.304  1.00 72.42  ? 326  GLU A CB    1 
ATOM   2065  C CG    . GLU A  1 326 ? 29.061   -1.118  19.064  1.00 72.56  ? 326  GLU A CG    1 
ATOM   2066  C CD    . GLU A  1 326 ? 29.237   -2.438  18.341  1.00 83.98  ? 326  GLU A CD    1 
ATOM   2067  O OE1   . GLU A  1 326 ? 28.548   -2.661  17.319  1.00 61.34  ? 326  GLU A OE1   1 
ATOM   2068  O OE2   . GLU A  1 326 ? 30.063   -3.259  18.807  1.00 84.88  ? 326  GLU A OE2   1 
ATOM   2069  N N     . TRP A  1 327 ? 26.649   3.154   18.586  1.00 74.37  ? 327  TRP A N     1 
ATOM   2070  C CA    . TRP A  1 327 ? 26.280   4.393   17.887  1.00 75.03  ? 327  TRP A CA    1 
ATOM   2071  C C     . TRP A  1 327 ? 27.231   5.590   18.197  1.00 80.85  ? 327  TRP A C     1 
ATOM   2072  O O     . TRP A  1 327 ? 27.670   6.232   17.239  1.00 80.44  ? 327  TRP A O     1 
ATOM   2073  C CB    . TRP A  1 327 ? 24.797   4.758   18.083  1.00 72.15  ? 327  TRP A CB    1 
ATOM   2074  C CG    . TRP A  1 327 ? 24.339   5.954   17.296  1.00 73.39  ? 327  TRP A CG    1 
ATOM   2075  C CD1   . TRP A  1 327 ? 24.400   7.256   17.688  1.00 76.93  ? 327  TRP A CD1   1 
ATOM   2076  C CD2   . TRP A  1 327 ? 23.666   5.948   16.027  1.00 72.92  ? 327  TRP A CD2   1 
ATOM   2077  N NE1   . TRP A  1 327 ? 23.855   8.068   16.723  1.00 76.52  ? 327  TRP A NE1   1 
ATOM   2078  C CE2   . TRP A  1 327 ? 23.393   7.293   15.693  1.00 77.22  ? 327  TRP A CE2   1 
ATOM   2079  C CE3   . TRP A  1 327 ? 23.271   4.935   15.132  1.00 73.70  ? 327  TRP A CE3   1 
ATOM   2080  C CZ2   . TRP A  1 327 ? 22.747   7.656   14.502  1.00 76.34  ? 327  TRP A CZ2   1 
ATOM   2081  C CZ3   . TRP A  1 327 ? 22.615   5.295   13.960  1.00 74.91  ? 327  TRP A CZ3   1 
ATOM   2082  C CH2   . TRP A  1 327 ? 22.373   6.641   13.647  1.00 75.95  ? 327  TRP A CH2   1 
ATOM   2083  N N     . PRO A  1 328 ? 27.619   5.896   19.470  1.00 78.38  ? 328  PRO A N     1 
ATOM   2084  C CA    . PRO A  1 328 ? 28.522   7.028   19.700  1.00 79.94  ? 328  PRO A CA    1 
ATOM   2085  C C     . PRO A  1 328 ? 29.798   6.958   18.874  1.00 89.53  ? 328  PRO A C     1 
ATOM   2086  O O     . PRO A  1 328 ? 30.562   7.932   18.853  1.00 92.91  ? 328  PRO A O     1 
ATOM   2087  C CB    . PRO A  1 328 ? 28.808   6.953   21.199  1.00 81.54  ? 328  PRO A CB    1 
ATOM   2088  C CG    . PRO A  1 328 ? 27.665   6.299   21.765  1.00 84.29  ? 328  PRO A CG    1 
ATOM   2089  C CD    . PRO A  1 328 ? 27.232   5.282   20.757  1.00 79.31  ? 328  PRO A CD    1 
ATOM   2090  N N     . GLU A  1 329 ? 30.022   5.811   18.185  1.00 85.95  ? 329  GLU A N     1 
ATOM   2091  C CA    . GLU A  1 329 ? 31.157   5.601   17.283  1.00 86.93  ? 329  GLU A CA    1 
ATOM   2092  C C     . GLU A  1 329 ? 30.724   5.914   15.834  1.00 85.97  ? 329  GLU A C     1 
ATOM   2093  O O     . GLU A  1 329 ? 30.049   5.119   15.156  1.00 82.61  ? 329  GLU A O     1 
ATOM   2094  C CB    . GLU A  1 329 ? 31.807   4.211   17.452  1.00 88.80  ? 329  GLU A CB    1 
ATOM   2095  C CG    . GLU A  1 329 ? 32.443   3.995   18.821  1.00 100.07 ? 329  GLU A CG    1 
ATOM   2096  C CD    . GLU A  1 329 ? 31.665   3.089   19.760  1.00 122.84 ? 329  GLU A CD    1 
ATOM   2097  O OE1   . GLU A  1 329 ? 32.139   1.959   20.016  1.00 121.01 ? 329  GLU A OE1   1 
ATOM   2098  O OE2   . GLU A  1 329 ? 30.584   3.503   20.240  1.00 112.72 ? 329  GLU A OE2   1 
ATOM   2099  N N     . LEU A  1 330 ? 31.058   7.157   15.434  1.00 81.07  ? 330  LEU A N     1 
ATOM   2100  C CA    . LEU A  1 330 ? 30.802   7.755   14.131  1.00 79.42  ? 330  LEU A CA    1 
ATOM   2101  C C     . LEU A  1 330 ? 32.145   8.188   13.514  1.00 81.76  ? 330  LEU A C     1 
ATOM   2102  O O     . LEU A  1 330 ? 32.832   9.100   14.001  1.00 81.33  ? 330  LEU A O     1 
ATOM   2103  C CB    . LEU A  1 330 ? 29.783   8.923   14.212  1.00 78.33  ? 330  LEU A CB    1 
ATOM   2104  C CG    . LEU A  1 330 ? 28.431   8.616   14.900  1.00 80.17  ? 330  LEU A CG    1 
ATOM   2105  C CD1   . LEU A  1 330 ? 27.501   9.814   14.896  1.00 79.23  ? 330  LEU A CD1   1 
ATOM   2106  C CD2   . LEU A  1 330 ? 27.743   7.495   14.231  1.00 82.46  ? 330  LEU A CD2   1 
ATOM   2107  N N     . ILE A  1 331 ? 32.536   7.434   12.480  1.00 75.72  ? 331  ILE A N     1 
ATOM   2108  C CA    . ILE A  1 331 ? 33.731   7.616   11.675  1.00 75.60  ? 331  ILE A CA    1 
ATOM   2109  C C     . ILE A  1 331 ? 33.439   8.749   10.658  1.00 79.62  ? 331  ILE A C     1 
ATOM   2110  O O     . ILE A  1 331 ? 32.314   8.875   10.144  1.00 76.00  ? 331  ILE A O     1 
ATOM   2111  C CB    . ILE A  1 331 ? 34.186   6.257   11.031  1.00 78.14  ? 331  ILE A CB    1 
ATOM   2112  C CG1   . ILE A  1 331 ? 34.297   5.120   12.119  1.00 76.79  ? 331  ILE A CG1   1 
ATOM   2113  C CG2   . ILE A  1 331 ? 35.517   6.419   10.236  1.00 81.41  ? 331  ILE A CG2   1 
ATOM   2114  C CD1   . ILE A  1 331 ? 34.603   3.629   11.637  1.00 71.88  ? 331  ILE A CD1   1 
ATOM   2115  N N     . LYS A  1 332 ? 34.453   9.613   10.427  1.00 80.00  ? 332  LYS A N     1 
ATOM   2116  C CA    . LYS A  1 332 ? 34.350   10.763  9.529   1.00 80.39  ? 332  LYS A CA    1 
ATOM   2117  C C     . LYS A  1 332 ? 35.384   10.810  8.370   1.00 84.14  ? 332  LYS A C     1 
ATOM   2118  O O     . LYS A  1 332 ? 36.557   10.486  8.553   1.00 82.90  ? 332  LYS A O     1 
ATOM   2119  C CB    . LYS A  1 332 ? 34.228   12.072  10.326  1.00 82.31  ? 332  LYS A CB    1 
ATOM   2120  C CG    . LYS A  1 332 ? 32.912   12.136  11.122  1.00 74.86  ? 332  LYS A CG    1 
ATOM   2121  C CD    . LYS A  1 332 ? 32.680   13.468  11.794  1.00 79.76  ? 332  LYS A CD    1 
ATOM   2122  C CE    . LYS A  1 332 ? 31.874   14.402  10.928  1.00 91.70  ? 332  LYS A CE    1 
ATOM   2123  N NZ    . LYS A  1 332 ? 31.567   15.668  11.635  1.00 106.78 ? 332  LYS A NZ    1 
ATOM   2124  N N     . GLU A  1 333 ? 34.879   11.171  7.167   1.00 80.83  ? 333  GLU A N     1 
ATOM   2125  C CA    . GLU A  1 333 ? 35.559   11.254  5.877   1.00 99.45  ? 333  GLU A CA    1 
ATOM   2126  C C     . GLU A  1 333 ? 35.805   12.703  5.437   1.00 119.57 ? 333  GLU A C     1 
ATOM   2127  O O     . GLU A  1 333 ? 34.896   13.532  5.462   1.00 82.41  ? 333  GLU A O     1 
ATOM   2128  C CB    . GLU A  1 333 ? 34.762   10.476  4.803   1.00 99.81  ? 333  GLU A CB    1 
ATOM   2129  C CG    . GLU A  1 333 ? 33.327   10.956  4.555   1.00 111.49 ? 333  GLU A CG    1 
ATOM   2130  C CD    . GLU A  1 333 ? 32.223   10.288  5.355   1.00 130.63 ? 333  GLU A CD    1 
ATOM   2131  O OE1   . GLU A  1 333 ? 31.931   10.760  6.478   1.00 124.06 ? 333  GLU A OE1   1 
ATOM   2132  O OE2   . GLU A  1 333 ? 31.597   9.341   4.823   1.00 120.89 ? 333  GLU A OE2   1 
ATOM   2133  N N     . LYS A  1 342 ? 30.594   17.385  9.213   1.00 73.32  ? 342  LYS A N     1 
ATOM   2134  C CA    . LYS A  1 342 ? 29.287   17.645  8.613   1.00 71.19  ? 342  LYS A CA    1 
ATOM   2135  C C     . LYS A  1 342 ? 28.257   17.886  9.696   1.00 76.55  ? 342  LYS A C     1 
ATOM   2136  O O     . LYS A  1 342 ? 28.302   17.213  10.730  1.00 75.14  ? 342  LYS A O     1 
ATOM   2137  C CB    . LYS A  1 342 ? 28.855   16.522  7.633   1.00 69.51  ? 342  LYS A CB    1 
ATOM   2138  C CG    . LYS A  1 342 ? 29.362   15.125  7.976   1.00 51.95  ? 342  LYS A CG    1 
ATOM   2139  C CD    . LYS A  1 342 ? 29.413   14.201  6.762   1.00 54.66  ? 342  LYS A CD    1 
ATOM   2140  C CE    . LYS A  1 342 ? 29.272   12.729  7.150   1.00 69.09  ? 342  LYS A CE    1 
ATOM   2141  N NZ    . LYS A  1 342 ? 29.334   11.788  5.989   1.00 79.17  ? 342  LYS A NZ    1 
ATOM   2142  N N     . GLU A  1 343 ? 27.335   18.863  9.463   1.00 74.87  ? 343  GLU A N     1 
ATOM   2143  C CA    . GLU A  1 343 ? 26.215   19.235  10.360  1.00 73.48  ? 343  GLU A CA    1 
ATOM   2144  C C     . GLU A  1 343 ? 25.396   18.004  10.727  1.00 75.05  ? 343  GLU A C     1 
ATOM   2145  O O     . GLU A  1 343 ? 24.802   17.958  11.806  1.00 73.00  ? 343  GLU A O     1 
ATOM   2146  C CB    . GLU A  1 343 ? 25.303   20.309  9.726   1.00 74.90  ? 343  GLU A CB    1 
ATOM   2147  C CG    . GLU A  1 343 ? 24.392   20.995  10.737  1.00 86.73  ? 343  GLU A CG    1 
ATOM   2148  C CD    . GLU A  1 343 ? 23.770   22.330  10.363  1.00 121.91 ? 343  GLU A CD    1 
ATOM   2149  O OE1   . GLU A  1 343 ? 24.480   23.202  9.807   1.00 121.68 ? 343  GLU A OE1   1 
ATOM   2150  O OE2   . GLU A  1 343 ? 22.588   22.536  10.721  1.00 120.24 ? 343  GLU A OE2   1 
ATOM   2151  N N     . GLN A  1 344 ? 25.427   16.990  9.835   1.00 71.89  ? 344  GLN A N     1 
ATOM   2152  C CA    . GLN A  1 344 ? 24.805   15.674  9.961   1.00 70.45  ? 344  GLN A CA    1 
ATOM   2153  C C     . GLN A  1 344 ? 25.211   15.039  11.297  1.00 74.08  ? 344  GLN A C     1 
ATOM   2154  O O     . GLN A  1 344 ? 24.348   14.457  11.969  1.00 71.45  ? 344  GLN A O     1 
ATOM   2155  C CB    . GLN A  1 344 ? 25.264   14.763  8.803   1.00 72.45  ? 344  GLN A CB    1 
ATOM   2156  C CG    . GLN A  1 344 ? 24.755   15.157  7.421   1.00 89.60  ? 344  GLN A CG    1 
ATOM   2157  C CD    . GLN A  1 344 ? 25.759   14.808  6.350   1.00 109.98 ? 344  GLN A CD    1 
ATOM   2158  O OE1   . GLN A  1 344 ? 26.081   13.639  6.128   1.00 101.09 ? 344  GLN A OE1   1 
ATOM   2159  N NE2   . GLN A  1 344 ? 26.269   15.817  5.652   1.00 110.46 ? 344  GLN A NE2   1 
ATOM   2160  N N     . TYR A  1 345 ? 26.526   15.182  11.687  1.00 72.20  ? 345  TYR A N     1 
ATOM   2161  C CA    . TYR A  1 345 ? 27.073   14.645  12.934  1.00 71.88  ? 345  TYR A CA    1 
ATOM   2162  C C     . TYR A  1 345 ? 26.388   15.191  14.174  1.00 76.48  ? 345  TYR A C     1 
ATOM   2163  O O     . TYR A  1 345 ? 25.981   14.401  15.012  1.00 74.17  ? 345  TYR A O     1 
ATOM   2164  C CB    . TYR A  1 345 ? 28.602   14.801  13.042  1.00 74.61  ? 345  TYR A CB    1 
ATOM   2165  C CG    . TYR A  1 345 ? 29.153   14.298  14.367  1.00 75.96  ? 345  TYR A CG    1 
ATOM   2166  C CD1   . TYR A  1 345 ? 29.519   12.962  14.534  1.00 77.21  ? 345  TYR A CD1   1 
ATOM   2167  C CD2   . TYR A  1 345 ? 29.267   15.148  15.468  1.00 76.84  ? 345  TYR A CD2   1 
ATOM   2168  C CE1   . TYR A  1 345 ? 29.990   12.487  15.761  1.00 76.63  ? 345  TYR A CE1   1 
ATOM   2169  C CE2   . TYR A  1 345 ? 29.718   14.678  16.704  1.00 77.12  ? 345  TYR A CE2   1 
ATOM   2170  C CZ    . TYR A  1 345 ? 30.076   13.347  16.846  1.00 80.08  ? 345  TYR A CZ    1 
ATOM   2171  O OH    . TYR A  1 345 ? 30.521   12.890  18.063  1.00 76.27  ? 345  TYR A OH    1 
ATOM   2172  N N     . GLU A  1 346 ? 26.323   16.522  14.326  1.00 76.46  ? 346  GLU A N     1 
ATOM   2173  C CA    . GLU A  1 346 ? 25.710   17.166  15.488  1.00 77.02  ? 346  GLU A CA    1 
ATOM   2174  C C     . GLU A  1 346 ? 24.219   16.917  15.531  1.00 80.43  ? 346  GLU A C     1 
ATOM   2175  O O     . GLU A  1 346 ? 23.655   16.776  16.618  1.00 80.26  ? 346  GLU A O     1 
ATOM   2176  C CB    . GLU A  1 346 ? 26.003   18.675  15.512  1.00 80.42  ? 346  GLU A CB    1 
ATOM   2177  C CG    . GLU A  1 346 ? 26.871   19.109  16.682  1.00 97.73  ? 346  GLU A CG    1 
ATOM   2178  C CD    . GLU A  1 346 ? 28.268   18.514  16.738  1.00 132.71 ? 346  GLU A CD    1 
ATOM   2179  O OE1   . GLU A  1 346 ? 28.970   18.532  15.700  1.00 135.08 ? 346  GLU A OE1   1 
ATOM   2180  O OE2   . GLU A  1 346 ? 28.664   18.038  17.828  1.00 129.21 ? 346  GLU A OE2   1 
ATOM   2181  N N     . THR A  1 347 ? 23.582   16.859  14.347  1.00 75.91  ? 347  THR A N     1 
ATOM   2182  C CA    . THR A  1 347 ? 22.156   16.608  14.214  1.00 73.62  ? 347  THR A CA    1 
ATOM   2183  C C     . THR A  1 347 ? 21.891   15.176  14.704  1.00 78.60  ? 347  THR A C     1 
ATOM   2184  O O     . THR A  1 347 ? 21.289   15.011  15.767  1.00 77.42  ? 347  THR A O     1 
ATOM   2185  C CB    . THR A  1 347 ? 21.677   16.925  12.768  1.00 74.78  ? 347  THR A CB    1 
ATOM   2186  O OG1   . THR A  1 347 ? 21.979   18.283  12.450  1.00 69.91  ? 347  THR A OG1   1 
ATOM   2187  C CG2   . THR A  1 347 ? 20.183   16.714  12.577  1.00 72.42  ? 347  THR A CG2   1 
ATOM   2188  N N     . HIS A  1 348 ? 22.423   14.160  13.992  1.00 76.60  ? 348  HIS A N     1 
ATOM   2189  C CA    . HIS A  1 348 ? 22.207   12.750  14.310  1.00 75.91  ? 348  HIS A CA    1 
ATOM   2190  C C     . HIS A  1 348 ? 23.298   12.124  15.210  1.00 83.11  ? 348  HIS A C     1 
ATOM   2191  O O     . HIS A  1 348 ? 23.754   11.005  14.956  1.00 83.68  ? 348  HIS A O     1 
ATOM   2192  C CB    . HIS A  1 348 ? 21.964   11.953  13.017  1.00 76.56  ? 348  HIS A CB    1 
ATOM   2193  C CG    . HIS A  1 348 ? 21.008   12.620  12.069  1.00 80.18  ? 348  HIS A CG    1 
ATOM   2194  N ND1   . HIS A  1 348 ? 21.466   13.416  11.027  1.00 83.70  ? 348  HIS A ND1   1 
ATOM   2195  C CD2   . HIS A  1 348 ? 19.650   12.618  12.054  1.00 80.84  ? 348  HIS A CD2   1 
ATOM   2196  C CE1   . HIS A  1 348 ? 20.381   13.844  10.398  1.00 82.58  ? 348  HIS A CE1   1 
ATOM   2197  N NE2   . HIS A  1 348 ? 19.264   13.399  10.984  1.00 81.20  ? 348  HIS A NE2   1 
ATOM   2198  N N     . ARG A  1 349 ? 23.690   12.847  16.282  1.00 80.61  ? 349  ARG A N     1 
ATOM   2199  C CA    . ARG A  1 349 ? 24.713   12.441  17.269  1.00 80.75  ? 349  ARG A CA    1 
ATOM   2200  C C     . ARG A  1 349 ? 24.126   11.530  18.341  1.00 81.11  ? 349  ARG A C     1 
ATOM   2201  O O     . ARG A  1 349 ? 24.851   10.700  18.892  1.00 79.86  ? 349  ARG A O     1 
ATOM   2202  C CB    . ARG A  1 349 ? 25.301   13.686  17.962  1.00 82.95  ? 349  ARG A CB    1 
ATOM   2203  C CG    . ARG A  1 349 ? 26.720   13.519  18.495  1.00 99.30  ? 349  ARG A CG    1 
ATOM   2204  C CD    . ARG A  1 349 ? 27.013   14.392  19.717  1.00 118.83 ? 349  ARG A CD    1 
ATOM   2205  N NE    . ARG A  1 349 ? 26.819   15.829  19.475  1.00 136.75 ? 349  ARG A NE    1 
ATOM   2206  C CZ    . ARG A  1 349 ? 25.882   16.577  20.060  1.00 150.99 ? 349  ARG A CZ    1 
ATOM   2207  N NH1   . ARG A  1 349 ? 25.045   16.039  20.939  1.00 132.63 ? 349  ARG A NH1   1 
ATOM   2208  N NH2   . ARG A  1 349 ? 25.780   17.868  19.774  1.00 140.17 ? 349  ARG A NH2   1 
ATOM   2209  N N     . ASN A  1 350 ? 22.831   11.741  18.682  1.00 74.93  ? 350  ASN A N     1 
ATOM   2210  C CA    . ASN A  1 350 ? 22.152   10.988  19.722  1.00 72.55  ? 350  ASN A CA    1 
ATOM   2211  C C     . ASN A  1 350 ? 21.052   10.121  19.142  1.00 73.55  ? 350  ASN A C     1 
ATOM   2212  O O     . ASN A  1 350 ? 20.006   10.630  18.703  1.00 74.70  ? 350  ASN A O     1 
ATOM   2213  C CB    . ASN A  1 350 ? 21.615   11.917  20.805  1.00 71.56  ? 350  ASN A CB    1 
ATOM   2214  C CG    . ASN A  1 350 ? 22.638   12.882  21.321  1.00 90.27  ? 350  ASN A CG    1 
ATOM   2215  O OD1   . ASN A  1 350 ? 23.497   12.552  22.149  1.00 80.32  ? 350  ASN A OD1   1 
ATOM   2216  N ND2   . ASN A  1 350 ? 22.567   14.096  20.824  1.00 85.21  ? 350  ASN A ND2   1 
ATOM   2217  N N     . LEU A  1 351 ? 21.293   8.795   19.139  1.00 64.37  ? 351  LEU A N     1 
ATOM   2218  C CA    . LEU A  1 351 ? 20.347   7.821   18.617  1.00 59.28  ? 351  LEU A CA    1 
ATOM   2219  C C     . LEU A  1 351 ? 19.129   7.750   19.503  1.00 59.16  ? 351  LEU A C     1 
ATOM   2220  O O     . LEU A  1 351 ? 19.251   7.669   20.728  1.00 58.00  ? 351  LEU A O     1 
ATOM   2221  C CB    . LEU A  1 351 ? 21.018   6.438   18.494  1.00 58.18  ? 351  LEU A CB    1 
ATOM   2222  C CG    . LEU A  1 351 ? 20.206   5.284   17.879  1.00 58.98  ? 351  LEU A CG    1 
ATOM   2223  C CD1   . LEU A  1 351 ? 19.849   5.545   16.426  1.00 57.78  ? 351  LEU A CD1   1 
ATOM   2224  C CD2   . LEU A  1 351 ? 20.966   3.994   17.996  1.00 58.66  ? 351  LEU A CD2   1 
ATOM   2225  N N     . THR A  1 352 ? 17.958   7.813   18.883  1.00 54.46  ? 352  THR A N     1 
ATOM   2226  C CA    . THR A  1 352 ? 16.700   7.637   19.592  1.00 53.51  ? 352  THR A CA    1 
ATOM   2227  C C     . THR A  1 352 ? 16.203   6.266   19.146  1.00 56.96  ? 352  THR A C     1 
ATOM   2228  O O     . THR A  1 352 ? 15.811   6.110   17.991  1.00 57.78  ? 352  THR A O     1 
ATOM   2229  C CB    . THR A  1 352 ? 15.741   8.817   19.352  1.00 65.22  ? 352  THR A CB    1 
ATOM   2230  O OG1   . THR A  1 352 ? 16.349   9.993   19.883  1.00 72.56  ? 352  THR A OG1   1 
ATOM   2231  C CG2   . THR A  1 352 ? 14.369   8.619   20.010  1.00 60.47  ? 352  THR A CG2   1 
ATOM   2232  N N     . ILE A  1 353 ? 16.304   5.257   20.026  1.00 51.00  ? 353  ILE A N     1 
ATOM   2233  C CA    . ILE A  1 353 ? 15.876   3.906   19.695  1.00 49.37  ? 353  ILE A CA    1 
ATOM   2234  C C     . ILE A  1 353 ? 14.892   3.321   20.715  1.00 51.04  ? 353  ILE A C     1 
ATOM   2235  O O     . ILE A  1 353 ? 15.150   3.338   21.912  1.00 50.81  ? 353  ILE A O     1 
ATOM   2236  C CB    . ILE A  1 353 ? 17.085   2.994   19.372  1.00 54.06  ? 353  ILE A CB    1 
ATOM   2237  C CG1   . ILE A  1 353 ? 16.630   1.616   18.798  1.00 54.05  ? 353  ILE A CG1   1 
ATOM   2238  C CG2   . ILE A  1 353 ? 18.061   2.867   20.564  1.00 55.24  ? 353  ILE A CG2   1 
ATOM   2239  C CD1   . ILE A  1 353 ? 17.713   0.792   18.084  1.00 61.42  ? 353  ILE A CD1   1 
ATOM   2240  N N     . VAL A  1 354 ? 13.761   2.819   20.236  1.00 46.72  ? 354  VAL A N     1 
ATOM   2241  C CA    . VAL A  1 354 ? 12.728   2.206   21.078  1.00 45.61  ? 354  VAL A CA    1 
ATOM   2242  C C     . VAL A  1 354 ? 12.513   0.767   20.611  1.00 49.68  ? 354  VAL A C     1 
ATOM   2243  O O     . VAL A  1 354 ? 12.567   0.496   19.405  1.00 50.16  ? 354  VAL A O     1 
ATOM   2244  C CB    . VAL A  1 354 ? 11.415   3.036   21.029  1.00 48.78  ? 354  VAL A CB    1 
ATOM   2245  C CG1   . VAL A  1 354 ? 10.234   2.281   21.627  1.00 47.32  ? 354  VAL A CG1   1 
ATOM   2246  C CG2   . VAL A  1 354 ? 11.603   4.368   21.733  1.00 49.45  ? 354  VAL A CG2   1 
ATOM   2247  N N     . GLY A  1 355 ? 12.256   -0.134  21.558  1.00 44.69  ? 355  GLY A N     1 
ATOM   2248  C CA    . GLY A  1 355 ? 12.004   -1.533  21.229  1.00 43.03  ? 355  GLY A CA    1 
ATOM   2249  C C     . GLY A  1 355 ? 10.632   -2.069  21.591  1.00 38.89  ? 355  GLY A C     1 
ATOM   2250  O O     . GLY A  1 355 ? 10.164   -1.850  22.706  1.00 36.38  ? 355  GLY A O     1 
ATOM   2251  N N     . LEU A  1 356 ? 9.992    -2.791  20.647  1.00 31.21  ? 356  LEU A N     1 
ATOM   2252  C CA    . LEU A  1 356 ? 8.716    -3.471  20.876  1.00 29.05  ? 356  LEU A CA    1 
ATOM   2253  C C     . LEU A  1 356 ? 8.993    -4.962  20.820  1.00 38.69  ? 356  LEU A C     1 
ATOM   2254  O O     . LEU A  1 356 ? 9.763    -5.401  19.963  1.00 40.16  ? 356  LEU A O     1 
ATOM   2255  C CB    . LEU A  1 356 ? 7.672    -3.128  19.818  1.00 26.97  ? 356  LEU A CB    1 
ATOM   2256  C CG    . LEU A  1 356 ? 7.148    -1.735  19.800  1.00 29.76  ? 356  LEU A CG    1 
ATOM   2257  C CD1   . LEU A  1 356 ? 6.535    -1.416  18.467  1.00 29.03  ? 356  LEU A CD1   1 
ATOM   2258  C CD2   . LEU A  1 356 ? 6.180    -1.501  20.927  1.00 30.02  ? 356  LEU A CD2   1 
ATOM   2259  N N     . VAL A  1 357 ? 8.392    -5.751  21.719  1.00 37.06  ? 357  VAL A N     1 
ATOM   2260  C CA    . VAL A  1 357 ? 8.668    -7.181  21.664  1.00 38.05  ? 357  VAL A CA    1 
ATOM   2261  C C     . VAL A  1 357 ? 7.650    -7.932  20.841  1.00 44.33  ? 357  VAL A C     1 
ATOM   2262  O O     . VAL A  1 357 ? 6.552    -8.227  21.323  1.00 44.15  ? 357  VAL A O     1 
ATOM   2263  C CB    . VAL A  1 357 ? 8.999    -7.893  23.005  1.00 41.64  ? 357  VAL A CB    1 
ATOM   2264  C CG1   . VAL A  1 357 ? 9.795    -9.168  22.747  1.00 41.44  ? 357  VAL A CG1   1 
ATOM   2265  C CG2   . VAL A  1 357 ? 9.757    -6.976  23.958  1.00 42.27  ? 357  VAL A CG2   1 
ATOM   2266  N N     . GLY A  1 358 ? 8.033    -8.222  19.603  1.00 42.22  ? 358  GLY A N     1 
ATOM   2267  C CA    . GLY A  1 358 ? 7.253    -9.033  18.679  1.00 42.13  ? 358  GLY A CA    1 
ATOM   2268  C C     . GLY A  1 358 ? 7.813    -10.438 18.750  1.00 46.52  ? 358  GLY A C     1 
ATOM   2269  O O     . GLY A  1 358 ? 8.818    -10.743 18.087  1.00 48.45  ? 358  GLY A O     1 
ATOM   2270  N N     . SER A  1 359 ? 7.224    -11.284 19.623  1.00 40.32  ? 359  SER A N     1 
ATOM   2271  C CA    . SER A  1 359 ? 7.701    -12.651 19.859  1.00 39.47  ? 359  SER A CA    1 
ATOM   2272  C C     . SER A  1 359 ? 6.626    -13.644 20.310  1.00 39.86  ? 359  SER A C     1 
ATOM   2273  O O     . SER A  1 359 ? 5.950    -13.389 21.299  1.00 38.67  ? 359  SER A O     1 
ATOM   2274  C CB    . SER A  1 359 ? 8.888    -12.631 20.827  1.00 42.58  ? 359  SER A CB    1 
ATOM   2275  O OG    . SER A  1 359 ? 8.741    -13.479 21.952  1.00 44.89  ? 359  SER A OG    1 
ATOM   2276  N N     . ILE A  1 360 ? 6.493    -14.781 19.601  1.00 35.94  ? 360  ILE A N     1 
ATOM   2277  C CA    . ILE A  1 360 ? 5.553    -15.843 19.962  1.00 36.21  ? 360  ILE A CA    1 
ATOM   2278  C C     . ILE A  1 360 ? 6.042    -16.603 21.225  1.00 46.42  ? 360  ILE A C     1 
ATOM   2279  O O     . ILE A  1 360 ? 5.230    -17.136 21.987  1.00 47.90  ? 360  ILE A O     1 
ATOM   2280  C CB    . ILE A  1 360 ? 5.217    -16.800 18.786  1.00 39.15  ? 360  ILE A CB    1 
ATOM   2281  C CG1   . ILE A  1 360 ? 6.344    -17.814 18.479  1.00 40.36  ? 360  ILE A CG1   1 
ATOM   2282  C CG2   . ILE A  1 360 ? 4.722    -16.047 17.539  1.00 40.61  ? 360  ILE A CG2   1 
ATOM   2283  C CD1   . ILE A  1 360 ? 5.949    -19.042 17.681  1.00 47.11  ? 360  ILE A CD1   1 
ATOM   2284  N N     . ASP A  1 361 ? 7.372    -16.625 21.429  1.00 44.63  ? 361  ASP A N     1 
ATOM   2285  C CA    . ASP A  1 361 ? 8.156    -17.250 22.504  1.00 44.85  ? 361  ASP A CA    1 
ATOM   2286  C C     . ASP A  1 361 ? 7.666    -16.927 23.916  1.00 46.37  ? 361  ASP A C     1 
ATOM   2287  O O     . ASP A  1 361 ? 7.439    -17.827 24.722  1.00 45.24  ? 361  ASP A O     1 
ATOM   2288  C CB    . ASP A  1 361 ? 9.605    -16.707 22.378  1.00 48.81  ? 361  ASP A CB    1 
ATOM   2289  C CG    . ASP A  1 361 ? 10.740   -17.683 22.543  1.00 67.33  ? 361  ASP A CG    1 
ATOM   2290  O OD1   . ASP A  1 361 ? 10.511   -18.768 23.133  1.00 70.15  ? 361  ASP A OD1   1 
ATOM   2291  O OD2   . ASP A  1 361 ? 11.879   -17.351 22.109  1.00 74.14  ? 361  ASP A OD2   1 
ATOM   2292  N N     . ASN A  1 362 ? 7.521    -15.617 24.186  1.00 43.62  ? 362  ASN A N     1 
ATOM   2293  C CA    . ASN A  1 362 ? 7.265    -14.927 25.452  1.00 43.75  ? 362  ASN A CA    1 
ATOM   2294  C C     . ASN A  1 362 ? 8.496    -15.021 26.370  1.00 49.82  ? 362  ASN A C     1 
ATOM   2295  O O     . ASN A  1 362 ? 8.372    -15.038 27.597  1.00 50.04  ? 362  ASN A O     1 
ATOM   2296  C CB    . ASN A  1 362 ? 5.921    -15.274 26.133  1.00 41.22  ? 362  ASN A CB    1 
ATOM   2297  C CG    . ASN A  1 362 ? 5.487    -14.234 27.163  1.00 40.10  ? 362  ASN A CG    1 
ATOM   2298  O OD1   . ASN A  1 362 ? 6.146    -13.212 27.394  1.00 31.41  ? 362  ASN A OD1   1 
ATOM   2299  N ND2   . ASN A  1 362 ? 4.392    -14.494 27.848  1.00 25.40  ? 362  ASN A ND2   1 
ATOM   2300  N N     . ASP A  1 363 ? 9.697    -15.026 25.742  1.00 47.12  ? 363  ASP A N     1 
ATOM   2301  C CA    . ASP A  1 363 ? 10.980   -15.142 26.429  1.00 47.97  ? 363  ASP A CA    1 
ATOM   2302  C C     . ASP A  1 363 ? 11.458   -13.848 27.096  1.00 51.75  ? 363  ASP A C     1 
ATOM   2303  O O     . ASP A  1 363 ? 11.953   -13.909 28.234  1.00 51.86  ? 363  ASP A O     1 
ATOM   2304  C CB    . ASP A  1 363 ? 12.054   -15.722 25.492  1.00 50.67  ? 363  ASP A CB    1 
ATOM   2305  C CG    . ASP A  1 363 ? 13.347   -16.082 26.174  1.00 60.76  ? 363  ASP A CG    1 
ATOM   2306  O OD1   . ASP A  1 363 ? 13.295   -16.619 27.296  1.00 60.84  ? 363  ASP A OD1   1 
ATOM   2307  O OD2   . ASP A  1 363 ? 14.415   -15.824 25.585  1.00 72.42  ? 363  ASP A OD2   1 
ATOM   2308  N N     . MET A  1 364 ? 11.305   -12.688 26.404  1.00 46.90  ? 364  MET A N     1 
ATOM   2309  C CA    . MET A  1 364 ? 11.746   -11.383 26.917  1.00 47.37  ? 364  MET A CA    1 
ATOM   2310  C C     . MET A  1 364 ? 11.353   -11.054 28.356  1.00 51.30  ? 364  MET A C     1 
ATOM   2311  O O     . MET A  1 364 ? 10.176   -11.177 28.735  1.00 50.33  ? 364  MET A O     1 
ATOM   2312  C CB    . MET A  1 364 ? 11.339   -10.237 25.982  1.00 49.19  ? 364  MET A CB    1 
ATOM   2313  C CG    . MET A  1 364 ? 12.156   -8.960  26.162  1.00 53.46  ? 364  MET A CG    1 
ATOM   2314  S SD    . MET A  1 364 ? 13.897   -9.237  25.737  1.00 59.95  ? 364  MET A SD    1 
ATOM   2315  C CE    . MET A  1 364 ? 14.425   -7.595  25.463  1.00 57.32  ? 364  MET A CE    1 
ATOM   2316  N N     . CYS A  1 365 ? 12.366   -10.616 29.132  1.00 47.86  ? 365  CYS A N     1 
ATOM   2317  C CA    . CYS A  1 365 ? 12.283   -10.187 30.528  1.00 47.21  ? 365  CYS A CA    1 
ATOM   2318  C C     . CYS A  1 365 ? 11.698   -8.795  30.649  1.00 49.06  ? 365  CYS A C     1 
ATOM   2319  O O     . CYS A  1 365 ? 11.874   -7.963  29.753  1.00 49.89  ? 365  CYS A O     1 
ATOM   2320  C CB    . CYS A  1 365 ? 13.661   -10.238 31.171  1.00 48.77  ? 365  CYS A CB    1 
ATOM   2321  S SG    . CYS A  1 365 ? 14.309   -11.905 31.392  1.00 53.12  ? 365  CYS A SG    1 
ATOM   2322  N N     . GLY A  1 366 ? 11.069   -8.536  31.789  1.00 43.54  ? 366  GLY A N     1 
ATOM   2323  C CA    . GLY A  1 366 ? 10.494   -7.232  32.104  1.00 42.91  ? 366  GLY A CA    1 
ATOM   2324  C C     . GLY A  1 366 ? 9.078    -7.019  31.628  1.00 44.04  ? 366  GLY A C     1 
ATOM   2325  O O     . GLY A  1 366 ? 8.421    -6.070  32.061  1.00 43.35  ? 366  GLY A O     1 
ATOM   2326  N N     . THR A  1 367 ? 8.607    -7.881  30.725  1.00 38.51  ? 367  THR A N     1 
ATOM   2327  C CA    . THR A  1 367 ? 7.266    -7.792  30.187  1.00 37.52  ? 367  THR A CA    1 
ATOM   2328  C C     . THR A  1 367 ? 6.523    -9.057  30.531  1.00 44.17  ? 367  THR A C     1 
ATOM   2329  O O     . THR A  1 367 ? 7.091    -10.150 30.445  1.00 45.97  ? 367  THR A O     1 
ATOM   2330  C CB    . THR A  1 367 ? 7.259    -7.404  28.704  1.00 41.58  ? 367  THR A CB    1 
ATOM   2331  O OG1   . THR A  1 367 ? 5.941    -7.011  28.344  1.00 45.85  ? 367  THR A OG1   1 
ATOM   2332  C CG2   . THR A  1 367 ? 7.758    -8.504  27.772  1.00 38.85  ? 367  THR A CG2   1 
ATOM   2333  N N     . ASP A  1 368 ? 5.265    -8.912  30.953  1.00 39.55  ? 368  ASP A N     1 
ATOM   2334  C CA    . ASP A  1 368 ? 4.446    -10.047 31.343  1.00 38.07  ? 368  ASP A CA    1 
ATOM   2335  C C     . ASP A  1 368 ? 4.057    -10.879 30.152  1.00 40.27  ? 368  ASP A C     1 
ATOM   2336  O O     . ASP A  1 368 ? 3.886    -12.085 30.299  1.00 39.45  ? 368  ASP A O     1 
ATOM   2337  C CB    . ASP A  1 368 ? 3.239    -9.591  32.172  1.00 39.35  ? 368  ASP A CB    1 
ATOM   2338  C CG    . ASP A  1 368 ? 3.526    -9.430  33.652  1.00 56.05  ? 368  ASP A CG    1 
ATOM   2339  O OD1   . ASP A  1 368 ? 4.735    -9.427  34.043  1.00 58.28  ? 368  ASP A OD1   1 
ATOM   2340  O OD2   . ASP A  1 368 ? 2.559    -9.347  34.429  1.00 62.37  ? 368  ASP A OD2   1 
ATOM   2341  N N     . SER A  1 369 ? 3.958    -10.243 28.964  1.00 36.90  ? 369  SER A N     1 
ATOM   2342  C CA    . SER A  1 369 ? 3.605    -10.880 27.687  1.00 35.89  ? 369  SER A CA    1 
ATOM   2343  C C     . SER A  1 369 ? 4.140    -10.090 26.494  1.00 40.69  ? 369  SER A C     1 
ATOM   2344  O O     . SER A  1 369 ? 4.181    -8.856  26.516  1.00 42.83  ? 369  SER A O     1 
ATOM   2345  C CB    . SER A  1 369 ? 2.098    -11.099 27.567  1.00 35.60  ? 369  SER A CB    1 
ATOM   2346  O OG    . SER A  1 369 ? 1.421    -9.896  27.878  1.00 40.11  ? 369  SER A OG    1 
ATOM   2347  N N     . THR A  1 370 ? 4.571    -10.811 25.461  1.00 34.57  ? 370  THR A N     1 
ATOM   2348  C CA    . THR A  1 370 ? 5.111    -10.226 24.230  1.00 33.56  ? 370  THR A CA    1 
ATOM   2349  C C     . THR A  1 370 ? 4.072    -10.293 23.100  1.00 39.78  ? 370  THR A C     1 
ATOM   2350  O O     . THR A  1 370 ? 3.189    -11.163 23.119  1.00 41.66  ? 370  THR A O     1 
ATOM   2351  C CB    . THR A  1 370 ? 6.396    -10.950 23.856  1.00 25.23  ? 370  THR A CB    1 
ATOM   2352  O OG1   . THR A  1 370 ? 6.082    -12.331 23.666  1.00 28.00  ? 370  THR A OG1   1 
ATOM   2353  C CG2   . THR A  1 370 ? 7.460    -10.804 24.902  1.00 12.76  ? 370  THR A CG2   1 
ATOM   2354  N N     . ILE A  1 371 ? 4.177    -9.385  22.114  1.00 35.94  ? 371  ILE A N     1 
ATOM   2355  C CA    . ILE A  1 371 ? 3.253    -9.357  20.978  1.00 35.10  ? 371  ILE A CA    1 
ATOM   2356  C C     . ILE A  1 371 ? 3.391    -10.627 20.148  1.00 40.78  ? 371  ILE A C     1 
ATOM   2357  O O     . ILE A  1 371 ? 4.481    -10.895 19.642  1.00 42.15  ? 371  ILE A O     1 
ATOM   2358  C CB    . ILE A  1 371 ? 3.409    -8.110  20.096  1.00 37.67  ? 371  ILE A CB    1 
ATOM   2359  C CG1   . ILE A  1 371 ? 3.530    -6.830  20.953  1.00 37.51  ? 371  ILE A CG1   1 
ATOM   2360  C CG2   . ILE A  1 371 ? 2.235    -8.047  19.104  1.00 38.32  ? 371  ILE A CG2   1 
ATOM   2361  C CD1   . ILE A  1 371 ? 3.955    -5.583  20.215  1.00 44.07  ? 371  ILE A CD1   1 
ATOM   2362  N N     . GLY A  1 372 ? 2.295    -11.392 20.044  1.00 35.61  ? 372  GLY A N     1 
ATOM   2363  C CA    . GLY A  1 372 ? 2.232    -12.633 19.281  1.00 33.98  ? 372  GLY A CA    1 
ATOM   2364  C C     . GLY A  1 372 ? 2.079    -13.865 20.139  1.00 37.42  ? 372  GLY A C     1 
ATOM   2365  O O     . GLY A  1 372 ? 1.538    -14.868 19.666  1.00 37.56  ? 372  GLY A O     1 
ATOM   2366  N N     . ALA A  1 373 ? 2.552    -13.806 21.412  1.00 33.10  ? 373  ALA A N     1 
ATOM   2367  C CA    . ALA A  1 373 ? 2.509    -14.929 22.362  1.00 32.20  ? 373  ALA A CA    1 
ATOM   2368  C C     . ALA A  1 373 ? 1.102    -15.541 22.569  1.00 35.26  ? 373  ALA A C     1 
ATOM   2369  O O     . ALA A  1 373 ? 0.930    -16.742 22.369  1.00 35.07  ? 373  ALA A O     1 
ATOM   2370  C CB    . ALA A  1 373 ? 3.140    -14.529 23.687  1.00 32.96  ? 373  ALA A CB    1 
ATOM   2371  N N     . TYR A  1 374 ? 0.100    -14.729 22.919  1.00 31.14  ? 374  TYR A N     1 
ATOM   2372  C CA    . TYR A  1 374 ? -1.252   -15.267 23.100  1.00 30.18  ? 374  TYR A CA    1 
ATOM   2373  C C     . TYR A  1 374 ? -1.864   -15.777 21.801  1.00 35.30  ? 374  TYR A C     1 
ATOM   2374  O O     . TYR A  1 374 ? -2.552   -16.798 21.840  1.00 36.80  ? 374  TYR A O     1 
ATOM   2375  C CB    . TYR A  1 374 ? -2.185   -14.281 23.839  1.00 29.77  ? 374  TYR A CB    1 
ATOM   2376  C CG    . TYR A  1 374 ? -1.997   -14.318 25.338  1.00 28.91  ? 374  TYR A CG    1 
ATOM   2377  C CD1   . TYR A  1 374 ? -2.626   -15.287 26.111  1.00 29.83  ? 374  TYR A CD1   1 
ATOM   2378  C CD2   . TYR A  1 374 ? -1.128   -13.433 25.975  1.00 29.64  ? 374  TYR A CD2   1 
ATOM   2379  C CE1   . TYR A  1 374 ? -2.397   -15.377 27.479  1.00 31.84  ? 374  TYR A CE1   1 
ATOM   2380  C CE2   . TYR A  1 374 ? -0.905   -13.501 27.348  1.00 30.67  ? 374  TYR A CE2   1 
ATOM   2381  C CZ    . TYR A  1 374 ? -1.551   -14.472 28.097  1.00 40.21  ? 374  TYR A CZ    1 
ATOM   2382  O OH    . TYR A  1 374 ? -1.360   -14.580 29.450  1.00 45.22  ? 374  TYR A OH    1 
ATOM   2383  N N     . SER A  1 375 ? -1.577   -15.106 20.650  1.00 29.70  ? 375  SER A N     1 
ATOM   2384  C CA    . SER A  1 375 ? -2.092   -15.519 19.341  1.00 28.63  ? 375  SER A CA    1 
ATOM   2385  C C     . SER A  1 375 ? -1.534   -16.873 18.979  1.00 32.27  ? 375  SER A C     1 
ATOM   2386  O O     . SER A  1 375 ? -2.299   -17.732 18.531  1.00 33.04  ? 375  SER A O     1 
ATOM   2387  C CB    . SER A  1 375 ? -1.745   -14.508 18.253  1.00 32.49  ? 375  SER A CB    1 
ATOM   2388  O OG    . SER A  1 375 ? -2.415   -13.275 18.440  1.00 39.20  ? 375  SER A OG    1 
ATOM   2389  N N     . SER A  1 376 ? -0.207   -17.083 19.217  1.00 27.07  ? 376  SER A N     1 
ATOM   2390  C CA    . SER A  1 376 ? 0.473    -18.346 18.930  1.00 26.43  ? 376  SER A CA    1 
ATOM   2391  C C     . SER A  1 376 ? -0.150   -19.440 19.785  1.00 31.64  ? 376  SER A C     1 
ATOM   2392  O O     . SER A  1 376 ? -0.442   -20.520 19.269  1.00 30.71  ? 376  SER A O     1 
ATOM   2393  C CB    . SER A  1 376 ? 1.958    -18.233 19.220  1.00 26.62  ? 376  SER A CB    1 
ATOM   2394  O OG    . SER A  1 376 ? 2.642    -19.326 18.633  1.00 26.35  ? 376  SER A OG    1 
ATOM   2395  N N     . LEU A  1 377 ? -0.421   -19.121 21.076  1.00 29.80  ? 377  LEU A N     1 
ATOM   2396  C CA    . LEU A  1 377 ? -1.060   -20.005 22.060  1.00 30.85  ? 377  LEU A CA    1 
ATOM   2397  C C     . LEU A  1 377 ? -2.444   -20.431 21.564  1.00 38.05  ? 377  LEU A C     1 
ATOM   2398  O O     . LEU A  1 377 ? -2.812   -21.606 21.692  1.00 39.81  ? 377  LEU A O     1 
ATOM   2399  C CB    . LEU A  1 377 ? -1.149   -19.312 23.442  1.00 30.32  ? 377  LEU A CB    1 
ATOM   2400  C CG    . LEU A  1 377 ? -1.841   -20.041 24.605  1.00 33.30  ? 377  LEU A CG    1 
ATOM   2401  C CD1   . LEU A  1 377 ? -1.207   -21.399 24.883  1.00 35.19  ? 377  LEU A CD1   1 
ATOM   2402  C CD2   . LEU A  1 377 ? -1.810   -19.192 25.858  1.00 30.90  ? 377  LEU A CD2   1 
ATOM   2403  N N     . GLU A  1 378 ? -3.171   -19.487 20.947  1.00 33.78  ? 378  GLU A N     1 
ATOM   2404  C CA    . GLU A  1 378 ? -4.479   -19.723 20.362  1.00 32.24  ? 378  GLU A CA    1 
ATOM   2405  C C     . GLU A  1 378 ? -4.394   -20.744 19.257  1.00 35.36  ? 378  GLU A C     1 
ATOM   2406  O O     . GLU A  1 378 ? -5.240   -21.630 19.229  1.00 34.57  ? 378  GLU A O     1 
ATOM   2407  C CB    . GLU A  1 378 ? -5.100   -18.414 19.870  1.00 32.96  ? 378  GLU A CB    1 
ATOM   2408  C CG    . GLU A  1 378 ? -5.723   -17.600 20.996  1.00 44.66  ? 378  GLU A CG    1 
ATOM   2409  C CD    . GLU A  1 378 ? -6.892   -18.220 21.750  1.00 63.72  ? 378  GLU A CD    1 
ATOM   2410  O OE1   . GLU A  1 378 ? -7.780   -18.828 21.107  1.00 53.34  ? 378  GLU A OE1   1 
ATOM   2411  O OE2   . GLU A  1 378 ? -6.936   -18.059 22.989  1.00 57.69  ? 378  GLU A OE2   1 
ATOM   2412  N N     . ARG A  1 379 ? -3.346   -20.664 18.387  1.00 32.91  ? 379  ARG A N     1 
ATOM   2413  C CA    . ARG A  1 379 ? -3.137   -21.614 17.272  1.00 33.71  ? 379  ARG A CA    1 
ATOM   2414  C C     . ARG A  1 379 ? -2.956   -23.044 17.778  1.00 41.07  ? 379  ARG A C     1 
ATOM   2415  O O     . ARG A  1 379 ? -3.518   -23.966 17.185  1.00 42.33  ? 379  ARG A O     1 
ATOM   2416  C CB    . ARG A  1 379 ? -1.966   -21.233 16.340  1.00 31.18  ? 379  ARG A CB    1 
ATOM   2417  C CG    . ARG A  1 379 ? -1.961   -19.809 15.783  1.00 34.22  ? 379  ARG A CG    1 
ATOM   2418  C CD    . ARG A  1 379 ? -2.977   -19.529 14.689  1.00 24.20  ? 379  ARG A CD    1 
ATOM   2419  N NE    . ARG A  1 379 ? -3.997   -18.586 15.183  1.00 37.32  ? 379  ARG A NE    1 
ATOM   2420  C CZ    . ARG A  1 379 ? -3.971   -17.255 15.030  1.00 51.04  ? 379  ARG A CZ    1 
ATOM   2421  N NH1   . ARG A  1 379 ? -2.992   -16.672 14.348  1.00 30.05  ? 379  ARG A NH1   1 
ATOM   2422  N NH2   . ARG A  1 379 ? -4.942   -16.502 15.535  1.00 38.09  ? 379  ARG A NH2   1 
ATOM   2423  N N     . ILE A  1 380 ? -2.179   -23.222 18.879  1.00 38.36  ? 380  ILE A N     1 
ATOM   2424  C CA    . ILE A  1 380 ? -1.921   -24.514 19.544  1.00 37.97  ? 380  ILE A CA    1 
ATOM   2425  C C     . ILE A  1 380 ? -3.270   -25.075 19.987  1.00 44.52  ? 380  ILE A C     1 
ATOM   2426  O O     . ILE A  1 380 ? -3.634   -26.191 19.590  1.00 45.26  ? 380  ILE A O     1 
ATOM   2427  C CB    . ILE A  1 380 ? -0.974   -24.364 20.776  1.00 39.55  ? 380  ILE A CB    1 
ATOM   2428  C CG1   . ILE A  1 380 ? 0.429    -23.875 20.384  1.00 39.08  ? 380  ILE A CG1   1 
ATOM   2429  C CG2   . ILE A  1 380 ? -0.901   -25.665 21.548  1.00 40.69  ? 380  ILE A CG2   1 
ATOM   2430  C CD1   . ILE A  1 380 ? 1.156    -23.167 21.499  1.00 34.06  ? 380  ILE A CD1   1 
ATOM   2431  N N     . ILE A  1 381 ? -4.014   -24.270 20.788  1.00 39.95  ? 381  ILE A N     1 
ATOM   2432  C CA    . ILE A  1 381 ? -5.329   -24.592 21.335  1.00 38.70  ? 381  ILE A CA    1 
ATOM   2433  C C     . ILE A  1 381 ? -6.297   -24.960 20.230  1.00 38.19  ? 381  ILE A C     1 
ATOM   2434  O O     . ILE A  1 381 ? -6.950   -25.979 20.355  1.00 39.71  ? 381  ILE A O     1 
ATOM   2435  C CB    . ILE A  1 381 ? -5.808   -23.468 22.304  1.00 42.48  ? 381  ILE A CB    1 
ATOM   2436  C CG1   . ILE A  1 381 ? -5.375   -23.760 23.753  1.00 44.09  ? 381  ILE A CG1   1 
ATOM   2437  C CG2   . ILE A  1 381 ? -7.313   -23.202 22.249  1.00 42.53  ? 381  ILE A CG2   1 
ATOM   2438  C CD1   . ILE A  1 381 ? -3.846   -23.805 24.022  1.00 56.44  ? 381  ILE A CD1   1 
ATOM   2439  N N     . GLU A  1 382 ? -6.296   -24.213 19.113  1.00 30.19  ? 382  GLU A N     1 
ATOM   2440  C CA    . GLU A  1 382 ? -7.116   -24.459 17.922  1.00 28.77  ? 382  GLU A CA    1 
ATOM   2441  C C     . GLU A  1 382 ? -6.959   -25.921 17.477  1.00 35.46  ? 382  GLU A C     1 
ATOM   2442  O O     . GLU A  1 382 ? -7.946   -26.613 17.258  1.00 36.39  ? 382  GLU A O     1 
ATOM   2443  C CB    . GLU A  1 382 ? -6.640   -23.535 16.790  1.00 29.64  ? 382  GLU A CB    1 
ATOM   2444  C CG    . GLU A  1 382 ? -7.699   -22.644 16.193  1.00 37.23  ? 382  GLU A CG    1 
ATOM   2445  C CD    . GLU A  1 382 ? -8.277   -23.153 14.892  1.00 60.89  ? 382  GLU A CD    1 
ATOM   2446  O OE1   . GLU A  1 382 ? -9.017   -24.164 14.934  1.00 79.42  ? 382  GLU A OE1   1 
ATOM   2447  O OE2   . GLU A  1 382 ? -8.008   -22.532 13.835  1.00 44.92  ? 382  GLU A OE2   1 
ATOM   2448  N N     . LEU A  1 383 ? -5.714   -26.395 17.398  1.00 33.06  ? 383  LEU A N     1 
ATOM   2449  C CA    . LEU A  1 383 ? -5.378   -27.740 16.953  1.00 33.66  ? 383  LEU A CA    1 
ATOM   2450  C C     . LEU A  1 383 ? -5.695   -28.824 17.977  1.00 39.68  ? 383  LEU A C     1 
ATOM   2451  O O     . LEU A  1 383 ? -6.330   -29.825 17.624  1.00 40.73  ? 383  LEU A O     1 
ATOM   2452  C CB    . LEU A  1 383 ? -3.904   -27.806 16.540  1.00 33.84  ? 383  LEU A CB    1 
ATOM   2453  C CG    . LEU A  1 383 ? -3.515   -27.310 15.149  1.00 37.41  ? 383  LEU A CG    1 
ATOM   2454  C CD1   . LEU A  1 383 ? -2.694   -28.343 14.438  1.00 39.04  ? 383  LEU A CD1   1 
ATOM   2455  C CD2   . LEU A  1 383 ? -4.700   -26.937 14.300  1.00 35.72  ? 383  LEU A CD2   1 
ATOM   2456  N N     . VAL A  1 384 ? -5.261   -28.636 19.239  1.00 34.58  ? 384  VAL A N     1 
ATOM   2457  C CA    . VAL A  1 384 ? -5.540   -29.598 20.309  1.00 33.08  ? 384  VAL A CA    1 
ATOM   2458  C C     . VAL A  1 384 ? -7.046   -29.717 20.553  1.00 35.33  ? 384  VAL A C     1 
ATOM   2459  O O     . VAL A  1 384 ? -7.509   -30.784 20.931  1.00 35.18  ? 384  VAL A O     1 
ATOM   2460  C CB    . VAL A  1 384 ? -4.762   -29.275 21.584  1.00 36.14  ? 384  VAL A CB    1 
ATOM   2461  C CG1   . VAL A  1 384 ? -4.925   -30.390 22.615  1.00 36.22  ? 384  VAL A CG1   1 
ATOM   2462  C CG2   . VAL A  1 384 ? -3.287   -29.054 21.257  1.00 36.61  ? 384  VAL A CG2   1 
ATOM   2463  N N     . ASP A  1 385 ? -7.819   -28.648 20.250  1.00 29.87  ? 385  ASP A N     1 
ATOM   2464  C CA    . ASP A  1 385 ? -9.261   -28.670 20.386  1.00 28.65  ? 385  ASP A CA    1 
ATOM   2465  C C     . ASP A  1 385 ? -9.890   -29.662 19.431  1.00 37.20  ? 385  ASP A C     1 
ATOM   2466  O O     . ASP A  1 385 ? -10.853  -30.329 19.827  1.00 39.58  ? 385  ASP A O     1 
ATOM   2467  C CB    . ASP A  1 385 ? -9.867   -27.278 20.245  1.00 28.74  ? 385  ASP A CB    1 
ATOM   2468  C CG    . ASP A  1 385 ? -9.800   -26.435 21.514  1.00 36.06  ? 385  ASP A CG    1 
ATOM   2469  O OD1   . ASP A  1 385 ? -9.074   -26.827 22.458  1.00 36.77  ? 385  ASP A OD1   1 
ATOM   2470  O OD2   . ASP A  1 385 ? -10.436  -25.360 21.547  1.00 42.42  ? 385  ASP A OD2   1 
ATOM   2471  N N     . TYR A  1 386 ? -9.324   -29.813 18.199  1.00 32.49  ? 386  TYR A N     1 
ATOM   2472  C CA    . TYR A  1 386 ? -9.802   -30.795 17.219  1.00 30.88  ? 386  TYR A CA    1 
ATOM   2473  C C     . TYR A  1 386 ? -9.499   -32.175 17.746  1.00 32.53  ? 386  TYR A C     1 
ATOM   2474  O O     . TYR A  1 386 ? -10.414  -32.971 17.841  1.00 34.24  ? 386  TYR A O     1 
ATOM   2475  C CB    . TYR A  1 386 ? -9.161   -30.590 15.847  1.00 32.68  ? 386  TYR A CB    1 
ATOM   2476  C CG    . TYR A  1 386 ? -9.706   -29.415 15.066  1.00 33.94  ? 386  TYR A CG    1 
ATOM   2477  C CD1   . TYR A  1 386 ? -11.054  -29.345 14.719  1.00 35.73  ? 386  TYR A CD1   1 
ATOM   2478  C CD2   . TYR A  1 386 ? -8.866   -28.399 14.623  1.00 33.70  ? 386  TYR A CD2   1 
ATOM   2479  C CE1   . TYR A  1 386 ? -11.555  -28.271 13.985  1.00 35.27  ? 386  TYR A CE1   1 
ATOM   2480  C CE2   . TYR A  1 386 ? -9.357   -27.320 13.892  1.00 33.17  ? 386  TYR A CE2   1 
ATOM   2481  C CZ    . TYR A  1 386 ? -10.698  -27.266 13.566  1.00 38.78  ? 386  TYR A CZ    1 
ATOM   2482  O OH    . TYR A  1 386 ? -11.167  -26.228 12.801  1.00 40.15  ? 386  TYR A OH    1 
ATOM   2483  N N     . ILE A  1 387 ? -8.249   -32.429 18.178  1.00 27.17  ? 387  ILE A N     1 
ATOM   2484  C CA    . ILE A  1 387 ? -7.824   -33.692 18.761  1.00 28.61  ? 387  ILE A CA    1 
ATOM   2485  C C     . ILE A  1 387 ? -8.824   -34.116 19.868  1.00 40.21  ? 387  ILE A C     1 
ATOM   2486  O O     . ILE A  1 387 ? -9.315   -35.246 19.850  1.00 42.98  ? 387  ILE A O     1 
ATOM   2487  C CB    . ILE A  1 387 ? -6.376   -33.560 19.299  1.00 31.55  ? 387  ILE A CB    1 
ATOM   2488  C CG1   . ILE A  1 387 ? -5.363   -33.433 18.134  1.00 32.44  ? 387  ILE A CG1   1 
ATOM   2489  C CG2   . ILE A  1 387 ? -6.016   -34.711 20.261  1.00 31.83  ? 387  ILE A CG2   1 
ATOM   2490  C CD1   . ILE A  1 387 ? -3.753   -33.396 18.504  1.00 23.20  ? 387  ILE A CD1   1 
ATOM   2491  N N     . ASP A  1 388 ? -9.156   -33.191 20.790  1.00 38.46  ? 388  ASP A N     1 
ATOM   2492  C CA    . ASP A  1 388 ? -10.072  -33.447 21.897  1.00 38.95  ? 388  ASP A CA    1 
ATOM   2493  C C     . ASP A  1 388 ? -11.501  -33.667 21.422  1.00 43.57  ? 388  ASP A C     1 
ATOM   2494  O O     . ASP A  1 388 ? -12.212  -34.458 22.035  1.00 43.56  ? 388  ASP A O     1 
ATOM   2495  C CB    . ASP A  1 388 ? -9.999   -32.322 22.964  1.00 40.90  ? 388  ASP A CB    1 
ATOM   2496  C CG    . ASP A  1 388 ? -8.663   -32.161 23.703  1.00 57.65  ? 388  ASP A CG    1 
ATOM   2497  O OD1   . ASP A  1 388 ? -7.913   -33.159 23.812  1.00 59.75  ? 388  ASP A OD1   1 
ATOM   2498  O OD2   . ASP A  1 388 ? -8.382   -31.040 24.197  1.00 67.03  ? 388  ASP A OD2   1 
ATOM   2499  N N     . ALA A  1 389 ? -11.912  -33.006 20.317  1.00 40.77  ? 389  ALA A N     1 
ATOM   2500  C CA    . ALA A  1 389 ? -13.279  -33.094 19.793  1.00 40.97  ? 389  ALA A CA    1 
ATOM   2501  C C     . ALA A  1 389 ? -13.624  -34.334 18.970  1.00 45.55  ? 389  ALA A C     1 
ATOM   2502  O O     . ALA A  1 389 ? -14.110  -34.222 17.856  1.00 45.36  ? 389  ALA A O     1 
ATOM   2503  C CB    . ALA A  1 389 ? -13.676  -31.811 19.069  1.00 41.20  ? 389  ALA A CB    1 
ATOM   2504  N N     . THR A  1 390 ? -13.407  -35.503 19.550  1.00 44.01  ? 390  THR A N     1 
ATOM   2505  C CA    . THR A  1 390 ? -13.749  -36.821 19.018  1.00 45.89  ? 390  THR A CA    1 
ATOM   2506  C C     . THR A  1 390 ? -14.208  -37.618 20.221  1.00 51.52  ? 390  THR A C     1 
ATOM   2507  O O     . THR A  1 390 ? -13.738  -37.347 21.322  1.00 50.47  ? 390  THR A O     1 
ATOM   2508  C CB    . THR A  1 390 ? -12.528  -37.538 18.438  1.00 59.50  ? 390  THR A CB    1 
ATOM   2509  O OG1   . THR A  1 390 ? -11.350  -37.136 19.141  1.00 67.59  ? 390  THR A OG1   1 
ATOM   2510  C CG2   . THR A  1 390 ? -12.379  -37.340 16.951  1.00 54.87  ? 390  THR A CG2   1 
ATOM   2511  N N     . ALA A  1 391 ? -15.104  -38.597 20.036  1.00 49.73  ? 391  ALA A N     1 
ATOM   2512  C CA    . ALA A  1 391 ? -15.542  -39.410 21.161  1.00 49.83  ? 391  ALA A CA    1 
ATOM   2513  C C     . ALA A  1 391 ? -14.393  -40.337 21.441  1.00 56.42  ? 391  ALA A C     1 
ATOM   2514  O O     . ALA A  1 391 ? -13.836  -40.921 20.504  1.00 59.12  ? 391  ALA A O     1 
ATOM   2515  C CB    . ALA A  1 391 ? -16.786  -40.193 20.807  1.00 50.80  ? 391  ALA A CB    1 
ATOM   2516  N N     . ALA A  1 392 ? -13.981  -40.386 22.719  1.00 51.34  ? 392  ALA A N     1 
ATOM   2517  C CA    . ALA A  1 392 ? -12.864  -41.163 23.259  1.00 51.28  ? 392  ALA A CA    1 
ATOM   2518  C C     . ALA A  1 392 ? -12.837  -42.628 22.861  1.00 56.53  ? 392  ALA A C     1 
ATOM   2519  O O     . ALA A  1 392 ? -13.883  -43.256 22.723  1.00 54.93  ? 392  ALA A O     1 
ATOM   2520  C CB    . ALA A  1 392 ? -12.818  -41.036 24.771  1.00 51.66  ? 392  ALA A CB    1 
ATOM   2521  N N     . SER A  1 393 ? -11.616  -43.150 22.641  1.00 56.61  ? 393  SER A N     1 
ATOM   2522  C CA    . SER A  1 393 ? -11.311  -44.541 22.286  1.00 58.51  ? 393  SER A CA    1 
ATOM   2523  C C     . SER A  1 393 ? -10.548  -45.164 23.452  1.00 66.81  ? 393  SER A C     1 
ATOM   2524  O O     . SER A  1 393 ? -9.889   -44.440 24.208  1.00 67.11  ? 393  SER A O     1 
ATOM   2525  C CB    . SER A  1 393 ? -10.487  -44.615 21.003  1.00 61.21  ? 393  SER A CB    1 
ATOM   2526  O OG    . SER A  1 393 ? -10.868  -43.627 20.057  1.00 66.80  ? 393  SER A OG    1 
ATOM   2527  N N     . HIS A  1 394 ? -10.634  -46.492 23.600  1.00 67.29  ? 394  HIS A N     1 
ATOM   2528  C CA    . HIS A  1 394 ? -10.052  -47.211 24.737  1.00 69.65  ? 394  HIS A CA    1 
ATOM   2529  C C     . HIS A  1 394 ? -8.544   -47.119 25.053  1.00 71.34  ? 394  HIS A C     1 
ATOM   2530  O O     . HIS A  1 394 ? -8.199   -47.122 26.240  1.00 70.41  ? 394  HIS A O     1 
ATOM   2531  C CB    . HIS A  1 394 ? -10.585  -48.643 24.893  1.00 72.74  ? 394  HIS A CB    1 
ATOM   2532  C CG    . HIS A  1 394 ? -10.778  -48.994 26.339  1.00 77.44  ? 394  HIS A CG    1 
ATOM   2533  N ND1   . HIS A  1 394 ? -9.751   -49.552 27.093  1.00 80.58  ? 394  HIS A ND1   1 
ATOM   2534  C CD2   . HIS A  1 394 ? -11.833  -48.741 27.154  1.00 79.39  ? 394  HIS A CD2   1 
ATOM   2535  C CE1   . HIS A  1 394 ? -10.235  -49.674 28.321  1.00 80.57  ? 394  HIS A CE1   1 
ATOM   2536  N NE2   . HIS A  1 394 ? -11.485  -49.198 28.407  1.00 80.09  ? 394  HIS A NE2   1 
ATOM   2537  N N     . SER A  1 395 ? -7.658   -47.061 24.036  1.00 66.06  ? 395  SER A N     1 
ATOM   2538  C CA    . SER A  1 395 ? -6.214   -46.997 24.294  1.00 65.15  ? 395  SER A CA    1 
ATOM   2539  C C     . SER A  1 395 ? -5.464   -46.032 23.359  1.00 63.43  ? 395  SER A C     1 
ATOM   2540  O O     . SER A  1 395 ? -4.532   -46.434 22.651  1.00 63.84  ? 395  SER A O     1 
ATOM   2541  C CB    . SER A  1 395 ? -5.607   -48.397 24.277  1.00 72.18  ? 395  SER A CB    1 
ATOM   2542  O OG    . SER A  1 395 ? -6.262   -49.262 25.192  1.00 85.66  ? 395  SER A OG    1 
ATOM   2543  N N     . ARG A  1 396 ? -5.855   -44.737 23.404  1.00 53.90  ? 396  ARG A N     1 
ATOM   2544  C CA    . ARG A  1 396 ? -5.305   -43.685 22.546  1.00 49.87  ? 396  ARG A CA    1 
ATOM   2545  C C     . ARG A  1 396 ? -4.500   -42.661 23.287  1.00 49.84  ? 396  ARG A C     1 
ATOM   2546  O O     . ARG A  1 396 ? -4.797   -42.379 24.448  1.00 50.17  ? 396  ARG A O     1 
ATOM   2547  C CB    . ARG A  1 396 ? -6.429   -43.011 21.766  1.00 44.65  ? 396  ARG A CB    1 
ATOM   2548  C CG    . ARG A  1 396 ? -7.000   -43.931 20.695  1.00 46.78  ? 396  ARG A CG    1 
ATOM   2549  C CD    . ARG A  1 396 ? -6.837   -43.381 19.300  1.00 47.53  ? 396  ARG A CD    1 
ATOM   2550  N NE    . ARG A  1 396 ? -5.430   -43.223 18.946  1.00 58.64  ? 396  ARG A NE    1 
ATOM   2551  C CZ    . ARG A  1 396 ? -5.006   -42.817 17.757  1.00 67.38  ? 396  ARG A CZ    1 
ATOM   2552  N NH1   . ARG A  1 396 ? -5.875   -42.560 16.790  1.00 39.21  ? 396  ARG A NH1   1 
ATOM   2553  N NH2   . ARG A  1 396 ? -3.708   -42.690 17.517  1.00 61.33  ? 396  ARG A NH2   1 
ATOM   2554  N N     . ALA A  1 397 ? -3.471   -42.101 22.605  1.00 43.08  ? 397  ALA A N     1 
ATOM   2555  C CA    . ALA A  1 397 ? -2.535   -41.073 23.093  1.00 40.50  ? 397  ALA A CA    1 
ATOM   2556  C C     . ALA A  1 397 ? -2.200   -40.057 21.988  1.00 41.06  ? 397  ALA A C     1 
ATOM   2557  O O     . ALA A  1 397 ? -2.173   -40.409 20.808  1.00 39.83  ? 397  ALA A O     1 
ATOM   2558  C CB    . ALA A  1 397 ? -1.259   -41.729 23.577  1.00 42.43  ? 397  ALA A CB    1 
ATOM   2559  N N     . PHE A  1 398 ? -1.939   -38.799 22.369  1.00 36.31  ? 398  PHE A N     1 
ATOM   2560  C CA    . PHE A  1 398 ? -1.630   -37.732 21.418  1.00 35.21  ? 398  PHE A CA    1 
ATOM   2561  C C     . PHE A  1 398 ? -0.448   -36.863 21.864  1.00 42.72  ? 398  PHE A C     1 
ATOM   2562  O O     . PHE A  1 398 ? -0.411   -36.424 23.008  1.00 44.43  ? 398  PHE A O     1 
ATOM   2563  C CB    . PHE A  1 398 ? -2.879   -36.878 21.165  1.00 34.94  ? 398  PHE A CB    1 
ATOM   2564  C CG    . PHE A  1 398 ? -4.085   -37.709 20.797  1.00 35.72  ? 398  PHE A CG    1 
ATOM   2565  C CD1   . PHE A  1 398 ? -4.173   -38.332 19.551  1.00 38.75  ? 398  PHE A CD1   1 
ATOM   2566  C CD2   . PHE A  1 398 ? -5.096   -37.934 21.715  1.00 36.44  ? 398  PHE A CD2   1 
ATOM   2567  C CE1   . PHE A  1 398 ? -5.250   -39.162 19.235  1.00 37.94  ? 398  PHE A CE1   1 
ATOM   2568  C CE2   . PHE A  1 398 ? -6.174   -38.760 21.392  1.00 38.66  ? 398  PHE A CE2   1 
ATOM   2569  C CZ    . PHE A  1 398 ? -6.241   -39.366 20.153  1.00 36.20  ? 398  PHE A CZ    1 
ATOM   2570  N N     . VAL A  1 399 ? 0.514    -36.619 20.966  1.00 39.36  ? 399  VAL A N     1 
ATOM   2571  C CA    . VAL A  1 399 ? 1.691    -35.790 21.249  1.00 38.83  ? 399  VAL A CA    1 
ATOM   2572  C C     . VAL A  1 399 ? 1.633    -34.506 20.397  1.00 42.33  ? 399  VAL A C     1 
ATOM   2573  O O     . VAL A  1 399 ? 1.538    -34.569 19.167  1.00 41.46  ? 399  VAL A O     1 
ATOM   2574  C CB    . VAL A  1 399 ? 3.041    -36.553 21.090  1.00 43.46  ? 399  VAL A CB    1 
ATOM   2575  C CG1   . VAL A  1 399 ? 4.228    -35.641 21.377  1.00 42.89  ? 399  VAL A CG1   1 
ATOM   2576  C CG2   . VAL A  1 399 ? 3.093    -37.783 21.988  1.00 44.28  ? 399  VAL A CG2   1 
ATOM   2577  N N     . VAL A  1 400 ? 1.707    -33.341 21.062  1.00 37.89  ? 400  VAL A N     1 
ATOM   2578  C CA    . VAL A  1 400 ? 1.687    -32.048 20.384  1.00 36.02  ? 400  VAL A CA    1 
ATOM   2579  C C     . VAL A  1 400 ? 3.037    -31.326 20.467  1.00 38.82  ? 400  VAL A C     1 
ATOM   2580  O O     . VAL A  1 400 ? 3.423    -30.831 21.526  1.00 37.83  ? 400  VAL A O     1 
ATOM   2581  C CB    . VAL A  1 400 ? 0.513    -31.160 20.846  1.00 39.07  ? 400  VAL A CB    1 
ATOM   2582  C CG1   . VAL A  1 400 ? 0.368    -29.933 19.940  1.00 38.47  ? 400  VAL A CG1   1 
ATOM   2583  C CG2   . VAL A  1 400 ? -0.797   -31.954 20.894  1.00 38.42  ? 400  VAL A CG2   1 
ATOM   2584  N N     . GLU A  1 401 ? 3.758    -31.291 19.345  1.00 37.09  ? 401  GLU A N     1 
ATOM   2585  C CA    . GLU A  1 401 ? 5.047    -30.612 19.222  1.00 37.88  ? 401  GLU A CA    1 
ATOM   2586  C C     . GLU A  1 401 ? 4.716    -29.147 18.924  1.00 44.16  ? 401  GLU A C     1 
ATOM   2587  O O     . GLU A  1 401 ? 4.241    -28.778 17.836  1.00 44.84  ? 401  GLU A O     1 
ATOM   2588  C CB    . GLU A  1 401 ? 5.939    -31.277 18.150  1.00 40.29  ? 401  GLU A CB    1 
ATOM   2589  C CG    . GLU A  1 401 ? 7.250    -30.566 17.834  1.00 52.91  ? 401  GLU A CG    1 
ATOM   2590  C CD    . GLU A  1 401 ? 8.459    -30.823 18.715  1.00 94.81  ? 401  GLU A CD    1 
ATOM   2591  O OE1   . GLU A  1 401 ? 9.414    -30.016 18.642  1.00 91.87  ? 401  GLU A OE1   1 
ATOM   2592  O OE2   . GLU A  1 401 ? 8.476    -31.840 19.447  1.00 107.38 ? 401  GLU A OE2   1 
ATOM   2593  N N     . VAL A  1 402 ? 4.907    -28.334 19.959  1.00 40.43  ? 402  VAL A N     1 
ATOM   2594  C CA    . VAL A  1 402 ? 4.653    -26.901 20.032  1.00 38.14  ? 402  VAL A CA    1 
ATOM   2595  C C     . VAL A  1 402 ? 5.993    -26.138 19.789  1.00 43.04  ? 402  VAL A C     1 
ATOM   2596  O O     . VAL A  1 402 ? 7.072    -26.622 20.154  1.00 42.40  ? 402  VAL A O     1 
ATOM   2597  C CB    . VAL A  1 402 ? 4.060    -26.669 21.439  1.00 40.69  ? 402  VAL A CB    1 
ATOM   2598  C CG1   . VAL A  1 402 ? 4.098    -25.214 21.857  1.00 40.88  ? 402  VAL A CG1   1 
ATOM   2599  C CG2   . VAL A  1 402 ? 2.646    -27.224 21.533  1.00 39.41  ? 402  VAL A CG2   1 
ATOM   2600  N N     . MET A  1 403 ? 5.913    -24.960 19.152  1.00 40.40  ? 403  MET A N     1 
ATOM   2601  C CA    . MET A  1 403 ? 7.079    -24.118 18.886  1.00 41.37  ? 403  MET A CA    1 
ATOM   2602  C C     . MET A  1 403 ? 7.384    -23.158 20.057  1.00 45.92  ? 403  MET A C     1 
ATOM   2603  O O     . MET A  1 403 ? 6.576    -23.019 20.969  1.00 44.49  ? 403  MET A O     1 
ATOM   2604  C CB    . MET A  1 403 ? 6.892    -23.362 17.576  1.00 43.53  ? 403  MET A CB    1 
ATOM   2605  C CG    . MET A  1 403 ? 7.327    -24.147 16.360  1.00 47.67  ? 403  MET A CG    1 
ATOM   2606  S SD    . MET A  1 403 ? 7.169    -23.152 14.861  1.00 51.60  ? 403  MET A SD    1 
ATOM   2607  C CE    . MET A  1 403 ? 8.352    -21.916 15.204  1.00 50.00  ? 403  MET A CE    1 
ATOM   2608  N N     . GLY A  1 404 ? 8.544    -22.517 20.017  1.00 44.51  ? 404  GLY A N     1 
ATOM   2609  C CA    . GLY A  1 404 ? 9.011    -21.634 21.079  1.00 45.87  ? 404  GLY A CA    1 
ATOM   2610  C C     . GLY A  1 404 ? 10.353   -22.141 21.545  1.00 57.69  ? 404  GLY A C     1 
ATOM   2611  O O     . GLY A  1 404 ? 10.427   -23.015 22.419  1.00 59.63  ? 404  GLY A O     1 
ATOM   2612  N N     . ARG A  1 405 ? 11.420   -21.648 20.895  1.00 57.15  ? 405  ARG A N     1 
ATOM   2613  C CA    . ARG A  1 405 ? 12.800   -22.080 21.091  1.00 58.77  ? 405  ARG A CA    1 
ATOM   2614  C C     . ARG A  1 405 ? 13.426   -21.797 22.462  1.00 65.29  ? 405  ARG A C     1 
ATOM   2615  O O     . ARG A  1 405 ? 14.138   -22.660 22.983  1.00 67.10  ? 405  ARG A O     1 
ATOM   2616  C CB    . ARG A  1 405 ? 13.688   -21.543 19.952  1.00 58.33  ? 405  ARG A CB    1 
ATOM   2617  N N     . HIS A  1 406 ? 13.178   -20.606 23.042  1.00 61.01  ? 406  HIS A N     1 
ATOM   2618  C CA    . HIS A  1 406 ? 13.838   -20.168 24.278  1.00 60.97  ? 406  HIS A CA    1 
ATOM   2619  C C     . HIS A  1 406 ? 13.046   -20.124 25.574  1.00 60.45  ? 406  HIS A C     1 
ATOM   2620  O O     . HIS A  1 406 ? 13.644   -19.875 26.624  1.00 61.42  ? 406  HIS A O     1 
ATOM   2621  C CB    . HIS A  1 406 ? 14.543   -18.821 24.037  1.00 62.98  ? 406  HIS A CB    1 
ATOM   2622  C CG    . HIS A  1 406 ? 15.560   -18.887 22.948  1.00 68.15  ? 406  HIS A CG    1 
ATOM   2623  N ND1   . HIS A  1 406 ? 16.834   -19.409 23.174  1.00 71.72  ? 406  HIS A ND1   1 
ATOM   2624  C CD2   . HIS A  1 406 ? 15.437   -18.571 21.639  1.00 70.31  ? 406  HIS A CD2   1 
ATOM   2625  C CE1   . HIS A  1 406 ? 17.448   -19.369 22.002  1.00 72.33  ? 406  HIS A CE1   1 
ATOM   2626  N NE2   . HIS A  1 406 ? 16.648   -18.868 21.048  1.00 71.88  ? 406  HIS A NE2   1 
ATOM   2627  N N     . CYS A  1 407 ? 11.728   -20.349 25.531  1.00 52.21  ? 407  CYS A N     1 
ATOM   2628  C CA    . CYS A  1 407 ? 10.912   -20.248 26.734  1.00 50.09  ? 407  CYS A CA    1 
ATOM   2629  C C     . CYS A  1 407 ? 9.782    -21.272 26.765  1.00 50.25  ? 407  CYS A C     1 
ATOM   2630  O O     . CYS A  1 407 ? 9.097    -21.466 25.758  1.00 51.03  ? 407  CYS A O     1 
ATOM   2631  C CB    . CYS A  1 407 ? 10.390   -18.820 26.858  1.00 50.16  ? 407  CYS A CB    1 
ATOM   2632  S SG    . CYS A  1 407 ? 9.333    -18.515 28.293  1.00 53.70  ? 407  CYS A SG    1 
ATOM   2633  N N     . GLY A  1 408 ? 9.565    -21.870 27.936  1.00 42.97  ? 408  GLY A N     1 
ATOM   2634  C CA    . GLY A  1 408 ? 8.526    -22.871 28.176  1.00 40.66  ? 408  GLY A CA    1 
ATOM   2635  C C     . GLY A  1 408 ? 7.123    -22.342 28.427  1.00 40.24  ? 408  GLY A C     1 
ATOM   2636  O O     . GLY A  1 408 ? 6.231    -23.117 28.762  1.00 38.32  ? 408  GLY A O     1 
ATOM   2637  N N     . TRP A  1 409 ? 6.906    -21.035 28.248  1.00 36.92  ? 409  TRP A N     1 
ATOM   2638  C CA    . TRP A  1 409 ? 5.617    -20.377 28.450  1.00 36.09  ? 409  TRP A CA    1 
ATOM   2639  C C     . TRP A  1 409 ? 4.514    -20.979 27.587  1.00 42.71  ? 409  TRP A C     1 
ATOM   2640  O O     . TRP A  1 409 ? 3.466    -21.329 28.133  1.00 43.29  ? 409  TRP A O     1 
ATOM   2641  C CB    . TRP A  1 409 ? 5.724    -18.869 28.214  1.00 33.67  ? 409  TRP A CB    1 
ATOM   2642  C CG    . TRP A  1 409 ? 4.472    -18.116 28.565  1.00 32.90  ? 409  TRP A CG    1 
ATOM   2643  C CD1   . TRP A  1 409 ? 4.140    -17.598 29.782  1.00 35.36  ? 409  TRP A CD1   1 
ATOM   2644  C CD2   . TRP A  1 409 ? 3.426    -17.731 27.668  1.00 31.60  ? 409  TRP A CD2   1 
ATOM   2645  N NE1   . TRP A  1 409 ? 2.948    -16.917 29.702  1.00 33.08  ? 409  TRP A NE1   1 
ATOM   2646  C CE2   . TRP A  1 409 ? 2.476    -16.998 28.421  1.00 34.32  ? 409  TRP A CE2   1 
ATOM   2647  C CE3   . TRP A  1 409 ? 3.204    -17.920 26.296  1.00 32.62  ? 409  TRP A CE3   1 
ATOM   2648  C CZ2   . TRP A  1 409 ? 1.306    -16.482 27.854  1.00 32.57  ? 409  TRP A CZ2   1 
ATOM   2649  C CZ3   . TRP A  1 409 ? 2.050    -17.398 25.735  1.00 33.44  ? 409  TRP A CZ3   1 
ATOM   2650  C CH2   . TRP A  1 409 ? 1.120    -16.682 26.511  1.00 33.28  ? 409  TRP A CH2   1 
ATOM   2651  N N     . LEU A  1 410 ? 4.749    -21.128 26.258  1.00 38.43  ? 410  LEU A N     1 
ATOM   2652  C CA    . LEU A  1 410 ? 3.743    -21.724 25.369  1.00 36.65  ? 410  LEU A CA    1 
ATOM   2653  C C     . LEU A  1 410 ? 3.394    -23.156 25.792  1.00 40.18  ? 410  LEU A C     1 
ATOM   2654  O O     . LEU A  1 410 ? 2.215    -23.469 25.908  1.00 39.19  ? 410  LEU A O     1 
ATOM   2655  C CB    . LEU A  1 410 ? 4.155    -21.669 23.886  1.00 36.43  ? 410  LEU A CB    1 
ATOM   2656  C CG    . LEU A  1 410 ? 4.075    -20.302 23.198  1.00 39.95  ? 410  LEU A CG    1 
ATOM   2657  C CD1   . LEU A  1 410 ? 4.798    -20.321 21.875  1.00 39.60  ? 410  LEU A CD1   1 
ATOM   2658  C CD2   . LEU A  1 410 ? 2.624    -19.867 22.978  1.00 42.65  ? 410  LEU A CD2   1 
ATOM   2659  N N     . GLY A  1 411 ? 4.417    -23.962 26.100  1.00 37.15  ? 411  GLY A N     1 
ATOM   2660  C CA    . GLY A  1 411 ? 4.275    -25.344 26.548  1.00 36.84  ? 411  GLY A CA    1 
ATOM   2661  C C     . GLY A  1 411 ? 3.420    -25.452 27.781  1.00 40.46  ? 411  GLY A C     1 
ATOM   2662  O O     . GLY A  1 411 ? 2.450    -26.218 27.804  1.00 39.94  ? 411  GLY A O     1 
ATOM   2663  N N     . LEU A  1 412 ? 3.747    -24.615 28.782  1.00 37.97  ? 412  LEU A N     1 
ATOM   2664  C CA    . LEU A  1 412 ? 3.058    -24.498 30.066  1.00 38.14  ? 412  LEU A CA    1 
ATOM   2665  C C     . LEU A  1 412 ? 1.583    -24.108 29.873  1.00 42.30  ? 412  LEU A C     1 
ATOM   2666  O O     . LEU A  1 412 ? 0.682    -24.822 30.329  1.00 42.79  ? 412  LEU A O     1 
ATOM   2667  C CB    . LEU A  1 412 ? 3.737    -23.397 30.888  1.00 38.59  ? 412  LEU A CB    1 
ATOM   2668  C CG    . LEU A  1 412 ? 3.893    -23.583 32.389  1.00 43.95  ? 412  LEU A CG    1 
ATOM   2669  C CD1   . LEU A  1 412 ? 4.225    -22.248 33.046  1.00 43.07  ? 412  LEU A CD1   1 
ATOM   2670  C CD2   . LEU A  1 412 ? 2.654    -24.223 33.033  1.00 46.98  ? 412  LEU A CD2   1 
ATOM   2671  N N     . MET A  1 413 ? 1.352    -22.956 29.223  1.00 36.73  ? 413  MET A N     1 
ATOM   2672  C CA    . MET A  1 413 ? 0.026    -22.401 29.027  1.00 35.08  ? 413  MET A CA    1 
ATOM   2673  C C     . MET A  1 413 ? -0.856   -23.338 28.256  1.00 38.83  ? 413  MET A C     1 
ATOM   2674  O O     . MET A  1 413 ? -2.014   -23.490 28.635  1.00 38.50  ? 413  MET A O     1 
ATOM   2675  C CB    . MET A  1 413 ? 0.091    -20.994 28.428  1.00 36.95  ? 413  MET A CB    1 
ATOM   2676  C CG    . MET A  1 413 ? 0.896    -20.019 29.270  1.00 40.61  ? 413  MET A CG    1 
ATOM   2677  S SD    . MET A  1 413 ? 0.128    -19.610 30.841  1.00 43.94  ? 413  MET A SD    1 
ATOM   2678  C CE    . MET A  1 413 ? -0.898   -18.232 30.287  1.00 40.41  ? 413  MET A CE    1 
ATOM   2679  N N     . SER A  1 414 ? -0.293   -24.030 27.233  1.00 35.46  ? 414  SER A N     1 
ATOM   2680  C CA    . SER A  1 414 ? -0.986   -25.057 26.442  1.00 34.48  ? 414  SER A CA    1 
ATOM   2681  C C     . SER A  1 414 ? -1.384   -26.204 27.383  1.00 38.18  ? 414  SER A C     1 
ATOM   2682  O O     . SER A  1 414 ? -2.493   -26.728 27.265  1.00 36.63  ? 414  SER A O     1 
ATOM   2683  C CB    . SER A  1 414 ? -0.071   -25.613 25.358  1.00 37.47  ? 414  SER A CB    1 
ATOM   2684  O OG    . SER A  1 414 ? 0.323    -24.602 24.449  1.00 44.07  ? 414  SER A OG    1 
ATOM   2685  N N     . GLY A  1 415 ? -0.487   -26.548 28.319  1.00 35.08  ? 415  GLY A N     1 
ATOM   2686  C CA    . GLY A  1 415 ? -0.723   -27.577 29.322  1.00 35.25  ? 415  GLY A CA    1 
ATOM   2687  C C     . GLY A  1 415 ? -1.970   -27.270 30.128  1.00 36.92  ? 415  GLY A C     1 
ATOM   2688  O O     . GLY A  1 415 ? -2.888   -28.093 30.176  1.00 37.91  ? 415  GLY A O     1 
ATOM   2689  N N     . ILE A  1 416 ? -2.035   -26.054 30.702  1.00 29.40  ? 416  ILE A N     1 
ATOM   2690  C CA    . ILE A  1 416 ? -3.196   -25.589 31.454  1.00 28.19  ? 416  ILE A CA    1 
ATOM   2691  C C     . ILE A  1 416 ? -4.409   -25.554 30.519  1.00 34.06  ? 416  ILE A C     1 
ATOM   2692  O O     . ILE A  1 416 ? -5.331   -26.352 30.697  1.00 35.15  ? 416  ILE A O     1 
ATOM   2693  C CB    . ILE A  1 416 ? -2.943   -24.217 32.132  1.00 30.95  ? 416  ILE A CB    1 
ATOM   2694  C CG1   . ILE A  1 416 ? -1.753   -24.287 33.114  1.00 32.17  ? 416  ILE A CG1   1 
ATOM   2695  C CG2   . ILE A  1 416 ? -4.212   -23.714 32.833  1.00 30.42  ? 416  ILE A CG2   1 
ATOM   2696  C CD1   . ILE A  1 416 ? -1.093   -22.988 33.375  1.00 36.80  ? 416  ILE A CD1   1 
ATOM   2697  N N     . ALA A  1 417 ? -4.375   -24.689 29.486  1.00 30.57  ? 417  ALA A N     1 
ATOM   2698  C CA    . ALA A  1 417 ? -5.441   -24.529 28.502  1.00 29.98  ? 417  ALA A CA    1 
ATOM   2699  C C     . ALA A  1 417 ? -6.026   -25.816 27.906  1.00 36.46  ? 417  ALA A C     1 
ATOM   2700  O O     . ALA A  1 417 ? -7.221   -25.836 27.620  1.00 36.43  ? 417  ALA A O     1 
ATOM   2701  C CB    . ALA A  1 417 ? -4.997   -23.596 27.407  1.00 30.32  ? 417  ALA A CB    1 
ATOM   2702  N N     . THR A  1 418 ? -5.226   -26.896 27.775  1.00 35.16  ? 418  THR A N     1 
ATOM   2703  C CA    . THR A  1 418 ? -5.703   -28.174 27.206  1.00 36.07  ? 418  THR A CA    1 
ATOM   2704  C C     . THR A  1 418 ? -5.884   -29.358 28.200  1.00 40.97  ? 418  THR A C     1 
ATOM   2705  O O     . THR A  1 418 ? -6.362   -30.436 27.805  1.00 39.90  ? 418  THR A O     1 
ATOM   2706  C CB    . THR A  1 418 ? -4.859   -28.585 25.976  1.00 39.84  ? 418  THR A CB    1 
ATOM   2707  O OG1   . THR A  1 418 ? -3.593   -29.071 26.406  1.00 35.06  ? 418  THR A OG1   1 
ATOM   2708  C CG2   . THR A  1 418 ? -4.676   -27.458 24.991  1.00 38.94  ? 418  THR A CG2   1 
ATOM   2709  N N     . GLY A  1 419 ? -5.483   -29.157 29.450  1.00 38.65  ? 419  GLY A N     1 
ATOM   2710  C CA    . GLY A  1 419 ? -5.535   -30.199 30.469  1.00 39.59  ? 419  GLY A CA    1 
ATOM   2711  C C     . GLY A  1 419 ? -4.601   -31.347 30.133  1.00 45.06  ? 419  GLY A C     1 
ATOM   2712  O O     . GLY A  1 419 ? -4.989   -32.508 30.248  1.00 45.34  ? 419  GLY A O     1 
ATOM   2713  N N     . ALA A  1 420 ? -3.374   -31.028 29.671  1.00 42.68  ? 420  ALA A N     1 
ATOM   2714  C CA    . ALA A  1 420 ? -2.356   -32.007 29.277  1.00 43.88  ? 420  ALA A CA    1 
ATOM   2715  C C     . ALA A  1 420 ? -1.914   -32.860 30.457  1.00 50.76  ? 420  ALA A C     1 
ATOM   2716  O O     . ALA A  1 420 ? -1.892   -32.362 31.594  1.00 51.37  ? 420  ALA A O     1 
ATOM   2717  C CB    . ALA A  1 420 ? -1.155   -31.290 28.699  1.00 44.70  ? 420  ALA A CB    1 
ATOM   2718  N N     . ASP A  1 421 ? -1.556   -34.143 30.197  1.00 47.31  ? 421  ASP A N     1 
ATOM   2719  C CA    . ASP A  1 421 ? -1.079   -35.073 31.238  1.00 47.05  ? 421  ASP A CA    1 
ATOM   2720  C C     . ASP A  1 421 ? 0.298    -34.682 31.716  1.00 48.71  ? 421  ASP A C     1 
ATOM   2721  O O     . ASP A  1 421 ? 0.536    -34.562 32.921  1.00 46.47  ? 421  ASP A O     1 
ATOM   2722  C CB    . ASP A  1 421 ? -1.062   -36.518 30.716  1.00 49.68  ? 421  ASP A CB    1 
ATOM   2723  C CG    . ASP A  1 421 ? -2.431   -37.059 30.394  1.00 61.47  ? 421  ASP A CG    1 
ATOM   2724  O OD1   . ASP A  1 421 ? -3.165   -36.396 29.616  1.00 57.93  ? 421  ASP A OD1   1 
ATOM   2725  O OD2   . ASP A  1 421 ? -2.768   -38.157 30.904  1.00 75.54  ? 421  ASP A OD2   1 
ATOM   2726  N N     . TYR A  1 422 ? 1.191    -34.460 30.742  1.00 47.28  ? 422  TYR A N     1 
ATOM   2727  C CA    . TYR A  1 422 ? 2.597    -34.132 30.918  1.00 48.33  ? 422  TYR A CA    1 
ATOM   2728  C C     . TYR A  1 422 ? 2.988    -33.043 29.913  1.00 48.37  ? 422  TYR A C     1 
ATOM   2729  O O     . TYR A  1 422 ? 2.405    -32.971 28.822  1.00 46.18  ? 422  TYR A O     1 
ATOM   2730  C CB    . TYR A  1 422 ? 3.420    -35.408 30.644  1.00 52.08  ? 422  TYR A CB    1 
ATOM   2731  C CG    . TYR A  1 422 ? 4.765    -35.467 31.327  1.00 57.88  ? 422  TYR A CG    1 
ATOM   2732  C CD1   . TYR A  1 422 ? 4.920    -36.113 32.554  1.00 61.65  ? 422  TYR A CD1   1 
ATOM   2733  C CD2   . TYR A  1 422 ? 5.906    -34.956 30.712  1.00 59.54  ? 422  TYR A CD2   1 
ATOM   2734  C CE1   . TYR A  1 422 ? 6.172    -36.207 33.173  1.00 64.15  ? 422  TYR A CE1   1 
ATOM   2735  C CE2   . TYR A  1 422 ? 7.159    -35.034 31.326  1.00 61.82  ? 422  TYR A CE2   1 
ATOM   2736  C CZ    . TYR A  1 422 ? 7.286    -35.659 32.557  1.00 70.50  ? 422  TYR A CZ    1 
ATOM   2737  O OH    . TYR A  1 422 ? 8.517    -35.732 33.156  1.00 72.95  ? 422  TYR A OH    1 
ATOM   2738  N N     . ILE A  1 423 ? 3.972    -32.207 30.289  1.00 43.67  ? 423  ILE A N     1 
ATOM   2739  C CA    . ILE A  1 423 ? 4.559    -31.165 29.441  1.00 42.87  ? 423  ILE A CA    1 
ATOM   2740  C C     . ILE A  1 423 ? 6.079    -31.204 29.524  1.00 46.22  ? 423  ILE A C     1 
ATOM   2741  O O     . ILE A  1 423 ? 6.623    -31.609 30.553  1.00 46.25  ? 423  ILE A O     1 
ATOM   2742  C CB    . ILE A  1 423 ? 4.015    -29.725 29.672  1.00 45.24  ? 423  ILE A CB    1 
ATOM   2743  C CG1   . ILE A  1 423 ? 4.352    -29.183 31.084  1.00 45.81  ? 423  ILE A CG1   1 
ATOM   2744  C CG2   . ILE A  1 423 ? 2.528    -29.585 29.294  1.00 44.68  ? 423  ILE A CG2   1 
ATOM   2745  C CD1   . ILE A  1 423 ? 4.579    -27.733 31.165  1.00 54.31  ? 423  ILE A CD1   1 
ATOM   2746  N N     . PHE A  1 424 ? 6.761    -30.764 28.456  1.00 42.56  ? 424  PHE A N     1 
ATOM   2747  C CA    . PHE A  1 424 ? 8.222    -30.695 28.427  1.00 43.48  ? 424  PHE A CA    1 
ATOM   2748  C C     . PHE A  1 424 ? 8.638    -29.251 28.247  1.00 49.31  ? 424  PHE A C     1 
ATOM   2749  O O     . PHE A  1 424 ? 8.293    -28.651 27.220  1.00 50.87  ? 424  PHE A O     1 
ATOM   2750  C CB    . PHE A  1 424 ? 8.782    -31.572 27.313  1.00 45.79  ? 424  PHE A CB    1 
ATOM   2751  C CG    . PHE A  1 424 ? 8.678    -33.043 27.604  1.00 48.43  ? 424  PHE A CG    1 
ATOM   2752  C CD1   . PHE A  1 424 ? 9.688    -33.706 28.294  1.00 53.42  ? 424  PHE A CD1   1 
ATOM   2753  C CD2   . PHE A  1 424 ? 7.571    -33.770 27.198  1.00 50.26  ? 424  PHE A CD2   1 
ATOM   2754  C CE1   . PHE A  1 424 ? 9.583    -35.068 28.585  1.00 55.04  ? 424  PHE A CE1   1 
ATOM   2755  C CE2   . PHE A  1 424 ? 7.470    -35.132 27.485  1.00 54.15  ? 424  PHE A CE2   1 
ATOM   2756  C CZ    . PHE A  1 424 ? 8.483    -35.775 28.167  1.00 53.54  ? 424  PHE A CZ    1 
ATOM   2757  N N     . ILE A  1 425 ? 9.297    -28.657 29.272  1.00 43.77  ? 425  ILE A N     1 
ATOM   2758  C CA    . ILE A  1 425 ? 9.734    -27.256 29.223  1.00 42.10  ? 425  ILE A CA    1 
ATOM   2759  C C     . ILE A  1 425 ? 11.221   -27.115 29.576  1.00 47.01  ? 425  ILE A C     1 
ATOM   2760  O O     . ILE A  1 425 ? 11.674   -27.818 30.471  1.00 46.42  ? 425  ILE A O     1 
ATOM   2761  C CB    . ILE A  1 425 ? 8.806    -26.262 29.992  1.00 43.35  ? 425  ILE A CB    1 
ATOM   2762  C CG1   . ILE A  1 425 ? 8.791    -26.509 31.522  1.00 43.97  ? 425  ILE A CG1   1 
ATOM   2763  C CG2   . ILE A  1 425 ? 7.405    -26.259 29.415  1.00 41.62  ? 425  ILE A CG2   1 
ATOM   2764  C CD1   . ILE A  1 425 ? 8.156    -25.379 32.367  1.00 43.03  ? 425  ILE A CD1   1 
ATOM   2765  N N     . PRO A  1 426 ? 12.000   -26.234 28.885  1.00 45.47  ? 426  PRO A N     1 
ATOM   2766  C CA    . PRO A  1 426 ? 13.438   -26.102 29.201  1.00 46.19  ? 426  PRO A CA    1 
ATOM   2767  C C     . PRO A  1 426 ? 13.761   -25.644 30.621  1.00 50.69  ? 426  PRO A C     1 
ATOM   2768  O O     . PRO A  1 426 ? 14.837   -25.975 31.123  1.00 50.89  ? 426  PRO A O     1 
ATOM   2769  C CB    . PRO A  1 426 ? 13.944   -25.086 28.167  1.00 47.78  ? 426  PRO A CB    1 
ATOM   2770  C CG    . PRO A  1 426 ? 12.952   -25.094 27.082  1.00 52.26  ? 426  PRO A CG    1 
ATOM   2771  C CD    . PRO A  1 426 ? 11.629   -25.357 27.753  1.00 47.05  ? 426  PRO A CD    1 
ATOM   2772  N N     . GLU A  1 427 ? 12.841   -24.886 31.259  1.00 46.71  ? 427  GLU A N     1 
ATOM   2773  C CA    . GLU A  1 427 ? 12.999   -24.353 32.615  1.00 47.46  ? 427  GLU A CA    1 
ATOM   2774  C C     . GLU A  1 427 ? 13.009   -25.422 33.692  1.00 54.44  ? 427  GLU A C     1 
ATOM   2775  O O     . GLU A  1 427 ? 13.795   -25.299 34.630  1.00 57.03  ? 427  GLU A O     1 
ATOM   2776  C CB    . GLU A  1 427 ? 12.005   -23.227 32.942  1.00 47.55  ? 427  GLU A CB    1 
ATOM   2777  C CG    . GLU A  1 427 ? 10.936   -22.992 31.897  1.00 57.96  ? 427  GLU A CG    1 
ATOM   2778  C CD    . GLU A  1 427 ? 11.342   -22.063 30.778  1.00 85.31  ? 427  GLU A CD    1 
ATOM   2779  O OE1   . GLU A  1 427 ? 11.490   -20.845 31.029  1.00 57.39  ? 427  GLU A OE1   1 
ATOM   2780  O OE2   . GLU A  1 427 ? 11.502   -22.559 29.640  1.00 99.23  ? 427  GLU A OE2   1 
ATOM   2781  N N     . ARG A  1 428 ? 12.152   -26.458 33.587  1.00 50.22  ? 428  ARG A N     1 
ATOM   2782  C CA    . ARG A  1 428 ? 12.191   -27.576 34.539  1.00 51.12  ? 428  ARG A CA    1 
ATOM   2783  C C     . ARG A  1 428 ? 12.284   -28.968 33.864  1.00 53.32  ? 428  ARG A C     1 
ATOM   2784  O O     . ARG A  1 428 ? 11.297   -29.689 33.772  1.00 51.42  ? 428  ARG A O     1 
ATOM   2785  C CB    . ARG A  1 428 ? 11.222   -27.436 35.735  1.00 53.29  ? 428  ARG A CB    1 
ATOM   2786  C CG    . ARG A  1 428 ? 12.006   -27.184 37.049  1.00 70.96  ? 428  ARG A CG    1 
ATOM   2787  C CD    . ARG A  1 428 ? 11.145   -26.981 38.290  1.00 89.52  ? 428  ARG A CD    1 
ATOM   2788  N NE    . ARG A  1 428 ? 10.320   -28.151 38.628  1.00 103.02 ? 428  ARG A NE    1 
ATOM   2789  C CZ    . ARG A  1 428 ? 9.518    -28.235 39.691  1.00 111.20 ? 428  ARG A CZ    1 
ATOM   2790  N NH1   . ARG A  1 428 ? 9.423    -27.219 40.544  1.00 86.95  ? 428  ARG A NH1   1 
ATOM   2791  N NH2   . ARG A  1 428 ? 8.808    -29.335 39.910  1.00 96.87  ? 428  ARG A NH2   1 
ATOM   2792  N N     . PRO A  1 429 ? 13.475   -29.312 33.317  1.00 51.56  ? 429  PRO A N     1 
ATOM   2793  C CA    . PRO A  1 429 ? 13.611   -30.568 32.575  1.00 52.85  ? 429  PRO A CA    1 
ATOM   2794  C C     . PRO A  1 429 ? 13.660   -31.817 33.448  1.00 61.82  ? 429  PRO A C     1 
ATOM   2795  O O     . PRO A  1 429 ? 14.159   -31.740 34.575  1.00 63.08  ? 429  PRO A O     1 
ATOM   2796  C CB    . PRO A  1 429 ? 14.917   -30.375 31.799  1.00 55.27  ? 429  PRO A CB    1 
ATOM   2797  C CG    . PRO A  1 429 ? 15.707   -29.476 32.612  1.00 59.78  ? 429  PRO A CG    1 
ATOM   2798  C CD    . PRO A  1 429 ? 14.748   -28.563 33.316  1.00 54.03  ? 429  PRO A CD    1 
ATOM   2799  N N     . PRO A  1 430 ? 13.189   -32.987 32.944  1.00 59.90  ? 430  PRO A N     1 
ATOM   2800  C CA    . PRO A  1 430 ? 13.239   -34.193 33.772  1.00 61.07  ? 430  PRO A CA    1 
ATOM   2801  C C     . PRO A  1 430 ? 14.606   -34.862 33.729  1.00 67.97  ? 430  PRO A C     1 
ATOM   2802  O O     . PRO A  1 430 ? 15.453   -34.466 32.927  1.00 68.88  ? 430  PRO A O     1 
ATOM   2803  C CB    . PRO A  1 430 ? 12.118   -35.067 33.204  1.00 61.85  ? 430  PRO A CB    1 
ATOM   2804  C CG    . PRO A  1 430 ? 11.771   -34.480 31.868  1.00 65.20  ? 430  PRO A CG    1 
ATOM   2805  C CD    . PRO A  1 430 ? 12.609   -33.278 31.617  1.00 60.76  ? 430  PRO A CD    1 
ATOM   2806  N N     . SER A  1 431 ? 14.831   -35.856 34.609  1.00 65.23  ? 431  SER A N     1 
ATOM   2807  C CA    . SER A  1 431 ? 16.090   -36.587 34.659  1.00 67.28  ? 431  SER A CA    1 
ATOM   2808  C C     . SER A  1 431 ? 16.323   -37.343 33.366  1.00 73.86  ? 431  SER A C     1 
ATOM   2809  O O     . SER A  1 431 ? 15.358   -37.808 32.766  1.00 73.49  ? 431  SER A O     1 
ATOM   2810  C CB    . SER A  1 431 ? 16.109   -37.554 35.841  1.00 71.52  ? 431  SER A CB    1 
ATOM   2811  O OG    . SER A  1 431 ? 15.331   -38.722 35.632  1.00 75.57  ? 431  SER A OG    1 
ATOM   2812  N N     . GLU A  1 432 ? 17.585   -37.462 32.922  1.00 73.31  ? 432  GLU A N     1 
ATOM   2813  C CA    . GLU A  1 432 ? 17.858   -38.246 31.720  1.00 74.91  ? 432  GLU A CA    1 
ATOM   2814  C C     . GLU A  1 432 ? 17.584   -39.721 32.044  1.00 82.17  ? 432  GLU A C     1 
ATOM   2815  O O     . GLU A  1 432 ? 16.999   -40.433 31.224  1.00 83.47  ? 432  GLU A O     1 
ATOM   2816  C CB    . GLU A  1 432 ? 19.271   -38.005 31.128  1.00 77.70  ? 432  GLU A CB    1 
ATOM   2817  C CG    . GLU A  1 432 ? 20.455   -38.314 32.033  1.00 94.42  ? 432  GLU A CG    1 
ATOM   2818  C CD    . GLU A  1 432 ? 21.769   -38.628 31.335  1.00 128.78 ? 432  GLU A CD    1 
ATOM   2819  O OE1   . GLU A  1 432 ? 22.669   -39.181 32.009  1.00 132.37 ? 432  GLU A OE1   1 
ATOM   2820  O OE2   . GLU A  1 432 ? 21.906   -38.328 30.125  1.00 124.39 ? 432  GLU A OE2   1 
ATOM   2821  N N     . SER A  1 433 ? 17.889   -40.112 33.296  1.00 79.05  ? 433  SER A N     1 
ATOM   2822  C CA    . SER A  1 433 ? 17.736   -41.448 33.852  1.00 79.30  ? 433  SER A CA    1 
ATOM   2823  C C     . SER A  1 433 ? 16.300   -41.990 33.885  1.00 81.32  ? 433  SER A C     1 
ATOM   2824  O O     . SER A  1 433 ? 16.109   -43.138 33.477  1.00 82.47  ? 433  SER A O     1 
ATOM   2825  C CB    . SER A  1 433 ? 18.397   -41.537 35.229  1.00 82.98  ? 433  SER A CB    1 
ATOM   2826  O OG    . SER A  1 433 ? 17.986   -40.488 36.091  1.00 89.00  ? 433  SER A OG    1 
ATOM   2827  N N     . ASN A  1 434 ? 15.302   -41.213 34.376  1.00 74.58  ? 434  ASN A N     1 
ATOM   2828  C CA    . ASN A  1 434 ? 13.941   -41.755 34.492  1.00 73.53  ? 434  ASN A CA    1 
ATOM   2829  C C     . ASN A  1 434 ? 12.757   -40.882 34.021  1.00 76.07  ? 434  ASN A C     1 
ATOM   2830  O O     . ASN A  1 434 ? 11.669   -40.979 34.611  1.00 75.47  ? 434  ASN A O     1 
ATOM   2831  C CB    . ASN A  1 434 ? 13.700   -42.305 35.908  1.00 76.15  ? 434  ASN A CB    1 
ATOM   2832  C CG    . ASN A  1 434 ? 14.647   -43.423 36.305  1.00 116.18 ? 434  ASN A CG    1 
ATOM   2833  O OD1   . ASN A  1 434 ? 14.487   -44.586 35.899  1.00 118.33 ? 434  ASN A OD1   1 
ATOM   2834  N ND2   . ASN A  1 434 ? 15.693   -43.084 37.063  1.00 106.43 ? 434  ASN A ND2   1 
ATOM   2835  N N     . TRP A  1 435 ? 12.931   -40.072 32.943  1.00 70.38  ? 435  TRP A N     1 
ATOM   2836  C CA    . TRP A  1 435 ? 11.817   -39.246 32.448  1.00 67.46  ? 435  TRP A CA    1 
ATOM   2837  C C     . TRP A  1 435 ? 10.736   -40.093 31.804  1.00 71.45  ? 435  TRP A C     1 
ATOM   2838  O O     . TRP A  1 435 ? 9.540    -39.792 31.932  1.00 68.87  ? 435  TRP A O     1 
ATOM   2839  C CB    . TRP A  1 435 ? 12.254   -38.085 31.530  1.00 64.99  ? 435  TRP A CB    1 
ATOM   2840  C CG    . TRP A  1 435 ? 12.778   -38.429 30.162  1.00 66.37  ? 435  TRP A CG    1 
ATOM   2841  C CD1   . TRP A  1 435 ? 14.085   -38.445 29.775  1.00 70.68  ? 435  TRP A CD1   1 
ATOM   2842  C CD2   . TRP A  1 435 ? 12.005   -38.628 28.965  1.00 65.23  ? 435  TRP A CD2   1 
ATOM   2843  N NE1   . TRP A  1 435 ? 14.180   -38.714 28.429  1.00 70.20  ? 435  TRP A NE1   1 
ATOM   2844  C CE2   . TRP A  1 435 ? 12.917   -38.837 27.908  1.00 69.80  ? 435  TRP A CE2   1 
ATOM   2845  C CE3   . TRP A  1 435 ? 10.629   -38.691 28.688  1.00 65.20  ? 435  TRP A CE3   1 
ATOM   2846  C CZ2   . TRP A  1 435 ? 12.501   -39.087 26.598  1.00 68.47  ? 435  TRP A CZ2   1 
ATOM   2847  C CZ3   . TRP A  1 435 ? 10.218   -38.954 27.390  1.00 66.11  ? 435  TRP A CZ3   1 
ATOM   2848  C CH2   . TRP A  1 435 ? 11.147   -39.148 26.363  1.00 67.45  ? 435  TRP A CH2   1 
ATOM   2849  N N     . LYS A  1 436 ? 11.170   -41.165 31.122  1.00 70.27  ? 436  LYS A N     1 
ATOM   2850  C CA    . LYS A  1 436 ? 10.290   -42.111 30.433  1.00 70.16  ? 436  LYS A CA    1 
ATOM   2851  C C     . LYS A  1 436 ? 9.427    -42.835 31.454  1.00 73.36  ? 436  LYS A C     1 
ATOM   2852  O O     . LYS A  1 436 ? 8.217    -42.918 31.264  1.00 73.23  ? 436  LYS A O     1 
ATOM   2853  C CB    . LYS A  1 436 ? 11.091   -43.099 29.549  1.00 73.46  ? 436  LYS A CB    1 
ATOM   2854  C CG    . LYS A  1 436 ? 12.020   -42.397 28.553  1.00 77.09  ? 436  LYS A CG    1 
ATOM   2855  C CD    . LYS A  1 436 ? 12.599   -43.321 27.505  1.00 75.02  ? 436  LYS A CD    1 
ATOM   2856  C CE    . LYS A  1 436 ? 13.584   -42.583 26.636  1.00 77.28  ? 436  LYS A CE    1 
ATOM   2857  N NZ    . LYS A  1 436 ? 14.187   -43.460 25.610  1.00 94.47  ? 436  LYS A NZ    1 
ATOM   2858  N N     . ASP A  1 437 ? 10.030   -43.262 32.571  1.00 68.91  ? 437  ASP A N     1 
ATOM   2859  C CA    . ASP A  1 437 ? 9.325    -43.956 33.646  1.00 68.17  ? 437  ASP A CA    1 
ATOM   2860  C C     . ASP A  1 437 ? 8.394    -43.035 34.437  1.00 67.35  ? 437  ASP A C     1 
ATOM   2861  O O     . ASP A  1 437 ? 7.351    -43.489 34.909  1.00 66.45  ? 437  ASP A O     1 
ATOM   2862  C CB    . ASP A  1 437 ? 10.309   -44.738 34.534  1.00 72.28  ? 437  ASP A CB    1 
ATOM   2863  C CG    . ASP A  1 437 ? 11.017   -45.838 33.764  1.00 84.07  ? 437  ASP A CG    1 
ATOM   2864  O OD1   . ASP A  1 437 ? 10.351   -46.843 33.418  1.00 85.29  ? 437  ASP A OD1   1 
ATOM   2865  O OD2   . ASP A  1 437 ? 12.218   -45.658 33.437  1.00 87.82  ? 437  ASP A OD2   1 
ATOM   2866  N N     . ASP A  1 438 ? 8.741    -41.742 34.541  1.00 61.60  ? 438  ASP A N     1 
ATOM   2867  C CA    . ASP A  1 438 ? 7.877    -40.765 35.208  1.00 59.70  ? 438  ASP A CA    1 
ATOM   2868  C C     . ASP A  1 438 ? 6.692    -40.409 34.304  1.00 56.77  ? 438  ASP A C     1 
ATOM   2869  O O     . ASP A  1 438 ? 5.580    -40.245 34.820  1.00 54.56  ? 438  ASP A O     1 
ATOM   2870  C CB    . ASP A  1 438 ? 8.645    -39.502 35.656  1.00 62.04  ? 438  ASP A CB    1 
ATOM   2871  C CG    . ASP A  1 438 ? 7.781    -38.490 36.392  1.00 75.75  ? 438  ASP A CG    1 
ATOM   2872  O OD1   . ASP A  1 438 ? 6.955    -38.912 37.241  1.00 77.99  ? 438  ASP A OD1   1 
ATOM   2873  O OD2   . ASP A  1 438 ? 7.909    -37.285 36.107  1.00 81.91  ? 438  ASP A OD2   1 
ATOM   2874  N N     . LEU A  1 439 ? 6.934    -40.327 32.960  1.00 49.58  ? 439  LEU A N     1 
ATOM   2875  C CA    . LEU A  1 439 ? 5.902    -40.063 31.947  1.00 46.89  ? 439  LEU A CA    1 
ATOM   2876  C C     . LEU A  1 439 ? 4.841    -41.151 32.063  1.00 48.21  ? 439  LEU A C     1 
ATOM   2877  O O     . LEU A  1 439 ? 3.659    -40.843 32.206  1.00 45.89  ? 439  LEU A O     1 
ATOM   2878  C CB    . LEU A  1 439 ? 6.497    -40.102 30.522  1.00 46.98  ? 439  LEU A CB    1 
ATOM   2879  C CG    . LEU A  1 439 ? 6.043    -39.036 29.470  1.00 49.41  ? 439  LEU A CG    1 
ATOM   2880  C CD1   . LEU A  1 439 ? 6.537    -39.397 28.093  1.00 49.71  ? 439  LEU A CD1   1 
ATOM   2881  C CD2   . LEU A  1 439 ? 4.537    -38.869 29.382  1.00 48.55  ? 439  LEU A CD2   1 
ATOM   2882  N N     . LYS A  1 440 ? 5.283    -42.418 32.049  1.00 45.73  ? 440  LYS A N     1 
ATOM   2883  C CA    . LYS A  1 440 ? 4.447    -43.612 32.177  1.00 45.76  ? 440  LYS A CA    1 
ATOM   2884  C C     . LYS A  1 440 ? 3.569    -43.548 33.433  1.00 51.34  ? 440  LYS A C     1 
ATOM   2885  O O     . LYS A  1 440 ? 2.346    -43.707 33.333  1.00 49.86  ? 440  LYS A O     1 
ATOM   2886  C CB    . LYS A  1 440 ? 5.306    -44.886 32.166  1.00 48.49  ? 440  LYS A CB    1 
ATOM   2887  C CG    . LYS A  1 440 ? 6.063    -45.120 30.862  1.00 45.94  ? 440  LYS A CG    1 
ATOM   2888  C CD    . LYS A  1 440 ? 6.959    -46.334 30.974  1.00 56.82  ? 440  LYS A CD    1 
ATOM   2889  C CE    . LYS A  1 440 ? 7.460    -46.825 29.636  1.00 66.35  ? 440  LYS A CE    1 
ATOM   2890  N NZ    . LYS A  1 440 ? 8.376    -47.982 29.800  1.00 70.18  ? 440  LYS A NZ    1 
ATOM   2891  N N     . LYS A  1 441 ? 4.189    -43.239 34.600  1.00 50.52  ? 441  LYS A N     1 
ATOM   2892  C CA    . LYS A  1 441 ? 3.508    -43.118 35.895  1.00 50.75  ? 441  LYS A CA    1 
ATOM   2893  C C     . LYS A  1 441 ? 2.295    -42.176 35.791  1.00 54.85  ? 441  LYS A C     1 
ATOM   2894  O O     . LYS A  1 441 ? 1.147    -42.635 35.873  1.00 53.10  ? 441  LYS A O     1 
ATOM   2895  C CB    . LYS A  1 441 ? 4.493    -42.671 36.998  1.00 53.07  ? 441  LYS A CB    1 
ATOM   2896  N N     . VAL A  1 442 ? 2.576    -40.878 35.522  1.00 52.48  ? 442  VAL A N     1 
ATOM   2897  C CA    . VAL A  1 442 ? 1.628    -39.764 35.377  1.00 50.91  ? 442  VAL A CA    1 
ATOM   2898  C C     . VAL A  1 442 ? 0.448    -40.136 34.494  1.00 56.59  ? 442  VAL A C     1 
ATOM   2899  O O     . VAL A  1 442 ? -0.691   -40.015 34.932  1.00 56.31  ? 442  VAL A O     1 
ATOM   2900  C CB    . VAL A  1 442 ? 2.342    -38.467 34.887  1.00 53.66  ? 442  VAL A CB    1 
ATOM   2901  C CG1   . VAL A  1 442 ? 1.370    -37.305 34.759  1.00 51.33  ? 442  VAL A CG1   1 
ATOM   2902  C CG2   . VAL A  1 442 ? 3.489    -38.082 35.816  1.00 54.91  ? 442  VAL A CG2   1 
ATOM   2903  N N     . CYS A  1 443 ? 0.725    -40.622 33.274  1.00 55.41  ? 443  CYS A N     1 
ATOM   2904  C CA    . CYS A  1 443 ? -0.278   -41.001 32.278  1.00 55.41  ? 443  CYS A CA    1 
ATOM   2905  C C     . CYS A  1 443 ? -1.203   -42.094 32.723  1.00 58.20  ? 443  CYS A C     1 
ATOM   2906  O O     . CYS A  1 443 ? -2.422   -41.912 32.654  1.00 57.12  ? 443  CYS A O     1 
ATOM   2907  C CB    . CYS A  1 443 ? 0.385    -41.350 30.957  1.00 57.02  ? 443  CYS A CB    1 
ATOM   2908  S SG    . CYS A  1 443 ? 1.182    -39.950 30.165  1.00 60.91  ? 443  CYS A SG    1 
ATOM   2909  N N     . LEU A  1 444 ? -0.626   -43.231 33.163  1.00 54.88  ? 444  LEU A N     1 
ATOM   2910  C CA    . LEU A  1 444 ? -1.371   -44.390 33.640  1.00 54.84  ? 444  LEU A CA    1 
ATOM   2911  C C     . LEU A  1 444 ? -2.198   -44.076 34.882  1.00 60.77  ? 444  LEU A C     1 
ATOM   2912  O O     . LEU A  1 444 ? -3.260   -44.686 35.063  1.00 60.72  ? 444  LEU A O     1 
ATOM   2913  C CB    . LEU A  1 444 ? -0.440   -45.566 33.893  1.00 55.88  ? 444  LEU A CB    1 
ATOM   2914  C CG    . LEU A  1 444 ? -0.047   -46.329 32.654  1.00 60.84  ? 444  LEU A CG    1 
ATOM   2915  C CD1   . LEU A  1 444 ? 1.313    -46.923 32.807  1.00 62.45  ? 444  LEU A CD1   1 
ATOM   2916  C CD2   . LEU A  1 444 ? -1.066   -47.403 32.315  1.00 63.28  ? 444  LEU A CD2   1 
ATOM   2917  N N     . ARG A  1 445 ? -1.726   -43.106 35.720  1.00 57.37  ? 445  ARG A N     1 
ATOM   2918  C CA    . ARG A  1 445 ? -2.426   -42.657 36.923  1.00 56.33  ? 445  ARG A CA    1 
ATOM   2919  C C     . ARG A  1 445 ? -3.744   -42.024 36.525  1.00 59.22  ? 445  ARG A C     1 
ATOM   2920  O O     . ARG A  1 445 ? -4.778   -42.358 37.111  1.00 59.53  ? 445  ARG A O     1 
ATOM   2921  C CB    . ARG A  1 445 ? -1.573   -41.675 37.748  1.00 54.97  ? 445  ARG A CB    1 
ATOM   2922  C CG    . ARG A  1 445 ? -2.275   -41.227 39.039  1.00 60.71  ? 445  ARG A CG    1 
ATOM   2923  C CD    . ARG A  1 445 ? -1.421   -40.341 39.909  1.00 70.77  ? 445  ARG A CD    1 
ATOM   2924  N NE    . ARG A  1 445 ? -1.470   -38.933 39.507  1.00 79.92  ? 445  ARG A NE    1 
ATOM   2925  C CZ    . ARG A  1 445 ? -0.398   -38.203 39.214  1.00 92.06  ? 445  ARG A CZ    1 
ATOM   2926  N NH1   . ARG A  1 445 ? 0.815    -38.740 39.265  1.00 83.60  ? 445  ARG A NH1   1 
ATOM   2927  N NH2   . ARG A  1 445 ? -0.530   -36.929 38.873  1.00 69.38  ? 445  ARG A NH2   1 
ATOM   2928  N N     . HIS A  1 446 ? -3.698   -41.118 35.523  1.00 54.54  ? 446  HIS A N     1 
ATOM   2929  C CA    . HIS A  1 446 ? -4.863   -40.414 34.990  1.00 53.02  ? 446  HIS A CA    1 
ATOM   2930  C C     . HIS A  1 446 ? -5.776   -41.393 34.275  1.00 54.17  ? 446  HIS A C     1 
ATOM   2931  O O     . HIS A  1 446 ? -6.983   -41.368 34.496  1.00 51.35  ? 446  HIS A O     1 
ATOM   2932  C CB    . HIS A  1 446 ? -4.439   -39.261 34.054  1.00 53.65  ? 446  HIS A CB    1 
ATOM   2933  C CG    . HIS A  1 446 ? -3.564   -38.220 34.694  1.00 57.24  ? 446  HIS A CG    1 
ATOM   2934  N ND1   . HIS A  1 446 ? -3.847   -37.703 35.949  1.00 59.09  ? 446  HIS A ND1   1 
ATOM   2935  C CD2   . HIS A  1 446 ? -2.470   -37.596 34.205  1.00 59.10  ? 446  HIS A CD2   1 
ATOM   2936  C CE1   . HIS A  1 446 ? -2.903   -36.813 36.193  1.00 58.51  ? 446  HIS A CE1   1 
ATOM   2937  N NE2   . HIS A  1 446 ? -2.050   -36.714 35.174  1.00 58.89  ? 446  HIS A NE2   1 
ATOM   2938  N N     . ARG A  1 447 ? -5.190   -42.298 33.475  1.00 52.78  ? 447  ARG A N     1 
ATOM   2939  C CA    . ARG A  1 447 ? -5.920   -43.337 32.747  1.00 53.84  ? 447  ARG A CA    1 
ATOM   2940  C C     . ARG A  1 447 ? -6.730   -44.213 33.705  1.00 61.39  ? 447  ARG A C     1 
ATOM   2941  O O     . ARG A  1 447 ? -7.863   -44.580 33.389  1.00 61.20  ? 447  ARG A O     1 
ATOM   2942  C CB    . ARG A  1 447 ? -4.974   -44.184 31.881  1.00 52.84  ? 447  ARG A CB    1 
ATOM   2943  C CG    . ARG A  1 447 ? -4.595   -43.521 30.575  1.00 54.88  ? 447  ARG A CG    1 
ATOM   2944  C CD    . ARG A  1 447 ? -4.553   -44.544 29.461  1.00 72.38  ? 447  ARG A CD    1 
ATOM   2945  N NE    . ARG A  1 447 ? -5.298   -44.085 28.284  1.00 89.80  ? 447  ARG A NE    1 
ATOM   2946  C CZ    . ARG A  1 447 ? -6.226   -44.799 27.656  1.00 100.86 ? 447  ARG A CZ    1 
ATOM   2947  N NH1   . ARG A  1 447 ? -6.527   -46.024 28.073  1.00 83.55  ? 447  ARG A NH1   1 
ATOM   2948  N NH2   . ARG A  1 447 ? -6.857   -44.295 26.598  1.00 82.31  ? 447  ARG A NH2   1 
ATOM   2949  N N     . GLU A  1 448 ? -6.152   -44.502 34.889  1.00 60.88  ? 448  GLU A N     1 
ATOM   2950  C CA    . GLU A  1 448 ? -6.760   -45.261 35.981  1.00 62.39  ? 448  GLU A CA    1 
ATOM   2951  C C     . GLU A  1 448 ? -8.001   -44.504 36.479  1.00 66.03  ? 448  GLU A C     1 
ATOM   2952  O O     . GLU A  1 448 ? -9.069   -45.112 36.639  1.00 67.28  ? 448  GLU A O     1 
ATOM   2953  C CB    . GLU A  1 448 ? -5.731   -45.455 37.119  1.00 65.00  ? 448  GLU A CB    1 
ATOM   2954  C CG    . GLU A  1 448 ? -6.284   -45.926 38.460  1.00 78.79  ? 448  GLU A CG    1 
ATOM   2955  C CD    . GLU A  1 448 ? -6.745   -47.366 38.528  1.00 112.07 ? 448  GLU A CD    1 
ATOM   2956  O OE1   . GLU A  1 448 ? -5.972   -48.257 38.107  1.00 124.19 ? 448  GLU A OE1   1 
ATOM   2957  O OE2   . GLU A  1 448 ? -7.860   -47.605 39.045  1.00 106.71 ? 448  GLU A OE2   1 
ATOM   2958  N N     . LYS A  1 449 ? -7.865   -43.173 36.668  1.00 59.32  ? 449  LYS A N     1 
ATOM   2959  C CA    . LYS A  1 449 ? -8.941   -42.315 37.153  1.00 56.48  ? 449  LYS A CA    1 
ATOM   2960  C C     . LYS A  1 449 ? -10.047  -41.995 36.124  1.00 55.90  ? 449  LYS A C     1 
ATOM   2961  O O     . LYS A  1 449 ? -11.026  -41.330 36.475  1.00 54.36  ? 449  LYS A O     1 
ATOM   2962  C CB    . LYS A  1 449 ? -8.378   -41.068 37.845  1.00 57.80  ? 449  LYS A CB    1 
ATOM   2963  C CG    . LYS A  1 449 ? -9.087   -40.726 39.151  1.00 64.47  ? 449  LYS A CG    1 
ATOM   2964  C CD    . LYS A  1 449 ? -8.561   -41.496 40.345  1.00 72.30  ? 449  LYS A CD    1 
ATOM   2965  C CE    . LYS A  1 449 ? -9.525   -41.461 41.506  1.00 86.29  ? 449  LYS A CE    1 
ATOM   2966  N NZ    . LYS A  1 449 ? -9.255   -42.568 42.461  1.00 108.31 ? 449  LYS A NZ    1 
ATOM   2967  N N     . GLY A  1 450 ? -9.910   -42.502 34.896  1.00 50.51  ? 450  GLY A N     1 
ATOM   2968  C CA    . GLY A  1 450 ? -10.928  -42.333 33.865  1.00 49.29  ? 450  GLY A CA    1 
ATOM   2969  C C     . GLY A  1 450 ? -10.526  -41.698 32.546  1.00 52.65  ? 450  GLY A C     1 
ATOM   2970  O O     . GLY A  1 450 ? -11.272  -41.817 31.559  1.00 53.38  ? 450  GLY A O     1 
ATOM   2971  N N     . ARG A  1 451 ? -9.367   -40.996 32.515  1.00 45.85  ? 451  ARG A N     1 
ATOM   2972  C CA    . ARG A  1 451 ? -8.852   -40.323 31.324  1.00 43.14  ? 451  ARG A CA    1 
ATOM   2973  C C     . ARG A  1 451 ? -8.598   -41.295 30.164  1.00 48.41  ? 451  ARG A C     1 
ATOM   2974  O O     . ARG A  1 451 ? -7.907   -42.298 30.342  1.00 47.91  ? 451  ARG A O     1 
ATOM   2975  C CB    . ARG A  1 451 ? -7.594   -39.529 31.664  1.00 39.34  ? 451  ARG A CB    1 
ATOM   2976  C CG    . ARG A  1 451 ? -7.111   -38.657 30.519  1.00 50.03  ? 451  ARG A CG    1 
ATOM   2977  C CD    . ARG A  1 451 ? -5.947   -37.796 30.940  1.00 70.39  ? 451  ARG A CD    1 
ATOM   2978  N NE    . ARG A  1 451 ? -6.371   -36.453 31.324  1.00 83.88  ? 451  ARG A NE    1 
ATOM   2979  C CZ    . ARG A  1 451 ? -6.456   -35.422 30.489  1.00 104.11 ? 451  ARG A CZ    1 
ATOM   2980  N NH1   . ARG A  1 451 ? -6.139   -35.568 29.207  1.00 90.93  ? 451  ARG A NH1   1 
ATOM   2981  N NH2   . ARG A  1 451 ? -6.869   -34.242 30.925  1.00 98.56  ? 451  ARG A NH2   1 
ATOM   2982  N N     . ARG A  1 452 ? -9.188   -41.002 28.986  1.00 46.75  ? 452  ARG A N     1 
ATOM   2983  C CA    . ARG A  1 452 ? -9.024   -41.812 27.766  1.00 48.31  ? 452  ARG A CA    1 
ATOM   2984  C C     . ARG A  1 452 ? -8.372   -40.998 26.625  1.00 55.59  ? 452  ARG A C     1 
ATOM   2985  O O     . ARG A  1 452 ? -8.091   -41.557 25.557  1.00 58.82  ? 452  ARG A O     1 
ATOM   2986  C CB    . ARG A  1 452 ? -10.370  -42.417 27.299  1.00 45.97  ? 452  ARG A CB    1 
ATOM   2987  C CG    . ARG A  1 452 ? -10.976  -43.488 28.212  1.00 47.46  ? 452  ARG A CG    1 
ATOM   2988  C CD    . ARG A  1 452 ? -10.227  -44.812 28.166  1.00 59.62  ? 452  ARG A CD    1 
ATOM   2989  N NE    . ARG A  1 452 ? -9.595   -45.086 29.454  1.00 71.96  ? 452  ARG A NE    1 
ATOM   2990  C CZ    . ARG A  1 452 ? -10.120  -45.855 30.399  1.00 91.14  ? 452  ARG A CZ    1 
ATOM   2991  N NH1   . ARG A  1 452 ? -11.276  -46.478 30.194  1.00 84.54  ? 452  ARG A NH1   1 
ATOM   2992  N NH2   . ARG A  1 452 ? -9.485   -46.029 31.548  1.00 78.21  ? 452  ARG A NH2   1 
ATOM   2993  N N     . LYS A  1 453 ? -8.128   -39.686 26.868  1.00 49.48  ? 453  LYS A N     1 
ATOM   2994  C CA    . LYS A  1 453 ? -7.546   -38.726 25.929  1.00 48.63  ? 453  LYS A CA    1 
ATOM   2995  C C     . LYS A  1 453 ? -6.182   -38.199 26.432  1.00 55.41  ? 453  LYS A C     1 
ATOM   2996  O O     . LYS A  1 453 ? -6.000   -36.986 26.666  1.00 55.17  ? 453  LYS A O     1 
ATOM   2997  C CB    . LYS A  1 453 ? -8.538   -37.566 25.669  1.00 49.31  ? 453  LYS A CB    1 
ATOM   2998  C CG    . LYS A  1 453 ? -9.838   -37.997 24.997  1.00 53.25  ? 453  LYS A CG    1 
ATOM   2999  C CD    . LYS A  1 453 ? -10.856  -36.877 24.945  1.00 50.37  ? 453  LYS A CD    1 
ATOM   3000  C CE    . LYS A  1 453 ? -11.903  -37.146 23.917  1.00 51.86  ? 453  LYS A CE    1 
ATOM   3001  N NZ    . LYS A  1 453 ? -11.330  -37.152 22.533  1.00 62.13  ? 453  LYS A NZ    1 
ATOM   3002  N N     . THR A  1 454 ? -5.221   -39.135 26.596  1.00 52.84  ? 454  THR A N     1 
ATOM   3003  C CA    . THR A  1 454 ? -3.854   -38.861 27.050  1.00 52.14  ? 454  THR A CA    1 
ATOM   3004  C C     . THR A  1 454 ? -3.147   -37.910 26.071  1.00 53.69  ? 454  THR A C     1 
ATOM   3005  O O     . THR A  1 454 ? -2.981   -38.234 24.892  1.00 53.40  ? 454  THR A O     1 
ATOM   3006  C CB    . THR A  1 454 ? -3.123   -40.179 27.365  1.00 56.74  ? 454  THR A CB    1 
ATOM   3007  O OG1   . THR A  1 454 ? -3.907   -40.912 28.301  1.00 57.81  ? 454  THR A OG1   1 
ATOM   3008  C CG2   . THR A  1 454 ? -1.748   -39.962 27.967  1.00 52.22  ? 454  THR A CG2   1 
ATOM   3009  N N     . THR A  1 455 ? -2.800   -36.714 26.565  1.00 48.27  ? 455  THR A N     1 
ATOM   3010  C CA    . THR A  1 455 ? -2.162   -35.655 25.778  1.00 47.18  ? 455  THR A CA    1 
ATOM   3011  C C     . THR A  1 455 ? -0.860   -35.201 26.426  1.00 47.86  ? 455  THR A C     1 
ATOM   3012  O O     . THR A  1 455 ? -0.826   -34.873 27.613  1.00 48.73  ? 455  THR A O     1 
ATOM   3013  C CB    . THR A  1 455 ? -3.147   -34.472 25.540  1.00 60.84  ? 455  THR A CB    1 
ATOM   3014  O OG1   . THR A  1 455 ? -4.438   -34.969 25.140  1.00 61.72  ? 455  THR A OG1   1 
ATOM   3015  C CG2   . THR A  1 455 ? -2.624   -33.466 24.516  1.00 59.25  ? 455  THR A CG2   1 
ATOM   3016  N N     . VAL A  1 456 ? 0.206    -35.171 25.633  1.00 41.41  ? 456  VAL A N     1 
ATOM   3017  C CA    . VAL A  1 456 ? 1.531    -34.719 26.061  1.00 40.82  ? 456  VAL A CA    1 
ATOM   3018  C C     . VAL A  1 456 ? 1.918    -33.543 25.160  1.00 40.94  ? 456  VAL A C     1 
ATOM   3019  O O     . VAL A  1 456 ? 1.612    -33.545 23.964  1.00 39.55  ? 456  VAL A O     1 
ATOM   3020  C CB    . VAL A  1 456 ? 2.598    -35.864 26.053  1.00 46.66  ? 456  VAL A CB    1 
ATOM   3021  C CG1   . VAL A  1 456 ? 3.979    -35.351 26.459  1.00 46.98  ? 456  VAL A CG1   1 
ATOM   3022  C CG2   . VAL A  1 456 ? 2.179    -37.015 26.966  1.00 47.08  ? 456  VAL A CG2   1 
ATOM   3023  N N     . ILE A  1 457 ? 2.549    -32.523 25.742  1.00 36.19  ? 457  ILE A N     1 
ATOM   3024  C CA    . ILE A  1 457 ? 2.982    -31.330 25.008  1.00 34.21  ? 457  ILE A CA    1 
ATOM   3025  C C     . ILE A  1 457 ? 4.498    -31.185 25.068  1.00 37.75  ? 457  ILE A C     1 
ATOM   3026  O O     . ILE A  1 457 ? 5.089    -31.098 26.153  1.00 38.46  ? 457  ILE A O     1 
ATOM   3027  C CB    . ILE A  1 457 ? 2.176    -30.088 25.444  1.00 35.61  ? 457  ILE A CB    1 
ATOM   3028  C CG1   . ILE A  1 457 ? 0.780    -30.138 24.779  1.00 35.25  ? 457  ILE A CG1   1 
ATOM   3029  C CG2   . ILE A  1 457 ? 2.897    -28.793 25.077  1.00 36.13  ? 457  ILE A CG2   1 
ATOM   3030  C CD1   . ILE A  1 457 ? -0.324   -29.778 25.623  1.00 38.54  ? 457  ILE A CD1   1 
ATOM   3031  N N     . VAL A  1 458 ? 5.126    -31.218 23.891  1.00 32.63  ? 458  VAL A N     1 
ATOM   3032  C CA    . VAL A  1 458 ? 6.581    -31.120 23.763  1.00 32.78  ? 458  VAL A CA    1 
ATOM   3033  C C     . VAL A  1 458 ? 6.957    -29.766 23.142  1.00 34.94  ? 458  VAL A C     1 
ATOM   3034  O O     . VAL A  1 458 ? 6.584    -29.478 21.998  1.00 33.21  ? 458  VAL A O     1 
ATOM   3035  C CB    . VAL A  1 458 ? 7.158    -32.301 22.954  1.00 37.75  ? 458  VAL A CB    1 
ATOM   3036  C CG1   . VAL A  1 458 ? 8.680    -32.254 22.920  1.00 38.73  ? 458  VAL A CG1   1 
ATOM   3037  C CG2   . VAL A  1 458 ? 6.669    -33.636 23.500  1.00 38.13  ? 458  VAL A CG2   1 
ATOM   3038  N N     . ALA A  1 459 ? 7.698    -28.947 23.899  1.00 31.30  ? 459  ALA A N     1 
ATOM   3039  C CA    . ALA A  1 459 ? 8.157    -27.647 23.439  1.00 31.83  ? 459  ALA A CA    1 
ATOM   3040  C C     . ALA A  1 459 ? 9.274    -27.784 22.412  1.00 38.66  ? 459  ALA A C     1 
ATOM   3041  O O     . ALA A  1 459 ? 9.936    -28.820 22.362  1.00 40.68  ? 459  ALA A O     1 
ATOM   3042  C CB    . ALA A  1 459 ? 8.648    -26.838 24.619  1.00 33.17  ? 459  ALA A CB    1 
ATOM   3043  N N     . GLU A  1 460 ? 9.487    -26.738 21.597  1.00 36.08  ? 460  GLU A N     1 
ATOM   3044  C CA    . GLU A  1 460 ? 10.546   -26.697 20.590  1.00 38.18  ? 460  GLU A CA    1 
ATOM   3045  C C     . GLU A  1 460 ? 11.918   -26.941 21.238  1.00 49.92  ? 460  GLU A C     1 
ATOM   3046  O O     . GLU A  1 460 ? 12.713   -27.720 20.699  1.00 53.36  ? 460  GLU A O     1 
ATOM   3047  C CB    . GLU A  1 460 ? 10.515   -25.354 19.833  1.00 38.60  ? 460  GLU A CB    1 
ATOM   3048  C CG    . GLU A  1 460 ? 11.560   -25.207 18.739  1.00 44.47  ? 460  GLU A CG    1 
ATOM   3049  C CD    . GLU A  1 460 ? 11.279   -24.205 17.638  1.00 68.70  ? 460  GLU A CD    1 
ATOM   3050  O OE1   . GLU A  1 460 ? 10.575   -23.190 17.880  1.00 59.72  ? 460  GLU A OE1   1 
ATOM   3051  O OE2   . GLU A  1 460 ? 11.788   -24.448 16.518  1.00 60.47  ? 460  GLU A OE2   1 
ATOM   3052  N N     . GLY A  1 461 ? 12.156   -26.312 22.395  1.00 47.85  ? 461  GLY A N     1 
ATOM   3053  C CA    . GLY A  1 461 ? 13.409   -26.445 23.127  1.00 49.51  ? 461  GLY A CA    1 
ATOM   3054  C C     . GLY A  1 461 ? 13.461   -27.511 24.214  1.00 54.74  ? 461  GLY A C     1 
ATOM   3055  O O     . GLY A  1 461 ? 14.386   -27.485 25.041  1.00 56.20  ? 461  GLY A O     1 
ATOM   3056  N N     . ALA A  1 462 ? 12.482   -28.461 24.227  1.00 48.62  ? 462  ALA A N     1 
ATOM   3057  C CA    . ALA A  1 462 ? 12.381   -29.540 25.219  1.00 47.84  ? 462  ALA A CA    1 
ATOM   3058  C C     . ALA A  1 462 ? 13.671   -30.317 25.373  1.00 50.55  ? 462  ALA A C     1 
ATOM   3059  O O     . ALA A  1 462 ? 14.288   -30.705 24.372  1.00 52.16  ? 462  ALA A O     1 
ATOM   3060  C CB    . ALA A  1 462 ? 11.249   -30.478 24.861  1.00 47.94  ? 462  ALA A CB    1 
ATOM   3061  N N     . ILE A  1 463 ? 14.101   -30.492 26.627  1.00 44.19  ? 463  ILE A N     1 
ATOM   3062  C CA    . ILE A  1 463 ? 15.357   -31.155 26.994  1.00 44.85  ? 463  ILE A CA    1 
ATOM   3063  C C     . ILE A  1 463 ? 15.204   -31.966 28.278  1.00 51.28  ? 463  ILE A C     1 
ATOM   3064  O O     . ILE A  1 463 ? 14.173   -31.860 28.954  1.00 49.66  ? 463  ILE A O     1 
ATOM   3065  C CB    . ILE A  1 463 ? 16.531   -30.117 27.162  1.00 46.92  ? 463  ILE A CB    1 
ATOM   3066  C CG1   . ILE A  1 463 ? 16.112   -28.887 27.991  1.00 44.63  ? 463  ILE A CG1   1 
ATOM   3067  C CG2   . ILE A  1 463 ? 17.164   -29.736 25.822  1.00 47.50  ? 463  ILE A CG2   1 
ATOM   3068  C CD1   . ILE A  1 463 ? 17.194   -28.112 28.616  1.00 46.73  ? 463  ILE A CD1   1 
ATOM   3069  N N     . ASP A  1 464 ? 16.237   -32.780 28.602  1.00 50.23  ? 464  ASP A N     1 
ATOM   3070  C CA    . ASP A  1 464 ? 16.366   -33.485 29.870  1.00 51.43  ? 464  ASP A CA    1 
ATOM   3071  C C     . ASP A  1 464 ? 17.422   -32.708 30.673  1.00 58.20  ? 464  ASP A C     1 
ATOM   3072  O O     . ASP A  1 464 ? 18.161   -31.904 30.083  1.00 57.79  ? 464  ASP A O     1 
ATOM   3073  C CB    . ASP A  1 464 ? 16.737   -34.976 29.708  1.00 54.75  ? 464  ASP A CB    1 
ATOM   3074  C CG    . ASP A  1 464 ? 18.046   -35.331 29.005  1.00 69.01  ? 464  ASP A CG    1 
ATOM   3075  O OD1   . ASP A  1 464 ? 18.103   -36.408 28.362  1.00 70.22  ? 464  ASP A OD1   1 
ATOM   3076  O OD2   . ASP A  1 464 ? 19.031   -34.583 29.161  1.00 77.43  ? 464  ASP A OD2   1 
ATOM   3077  N N     . ASP A  1 465 ? 17.512   -32.949 31.999  1.00 56.21  ? 465  ASP A N     1 
ATOM   3078  C CA    . ASP A  1 465 ? 18.461   -32.273 32.894  1.00 56.78  ? 465  ASP A CA    1 
ATOM   3079  C C     . ASP A  1 465 ? 19.964   -32.375 32.498  1.00 60.51  ? 465  ASP A C     1 
ATOM   3080  O O     . ASP A  1 465 ? 20.808   -31.683 33.080  1.00 60.76  ? 465  ASP A O     1 
ATOM   3081  C CB    . ASP A  1 465 ? 18.204   -32.654 34.356  1.00 59.39  ? 465  ASP A CB    1 
ATOM   3082  C CG    . ASP A  1 465 ? 18.511   -34.092 34.721  1.00 79.91  ? 465  ASP A CG    1 
ATOM   3083  O OD1   . ASP A  1 465 ? 18.909   -34.869 33.821  1.00 82.78  ? 465  ASP A OD1   1 
ATOM   3084  O OD2   . ASP A  1 465 ? 18.346   -34.450 35.905  1.00 91.40  ? 465  ASP A OD2   1 
ATOM   3085  N N     . GLN A  1 466 ? 20.284   -33.218 31.496  1.00 55.20  ? 466  GLN A N     1 
ATOM   3086  C CA    . GLN A  1 466 ? 21.638   -33.350 30.972  1.00 55.33  ? 466  GLN A CA    1 
ATOM   3087  C C     . GLN A  1 466 ? 21.771   -32.641 29.613  1.00 57.68  ? 466  GLN A C     1 
ATOM   3088  O O     . GLN A  1 466 ? 22.705   -32.925 28.849  1.00 57.79  ? 466  GLN A O     1 
ATOM   3089  C CB    . GLN A  1 466 ? 22.062   -34.822 30.909  1.00 57.83  ? 466  GLN A CB    1 
ATOM   3090  C CG    . GLN A  1 466 ? 23.478   -35.054 31.432  1.00 73.77  ? 466  GLN A CG    1 
ATOM   3091  C CD    . GLN A  1 466 ? 23.667   -34.616 32.871  1.00 96.17  ? 466  GLN A CD    1 
ATOM   3092  O OE1   . GLN A  1 466 ? 22.836   -34.886 33.752  1.00 85.63  ? 466  GLN A OE1   1 
ATOM   3093  N NE2   . GLN A  1 466 ? 24.776   -33.936 33.142  1.00 100.17 ? 466  GLN A NE2   1 
ATOM   3094  N N     . LEU A  1 467 ? 20.827   -31.693 29.328  1.00 51.82  ? 467  LEU A N     1 
ATOM   3095  C CA    . LEU A  1 467 ? 20.761   -30.854 28.122  1.00 50.60  ? 467  LEU A CA    1 
ATOM   3096  C C     . LEU A  1 467 ? 20.401   -31.572 26.814  1.00 52.18  ? 467  LEU A C     1 
ATOM   3097  O O     . LEU A  1 467 ? 20.317   -30.920 25.767  1.00 50.73  ? 467  LEU A O     1 
ATOM   3098  C CB    . LEU A  1 467 ? 22.039   -29.975 27.953  1.00 52.28  ? 467  LEU A CB    1 
ATOM   3099  C CG    . LEU A  1 467 ? 21.949   -28.468 28.282  1.00 57.36  ? 467  LEU A CG    1 
ATOM   3100  C CD1   . LEU A  1 467 ? 21.077   -27.717 27.273  1.00 57.63  ? 467  LEU A CD1   1 
ATOM   3101  C CD2   . LEU A  1 467 ? 21.449   -28.221 29.685  1.00 59.69  ? 467  LEU A CD2   1 
ATOM   3102  N N     . ASN A  1 468 ? 20.170   -32.893 26.869  1.00 48.86  ? 468  ASN A N     1 
ATOM   3103  C CA    . ASN A  1 468 ? 19.818   -33.679 25.691  1.00 49.03  ? 468  ASN A CA    1 
ATOM   3104  C C     . ASN A  1 468 ? 18.400   -33.330 25.250  1.00 52.37  ? 468  ASN A C     1 
ATOM   3105  O O     . ASN A  1 468 ? 17.487   -33.313 26.086  1.00 51.08  ? 468  ASN A O     1 
ATOM   3106  C CB    . ASN A  1 468 ? 19.915   -35.190 25.946  1.00 50.75  ? 468  ASN A CB    1 
ATOM   3107  C CG    . ASN A  1 468 ? 21.179   -35.641 26.598  1.00 79.58  ? 468  ASN A CG    1 
ATOM   3108  O OD1   . ASN A  1 468 ? 22.259   -35.565 26.015  1.00 73.89  ? 468  ASN A OD1   1 
ATOM   3109  N ND2   . ASN A  1 468 ? 21.063   -36.144 27.818  1.00 78.87  ? 468  ASN A ND2   1 
ATOM   3110  N N     . PRO A  1 469 ? 18.184   -33.052 23.945  1.00 48.42  ? 469  PRO A N     1 
ATOM   3111  C CA    . PRO A  1 469 ? 16.827   -32.728 23.498  1.00 46.59  ? 469  PRO A CA    1 
ATOM   3112  C C     . PRO A  1 469 ? 15.873   -33.919 23.589  1.00 49.77  ? 469  PRO A C     1 
ATOM   3113  O O     . PRO A  1 469 ? 16.303   -35.079 23.537  1.00 50.72  ? 469  PRO A O     1 
ATOM   3114  C CB    . PRO A  1 469 ? 17.037   -32.261 22.057  1.00 48.50  ? 469  PRO A CB    1 
ATOM   3115  C CG    . PRO A  1 469 ? 18.291   -32.921 21.614  1.00 53.95  ? 469  PRO A CG    1 
ATOM   3116  C CD    . PRO A  1 469 ? 19.150   -33.018 22.826  1.00 50.65  ? 469  PRO A CD    1 
ATOM   3117  N N     . ILE A  1 470 ? 14.577   -33.623 23.772  1.00 43.62  ? 470  ILE A N     1 
ATOM   3118  C CA    . ILE A  1 470 ? 13.525   -34.638 23.854  1.00 41.77  ? 470  ILE A CA    1 
ATOM   3119  C C     . ILE A  1 470 ? 12.628   -34.421 22.655  1.00 47.18  ? 470  ILE A C     1 
ATOM   3120  O O     . ILE A  1 470 ? 11.910   -33.411 22.592  1.00 47.85  ? 470  ILE A O     1 
ATOM   3121  C CB    . ILE A  1 470 ? 12.773   -34.642 25.228  1.00 42.72  ? 470  ILE A CB    1 
ATOM   3122  C CG1   . ILE A  1 470 ? 13.758   -34.950 26.397  1.00 43.08  ? 470  ILE A CG1   1 
ATOM   3123  C CG2   . ILE A  1 470 ? 11.626   -35.639 25.227  1.00 42.14  ? 470  ILE A CG2   1 
ATOM   3124  C CD1   . ILE A  1 470 ? 13.191   -34.901 27.804  1.00 39.04  ? 470  ILE A CD1   1 
ATOM   3125  N N     . THR A  1 471 ? 12.735   -35.314 21.657  1.00 43.74  ? 471  THR A N     1 
ATOM   3126  C CA    . THR A  1 471 ? 11.904   -35.212 20.460  1.00 42.62  ? 471  THR A CA    1 
ATOM   3127  C C     . THR A  1 471 ? 10.519   -35.772 20.752  1.00 45.76  ? 471  THR A C     1 
ATOM   3128  O O     . THR A  1 471 ? 10.353   -36.568 21.673  1.00 44.56  ? 471  THR A O     1 
ATOM   3129  C CB    . THR A  1 471 ? 12.554   -35.878 19.247  1.00 51.85  ? 471  THR A CB    1 
ATOM   3130  O OG1   . THR A  1 471 ? 12.770   -37.268 19.500  1.00 53.46  ? 471  THR A OG1   1 
ATOM   3131  C CG2   . THR A  1 471 ? 13.823   -35.174 18.799  1.00 50.01  ? 471  THR A CG2   1 
ATOM   3132  N N     . SER A  1 472 ? 9.521    -35.352 19.968  1.00 43.45  ? 472  SER A N     1 
ATOM   3133  C CA    . SER A  1 472 ? 8.149    -35.830 20.122  1.00 42.99  ? 472  SER A CA    1 
ATOM   3134  C C     . SER A  1 472 ? 8.084    -37.299 19.734  1.00 48.89  ? 472  SER A C     1 
ATOM   3135  O O     . SER A  1 472 ? 7.249    -38.038 20.260  1.00 48.76  ? 472  SER A O     1 
ATOM   3136  C CB    . SER A  1 472 ? 7.179    -34.988 19.301  1.00 44.86  ? 472  SER A CB    1 
ATOM   3137  O OG    . SER A  1 472 ? 7.499    -35.063 17.923  1.00 57.01  ? 472  SER A OG    1 
ATOM   3138  N N     . GLU A  1 473 ? 9.006    -37.731 18.855  1.00 47.23  ? 473  GLU A N     1 
ATOM   3139  C CA    . GLU A  1 473 ? 9.100    -39.122 18.428  1.00 48.16  ? 473  GLU A CA    1 
ATOM   3140  C C     . GLU A  1 473 ? 9.550    -39.974 19.610  1.00 53.58  ? 473  GLU A C     1 
ATOM   3141  O O     . GLU A  1 473 ? 8.998    -41.050 19.812  1.00 54.65  ? 473  GLU A O     1 
ATOM   3142  C CB    . GLU A  1 473 ? 10.033   -39.269 17.217  1.00 50.52  ? 473  GLU A CB    1 
ATOM   3143  C CG    . GLU A  1 473 ? 9.790    -40.531 16.409  1.00 64.90  ? 473  GLU A CG    1 
ATOM   3144  C CD    . GLU A  1 473 ? 8.393    -40.761 15.856  1.00 96.99  ? 473  GLU A CD    1 
ATOM   3145  O OE1   . GLU A  1 473 ? 7.862    -41.882 16.042  1.00 97.46  ? 473  GLU A OE1   1 
ATOM   3146  O OE2   . GLU A  1 473 ? 7.839    -39.834 15.220  1.00 94.50  ? 473  GLU A OE2   1 
ATOM   3147  N N     . GLU A  1 474 ? 10.490   -39.455 20.432  1.00 49.84  ? 474  GLU A N     1 
ATOM   3148  C CA    . GLU A  1 474 ? 10.993   -40.117 21.643  1.00 50.44  ? 474  GLU A CA    1 
ATOM   3149  C C     . GLU A  1 474 ? 9.834    -40.363 22.592  1.00 52.79  ? 474  GLU A C     1 
ATOM   3150  O O     . GLU A  1 474 ? 9.645    -41.487 23.061  1.00 52.02  ? 474  GLU A O     1 
ATOM   3151  C CB    . GLU A  1 474 ? 12.042   -39.237 22.350  1.00 52.05  ? 474  GLU A CB    1 
ATOM   3152  C CG    . GLU A  1 474 ? 13.475   -39.413 21.877  1.00 63.07  ? 474  GLU A CG    1 
ATOM   3153  C CD    . GLU A  1 474 ? 14.389   -38.255 22.236  1.00 95.11  ? 474  GLU A CD    1 
ATOM   3154  O OE1   . GLU A  1 474 ? 14.503   -37.927 23.440  1.00 99.75  ? 474  GLU A OE1   1 
ATOM   3155  O OE2   . GLU A  1 474 ? 15.003   -37.681 21.307  1.00 93.04  ? 474  GLU A OE2   1 
ATOM   3156  N N     . VAL A  1 475 ? 9.032    -39.298 22.822  1.00 48.52  ? 475  VAL A N     1 
ATOM   3157  C CA    . VAL A  1 475 ? 7.836    -39.272 23.680  1.00 46.82  ? 475  VAL A CA    1 
ATOM   3158  C C     . VAL A  1 475 ? 6.760    -40.272 23.183  1.00 51.60  ? 475  VAL A C     1 
ATOM   3159  O O     . VAL A  1 475 ? 6.207    -41.019 23.998  1.00 51.94  ? 475  VAL A O     1 
ATOM   3160  C CB    . VAL A  1 475 ? 7.299    -37.833 23.834  1.00 47.69  ? 475  VAL A CB    1 
ATOM   3161  C CG1   . VAL A  1 475 ? 6.100    -37.791 24.751  1.00 46.50  ? 475  VAL A CG1   1 
ATOM   3162  C CG2   . VAL A  1 475 ? 8.381    -36.908 24.354  1.00 47.67  ? 475  VAL A CG2   1 
ATOM   3163  N N     . LYS A  1 476 ? 6.504    -40.299 21.847  1.00 46.28  ? 476  LYS A N     1 
ATOM   3164  C CA    . LYS A  1 476 ? 5.562    -41.201 21.189  1.00 45.17  ? 476  LYS A CA    1 
ATOM   3165  C C     . LYS A  1 476 ? 5.906    -42.650 21.546  1.00 49.86  ? 476  LYS A C     1 
ATOM   3166  O O     . LYS A  1 476 ? 5.049    -43.386 22.039  1.00 48.08  ? 476  LYS A O     1 
ATOM   3167  C CB    . LYS A  1 476 ? 5.606    -40.985 19.660  1.00 47.69  ? 476  LYS A CB    1 
ATOM   3168  C CG    . LYS A  1 476 ? 4.548    -41.764 18.864  1.00 54.45  ? 476  LYS A CG    1 
ATOM   3169  C CD    . LYS A  1 476 ? 5.185    -42.657 17.817  1.00 61.39  ? 476  LYS A CD    1 
ATOM   3170  C CE    . LYS A  1 476 ? 4.158    -43.371 16.991  1.00 76.86  ? 476  LYS A CE    1 
ATOM   3171  N NZ    . LYS A  1 476 ? 3.487    -42.462 16.020  1.00 91.63  ? 476  LYS A NZ    1 
ATOM   3172  N N     . ASP A  1 477 ? 7.183    -43.019 21.359  1.00 49.97  ? 477  ASP A N     1 
ATOM   3173  C CA    . ASP A  1 477 ? 7.735    -44.345 21.651  1.00 51.95  ? 477  ASP A CA    1 
ATOM   3174  C C     . ASP A  1 477 ? 7.486    -44.780 23.099  1.00 54.34  ? 477  ASP A C     1 
ATOM   3175  O O     . ASP A  1 477 ? 7.139    -45.938 23.318  1.00 53.46  ? 477  ASP A O     1 
ATOM   3176  C CB    . ASP A  1 477 ? 9.234    -44.397 21.294  1.00 55.71  ? 477  ASP A CB    1 
ATOM   3177  C CG    . ASP A  1 477 ? 9.591    -44.073 19.838  1.00 69.16  ? 477  ASP A CG    1 
ATOM   3178  O OD1   . ASP A  1 477 ? 8.704    -44.195 18.954  1.00 67.36  ? 477  ASP A OD1   1 
ATOM   3179  O OD2   . ASP A  1 477 ? 10.758   -43.709 19.582  1.00 80.68  ? 477  ASP A OD2   1 
ATOM   3180  N N     . VAL A  1 478 ? 7.604    -43.838 24.069  1.00 50.56  ? 478  VAL A N     1 
ATOM   3181  C CA    . VAL A  1 478 ? 7.361    -44.096 25.497  1.00 50.57  ? 478  VAL A CA    1 
ATOM   3182  C C     . VAL A  1 478 ? 5.910    -44.539 25.692  1.00 53.70  ? 478  VAL A C     1 
ATOM   3183  O O     . VAL A  1 478 ? 5.673    -45.606 26.250  1.00 54.24  ? 478  VAL A O     1 
ATOM   3184  C CB    . VAL A  1 478 ? 7.709    -42.887 26.422  1.00 53.98  ? 478  VAL A CB    1 
ATOM   3185  C CG1   . VAL A  1 478 ? 7.540    -43.250 27.898  1.00 53.54  ? 478  VAL A CG1   1 
ATOM   3186  C CG2   . VAL A  1 478 ? 9.120    -42.357 26.162  1.00 55.00  ? 478  VAL A CG2   1 
ATOM   3187  N N     . LEU A  1 479 ? 4.951    -43.722 25.207  1.00 48.60  ? 479  LEU A N     1 
ATOM   3188  C CA    . LEU A  1 479 ? 3.503    -43.955 25.322  1.00 46.42  ? 479  LEU A CA    1 
ATOM   3189  C C     . LEU A  1 479 ? 3.042    -45.204 24.564  1.00 49.71  ? 479  LEU A C     1 
ATOM   3190  O O     . LEU A  1 479 ? 2.097    -45.869 25.000  1.00 48.37  ? 479  LEU A O     1 
ATOM   3191  C CB    . LEU A  1 479 ? 2.700    -42.715 24.868  1.00 44.51  ? 479  LEU A CB    1 
ATOM   3192  C CG    . LEU A  1 479 ? 3.055    -41.354 25.501  1.00 48.07  ? 479  LEU A CG    1 
ATOM   3193  C CD1   . LEU A  1 479 ? 2.362    -40.238 24.790  1.00 47.15  ? 479  LEU A CD1   1 
ATOM   3194  C CD2   . LEU A  1 479 ? 2.700    -41.296 26.972  1.00 49.76  ? 479  LEU A CD2   1 
ATOM   3195  N N     . VAL A  1 480 ? 3.715    -45.524 23.443  1.00 46.73  ? 480  VAL A N     1 
ATOM   3196  C CA    . VAL A  1 480 ? 3.393    -46.689 22.634  1.00 47.74  ? 480  VAL A CA    1 
ATOM   3197  C C     . VAL A  1 480 ? 3.714    -47.967 23.421  1.00 56.93  ? 480  VAL A C     1 
ATOM   3198  O O     . VAL A  1 480 ? 2.903    -48.895 23.416  1.00 58.36  ? 480  VAL A O     1 
ATOM   3199  C CB    . VAL A  1 480 ? 4.028    -46.602 21.212  1.00 51.73  ? 480  VAL A CB    1 
ATOM   3200  C CG1   . VAL A  1 480 ? 4.242    -47.974 20.579  1.00 53.21  ? 480  VAL A CG1   1 
ATOM   3201  C CG2   . VAL A  1 480 ? 3.197    -45.715 20.290  1.00 49.89  ? 480  VAL A CG2   1 
ATOM   3202  N N     . GLU A  1 481 ? 4.837    -47.982 24.175  1.00 56.03  ? 481  GLU A N     1 
ATOM   3203  C CA    . GLU A  1 481 ? 5.214    -49.140 25.002  1.00 57.90  ? 481  GLU A CA    1 
ATOM   3204  C C     . GLU A  1 481 ? 4.362    -49.291 26.296  1.00 62.48  ? 481  GLU A C     1 
ATOM   3205  O O     . GLU A  1 481 ? 4.538    -50.235 27.058  1.00 64.72  ? 481  GLU A O     1 
ATOM   3206  C CB    . GLU A  1 481 ? 6.744    -49.263 25.212  1.00 60.77  ? 481  GLU A CB    1 
ATOM   3207  C CG    . GLU A  1 481 ? 7.391    -48.162 26.040  1.00 76.74  ? 481  GLU A CG    1 
ATOM   3208  C CD    . GLU A  1 481 ? 8.908    -48.080 25.990  1.00 115.22 ? 481  GLU A CD    1 
ATOM   3209  O OE1   . GLU A  1 481 ? 9.514    -47.759 27.039  1.00 119.56 ? 481  GLU A OE1   1 
ATOM   3210  O OE2   . GLU A  1 481 ? 9.491    -48.308 24.903  1.00 112.70 ? 481  GLU A OE2   1 
ATOM   3211  N N     . ILE A  1 482 ? 3.397    -48.393 26.489  1.00 56.91  ? 482  ILE A N     1 
ATOM   3212  C CA    . ILE A  1 482 ? 2.418    -48.397 27.570  1.00 55.70  ? 482  ILE A CA    1 
ATOM   3213  C C     . ILE A  1 482 ? 1.068    -48.924 26.999  1.00 57.21  ? 482  ILE A C     1 
ATOM   3214  O O     . ILE A  1 482 ? 0.076    -49.040 27.715  1.00 56.31  ? 482  ILE A O     1 
ATOM   3215  C CB    . ILE A  1 482 ? 2.419    -46.978 28.249  1.00 58.23  ? 482  ILE A CB    1 
ATOM   3216  C CG1   . ILE A  1 482 ? 3.546    -46.874 29.285  1.00 59.64  ? 482  ILE A CG1   1 
ATOM   3217  C CG2   . ILE A  1 482 ? 1.083    -46.462 28.816  1.00 58.47  ? 482  ILE A CG2   1 
ATOM   3218  C CD1   . ILE A  1 482 ? 3.702    -48.025 30.284  1.00 68.77  ? 482  ILE A CD1   1 
ATOM   3219  N N     . GLY A  1 483 ? 1.097    -49.321 25.727  1.00 53.49  ? 483  GLY A N     1 
ATOM   3220  C CA    . GLY A  1 483 ? -0.029   -49.897 24.999  1.00 53.48  ? 483  GLY A CA    1 
ATOM   3221  C C     . GLY A  1 483 ? -1.005   -48.900 24.404  1.00 56.58  ? 483  GLY A C     1 
ATOM   3222  O O     . GLY A  1 483 ? -2.172   -49.248 24.166  1.00 55.50  ? 483  GLY A O     1 
ATOM   3223  N N     . LEU A  1 484 ? -0.525   -47.655 24.145  1.00 51.03  ? 484  LEU A N     1 
ATOM   3224  C CA    . LEU A  1 484 ? -1.335   -46.577 23.594  1.00 48.30  ? 484  LEU A CA    1 
ATOM   3225  C C     . LEU A  1 484 ? -0.992   -46.253 22.147  1.00 52.50  ? 484  LEU A C     1 
ATOM   3226  O O     . LEU A  1 484 ? 0.182    -46.060 21.822  1.00 51.55  ? 484  LEU A O     1 
ATOM   3227  C CB    . LEU A  1 484 ? -1.159   -45.312 24.432  1.00 46.71  ? 484  LEU A CB    1 
ATOM   3228  C CG    . LEU A  1 484 ? -1.540   -45.367 25.885  1.00 49.89  ? 484  LEU A CG    1 
ATOM   3229  C CD1   . LEU A  1 484 ? -1.039   -44.135 26.593  1.00 48.00  ? 484  LEU A CD1   1 
ATOM   3230  C CD2   . LEU A  1 484 ? -3.046   -45.507 26.050  1.00 51.48  ? 484  LEU A CD2   1 
ATOM   3231  N N     . ASP A  1 485 ? -2.024   -46.142 21.292  1.00 50.55  ? 485  ASP A N     1 
ATOM   3232  C CA    . ASP A  1 485 ? -1.852   -45.759 19.892  1.00 52.26  ? 485  ASP A CA    1 
ATOM   3233  C C     . ASP A  1 485 ? -1.639   -44.233 19.850  1.00 56.83  ? 485  ASP A C     1 
ATOM   3234  O O     . ASP A  1 485 ? -2.597   -43.447 19.965  1.00 55.49  ? 485  ASP A O     1 
ATOM   3235  C CB    . ASP A  1 485 ? -3.051   -46.215 19.032  1.00 55.28  ? 485  ASP A CB    1 
ATOM   3236  C CG    . ASP A  1 485 ? -2.876   -45.971 17.538  1.00 82.30  ? 485  ASP A CG    1 
ATOM   3237  O OD1   . ASP A  1 485 ? -1.713   -46.054 17.043  1.00 88.14  ? 485  ASP A OD1   1 
ATOM   3238  O OD2   . ASP A  1 485 ? -3.895   -45.719 16.858  1.00 89.79  ? 485  ASP A OD2   1 
ATOM   3239  N N     . THR A  1 486 ? -0.351   -43.833 19.759  1.00 53.39  ? 486  THR A N     1 
ATOM   3240  C CA    . THR A  1 486 ? 0.109    -42.441 19.807  1.00 51.16  ? 486  THR A CA    1 
ATOM   3241  C C     . THR A  1 486 ? 0.204    -41.761 18.444  1.00 53.03  ? 486  THR A C     1 
ATOM   3242  O O     . THR A  1 486 ? 0.658    -42.367 17.488  1.00 54.61  ? 486  THR A O     1 
ATOM   3243  C CB    . THR A  1 486 ? 1.383    -42.330 20.663  1.00 53.82  ? 486  THR A CB    1 
ATOM   3244  O OG1   . THR A  1 486 ? 1.285    -43.213 21.783  1.00 49.38  ? 486  THR A OG1   1 
ATOM   3245  C CG2   . THR A  1 486 ? 1.626    -40.925 21.173  1.00 51.83  ? 486  THR A CG2   1 
ATOM   3246  N N     . ARG A  1 487 ? -0.212   -40.485 18.380  1.00 46.26  ? 487  ARG A N     1 
ATOM   3247  C CA    . ARG A  1 487 ? -0.213   -39.648 17.183  1.00 44.54  ? 487  ARG A CA    1 
ATOM   3248  C C     . ARG A  1 487 ? 0.455    -38.271 17.389  1.00 46.42  ? 487  ARG A C     1 
ATOM   3249  O O     . ARG A  1 487 ? -0.101   -37.412 18.099  1.00 45.60  ? 487  ARG A O     1 
ATOM   3250  C CB    . ARG A  1 487 ? -1.665   -39.411 16.740  1.00 43.97  ? 487  ARG A CB    1 
ATOM   3251  C CG    . ARG A  1 487 ? -2.087   -40.215 15.556  1.00 48.76  ? 487  ARG A CG    1 
ATOM   3252  C CD    . ARG A  1 487 ? -1.463   -39.742 14.266  1.00 45.83  ? 487  ARG A CD    1 
ATOM   3253  N NE    . ARG A  1 487 ? -2.019   -40.507 13.157  1.00 51.18  ? 487  ARG A NE    1 
ATOM   3254  C CZ    . ARG A  1 487 ? -1.576   -41.684 12.734  1.00 64.18  ? 487  ARG A CZ    1 
ATOM   3255  N NH1   . ARG A  1 487 ? -0.535   -42.265 13.327  1.00 60.15  ? 487  ARG A NH1   1 
ATOM   3256  N NH2   . ARG A  1 487 ? -2.176   -42.296 11.724  1.00 49.24  ? 487  ARG A NH2   1 
ATOM   3257  N N     . ILE A  1 488 ? 1.595    -38.033 16.703  1.00 41.17  ? 488  ILE A N     1 
ATOM   3258  C CA    . ILE A  1 488 ? 2.270    -36.735 16.781  1.00 39.95  ? 488  ILE A CA    1 
ATOM   3259  C C     . ILE A  1 488 ? 1.523    -35.692 15.934  1.00 45.53  ? 488  ILE A C     1 
ATOM   3260  O O     . ILE A  1 488 ? 1.020    -36.021 14.854  1.00 47.02  ? 488  ILE A O     1 
ATOM   3261  C CB    . ILE A  1 488 ? 3.775    -36.798 16.407  1.00 43.30  ? 488  ILE A CB    1 
ATOM   3262  C CG1   . ILE A  1 488 ? 4.537    -37.838 17.256  1.00 43.29  ? 488  ILE A CG1   1 
ATOM   3263  C CG2   . ILE A  1 488 ? 4.445    -35.413 16.489  1.00 43.44  ? 488  ILE A CG2   1 
ATOM   3264  C CD1   . ILE A  1 488 ? 4.967    -38.964 16.489  1.00 47.38  ? 488  ILE A CD1   1 
ATOM   3265  N N     . THR A  1 489 ? 1.436    -34.445 16.452  1.00 39.90  ? 489  THR A N     1 
ATOM   3266  C CA    . THR A  1 489 ? 0.859    -33.295 15.768  1.00 37.45  ? 489  THR A CA    1 
ATOM   3267  C C     . THR A  1 489 ? 1.875    -32.186 15.924  1.00 40.76  ? 489  THR A C     1 
ATOM   3268  O O     . THR A  1 489 ? 2.079    -31.691 17.027  1.00 41.27  ? 489  THR A O     1 
ATOM   3269  C CB    . THR A  1 489 ? -0.564   -32.968 16.272  1.00 35.25  ? 489  THR A CB    1 
ATOM   3270  O OG1   . THR A  1 489 ? -1.426   -34.069 15.945  1.00 40.21  ? 489  THR A OG1   1 
ATOM   3271  C CG2   . THR A  1 489 ? -1.126   -31.659 15.689  1.00 19.84  ? 489  THR A CG2   1 
ATOM   3272  N N     . ARG A  1 490 ? 2.564    -31.858 14.840  1.00 36.69  ? 490  ARG A N     1 
ATOM   3273  C CA    . ARG A  1 490 ? 3.538    -30.781 14.817  1.00 36.85  ? 490  ARG A CA    1 
ATOM   3274  C C     . ARG A  1 490 ? 2.854    -29.502 14.256  1.00 39.20  ? 490  ARG A C     1 
ATOM   3275  O O     . ARG A  1 490 ? 2.383    -29.498 13.120  1.00 38.47  ? 490  ARG A O     1 
ATOM   3276  C CB    . ARG A  1 490 ? 4.787    -31.190 14.012  1.00 38.36  ? 490  ARG A CB    1 
ATOM   3277  C CG    . ARG A  1 490 ? 5.652    -32.219 14.743  1.00 47.15  ? 490  ARG A CG    1 
ATOM   3278  C CD    . ARG A  1 490 ? 6.677    -32.915 13.855  1.00 43.42  ? 490  ARG A CD    1 
ATOM   3279  N NE    . ARG A  1 490 ? 6.217    -34.231 13.410  1.00 45.21  ? 490  ARG A NE    1 
ATOM   3280  C CZ    . ARG A  1 490 ? 6.771    -35.381 13.775  1.00 73.59  ? 490  ARG A CZ    1 
ATOM   3281  N NH1   . ARG A  1 490 ? 7.814    -35.393 14.594  1.00 63.57  ? 490  ARG A NH1   1 
ATOM   3282  N NH2   . ARG A  1 490 ? 6.282    -36.532 13.325  1.00 75.00  ? 490  ARG A NH2   1 
ATOM   3283  N N     . LEU A  1 491 ? 2.748    -28.451 15.087  1.00 34.48  ? 491  LEU A N     1 
ATOM   3284  C CA    . LEU A  1 491 ? 2.120    -27.169 14.731  1.00 33.00  ? 491  LEU A CA    1 
ATOM   3285  C C     . LEU A  1 491 ? 2.855    -26.461 13.614  1.00 39.06  ? 491  LEU A C     1 
ATOM   3286  O O     . LEU A  1 491 ? 2.218    -25.957 12.702  1.00 38.75  ? 491  LEU A O     1 
ATOM   3287  C CB    . LEU A  1 491 ? 2.021    -26.228 15.961  1.00 31.55  ? 491  LEU A CB    1 
ATOM   3288  C CG    . LEU A  1 491 ? 0.668    -26.080 16.673  1.00 33.10  ? 491  LEU A CG    1 
ATOM   3289  C CD1   . LEU A  1 491 ? -0.324   -25.320 15.847  1.00 30.99  ? 491  LEU A CD1   1 
ATOM   3290  C CD2   . LEU A  1 491 ? 0.116    -27.419 17.146  1.00 35.84  ? 491  LEU A CD2   1 
ATOM   3291  N N     . GLY A  1 492 ? 4.184    -26.425 13.695  1.00 37.53  ? 492  GLY A N     1 
ATOM   3292  C CA    . GLY A  1 492 ? 5.039    -25.791 12.694  1.00 36.99  ? 492  GLY A CA    1 
ATOM   3293  C C     . GLY A  1 492 ? 4.757    -24.319 12.514  1.00 39.02  ? 492  GLY A C     1 
ATOM   3294  O O     . GLY A  1 492 ? 4.377    -23.633 13.469  1.00 38.65  ? 492  GLY A O     1 
ATOM   3295  N N     . HIS A  1 493 ? 4.866    -23.838 11.270  1.00 34.47  ? 493  HIS A N     1 
ATOM   3296  C CA    . HIS A  1 493 ? 4.661    -22.435 10.952  1.00 33.15  ? 493  HIS A CA    1 
ATOM   3297  C C     . HIS A  1 493 ? 3.240    -21.893 11.214  1.00 33.20  ? 493  HIS A C     1 
ATOM   3298  O O     . HIS A  1 493 ? 3.059    -20.670 11.246  1.00 35.75  ? 493  HIS A O     1 
ATOM   3299  C CB    . HIS A  1 493 ? 5.171    -22.124 9.547   1.00 35.80  ? 493  HIS A CB    1 
ATOM   3300  C CG    . HIS A  1 493 ? 5.460    -20.668 9.317   1.00 39.99  ? 493  HIS A CG    1 
ATOM   3301  N ND1   . HIS A  1 493 ? 6.582    -20.067 9.849   1.00 42.26  ? 493  HIS A ND1   1 
ATOM   3302  C CD2   . HIS A  1 493 ? 4.754    -19.743 8.621   1.00 41.91  ? 493  HIS A CD2   1 
ATOM   3303  C CE1   . HIS A  1 493 ? 6.530    -18.807 9.461   1.00 41.90  ? 493  HIS A CE1   1 
ATOM   3304  N NE2   . HIS A  1 493 ? 5.446    -18.563 8.727   1.00 41.91  ? 493  HIS A NE2   1 
ATOM   3305  N N     . VAL A  1 494 ? 2.256    -22.784 11.467  1.00 23.24  ? 494  VAL A N     1 
ATOM   3306  C CA    . VAL A  1 494 ? 0.860    -22.457 11.815  1.00 19.21  ? 494  VAL A CA    1 
ATOM   3307  C C     . VAL A  1 494 ? 0.840    -21.475 13.020  1.00 26.05  ? 494  VAL A C     1 
ATOM   3308  O O     . VAL A  1 494 ? 0.081    -20.503 13.019  1.00 26.09  ? 494  VAL A O     1 
ATOM   3309  C CB    . VAL A  1 494 ? 0.033    -23.758 12.062  1.00 19.42  ? 494  VAL A CB    1 
ATOM   3310  C CG1   . VAL A  1 494 ? -1.285   -23.493 12.744  1.00 18.01  ? 494  VAL A CG1   1 
ATOM   3311  C CG2   . VAL A  1 494 ? -0.200   -24.522 10.772  1.00 19.28  ? 494  VAL A CG2   1 
ATOM   3312  N N     . GLN A  1 495 ? 1.735    -21.687 13.985  1.00 25.26  ? 495  GLN A N     1 
ATOM   3313  C CA    . GLN A  1 495 ? 1.869    -20.884 15.197  1.00 27.18  ? 495  GLN A CA    1 
ATOM   3314  C C     . GLN A  1 495 ? 2.352    -19.431 14.989  1.00 35.36  ? 495  GLN A C     1 
ATOM   3315  O O     . GLN A  1 495 ? 2.403    -18.683 15.972  1.00 37.46  ? 495  GLN A O     1 
ATOM   3316  C CB    . GLN A  1 495 ? 2.811    -21.606 16.191  1.00 29.80  ? 495  GLN A CB    1 
ATOM   3317  C CG    . GLN A  1 495 ? 2.115    -22.343 17.329  1.00 42.06  ? 495  GLN A CG    1 
ATOM   3318  C CD    . GLN A  1 495 ? 3.124    -22.997 18.223  1.00 50.11  ? 495  GLN A CD    1 
ATOM   3319  O OE1   . GLN A  1 495 ? 3.473    -24.169 18.053  1.00 45.70  ? 495  GLN A OE1   1 
ATOM   3320  N NE2   . GLN A  1 495 ? 3.624    -22.249 19.188  1.00 40.88  ? 495  GLN A NE2   1 
ATOM   3321  N N     . ARG A  1 496 ? 2.749    -19.035 13.759  1.00 31.83  ? 496  ARG A N     1 
ATOM   3322  C CA    . ARG A  1 496 ? 3.249    -17.673 13.494  1.00 31.86  ? 496  ARG A CA    1 
ATOM   3323  C C     . ARG A  1 496 ? 2.315    -16.845 12.579  1.00 39.19  ? 496  ARG A C     1 
ATOM   3324  O O     . ARG A  1 496 ? 2.444    -15.618 12.490  1.00 39.31  ? 496  ARG A O     1 
ATOM   3325  C CB    . ARG A  1 496 ? 4.656    -17.709 12.915  1.00 30.81  ? 496  ARG A CB    1 
ATOM   3326  C CG    . ARG A  1 496 ? 5.597    -18.656 13.640  1.00 47.23  ? 496  ARG A CG    1 
ATOM   3327  C CD    . ARG A  1 496 ? 7.041    -18.343 13.343  1.00 53.29  ? 496  ARG A CD    1 
ATOM   3328  N NE    . ARG A  1 496 ? 7.507    -17.280 14.217  1.00 52.85  ? 496  ARG A NE    1 
ATOM   3329  C CZ    . ARG A  1 496 ? 8.422    -17.429 15.163  1.00 61.74  ? 496  ARG A CZ    1 
ATOM   3330  N NH1   . ARG A  1 496 ? 9.031    -18.595 15.331  1.00 43.53  ? 496  ARG A NH1   1 
ATOM   3331  N NH2   . ARG A  1 496 ? 8.755    -16.405 15.935  1.00 53.46  ? 496  ARG A NH2   1 
ATOM   3332  N N     . GLY A  1 497 ? 1.382    -17.524 11.917  1.00 36.40  ? 497  GLY A N     1 
ATOM   3333  C CA    . GLY A  1 497 ? 0.455    -16.892 10.994  1.00 35.02  ? 497  GLY A CA    1 
ATOM   3334  C C     . GLY A  1 497 ? -0.944   -16.704 11.523  1.00 37.40  ? 497  GLY A C     1 
ATOM   3335  O O     . GLY A  1 497 ? -1.312   -17.272 12.554  1.00 35.03  ? 497  GLY A O     1 
ATOM   3336  N N     . GLY A  1 498 ? -1.722   -15.920 10.774  1.00 34.29  ? 498  GLY A N     1 
ATOM   3337  C CA    . GLY A  1 498 ? -3.106   -15.578 11.083  1.00 31.45  ? 498  GLY A CA    1 
ATOM   3338  C C     . GLY A  1 498 ? -3.263   -14.222 11.729  1.00 30.96  ? 498  GLY A C     1 
ATOM   3339  O O     . GLY A  1 498 ? -2.287   -13.583 12.115  1.00 27.38  ? 498  GLY A O     1 
ATOM   3340  N N     . ALA A  1 499 ? -4.512   -13.774 11.837  1.00 29.86  ? 499  ALA A N     1 
ATOM   3341  C CA    . ALA A  1 499 ? -4.862   -12.488 12.459  1.00 29.12  ? 499  ALA A CA    1 
ATOM   3342  C C     . ALA A  1 499 ? -4.535   -12.533 13.956  1.00 35.12  ? 499  ALA A C     1 
ATOM   3343  O O     . ALA A  1 499 ? -4.725   -13.582 14.590  1.00 38.17  ? 499  ALA A O     1 
ATOM   3344  C CB    . ALA A  1 499 ? -6.339   -12.189 12.260  1.00 28.32  ? 499  ALA A CB    1 
ATOM   3345  N N     . PRO A  1 500 ? -4.031   -11.442 14.556  1.00 28.44  ? 500  PRO A N     1 
ATOM   3346  C CA    . PRO A  1 500 ? -3.757   -11.489 15.994  1.00 28.04  ? 500  PRO A CA    1 
ATOM   3347  C C     . PRO A  1 500 ? -5.039   -11.692 16.824  1.00 34.09  ? 500  PRO A C     1 
ATOM   3348  O O     . PRO A  1 500 ? -6.128   -11.321 16.381  1.00 33.86  ? 500  PRO A O     1 
ATOM   3349  C CB    . PRO A  1 500 ? -3.100   -10.136 16.269  1.00 29.85  ? 500  PRO A CB    1 
ATOM   3350  C CG    . PRO A  1 500 ? -3.524   -9.252  15.150  1.00 33.52  ? 500  PRO A CG    1 
ATOM   3351  C CD    . PRO A  1 500 ? -3.734   -10.116 13.978  1.00 29.73  ? 500  PRO A CD    1 
ATOM   3352  N N     . CYS A  1 501 ? -4.925   -12.291 18.013  1.00 31.68  ? 501  CYS A N     1 
ATOM   3353  C CA    . CYS A  1 501 ? -6.081   -12.460 18.883  1.00 31.69  ? 501  CYS A CA    1 
ATOM   3354  C C     . CYS A  1 501 ? -6.471   -11.109 19.485  1.00 34.90  ? 501  CYS A C     1 
ATOM   3355  O O     . CYS A  1 501 ? -5.749   -10.119 19.319  1.00 34.15  ? 501  CYS A O     1 
ATOM   3356  C CB    . CYS A  1 501 ? -5.814   -13.503 19.965  1.00 33.25  ? 501  CYS A CB    1 
ATOM   3357  S SG    . CYS A  1 501 ? -4.596   -13.002 21.216  1.00 38.39  ? 501  CYS A SG    1 
ATOM   3358  N N     . ALA A  1 502 ? -7.611   -11.076 20.191  1.00 31.91  ? 502  ALA A N     1 
ATOM   3359  C CA    . ALA A  1 502 ? -8.154   -9.873  20.807  1.00 32.03  ? 502  ALA A CA    1 
ATOM   3360  C C     . ALA A  1 502 ? -7.112   -9.139  21.640  1.00 36.24  ? 502  ALA A C     1 
ATOM   3361  O O     . ALA A  1 502 ? -6.890   -7.948  21.409  1.00 39.17  ? 502  ALA A O     1 
ATOM   3362  C CB    . ALA A  1 502 ? -9.356   -10.229 21.657  1.00 32.49  ? 502  ALA A CB    1 
ATOM   3363  N N     . PHE A  1 503 ? -6.438   -9.856  22.563  1.00 28.48  ? 503  PHE A N     1 
ATOM   3364  C CA    . PHE A  1 503 ? -5.417   -9.274  23.426  1.00 26.61  ? 503  PHE A CA    1 
ATOM   3365  C C     . PHE A  1 503 ? -4.232   -8.720  22.656  1.00 32.15  ? 503  PHE A C     1 
ATOM   3366  O O     . PHE A  1 503 ? -3.816   -7.601  22.945  1.00 33.14  ? 503  PHE A O     1 
ATOM   3367  C CB    . PHE A  1 503 ? -4.978   -10.259 24.520  1.00 27.53  ? 503  PHE A CB    1 
ATOM   3368  C CG    . PHE A  1 503 ? -3.885   -9.702  25.394  1.00 28.76  ? 503  PHE A CG    1 
ATOM   3369  C CD1   . PHE A  1 503 ? -2.581   -10.175 25.292  1.00 32.17  ? 503  PHE A CD1   1 
ATOM   3370  C CD2   . PHE A  1 503 ? -4.133   -8.643  26.256  1.00 29.30  ? 503  PHE A CD2   1 
ATOM   3371  C CE1   . PHE A  1 503 ? -1.553   -9.633  26.075  1.00 31.84  ? 503  PHE A CE1   1 
ATOM   3372  C CE2   . PHE A  1 503 ? -3.100   -8.096  27.027  1.00 32.21  ? 503  PHE A CE2   1 
ATOM   3373  C CZ    . PHE A  1 503 ? -1.820   -8.603  26.936  1.00 30.39  ? 503  PHE A CZ    1 
ATOM   3374  N N     . ASP A  1 504 ? -3.683   -9.485  21.688  1.00 29.55  ? 504  ASP A N     1 
ATOM   3375  C CA    . ASP A  1 504 ? -2.554   -9.026  20.864  1.00 30.58  ? 504  ASP A CA    1 
ATOM   3376  C C     . ASP A  1 504 ? -2.874   -7.737  20.082  1.00 32.90  ? 504  ASP A C     1 
ATOM   3377  O O     . ASP A  1 504 ? -2.054   -6.812  20.081  1.00 32.98  ? 504  ASP A O     1 
ATOM   3378  C CB    . ASP A  1 504 ? -2.025   -10.132 19.945  1.00 33.17  ? 504  ASP A CB    1 
ATOM   3379  C CG    . ASP A  1 504 ? -1.041   -11.076 20.618  1.00 48.76  ? 504  ASP A CG    1 
ATOM   3380  O OD1   . ASP A  1 504 ? -0.243   -10.609 21.492  1.00 51.37  ? 504  ASP A OD1   1 
ATOM   3381  O OD2   . ASP A  1 504 ? -1.035   -12.260 20.262  1.00 51.98  ? 504  ASP A OD2   1 
ATOM   3382  N N     . ARG A  1 505 ? -4.087   -7.658  19.491  1.00 26.25  ? 505  ARG A N     1 
ATOM   3383  C CA    . ARG A  1 505 ? -4.572   -6.470  18.789  1.00 24.55  ? 505  ARG A CA    1 
ATOM   3384  C C     . ARG A  1 505 ? -4.509   -5.265  19.750  1.00 26.28  ? 505  ARG A C     1 
ATOM   3385  O O     . ARG A  1 505 ? -3.987   -4.198  19.377  1.00 26.84  ? 505  ARG A O     1 
ATOM   3386  C CB    . ARG A  1 505 ? -6.004   -6.689  18.271  1.00 21.39  ? 505  ARG A CB    1 
ATOM   3387  C CG    . ARG A  1 505 ? -6.070   -7.564  17.056  1.00 20.27  ? 505  ARG A CG    1 
ATOM   3388  C CD    . ARG A  1 505 ? -7.378   -8.308  16.954  1.00 25.57  ? 505  ARG A CD    1 
ATOM   3389  N NE    . ARG A  1 505 ? -8.167   -7.848  15.811  1.00 32.43  ? 505  ARG A NE    1 
ATOM   3390  C CZ    . ARG A  1 505 ? -8.519   -8.598  14.772  1.00 45.08  ? 505  ARG A CZ    1 
ATOM   3391  N NH1   . ARG A  1 505 ? -8.167   -9.875  14.715  1.00 27.03  ? 505  ARG A NH1   1 
ATOM   3392  N NH2   . ARG A  1 505 ? -9.229   -8.079  13.785  1.00 40.31  ? 505  ARG A NH2   1 
ATOM   3393  N N     . PHE A  1 506 ? -4.974   -5.455  20.994  1.00 20.33  ? 506  PHE A N     1 
ATOM   3394  C CA    . PHE A  1 506 ? -4.885   -4.407  22.005  1.00 21.74  ? 506  PHE A CA    1 
ATOM   3395  C C     . PHE A  1 506 ? -3.411   -4.111  22.350  1.00 25.74  ? 506  PHE A C     1 
ATOM   3396  O O     . PHE A  1 506 ? -2.992   -2.956  22.298  1.00 24.30  ? 506  PHE A O     1 
ATOM   3397  C CB    . PHE A  1 506 ? -5.678   -4.782  23.279  1.00 23.79  ? 506  PHE A CB    1 
ATOM   3398  C CG    . PHE A  1 506 ? -5.096   -4.244  24.575  1.00 25.27  ? 506  PHE A CG    1 
ATOM   3399  C CD1   . PHE A  1 506 ? -5.425   -2.974  25.029  1.00 28.72  ? 506  PHE A CD1   1 
ATOM   3400  C CD2   . PHE A  1 506 ? -4.217   -5.015  25.338  1.00 26.85  ? 506  PHE A CD2   1 
ATOM   3401  C CE1   . PHE A  1 506 ? -4.899   -2.489  26.225  1.00 30.30  ? 506  PHE A CE1   1 
ATOM   3402  C CE2   . PHE A  1 506 ? -3.658   -4.515  26.515  1.00 29.90  ? 506  PHE A CE2   1 
ATOM   3403  C CZ    . PHE A  1 506 ? -4.006   -3.260  26.955  1.00 28.74  ? 506  PHE A CZ    1 
ATOM   3404  N N     . LEU A  1 507 ? -2.641   -5.170  22.693  1.00 24.55  ? 507  LEU A N     1 
ATOM   3405  C CA    . LEU A  1 507 ? -1.250   -5.074  23.130  1.00 25.57  ? 507  LEU A CA    1 
ATOM   3406  C C     . LEU A  1 507 ? -0.328   -4.371  22.135  1.00 32.64  ? 507  LEU A C     1 
ATOM   3407  O O     . LEU A  1 507 ? 0.424    -3.489  22.533  1.00 33.28  ? 507  LEU A O     1 
ATOM   3408  C CB    . LEU A  1 507 ? -0.709   -6.439  23.585  1.00 24.77  ? 507  LEU A CB    1 
ATOM   3409  C CG    . LEU A  1 507 ? 0.685    -6.454  24.222  1.00 29.60  ? 507  LEU A CG    1 
ATOM   3410  C CD1   . LEU A  1 507 ? 0.725    -5.745  25.547  1.00 30.29  ? 507  LEU A CD1   1 
ATOM   3411  C CD2   . LEU A  1 507 ? 1.200    -7.866  24.356  1.00 30.33  ? 507  LEU A CD2   1 
ATOM   3412  N N     . ALA A  1 508 ? -0.422   -4.721  20.861  1.00 29.98  ? 508  ALA A N     1 
ATOM   3413  C CA    . ALA A  1 508 ? 0.400    -4.118  19.827  1.00 32.01  ? 508  ALA A CA    1 
ATOM   3414  C C     . ALA A  1 508 ? -0.002   -2.676  19.518  1.00 37.96  ? 508  ALA A C     1 
ATOM   3415  O O     . ALA A  1 508 ? 0.875    -1.840  19.259  1.00 38.54  ? 508  ALA A O     1 
ATOM   3416  C CB    . ALA A  1 508 ? 0.311    -4.948  18.565  1.00 33.34  ? 508  ALA A CB    1 
ATOM   3417  N N     . THR A  1 509 ? -1.328   -2.395  19.500  1.00 34.01  ? 509  THR A N     1 
ATOM   3418  C CA    . THR A  1 509 ? -1.839   -1.062  19.200  1.00 33.84  ? 509  THR A CA    1 
ATOM   3419  C C     . THR A  1 509 ? -1.429   -0.049  20.289  1.00 37.23  ? 509  THR A C     1 
ATOM   3420  O O     . THR A  1 509 ? -0.854   1.010   19.993  1.00 37.61  ? 509  THR A O     1 
ATOM   3421  C CB    . THR A  1 509 ? -3.299   -1.141  18.761  1.00 39.19  ? 509  THR A CB    1 
ATOM   3422  O OG1   . THR A  1 509 ? -3.324   -1.223  17.327  1.00 37.73  ? 509  THR A OG1   1 
ATOM   3423  C CG2   . THR A  1 509 ? -4.122   0.048   19.223  1.00 41.34  ? 509  THR A CG2   1 
ATOM   3424  N N     . VAL A  1 510 ? -1.643   -0.440  21.541  1.00 31.84  ? 510  VAL A N     1 
ATOM   3425  C CA    . VAL A  1 510 ? -1.321   0.341   22.716  1.00 31.83  ? 510  VAL A CA    1 
ATOM   3426  C C     . VAL A  1 510 ? 0.199    0.553   22.894  1.00 33.26  ? 510  VAL A C     1 
ATOM   3427  O O     . VAL A  1 510 ? 0.625    1.696   23.062  1.00 33.61  ? 510  VAL A O     1 
ATOM   3428  C CB    . VAL A  1 510 ? -2.054   -0.267  23.936  1.00 36.36  ? 510  VAL A CB    1 
ATOM   3429  C CG1   . VAL A  1 510 ? -1.437   0.165   25.247  1.00 37.27  ? 510  VAL A CG1   1 
ATOM   3430  C CG2   . VAL A  1 510 ? -3.545   0.081   23.899  1.00 35.31  ? 510  VAL A CG2   1 
ATOM   3431  N N     . GLN A  1 511 ? 1.007    -0.519  22.802  1.00 28.33  ? 511  GLN A N     1 
ATOM   3432  C CA    . GLN A  1 511 ? 2.470    -0.434  22.931  1.00 28.76  ? 511  GLN A CA    1 
ATOM   3433  C C     . GLN A  1 511 ? 3.036    0.362   21.766  1.00 33.83  ? 511  GLN A C     1 
ATOM   3434  O O     . GLN A  1 511 ? 4.000    1.098   21.965  1.00 34.66  ? 511  GLN A O     1 
ATOM   3435  C CB    . GLN A  1 511 ? 3.145    -1.830  23.011  1.00 29.90  ? 511  GLN A CB    1 
ATOM   3436  C CG    . GLN A  1 511 ? 3.066    -2.564  24.364  1.00 21.21  ? 511  GLN A CG    1 
ATOM   3437  C CD    . GLN A  1 511 ? 3.892    -3.833  24.404  1.00 51.28  ? 511  GLN A CD    1 
ATOM   3438  O OE1   . GLN A  1 511 ? 4.368    -4.336  23.386  1.00 48.61  ? 511  GLN A OE1   1 
ATOM   3439  N NE2   . GLN A  1 511 ? 4.110    -4.388  25.592  1.00 52.66  ? 511  GLN A NE2   1 
ATOM   3440  N N     . GLY A  1 512 ? 2.422    0.225   20.577  1.00 30.84  ? 512  GLY A N     1 
ATOM   3441  C CA    . GLY A  1 512 ? 2.812    0.924   19.344  1.00 30.81  ? 512  GLY A CA    1 
ATOM   3442  C C     . GLY A  1 512 ? 2.680    2.425   19.466  1.00 35.49  ? 512  GLY A C     1 
ATOM   3443  O O     . GLY A  1 512 ? 3.579    3.160   19.061  1.00 36.55  ? 512  GLY A O     1 
ATOM   3444  N N     . VAL A  1 513 ? 1.564    2.889   20.075  1.00 31.99  ? 513  VAL A N     1 
ATOM   3445  C CA    . VAL A  1 513 ? 1.303    4.313   20.340  1.00 31.18  ? 513  VAL A CA    1 
ATOM   3446  C C     . VAL A  1 513 ? 2.326    4.819   21.342  1.00 38.78  ? 513  VAL A C     1 
ATOM   3447  O O     . VAL A  1 513 ? 2.932    5.873   21.110  1.00 40.11  ? 513  VAL A O     1 
ATOM   3448  C CB    . VAL A  1 513 ? -0.134   4.553   20.820  1.00 31.68  ? 513  VAL A CB    1 
ATOM   3449  C CG1   . VAL A  1 513 ? -0.277   5.937   21.430  1.00 31.21  ? 513  VAL A CG1   1 
ATOM   3450  C CG2   . VAL A  1 513 ? -1.123   4.353   19.683  1.00 30.77  ? 513  VAL A CG2   1 
ATOM   3451  N N     . ASP A  1 514 ? 2.554    4.041   22.434  1.00 36.17  ? 514  ASP A N     1 
ATOM   3452  C CA    . ASP A  1 514 ? 3.545    4.409   23.441  1.00 37.17  ? 514  ASP A CA    1 
ATOM   3453  C C     . ASP A  1 514 ? 4.962    4.478   22.867  1.00 43.53  ? 514  ASP A C     1 
ATOM   3454  O O     . ASP A  1 514 ? 5.707    5.381   23.241  1.00 44.43  ? 514  ASP A O     1 
ATOM   3455  C CB    . ASP A  1 514 ? 3.487    3.526   24.686  1.00 38.13  ? 514  ASP A CB    1 
ATOM   3456  C CG    . ASP A  1 514 ? 4.092    4.225   25.893  1.00 51.79  ? 514  ASP A CG    1 
ATOM   3457  O OD1   . ASP A  1 514 ? 5.127    3.747   26.397  1.00 51.38  ? 514  ASP A OD1   1 
ATOM   3458  O OD2   . ASP A  1 514 ? 3.550    5.283   26.308  1.00 61.65  ? 514  ASP A OD2   1 
ATOM   3459  N N     . ALA A  1 515 ? 5.310    3.574   21.911  1.00 39.96  ? 515  ALA A N     1 
ATOM   3460  C CA    . ALA A  1 515 ? 6.625    3.563   21.256  1.00 40.29  ? 515  ALA A CA    1 
ATOM   3461  C C     . ALA A  1 515 ? 6.886    4.925   20.594  1.00 43.56  ? 515  ALA A C     1 
ATOM   3462  O O     . ALA A  1 515 ? 7.951    5.522   20.822  1.00 42.94  ? 515  ALA A O     1 
ATOM   3463  C CB    . ALA A  1 515 ? 6.696    2.445   20.230  1.00 40.37  ? 515  ALA A CB    1 
ATOM   3464  N N     . VAL A  1 516 ? 5.869    5.448   19.857  1.00 38.29  ? 516  VAL A N     1 
ATOM   3465  C CA    . VAL A  1 516 ? 5.936    6.763   19.210  1.00 38.58  ? 516  VAL A CA    1 
ATOM   3466  C C     . VAL A  1 516 ? 6.103    7.850   20.256  1.00 41.21  ? 516  VAL A C     1 
ATOM   3467  O O     . VAL A  1 516 ? 6.943    8.731   20.074  1.00 41.39  ? 516  VAL A O     1 
ATOM   3468  C CB    . VAL A  1 516 ? 4.732    7.011   18.276  1.00 41.93  ? 516  VAL A CB    1 
ATOM   3469  C CG1   . VAL A  1 516 ? 4.695    8.447   17.765  1.00 42.21  ? 516  VAL A CG1   1 
ATOM   3470  C CG2   . VAL A  1 516 ? 4.763    6.040   17.112  1.00 41.51  ? 516  VAL A CG2   1 
ATOM   3471  N N     . ARG A  1 517 ? 5.340    7.749   21.376  1.00 36.35  ? 517  ARG A N     1 
ATOM   3472  C CA    . ARG A  1 517 ? 5.412    8.694   22.495  1.00 36.40  ? 517  ARG A CA    1 
ATOM   3473  C C     . ARG A  1 517 ? 6.821    8.676   23.117  1.00 42.00  ? 517  ARG A C     1 
ATOM   3474  O O     . ARG A  1 517 ? 7.472    9.716   23.203  1.00 42.06  ? 517  ARG A O     1 
ATOM   3475  C CB    . ARG A  1 517 ? 4.306    8.420   23.525  1.00 32.54  ? 517  ARG A CB    1 
ATOM   3476  C CG    . ARG A  1 517 ? 2.951    8.879   23.030  1.00 41.87  ? 517  ARG A CG    1 
ATOM   3477  C CD    . ARG A  1 517 ? 1.799    8.340   23.854  1.00 52.65  ? 517  ARG A CD    1 
ATOM   3478  N NE    . ARG A  1 517 ? 0.517    8.870   23.374  1.00 47.02  ? 517  ARG A NE    1 
ATOM   3479  C CZ    . ARG A  1 517 ? -0.670   8.592   23.907  1.00 54.40  ? 517  ARG A CZ    1 
ATOM   3480  N NH1   . ARG A  1 517 ? -0.767   7.757   24.939  1.00 32.99  ? 517  ARG A NH1   1 
ATOM   3481  N NH2   . ARG A  1 517 ? -1.769   9.142   23.412  1.00 46.65  ? 517  ARG A NH2   1 
ATOM   3482  N N     . ALA A  1 518 ? 7.327    7.474   23.415  1.00 38.78  ? 518  ALA A N     1 
ATOM   3483  C CA    . ALA A  1 518 ? 8.657    7.240   23.963  1.00 39.50  ? 518  ALA A CA    1 
ATOM   3484  C C     . ALA A  1 518 ? 9.763    7.887   23.101  1.00 45.48  ? 518  ALA A C     1 
ATOM   3485  O O     . ALA A  1 518 ? 10.773   8.346   23.647  1.00 46.81  ? 518  ALA A O     1 
ATOM   3486  C CB    . ALA A  1 518 ? 8.901    5.744   24.107  1.00 39.33  ? 518  ALA A CB    1 
ATOM   3487  N N     . VAL A  1 519 ? 9.554    7.947   21.764  1.00 41.39  ? 519  VAL A N     1 
ATOM   3488  C CA    . VAL A  1 519 ? 10.502   8.554   20.825  1.00 42.43  ? 519  VAL A CA    1 
ATOM   3489  C C     . VAL A  1 519 ? 10.488   10.044  21.077  1.00 48.24  ? 519  VAL A C     1 
ATOM   3490  O O     . VAL A  1 519 ? 11.547   10.628  21.274  1.00 50.07  ? 519  VAL A O     1 
ATOM   3491  C CB    . VAL A  1 519 ? 10.183   8.230   19.335  1.00 46.20  ? 519  VAL A CB    1 
ATOM   3492  C CG1   . VAL A  1 519 ? 10.950   9.145   18.391  1.00 47.08  ? 519  VAL A CG1   1 
ATOM   3493  C CG2   . VAL A  1 519 ? 10.453   6.777   18.991  1.00 45.45  ? 519  VAL A CG2   1 
ATOM   3494  N N     . LEU A  1 520 ? 9.287    10.653  21.085  1.00 45.30  ? 520  LEU A N     1 
ATOM   3495  C CA    . LEU A  1 520 ? 9.089    12.096  21.279  1.00 46.59  ? 520  LEU A CA    1 
ATOM   3496  C C     . LEU A  1 520 ? 9.540    12.558  22.663  1.00 51.45  ? 520  LEU A C     1 
ATOM   3497  O O     . LEU A  1 520 ? 10.322   13.504  22.774  1.00 52.63  ? 520  LEU A O     1 
ATOM   3498  C CB    . LEU A  1 520 ? 7.633    12.492  21.005  1.00 45.79  ? 520  LEU A CB    1 
ATOM   3499  C CG    . LEU A  1 520 ? 7.025    11.971  19.701  1.00 50.14  ? 520  LEU A CG    1 
ATOM   3500  C CD1   . LEU A  1 520 ? 5.521    11.850  19.827  1.00 49.82  ? 520  LEU A CD1   1 
ATOM   3501  C CD2   . LEU A  1 520 ? 7.452    12.811  18.476  1.00 51.38  ? 520  LEU A CD2   1 
ATOM   3502  N N     . GLU A  1 521 ? 9.133    11.812  23.698  1.00 46.70  ? 521  GLU A N     1 
ATOM   3503  C CA    . GLU A  1 521 ? 9.455    12.049  25.105  1.00 46.13  ? 521  GLU A CA    1 
ATOM   3504  C C     . GLU A  1 521 ? 10.957   11.795  25.458  1.00 51.01  ? 521  GLU A C     1 
ATOM   3505  O O     . GLU A  1 521 ? 11.342   11.941  26.620  1.00 50.62  ? 521  GLU A O     1 
ATOM   3506  C CB    . GLU A  1 521 ? 8.483    11.237  25.998  1.00 45.85  ? 521  GLU A CB    1 
ATOM   3507  C CG    . GLU A  1 521 ? 7.013    11.621  25.823  1.00 53.16  ? 521  GLU A CG    1 
ATOM   3508  C CD    . GLU A  1 521 ? 5.964    10.753  26.497  1.00 72.97  ? 521  GLU A CD    1 
ATOM   3509  O OE1   . GLU A  1 521 ? 6.298    10.065  27.488  1.00 79.54  ? 521  GLU A OE1   1 
ATOM   3510  O OE2   . GLU A  1 521 ? 4.791    10.789  26.057  1.00 58.95  ? 521  GLU A OE2   1 
ATOM   3511  N N     . SER A  1 522 ? 11.798   11.461  24.451  1.00 49.36  ? 522  SER A N     1 
ATOM   3512  C CA    . SER A  1 522 ? 13.228   11.182  24.629  1.00 51.55  ? 522  SER A CA    1 
ATOM   3513  C C     . SER A  1 522 ? 14.154   12.404  24.652  1.00 60.37  ? 522  SER A C     1 
ATOM   3514  O O     . SER A  1 522 ? 13.835   13.456  24.104  1.00 61.82  ? 522  SER A O     1 
ATOM   3515  C CB    . SER A  1 522 ? 13.725   10.185  23.587  1.00 54.49  ? 522  SER A CB    1 
ATOM   3516  O OG    . SER A  1 522 ? 15.111   9.915   23.730  1.00 59.95  ? 522  SER A OG    1 
ATOM   3517  N N     . THR A  1 523 ? 15.323   12.210  25.283  1.00 58.53  ? 523  THR A N     1 
ATOM   3518  C CA    . THR A  1 523 ? 16.493   13.085  25.461  1.00 59.96  ? 523  THR A CA    1 
ATOM   3519  C C     . THR A  1 523 ? 17.676   12.141  25.761  1.00 62.82  ? 523  THR A C     1 
ATOM   3520  O O     . THR A  1 523 ? 17.437   11.051  26.276  1.00 61.18  ? 523  THR A O     1 
ATOM   3521  C CB    . THR A  1 523 ? 16.335   14.032  26.659  1.00 73.07  ? 523  THR A CB    1 
ATOM   3522  O OG1   . THR A  1 523 ? 15.892   13.307  27.811  1.00 76.44  ? 523  THR A OG1   1 
ATOM   3523  C CG2   . THR A  1 523 ? 15.449   15.226  26.360  1.00 72.48  ? 523  THR A CG2   1 
ATOM   3524  N N     . PRO A  1 524 ? 18.949   12.515  25.518  1.00 60.88  ? 524  PRO A N     1 
ATOM   3525  C CA    . PRO A  1 524 ? 20.054   11.586  25.834  1.00 62.27  ? 524  PRO A CA    1 
ATOM   3526  C C     . PRO A  1 524 ? 20.150   11.124  27.302  1.00 68.50  ? 524  PRO A C     1 
ATOM   3527  O O     . PRO A  1 524 ? 20.698   10.048  27.577  1.00 67.89  ? 524  PRO A O     1 
ATOM   3528  C CB    . PRO A  1 524 ? 21.294   12.357  25.379  1.00 65.45  ? 524  PRO A CB    1 
ATOM   3529  C CG    . PRO A  1 524 ? 20.776   13.318  24.353  1.00 68.83  ? 524  PRO A CG    1 
ATOM   3530  C CD    . PRO A  1 524 ? 19.462   13.746  24.888  1.00 63.23  ? 524  PRO A CD    1 
ATOM   3531  N N     . ALA A  1 525 ? 19.583   11.927  28.233  1.00 66.28  ? 525  ALA A N     1 
ATOM   3532  C CA    . ALA A  1 525 ? 19.532   11.652  29.668  1.00 66.08  ? 525  ALA A CA    1 
ATOM   3533  C C     . ALA A  1 525 ? 18.584   10.490  29.953  1.00 69.19  ? 525  ALA A C     1 
ATOM   3534  O O     . ALA A  1 525 ? 18.869   9.661   30.815  1.00 69.62  ? 525  ALA A O     1 
ATOM   3535  C CB    . ALA A  1 525 ? 19.077   12.892  30.418  1.00 67.11  ? 525  ALA A CB    1 
ATOM   3536  N N     . ILE A  1 526 ? 17.463   10.423  29.231  1.00 64.61  ? 526  ILE A N     1 
ATOM   3537  C CA    . ILE A  1 526 ? 16.500   9.345   29.419  1.00 63.00  ? 526  ILE A CA    1 
ATOM   3538  C C     . ILE A  1 526 ? 16.855   8.088   28.567  1.00 67.99  ? 526  ILE A C     1 
ATOM   3539  O O     . ILE A  1 526 ? 16.922   8.169   27.338  1.00 68.00  ? 526  ILE A O     1 
ATOM   3540  C CB    . ILE A  1 526 ? 15.008   9.818   29.441  1.00 63.90  ? 526  ILE A CB    1 
ATOM   3541  C CG1   . ILE A  1 526 ? 14.059   8.739   29.990  1.00 62.62  ? 526  ILE A CG1   1 
ATOM   3542  C CG2   . ILE A  1 526 ? 14.538   10.401  28.124  1.00 63.03  ? 526  ILE A CG2   1 
ATOM   3543  C CD1   . ILE A  1 526 ? 13.953   8.678   31.519  1.00 65.69  ? 526  ILE A CD1   1 
ATOM   3544  N N     . PRO A  1 527 ? 17.199   6.952   29.224  1.00 63.63  ? 527  PRO A N     1 
ATOM   3545  C CA    . PRO A  1 527 ? 17.638   5.759   28.474  1.00 62.48  ? 527  PRO A CA    1 
ATOM   3546  C C     . PRO A  1 527 ? 16.655   5.137   27.472  1.00 63.26  ? 527  PRO A C     1 
ATOM   3547  O O     . PRO A  1 527 ? 15.444   5.199   27.672  1.00 63.34  ? 527  PRO A O     1 
ATOM   3548  C CB    . PRO A  1 527 ? 18.021   4.771   29.586  1.00 64.11  ? 527  PRO A CB    1 
ATOM   3549  C CG    . PRO A  1 527 ? 17.247   5.215   30.767  1.00 68.00  ? 527  PRO A CG    1 
ATOM   3550  C CD    . PRO A  1 527 ? 17.242   6.706   30.679  1.00 64.55  ? 527  PRO A CD    1 
ATOM   3551  N N     . SER A  1 528 ? 17.207   4.512   26.404  1.00 56.88  ? 528  SER A N     1 
ATOM   3552  C CA    . SER A  1 528 ? 16.493   3.795   25.344  1.00 54.50  ? 528  SER A CA    1 
ATOM   3553  C C     . SER A  1 528 ? 15.622   2.681   25.951  1.00 55.81  ? 528  SER A C     1 
ATOM   3554  O O     . SER A  1 528 ? 16.151   1.795   26.629  1.00 56.60  ? 528  SER A O     1 
ATOM   3555  C CB    . SER A  1 528 ? 17.479   3.204   24.333  1.00 58.51  ? 528  SER A CB    1 
ATOM   3556  O OG    . SER A  1 528 ? 18.040   4.192   23.482  1.00 68.79  ? 528  SER A OG    1 
ATOM   3557  N N     . PRO A  1 529 ? 14.286   2.722   25.767  1.00 49.07  ? 529  PRO A N     1 
ATOM   3558  C CA    . PRO A  1 529 ? 13.430   1.711   26.409  1.00 47.39  ? 529  PRO A CA    1 
ATOM   3559  C C     . PRO A  1 529 ? 12.990   0.535   25.552  1.00 50.58  ? 529  PRO A C     1 
ATOM   3560  O O     . PRO A  1 529 ? 13.260   0.468   24.357  1.00 50.37  ? 529  PRO A O     1 
ATOM   3561  C CB    . PRO A  1 529 ? 12.209   2.533   26.805  1.00 48.37  ? 529  PRO A CB    1 
ATOM   3562  C CG    . PRO A  1 529 ? 12.114   3.576   25.713  1.00 52.56  ? 529  PRO A CG    1 
ATOM   3563  C CD    . PRO A  1 529 ? 13.471   3.736   25.073  1.00 49.16  ? 529  PRO A CD    1 
ATOM   3564  N N     . VAL A  1 530 ? 12.262   -0.378  26.195  1.00 48.01  ? 530  VAL A N     1 
ATOM   3565  C CA    . VAL A  1 530 ? 11.563   -1.543  25.635  1.00 47.07  ? 530  VAL A CA    1 
ATOM   3566  C C     . VAL A  1 530 ? 10.140   -1.324  26.128  1.00 50.50  ? 530  VAL A C     1 
ATOM   3567  O O     . VAL A  1 530 ? 9.908    -1.302  27.344  1.00 51.91  ? 530  VAL A O     1 
ATOM   3568  C CB    . VAL A  1 530 ? 12.091   -2.934  26.117  1.00 51.05  ? 530  VAL A CB    1 
ATOM   3569  C CG1   . VAL A  1 530 ? 11.139   -4.048  25.718  1.00 49.67  ? 530  VAL A CG1   1 
ATOM   3570  C CG2   . VAL A  1 530 ? 13.470   -3.234  25.576  1.00 52.27  ? 530  VAL A CG2   1 
ATOM   3571  N N     . ILE A  1 531 ? 9.194    -1.130  25.214  1.00 44.63  ? 531  ILE A N     1 
ATOM   3572  C CA    . ILE A  1 531 ? 7.802    -0.969  25.642  1.00 41.36  ? 531  ILE A CA    1 
ATOM   3573  C C     . ILE A  1 531 ? 7.329    -2.341  26.117  1.00 42.63  ? 531  ILE A C     1 
ATOM   3574  O O     . ILE A  1 531 ? 7.331    -3.307  25.355  1.00 42.31  ? 531  ILE A O     1 
ATOM   3575  C CB    . ILE A  1 531 ? 6.894    -0.320  24.577  1.00 42.34  ? 531  ILE A CB    1 
ATOM   3576  C CG1   . ILE A  1 531 ? 7.591    0.872   23.869  1.00 42.30  ? 531  ILE A CG1   1 
ATOM   3577  C CG2   . ILE A  1 531 ? 5.569    0.082   25.197  1.00 42.43  ? 531  ILE A CG2   1 
ATOM   3578  C CD1   . ILE A  1 531 ? 8.040    2.105   24.770  1.00 47.29  ? 531  ILE A CD1   1 
ATOM   3579  N N     . SER A  1 532 ? 7.062    -2.426  27.408  1.00 38.27  ? 532  SER A N     1 
ATOM   3580  C CA    . SER A  1 532 ? 6.657    -3.636  28.103  1.00 38.36  ? 532  SER A CA    1 
ATOM   3581  C C     . SER A  1 532 ? 5.272    -3.480  28.743  1.00 41.67  ? 532  SER A C     1 
ATOM   3582  O O     . SER A  1 532 ? 4.739    -2.372  28.801  1.00 40.03  ? 532  SER A O     1 
ATOM   3583  C CB    . SER A  1 532 ? 7.673    -3.958  29.196  1.00 44.23  ? 532  SER A CB    1 
ATOM   3584  O OG    . SER A  1 532 ? 9.004    -4.030  28.707  1.00 54.08  ? 532  SER A OG    1 
ATOM   3585  N N     . ILE A  1 533 ? 4.702    -4.605  29.222  1.00 38.80  ? 533  ILE A N     1 
ATOM   3586  C CA    . ILE A  1 533 ? 3.422    -4.674  29.930  1.00 37.68  ? 533  ILE A CA    1 
ATOM   3587  C C     . ILE A  1 533 ? 3.672    -5.340  31.273  1.00 44.05  ? 533  ILE A C     1 
ATOM   3588  O O     . ILE A  1 533 ? 4.371    -6.360  31.318  1.00 42.53  ? 533  ILE A O     1 
ATOM   3589  C CB    . ILE A  1 533 ? 2.277    -5.352  29.112  1.00 38.81  ? 533  ILE A CB    1 
ATOM   3590  C CG1   . ILE A  1 533 ? 0.915    -5.244  29.828  1.00 38.09  ? 533  ILE A CG1   1 
ATOM   3591  C CG2   . ILE A  1 533 ? 2.585    -6.794  28.732  1.00 38.98  ? 533  ILE A CG2   1 
ATOM   3592  C CD1   . ILE A  1 533 ? -0.281   -4.970  28.942  1.00 38.58  ? 533  ILE A CD1   1 
ATOM   3593  N N     . LEU A  1 534 ? 3.146    -4.741  32.377  1.00 42.42  ? 534  LEU A N     1 
ATOM   3594  C CA    . LEU A  1 534 ? 3.299    -5.351  33.691  1.00 42.75  ? 534  LEU A CA    1 
ATOM   3595  C C     . LEU A  1 534 ? 2.000    -5.696  34.416  1.00 50.22  ? 534  LEU A C     1 
ATOM   3596  O O     . LEU A  1 534 ? 1.484    -6.785  34.169  1.00 52.58  ? 534  LEU A O     1 
ATOM   3597  C CB    . LEU A  1 534 ? 4.400    -4.751  34.544  1.00 43.41  ? 534  LEU A CB    1 
ATOM   3598  C CG    . LEU A  1 534 ? 5.818    -5.088  34.071  1.00 48.42  ? 534  LEU A CG    1 
ATOM   3599  C CD1   . LEU A  1 534 ? 6.802    -4.057  34.541  1.00 50.72  ? 534  LEU A CD1   1 
ATOM   3600  C CD2   . LEU A  1 534 ? 6.242    -6.455  34.538  1.00 49.31  ? 534  LEU A CD2   1 
ATOM   3601  N N     . GLU A  1 535 ? 1.410    -4.839  35.229  1.00 47.53  ? 535  GLU A N     1 
ATOM   3602  C CA    . GLU A  1 535 ? 0.163    -5.335  35.837  1.00 48.13  ? 535  GLU A CA    1 
ATOM   3603  C C     . GLU A  1 535 ? -1.045   -4.852  35.079  1.00 53.18  ? 535  GLU A C     1 
ATOM   3604  O O     . GLU A  1 535 ? -1.935   -4.213  35.652  1.00 54.85  ? 535  GLU A O     1 
ATOM   3605  C CB    . GLU A  1 535 ? 0.103    -5.112  37.357  1.00 50.62  ? 535  GLU A CB    1 
ATOM   3606  C CG    . GLU A  1 535 ? 0.836    -6.207  38.118  1.00 65.05  ? 535  GLU A CG    1 
ATOM   3607  C CD    . GLU A  1 535 ? 0.482    -6.378  39.585  1.00 96.10  ? 535  GLU A CD    1 
ATOM   3608  O OE1   . GLU A  1 535 ? 1.386    -6.173  40.427  1.00 112.61 ? 535  GLU A OE1   1 
ATOM   3609  O OE2   . GLU A  1 535 ? -0.679   -6.732  39.899  1.00 82.37  ? 535  GLU A OE2   1 
ATOM   3610  N N     . ASN A  1 536 ? -1.073   -5.197  33.758  1.00 48.19  ? 536  ASN A N     1 
ATOM   3611  C CA    . ASN A  1 536 ? -2.026   -4.772  32.722  1.00 47.38  ? 536  ASN A CA    1 
ATOM   3612  C C     . ASN A  1 536 ? -1.771   -3.288  32.374  1.00 52.22  ? 536  ASN A C     1 
ATOM   3613  O O     . ASN A  1 536 ? -2.588   -2.640  31.693  1.00 53.93  ? 536  ASN A O     1 
ATOM   3614  C CB    . ASN A  1 536 ? -3.485   -4.984  33.127  1.00 48.80  ? 536  ASN A CB    1 
ATOM   3615  C CG    . ASN A  1 536 ? -4.037   -6.294  32.678  1.00 77.45  ? 536  ASN A CG    1 
ATOM   3616  O OD1   . ASN A  1 536 ? -3.795   -6.751  31.551  1.00 47.94  ? 536  ASN A OD1   1 
ATOM   3617  N ND2   . ASN A  1 536 ? -4.826   -6.910  33.559  1.00 86.77  ? 536  ASN A ND2   1 
ATOM   3618  N N     . LYS A  1 537 ? -0.625   -2.767  32.862  1.00 45.10  ? 537  LYS A N     1 
ATOM   3619  C CA    . LYS A  1 537 ? -0.149   -1.416  32.682  1.00 42.98  ? 537  LYS A CA    1 
ATOM   3620  C C     . LYS A  1 537 ? 1.073    -1.456  31.778  1.00 40.74  ? 537  LYS A C     1 
ATOM   3621  O O     . LYS A  1 537 ? 1.977    -2.274  31.988  1.00 38.03  ? 537  LYS A O     1 
ATOM   3622  C CB    . LYS A  1 537 ? 0.231    -0.811  34.052  1.00 47.23  ? 537  LYS A CB    1 
ATOM   3623  C CG    . LYS A  1 537 ? -0.905   -0.068  34.756  1.00 64.91  ? 537  LYS A CG    1 
ATOM   3624  C CD    . LYS A  1 537 ? -1.531   -0.881  35.890  1.00 79.02  ? 537  LYS A CD    1 
ATOM   3625  C CE    . LYS A  1 537 ? -3.028   -1.086  35.733  1.00 82.73  ? 537  LYS A CE    1 
ATOM   3626  N NZ    . LYS A  1 537 ? -3.543   -2.167  36.635  1.00 88.48  ? 537  LYS A NZ    1 
ATOM   3627  N N     . ILE A  1 538 ? 1.084    -0.579  30.761  1.00 34.88  ? 538  ILE A N     1 
ATOM   3628  C CA    . ILE A  1 538 ? 2.199    -0.406  29.827  1.00 33.59  ? 538  ILE A CA    1 
ATOM   3629  C C     . ILE A  1 538 ? 3.292    0.316   30.584  1.00 37.86  ? 538  ILE A C     1 
ATOM   3630  O O     . ILE A  1 538 ? 3.020    1.273   31.306  1.00 38.63  ? 538  ILE A O     1 
ATOM   3631  C CB    . ILE A  1 538 ? 1.738    0.334   28.547  1.00 35.65  ? 538  ILE A CB    1 
ATOM   3632  C CG1   . ILE A  1 538 ? 0.619    -0.448  27.829  1.00 34.53  ? 538  ILE A CG1   1 
ATOM   3633  C CG2   . ILE A  1 538 ? 2.889    0.669   27.600  1.00 36.03  ? 538  ILE A CG2   1 
ATOM   3634  C CD1   . ILE A  1 538 ? 0.949    -1.879  27.378  1.00 39.88  ? 538  ILE A CD1   1 
ATOM   3635  N N     . VAL A  1 539 ? 4.509    -0.197  30.491  1.00 34.02  ? 539  VAL A N     1 
ATOM   3636  C CA    . VAL A  1 539 ? 5.687    0.268   31.234  1.00 33.43  ? 539  VAL A CA    1 
ATOM   3637  C C     . VAL A  1 539 ? 6.847    0.417   30.227  1.00 38.93  ? 539  VAL A C     1 
ATOM   3638  O O     . VAL A  1 539 ? 6.890    -0.298  29.219  1.00 40.44  ? 539  VAL A O     1 
ATOM   3639  C CB    . VAL A  1 539 ? 5.992    -0.825  32.323  1.00 35.98  ? 539  VAL A CB    1 
ATOM   3640  C CG1   . VAL A  1 539 ? 7.334    -0.615  32.998  1.00 37.99  ? 539  VAL A CG1   1 
ATOM   3641  C CG2   . VAL A  1 539 ? 4.870    -0.924  33.364  1.00 34.19  ? 539  VAL A CG2   1 
ATOM   3642  N N     . ARG A  1 540 ? 7.778    1.331   30.491  1.00 34.40  ? 540  ARG A N     1 
ATOM   3643  C CA    . ARG A  1 540 ? 8.949    1.507   29.639  1.00 34.75  ? 540  ARG A CA    1 
ATOM   3644  C C     . ARG A  1 540 ? 10.184   0.991   30.387  1.00 43.73  ? 540  ARG A C     1 
ATOM   3645  O O     . ARG A  1 540 ? 10.729   1.684   31.253  1.00 47.15  ? 540  ARG A O     1 
ATOM   3646  C CB    . ARG A  1 540 ? 9.121    2.980   29.239  1.00 32.95  ? 540  ARG A CB    1 
ATOM   3647  C CG    . ARG A  1 540 ? 8.039    3.499   28.324  1.00 31.05  ? 540  ARG A CG    1 
ATOM   3648  C CD    . ARG A  1 540 ? 8.212    4.963   28.090  1.00 31.01  ? 540  ARG A CD    1 
ATOM   3649  N NE    . ARG A  1 540 ? 7.043    5.519   27.416  1.00 43.21  ? 540  ARG A NE    1 
ATOM   3650  C CZ    . ARG A  1 540 ? 6.911    6.798   27.088  1.00 52.45  ? 540  ARG A CZ    1 
ATOM   3651  N NH1   . ARG A  1 540 ? 7.874    7.663   27.365  1.00 40.42  ? 540  ARG A NH1   1 
ATOM   3652  N NH2   . ARG A  1 540 ? 5.815    7.223   26.478  1.00 37.08  ? 540  ARG A NH2   1 
ATOM   3653  N N     . GLN A  1 541 ? 10.597   -0.247  30.095  1.00 39.33  ? 541  GLN A N     1 
ATOM   3654  C CA    . GLN A  1 541 ? 11.764   -0.860  30.729  1.00 38.50  ? 541  GLN A CA    1 
ATOM   3655  C C     . GLN A  1 541 ? 13.005   -0.507  29.943  1.00 44.79  ? 541  GLN A C     1 
ATOM   3656  O O     . GLN A  1 541 ? 12.890   -0.274  28.742  1.00 43.94  ? 541  GLN A O     1 
ATOM   3657  C CB    . GLN A  1 541 ? 11.609   -2.374  30.773  1.00 38.61  ? 541  GLN A CB    1 
ATOM   3658  C CG    . GLN A  1 541 ? 10.350   -2.851  31.476  1.00 50.24  ? 541  GLN A CG    1 
ATOM   3659  C CD    . GLN A  1 541 ? 10.460   -2.921  32.975  1.00 61.80  ? 541  GLN A CD    1 
ATOM   3660  O OE1   . GLN A  1 541 ? 10.109   -3.938  33.591  1.00 50.39  ? 541  GLN A OE1   1 
ATOM   3661  N NE2   . GLN A  1 541 ? 10.842   -1.818  33.603  1.00 58.50  ? 541  GLN A NE2   1 
ATOM   3662  N N     . PRO A  1 542 ? 14.213   -0.470  30.551  1.00 44.72  ? 542  PRO A N     1 
ATOM   3663  C CA    . PRO A  1 542 ? 15.416   -0.153  29.746  1.00 46.30  ? 542  PRO A CA    1 
ATOM   3664  C C     . PRO A  1 542 ? 15.885   -1.350  28.915  1.00 51.50  ? 542  PRO A C     1 
ATOM   3665  O O     . PRO A  1 542 ? 15.979   -2.456  29.451  1.00 49.92  ? 542  PRO A O     1 
ATOM   3666  C CB    . PRO A  1 542 ? 16.456   0.271   30.785  1.00 49.13  ? 542  PRO A CB    1 
ATOM   3667  C CG    . PRO A  1 542 ? 15.794   0.097   32.123  1.00 52.45  ? 542  PRO A CG    1 
ATOM   3668  C CD    . PRO A  1 542 ? 14.566   -0.709  31.962  1.00 46.39  ? 542  PRO A CD    1 
ATOM   3669  N N     . LEU A  1 543 ? 16.148   -1.126  27.598  1.00 50.12  ? 543  LEU A N     1 
ATOM   3670  C CA    . LEU A  1 543 ? 16.622   -2.130  26.615  1.00 50.13  ? 543  LEU A CA    1 
ATOM   3671  C C     . LEU A  1 543 ? 17.843   -2.879  27.123  1.00 54.06  ? 543  LEU A C     1 
ATOM   3672  O O     . LEU A  1 543 ? 17.935   -4.098  26.959  1.00 53.13  ? 543  LEU A O     1 
ATOM   3673  C CB    . LEU A  1 543 ? 16.999   -1.445  25.285  1.00 50.59  ? 543  LEU A CB    1 
ATOM   3674  C CG    . LEU A  1 543 ? 16.560   -2.052  23.936  1.00 54.40  ? 543  LEU A CG    1 
ATOM   3675  C CD1   . LEU A  1 543 ? 17.395   -1.475  22.794  1.00 56.35  ? 543  LEU A CD1   1 
ATOM   3676  C CD2   . LEU A  1 543 ? 16.716   -3.545  23.882  1.00 54.58  ? 543  LEU A CD2   1 
ATOM   3677  N N     . VAL A  1 544 ? 18.776   -2.128  27.731  1.00 51.72  ? 544  VAL A N     1 
ATOM   3678  C CA    . VAL A  1 544 ? 20.028   -2.635  28.285  1.00 53.34  ? 544  VAL A CA    1 
ATOM   3679  C C     . VAL A  1 544 ? 19.768   -3.740  29.297  1.00 56.72  ? 544  VAL A C     1 
ATOM   3680  O O     . VAL A  1 544 ? 20.306   -4.840  29.146  1.00 58.58  ? 544  VAL A O     1 
ATOM   3681  C CB    . VAL A  1 544 ? 20.940   -1.530  28.883  1.00 58.12  ? 544  VAL A CB    1 
ATOM   3682  C CG1   . VAL A  1 544 ? 22.284   -1.493  28.177  1.00 58.75  ? 544  VAL A CG1   1 
ATOM   3683  C CG2   . VAL A  1 544 ? 20.262   -0.157  28.874  1.00 58.01  ? 544  VAL A CG2   1 
ATOM   3684  N N     . GLU A  1 545 ? 18.918   -3.450  30.296  1.00 48.70  ? 545  GLU A N     1 
ATOM   3685  C CA    . GLU A  1 545 ? 18.580   -4.368  31.371  1.00 46.58  ? 545  GLU A CA    1 
ATOM   3686  C C     . GLU A  1 545 ? 17.809   -5.570  30.896  1.00 48.60  ? 545  GLU A C     1 
ATOM   3687  O O     . GLU A  1 545 ? 18.095   -6.672  31.348  1.00 47.57  ? 545  GLU A O     1 
ATOM   3688  C CB    . GLU A  1 545 ? 17.815   -3.641  32.477  1.00 47.52  ? 545  GLU A CB    1 
ATOM   3689  C CG    . GLU A  1 545 ? 18.702   -2.745  33.319  1.00 64.29  ? 545  GLU A CG    1 
ATOM   3690  C CD    . GLU A  1 545 ? 18.016   -2.020  34.452  1.00 106.70 ? 545  GLU A CD    1 
ATOM   3691  O OE1   . GLU A  1 545 ? 17.149   -2.634  35.119  1.00 117.67 ? 545  GLU A OE1   1 
ATOM   3692  O OE2   . GLU A  1 545 ? 18.383   -0.846  34.699  1.00 109.95 ? 545  GLU A OE2   1 
ATOM   3693  N N     . SER A  1 546 ? 16.826   -5.367  29.989  1.00 46.83  ? 546  SER A N     1 
ATOM   3694  C CA    . SER A  1 546 ? 15.929   -6.413  29.469  1.00 46.14  ? 546  SER A CA    1 
ATOM   3695  C C     . SER A  1 546 ? 16.636   -7.479  28.647  1.00 51.50  ? 546  SER A C     1 
ATOM   3696  O O     . SER A  1 546 ? 16.306   -8.670  28.780  1.00 51.18  ? 546  SER A O     1 
ATOM   3697  C CB    . SER A  1 546 ? 14.764   -5.803  28.714  1.00 48.68  ? 546  SER A CB    1 
ATOM   3698  O OG    . SER A  1 546 ? 13.910   -5.162  29.646  1.00 63.42  ? 546  SER A OG    1 
ATOM   3699  N N     . VAL A  1 547 ? 17.627   -7.052  27.820  1.00 47.17  ? 547  VAL A N     1 
ATOM   3700  C CA    . VAL A  1 547 ? 18.439   -7.934  26.981  1.00 45.97  ? 547  VAL A CA    1 
ATOM   3701  C C     . VAL A  1 547 ? 19.382   -8.713  27.898  1.00 51.95  ? 547  VAL A C     1 
ATOM   3702  O O     . VAL A  1 547 ? 19.584   -9.905  27.701  1.00 53.43  ? 547  VAL A O     1 
ATOM   3703  C CB    . VAL A  1 547 ? 19.182   -7.145  25.865  1.00 49.30  ? 547  VAL A CB    1 
ATOM   3704  C CG1   . VAL A  1 547 ? 20.240   -8.001  25.167  1.00 50.38  ? 547  VAL A CG1   1 
ATOM   3705  C CG2   . VAL A  1 547 ? 18.207   -6.578  24.847  1.00 47.51  ? 547  VAL A CG2   1 
ATOM   3706  N N     . ALA A  1 548 ? 19.943   -8.031  28.907  1.00 48.45  ? 548  ALA A N     1 
ATOM   3707  C CA    . ALA A  1 548 ? 20.866   -8.590  29.884  1.00 48.37  ? 548  ALA A CA    1 
ATOM   3708  C C     . ALA A  1 548 ? 20.180   -9.666  30.727  1.00 51.42  ? 548  ALA A C     1 
ATOM   3709  O O     . ALA A  1 548 ? 20.733   -10.757 30.889  1.00 53.78  ? 548  ALA A O     1 
ATOM   3710  C CB    . ALA A  1 548 ? 21.407   -7.486  30.775  1.00 49.49  ? 548  ALA A CB    1 
ATOM   3711  N N     . GLN A  1 549 ? 18.973   -9.374  31.232  1.00 44.04  ? 549  GLN A N     1 
ATOM   3712  C CA    . GLN A  1 549 ? 18.200   -10.296 32.066  1.00 42.56  ? 549  GLN A CA    1 
ATOM   3713  C C     . GLN A  1 549 ? 17.830   -11.557 31.277  1.00 47.55  ? 549  GLN A C     1 
ATOM   3714  O O     . GLN A  1 549 ? 17.939   -12.672 31.797  1.00 47.48  ? 549  GLN A O     1 
ATOM   3715  C CB    . GLN A  1 549 ? 16.938   -9.601  32.604  1.00 41.79  ? 549  GLN A CB    1 
ATOM   3716  C CG    . GLN A  1 549 ? 17.165   -8.670  33.788  1.00 51.24  ? 549  GLN A CG    1 
ATOM   3717  C CD    . GLN A  1 549 ? 15.981   -7.776  34.083  1.00 84.44  ? 549  GLN A CD    1 
ATOM   3718  O OE1   . GLN A  1 549 ? 16.129   -6.553  34.219  1.00 88.22  ? 549  GLN A OE1   1 
ATOM   3719  N NE2   . GLN A  1 549 ? 14.783   -8.355  34.210  1.00 75.38  ? 549  GLN A NE2   1 
ATOM   3720  N N     . THR A  1 550 ? 17.412   -11.369 30.006  1.00 44.41  ? 550  THR A N     1 
ATOM   3721  C CA    . THR A  1 550 ? 17.011   -12.449 29.105  1.00 43.06  ? 550  THR A CA    1 
ATOM   3722  C C     . THR A  1 550 ? 18.153   -13.372 28.754  1.00 44.83  ? 550  THR A C     1 
ATOM   3723  O O     . THR A  1 550 ? 17.916   -14.559 28.603  1.00 44.31  ? 550  THR A O     1 
ATOM   3724  C CB    . THR A  1 550 ? 16.097   -11.952 27.961  1.00 56.00  ? 550  THR A CB    1 
ATOM   3725  O OG1   . THR A  1 550 ? 15.335   -13.053 27.483  1.00 59.43  ? 550  THR A OG1   1 
ATOM   3726  C CG2   . THR A  1 550 ? 16.854   -11.341 26.806  1.00 56.70  ? 550  THR A CG2   1 
ATOM   3727  N N     . LYS A  1 551 ? 19.395   -12.834 28.680  1.00 41.72  ? 551  LYS A N     1 
ATOM   3728  C CA    . LYS A  1 551 ? 20.638   -13.584 28.411  1.00 42.42  ? 551  LYS A CA    1 
ATOM   3729  C C     . LYS A  1 551 ? 20.980   -14.469 29.599  1.00 46.66  ? 551  LYS A C     1 
ATOM   3730  O O     . LYS A  1 551 ? 21.450   -15.581 29.394  1.00 47.62  ? 551  LYS A O     1 
ATOM   3731  C CB    . LYS A  1 551 ? 21.825   -12.654 28.116  1.00 45.18  ? 551  LYS A CB    1 
ATOM   3732  C CG    . LYS A  1 551 ? 21.965   -12.257 26.652  1.00 58.28  ? 551  LYS A CG    1 
ATOM   3733  C CD    . LYS A  1 551 ? 23.145   -11.301 26.471  1.00 77.50  ? 551  LYS A CD    1 
ATOM   3734  C CE    . LYS A  1 551 ? 23.323   -10.802 25.050  1.00 84.19  ? 551  LYS A CE    1 
ATOM   3735  N NZ    . LYS A  1 551 ? 24.573   -10.004 24.880  1.00 84.43  ? 551  LYS A NZ    1 
ATOM   3736  N N     . THR A  1 552 ? 20.740   -13.985 30.836  1.00 42.00  ? 552  THR A N     1 
ATOM   3737  C CA    . THR A  1 552 ? 20.990   -14.752 32.053  1.00 42.18  ? 552  THR A CA    1 
ATOM   3738  C C     . THR A  1 552 ? 20.094   -16.000 32.193  1.00 48.43  ? 552  THR A C     1 
ATOM   3739  O O     . THR A  1 552 ? 20.545   -16.962 32.819  1.00 48.85  ? 552  THR A O     1 
ATOM   3740  C CB    . THR A  1 552 ? 21.127   -13.871 33.303  1.00 46.17  ? 552  THR A CB    1 
ATOM   3741  O OG1   . THR A  1 552 ? 19.884   -13.275 33.627  1.00 47.49  ? 552  THR A OG1   1 
ATOM   3742  C CG2   . THR A  1 552 ? 22.184   -12.799 33.150  1.00 48.38  ? 552  THR A CG2   1 
ATOM   3743  N N     . VAL A  1 553 ? 18.859   -16.016 31.582  1.00 45.46  ? 553  VAL A N     1 
ATOM   3744  C CA    . VAL A  1 553 ? 18.009   -17.222 31.610  1.00 45.96  ? 553  VAL A CA    1 
ATOM   3745  C C     . VAL A  1 553 ? 18.583   -18.288 30.651  1.00 54.16  ? 553  VAL A C     1 
ATOM   3746  O O     . VAL A  1 553 ? 18.720   -19.461 31.029  1.00 54.74  ? 553  VAL A O     1 
ATOM   3747  C CB    . VAL A  1 553 ? 16.484   -17.012 31.467  1.00 48.27  ? 553  VAL A CB    1 
ATOM   3748  C CG1   . VAL A  1 553 ? 16.039   -15.737 32.173  1.00 48.13  ? 553  VAL A CG1   1 
ATOM   3749  C CG2   . VAL A  1 553 ? 16.029   -17.019 30.010  1.00 47.42  ? 553  VAL A CG2   1 
ATOM   3750  N N     . SER A  1 554 ? 19.005   -17.838 29.441  1.00 51.30  ? 554  SER A N     1 
ATOM   3751  C CA    . SER A  1 554 ? 19.636   -18.650 28.399  1.00 51.44  ? 554  SER A CA    1 
ATOM   3752  C C     . SER A  1 554 ? 20.927   -19.241 28.959  1.00 57.71  ? 554  SER A C     1 
ATOM   3753  O O     . SER A  1 554 ? 21.184   -20.429 28.757  1.00 60.51  ? 554  SER A O     1 
ATOM   3754  C CB    . SER A  1 554 ? 19.954   -17.796 27.177  1.00 56.16  ? 554  SER A CB    1 
ATOM   3755  O OG    . SER A  1 554 ? 18.814   -17.096 26.703  1.00 73.05  ? 554  SER A OG    1 
ATOM   3756  N N     . ALA A  1 555 ? 21.711   -18.419 29.703  1.00 51.89  ? 555  ALA A N     1 
ATOM   3757  C CA    . ALA A  1 555 ? 22.945   -18.810 30.358  1.00 51.94  ? 555  ALA A CA    1 
ATOM   3758  C C     . ALA A  1 555 ? 22.670   -19.884 31.399  1.00 54.29  ? 555  ALA A C     1 
ATOM   3759  O O     . ALA A  1 555 ? 23.327   -20.909 31.358  1.00 53.19  ? 555  ALA A O     1 
ATOM   3760  C CB    . ALA A  1 555 ? 23.589   -17.599 31.015  1.00 53.37  ? 555  ALA A CB    1 
ATOM   3761  N N     . ALA A  1 556 ? 21.660   -19.674 32.286  1.00 51.76  ? 556  ALA A N     1 
ATOM   3762  C CA    . ALA A  1 556 ? 21.257   -20.601 33.352  1.00 52.00  ? 556  ALA A CA    1 
ATOM   3763  C C     . ALA A  1 556 ? 20.961   -21.996 32.802  1.00 57.01  ? 556  ALA A C     1 
ATOM   3764  O O     . ALA A  1 556 ? 21.537   -22.975 33.294  1.00 57.86  ? 556  ALA A O     1 
ATOM   3765  C CB    . ALA A  1 556 ? 20.065   -20.050 34.131  1.00 51.07  ? 556  ALA A CB    1 
ATOM   3766  N N     . ILE A  1 557 ? 20.122   -22.074 31.744  1.00 53.22  ? 557  ILE A N     1 
ATOM   3767  C CA    . ILE A  1 557 ? 19.774   -23.330 31.069  1.00 53.37  ? 557  ILE A CA    1 
ATOM   3768  C C     . ILE A  1 557 ? 21.052   -23.995 30.535  1.00 60.38  ? 557  ILE A C     1 
ATOM   3769  O O     . ILE A  1 557 ? 21.308   -25.143 30.885  1.00 62.20  ? 557  ILE A O     1 
ATOM   3770  C CB    . ILE A  1 557 ? 18.732   -23.130 29.937  1.00 54.90  ? 557  ILE A CB    1 
ATOM   3771  C CG1   . ILE A  1 557 ? 17.488   -22.298 30.388  1.00 53.59  ? 557  ILE A CG1   1 
ATOM   3772  C CG2   . ILE A  1 557 ? 18.375   -24.468 29.247  1.00 55.42  ? 557  ILE A CG2   1 
ATOM   3773  C CD1   . ILE A  1 557 ? 16.370   -23.024 31.114  1.00 59.09  ? 557  ILE A CD1   1 
ATOM   3774  N N     . GLU A  1 558 ? 21.866   -23.258 29.727  1.00 56.59  ? 558  GLU A N     1 
ATOM   3775  C CA    . GLU A  1 558 ? 23.142   -23.716 29.145  1.00 56.81  ? 558  GLU A CA    1 
ATOM   3776  C C     . GLU A  1 558 ? 24.105   -24.222 30.213  1.00 60.04  ? 558  GLU A C     1 
ATOM   3777  O O     . GLU A  1 558 ? 24.842   -25.171 29.964  1.00 60.49  ? 558  GLU A O     1 
ATOM   3778  C CB    . GLU A  1 558 ? 23.805   -22.591 28.341  1.00 58.43  ? 558  GLU A CB    1 
ATOM   3779  N N     . ALA A  1 559 ? 24.058   -23.610 31.414  1.00 55.86  ? 559  ALA A N     1 
ATOM   3780  C CA    . ALA A  1 559 ? 24.872   -23.938 32.577  1.00 56.48  ? 559  ALA A CA    1 
ATOM   3781  C C     . ALA A  1 559 ? 24.266   -25.051 33.432  1.00 59.18  ? 559  ALA A C     1 
ATOM   3782  O O     . ALA A  1 559 ? 24.784   -25.330 34.520  1.00 62.40  ? 559  ALA A O     1 
ATOM   3783  C CB    . ALA A  1 559 ? 25.090   -22.691 33.421  1.00 57.40  ? 559  ALA A CB    1 
ATOM   3784  N N     . LYS A  1 560 ? 23.198   -25.702 32.943  1.00 51.68  ? 560  LYS A N     1 
ATOM   3785  C CA    . LYS A  1 560 ? 22.479   -26.797 33.608  1.00 51.14  ? 560  LYS A CA    1 
ATOM   3786  C C     . LYS A  1 560 ? 21.926   -26.417 34.996  1.00 55.60  ? 560  LYS A C     1 
ATOM   3787  O O     . LYS A  1 560 ? 21.663   -27.312 35.805  1.00 55.11  ? 560  LYS A O     1 
ATOM   3788  C CB    . LYS A  1 560 ? 23.295   -28.122 33.655  1.00 56.17  ? 560  LYS A CB    1 
ATOM   3789  C CG    . LYS A  1 560 ? 23.831   -28.634 32.311  1.00 71.47  ? 560  LYS A CG    1 
ATOM   3790  C CD    . LYS A  1 560 ? 24.462   -30.027 32.397  1.00 78.17  ? 560  LYS A CD    1 
ATOM   3791  C CE    . LYS A  1 560 ? 25.445   -30.249 31.269  1.00 87.76  ? 560  LYS A CE    1 
ATOM   3792  N NZ    . LYS A  1 560 ? 25.776   -31.688 31.063  1.00 99.41  ? 560  LYS A NZ    1 
ATOM   3793  N N     . ASP A  1 561 ? 21.773   -25.097 35.279  1.00 53.24  ? 561  ASP A N     1 
ATOM   3794  C CA    . ASP A  1 561 ? 21.200   -24.600 36.534  1.00 54.26  ? 561  ASP A CA    1 
ATOM   3795  C C     . ASP A  1 561 ? 19.786   -24.100 36.221  1.00 60.96  ? 561  ASP A C     1 
ATOM   3796  O O     . ASP A  1 561 ? 19.524   -22.893 36.073  1.00 59.89  ? 561  ASP A O     1 
ATOM   3797  C CB    . ASP A  1 561 ? 22.063   -23.498 37.168  1.00 57.44  ? 561  ASP A CB    1 
ATOM   3798  C CG    . ASP A  1 561 ? 21.567   -22.959 38.514  1.00 74.48  ? 561  ASP A CG    1 
ATOM   3799  O OD1   . ASP A  1 561 ? 22.216   -22.034 39.055  1.00 77.50  ? 561  ASP A OD1   1 
ATOM   3800  O OD2   . ASP A  1 561 ? 20.529   -23.469 39.030  1.00 80.79  ? 561  ASP A OD2   1 
ATOM   3801  N N     . PHE A  1 562 ? 18.873   -25.061 36.114  1.00 58.69  ? 562  PHE A N     1 
ATOM   3802  C CA    . PHE A  1 562 ? 17.485   -24.821 35.763  1.00 57.45  ? 562  PHE A CA    1 
ATOM   3803  C C     . PHE A  1 562 ? 16.685   -24.171 36.877  1.00 63.60  ? 562  PHE A C     1 
ATOM   3804  O O     . PHE A  1 562 ? 15.593   -23.651 36.628  1.00 62.48  ? 562  PHE A O     1 
ATOM   3805  C CB    . PHE A  1 562 ? 16.841   -26.119 35.262  1.00 58.82  ? 562  PHE A CB    1 
ATOM   3806  C CG    . PHE A  1 562 ? 17.733   -26.943 34.357  1.00 60.89  ? 562  PHE A CG    1 
ATOM   3807  C CD1   . PHE A  1 562 ? 17.988   -26.544 33.050  1.00 63.52  ? 562  PHE A CD1   1 
ATOM   3808  C CD2   . PHE A  1 562 ? 18.307   -28.123 34.809  1.00 64.08  ? 562  PHE A CD2   1 
ATOM   3809  C CE1   . PHE A  1 562 ? 18.822   -27.300 32.218  1.00 65.38  ? 562  PHE A CE1   1 
ATOM   3810  C CE2   . PHE A  1 562 ? 19.137   -28.880 33.977  1.00 67.90  ? 562  PHE A CE2   1 
ATOM   3811  C CZ    . PHE A  1 562 ? 19.383   -28.467 32.686  1.00 65.64  ? 562  PHE A CZ    1 
ATOM   3812  N N     . ASP A  1 563 ? 17.231   -24.176 38.095  1.00 63.51  ? 563  ASP A N     1 
ATOM   3813  C CA    . ASP A  1 563 ? 16.597   -23.554 39.249  1.00 64.54  ? 563  ASP A CA    1 
ATOM   3814  C C     . ASP A  1 563 ? 16.674   -22.050 39.099  1.00 66.91  ? 563  ASP A C     1 
ATOM   3815  O O     . ASP A  1 563 ? 15.651   -21.389 39.218  1.00 64.27  ? 563  ASP A O     1 
ATOM   3816  C CB    . ASP A  1 563 ? 17.268   -24.014 40.559  1.00 70.00  ? 563  ASP A CB    1 
ATOM   3817  C CG    . ASP A  1 563 ? 16.538   -25.148 41.255  1.00 91.52  ? 563  ASP A CG    1 
ATOM   3818  O OD1   . ASP A  1 563 ? 15.271   -25.110 41.296  1.00 92.96  ? 563  ASP A OD1   1 
ATOM   3819  O OD2   . ASP A  1 563 ? 17.226   -26.056 41.793  1.00 97.70  ? 563  ASP A OD2   1 
ATOM   3820  N N     . LYS A  1 564 ? 17.876   -21.519 38.761  1.00 65.33  ? 564  LYS A N     1 
ATOM   3821  C CA    . LYS A  1 564 ? 18.132   -20.091 38.540  1.00 65.32  ? 564  LYS A CA    1 
ATOM   3822  C C     . LYS A  1 564 ? 17.209   -19.572 37.445  1.00 68.59  ? 564  LYS A C     1 
ATOM   3823  O O     . LYS A  1 564 ? 16.644   -18.492 37.595  1.00 66.86  ? 564  LYS A O     1 
ATOM   3824  C CB    . LYS A  1 564 ? 19.609   -19.852 38.152  1.00 68.97  ? 564  LYS A CB    1 
ATOM   3825  C CG    . LYS A  1 564 ? 20.045   -18.385 38.179  1.00 81.78  ? 564  LYS A CG    1 
ATOM   3826  C CD    . LYS A  1 564 ? 21.185   -18.119 37.183  1.00 94.92  ? 564  LYS A CD    1 
ATOM   3827  C CE    . LYS A  1 564 ? 21.702   -16.697 37.211  1.00 102.03 ? 564  LYS A CE    1 
ATOM   3828  N NZ    . LYS A  1 564 ? 22.550   -16.392 36.023  1.00 106.76 ? 564  LYS A NZ    1 
ATOM   3829  N N     . ALA A  1 565 ? 17.045   -20.371 36.361  1.00 66.35  ? 565  ALA A N     1 
ATOM   3830  C CA    . ALA A  1 565 ? 16.204   -20.089 35.190  1.00 65.09  ? 565  ALA A CA    1 
ATOM   3831  C C     . ALA A  1 565 ? 14.724   -19.966 35.548  1.00 66.47  ? 565  ALA A C     1 
ATOM   3832  O O     . ALA A  1 565 ? 14.109   -18.953 35.209  1.00 62.72  ? 565  ALA A O     1 
ATOM   3833  C CB    . ALA A  1 565 ? 16.401   -21.164 34.141  1.00 66.15  ? 565  ALA A CB    1 
ATOM   3834  N N     . LEU A  1 566 ? 14.160   -20.974 36.253  1.00 64.29  ? 566  LEU A N     1 
ATOM   3835  C CA    . LEU A  1 566 ? 12.767   -20.921 36.680  1.00 63.28  ? 566  LEU A CA    1 
ATOM   3836  C C     . LEU A  1 566 ? 12.548   -19.744 37.650  1.00 67.74  ? 566  LEU A C     1 
ATOM   3837  O O     . LEU A  1 566 ? 11.548   -19.037 37.525  1.00 66.43  ? 566  LEU A O     1 
ATOM   3838  C CB    . LEU A  1 566 ? 12.308   -22.250 37.307  1.00 63.66  ? 566  LEU A CB    1 
ATOM   3839  C CG    . LEU A  1 566 ? 10.790   -22.457 37.261  1.00 67.73  ? 566  LEU A CG    1 
ATOM   3840  C CD1   . LEU A  1 566 ? 10.420   -23.774 36.594  1.00 68.46  ? 566  LEU A CD1   1 
ATOM   3841  C CD2   . LEU A  1 566 ? 10.152   -22.292 38.626  1.00 68.68  ? 566  LEU A CD2   1 
ATOM   3842  N N     . GLN A  1 567 ? 13.501   -19.516 38.584  1.00 65.43  ? 567  GLN A N     1 
ATOM   3843  C CA    . GLN A  1 567 ? 13.446   -18.416 39.542  1.00 65.50  ? 567  GLN A CA    1 
ATOM   3844  C C     . GLN A  1 567 ? 13.498   -17.072 38.810  1.00 69.50  ? 567  GLN A C     1 
ATOM   3845  O O     . GLN A  1 567 ? 12.840   -16.125 39.243  1.00 68.81  ? 567  GLN A O     1 
ATOM   3846  C CB    . GLN A  1 567 ? 14.601   -18.511 40.541  1.00 68.80  ? 567  GLN A CB    1 
ATOM   3847  C CG    . GLN A  1 567 ? 14.410   -19.568 41.637  1.00 85.80  ? 567  GLN A CG    1 
ATOM   3848  C CD    . GLN A  1 567 ? 15.729   -20.086 42.197  1.00 102.09 ? 567  GLN A CD    1 
ATOM   3849  O OE1   . GLN A  1 567 ? 16.667   -19.328 42.494  1.00 96.14  ? 567  GLN A OE1   1 
ATOM   3850  N NE2   . GLN A  1 567 ? 15.823   -21.400 42.375  1.00 89.98  ? 567  GLN A NE2   1 
ATOM   3851  N N     . LEU A  1 568 ? 14.247   -17.011 37.673  1.00 66.04  ? 568  LEU A N     1 
ATOM   3852  C CA    . LEU A  1 568 ? 14.419   -15.829 36.813  1.00 64.86  ? 568  LEU A CA    1 
ATOM   3853  C C     . LEU A  1 568 ? 13.186   -15.464 35.973  1.00 65.50  ? 568  LEU A C     1 
ATOM   3854  O O     . LEU A  1 568 ? 13.220   -14.452 35.274  1.00 65.34  ? 568  LEU A O     1 
ATOM   3855  C CB    . LEU A  1 568 ? 15.641   -16.001 35.901  1.00 65.93  ? 568  LEU A CB    1 
ATOM   3856  C CG    . LEU A  1 568 ? 16.836   -15.107 36.209  1.00 72.36  ? 568  LEU A CG    1 
ATOM   3857  C CD1   . LEU A  1 568 ? 18.135   -15.856 36.028  1.00 73.51  ? 568  LEU A CD1   1 
ATOM   3858  C CD2   . LEU A  1 568 ? 16.808   -13.810 35.364  1.00 75.13  ? 568  LEU A CD2   1 
ATOM   3859  N N     . ARG A  1 569 ? 12.109   -16.273 36.036  1.00 59.32  ? 569  ARG A N     1 
ATOM   3860  C CA    . ARG A  1 569 ? 10.861   -16.040 35.304  1.00 57.07  ? 569  ARG A CA    1 
ATOM   3861  C C     . ARG A  1 569 ? 9.880    -15.299 36.187  1.00 62.45  ? 569  ARG A C     1 
ATOM   3862  O O     . ARG A  1 569 ? 9.831    -15.565 37.387  1.00 62.35  ? 569  ARG A O     1 
ATOM   3863  C CB    . ARG A  1 569 ? 10.229   -17.371 34.849  1.00 52.62  ? 569  ARG A CB    1 
ATOM   3864  C CG    . ARG A  1 569 ? 11.033   -18.154 33.825  1.00 52.46  ? 569  ARG A CG    1 
ATOM   3865  C CD    . ARG A  1 569 ? 10.893   -17.556 32.447  1.00 52.44  ? 569  ARG A CD    1 
ATOM   3866  N NE    . ARG A  1 569 ? 11.701   -18.273 31.463  1.00 50.13  ? 569  ARG A NE    1 
ATOM   3867  C CZ    . ARG A  1 569 ? 12.216   -17.721 30.371  1.00 57.87  ? 569  ARG A CZ    1 
ATOM   3868  N NH1   . ARG A  1 569 ? 12.017   -16.429 30.112  1.00 45.30  ? 569  ARG A NH1   1 
ATOM   3869  N NH2   . ARG A  1 569 ? 12.934   -18.453 29.527  1.00 37.40  ? 569  ARG A NH2   1 
ATOM   3870  N N     . ASP A  1 570 ? 9.064    -14.408 35.594  1.00 59.88  ? 570  ASP A N     1 
ATOM   3871  C CA    . ASP A  1 570 ? 8.052    -13.634 36.322  1.00 59.69  ? 570  ASP A CA    1 
ATOM   3872  C C     . ASP A  1 570 ? 7.027    -14.473 37.067  1.00 60.76  ? 570  ASP A C     1 
ATOM   3873  O O     . ASP A  1 570 ? 6.888    -15.666 36.785  1.00 59.88  ? 570  ASP A O     1 
ATOM   3874  C CB    . ASP A  1 570 ? 7.373    -12.535 35.460  1.00 62.05  ? 570  ASP A CB    1 
ATOM   3875  C CG    . ASP A  1 570 ? 6.781    -12.944 34.126  1.00 78.83  ? 570  ASP A CG    1 
ATOM   3876  O OD1   . ASP A  1 570 ? 6.137    -14.023 34.061  1.00 81.65  ? 570  ASP A OD1   1 
ATOM   3877  O OD2   . ASP A  1 570 ? 6.900    -12.149 33.158  1.00 83.02  ? 570  ASP A OD2   1 
ATOM   3878  N N     . GLN A  1 571 ? 6.328    -13.847 38.042  1.00 56.35  ? 571  GLN A N     1 
ATOM   3879  C CA    . GLN A  1 571 ? 5.331    -14.515 38.874  1.00 55.98  ? 571  GLN A CA    1 
ATOM   3880  C C     . GLN A  1 571 ? 4.249    -15.163 38.030  1.00 61.23  ? 571  GLN A C     1 
ATOM   3881  O O     . GLN A  1 571 ? 3.791    -16.253 38.373  1.00 60.94  ? 571  GLN A O     1 
ATOM   3882  C CB    . GLN A  1 571 ? 4.745    -13.575 39.944  1.00 57.00  ? 571  GLN A CB    1 
ATOM   3883  C CG    . GLN A  1 571 ? 5.496    -13.600 41.284  1.00 71.58  ? 571  GLN A CG    1 
ATOM   3884  C CD    . GLN A  1 571 ? 5.696    -14.988 41.855  1.00 87.25  ? 571  GLN A CD    1 
ATOM   3885  O OE1   . GLN A  1 571 ? 4.737    -15.747 42.051  1.00 92.85  ? 571  GLN A OE1   1 
ATOM   3886  N NE2   . GLN A  1 571 ? 6.951    -15.357 42.112  1.00 60.25  ? 571  GLN A NE2   1 
ATOM   3887  N N     . GLU A  1 572 ? 3.908    -14.524 36.875  1.00 57.78  ? 572  GLU A N     1 
ATOM   3888  C CA    . GLU A  1 572 ? 2.942    -15.002 35.886  1.00 55.66  ? 572  GLU A CA    1 
ATOM   3889  C C     . GLU A  1 572 ? 3.313    -16.447 35.500  1.00 56.67  ? 572  GLU A C     1 
ATOM   3890  O O     . GLU A  1 572 ? 2.478    -17.340 35.631  1.00 56.40  ? 572  GLU A O     1 
ATOM   3891  C CB    . GLU A  1 572 ? 2.955    -14.061 34.672  1.00 57.02  ? 572  GLU A CB    1 
ATOM   3892  C CG    . GLU A  1 572 ? 1.966    -14.433 33.578  1.00 78.64  ? 572  GLU A CG    1 
ATOM   3893  C CD    . GLU A  1 572 ? 2.520    -14.827 32.216  1.00 118.23 ? 572  GLU A CD    1 
ATOM   3894  O OE1   . GLU A  1 572 ? 3.764    -14.867 32.046  1.00 116.66 ? 572  GLU A OE1   1 
ATOM   3895  O OE2   . GLU A  1 572 ? 1.694    -15.099 31.313  1.00 115.58 ? 572  GLU A OE2   1 
ATOM   3896  N N     . PHE A  1 573 ? 4.591    -16.677 35.124  1.00 50.86  ? 573  PHE A N     1 
ATOM   3897  C CA    . PHE A  1 573 ? 5.131    -17.984 34.758  1.00 49.22  ? 573  PHE A CA    1 
ATOM   3898  C C     . PHE A  1 573 ? 5.121    -18.930 35.960  1.00 51.51  ? 573  PHE A C     1 
ATOM   3899  O O     . PHE A  1 573 ? 4.730    -20.089 35.828  1.00 50.91  ? 573  PHE A O     1 
ATOM   3900  C CB    . PHE A  1 573 ? 6.566    -17.823 34.235  1.00 51.59  ? 573  PHE A CB    1 
ATOM   3901  C CG    . PHE A  1 573 ? 7.131    -19.024 33.507  1.00 52.98  ? 573  PHE A CG    1 
ATOM   3902  C CD1   . PHE A  1 573 ? 7.235    -19.031 32.121  1.00 55.11  ? 573  PHE A CD1   1 
ATOM   3903  C CD2   . PHE A  1 573 ? 7.587    -20.140 34.209  1.00 54.04  ? 573  PHE A CD2   1 
ATOM   3904  C CE1   . PHE A  1 573 ? 7.767    -20.136 31.454  1.00 55.88  ? 573  PHE A CE1   1 
ATOM   3905  C CE2   . PHE A  1 573 ? 8.091    -21.251 33.534  1.00 56.44  ? 573  PHE A CE2   1 
ATOM   3906  C CZ    . PHE A  1 573 ? 8.174    -21.242 32.165  1.00 54.39  ? 573  PHE A CZ    1 
ATOM   3907  N N     . ALA A  1 574 ? 5.563    -18.432 37.118  1.00 48.24  ? 574  ALA A N     1 
ATOM   3908  C CA    . ALA A  1 574 ? 5.678    -19.192 38.361  1.00 48.97  ? 574  ALA A CA    1 
ATOM   3909  C C     . ALA A  1 574 ? 4.334    -19.728 38.879  1.00 51.42  ? 574  ALA A C     1 
ATOM   3910  O O     . ALA A  1 574 ? 4.222    -20.930 39.166  1.00 50.64  ? 574  ALA A O     1 
ATOM   3911  C CB    . ALA A  1 574 ? 6.365    -18.341 39.418  1.00 50.66  ? 574  ALA A CB    1 
ATOM   3912  N N     . THR A  1 575 ? 3.317    -18.840 38.962  1.00 46.98  ? 575  THR A N     1 
ATOM   3913  C CA    . THR A  1 575 ? 1.969    -19.157 39.445  1.00 46.38  ? 575  THR A CA    1 
ATOM   3914  C C     . THR A  1 575 ? 1.268    -20.142 38.533  1.00 49.85  ? 575  THR A C     1 
ATOM   3915  O O     . THR A  1 575 ? 0.559    -21.025 39.034  1.00 49.56  ? 575  THR A O     1 
ATOM   3916  C CB    . THR A  1 575 ? 1.139    -17.888 39.715  1.00 58.98  ? 575  THR A CB    1 
ATOM   3917  O OG1   . THR A  1 575 ? 1.012    -17.128 38.512  1.00 58.92  ? 575  THR A OG1   1 
ATOM   3918  C CG2   . THR A  1 575 ? 1.728    -17.011 40.844  1.00 60.39  ? 575  THR A CG2   1 
ATOM   3919  N N     . SER A  1 576 ? 1.502    -20.008 37.190  1.00 45.56  ? 576  SER A N     1 
ATOM   3920  C CA    . SER A  1 576 ? 0.949    -20.869 36.133  1.00 43.95  ? 576  SER A CA    1 
ATOM   3921  C C     . SER A  1 576 ? 1.515    -22.274 36.212  1.00 49.22  ? 576  SER A C     1 
ATOM   3922  O O     . SER A  1 576 ? 0.770    -23.245 36.076  1.00 48.89  ? 576  SER A O     1 
ATOM   3923  C CB    . SER A  1 576 ? 1.227    -20.277 34.758  1.00 45.77  ? 576  SER A CB    1 
ATOM   3924  O OG    . SER A  1 576 ? 0.425    -19.134 34.514  1.00 53.93  ? 576  SER A OG    1 
ATOM   3925  N N     . TYR A  1 577 ? 2.835    -22.385 36.435  1.00 47.79  ? 577  TYR A N     1 
ATOM   3926  C CA    . TYR A  1 577 ? 3.513    -23.667 36.540  1.00 48.86  ? 577  TYR A CA    1 
ATOM   3927  C C     . TYR A  1 577 ? 3.038    -24.401 37.767  1.00 54.92  ? 577  TYR A C     1 
ATOM   3928  O O     . TYR A  1 577 ? 2.760    -25.602 37.679  1.00 54.27  ? 577  TYR A O     1 
ATOM   3929  C CB    . TYR A  1 577 ? 5.040    -23.482 36.543  1.00 51.04  ? 577  TYR A CB    1 
ATOM   3930  C CG    . TYR A  1 577 ? 5.823    -24.779 36.537  1.00 53.44  ? 577  TYR A CG    1 
ATOM   3931  C CD1   . TYR A  1 577 ? 5.549    -25.780 35.607  1.00 55.58  ? 577  TYR A CD1   1 
ATOM   3932  C CD2   . TYR A  1 577 ? 6.878    -24.981 37.416  1.00 54.23  ? 577  TYR A CD2   1 
ATOM   3933  C CE1   . TYR A  1 577 ? 6.276    -26.968 35.588  1.00 57.06  ? 577  TYR A CE1   1 
ATOM   3934  C CE2   . TYR A  1 577 ? 7.617    -26.160 37.398  1.00 55.85  ? 577  TYR A CE2   1 
ATOM   3935  C CZ    . TYR A  1 577 ? 7.310    -27.154 36.486  1.00 63.75  ? 577  TYR A CZ    1 
ATOM   3936  O OH    . TYR A  1 577 ? 8.038    -28.318 36.452  1.00 67.80  ? 577  TYR A OH    1 
ATOM   3937  N N     . GLU A  1 578 ? 2.903    -23.655 38.904  1.00 52.99  ? 578  GLU A N     1 
ATOM   3938  C CA    . GLU A  1 578 ? 2.437    -24.162 40.202  1.00 53.24  ? 578  GLU A CA    1 
ATOM   3939  C C     . GLU A  1 578 ? 1.010    -24.726 40.064  1.00 56.53  ? 578  GLU A C     1 
ATOM   3940  O O     . GLU A  1 578 ? 0.715    -25.797 40.581  1.00 56.43  ? 578  GLU A O     1 
ATOM   3941  C CB    . GLU A  1 578 ? 2.512    -23.065 41.267  1.00 54.45  ? 578  GLU A CB    1 
ATOM   3942  N N     . ASN A  1 579 ? 0.168    -24.042 39.302  1.00 52.80  ? 579  ASN A N     1 
ATOM   3943  C CA    . ASN A  1 579 ? -1.209   -24.444 39.029  1.00 52.38  ? 579  ASN A CA    1 
ATOM   3944  C C     . ASN A  1 579 ? -1.307   -25.711 38.194  1.00 55.24  ? 579  ASN A C     1 
ATOM   3945  O O     . ASN A  1 579 ? -2.143   -26.567 38.491  1.00 55.34  ? 579  ASN A O     1 
ATOM   3946  C CB    . ASN A  1 579 ? -1.967   -23.301 38.356  1.00 54.33  ? 579  ASN A CB    1 
ATOM   3947  C CG    . ASN A  1 579 ? -2.682   -22.417 39.333  1.00 92.50  ? 579  ASN A CG    1 
ATOM   3948  O OD1   . ASN A  1 579 ? -3.765   -21.924 39.039  1.00 91.83  ? 579  ASN A OD1   1 
ATOM   3949  N ND2   . ASN A  1 579 ? -2.126   -22.225 40.537  1.00 87.02  ? 579  ASN A ND2   1 
ATOM   3950  N N     . PHE A  1 580 ? -0.459   -25.825 37.150  1.00 49.91  ? 580  PHE A N     1 
ATOM   3951  C CA    . PHE A  1 580 ? -0.422   -26.983 36.266  1.00 48.75  ? 580  PHE A CA    1 
ATOM   3952  C C     . PHE A  1 580 ? 0.027    -28.194 37.089  1.00 54.47  ? 580  PHE A C     1 
ATOM   3953  O O     . PHE A  1 580 ? -0.603   -29.250 37.030  1.00 55.68  ? 580  PHE A O     1 
ATOM   3954  C CB    . PHE A  1 580 ? 0.525    -26.731 35.075  1.00 49.99  ? 580  PHE A CB    1 
ATOM   3955  C CG    . PHE A  1 580 ? 0.720    -27.940 34.190  1.00 51.27  ? 580  PHE A CG    1 
ATOM   3956  C CD1   . PHE A  1 580 ? -0.218   -28.269 33.224  1.00 53.97  ? 580  PHE A CD1   1 
ATOM   3957  C CD2   . PHE A  1 580 ? 1.820    -28.774 34.354  1.00 53.96  ? 580  PHE A CD2   1 
ATOM   3958  C CE1   . PHE A  1 580 ? -0.054   -29.408 32.428  1.00 55.64  ? 580  PHE A CE1   1 
ATOM   3959  C CE2   . PHE A  1 580 ? 1.977    -29.920 33.574  1.00 57.41  ? 580  PHE A CE2   1 
ATOM   3960  C CZ    . PHE A  1 580 ? 1.048    -30.224 32.604  1.00 55.32  ? 580  PHE A CZ    1 
ATOM   3961  N N     . LEU A  1 581 ? 1.095    -28.021 37.883  1.00 49.59  ? 581  LEU A N     1 
ATOM   3962  C CA    . LEU A  1 581 ? 1.643    -29.055 38.748  1.00 49.04  ? 581  LEU A CA    1 
ATOM   3963  C C     . LEU A  1 581 ? 0.626    -29.526 39.802  1.00 50.61  ? 581  LEU A C     1 
ATOM   3964  O O     . LEU A  1 581 ? 0.500    -30.734 40.025  1.00 51.99  ? 581  LEU A O     1 
ATOM   3965  C CB    . LEU A  1 581 ? 2.947    -28.551 39.379  1.00 49.99  ? 581  LEU A CB    1 
ATOM   3966  C CG    . LEU A  1 581 ? 4.249    -29.195 38.869  1.00 56.91  ? 581  LEU A CG    1 
ATOM   3967  C CD1   . LEU A  1 581 ? 4.279    -29.324 37.347  1.00 57.46  ? 581  LEU A CD1   1 
ATOM   3968  C CD2   . LEU A  1 581 ? 5.470    -28.430 39.349  1.00 60.17  ? 581  LEU A CD2   1 
ATOM   3969  N N     . SER A  1 582 ? -0.148   -28.585 40.385  1.00 43.62  ? 582  SER A N     1 
ATOM   3970  C CA    . SER A  1 582 ? -1.190   -28.875 41.368  1.00 42.67  ? 582  SER A CA    1 
ATOM   3971  C C     . SER A  1 582 ? -2.229   -29.796 40.762  1.00 42.81  ? 582  SER A C     1 
ATOM   3972  O O     . SER A  1 582 ? -2.304   -30.964 41.169  1.00 43.16  ? 582  SER A O     1 
ATOM   3973  C CB    . SER A  1 582 ? -1.863   -27.591 41.834  1.00 49.33  ? 582  SER A CB    1 
ATOM   3974  O OG    . SER A  1 582 ? -0.928   -26.728 42.464  1.00 70.10  ? 582  SER A OG    1 
ATOM   3975  N N     . VAL A  1 583 ? -2.960   -29.303 39.719  1.00 33.83  ? 583  VAL A N     1 
ATOM   3976  C CA    . VAL A  1 583 ? -4.004   -30.046 39.014  1.00 30.98  ? 583  VAL A CA    1 
ATOM   3977  C C     . VAL A  1 583 ? -3.549   -31.429 38.568  1.00 38.50  ? 583  VAL A C     1 
ATOM   3978  O O     . VAL A  1 583 ? -4.269   -32.412 38.766  1.00 38.98  ? 583  VAL A O     1 
ATOM   3979  C CB    . VAL A  1 583 ? -4.688   -29.238 37.889  1.00 31.77  ? 583  VAL A CB    1 
ATOM   3980  C CG1   . VAL A  1 583 ? -5.845   -30.015 37.266  1.00 29.97  ? 583  VAL A CG1   1 
ATOM   3981  C CG2   . VAL A  1 583 ? -5.174   -27.881 38.398  1.00 30.92  ? 583  VAL A CG2   1 
ATOM   3982  N N     . SER A  1 584 ? -2.335   -31.521 38.023  1.00 39.02  ? 584  SER A N     1 
ATOM   3983  C CA    . SER A  1 584 ? -1.794   -32.802 37.566  1.00 41.34  ? 584  SER A CA    1 
ATOM   3984  C C     . SER A  1 584 ? -1.718   -33.804 38.735  1.00 48.01  ? 584  SER A C     1 
ATOM   3985  O O     . SER A  1 584 ? -2.206   -34.929 38.609  1.00 48.05  ? 584  SER A O     1 
ATOM   3986  C CB    . SER A  1 584 ? -0.437   -32.609 36.896  1.00 46.01  ? 584  SER A CB    1 
ATOM   3987  O OG    . SER A  1 584 ? -0.212   -33.623 35.927  1.00 57.30  ? 584  SER A OG    1 
ATOM   3988  N N     . LYS A  1 585 ? -1.222   -33.340 39.901  1.00 44.88  ? 585  LYS A N     1 
ATOM   3989  C CA    . LYS A  1 585 ? -1.073   -34.149 41.103  1.00 45.00  ? 585  LYS A CA    1 
ATOM   3990  C C     . LYS A  1 585 ? -2.362   -34.333 41.940  1.00 48.61  ? 585  LYS A C     1 
ATOM   3991  O O     . LYS A  1 585 ? -2.270   -34.912 43.013  1.00 50.12  ? 585  LYS A O     1 
ATOM   3992  C CB    . LYS A  1 585 ? 0.092    -33.607 41.951  1.00 47.37  ? 585  LYS A CB    1 
ATOM   3993  N N     . TYR A  1 586 ? -3.556   -33.877 41.476  1.00 43.17  ? 586  TYR A N     1 
ATOM   3994  C CA    . TYR A  1 586 ? -4.810   -34.063 42.255  1.00 41.99  ? 586  TYR A CA    1 
ATOM   3995  C C     . TYR A  1 586 ? -5.179   -35.548 42.413  1.00 52.16  ? 586  TYR A C     1 
ATOM   3996  O O     . TYR A  1 586 ? -5.775   -35.924 43.417  1.00 54.16  ? 586  TYR A O     1 
ATOM   3997  C CB    . TYR A  1 586 ? -6.009   -33.288 41.657  1.00 38.79  ? 586  TYR A CB    1 
ATOM   3998  C CG    . TYR A  1 586 ? -6.005   -31.777 41.812  1.00 34.93  ? 586  TYR A CG    1 
ATOM   3999  C CD1   . TYR A  1 586 ? -5.175   -31.150 42.737  1.00 37.26  ? 586  TYR A CD1   1 
ATOM   4000  C CD2   . TYR A  1 586 ? -6.872   -30.979 41.069  1.00 32.21  ? 586  TYR A CD2   1 
ATOM   4001  C CE1   . TYR A  1 586 ? -5.147   -29.762 42.861  1.00 37.43  ? 586  TYR A CE1   1 
ATOM   4002  C CE2   . TYR A  1 586 ? -6.867   -29.594 41.194  1.00 31.98  ? 586  TYR A CE2   1 
ATOM   4003  C CZ    . TYR A  1 586 ? -6.002   -28.985 42.091  1.00 43.17  ? 586  TYR A CZ    1 
ATOM   4004  O OH    . TYR A  1 586 ? -6.008   -27.611 42.215  1.00 42.81  ? 586  TYR A OH    1 
ATOM   4005  N N     . ASP A  1 587 ? -4.796   -36.386 41.434  1.00 51.23  ? 587  ASP A N     1 
ATOM   4006  C CA    . ASP A  1 587 ? -5.025   -37.837 41.415  1.00 52.41  ? 587  ASP A CA    1 
ATOM   4007  C C     . ASP A  1 587 ? -4.193   -38.585 42.458  1.00 56.83  ? 587  ASP A C     1 
ATOM   4008  O O     . ASP A  1 587 ? -4.524   -39.729 42.755  1.00 58.94  ? 587  ASP A O     1 
ATOM   4009  C CB    . ASP A  1 587 ? -4.673   -38.418 40.034  1.00 54.45  ? 587  ASP A CB    1 
ATOM   4010  C CG    . ASP A  1 587 ? -5.410   -37.818 38.873  1.00 66.89  ? 587  ASP A CG    1 
ATOM   4011  O OD1   . ASP A  1 587 ? -5.945   -38.586 38.065  1.00 69.98  ? 587  ASP A OD1   1 
ATOM   4012  O OD2   . ASP A  1 587 ? -5.399   -36.571 38.738  1.00 72.13  ? 587  ASP A OD2   1 
ATOM   4013  N N     . ASP A  1 588 ? -3.087   -37.984 42.954  1.00 51.87  ? 588  ASP A N     1 
ATOM   4014  C CA    . ASP A  1 588 ? -2.175   -38.579 43.941  1.00 52.94  ? 588  ASP A CA    1 
ATOM   4015  C C     . ASP A  1 588 ? -2.881   -39.156 45.146  1.00 59.51  ? 588  ASP A C     1 
ATOM   4016  O O     . ASP A  1 588 ? -2.629   -40.304 45.535  1.00 59.77  ? 588  ASP A O     1 
ATOM   4017  C CB    . ASP A  1 588 ? -1.224   -37.517 44.500  1.00 54.50  ? 588  ASP A CB    1 
ATOM   4018  C CG    . ASP A  1 588 ? -0.043   -37.136 43.656  1.00 73.71  ? 588  ASP A CG    1 
ATOM   4019  O OD1   . ASP A  1 588 ? 0.228    -37.843 42.647  1.00 75.11  ? 588  ASP A OD1   1 
ATOM   4020  O OD2   . ASP A  1 588 ? 0.653    -36.167 44.028  1.00 85.84  ? 588  ASP A OD2   1 
ATOM   4021  N N     . GLY A  1 589 ? -3.727   -38.316 45.743  1.00 57.04  ? 589  GLY A N     1 
ATOM   4022  C CA    . GLY A  1 589 ? -4.412   -38.578 46.997  1.00 57.68  ? 589  GLY A CA    1 
ATOM   4023  C C     . GLY A  1 589 ? -3.617   -37.898 48.095  1.00 61.19  ? 589  GLY A C     1 
ATOM   4024  O O     . GLY A  1 589 ? -3.878   -38.093 49.283  1.00 62.45  ? 589  GLY A O     1 
ATOM   4025  N N     . SER A  1 590 ? -2.613   -37.099 47.688  1.00 54.75  ? 590  SER A N     1 
ATOM   4026  C CA    . SER A  1 590 ? -1.771   -36.330 48.579  1.00 54.18  ? 590  SER A CA    1 
ATOM   4027  C C     . SER A  1 590 ? -2.553   -35.142 49.109  1.00 56.92  ? 590  SER A C     1 
ATOM   4028  O O     . SER A  1 590 ? -2.250   -34.656 50.197  1.00 57.34  ? 590  SER A O     1 
ATOM   4029  C CB    . SER A  1 590 ? -0.509   -35.869 47.856  1.00 57.79  ? 590  SER A CB    1 
ATOM   4030  O OG    . SER A  1 590 ? -0.793   -35.200 46.638  1.00 67.50  ? 590  SER A OG    1 
ATOM   4031  N N     . TYR A  1 591 ? -3.586   -34.703 48.359  1.00 52.73  ? 591  TYR A N     1 
ATOM   4032  C CA    . TYR A  1 591 ? -4.448   -33.576 48.703  1.00 52.10  ? 591  TYR A CA    1 
ATOM   4033  C C     . TYR A  1 591 ? -5.534   -33.929 49.728  1.00 54.64  ? 591  TYR A C     1 
ATOM   4034  O O     . TYR A  1 591 ? -6.120   -33.028 50.346  1.00 54.18  ? 591  TYR A O     1 
ATOM   4035  C CB    . TYR A  1 591 ? -5.061   -33.005 47.434  1.00 53.11  ? 591  TYR A CB    1 
ATOM   4036  C CG    . TYR A  1 591 ? -4.059   -32.245 46.597  1.00 56.98  ? 591  TYR A CG    1 
ATOM   4037  C CD1   . TYR A  1 591 ? -3.303   -32.891 45.618  1.00 59.55  ? 591  TYR A CD1   1 
ATOM   4038  C CD2   . TYR A  1 591 ? -3.876   -30.875 46.770  1.00 57.91  ? 591  TYR A CD2   1 
ATOM   4039  C CE1   . TYR A  1 591 ? -2.376   -32.194 44.844  1.00 62.11  ? 591  TYR A CE1   1 
ATOM   4040  C CE2   . TYR A  1 591 ? -2.958   -30.163 45.997  1.00 59.10  ? 591  TYR A CE2   1 
ATOM   4041  C CZ    . TYR A  1 591 ? -2.207   -30.826 45.036  1.00 72.16  ? 591  TYR A CZ    1 
ATOM   4042  O OH    . TYR A  1 591 ? -1.287   -30.128 44.281  1.00 77.28  ? 591  TYR A OH    1 
ATOM   4043  N N     . LEU A  1 592 ? -5.767   -35.244 49.914  1.00 49.63  ? 592  LEU A N     1 
ATOM   4044  C CA    . LEU A  1 592 ? -6.726   -35.869 50.816  1.00 49.72  ? 592  LEU A CA    1 
ATOM   4045  C C     . LEU A  1 592 ? -6.581   -35.387 52.250  1.00 57.85  ? 592  LEU A C     1 
ATOM   4046  O O     . LEU A  1 592 ? -5.459   -35.351 52.784  1.00 61.26  ? 592  LEU A O     1 
ATOM   4047  C CB    . LEU A  1 592 ? -6.488   -37.376 50.755  1.00 50.83  ? 592  LEU A CB    1 
ATOM   4048  C CG    . LEU A  1 592 ? -7.673   -38.309 50.799  1.00 56.16  ? 592  LEU A CG    1 
ATOM   4049  C CD1   . LEU A  1 592 ? -7.998   -38.733 52.215  1.00 56.88  ? 592  LEU A CD1   1 
ATOM   4050  C CD2   . LEU A  1 592 ? -8.858   -37.781 49.965  1.00 60.32  ? 592  LEU A CD2   1 
ATOM   4051  N N     . VAL A  1 593 ? -7.720   -35.015 52.876  1.00 53.34  ? 593  VAL A N     1 
ATOM   4052  C CA    . VAL A  1 593 ? -7.799   -34.480 54.254  1.00 53.08  ? 593  VAL A CA    1 
ATOM   4053  C C     . VAL A  1 593 ? -8.556   -35.435 55.192  1.00 58.57  ? 593  VAL A C     1 
ATOM   4054  O O     . VAL A  1 593 ? -9.407   -36.172 54.685  1.00 57.30  ? 593  VAL A O     1 
ATOM   4055  C CB    . VAL A  1 593 ? -8.360   -33.014 54.301  1.00 54.44  ? 593  VAL A CB    1 
ATOM   4056  C CG1   . VAL A  1 593 ? -7.657   -32.106 53.290  1.00 52.64  ? 593  VAL A CG1   1 
ATOM   4057  C CG2   . VAL A  1 593 ? -9.873   -32.960 54.113  1.00 53.14  ? 593  VAL A CG2   1 
ATOM   4058  N N     . PRO A  1 594 ? -8.305   -35.435 56.539  1.00 58.60  ? 594  PRO A N     1 
ATOM   4059  C CA    . PRO A  1 594 ? -9.049   -36.356 57.441  1.00 60.27  ? 594  PRO A CA    1 
ATOM   4060  C C     . PRO A  1 594 ? -10.573  -36.370 57.281  1.00 66.18  ? 594  PRO A C     1 
ATOM   4061  O O     . PRO A  1 594 ? -11.170  -35.334 56.958  1.00 65.23  ? 594  PRO A O     1 
ATOM   4062  C CB    . PRO A  1 594 ? -8.658   -35.883 58.848  1.00 62.59  ? 594  PRO A CB    1 
ATOM   4063  C CG    . PRO A  1 594 ? -7.946   -34.584 58.664  1.00 65.65  ? 594  PRO A CG    1 
ATOM   4064  C CD    . PRO A  1 594 ? -7.321   -34.646 57.309  1.00 60.31  ? 594  PRO A CD    1 
ATOM   4065  N N     . GLU A  1 595 ? -11.189  -37.550 57.505  1.00 63.83  ? 595  GLU A N     1 
ATOM   4066  C CA    . GLU A  1 595 ? -12.634  -37.795 57.390  1.00 63.64  ? 595  GLU A CA    1 
ATOM   4067  C C     . GLU A  1 595 ? -13.503  -36.719 58.027  1.00 64.59  ? 595  GLU A C     1 
ATOM   4068  O O     . GLU A  1 595 ? -14.460  -36.264 57.403  1.00 63.33  ? 595  GLU A O     1 
ATOM   4069  C CB    . GLU A  1 595 ? -13.012  -39.197 57.896  1.00 67.21  ? 595  GLU A CB    1 
ATOM   4070  C CG    . GLU A  1 595 ? -12.960  -40.273 56.816  1.00 85.14  ? 595  GLU A CG    1 
ATOM   4071  C CD    . GLU A  1 595 ? -12.264  -41.571 57.214  1.00 127.19 ? 595  GLU A CD    1 
ATOM   4072  O OE1   . GLU A  1 595 ? -12.782  -42.283 58.109  1.00 135.71 ? 595  GLU A OE1   1 
ATOM   4073  O OE2   . GLU A  1 595 ? -11.207  -41.886 56.616  1.00 123.37 ? 595  GLU A OE2   1 
ATOM   4074  N N     . SER A  1 596 ? -13.137  -36.285 59.239  1.00 60.38  ? 596  SER A N     1 
ATOM   4075  C CA    . SER A  1 596 ? -13.806  -35.233 59.995  1.00 59.82  ? 596  SER A CA    1 
ATOM   4076  C C     . SER A  1 596 ? -13.779  -33.899 59.239  1.00 62.22  ? 596  SER A C     1 
ATOM   4077  O O     . SER A  1 596 ? -14.793  -33.194 59.211  1.00 62.29  ? 596  SER A O     1 
ATOM   4078  C CB    . SER A  1 596 ? -13.160  -35.075 61.370  1.00 65.89  ? 596  SER A CB    1 
ATOM   4079  O OG    . SER A  1 596 ? -11.792  -35.467 61.392  1.00 78.42  ? 596  SER A OG    1 
ATOM   4080  N N     . SER A  1 597 ? -12.643  -33.587 58.579  1.00 56.41  ? 597  SER A N     1 
ATOM   4081  C CA    . SER A  1 597 ? -12.443  -32.357 57.824  1.00 53.79  ? 597  SER A CA    1 
ATOM   4082  C C     . SER A  1 597 ? -13.088  -32.325 56.422  1.00 55.93  ? 597  SER A C     1 
ATOM   4083  O O     . SER A  1 597 ? -13.027  -31.290 55.754  1.00 55.42  ? 597  SER A O     1 
ATOM   4084  C CB    . SER A  1 597 ? -10.959  -32.022 57.762  1.00 56.90  ? 597  SER A CB    1 
ATOM   4085  O OG    . SER A  1 597 ? -10.494  -31.612 59.037  1.00 69.06  ? 597  SER A OG    1 
ATOM   4086  N N     . ARG A  1 598 ? -13.719  -33.423 55.976  1.00 50.76  ? 598  ARG A N     1 
ATOM   4087  C CA    . ARG A  1 598 ? -14.356  -33.472 54.648  1.00 47.92  ? 598  ARG A CA    1 
ATOM   4088  C C     . ARG A  1 598 ? -15.692  -32.719 54.656  1.00 47.79  ? 598  ARG A C     1 
ATOM   4089  O O     . ARG A  1 598 ? -16.409  -32.770 55.661  1.00 49.23  ? 598  ARG A O     1 
ATOM   4090  C CB    . ARG A  1 598 ? -14.516  -34.916 54.159  1.00 48.23  ? 598  ARG A CB    1 
ATOM   4091  C CG    . ARG A  1 598 ? -13.204  -35.672 54.002  1.00 54.81  ? 598  ARG A CG    1 
ATOM   4092  C CD    . ARG A  1 598 ? -13.481  -37.066 53.470  1.00 60.86  ? 598  ARG A CD    1 
ATOM   4093  N NE    . ARG A  1 598 ? -12.653  -38.097 54.100  1.00 66.26  ? 598  ARG A NE    1 
ATOM   4094  C CZ    . ARG A  1 598 ? -11.398  -38.354 53.756  1.00 75.13  ? 598  ARG A CZ    1 
ATOM   4095  N NH1   . ARG A  1 598 ? -10.803  -37.642 52.812  1.00 62.50  ? 598  ARG A NH1   1 
ATOM   4096  N NH2   . ARG A  1 598 ? -10.719  -39.305 54.377  1.00 60.89  ? 598  ARG A NH2   1 
ATOM   4097  N N     . LEU A  1 599 ? -15.996  -31.984 53.561  1.00 38.87  ? 599  LEU A N     1 
ATOM   4098  C CA    . LEU A  1 599 ? -17.165  -31.102 53.447  1.00 36.11  ? 599  LEU A CA    1 
ATOM   4099  C C     . LEU A  1 599 ? -17.973  -31.398 52.233  1.00 41.22  ? 599  LEU A C     1 
ATOM   4100  O O     . LEU A  1 599 ? -17.501  -32.108 51.357  1.00 42.70  ? 599  LEU A O     1 
ATOM   4101  C CB    . LEU A  1 599 ? -16.742  -29.617 53.356  1.00 34.14  ? 599  LEU A CB    1 
ATOM   4102  C CG    . LEU A  1 599 ? -15.487  -29.137 54.067  1.00 36.93  ? 599  LEU A CG    1 
ATOM   4103  C CD1   . LEU A  1 599 ? -14.874  -27.950 53.346  1.00 35.66  ? 599  LEU A CD1   1 
ATOM   4104  C CD2   . LEU A  1 599 ? -15.762  -28.826 55.496  1.00 36.72  ? 599  LEU A CD2   1 
ATOM   4105  N N     . ASN A  1 600 ? -19.177  -30.791 52.146  1.00 37.20  ? 600  ASN A N     1 
ATOM   4106  C CA    . ASN A  1 600 ? -20.100  -30.891 51.016  1.00 36.41  ? 600  ASN A CA    1 
ATOM   4107  C C     . ASN A  1 600 ? -20.139  -29.530 50.345  1.00 40.06  ? 600  ASN A C     1 
ATOM   4108  O O     . ASN A  1 600 ? -20.653  -28.556 50.925  1.00 39.07  ? 600  ASN A O     1 
ATOM   4109  C CB    . ASN A  1 600 ? -21.484  -31.301 51.483  1.00 37.22  ? 600  ASN A CB    1 
ATOM   4110  C CG    . ASN A  1 600 ? -21.579  -32.748 51.863  1.00 53.51  ? 600  ASN A CG    1 
ATOM   4111  O OD1   . ASN A  1 600 ? -20.615  -33.529 51.767  1.00 42.60  ? 600  ASN A OD1   1 
ATOM   4112  N ND2   . ASN A  1 600 ? -22.762  -33.142 52.288  1.00 47.84  ? 600  ASN A ND2   1 
ATOM   4113  N N     . ILE A  1 601 ? -19.527  -29.456 49.134  1.00 34.36  ? 601  ILE A N     1 
ATOM   4114  C CA    . ILE A  1 601 ? -19.359  -28.211 48.373  1.00 30.46  ? 601  ILE A CA    1 
ATOM   4115  C C     . ILE A  1 601 ? -20.400  -28.054 47.281  1.00 33.62  ? 601  ILE A C     1 
ATOM   4116  O O     . ILE A  1 601 ? -20.645  -28.999 46.544  1.00 35.54  ? 601  ILE A O     1 
ATOM   4117  C CB    . ILE A  1 601 ? -17.884  -28.021 47.917  1.00 30.58  ? 601  ILE A CB    1 
ATOM   4118  C CG1   . ILE A  1 601 ? -16.875  -28.087 49.095  1.00 29.32  ? 601  ILE A CG1   1 
ATOM   4119  C CG2   . ILE A  1 601 ? -17.690  -26.773 47.106  1.00 30.92  ? 601  ILE A CG2   1 
ATOM   4120  C CD1   . ILE A  1 601 ? -17.137  -27.213 50.354  1.00 21.77  ? 601  ILE A CD1   1 
ATOM   4121  N N     . ALA A  1 602 ? -21.041  -26.880 47.210  1.00 27.64  ? 602  ALA A N     1 
ATOM   4122  C CA    . ALA A  1 602 ? -22.059  -26.628 46.214  1.00 26.75  ? 602  ALA A CA    1 
ATOM   4123  C C     . ALA A  1 602 ? -21.555  -25.644 45.156  1.00 30.71  ? 602  ALA A C     1 
ATOM   4124  O O     . ALA A  1 602 ? -20.898  -24.655 45.506  1.00 33.67  ? 602  ALA A O     1 
ATOM   4125  C CB    . ALA A  1 602 ? -23.317  -26.101 46.882  1.00 27.80  ? 602  ALA A CB    1 
ATOM   4126  N N     . ILE A  1 603 ? -21.830  -25.930 43.872  1.00 22.61  ? 603  ILE A N     1 
ATOM   4127  C CA    . ILE A  1 603 ? -21.474  -25.067 42.766  1.00 22.01  ? 603  ILE A CA    1 
ATOM   4128  C C     . ILE A  1 603 ? -22.771  -24.721 42.034  1.00 32.41  ? 603  ILE A C     1 
ATOM   4129  O O     . ILE A  1 603 ? -23.571  -25.619 41.719  1.00 35.71  ? 603  ILE A O     1 
ATOM   4130  C CB    . ILE A  1 603 ? -20.396  -25.670 41.819  1.00 24.77  ? 603  ILE A CB    1 
ATOM   4131  C CG1   . ILE A  1 603 ? -19.122  -26.099 42.588  1.00 26.30  ? 603  ILE A CG1   1 
ATOM   4132  C CG2   . ILE A  1 603 ? -20.031  -24.671 40.677  1.00 23.75  ? 603  ILE A CG2   1 
ATOM   4133  C CD1   . ILE A  1 603 ? -18.012  -26.817 41.715  1.00 36.71  ? 603  ILE A CD1   1 
ATOM   4134  N N     . ILE A  1 604 ? -22.978  -23.421 41.765  1.00 27.21  ? 604  ILE A N     1 
ATOM   4135  C CA    . ILE A  1 604 ? -24.155  -22.920 41.079  1.00 25.47  ? 604  ILE A CA    1 
ATOM   4136  C C     . ILE A  1 604 ? -23.740  -21.916 39.987  1.00 30.08  ? 604  ILE A C     1 
ATOM   4137  O O     . ILE A  1 604 ? -22.770  -21.177 40.154  1.00 26.73  ? 604  ILE A O     1 
ATOM   4138  C CB    . ILE A  1 604 ? -25.207  -22.379 42.089  1.00 28.35  ? 604  ILE A CB    1 
ATOM   4139  C CG1   . ILE A  1 604 ? -26.579  -22.154 41.444  1.00 29.23  ? 604  ILE A CG1   1 
ATOM   4140  C CG2   . ILE A  1 604 ? -24.727  -21.137 42.810  1.00 28.80  ? 604  ILE A CG2   1 
ATOM   4141  C CD1   . ILE A  1 604 ? -27.746  -21.970 42.435  1.00 34.24  ? 604  ILE A CD1   1 
ATOM   4142  N N     . HIS A  1 605 ? -24.460  -21.940 38.841  1.00 30.95  ? 605  HIS A N     1 
ATOM   4143  C CA    . HIS A  1 605 ? -24.215  -21.039 37.725  1.00 30.14  ? 605  HIS A CA    1 
ATOM   4144  C C     . HIS A  1 605 ? -25.351  -20.026 37.671  1.00 37.68  ? 605  HIS A C     1 
ATOM   4145  O O     . HIS A  1 605 ? -26.481  -20.371 37.285  1.00 39.58  ? 605  HIS A O     1 
ATOM   4146  C CB    . HIS A  1 605 ? -24.033  -21.804 36.411  1.00 29.60  ? 605  HIS A CB    1 
ATOM   4147  C CG    . HIS A  1 605 ? -22.840  -22.708 36.387  1.00 32.77  ? 605  HIS A CG    1 
ATOM   4148  N ND1   . HIS A  1 605 ? -22.670  -23.651 35.382  1.00 34.50  ? 605  HIS A ND1   1 
ATOM   4149  C CD2   . HIS A  1 605 ? -21.799  -22.797 37.242  1.00 34.13  ? 605  HIS A CD2   1 
ATOM   4150  C CE1   . HIS A  1 605 ? -21.550  -24.288 35.666  1.00 33.52  ? 605  HIS A CE1   1 
ATOM   4151  N NE2   . HIS A  1 605 ? -20.999  -23.820 36.785  1.00 34.11  ? 605  HIS A NE2   1 
ATOM   4152  N N     . VAL A  1 606 ? -25.062  -18.787 38.134  1.00 33.41  ? 606  VAL A N     1 
ATOM   4153  C CA    . VAL A  1 606 ? -26.029  -17.696 38.165  1.00 33.38  ? 606  VAL A CA    1 
ATOM   4154  C C     . VAL A  1 606 ? -25.703  -16.608 37.111  1.00 36.02  ? 606  VAL A C     1 
ATOM   4155  O O     . VAL A  1 606 ? -24.695  -15.918 37.217  1.00 36.41  ? 606  VAL A O     1 
ATOM   4156  C CB    . VAL A  1 606 ? -26.282  -17.129 39.582  1.00 38.42  ? 606  VAL A CB    1 
ATOM   4157  C CG1   . VAL A  1 606 ? -27.339  -16.024 39.549  1.00 38.58  ? 606  VAL A CG1   1 
ATOM   4158  C CG2   . VAL A  1 606 ? -26.727  -18.231 40.531  1.00 39.19  ? 606  VAL A CG2   1 
ATOM   4159  N N     . GLY A  1 607 ? -26.582  -16.467 36.128  1.00 29.75  ? 607  GLY A N     1 
ATOM   4160  C CA    . GLY A  1 607 ? -26.436  -15.486 35.070  1.00 29.14  ? 607  GLY A CA    1 
ATOM   4161  C C     . GLY A  1 607 ? -26.537  -16.076 33.683  1.00 33.64  ? 607  GLY A C     1 
ATOM   4162  O O     . GLY A  1 607 ? -26.740  -17.278 33.551  1.00 36.40  ? 607  GLY A O     1 
ATOM   4163  N N     . ALA A  1 608 ? -26.387  -15.239 32.636  1.00 27.20  ? 608  ALA A N     1 
ATOM   4164  C CA    . ALA A  1 608 ? -26.390  -15.635 31.225  1.00 25.60  ? 608  ALA A CA    1 
ATOM   4165  C C     . ALA A  1 608 ? -25.144  -16.506 30.920  1.00 30.29  ? 608  ALA A C     1 
ATOM   4166  O O     . ALA A  1 608 ? -24.128  -16.426 31.635  1.00 32.88  ? 608  ALA A O     1 
ATOM   4167  C CB    . ALA A  1 608 ? -26.381  -14.393 30.347  1.00 26.07  ? 608  ALA A CB    1 
ATOM   4168  N N     . PRO A  1 609 ? -25.180  -17.340 29.866  1.00 24.72  ? 609  PRO A N     1 
ATOM   4169  C CA    . PRO A  1 609 ? -24.035  -18.231 29.605  1.00 23.68  ? 609  PRO A CA    1 
ATOM   4170  C C     . PRO A  1 609 ? -22.779  -17.570 29.098  1.00 27.43  ? 609  PRO A C     1 
ATOM   4171  O O     . PRO A  1 609 ? -22.841  -16.570 28.407  1.00 24.11  ? 609  PRO A O     1 
ATOM   4172  C CB    . PRO A  1 609 ? -24.571  -19.211 28.562  1.00 25.32  ? 609  PRO A CB    1 
ATOM   4173  C CG    . PRO A  1 609 ? -26.070  -19.043 28.560  1.00 30.07  ? 609  PRO A CG    1 
ATOM   4174  C CD    . PRO A  1 609 ? -26.307  -17.627 28.957  1.00 26.15  ? 609  PRO A CD    1 
ATOM   4175  N N     . THR A  1 610 ? -21.636  -18.154 29.464  1.00 29.12  ? 610  THR A N     1 
ATOM   4176  C CA    . THR A  1 610 ? -20.277  -17.822 29.006  1.00 30.39  ? 610  THR A CA    1 
ATOM   4177  C C     . THR A  1 610 ? -19.575  -19.154 28.759  1.00 35.38  ? 610  THR A C     1 
ATOM   4178  O O     . THR A  1 610 ? -19.891  -20.151 29.420  1.00 36.41  ? 610  THR A O     1 
ATOM   4179  C CB    . THR A  1 610 ? -19.500  -16.954 29.988  1.00 47.42  ? 610  THR A CB    1 
ATOM   4180  O OG1   . THR A  1 610 ? -19.617  -17.505 31.298  1.00 49.99  ? 610  THR A OG1   1 
ATOM   4181  C CG2   . THR A  1 610 ? -19.955  -15.492 29.972  1.00 55.19  ? 610  THR A CG2   1 
ATOM   4182  N N     . SER A  1 611 ? -18.659  -19.194 27.796  1.00 30.30  ? 611  SER A N     1 
ATOM   4183  C CA    . SER A  1 611 ? -17.943  -20.415 27.469  1.00 29.86  ? 611  SER A CA    1 
ATOM   4184  C C     . SER A  1 611 ? -17.039  -20.851 28.641  1.00 32.05  ? 611  SER A C     1 
ATOM   4185  O O     . SER A  1 611 ? -16.782  -22.033 28.812  1.00 32.10  ? 611  SER A O     1 
ATOM   4186  C CB    . SER A  1 611 ? -17.137  -20.213 26.195  1.00 35.07  ? 611  SER A CB    1 
ATOM   4187  O OG    . SER A  1 611 ? -16.381  -19.019 26.335  1.00 50.12  ? 611  SER A OG    1 
ATOM   4188  N N     . ALA A  1 612 ? -16.626  -19.893 29.465  1.00 28.41  ? 612  ALA A N     1 
ATOM   4189  C CA    . ALA A  1 612 ? -15.771  -20.048 30.646  1.00 29.13  ? 612  ALA A CA    1 
ATOM   4190  C C     . ALA A  1 612 ? -16.378  -20.821 31.830  1.00 34.47  ? 612  ALA A C     1 
ATOM   4191  O O     . ALA A  1 612 ? -15.630  -21.187 32.741  1.00 34.98  ? 612  ALA A O     1 
ATOM   4192  C CB    . ALA A  1 612 ? -15.308  -18.679 31.121  1.00 29.80  ? 612  ALA A CB    1 
ATOM   4193  N N     . LEU A  1 613 ? -17.706  -21.053 31.839  1.00 30.97  ? 613  LEU A N     1 
ATOM   4194  C CA    . LEU A  1 613 ? -18.371  -21.751 32.937  1.00 31.58  ? 613  LEU A CA    1 
ATOM   4195  C C     . LEU A  1 613 ? -17.900  -23.200 33.153  1.00 36.98  ? 613  LEU A C     1 
ATOM   4196  O O     . LEU A  1 613 ? -17.528  -23.515 34.279  1.00 36.00  ? 613  LEU A O     1 
ATOM   4197  C CB    . LEU A  1 613 ? -19.895  -21.690 32.823  1.00 31.90  ? 613  LEU A CB    1 
ATOM   4198  C CG    . LEU A  1 613 ? -20.582  -20.356 33.059  1.00 37.52  ? 613  LEU A CG    1 
ATOM   4199  C CD1   . LEU A  1 613 ? -22.017  -20.388 32.535  1.00 38.40  ? 613  LEU A CD1   1 
ATOM   4200  C CD2   . LEU A  1 613 ? -20.633  -20.025 34.508  1.00 41.21  ? 613  LEU A CD2   1 
ATOM   4201  N N     . ASN A  1 614 ? -17.937  -24.084 32.113  1.00 35.90  ? 614  ASN A N     1 
ATOM   4202  C CA    . ASN A  1 614 ? -17.510  -25.484 32.305  1.00 36.74  ? 614  ASN A CA    1 
ATOM   4203  C C     . ASN A  1 614 ? -16.050  -25.648 32.714  1.00 44.43  ? 614  ASN A C     1 
ATOM   4204  O O     . ASN A  1 614 ? -15.821  -26.297 33.750  1.00 45.74  ? 614  ASN A O     1 
ATOM   4205  C CB    . ASN A  1 614 ? -17.968  -26.458 31.213  1.00 31.89  ? 614  ASN A CB    1 
ATOM   4206  C CG    . ASN A  1 614 ? -19.472  -26.654 31.201  1.00 62.55  ? 614  ASN A CG    1 
ATOM   4207  O OD1   . ASN A  1 614 ? -20.143  -26.716 32.248  1.00 60.54  ? 614  ASN A OD1   1 
ATOM   4208  N ND2   . ASN A  1 614 ? -20.045  -26.736 30.010  1.00 58.85  ? 614  ASN A ND2   1 
ATOM   4209  N N     . PRO A  1 615 ? -15.056  -24.978 32.044  1.00 40.11  ? 615  PRO A N     1 
ATOM   4210  C CA    . PRO A  1 615 ? -13.656  -25.094 32.513  1.00 39.63  ? 615  PRO A CA    1 
ATOM   4211  C C     . PRO A  1 615 ? -13.463  -24.718 33.984  1.00 39.04  ? 615  PRO A C     1 
ATOM   4212  O O     . PRO A  1 615 ? -12.822  -25.472 34.707  1.00 40.07  ? 615  PRO A O     1 
ATOM   4213  C CB    . PRO A  1 615 ? -12.873  -24.177 31.560  1.00 40.85  ? 615  PRO A CB    1 
ATOM   4214  C CG    . PRO A  1 615 ? -13.879  -23.375 30.873  1.00 44.05  ? 615  PRO A CG    1 
ATOM   4215  C CD    . PRO A  1 615 ? -15.125  -24.163 30.816  1.00 39.79  ? 615  PRO A CD    1 
ATOM   4216  N N     . ALA A  1 616 ? -14.070  -23.604 34.431  1.00 30.60  ? 616  ALA A N     1 
ATOM   4217  C CA    . ALA A  1 616 ? -14.017  -23.146 35.822  1.00 28.74  ? 616  ALA A CA    1 
ATOM   4218  C C     . ALA A  1 616 ? -14.599  -24.200 36.793  1.00 31.19  ? 616  ALA A C     1 
ATOM   4219  O O     . ALA A  1 616 ? -13.975  -24.487 37.818  1.00 33.28  ? 616  ALA A O     1 
ATOM   4220  C CB    . ALA A  1 616 ? -14.752  -21.824 35.969  1.00 28.63  ? 616  ALA A CB    1 
ATOM   4221  N N     . THR A  1 617 ? -15.767  -24.794 36.463  1.00 24.14  ? 617  THR A N     1 
ATOM   4222  C CA    . THR A  1 617 ? -16.457  -25.811 37.273  1.00 22.88  ? 617  THR A CA    1 
ATOM   4223  C C     . THR A  1 617 ? -15.649  -27.082 37.348  1.00 25.75  ? 617  THR A C     1 
ATOM   4224  O O     . THR A  1 617 ? -15.636  -27.739 38.379  1.00 24.61  ? 617  THR A O     1 
ATOM   4225  C CB    . THR A  1 617 ? -17.861  -26.071 36.735  1.00 25.52  ? 617  THR A CB    1 
ATOM   4226  O OG1   . THR A  1 617 ? -18.490  -24.806 36.552  1.00 27.04  ? 617  THR A OG1   1 
ATOM   4227  C CG2   . THR A  1 617 ? -18.709  -26.951 37.676  1.00 18.28  ? 617  THR A CG2   1 
ATOM   4228  N N     . ARG A  1 618 ? -14.978  -27.427 36.245  1.00 23.59  ? 618  ARG A N     1 
ATOM   4229  C CA    . ARG A  1 618 ? -14.113  -28.593 36.150  1.00 23.78  ? 618  ARG A CA    1 
ATOM   4230  C C     . ARG A  1 618 ? -13.016  -28.488 37.223  1.00 25.55  ? 618  ARG A C     1 
ATOM   4231  O O     . ARG A  1 618 ? -13.031  -29.289 38.152  1.00 23.85  ? 618  ARG A O     1 
ATOM   4232  C CB    . ARG A  1 618 ? -13.519  -28.715 34.721  1.00 26.80  ? 618  ARG A CB    1 
ATOM   4233  C CG    . ARG A  1 618 ? -12.598  -29.929 34.515  1.00 42.29  ? 618  ARG A CG    1 
ATOM   4234  C CD    . ARG A  1 618 ? -12.117  -30.067 33.086  1.00 51.78  ? 618  ARG A CD    1 
ATOM   4235  N NE    . ARG A  1 618 ? -10.804  -30.709 33.036  1.00 66.90  ? 618  ARG A NE    1 
ATOM   4236  C CZ    . ARG A  1 618 ? -9.645   -30.054 33.103  1.00 87.49  ? 618  ARG A CZ    1 
ATOM   4237  N NH1   . ARG A  1 618 ? -9.627   -28.729 33.220  1.00 76.71  ? 618  ARG A NH1   1 
ATOM   4238  N NH2   . ARG A  1 618 ? -8.496   -30.719 33.059  1.00 74.42  ? 618  ARG A NH2   1 
ATOM   4239  N N     . VAL A  1 619 ? -12.148  -27.443 37.139  1.00 22.89  ? 619  VAL A N     1 
ATOM   4240  C CA    . VAL A  1 619 ? -11.030  -27.191 38.046  1.00 24.92  ? 619  VAL A CA    1 
ATOM   4241  C C     . VAL A  1 619 ? -11.489  -27.152 39.509  1.00 34.02  ? 619  VAL A C     1 
ATOM   4242  O O     . VAL A  1 619 ? -10.850  -27.786 40.356  1.00 36.66  ? 619  VAL A O     1 
ATOM   4243  C CB    . VAL A  1 619 ? -10.169  -25.972 37.629  1.00 28.65  ? 619  VAL A CB    1 
ATOM   4244  C CG1   . VAL A  1 619 ? -8.982   -25.769 38.571  1.00 29.48  ? 619  VAL A CG1   1 
ATOM   4245  C CG2   . VAL A  1 619 ? -9.676   -26.124 36.203  1.00 28.12  ? 619  VAL A CG2   1 
ATOM   4246  N N     . ALA A  1 620 ? -12.629  -26.486 39.787  1.00 29.63  ? 620  ALA A N     1 
ATOM   4247  C CA    . ALA A  1 620 ? -13.211  -26.418 41.122  1.00 29.32  ? 620  ALA A CA    1 
ATOM   4248  C C     . ALA A  1 620 ? -13.621  -27.810 41.644  1.00 33.43  ? 620  ALA A C     1 
ATOM   4249  O O     . ALA A  1 620 ? -13.323  -28.116 42.794  1.00 35.65  ? 620  ALA A O     1 
ATOM   4250  C CB    . ALA A  1 620 ? -14.397  -25.483 41.123  1.00 29.34  ? 620  ALA A CB    1 
ATOM   4251  N N     . THR A  1 621 ? -14.226  -28.674 40.790  1.00 26.94  ? 621  THR A N     1 
ATOM   4252  C CA    . THR A  1 621 ? -14.655  -30.022 41.171  1.00 26.66  ? 621  THR A CA    1 
ATOM   4253  C C     . THR A  1 621 ? -13.471  -30.900 41.481  1.00 33.68  ? 621  THR A C     1 
ATOM   4254  O O     . THR A  1 621 ? -13.495  -31.582 42.493  1.00 33.87  ? 621  THR A O     1 
ATOM   4255  C CB    . THR A  1 621 ? -15.550  -30.654 40.108  1.00 31.80  ? 621  THR A CB    1 
ATOM   4256  O OG1   . THR A  1 621 ? -16.637  -29.785 39.823  1.00 33.32  ? 621  THR A OG1   1 
ATOM   4257  C CG2   . THR A  1 621 ? -16.116  -31.984 40.543  1.00 30.73  ? 621  THR A CG2   1 
ATOM   4258  N N     . LEU A  1 622 ? -12.437  -30.891 40.615  1.00 32.83  ? 622  LEU A N     1 
ATOM   4259  C CA    . LEU A  1 622 ? -11.208  -31.688 40.776  1.00 33.58  ? 622  LEU A CA    1 
ATOM   4260  C C     . LEU A  1 622 ? -10.470  -31.272 42.034  1.00 38.33  ? 622  LEU A C     1 
ATOM   4261  O O     . LEU A  1 622 ? -10.064  -32.148 42.813  1.00 39.05  ? 622  LEU A O     1 
ATOM   4262  C CB    . LEU A  1 622 ? -10.258  -31.524 39.579  1.00 32.97  ? 622  LEU A CB    1 
ATOM   4263  C CG    . LEU A  1 622 ? -10.808  -31.742 38.197  1.00 35.33  ? 622  LEU A CG    1 
ATOM   4264  C CD1   . LEU A  1 622 ? -9.799   -31.283 37.157  1.00 34.84  ? 622  LEU A CD1   1 
ATOM   4265  C CD2   . LEU A  1 622 ? -11.269  -33.171 38.011  1.00 35.58  ? 622  LEU A CD2   1 
ATOM   4266  N N     . ASN A  1 623 ? -10.309  -29.942 42.239  1.00 33.70  ? 623  ASN A N     1 
ATOM   4267  C CA    . ASN A  1 623 ? -9.635   -29.408 43.421  1.00 34.53  ? 623  ASN A CA    1 
ATOM   4268  C C     . ASN A  1 623 ? -10.288  -29.928 44.687  1.00 38.57  ? 623  ASN A C     1 
ATOM   4269  O O     . ASN A  1 623 ? -9.594   -30.449 45.561  1.00 37.42  ? 623  ASN A O     1 
ATOM   4270  C CB    . ASN A  1 623 ? -9.609   -27.888 43.407  1.00 34.14  ? 623  ASN A CB    1 
ATOM   4271  C CG    . ASN A  1 623 ? -8.788   -27.297 44.505  1.00 64.60  ? 623  ASN A CG    1 
ATOM   4272  O OD1   . ASN A  1 623 ? -9.173   -27.320 45.672  1.00 60.42  ? 623  ASN A OD1   1 
ATOM   4273  N ND2   . ASN A  1 623 ? -7.637   -26.750 44.157  1.00 64.48  ? 623  ASN A ND2   1 
ATOM   4274  N N     . SER A  1 624 ? -11.630  -29.837 44.745  1.00 35.03  ? 624  SER A N     1 
ATOM   4275  C CA    . SER A  1 624 ? -12.445  -30.273 45.883  1.00 33.96  ? 624  SER A CA    1 
ATOM   4276  C C     . SER A  1 624 ? -12.419  -31.786 46.114  1.00 31.77  ? 624  SER A C     1 
ATOM   4277  O O     . SER A  1 624 ? -12.218  -32.215 47.246  1.00 27.93  ? 624  SER A O     1 
ATOM   4278  C CB    . SER A  1 624 ? -13.871  -29.754 45.733  1.00 36.71  ? 624  SER A CB    1 
ATOM   4279  O OG    . SER A  1 624 ? -13.834  -28.364 45.458  1.00 44.43  ? 624  SER A OG    1 
ATOM   4280  N N     . LEU A  1 625 ? -12.598  -32.583 45.037  1.00 28.42  ? 625  LEU A N     1 
ATOM   4281  C CA    . LEU A  1 625 ? -12.601  -34.049 45.089  1.00 28.99  ? 625  LEU A CA    1 
ATOM   4282  C C     . LEU A  1 625 ? -11.264  -34.592 45.552  1.00 35.70  ? 625  LEU A C     1 
ATOM   4283  O O     . LEU A  1 625 ? -11.240  -35.586 46.278  1.00 35.77  ? 625  LEU A O     1 
ATOM   4284  C CB    . LEU A  1 625 ? -12.978  -34.679 43.739  1.00 27.87  ? 625  LEU A CB    1 
ATOM   4285  C CG    . LEU A  1 625 ? -14.411  -34.537 43.244  1.00 30.32  ? 625  LEU A CG    1 
ATOM   4286  C CD1   . LEU A  1 625 ? -14.534  -35.126 41.892  1.00 30.49  ? 625  LEU A CD1   1 
ATOM   4287  C CD2   . LEU A  1 625 ? -15.415  -35.198 44.159  1.00 30.74  ? 625  LEU A CD2   1 
ATOM   4288  N N     . ALA A  1 626 ? -10.158  -33.924 45.148  1.00 34.30  ? 626  ALA A N     1 
ATOM   4289  C CA    . ALA A  1 626 ? -8.779   -34.271 45.513  1.00 36.37  ? 626  ALA A CA    1 
ATOM   4290  C C     . ALA A  1 626 ? -8.585   -34.297 47.023  1.00 42.29  ? 626  ALA A C     1 
ATOM   4291  O O     . ALA A  1 626 ? -7.789   -35.089 47.512  1.00 44.77  ? 626  ALA A O     1 
ATOM   4292  C CB    . ALA A  1 626 ? -7.810   -33.272 44.894  1.00 36.96  ? 626  ALA A CB    1 
ATOM   4293  N N     . LYS A  1 627 ? -9.324   -33.434 47.751  1.00 37.87  ? 627  LYS A N     1 
ATOM   4294  C CA    . LYS A  1 627 ? -9.277   -33.299 49.211  1.00 37.69  ? 627  LYS A CA    1 
ATOM   4295  C C     . LYS A  1 627 ? -10.248  -34.266 49.937  1.00 44.29  ? 627  LYS A C     1 
ATOM   4296  O O     . LYS A  1 627 ? -10.208  -34.383 51.166  1.00 44.71  ? 627  LYS A O     1 
ATOM   4297  C CB    . LYS A  1 627 ? -9.557   -31.844 49.626  1.00 36.56  ? 627  LYS A CB    1 
ATOM   4298  C CG    . LYS A  1 627 ? -8.646   -30.796 48.996  1.00 27.63  ? 627  LYS A CG    1 
ATOM   4299  C CD    . LYS A  1 627 ? -9.376   -29.453 48.900  1.00 30.77  ? 627  LYS A CD    1 
ATOM   4300  C CE    . LYS A  1 627 ? -8.449   -28.282 48.699  1.00 49.71  ? 627  LYS A CE    1 
ATOM   4301  N NZ    . LYS A  1 627 ? -9.127   -26.984 48.960  1.00 54.93  ? 627  LYS A NZ    1 
ATOM   4302  N N     . GLY A  1 628 ? -11.105  -34.943 49.178  1.00 40.58  ? 628  GLY A N     1 
ATOM   4303  C CA    . GLY A  1 628 ? -12.101  -35.850 49.747  1.00 40.09  ? 628  GLY A CA    1 
ATOM   4304  C C     . GLY A  1 628 ? -13.451  -35.201 50.000  1.00 39.35  ? 628  GLY A C     1 
ATOM   4305  O O     . GLY A  1 628 ? -14.323  -35.810 50.618  1.00 37.24  ? 628  GLY A O     1 
ATOM   4306  N N     . HIS A  1 629 ? -13.633  -33.964 49.519  1.00 35.24  ? 629  HIS A N     1 
ATOM   4307  C CA    . HIS A  1 629 ? -14.891  -33.246 49.674  1.00 35.44  ? 629  HIS A CA    1 
ATOM   4308  C C     . HIS A  1 629 ? -15.881  -33.794 48.679  1.00 39.65  ? 629  HIS A C     1 
ATOM   4309  O O     . HIS A  1 629 ? -15.465  -34.403 47.696  1.00 39.38  ? 629  HIS A O     1 
ATOM   4310  C CB    . HIS A  1 629 ? -14.709  -31.723 49.469  1.00 35.36  ? 629  HIS A CB    1 
ATOM   4311  C CG    . HIS A  1 629 ? -13.711  -31.104 50.393  1.00 39.34  ? 629  HIS A CG    1 
ATOM   4312  N ND1   . HIS A  1 629 ? -13.759  -31.314 51.751  1.00 42.37  ? 629  HIS A ND1   1 
ATOM   4313  C CD2   . HIS A  1 629 ? -12.676  -30.286 50.114  1.00 40.56  ? 629  HIS A CD2   1 
ATOM   4314  C CE1   . HIS A  1 629 ? -12.741  -30.643 52.250  1.00 42.17  ? 629  HIS A CE1   1 
ATOM   4315  N NE2   . HIS A  1 629 ? -12.065  -30.003 51.300  1.00 41.34  ? 629  HIS A NE2   1 
ATOM   4316  N N     . ARG A  1 630 ? -17.182  -33.607 48.937  1.00 36.90  ? 630  ARG A N     1 
ATOM   4317  C CA    . ARG A  1 630 ? -18.228  -34.049 48.020  1.00 36.58  ? 630  ARG A CA    1 
ATOM   4318  C C     . ARG A  1 630 ? -18.721  -32.821 47.248  1.00 39.10  ? 630  ARG A C     1 
ATOM   4319  O O     . ARG A  1 630 ? -19.030  -31.781 47.857  1.00 38.55  ? 630  ARG A O     1 
ATOM   4320  C CB    . ARG A  1 630 ? -19.373  -34.759 48.753  1.00 37.37  ? 630  ARG A CB    1 
ATOM   4321  C CG    . ARG A  1 630 ? -18.986  -36.106 49.333  1.00 45.70  ? 630  ARG A CG    1 
ATOM   4322  C CD    . ARG A  1 630 ? -20.129  -36.748 50.076  1.00 48.57  ? 630  ARG A CD    1 
ATOM   4323  N NE    . ARG A  1 630 ? -21.155  -37.281 49.175  1.00 51.74  ? 630  ARG A NE    1 
ATOM   4324  C CZ    . ARG A  1 630 ? -22.315  -37.791 49.588  1.00 63.49  ? 630  ARG A CZ    1 
ATOM   4325  N NH1   . ARG A  1 630 ? -22.611  -37.823 50.883  1.00 42.00  ? 630  ARG A NH1   1 
ATOM   4326  N NH2   . ARG A  1 630 ? -23.193  -38.262 48.707  1.00 43.14  ? 630  ARG A NH2   1 
ATOM   4327  N N     . VAL A  1 631 ? -18.735  -32.928 45.904  1.00 32.36  ? 631  VAL A N     1 
ATOM   4328  C CA    . VAL A  1 631 ? -19.136  -31.829 45.027  1.00 28.95  ? 631  VAL A CA    1 
ATOM   4329  C C     . VAL A  1 631 ? -20.564  -32.043 44.513  1.00 32.08  ? 631  VAL A C     1 
ATOM   4330  O O     . VAL A  1 631 ? -20.870  -33.082 43.932  1.00 29.83  ? 631  VAL A O     1 
ATOM   4331  C CB    . VAL A  1 631 ? -18.123  -31.574 43.894  1.00 29.87  ? 631  VAL A CB    1 
ATOM   4332  C CG1   . VAL A  1 631 ? -18.462  -30.300 43.133  1.00 28.23  ? 631  VAL A CG1   1 
ATOM   4333  C CG2   . VAL A  1 631 ? -16.702  -31.521 44.431  1.00 29.49  ? 631  VAL A CG2   1 
ATOM   4334  N N     . PHE A  1 632 ? -21.426  -31.037 44.750  1.00 29.65  ? 632  PHE A N     1 
ATOM   4335  C CA    . PHE A  1 632 ? -22.838  -31.020 44.393  1.00 29.18  ? 632  PHE A CA    1 
ATOM   4336  C C     . PHE A  1 632 ? -23.100  -29.841 43.535  1.00 30.84  ? 632  PHE A C     1 
ATOM   4337  O O     . PHE A  1 632 ? -22.804  -28.717 43.933  1.00 29.53  ? 632  PHE A O     1 
ATOM   4338  C CB    . PHE A  1 632 ? -23.720  -30.973 45.647  1.00 32.17  ? 632  PHE A CB    1 
ATOM   4339  C CG    . PHE A  1 632 ? -23.508  -32.143 46.587  1.00 35.26  ? 632  PHE A CG    1 
ATOM   4340  C CD1   . PHE A  1 632 ? -24.161  -33.358 46.377  1.00 39.16  ? 632  PHE A CD1   1 
ATOM   4341  C CD2   . PHE A  1 632 ? -22.645  -32.038 47.669  1.00 37.03  ? 632  PHE A CD2   1 
ATOM   4342  C CE1   . PHE A  1 632 ? -23.949  -34.444 47.236  1.00 40.44  ? 632  PHE A CE1   1 
ATOM   4343  C CE2   . PHE A  1 632 ? -22.446  -33.122 48.532  1.00 40.59  ? 632  PHE A CE2   1 
ATOM   4344  C CZ    . PHE A  1 632 ? -23.087  -34.319 48.304  1.00 38.85  ? 632  PHE A CZ    1 
ATOM   4345  N N     . ALA A  1 633 ? -23.626  -30.097 42.333  1.00 28.03  ? 633  ALA A N     1 
ATOM   4346  C CA    . ALA A  1 633 ? -23.913  -29.064 41.352  1.00 27.04  ? 633  ALA A CA    1 
ATOM   4347  C C     . ALA A  1 633 ? -25.396  -28.763 41.331  1.00 32.71  ? 633  ALA A C     1 
ATOM   4348  O O     . ALA A  1 633 ? -26.201  -29.640 40.981  1.00 33.27  ? 633  ALA A O     1 
ATOM   4349  C CB    . ALA A  1 633 ? -23.440  -29.512 39.983  1.00 27.04  ? 633  ALA A CB    1 
ATOM   4350  N N     . ILE A  1 634 ? -25.758  -27.531 41.762  1.00 29.17  ? 634  ILE A N     1 
ATOM   4351  C CA    . ILE A  1 634 ? -27.130  -27.009 41.724  1.00 29.31  ? 634  ILE A CA    1 
ATOM   4352  C C     . ILE A  1 634 ? -27.459  -26.682 40.233  1.00 32.93  ? 634  ILE A C     1 
ATOM   4353  O O     . ILE A  1 634 ? -26.978  -25.692 39.640  1.00 33.42  ? 634  ILE A O     1 
ATOM   4354  C CB    . ILE A  1 634 ? -27.365  -25.810 42.689  1.00 32.64  ? 634  ILE A CB    1 
ATOM   4355  C CG1   . ILE A  1 634 ? -27.104  -26.217 44.158  1.00 34.17  ? 634  ILE A CG1   1 
ATOM   4356  C CG2   . ILE A  1 634 ? -28.778  -25.273 42.519  1.00 32.91  ? 634  ILE A CG2   1 
ATOM   4357  C CD1   . ILE A  1 634 ? -26.560  -25.133 45.083  1.00 41.81  ? 634  ILE A CD1   1 
ATOM   4358  N N     . ARG A  1 635 ? -28.221  -27.588 39.632  1.00 28.22  ? 635  ARG A N     1 
ATOM   4359  C CA    . ARG A  1 635 ? -28.635  -27.549 38.242  1.00 27.08  ? 635  ARG A CA    1 
ATOM   4360  C C     . ARG A  1 635 ? -29.704  -26.509 37.994  1.00 33.92  ? 635  ARG A C     1 
ATOM   4361  O O     . ARG A  1 635 ? -30.699  -26.435 38.728  1.00 36.27  ? 635  ARG A O     1 
ATOM   4362  C CB    . ARG A  1 635 ? -29.151  -28.910 37.812  1.00 24.27  ? 635  ARG A CB    1 
ATOM   4363  C CG    . ARG A  1 635 ? -28.105  -30.018 37.775  1.00 35.99  ? 635  ARG A CG    1 
ATOM   4364  C CD    . ARG A  1 635 ? -28.751  -31.357 37.450  1.00 41.10  ? 635  ARG A CD    1 
ATOM   4365  N NE    . ARG A  1 635 ? -29.686  -31.235 36.330  1.00 53.75  ? 635  ARG A NE    1 
ATOM   4366  C CZ    . ARG A  1 635 ? -30.985  -31.539 36.373  1.00 69.70  ? 635  ARG A CZ    1 
ATOM   4367  N NH1   . ARG A  1 635 ? -31.523  -32.047 37.478  1.00 40.62  ? 635  ARG A NH1   1 
ATOM   4368  N NH2   . ARG A  1 635 ? -31.750  -31.353 35.306  1.00 64.28  ? 635  ARG A NH2   1 
ATOM   4369  N N     . ASN A  1 636 ? -29.507  -25.719 36.937  1.00 30.20  ? 636  ASN A N     1 
ATOM   4370  C CA    . ASN A  1 636 ? -30.435  -24.660 36.504  1.00 30.49  ? 636  ASN A CA    1 
ATOM   4371  C C     . ASN A  1 636 ? -30.702  -23.541 37.525  1.00 32.36  ? 636  ASN A C     1 
ATOM   4372  O O     . ASN A  1 636 ? -31.856  -23.184 37.762  1.00 30.50  ? 636  ASN A O     1 
ATOM   4373  C CB    . ASN A  1 636 ? -31.734  -25.261 35.925  1.00 33.32  ? 636  ASN A CB    1 
ATOM   4374  C CG    . ASN A  1 636 ? -31.477  -26.232 34.805  1.00 49.52  ? 636  ASN A CG    1 
ATOM   4375  O OD1   . ASN A  1 636 ? -30.868  -25.882 33.772  1.00 44.48  ? 636  ASN A OD1   1 
ATOM   4376  N ND2   . ASN A  1 636 ? -31.913  -27.484 35.012  1.00 33.88  ? 636  ASN A ND2   1 
ATOM   4377  N N     . GLY A  1 637 ? -29.616  -22.992 38.070  1.00 29.95  ? 637  GLY A N     1 
ATOM   4378  C CA    . GLY A  1 637 ? -29.605  -21.891 39.031  1.00 30.23  ? 637  GLY A CA    1 
ATOM   4379  C C     . GLY A  1 637 ? -30.475  -22.045 40.271  1.00 32.05  ? 637  GLY A C     1 
ATOM   4380  O O     . GLY A  1 637 ? -30.754  -23.173 40.723  1.00 28.97  ? 637  GLY A O     1 
ATOM   4381  N N     . PHE A  1 638 ? -30.896  -20.879 40.847  1.00 27.00  ? 638  PHE A N     1 
ATOM   4382  C CA    . PHE A  1 638 ? -31.747  -20.932 42.015  1.00 26.37  ? 638  PHE A CA    1 
ATOM   4383  C C     . PHE A  1 638 ? -33.136  -21.435 41.712  1.00 32.37  ? 638  PHE A C     1 
ATOM   4384  O O     . PHE A  1 638 ? -33.686  -22.163 42.526  1.00 35.73  ? 638  PHE A O     1 
ATOM   4385  C CB    . PHE A  1 638 ? -31.717  -19.653 42.820  1.00 27.59  ? 638  PHE A CB    1 
ATOM   4386  C CG    . PHE A  1 638 ? -30.445  -19.523 43.620  1.00 28.97  ? 638  PHE A CG    1 
ATOM   4387  C CD1   . PHE A  1 638 ? -30.227  -20.305 44.749  1.00 33.00  ? 638  PHE A CD1   1 
ATOM   4388  C CD2   . PHE A  1 638 ? -29.455  -18.634 43.235  1.00 30.38  ? 638  PHE A CD2   1 
ATOM   4389  C CE1   . PHE A  1 638 ? -29.036  -20.196 45.480  1.00 33.80  ? 638  PHE A CE1   1 
ATOM   4390  C CE2   . PHE A  1 638 ? -28.280  -18.505 43.975  1.00 33.17  ? 638  PHE A CE2   1 
ATOM   4391  C CZ    . PHE A  1 638 ? -28.080  -19.286 45.094  1.00 32.26  ? 638  PHE A CZ    1 
ATOM   4392  N N     . ALA A  1 639 ? -33.663  -21.158 40.520  1.00 27.86  ? 639  ALA A N     1 
ATOM   4393  C CA    . ALA A  1 639 ? -34.975  -21.656 40.098  1.00 28.62  ? 639  ALA A CA    1 
ATOM   4394  C C     . ALA A  1 639 ? -35.034  -23.204 40.063  1.00 33.48  ? 639  ALA A C     1 
ATOM   4395  O O     . ALA A  1 639 ? -36.004  -23.796 40.544  1.00 33.82  ? 639  ALA A O     1 
ATOM   4396  C CB    . ALA A  1 639 ? -35.342  -21.081 38.751  1.00 29.07  ? 639  ALA A CB    1 
ATOM   4397  N N     . GLY A  1 640 ? -33.971  -23.832 39.549  1.00 29.51  ? 640  GLY A N     1 
ATOM   4398  C CA    . GLY A  1 640 ? -33.831  -25.285 39.493  1.00 29.44  ? 640  GLY A CA    1 
ATOM   4399  C C     . GLY A  1 640 ? -33.862  -25.876 40.889  1.00 35.25  ? 640  GLY A C     1 
ATOM   4400  O O     . GLY A  1 640 ? -34.541  -26.874 41.123  1.00 36.08  ? 640  GLY A O     1 
ATOM   4401  N N     . LEU A  1 641 ? -33.165  -25.198 41.849  1.00 30.73  ? 641  LEU A N     1 
ATOM   4402  C CA    . LEU A  1 641 ? -33.113  -25.566 43.251  1.00 29.34  ? 641  LEU A CA    1 
ATOM   4403  C C     . LEU A  1 641 ? -34.507  -25.440 43.857  1.00 32.78  ? 641  LEU A C     1 
ATOM   4404  O O     . LEU A  1 641 ? -35.031  -26.433 44.331  1.00 34.01  ? 641  LEU A O     1 
ATOM   4405  C CB    . LEU A  1 641 ? -32.121  -24.669 44.007  1.00 28.45  ? 641  LEU A CB    1 
ATOM   4406  C CG    . LEU A  1 641 ? -31.376  -25.244 45.247  1.00 33.16  ? 641  LEU A CG    1 
ATOM   4407  C CD1   . LEU A  1 641 ? -31.555  -24.367 46.448  1.00 33.86  ? 641  LEU A CD1   1 
ATOM   4408  C CD2   . LEU A  1 641 ? -31.670  -26.736 45.519  1.00 34.10  ? 641  LEU A CD2   1 
ATOM   4409  N N     . ILE A  1 642 ? -35.111  -24.240 43.805  1.00 27.14  ? 642  ILE A N     1 
ATOM   4410  C CA    . ILE A  1 642 ? -36.429  -23.928 44.360  1.00 27.49  ? 642  ILE A CA    1 
ATOM   4411  C C     . ILE A  1 642 ? -37.563  -24.832 43.817  1.00 37.15  ? 642  ILE A C     1 
ATOM   4412  O O     . ILE A  1 642 ? -38.311  -25.450 44.588  1.00 37.93  ? 642  ILE A O     1 
ATOM   4413  C CB    . ILE A  1 642 ? -36.749  -22.405 44.185  1.00 27.79  ? 642  ILE A CB    1 
ATOM   4414  C CG1   . ILE A  1 642 ? -35.769  -21.539 45.003  1.00 26.97  ? 642  ILE A CG1   1 
ATOM   4415  C CG2   . ILE A  1 642 ? -38.220  -22.067 44.542  1.00 26.91  ? 642  ILE A CG2   1 
ATOM   4416  C CD1   . ILE A  1 642 ? -35.454  -20.214 44.427  1.00 19.08  ? 642  ILE A CD1   1 
ATOM   4417  N N     . ARG A  1 643 ? -37.693  -24.876 42.494  1.00 34.74  ? 643  ARG A N     1 
ATOM   4418  C CA    . ARG A  1 643 ? -38.774  -25.564 41.804  1.00 34.22  ? 643  ARG A CA    1 
ATOM   4419  C C     . ARG A  1 643 ? -38.652  -27.081 41.738  1.00 37.23  ? 643  ARG A C     1 
ATOM   4420  O O     . ARG A  1 643 ? -39.684  -27.745 41.672  1.00 37.82  ? 643  ARG A O     1 
ATOM   4421  C CB    . ARG A  1 643 ? -38.986  -24.952 40.391  1.00 32.05  ? 643  ARG A CB    1 
ATOM   4422  C CG    . ARG A  1 643 ? -39.344  -23.479 40.402  1.00 37.13  ? 643  ARG A CG    1 
ATOM   4423  C CD    . ARG A  1 643 ? -39.313  -22.856 39.029  1.00 56.31  ? 643  ARG A CD    1 
ATOM   4424  N NE    . ARG A  1 643 ? -39.924  -21.515 39.049  1.00 72.42  ? 643  ARG A NE    1 
ATOM   4425  C CZ    . ARG A  1 643 ? -41.168  -21.233 38.681  1.00 89.87  ? 643  ARG A CZ    1 
ATOM   4426  N NH1   . ARG A  1 643 ? -41.967  -22.191 38.230  1.00 83.28  ? 643  ARG A NH1   1 
ATOM   4427  N NH2   . ARG A  1 643 ? -41.619  -19.985 38.747  1.00 78.03  ? 643  ARG A NH2   1 
ATOM   4428  N N     . HIS A  1 644 ? -37.418  -27.634 41.706  1.00 32.93  ? 644  HIS A N     1 
ATOM   4429  C CA    . HIS A  1 644 ? -37.214  -29.081 41.524  1.00 33.08  ? 644  HIS A CA    1 
ATOM   4430  C C     . HIS A  1 644 ? -36.195  -29.788 42.417  1.00 34.82  ? 644  HIS A C     1 
ATOM   4431  O O     . HIS A  1 644 ? -36.038  -30.999 42.296  1.00 33.20  ? 644  HIS A O     1 
ATOM   4432  C CB    . HIS A  1 644 ? -36.900  -29.372 40.047  1.00 34.60  ? 644  HIS A CB    1 
ATOM   4433  C CG    . HIS A  1 644 ? -37.915  -28.813 39.105  1.00 39.45  ? 644  HIS A CG    1 
ATOM   4434  N ND1   . HIS A  1 644 ? -39.223  -29.291 39.080  1.00 43.05  ? 644  HIS A ND1   1 
ATOM   4435  C CD2   . HIS A  1 644 ? -37.807  -27.787 38.231  1.00 42.10  ? 644  HIS A CD2   1 
ATOM   4436  C CE1   . HIS A  1 644 ? -39.866  -28.545 38.192  1.00 42.92  ? 644  HIS A CE1   1 
ATOM   4437  N NE2   . HIS A  1 644 ? -39.058  -27.624 37.651  1.00 42.65  ? 644  HIS A NE2   1 
ATOM   4438  N N     . GLY A  1 645 ? -35.503  -29.045 43.283  1.00 32.55  ? 645  GLY A N     1 
ATOM   4439  C CA    . GLY A  1 645 ? -34.480  -29.578 44.184  1.00 32.36  ? 645  GLY A CA    1 
ATOM   4440  C C     . GLY A  1 645 ? -33.306  -30.184 43.445  1.00 36.71  ? 645  GLY A C     1 
ATOM   4441  O O     . GLY A  1 645 ? -32.606  -31.040 43.992  1.00 35.97  ? 645  GLY A O     1 
ATOM   4442  N N     . ALA A  1 646 ? -33.107  -29.713 42.191  1.00 33.16  ? 646  ALA A N     1 
ATOM   4443  C CA    . ALA A  1 646 ? -32.143  -30.083 41.161  1.00 32.34  ? 646  ALA A CA    1 
ATOM   4444  C C     . ALA A  1 646 ? -30.673  -30.067 41.555  1.00 37.03  ? 646  ALA A C     1 
ATOM   4445  O O     . ALA A  1 646 ? -29.908  -29.278 41.012  1.00 37.31  ? 646  ALA A O     1 
ATOM   4446  C CB    . ALA A  1 646 ? -32.354  -29.192 39.950  1.00 32.18  ? 646  ALA A CB    1 
ATOM   4447  N N     . VAL A  1 647 ? -30.263  -30.968 42.444  1.00 34.14  ? 647  VAL A N     1 
ATOM   4448  C CA    . VAL A  1 647 ? -28.878  -31.093 42.916  1.00 33.84  ? 647  VAL A CA    1 
ATOM   4449  C C     . VAL A  1 647 ? -28.334  -32.358 42.285  1.00 38.88  ? 647  VAL A C     1 
ATOM   4450  O O     . VAL A  1 647 ? -29.030  -33.382 42.255  1.00 40.12  ? 647  VAL A O     1 
ATOM   4451  C CB    . VAL A  1 647 ? -28.823  -31.179 44.468  1.00 39.60  ? 647  VAL A CB    1 
ATOM   4452  C CG1   . VAL A  1 647 ? -27.393  -31.334 44.976  1.00 39.48  ? 647  VAL A CG1   1 
ATOM   4453  C CG2   . VAL A  1 647 ? -29.510  -29.974 45.123  1.00 39.85  ? 647  VAL A CG2   1 
ATOM   4454  N N     . ARG A  1 648 ? -27.101  -32.304 41.784  1.00 35.61  ? 648  ARG A N     1 
ATOM   4455  C CA    . ARG A  1 648 ? -26.456  -33.459 41.147  1.00 36.13  ? 648  ARG A CA    1 
ATOM   4456  C C     . ARG A  1 648 ? -25.031  -33.615 41.674  1.00 42.63  ? 648  ARG A C     1 
ATOM   4457  O O     . ARG A  1 648 ? -24.238  -32.672 41.599  1.00 43.92  ? 648  ARG A O     1 
ATOM   4458  C CB    . ARG A  1 648 ? -26.482  -33.278 39.611  1.00 36.37  ? 648  ARG A CB    1 
ATOM   4459  C CG    . ARG A  1 648 ? -25.743  -34.317 38.776  1.00 45.35  ? 648  ARG A CG    1 
ATOM   4460  C CD    . ARG A  1 648 ? -24.677  -33.601 37.966  1.00 64.01  ? 648  ARG A CD    1 
ATOM   4461  N NE    . ARG A  1 648 ? -24.021  -34.462 36.976  1.00 69.61  ? 648  ARG A NE    1 
ATOM   4462  C CZ    . ARG A  1 648 ? -24.079  -34.273 35.660  1.00 75.80  ? 648  ARG A CZ    1 
ATOM   4463  N NH1   . ARG A  1 648 ? -24.772  -33.257 35.156  1.00 59.07  ? 648  ARG A NH1   1 
ATOM   4464  N NH2   . ARG A  1 648 ? -23.455  -35.102 34.838  1.00 58.83  ? 648  ARG A NH2   1 
ATOM   4465  N N     . GLU A  1 649 ? -24.706  -34.787 42.219  1.00 39.85  ? 649  GLU A N     1 
ATOM   4466  C CA    . GLU A  1 649 ? -23.348  -35.024 42.708  1.00 40.28  ? 649  GLU A CA    1 
ATOM   4467  C C     . GLU A  1 649 ? -22.343  -35.248 41.556  1.00 45.45  ? 649  GLU A C     1 
ATOM   4468  O O     . GLU A  1 649 ? -22.626  -35.968 40.592  1.00 45.62  ? 649  GLU A O     1 
ATOM   4469  C CB    . GLU A  1 649 ? -23.299  -36.168 43.737  1.00 42.46  ? 649  GLU A CB    1 
ATOM   4470  C CG    . GLU A  1 649 ? -21.959  -36.261 44.441  1.00 46.51  ? 649  GLU A CG    1 
ATOM   4471  C CD    . GLU A  1 649 ? -21.913  -37.035 45.739  1.00 62.80  ? 649  GLU A CD    1 
ATOM   4472  O OE1   . GLU A  1 649 ? -20.795  -37.154 46.294  1.00 73.16  ? 649  GLU A OE1   1 
ATOM   4473  O OE2   . GLU A  1 649 ? -22.980  -37.494 46.218  1.00 31.19  ? 649  GLU A OE2   1 
ATOM   4474  N N     . LEU A  1 650 ? -21.176  -34.626 41.672  1.00 42.80  ? 650  LEU A N     1 
ATOM   4475  C CA    . LEU A  1 650 ? -20.121  -34.752 40.677  1.00 43.05  ? 650  LEU A CA    1 
ATOM   4476  C C     . LEU A  1 650 ? -18.969  -35.656 41.146  1.00 50.72  ? 650  LEU A C     1 
ATOM   4477  O O     . LEU A  1 650 ? -18.612  -35.644 42.332  1.00 52.40  ? 650  LEU A O     1 
ATOM   4478  C CB    . LEU A  1 650 ? -19.598  -33.368 40.264  1.00 41.75  ? 650  LEU A CB    1 
ATOM   4479  C CG    . LEU A  1 650 ? -20.597  -32.419 39.614  1.00 44.67  ? 650  LEU A CG    1 
ATOM   4480  C CD1   . LEU A  1 650 ? -19.991  -31.063 39.451  1.00 44.08  ? 650  LEU A CD1   1 
ATOM   4481  C CD2   . LEU A  1 650 ? -21.043  -32.932 38.286  1.00 46.60  ? 650  LEU A CD2   1 
ATOM   4482  N N     . ASN A  1 651 ? -18.393  -36.430 40.197  1.00 47.32  ? 651  ASN A N     1 
ATOM   4483  C CA    . ASN A  1 651 ? -17.277  -37.364 40.395  1.00 47.84  ? 651  ASN A CA    1 
ATOM   4484  C C     . ASN A  1 651 ? -16.176  -37.153 39.340  1.00 52.26  ? 651  ASN A C     1 
ATOM   4485  O O     . ASN A  1 651 ? -16.444  -36.500 38.326  1.00 51.91  ? 651  ASN A O     1 
ATOM   4486  C CB    . ASN A  1 651 ? -17.809  -38.784 40.349  1.00 47.24  ? 651  ASN A CB    1 
ATOM   4487  C CG    . ASN A  1 651 ? -18.677  -39.119 41.541  1.00 60.98  ? 651  ASN A CG    1 
ATOM   4488  O OD1   . ASN A  1 651 ? -18.178  -39.504 42.623  1.00 60.76  ? 651  ASN A OD1   1 
ATOM   4489  N ND2   . ASN A  1 651 ? -19.991  -38.966 41.375  1.00 33.73  ? 651  ASN A ND2   1 
ATOM   4490  N N     . TRP A  1 652 ? -14.947  -37.699 39.560  1.00 49.75  ? 652  TRP A N     1 
ATOM   4491  C CA    . TRP A  1 652 ? -13.814  -37.543 38.624  1.00 50.68  ? 652  TRP A CA    1 
ATOM   4492  C C     . TRP A  1 652 ? -14.216  -37.726 37.150  1.00 51.89  ? 652  TRP A C     1 
ATOM   4493  O O     . TRP A  1 652 ? -13.810  -36.945 36.288  1.00 50.24  ? 652  TRP A O     1 
ATOM   4494  C CB    . TRP A  1 652 ? -12.659  -38.498 38.961  1.00 52.13  ? 652  TRP A CB    1 
ATOM   4495  C CG    . TRP A  1 652 ? -11.997  -38.252 40.278  1.00 55.54  ? 652  TRP A CG    1 
ATOM   4496  C CD1   . TRP A  1 652 ? -12.149  -38.985 41.427  1.00 60.09  ? 652  TRP A CD1   1 
ATOM   4497  C CD2   . TRP A  1 652 ? -10.994  -37.267 40.559  1.00 55.77  ? 652  TRP A CD2   1 
ATOM   4498  N NE1   . TRP A  1 652 ? -11.307  -38.508 42.413  1.00 60.49  ? 652  TRP A NE1   1 
ATOM   4499  C CE2   . TRP A  1 652 ? -10.604  -37.436 41.914  1.00 61.52  ? 652  TRP A CE2   1 
ATOM   4500  C CE3   . TRP A  1 652 ? -10.348  -36.287 39.787  1.00 56.48  ? 652  TRP A CE3   1 
ATOM   4501  C CZ2   . TRP A  1 652 ? -9.641   -36.615 42.526  1.00 61.12  ? 652  TRP A CZ2   1 
ATOM   4502  C CZ3   . TRP A  1 652 ? -9.405   -35.468 40.398  1.00 58.59  ? 652  TRP A CZ3   1 
ATOM   4503  C CH2   . TRP A  1 652 ? -9.060   -35.635 41.751  1.00 60.27  ? 652  TRP A CH2   1 
ATOM   4504  N N     . ILE A  1 653 ? -15.043  -38.737 36.887  1.00 47.96  ? 653  ILE A N     1 
ATOM   4505  C CA    . ILE A  1 653 ? -15.534  -39.082 35.559  1.00 47.55  ? 653  ILE A CA    1 
ATOM   4506  C C     . ILE A  1 653 ? -16.529  -38.073 34.945  1.00 54.47  ? 653  ILE A C     1 
ATOM   4507  O O     . ILE A  1 653 ? -16.559  -37.949 33.712  1.00 54.70  ? 653  ILE A O     1 
ATOM   4508  C CB    . ILE A  1 653 ? -16.050  -40.549 35.526  1.00 50.44  ? 653  ILE A CB    1 
ATOM   4509  C CG1   . ILE A  1 653 ? -16.016  -41.146 34.105  1.00 50.85  ? 653  ILE A CG1   1 
ATOM   4510  C CG2   . ILE A  1 653 ? -17.407  -40.739 36.234  1.00 48.58  ? 653  ILE A CG2   1 
ATOM   4511  C CD1   . ILE A  1 653 ? -14.745  -41.946 33.745  1.00 57.74  ? 653  ILE A CD1   1 
ATOM   4512  N N     . ASP A  1 654 ? -17.352  -37.387 35.785  1.00 51.70  ? 654  ASP A N     1 
ATOM   4513  C CA    . ASP A  1 654 ? -18.372  -36.429 35.339  1.00 51.46  ? 654  ASP A CA    1 
ATOM   4514  C C     . ASP A  1 654 ? -17.778  -35.199 34.656  1.00 60.50  ? 654  ASP A C     1 
ATOM   4515  O O     . ASP A  1 654 ? -18.358  -34.674 33.695  1.00 61.47  ? 654  ASP A O     1 
ATOM   4516  C CB    . ASP A  1 654 ? -19.265  -36.009 36.503  1.00 52.90  ? 654  ASP A CB    1 
ATOM   4517  C CG    . ASP A  1 654 ? -20.216  -37.094 36.968  1.00 67.26  ? 654  ASP A CG    1 
ATOM   4518  O OD1   . ASP A  1 654 ? -21.210  -37.364 36.253  1.00 67.10  ? 654  ASP A OD1   1 
ATOM   4519  O OD2   . ASP A  1 654 ? -19.989  -37.652 38.062  1.00 75.94  ? 654  ASP A OD2   1 
ATOM   4520  N N     . VAL A  1 655 ? -16.600  -34.779 35.134  1.00 59.04  ? 655  VAL A N     1 
ATOM   4521  C CA    . VAL A  1 655 ? -15.814  -33.630 34.698  1.00 59.34  ? 655  VAL A CA    1 
ATOM   4522  C C     . VAL A  1 655 ? -15.327  -33.709 33.238  1.00 65.81  ? 655  VAL A C     1 
ATOM   4523  O O     . VAL A  1 655 ? -15.001  -32.673 32.657  1.00 63.78  ? 655  VAL A O     1 
ATOM   4524  C CB    . VAL A  1 655 ? -14.667  -33.454 35.737  1.00 64.90  ? 655  VAL A CB    1 
ATOM   4525  C CG1   . VAL A  1 655 ? -13.258  -33.620 35.144  1.00 65.59  ? 655  VAL A CG1   1 
ATOM   4526  C CG2   . VAL A  1 655 ? -14.816  -32.163 36.518  1.00 64.11  ? 655  VAL A CG2   1 
ATOM   4527  N N     . GLU A  1 656 ? -15.274  -34.934 32.664  1.00 67.29  ? 656  GLU A N     1 
ATOM   4528  C CA    . GLU A  1 656 ? -14.766  -35.260 31.323  1.00 69.08  ? 656  GLU A CA    1 
ATOM   4529  C C     . GLU A  1 656 ? -15.262  -34.444 30.113  1.00 74.27  ? 656  GLU A C     1 
ATOM   4530  O O     . GLU A  1 656 ? -16.467  -34.458 29.790  1.00 73.39  ? 656  GLU A O     1 
ATOM   4531  C CB    . GLU A  1 656 ? -14.795  -36.771 31.054  1.00 72.01  ? 656  GLU A CB    1 
ATOM   4532  C CG    . GLU A  1 656 ? -13.710  -37.543 31.799  1.00 91.13  ? 656  GLU A CG    1 
ATOM   4533  C CD    . GLU A  1 656 ? -13.052  -38.668 31.018  1.00 126.02 ? 656  GLU A CD    1 
ATOM   4534  O OE1   . GLU A  1 656 ? -11.969  -38.441 30.425  1.00 120.45 ? 656  GLU A OE1   1 
ATOM   4535  O OE2   . GLU A  1 656 ? -13.627  -39.781 30.998  1.00 124.18 ? 656  GLU A OE2   1 
ATOM   4536  N N     . ASP A  1 657 ? -14.271  -33.750 29.438  1.00 70.28  ? 657  ASP A N     1 
ATOM   4537  C CA    . ASP A  1 657 ? -14.346  -32.891 28.235  1.00 68.09  ? 657  ASP A CA    1 
ATOM   4538  C C     . ASP A  1 657 ? -14.773  -31.426 28.459  1.00 69.83  ? 657  ASP A C     1 
ATOM   4539  O O     . ASP A  1 657 ? -14.815  -30.652 27.503  1.00 68.45  ? 657  ASP A O     1 
ATOM   4540  C CB    . ASP A  1 657 ? -15.087  -33.579 27.069  1.00 69.61  ? 657  ASP A CB    1 
ATOM   4541  C CG    . ASP A  1 657 ? -14.331  -34.759 26.462  1.00 83.42  ? 657  ASP A CG    1 
ATOM   4542  O OD1   . ASP A  1 657 ? -13.099  -34.623 26.217  1.00 83.37  ? 657  ASP A OD1   1 
ATOM   4543  O OD2   . ASP A  1 657 ? -14.979  -35.801 26.178  1.00 91.82  ? 657  ASP A OD2   1 
ATOM   4544  N N     . TRP A  1 658 ? -15.002  -31.041 29.738  1.00 66.00  ? 658  TRP A N     1 
ATOM   4545  C CA    . TRP A  1 658 ? -15.455  -29.720 30.208  1.00 64.40  ? 658  TRP A CA    1 
ATOM   4546  C C     . TRP A  1 658 ? -14.482  -28.528 30.018  1.00 65.62  ? 658  TRP A C     1 
ATOM   4547  O O     . TRP A  1 658 ? -14.953  -27.384 30.009  1.00 65.25  ? 658  TRP A O     1 
ATOM   4548  C CB    . TRP A  1 658 ? -15.928  -29.791 31.684  1.00 63.19  ? 658  TRP A CB    1 
ATOM   4549  C CG    . TRP A  1 658 ? -17.236  -30.499 31.952  1.00 64.12  ? 658  TRP A CG    1 
ATOM   4550  C CD1   . TRP A  1 658 ? -17.787  -31.528 31.237  1.00 67.33  ? 658  TRP A CD1   1 
ATOM   4551  C CD2   . TRP A  1 658 ? -18.090  -30.301 33.091  1.00 63.61  ? 658  TRP A CD2   1 
ATOM   4552  N NE1   . TRP A  1 658 ? -18.959  -31.946 31.833  1.00 66.77  ? 658  TRP A NE1   1 
ATOM   4553  C CE2   . TRP A  1 658 ? -19.171  -31.207 32.969  1.00 67.67  ? 658  TRP A CE2   1 
ATOM   4554  C CE3   . TRP A  1 658 ? -18.063  -29.425 34.189  1.00 64.29  ? 658  TRP A CE3   1 
ATOM   4555  C CZ2   . TRP A  1 658 ? -20.203  -31.271 33.913  1.00 66.78  ? 658  TRP A CZ2   1 
ATOM   4556  C CZ3   . TRP A  1 658 ? -19.101  -29.469 35.104  1.00 65.82  ? 658  TRP A CZ3   1 
ATOM   4557  C CH2   . TRP A  1 658 ? -20.158  -30.378 34.959  1.00 66.83  ? 658  TRP A CH2   1 
ATOM   4558  N N     . HIS A  1 659 ? -13.149  -28.779 29.901  1.00 59.34  ? 659  HIS A N     1 
ATOM   4559  C CA    . HIS A  1 659 ? -12.117  -27.735 29.721  1.00 57.84  ? 659  HIS A CA    1 
ATOM   4560  C C     . HIS A  1 659 ? -12.216  -27.028 28.350  1.00 60.83  ? 659  HIS A C     1 
ATOM   4561  O O     . HIS A  1 659 ? -11.677  -25.936 28.174  1.00 60.50  ? 659  HIS A O     1 
ATOM   4562  C CB    . HIS A  1 659 ? -10.712  -28.342 29.898  1.00 59.22  ? 659  HIS A CB    1 
ATOM   4563  C CG    . HIS A  1 659 ? -10.237  -29.158 28.724  1.00 63.09  ? 659  HIS A CG    1 
ATOM   4564  N ND1   . HIS A  1 659 ? -10.669  -30.461 28.522  1.00 65.46  ? 659  HIS A ND1   1 
ATOM   4565  C CD2   . HIS A  1 659 ? -9.385   -28.828 27.723  1.00 64.58  ? 659  HIS A CD2   1 
ATOM   4566  C CE1   . HIS A  1 659 ? -10.072  -30.875 27.415  1.00 64.69  ? 659  HIS A CE1   1 
ATOM   4567  N NE2   . HIS A  1 659 ? -9.298   -29.925 26.892  1.00 64.63  ? 659  HIS A NE2   1 
ATOM   4568  N N     . ASN A  1 660 ? -12.885  -27.694 27.387  1.00 56.89  ? 660  ASN A N     1 
ATOM   4569  C CA    . ASN A  1 660 ? -13.091  -27.335 25.986  1.00 55.76  ? 660  ASN A CA    1 
ATOM   4570  C C     . ASN A  1 660 ? -14.495  -26.794 25.718  1.00 60.70  ? 660  ASN A C     1 
ATOM   4571  O O     . ASN A  1 660 ? -14.649  -25.901 24.884  1.00 59.55  ? 660  ASN A O     1 
ATOM   4572  C CB    . ASN A  1 660 ? -12.896  -28.606 25.150  1.00 55.58  ? 660  ASN A CB    1 
ATOM   4573  C CG    . ASN A  1 660 ? -12.024  -28.436 23.942  1.00 88.87  ? 660  ASN A CG    1 
ATOM   4574  O OD1   . ASN A  1 660 ? -12.490  -28.514 22.799  1.00 89.32  ? 660  ASN A OD1   1 
ATOM   4575  N ND2   . ASN A  1 660 ? -10.728  -28.255 24.163  1.00 82.64  ? 660  ASN A ND2   1 
ATOM   4576  N N     . THR A  1 661 ? -15.526  -27.375 26.385  1.00 59.36  ? 661  THR A N     1 
ATOM   4577  C CA    . THR A  1 661 ? -16.956  -27.047 26.219  1.00 58.99  ? 661  THR A CA    1 
ATOM   4578  C C     . THR A  1 661 ? -17.422  -25.677 26.735  1.00 62.11  ? 661  THR A C     1 
ATOM   4579  O O     . THR A  1 661 ? -17.058  -25.256 27.830  1.00 61.82  ? 661  THR A O     1 
ATOM   4580  C CB    . THR A  1 661 ? -17.872  -28.191 26.716  1.00 66.56  ? 661  THR A CB    1 
ATOM   4581  O OG1   . THR A  1 661 ? -17.673  -28.393 28.113  1.00 70.77  ? 661  THR A OG1   1 
ATOM   4582  C CG2   . THR A  1 661 ? -17.663  -29.505 25.951  1.00 63.95  ? 661  THR A CG2   1 
ATOM   4583  N N     . GLY A  1 662 ? -18.256  -25.029 25.927  1.00 58.35  ? 662  GLY A N     1 
ATOM   4584  C CA    . GLY A  1 662 ? -18.890  -23.750 26.218  1.00 57.42  ? 662  GLY A CA    1 
ATOM   4585  C C     . GLY A  1 662 ? -20.247  -23.918 26.886  1.00 60.10  ? 662  GLY A C     1 
ATOM   4586  O O     . GLY A  1 662 ? -20.770  -25.037 26.974  1.00 60.60  ? 662  GLY A O     1 
ATOM   4587  N N     . GLY A  1 663 ? -20.819  -22.802 27.345  1.00 54.20  ? 663  GLY A N     1 
ATOM   4588  C CA    . GLY A  1 663 ? -22.095  -22.781 28.055  1.00 52.64  ? 663  GLY A CA    1 
ATOM   4589  C C     . GLY A  1 663 ? -22.017  -23.476 29.405  1.00 55.05  ? 663  GLY A C     1 
ATOM   4590  O O     . GLY A  1 663 ? -20.947  -23.506 30.040  1.00 55.16  ? 663  GLY A O     1 
ATOM   4591  N N     . SER A  1 664 ? -23.150  -24.074 29.832  1.00 49.01  ? 664  SER A N     1 
ATOM   4592  C CA    . SER A  1 664 ? -23.269  -24.788 31.099  1.00 47.87  ? 664  SER A CA    1 
ATOM   4593  C C     . SER A  1 664 ? -23.834  -26.208 30.930  1.00 49.08  ? 664  SER A C     1 
ATOM   4594  O O     . SER A  1 664 ? -24.819  -26.394 30.227  1.00 48.95  ? 664  SER A O     1 
ATOM   4595  C CB    . SER A  1 664 ? -24.123  -23.984 32.070  1.00 51.28  ? 664  SER A CB    1 
ATOM   4596  O OG    . SER A  1 664 ? -24.173  -24.596 33.345  1.00 62.60  ? 664  SER A OG    1 
ATOM   4597  N N     . GLU A  1 665 ? -23.194  -27.201 31.577  1.00 44.44  ? 665  GLU A N     1 
ATOM   4598  C CA    . GLU A  1 665 ? -23.578  -28.626 31.583  1.00 43.60  ? 665  GLU A CA    1 
ATOM   4599  C C     . GLU A  1 665 ? -24.609  -28.936 32.689  1.00 39.99  ? 665  GLU A C     1 
ATOM   4600  O O     . GLU A  1 665 ? -25.252  -30.006 32.694  1.00 38.19  ? 665  GLU A O     1 
ATOM   4601  C CB    . GLU A  1 665 ? -22.334  -29.517 31.789  1.00 46.02  ? 665  GLU A CB    1 
ATOM   4602  C CG    . GLU A  1 665 ? -21.430  -29.679 30.569  1.00 63.07  ? 665  GLU A CG    1 
ATOM   4603  C CD    . GLU A  1 665 ? -22.021  -30.279 29.305  1.00 93.84  ? 665  GLU A CD    1 
ATOM   4604  O OE1   . GLU A  1 665 ? -21.534  -29.911 28.212  1.00 90.46  ? 665  GLU A OE1   1 
ATOM   4605  O OE2   . GLU A  1 665 ? -22.956  -31.110 29.397  1.00 93.66  ? 665  GLU A OE2   1 
ATOM   4606  N N     . ILE A  1 666 ? -24.731  -27.988 33.629  1.00 31.51  ? 666  ILE A N     1 
ATOM   4607  C CA    . ILE A  1 666 ? -25.604  -28.044 34.793  1.00 29.71  ? 666  ILE A CA    1 
ATOM   4608  C C     . ILE A  1 666 ? -26.731  -27.017 34.646  1.00 31.34  ? 666  ILE A C     1 
ATOM   4609  O O     . ILE A  1 666 ? -27.760  -27.122 35.318  1.00 29.08  ? 666  ILE A O     1 
ATOM   4610  C CB    . ILE A  1 666 ? -24.774  -27.894 36.130  1.00 32.52  ? 666  ILE A CB    1 
ATOM   4611  C CG1   . ILE A  1 666 ? -24.193  -26.500 36.321  1.00 32.68  ? 666  ILE A CG1   1 
ATOM   4612  C CG2   . ILE A  1 666 ? -23.661  -28.924 36.231  1.00 31.82  ? 666  ILE A CG2   1 
ATOM   4613  C CD1   . ILE A  1 666 ? -24.167  -26.063 37.775  1.00 50.30  ? 666  ILE A CD1   1 
ATOM   4614  N N     . GLY A  1 667 ? -26.519  -26.034 33.767  1.00 28.94  ? 667  GLY A N     1 
ATOM   4615  C CA    . GLY A  1 667 ? -27.501  -24.994 33.470  1.00 28.95  ? 667  GLY A CA    1 
ATOM   4616  C C     . GLY A  1 667 ? -27.215  -23.698 34.170  1.00 32.33  ? 667  GLY A C     1 
ATOM   4617  O O     . GLY A  1 667 ? -26.891  -23.709 35.353  1.00 36.87  ? 667  GLY A O     1 
ATOM   4618  N N     . THR A  1 668 ? -27.343  -22.585 33.459  1.00 25.70  ? 668  THR A N     1 
ATOM   4619  C CA    . THR A  1 668 ? -27.087  -21.235 33.988  1.00 24.95  ? 668  THR A CA    1 
ATOM   4620  C C     . THR A  1 668 ? -28.257  -20.287 33.735  1.00 28.24  ? 668  THR A C     1 
ATOM   4621  O O     . THR A  1 668 ? -28.777  -20.231 32.614  1.00 26.44  ? 668  THR A O     1 
ATOM   4622  C CB    . THR A  1 668 ? -25.741  -20.691 33.445  1.00 30.60  ? 668  THR A CB    1 
ATOM   4623  O OG1   . THR A  1 668 ? -25.406  -19.481 34.098  1.00 32.72  ? 668  THR A OG1   1 
ATOM   4624  C CG2   . THR A  1 668 ? -25.722  -20.481 31.951  1.00 23.84  ? 668  THR A CG2   1 
ATOM   4625  N N     . ASN A  1 669 ? -28.694  -19.556 34.775  1.00 23.62  ? 669  ASN A N     1 
ATOM   4626  C CA    . ASN A  1 669 ? -29.777  -18.569 34.611  1.00 21.68  ? 669  ASN A CA    1 
ATOM   4627  C C     . ASN A  1 669 ? -29.726  -17.484 35.673  1.00 26.55  ? 669  ASN A C     1 
ATOM   4628  O O     . ASN A  1 669 ? -29.086  -17.674 36.721  1.00 27.55  ? 669  ASN A O     1 
ATOM   4629  C CB    . ASN A  1 669 ? -31.144  -19.202 34.440  1.00 14.03  ? 669  ASN A CB    1 
ATOM   4630  C CG    . ASN A  1 669 ? -31.758  -19.703 35.695  1.00 38.77  ? 669  ASN A CG    1 
ATOM   4631  O OD1   . ASN A  1 669 ? -32.210  -18.916 36.519  1.00 23.95  ? 669  ASN A OD1   1 
ATOM   4632  N ND2   . ASN A  1 669 ? -31.835  -21.027 35.845  1.00 37.75  ? 669  ASN A ND2   1 
ATOM   4633  N N     . ARG A  1 670 ? -30.354  -16.335 35.384  1.00 22.45  ? 670  ARG A N     1 
ATOM   4634  C CA    . ARG A  1 670 ? -30.352  -15.154 36.251  1.00 21.61  ? 670  ARG A CA    1 
ATOM   4635  C C     . ARG A  1 670 ? -31.419  -15.157 37.390  1.00 25.94  ? 670  ARG A C     1 
ATOM   4636  O O     . ARG A  1 670 ? -31.672  -14.087 37.968  1.00 29.11  ? 670  ARG A O     1 
ATOM   4637  C CB    . ARG A  1 670 ? -30.466  -13.852 35.425  1.00 20.57  ? 670  ARG A CB    1 
ATOM   4638  C CG    . ARG A  1 670 ? -29.532  -13.692 34.225  1.00 27.91  ? 670  ARG A CG    1 
ATOM   4639  C CD    . ARG A  1 670 ? -30.083  -12.592 33.336  1.00 25.13  ? 670  ARG A CD    1 
ATOM   4640  N NE    . ARG A  1 670 ? -29.238  -12.249 32.188  1.00 16.99  ? 670  ARG A NE    1 
ATOM   4641  C CZ    . ARG A  1 670 ? -28.273  -11.334 32.212  1.00 48.53  ? 670  ARG A CZ    1 
ATOM   4642  N NH1   . ARG A  1 670 ? -27.954  -10.723 33.349  1.00 47.34  ? 670  ARG A NH1   1 
ATOM   4643  N NH2   . ARG A  1 670 ? -27.590  -11.053 31.112  1.00 40.29  ? 670  ARG A NH2   1 
ATOM   4644  N N     . SER A  1 671 ? -32.037  -16.322 37.730  1.00 17.97  ? 671  SER A N     1 
ATOM   4645  C CA    . SER A  1 671 ? -32.981  -16.389 38.853  1.00 17.48  ? 671  SER A CA    1 
ATOM   4646  C C     . SER A  1 671 ? -32.225  -16.120 40.172  1.00 26.84  ? 671  SER A C     1 
ATOM   4647  O O     . SER A  1 671 ? -31.030  -16.430 40.280  1.00 27.87  ? 671  SER A O     1 
ATOM   4648  C CB    . SER A  1 671 ? -33.662  -17.744 38.918  1.00 18.95  ? 671  SER A CB    1 
ATOM   4649  O OG    . SER A  1 671 ? -32.731  -18.803 39.053  1.00 31.50  ? 671  SER A OG    1 
ATOM   4650  N N     . LEU A  1 672 ? -32.901  -15.515 41.156  1.00 25.17  ? 672  LEU A N     1 
ATOM   4651  C CA    . LEU A  1 672 ? -32.257  -15.155 42.416  1.00 25.00  ? 672  LEU A CA    1 
ATOM   4652  C C     . LEU A  1 672 ? -32.774  -15.922 43.636  1.00 33.73  ? 672  LEU A C     1 
ATOM   4653  O O     . LEU A  1 672 ? -33.940  -16.318 43.628  1.00 34.63  ? 672  LEU A O     1 
ATOM   4654  C CB    . LEU A  1 672 ? -32.338  -13.635 42.636  1.00 24.37  ? 672  LEU A CB    1 
ATOM   4655  C CG    . LEU A  1 672 ? -31.543  -12.743 41.657  1.00 25.75  ? 672  LEU A CG    1 
ATOM   4656  C CD1   . LEU A  1 672 ? -31.822  -11.301 41.935  1.00 24.98  ? 672  LEU A CD1   1 
ATOM   4657  C CD2   . LEU A  1 672 ? -30.060  -12.992 41.748  1.00 25.15  ? 672  LEU A CD2   1 
ATOM   4658  N N     . PRO A  1 673 ? -31.967  -16.128 44.723  1.00 32.42  ? 673  PRO A N     1 
ATOM   4659  C CA    . PRO A  1 673 ? -32.495  -16.859 45.893  1.00 33.36  ? 673  PRO A CA    1 
ATOM   4660  C C     . PRO A  1 673 ? -33.728  -16.190 46.488  1.00 39.44  ? 673  PRO A C     1 
ATOM   4661  O O     . PRO A  1 673 ? -34.528  -16.864 47.111  1.00 40.77  ? 673  PRO A O     1 
ATOM   4662  C CB    . PRO A  1 673 ? -31.316  -16.886 46.862  1.00 35.53  ? 673  PRO A CB    1 
ATOM   4663  C CG    . PRO A  1 673 ? -30.422  -15.785 46.423  1.00 39.37  ? 673  PRO A CG    1 
ATOM   4664  C CD    . PRO A  1 673 ? -30.573  -15.699 44.949  1.00 33.96  ? 673  PRO A CD    1 
ATOM   4665  N N     . SER A  1 674 ? -33.899  -14.879 46.216  1.00 36.39  ? 674  SER A N     1 
ATOM   4666  C CA    . SER A  1 674 ? -35.005  -13.999 46.581  1.00 36.85  ? 674  SER A CA    1 
ATOM   4667  C C     . SER A  1 674 ? -36.308  -14.642 46.270  1.00 42.02  ? 674  SER A C     1 
ATOM   4668  O O     . SER A  1 674 ? -37.255  -14.489 47.043  1.00 43.95  ? 674  SER A O     1 
ATOM   4669  C CB    . SER A  1 674 ? -34.952  -12.727 45.748  1.00 40.74  ? 674  SER A CB    1 
ATOM   4670  O OG    . SER A  1 674 ? -33.922  -11.871 46.203  1.00 49.63  ? 674  SER A OG    1 
ATOM   4671  N N     . ASP A  1 675 ? -36.365  -15.338 45.111  1.00 37.09  ? 675  ASP A N     1 
ATOM   4672  C CA    . ASP A  1 675 ? -37.535  -16.032 44.587  1.00 37.04  ? 675  ASP A CA    1 
ATOM   4673  C C     . ASP A  1 675 ? -38.243  -16.865 45.672  1.00 40.74  ? 675  ASP A C     1 
ATOM   4674  O O     . ASP A  1 675 ? -39.478  -16.848 45.719  1.00 42.77  ? 675  ASP A O     1 
ATOM   4675  C CB    . ASP A  1 675 ? -37.170  -16.837 43.324  1.00 39.01  ? 675  ASP A CB    1 
ATOM   4676  C CG    . ASP A  1 675 ? -36.569  -16.019 42.170  1.00 59.09  ? 675  ASP A CG    1 
ATOM   4677  O OD1   . ASP A  1 675 ? -36.246  -14.815 42.383  1.00 62.98  ? 675  ASP A OD1   1 
ATOM   4678  O OD2   . ASP A  1 675 ? -36.345  -16.602 41.082  1.00 64.70  ? 675  ASP A OD2   1 
ATOM   4679  N N     . ASP A  1 676 ? -37.461  -17.464 46.620  1.00 33.93  ? 676  ASP A N     1 
ATOM   4680  C CA    . ASP A  1 676 ? -37.909  -18.200 47.809  1.00 33.39  ? 676  ASP A CA    1 
ATOM   4681  C C     . ASP A  1 676 ? -36.696  -18.550 48.694  1.00 34.89  ? 676  ASP A C     1 
ATOM   4682  O O     . ASP A  1 676 ? -36.091  -19.614 48.495  1.00 34.96  ? 676  ASP A O     1 
ATOM   4683  C CB    . ASP A  1 676 ? -38.683  -19.482 47.425  1.00 36.06  ? 676  ASP A CB    1 
ATOM   4684  C CG    . ASP A  1 676 ? -39.625  -20.084 48.469  1.00 51.99  ? 676  ASP A CG    1 
ATOM   4685  O OD1   . ASP A  1 676 ? -40.588  -20.783 48.065  1.00 53.51  ? 676  ASP A OD1   1 
ATOM   4686  O OD2   . ASP A  1 676 ? -39.361  -19.921 49.686  1.00 61.23  ? 676  ASP A OD2   1 
ATOM   4687  N N     . MET A  1 677 ? -36.336  -17.673 49.669  1.00 28.48  ? 677  MET A N     1 
ATOM   4688  C CA    . MET A  1 677 ? -35.198  -17.966 50.557  1.00 27.47  ? 677  MET A CA    1 
ATOM   4689  C C     . MET A  1 677 ? -35.437  -19.233 51.335  1.00 32.57  ? 677  MET A C     1 
ATOM   4690  O O     . MET A  1 677 ? -34.555  -20.088 51.395  1.00 31.17  ? 677  MET A O     1 
ATOM   4691  C CB    . MET A  1 677 ? -34.963  -16.851 51.565  1.00 30.00  ? 677  MET A CB    1 
ATOM   4692  C CG    . MET A  1 677 ? -34.009  -15.831 51.110  1.00 33.00  ? 677  MET A CG    1 
ATOM   4693  S SD    . MET A  1 677 ? -32.392  -16.442 50.668  1.00 36.55  ? 677  MET A SD    1 
ATOM   4694  C CE    . MET A  1 677 ? -31.723  -14.971 49.926  1.00 32.86  ? 677  MET A CE    1 
ATOM   4695  N N     . GLY A  1 678 ? -36.631  -19.332 51.927  1.00 30.70  ? 678  GLY A N     1 
ATOM   4696  C CA    . GLY A  1 678 ? -37.063  -20.470 52.721  1.00 31.54  ? 678  GLY A CA    1 
ATOM   4697  C C     . GLY A  1 678 ? -36.760  -21.786 52.049  1.00 36.28  ? 678  GLY A C     1 
ATOM   4698  O O     . GLY A  1 678 ? -36.161  -22.663 52.676  1.00 38.43  ? 678  GLY A O     1 
ATOM   4699  N N     . THR A  1 679 ? -37.112  -21.902 50.743  1.00 30.62  ? 679  THR A N     1 
ATOM   4700  C CA    . THR A  1 679 ? -36.873  -23.106 49.949  1.00 30.11  ? 679  THR A CA    1 
ATOM   4701  C C     . THR A  1 679 ? -35.399  -23.341 49.719  1.00 35.43  ? 679  THR A C     1 
ATOM   4702  O O     . THR A  1 679 ? -34.962  -24.482 49.877  1.00 37.68  ? 679  THR A O     1 
ATOM   4703  C CB    . THR A  1 679 ? -37.750  -23.131 48.710  1.00 32.30  ? 679  THR A CB    1 
ATOM   4704  O OG1   . THR A  1 679 ? -39.084  -23.120 49.170  1.00 30.29  ? 679  THR A OG1   1 
ATOM   4705  C CG2   . THR A  1 679 ? -37.576  -24.390 47.895  1.00 29.40  ? 679  THR A CG2   1 
ATOM   4706  N N     . VAL A  1 680 ? -34.632  -22.274 49.398  1.00 29.91  ? 680  VAL A N     1 
ATOM   4707  C CA    . VAL A  1 680 ? -33.175  -22.353 49.216  1.00 28.53  ? 680  VAL A CA    1 
ATOM   4708  C C     . VAL A  1 680 ? -32.571  -22.864 50.538  1.00 33.49  ? 680  VAL A C     1 
ATOM   4709  O O     . VAL A  1 680 ? -31.839  -23.865 50.531  1.00 33.05  ? 680  VAL A O     1 
ATOM   4710  C CB    . VAL A  1 680 ? -32.532  -21.010 48.779  1.00 31.05  ? 680  VAL A CB    1 
ATOM   4711  C CG1   . VAL A  1 680 ? -31.021  -21.122 48.737  1.00 30.26  ? 680  VAL A CG1   1 
ATOM   4712  C CG2   . VAL A  1 680 ? -33.072  -20.523 47.432  1.00 30.02  ? 680  VAL A CG2   1 
ATOM   4713  N N     . ALA A  1 681 ? -32.968  -22.231 51.677  1.00 30.60  ? 681  ALA A N     1 
ATOM   4714  C CA    . ALA A  1 681 ? -32.507  -22.590 53.035  1.00 30.15  ? 681  ALA A CA    1 
ATOM   4715  C C     . ALA A  1 681 ? -32.882  -24.006 53.452  1.00 33.10  ? 681  ALA A C     1 
ATOM   4716  O O     . ALA A  1 681 ? -32.096  -24.654 54.135  1.00 35.49  ? 681  ALA A O     1 
ATOM   4717  C CB    . ALA A  1 681 ? -32.996  -21.588 54.049  1.00 30.80  ? 681  ALA A CB    1 
ATOM   4718  N N     . TYR A  1 682 ? -34.050  -24.499 53.011  1.00 25.89  ? 682  TYR A N     1 
ATOM   4719  C CA    . TYR A  1 682 ? -34.491  -25.856 53.288  1.00 25.65  ? 682  TYR A CA    1 
ATOM   4720  C C     . TYR A  1 682 ? -33.496  -26.823 52.612  1.00 29.81  ? 682  TYR A C     1 
ATOM   4721  O O     . TYR A  1 682 ? -33.010  -27.775 53.228  1.00 26.17  ? 682  TYR A O     1 
ATOM   4722  C CB    . TYR A  1 682 ? -35.936  -26.068 52.737  1.00 26.40  ? 682  TYR A CB    1 
ATOM   4723  C CG    . TYR A  1 682 ? -36.333  -27.533 52.635  1.00 29.04  ? 682  TYR A CG    1 
ATOM   4724  C CD1   . TYR A  1 682 ? -35.984  -28.297 51.520  1.00 29.92  ? 682  TYR A CD1   1 
ATOM   4725  C CD2   . TYR A  1 682 ? -37.007  -28.171 53.679  1.00 30.25  ? 682  TYR A CD2   1 
ATOM   4726  C CE1   . TYR A  1 682 ? -36.275  -29.659 51.456  1.00 28.85  ? 682  TYR A CE1   1 
ATOM   4727  C CE2   . TYR A  1 682 ? -37.325  -29.529 53.613  1.00 30.70  ? 682  TYR A CE2   1 
ATOM   4728  C CZ    . TYR A  1 682 ? -36.947  -30.267 52.505  1.00 36.12  ? 682  TYR A CZ    1 
ATOM   4729  O OH    . TYR A  1 682 ? -37.247  -31.599 52.454  1.00 43.03  ? 682  TYR A OH    1 
ATOM   4730  N N     . TYR A  1 683 ? -33.222  -26.567 51.318  1.00 30.12  ? 683  TYR A N     1 
ATOM   4731  C CA    . TYR A  1 683 ? -32.354  -27.411 50.498  1.00 29.94  ? 683  TYR A CA    1 
ATOM   4732  C C     . TYR A  1 683 ? -30.934  -27.379 50.919  1.00 32.81  ? 683  TYR A C     1 
ATOM   4733  O O     . TYR A  1 683 ? -30.279  -28.417 50.822  1.00 33.24  ? 683  TYR A O     1 
ATOM   4734  C CB    . TYR A  1 683 ? -32.477  -27.121 48.996  1.00 29.87  ? 683  TYR A CB    1 
ATOM   4735  C CG    . TYR A  1 683 ? -33.689  -27.746 48.355  1.00 31.93  ? 683  TYR A CG    1 
ATOM   4736  C CD1   . TYR A  1 683 ? -33.830  -29.127 48.286  1.00 34.82  ? 683  TYR A CD1   1 
ATOM   4737  C CD2   . TYR A  1 683 ? -34.687  -26.958 47.792  1.00 32.57  ? 683  TYR A CD2   1 
ATOM   4738  C CE1   . TYR A  1 683 ? -34.960  -29.707 47.717  1.00 37.22  ? 683  TYR A CE1   1 
ATOM   4739  C CE2   . TYR A  1 683 ? -35.817  -27.527 47.213  1.00 33.64  ? 683  TYR A CE2   1 
ATOM   4740  C CZ    . TYR A  1 683 ? -35.943  -28.900 47.170  1.00 40.36  ? 683  TYR A CZ    1 
ATOM   4741  O OH    . TYR A  1 683 ? -37.036  -29.442 46.563  1.00 43.74  ? 683  TYR A OH    1 
ATOM   4742  N N     . PHE A  1 684 ? -30.439  -26.211 51.380  1.00 26.83  ? 684  PHE A N     1 
ATOM   4743  C CA    . PHE A  1 684 ? -29.053  -26.111 51.826  1.00 25.99  ? 684  PHE A CA    1 
ATOM   4744  C C     . PHE A  1 684 ? -28.878  -27.017 53.063  1.00 34.02  ? 684  PHE A C     1 
ATOM   4745  O O     . PHE A  1 684 ? -27.905  -27.780 53.147  1.00 33.16  ? 684  PHE A O     1 
ATOM   4746  C CB    . PHE A  1 684 ? -28.684  -24.643 52.099  1.00 26.62  ? 684  PHE A CB    1 
ATOM   4747  C CG    . PHE A  1 684 ? -28.119  -23.896 50.901  1.00 26.65  ? 684  PHE A CG    1 
ATOM   4748  C CD1   . PHE A  1 684 ? -26.975  -23.112 51.023  1.00 27.72  ? 684  PHE A CD1   1 
ATOM   4749  C CD2   . PHE A  1 684 ? -28.732  -23.980 49.644  1.00 27.26  ? 684  PHE A CD2   1 
ATOM   4750  C CE1   . PHE A  1 684 ? -26.453  -22.431 49.911  1.00 27.02  ? 684  PHE A CE1   1 
ATOM   4751  C CE2   . PHE A  1 684 ? -28.198  -23.313 48.533  1.00 27.08  ? 684  PHE A CE2   1 
ATOM   4752  C CZ    . PHE A  1 684 ? -27.062  -22.547 48.672  1.00 24.47  ? 684  PHE A CZ    1 
ATOM   4753  N N     . GLN A  1 685 ? -29.903  -27.018 53.950  1.00 32.60  ? 685  GLN A N     1 
ATOM   4754  C CA    . GLN A  1 685 ? -29.942  -27.816 55.173  1.00 33.90  ? 685  GLN A CA    1 
ATOM   4755  C C     . GLN A  1 685 ? -30.025  -29.309 54.898  1.00 40.86  ? 685  GLN A C     1 
ATOM   4756  O O     . GLN A  1 685 ? -29.402  -30.091 55.624  1.00 42.73  ? 685  GLN A O     1 
ATOM   4757  C CB    . GLN A  1 685 ? -31.079  -27.357 56.102  1.00 35.15  ? 685  GLN A CB    1 
ATOM   4758  C CG    . GLN A  1 685 ? -31.347  -28.330 57.257  1.00 21.01  ? 685  GLN A CG    1 
ATOM   4759  C CD    . GLN A  1 685 ? -32.197  -27.737 58.340  1.00 38.17  ? 685  GLN A CD    1 
ATOM   4760  O OE1   . GLN A  1 685 ? -32.387  -26.523 58.431  1.00 41.31  ? 685  GLN A OE1   1 
ATOM   4761  N NE2   . GLN A  1 685 ? -32.660  -28.569 59.238  1.00 22.19  ? 685  GLN A NE2   1 
ATOM   4762  N N     . GLN A  1 686 ? -30.835  -29.707 53.901  1.00 37.62  ? 686  GLN A N     1 
ATOM   4763  C CA    . GLN A  1 686 ? -31.044  -31.120 53.543  1.00 37.49  ? 686  GLN A CA    1 
ATOM   4764  C C     . GLN A  1 686 ? -29.773  -31.744 53.027  1.00 43.05  ? 686  GLN A C     1 
ATOM   4765  O O     . GLN A  1 686 ? -29.370  -32.795 53.522  1.00 44.03  ? 686  GLN A O     1 
ATOM   4766  C CB    . GLN A  1 686 ? -32.147  -31.271 52.506  1.00 37.81  ? 686  GLN A CB    1 
ATOM   4767  C CG    . GLN A  1 686 ? -33.524  -31.096 53.089  1.00 52.87  ? 686  GLN A CG    1 
ATOM   4768  C CD    . GLN A  1 686 ? -33.959  -32.300 53.859  1.00 67.52  ? 686  GLN A CD    1 
ATOM   4769  O OE1   . GLN A  1 686 ? -33.869  -33.429 53.373  1.00 65.29  ? 686  GLN A OE1   1 
ATOM   4770  N NE2   . GLN A  1 686 ? -34.468  -32.079 55.065  1.00 58.32  ? 686  GLN A NE2   1 
ATOM   4771  N N     . TYR A  1 687 ? -29.124  -31.071 52.055  1.00 40.01  ? 687  TYR A N     1 
ATOM   4772  C CA    . TYR A  1 687 ? -27.876  -31.492 51.438  1.00 39.74  ? 687  TYR A CA    1 
ATOM   4773  C C     . TYR A  1 687 ? -26.668  -31.138 52.285  1.00 41.68  ? 687  TYR A C     1 
ATOM   4774  O O     . TYR A  1 687 ? -25.566  -31.563 51.958  1.00 41.47  ? 687  TYR A O     1 
ATOM   4775  C CB    . TYR A  1 687 ? -27.759  -30.954 50.027  1.00 41.28  ? 687  TYR A CB    1 
ATOM   4776  C CG    . TYR A  1 687 ? -28.767  -31.552 49.082  1.00 45.82  ? 687  TYR A CG    1 
ATOM   4777  C CD1   . TYR A  1 687 ? -28.433  -32.626 48.266  1.00 48.57  ? 687  TYR A CD1   1 
ATOM   4778  C CD2   . TYR A  1 687 ? -30.052  -31.030 48.984  1.00 48.43  ? 687  TYR A CD2   1 
ATOM   4779  C CE1   . TYR A  1 687 ? -29.366  -33.190 47.392  1.00 51.03  ? 687  TYR A CE1   1 
ATOM   4780  C CE2   . TYR A  1 687 ? -30.996  -31.587 48.120  1.00 51.29  ? 687  TYR A CE2   1 
ATOM   4781  C CZ    . TYR A  1 687 ? -30.647  -32.660 47.316  1.00 63.48  ? 687  TYR A CZ    1 
ATOM   4782  O OH    . TYR A  1 687 ? -31.582  -33.167 46.437  1.00 69.64  ? 687  TYR A OH    1 
ATOM   4783  N N     . LYS A  1 688 ? -26.874  -30.406 53.394  1.00 37.92  ? 688  LYS A N     1 
ATOM   4784  C CA    . LYS A  1 688 ? -25.834  -30.077 54.369  1.00 38.36  ? 688  LYS A CA    1 
ATOM   4785  C C     . LYS A  1 688 ? -24.561  -29.468 53.708  1.00 42.39  ? 688  LYS A C     1 
ATOM   4786  O O     . LYS A  1 688 ? -23.449  -29.981 53.872  1.00 44.16  ? 688  LYS A O     1 
ATOM   4787  C CB    . LYS A  1 688 ? -25.545  -31.321 55.257  1.00 41.98  ? 688  LYS A CB    1 
ATOM   4788  C CG    . LYS A  1 688 ? -26.726  -31.730 56.155  1.00 65.95  ? 688  LYS A CG    1 
ATOM   4789  C CD    . LYS A  1 688 ? -26.556  -33.097 56.867  1.00 86.24  ? 688  LYS A CD    1 
ATOM   4790  C CE    . LYS A  1 688 ? -27.718  -33.388 57.812  1.00 92.72  ? 688  LYS A CE    1 
ATOM   4791  N NZ    . LYS A  1 688 ? -27.501  -34.594 58.667  1.00 84.73  ? 688  LYS A NZ    1 
ATOM   4792  N N     . PHE A  1 689 ? -24.747  -28.390 52.937  1.00 36.88  ? 689  PHE A N     1 
ATOM   4793  C CA    . PHE A  1 689 ? -23.656  -27.722 52.237  1.00 36.94  ? 689  PHE A CA    1 
ATOM   4794  C C     . PHE A  1 689 ? -22.786  -26.958 53.200  1.00 44.19  ? 689  PHE A C     1 
ATOM   4795  O O     . PHE A  1 689 ? -23.292  -26.223 54.042  1.00 44.50  ? 689  PHE A O     1 
ATOM   4796  C CB    . PHE A  1 689 ? -24.187  -26.774 51.150  1.00 37.92  ? 689  PHE A CB    1 
ATOM   4797  C CG    . PHE A  1 689 ? -24.956  -27.432 50.025  1.00 38.80  ? 689  PHE A CG    1 
ATOM   4798  C CD1   . PHE A  1 689 ? -24.490  -28.602 49.429  1.00 41.76  ? 689  PHE A CD1   1 
ATOM   4799  C CD2   . PHE A  1 689 ? -26.132  -26.868 49.543  1.00 39.80  ? 689  PHE A CD2   1 
ATOM   4800  C CE1   . PHE A  1 689 ? -25.199  -29.205 48.385  1.00 42.01  ? 689  PHE A CE1   1 
ATOM   4801  C CE2   . PHE A  1 689 ? -26.823  -27.458 48.479  1.00 42.39  ? 689  PHE A CE2   1 
ATOM   4802  C CZ    . PHE A  1 689 ? -26.348  -28.618 47.901  1.00 40.31  ? 689  PHE A CZ    1 
ATOM   4803  N N     . ASP A  1 690 ? -21.475  -27.132 53.086  1.00 42.67  ? 690  ASP A N     1 
ATOM   4804  C CA    . ASP A  1 690 ? -20.518  -26.473 53.975  1.00 42.74  ? 690  ASP A CA    1 
ATOM   4805  C C     . ASP A  1 690 ? -19.761  -25.330 53.276  1.00 47.09  ? 690  ASP A C     1 
ATOM   4806  O O     . ASP A  1 690 ? -18.949  -24.661 53.917  1.00 48.20  ? 690  ASP A O     1 
ATOM   4807  C CB    . ASP A  1 690 ? -19.554  -27.511 54.590  1.00 44.47  ? 690  ASP A CB    1 
ATOM   4808  C CG    . ASP A  1 690 ? -20.253  -28.730 55.163  1.00 49.79  ? 690  ASP A CG    1 
ATOM   4809  O OD1   . ASP A  1 690 ? -20.957  -28.585 56.182  1.00 52.53  ? 690  ASP A OD1   1 
ATOM   4810  O OD2   . ASP A  1 690 ? -20.099  -29.828 54.588  1.00 50.37  ? 690  ASP A OD2   1 
ATOM   4811  N N     . GLY A  1 691 ? -20.037  -25.126 51.984  1.00 41.74  ? 691  GLY A N     1 
ATOM   4812  C CA    . GLY A  1 691 ? -19.406  -24.106 51.148  1.00 40.29  ? 691  GLY A CA    1 
ATOM   4813  C C     . GLY A  1 691 ? -20.131  -23.956 49.832  1.00 43.90  ? 691  GLY A C     1 
ATOM   4814  O O     . GLY A  1 691 ? -20.768  -24.912 49.364  1.00 42.73  ? 691  GLY A O     1 
ATOM   4815  N N     . LEU A  1 692 ? -20.068  -22.747 49.229  1.00 40.46  ? 692  LEU A N     1 
ATOM   4816  C CA    . LEU A  1 692 ? -20.776  -22.468 47.961  1.00 38.36  ? 692  LEU A CA    1 
ATOM   4817  C C     . LEU A  1 692 ? -20.002  -21.571 47.004  1.00 38.39  ? 692  LEU A C     1 
ATOM   4818  O O     . LEU A  1 692 ? -19.464  -20.549 47.440  1.00 41.09  ? 692  LEU A O     1 
ATOM   4819  C CB    . LEU A  1 692 ? -22.170  -21.879 48.261  1.00 38.32  ? 692  LEU A CB    1 
ATOM   4820  C CG    . LEU A  1 692 ? -22.981  -21.274 47.115  1.00 42.73  ? 692  LEU A CG    1 
ATOM   4821  C CD1   . LEU A  1 692 ? -23.612  -22.346 46.255  1.00 43.44  ? 692  LEU A CD1   1 
ATOM   4822  C CD2   . LEU A  1 692 ? -24.059  -20.372 47.653  1.00 44.37  ? 692  LEU A CD2   1 
ATOM   4823  N N     . ILE A  1 693 ? -19.954  -21.951 45.708  1.00 28.98  ? 693  ILE A N     1 
ATOM   4824  C CA    . ILE A  1 693 ? -19.308  -21.171 44.639  1.00 27.03  ? 693  ILE A CA    1 
ATOM   4825  C C     . ILE A  1 693 ? -20.368  -20.764 43.635  1.00 29.53  ? 693  ILE A C     1 
ATOM   4826  O O     . ILE A  1 693 ? -20.942  -21.614 42.965  1.00 29.56  ? 693  ILE A O     1 
ATOM   4827  C CB    . ILE A  1 693 ? -18.111  -21.870 43.941  1.00 30.04  ? 693  ILE A CB    1 
ATOM   4828  C CG1   . ILE A  1 693 ? -17.146  -22.504 44.976  1.00 32.87  ? 693  ILE A CG1   1 
ATOM   4829  C CG2   . ILE A  1 693 ? -17.389  -20.858 43.045  1.00 29.59  ? 693  ILE A CG2   1 
ATOM   4830  C CD1   . ILE A  1 693 ? -15.955  -23.355 44.464  1.00 38.90  ? 693  ILE A CD1   1 
ATOM   4831  N N     . ILE A  1 694 ? -20.636  -19.466 43.543  1.00 25.97  ? 694  ILE A N     1 
ATOM   4832  C CA    . ILE A  1 694 ? -21.622  -18.900 42.620  1.00 24.45  ? 694  ILE A CA    1 
ATOM   4833  C C     . ILE A  1 694 ? -20.859  -18.342 41.420  1.00 33.38  ? 694  ILE A C     1 
ATOM   4834  O O     . ILE A  1 694 ? -20.321  -17.235 41.494  1.00 35.42  ? 694  ILE A O     1 
ATOM   4835  C CB    . ILE A  1 694 ? -22.486  -17.814 43.302  1.00 25.37  ? 694  ILE A CB    1 
ATOM   4836  C CG1   . ILE A  1 694 ? -22.881  -18.222 44.743  1.00 26.26  ? 694  ILE A CG1   1 
ATOM   4837  C CG2   . ILE A  1 694 ? -23.694  -17.504 42.452  1.00 22.56  ? 694  ILE A CG2   1 
ATOM   4838  C CD1   . ILE A  1 694 ? -23.552  -17.144 45.603  1.00 27.79  ? 694  ILE A CD1   1 
ATOM   4839  N N     . ILE A  1 695 ? -20.759  -19.130 40.336  1.00 29.82  ? 695  ILE A N     1 
ATOM   4840  C CA    . ILE A  1 695 ? -20.083  -18.683 39.113  1.00 28.07  ? 695  ILE A CA    1 
ATOM   4841  C C     . ILE A  1 695 ? -21.111  -17.946 38.277  1.00 33.49  ? 695  ILE A C     1 
ATOM   4842  O O     . ILE A  1 695 ? -22.157  -18.507 37.936  1.00 35.04  ? 695  ILE A O     1 
ATOM   4843  C CB    . ILE A  1 695 ? -19.410  -19.819 38.308  1.00 29.47  ? 695  ILE A CB    1 
ATOM   4844  C CG1   . ILE A  1 695 ? -18.676  -20.800 39.233  1.00 30.42  ? 695  ILE A CG1   1 
ATOM   4845  C CG2   . ILE A  1 695 ? -18.454  -19.229 37.273  1.00 27.60  ? 695  ILE A CG2   1 
ATOM   4846  C CD1   . ILE A  1 695 ? -18.458  -22.190 38.627  1.00 43.39  ? 695  ILE A CD1   1 
ATOM   4847  N N     . GLY A  1 696 ? -20.815  -16.696 37.967  1.00 29.39  ? 696  GLY A N     1 
ATOM   4848  C CA    . GLY A  1 696 ? -21.696  -15.885 37.150  1.00 28.83  ? 696  GLY A CA    1 
ATOM   4849  C C     . GLY A  1 696 ? -21.413  -14.400 37.130  1.00 34.20  ? 696  GLY A C     1 
ATOM   4850  O O     . GLY A  1 696 ? -20.315  -13.951 37.483  1.00 35.73  ? 696  GLY A O     1 
ATOM   4851  N N     . GLY A  1 697 ? -22.424  -13.649 36.708  1.00 29.75  ? 697  GLY A N     1 
ATOM   4852  C CA    . GLY A  1 697 ? -22.347  -12.212 36.511  1.00 29.54  ? 697  GLY A CA    1 
ATOM   4853  C C     . GLY A  1 697 ? -22.846  -11.358 37.650  1.00 33.27  ? 697  GLY A C     1 
ATOM   4854  O O     . GLY A  1 697 ? -22.550  -11.618 38.823  1.00 33.50  ? 697  GLY A O     1 
ATOM   4855  N N     . PHE A  1 698 ? -23.554  -10.284 37.293  1.00 27.87  ? 698  PHE A N     1 
ATOM   4856  C CA    . PHE A  1 698 ? -24.102  -9.367  38.267  1.00 26.29  ? 698  PHE A CA    1 
ATOM   4857  C C     . PHE A  1 698 ? -25.133  -10.047 39.165  1.00 32.34  ? 698  PHE A C     1 
ATOM   4858  O O     . PHE A  1 698 ? -25.227  -9.679  40.337  1.00 33.85  ? 698  PHE A O     1 
ATOM   4859  C CB    . PHE A  1 698 ? -24.681  -8.126  37.587  1.00 26.52  ? 698  PHE A CB    1 
ATOM   4860  C CG    . PHE A  1 698 ? -24.723  -6.954  38.528  1.00 26.81  ? 698  PHE A CG    1 
ATOM   4861  C CD1   . PHE A  1 698 ? -25.869  -6.675  39.262  1.00 28.60  ? 698  PHE A CD1   1 
ATOM   4862  C CD2   . PHE A  1 698 ? -23.596  -6.164  38.728  1.00 27.00  ? 698  PHE A CD2   1 
ATOM   4863  C CE1   . PHE A  1 698 ? -25.893  -5.623  40.161  1.00 29.07  ? 698  PHE A CE1   1 
ATOM   4864  C CE2   . PHE A  1 698 ? -23.617  -5.126  39.646  1.00 29.56  ? 698  PHE A CE2   1 
ATOM   4865  C CZ    . PHE A  1 698 ? -24.766  -4.857  40.348  1.00 28.02  ? 698  PHE A CZ    1 
ATOM   4866  N N     . GLU A  1 699 ? -25.876  -11.056 38.639  1.00 27.88  ? 699  GLU A N     1 
ATOM   4867  C CA    . GLU A  1 699 ? -26.848  -11.809 39.435  1.00 27.64  ? 699  GLU A CA    1 
ATOM   4868  C C     . GLU A  1 699 ? -26.152  -12.780 40.406  1.00 29.56  ? 699  GLU A C     1 
ATOM   4869  O O     . GLU A  1 699 ? -26.685  -13.035 41.481  1.00 30.72  ? 699  GLU A O     1 
ATOM   4870  C CB    . GLU A  1 699 ? -27.881  -12.514 38.562  1.00 29.09  ? 699  GLU A CB    1 
ATOM   4871  C CG    . GLU A  1 699 ? -29.029  -11.619 38.126  1.00 42.93  ? 699  GLU A CG    1 
ATOM   4872  C CD    . GLU A  1 699 ? -28.682  -10.603 37.058  1.00 82.00  ? 699  GLU A CD    1 
ATOM   4873  O OE1   . GLU A  1 699 ? -28.045  -10.992 36.049  1.00 81.46  ? 699  GLU A OE1   1 
ATOM   4874  O OE2   . GLU A  1 699 ? -29.023  -9.410  37.247  1.00 80.67  ? 699  GLU A OE2   1 
ATOM   4875  N N     . ALA A  1 700 ? -24.954  -13.281 40.057  1.00 22.78  ? 700  ALA A N     1 
ATOM   4876  C CA    . ALA A  1 700 ? -24.158  -14.129 40.942  1.00 22.30  ? 700  ALA A CA    1 
ATOM   4877  C C     . ALA A  1 700 ? -23.638  -13.254 42.043  1.00 27.20  ? 700  ALA A C     1 
ATOM   4878  O O     . ALA A  1 700 ? -23.587  -13.673 43.193  1.00 28.46  ? 700  ALA A O     1 
ATOM   4879  C CB    . ALA A  1 700 ? -22.991  -14.728 40.202  1.00 22.95  ? 700  ALA A CB    1 
ATOM   4880  N N     . PHE A  1 701 ? -23.288  -12.008 41.702  1.00 23.59  ? 701  PHE A N     1 
ATOM   4881  C CA    . PHE A  1 701 ? -22.854  -11.016 42.674  1.00 23.57  ? 701  PHE A CA    1 
ATOM   4882  C C     . PHE A  1 701 ? -24.059  -10.686 43.590  1.00 28.87  ? 701  PHE A C     1 
ATOM   4883  O O     . PHE A  1 701 ? -23.905  -10.690 44.811  1.00 28.84  ? 701  PHE A O     1 
ATOM   4884  C CB    . PHE A  1 701 ? -22.297  -9.777  41.950  1.00 24.78  ? 701  PHE A CB    1 
ATOM   4885  C CG    . PHE A  1 701 ? -22.151  -8.539  42.794  1.00 27.31  ? 701  PHE A CG    1 
ATOM   4886  C CD1   . PHE A  1 701 ? -21.165  -8.455  43.768  1.00 31.55  ? 701  PHE A CD1   1 
ATOM   4887  C CD2   . PHE A  1 701 ? -22.977  -7.442  42.594  1.00 29.85  ? 701  PHE A CD2   1 
ATOM   4888  C CE1   . PHE A  1 701 ? -21.010  -7.295  44.529  1.00 33.12  ? 701  PHE A CE1   1 
ATOM   4889  C CE2   . PHE A  1 701 ? -22.840  -6.294  43.376  1.00 33.34  ? 701  PHE A CE2   1 
ATOM   4890  C CZ    . PHE A  1 701 ? -21.858  -6.225  44.337  1.00 31.68  ? 701  PHE A CZ    1 
ATOM   4891  N N     . THR A  1 702 ? -25.269  -10.486 42.995  1.00 24.76  ? 702  THR A N     1 
ATOM   4892  C CA    . THR A  1 702 ? -26.503  -10.185 43.721  1.00 24.34  ? 702  THR A CA    1 
ATOM   4893  C C     . THR A  1 702 ? -26.882  -11.317 44.676  1.00 28.33  ? 702  THR A C     1 
ATOM   4894  O O     . THR A  1 702 ? -27.166  -11.052 45.840  1.00 27.90  ? 702  THR A O     1 
ATOM   4895  C CB    . THR A  1 702 ? -27.625  -9.855  42.746  1.00 35.26  ? 702  THR A CB    1 
ATOM   4896  O OG1   . THR A  1 702 ? -27.276  -8.692  41.993  1.00 40.55  ? 702  THR A OG1   1 
ATOM   4897  C CG2   . THR A  1 702 ? -28.961  -9.641  43.447  1.00 34.78  ? 702  THR A CG2   1 
ATOM   4898  N N     . ALA A  1 703 ? -26.876  -12.580 44.184  1.00 25.18  ? 703  ALA A N     1 
ATOM   4899  C CA    . ALA A  1 703 ? -27.201  -13.776 44.970  1.00 24.69  ? 703  ALA A CA    1 
ATOM   4900  C C     . ALA A  1 703 ? -26.268  -13.896 46.201  1.00 29.46  ? 703  ALA A C     1 
ATOM   4901  O O     . ALA A  1 703 ? -26.762  -14.060 47.320  1.00 29.65  ? 703  ALA A O     1 
ATOM   4902  C CB    . ALA A  1 703 ? -27.117  -15.015 44.100  1.00 24.28  ? 703  ALA A CB    1 
ATOM   4903  N N     . LEU A  1 704 ? -24.941  -13.729 46.001  1.00 25.59  ? 704  LEU A N     1 
ATOM   4904  C CA    . LEU A  1 704 ? -23.950  -13.752 47.076  1.00 27.11  ? 704  LEU A CA    1 
ATOM   4905  C C     . LEU A  1 704 ? -24.353  -12.758 48.185  1.00 34.41  ? 704  LEU A C     1 
ATOM   4906  O O     . LEU A  1 704 ? -24.368  -13.115 49.360  1.00 35.86  ? 704  LEU A O     1 
ATOM   4907  C CB    . LEU A  1 704 ? -22.540  -13.375 46.540  1.00 26.53  ? 704  LEU A CB    1 
ATOM   4908  C CG    . LEU A  1 704 ? -21.278  -14.012 47.183  1.00 30.80  ? 704  LEU A CG    1 
ATOM   4909  C CD1   . LEU A  1 704 ? -20.264  -12.961 47.560  1.00 31.13  ? 704  LEU A CD1   1 
ATOM   4910  C CD2   . LEU A  1 704 ? -21.584  -14.884 48.386  1.00 32.20  ? 704  LEU A CD2   1 
ATOM   4911  N N     . TYR A  1 705 ? -24.715  -11.533 47.792  1.00 30.02  ? 705  TYR A N     1 
ATOM   4912  C CA    . TYR A  1 705 ? -25.146  -10.489 48.698  1.00 29.08  ? 705  TYR A CA    1 
ATOM   4913  C C     . TYR A  1 705 ? -26.415  -10.897 49.440  1.00 32.42  ? 705  TYR A C     1 
ATOM   4914  O O     . TYR A  1 705 ? -26.451  -10.789 50.652  1.00 34.60  ? 705  TYR A O     1 
ATOM   4915  C CB    . TYR A  1 705 ? -25.348  -9.174  47.926  1.00 29.08  ? 705  TYR A CB    1 
ATOM   4916  C CG    . TYR A  1 705 ? -25.961  -8.094  48.777  1.00 31.28  ? 705  TYR A CG    1 
ATOM   4917  C CD1   . TYR A  1 705 ? -27.297  -7.733  48.626  1.00 33.55  ? 705  TYR A CD1   1 
ATOM   4918  C CD2   . TYR A  1 705 ? -25.230  -7.485  49.792  1.00 32.56  ? 705  TYR A CD2   1 
ATOM   4919  C CE1   . TYR A  1 705 ? -27.881  -6.768  49.444  1.00 35.86  ? 705  TYR A CE1   1 
ATOM   4920  C CE2   . TYR A  1 705 ? -25.798  -6.513  50.607  1.00 34.39  ? 705  TYR A CE2   1 
ATOM   4921  C CZ    . TYR A  1 705 ? -27.123  -6.153  50.429  1.00 41.25  ? 705  TYR A CZ    1 
ATOM   4922  O OH    . TYR A  1 705 ? -27.678  -5.204  51.252  1.00 43.90  ? 705  TYR A OH    1 
ATOM   4923  N N     . GLU A  1 706 ? -27.448  -11.331 48.712  1.00 27.00  ? 706  GLU A N     1 
ATOM   4924  C CA    . GLU A  1 706 ? -28.745  -11.747 49.236  1.00 26.56  ? 706  GLU A CA    1 
ATOM   4925  C C     . GLU A  1 706 ? -28.616  -12.864 50.260  1.00 32.96  ? 706  GLU A C     1 
ATOM   4926  O O     . GLU A  1 706 ? -29.226  -12.782 51.333  1.00 35.29  ? 706  GLU A O     1 
ATOM   4927  C CB    . GLU A  1 706 ? -29.635  -12.224 48.098  1.00 26.76  ? 706  GLU A CB    1 
ATOM   4928  C CG    . GLU A  1 706 ? -30.187  -11.076 47.299  1.00 38.44  ? 706  GLU A CG    1 
ATOM   4929  C CD    . GLU A  1 706 ? -31.249  -11.434 46.291  1.00 57.82  ? 706  GLU A CD    1 
ATOM   4930  O OE1   . GLU A  1 706 ? -31.496  -12.643 46.070  1.00 53.84  ? 706  GLU A OE1   1 
ATOM   4931  O OE2   . GLU A  1 706 ? -31.868  -10.492 45.747  1.00 45.77  ? 706  GLU A OE2   1 
ATOM   4932  N N     . LEU A  1 707 ? -27.829  -13.912 49.923  1.00 26.76  ? 707  LEU A N     1 
ATOM   4933  C CA    . LEU A  1 707 ? -27.586  -15.053 50.787  1.00 25.56  ? 707  LEU A CA    1 
ATOM   4934  C C     . LEU A  1 707 ? -26.817  -14.616 52.001  1.00 31.15  ? 707  LEU A C     1 
ATOM   4935  O O     . LEU A  1 707 ? -27.163  -15.042 53.089  1.00 34.60  ? 707  LEU A O     1 
ATOM   4936  C CB    . LEU A  1 707 ? -26.847  -16.175 50.047  1.00 24.64  ? 707  LEU A CB    1 
ATOM   4937  C CG    . LEU A  1 707 ? -27.610  -16.948 48.967  1.00 27.28  ? 707  LEU A CG    1 
ATOM   4938  C CD1   . LEU A  1 707 ? -26.689  -17.888 48.258  1.00 26.62  ? 707  LEU A CD1   1 
ATOM   4939  C CD2   . LEU A  1 707 ? -28.789  -17.739 49.552  1.00 28.54  ? 707  LEU A CD2   1 
ATOM   4940  N N     . ASP A  1 708 ? -25.822  -13.724 51.839  1.00 27.32  ? 708  ASP A N     1 
ATOM   4941  C CA    . ASP A  1 708 ? -25.038  -13.156 52.951  1.00 28.62  ? 708  ASP A CA    1 
ATOM   4942  C C     . ASP A  1 708 ? -25.949  -12.415 53.897  1.00 31.50  ? 708  ASP A C     1 
ATOM   4943  O O     . ASP A  1 708 ? -25.855  -12.619 55.093  1.00 33.04  ? 708  ASP A O     1 
ATOM   4944  C CB    . ASP A  1 708 ? -23.929  -12.210 52.441  1.00 30.91  ? 708  ASP A CB    1 
ATOM   4945  C CG    . ASP A  1 708 ? -23.181  -11.469 53.527  1.00 47.84  ? 708  ASP A CG    1 
ATOM   4946  O OD1   . ASP A  1 708 ? -22.395  -12.118 54.258  1.00 49.33  ? 708  ASP A OD1   1 
ATOM   4947  O OD2   . ASP A  1 708 ? -23.372  -10.237 53.641  1.00 58.77  ? 708  ASP A OD2   1 
ATOM   4948  N N     . ALA A  1 709 ? -26.850  -11.596 53.367  1.00 27.45  ? 709  ALA A N     1 
ATOM   4949  C CA    . ALA A  1 709 ? -27.795  -10.840 54.168  1.00 29.22  ? 709  ALA A CA    1 
ATOM   4950  C C     . ALA A  1 709 ? -28.769  -11.770 54.895  1.00 37.82  ? 709  ALA A C     1 
ATOM   4951  O O     . ALA A  1 709 ? -29.123  -11.500 56.054  1.00 40.85  ? 709  ALA A O     1 
ATOM   4952  C CB    . ALA A  1 709 ? -28.542  -9.854  53.290  1.00 29.64  ? 709  ALA A CB    1 
ATOM   4953  N N     . ALA A  1 710 ? -29.146  -12.893 54.246  1.00 33.26  ? 710  ALA A N     1 
ATOM   4954  C CA    . ALA A  1 710 ? -30.072  -13.871 54.822  1.00 34.07  ? 710  ALA A CA    1 
ATOM   4955  C C     . ALA A  1 710 ? -29.498  -14.689 56.005  1.00 38.36  ? 710  ALA A C     1 
ATOM   4956  O O     . ALA A  1 710 ? -30.278  -15.334 56.711  1.00 37.95  ? 710  ALA A O     1 
ATOM   4957  C CB    . ALA A  1 710 ? -30.624  -14.786 53.736  1.00 34.14  ? 710  ALA A CB    1 
ATOM   4958  N N     . ARG A  1 711 ? -28.153  -14.624 56.247  1.00 35.37  ? 711  ARG A N     1 
ATOM   4959  C CA    . ARG A  1 711 ? -27.438  -15.325 57.335  1.00 36.23  ? 711  ARG A CA    1 
ATOM   4960  C C     . ARG A  1 711 ? -28.091  -15.148 58.689  1.00 43.37  ? 711  ARG A C     1 
ATOM   4961  O O     . ARG A  1 711 ? -28.069  -16.064 59.516  1.00 43.05  ? 711  ARG A O     1 
ATOM   4962  C CB    . ARG A  1 711 ? -25.991  -14.859 57.432  1.00 34.59  ? 711  ARG A CB    1 
ATOM   4963  C CG    . ARG A  1 711 ? -25.093  -15.478 56.393  1.00 37.17  ? 711  ARG A CG    1 
ATOM   4964  C CD    . ARG A  1 711 ? -23.730  -14.835 56.423  1.00 33.57  ? 711  ARG A CD    1 
ATOM   4965  N NE    . ARG A  1 711 ? -22.805  -15.563 55.558  1.00 32.02  ? 711  ARG A NE    1 
ATOM   4966  C CZ    . ARG A  1 711 ? -21.486  -15.503 55.677  1.00 39.36  ? 711  ARG A CZ    1 
ATOM   4967  N NH1   . ARG A  1 711 ? -20.933  -14.752 56.623  1.00 18.00  ? 711  ARG A NH1   1 
ATOM   4968  N NH2   . ARG A  1 711 ? -20.707  -16.202 54.856  1.00 24.26  ? 711  ARG A NH2   1 
ATOM   4969  N N     . ALA A  1 712 ? -28.666  -13.946 58.905  1.00 42.30  ? 712  ALA A N     1 
ATOM   4970  C CA    . ALA A  1 712 ? -29.420  -13.518 60.084  1.00 42.74  ? 712  ALA A CA    1 
ATOM   4971  C C     . ALA A  1 712 ? -30.667  -14.434 60.252  1.00 47.16  ? 712  ALA A C     1 
ATOM   4972  O O     . ALA A  1 712 ? -30.744  -15.205 61.213  1.00 47.49  ? 712  ALA A O     1 
ATOM   4973  C CB    . ALA A  1 712 ? -29.847  -12.062 59.898  1.00 42.76  ? 712  ALA A CB    1 
ATOM   4974  N N     . GLN A  1 713 ? -31.589  -14.387 59.256  1.00 42.39  ? 713  GLN A N     1 
ATOM   4975  C CA    . GLN A  1 713 ? -32.835  -15.154 59.176  1.00 42.05  ? 713  GLN A CA    1 
ATOM   4976  C C     . GLN A  1 713 ? -32.618  -16.686 59.062  1.00 43.48  ? 713  GLN A C     1 
ATOM   4977  O O     . GLN A  1 713 ? -33.407  -17.460 59.616  1.00 42.78  ? 713  GLN A O     1 
ATOM   4978  C CB    . GLN A  1 713 ? -33.692  -14.677 57.969  1.00 42.43  ? 713  GLN A CB    1 
ATOM   4979  C CG    . GLN A  1 713 ? -34.133  -13.211 57.940  1.00 52.17  ? 713  GLN A CG    1 
ATOM   4980  C CD    . GLN A  1 713 ? -33.189  -12.363 57.135  1.00 80.89  ? 713  GLN A CD    1 
ATOM   4981  O OE1   . GLN A  1 713 ? -32.379  -11.588 57.679  1.00 77.56  ? 713  GLN A OE1   1 
ATOM   4982  N NE2   . GLN A  1 713 ? -33.262  -12.501 55.811  1.00 79.08  ? 713  GLN A NE2   1 
ATOM   4983  N N     . TYR A  1 714 ? -31.592  -17.124 58.312  1.00 38.23  ? 714  TYR A N     1 
ATOM   4984  C CA    . TYR A  1 714 ? -31.362  -18.558 58.087  1.00 36.91  ? 714  TYR A CA    1 
ATOM   4985  C C     . TYR A  1 714 ? -29.953  -19.024 58.478  1.00 43.56  ? 714  TYR A C     1 
ATOM   4986  O O     . TYR A  1 714 ? -29.064  -19.022 57.614  1.00 44.97  ? 714  TYR A O     1 
ATOM   4987  C CB    . TYR A  1 714 ? -31.674  -18.948 56.628  1.00 33.96  ? 714  TYR A CB    1 
ATOM   4988  C CG    . TYR A  1 714 ? -32.987  -18.407 56.112  1.00 32.18  ? 714  TYR A CG    1 
ATOM   4989  C CD1   . TYR A  1 714 ? -34.162  -19.150 56.217  1.00 32.94  ? 714  TYR A CD1   1 
ATOM   4990  C CD2   . TYR A  1 714 ? -33.063  -17.151 55.533  1.00 32.44  ? 714  TYR A CD2   1 
ATOM   4991  C CE1   . TYR A  1 714 ? -35.371  -18.670 55.718  1.00 29.50  ? 714  TYR A CE1   1 
ATOM   4992  C CE2   . TYR A  1 714 ? -34.273  -16.644 55.061  1.00 33.33  ? 714  TYR A CE2   1 
ATOM   4993  C CZ    . TYR A  1 714 ? -35.425  -17.411 55.149  1.00 33.85  ? 714  TYR A CZ    1 
ATOM   4994  O OH    . TYR A  1 714 ? -36.622  -16.901 54.705  1.00 28.74  ? 714  TYR A OH    1 
ATOM   4995  N N     . PRO A  1 715 ? -29.740  -19.478 59.746  1.00 37.67  ? 715  PRO A N     1 
ATOM   4996  C CA    . PRO A  1 715 ? -28.410  -19.967 60.159  1.00 36.86  ? 715  PRO A CA    1 
ATOM   4997  C C     . PRO A  1 715 ? -27.619  -20.828 59.156  1.00 37.61  ? 715  PRO A C     1 
ATOM   4998  O O     . PRO A  1 715 ? -26.397  -20.776 59.129  1.00 37.01  ? 715  PRO A O     1 
ATOM   4999  C CB    . PRO A  1 715 ? -28.712  -20.775 61.446  1.00 39.88  ? 715  PRO A CB    1 
ATOM   5000  C CG    . PRO A  1 715 ? -30.176  -20.662 61.700  1.00 43.96  ? 715  PRO A CG    1 
ATOM   5001  C CD    . PRO A  1 715 ? -30.688  -19.532 60.872  1.00 39.00  ? 715  PRO A CD    1 
ATOM   5002  N N     . ILE A  1 716 ? -28.313  -21.623 58.351  1.00 34.32  ? 716  ILE A N     1 
ATOM   5003  C CA    . ILE A  1 716 ? -27.696  -22.522 57.392  1.00 34.86  ? 716  ILE A CA    1 
ATOM   5004  C C     . ILE A  1 716 ? -26.817  -21.820 56.348  1.00 41.65  ? 716  ILE A C     1 
ATOM   5005  O O     . ILE A  1 716 ? -25.892  -22.445 55.818  1.00 41.83  ? 716  ILE A O     1 
ATOM   5006  C CB    . ILE A  1 716 ? -28.759  -23.495 56.785  1.00 37.85  ? 716  ILE A CB    1 
ATOM   5007  C CG1   . ILE A  1 716 ? -28.204  -24.924 56.619  1.00 38.17  ? 716  ILE A CG1   1 
ATOM   5008  C CG2   . ILE A  1 716 ? -29.450  -22.952 55.516  1.00 36.23  ? 716  ILE A CG2   1 
ATOM   5009  C CD1   . ILE A  1 716 ? -28.219  -25.759 57.937  1.00 42.82  ? 716  ILE A CD1   1 
ATOM   5010  N N     . PHE A  1 717 ? -27.097  -20.523 56.070  1.00 38.13  ? 717  PHE A N     1 
ATOM   5011  C CA    . PHE A  1 717 ? -26.366  -19.716 55.095  1.00 35.43  ? 717  PHE A CA    1 
ATOM   5012  C C     . PHE A  1 717 ? -25.060  -19.166 55.650  1.00 37.16  ? 717  PHE A C     1 
ATOM   5013  O O     . PHE A  1 717 ? -24.288  -18.578 54.891  1.00 36.24  ? 717  PHE A O     1 
ATOM   5014  C CB    . PHE A  1 717 ? -27.243  -18.582 54.546  1.00 36.12  ? 717  PHE A CB    1 
ATOM   5015  C CG    . PHE A  1 717 ? -28.444  -18.993 53.735  1.00 37.33  ? 717  PHE A CG    1 
ATOM   5016  C CD1   . PHE A  1 717 ? -28.377  -20.058 52.846  1.00 40.61  ? 717  PHE A CD1   1 
ATOM   5017  C CD2   . PHE A  1 717 ? -29.622  -18.269 53.798  1.00 40.50  ? 717  PHE A CD2   1 
ATOM   5018  C CE1   . PHE A  1 717 ? -29.490  -20.419 52.068  1.00 40.93  ? 717  PHE A CE1   1 
ATOM   5019  C CE2   . PHE A  1 717 ? -30.732  -18.629 53.021  1.00 42.64  ? 717  PHE A CE2   1 
ATOM   5020  C CZ    . PHE A  1 717 ? -30.650  -19.687 52.150  1.00 39.74  ? 717  PHE A CZ    1 
ATOM   5021  N N     . ASN A  1 718 ? -24.797  -19.349 56.952  1.00 34.05  ? 718  ASN A N     1 
ATOM   5022  C CA    . ASN A  1 718 ? -23.555  -18.863 57.571  1.00 34.93  ? 718  ASN A CA    1 
ATOM   5023  C C     . ASN A  1 718 ? -22.391  -19.820 57.293  1.00 40.07  ? 718  ASN A C     1 
ATOM   5024  O O     . ASN A  1 718 ? -21.782  -20.374 58.206  1.00 43.23  ? 718  ASN A O     1 
ATOM   5025  C CB    . ASN A  1 718 ? -23.738  -18.562 59.075  1.00 38.77  ? 718  ASN A CB    1 
ATOM   5026  C CG    . ASN A  1 718 ? -22.635  -17.727 59.707  1.00 75.13  ? 718  ASN A CG    1 
ATOM   5027  O OD1   . ASN A  1 718 ? -21.718  -17.162 59.053  1.00 56.63  ? 718  ASN A OD1   1 
ATOM   5028  N ND2   . ASN A  1 718 ? -22.695  -17.655 61.029  1.00 78.30  ? 718  ASN A ND2   1 
ATOM   5029  N N     . ILE A  1 719 ? -22.132  -20.043 56.013  1.00 34.07  ? 719  ILE A N     1 
ATOM   5030  C CA    . ILE A  1 719 ? -21.080  -20.897 55.483  1.00 33.45  ? 719  ILE A CA    1 
ATOM   5031  C C     . ILE A  1 719 ? -20.169  -19.989 54.646  1.00 40.05  ? 719  ILE A C     1 
ATOM   5032  O O     . ILE A  1 719 ? -20.620  -18.920 54.240  1.00 39.96  ? 719  ILE A O     1 
ATOM   5033  C CB    . ILE A  1 719 ? -21.667  -22.072 54.608  1.00 35.38  ? 719  ILE A CB    1 
ATOM   5034  C CG1   . ILE A  1 719 ? -22.650  -21.603 53.504  1.00 33.95  ? 719  ILE A CG1   1 
ATOM   5035  C CG2   . ILE A  1 719 ? -22.273  -23.159 55.448  1.00 37.74  ? 719  ILE A CG2   1 
ATOM   5036  C CD1   . ILE A  1 719 ? -22.759  -22.524 52.322  1.00 36.84  ? 719  ILE A CD1   1 
ATOM   5037  N N     . PRO A  1 720 ? -18.918  -20.373 54.319  1.00 38.43  ? 720  PRO A N     1 
ATOM   5038  C CA    . PRO A  1 720 ? -18.136  -19.536 53.415  1.00 37.70  ? 720  PRO A CA    1 
ATOM   5039  C C     . PRO A  1 720 ? -18.771  -19.631 52.022  1.00 44.07  ? 720  PRO A C     1 
ATOM   5040  O O     . PRO A  1 720 ? -19.122  -20.722 51.560  1.00 44.39  ? 720  PRO A O     1 
ATOM   5041  C CB    . PRO A  1 720 ? -16.738  -20.175 53.442  1.00 39.38  ? 720  PRO A CB    1 
ATOM   5042  C CG    . PRO A  1 720 ? -16.763  -21.146 54.559  1.00 45.25  ? 720  PRO A CG    1 
ATOM   5043  C CD    . PRO A  1 720 ? -18.168  -21.590 54.682  1.00 41.12  ? 720  PRO A CD    1 
ATOM   5044  N N     . MET A  1 721 ? -18.982  -18.480 51.387  1.00 41.82  ? 721  MET A N     1 
ATOM   5045  C CA    . MET A  1 721 ? -19.562  -18.386 50.052  1.00 40.89  ? 721  MET A CA    1 
ATOM   5046  C C     . MET A  1 721 ? -18.746  -17.446 49.223  1.00 41.38  ? 721  MET A C     1 
ATOM   5047  O O     . MET A  1 721 ? -18.236  -16.450 49.738  1.00 40.24  ? 721  MET A O     1 
ATOM   5048  C CB    . MET A  1 721 ? -20.991  -17.842 50.115  1.00 43.82  ? 721  MET A CB    1 
ATOM   5049  C CG    . MET A  1 721 ? -21.987  -18.790 50.649  1.00 49.09  ? 721  MET A CG    1 
ATOM   5050  S SD    . MET A  1 721 ? -23.337  -17.812 51.279  1.00 54.94  ? 721  MET A SD    1 
ATOM   5051  C CE    . MET A  1 721 ? -24.630  -18.985 51.167  1.00 51.96  ? 721  MET A CE    1 
ATOM   5052  N N     . CYS A  1 722 ? -18.652  -17.728 47.930  1.00 37.42  ? 722  CYS A N     1 
ATOM   5053  C CA    . CYS A  1 722 ? -17.935  -16.843 47.026  1.00 36.99  ? 722  CYS A CA    1 
ATOM   5054  C C     . CYS A  1 722 ? -18.553  -16.742 45.655  1.00 39.18  ? 722  CYS A C     1 
ATOM   5055  O O     . CYS A  1 722 ? -19.244  -17.667 45.206  1.00 37.42  ? 722  CYS A O     1 
ATOM   5056  C CB    . CYS A  1 722 ? -16.438  -17.152 46.960  1.00 37.54  ? 722  CYS A CB    1 
ATOM   5057  S SG    . CYS A  1 722 ? -16.029  -18.712 46.136  1.00 40.84  ? 722  CYS A SG    1 
ATOM   5058  N N     . CYS A  1 723 ? -18.309  -15.582 45.004  1.00 34.54  ? 723  CYS A N     1 
ATOM   5059  C CA    . CYS A  1 723 ? -18.754  -15.302 43.654  1.00 32.94  ? 723  CYS A CA    1 
ATOM   5060  C C     . CYS A  1 723 ? -17.543  -15.298 42.740  1.00 34.77  ? 723  CYS A C     1 
ATOM   5061  O O     . CYS A  1 723 ? -16.592  -14.551 42.961  1.00 32.88  ? 723  CYS A O     1 
ATOM   5062  C CB    . CYS A  1 723 ? -19.515  -13.984 43.579  1.00 32.98  ? 723  CYS A CB    1 
ATOM   5063  S SG    . CYS A  1 723 ? -19.804  -13.395 41.893  1.00 36.02  ? 723  CYS A SG    1 
ATOM   5064  N N     . LEU A  1 724 ? -17.556  -16.182 41.753  1.00 31.63  ? 724  LEU A N     1 
ATOM   5065  C CA    . LEU A  1 724 ? -16.494  -16.234 40.776  1.00 31.68  ? 724  LEU A CA    1 
ATOM   5066  C C     . LEU A  1 724 ? -17.082  -15.499 39.565  1.00 37.29  ? 724  LEU A C     1 
ATOM   5067  O O     . LEU A  1 724 ? -18.025  -15.977 38.922  1.00 35.47  ? 724  LEU A O     1 
ATOM   5068  C CB    . LEU A  1 724 ? -16.082  -17.694 40.470  1.00 32.00  ? 724  LEU A CB    1 
ATOM   5069  C CG    . LEU A  1 724 ? -15.017  -17.964 39.385  1.00 35.51  ? 724  LEU A CG    1 
ATOM   5070  C CD1   . LEU A  1 724 ? -13.961  -16.896 39.334  1.00 36.48  ? 724  LEU A CD1   1 
ATOM   5071  C CD2   . LEU A  1 724 ? -14.365  -19.284 39.611  1.00 34.19  ? 724  LEU A CD2   1 
ATOM   5072  N N     . PRO A  1 725 ? -16.602  -14.262 39.330  1.00 36.13  ? 725  PRO A N     1 
ATOM   5073  C CA    . PRO A  1 725 ? -17.168  -13.445 38.255  1.00 35.03  ? 725  PRO A CA    1 
ATOM   5074  C C     . PRO A  1 725 ? -16.895  -13.987 36.864  1.00 36.06  ? 725  PRO A C     1 
ATOM   5075  O O     . PRO A  1 725 ? -15.747  -14.112 36.437  1.00 34.17  ? 725  PRO A O     1 
ATOM   5076  C CB    . PRO A  1 725 ? -16.536  -12.060 38.487  1.00 36.84  ? 725  PRO A CB    1 
ATOM   5077  C CG    . PRO A  1 725 ? -15.946  -12.107 39.842  1.00 41.75  ? 725  PRO A CG    1 
ATOM   5078  C CD    . PRO A  1 725 ? -15.540  -13.528 40.035  1.00 38.06  ? 725  PRO A CD    1 
ATOM   5079  N N     . ALA A  1 726 ? -17.984  -14.321 36.183  1.00 32.65  ? 726  ALA A N     1 
ATOM   5080  C CA    . ALA A  1 726 ? -18.003  -14.805 34.813  1.00 32.63  ? 726  ALA A CA    1 
ATOM   5081  C C     . ALA A  1 726 ? -19.123  -14.070 34.085  1.00 37.59  ? 726  ALA A C     1 
ATOM   5082  O O     . ALA A  1 726 ? -20.294  -14.206 34.446  1.00 36.00  ? 726  ALA A O     1 
ATOM   5083  C CB    . ALA A  1 726 ? -18.218  -16.311 34.769  1.00 33.31  ? 726  ALA A CB    1 
ATOM   5084  N N     . THR A  1 727 ? -18.736  -13.218 33.111  1.00 35.56  ? 727  THR A N     1 
ATOM   5085  C CA    . THR A  1 727 ? -19.624  -12.384 32.281  1.00 35.43  ? 727  THR A CA    1 
ATOM   5086  C C     . THR A  1 727 ? -18.876  -11.763 31.118  1.00 41.05  ? 727  THR A C     1 
ATOM   5087  O O     . THR A  1 727 ? -17.714  -11.407 31.228  1.00 41.39  ? 727  THR A O     1 
ATOM   5088  C CB    . THR A  1 727 ? -20.430  -11.311 33.099  1.00 37.48  ? 727  THR A CB    1 
ATOM   5089  O OG1   . THR A  1 727 ? -21.259  -10.578 32.197  1.00 39.93  ? 727  THR A OG1   1 
ATOM   5090  C CG2   . THR A  1 727 ? -19.557  -10.327 33.868  1.00 27.50  ? 727  THR A CG2   1 
ATOM   5091  N N     . VAL A  1 728 ? -19.573  -11.584 30.030  1.00 39.48  ? 728  VAL A N     1 
ATOM   5092  C CA    . VAL A  1 728 ? -19.074  -10.991 28.802  1.00 40.27  ? 728  VAL A CA    1 
ATOM   5093  C C     . VAL A  1 728 ? -18.914  -9.479  28.969  1.00 45.68  ? 728  VAL A C     1 
ATOM   5094  O O     . VAL A  1 728 ? -17.944  -8.920  28.472  1.00 47.21  ? 728  VAL A O     1 
ATOM   5095  C CB    . VAL A  1 728 ? -20.084  -11.406 27.708  1.00 45.32  ? 728  VAL A CB    1 
ATOM   5096  C CG1   . VAL A  1 728 ? -20.476  -10.265 26.780  1.00 45.31  ? 728  VAL A CG1   1 
ATOM   5097  C CG2   . VAL A  1 728 ? -19.606  -12.638 26.946  1.00 45.29  ? 728  VAL A CG2   1 
ATOM   5098  N N     . SER A  1 729 ? -19.825  -8.840  29.734  1.00 42.71  ? 729  SER A N     1 
ATOM   5099  C CA    . SER A  1 729 ? -19.914  -7.393  30.027  1.00 42.36  ? 729  SER A CA    1 
ATOM   5100  C C     . SER A  1 729 ? -18.764  -6.785  30.803  1.00 46.37  ? 729  SER A C     1 
ATOM   5101  O O     . SER A  1 729 ? -18.510  -5.594  30.633  1.00 48.09  ? 729  SER A O     1 
ATOM   5102  C CB    . SER A  1 729 ? -21.187  -7.095  30.814  1.00 45.39  ? 729  SER A CB    1 
ATOM   5103  O OG    . SER A  1 729 ? -22.350  -7.525  30.127  1.00 58.25  ? 729  SER A OG    1 
ATOM   5104  N N     . ASN A  1 730 ? -18.125  -7.575  31.697  1.00 41.34  ? 730  ASN A N     1 
ATOM   5105  C CA    . ASN A  1 730 ? -17.092  -7.175  32.666  1.00 40.29  ? 730  ASN A CA    1 
ATOM   5106  C C     . ASN A  1 730 ? -17.708  -6.133  33.642  1.00 39.13  ? 730  ASN A C     1 
ATOM   5107  O O     . ASN A  1 730 ? -17.065  -5.179  34.043  1.00 38.63  ? 730  ASN A O     1 
ATOM   5108  C CB    . ASN A  1 730 ? -15.789  -6.693  31.992  1.00 40.64  ? 730  ASN A CB    1 
ATOM   5109  C CG    . ASN A  1 730 ? -14.528  -6.916  32.818  1.00 45.13  ? 730  ASN A CG    1 
ATOM   5110  O OD1   . ASN A  1 730 ? -13.599  -7.615  32.394  1.00 32.43  ? 730  ASN A OD1   1 
ATOM   5111  N ND2   . ASN A  1 730 ? -14.449  -6.327  34.007  1.00 29.02  ? 730  ASN A ND2   1 
ATOM   5112  N N     . ASN A  1 731 ? -18.973  -6.356  34.014  1.00 32.17  ? 731  ASN A N     1 
ATOM   5113  C CA    . ASN A  1 731 ? -19.784  -5.498  34.855  1.00 30.75  ? 731  ASN A CA    1 
ATOM   5114  C C     . ASN A  1 731 ? -19.914  -5.925  36.330  1.00 35.85  ? 731  ASN A C     1 
ATOM   5115  O O     . ASN A  1 731 ? -20.755  -5.371  37.053  1.00 37.02  ? 731  ASN A O     1 
ATOM   5116  C CB    . ASN A  1 731 ? -21.169  -5.321  34.199  1.00 30.75  ? 731  ASN A CB    1 
ATOM   5117  C CG    . ASN A  1 731 ? -22.111  -6.492  34.294  1.00 67.62  ? 731  ASN A CG    1 
ATOM   5118  O OD1   . ASN A  1 731 ? -21.734  -7.669  34.226  1.00 66.73  ? 731  ASN A OD1   1 
ATOM   5119  N ND2   . ASN A  1 731 ? -23.384  -6.182  34.416  1.00 69.11  ? 731  ASN A ND2   1 
ATOM   5120  N N     . VAL A  1 732 ? -19.081  -6.874  36.799  1.00 32.18  ? 732  VAL A N     1 
ATOM   5121  C CA    . VAL A  1 732 ? -19.145  -7.330  38.202  1.00 31.95  ? 732  VAL A CA    1 
ATOM   5122  C C     . VAL A  1 732 ? -18.150  -6.559  39.079  1.00 35.13  ? 732  VAL A C     1 
ATOM   5123  O O     . VAL A  1 732 ? -16.940  -6.555  38.786  1.00 33.85  ? 732  VAL A O     1 
ATOM   5124  C CB    . VAL A  1 732 ? -18.976  -8.880  38.370  1.00 35.84  ? 732  VAL A CB    1 
ATOM   5125  C CG1   . VAL A  1 732 ? -19.159  -9.320  39.826  1.00 35.84  ? 732  VAL A CG1   1 
ATOM   5126  C CG2   . VAL A  1 732 ? -19.932  -9.645  37.471  1.00 35.08  ? 732  VAL A CG2   1 
ATOM   5127  N N     . PRO A  1 733 ? -18.635  -5.946  40.186  1.00 32.63  ? 733  PRO A N     1 
ATOM   5128  C CA    . PRO A  1 733 ? -17.708  -5.261  41.114  1.00 32.77  ? 733  PRO A CA    1 
ATOM   5129  C C     . PRO A  1 733 ? -16.797  -6.270  41.806  1.00 35.98  ? 733  PRO A C     1 
ATOM   5130  O O     . PRO A  1 733 ? -17.185  -7.420  41.954  1.00 35.00  ? 733  PRO A O     1 
ATOM   5131  C CB    . PRO A  1 733 ? -18.644  -4.600  42.144  1.00 34.85  ? 733  PRO A CB    1 
ATOM   5132  C CG    . PRO A  1 733 ? -20.009  -4.662  41.561  1.00 39.17  ? 733  PRO A CG    1 
ATOM   5133  C CD    . PRO A  1 733 ? -20.026  -5.878  40.677  1.00 34.41  ? 733  PRO A CD    1 
ATOM   5134  N N     . GLY A  1 734 ? -15.611  -5.835  42.224  1.00 33.43  ? 734  GLY A N     1 
ATOM   5135  C CA    . GLY A  1 734 ? -14.653  -6.693  42.922  1.00 33.31  ? 734  GLY A CA    1 
ATOM   5136  C C     . GLY A  1 734 ? -13.605  -7.405  42.080  1.00 36.10  ? 734  GLY A C     1 
ATOM   5137  O O     . GLY A  1 734 ? -12.785  -8.147  42.637  1.00 37.44  ? 734  GLY A O     1 
ATOM   5138  N N     . THR A  1 735 ? -13.627  -7.201  40.740  1.00 29.16  ? 735  THR A N     1 
ATOM   5139  C CA    . THR A  1 735 ? -12.653  -7.733  39.789  1.00 27.90  ? 735  THR A CA    1 
ATOM   5140  C C     . THR A  1 735 ? -12.396  -6.784  38.611  1.00 33.15  ? 735  THR A C     1 
ATOM   5141  O O     . THR A  1 735 ? -13.258  -5.969  38.270  1.00 32.76  ? 735  THR A O     1 
ATOM   5142  C CB    . THR A  1 735 ? -13.055  -9.122  39.300  1.00 28.16  ? 735  THR A CB    1 
ATOM   5143  O OG1   . THR A  1 735 ? -11.958  -9.671  38.564  1.00 20.23  ? 735  THR A OG1   1 
ATOM   5144  C CG2   . THR A  1 735 ? -14.299  -9.108  38.420  1.00 29.63  ? 735  THR A CG2   1 
ATOM   5145  N N     . GLU A  1 736 ? -11.225  -6.922  37.965  1.00 30.86  ? 736  GLU A N     1 
ATOM   5146  C CA    . GLU A  1 736 ? -10.885  -6.166  36.751  1.00 30.81  ? 736  GLU A CA    1 
ATOM   5147  C C     . GLU A  1 736 ? -11.167  -7.068  35.571  1.00 32.41  ? 736  GLU A C     1 
ATOM   5148  O O     . GLU A  1 736 ? -11.292  -6.596  34.455  1.00 30.85  ? 736  GLU A O     1 
ATOM   5149  C CB    . GLU A  1 736 ? -9.412   -5.724  36.753  1.00 33.21  ? 736  GLU A CB    1 
ATOM   5150  C CG    . GLU A  1 736 ? -9.143   -4.535  37.665  1.00 48.20  ? 736  GLU A CG    1 
ATOM   5151  C CD    . GLU A  1 736 ? -7.698   -4.203  37.966  1.00 71.33  ? 736  GLU A CD    1 
ATOM   5152  O OE1   . GLU A  1 736 ? -6.798   -4.556  37.164  1.00 73.44  ? 736  GLU A OE1   1 
ATOM   5153  O OE2   . GLU A  1 736 ? -7.473   -3.546  39.006  1.00 69.39  ? 736  GLU A OE2   1 
ATOM   5154  N N     . TYR A  1 737 ? -11.291  -8.370  35.829  1.00 30.42  ? 737  TYR A N     1 
ATOM   5155  C CA    . TYR A  1 737 ? -11.562  -9.346  34.791  1.00 30.21  ? 737  TYR A CA    1 
ATOM   5156  C C     . TYR A  1 737 ? -12.646  -10.357 35.172  1.00 35.79  ? 737  TYR A C     1 
ATOM   5157  O O     . TYR A  1 737 ? -12.554  -11.018 36.213  1.00 37.88  ? 737  TYR A O     1 
ATOM   5158  C CB    . TYR A  1 737 ? -10.278  -10.086 34.377  1.00 30.45  ? 737  TYR A CB    1 
ATOM   5159  C CG    . TYR A  1 737 ? -10.505  -10.988 33.181  1.00 30.25  ? 737  TYR A CG    1 
ATOM   5160  C CD1   . TYR A  1 737 ? -10.651  -12.364 33.336  1.00 31.07  ? 737  TYR A CD1   1 
ATOM   5161  C CD2   . TYR A  1 737 ? -10.642  -10.460 31.904  1.00 30.49  ? 737  TYR A CD2   1 
ATOM   5162  C CE1   . TYR A  1 737 ? -10.877  -13.190 32.240  1.00 30.55  ? 737  TYR A CE1   1 
ATOM   5163  C CE2   . TYR A  1 737 ? -10.858  -11.277 30.801  1.00 30.54  ? 737  TYR A CE2   1 
ATOM   5164  C CZ    . TYR A  1 737 ? -10.993  -12.636 30.973  1.00 37.00  ? 737  TYR A CZ    1 
ATOM   5165  O OH    . TYR A  1 737 ? -11.228  -13.400 29.859  1.00 38.42  ? 737  TYR A OH    1 
ATOM   5166  N N     . SER A  1 738 ? -13.611  -10.529 34.276  1.00 29.71  ? 738  SER A N     1 
ATOM   5167  C CA    . SER A  1 738 ? -14.679  -11.504 34.405  1.00 28.99  ? 738  SER A CA    1 
ATOM   5168  C C     . SER A  1 738 ? -14.473  -12.556 33.331  1.00 33.13  ? 738  SER A C     1 
ATOM   5169  O O     . SER A  1 738 ? -14.183  -12.233 32.177  1.00 31.25  ? 738  SER A O     1 
ATOM   5170  C CB    . SER A  1 738 ? -16.040  -10.845 34.240  1.00 31.11  ? 738  SER A CB    1 
ATOM   5171  O OG    . SER A  1 738 ? -16.165  -10.225 32.972  1.00 37.67  ? 738  SER A OG    1 
ATOM   5172  N N     . LEU A  1 739 ? -14.581  -13.821 33.725  1.00 32.40  ? 739  LEU A N     1 
ATOM   5173  C CA    . LEU A  1 739 ? -14.390  -14.975 32.853  1.00 32.43  ? 739  LEU A CA    1 
ATOM   5174  C C     . LEU A  1 739 ? -15.386  -14.929 31.719  1.00 38.87  ? 739  LEU A C     1 
ATOM   5175  O O     . LEU A  1 739 ? -16.571  -14.610 31.934  1.00 40.93  ? 739  LEU A O     1 
ATOM   5176  C CB    . LEU A  1 739 ? -14.559  -16.285 33.649  1.00 32.52  ? 739  LEU A CB    1 
ATOM   5177  C CG    . LEU A  1 739 ? -13.542  -16.600 34.720  1.00 37.69  ? 739  LEU A CG    1 
ATOM   5178  C CD1   . LEU A  1 739 ? -13.938  -17.852 35.467  1.00 38.71  ? 739  LEU A CD1   1 
ATOM   5179  C CD2   . LEU A  1 739 ? -12.123  -16.716 34.147  1.00 38.16  ? 739  LEU A CD2   1 
ATOM   5180  N N     . GLY A  1 740 ? -14.900  -15.210 30.518  1.00 33.86  ? 740  GLY A N     1 
ATOM   5181  C CA    . GLY A  1 740 ? -15.739  -15.196 29.324  1.00 32.54  ? 740  GLY A CA    1 
ATOM   5182  C C     . GLY A  1 740 ? -15.638  -13.934 28.501  1.00 31.15  ? 740  GLY A C     1 
ATOM   5183  O O     . GLY A  1 740 ? -16.068  -13.934 27.347  1.00 28.91  ? 740  GLY A O     1 
ATOM   5184  N N     . SER A  1 741 ? -15.067  -12.852 29.080  1.00 27.12  ? 741  SER A N     1 
ATOM   5185  C CA    . SER A  1 741 ? -14.921  -11.585 28.367  1.00 26.91  ? 741  SER A CA    1 
ATOM   5186  C C     . SER A  1 741 ? -13.882  -11.642 27.231  1.00 30.43  ? 741  SER A C     1 
ATOM   5187  O O     . SER A  1 741 ? -14.152  -11.114 26.157  1.00 29.71  ? 741  SER A O     1 
ATOM   5188  C CB    . SER A  1 741 ? -14.692  -10.419 29.321  1.00 31.87  ? 741  SER A CB    1 
ATOM   5189  O OG    . SER A  1 741 ? -13.320  -10.161 29.565  1.00 47.81  ? 741  SER A OG    1 
ATOM   5190  N N     . ASP A  1 742 ? -12.732  -12.318 27.435  1.00 27.47  ? 742  ASP A N     1 
ATOM   5191  C CA    . ASP A  1 742 ? -11.736  -12.435 26.370  1.00 26.87  ? 742  ASP A CA    1 
ATOM   5192  C C     . ASP A  1 742 ? -12.243  -13.270 25.194  1.00 28.63  ? 742  ASP A C     1 
ATOM   5193  O O     . ASP A  1 742 ? -11.978  -12.919 24.033  1.00 29.67  ? 742  ASP A O     1 
ATOM   5194  C CB    . ASP A  1 742 ? -10.367  -12.913 26.878  1.00 29.53  ? 742  ASP A CB    1 
ATOM   5195  C CG    . ASP A  1 742 ? -9.304   -12.796 25.804  1.00 47.55  ? 742  ASP A CG    1 
ATOM   5196  O OD1   . ASP A  1 742 ? -8.876   -13.856 25.272  1.00 51.45  ? 742  ASP A OD1   1 
ATOM   5197  O OD2   . ASP A  1 742 ? -8.984   -11.643 25.403  1.00 50.48  ? 742  ASP A OD2   1 
ATOM   5198  N N     . THR A  1 743 ? -13.027  -14.329 25.484  1.00 22.20  ? 743  THR A N     1 
ATOM   5199  C CA    . THR A  1 743 ? -13.654  -15.160 24.443  1.00 21.92  ? 743  THR A CA    1 
ATOM   5200  C C     . THR A  1 743 ? -14.546  -14.263 23.586  1.00 26.84  ? 743  THR A C     1 
ATOM   5201  O O     . THR A  1 743 ? -14.477  -14.310 22.360  1.00 28.33  ? 743  THR A O     1 
ATOM   5202  C CB    . THR A  1 743 ? -14.472  -16.289 25.067  1.00 28.02  ? 743  THR A CB    1 
ATOM   5203  O OG1   . THR A  1 743 ? -13.603  -17.175 25.769  1.00 22.40  ? 743  THR A OG1   1 
ATOM   5204  C CG2   . THR A  1 743 ? -15.286  -17.055 24.044  1.00 27.85  ? 743  THR A CG2   1 
ATOM   5205  N N     . CYS A  1 744 ? -15.347  -13.414 24.248  1.00 22.26  ? 744  CYS A N     1 
ATOM   5206  C CA    . CYS A  1 744 ? -16.251  -12.486 23.603  1.00 21.04  ? 744  CYS A CA    1 
ATOM   5207  C C     . CYS A  1 744 ? -15.525  -11.505 22.672  1.00 26.77  ? 744  CYS A C     1 
ATOM   5208  O O     . CYS A  1 744 ? -15.949  -11.328 21.526  1.00 26.56  ? 744  CYS A O     1 
ATOM   5209  C CB    . CYS A  1 744 ? -17.087  -11.758 24.640  1.00 20.67  ? 744  CYS A CB    1 
ATOM   5210  S SG    . CYS A  1 744 ? -18.254  -10.603 23.922  1.00 24.71  ? 744  CYS A SG    1 
ATOM   5211  N N     . LEU A  1 745 ? -14.429  -10.882 23.156  1.00 23.32  ? 745  LEU A N     1 
ATOM   5212  C CA    . LEU A  1 745 ? -13.654  -9.946  22.348  1.00 22.21  ? 745  LEU A CA    1 
ATOM   5213  C C     . LEU A  1 745 ? -13.084  -10.638 21.120  1.00 27.16  ? 745  LEU A C     1 
ATOM   5214  O O     . LEU A  1 745 ? -13.132  -10.067 20.029  1.00 28.11  ? 745  LEU A O     1 
ATOM   5215  C CB    . LEU A  1 745 ? -12.562  -9.251  23.163  1.00 21.67  ? 745  LEU A CB    1 
ATOM   5216  C CG    . LEU A  1 745 ? -12.864  -7.874  23.816  1.00 25.19  ? 745  LEU A CG    1 
ATOM   5217  C CD1   . LEU A  1 745 ? -13.921  -7.067  23.070  1.00 23.60  ? 745  LEU A CD1   1 
ATOM   5218  C CD2   . LEU A  1 745 ? -13.189  -8.016  25.268  1.00 29.85  ? 745  LEU A CD2   1 
ATOM   5219  N N     . ASN A  1 746 ? -12.635  -11.900 21.279  1.00 23.62  ? 746  ASN A N     1 
ATOM   5220  C CA    . ASN A  1 746 ? -12.121  -12.718 20.170  1.00 24.28  ? 746  ASN A CA    1 
ATOM   5221  C C     . ASN A  1 746 ? -13.217  -13.030 19.151  1.00 27.25  ? 746  ASN A C     1 
ATOM   5222  O O     . ASN A  1 746 ? -12.982  -12.941 17.952  1.00 25.16  ? 746  ASN A O     1 
ATOM   5223  C CB    . ASN A  1 746 ? -11.493  -14.000 20.689  1.00 21.57  ? 746  ASN A CB    1 
ATOM   5224  C CG    . ASN A  1 746 ? -10.115  -13.785 21.215  1.00 37.40  ? 746  ASN A CG    1 
ATOM   5225  O OD1   . ASN A  1 746 ? -9.202   -13.407 20.468  1.00 29.92  ? 746  ASN A OD1   1 
ATOM   5226  N ND2   . ASN A  1 746 ? -9.933   -14.021 22.511  1.00 27.81  ? 746  ASN A ND2   1 
ATOM   5227  N N     . THR A  1 747 ? -14.426  -13.339 19.648  1.00 24.36  ? 747  THR A N     1 
ATOM   5228  C CA    . THR A  1 747 ? -15.602  -13.644 18.844  1.00 23.26  ? 747  THR A CA    1 
ATOM   5229  C C     . THR A  1 747 ? -15.990  -12.417 18.070  1.00 27.80  ? 747  THR A C     1 
ATOM   5230  O O     . THR A  1 747 ? -16.268  -12.538 16.878  1.00 29.06  ? 747  THR A O     1 
ATOM   5231  C CB    . THR A  1 747 ? -16.718  -14.243 19.722  1.00 24.74  ? 747  THR A CB    1 
ATOM   5232  O OG1   . THR A  1 747 ? -16.269  -15.484 20.292  1.00 25.33  ? 747  THR A OG1   1 
ATOM   5233  C CG2   . THR A  1 747 ? -17.955  -14.539 18.950  1.00 21.08  ? 747  THR A CG2   1 
ATOM   5234  N N     . LEU A  1 748 ? -15.920  -11.228 18.715  1.00 24.44  ? 748  LEU A N     1 
ATOM   5235  C CA    . LEU A  1 748 ? -16.283  -9.946  18.095  1.00 24.47  ? 748  LEU A CA    1 
ATOM   5236  C C     . LEU A  1 748 ? -15.333  -9.484  17.038  1.00 27.91  ? 748  LEU A C     1 
ATOM   5237  O O     . LEU A  1 748 ? -15.790  -9.164  15.939  1.00 27.89  ? 748  LEU A O     1 
ATOM   5238  C CB    . LEU A  1 748 ? -16.573  -8.844  19.118  1.00 24.90  ? 748  LEU A CB    1 
ATOM   5239  C CG    . LEU A  1 748 ? -17.841  -9.043  20.001  1.00 31.10  ? 748  LEU A CG    1 
ATOM   5240  C CD1   . LEU A  1 748 ? -17.922  -8.000  21.090  1.00 31.62  ? 748  LEU A CD1   1 
ATOM   5241  C CD2   . LEU A  1 748 ? -19.117  -9.018  19.175  1.00 34.09  ? 748  LEU A CD2   1 
ATOM   5242  N N     . SER A  1 749 ? -14.017  -9.501  17.325  1.00 25.10  ? 749  SER A N     1 
ATOM   5243  C CA    . SER A  1 749 ? -12.987  -9.102  16.345  1.00 25.50  ? 749  SER A CA    1 
ATOM   5244  C C     . SER A  1 749 ? -13.098  -9.913  15.058  1.00 27.78  ? 749  SER A C     1 
ATOM   5245  O O     . SER A  1 749 ? -13.133  -9.318  13.979  1.00 28.30  ? 749  SER A O     1 
ATOM   5246  C CB    . SER A  1 749 ? -11.562  -9.163  16.916  1.00 29.81  ? 749  SER A CB    1 
ATOM   5247  O OG    . SER A  1 749 ? -11.373  -10.076 17.985  1.00 34.51  ? 749  SER A OG    1 
ATOM   5248  N N     . GLY A  1 750 ? -13.253  -11.237 15.204  1.00 21.45  ? 750  GLY A N     1 
ATOM   5249  C CA    . GLY A  1 750 ? -13.413  -12.189 14.113  1.00 20.03  ? 750  GLY A CA    1 
ATOM   5250  C C     . GLY A  1 750 ? -14.666  -11.893 13.348  1.00 26.06  ? 750  GLY A C     1 
ATOM   5251  O O     . GLY A  1 750 ? -14.637  -11.846 12.123  1.00 25.65  ? 750  GLY A O     1 
ATOM   5252  N N     . TYR A  1 751 ? -15.765  -11.639 14.073  1.00 27.11  ? 751  TYR A N     1 
ATOM   5253  C CA    . TYR A  1 751 ? -17.060  -11.307 13.491  1.00 30.03  ? 751  TYR A CA    1 
ATOM   5254  C C     . TYR A  1 751 ? -16.926  -10.048 12.626  1.00 38.26  ? 751  TYR A C     1 
ATOM   5255  O O     . TYR A  1 751 ? -17.378  -10.050 11.482  1.00 38.44  ? 751  TYR A O     1 
ATOM   5256  C CB    . TYR A  1 751 ? -18.102  -11.098 14.593  1.00 32.25  ? 751  TYR A CB    1 
ATOM   5257  C CG    . TYR A  1 751 ? -19.511  -10.907 14.075  1.00 36.25  ? 751  TYR A CG    1 
ATOM   5258  C CD1   . TYR A  1 751 ? -19.951  -9.660  13.623  1.00 38.12  ? 751  TYR A CD1   1 
ATOM   5259  C CD2   . TYR A  1 751 ? -20.429  -11.950 14.101  1.00 37.82  ? 751  TYR A CD2   1 
ATOM   5260  C CE1   . TYR A  1 751 ? -21.251  -9.475  13.155  1.00 38.66  ? 751  TYR A CE1   1 
ATOM   5261  C CE2   . TYR A  1 751 ? -21.738  -11.772 13.660  1.00 39.61  ? 751  TYR A CE2   1 
ATOM   5262  C CZ    . TYR A  1 751 ? -22.140  -10.534 13.179  1.00 51.54  ? 751  TYR A CZ    1 
ATOM   5263  O OH    . TYR A  1 751 ? -23.419  -10.365 12.727  1.00 57.43  ? 751  TYR A OH    1 
ATOM   5264  N N     . CYS A  1 752 ? -16.286  -8.991  13.163  1.00 36.00  ? 752  CYS A N     1 
ATOM   5265  C CA    . CYS A  1 752 ? -16.081  -7.744  12.440  1.00 36.74  ? 752  CYS A CA    1 
ATOM   5266  C C     . CYS A  1 752 ? -15.155  -7.872  11.258  1.00 45.13  ? 752  CYS A C     1 
ATOM   5267  O O     . CYS A  1 752 ? -15.262  -7.067  10.331  1.00 45.84  ? 752  CYS A O     1 
ATOM   5268  C CB    . CYS A  1 752 ? -15.618  -6.654  13.382  1.00 36.76  ? 752  CYS A CB    1 
ATOM   5269  S SG    . CYS A  1 752 ? -16.828  -6.262  14.642  1.00 40.93  ? 752  CYS A SG    1 
ATOM   5270  N N     . ASP A  1 753 ? -14.220  -8.853  11.282  1.00 42.98  ? 753  ASP A N     1 
ATOM   5271  C CA    . ASP A  1 753 ? -13.282  -9.057  10.174  1.00 43.57  ? 753  ASP A CA    1 
ATOM   5272  C C     . ASP A  1 753 ? -14.069  -9.540  8.984   1.00 47.81  ? 753  ASP A C     1 
ATOM   5273  O O     . ASP A  1 753 ? -13.790  -9.147  7.865   1.00 49.68  ? 753  ASP A O     1 
ATOM   5274  C CB    . ASP A  1 753 ? -12.182  -10.055 10.539  1.00 46.60  ? 753  ASP A CB    1 
ATOM   5275  C CG    . ASP A  1 753 ? -11.204  -9.623  11.632  1.00 62.44  ? 753  ASP A CG    1 
ATOM   5276  O OD1   . ASP A  1 753 ? -11.255  -8.427  12.050  1.00 63.01  ? 753  ASP A OD1   1 
ATOM   5277  O OD2   . ASP A  1 753 ? -10.384  -10.484 12.079  1.00 66.20  ? 753  ASP A OD2   1 
ATOM   5278  N N     . ALA A  1 754 ? -15.105  -10.336 9.242   1.00 44.10  ? 754  ALA A N     1 
ATOM   5279  C CA    . ALA A  1 754 ? -16.007  -10.859 8.230   1.00 44.60  ? 754  ALA A CA    1 
ATOM   5280  C C     . ALA A  1 754 ? -16.952  -9.750  7.755   1.00 51.16  ? 754  ALA A C     1 
ATOM   5281  O O     . ALA A  1 754 ? -17.395  -9.779  6.607   1.00 50.65  ? 754  ALA A O     1 
ATOM   5282  C CB    . ALA A  1 754 ? -16.803  -12.021 8.808   1.00 44.82  ? 754  ALA A CB    1 
ATOM   5283  N N     . VAL A  1 755 ? -17.268  -8.784  8.648   1.00 49.97  ? 755  VAL A N     1 
ATOM   5284  C CA    . VAL A  1 755 ? -18.131  -7.636  8.365   1.00 51.13  ? 755  VAL A CA    1 
ATOM   5285  C C     . VAL A  1 755 ? -17.413  -6.731  7.349   1.00 58.54  ? 755  VAL A C     1 
ATOM   5286  O O     . VAL A  1 755 ? -17.973  -6.473  6.286   1.00 59.83  ? 755  VAL A O     1 
ATOM   5287  C CB    . VAL A  1 755 ? -18.483  -6.872  9.663   1.00 55.43  ? 755  VAL A CB    1 
ATOM   5288  C CG1   . VAL A  1 755 ? -19.015  -5.484  9.380   1.00 55.65  ? 755  VAL A CG1   1 
ATOM   5289  C CG2   . VAL A  1 755 ? -19.464  -7.641  10.518  1.00 55.12  ? 755  VAL A CG2   1 
ATOM   5290  N N     . LYS A  1 756 ? -16.175  -6.277  7.661   1.00 55.60  ? 756  LYS A N     1 
ATOM   5291  C CA    . LYS A  1 756 ? -15.371  -5.414  6.798   1.00 56.67  ? 756  LYS A CA    1 
ATOM   5292  C C     . LYS A  1 756 ? -15.068  -6.047  5.445   1.00 64.31  ? 756  LYS A C     1 
ATOM   5293  O O     . LYS A  1 756 ? -14.937  -5.317  4.465   1.00 64.83  ? 756  LYS A O     1 
ATOM   5294  C CB    . LYS A  1 756 ? -14.085  -4.967  7.499   1.00 59.24  ? 756  LYS A CB    1 
ATOM   5295  C CG    . LYS A  1 756 ? -14.289  -3.897  8.571   1.00 70.73  ? 756  LYS A CG    1 
ATOM   5296  C CD    . LYS A  1 756 ? -12.961  -3.322  9.060   1.00 80.88  ? 756  LYS A CD    1 
ATOM   5297  C CE    . LYS A  1 756 ? -13.111  -2.031  9.839   1.00 94.82  ? 756  LYS A CE    1 
ATOM   5298  N NZ    . LYS A  1 756 ? -11.792  -1.462  10.241  1.00 103.21 ? 756  LYS A NZ    1 
ATOM   5299  N N     . GLN A  1 757 ? -14.989  -7.394  5.378   1.00 64.21  ? 757  GLN A N     1 
ATOM   5300  C CA    . GLN A  1 757 ? -14.757  -8.123  4.123   1.00 66.92  ? 757  GLN A CA    1 
ATOM   5301  C C     . GLN A  1 757 ? -16.016  -8.119  3.219   1.00 73.96  ? 757  GLN A C     1 
ATOM   5302  O O     . GLN A  1 757 ? -15.895  -7.969  1.998   1.00 74.49  ? 757  GLN A O     1 
ATOM   5303  C CB    . GLN A  1 757 ? -14.113  -9.531  4.347   1.00 68.42  ? 757  GLN A CB    1 
ATOM   5304  C CG    . GLN A  1 757 ? -15.067  -10.750 4.413   1.00 92.92  ? 757  GLN A CG    1 
ATOM   5305  C CD    . GLN A  1 757 ? -15.360  -11.428 3.074   1.00 105.93 ? 757  GLN A CD    1 
ATOM   5306  O OE1   . GLN A  1 757 ? -14.453  -11.891 2.372   1.00 97.73  ? 757  GLN A OE1   1 
ATOM   5307  N NE2   . GLN A  1 757 ? -16.644  -11.574 2.728   1.00 94.07  ? 757  GLN A NE2   1 
ATOM   5308  N N     . SER A  1 758 ? -17.216  -8.239  3.830   1.00 72.40  ? 758  SER A N     1 
ATOM   5309  C CA    . SER A  1 758 ? -18.505  -8.186  3.124   1.00 74.30  ? 758  SER A CA    1 
ATOM   5310  C C     . SER A  1 758 ? -18.872  -6.713  2.782   1.00 80.65  ? 758  SER A C     1 
ATOM   5311  O O     . SER A  1 758 ? -19.793  -6.454  1.991   1.00 81.89  ? 758  SER A O     1 
ATOM   5312  C CB    . SER A  1 758 ? -19.608  -8.871  3.933   1.00 77.71  ? 758  SER A CB    1 
ATOM   5313  O OG    . SER A  1 758 ? -19.775  -8.315  5.226   1.00 85.63  ? 758  SER A OG    1 
ATOM   5314  N N     . ALA A  1 759 ? -18.104  -5.759  3.374   1.00 75.66  ? 759  ALA A N     1 
ATOM   5315  C CA    . ALA A  1 759 ? -18.197  -4.315  3.186   1.00 74.74  ? 759  ALA A CA    1 
ATOM   5316  C C     . ALA A  1 759 ? -17.194  -3.838  2.108   1.00 78.24  ? 759  ALA A C     1 
ATOM   5317  O O     . ALA A  1 759 ? -16.882  -2.644  2.046   1.00 79.43  ? 759  ALA A O     1 
ATOM   5318  C CB    . ALA A  1 759 ? -17.949  -3.606  4.515   1.00 74.62  ? 759  ALA A CB    1 
ATOM   5319  N N     . SER A  1 760 ? -16.709  -4.777  1.251   1.00 73.38  ? 760  SER A N     1 
ATOM   5320  C CA    . SER A  1 760 ? -15.759  -4.513  0.159   1.00 77.01  ? 760  SER A CA    1 
ATOM   5321  C C     . SER A  1 760 ? -16.418  -4.754  -1.207  1.00 109.89 ? 760  SER A C     1 
ATOM   5322  O O     . SER A  1 760 ? -17.592  -4.425  -1.402  1.00 71.58  ? 760  SER A O     1 
ATOM   5323  C CB    . SER A  1 760 ? -14.504  -5.373  0.306   1.00 78.16  ? 760  SER A CB    1 
ATOM   5324  O OG    . SER A  1 760 ? -13.822  -5.152  1.532   1.00 78.35  ? 760  SER A OG    1 
ATOM   5325  N N     . SER A  1 762 ? -21.936  -4.846  -5.235  1.00 92.57  ? 762  SER A N     1 
ATOM   5326  C CA    . SER A  1 762 ? -22.940  -3.820  -4.921  1.00 92.74  ? 762  SER A CA    1 
ATOM   5327  C C     . SER A  1 762 ? -23.821  -4.270  -3.739  1.00 98.02  ? 762  SER A C     1 
ATOM   5328  O O     . SER A  1 762 ? -25.055  -4.390  -3.861  1.00 98.82  ? 762  SER A O     1 
ATOM   5329  C CB    . SER A  1 762 ? -23.770  -3.448  -6.153  1.00 94.50  ? 762  SER A CB    1 
ATOM   5330  O OG    . SER A  1 762 ? -24.800  -2.518  -5.878  1.00 95.91  ? 762  SER A OG    1 
ATOM   5331  N N     . ARG A  1 763 ? -23.158  -4.509  -2.581  1.00 92.70  ? 763  ARG A N     1 
ATOM   5332  C CA    . ARG A  1 763 ? -23.808  -4.942  -1.343  1.00 90.47  ? 763  ARG A CA    1 
ATOM   5333  C C     . ARG A  1 763 ? -23.893  -3.847  -0.228  1.00 90.84  ? 763  ARG A C     1 
ATOM   5334  O O     . ARG A  1 763 ? -24.955  -3.228  -0.083  1.00 90.24  ? 763  ARG A O     1 
ATOM   5335  C CB    . ARG A  1 763 ? -23.201  -6.278  -0.845  1.00 89.05  ? 763  ARG A CB    1 
ATOM   5336  C CG    . ARG A  1 763 ? -24.029  -7.012  0.213   1.00 93.24  ? 763  ARG A CG    1 
ATOM   5337  C CD    . ARG A  1 763 ? -25.191  -7.770  -0.381  1.00 94.76  ? 763  ARG A CD    1 
ATOM   5338  N NE    . ARG A  1 763 ? -26.431  -7.483  0.336   1.00 96.07  ? 763  ARG A NE    1 
ATOM   5339  C CZ    . ARG A  1 763 ? -27.311  -6.555  -0.020  1.00 103.87 ? 763  ARG A CZ    1 
ATOM   5340  N NH1   . ARG A  1 763 ? -27.093  -5.794  -1.090  1.00 82.86  ? 763  ARG A NH1   1 
ATOM   5341  N NH2   . ARG A  1 763 ? -28.413  -6.372  0.695   1.00 92.34  ? 763  ARG A NH2   1 
ATOM   5342  N N     . ARG A  1 764 ? -22.786  -3.616  0.540   1.00 83.89  ? 764  ARG A N     1 
ATOM   5343  C CA    . ARG A  1 764 ? -22.744  -2.677  1.673   1.00 81.54  ? 764  ARG A CA    1 
ATOM   5344  C C     . ARG A  1 764 ? -21.418  -1.902  1.856   1.00 81.08  ? 764  ARG A C     1 
ATOM   5345  O O     . ARG A  1 764 ? -20.377  -2.374  1.408   1.00 83.28  ? 764  ARG A O     1 
ATOM   5346  C CB    . ARG A  1 764 ? -23.066  -3.441  2.954   1.00 79.90  ? 764  ARG A CB    1 
ATOM   5347  N N     . ARG A  1 765 ? -21.455  -0.735  2.545   1.00 70.21  ? 765  ARG A N     1 
ATOM   5348  C CA    . ARG A  1 765 ? -20.280  0.100   2.796   1.00 66.40  ? 765  ARG A CA    1 
ATOM   5349  C C     . ARG A  1 765 ? -19.967  0.250   4.286   1.00 62.52  ? 765  ARG A C     1 
ATOM   5350  O O     . ARG A  1 765 ? -18.893  -0.163  4.719   1.00 60.93  ? 765  ARG A O     1 
ATOM   5351  C CB    . ARG A  1 765 ? -20.421  1.472   2.118   1.00 66.45  ? 765  ARG A CB    1 
ATOM   5352  C CG    . ARG A  1 765 ? -19.678  1.559   0.811   1.00 79.60  ? 765  ARG A CG    1 
ATOM   5353  C CD    . ARG A  1 765 ? -19.893  2.908   0.187   1.00 89.45  ? 765  ARG A CD    1 
ATOM   5354  N NE    . ARG A  1 765 ? -20.040  2.814   -1.262  1.00 103.97 ? 765  ARG A NE    1 
ATOM   5355  C CZ    . ARG A  1 765 ? -20.371  3.831   -2.054  1.00 119.89 ? 765  ARG A CZ    1 
ATOM   5356  N NH1   . ARG A  1 765 ? -20.597  5.034   -1.541  1.00 95.65  ? 765  ARG A NH1   1 
ATOM   5357  N NH2   . ARG A  1 765 ? -20.476  3.655   -3.363  1.00 117.74 ? 765  ARG A NH2   1 
ATOM   5358  N N     . THR A  1 766 ? -20.889  0.863   5.060   1.00 54.46  ? 766  THR A N     1 
ATOM   5359  C CA    . THR A  1 766 ? -20.731  1.119   6.494   1.00 51.10  ? 766  THR A CA    1 
ATOM   5360  C C     . THR A  1 766 ? -21.573  0.134   7.291   1.00 47.61  ? 766  THR A C     1 
ATOM   5361  O O     . THR A  1 766 ? -22.695  -0.193  6.894   1.00 44.90  ? 766  THR A O     1 
ATOM   5362  C CB    . THR A  1 766 ? -21.070  2.592   6.846   1.00 61.36  ? 766  THR A CB    1 
ATOM   5363  O OG1   . THR A  1 766 ? -20.432  3.470   5.921   1.00 63.73  ? 766  THR A OG1   1 
ATOM   5364  C CG2   . THR A  1 766 ? -20.646  2.975   8.259   1.00 58.59  ? 766  THR A CG2   1 
ATOM   5365  N N     . PHE A  1 767 ? -21.019  -0.332  8.425   1.00 40.65  ? 767  PHE A N     1 
ATOM   5366  C CA    . PHE A  1 767 ? -21.702  -1.273  9.294   1.00 38.23  ? 767  PHE A CA    1 
ATOM   5367  C C     . PHE A  1 767 ? -21.821  -0.803  10.717  1.00 37.29  ? 767  PHE A C     1 
ATOM   5368  O O     . PHE A  1 767 ? -20.847  -0.346  11.310  1.00 37.10  ? 767  PHE A O     1 
ATOM   5369  C CB    . PHE A  1 767 ? -21.025  -2.637  9.256   1.00 39.85  ? 767  PHE A CB    1 
ATOM   5370  C CG    . PHE A  1 767 ? -21.497  -3.514  8.129   1.00 42.56  ? 767  PHE A CG    1 
ATOM   5371  C CD1   . PHE A  1 767 ? -22.548  -4.405  8.313   1.00 46.89  ? 767  PHE A CD1   1 
ATOM   5372  C CD2   . PHE A  1 767 ? -20.861  -3.484  6.892   1.00 44.91  ? 767  PHE A CD2   1 
ATOM   5373  C CE1   . PHE A  1 767 ? -22.974  -5.231  7.264   1.00 48.39  ? 767  PHE A CE1   1 
ATOM   5374  C CE2   . PHE A  1 767 ? -21.293  -4.297  5.847   1.00 48.23  ? 767  PHE A CE2   1 
ATOM   5375  C CZ    . PHE A  1 767 ? -22.361  -5.151  6.032   1.00 46.74  ? 767  PHE A CZ    1 
ATOM   5376  N N     . VAL A  1 768 ? -23.019  -0.919  11.267  1.00 30.81  ? 768  VAL A N     1 
ATOM   5377  C CA    . VAL A  1 768 ? -23.240  -0.583  12.653  1.00 30.32  ? 768  VAL A CA    1 
ATOM   5378  C C     . VAL A  1 768 ? -23.363  -1.926  13.400  1.00 36.87  ? 768  VAL A C     1 
ATOM   5379  O O     . VAL A  1 768 ? -24.401  -2.597  13.355  1.00 37.73  ? 768  VAL A O     1 
ATOM   5380  C CB    . VAL A  1 768 ? -24.413  0.391   12.900  1.00 33.29  ? 768  VAL A CB    1 
ATOM   5381  C CG1   . VAL A  1 768 ? -24.384  0.914   14.330  1.00 32.91  ? 768  VAL A CG1   1 
ATOM   5382  C CG2   . VAL A  1 768 ? -24.355  1.550   11.937  1.00 33.43  ? 768  VAL A CG2   1 
ATOM   5383  N N     . VAL A  1 769 ? -22.259  -2.343  14.015  1.00 32.46  ? 769  VAL A N     1 
ATOM   5384  C CA    . VAL A  1 769 ? -22.166  -3.594  14.733  1.00 30.54  ? 769  VAL A CA    1 
ATOM   5385  C C     . VAL A  1 769 ? -22.601  -3.293  16.147  1.00 31.12  ? 769  VAL A C     1 
ATOM   5386  O O     . VAL A  1 769 ? -22.028  -2.416  16.793  1.00 28.86  ? 769  VAL A O     1 
ATOM   5387  C CB    . VAL A  1 769 ? -20.723  -4.187  14.643  1.00 34.61  ? 769  VAL A CB    1 
ATOM   5388  C CG1   . VAL A  1 769 ? -20.542  -5.365  15.587  1.00 34.16  ? 769  VAL A CG1   1 
ATOM   5389  C CG2   . VAL A  1 769 ? -20.375  -4.599  13.214  1.00 34.20  ? 769  VAL A CG2   1 
ATOM   5390  N N     . GLU A  1 770 ? -23.653  -3.991  16.599  1.00 28.09  ? 770  GLU A N     1 
ATOM   5391  C CA    . GLU A  1 770 ? -24.185  -3.833  17.947  1.00 28.29  ? 770  GLU A CA    1 
ATOM   5392  C C     . GLU A  1 770 ? -23.532  -4.796  18.926  1.00 36.01  ? 770  GLU A C     1 
ATOM   5393  O O     . GLU A  1 770 ? -23.645  -6.023  18.788  1.00 39.12  ? 770  GLU A O     1 
ATOM   5394  C CB    . GLU A  1 770 ? -25.703  -3.997  17.984  1.00 29.39  ? 770  GLU A CB    1 
ATOM   5395  C CG    . GLU A  1 770 ? -26.273  -3.754  19.365  1.00 32.82  ? 770  GLU A CG    1 
ATOM   5396  C CD    . GLU A  1 770 ? -27.706  -4.187  19.513  1.00 55.39  ? 770  GLU A CD    1 
ATOM   5397  O OE1   . GLU A  1 770 ? -28.595  -3.560  18.891  1.00 77.82  ? 770  GLU A OE1   1 
ATOM   5398  O OE2   . GLU A  1 770 ? -27.939  -5.168  20.251  1.00 50.71  ? 770  GLU A OE2   1 
ATOM   5399  N N     . VAL A  1 771 ? -22.886  -4.228  19.937  1.00 30.99  ? 771  VAL A N     1 
ATOM   5400  C CA    . VAL A  1 771 ? -22.199  -4.959  20.982  1.00 30.03  ? 771  VAL A CA    1 
ATOM   5401  C C     . VAL A  1 771 ? -23.075  -5.012  22.229  1.00 35.14  ? 771  VAL A C     1 
ATOM   5402  O O     . VAL A  1 771 ? -23.554  -3.986  22.703  1.00 34.07  ? 771  VAL A O     1 
ATOM   5403  C CB    . VAL A  1 771 ? -20.806  -4.330  21.204  1.00 34.11  ? 771  VAL A CB    1 
ATOM   5404  C CG1   . VAL A  1 771 ? -20.272  -4.562  22.618  1.00 34.43  ? 771  VAL A CG1   1 
ATOM   5405  C CG2   . VAL A  1 771 ? -19.824  -4.846  20.164  1.00 33.59  ? 771  VAL A CG2   1 
ATOM   5406  N N     . GLN A  1 772 ? -23.307  -6.216  22.740  1.00 34.55  ? 772  GLN A N     1 
ATOM   5407  C CA    . GLN A  1 772 ? -24.128  -6.406  23.925  1.00 35.54  ? 772  GLN A CA    1 
ATOM   5408  C C     . GLN A  1 772 ? -23.255  -6.588  25.147  1.00 40.16  ? 772  GLN A C     1 
ATOM   5409  O O     . GLN A  1 772 ? -22.970  -7.713  25.518  1.00 40.62  ? 772  GLN A O     1 
ATOM   5410  C CB    . GLN A  1 772 ? -25.084  -7.594  23.747  1.00 37.65  ? 772  GLN A CB    1 
ATOM   5411  C CG    . GLN A  1 772 ? -26.238  -7.349  22.754  1.00 55.80  ? 772  GLN A CG    1 
ATOM   5412  C CD    . GLN A  1 772 ? -26.992  -8.619  22.426  1.00 71.81  ? 772  GLN A CD    1 
ATOM   5413  O OE1   . GLN A  1 772 ? -26.909  -9.653  23.130  1.00 65.31  ? 772  GLN A OE1   1 
ATOM   5414  N NE2   . GLN A  1 772 ? -27.766  -8.556  21.356  1.00 60.38  ? 772  GLN A NE2   1 
ATOM   5415  N N     . GLY A  1 773 ? -22.837  -5.481  25.750  1.00 37.99  ? 773  GLY A N     1 
ATOM   5416  C CA    . GLY A  1 773 ? -22.014  -5.481  26.950  1.00 38.92  ? 773  GLY A CA    1 
ATOM   5417  C C     . GLY A  1 773 ? -22.651  -4.838  28.172  1.00 47.00  ? 773  GLY A C     1 
ATOM   5418  O O     . GLY A  1 773 ? -21.945  -4.266  29.017  1.00 47.97  ? 773  GLY A O     1 
ATOM   5419  N N     . GLY A  1 774 ? -23.976  -4.948  28.275  1.00 44.96  ? 774  GLY A N     1 
ATOM   5420  C CA    . GLY A  1 774 ? -24.754  -4.402  29.383  1.00 45.65  ? 774  GLY A CA    1 
ATOM   5421  C C     . GLY A  1 774 ? -24.861  -2.887  29.400  1.00 49.94  ? 774  GLY A C     1 
ATOM   5422  O O     . GLY A  1 774 ? -25.091  -2.263  28.358  1.00 49.64  ? 774  GLY A O     1 
ATOM   5423  N N     . TYR A  1 775 ? -24.730  -2.294  30.604  1.00 46.09  ? 775  TYR A N     1 
ATOM   5424  C CA    . TYR A  1 775 ? -24.800  -0.847  30.827  1.00 46.00  ? 775  TYR A CA    1 
ATOM   5425  C C     . TYR A  1 775 ? -23.419  -0.200  30.972  1.00 47.52  ? 775  TYR A C     1 
ATOM   5426  O O     . TYR A  1 775 ? -23.313  0.966   31.333  1.00 46.41  ? 775  TYR A O     1 
ATOM   5427  C CB    . TYR A  1 775 ? -25.671  -0.536  32.051  1.00 48.03  ? 775  TYR A CB    1 
ATOM   5428  C CG    . TYR A  1 775 ? -27.132  -0.333  31.720  1.00 50.41  ? 775  TYR A CG    1 
ATOM   5429  C CD1   . TYR A  1 775 ? -27.604  0.902   31.276  1.00 52.58  ? 775  TYR A CD1   1 
ATOM   5430  C CD2   . TYR A  1 775 ? -28.054  -1.362  31.887  1.00 51.19  ? 775  TYR A CD2   1 
ATOM   5431  C CE1   . TYR A  1 775 ? -28.953  1.101   30.983  1.00 53.06  ? 775  TYR A CE1   1 
ATOM   5432  C CE2   . TYR A  1 775 ? -29.409  -1.174  31.599  1.00 52.60  ? 775  TYR A CE2   1 
ATOM   5433  C CZ    . TYR A  1 775 ? -29.854  0.061   31.149  1.00 60.71  ? 775  TYR A CZ    1 
ATOM   5434  O OH    . TYR A  1 775 ? -31.182  0.250   30.842  1.00 63.29  ? 775  TYR A OH    1 
ATOM   5435  N N     . SER A  1 776 ? -22.367  -0.972  30.696  1.00 43.69  ? 776  SER A N     1 
ATOM   5436  C CA    . SER A  1 776 ? -20.976  -0.556  30.784  1.00 43.03  ? 776  SER A CA    1 
ATOM   5437  C C     . SER A  1 776 ? -20.412  -0.493  29.362  1.00 47.03  ? 776  SER A C     1 
ATOM   5438  O O     . SER A  1 776 ? -20.657  -1.382  28.538  1.00 49.17  ? 776  SER A O     1 
ATOM   5439  C CB    . SER A  1 776 ? -20.197  -1.549  31.650  1.00 45.18  ? 776  SER A CB    1 
ATOM   5440  O OG    . SER A  1 776 ? -18.786  -1.421  31.549  1.00 56.01  ? 776  SER A OG    1 
ATOM   5441  N N     . GLY A  1 777 ? -19.654  0.546   29.087  1.00 41.26  ? 777  GLY A N     1 
ATOM   5442  C CA    . GLY A  1 777 ? -19.044  0.722   27.778  1.00 40.39  ? 777  GLY A CA    1 
ATOM   5443  C C     . GLY A  1 777 ? -17.741  -0.001  27.533  1.00 42.93  ? 777  GLY A C     1 
ATOM   5444  O O     . GLY A  1 777 ? -17.158  0.200   26.466  1.00 43.33  ? 777  GLY A O     1 
ATOM   5445  N N     . TYR A  1 778 ? -17.267  -0.838  28.503  1.00 38.03  ? 778  TYR A N     1 
ATOM   5446  C CA    . TYR A  1 778 ? -16.010  -1.599  28.407  1.00 37.28  ? 778  TYR A CA    1 
ATOM   5447  C C     . TYR A  1 778 ? -15.921  -2.462  27.163  1.00 37.96  ? 778  TYR A C     1 
ATOM   5448  O O     . TYR A  1 778 ? -14.960  -2.321  26.399  1.00 34.55  ? 778  TYR A O     1 
ATOM   5449  C CB    . TYR A  1 778 ? -15.756  -2.450  29.665  1.00 38.99  ? 778  TYR A CB    1 
ATOM   5450  C CG    . TYR A  1 778 ? -14.603  -3.434  29.536  1.00 40.75  ? 778  TYR A CG    1 
ATOM   5451  C CD1   . TYR A  1 778 ? -14.826  -4.750  29.146  1.00 42.38  ? 778  TYR A CD1   1 
ATOM   5452  C CD2   . TYR A  1 778 ? -13.294  -3.057  29.841  1.00 41.85  ? 778  TYR A CD2   1 
ATOM   5453  C CE1   . TYR A  1 778 ? -13.774  -5.653  29.000  1.00 44.96  ? 778  TYR A CE1   1 
ATOM   5454  C CE2   . TYR A  1 778 ? -12.233  -3.959  29.719  1.00 43.13  ? 778  TYR A CE2   1 
ATOM   5455  C CZ    . TYR A  1 778 ? -12.477  -5.260  29.295  1.00 52.53  ? 778  TYR A CZ    1 
ATOM   5456  O OH    . TYR A  1 778 ? -11.455  -6.186  29.185  1.00 53.06  ? 778  TYR A OH    1 
ATOM   5457  N N     . LEU A  1 779 ? -16.909  -3.369  26.981  1.00 35.83  ? 779  LEU A N     1 
ATOM   5458  C CA    . LEU A  1 779 ? -16.950  -4.281  25.834  1.00 35.30  ? 779  LEU A CA    1 
ATOM   5459  C C     . LEU A  1 779 ? -16.854  -3.497  24.545  1.00 38.38  ? 779  LEU A C     1 
ATOM   5460  O O     . LEU A  1 779 ? -15.922  -3.721  23.783  1.00 39.19  ? 779  LEU A O     1 
ATOM   5461  C CB    . LEU A  1 779 ? -18.232  -5.124  25.827  1.00 35.02  ? 779  LEU A CB    1 
ATOM   5462  C CG    . LEU A  1 779 ? -18.117  -6.662  25.758  1.00 38.17  ? 779  LEU A CG    1 
ATOM   5463  C CD1   . LEU A  1 779 ? -19.318  -7.248  25.041  1.00 37.32  ? 779  LEU A CD1   1 
ATOM   5464  C CD2   . LEU A  1 779 ? -16.866  -7.128  25.070  1.00 37.99  ? 779  LEU A CD2   1 
ATOM   5465  N N     . ALA A  1 780 ? -17.773  -2.531  24.343  1.00 33.47  ? 780  ALA A N     1 
ATOM   5466  C CA    . ALA A  1 780 ? -17.809  -1.682  23.153  1.00 32.84  ? 780  ALA A CA    1 
ATOM   5467  C C     . ALA A  1 780 ? -16.494  -0.948  22.916  1.00 35.80  ? 780  ALA A C     1 
ATOM   5468  O O     . ALA A  1 780 ? -15.980  -1.006  21.805  1.00 36.69  ? 780  ALA A O     1 
ATOM   5469  C CB    . ALA A  1 780 ? -18.969  -0.699  23.238  1.00 33.48  ? 780  ALA A CB    1 
ATOM   5470  N N     . SER A  1 781 ? -15.936  -0.309  23.961  1.00 30.71  ? 781  SER A N     1 
ATOM   5471  C CA    . SER A  1 781 ? -14.683  0.429   23.881  1.00 30.25  ? 781  SER A CA    1 
ATOM   5472  C C     . SER A  1 781 ? -13.552  -0.485  23.466  1.00 33.98  ? 781  SER A C     1 
ATOM   5473  O O     . SER A  1 781 ? -12.898  -0.183  22.471  1.00 36.12  ? 781  SER A O     1 
ATOM   5474  C CB    . SER A  1 781 ? -14.362  1.116   25.199  1.00 33.96  ? 781  SER A CB    1 
ATOM   5475  O OG    . SER A  1 781 ? -15.379  2.057   25.498  1.00 43.68  ? 781  SER A OG    1 
ATOM   5476  N N     . TYR A  1 782 ? -13.362  -1.628  24.165  1.00 27.25  ? 782  TYR A N     1 
ATOM   5477  C CA    . TYR A  1 782 ? -12.326  -2.605  23.831  1.00 24.75  ? 782  TYR A CA    1 
ATOM   5478  C C     . TYR A  1 782 ? -12.492  -3.048  22.382  1.00 26.22  ? 782  TYR A C     1 
ATOM   5479  O O     . TYR A  1 782 ? -11.549  -2.932  21.594  1.00 26.29  ? 782  TYR A O     1 
ATOM   5480  C CB    . TYR A  1 782 ? -12.408  -3.821  24.756  1.00 25.72  ? 782  TYR A CB    1 
ATOM   5481  C CG    . TYR A  1 782 ? -11.104  -4.570  24.913  1.00 29.96  ? 782  TYR A CG    1 
ATOM   5482  C CD1   . TYR A  1 782 ? -10.433  -5.089  23.806  1.00 32.97  ? 782  TYR A CD1   1 
ATOM   5483  C CD2   . TYR A  1 782 ? -10.567  -4.814  26.171  1.00 31.27  ? 782  TYR A CD2   1 
ATOM   5484  C CE1   . TYR A  1 782 ? -9.219   -5.767  23.941  1.00 34.32  ? 782  TYR A CE1   1 
ATOM   5485  C CE2   . TYR A  1 782 ? -9.373   -5.520  26.321  1.00 33.05  ? 782  TYR A CE2   1 
ATOM   5486  C CZ    . TYR A  1 782 ? -8.698   -5.993  25.203  1.00 39.38  ? 782  TYR A CZ    1 
ATOM   5487  O OH    . TYR A  1 782 ? -7.526   -6.697  25.354  1.00 38.89  ? 782  TYR A OH    1 
ATOM   5488  N N     . ALA A  1 783 ? -13.711  -3.509  22.022  1.00 20.63  ? 783  ALA A N     1 
ATOM   5489  C CA    . ALA A  1 783 ? -14.050  -3.987  20.687  1.00 18.78  ? 783  ALA A CA    1 
ATOM   5490  C C     . ALA A  1 783 ? -13.710  -2.929  19.647  1.00 26.63  ? 783  ALA A C     1 
ATOM   5491  O O     . ALA A  1 783 ? -13.066  -3.254  18.653  1.00 29.57  ? 783  ALA A O     1 
ATOM   5492  C CB    . ALA A  1 783 ? -15.509  -4.370  20.618  1.00 18.20  ? 783  ALA A CB    1 
ATOM   5493  N N     . GLY A  1 784 ? -14.042  -1.672  19.924  1.00 21.38  ? 784  GLY A N     1 
ATOM   5494  C CA    . GLY A  1 784 ? -13.753  -0.561  19.037  1.00 21.38  ? 784  GLY A CA    1 
ATOM   5495  C C     . GLY A  1 784 ? -12.279  -0.471  18.715  1.00 28.74  ? 784  GLY A C     1 
ATOM   5496  O O     . GLY A  1 784 ? -11.916  -0.462  17.539  1.00 29.77  ? 784  GLY A O     1 
ATOM   5497  N N     . LEU A  1 785 ? -11.414  -0.434  19.750  1.00 27.23  ? 785  LEU A N     1 
ATOM   5498  C CA    . LEU A  1 785 ? -9.946   -0.347  19.593  1.00 28.25  ? 785  LEU A CA    1 
ATOM   5499  C C     . LEU A  1 785 ? -9.414   -1.466  18.697  1.00 33.00  ? 785  LEU A C     1 
ATOM   5500  O O     . LEU A  1 785 ? -8.717   -1.188  17.723  1.00 33.78  ? 785  LEU A O     1 
ATOM   5501  C CB    . LEU A  1 785 ? -9.224   -0.373  20.963  1.00 28.44  ? 785  LEU A CB    1 
ATOM   5502  C CG    . LEU A  1 785 ? -7.675   -0.381  20.952  1.00 32.75  ? 785  LEU A CG    1 
ATOM   5503  C CD1   . LEU A  1 785 ? -7.137   0.981   21.236  1.00 34.19  ? 785  LEU A CD1   1 
ATOM   5504  C CD2   . LEU A  1 785 ? -7.122   -1.314  21.999  1.00 31.61  ? 785  LEU A CD2   1 
ATOM   5505  N N     . ILE A  1 786 ? -9.771   -2.720  19.017  1.00 28.59  ? 786  ILE A N     1 
ATOM   5506  C CA    . ILE A  1 786 ? -9.306   -3.909  18.305  1.00 27.10  ? 786  ILE A CA    1 
ATOM   5507  C C     . ILE A  1 786 ? -9.923   -4.114  16.916  1.00 33.98  ? 786  ILE A C     1 
ATOM   5508  O O     . ILE A  1 786 ? -9.393   -4.909  16.146  1.00 36.23  ? 786  ILE A O     1 
ATOM   5509  C CB    . ILE A  1 786 ? -9.300   -5.177  19.206  1.00 28.23  ? 786  ILE A CB    1 
ATOM   5510  C CG1   . ILE A  1 786 ? -10.738  -5.616  19.607  1.00 27.49  ? 786  ILE A CG1   1 
ATOM   5511  C CG2   . ILE A  1 786 ? -8.389   -4.972  20.445  1.00 26.91  ? 786  ILE A CG2   1 
ATOM   5512  C CD1   . ILE A  1 786 ? -10.881  -7.091  19.968  1.00 33.05  ? 786  ILE A CD1   1 
ATOM   5513  N N     . THR A  1 787 ? -11.007  -3.413  16.569  1.00 29.59  ? 787  THR A N     1 
ATOM   5514  C CA    . THR A  1 787 ? -11.582  -3.609  15.229  1.00 30.14  ? 787  THR A CA    1 
ATOM   5515  C C     . THR A  1 787 ? -11.342  -2.429  14.283  1.00 38.64  ? 787  THR A C     1 
ATOM   5516  O O     . THR A  1 787 ? -11.660  -2.513  13.090  1.00 38.32  ? 787  THR A O     1 
ATOM   5517  C CB    . THR A  1 787 ? -13.061  -4.013  15.269  1.00 28.59  ? 787  THR A CB    1 
ATOM   5518  O OG1   . THR A  1 787 ? -13.822  -2.939  15.771  1.00 21.94  ? 787  THR A OG1   1 
ATOM   5519  C CG2   . THR A  1 787 ? -13.320  -5.271  16.076  1.00 26.99  ? 787  THR A CG2   1 
ATOM   5520  N N     . GLY A  1 788 ? -10.777  -1.356  14.820  1.00 37.86  ? 788  GLY A N     1 
ATOM   5521  C CA    . GLY A  1 788 ? -10.510  -0.145  14.070  1.00 39.77  ? 788  GLY A CA    1 
ATOM   5522  C C     . GLY A  1 788 ? -11.795  0.534   13.667  1.00 48.58  ? 788  GLY A C     1 
ATOM   5523  O O     . GLY A  1 788 ? -11.916  0.987   12.519  1.00 51.91  ? 788  GLY A O     1 
ATOM   5524  N N     . ALA A  1 789 ? -12.783  0.576   14.607  1.00 44.52  ? 789  ALA A N     1 
ATOM   5525  C CA    . ALA A  1 789 ? -14.095  1.210   14.402  1.00 43.88  ? 789  ALA A CA    1 
ATOM   5526  C C     . ALA A  1 789 ? -13.932  2.732   14.321  1.00 49.70  ? 789  ALA A C     1 
ATOM   5527  O O     . ALA A  1 789 ? -13.106  3.293   15.046  1.00 50.68  ? 789  ALA A O     1 
ATOM   5528  C CB    . ALA A  1 789 ? -15.031  0.850   15.537  1.00 43.33  ? 789  ALA A CB    1 
ATOM   5529  N N     . LEU A  1 790 ? -14.695  3.395   13.433  1.00 46.21  ? 790  LEU A N     1 
ATOM   5530  C CA    . LEU A  1 790 ? -14.659  4.854   13.275  1.00 46.54  ? 790  LEU A CA    1 
ATOM   5531  C C     . LEU A  1 790 ? -15.193  5.536   14.528  1.00 51.19  ? 790  LEU A C     1 
ATOM   5532  O O     . LEU A  1 790 ? -14.447  6.274   15.204  1.00 51.10  ? 790  LEU A O     1 
ATOM   5533  C CB    . LEU A  1 790 ? -15.471  5.306   12.049  1.00 46.85  ? 790  LEU A CB    1 
ATOM   5534  C CG    . LEU A  1 790 ? -14.720  5.487   10.755  1.00 52.60  ? 790  LEU A CG    1 
ATOM   5535  C CD1   . LEU A  1 790 ? -15.620  6.073   9.717   1.00 54.10  ? 790  LEU A CD1   1 
ATOM   5536  C CD2   . LEU A  1 790 ? -13.497  6.401   10.931  1.00 56.84  ? 790  LEU A CD2   1 
ATOM   5537  N N     . ALA A  1 791 ? -16.485  5.252   14.847  1.00 47.13  ? 791  ALA A N     1 
ATOM   5538  C CA    . ALA A  1 791 ? -17.170  5.763   16.023  1.00 46.17  ? 791  ALA A CA    1 
ATOM   5539  C C     . ALA A  1 791 ? -17.625  4.603   16.902  1.00 47.37  ? 791  ALA A C     1 
ATOM   5540  O O     . ALA A  1 791 ? -17.928  3.517   16.395  1.00 44.97  ? 791  ALA A O     1 
ATOM   5541  C CB    . ALA A  1 791 ? -18.359  6.610   15.608  1.00 47.47  ? 791  ALA A CB    1 
ATOM   5542  N N     . VAL A  1 792 ? -17.636  4.830   18.227  1.00 44.34  ? 792  VAL A N     1 
ATOM   5543  C CA    . VAL A  1 792 ? -18.091  3.863   19.236  1.00 43.79  ? 792  VAL A CA    1 
ATOM   5544  C C     . VAL A  1 792 ? -19.162  4.528   20.107  1.00 49.20  ? 792  VAL A C     1 
ATOM   5545  O O     . VAL A  1 792 ? -18.880  5.553   20.732  1.00 52.84  ? 792  VAL A O     1 
ATOM   5546  C CB    . VAL A  1 792 ? -16.934  3.290   20.079  1.00 47.48  ? 792  VAL A CB    1 
ATOM   5547  C CG1   . VAL A  1 792 ? -17.469  2.440   21.225  1.00 46.63  ? 792  VAL A CG1   1 
ATOM   5548  C CG2   . VAL A  1 792 ? -15.977  2.472   19.208  1.00 47.64  ? 792  VAL A CG2   1 
ATOM   5549  N N     . TYR A  1 793 ? -20.384  3.972   20.136  1.00 41.40  ? 793  TYR A N     1 
ATOM   5550  C CA    . TYR A  1 793 ? -21.498  4.533   20.909  1.00 39.52  ? 793  TYR A CA    1 
ATOM   5551  C C     . TYR A  1 793 ? -21.600  3.825   22.254  1.00 44.94  ? 793  TYR A C     1 
ATOM   5552  O O     . TYR A  1 793 ? -21.687  2.591   22.299  1.00 45.53  ? 793  TYR A O     1 
ATOM   5553  C CB    . TYR A  1 793 ? -22.803  4.427   20.111  1.00 38.85  ? 793  TYR A CB    1 
ATOM   5554  C CG    . TYR A  1 793 ? -22.763  5.218   18.824  1.00 39.15  ? 793  TYR A CG    1 
ATOM   5555  C CD1   . TYR A  1 793 ? -23.113  6.558   18.802  1.00 42.96  ? 793  TYR A CD1   1 
ATOM   5556  C CD2   . TYR A  1 793 ? -22.343  4.633   17.632  1.00 38.10  ? 793  TYR A CD2   1 
ATOM   5557  C CE1   . TYR A  1 793 ? -23.030  7.305   17.635  1.00 46.70  ? 793  TYR A CE1   1 
ATOM   5558  C CE2   . TYR A  1 793 ? -22.267  5.363   16.459  1.00 38.59  ? 793  TYR A CE2   1 
ATOM   5559  C CZ    . TYR A  1 793 ? -22.622  6.701   16.461  1.00 52.00  ? 793  TYR A CZ    1 
ATOM   5560  O OH    . TYR A  1 793 ? -22.591  7.458   15.313  1.00 57.66  ? 793  TYR A OH    1 
ATOM   5561  N N     . THR A  1 794 ? -21.511  4.590   23.352  1.00 40.64  ? 794  THR A N     1 
ATOM   5562  C CA    . THR A  1 794 ? -21.532  4.037   24.715  1.00 39.52  ? 794  THR A CA    1 
ATOM   5563  C C     . THR A  1 794 ? -22.434  4.835   25.674  1.00 46.74  ? 794  THR A C     1 
ATOM   5564  O O     . THR A  1 794 ? -22.614  6.043   25.467  1.00 48.78  ? 794  THR A O     1 
ATOM   5565  C CB    . THR A  1 794 ? -20.120  3.952   25.293  1.00 36.88  ? 794  THR A CB    1 
ATOM   5566  O OG1   . THR A  1 794 ? -19.499  5.247   25.266  1.00 39.40  ? 794  THR A OG1   1 
ATOM   5567  C CG2   . THR A  1 794 ? -19.262  2.889   24.610  1.00 31.30  ? 794  THR A CG2   1 
ATOM   5568  N N     . PRO A  1 795 ? -22.967  4.208   26.761  1.00 42.32  ? 795  PRO A N     1 
ATOM   5569  C CA    . PRO A  1 795 ? -23.798  4.972   27.716  1.00 42.78  ? 795  PRO A CA    1 
ATOM   5570  C C     . PRO A  1 795 ? -23.047  6.103   28.440  1.00 47.65  ? 795  PRO A C     1 
ATOM   5571  O O     . PRO A  1 795 ? -23.650  7.112   28.798  1.00 48.83  ? 795  PRO A O     1 
ATOM   5572  C CB    . PRO A  1 795 ? -24.304  3.897   28.687  1.00 43.40  ? 795  PRO A CB    1 
ATOM   5573  C CG    . PRO A  1 795 ? -23.359  2.794   28.553  1.00 46.41  ? 795  PRO A CG    1 
ATOM   5574  C CD    . PRO A  1 795 ? -22.870  2.790   27.161  1.00 41.98  ? 795  PRO A CD    1 
ATOM   5575  N N     . GLU A  1 796 ? -21.733  5.945   28.615  1.00 42.56  ? 796  GLU A N     1 
ATOM   5576  C CA    . GLU A  1 796 ? -20.848  6.901   29.267  1.00 42.47  ? 796  GLU A CA    1 
ATOM   5577  C C     . GLU A  1 796 ? -20.703  8.219   28.490  1.00 46.63  ? 796  GLU A C     1 
ATOM   5578  O O     . GLU A  1 796 ? -20.476  9.256   29.111  1.00 48.57  ? 796  GLU A O     1 
ATOM   5579  C CB    . GLU A  1 796 ? -19.453  6.268   29.495  1.00 43.83  ? 796  GLU A CB    1 
ATOM   5580  C CG    . GLU A  1 796 ? -19.396  5.127   30.511  1.00 54.93  ? 796  GLU A CG    1 
ATOM   5581  C CD    . GLU A  1 796 ? -20.027  3.795   30.142  1.00 70.57  ? 796  GLU A CD    1 
ATOM   5582  O OE1   . GLU A  1 796 ? -20.007  3.438   28.943  1.00 55.49  ? 796  GLU A OE1   1 
ATOM   5583  O OE2   . GLU A  1 796 ? -20.535  3.105   31.056  1.00 63.73  ? 796  GLU A OE2   1 
ATOM   5584  N N     . ASN A  1 797 ? -20.797  8.182   27.145  1.00 41.71  ? 797  ASN A N     1 
ATOM   5585  C CA    . ASN A  1 797 ? -20.629  9.364   26.290  1.00 41.70  ? 797  ASN A CA    1 
ATOM   5586  C C     . ASN A  1 797 ? -21.916  9.756   25.546  1.00 42.04  ? 797  ASN A C     1 
ATOM   5587  O O     . ASN A  1 797 ? -22.536  8.904   24.880  1.00 39.48  ? 797  ASN A O     1 
ATOM   5588  C CB    . ASN A  1 797 ? -19.458  9.178   25.340  1.00 49.87  ? 797  ASN A CB    1 
ATOM   5589  C CG    . ASN A  1 797 ? -18.139  9.029   26.070  1.00 96.17  ? 797  ASN A CG    1 
ATOM   5590  O OD1   . ASN A  1 797 ? -17.820  7.974   26.646  1.00 94.18  ? 797  ASN A OD1   1 
ATOM   5591  N ND2   . ASN A  1 797 ? -17.362  10.101  26.102  1.00 92.50  ? 797  ASN A ND2   1 
ATOM   5592  N N     . PRO A  1 798 ? -22.319  11.056  25.667  1.00 36.91  ? 798  PRO A N     1 
ATOM   5593  C CA    . PRO A  1 798 ? -23.591  11.513  25.082  1.00 35.99  ? 798  PRO A CA    1 
ATOM   5594  C C     . PRO A  1 798 ? -23.791  11.423  23.574  1.00 35.69  ? 798  PRO A C     1 
ATOM   5595  O O     . PRO A  1 798 ? -22.883  11.729  22.802  1.00 34.51  ? 798  PRO A O     1 
ATOM   5596  C CB    . PRO A  1 798 ? -23.699  12.953  25.568  1.00 39.06  ? 798  PRO A CB    1 
ATOM   5597  C CG    . PRO A  1 798 ? -22.835  13.019  26.763  1.00 43.74  ? 798  PRO A CG    1 
ATOM   5598  C CD    . PRO A  1 798 ? -21.687  12.145  26.430  1.00 38.81  ? 798  PRO A CD    1 
ATOM   5599  N N     . ILE A  1 799 ? -25.014  11.018  23.164  1.00 29.67  ? 799  ILE A N     1 
ATOM   5600  C CA    . ILE A  1 799 ? -25.393  10.907  21.759  1.00 28.99  ? 799  ILE A CA    1 
ATOM   5601  C C     . ILE A  1 799 ? -26.481  11.934  21.439  1.00 35.23  ? 799  ILE A C     1 
ATOM   5602  O O     . ILE A  1 799 ? -27.516  11.972  22.115  1.00 37.88  ? 799  ILE A O     1 
ATOM   5603  C CB    . ILE A  1 799 ? -25.775  9.462   21.341  1.00 30.61  ? 799  ILE A CB    1 
ATOM   5604  C CG1   . ILE A  1 799 ? -24.734  8.428   21.833  1.00 29.56  ? 799  ILE A CG1   1 
ATOM   5605  C CG2   . ILE A  1 799 ? -25.932  9.374   19.832  1.00 31.66  ? 799  ILE A CG2   1 
ATOM   5606  C CD1   . ILE A  1 799 ? -25.318  7.014   22.187  1.00 32.14  ? 799  ILE A CD1   1 
ATOM   5607  N N     . ASN A  1 800 ? -26.224  12.802  20.454  1.00 30.53  ? 800  ASN A N     1 
ATOM   5608  C CA    . ASN A  1 800 ? -27.160  13.837  20.027  1.00 31.47  ? 800  ASN A CA    1 
ATOM   5609  C C     . ASN A  1 800 ? -26.959  14.255  18.552  1.00 32.65  ? 800  ASN A C     1 
ATOM   5610  O O     . ASN A  1 800 ? -26.051  13.748  17.882  1.00 27.52  ? 800  ASN A O     1 
ATOM   5611  C CB    . ASN A  1 800 ? -27.153  15.049  20.986  1.00 36.85  ? 800  ASN A CB    1 
ATOM   5612  C CG    . ASN A  1 800 ? -25.988  15.992  20.851  1.00 56.09  ? 800  ASN A CG    1 
ATOM   5613  O OD1   . ASN A  1 800 ? -26.033  16.986  20.113  1.00 54.77  ? 800  ASN A OD1   1 
ATOM   5614  N ND2   . ASN A  1 800 ? -24.976  15.754  21.650  1.00 44.42  ? 800  ASN A ND2   1 
ATOM   5615  N N     . LEU A  1 801 ? -27.827  15.188  18.059  1.00 30.95  ? 801  LEU A N     1 
ATOM   5616  C CA    . LEU A  1 801 ? -27.777  15.711  16.697  1.00 31.18  ? 801  LEU A CA    1 
ATOM   5617  C C     . LEU A  1 801 ? -26.414  16.289  16.329  1.00 35.96  ? 801  LEU A C     1 
ATOM   5618  O O     . LEU A  1 801 ? -25.949  16.030  15.215  1.00 34.79  ? 801  LEU A O     1 
ATOM   5619  C CB    . LEU A  1 801 ? -28.921  16.680  16.412  1.00 31.77  ? 801  LEU A CB    1 
ATOM   5620  C CG    . LEU A  1 801 ? -30.321  16.042  16.360  1.00 34.69  ? 801  LEU A CG    1 
ATOM   5621  C CD1   . LEU A  1 801 ? -31.366  17.096  16.208  1.00 37.66  ? 801  LEU A CD1   1 
ATOM   5622  C CD2   . LEU A  1 801 ? -30.464  15.067  15.224  1.00 29.79  ? 801  LEU A CD2   1 
ATOM   5623  N N     . GLN A  1 802 ? -25.721  16.963  17.298  1.00 33.29  ? 802  GLN A N     1 
ATOM   5624  C CA    . GLN A  1 802 ? -24.358  17.455  17.079  1.00 32.92  ? 802  GLN A CA    1 
ATOM   5625  C C     . GLN A  1 802 ? -23.352  16.289  17.032  1.00 36.71  ? 802  GLN A C     1 
ATOM   5626  O O     . GLN A  1 802 ? -22.595  16.200  16.056  1.00 37.36  ? 802  GLN A O     1 
ATOM   5627  C CB    . GLN A  1 802 ? -23.955  18.539  18.079  1.00 34.37  ? 802  GLN A CB    1 
ATOM   5628  C CG    . GLN A  1 802 ? -22.491  19.018  17.940  1.00 57.06  ? 802  GLN A CG    1 
ATOM   5629  C CD    . GLN A  1 802 ? -22.130  19.675  16.613  1.00 68.47  ? 802  GLN A CD    1 
ATOM   5630  O OE1   . GLN A  1 802 ? -21.742  19.028  15.616  1.00 57.97  ? 802  GLN A OE1   1 
ATOM   5631  N NE2   . GLN A  1 802 ? -22.122  20.991  16.625  1.00 59.48  ? 802  GLN A NE2   1 
ATOM   5632  N N     . THR A  1 803 ? -23.382  15.372  18.036  1.00 30.58  ? 803  THR A N     1 
ATOM   5633  C CA    . THR A  1 803 ? -22.464  14.224  18.030  1.00 29.64  ? 803  THR A CA    1 
ATOM   5634  C C     . THR A  1 803 ? -22.603  13.372  16.764  1.00 34.04  ? 803  THR A C     1 
ATOM   5635  O O     . THR A  1 803 ? -21.586  13.032  16.149  1.00 34.40  ? 803  THR A O     1 
ATOM   5636  C CB    . THR A  1 803 ? -22.519  13.392  19.314  1.00 33.32  ? 803  THR A CB    1 
ATOM   5637  O OG1   . THR A  1 803 ? -23.709  12.629  19.349  1.00 41.27  ? 803  THR A OG1   1 
ATOM   5638  C CG2   . THR A  1 803 ? -22.382  14.216  20.557  1.00 29.34  ? 803  THR A CG2   1 
ATOM   5639  N N     . VAL A  1 804 ? -23.863  13.088  16.358  1.00 29.36  ? 804  VAL A N     1 
ATOM   5640  C CA    . VAL A  1 804 ? -24.209  12.288  15.177  1.00 28.36  ? 804  VAL A CA    1 
ATOM   5641  C C     . VAL A  1 804 ? -23.659  12.953  13.918  1.00 32.59  ? 804  VAL A C     1 
ATOM   5642  O O     . VAL A  1 804 ? -22.989  12.295  13.120  1.00 29.41  ? 804  VAL A O     1 
ATOM   5643  C CB    . VAL A  1 804 ? -25.726  11.949  15.096  1.00 31.19  ? 804  VAL A CB    1 
ATOM   5644  C CG1   . VAL A  1 804 ? -26.084  11.317  13.765  1.00 29.82  ? 804  VAL A CG1   1 
ATOM   5645  C CG2   . VAL A  1 804 ? -26.140  11.004  16.230  1.00 30.54  ? 804  VAL A CG2   1 
ATOM   5646  N N     . GLN A  1 805 ? -23.886  14.276  13.783  1.00 32.40  ? 805  GLN A N     1 
ATOM   5647  C CA    . GLN A  1 805 ? -23.414  15.083  12.651  1.00 32.62  ? 805  GLN A CA    1 
ATOM   5648  C C     . GLN A  1 805 ? -21.899  15.004  12.525  1.00 39.12  ? 805  GLN A C     1 
ATOM   5649  O O     . GLN A  1 805 ? -21.386  14.875  11.407  1.00 40.15  ? 805  GLN A O     1 
ATOM   5650  C CB    . GLN A  1 805 ? -23.879  16.531  12.798  1.00 33.35  ? 805  GLN A CB    1 
ATOM   5651  C CG    . GLN A  1 805 ? -25.229  16.758  12.172  1.00 17.94  ? 805  GLN A CG    1 
ATOM   5652  C CD    . GLN A  1 805 ? -25.784  18.078  12.577  1.00 37.33  ? 805  GLN A CD    1 
ATOM   5653  O OE1   . GLN A  1 805 ? -26.575  18.172  13.520  1.00 32.62  ? 805  GLN A OE1   1 
ATOM   5654  N NE2   . GLN A  1 805 ? -25.361  19.138  11.900  1.00 36.35  ? 805  GLN A NE2   1 
ATOM   5655  N N     . GLU A  1 806 ? -21.197  15.045  13.689  1.00 34.63  ? 806  GLU A N     1 
ATOM   5656  C CA    . GLU A  1 806 ? -19.749  14.923  13.800  1.00 33.52  ? 806  GLU A CA    1 
ATOM   5657  C C     . GLU A  1 806 ? -19.311  13.530  13.314  1.00 35.45  ? 806  GLU A C     1 
ATOM   5658  O O     . GLU A  1 806 ? -18.405  13.455  12.483  1.00 36.00  ? 806  GLU A O     1 
ATOM   5659  C CB    . GLU A  1 806 ? -19.299  15.164  15.244  1.00 34.73  ? 806  GLU A CB    1 
ATOM   5660  C CG    . GLU A  1 806 ? -19.324  16.625  15.651  1.00 47.39  ? 806  GLU A CG    1 
ATOM   5661  C CD    . GLU A  1 806 ? -19.070  16.959  17.107  1.00 75.32  ? 806  GLU A CD    1 
ATOM   5662  O OE1   . GLU A  1 806 ? -18.613  16.080  17.878  1.00 60.07  ? 806  GLU A OE1   1 
ATOM   5663  O OE2   . GLU A  1 806 ? -19.304  18.136  17.466  1.00 82.91  ? 806  GLU A OE2   1 
ATOM   5664  N N     . ASP A  1 807 ? -19.991  12.440  13.792  1.00 28.17  ? 807  ASP A N     1 
ATOM   5665  C CA    . ASP A  1 807 ? -19.742  11.051  13.375  1.00 25.54  ? 807  ASP A CA    1 
ATOM   5666  C C     . ASP A  1 807 ? -19.910  10.944  11.856  1.00 30.78  ? 807  ASP A C     1 
ATOM   5667  O O     . ASP A  1 807 ? -19.029  10.370  11.200  1.00 32.06  ? 807  ASP A O     1 
ATOM   5668  C CB    . ASP A  1 807 ? -20.682  10.048  14.080  1.00 25.54  ? 807  ASP A CB    1 
ATOM   5669  C CG    . ASP A  1 807 ? -20.610  10.013  15.599  1.00 40.57  ? 807  ASP A CG    1 
ATOM   5670  O OD1   . ASP A  1 807 ? -19.475  9.980   16.139  1.00 41.37  ? 807  ASP A OD1   1 
ATOM   5671  O OD2   . ASP A  1 807 ? -21.707  9.978   16.260  1.00 44.59  ? 807  ASP A OD2   1 
ATOM   5672  N N     . ILE A  1 808 ? -21.019  11.531  11.287  1.00 25.23  ? 808  ILE A N     1 
ATOM   5673  C CA    . ILE A  1 808 ? -21.280  11.532  9.837   1.00 23.84  ? 808  ILE A CA    1 
ATOM   5674  C C     . ILE A  1 808 ? -20.129  12.273  9.112   1.00 32.01  ? 808  ILE A C     1 
ATOM   5675  O O     . ILE A  1 808 ? -19.633  11.771  8.105   1.00 32.09  ? 808  ILE A O     1 
ATOM   5676  C CB    . ILE A  1 808 ? -22.678  12.088  9.404   1.00 24.70  ? 808  ILE A CB    1 
ATOM   5677  C CG1   . ILE A  1 808 ? -23.887  11.380  10.039  1.00 24.15  ? 808  ILE A CG1   1 
ATOM   5678  C CG2   . ILE A  1 808 ? -22.810  12.160  7.908   1.00 20.81  ? 808  ILE A CG2   1 
ATOM   5679  C CD1   . ILE A  1 808 ? -24.156  9.960   9.691   1.00 39.42  ? 808  ILE A CD1   1 
ATOM   5680  N N     . GLU A  1 809 ? -19.694  13.441  9.645   1.00 30.00  ? 809  GLU A N     1 
ATOM   5681  C CA    . GLU A  1 809 ? -18.609  14.240  9.072   1.00 31.06  ? 809  GLU A CA    1 
ATOM   5682  C C     . GLU A  1 809 ? -17.312  13.419  8.971   1.00 34.89  ? 809  GLU A C     1 
ATOM   5683  O O     . GLU A  1 809 ? -16.666  13.451  7.922   1.00 36.41  ? 809  GLU A O     1 
ATOM   5684  C CB    . GLU A  1 809 ? -18.403  15.542  9.874   1.00 33.31  ? 809  GLU A CB    1 
ATOM   5685  C CG    . GLU A  1 809 ? -17.347  16.496  9.313   1.00 51.48  ? 809  GLU A CG    1 
ATOM   5686  C CD    . GLU A  1 809 ? -16.999  17.722  10.150  1.00 87.54  ? 809  GLU A CD    1 
ATOM   5687  O OE1   . GLU A  1 809 ? -17.927  18.381  10.675  1.00 103.70 ? 809  GLU A OE1   1 
ATOM   5688  O OE2   . GLU A  1 809 ? -15.796  18.061  10.226  1.00 75.80  ? 809  GLU A OE2   1 
ATOM   5689  N N     . LEU A  1 810 ? -16.957  12.657  10.033  1.00 29.51  ? 810  LEU A N     1 
ATOM   5690  C CA    . LEU A  1 810 ? -15.753  11.829  10.052  1.00 29.04  ? 810  LEU A CA    1 
ATOM   5691  C C     . LEU A  1 810 ? -15.850  10.794  8.971   1.00 36.66  ? 810  LEU A C     1 
ATOM   5692  O O     . LEU A  1 810 ? -14.939  10.719  8.154   1.00 36.35  ? 810  LEU A O     1 
ATOM   5693  C CB    . LEU A  1 810 ? -15.537  11.153  11.416  1.00 28.23  ? 810  LEU A CB    1 
ATOM   5694  C CG    . LEU A  1 810 ? -14.359  10.138  11.496  1.00 32.43  ? 810  LEU A CG    1 
ATOM   5695  C CD1   . LEU A  1 810 ? -13.006  10.794  11.086  1.00 32.56  ? 810  LEU A CD1   1 
ATOM   5696  C CD2   . LEU A  1 810 ? -14.292  9.487   12.870  1.00 31.65  ? 810  LEU A CD2   1 
ATOM   5697  N N     . LEU A  1 811 ? -16.982  10.025  8.942   1.00 35.56  ? 811  LEU A N     1 
ATOM   5698  C CA    . LEU A  1 811 ? -17.279  9.004   7.933   1.00 35.55  ? 811  LEU A CA    1 
ATOM   5699  C C     . LEU A  1 811 ? -17.207  9.590   6.514   1.00 42.11  ? 811  LEU A C     1 
ATOM   5700  O O     . LEU A  1 811 ? -16.579  8.992   5.646   1.00 43.70  ? 811  LEU A O     1 
ATOM   5701  C CB    . LEU A  1 811 ? -18.660  8.398   8.198   1.00 34.46  ? 811  LEU A CB    1 
ATOM   5702  C CG    . LEU A  1 811 ? -19.144  7.277   7.253   1.00 37.53  ? 811  LEU A CG    1 
ATOM   5703  C CD1   . LEU A  1 811 ? -18.373  5.993   7.450   1.00 35.52  ? 811  LEU A CD1   1 
ATOM   5704  C CD2   . LEU A  1 811 ? -20.599  6.997   7.494   1.00 38.06  ? 811  LEU A CD2   1 
ATOM   5705  N N     . THR A  1 812 ? -17.804  10.772  6.310   1.00 38.32  ? 812  THR A N     1 
ATOM   5706  C CA    . THR A  1 812 ? -17.807  11.504  5.051   1.00 39.05  ? 812  THR A CA    1 
ATOM   5707  C C     . THR A  1 812 ? -16.371  11.844  4.655   1.00 44.86  ? 812  THR A C     1 
ATOM   5708  O O     . THR A  1 812 ? -15.949  11.448  3.575   1.00 45.43  ? 812  THR A O     1 
ATOM   5709  C CB    . THR A  1 812 ? -18.742  12.717  5.164   1.00 41.05  ? 812  THR A CB    1 
ATOM   5710  O OG1   . THR A  1 812 ? -20.039  12.246  5.507   1.00 42.82  ? 812  THR A OG1   1 
ATOM   5711  C CG2   . THR A  1 812 ? -18.837  13.504  3.891   1.00 38.28  ? 812  THR A CG2   1 
ATOM   5712  N N     . ARG A  1 813 ? -15.616  12.519  5.544   1.00 42.62  ? 813  ARG A N     1 
ATOM   5713  C CA    . ARG A  1 813 ? -14.236  12.913  5.288   1.00 44.37  ? 813  ARG A CA    1 
ATOM   5714  C C     . ARG A  1 813 ? -13.300  11.698  5.090   1.00 50.68  ? 813  ARG A C     1 
ATOM   5715  O O     . ARG A  1 813 ? -12.338  11.787  4.326   1.00 50.73  ? 813  ARG A O     1 
ATOM   5716  C CB    . ARG A  1 813 ? -13.720  13.896  6.357   1.00 45.69  ? 813  ARG A CB    1 
ATOM   5717  C CG    . ARG A  1 813 ? -12.724  14.918  5.803   1.00 70.68  ? 813  ARG A CG    1 
ATOM   5718  C CD    . ARG A  1 813 ? -12.123  15.844  6.853   1.00 92.83  ? 813  ARG A CD    1 
ATOM   5719  N NE    . ARG A  1 813 ? -11.049  16.675  6.293   1.00 107.04 ? 813  ARG A NE    1 
ATOM   5720  C CZ    . ARG A  1 813 ? -10.153  17.351  7.015   1.00 119.38 ? 813  ARG A CZ    1 
ATOM   5721  N NH1   . ARG A  1 813 ? -10.185  17.304  8.345   1.00 100.86 ? 813  ARG A NH1   1 
ATOM   5722  N NH2   . ARG A  1 813 ? -9.218   18.078  6.414   1.00 105.16 ? 813  ARG A NH2   1 
ATOM   5723  N N     . THR A  1 814 ? -13.622  10.559  5.720   1.00 48.67  ? 814  THR A N     1 
ATOM   5724  C CA    . THR A  1 814 ? -12.848  9.316   5.610   1.00 49.13  ? 814  THR A CA    1 
ATOM   5725  C C     . THR A  1 814 ? -13.036  8.705   4.218   1.00 57.69  ? 814  THR A C     1 
ATOM   5726  O O     . THR A  1 814 ? -12.045  8.442   3.534   1.00 57.92  ? 814  THR A O     1 
ATOM   5727  C CB    . THR A  1 814 ? -13.172  8.361   6.799   1.00 48.67  ? 814  THR A CB    1 
ATOM   5728  O OG1   . THR A  1 814 ? -12.555  8.858   7.975   1.00 43.48  ? 814  THR A OG1   1 
ATOM   5729  C CG2   . THR A  1 814 ? -12.688  6.955   6.590   1.00 45.22  ? 814  THR A CG2   1 
ATOM   5730  N N     . TYR A  1 815 ? -14.303  8.497   3.809   1.00 57.65  ? 815  TYR A N     1 
ATOM   5731  C CA    . TYR A  1 815 ? -14.671  7.922   2.519   1.00 60.20  ? 815  TYR A CA    1 
ATOM   5732  C C     . TYR A  1 815 ? -14.187  8.725   1.309   1.00 65.85  ? 815  TYR A C     1 
ATOM   5733  O O     . TYR A  1 815 ? -13.876  8.124   0.279   1.00 64.70  ? 815  TYR A O     1 
ATOM   5734  C CB    . TYR A  1 815 ? -16.172  7.654   2.448   1.00 63.35  ? 815  TYR A CB    1 
ATOM   5735  C CG    . TYR A  1 815 ? -16.539  6.235   2.827   1.00 67.80  ? 815  TYR A CG    1 
ATOM   5736  C CD1   . TYR A  1 815 ? -16.672  5.244   1.856   1.00 71.29  ? 815  TYR A CD1   1 
ATOM   5737  C CD2   . TYR A  1 815 ? -16.772  5.884   4.152   1.00 68.19  ? 815  TYR A CD2   1 
ATOM   5738  C CE1   . TYR A  1 815 ? -17.023  3.934   2.193   1.00 72.56  ? 815  TYR A CE1   1 
ATOM   5739  C CE2   . TYR A  1 815 ? -17.126  4.576   4.501   1.00 69.06  ? 815  TYR A CE2   1 
ATOM   5740  C CZ    . TYR A  1 815 ? -17.252  3.605   3.516   1.00 80.00  ? 815  TYR A CZ    1 
ATOM   5741  O OH    . TYR A  1 815 ? -17.576  2.307   3.841   1.00 83.52  ? 815  TYR A OH    1 
ATOM   5742  N N     . GLU A  1 816 ? -14.073  10.060  1.441   1.00 65.39  ? 816  GLU A N     1 
ATOM   5743  C CA    . GLU A  1 816 ? -13.577  10.910  0.359   1.00 68.05  ? 816  GLU A CA    1 
ATOM   5744  C C     . GLU A  1 816 ? -12.046  11.039  0.358   1.00 75.92  ? 816  GLU A C     1 
ATOM   5745  O O     . GLU A  1 816 ? -11.495  12.125  0.194   1.00 78.22  ? 816  GLU A O     1 
ATOM   5746  C CB    . GLU A  1 816 ? -14.341  12.251  0.235   1.00 70.51  ? 816  GLU A CB    1 
ATOM   5747  C CG    . GLU A  1 816 ? -14.283  13.191  1.436   1.00 82.83  ? 816  GLU A CG    1 
ATOM   5748  C CD    . GLU A  1 816 ? -15.146  14.442  1.370   1.00 100.39 ? 816  GLU A CD    1 
ATOM   5749  O OE1   . GLU A  1 816 ? -14.691  15.488  1.885   1.00 97.17  ? 816  GLU A OE1   1 
ATOM   5750  O OE2   . GLU A  1 816 ? -16.280  14.379  0.836   1.00 85.58  ? 816  GLU A OE2   1 
ATOM   5751  N N     . GLU A  1 817 ? -11.368  9.896   0.534   1.00 73.07  ? 817  GLU A N     1 
ATOM   5752  C CA    . GLU A  1 817 ? -9.914   9.728   0.538   1.00 74.26  ? 817  GLU A CA    1 
ATOM   5753  C C     . GLU A  1 817 ? -9.584   8.309   0.075   1.00 80.06  ? 817  GLU A C     1 
ATOM   5754  O O     . GLU A  1 817 ? -8.587   8.108   -0.620  1.00 80.30  ? 817  GLU A O     1 
ATOM   5755  C CB    . GLU A  1 817 ? -9.332   9.967   1.941   1.00 75.19  ? 817  GLU A CB    1 
ATOM   5756  C CG    . GLU A  1 817 ? -9.037   11.425  2.262   1.00 89.19  ? 817  GLU A CG    1 
ATOM   5757  C CD    . GLU A  1 817 ? -9.154   11.825  3.724   1.00 112.35 ? 817  GLU A CD    1 
ATOM   5758  O OE1   . GLU A  1 817 ? -9.337   13.039  3.990   1.00 112.60 ? 817  GLU A OE1   1 
ATOM   5759  O OE2   . GLU A  1 817 ? -9.078   10.929  4.602   1.00 94.27  ? 817  GLU A OE2   1 
ATOM   5760  N N     . ASP A  1 818 ? -10.438  7.331   0.458   1.00 77.93  ? 818  ASP A N     1 
ATOM   5761  C CA    . ASP A  1 818 ? -10.308  5.908   0.127   1.00 78.44  ? 818  ASP A CA    1 
ATOM   5762  C C     . ASP A  1 818 ? -10.271  5.631   -1.397  1.00 86.11  ? 818  ASP A C     1 
ATOM   5763  O O     . ASP A  1 818 ? -10.878  6.377   -2.180  1.00 87.18  ? 818  ASP A O     1 
ATOM   5764  C CB    . ASP A  1 818 ? -11.388  5.075   0.841   1.00 78.68  ? 818  ASP A CB    1 
ATOM   5765  N N     . ASP A  1 819 ? -9.500   4.586   -1.806  1.00 82.97  ? 819  ASP A N     1 
ATOM   5766  C CA    . ASP A  1 819 ? -9.314   4.173   -3.204  1.00 96.76  ? 819  ASP A CA    1 
ATOM   5767  C C     . ASP A  1 819 ? -9.354   2.652   -3.360  1.00 106.47 ? 819  ASP A C     1 
ATOM   5768  O O     . ASP A  1 819 ? -8.770   1.919   -2.560  1.00 58.83  ? 819  ASP A O     1 
ATOM   5769  C CB    . ASP A  1 819 ? -7.996   4.731   -3.759  1.00 99.45  ? 819  ASP A CB    1 
ATOM   5770  N N     . ARG A  1 823 ? -7.835   -1.929  0.334   1.00 74.78  ? 823  ARG A N     1 
ATOM   5771  C CA    . ARG A  1 823 ? -8.853   -2.651  1.094   1.00 74.17  ? 823  ARG A CA    1 
ATOM   5772  C C     . ARG A  1 823 ? -9.665   -1.675  1.934   1.00 80.05  ? 823  ARG A C     1 
ATOM   5773  O O     . ARG A  1 823 ? -9.081   -0.963  2.755   1.00 79.96  ? 823  ARG A O     1 
ATOM   5774  C CB    . ARG A  1 823 ? -8.210   -3.737  1.985   1.00 72.51  ? 823  ARG A CB    1 
ATOM   5775  N N     . SER A  1 824 ? -11.010  -1.636  1.726   1.00 77.22  ? 824  SER A N     1 
ATOM   5776  C CA    . SER A  1 824 ? -11.937  -0.737  2.438   1.00 76.45  ? 824  SER A CA    1 
ATOM   5777  C C     . SER A  1 824 ? -13.115  -1.457  3.149   1.00 78.20  ? 824  SER A C     1 
ATOM   5778  O O     . SER A  1 824 ? -13.151  -2.694  3.198   1.00 76.93  ? 824  SER A O     1 
ATOM   5779  C CB    . SER A  1 824 ? -12.425  0.387   1.521   1.00 80.86  ? 824  SER A CB    1 
ATOM   5780  O OG    . SER A  1 824 ? -11.354  1.171   1.018   1.00 88.33  ? 824  SER A OG    1 
ATOM   5781  N N     . GLY A  1 825 ? -14.029  -0.659  3.720   1.00 73.88  ? 825  GLY A N     1 
ATOM   5782  C CA    . GLY A  1 825 ? -15.184  -1.112  4.494   1.00 72.07  ? 825  GLY A CA    1 
ATOM   5783  C C     . GLY A  1 825 ? -15.086  -0.648  5.938   1.00 72.06  ? 825  GLY A C     1 
ATOM   5784  O O     . GLY A  1 825 ? -14.203  -1.113  6.670   1.00 70.75  ? 825  GLY A O     1 
ATOM   5785  N N     . LYS A  1 826 ? -15.958  0.312   6.346   1.00 65.81  ? 826  LYS A N     1 
ATOM   5786  C CA    . LYS A  1 826 ? -15.928  0.910   7.690   1.00 63.49  ? 826  LYS A CA    1 
ATOM   5787  C C     . LYS A  1 826 ? -16.973  0.422   8.695   1.00 62.63  ? 826  LYS A C     1 
ATOM   5788  O O     . LYS A  1 826 ? -18.059  -0.020  8.303   1.00 62.02  ? 826  LYS A O     1 
ATOM   5789  C CB    . LYS A  1 826 ? -15.812  2.459   7.650   1.00 66.42  ? 826  LYS A CB    1 
ATOM   5790  C CG    . LYS A  1 826 ? -14.414  3.011   7.239   1.00 88.51  ? 826  LYS A CG    1 
ATOM   5791  C CD    . LYS A  1 826 ? -13.149  2.292   7.869   1.00 103.39 ? 826  LYS A CD    1 
ATOM   5792  C CE    . LYS A  1 826 ? -12.907  2.476   9.372   1.00 105.97 ? 826  LYS A CE    1 
ATOM   5793  N NZ    . LYS A  1 826 ? -13.642  1.491   10.230  1.00 93.12  ? 826  LYS A NZ    1 
ATOM   5794  N N     . ILE A  1 827 ? -16.622  0.472   10.001  1.00 55.10  ? 827  ILE A N     1 
ATOM   5795  C CA    . ILE A  1 827 ? -17.519  0.020   11.075  1.00 51.95  ? 827  ILE A CA    1 
ATOM   5796  C C     . ILE A  1 827 ? -17.708  1.023   12.209  1.00 51.51  ? 827  ILE A C     1 
ATOM   5797  O O     . ILE A  1 827 ? -16.808  1.808   12.508  1.00 52.65  ? 827  ILE A O     1 
ATOM   5798  C CB    . ILE A  1 827 ? -17.251  -1.430  11.613  1.00 53.41  ? 827  ILE A CB    1 
ATOM   5799  C CG1   . ILE A  1 827 ? -16.021  -1.517  12.476  1.00 52.66  ? 827  ILE A CG1   1 
ATOM   5800  C CG2   . ILE A  1 827 ? -17.252  -2.499  10.531  1.00 54.79  ? 827  ILE A CG2   1 
ATOM   5801  C CD1   . ILE A  1 827 ? -16.311  -2.158  13.706  1.00 59.85  ? 827  ILE A CD1   1 
ATOM   5802  N N     . PHE A  1 828 ? -18.892  0.968   12.841  1.00 42.39  ? 828  PHE A N     1 
ATOM   5803  C CA    . PHE A  1 828 ? -19.273  1.764   13.996  1.00 39.83  ? 828  PHE A CA    1 
ATOM   5804  C C     . PHE A  1 828 ? -19.646  0.757   15.068  1.00 38.74  ? 828  PHE A C     1 
ATOM   5805  O O     . PHE A  1 828 ? -20.308  -0.244  14.756  1.00 38.07  ? 828  PHE A O     1 
ATOM   5806  C CB    . PHE A  1 828 ? -20.488  2.652   13.679  1.00 42.10  ? 828  PHE A CB    1 
ATOM   5807  C CG    . PHE A  1 828 ? -20.236  3.941   12.938  1.00 44.49  ? 828  PHE A CG    1 
ATOM   5808  C CD1   . PHE A  1 828 ? -19.572  3.945   11.726  1.00 48.76  ? 828  PHE A CD1   1 
ATOM   5809  C CD2   . PHE A  1 828 ? -20.782  5.128   13.383  1.00 47.16  ? 828  PHE A CD2   1 
ATOM   5810  C CE1   . PHE A  1 828 ? -19.362  5.137   11.034  1.00 50.89  ? 828  PHE A CE1   1 
ATOM   5811  C CE2   . PHE A  1 828 ? -20.574  6.319   12.689  1.00 50.97  ? 828  PHE A CE2   1 
ATOM   5812  C CZ    . PHE A  1 828 ? -19.855  6.319   11.529  1.00 49.69  ? 828  PHE A CZ    1 
ATOM   5813  N N     . ILE A  1 829 ? -19.197  0.983   16.321  1.00 31.56  ? 829  ILE A N     1 
ATOM   5814  C CA    . ILE A  1 829 ? -19.556  0.054   17.376  1.00 30.19  ? 829  ILE A CA    1 
ATOM   5815  C C     . ILE A  1 829 ? -20.610  0.652   18.287  1.00 34.75  ? 829  ILE A C     1 
ATOM   5816  O O     . ILE A  1 829 ? -20.376  1.662   18.939  1.00 33.20  ? 829  ILE A O     1 
ATOM   5817  C CB    . ILE A  1 829 ? -18.358  -0.680  18.040  1.00 32.70  ? 829  ILE A CB    1 
ATOM   5818  C CG1   . ILE A  1 829 ? -17.864  -1.787  17.096  1.00 32.36  ? 829  ILE A CG1   1 
ATOM   5819  C CG2   . ILE A  1 829 ? -18.718  -1.279  19.415  1.00 33.02  ? 829  ILE A CG2   1 
ATOM   5820  C CD1   . ILE A  1 829 ? -16.692  -2.562  17.560  1.00 39.93  ? 829  ILE A CD1   1 
ATOM   5821  N N     . HIS A  1 830 ? -21.804  0.063   18.256  1.00 33.60  ? 830  HIS A N     1 
ATOM   5822  C CA    . HIS A  1 830 ? -22.933  0.531   19.042  1.00 33.95  ? 830  HIS A CA    1 
ATOM   5823  C C     . HIS A  1 830 ? -23.246  -0.404  20.204  1.00 35.91  ? 830  HIS A C     1 
ATOM   5824  O O     . HIS A  1 830 ? -23.688  -1.536  19.983  1.00 35.73  ? 830  HIS A O     1 
ATOM   5825  C CB    . HIS A  1 830 ? -24.175  0.711   18.153  1.00 35.22  ? 830  HIS A CB    1 
ATOM   5826  C CG    . HIS A  1 830 ? -25.210  1.599   18.764  1.00 38.99  ? 830  HIS A CG    1 
ATOM   5827  N ND1   . HIS A  1 830 ? -26.083  1.130   19.714  1.00 40.32  ? 830  HIS A ND1   1 
ATOM   5828  C CD2   . HIS A  1 830 ? -25.478  2.905   18.523  1.00 42.04  ? 830  HIS A CD2   1 
ATOM   5829  C CE1   . HIS A  1 830 ? -26.844  2.165   20.038  1.00 40.94  ? 830  HIS A CE1   1 
ATOM   5830  N NE2   . HIS A  1 830 ? -26.511  3.256   19.345  1.00 42.00  ? 830  HIS A NE2   1 
ATOM   5831  N N     . ASN A  1 831 ? -23.054  0.083   21.438  1.00 29.42  ? 831  ASN A N     1 
ATOM   5832  C CA    . ASN A  1 831 ? -23.387  -0.704  22.605  1.00 28.74  ? 831  ASN A CA    1 
ATOM   5833  C C     . ASN A  1 831 ? -24.905  -0.772  22.749  1.00 32.81  ? 831  ASN A C     1 
ATOM   5834  O O     . ASN A  1 831 ? -25.518  0.275   22.846  1.00 35.31  ? 831  ASN A O     1 
ATOM   5835  C CB    . ASN A  1 831 ? -22.751  -0.115  23.860  1.00 30.13  ? 831  ASN A CB    1 
ATOM   5836  C CG    . ASN A  1 831 ? -23.030  -0.934  25.098  1.00 59.91  ? 831  ASN A CG    1 
ATOM   5837  O OD1   . ASN A  1 831 ? -22.692  -2.130  25.187  1.00 55.23  ? 831  ASN A OD1   1 
ATOM   5838  N ND2   . ASN A  1 831 ? -23.694  -0.315  26.062  1.00 50.70  ? 831  ASN A ND2   1 
ATOM   5839  N N     . GLU A  1 832 ? -25.502  -1.980  22.787  1.00 27.80  ? 832  GLU A N     1 
ATOM   5840  C CA    . GLU A  1 832 ? -26.944  -2.195  22.938  1.00 29.30  ? 832  GLU A CA    1 
ATOM   5841  C C     . GLU A  1 832 ? -27.681  -1.217  23.896  1.00 36.21  ? 832  GLU A C     1 
ATOM   5842  O O     . GLU A  1 832 ? -28.798  -0.778  23.594  1.00 38.49  ? 832  GLU A O     1 
ATOM   5843  C CB    . GLU A  1 832 ? -27.297  -3.696  23.152  1.00 31.14  ? 832  GLU A CB    1 
ATOM   5844  C CG    . GLU A  1 832 ? -27.731  -4.165  24.545  1.00 49.09  ? 832  GLU A CG    1 
ATOM   5845  C CD    . GLU A  1 832 ? -26.647  -4.485  25.568  1.00 71.36  ? 832  GLU A CD    1 
ATOM   5846  O OE1   . GLU A  1 832 ? -26.715  -5.568  26.197  1.00 55.54  ? 832  GLU A OE1   1 
ATOM   5847  O OE2   . GLU A  1 832 ? -25.750  -3.635  25.772  1.00 66.39  ? 832  GLU A OE2   1 
ATOM   5848  N N     . LYS A  1 833 ? -27.030  -0.824  25.002  1.00 32.06  ? 833  LYS A N     1 
ATOM   5849  C CA    . LYS A  1 833 ? -27.622  0.108   25.953  1.00 32.67  ? 833  LYS A CA    1 
ATOM   5850  C C     . LYS A  1 833 ? -26.821  1.401   25.960  1.00 40.32  ? 833  LYS A C     1 
ATOM   5851  O O     . LYS A  1 833 ? -26.085  1.648   26.916  1.00 44.06  ? 833  LYS A O     1 
ATOM   5852  C CB    . LYS A  1 833 ? -27.732  -0.527  27.367  1.00 34.07  ? 833  LYS A CB    1 
ATOM   5853  C CG    . LYS A  1 833 ? -29.172  -0.764  27.845  1.00 41.41  ? 833  LYS A CG    1 
ATOM   5854  C CD    . LYS A  1 833 ? -29.888  -1.966  27.203  1.00 46.92  ? 833  LYS A CD    1 
ATOM   5855  C CE    . LYS A  1 833 ? -30.276  -2.998  28.230  1.00 58.07  ? 833  LYS A CE    1 
ATOM   5856  N NZ    . LYS A  1 833 ? -29.117  -3.812  28.680  1.00 57.82  ? 833  LYS A NZ    1 
ATOM   5857  N N     . ALA A  1 834 ? -26.914  2.202   24.879  1.00 35.09  ? 834  ALA A N     1 
ATOM   5858  C CA    . ALA A  1 834 ? -26.213  3.484   24.783  1.00 34.57  ? 834  ALA A CA    1 
ATOM   5859  C C     . ALA A  1 834 ? -27.208  4.652   24.731  1.00 39.79  ? 834  ALA A C     1 
ATOM   5860  O O     . ALA A  1 834 ? -27.004  5.639   25.422  1.00 41.02  ? 834  ALA A O     1 
ATOM   5861  C CB    . ALA A  1 834 ? -25.287  3.513   23.580  1.00 34.84  ? 834  ALA A CB    1 
ATOM   5862  N N     . SER A  1 835 ? -28.281  4.542   23.932  1.00 35.28  ? 835  SER A N     1 
ATOM   5863  C CA    . SER A  1 835 ? -29.328  5.567   23.818  1.00 34.95  ? 835  SER A CA    1 
ATOM   5864  C C     . SER A  1 835 ? -30.669  4.888   23.543  1.00 37.37  ? 835  SER A C     1 
ATOM   5865  O O     . SER A  1 835 ? -30.717  3.908   22.793  1.00 35.90  ? 835  SER A O     1 
ATOM   5866  C CB    . SER A  1 835 ? -29.013  6.543   22.686  1.00 37.99  ? 835  SER A CB    1 
ATOM   5867  O OG    . SER A  1 835 ? -29.980  7.575   22.559  1.00 41.06  ? 835  SER A OG    1 
ATOM   5868  N N     . LYS A  1 836 ? -31.758  5.399   24.148  1.00 31.82  ? 836  LYS A N     1 
ATOM   5869  C CA    . LYS A  1 836 ? -33.079  4.846   23.893  1.00 29.67  ? 836  LYS A CA    1 
ATOM   5870  C C     . LYS A  1 836 ? -33.631  5.494   22.600  1.00 34.61  ? 836  LYS A C     1 
ATOM   5871  O O     . LYS A  1 836 ? -34.667  5.079   22.070  1.00 35.84  ? 836  LYS A O     1 
ATOM   5872  C CB    . LYS A  1 836 ? -33.998  5.038   25.109  1.00 30.37  ? 836  LYS A CB    1 
ATOM   5873  C CG    . LYS A  1 836 ? -34.607  6.435   25.234  1.00 50.50  ? 836  LYS A CG    1 
ATOM   5874  C CD    . LYS A  1 836 ? -36.043  6.419   25.799  1.00 61.65  ? 836  LYS A CD    1 
ATOM   5875  C CE    . LYS A  1 836 ? -37.121  6.182   24.764  1.00 71.98  ? 836  LYS A CE    1 
ATOM   5876  N NZ    . LYS A  1 836 ? -38.404  5.755   25.407  1.00 78.70  ? 836  LYS A NZ    1 
ATOM   5877  N N     . VAL A  1 837 ? -32.911  6.503   22.094  1.00 30.51  ? 837  VAL A N     1 
ATOM   5878  C CA    . VAL A  1 837 ? -33.245  7.232   20.875  1.00 31.08  ? 837  VAL A CA    1 
ATOM   5879  C C     . VAL A  1 837 ? -32.343  6.760   19.723  1.00 36.66  ? 837  VAL A C     1 
ATOM   5880  O O     . VAL A  1 837 ? -32.808  6.104   18.785  1.00 37.83  ? 837  VAL A O     1 
ATOM   5881  C CB    . VAL A  1 837 ? -33.136  8.759   21.083  1.00 34.20  ? 837  VAL A CB    1 
ATOM   5882  C CG1   . VAL A  1 837 ? -33.538  9.515   19.818  1.00 34.04  ? 837  VAL A CG1   1 
ATOM   5883  C CG2   . VAL A  1 837 ? -33.944  9.215   22.296  1.00 34.50  ? 837  VAL A CG2   1 
ATOM   5884  N N     . TYR A  1 838 ? -31.060  7.110   19.805  1.00 31.40  ? 838  TYR A N     1 
ATOM   5885  C CA    . TYR A  1 838 ? -30.075  6.810   18.799  1.00 30.32  ? 838  TYR A CA    1 
ATOM   5886  C C     . TYR A  1 838 ? -29.590  5.392   19.016  1.00 32.66  ? 838  TYR A C     1 
ATOM   5887  O O     . TYR A  1 838 ? -28.548  5.139   19.636  1.00 31.09  ? 838  TYR A O     1 
ATOM   5888  C CB    . TYR A  1 838 ? -28.948  7.853   18.828  1.00 32.18  ? 838  TYR A CB    1 
ATOM   5889  C CG    . TYR A  1 838 ? -29.422  9.289   18.777  1.00 34.74  ? 838  TYR A CG    1 
ATOM   5890  C CD1   . TYR A  1 838 ? -29.730  9.902   17.566  1.00 37.10  ? 838  TYR A CD1   1 
ATOM   5891  C CD2   . TYR A  1 838 ? -29.545  10.044  19.938  1.00 35.56  ? 838  TYR A CD2   1 
ATOM   5892  C CE1   . TYR A  1 838 ? -30.158  11.230  17.515  1.00 36.65  ? 838  TYR A CE1   1 
ATOM   5893  C CE2   . TYR A  1 838 ? -29.984  11.370  19.899  1.00 37.15  ? 838  TYR A CE2   1 
ATOM   5894  C CZ    . TYR A  1 838 ? -30.288  11.956  18.688  1.00 44.62  ? 838  TYR A CZ    1 
ATOM   5895  O OH    . TYR A  1 838 ? -30.699  13.262  18.681  1.00 53.05  ? 838  TYR A OH    1 
ATOM   5896  N N     . THR A  1 839 ? -30.407  4.458   18.540  1.00 29.73  ? 839  THR A N     1 
ATOM   5897  C CA    . THR A  1 839 ? -30.182  3.006   18.618  1.00 29.10  ? 839  THR A CA    1 
ATOM   5898  C C     . THR A  1 839 ? -29.322  2.547   17.405  1.00 36.36  ? 839  THR A C     1 
ATOM   5899  O O     . THR A  1 839 ? -29.091  3.364   16.492  1.00 39.68  ? 839  THR A O     1 
ATOM   5900  C CB    . THR A  1 839 ? -31.547  2.320   18.648  1.00 30.71  ? 839  THR A CB    1 
ATOM   5901  O OG1   . THR A  1 839 ? -32.228  2.576   17.407  1.00 35.17  ? 839  THR A OG1   1 
ATOM   5902  C CG2   . THR A  1 839 ? -32.402  2.811   19.787  1.00 27.10  ? 839  THR A CG2   1 
ATOM   5903  N N     . THR A  1 840 ? -28.883  1.253   17.367  1.00 29.81  ? 840  THR A N     1 
ATOM   5904  C CA    . THR A  1 840 ? -28.105  0.698   16.247  1.00 29.12  ? 840  THR A CA    1 
ATOM   5905  C C     . THR A  1 840 ? -28.898  0.937   14.979  1.00 36.13  ? 840  THR A C     1 
ATOM   5906  O O     . THR A  1 840 ? -28.335  1.357   13.956  1.00 37.91  ? 840  THR A O     1 
ATOM   5907  C CB    . THR A  1 840 ? -27.870  -0.820  16.441  1.00 32.37  ? 840  THR A CB    1 
ATOM   5908  O OG1   . THR A  1 840 ? -27.096  -1.040  17.621  1.00 33.66  ? 840  THR A OG1   1 
ATOM   5909  C CG2   . THR A  1 840 ? -27.204  -1.476  15.230  1.00 23.68  ? 840  THR A CG2   1 
ATOM   5910  N N     . ASP A  1 841 ? -30.231  0.711   15.079  1.00 31.72  ? 841  ASP A N     1 
ATOM   5911  C CA    . ASP A  1 841 ? -31.150  0.906   13.981  1.00 31.84  ? 841  ASP A CA    1 
ATOM   5912  C C     . ASP A  1 841 ? -31.275  2.370   13.531  1.00 31.73  ? 841  ASP A C     1 
ATOM   5913  O O     . ASP A  1 841 ? -31.200  2.626   12.316  1.00 34.49  ? 841  ASP A O     1 
ATOM   5914  C CB    . ASP A  1 841 ? -32.489  0.230   14.279  1.00 35.40  ? 841  ASP A CB    1 
ATOM   5915  C CG    . ASP A  1 841 ? -32.544  -1.233  13.845  1.00 54.24  ? 841  ASP A CG    1 
ATOM   5916  O OD1   . ASP A  1 841 ? -31.453  -1.823  13.567  1.00 54.90  ? 841  ASP A OD1   1 
ATOM   5917  O OD2   . ASP A  1 841 ? -33.680  -1.785  13.742  1.00 60.03  ? 841  ASP A OD2   1 
ATOM   5918  N N     . LEU A  1 842 ? -31.380  3.335   14.481  1.00 21.40  ? 842  LEU A N     1 
ATOM   5919  C CA    . LEU A  1 842 ? -31.472  4.741   14.060  1.00 19.51  ? 842  LEU A CA    1 
ATOM   5920  C C     . LEU A  1 842 ? -30.138  5.261   13.511  1.00 24.30  ? 842  LEU A C     1 
ATOM   5921  O O     . LEU A  1 842 ? -30.127  5.949   12.478  1.00 24.60  ? 842  LEU A O     1 
ATOM   5922  C CB    . LEU A  1 842 ? -32.066  5.689   15.131  1.00 17.59  ? 842  LEU A CB    1 
ATOM   5923  C CG    . LEU A  1 842 ? -32.222  7.186   14.711  1.00 17.94  ? 842  LEU A CG    1 
ATOM   5924  C CD1   . LEU A  1 842 ? -33.118  7.339   13.528  1.00 17.18  ? 842  LEU A CD1   1 
ATOM   5925  C CD2   . LEU A  1 842 ? -32.622  8.090   15.870  1.00 15.59  ? 842  LEU A CD2   1 
ATOM   5926  N N     . ILE A  1 843 ? -29.018  4.921   14.186  1.00 18.11  ? 843  ILE A N     1 
ATOM   5927  C CA    . ILE A  1 843 ? -27.699  5.366   13.727  1.00 17.32  ? 843  ILE A CA    1 
ATOM   5928  C C     . ILE A  1 843 ? -27.468  4.903   12.263  1.00 24.35  ? 843  ILE A C     1 
ATOM   5929  O O     . ILE A  1 843 ? -27.172  5.728   11.392  1.00 24.45  ? 843  ILE A O     1 
ATOM   5930  C CB    . ILE A  1 843 ? -26.567  4.947   14.696  1.00 17.98  ? 843  ILE A CB    1 
ATOM   5931  C CG1   . ILE A  1 843 ? -26.711  5.609   16.090  1.00 17.14  ? 843  ILE A CG1   1 
ATOM   5932  C CG2   . ILE A  1 843 ? -25.198  5.203   14.085  1.00 18.38  ? 843  ILE A CG2   1 
ATOM   5933  C CD1   . ILE A  1 843 ? -26.548  7.162   16.152  1.00 16.22  ? 843  ILE A CD1   1 
ATOM   5934  N N     . ALA A  1 844 ? -27.714  3.600   11.994  1.00 20.82  ? 844  ALA A N     1 
ATOM   5935  C CA    . ALA A  1 844 ? -27.594  3.016   10.663  1.00 20.40  ? 844  ALA A CA    1 
ATOM   5936  C C     . ALA A  1 844 ? -28.495  3.755   9.674   1.00 30.35  ? 844  ALA A C     1 
ATOM   5937  O O     . ALA A  1 844 ? -28.049  4.068   8.572   1.00 31.72  ? 844  ALA A O     1 
ATOM   5938  C CB    . ALA A  1 844 ? -27.953  1.539   10.707  1.00 19.33  ? 844  ALA A CB    1 
ATOM   5939  N N     . ALA A  1 845 ? -29.734  4.093   10.089  1.00 28.20  ? 845  ALA A N     1 
ATOM   5940  C CA    . ALA A  1 845 ? -30.688  4.791   9.243   1.00 30.28  ? 845  ALA A CA    1 
ATOM   5941  C C     . ALA A  1 845 ? -30.246  6.217   8.865   1.00 36.05  ? 845  ALA A C     1 
ATOM   5942  O O     . ALA A  1 845 ? -30.562  6.691   7.771   1.00 38.14  ? 845  ALA A O     1 
ATOM   5943  C CB    . ALA A  1 845 ? -32.036  4.825   9.931   1.00 31.63  ? 845  ALA A CB    1 
ATOM   5944  N N     . ILE A  1 846 ? -29.539  6.901   9.779   1.00 30.51  ? 846  ILE A N     1 
ATOM   5945  C CA    . ILE A  1 846 ? -29.068  8.265   9.567   1.00 30.71  ? 846  ILE A CA    1 
ATOM   5946  C C     . ILE A  1 846 ? -27.856  8.282   8.617   1.00 36.74  ? 846  ILE A C     1 
ATOM   5947  O O     . ILE A  1 846 ? -27.760  9.172   7.780   1.00 39.44  ? 846  ILE A O     1 
ATOM   5948  C CB    . ILE A  1 846 ? -28.825  8.953   10.938  1.00 33.65  ? 846  ILE A CB    1 
ATOM   5949  C CG1   . ILE A  1 846 ? -30.174  9.351   11.598  1.00 32.96  ? 846  ILE A CG1   1 
ATOM   5950  C CG2   . ILE A  1 846 ? -27.858  10.140  10.827  1.00 35.19  ? 846  ILE A CG2   1 
ATOM   5951  C CD1   . ILE A  1 846 ? -30.095  9.697   13.011  1.00 29.53  ? 846  ILE A CD1   1 
ATOM   5952  N N     . ILE A  1 847 ? -26.953  7.293   8.741   1.00 32.68  ? 847  ILE A N     1 
ATOM   5953  C CA    . ILE A  1 847 ? -25.774  7.079   7.901   1.00 32.51  ? 847  ILE A CA    1 
ATOM   5954  C C     . ILE A  1 847 ? -26.220  6.851   6.457   1.00 35.64  ? 847  ILE A C     1 
ATOM   5955  O O     . ILE A  1 847 ? -25.656  7.447   5.552   1.00 38.46  ? 847  ILE A O     1 
ATOM   5956  C CB    . ILE A  1 847 ? -24.915  5.898   8.464   1.00 35.51  ? 847  ILE A CB    1 
ATOM   5957  C CG1   . ILE A  1 847 ? -24.261  6.281   9.807   1.00 36.30  ? 847  ILE A CG1   1 
ATOM   5958  C CG2   . ILE A  1 847 ? -23.859  5.411   7.467   1.00 36.38  ? 847  ILE A CG2   1 
ATOM   5959  C CD1   . ILE A  1 847 ? -23.791  5.115   10.655  1.00 46.37  ? 847  ILE A CD1   1 
ATOM   5960  N N     . GLY A  1 848 ? -27.244  6.033   6.263   1.00 30.69  ? 848  GLY A N     1 
ATOM   5961  C CA    . GLY A  1 848 ? -27.818  5.739   4.949   1.00 32.54  ? 848  GLY A CA    1 
ATOM   5962  C C     . GLY A  1 848 ? -28.303  6.953   4.185   1.00 42.02  ? 848  GLY A C     1 
ATOM   5963  O O     . GLY A  1 848 ? -27.890  7.144   3.044   1.00 42.81  ? 848  GLY A O     1 
ATOM   5964  N N     . GLU A  1 849 ? -29.154  7.808   4.825   1.00 43.57  ? 849  GLU A N     1 
ATOM   5965  C CA    . GLU A  1 849 ? -29.688  9.050   4.250   1.00 46.97  ? 849  GLU A CA    1 
ATOM   5966  C C     . GLU A  1 849 ? -28.591  10.144  4.087   1.00 58.50  ? 849  GLU A C     1 
ATOM   5967  O O     . GLU A  1 849 ? -28.783  11.106  3.327   1.00 59.51  ? 849  GLU A O     1 
ATOM   5968  C CB    . GLU A  1 849 ? -30.917  9.560   5.034   1.00 48.27  ? 849  GLU A CB    1 
ATOM   5969  C CG    . GLU A  1 849 ? -31.920  10.327  4.153   1.00 62.24  ? 849  GLU A CG    1 
ATOM   5970  C CD    . GLU A  1 849 ? -33.338  10.561  4.675   1.00 90.82  ? 849  GLU A CD    1 
ATOM   5971  O OE1   . GLU A  1 849 ? -34.305  10.332  3.908   1.00 76.17  ? 849  GLU A OE1   1 
ATOM   5972  O OE2   . GLU A  1 849 ? -33.484  11.006  5.839   1.00 86.53  ? 849  GLU A OE2   1 
ATOM   5973  N N     . ALA A  1 850 ? -27.431  9.966   4.768   1.00 58.70  ? 850  ALA A N     1 
ATOM   5974  C CA    . ALA A  1 850 ? -26.295  10.885  4.728   1.00 60.48  ? 850  ALA A CA    1 
ATOM   5975  C C     . ALA A  1 850 ? -25.588  10.884  3.374   1.00 72.29  ? 850  ALA A C     1 
ATOM   5976  O O     . ALA A  1 850 ? -25.346  9.820   2.776   1.00 71.13  ? 850  ALA A O     1 
ATOM   5977  C CB    . ALA A  1 850 ? -25.317  10.559  5.828   1.00 59.75  ? 850  ALA A CB    1 
ATOM   5978  N N     . GLY A  1 851 ? -25.262  12.099  2.924   1.00 75.34  ? 851  GLY A N     1 
ATOM   5979  C CA    . GLY A  1 851 ? -24.624  12.388  1.643   1.00 78.14  ? 851  GLY A CA    1 
ATOM   5980  C C     . GLY A  1 851 ? -25.603  12.228  0.494   1.00 87.71  ? 851  GLY A C     1 
ATOM   5981  O O     . GLY A  1 851 ? -25.205  11.832  -0.612  1.00 87.81  ? 851  GLY A O     1 
ATOM   5982  N N     . LYS A  1 852 ? -26.917  12.528  0.771   1.00 87.16  ? 852  LYS A N     1 
ATOM   5983  C CA    . LYS A  1 852 ? -28.068  12.376  -0.139  1.00 88.69  ? 852  LYS A CA    1 
ATOM   5984  C C     . LYS A  1 852 ? -28.122  10.929  -0.696  1.00 93.78  ? 852  LYS A C     1 
ATOM   5985  O O     . LYS A  1 852 ? -28.389  10.726  -1.890  1.00 95.98  ? 852  LYS A O     1 
ATOM   5986  C CB    . LYS A  1 852 ? -28.039  13.437  -1.263  1.00 92.92  ? 852  LYS A CB    1 
ATOM   5987  N N     . GLY A  1 853 ? -27.845  9.954   0.187   1.00 87.43  ? 853  GLY A N     1 
ATOM   5988  C CA    . GLY A  1 853 ? -27.739  8.540   -0.146  1.00 85.72  ? 853  GLY A CA    1 
ATOM   5989  C C     . GLY A  1 853 ? -26.383  8.293   -0.778  1.00 88.18  ? 853  GLY A C     1 
ATOM   5990  O O     . GLY A  1 853 ? -26.291  7.946   -1.958  1.00 88.19  ? 853  GLY A O     1 
ATOM   5991  N N     . ARG A  1 854 ? -25.314  8.545   -0.011  1.00 83.34  ? 854  ARG A N     1 
ATOM   5992  C CA    . ARG A  1 854 ? -23.944  8.400   -0.500  1.00 82.76  ? 854  ARG A CA    1 
ATOM   5993  C C     . ARG A  1 854 ? -23.437  6.970   -0.365  1.00 82.97  ? 854  ARG A C     1 
ATOM   5994  O O     . ARG A  1 854 ? -22.937  6.417   -1.345  1.00 81.87  ? 854  ARG A O     1 
ATOM   5995  C CB    . ARG A  1 854 ? -23.004  9.384   0.222   1.00 84.75  ? 854  ARG A CB    1 
ATOM   5996  C CG    . ARG A  1 854 ? -21.739  9.736   -0.562  1.00 94.67  ? 854  ARG A CG    1 
ATOM   5997  C CD    . ARG A  1 854 ? -20.890  10.787  0.134   1.00 100.35 ? 854  ARG A CD    1 
ATOM   5998  N NE    . ARG A  1 854 ? -21.514  12.111  0.120   1.00 110.21 ? 854  ARG A NE    1 
ATOM   5999  C CZ    . ARG A  1 854 ? -21.376  13.004  -0.858  1.00 128.43 ? 854  ARG A CZ    1 
ATOM   6000  N NH1   . ARG A  1 854 ? -20.637  12.722  -1.926  1.00 115.80 ? 854  ARG A NH1   1 
ATOM   6001  N NH2   . ARG A  1 854 ? -21.980  14.183  -0.777  1.00 117.17 ? 854  ARG A NH2   1 
ATOM   6002  N N     . PHE A  1 855 ? -23.554  6.391   0.857   1.00 77.83  ? 855  PHE A N     1 
ATOM   6003  C CA    . PHE A  1 855 ? -23.107  5.035   1.228   1.00 76.20  ? 855  PHE A CA    1 
ATOM   6004  C C     . PHE A  1 855 ? -24.279  4.153   1.667   1.00 78.27  ? 855  PHE A C     1 
ATOM   6005  O O     . PHE A  1 855 ? -25.349  4.663   2.030   1.00 78.36  ? 855  PHE A O     1 
ATOM   6006  C CB    . PHE A  1 855 ? -22.021  5.062   2.348   1.00 76.79  ? 855  PHE A CB    1 
ATOM   6007  C CG    . PHE A  1 855 ? -21.831  6.387   3.054   1.00 77.94  ? 855  PHE A CG    1 
ATOM   6008  C CD1   . PHE A  1 855 ? -22.791  6.870   3.937   1.00 79.60  ? 855  PHE A CD1   1 
ATOM   6009  C CD2   . PHE A  1 855 ? -20.700  7.161   2.819   1.00 80.58  ? 855  PHE A CD2   1 
ATOM   6010  C CE1   . PHE A  1 855 ? -22.633  8.111   4.553   1.00 80.84  ? 855  PHE A CE1   1 
ATOM   6011  C CE2   . PHE A  1 855 ? -20.540  8.404   3.442   1.00 83.58  ? 855  PHE A CE2   1 
ATOM   6012  C CZ    . PHE A  1 855 ? -21.505  8.869   4.306   1.00 81.07  ? 855  PHE A CZ    1 
ATOM   6013  N N     . GLU A  1 856 ? -24.062  2.825   1.638   1.00 71.95  ? 856  GLU A N     1 
ATOM   6014  C CA    . GLU A  1 856 ? -25.061  1.849   2.047   1.00 69.71  ? 856  GLU A CA    1 
ATOM   6015  C C     . GLU A  1 856 ? -24.761  1.425   3.489   1.00 68.77  ? 856  GLU A C     1 
ATOM   6016  O O     . GLU A  1 856 ? -23.761  0.757   3.745   1.00 68.26  ? 856  GLU A O     1 
ATOM   6017  C CB    . GLU A  1 856 ? -25.099  0.647   1.076   1.00 71.44  ? 856  GLU A CB    1 
ATOM   6018  C CG    . GLU A  1 856 ? -25.681  0.959   -0.298  1.00 88.21  ? 856  GLU A CG    1 
ATOM   6019  C CD    . GLU A  1 856 ? -26.953  0.224   -0.698  1.00 118.08 ? 856  GLU A CD    1 
ATOM   6020  O OE1   . GLU A  1 856 ? -28.008  0.458   -0.063  1.00 115.66 ? 856  GLU A OE1   1 
ATOM   6021  O OE2   . GLU A  1 856 ? -26.906  -0.545  -1.687  1.00 114.40 ? 856  GLU A OE2   1 
ATOM   6022  N N     . SER A  1 857 ? -25.598  1.866   4.437   1.00 61.65  ? 857  SER A N     1 
ATOM   6023  C CA    . SER A  1 857 ? -25.432  1.514   5.845   1.00 58.90  ? 857  SER A CA    1 
ATOM   6024  C C     . SER A  1 857 ? -26.178  0.232   6.157   1.00 60.62  ? 857  SER A C     1 
ATOM   6025  O O     . SER A  1 857 ? -27.291  0.021   5.647   1.00 61.95  ? 857  SER A O     1 
ATOM   6026  C CB    . SER A  1 857 ? -25.949  2.623   6.743   1.00 61.68  ? 857  SER A CB    1 
ATOM   6027  O OG    . SER A  1 857 ? -27.358  2.714   6.654   1.00 70.62  ? 857  SER A OG    1 
ATOM   6028  N N     . ARG A  1 858 ? -25.571  -0.621  7.010   1.00 52.58  ? 858  ARG A N     1 
ATOM   6029  C CA    . ARG A  1 858 ? -26.136  -1.905  7.420   1.00 49.16  ? 858  ARG A CA    1 
ATOM   6030  C C     . ARG A  1 858 ? -25.901  -2.147  8.889   1.00 49.88  ? 858  ARG A C     1 
ATOM   6031  O O     . ARG A  1 858 ? -24.868  -1.752  9.424   1.00 50.70  ? 858  ARG A O     1 
ATOM   6032  C CB    . ARG A  1 858 ? -25.518  -3.062  6.616   1.00 46.68  ? 858  ARG A CB    1 
ATOM   6033  C CG    . ARG A  1 858 ? -25.717  -3.017  5.117   1.00 58.43  ? 858  ARG A CG    1 
ATOM   6034  C CD    . ARG A  1 858 ? -27.102  -3.441  4.662   1.00 79.03  ? 858  ARG A CD    1 
ATOM   6035  N NE    . ARG A  1 858 ? -27.519  -2.717  3.456   1.00 92.00  ? 858  ARG A NE    1 
ATOM   6036  C CZ    . ARG A  1 858 ? -27.219  -3.094  2.219   1.00 103.37 ? 858  ARG A CZ    1 
ATOM   6037  N NH1   . ARG A  1 858 ? -26.502  -4.190  2.007   1.00 90.08  ? 858  ARG A NH1   1 
ATOM   6038  N NH2   . ARG A  1 858 ? -27.627  -2.373  1.184   1.00 88.69  ? 858  ARG A NH2   1 
ATOM   6039  N N     . THR A  1 859 ? -26.853  -2.808  9.540   1.00 43.26  ? 859  THR A N     1 
ATOM   6040  C CA    . THR A  1 859 ? -26.742  -3.185  10.941  1.00 41.25  ? 859  THR A CA    1 
ATOM   6041  C C     . THR A  1 859 ? -26.274  -4.631  10.975  1.00 42.72  ? 859  THR A C     1 
ATOM   6042  O O     . THR A  1 859 ? -26.537  -5.402  10.039  1.00 43.62  ? 859  THR A O     1 
ATOM   6043  C CB    . THR A  1 859 ? -28.077  -3.046  11.689  1.00 53.30  ? 859  THR A CB    1 
ATOM   6044  O OG1   . THR A  1 859 ? -29.078  -3.868  11.088  1.00 54.16  ? 859  THR A OG1   1 
ATOM   6045  C CG2   . THR A  1 859 ? -28.566  -1.628  11.755  1.00 56.96  ? 859  THR A CG2   1 
ATOM   6046  N N     . ALA A  1 860 ? -25.582  -4.990  12.056  1.00 34.73  ? 860  ALA A N     1 
ATOM   6047  C CA    . ALA A  1 860 ? -25.062  -6.313  12.342  1.00 31.67  ? 860  ALA A CA    1 
ATOM   6048  C C     . ALA A  1 860 ? -25.285  -6.528  13.821  1.00 33.11  ? 860  ALA A C     1 
ATOM   6049  O O     . ALA A  1 860 ? -24.978  -5.645  14.644  1.00 33.45  ? 860  ALA A O     1 
ATOM   6050  C CB    . ALA A  1 860 ? -23.572  -6.360  12.036  1.00 32.61  ? 860  ALA A CB    1 
ATOM   6051  N N     . VAL A  1 861 ? -25.881  -7.662  14.170  1.00 26.72  ? 861  VAL A N     1 
ATOM   6052  C CA    . VAL A  1 861 ? -26.141  -7.965  15.570  1.00 24.53  ? 861  VAL A CA    1 
ATOM   6053  C C     . VAL A  1 861 ? -25.598  -9.357  15.923  1.00 30.75  ? 861  VAL A C     1 
ATOM   6054  O O     . VAL A  1 861 ? -26.342  -10.353 15.887  1.00 29.53  ? 861  VAL A O     1 
ATOM   6055  C CB    . VAL A  1 861 ? -27.601  -7.706  16.069  1.00 25.88  ? 861  VAL A CB    1 
ATOM   6056  C CG1   . VAL A  1 861 ? -27.613  -7.282  17.531  1.00 24.34  ? 861  VAL A CG1   1 
ATOM   6057  C CG2   . VAL A  1 861 ? -28.339  -6.691  15.215  1.00 25.84  ? 861  VAL A CG2   1 
ATOM   6058  N N     . PRO A  1 862 ? -24.287  -9.448  16.262  1.00 31.62  ? 862  PRO A N     1 
ATOM   6059  C CA    . PRO A  1 862 ? -23.727  -10.762 16.670  1.00 32.56  ? 862  PRO A CA    1 
ATOM   6060  C C     . PRO A  1 862 ? -24.600  -11.365 17.773  1.00 39.86  ? 862  PRO A C     1 
ATOM   6061  O O     . PRO A  1 862 ? -25.103  -12.478 17.624  1.00 39.81  ? 862  PRO A O     1 
ATOM   6062  C CB    . PRO A  1 862 ? -22.307  -10.436 17.158  1.00 33.63  ? 862  PRO A CB    1 
ATOM   6063  C CG    . PRO A  1 862 ? -22.010  -9.077  16.674  1.00 37.99  ? 862  PRO A CG    1 
ATOM   6064  C CD    . PRO A  1 862 ? -23.287  -8.364  16.375  1.00 33.45  ? 862  PRO A CD    1 
ATOM   6065  N N     . GLY A  1 863 ? -24.878  -10.558 18.797  1.00 38.74  ? 863  GLY A N     1 
ATOM   6066  C CA    . GLY A  1 863 ? -25.787  -10.911 19.875  1.00 39.37  ? 863  GLY A CA    1 
ATOM   6067  C C     . GLY A  1 863 ? -25.325  -12.037 20.753  1.00 44.35  ? 863  GLY A C     1 
ATOM   6068  O O     . GLY A  1 863 ? -24.194  -12.008 21.230  1.00 44.79  ? 863  GLY A O     1 
ATOM   6069  N N     . HIS A  1 864 ? -26.195  -13.034 20.977  1.00 41.19  ? 864  HIS A N     1 
ATOM   6070  C CA    . HIS A  1 864 ? -25.895  -14.191 21.835  1.00 40.55  ? 864  HIS A CA    1 
ATOM   6071  C C     . HIS A  1 864 ? -24.738  -15.070 21.380  1.00 41.24  ? 864  HIS A C     1 
ATOM   6072  O O     . HIS A  1 864 ? -24.290  -15.919 22.148  1.00 39.38  ? 864  HIS A O     1 
ATOM   6073  C CB    . HIS A  1 864 ? -27.162  -14.987 22.185  1.00 41.61  ? 864  HIS A CB    1 
ATOM   6074  C CG    . HIS A  1 864 ? -28.032  -14.257 23.149  1.00 44.89  ? 864  HIS A CG    1 
ATOM   6075  N ND1   . HIS A  1 864 ? -29.013  -13.386 22.713  1.00 47.12  ? 864  HIS A ND1   1 
ATOM   6076  C CD2   . HIS A  1 864 ? -28.000  -14.248 24.502  1.00 46.44  ? 864  HIS A CD2   1 
ATOM   6077  C CE1   . HIS A  1 864 ? -29.565  -12.896 23.813  1.00 46.72  ? 864  HIS A CE1   1 
ATOM   6078  N NE2   . HIS A  1 864 ? -28.994  -13.395 24.914  1.00 46.65  ? 864  HIS A NE2   1 
ATOM   6079  N N     . VAL A  1 865 ? -24.209  -14.813 20.165  1.00 37.85  ? 865  VAL A N     1 
ATOM   6080  C CA    . VAL A  1 865 ? -23.032  -15.491 19.636  1.00 38.86  ? 865  VAL A CA    1 
ATOM   6081  C C     . VAL A  1 865 ? -21.754  -15.027 20.370  1.00 42.15  ? 865  VAL A C     1 
ATOM   6082  O O     . VAL A  1 865 ? -20.750  -15.721 20.325  1.00 41.29  ? 865  VAL A O     1 
ATOM   6083  C CB    . VAL A  1 865 ? -22.935  -15.340 18.104  1.00 43.94  ? 865  VAL A CB    1 
ATOM   6084  C CG1   . VAL A  1 865 ? -22.144  -14.100 17.704  1.00 43.67  ? 865  VAL A CG1   1 
ATOM   6085  C CG2   . VAL A  1 865 ? -22.341  -16.598 17.480  1.00 44.41  ? 865  VAL A CG2   1 
ATOM   6086  N N     . GLN A  1 866 ? -21.819  -13.860 21.038  1.00 39.16  ? 866  GLN A N     1 
ATOM   6087  C CA    . GLN A  1 866 ? -20.773  -13.252 21.838  1.00 39.25  ? 866  GLN A CA    1 
ATOM   6088  C C     . GLN A  1 866 ? -20.217  -14.201 22.905  1.00 45.84  ? 866  GLN A C     1 
ATOM   6089  O O     . GLN A  1 866 ? -19.074  -14.005 23.300  1.00 46.36  ? 866  GLN A O     1 
ATOM   6090  C CB    . GLN A  1 866 ? -21.288  -11.971 22.512  1.00 40.63  ? 866  GLN A CB    1 
ATOM   6091  C CG    . GLN A  1 866 ? -21.149  -10.736 21.637  1.00 54.68  ? 866  GLN A CG    1 
ATOM   6092  C CD    . GLN A  1 866 ? -21.930  -9.511  22.090  1.00 58.42  ? 866  GLN A CD    1 
ATOM   6093  O OE1   . GLN A  1 866 ? -22.519  -8.790  21.270  1.00 59.10  ? 866  GLN A OE1   1 
ATOM   6094  N NE2   . GLN A  1 866 ? -21.927  -9.217  23.381  1.00 33.73  ? 866  GLN A NE2   1 
ATOM   6095  N N     . GLN A  1 867 ? -20.986  -15.222 23.373  1.00 43.77  ? 867  GLN A N     1 
ATOM   6096  C CA    . GLN A  1 867 ? -20.448  -16.163 24.362  1.00 44.84  ? 867  GLN A CA    1 
ATOM   6097  C C     . GLN A  1 867 ? -19.380  -17.116 23.830  1.00 51.16  ? 867  GLN A C     1 
ATOM   6098  O O     . GLN A  1 867 ? -18.554  -17.562 24.621  1.00 53.47  ? 867  GLN A O     1 
ATOM   6099  C CB    . GLN A  1 867 ? -21.498  -16.875 25.235  1.00 46.66  ? 867  GLN A CB    1 
ATOM   6100  C CG    . GLN A  1 867 ? -22.851  -17.159 24.582  1.00 67.40  ? 867  GLN A CG    1 
ATOM   6101  C CD    . GLN A  1 867 ? -24.000  -16.465 25.296  1.00 78.41  ? 867  GLN A CD    1 
ATOM   6102  O OE1   . GLN A  1 867 ? -23.926  -15.300 25.722  1.00 67.23  ? 867  GLN A OE1   1 
ATOM   6103  N NE2   . GLN A  1 867 ? -25.109  -17.159 25.407  1.00 68.94  ? 867  GLN A NE2   1 
ATOM   6104  N N     . GLY A  1 868 ? -19.380  -17.385 22.518  1.00 46.66  ? 868  GLY A N     1 
ATOM   6105  C CA    . GLY A  1 868 ? -18.379  -18.213 21.843  1.00 47.12  ? 868  GLY A CA    1 
ATOM   6106  C C     . GLY A  1 868 ? -18.573  -19.711 21.945  1.00 53.48  ? 868  GLY A C     1 
ATOM   6107  O O     . GLY A  1 868 ? -19.284  -20.177 22.840  1.00 54.26  ? 868  GLY A O     1 
ATOM   6108  N N     . LYS A  1 869 ? -17.942  -20.491 21.026  1.00 50.62  ? 869  LYS A N     1 
ATOM   6109  C CA    . LYS A  1 869 ? -18.053  -21.961 21.059  1.00 50.04  ? 869  LYS A CA    1 
ATOM   6110  C C     . LYS A  1 869 ? -17.128  -22.559 22.118  1.00 51.49  ? 869  LYS A C     1 
ATOM   6111  O O     . LYS A  1 869 ? -17.594  -23.325 22.968  1.00 52.52  ? 869  LYS A O     1 
ATOM   6112  C CB    . LYS A  1 869 ? -17.886  -22.621 19.671  1.00 52.76  ? 869  LYS A CB    1 
ATOM   6113  C CG    . LYS A  1 869 ? -18.555  -24.002 19.596  1.00 66.56  ? 869  LYS A CG    1 
ATOM   6114  C CD    . LYS A  1 869 ? -18.744  -24.502 18.147  1.00 78.72  ? 869  LYS A CD    1 
ATOM   6115  C CE    . LYS A  1 869 ? -19.706  -25.687 18.000  1.00 71.42  ? 869  LYS A CE    1 
ATOM   6116  N NZ    . LYS A  1 869 ? -19.830  -26.165 16.589  1.00 42.99  ? 869  LYS A NZ    1 
ATOM   6117  N N     . SER A  1 870 ? -15.841  -22.179 22.100  1.00 45.06  ? 870  SER A N     1 
ATOM   6118  C CA    . SER A  1 870 ? -14.876  -22.657 23.085  1.00 44.30  ? 870  SER A CA    1 
ATOM   6119  C C     . SER A  1 870 ? -14.224  -21.487 23.847  1.00 43.30  ? 870  SER A C     1 
ATOM   6120  O O     . SER A  1 870 ? -13.941  -20.455 23.217  1.00 45.68  ? 870  SER A O     1 
ATOM   6121  C CB    . SER A  1 870 ? -13.790  -23.476 22.404  1.00 51.32  ? 870  SER A CB    1 
ATOM   6122  O OG    . SER A  1 870 ? -14.285  -24.729 21.959  1.00 69.02  ? 870  SER A OG    1 
ATOM   6123  N N     . PRO A  1 871 ? -13.948  -21.615 25.180  1.00 31.12  ? 871  PRO A N     1 
ATOM   6124  C CA    . PRO A  1 871 ? -13.293  -20.521 25.891  1.00 27.85  ? 871  PRO A CA    1 
ATOM   6125  C C     . PRO A  1 871 ? -11.897  -20.264 25.350  1.00 30.57  ? 871  PRO A C     1 
ATOM   6126  O O     . PRO A  1 871 ? -11.215  -21.199 24.970  1.00 32.28  ? 871  PRO A O     1 
ATOM   6127  C CB    . PRO A  1 871 ? -13.235  -21.033 27.333  1.00 29.04  ? 871  PRO A CB    1 
ATOM   6128  C CG    . PRO A  1 871 ? -13.315  -22.471 27.246  1.00 34.20  ? 871  PRO A CG    1 
ATOM   6129  C CD    . PRO A  1 871 ? -14.222  -22.736 26.101  1.00 31.40  ? 871  PRO A CD    1 
ATOM   6130  N N     . SER A  1 872 ? -11.473  -19.006 25.317  1.00 25.39  ? 872  SER A N     1 
ATOM   6131  C CA    . SER A  1 872 ? -10.133  -18.629 24.894  1.00 25.22  ? 872  SER A CA    1 
ATOM   6132  C C     . SER A  1 872 ? -9.117   -19.177 25.911  1.00 32.90  ? 872  SER A C     1 
ATOM   6133  O O     . SER A  1 872 ? -9.500   -19.620 26.993  1.00 33.37  ? 872  SER A O     1 
ATOM   6134  C CB    . SER A  1 872 ? -10.020  -17.104 24.821  1.00 27.00  ? 872  SER A CB    1 
ATOM   6135  O OG    . SER A  1 872 ? -9.747   -16.493 26.074  1.00 24.90  ? 872  SER A OG    1 
ATOM   6136  N N     . SER A  1 873 ? -7.827   -19.122 25.570  1.00 31.28  ? 873  SER A N     1 
ATOM   6137  C CA    . SER A  1 873 ? -6.739   -19.553 26.436  1.00 31.47  ? 873  SER A CA    1 
ATOM   6138  C C     . SER A  1 873 ? -6.662   -18.666 27.688  1.00 37.67  ? 873  SER A C     1 
ATOM   6139  O O     . SER A  1 873 ? -6.501   -19.206 28.790  1.00 39.46  ? 873  SER A O     1 
ATOM   6140  C CB    . SER A  1 873 ? -5.431   -19.548 25.665  1.00 34.98  ? 873  SER A CB    1 
ATOM   6141  O OG    . SER A  1 873 ? -5.197   -18.269 25.101  1.00 47.38  ? 873  SER A OG    1 
ATOM   6142  N N     . ILE A  1 874 ? -6.840   -17.321 27.537  1.00 32.68  ? 874  ILE A N     1 
ATOM   6143  C CA    . ILE A  1 874 ? -6.868   -16.385 28.675  1.00 31.73  ? 874  ILE A CA    1 
ATOM   6144  C C     . ILE A  1 874 ? -8.005   -16.816 29.624  1.00 37.70  ? 874  ILE A C     1 
ATOM   6145  O O     . ILE A  1 874 ? -7.809   -16.855 30.841  1.00 39.39  ? 874  ILE A O     1 
ATOM   6146  C CB    . ILE A  1 874 ? -7.023   -14.907 28.208  1.00 33.17  ? 874  ILE A CB    1 
ATOM   6147  C CG1   . ILE A  1 874 ? -5.683   -14.340 27.750  1.00 33.79  ? 874  ILE A CG1   1 
ATOM   6148  C CG2   . ILE A  1 874 ? -7.623   -14.030 29.292  1.00 30.59  ? 874  ILE A CG2   1 
ATOM   6149  C CD1   . ILE A  1 874 ? -5.717   -13.072 26.903  1.00 37.57  ? 874  ILE A CD1   1 
ATOM   6150  N N     . ASP A  1 875 ? -9.165   -17.186 29.057  1.00 32.69  ? 875  ASP A N     1 
ATOM   6151  C CA    . ASP A  1 875 ? -10.294  -17.636 29.847  1.00 32.39  ? 875  ASP A CA    1 
ATOM   6152  C C     . ASP A  1 875 ? -10.042  -18.952 30.546  1.00 39.28  ? 875  ASP A C     1 
ATOM   6153  O O     . ASP A  1 875 ? -10.358  -19.061 31.727  1.00 40.45  ? 875  ASP A O     1 
ATOM   6154  C CB    . ASP A  1 875 ? -11.558  -17.694 29.013  1.00 33.16  ? 875  ASP A CB    1 
ATOM   6155  C CG    . ASP A  1 875 ? -12.257  -16.363 28.979  1.00 35.87  ? 875  ASP A CG    1 
ATOM   6156  O OD1   . ASP A  1 875 ? -12.109  -15.595 29.950  1.00 34.83  ? 875  ASP A OD1   1 
ATOM   6157  O OD2   . ASP A  1 875 ? -12.958  -16.091 27.986  1.00 36.96  ? 875  ASP A OD2   1 
ATOM   6158  N N     . ARG A  1 876 ? -9.439   -19.930 29.835  1.00 35.83  ? 876  ARG A N     1 
ATOM   6159  C CA    . ARG A  1 876 ? -9.063   -21.263 30.341  1.00 34.28  ? 876  ARG A CA    1 
ATOM   6160  C C     . ARG A  1 876 ? -8.034   -21.147 31.471  1.00 38.87  ? 876  ARG A C     1 
ATOM   6161  O O     . ARG A  1 876 ? -8.201   -21.784 32.514  1.00 38.31  ? 876  ARG A O     1 
ATOM   6162  C CB    . ARG A  1 876 ? -8.457   -22.126 29.227  1.00 26.94  ? 876  ARG A CB    1 
ATOM   6163  C CG    . ARG A  1 876 ? -9.460   -22.738 28.291  1.00 27.52  ? 876  ARG A CG    1 
ATOM   6164  C CD    . ARG A  1 876 ? -8.740   -23.137 27.029  1.00 31.39  ? 876  ARG A CD    1 
ATOM   6165  N NE    . ARG A  1 876 ? -9.654   -23.301 25.917  1.00 30.86  ? 876  ARG A NE    1 
ATOM   6166  C CZ    . ARG A  1 876 ? -9.714   -24.383 25.155  1.00 52.66  ? 876  ARG A CZ    1 
ATOM   6167  N NH1   . ARG A  1 876 ? -8.888   -25.403 25.370  1.00 48.41  ? 876  ARG A NH1   1 
ATOM   6168  N NH2   . ARG A  1 876 ? -10.593  -24.454 24.161  1.00 37.99  ? 876  ARG A NH2   1 
ATOM   6169  N N     . VAL A  1 877 ? -6.973   -20.344 31.260  1.00 35.03  ? 877  VAL A N     1 
ATOM   6170  C CA    . VAL A  1 877 ? -5.928   -20.139 32.252  1.00 35.58  ? 877  VAL A CA    1 
ATOM   6171  C C     . VAL A  1 877 ? -6.497   -19.463 33.524  1.00 38.74  ? 877  VAL A C     1 
ATOM   6172  O O     . VAL A  1 877 ? -6.295   -19.981 34.626  1.00 38.60  ? 877  VAL A O     1 
ATOM   6173  C CB    . VAL A  1 877 ? -4.712   -19.416 31.619  1.00 40.43  ? 877  VAL A CB    1 
ATOM   6174  C CG1   . VAL A  1 877 ? -3.805   -18.790 32.671  1.00 40.93  ? 877  VAL A CG1   1 
ATOM   6175  C CG2   . VAL A  1 877 ? -3.922   -20.365 30.724  1.00 41.03  ? 877  VAL A CG2   1 
ATOM   6176  N N     . ASN A  1 878 ? -7.259   -18.362 33.367  1.00 34.43  ? 878  ASN A N     1 
ATOM   6177  C CA    . ASN A  1 878 ? -7.862   -17.672 34.512  1.00 34.08  ? 878  ASN A CA    1 
ATOM   6178  C C     . ASN A  1 878 ? -8.933   -18.467 35.254  1.00 37.34  ? 878  ASN A C     1 
ATOM   6179  O O     . ASN A  1 878 ? -8.962   -18.429 36.491  1.00 38.07  ? 878  ASN A O     1 
ATOM   6180  C CB    . ASN A  1 878 ? -8.341   -16.287 34.152  1.00 33.00  ? 878  ASN A CB    1 
ATOM   6181  C CG    . ASN A  1 878 ? -7.217   -15.309 34.041  1.00 47.88  ? 878  ASN A CG    1 
ATOM   6182  O OD1   . ASN A  1 878 ? -6.284   -15.281 34.863  1.00 48.18  ? 878  ASN A OD1   1 
ATOM   6183  N ND2   . ASN A  1 878 ? -7.288   -14.483 33.023  1.00 37.27  ? 878  ASN A ND2   1 
ATOM   6184  N N     . ALA A  1 879 ? -9.770   -19.222 34.515  1.00 31.75  ? 879  ALA A N     1 
ATOM   6185  C CA    . ALA A  1 879 ? -10.804  -20.080 35.092  1.00 31.19  ? 879  ALA A CA    1 
ATOM   6186  C C     . ALA A  1 879 ? -10.188  -21.062 36.042  1.00 34.69  ? 879  ALA A C     1 
ATOM   6187  O O     . ALA A  1 879 ? -10.752  -21.361 37.080  1.00 36.72  ? 879  ALA A O     1 
ATOM   6188  C CB    . ALA A  1 879 ? -11.535  -20.833 33.999  1.00 31.89  ? 879  ALA A CB    1 
ATOM   6189  N N     . CYS A  1 880 ? -9.007   -21.518 35.712  1.00 30.45  ? 880  CYS A N     1 
ATOM   6190  C CA    . CYS A  1 880 ? -8.262   -22.483 36.506  1.00 31.39  ? 880  CYS A CA    1 
ATOM   6191  C C     . CYS A  1 880 ? -7.631   -21.837 37.741  1.00 36.82  ? 880  CYS A C     1 
ATOM   6192  O O     . CYS A  1 880 ? -7.735   -22.412 38.826  1.00 39.13  ? 880  CYS A O     1 
ATOM   6193  C CB    . CYS A  1 880 ? -7.227   -23.182 35.630  1.00 31.52  ? 880  CYS A CB    1 
ATOM   6194  S SG    . CYS A  1 880 ? -6.050   -24.166 36.543  1.00 35.94  ? 880  CYS A SG    1 
ATOM   6195  N N     . ARG A  1 881 ? -6.991   -20.648 37.579  1.00 30.84  ? 881  ARG A N     1 
ATOM   6196  C CA    . ARG A  1 881 ? -6.366   -19.869 38.646  1.00 30.27  ? 881  ARG A CA    1 
ATOM   6197  C C     . ARG A  1 881 ? -7.403   -19.530 39.727  1.00 35.89  ? 881  ARG A C     1 
ATOM   6198  O O     . ARG A  1 881 ? -7.205   -19.832 40.911  1.00 35.90  ? 881  ARG A O     1 
ATOM   6199  C CB    . ARG A  1 881 ? -5.758   -18.587 38.048  1.00 29.53  ? 881  ARG A CB    1 
ATOM   6200  C CG    . ARG A  1 881 ? -5.072   -17.629 39.047  1.00 46.72  ? 881  ARG A CG    1 
ATOM   6201  C CD    . ARG A  1 881 ? -4.199   -16.626 38.311  1.00 54.00  ? 881  ARG A CD    1 
ATOM   6202  N NE    . ARG A  1 881 ? -3.868   -15.419 39.069  1.00 55.13  ? 881  ARG A NE    1 
ATOM   6203  C CZ    . ARG A  1 881 ? -2.922   -15.348 39.996  1.00 79.63  ? 881  ARG A CZ    1 
ATOM   6204  N NH1   . ARG A  1 881 ? -2.263   -16.442 40.366  1.00 70.53  ? 881  ARG A NH1   1 
ATOM   6205  N NH2   . ARG A  1 881 ? -2.658   -14.191 40.595  1.00 71.58  ? 881  ARG A NH2   1 
ATOM   6206  N N     . LEU A  1 882 ? -8.529   -18.942 39.295  1.00 32.61  ? 882  LEU A N     1 
ATOM   6207  C CA    . LEU A  1 882 ? -9.597   -18.506 40.170  1.00 31.81  ? 882  LEU A CA    1 
ATOM   6208  C C     . LEU A  1 882 ? -10.412  -19.634 40.797  1.00 34.50  ? 882  LEU A C     1 
ATOM   6209  O O     . LEU A  1 882 ? -10.798  -19.509 41.972  1.00 36.18  ? 882  LEU A O     1 
ATOM   6210  C CB    . LEU A  1 882 ? -10.480  -17.526 39.438  1.00 30.87  ? 882  LEU A CB    1 
ATOM   6211  C CG    . LEU A  1 882 ? -9.824   -16.231 39.036  1.00 35.58  ? 882  LEU A CG    1 
ATOM   6212  C CD1   . LEU A  1 882 ? -10.561  -15.623 37.838  1.00 36.43  ? 882  LEU A CD1   1 
ATOM   6213  C CD2   . LEU A  1 882 ? -9.775   -15.263 40.198  1.00 35.49  ? 882  LEU A CD2   1 
ATOM   6214  N N     . ALA A  1 883 ? -10.673  -20.731 40.042  1.00 25.94  ? 883  ALA A N     1 
ATOM   6215  C CA    . ALA A  1 883 ? -11.415  -21.860 40.602  1.00 24.26  ? 883  ALA A CA    1 
ATOM   6216  C C     . ALA A  1 883 ? -10.624  -22.390 41.775  1.00 27.97  ? 883  ALA A C     1 
ATOM   6217  O O     . ALA A  1 883 ? -11.212  -22.597 42.836  1.00 27.80  ? 883  ALA A O     1 
ATOM   6218  C CB    . ALA A  1 883 ? -11.619  -22.951 39.571  1.00 24.00  ? 883  ALA A CB    1 
ATOM   6219  N N     . ILE A  1 884 ? -9.282   -22.523 41.601  1.00 24.51  ? 884  ILE A N     1 
ATOM   6220  C CA    . ILE A  1 884 ? -8.329   -22.976 42.625  1.00 26.49  ? 884  ILE A CA    1 
ATOM   6221  C C     . ILE A  1 884 ? -8.405   -22.073 43.860  1.00 35.04  ? 884  ILE A C     1 
ATOM   6222  O O     . ILE A  1 884 ? -8.498   -22.565 44.986  1.00 34.25  ? 884  ILE A O     1 
ATOM   6223  C CB    . ILE A  1 884 ? -6.894   -23.101 42.029  1.00 29.18  ? 884  ILE A CB    1 
ATOM   6224  C CG1   . ILE A  1 884 ? -6.695   -24.467 41.354  1.00 30.13  ? 884  ILE A CG1   1 
ATOM   6225  C CG2   . ILE A  1 884 ? -5.839   -22.894 43.080  1.00 30.92  ? 884  ILE A CG2   1 
ATOM   6226  C CD1   . ILE A  1 884 ? -5.636   -24.530 40.251  1.00 38.71  ? 884  ILE A CD1   1 
ATOM   6227  N N     . LYS A  1 885 ? -8.440   -20.758 43.626  1.00 35.22  ? 885  LYS A N     1 
ATOM   6228  C CA    . LYS A  1 885 ? -8.509   -19.784 44.701  1.00 37.05  ? 885  LYS A CA    1 
ATOM   6229  C C     . LYS A  1 885 ? -9.859   -19.785 45.448  1.00 40.05  ? 885  LYS A C     1 
ATOM   6230  O O     . LYS A  1 885 ? -9.885   -19.558 46.665  1.00 40.81  ? 885  LYS A O     1 
ATOM   6231  C CB    . LYS A  1 885 ? -8.063   -18.393 44.197  1.00 40.56  ? 885  LYS A CB    1 
ATOM   6232  C CG    . LYS A  1 885 ? -6.552   -18.311 43.874  1.00 49.64  ? 885  LYS A CG    1 
ATOM   6233  C CD    . LYS A  1 885 ? -5.672   -18.261 45.127  1.00 51.82  ? 885  LYS A CD    1 
ATOM   6234  C CE    . LYS A  1 885 ? -4.455   -17.395 44.908  1.00 60.13  ? 885  LYS A CE    1 
ATOM   6235  N NZ    . LYS A  1 885 ? -3.989   -16.730 46.170  1.00 66.41  ? 885  LYS A NZ    1 
ATOM   6236  N N     . CYS A  1 886 ? -10.957  -20.096 44.729  1.00 35.14  ? 886  CYS A N     1 
ATOM   6237  C CA    . CYS A  1 886 ? -12.294  -20.218 45.301  1.00 35.52  ? 886  CYS A CA    1 
ATOM   6238  C C     . CYS A  1 886 ? -12.319  -21.357 46.308  1.00 38.14  ? 886  CYS A C     1 
ATOM   6239  O O     . CYS A  1 886 ? -12.664  -21.134 47.463  1.00 37.98  ? 886  CYS A O     1 
ATOM   6240  C CB    . CYS A  1 886 ? -13.342  -20.425 44.211  1.00 36.32  ? 886  CYS A CB    1 
ATOM   6241  S SG    . CYS A  1 886 ? -13.844  -18.908 43.350  1.00 40.03  ? 886  CYS A SG    1 
ATOM   6242  N N     . CYS A  1 887 ? -11.923  -22.561 45.871  1.00 35.33  ? 887  CYS A N     1 
ATOM   6243  C CA    . CYS A  1 887 ? -11.852  -23.776 46.677  1.00 37.04  ? 887  CYS A CA    1 
ATOM   6244  C C     . CYS A  1 887 ? -10.953  -23.576 47.894  1.00 42.01  ? 887  CYS A C     1 
ATOM   6245  O O     . CYS A  1 887 ? -11.322  -23.938 49.016  1.00 43.89  ? 887  CYS A O     1 
ATOM   6246  C CB    . CYS A  1 887 ? -11.369  -24.945 45.830  1.00 38.76  ? 887  CYS A CB    1 
ATOM   6247  S SG    . CYS A  1 887 ? -12.440  -25.342 44.423  1.00 42.76  ? 887  CYS A SG    1 
ATOM   6248  N N     . ASN A  1 888 ? -9.793   -22.953 47.687  1.00 34.52  ? 888  ASN A N     1 
ATOM   6249  C CA    . ASN A  1 888 ? -8.886   -22.698 48.771  1.00 32.73  ? 888  ASN A CA    1 
ATOM   6250  C C     . ASN A  1 888 ? -9.533   -21.853 49.832  1.00 35.31  ? 888  ASN A C     1 
ATOM   6251  O O     . ASN A  1 888 ? -9.282   -22.086 51.010  1.00 37.31  ? 888  ASN A O     1 
ATOM   6252  C CB    . ASN A  1 888 ? -7.606   -22.083 48.239  1.00 32.16  ? 888  ASN A CB    1 
ATOM   6253  C CG    . ASN A  1 888 ? -6.692   -23.090 47.553  1.00 50.91  ? 888  ASN A CG    1 
ATOM   6254  O OD1   . ASN A  1 888 ? -7.027   -24.266 47.331  1.00 33.17  ? 888  ASN A OD1   1 
ATOM   6255  N ND2   . ASN A  1 888 ? -5.507   -22.643 47.184  1.00 50.61  ? 888  ASN A ND2   1 
ATOM   6256  N N     . PHE A  1 889 ? -10.404  -20.914 49.437  1.00 30.94  ? 889  PHE A N     1 
ATOM   6257  C CA    . PHE A  1 889 ? -11.110  -20.021 50.363  1.00 31.55  ? 889  PHE A CA    1 
ATOM   6258  C C     . PHE A  1 889 ? -12.233  -20.698 51.135  1.00 36.77  ? 889  PHE A C     1 
ATOM   6259  O O     . PHE A  1 889 ? -12.172  -20.718 52.352  1.00 37.41  ? 889  PHE A O     1 
ATOM   6260  C CB    . PHE A  1 889 ? -11.600  -18.742 49.661  1.00 32.70  ? 889  PHE A CB    1 
ATOM   6261  C CG    . PHE A  1 889 ? -12.325  -17.771 50.567  1.00 34.61  ? 889  PHE A CG    1 
ATOM   6262  C CD1   . PHE A  1 889 ? -11.624  -16.827 51.302  1.00 36.57  ? 889  PHE A CD1   1 
ATOM   6263  C CD2   . PHE A  1 889 ? -13.718  -17.776 50.653  1.00 37.08  ? 889  PHE A CD2   1 
ATOM   6264  C CE1   . PHE A  1 889 ? -12.292  -15.934 52.137  1.00 37.78  ? 889  PHE A CE1   1 
ATOM   6265  C CE2   . PHE A  1 889 ? -14.384  -16.884 51.495  1.00 39.89  ? 889  PHE A CE2   1 
ATOM   6266  C CZ    . PHE A  1 889 ? -13.663  -15.968 52.229  1.00 38.22  ? 889  PHE A CZ    1 
ATOM   6267  N N     . ILE A  1 890 ? -13.278  -21.195 50.443  1.00 34.70  ? 890  ILE A N     1 
ATOM   6268  C CA    . ILE A  1 890 ? -14.447  -21.834 51.064  1.00 35.82  ? 890  ILE A CA    1 
ATOM   6269  C C     . ILE A  1 890 ? -14.065  -23.074 51.885  1.00 44.57  ? 890  ILE A C     1 
ATOM   6270  O O     . ILE A  1 890 ? -14.565  -23.258 53.005  1.00 45.87  ? 890  ILE A O     1 
ATOM   6271  C CB    . ILE A  1 890 ? -15.608  -22.093 50.070  1.00 38.31  ? 890  ILE A CB    1 
ATOM   6272  C CG1   . ILE A  1 890 ? -15.187  -23.015 48.932  1.00 39.48  ? 890  ILE A CG1   1 
ATOM   6273  C CG2   . ILE A  1 890 ? -16.228  -20.787 49.534  1.00 38.24  ? 890  ILE A CG2   1 
ATOM   6274  C CD1   . ILE A  1 890 ? -16.329  -23.764 48.351  1.00 59.86  ? 890  ILE A CD1   1 
ATOM   6275  N N     . GLU A  1 891 ? -13.121  -23.881 51.355  1.00 41.57  ? 891  GLU A N     1 
ATOM   6276  C CA    . GLU A  1 891 ? -12.650  -25.112 51.996  1.00 41.88  ? 891  GLU A CA    1 
ATOM   6277  C C     . GLU A  1 891 ? -11.537  -24.889 53.042  1.00 46.72  ? 891  GLU A C     1 
ATOM   6278  O O     . GLU A  1 891 ? -10.983  -25.858 53.571  1.00 45.73  ? 891  GLU A O     1 
ATOM   6279  C CB    . GLU A  1 891 ? -12.236  -26.144 50.939  1.00 42.63  ? 891  GLU A CB    1 
ATOM   6280  C CG    . GLU A  1 891 ? -13.366  -26.537 50.001  1.00 51.00  ? 891  GLU A CG    1 
ATOM   6281  C CD    . GLU A  1 891 ? -12.960  -26.988 48.609  1.00 66.63  ? 891  GLU A CD    1 
ATOM   6282  O OE1   . GLU A  1 891 ? -11.749  -27.175 48.351  1.00 73.13  ? 891  GLU A OE1   1 
ATOM   6283  O OE2   . GLU A  1 891 ? -13.865  -27.146 47.764  1.00 48.69  ? 891  GLU A OE2   1 
ATOM   6284  N N     . ASP A  1 892 ? -11.220  -23.617 53.343  1.00 44.71  ? 892  ASP A N     1 
ATOM   6285  C CA    . ASP A  1 892 ? -10.206  -23.259 54.330  1.00 46.76  ? 892  ASP A CA    1 
ATOM   6286  C C     . ASP A  1 892 ? -10.712  -23.692 55.704  1.00 55.28  ? 892  ASP A C     1 
ATOM   6287  O O     . ASP A  1 892 ? -11.859  -23.412 56.064  1.00 55.98  ? 892  ASP A O     1 
ATOM   6288  C CB    . ASP A  1 892 ? -9.963   -21.742 54.313  1.00 48.32  ? 892  ASP A CB    1 
ATOM   6289  C CG    . ASP A  1 892 ? -8.700   -21.233 54.978  1.00 61.28  ? 892  ASP A CG    1 
ATOM   6290  O OD1   . ASP A  1 892 ? -8.318   -21.778 56.050  1.00 58.46  ? 892  ASP A OD1   1 
ATOM   6291  O OD2   . ASP A  1 892 ? -8.129   -20.248 54.472  1.00 76.42  ? 892  ASP A OD2   1 
ATOM   6292  N N     . ALA A  1 893 ? -9.859   -24.391 56.461  1.00 54.16  ? 893  ALA A N     1 
ATOM   6293  C CA    . ALA A  1 893 ? -10.200  -24.895 57.786  1.00 55.56  ? 893  ALA A CA    1 
ATOM   6294  C C     . ALA A  1 893 ? -10.505  -23.774 58.786  1.00 59.52  ? 893  ALA A C     1 
ATOM   6295  O O     . ALA A  1 893 ? -11.301  -23.985 59.708  1.00 60.36  ? 893  ALA A O     1 
ATOM   6296  C CB    . ALA A  1 893 ? -9.095   -25.796 58.304  1.00 57.83  ? 893  ALA A CB    1 
ATOM   6297  N N     . ASN A  1 894 ? -9.906   -22.584 58.581  1.00 54.35  ? 894  ASN A N     1 
ATOM   6298  C CA    . ASN A  1 894 ? -10.110  -21.419 59.434  1.00 55.05  ? 894  ASN A CA    1 
ATOM   6299  C C     . ASN A  1 894 ? -11.565  -20.998 59.464  1.00 57.23  ? 894  ASN A C     1 
ATOM   6300  O O     . ASN A  1 894 ? -12.036  -20.558 60.515  1.00 59.36  ? 894  ASN A O     1 
ATOM   6301  C CB    . ASN A  1 894 ? -9.244   -20.241 58.985  1.00 59.45  ? 894  ASN A CB    1 
ATOM   6302  C CG    . ASN A  1 894 ? -7.769   -20.446 59.210  1.00 93.30  ? 894  ASN A CG    1 
ATOM   6303  O OD1   . ASN A  1 894 ? -7.305   -20.587 60.345  1.00 93.55  ? 894  ASN A OD1   1 
ATOM   6304  N ND2   . ASN A  1 894 ? -6.991   -20.427 58.134  1.00 84.99  ? 894  ASN A ND2   1 
ATOM   6305  N N     . PHE A  1 895 ? -12.269  -21.138 58.325  1.00 49.56  ? 895  PHE A N     1 
ATOM   6306  C CA    . PHE A  1 895 ? -13.684  -20.792 58.182  1.00 47.95  ? 895  PHE A CA    1 
ATOM   6307  C C     . PHE A  1 895 ? -14.589  -21.975 58.469  1.00 51.15  ? 895  PHE A C     1 
ATOM   6308  O O     . PHE A  1 895 ? -15.815  -21.862 58.370  1.00 52.10  ? 895  PHE A O     1 
ATOM   6309  C CB    . PHE A  1 895 ? -13.959  -20.272 56.766  1.00 48.35  ? 895  PHE A CB    1 
ATOM   6310  C CG    . PHE A  1 895 ? -13.069  -19.131 56.339  1.00 50.17  ? 895  PHE A CG    1 
ATOM   6311  C CD1   . PHE A  1 895 ? -12.979  -17.973 57.104  1.00 54.00  ? 895  PHE A CD1   1 
ATOM   6312  C CD2   . PHE A  1 895 ? -12.323  -19.209 55.174  1.00 51.12  ? 895  PHE A CD2   1 
ATOM   6313  C CE1   . PHE A  1 895 ? -12.169  -16.917 56.703  1.00 54.11  ? 895  PHE A CE1   1 
ATOM   6314  C CE2   . PHE A  1 895 ? -11.495  -18.162 54.785  1.00 53.18  ? 895  PHE A CE2   1 
ATOM   6315  C CZ    . PHE A  1 895 ? -11.435  -17.018 55.543  1.00 51.83  ? 895  PHE A CZ    1 
ATOM   6316  N N     . GLN A  1 896 ? -13.995  -23.112 58.818  1.00 45.59  ? 896  GLN A N     1 
ATOM   6317  C CA    . GLN A  1 896 ? -14.755  -24.319 59.057  1.00 44.35  ? 896  GLN A CA    1 
ATOM   6318  C C     . GLN A  1 896 ? -14.818  -24.685 60.512  1.00 48.27  ? 896  GLN A C     1 
ATOM   6319  O O     . GLN A  1 896 ? -13.928  -24.306 61.254  1.00 50.82  ? 896  GLN A O     1 
ATOM   6320  C CB    . GLN A  1 896 ? -14.226  -25.456 58.174  1.00 45.18  ? 896  GLN A CB    1 
ATOM   6321  C CG    . GLN A  1 896 ? -14.526  -25.270 56.671  1.00 39.68  ? 896  GLN A CG    1 
ATOM   6322  C CD    . GLN A  1 896 ? -16.005  -25.307 56.358  1.00 60.94  ? 896  GLN A CD    1 
ATOM   6323  O OE1   . GLN A  1 896 ? -16.807  -25.917 57.078  1.00 62.66  ? 896  GLN A OE1   1 
ATOM   6324  N NE2   . GLN A  1 896 ? -16.393  -24.689 55.257  1.00 46.89  ? 896  GLN A NE2   1 
ATOM   6325  N N     . VAL A  1 897 ? -15.904  -25.370 60.930  1.00 43.49  ? 897  VAL A N     1 
ATOM   6326  C CA    . VAL A  1 897 ? -16.194  -25.834 62.303  1.00 43.92  ? 897  VAL A CA    1 
ATOM   6327  C C     . VAL A  1 897 ? -14.992  -26.575 62.907  1.00 49.88  ? 897  VAL A C     1 
ATOM   6328  O O     . VAL A  1 897 ? -14.410  -27.417 62.223  1.00 50.60  ? 897  VAL A O     1 
ATOM   6329  C CB    . VAL A  1 897 ? -17.457  -26.731 62.289  1.00 46.94  ? 897  VAL A CB    1 
ATOM   6330  C CG1   . VAL A  1 897 ? -17.626  -27.484 63.596  1.00 48.64  ? 897  VAL A CG1   1 
ATOM   6331  C CG2   . VAL A  1 897 ? -18.704  -25.925 61.963  1.00 45.62  ? 897  VAL A CG2   1 
ATOM   6332  N N     . LYS A  1 898 ? -14.627  -26.273 64.173  1.00 47.42  ? 898  LYS A N     1 
ATOM   6333  C CA    . LYS A  1 898 ? -13.503  -26.919 64.874  1.00 48.30  ? 898  LYS A CA    1 
ATOM   6334  C C     . LYS A  1 898 ? -13.882  -28.286 65.442  1.00 57.78  ? 898  LYS A C     1 
ATOM   6335  O O     . LYS A  1 898 ? -14.923  -28.408 66.090  1.00 59.26  ? 898  LYS A O     1 
ATOM   6336  C CB    . LYS A  1 898 ? -12.926  -25.994 65.933  1.00 48.99  ? 898  LYS A CB    1 
ATOM   6337  C CG    . LYS A  1 898 ? -11.819  -25.123 65.378  1.00 40.46  ? 898  LYS A CG    1 
ATOM   6338  C CD    . LYS A  1 898 ? -12.254  -24.091 64.362  1.00 31.27  ? 898  LYS A CD    1 
ATOM   6339  C CE    . LYS A  1 898 ? -11.329  -24.074 63.178  1.00 39.71  ? 898  LYS A CE    1 
ATOM   6340  N NZ    . LYS A  1 898 ? -11.668  -22.959 62.256  1.00 56.79  ? 898  LYS A NZ    1 
ATOM   6341  N N     . HIS A  1 899 ? -13.084  -29.326 65.148  1.00 56.86  ? 899  HIS A N     1 
ATOM   6342  C CA    . HIS A  1 899 ? -13.442  -30.678 65.559  1.00 59.33  ? 899  HIS A CA    1 
ATOM   6343  C C     . HIS A  1 899 ? -13.085  -31.104 66.979  1.00 62.05  ? 899  HIS A C     1 
ATOM   6344  O O     . HIS A  1 899 ? -13.706  -32.034 67.508  1.00 61.77  ? 899  HIS A O     1 
ATOM   6345  C CB    . HIS A  1 899 ? -13.145  -31.717 64.471  1.00 61.52  ? 899  HIS A CB    1 
ATOM   6346  C CG    . HIS A  1 899 ? -13.959  -31.491 63.225  1.00 65.13  ? 899  HIS A CG    1 
ATOM   6347  N ND1   . HIS A  1 899 ? -15.348  -31.658 63.213  1.00 67.58  ? 899  HIS A ND1   1 
ATOM   6348  C CD2   . HIS A  1 899 ? -13.561  -31.105 61.986  1.00 66.66  ? 899  HIS A CD2   1 
ATOM   6349  C CE1   . HIS A  1 899 ? -15.743  -31.358 61.980  1.00 65.68  ? 899  HIS A CE1   1 
ATOM   6350  N NE2   . HIS A  1 899 ? -14.709  -31.019 61.204  1.00 65.39  ? 899  HIS A NE2   1 
ATOM   6351  N N     . ASN A  1 900 ? -12.161  -30.387 67.627  1.00 57.95  ? 900  ASN A N     1 
ATOM   6352  C CA    . ASN A  1 900 ? -11.847  -30.693 69.017  1.00 59.75  ? 900  ASN A CA    1 
ATOM   6353  C C     . ASN A  1 900 ? -12.619  -29.730 69.931  1.00 63.01  ? 900  ASN A C     1 
ATOM   6354  O O     . ASN A  1 900 ? -12.039  -28.817 70.540  1.00 63.80  ? 900  ASN A O     1 
ATOM   6355  C CB    . ASN A  1 900 ? -10.338  -30.733 69.308  1.00 61.33  ? 900  ASN A CB    1 
ATOM   6356  C CG    . ASN A  1 900 ? -9.577   -31.805 68.567  1.00 80.29  ? 900  ASN A CG    1 
ATOM   6357  O OD1   . ASN A  1 900 ? -9.881   -32.999 68.621  1.00 68.24  ? 900  ASN A OD1   1 
ATOM   6358  N ND2   . ASN A  1 900 ? -8.517   -31.406 67.908  1.00 78.91  ? 900  ASN A ND2   1 
ATOM   6359  N N     . ALA A  1 901 ? -13.952  -29.937 69.989  1.00 56.70  ? 901  ALA A N     1 
ATOM   6360  C CA    . ALA A  1 901 ? -14.894  -29.180 70.812  1.00 56.03  ? 901  ALA A CA    1 
ATOM   6361  C C     . ALA A  1 901 ? -16.092  -30.061 71.214  1.00 63.13  ? 901  ALA A C     1 
ATOM   6362  O O     . ALA A  1 901 ? -16.484  -30.909 70.409  1.00 63.89  ? 901  ALA A O     1 
ATOM   6363  C CB    . ALA A  1 901 ? -15.373  -27.974 70.041  1.00 54.12  ? 901  ALA A CB    1 
ATOM   6364  N N     . ASN A  1 902 ? -16.678  -29.875 72.439  1.00 60.69  ? 902  ASN A N     1 
ATOM   6365  C CA    . ASN A  1 902 ? -17.861  -30.627 72.916  1.00 61.35  ? 902  ASN A CA    1 
ATOM   6366  C C     . ASN A  1 902 ? -19.091  -30.122 72.110  1.00 65.73  ? 902  ASN A C     1 
ATOM   6367  O O     . ASN A  1 902 ? -19.962  -29.415 72.650  1.00 66.28  ? 902  ASN A O     1 
ATOM   6368  C CB    . ASN A  1 902 ? -18.112  -30.421 74.435  1.00 65.53  ? 902  ASN A CB    1 
ATOM   6369  C CG    . ASN A  1 902 ? -16.951  -30.638 75.407  1.00 96.94  ? 902  ASN A CG    1 
ATOM   6370  O OD1   . ASN A  1 902 ? -16.122  -31.553 75.259  1.00 89.04  ? 902  ASN A OD1   1 
ATOM   6371  N ND2   . ASN A  1 902 ? -16.934  -29.852 76.498  1.00 87.58  ? 902  ASN A ND2   1 
ATOM   6372  N N     . LEU A  1 903 ? -19.130  -30.461 70.798  1.00 60.74  ? 903  LEU A N     1 
ATOM   6373  C CA    . LEU A  1 903 ? -20.176  -30.039 69.868  1.00 58.71  ? 903  LEU A CA    1 
ATOM   6374  C C     . LEU A  1 903 ? -21.126  -31.152 69.459  1.00 62.19  ? 903  LEU A C     1 
ATOM   6375  O O     . LEU A  1 903 ? -20.677  -32.237 69.078  1.00 62.37  ? 903  LEU A O     1 
ATOM   6376  C CB    . LEU A  1 903 ? -19.556  -29.431 68.596  1.00 56.71  ? 903  LEU A CB    1 
ATOM   6377  C CG    . LEU A  1 903 ? -18.923  -28.056 68.692  1.00 59.89  ? 903  LEU A CG    1 
ATOM   6378  C CD1   . LEU A  1 903 ? -18.149  -27.744 67.421  1.00 58.63  ? 903  LEU A CD1   1 
ATOM   6379  C CD2   . LEU A  1 903 ? -19.974  -27.000 68.909  1.00 60.66  ? 903  LEU A CD2   1 
ATOM   6380  N N     . SER A  1 904 ? -22.438  -30.856 69.472  1.00 57.36  ? 904  SER A N     1 
ATOM   6381  C CA    . SER A  1 904 ? -23.468  -31.787 69.026  1.00 56.81  ? 904  SER A CA    1 
ATOM   6382  C C     . SER A  1 904 ? -23.508  -31.714 67.508  1.00 59.50  ? 904  SER A C     1 
ATOM   6383  O O     . SER A  1 904 ? -23.030  -30.730 66.943  1.00 59.89  ? 904  SER A O     1 
ATOM   6384  C CB    . SER A  1 904 ? -24.827  -31.431 69.631  1.00 60.74  ? 904  SER A CB    1 
ATOM   6385  O OG    . SER A  1 904 ? -25.546  -30.444 68.906  1.00 71.65  ? 904  SER A OG    1 
ATOM   6386  N N     . ALA A  1 905 ? -24.079  -32.727 66.846  1.00 54.27  ? 905  ALA A N     1 
ATOM   6387  C CA    . ALA A  1 905 ? -24.163  -32.735 65.392  1.00 51.92  ? 905  ALA A CA    1 
ATOM   6388  C C     . ALA A  1 905 ? -24.905  -31.502 64.850  1.00 54.03  ? 905  ALA A C     1 
ATOM   6389  O O     . ALA A  1 905 ? -24.487  -30.930 63.836  1.00 51.20  ? 905  ALA A O     1 
ATOM   6390  C CB    . ALA A  1 905 ? -24.822  -34.015 64.920  1.00 52.87  ? 905  ALA A CB    1 
ATOM   6391  N N     . ASP A  1 906 ? -25.974  -31.079 65.567  1.00 51.27  ? 906  ASP A N     1 
ATOM   6392  C CA    . ASP A  1 906 ? -26.794  -29.920 65.216  1.00 49.79  ? 906  ASP A CA    1 
ATOM   6393  C C     . ASP A  1 906 ? -26.028  -28.642 65.431  1.00 51.53  ? 906  ASP A C     1 
ATOM   6394  O O     . ASP A  1 906 ? -26.165  -27.716 64.627  1.00 49.83  ? 906  ASP A O     1 
ATOM   6395  C CB    . ASP A  1 906 ? -28.097  -29.892 66.034  1.00 52.36  ? 906  ASP A CB    1 
ATOM   6396  C CG    . ASP A  1 906 ? -29.032  -31.012 65.693  1.00 57.54  ? 906  ASP A CG    1 
ATOM   6397  O OD1   . ASP A  1 906 ? -29.322  -31.195 64.480  1.00 55.11  ? 906  ASP A OD1   1 
ATOM   6398  O OD2   . ASP A  1 906 ? -29.462  -31.729 66.631  1.00 63.13  ? 906  ASP A OD2   1 
ATOM   6399  N N     . GLU A  1 907 ? -25.223  -28.591 66.514  1.00 47.32  ? 907  GLU A N     1 
ATOM   6400  C CA    . GLU A  1 907 ? -24.375  -27.446 66.832  1.00 46.09  ? 907  GLU A CA    1 
ATOM   6401  C C     . GLU A  1 907 ? -23.372  -27.259 65.704  1.00 50.65  ? 907  GLU A C     1 
ATOM   6402  O O     . GLU A  1 907 ? -23.231  -26.138 65.213  1.00 48.11  ? 907  GLU A O     1 
ATOM   6403  C CB    . GLU A  1 907 ? -23.691  -27.617 68.200  1.00 48.42  ? 907  GLU A CB    1 
ATOM   6404  C CG    . GLU A  1 907 ? -24.635  -27.297 69.350  1.00 54.02  ? 907  GLU A CG    1 
ATOM   6405  C CD    . GLU A  1 907 ? -24.236  -27.663 70.764  1.00 69.19  ? 907  GLU A CD    1 
ATOM   6406  O OE1   . GLU A  1 907 ? -23.214  -28.367 70.951  1.00 78.76  ? 907  GLU A OE1   1 
ATOM   6407  O OE2   . GLU A  1 907 ? -24.970  -27.249 71.692  1.00 58.49  ? 907  GLU A OE2   1 
ATOM   6408  N N     . ARG A  1 908 ? -22.760  -28.368 65.217  1.00 50.96  ? 908  ARG A N     1 
ATOM   6409  C CA    . ARG A  1 908 ? -21.833  -28.287 64.095  1.00 51.66  ? 908  ARG A CA    1 
ATOM   6410  C C     . ARG A  1 908 ? -22.480  -27.874 62.764  1.00 56.30  ? 908  ARG A C     1 
ATOM   6411  O O     . ARG A  1 908 ? -21.821  -27.200 61.972  1.00 54.81  ? 908  ARG A O     1 
ATOM   6412  C CB    . ARG A  1 908 ? -20.781  -29.435 63.999  1.00 58.11  ? 908  ARG A CB    1 
ATOM   6413  C CG    . ARG A  1 908 ? -21.185  -30.873 64.356  1.00 76.79  ? 908  ARG A CG    1 
ATOM   6414  C CD    . ARG A  1 908 ? -20.305  -31.931 63.675  1.00 89.19  ? 908  ARG A CD    1 
ATOM   6415  N NE    . ARG A  1 908 ? -20.672  -32.179 62.263  1.00 98.34  ? 908  ARG A NE    1 
ATOM   6416  C CZ    . ARG A  1 908 ? -21.266  -33.290 61.811  1.00 102.83 ? 908  ARG A CZ    1 
ATOM   6417  N NH1   . ARG A  1 908 ? -21.572  -34.277 62.648  1.00 94.33  ? 908  ARG A NH1   1 
ATOM   6418  N NH2   . ARG A  1 908 ? -21.555  -33.421 60.515  1.00 62.88  ? 908  ARG A NH2   1 
ATOM   6419  N N     . HIS A  1 909 ? -23.793  -28.188 62.563  1.00 54.55  ? 909  HIS A N     1 
ATOM   6420  C CA    . HIS A  1 909 ? -24.584  -27.809 61.370  1.00 52.38  ? 909  HIS A CA    1 
ATOM   6421  C C     . HIS A  1 909 ? -25.048  -26.355 61.456  1.00 52.44  ? 909  HIS A C     1 
ATOM   6422  O O     . HIS A  1 909 ? -25.055  -25.656 60.442  1.00 49.85  ? 909  HIS A O     1 
ATOM   6423  C CB    . HIS A  1 909 ? -25.809  -28.711 61.201  1.00 54.39  ? 909  HIS A CB    1 
ATOM   6424  C CG    . HIS A  1 909 ? -25.492  -30.141 60.891  1.00 59.31  ? 909  HIS A CG    1 
ATOM   6425  N ND1   . HIS A  1 909 ? -26.211  -31.184 61.476  1.00 62.96  ? 909  HIS A ND1   1 
ATOM   6426  C CD2   . HIS A  1 909 ? -24.556  -30.664 60.061  1.00 60.97  ? 909  HIS A CD2   1 
ATOM   6427  C CE1   . HIS A  1 909 ? -25.695  -32.296 60.978  1.00 62.66  ? 909  HIS A CE1   1 
ATOM   6428  N NE2   . HIS A  1 909 ? -24.687  -32.037 60.132  1.00 61.86  ? 909  HIS A NE2   1 
ATOM   6429  N N     . LEU A  1 910 ? -25.443  -25.901 62.673  1.00 48.74  ? 910  LEU A N     1 
ATOM   6430  C CA    . LEU A  1 910 ? -25.864  -24.519 62.944  1.00 46.67  ? 910  LEU A CA    1 
ATOM   6431  C C     . LEU A  1 910 ? -24.675  -23.569 63.010  1.00 49.32  ? 910  LEU A C     1 
ATOM   6432  O O     . LEU A  1 910 ? -24.842  -22.374 62.781  1.00 49.33  ? 910  LEU A O     1 
ATOM   6433  C CB    . LEU A  1 910 ? -26.705  -24.436 64.215  1.00 47.24  ? 910  LEU A CB    1 
ATOM   6434  C CG    . LEU A  1 910 ? -28.139  -24.893 64.046  1.00 50.20  ? 910  LEU A CG    1 
ATOM   6435  C CD1   . LEU A  1 910 ? -28.731  -25.317 65.349  1.00 51.81  ? 910  LEU A CD1   1 
ATOM   6436  C CD2   . LEU A  1 910 ? -28.972  -23.804 63.454  1.00 50.92  ? 910  LEU A CD2   1 
ATOM   6437  N N     . ARG A  1 911 ? -23.472  -24.121 63.252  1.00 45.08  ? 911  ARG A N     1 
ATOM   6438  C CA    . ARG A  1 911 ? -22.193  -23.424 63.317  1.00 45.29  ? 911  ARG A CA    1 
ATOM   6439  C C     . ARG A  1 911 ? -22.073  -22.463 64.512  1.00 50.18  ? 911  ARG A C     1 
ATOM   6440  O O     . ARG A  1 911 ? -21.297  -21.495 64.476  1.00 50.10  ? 911  ARG A O     1 
ATOM   6441  C CB    . ARG A  1 911 ? -21.831  -22.758 61.986  1.00 46.74  ? 911  ARG A CB    1 
ATOM   6442  C CG    . ARG A  1 911 ? -21.772  -23.724 60.835  1.00 60.79  ? 911  ARG A CG    1 
ATOM   6443  C CD    . ARG A  1 911 ? -20.807  -23.218 59.800  1.00 68.66  ? 911  ARG A CD    1 
ATOM   6444  N NE    . ARG A  1 911 ? -20.516  -24.264 58.831  1.00 75.54  ? 911  ARG A NE    1 
ATOM   6445  C CZ    . ARG A  1 911 ? -19.489  -24.247 57.989  1.00 92.14  ? 911  ARG A CZ    1 
ATOM   6446  N NH1   . ARG A  1 911 ? -18.638  -23.220 57.982  1.00 68.57  ? 911  ARG A NH1   1 
ATOM   6447  N NH2   . ARG A  1 911 ? -19.305  -25.248 57.142  1.00 85.73  ? 911  ARG A NH2   1 
ATOM   6448  N N     . PHE A  1 912 ? -22.838  -22.770 65.580  1.00 46.18  ? 912  PHE A N     1 
ATOM   6449  C CA    . PHE A  1 912 ? -22.857  -22.074 66.856  1.00 47.24  ? 912  PHE A CA    1 
ATOM   6450  C C     . PHE A  1 912 ? -23.352  -22.990 67.968  1.00 54.96  ? 912  PHE A C     1 
ATOM   6451  O O     . PHE A  1 912 ? -24.105  -23.935 67.704  1.00 55.93  ? 912  PHE A O     1 
ATOM   6452  C CB    . PHE A  1 912 ? -23.681  -20.782 66.809  1.00 48.61  ? 912  PHE A CB    1 
ATOM   6453  C CG    . PHE A  1 912 ? -25.172  -20.909 66.569  1.00 50.53  ? 912  PHE A CG    1 
ATOM   6454  C CD1   . PHE A  1 912 ? -26.043  -21.222 67.617  1.00 55.56  ? 912  PHE A CD1   1 
ATOM   6455  C CD2   . PHE A  1 912 ? -25.720  -20.612 65.324  1.00 51.41  ? 912  PHE A CD2   1 
ATOM   6456  C CE1   . PHE A  1 912 ? -27.428  -21.291 67.406  1.00 56.06  ? 912  PHE A CE1   1 
ATOM   6457  C CE2   . PHE A  1 912 ? -27.100  -20.679 65.113  1.00 54.03  ? 912  PHE A CE2   1 
ATOM   6458  C CZ    . PHE A  1 912 ? -27.943  -21.022 66.157  1.00 53.65  ? 912  PHE A CZ    1 
ATOM   6459  N N     . PHE A  1 913 ? -22.960  -22.691 69.214  1.00 52.28  ? 913  PHE A N     1 
ATOM   6460  C CA    . PHE A  1 913 ? -23.368  -23.447 70.398  1.00 53.53  ? 913  PHE A CA    1 
ATOM   6461  C C     . PHE A  1 913 ? -23.549  -22.507 71.577  1.00 58.82  ? 913  PHE A C     1 
ATOM   6462  O O     . PHE A  1 913 ? -22.931  -21.442 71.592  1.00 58.38  ? 913  PHE A O     1 
ATOM   6463  C CB    . PHE A  1 913 ? -22.331  -24.540 70.710  1.00 55.91  ? 913  PHE A CB    1 
ATOM   6464  C CG    . PHE A  1 913 ? -20.959  -24.044 71.091  1.00 57.62  ? 913  PHE A CG    1 
ATOM   6465  C CD1   . PHE A  1 913 ? -20.579  -23.961 72.429  1.00 61.72  ? 913  PHE A CD1   1 
ATOM   6466  C CD2   . PHE A  1 913 ? -20.041  -23.669 70.115  1.00 58.06  ? 913  PHE A CD2   1 
ATOM   6467  C CE1   . PHE A  1 913 ? -19.311  -23.517 72.781  1.00 62.62  ? 913  PHE A CE1   1 
ATOM   6468  C CE2   . PHE A  1 913 ? -18.769  -23.220 70.472  1.00 61.07  ? 913  PHE A CE2   1 
ATOM   6469  C CZ    . PHE A  1 913 ? -18.412  -23.158 71.801  1.00 60.57  ? 913  PHE A CZ    1 
ATOM   6470  N N     . TYR A  1 914 ? -24.400  -22.865 72.553  1.00 56.58  ? 914  TYR A N     1 
ATOM   6471  C CA    . TYR A  1 914 ? -24.576  -22.002 73.723  1.00 57.95  ? 914  TYR A CA    1 
ATOM   6472  C C     . TYR A  1 914 ? -23.689  -22.511 74.855  1.00 67.99  ? 914  TYR A C     1 
ATOM   6473  O O     . TYR A  1 914 ? -23.892  -23.620 75.369  1.00 67.78  ? 914  TYR A O     1 
ATOM   6474  C CB    . TYR A  1 914 ? -26.050  -21.860 74.141  1.00 58.76  ? 914  TYR A CB    1 
ATOM   6475  C CG    . TYR A  1 914 ? -26.849  -20.924 73.259  1.00 59.12  ? 914  TYR A CG    1 
ATOM   6476  C CD1   . TYR A  1 914 ? -27.259  -19.677 73.721  1.00 61.00  ? 914  TYR A CD1   1 
ATOM   6477  C CD2   . TYR A  1 914 ? -27.211  -21.291 71.962  1.00 58.67  ? 914  TYR A CD2   1 
ATOM   6478  C CE1   . TYR A  1 914 ? -28.005  -18.817 72.914  1.00 59.73  ? 914  TYR A CE1   1 
ATOM   6479  C CE2   . TYR A  1 914 ? -27.931  -20.430 71.140  1.00 58.30  ? 914  TYR A CE2   1 
ATOM   6480  C CZ    . TYR A  1 914 ? -28.323  -19.194 71.618  1.00 68.90  ? 914  TYR A CZ    1 
ATOM   6481  O OH    . TYR A  1 914 ? -29.052  -18.371 70.792  1.00 77.55  ? 914  TYR A OH    1 
ATOM   6482  N N     . ASP A  1 915 ? -22.646  -21.733 75.174  1.00 68.40  ? 915  ASP A N     1 
ATOM   6483  C CA    . ASP A  1 915 ? -21.721  -22.071 76.239  1.00 71.76  ? 915  ASP A CA    1 
ATOM   6484  C C     . ASP A  1 915 ? -21.970  -21.154 77.424  1.00 79.45  ? 915  ASP A C     1 
ATOM   6485  O O     . ASP A  1 915 ? -21.885  -19.928 77.280  1.00 78.29  ? 915  ASP A O     1 
ATOM   6486  C CB    . ASP A  1 915 ? -20.269  -21.968 75.773  1.00 73.99  ? 915  ASP A CB    1 
ATOM   6487  C CG    . ASP A  1 915 ? -19.252  -22.385 76.828  1.00 97.81  ? 915  ASP A CG    1 
ATOM   6488  O OD1   . ASP A  1 915 ? -19.460  -23.440 77.477  1.00 101.35 ? 915  ASP A OD1   1 
ATOM   6489  O OD2   . ASP A  1 915 ? -18.241  -21.665 76.997  1.00 108.28 ? 915  ASP A OD2   1 
ATOM   6490  N N     . ASP A  1 916 ? -22.305  -21.757 78.597  1.00 79.46  ? 916  ASP A N     1 
ATOM   6491  C CA    . ASP A  1 916 ? -22.601  -21.062 79.854  1.00 81.13  ? 916  ASP A CA    1 
ATOM   6492  C C     . ASP A  1 916 ? -23.511  -19.827 79.619  1.00 81.57  ? 916  ASP A C     1 
ATOM   6493  O O     . ASP A  1 916 ? -23.249  -18.732 80.124  1.00 80.48  ? 916  ASP A O     1 
ATOM   6494  C CB    . ASP A  1 916 ? -21.289  -20.712 80.591  1.00 85.44  ? 916  ASP A CB    1 
ATOM   6495  C CG    . ASP A  1 916 ? -20.919  -21.658 81.725  1.00 105.19 ? 916  ASP A CG    1 
ATOM   6496  O OD1   . ASP A  1 916 ? -21.379  -21.423 82.866  1.00 107.82 ? 916  ASP A OD1   1 
ATOM   6497  O OD2   . ASP A  1 916 ? -20.113  -22.594 81.486  1.00 114.09 ? 916  ASP A OD2   1 
ATOM   6498  N N     . GLY A  1 917 ? -24.552  -20.028 78.808  1.00 76.39  ? 917  GLY A N     1 
ATOM   6499  C CA    . GLY A  1 917 ? -25.515  -18.992 78.451  1.00 75.14  ? 917  GLY A CA    1 
ATOM   6500  C C     . GLY A  1 917 ? -25.158  -18.234 77.189  1.00 76.74  ? 917  GLY A C     1 
ATOM   6501  O O     . GLY A  1 917 ? -26.043  -17.931 76.376  1.00 75.83  ? 917  GLY A O     1 
ATOM   6502  N N     . VAL A  1 918 ? -23.848  -17.926 77.010  1.00 70.95  ? 918  VAL A N     1 
ATOM   6503  C CA    . VAL A  1 918 ? -23.313  -17.174 75.863  1.00 66.76  ? 918  VAL A CA    1 
ATOM   6504  C C     . VAL A  1 918 ? -23.350  -17.962 74.553  1.00 65.41  ? 918  VAL A C     1 
ATOM   6505  O O     . VAL A  1 918 ? -22.842  -19.087 74.496  1.00 65.54  ? 918  VAL A O     1 
ATOM   6506  C CB    . VAL A  1 918 ? -21.900  -16.628 76.164  1.00 70.20  ? 918  VAL A CB    1 
ATOM   6507  N N     . LYS A  1 919 ? -23.965  -17.375 73.505  1.00 57.70  ? 919  LYS A N     1 
ATOM   6508  C CA    . LYS A  1 919 ? -24.021  -17.983 72.168  1.00 55.00  ? 919  LYS A CA    1 
ATOM   6509  C C     . LYS A  1 919 ? -22.637  -17.782 71.517  1.00 61.00  ? 919  LYS A C     1 
ATOM   6510  O O     . LYS A  1 919 ? -22.245  -16.650 71.198  1.00 61.81  ? 919  LYS A O     1 
ATOM   6511  C CB    . LYS A  1 919 ? -25.137  -17.357 71.306  1.00 53.26  ? 919  LYS A CB    1 
ATOM   6512  C CG    . LYS A  1 919 ? -25.274  -17.958 69.912  1.00 43.29  ? 919  LYS A CG    1 
ATOM   6513  C CD    . LYS A  1 919 ? -26.312  -17.214 69.098  1.00 47.10  ? 919  LYS A CD    1 
ATOM   6514  C CE    . LYS A  1 919 ? -26.601  -17.835 67.755  1.00 37.59  ? 919  LYS A CE    1 
ATOM   6515  N NZ    . LYS A  1 919 ? -27.755  -17.198 67.088  1.00 42.38  ? 919  LYS A NZ    1 
ATOM   6516  N N     . THR A  1 920 ? -21.909  -18.884 71.337  1.00 56.21  ? 920  THR A N     1 
ATOM   6517  C CA    . THR A  1 920 ? -20.555  -18.918 70.807  1.00 54.57  ? 920  THR A CA    1 
ATOM   6518  C C     . THR A  1 920 ? -20.508  -19.553 69.418  1.00 58.03  ? 920  THR A C     1 
ATOM   6519  O O     . THR A  1 920 ? -21.222  -20.522 69.163  1.00 58.33  ? 920  THR A O     1 
ATOM   6520  C CB    . THR A  1 920 ? -19.700  -19.708 71.802  1.00 55.50  ? 920  THR A CB    1 
ATOM   6521  O OG1   . THR A  1 920 ? -19.897  -19.167 73.109  1.00 53.39  ? 920  THR A OG1   1 
ATOM   6522  C CG2   . THR A  1 920 ? -18.230  -19.712 71.456  1.00 54.34  ? 920  THR A CG2   1 
ATOM   6523  N N     . SER A  1 921 ? -19.620  -19.044 68.547  1.00 52.40  ? 921  SER A N     1 
ATOM   6524  C CA    . SER A  1 921 ? -19.404  -19.572 67.205  1.00 49.39  ? 921  SER A CA    1 
ATOM   6525  C C     . SER A  1 921 ? -18.579  -20.862 67.264  1.00 49.98  ? 921  SER A C     1 
ATOM   6526  O O     . SER A  1 921 ? -17.479  -20.868 67.810  1.00 49.76  ? 921  SER A O     1 
ATOM   6527  C CB    . SER A  1 921 ? -18.691  -18.532 66.349  1.00 53.15  ? 921  SER A CB    1 
ATOM   6528  O OG    . SER A  1 921 ? -18.383  -19.019 65.053  1.00 65.14  ? 921  SER A OG    1 
ATOM   6529  N N     . ALA A  1 922 ? -19.103  -21.947 66.682  1.00 44.58  ? 922  ALA A N     1 
ATOM   6530  C CA    . ALA A  1 922 ? -18.440  -23.254 66.629  1.00 43.79  ? 922  ALA A CA    1 
ATOM   6531  C C     . ALA A  1 922 ? -17.177  -23.230 65.745  1.00 46.39  ? 922  ALA A C     1 
ATOM   6532  O O     . ALA A  1 922 ? -16.485  -24.236 65.625  1.00 44.10  ? 922  ALA A O     1 
ATOM   6533  C CB    . ALA A  1 922 ? -19.418  -24.309 66.130  1.00 43.78  ? 922  ALA A CB    1 
ATOM   6534  N N     . VAL A  1 923 ? -16.880  -22.067 65.135  1.00 45.28  ? 923  VAL A N     1 
ATOM   6535  C CA    . VAL A  1 923 ? -15.722  -21.824 64.263  1.00 44.97  ? 923  VAL A CA    1 
ATOM   6536  C C     . VAL A  1 923 ? -14.704  -20.916 64.991  1.00 51.35  ? 923  VAL A C     1 
ATOM   6537  O O     . VAL A  1 923 ? -13.665  -21.393 65.430  1.00 53.99  ? 923  VAL A O     1 
ATOM   6538  C CB    . VAL A  1 923 ? -16.135  -21.227 62.881  1.00 46.06  ? 923  VAL A CB    1 
ATOM   6539  C CG1   . VAL A  1 923 ? -14.920  -21.075 61.976  1.00 45.36  ? 923  VAL A CG1   1 
ATOM   6540  C CG2   . VAL A  1 923 ? -17.201  -22.073 62.196  1.00 44.40  ? 923  VAL A CG2   1 
ATOM   6541  N N     . SER A  1 924 ? -15.027  -19.629 65.149  1.00 46.91  ? 924  SER A N     1 
ATOM   6542  C CA    . SER A  1 924 ? -14.150  -18.642 65.767  1.00 48.29  ? 924  SER A CA    1 
ATOM   6543  C C     . SER A  1 924 ? -13.984  -18.728 67.262  1.00 57.30  ? 924  SER A C     1 
ATOM   6544  O O     . SER A  1 924 ? -13.014  -18.183 67.793  1.00 59.17  ? 924  SER A O     1 
ATOM   6545  C CB    . SER A  1 924 ? -14.595  -17.237 65.393  1.00 51.35  ? 924  SER A CB    1 
ATOM   6546  O OG    . SER A  1 924 ? -15.975  -17.046 65.651  1.00 62.52  ? 924  SER A OG    1 
ATOM   6547  N N     . GLY A  1 925 ? -14.942  -19.352 67.941  1.00 55.58  ? 925  GLY A N     1 
ATOM   6548  C CA    . GLY A  1 925 ? -14.980  -19.385 69.399  1.00 57.30  ? 925  GLY A CA    1 
ATOM   6549  C C     . GLY A  1 925 ? -15.429  -18.030 69.941  1.00 60.74  ? 925  GLY A C     1 
ATOM   6550  O O     . GLY A  1 925 ? -15.534  -17.825 71.150  1.00 59.82  ? 925  GLY A O     1 
ATOM   6551  N N     . LYS A  1 926 ? -15.696  -17.092 69.023  1.00 57.82  ? 926  LYS A N     1 
ATOM   6552  C CA    . LYS A  1 926 ? -16.108  -15.727 69.301  1.00 58.34  ? 926  LYS A CA    1 
ATOM   6553  C C     . LYS A  1 926 ? -17.595  -15.669 69.576  1.00 66.45  ? 926  LYS A C     1 
ATOM   6554  O O     . LYS A  1 926 ? -18.329  -16.563 69.148  1.00 65.86  ? 926  LYS A O     1 
ATOM   6555  C CB    . LYS A  1 926 ? -15.714  -14.794 68.131  1.00 57.40  ? 926  LYS A CB    1 
ATOM   6556  C CG    . LYS A  1 926 ? -14.198  -14.650 67.951  1.00 53.86  ? 926  LYS A CG    1 
ATOM   6557  C CD    . LYS A  1 926 ? -13.782  -13.492 67.067  1.00 67.51  ? 926  LYS A CD    1 
ATOM   6558  C CE    . LYS A  1 926 ? -12.270  -13.323 67.068  1.00 90.03  ? 926  LYS A CE    1 
ATOM   6559  N NZ    . LYS A  1 926 ? -11.824  -11.950 66.672  1.00 102.23 ? 926  LYS A NZ    1 
ATOM   6560  N N     . SER A  1 927 ? -18.032  -14.618 70.305  1.00 66.26  ? 927  SER A N     1 
ATOM   6561  C CA    . SER A  1 927 ? -19.422  -14.340 70.668  1.00 67.55  ? 927  SER A CA    1 
ATOM   6562  C C     . SER A  1 927 ? -20.243  -13.991 69.413  1.00 73.55  ? 927  SER A C     1 
ATOM   6563  O O     . SER A  1 927 ? -21.404  -14.408 69.309  1.00 74.19  ? 927  SER A O     1 
ATOM   6564  C CB    . SER A  1 927 ? -19.483  -13.199 71.674  1.00 73.05  ? 927  SER A CB    1 
ATOM   6565  O OG    . SER A  1 927 ? -18.527  -13.376 72.712  1.00 87.32  ? 927  SER A OG    1 
ATOM   6566  N N     . SER A  1 928 ? -19.627  -13.266 68.446  1.00 69.36  ? 928  SER A N     1 
ATOM   6567  C CA    . SER A  1 928 ? -20.279  -12.896 67.188  1.00 67.54  ? 928  SER A CA    1 
ATOM   6568  C C     . SER A  1 928 ? -20.254  -14.066 66.224  1.00 69.78  ? 928  SER A C     1 
ATOM   6569  O O     . SER A  1 928 ? -19.219  -14.385 65.624  1.00 69.78  ? 928  SER A O     1 
ATOM   6570  C CB    . SER A  1 928 ? -19.647  -11.651 66.570  1.00 72.04  ? 928  SER A CB    1 
ATOM   6571  O OG    . SER A  1 928 ? -18.257  -11.829 66.346  1.00 86.60  ? 928  SER A OG    1 
ATOM   6572  N N     . VAL A  1 929 ? -21.414  -14.713 66.092  1.00 64.24  ? 929  VAL A N     1 
ATOM   6573  C CA    . VAL A  1 929 ? -21.646  -15.898 65.263  1.00 61.39  ? 929  VAL A CA    1 
ATOM   6574  C C     . VAL A  1 929 ? -21.403  -15.684 63.746  1.00 61.04  ? 929  VAL A C     1 
ATOM   6575  O O     . VAL A  1 929 ? -20.839  -16.572 63.099  1.00 59.37  ? 929  VAL A O     1 
ATOM   6576  C CB    . VAL A  1 929 ? -23.008  -16.552 65.646  1.00 64.86  ? 929  VAL A CB    1 
ATOM   6577  C CG1   . VAL A  1 929 ? -23.410  -17.651 64.682  1.00 63.43  ? 929  VAL A CG1   1 
ATOM   6578  C CG2   . VAL A  1 929 ? -22.957  -17.091 67.079  1.00 66.59  ? 929  VAL A CG2   1 
ATOM   6579  N N     . ILE A  1 930 ? -21.761  -14.492 63.215  1.00 56.31  ? 930  ILE A N     1 
ATOM   6580  C CA    . ILE A  1 930 ? -21.651  -14.125 61.786  1.00 54.06  ? 930  ILE A CA    1 
ATOM   6581  C C     . ILE A  1 930 ? -20.397  -13.299 61.433  1.00 58.99  ? 930  ILE A C     1 
ATOM   6582  O O     . ILE A  1 930 ? -20.227  -12.179 61.930  1.00 58.81  ? 930  ILE A O     1 
ATOM   6583  C CB    . ILE A  1 930 ? -22.987  -13.488 61.245  1.00 55.16  ? 930  ILE A CB    1 
ATOM   6584  C CG1   . ILE A  1 930 ? -24.131  -14.526 61.216  1.00 53.96  ? 930  ILE A CG1   1 
ATOM   6585  C CG2   . ILE A  1 930 ? -22.806  -12.834 59.867  1.00 54.35  ? 930  ILE A CG2   1 
ATOM   6586  C CD1   . ILE A  1 930 ? -25.564  -13.984 61.146  1.00 53.59  ? 930  ILE A CD1   1 
ATOM   6587  N N     . ASP A  1 931 ? -19.550  -13.855 60.533  1.00 55.69  ? 931  ASP A N     1 
ATOM   6588  C CA    . ASP A  1 931 ? -18.334  -13.211 60.021  1.00 55.24  ? 931  ASP A CA    1 
ATOM   6589  C C     . ASP A  1 931 ? -18.622  -12.699 58.609  1.00 59.11  ? 931  ASP A C     1 
ATOM   6590  O O     . ASP A  1 931 ? -18.903  -13.496 57.716  1.00 57.97  ? 931  ASP A O     1 
ATOM   6591  C CB    . ASP A  1 931 ? -17.151  -14.201 59.995  1.00 56.67  ? 931  ASP A CB    1 
ATOM   6592  C CG    . ASP A  1 931 ? -15.788  -13.607 59.648  1.00 63.26  ? 931  ASP A CG    1 
ATOM   6593  O OD1   . ASP A  1 931 ? -15.747  -12.492 59.078  1.00 64.36  ? 931  ASP A OD1   1 
ATOM   6594  O OD2   . ASP A  1 931 ? -14.763  -14.265 59.934  1.00 64.54  ? 931  ASP A OD2   1 
ATOM   6595  N N     . ASP A  1 932 ? -18.535  -11.380 58.411  1.00 56.06  ? 932  ASP A N     1 
ATOM   6596  C CA    . ASP A  1 932 ? -18.803  -10.768 57.114  1.00 55.49  ? 932  ASP A CA    1 
ATOM   6597  C C     . ASP A  1 932 ? -17.760  -11.053 56.020  1.00 57.75  ? 932  ASP A C     1 
ATOM   6598  O O     . ASP A  1 932 ? -18.075  -10.990 54.820  1.00 57.25  ? 932  ASP A O     1 
ATOM   6599  C CB    . ASP A  1 932 ? -19.092  -9.267  57.260  1.00 58.28  ? 932  ASP A CB    1 
ATOM   6600  C CG    . ASP A  1 932 ? -20.530  -8.974  57.679  1.00 72.22  ? 932  ASP A CG    1 
ATOM   6601  O OD1   . ASP A  1 932 ? -21.461  -9.719  57.225  1.00 72.14  ? 932  ASP A OD1   1 
ATOM   6602  O OD2   . ASP A  1 932 ? -20.738  -7.992  58.432  1.00 77.63  ? 932  ASP A OD2   1 
ATOM   6603  N N     . ASN A  1 933 ? -16.547  -11.417 56.441  1.00 52.27  ? 933  ASN A N     1 
ATOM   6604  C CA    . ASN A  1 933 ? -15.440  -11.744 55.554  1.00 50.56  ? 933  ASN A CA    1 
ATOM   6605  C C     . ASN A  1 933 ? -15.608  -13.096 54.855  1.00 53.15  ? 933  ASN A C     1 
ATOM   6606  O O     . ASN A  1 933 ? -14.896  -13.368 53.886  1.00 52.22  ? 933  ASN A O     1 
ATOM   6607  C CB    . ASN A  1 933 ? -14.115  -11.699 56.314  1.00 50.47  ? 933  ASN A CB    1 
ATOM   6608  C CG    . ASN A  1 933 ? -13.839  -10.392 57.037  1.00 73.42  ? 933  ASN A CG    1 
ATOM   6609  O OD1   . ASN A  1 933 ? -14.180  -9.290  56.581  1.00 64.72  ? 933  ASN A OD1   1 
ATOM   6610  N ND2   . ASN A  1 933 ? -13.190  -10.485 58.188  1.00 68.75  ? 933  ASN A ND2   1 
ATOM   6611  N N     . THR A  1 934 ? -16.542  -13.940 55.324  1.00 48.73  ? 934  THR A N     1 
ATOM   6612  C CA    . THR A  1 934 ? -16.781  -15.258 54.731  1.00 46.52  ? 934  THR A CA    1 
ATOM   6613  C C     . THR A  1 934 ? -17.547  -15.246 53.390  1.00 47.53  ? 934  THR A C     1 
ATOM   6614  O O     . THR A  1 934 ? -17.424  -16.200 52.636  1.00 47.21  ? 934  THR A O     1 
ATOM   6615  C CB    . THR A  1 934 ? -17.221  -16.277 55.774  1.00 48.94  ? 934  THR A CB    1 
ATOM   6616  O OG1   . THR A  1 934 ? -18.345  -15.777 56.487  1.00 50.49  ? 934  THR A OG1   1 
ATOM   6617  C CG2   . THR A  1 934 ? -16.136  -16.573 56.763  1.00 45.97  ? 934  THR A CG2   1 
ATOM   6618  N N     . SER A  1 935 ? -18.296  -14.165 53.072  1.00 42.19  ? 935  SER A N     1 
ATOM   6619  C CA    . SER A  1 935 ? -19.029  -14.004 51.802  1.00 40.09  ? 935  SER A CA    1 
ATOM   6620  C C     . SER A  1 935 ? -18.223  -13.034 50.948  1.00 42.40  ? 935  SER A C     1 
ATOM   6621  O O     . SER A  1 935 ? -18.347  -11.818 51.086  1.00 42.06  ? 935  SER A O     1 
ATOM   6622  C CB    . SER A  1 935 ? -20.428  -13.458 52.055  1.00 43.45  ? 935  SER A CB    1 
ATOM   6623  O OG    . SER A  1 935 ? -21.349  -14.468 52.423  1.00 51.81  ? 935  SER A OG    1 
ATOM   6624  N N     . VAL A  1 936 ? -17.369  -13.579 50.088  1.00 38.08  ? 936  VAL A N     1 
ATOM   6625  C CA    . VAL A  1 936 ? -16.393  -12.810 49.330  1.00 36.89  ? 936  VAL A CA    1 
ATOM   6626  C C     . VAL A  1 936 ? -16.505  -12.919 47.791  1.00 40.97  ? 936  VAL A C     1 
ATOM   6627  O O     . VAL A  1 936 ? -16.994  -13.922 47.284  1.00 39.06  ? 936  VAL A O     1 
ATOM   6628  C CB    . VAL A  1 936 ? -15.031  -13.261 49.900  1.00 40.74  ? 936  VAL A CB    1 
ATOM   6629  C CG1   . VAL A  1 936 ? -14.151  -13.964 48.881  1.00 40.71  ? 936  VAL A CG1   1 
ATOM   6630  C CG2   . VAL A  1 936 ? -14.318  -12.145 50.611  1.00 40.86  ? 936  VAL A CG2   1 
ATOM   6631  N N     . VAL A  1 937 ? -16.069  -11.858 47.057  1.00 38.84  ? 937  VAL A N     1 
ATOM   6632  C CA    . VAL A  1 937 ? -16.003  -11.811 45.581  1.00 36.85  ? 937  VAL A CA    1 
ATOM   6633  C C     . VAL A  1 937 ? -14.533  -12.061 45.217  1.00 42.59  ? 937  VAL A C     1 
ATOM   6634  O O     . VAL A  1 937 ? -13.665  -11.285 45.628  1.00 43.28  ? 937  VAL A O     1 
ATOM   6635  C CB    . VAL A  1 937 ? -16.555  -10.503 44.934  1.00 37.37  ? 937  VAL A CB    1 
ATOM   6636  C CG1   . VAL A  1 937 ? -16.279  -10.481 43.430  1.00 34.98  ? 937  VAL A CG1   1 
ATOM   6637  C CG2   . VAL A  1 937 ? -18.048  -10.347 45.208  1.00 36.61  ? 937  VAL A CG2   1 
ATOM   6638  N N     . ILE A  1 938 ? -14.256  -13.159 44.501  1.00 40.08  ? 938  ILE A N     1 
ATOM   6639  C CA    . ILE A  1 938 ? -12.891  -13.510 44.110  1.00 41.26  ? 938  ILE A CA    1 
ATOM   6640  C C     . ILE A  1 938 ? -12.590  -12.996 42.712  1.00 46.70  ? 938  ILE A C     1 
ATOM   6641  O O     . ILE A  1 938 ? -13.121  -13.516 41.736  1.00 45.11  ? 938  ILE A O     1 
ATOM   6642  C CB    . ILE A  1 938 ? -12.557  -15.018 44.354  1.00 44.76  ? 938  ILE A CB    1 
ATOM   6643  C CG1   . ILE A  1 938 ? -12.476  -15.283 45.868  1.00 46.13  ? 938  ILE A CG1   1 
ATOM   6644  C CG2   . ILE A  1 938 ? -11.238  -15.432 43.680  1.00 44.56  ? 938  ILE A CG2   1 
ATOM   6645  C CD1   . ILE A  1 938 ? -12.866  -16.611 46.346  1.00 54.70  ? 938  ILE A CD1   1 
ATOM   6646  N N     . GLY A  1 939 ? -11.762  -11.959 42.641  1.00 45.54  ? 939  GLY A N     1 
ATOM   6647  C CA    . GLY A  1 939 ? -11.397  -11.338 41.377  1.00 45.34  ? 939  GLY A CA    1 
ATOM   6648  C C     . GLY A  1 939 ? -9.933   -11.013 41.184  1.00 50.27  ? 939  GLY A C     1 
ATOM   6649  O O     . GLY A  1 939 ? -9.092   -11.386 41.993  1.00 47.80  ? 939  GLY A O     1 
ATOM   6650  N N     . ILE A  1 940 ? -9.628   -10.337 40.078  1.00 51.54  ? 940  ILE A N     1 
ATOM   6651  C CA    . ILE A  1 940 ? -8.270   -9.941  39.740  1.00 54.46  ? 940  ILE A CA    1 
ATOM   6652  C C     . ILE A  1 940 ? -8.134   -8.418  39.801  1.00 62.22  ? 940  ILE A C     1 
ATOM   6653  O O     . ILE A  1 940 ? -8.976   -7.705  39.255  1.00 60.57  ? 940  ILE A O     1 
ATOM   6654  C CB    . ILE A  1 940 ? -7.816   -10.517 38.362  1.00 58.21  ? 940  ILE A CB    1 
ATOM   6655  C CG1   . ILE A  1 940 ? -8.057   -12.036 38.276  1.00 58.55  ? 940  ILE A CG1   1 
ATOM   6656  C CG2   . ILE A  1 940 ? -6.328   -10.199 38.069  1.00 61.30  ? 940  ILE A CG2   1 
ATOM   6657  C CD1   . ILE A  1 940 ? -8.786   -12.418 37.061  1.00 68.59  ? 940  ILE A CD1   1 
ATOM   6658  N N     . GLN A  1 941 ? -7.077   -7.940  40.488  1.00 62.92  ? 941  GLN A N     1 
ATOM   6659  C CA    . GLN A  1 941 ? -6.696   -6.535  40.616  1.00 65.25  ? 941  GLN A CA    1 
ATOM   6660  C C     . GLN A  1 941 ? -5.216   -6.518  40.216  1.00 73.30  ? 941  GLN A C     1 
ATOM   6661  O O     . GLN A  1 941 ? -4.375   -7.040  40.956  1.00 74.57  ? 941  GLN A O     1 
ATOM   6662  C CB    . GLN A  1 941 ? -6.909   -6.025  42.061  1.00 67.92  ? 941  GLN A CB    1 
ATOM   6663  C CG    . GLN A  1 941 ? -8.094   -5.045  42.260  1.00 93.52  ? 941  GLN A CG    1 
ATOM   6664  C CD    . GLN A  1 941 ? -9.491   -5.668  42.323  1.00 108.77 ? 941  GLN A CD    1 
ATOM   6665  O OE1   . GLN A  1 941 ? -10.127  -5.745  43.387  1.00 104.79 ? 941  GLN A OE1   1 
ATOM   6666  N NE2   . GLN A  1 941 ? -10.048  -6.027  41.173  1.00 92.62  ? 941  GLN A NE2   1 
ATOM   6667  N N     . GLY A  1 942 ? -4.934   -6.015  39.006  1.00 70.46  ? 942  GLY A N     1 
ATOM   6668  C CA    . GLY A  1 942 ? -3.600   -6.020  38.415  1.00 70.42  ? 942  GLY A CA    1 
ATOM   6669  C C     . GLY A  1 942 ? -3.292   -7.412  37.887  1.00 72.65  ? 942  GLY A C     1 
ATOM   6670  O O     . GLY A  1 942 ? -3.789   -7.808  36.827  1.00 71.03  ? 942  GLY A O     1 
ATOM   6671  N N     . SER A  1 943 ? -2.523   -8.182  38.665  1.00 68.08  ? 943  SER A N     1 
ATOM   6672  C CA    . SER A  1 943 ? -2.125   -9.562  38.370  1.00 66.62  ? 943  SER A CA    1 
ATOM   6673  C C     . SER A  1 943 ? -2.641   -10.471 39.511  1.00 68.77  ? 943  SER A C     1 
ATOM   6674  O O     . SER A  1 943 ? -3.066   -11.610 39.273  1.00 67.63  ? 943  SER A O     1 
ATOM   6675  C CB    . SER A  1 943 ? -0.602   -9.643  38.267  1.00 70.42  ? 943  SER A CB    1 
ATOM   6676  O OG    . SER A  1 943 ? -0.112   -10.969 38.165  1.00 77.76  ? 943  SER A OG    1 
ATOM   6677  N N     . GLU A  1 944 ? -2.588   -9.935  40.758  1.00 63.32  ? 944  GLU A N     1 
ATOM   6678  C CA    . GLU A  1 944 ? -3.010   -10.552 42.019  1.00 60.76  ? 944  GLU A CA    1 
ATOM   6679  C C     . GLU A  1 944 ? -4.527   -10.862 42.080  1.00 59.69  ? 944  GLU A C     1 
ATOM   6680  O O     . GLU A  1 944 ? -5.336   -10.095 41.531  1.00 59.28  ? 944  GLU A O     1 
ATOM   6681  C CB    . GLU A  1 944 ? -2.636   -9.610  43.167  1.00 62.15  ? 944  GLU A CB    1 
ATOM   6682  C CG    . GLU A  1 944 ? -2.619   -10.265 44.533  1.00 67.29  ? 944  GLU A CG    1 
ATOM   6683  C CD    . GLU A  1 944 ? -2.369   -9.310  45.678  1.00 80.37  ? 944  GLU A CD    1 
ATOM   6684  O OE1   . GLU A  1 944 ? -3.326   -8.606  46.073  1.00 63.70  ? 944  GLU A OE1   1 
ATOM   6685  O OE2   . GLU A  1 944 ? -1.225   -9.274  46.188  1.00 75.08  ? 944  GLU A OE2   1 
ATOM   6686  N N     . VAL A  1 945 ? -4.890   -11.980 42.782  1.00 49.99  ? 945  VAL A N     1 
ATOM   6687  C CA    . VAL A  1 945 ? -6.258   -12.451 43.048  1.00 45.16  ? 945  VAL A CA    1 
ATOM   6688  C C     . VAL A  1 945 ? -6.697   -11.780 44.357  1.00 48.14  ? 945  VAL A C     1 
ATOM   6689  O O     . VAL A  1 945 ? -5.947   -11.790 45.321  1.00 50.80  ? 945  VAL A O     1 
ATOM   6690  C CB    . VAL A  1 945 ? -6.314   -13.998 43.143  1.00 46.29  ? 945  VAL A CB    1 
ATOM   6691  C CG1   . VAL A  1 945 ? -7.627   -14.483 43.757  1.00 45.53  ? 945  VAL A CG1   1 
ATOM   6692  C CG2   . VAL A  1 945 ? -6.075   -14.642 41.783  1.00 44.94  ? 945  VAL A CG2   1 
ATOM   6693  N N     . THR A  1 946 ? -7.876   -11.173 44.385  1.00 42.15  ? 946  THR A N     1 
ATOM   6694  C CA    . THR A  1 946 ? -8.401   -10.468 45.570  1.00 41.02  ? 946  THR A CA    1 
ATOM   6695  C C     . THR A  1 946 ? -9.712   -11.059 46.077  1.00 42.39  ? 946  THR A C     1 
ATOM   6696  O O     . THR A  1 946 ? -10.575  -11.443 45.288  1.00 41.41  ? 946  THR A O     1 
ATOM   6697  C CB    . THR A  1 946 ? -8.559   -8.959  45.295  1.00 40.88  ? 946  THR A CB    1 
ATOM   6698  O OG1   . THR A  1 946 ? -9.459   -8.746  44.199  1.00 40.73  ? 946  THR A OG1   1 
ATOM   6699  C CG2   . THR A  1 946 ? -7.237   -8.266  45.050  1.00 34.56  ? 946  THR A CG2   1 
ATOM   6700  N N     . PHE A  1 947 ? -9.877   -11.064 47.393  1.00 37.85  ? 947  PHE A N     1 
ATOM   6701  C CA    . PHE A  1 947 ? -11.059  -11.584 48.090  1.00 37.17  ? 947  PHE A CA    1 
ATOM   6702  C C     . PHE A  1 947 ? -11.755  -10.377 48.713  1.00 42.12  ? 947  PHE A C     1 
ATOM   6703  O O     . PHE A  1 947 ? -11.201  -9.750  49.597  1.00 43.72  ? 947  PHE A O     1 
ATOM   6704  C CB    . PHE A  1 947 ? -10.627  -12.632 49.149  1.00 39.36  ? 947  PHE A CB    1 
ATOM   6705  C CG    . PHE A  1 947 ? -9.758   -13.749 48.586  1.00 40.89  ? 947  PHE A CG    1 
ATOM   6706  C CD1   . PHE A  1 947 ? -10.279  -15.009 48.362  1.00 44.25  ? 947  PHE A CD1   1 
ATOM   6707  C CD2   . PHE A  1 947 ? -8.425   -13.521 48.245  1.00 42.86  ? 947  PHE A CD2   1 
ATOM   6708  C CE1   . PHE A  1 947 ? -9.485   -16.026 47.806  1.00 45.52  ? 947  PHE A CE1   1 
ATOM   6709  C CE2   . PHE A  1 947 ? -7.639   -14.531 47.688  1.00 45.03  ? 947  PHE A CE2   1 
ATOM   6710  C CZ    . PHE A  1 947 ? -8.167   -15.783 47.489  1.00 43.27  ? 947  PHE A CZ    1 
ATOM   6711  N N     . THR A  1 948 ? -12.910  -9.989  48.202  1.00 38.16  ? 948  THR A N     1 
ATOM   6712  C CA    . THR A  1 948 ? -13.570  -8.785  48.695  1.00 38.83  ? 948  THR A CA    1 
ATOM   6713  C C     . THR A  1 948 ? -14.985  -9.070  49.226  1.00 45.49  ? 948  THR A C     1 
ATOM   6714  O O     . THR A  1 948 ? -15.821  -9.590  48.490  1.00 47.59  ? 948  THR A O     1 
ATOM   6715  C CB    . THR A  1 948 ? -13.600  -7.762  47.566  1.00 48.90  ? 948  THR A CB    1 
ATOM   6716  O OG1   . THR A  1 948 ? -12.299  -7.663  46.971  1.00 55.01  ? 948  THR A OG1   1 
ATOM   6717  C CG2   . THR A  1 948 ? -14.121  -6.403  48.016  1.00 43.11  ? 948  THR A CG2   1 
ATOM   6718  N N     . PRO A  1 949 ? -15.307  -8.701  50.467  1.00 40.55  ? 949  PRO A N     1 
ATOM   6719  C CA    . PRO A  1 949 ? -16.649  -8.997  50.993  1.00 40.74  ? 949  PRO A CA    1 
ATOM   6720  C C     . PRO A  1 949 ? -17.785  -8.198  50.347  1.00 45.98  ? 949  PRO A C     1 
ATOM   6721  O O     . PRO A  1 949 ? -17.673  -6.983  50.222  1.00 46.44  ? 949  PRO A O     1 
ATOM   6722  C CB    . PRO A  1 949 ? -16.508  -8.701  52.497  1.00 43.30  ? 949  PRO A CB    1 
ATOM   6723  C CG    . PRO A  1 949 ? -15.046  -8.706  52.750  1.00 47.44  ? 949  PRO A CG    1 
ATOM   6724  C CD    . PRO A  1 949 ? -14.457  -8.120  51.509  1.00 42.37  ? 949  PRO A CD    1 
ATOM   6725  N N     . VAL A  1 950 ? -18.884  -8.888  49.955  1.00 42.52  ? 950  VAL A N     1 
ATOM   6726  C CA    . VAL A  1 950 ? -20.084  -8.304  49.336  1.00 42.26  ? 950  VAL A CA    1 
ATOM   6727  C C     . VAL A  1 950 ? -20.677  -7.085  50.013  1.00 49.85  ? 950  VAL A C     1 
ATOM   6728  O O     . VAL A  1 950 ? -21.008  -6.141  49.299  1.00 50.52  ? 950  VAL A O     1 
ATOM   6729  C CB    . VAL A  1 950 ? -21.227  -9.292  49.010  1.00 45.69  ? 950  VAL A CB    1 
ATOM   6730  C CG1   . VAL A  1 950 ? -21.161  -9.767  47.566  1.00 44.93  ? 950  VAL A CG1   1 
ATOM   6731  C CG2   . VAL A  1 950 ? -21.321  -10.440 50.010  1.00 45.80  ? 950  VAL A CG2   1 
ATOM   6732  N N     . LYS A  1 951 ? -20.895  -7.117  51.356  1.00 47.69  ? 951  LYS A N     1 
ATOM   6733  C CA    . LYS A  1 951 ? -21.527  -6.020  52.101  1.00 48.01  ? 951  LYS A CA    1 
ATOM   6734  C C     . LYS A  1 951 ? -20.948  -4.654  51.711  1.00 53.34  ? 951  LYS A C     1 
ATOM   6735  O O     . LYS A  1 951 ? -21.691  -3.738  51.350  1.00 52.78  ? 951  LYS A O     1 
ATOM   6736  C CB    . LYS A  1 951 ? -21.438  -6.261  53.618  1.00 51.12  ? 951  LYS A CB    1 
ATOM   6737  C CG    . LYS A  1 951 ? -22.610  -7.044  54.169  1.00 66.53  ? 951  LYS A CG    1 
ATOM   6738  C CD    . LYS A  1 951 ? -22.914  -6.668  55.618  1.00 81.04  ? 951  LYS A CD    1 
ATOM   6739  C CE    . LYS A  1 951 ? -24.063  -7.471  56.195  1.00 93.91  ? 951  LYS A CE    1 
ATOM   6740  N NZ    . LYS A  1 951 ? -24.247  -7.201  57.648  1.00 106.29 ? 951  LYS A NZ    1 
ATOM   6741  N N     . GLN A  1 952 ? -19.614  -4.577  51.691  1.00 50.97  ? 952  GLN A N     1 
ATOM   6742  C CA    . GLN A  1 952 ? -18.801  -3.416  51.337  1.00 51.49  ? 952  GLN A CA    1 
ATOM   6743  C C     . GLN A  1 952 ? -18.954  -3.110  49.853  1.00 55.53  ? 952  GLN A C     1 
ATOM   6744  O O     . GLN A  1 952 ? -19.234  -1.965  49.500  1.00 56.48  ? 952  GLN A O     1 
ATOM   6745  C CB    . GLN A  1 952 ? -17.307  -3.631  51.714  1.00 53.63  ? 952  GLN A CB    1 
ATOM   6746  C CG    . GLN A  1 952 ? -16.979  -4.772  52.733  1.00 76.80  ? 952  GLN A CG    1 
ATOM   6747  C CD    . GLN A  1 952 ? -17.903  -4.952  53.953  1.00 91.56  ? 952  GLN A CD    1 
ATOM   6748  O OE1   . GLN A  1 952 ? -18.481  -4.002  54.511  1.00 79.07  ? 952  GLN A OE1   1 
ATOM   6749  N NE2   . GLN A  1 952 ? -18.090  -6.203  54.369  1.00 87.20  ? 952  GLN A NE2   1 
ATOM   6750  N N     . LEU A  1 953 ? -18.834  -4.131  48.982  1.00 50.41  ? 953  LEU A N     1 
ATOM   6751  C CA    . LEU A  1 953 ? -19.012  -3.965  47.534  1.00 48.75  ? 953  LEU A CA    1 
ATOM   6752  C C     . LEU A  1 953 ? -20.429  -3.525  47.150  1.00 57.06  ? 953  LEU A C     1 
ATOM   6753  O O     . LEU A  1 953 ? -20.595  -2.809  46.160  1.00 57.14  ? 953  LEU A O     1 
ATOM   6754  C CB    . LEU A  1 953 ? -18.690  -5.263  46.798  1.00 46.75  ? 953  LEU A CB    1 
ATOM   6755  C CG    . LEU A  1 953 ? -17.259  -5.499  46.414  1.00 49.85  ? 953  LEU A CG    1 
ATOM   6756  C CD1   . LEU A  1 953 ? -17.135  -6.821  45.753  1.00 50.16  ? 953  LEU A CD1   1 
ATOM   6757  C CD2   . LEU A  1 953 ? -16.757  -4.449  45.457  1.00 49.94  ? 953  LEU A CD2   1 
ATOM   6758  N N     . TRP A  1 954 ? -21.440  -3.975  47.910  1.00 56.43  ? 954  TRP A N     1 
ATOM   6759  C CA    . TRP A  1 954 ? -22.828  -3.657  47.641  1.00 57.72  ? 954  TRP A CA    1 
ATOM   6760  C C     . TRP A  1 954 ? -23.230  -2.223  47.905  1.00 67.50  ? 954  TRP A C     1 
ATOM   6761  O O     . TRP A  1 954 ? -24.112  -1.741  47.197  1.00 67.28  ? 954  TRP A O     1 
ATOM   6762  C CB    . TRP A  1 954 ? -23.780  -4.662  48.252  1.00 56.70  ? 954  TRP A CB    1 
ATOM   6763  C CG    . TRP A  1 954 ? -24.837  -5.097  47.288  1.00 57.15  ? 954  TRP A CG    1 
ATOM   6764  C CD1   . TRP A  1 954 ? -24.704  -5.988  46.262  1.00 59.37  ? 954  TRP A CD1   1 
ATOM   6765  C CD2   . TRP A  1 954 ? -26.175  -4.614  47.227  1.00 57.02  ? 954  TRP A CD2   1 
ATOM   6766  N NE1   . TRP A  1 954 ? -25.887  -6.090  45.564  1.00 58.01  ? 954  TRP A NE1   1 
ATOM   6767  C CE2   . TRP A  1 954 ? -26.812  -5.274  46.149  1.00 59.71  ? 954  TRP A CE2   1 
ATOM   6768  C CE3   . TRP A  1 954 ? -26.899  -3.679  47.976  1.00 59.51  ? 954  TRP A CE3   1 
ATOM   6769  C CZ2   . TRP A  1 954 ? -28.138  -5.045  45.819  1.00 59.57  ? 954  TRP A CZ2   1 
ATOM   6770  C CZ3   . TRP A  1 954 ? -28.226  -3.459  47.658  1.00 61.82  ? 954  TRP A CZ3   1 
ATOM   6771  C CH2   . TRP A  1 954 ? -28.835  -4.139  46.592  1.00 61.82  ? 954  TRP A CH2   1 
ATOM   6772  N N     . GLU A  1 955 ? -22.573  -1.514  48.866  1.00 68.66  ? 955  GLU A N     1 
ATOM   6773  C CA    . GLU A  1 955 ? -22.833  -0.080  49.073  1.00 70.63  ? 955  GLU A CA    1 
ATOM   6774  C C     . GLU A  1 955 ? -22.147  0.734   47.962  1.00 79.16  ? 955  GLU A C     1 
ATOM   6775  O O     . GLU A  1 955 ? -22.708  1.725   47.488  1.00 80.59  ? 955  GLU A O     1 
ATOM   6776  C CB    . GLU A  1 955 ? -22.469  0.423   50.480  1.00 73.14  ? 955  GLU A CB    1 
ATOM   6777  C CG    . GLU A  1 955 ? -21.096  0.015   51.002  1.00 89.35  ? 955  GLU A CG    1 
ATOM   6778  C CD    . GLU A  1 955 ? -19.887  0.910   50.759  1.00 116.04 ? 955  GLU A CD    1 
ATOM   6779  O OE1   . GLU A  1 955 ? -18.963  0.889   51.607  1.00 93.23  ? 955  GLU A OE1   1 
ATOM   6780  O OE2   . GLU A  1 955 ? -19.832  1.589   49.709  1.00 119.59 ? 955  GLU A OE2   1 
ATOM   6781  N N     . ASN A  1 956 ? -20.956  0.281   47.522  1.00 77.41  ? 956  ASN A N     1 
ATOM   6782  C CA    . ASN A  1 956 ? -20.171  0.895   46.457  1.00 78.19  ? 956  ASN A CA    1 
ATOM   6783  C C     . ASN A  1 956 ? -20.855  0.862   45.069  1.00 86.55  ? 956  ASN A C     1 
ATOM   6784  O O     . ASN A  1 956 ? -20.855  1.889   44.390  1.00 87.59  ? 956  ASN A O     1 
ATOM   6785  C CB    . ASN A  1 956 ? -18.785  0.259   46.397  1.00 77.60  ? 956  ASN A CB    1 
ATOM   6786  C CG    . ASN A  1 956 ? -17.666  1.245   46.637  1.00 104.80 ? 956  ASN A CG    1 
ATOM   6787  O OD1   . ASN A  1 956 ? -16.821  1.519   45.761  1.00 100.24 ? 956  ASN A OD1   1 
ATOM   6788  N ND2   . ASN A  1 956 ? -17.657  1.841   47.819  1.00 97.37  ? 956  ASN A ND2   1 
ATOM   6789  N N     . GLU A  1 957 ? -21.435  -0.297  44.653  1.00 84.53  ? 957  GLU A N     1 
ATOM   6790  C CA    . GLU A  1 957 ? -22.086  -0.488  43.344  1.00 84.09  ? 957  GLU A CA    1 
ATOM   6791  C C     . GLU A  1 957 ? -23.283  0.441   43.086  1.00 90.71  ? 957  GLU A C     1 
ATOM   6792  O O     . GLU A  1 957 ? -23.895  0.930   44.043  1.00 89.90  ? 957  GLU A O     1 
ATOM   6793  C CB    . GLU A  1 957 ? -22.465  -1.961  43.117  1.00 84.53  ? 957  GLU A CB    1 
ATOM   6794  N N     . THR A  1 958 ? -23.590  0.689   41.774  1.00 90.43  ? 958  THR A N     1 
ATOM   6795  C CA    . THR A  1 958 ? -24.702  1.529   41.254  1.00 91.68  ? 958  THR A CA    1 
ATOM   6796  C C     . THR A  1 958 ? -25.915  0.674   40.758  1.00 98.84  ? 958  THR A C     1 
ATOM   6797  O O     . THR A  1 958 ? -25.739  -0.490  40.371  1.00 98.38  ? 958  THR A O     1 
ATOM   6798  C CB    . THR A  1 958 ? -24.224  2.525   40.139  1.00 92.90  ? 958  THR A CB    1 
ATOM   6799  O OG1   . THR A  1 958 ? -23.717  1.809   39.012  1.00 89.47  ? 958  THR A OG1   1 
ATOM   6800  C CG2   . THR A  1 958 ? -23.186  3.533   40.624  1.00 89.17  ? 958  THR A CG2   1 
ATOM   6801  N N     . HIS A  1 959 ? -27.139  1.271   40.749  1.00 97.22  ? 959  HIS A N     1 
ATOM   6802  C CA    . HIS A  1 959 ? -28.381  0.625   40.272  1.00 97.12  ? 959  HIS A CA    1 
ATOM   6803  C C     . HIS A  1 959 ? -28.369  0.412   38.729  1.00 99.55  ? 959  HIS A C     1 
ATOM   6804  O O     . HIS A  1 959 ? -29.286  -0.212  38.179  1.00 97.83  ? 959  HIS A O     1 
ATOM   6805  C CB    . HIS A  1 959 ? -29.618  1.429   40.717  1.00 98.72  ? 959  HIS A CB    1 
ATOM   6806  N N     . HIS A  1 960 ? -27.301  0.933   38.055  1.00 95.68  ? 960  HIS A N     1 
ATOM   6807  C CA    . HIS A  1 960 ? -27.007  0.818   36.623  1.00 94.34  ? 960  HIS A CA    1 
ATOM   6808  C C     . HIS A  1 960 ? -26.066  -0.388  36.376  1.00 93.74  ? 960  HIS A C     1 
ATOM   6809  O O     . HIS A  1 960 ? -25.261  -0.383  35.441  1.00 92.29  ? 960  HIS A O     1 
ATOM   6810  C CB    . HIS A  1 960 ? -26.385  2.127   36.099  1.00 95.92  ? 960  HIS A CB    1 
ATOM   6811  C CG    . HIS A  1 960 ? -27.348  3.269   36.029  1.00 100.38 ? 960  HIS A CG    1 
ATOM   6812  N ND1   . HIS A  1 960 ? -28.308  3.344   35.030  1.00 102.24 ? 960  HIS A ND1   1 
ATOM   6813  C CD2   . HIS A  1 960 ? -27.463  4.354   36.832  1.00 103.15 ? 960  HIS A CD2   1 
ATOM   6814  C CE1   . HIS A  1 960 ? -28.980  4.460   35.262  1.00 102.47 ? 960  HIS A CE1   1 
ATOM   6815  N NE2   . HIS A  1 960 ? -28.507  5.104   36.335  1.00 103.38 ? 960  HIS A NE2   1 
ATOM   6816  N N     . LYS A  1 961 ? -26.191  -1.421  37.235  1.00 88.49  ? 961  LYS A N     1 
ATOM   6817  C CA    . LYS A  1 961 ? -25.452  -2.690  37.214  1.00 87.21  ? 961  LYS A CA    1 
ATOM   6818  C C     . LYS A  1 961 ? -23.906  -2.535  37.201  1.00 91.50  ? 961  LYS A C     1 
ATOM   6819  O O     . LYS A  1 961 ? -23.197  -3.288  36.526  1.00 89.48  ? 961  LYS A O     1 
ATOM   6820  C CB    . LYS A  1 961 ? -26.003  -3.641  36.121  1.00 87.70  ? 961  LYS A CB    1 
ATOM   6821  C CG    . LYS A  1 961 ? -27.521  -3.882  36.212  1.00 79.11  ? 961  LYS A CG    1 
ATOM   6822  C CD    . LYS A  1 961 ? -27.890  -5.316  36.526  1.00 75.76  ? 961  LYS A CD    1 
ATOM   6823  C CE    . LYS A  1 961 ? -27.846  -6.196  35.308  1.00 73.06  ? 961  LYS A CE    1 
ATOM   6824  N NZ    . LYS A  1 961 ? -27.735  -7.620  35.687  1.00 65.00  ? 961  LYS A NZ    1 
ATOM   6825  N N     . TRP A  1 962 ? -23.405  -1.555  37.997  1.00 90.01  ? 962  TRP A N     1 
ATOM   6826  C CA    . TRP A  1 962 ? -21.995  -1.170  38.173  1.00 119.32 ? 962  TRP A CA    1 
ATOM   6827  C C     . TRP A  1 962 ? -21.195  -1.081  36.861  1.00 135.89 ? 962  TRP A C     1 
ATOM   6828  O O     . TRP A  1 962 ? -21.688  -0.542  35.866  1.00 86.06  ? 962  TRP A O     1 
ATOM   6829  C CB    . TRP A  1 962 ? -21.288  -2.051  39.214  1.00 118.08 ? 962  TRP A CB    1 
ATOM   6830  N N     . ASN A  1 967 ? -17.039  4.944   38.597  1.00 93.91  ? 967  ASN A N     1 
ATOM   6831  C CA    . ASN A  1 967 ? -15.960  4.485   39.480  1.00 93.99  ? 967  ASN A CA    1 
ATOM   6832  C C     . ASN A  1 967 ? -14.776  3.844   38.725  1.00 97.50  ? 967  ASN A C     1 
ATOM   6833  O O     . ASN A  1 967 ? -13.616  4.139   39.035  1.00 97.23  ? 967  ASN A O     1 
ATOM   6834  C CB    . ASN A  1 967 ? -16.501  3.530   40.558  1.00 92.92  ? 967  ASN A CB    1 
ATOM   6835  N N     . VAL A  1 968 ? -15.079  2.973   37.734  1.00 93.79  ? 968  VAL A N     1 
ATOM   6836  C CA    . VAL A  1 968 ? -14.107  2.218   36.916  1.00 92.89  ? 968  VAL A CA    1 
ATOM   6837  C C     . VAL A  1 968 ? -13.825  2.913   35.560  1.00 95.79  ? 968  VAL A C     1 
ATOM   6838  O O     . VAL A  1 968 ? -14.769  3.319   34.863  1.00 94.83  ? 968  VAL A O     1 
ATOM   6839  C CB    . VAL A  1 968 ? -14.536  0.727   36.735  1.00 95.61  ? 968  VAL A CB    1 
ATOM   6840  C CG1   . VAL A  1 968 ? -13.371  -0.137  36.247  1.00 95.05  ? 968  VAL A CG1   1 
ATOM   6841  C CG2   . VAL A  1 968 ? -15.117  0.149   38.027  1.00 95.43  ? 968  VAL A CG2   1 
ATOM   6842  N N     . HIS A  1 969 ? -12.522  3.036   35.191  1.00 91.68  ? 969  HIS A N     1 
ATOM   6843  C CA    . HIS A  1 969 ? -12.121  3.689   33.942  1.00 90.87  ? 969  HIS A CA    1 
ATOM   6844  C C     . HIS A  1 969 ? -11.205  2.961   32.987  1.00 87.01  ? 969  HIS A C     1 
ATOM   6845  O O     . HIS A  1 969 ? -10.111  2.523   33.352  1.00 86.67  ? 969  HIS A O     1 
ATOM   6846  C CB    . HIS A  1 969 ? -11.651  5.131   34.156  1.00 94.02  ? 969  HIS A CB    1 
ATOM   6847  C CG    . HIS A  1 969 ? -12.777  6.111   34.167  1.00 98.91  ? 969  HIS A CG    1 
ATOM   6848  N ND1   . HIS A  1 969 ? -13.774  6.077   33.198  1.00 100.89 ? 969  HIS A ND1   1 
ATOM   6849  C CD2   . HIS A  1 969 ? -13.035  7.122   35.032  1.00 102.19 ? 969  HIS A CD2   1 
ATOM   6850  C CE1   . HIS A  1 969 ? -14.597  7.071   33.507  1.00 101.16 ? 969  HIS A CE1   1 
ATOM   6851  N NE2   . HIS A  1 969 ? -14.193  7.729   34.600  1.00 102.11 ? 969  HIS A NE2   1 
ATOM   6852  N N     . TRP A  1 970 ? -11.662  2.908   31.730  1.00 77.40  ? 970  TRP A N     1 
ATOM   6853  C CA    . TRP A  1 970 ? -11.019  2.325   30.555  1.00 73.80  ? 970  TRP A CA    1 
ATOM   6854  C C     . TRP A  1 970 ? -10.916  3.419   29.463  1.00 72.58  ? 970  TRP A C     1 
ATOM   6855  O O     . TRP A  1 970 ? -10.974  3.112   28.274  1.00 71.52  ? 970  TRP A O     1 
ATOM   6856  C CB    . TRP A  1 970 ? -11.870  1.143   30.055  1.00 71.32  ? 970  TRP A CB    1 
ATOM   6857  C CG    . TRP A  1 970 ? -13.305  1.504   29.798  1.00 71.84  ? 970  TRP A CG    1 
ATOM   6858  C CD1   . TRP A  1 970 ? -13.819  2.089   28.678  1.00 74.70  ? 970  TRP A CD1   1 
ATOM   6859  C CD2   . TRP A  1 970 ? -14.405  1.325   30.698  1.00 71.46  ? 970  TRP A CD2   1 
ATOM   6860  N NE1   . TRP A  1 970 ? -15.171  2.294   28.828  1.00 74.00  ? 970  TRP A NE1   1 
ATOM   6861  C CE2   . TRP A  1 970 ? -15.562  1.817   30.052  1.00 75.21  ? 970  TRP A CE2   1 
ATOM   6862  C CE3   . TRP A  1 970 ? -14.531  0.779   31.982  1.00 72.70  ? 970  TRP A CE3   1 
ATOM   6863  C CZ2   . TRP A  1 970 ? -16.825  1.798   30.658  1.00 74.31  ? 970  TRP A CZ2   1 
ATOM   6864  C CZ3   . TRP A  1 970 ? -15.783  0.757   32.578  1.00 74.08  ? 970  TRP A CZ3   1 
ATOM   6865  C CH2   . TRP A  1 970 ? -16.911  1.268   31.922  1.00 74.51  ? 970  TRP A CH2   1 
ATOM   6866  N N     . GLU A  1 971 ? -10.795  4.698   29.882  1.00 66.26  ? 971  GLU A N     1 
ATOM   6867  C CA    . GLU A  1 971 ? -10.735  5.889   29.031  1.00 64.57  ? 971  GLU A CA    1 
ATOM   6868  C C     . GLU A  1 971 ? -9.710   5.795   27.923  1.00 64.94  ? 971  GLU A C     1 
ATOM   6869  O O     . GLU A  1 971 ? -10.039  6.126   26.783  1.00 66.04  ? 971  GLU A O     1 
ATOM   6870  C CB    . GLU A  1 971 ? -10.477  7.157   29.859  1.00 67.06  ? 971  GLU A CB    1 
ATOM   6871  N N     . GLN A  1 972 ? -8.474   5.337   28.239  1.00 56.86  ? 972  GLN A N     1 
ATOM   6872  C CA    . GLN A  1 972 ? -7.396   5.236   27.262  1.00 54.29  ? 972  GLN A CA    1 
ATOM   6873  C C     . GLN A  1 972 ? -7.658   4.296   26.070  1.00 53.84  ? 972  GLN A C     1 
ATOM   6874  O O     . GLN A  1 972 ? -7.006   4.438   25.028  1.00 55.79  ? 972  GLN A O     1 
ATOM   6875  C CB    . GLN A  1 972 ? -6.050   5.021   27.943  1.00 55.49  ? 972  GLN A CB    1 
ATOM   6876  C CG    . GLN A  1 972 ? -4.903   5.797   27.280  1.00 69.06  ? 972  GLN A CG    1 
ATOM   6877  C CD    . GLN A  1 972 ? -4.924   7.313   27.428  1.00 83.03  ? 972  GLN A CD    1 
ATOM   6878  O OE1   . GLN A  1 972 ? -4.295   8.027   26.624  1.00 83.42  ? 972  GLN A OE1   1 
ATOM   6879  N NE2   . GLN A  1 972 ? -5.600   7.845   28.468  1.00 58.87  ? 972  GLN A NE2   1 
ATOM   6880  N N     . LEU A  1 973 ? -8.656   3.395   26.185  1.00 44.41  ? 973  LEU A N     1 
ATOM   6881  C CA    . LEU A  1 973 ? -9.051   2.524   25.075  1.00 41.89  ? 973  LEU A CA    1 
ATOM   6882  C C     . LEU A  1 973 ? -9.654   3.414   24.004  1.00 47.83  ? 973  LEU A C     1 
ATOM   6883  O O     . LEU A  1 973 ? -9.229   3.369   22.839  1.00 49.65  ? 973  LEU A O     1 
ATOM   6884  C CB    . LEU A  1 973 ? -10.057  1.444   25.505  1.00 39.52  ? 973  LEU A CB    1 
ATOM   6885  C CG    . LEU A  1 973 ? -9.517   0.341   26.405  1.00 40.71  ? 973  LEU A CG    1 
ATOM   6886  C CD1   . LEU A  1 973 ? -10.591  -0.631  26.763  1.00 39.03  ? 973  LEU A CD1   1 
ATOM   6887  C CD2   . LEU A  1 973 ? -8.397   -0.398  25.736  1.00 42.84  ? 973  LEU A CD2   1 
ATOM   6888  N N     . ASN A  1 974 ? -10.563  4.304   24.437  1.00 42.22  ? 974  ASN A N     1 
ATOM   6889  C CA    . ASN A  1 974 ? -11.227  5.293   23.593  1.00 40.98  ? 974  ASN A CA    1 
ATOM   6890  C C     . ASN A  1 974 ? -10.272  6.366   23.040  1.00 41.16  ? 974  ASN A C     1 
ATOM   6891  O O     . ASN A  1 974 ? -10.446  6.793   21.907  1.00 39.38  ? 974  ASN A O     1 
ATOM   6892  C CB    . ASN A  1 974 ? -12.365  5.938   24.370  1.00 41.22  ? 974  ASN A CB    1 
ATOM   6893  C CG    . ASN A  1 974 ? -13.576  5.078   24.404  1.00 70.95  ? 974  ASN A CG    1 
ATOM   6894  O OD1   . ASN A  1 974 ? -14.232  4.862   23.376  1.00 78.77  ? 974  ASN A OD1   1 
ATOM   6895  N ND2   . ASN A  1 974 ? -13.894  4.565   25.582  1.00 57.22  ? 974  ASN A ND2   1 
ATOM   6896  N N     . ILE A  1 975 ? -9.286   6.809   23.840  1.00 37.55  ? 975  ILE A N     1 
ATOM   6897  C CA    . ILE A  1 975 ? -8.320   7.824   23.406  1.00 38.16  ? 975  ILE A CA    1 
ATOM   6898  C C     . ILE A  1 975 ? -7.444   7.293   22.272  1.00 39.93  ? 975  ILE A C     1 
ATOM   6899  O O     . ILE A  1 975 ? -7.353   7.942   21.226  1.00 38.78  ? 975  ILE A O     1 
ATOM   6900  C CB    . ILE A  1 975 ? -7.516   8.435   24.595  1.00 41.89  ? 975  ILE A CB    1 
ATOM   6901  C CG1   . ILE A  1 975 ? -8.409   9.373   25.423  1.00 41.97  ? 975  ILE A CG1   1 
ATOM   6902  C CG2   . ILE A  1 975 ? -6.272   9.197   24.113  1.00 43.32  ? 975  ILE A CG2   1 
ATOM   6903  C CD1   . ILE A  1 975 ? -8.429   9.099   26.846  1.00 44.16  ? 975  ILE A CD1   1 
ATOM   6904  N N     . VAL A  1 976 ? -6.845   6.102   22.462  1.00 35.95  ? 976  VAL A N     1 
ATOM   6905  C CA    . VAL A  1 976 ? -5.987   5.459   21.461  1.00 35.47  ? 976  VAL A CA    1 
ATOM   6906  C C     . VAL A  1 976 ? -6.760   5.120   20.163  1.00 38.33  ? 976  VAL A C     1 
ATOM   6907  O O     . VAL A  1 976 ? -6.292   5.437   19.065  1.00 35.90  ? 976  VAL A O     1 
ATOM   6908  C CB    . VAL A  1 976 ? -5.230   4.255   22.052  1.00 37.80  ? 976  VAL A CB    1 
ATOM   6909  C CG1   . VAL A  1 976 ? -4.487   3.489   20.962  1.00 36.85  ? 976  VAL A CG1   1 
ATOM   6910  C CG2   . VAL A  1 976 ? -4.267   4.718   23.142  1.00 37.99  ? 976  VAL A CG2   1 
ATOM   6911  N N     . SER A  1 977 ? -7.965   4.542   20.303  1.00 35.68  ? 977  SER A N     1 
ATOM   6912  C CA    . SER A  1 977 ? -8.788   4.217   19.146  1.00 36.45  ? 977  SER A CA    1 
ATOM   6913  C C     . SER A  1 977 ? -9.082   5.444   18.291  1.00 41.73  ? 977  SER A C     1 
ATOM   6914  O O     . SER A  1 977 ? -8.887   5.375   17.079  1.00 45.05  ? 977  SER A O     1 
ATOM   6915  C CB    . SER A  1 977 ? -10.058  3.468   19.550  1.00 42.35  ? 977  SER A CB    1 
ATOM   6916  O OG    . SER A  1 977 ? -10.953  4.249   20.322  1.00 61.65  ? 977  SER A OG    1 
ATOM   6917  N N     . ASP A  1 978 ? -9.440   6.580   18.923  1.00 35.83  ? 978  ASP A N     1 
ATOM   6918  C CA    . ASP A  1 978 ? -9.729   7.850   18.257  1.00 35.66  ? 978  ASP A CA    1 
ATOM   6919  C C     . ASP A  1 978 ? -8.504   8.457   17.624  1.00 39.81  ? 978  ASP A C     1 
ATOM   6920  O O     . ASP A  1 978 ? -8.627   9.171   16.631  1.00 41.01  ? 978  ASP A O     1 
ATOM   6921  C CB    . ASP A  1 978 ? -10.340  8.853   19.235  1.00 38.45  ? 978  ASP A CB    1 
ATOM   6922  C CG    . ASP A  1 978 ? -11.802  8.624   19.574  1.00 59.07  ? 978  ASP A CG    1 
ATOM   6923  O OD1   . ASP A  1 978 ? -12.442  7.741   18.925  1.00 61.16  ? 978  ASP A OD1   1 
ATOM   6924  O OD2   . ASP A  1 978 ? -12.329  9.359   20.452  1.00 67.89  ? 978  ASP A OD2   1 
ATOM   6925  N N     . LEU A  1 979 ? -7.321   8.210   18.201  1.00 34.97  ? 979  LEU A N     1 
ATOM   6926  C CA    . LEU A  1 979 ? -6.083   8.730   17.636  1.00 34.07  ? 979  LEU A CA    1 
ATOM   6927  C C     . LEU A  1 979 ? -5.837   8.011   16.314  1.00 34.97  ? 979  LEU A C     1 
ATOM   6928  O O     . LEU A  1 979 ? -5.607   8.667   15.305  1.00 34.06  ? 979  LEU A O     1 
ATOM   6929  C CB    . LEU A  1 979 ? -4.916   8.489   18.608  1.00 34.36  ? 979  LEU A CB    1 
ATOM   6930  C CG    . LEU A  1 979 ? -3.658   9.301   18.364  1.00 41.01  ? 979  LEU A CG    1 
ATOM   6931  C CD1   . LEU A  1 979 ? -2.978   9.620   19.664  1.00 42.86  ? 979  LEU A CD1   1 
ATOM   6932  C CD2   . LEU A  1 979 ? -2.688   8.574   17.476  1.00 42.57  ? 979  LEU A CD2   1 
ATOM   6933  N N     . LEU A  1 980 ? -5.927   6.659   16.335  1.00 30.86  ? 980  LEU A N     1 
ATOM   6934  C CA    . LEU A  1 980 ? -5.660   5.749   15.215  1.00 29.80  ? 980  LEU A CA    1 
ATOM   6935  C C     . LEU A  1 980 ? -6.704   5.730   14.085  1.00 31.23  ? 980  LEU A C     1 
ATOM   6936  O O     . LEU A  1 980 ? -6.317   5.547   12.928  1.00 28.73  ? 980  LEU A O     1 
ATOM   6937  C CB    . LEU A  1 980 ? -5.198   4.356   15.697  1.00 28.76  ? 980  LEU A CB    1 
ATOM   6938  C CG    . LEU A  1 980 ? -4.031   4.330   16.705  1.00 33.71  ? 980  LEU A CG    1 
ATOM   6939  C CD1   . LEU A  1 980 ? -3.636   2.924   17.053  1.00 34.49  ? 980  LEU A CD1   1 
ATOM   6940  C CD2   . LEU A  1 980 ? -2.808   5.039   16.180  1.00 37.50  ? 980  LEU A CD2   1 
ATOM   6941  N N     . SER A  1 981 ? -7.997   5.992   14.407  1.00 27.62  ? 981  SER A N     1 
ATOM   6942  C CA    . SER A  1 981 ? -9.059   6.249   13.427  1.00 28.66  ? 981  SER A CA    1 
ATOM   6943  C C     . SER A  1 981 ? -8.879   7.751   13.105  1.00 40.18  ? 981  SER A C     1 
ATOM   6944  O O     . SER A  1 981 ? -8.065   8.430   13.744  1.00 45.79  ? 981  SER A O     1 
ATOM   6945  C CB    . SER A  1 981 ? -10.437  6.046   14.054  1.00 30.17  ? 981  SER A CB    1 
ATOM   6946  O OG    . SER A  1 981 ? -10.765  7.019   15.035  1.00 29.58  ? 981  SER A OG    1 
ATOM   6947  N N     . GLY A  1 982 ? -9.621   8.302   12.174  1.00 35.15  ? 982  GLY A N     1 
ATOM   6948  C CA    . GLY A  1 982 ? -9.450   9.729   11.903  1.00 35.16  ? 982  GLY A CA    1 
ATOM   6949  C C     . GLY A  1 982 ? -9.908   10.688  12.991  1.00 40.28  ? 982  GLY A C     1 
ATOM   6950  O O     . GLY A  1 982 ? -9.472   11.840  12.995  1.00 42.98  ? 982  GLY A O     1 
ATOM   6951  N N     . ARG A  1 983 ? -10.799  10.229  13.926  1.00 34.76  ? 983  ARG A N     1 
ATOM   6952  C CA    . ARG A  1 983 ? -11.423  11.033  14.990  1.00 33.71  ? 983  ARG A CA    1 
ATOM   6953  C C     . ARG A  1 983 ? -10.609  12.153  15.624  1.00 39.09  ? 983  ARG A C     1 
ATOM   6954  O O     . ARG A  1 983 ? -10.971  13.312  15.437  1.00 40.67  ? 983  ARG A O     1 
ATOM   6955  C CB    . ARG A  1 983 ? -12.201  10.200  16.012  1.00 31.19  ? 983  ARG A CB    1 
ATOM   6956  C CG    . ARG A  1 983 ? -13.047  11.067  16.957  1.00 46.46  ? 983  ARG A CG    1 
ATOM   6957  C CD    . ARG A  1 983 ? -14.193  10.331  17.642  1.00 66.04  ? 983  ARG A CD    1 
ATOM   6958  N NE    . ARG A  1 983 ? -15.108  9.734   16.672  1.00 82.85  ? 983  ARG A NE    1 
ATOM   6959  C CZ    . ARG A  1 983 ? -16.121  10.378  16.104  1.00 101.93 ? 983  ARG A CZ    1 
ATOM   6960  N NH1   . ARG A  1 983 ? -16.373  11.647  16.417  1.00 96.42  ? 983  ARG A NH1   1 
ATOM   6961  N NH2   . ARG A  1 983 ? -16.892  9.761   15.220  1.00 84.09  ? 983  ARG A NH2   1 
ATOM   6962  N N     . LEU A  1 984 ? -9.521   11.830  16.347  1.00 34.94  ? 984  LEU A N     1 
ATOM   6963  C CA    . LEU A  1 984 ? -8.691   12.842  17.017  1.00 35.19  ? 984  LEU A CA    1 
ATOM   6964  C C     . LEU A  1 984 ? -8.106   13.875  16.063  1.00 39.97  ? 984  LEU A C     1 
ATOM   6965  O O     . LEU A  1 984 ? -7.960   15.028  16.436  1.00 40.27  ? 984  LEU A O     1 
ATOM   6966  C CB    . LEU A  1 984 ? -7.567   12.190  17.819  1.00 34.91  ? 984  LEU A CB    1 
ATOM   6967  C CG    . LEU A  1 984 ? -7.556   12.425  19.316  1.00 38.73  ? 984  LEU A CG    1 
ATOM   6968  C CD1   . LEU A  1 984 ? -6.307   11.842  19.928  1.00 38.87  ? 984  LEU A CD1   1 
ATOM   6969  C CD2   . LEU A  1 984 ? -7.595   13.886  19.643  1.00 41.93  ? 984  LEU A CD2   1 
ATOM   6970  N N     . SER A  1 985 ? -7.787   13.464  14.833  1.00 36.80  ? 985  SER A N     1 
ATOM   6971  C CA    . SER A  1 985 ? -7.229   14.340  13.809  1.00 37.18  ? 985  SER A CA    1 
ATOM   6972  C C     . SER A  1 985 ? -8.301   15.259  13.238  1.00 42.11  ? 985  SER A C     1 
ATOM   6973  O O     . SER A  1 985 ? -8.005   16.424  12.973  1.00 43.22  ? 985  SER A O     1 
ATOM   6974  C CB    . SER A  1 985 ? -6.562   13.522  12.708  1.00 39.58  ? 985  SER A CB    1 
ATOM   6975  O OG    . SER A  1 985 ? -5.972   12.358  13.267  1.00 51.34  ? 985  SER A OG    1 
ATOM   6976  N N     . ILE A  1 986 ? -9.545   14.743  13.046  1.00 37.70  ? 986  ILE A N     1 
ATOM   6977  C CA    . ILE A  1 986 ? -10.665  15.530  12.522  1.00 37.78  ? 986  ILE A CA    1 
ATOM   6978  C C     . ILE A  1 986 ? -11.150  16.490  13.591  1.00 41.17  ? 986  ILE A C     1 
ATOM   6979  O O     . ILE A  1 986 ? -11.485  17.640  13.287  1.00 41.89  ? 986  ILE A O     1 
ATOM   6980  C CB    . ILE A  1 986 ? -11.757  14.636  11.872  1.00 40.59  ? 986  ILE A CB    1 
ATOM   6981  C CG1   . ILE A  1 986 ? -11.399  14.352  10.393  1.00 42.83  ? 986  ILE A CG1   1 
ATOM   6982  C CG2   . ILE A  1 986 ? -13.151  15.273  11.923  1.00 40.44  ? 986  ILE A CG2   1 
ATOM   6983  C CD1   . ILE A  1 986 ? -10.310  13.244  10.101  1.00 56.68  ? 986  ILE A CD1   1 
ATOM   6984  N N     . ARG A  1 987 ? -11.090  16.037  14.857  1.00 36.34  ? 987  ARG A N     1 
ATOM   6985  C CA    . ARG A  1 987 ? -11.466  16.804  16.043  1.00 35.28  ? 987  ARG A CA    1 
ATOM   6986  C C     . ARG A  1 987 ? -10.498  17.962  16.351  1.00 41.47  ? 987  ARG A C     1 
ATOM   6987  O O     . ARG A  1 987 ? -10.885  18.868  17.084  1.00 41.45  ? 987  ARG A O     1 
ATOM   6988  C CB    . ARG A  1 987 ? -11.619  15.878  17.258  1.00 28.85  ? 987  ARG A CB    1 
ATOM   6989  C CG    . ARG A  1 987 ? -13.027  15.339  17.471  1.00 27.12  ? 987  ARG A CG    1 
ATOM   6990  C CD    . ARG A  1 987 ? -13.103  14.473  18.734  1.00 36.50  ? 987  ARG A CD    1 
ATOM   6991  N NE    . ARG A  1 987 ? -13.222  15.270  19.955  1.00 41.02  ? 987  ARG A NE    1 
ATOM   6992  C CZ    . ARG A  1 987 ? -14.377  15.621  20.513  1.00 72.92  ? 987  ARG A CZ    1 
ATOM   6993  N NH1   . ARG A  1 987 ? -15.530  15.207  19.991  1.00 75.00  ? 987  ARG A NH1   1 
ATOM   6994  N NH2   . ARG A  1 987 ? -14.390  16.382  21.603  1.00 60.76  ? 987  ARG A NH2   1 
ATOM   6995  N N     . THR A  1 988 ? -9.264   17.944  15.786  1.00 40.40  ? 988  THR A N     1 
ATOM   6996  C CA    . THR A  1 988 ? -8.226   18.978  15.995  1.00 42.52  ? 988  THR A CA    1 
ATOM   6997  C C     . THR A  1 988 ? -7.736   19.707  14.690  1.00 50.93  ? 988  THR A C     1 
ATOM   6998  O O     . THR A  1 988 ? -6.971   20.665  14.777  1.00 50.88  ? 988  THR A O     1 
ATOM   6999  C CB    . THR A  1 988 ? -7.024   18.380  16.760  1.00 47.45  ? 988  THR A CB    1 
ATOM   7000  O OG1   . THR A  1 988 ? -6.407   17.349  15.981  1.00 46.13  ? 988  THR A OG1   1 
ATOM   7001  C CG2   . THR A  1 988 ? -7.392   17.856  18.121  1.00 41.88  ? 988  THR A CG2   1 
ATOM   7002  N N     . THR A  1 989 ? -8.202   19.255  13.499  1.00 50.15  ? 989  THR A N     1 
ATOM   7003  C CA    . THR A  1 989 ? -7.827   19.715  12.151  1.00 83.24  ? 989  THR A CA    1 
ATOM   7004  C C     . THR A  1 989 ? -6.348   19.462  11.888  1.00 90.55  ? 989  THR A C     1 
ATOM   7005  O O     . THR A  1 989 ? -5.825   18.410  12.255  1.00 54.28  ? 989  THR A O     1 
ATOM   7006  C CB    . THR A  1 989 ? -8.324   21.141  11.848  1.00 97.50  ? 989  THR A CB    1 
ATOM   7007  O OG1   . THR A  1 989 ? -9.744   21.179  12.001  1.00 100.44 ? 989  THR A OG1   1 
ATOM   7008  C CG2   . THR A  1 989 ? -7.960   21.619  10.446  1.00 98.53  ? 989  THR A CG2   1 
ATOM   7009  N N     . SER B  2 5   ? -76.417  -1.418  -37.074 1.00 88.52  ? 5    SER B N     1 
ATOM   7010  C CA    . SER B  2 5   ? -75.523  -2.112  -38.000 1.00 86.92  ? 5    SER B CA    1 
ATOM   7011  C C     . SER B  2 5   ? -76.304  -2.947  -39.018 1.00 92.10  ? 5    SER B C     1 
ATOM   7012  O O     . SER B  2 5   ? -77.537  -2.934  -39.014 1.00 94.34  ? 5    SER B O     1 
ATOM   7013  C CB    . SER B  2 5   ? -74.546  -2.999  -37.230 1.00 87.95  ? 5    SER B CB    1 
ATOM   7014  N N     . LEU B  2 6   ? -75.581  -3.648  -39.913 1.00 86.45  ? 6    LEU B N     1 
ATOM   7015  C CA    . LEU B  2 6   ? -76.160  -4.558  -40.903 1.00 86.63  ? 6    LEU B CA    1 
ATOM   7016  C C     . LEU B  2 6   ? -75.474  -5.903  -40.867 1.00 87.62  ? 6    LEU B C     1 
ATOM   7017  O O     . LEU B  2 6   ? -76.148  -6.911  -41.026 1.00 88.70  ? 6    LEU B O     1 
ATOM   7018  C CB    . LEU B  2 6   ? -76.261  -3.969  -42.303 1.00 87.75  ? 6    LEU B CB    1 
ATOM   7019  C CG    . LEU B  2 6   ? -77.536  -3.189  -42.490 1.00 95.19  ? 6    LEU B CG    1 
ATOM   7020  C CD1   . LEU B  2 6   ? -77.271  -1.719  -42.673 1.00 95.63  ? 6    LEU B CD1   1 
ATOM   7021  C CD2   . LEU B  2 6   ? -78.376  -3.760  -43.579 1.00 99.94  ? 6    LEU B CD2   1 
ATOM   7022  N N     . PHE B  2 7   ? -74.157  -5.931  -40.563 1.00 79.80  ? 7    PHE B N     1 
ATOM   7023  C CA    . PHE B  2 7   ? -73.410  -7.165  -40.352 1.00 77.44  ? 7    PHE B CA    1 
ATOM   7024  C C     . PHE B  2 7   ? -73.563  -7.398  -38.851 1.00 81.46  ? 7    PHE B C     1 
ATOM   7025  O O     . PHE B  2 7   ? -72.657  -7.102  -38.067 1.00 79.98  ? 7    PHE B O     1 
ATOM   7026  C CB    . PHE B  2 7   ? -71.938  -6.987  -40.764 1.00 76.88  ? 7    PHE B CB    1 
ATOM   7027  C CG    . PHE B  2 7   ? -71.621  -7.123  -42.240 1.00 78.60  ? 7    PHE B CG    1 
ATOM   7028  C CD1   . PHE B  2 7   ? -72.107  -6.203  -43.163 1.00 82.90  ? 7    PHE B CD1   1 
ATOM   7029  C CD2   . PHE B  2 7   ? -70.752  -8.108  -42.692 1.00 78.87  ? 7    PHE B CD2   1 
ATOM   7030  C CE1   . PHE B  2 7   ? -71.767  -6.296  -44.512 1.00 83.90  ? 7    PHE B CE1   1 
ATOM   7031  C CE2   . PHE B  2 7   ? -70.398  -8.186  -44.035 1.00 82.13  ? 7    PHE B CE2   1 
ATOM   7032  C CZ    . PHE B  2 7   ? -70.917  -7.287  -44.938 1.00 81.86  ? 7    PHE B CZ    1 
ATOM   7033  N N     . ASN B  2 8   ? -74.769  -7.844  -38.460 1.00 80.02  ? 8    ASN B N     1 
ATOM   7034  C CA    . ASN B  2 8   ? -75.208  -8.031  -37.078 1.00 80.26  ? 8    ASN B CA    1 
ATOM   7035  C C     . ASN B  2 8   ? -74.480  -9.070  -36.229 1.00 84.79  ? 8    ASN B C     1 
ATOM   7036  O O     . ASN B  2 8   ? -74.372  -8.887  -35.019 1.00 83.02  ? 8    ASN B O     1 
ATOM   7037  C CB    . ASN B  2 8   ? -76.720  -8.189  -37.015 1.00 80.02  ? 8    ASN B CB    1 
ATOM   7038  C CG    . ASN B  2 8   ? -77.468  -6.994  -37.570 1.00 102.78 ? 8    ASN B CG    1 
ATOM   7039  O OD1   . ASN B  2 8   ? -78.553  -7.136  -38.148 1.00 98.89  ? 8    ASN B OD1   1 
ATOM   7040  N ND2   . ASN B  2 8   ? -76.920  -5.782  -37.397 1.00 93.36  ? 8    ASN B ND2   1 
ATOM   7041  N N     . GLY B  2 9   ? -73.990  -10.135 -36.855 1.00 82.82  ? 9    GLY B N     1 
ATOM   7042  C CA    . GLY B  2 9   ? -73.280  -11.205 -36.163 1.00 82.24  ? 9    GLY B CA    1 
ATOM   7043  C C     . GLY B  2 9   ? -72.469  -12.075 -37.093 1.00 87.82  ? 9    GLY B C     1 
ATOM   7044  O O     . GLY B  2 9   ? -72.204  -11.688 -38.232 1.00 87.44  ? 9    GLY B O     1 
ATOM   7045  N N     . THR B  2 10  ? -72.062  -13.252 -36.609 1.00 86.51  ? 10   THR B N     1 
ATOM   7046  C CA    . THR B  2 10  ? -71.270  -14.230 -37.379 1.00 86.98  ? 10   THR B CA    1 
ATOM   7047  C C     . THR B  2 10  ? -71.942  -15.604 -37.214 1.00 93.13  ? 10   THR B C     1 
ATOM   7048  O O     . THR B  2 10  ? -71.880  -16.207 -36.131 1.00 93.29  ? 10   THR B O     1 
ATOM   7049  C CB    . THR B  2 10  ? -69.781  -14.244 -36.931 1.00 95.32  ? 10   THR B CB    1 
ATOM   7050  O OG1   . THR B  2 10  ? -69.508  -13.207 -35.970 1.00 97.07  ? 10   THR B OG1   1 
ATOM   7051  C CG2   . THR B  2 10  ? -68.821  -14.181 -38.099 1.00 90.03  ? 10   THR B CG2   1 
ATOM   7052  N N     . SER B  2 11  ? -72.634  -16.066 -38.266 1.00 90.31  ? 11   SER B N     1 
ATOM   7053  C CA    . SER B  2 11  ? -73.374  -17.327 -38.211 1.00 91.40  ? 11   SER B CA    1 
ATOM   7054  C C     . SER B  2 11  ? -72.496  -18.588 -38.275 1.00 93.94  ? 11   SER B C     1 
ATOM   7055  O O     . SER B  2 11  ? -72.520  -19.399 -37.334 1.00 93.72  ? 11   SER B O     1 
ATOM   7056  C CB    . SER B  2 11  ? -74.465  -17.353 -39.274 1.00 96.90  ? 11   SER B CB    1 
ATOM   7057  O OG    . SER B  2 11  ? -75.247  -16.172 -39.230 1.00 105.95 ? 11   SER B OG    1 
ATOM   7058  N N     . PHE B  2 12  ? -71.729  -18.751 -39.383 1.00 88.95  ? 12   PHE B N     1 
ATOM   7059  C CA    . PHE B  2 12  ? -70.879  -19.918 -39.615 1.00 88.22  ? 12   PHE B CA    1 
ATOM   7060  C C     . PHE B  2 12  ? -69.829  -19.703 -40.698 1.00 90.60  ? 12   PHE B C     1 
ATOM   7061  O O     . PHE B  2 12  ? -70.005  -18.866 -41.587 1.00 90.05  ? 12   PHE B O     1 
ATOM   7062  C CB    . PHE B  2 12  ? -71.738  -21.156 -39.966 1.00 92.11  ? 12   PHE B CB    1 
ATOM   7063  C CG    . PHE B  2 12  ? -72.642  -20.988 -41.168 1.00 95.63  ? 12   PHE B CG    1 
ATOM   7064  C CD1   . PHE B  2 12  ? -72.226  -21.382 -42.433 1.00 99.70  ? 12   PHE B CD1   1 
ATOM   7065  C CD2   . PHE B  2 12  ? -73.917  -20.451 -41.033 1.00 99.05  ? 12   PHE B CD2   1 
ATOM   7066  C CE1   . PHE B  2 12  ? -73.059  -21.219 -43.542 1.00 102.32 ? 12   PHE B CE1   1 
ATOM   7067  C CE2   . PHE B  2 12  ? -74.743  -20.276 -42.145 1.00 103.62 ? 12   PHE B CE2   1 
ATOM   7068  C CZ    . PHE B  2 12  ? -74.318  -20.679 -43.388 1.00 102.24 ? 12   PHE B CZ    1 
ATOM   7069  N N     . ILE B  2 13  ? -68.752  -20.504 -40.632 1.00 86.56  ? 13   ILE B N     1 
ATOM   7070  C CA    . ILE B  2 13  ? -67.667  -20.552 -41.610 1.00 86.39  ? 13   ILE B CA    1 
ATOM   7071  C C     . ILE B  2 13  ? -67.992  -21.702 -42.592 1.00 91.76  ? 13   ILE B C     1 
ATOM   7072  O O     . ILE B  2 13  ? -68.361  -22.792 -42.160 1.00 91.03  ? 13   ILE B O     1 
ATOM   7073  C CB    . ILE B  2 13  ? -66.258  -20.659 -40.931 1.00 88.68  ? 13   ILE B CB    1 
ATOM   7074  C CG1   . ILE B  2 13  ? -65.136  -21.151 -41.904 1.00 90.25  ? 13   ILE B CG1   1 
ATOM   7075  C CG2   . ILE B  2 13  ? -66.287  -21.504 -39.661 1.00 89.19  ? 13   ILE B CG2   1 
ATOM   7076  C CD1   . ILE B  2 13  ? -64.388  -20.055 -42.781 1.00 99.63  ? 13   ILE B CD1   1 
ATOM   7077  N N     . THR B  2 14  ? -67.909  -21.430 -43.901 1.00 90.32  ? 14   THR B N     1 
ATOM   7078  C CA    . THR B  2 14  ? -68.208  -22.406 -44.953 1.00 92.74  ? 14   THR B CA    1 
ATOM   7079  C C     . THR B  2 14  ? -66.909  -22.873 -45.648 1.00 99.97  ? 14   THR B C     1 
ATOM   7080  O O     . THR B  2 14  ? -66.192  -22.048 -46.225 1.00 99.75  ? 14   THR B O     1 
ATOM   7081  C CB    . THR B  2 14  ? -69.239  -21.827 -45.938 1.00 97.47  ? 14   THR B CB    1 
ATOM   7082  O OG1   . THR B  2 14  ? -70.011  -20.801 -45.301 1.00 93.19  ? 14   THR B OG1   1 
ATOM   7083  C CG2   . THR B  2 14  ? -70.147  -22.898 -46.510 1.00 97.55  ? 14   THR B CG2   1 
ATOM   7084  N N     . LEU B  2 15  ? -66.600  -24.187 -45.572 1.00 98.47  ? 15   LEU B N     1 
ATOM   7085  C CA    . LEU B  2 15  ? -65.396  -24.773 -46.175 1.00 99.29  ? 15   LEU B CA    1 
ATOM   7086  C C     . LEU B  2 15  ? -65.735  -25.770 -47.291 1.00 108.86 ? 15   LEU B C     1 
ATOM   7087  O O     . LEU B  2 15  ? -66.589  -26.639 -47.098 1.00 109.39 ? 15   LEU B O     1 
ATOM   7088  C CB    . LEU B  2 15  ? -64.512  -25.471 -45.118 1.00 98.35  ? 15   LEU B CB    1 
ATOM   7089  C CG    . LEU B  2 15  ? -64.123  -24.715 -43.843 1.00 100.28 ? 15   LEU B CG    1 
ATOM   7090  C CD1   . LEU B  2 15  ? -63.467  -25.656 -42.850 1.00 99.83  ? 15   LEU B CD1   1 
ATOM   7091  C CD2   . LEU B  2 15  ? -63.199  -23.544 -44.136 1.00 100.85 ? 15   LEU B CD2   1 
ATOM   7092  N N     . PHE B  2 16  ? -65.043  -25.649 -48.449 1.00 108.78 ? 16   PHE B N     1 
ATOM   7093  C CA    . PHE B  2 16  ? -65.204  -26.520 -49.622 1.00 111.41 ? 16   PHE B CA    1 
ATOM   7094  C C     . PHE B  2 16  ? -64.023  -27.502 -49.719 1.00 118.82 ? 16   PHE B C     1 
ATOM   7095  O O     . PHE B  2 16  ? -62.864  -27.081 -49.690 1.00 117.26 ? 16   PHE B O     1 
ATOM   7096  C CB    . PHE B  2 16  ? -65.358  -25.694 -50.914 1.00 113.90 ? 16   PHE B CB    1 
ATOM   7097  N N     . ALA B  2 17  ? -64.333  -28.815 -49.806 1.00 119.84 ? 17   ALA B N     1 
ATOM   7098  C CA    . ALA B  2 17  ? -63.378  -29.934 -49.861 1.00 121.60 ? 17   ALA B CA    1 
ATOM   7099  C C     . ALA B  2 17  ? -63.173  -30.522 -51.281 1.00 129.30 ? 17   ALA B C     1 
ATOM   7100  O O     . ALA B  2 17  ? -64.103  -30.461 -52.091 1.00 129.53 ? 17   ALA B O     1 
ATOM   7101  C CB    . ALA B  2 17  ? -63.831  -31.034 -48.910 1.00 122.57 ? 17   ALA B CB    1 
ATOM   7102  N N     . PRO B  2 18  ? -61.989  -31.125 -51.596 1.00 128.50 ? 18   PRO B N     1 
ATOM   7103  C CA    . PRO B  2 18  ? -61.797  -31.717 -52.937 1.00 130.95 ? 18   PRO B CA    1 
ATOM   7104  C C     . PRO B  2 18  ? -62.332  -33.148 -53.051 1.00 137.20 ? 18   PRO B C     1 
ATOM   7105  O O     . PRO B  2 18  ? -61.776  -34.071 -52.444 1.00 137.35 ? 18   PRO B O     1 
ATOM   7106  C CB    . PRO B  2 18  ? -60.276  -31.661 -53.148 1.00 133.07 ? 18   PRO B CB    1 
ATOM   7107  C CG    . PRO B  2 18  ? -59.679  -31.341 -51.792 1.00 135.79 ? 18   PRO B CG    1 
ATOM   7108  C CD    . PRO B  2 18  ? -60.777  -31.292 -50.772 1.00 129.77 ? 18   PRO B CD    1 
ATOM   7109  N N     . ASN B  2 19  ? -63.409  -33.320 -53.852 1.00 135.04 ? 19   ASN B N     1 
ATOM   7110  C CA    . ASN B  2 19  ? -64.126  -34.575 -54.128 1.00 170.18 ? 19   ASN B CA    1 
ATOM   7111  C C     . ASN B  2 19  ? -64.693  -35.272 -52.879 1.00 189.98 ? 19   ASN B C     1 
ATOM   7112  O O     . ASN B  2 19  ? -63.956  -35.803 -52.049 1.00 144.35 ? 19   ASN B O     1 
ATOM   7113  C CB    . ASN B  2 19  ? -63.314  -35.531 -55.018 1.00 172.96 ? 19   ASN B CB    1 
ATOM   7114  N N     . SER B  2 21  ? -63.155  -36.708 -49.654 1.00 67.14  ? 21   SER B N     1 
ATOM   7115  C CA    . SER B  2 21  ? -61.884  -37.420 -49.603 1.00 94.65  ? 21   SER B CA    1 
ATOM   7116  C C     . SER B  2 21  ? -61.142  -37.169 -48.288 1.00 133.57 ? 21   SER B C     1 
ATOM   7117  O O     . SER B  2 21  ? -60.917  -36.020 -47.901 1.00 100.47 ? 21   SER B O     1 
ATOM   7118  C CB    . SER B  2 21  ? -61.010  -37.039 -50.794 1.00 98.64  ? 21   SER B CB    1 
ATOM   7119  N N     . LEU B  2 23  ? -61.734  -33.716 -46.682 1.00 129.21 ? 23   LEU B N     1 
ATOM   7120  C CA    . LEU B  2 23  ? -63.123  -33.827 -46.237 1.00 128.89 ? 23   LEU B CA    1 
ATOM   7121  C C     . LEU B  2 23  ? -63.256  -34.635 -44.941 1.00 132.00 ? 23   LEU B C     1 
ATOM   7122  O O     . LEU B  2 23  ? -63.865  -34.158 -43.984 1.00 130.37 ? 23   LEU B O     1 
ATOM   7123  C CB    . LEU B  2 23  ? -64.010  -34.421 -47.343 1.00 130.56 ? 23   LEU B CB    1 
ATOM   7124  N N     . GLN B  2 24  ? -62.700  -35.857 -44.916 1.00 129.29 ? 24   GLN B N     1 
ATOM   7125  C CA    . GLN B  2 24  ? -62.740  -36.721 -43.739 1.00 129.32 ? 24   GLN B CA    1 
ATOM   7126  C C     . GLN B  2 24  ? -61.564  -36.408 -42.814 1.00 133.04 ? 24   GLN B C     1 
ATOM   7127  O O     . GLN B  2 24  ? -61.731  -36.413 -41.592 1.00 131.93 ? 24   GLN B O     1 
ATOM   7128  C CB    . GLN B  2 24  ? -62.774  -38.208 -44.146 1.00 132.44 ? 24   GLN B CB    1 
ATOM   7129  C CG    . GLN B  2 24  ? -63.006  -39.203 -42.995 1.00 136.93 ? 24   GLN B CG    1 
ATOM   7130  C CD    . GLN B  2 24  ? -64.206  -38.895 -42.120 1.00 142.96 ? 24   GLN B CD    1 
ATOM   7131  O OE1   . GLN B  2 24  ? -64.068  -38.503 -40.956 1.00 134.41 ? 24   GLN B OE1   1 
ATOM   7132  N NE2   . GLN B  2 24  ? -65.405  -39.083 -42.652 1.00 132.79 ? 24   GLN B NE2   1 
ATOM   7133  N N     . ALA B  2 25  ? -60.383  -36.115 -43.402 1.00 130.25 ? 25   ALA B N     1 
ATOM   7134  C CA    . ALA B  2 25  ? -59.153  -35.755 -42.689 1.00 129.64 ? 25   ALA B CA    1 
ATOM   7135  C C     . ALA B  2 25  ? -59.386  -34.508 -41.848 1.00 130.65 ? 25   ALA B C     1 
ATOM   7136  O O     . ALA B  2 25  ? -58.929  -34.456 -40.703 1.00 130.29 ? 25   ALA B O     1 
ATOM   7137  C CB    . ALA B  2 25  ? -58.022  -35.516 -43.679 1.00 131.02 ? 25   ALA B CB    1 
ATOM   7138  N N     . SER B  2 26  ? -60.136  -33.527 -42.406 1.00 125.08 ? 26   SER B N     1 
ATOM   7139  C CA    . SER B  2 26  ? -60.517  -32.293 -41.719 1.00 122.73 ? 26   SER B CA    1 
ATOM   7140  C C     . SER B  2 26  ? -61.615  -32.569 -40.687 1.00 125.54 ? 26   SER B C     1 
ATOM   7141  O O     . SER B  2 26  ? -61.532  -32.044 -39.577 1.00 123.85 ? 26   SER B O     1 
ATOM   7142  C CB    . SER B  2 26  ? -60.950  -31.219 -42.711 1.00 124.59 ? 26   SER B CB    1 
ATOM   7143  O OG    . SER B  2 26  ? -59.825  -30.482 -43.159 1.00 130.49 ? 26   SER B OG    1 
ATOM   7144  N N     . ILE B  2 27  ? -62.604  -33.437 -41.026 1.00 122.80 ? 27   ILE B N     1 
ATOM   7145  C CA    . ILE B  2 27  ? -63.683  -33.843 -40.112 1.00 122.48 ? 27   ILE B CA    1 
ATOM   7146  C C     . ILE B  2 27  ? -63.097  -34.438 -38.824 1.00 125.24 ? 27   ILE B C     1 
ATOM   7147  O O     . ILE B  2 27  ? -63.569  -34.097 -37.744 1.00 123.68 ? 27   ILE B O     1 
ATOM   7148  C CB    . ILE B  2 27  ? -64.691  -34.804 -40.785 1.00 127.14 ? 27   ILE B CB    1 
ATOM   7149  N N     . ASP B  2 28  ? -62.028  -35.265 -38.943 1.00 122.16 ? 28   ASP B N     1 
ATOM   7150  C CA    . ASP B  2 28  ? -61.310  -35.871 -37.816 1.00 122.16 ? 28   ASP B CA    1 
ATOM   7151  C C     . ASP B  2 28  ? -60.512  -34.826 -37.021 1.00 122.34 ? 28   ASP B C     1 
ATOM   7152  O O     . ASP B  2 28  ? -60.407  -34.954 -35.805 1.00 122.42 ? 28   ASP B O     1 
ATOM   7153  C CB    . ASP B  2 28  ? -60.363  -36.988 -38.297 1.00 125.97 ? 28   ASP B CB    1 
ATOM   7154  C CG    . ASP B  2 28  ? -61.035  -38.279 -38.734 1.00 138.91 ? 28   ASP B CG    1 
ATOM   7155  O OD1   . ASP B  2 28  ? -61.772  -38.877 -37.913 1.00 140.93 ? 28   ASP B OD1   1 
ATOM   7156  O OD2   . ASP B  2 28  ? -60.753  -38.741 -39.863 1.00 144.53 ? 28   ASP B OD2   1 
ATOM   7157  N N     . PHE B  2 29  ? -59.948  -33.808 -37.706 1.00 115.84 ? 29   PHE B N     1 
ATOM   7158  C CA    . PHE B  2 29  ? -59.144  -32.745 -37.097 1.00 113.92 ? 29   PHE B CA    1 
ATOM   7159  C C     . PHE B  2 29  ? -59.959  -31.815 -36.201 1.00 114.47 ? 29   PHE B C     1 
ATOM   7160  O O     . PHE B  2 29  ? -59.658  -31.708 -35.015 1.00 113.49 ? 29   PHE B O     1 
ATOM   7161  C CB    . PHE B  2 29  ? -58.370  -31.956 -38.176 1.00 115.36 ? 29   PHE B CB    1 
ATOM   7162  C CG    . PHE B  2 29  ? -57.594  -30.752 -37.691 1.00 116.21 ? 29   PHE B CG    1 
ATOM   7163  C CD1   . PHE B  2 29  ? -58.099  -29.469 -37.851 1.00 118.01 ? 29   PHE B CD1   1 
ATOM   7164  C CD2   . PHE B  2 29  ? -56.347  -30.901 -37.094 1.00 119.75 ? 29   PHE B CD2   1 
ATOM   7165  C CE1   . PHE B  2 29  ? -57.375  -28.355 -37.414 1.00 118.25 ? 29   PHE B CE1   1 
ATOM   7166  C CE2   . PHE B  2 29  ? -55.629  -29.785 -36.648 1.00 122.01 ? 29   PHE B CE2   1 
ATOM   7167  C CZ    . PHE B  2 29  ? -56.143  -28.520 -36.820 1.00 118.27 ? 29   PHE B CZ    1 
ATOM   7168  N N     . TYR B  2 30  ? -60.979  -31.142 -36.767 1.00 109.91 ? 30   TYR B N     1 
ATOM   7169  C CA    . TYR B  2 30  ? -61.834  -30.198 -36.045 1.00 108.82 ? 30   TYR B CA    1 
ATOM   7170  C C     . TYR B  2 30  ? -62.638  -30.833 -34.904 1.00 112.45 ? 30   TYR B C     1 
ATOM   7171  O O     . TYR B  2 30  ? -63.044  -30.113 -33.993 1.00 111.49 ? 30   TYR B O     1 
ATOM   7172  C CB    . TYR B  2 30  ? -62.742  -29.408 -37.004 1.00 110.05 ? 30   TYR B CB    1 
ATOM   7173  C CG    . TYR B  2 30  ? -61.996  -28.539 -37.997 1.00 112.27 ? 30   TYR B CG    1 
ATOM   7174  C CD1   . TYR B  2 30  ? -61.546  -27.269 -37.644 1.00 112.70 ? 30   TYR B CD1   1 
ATOM   7175  C CD2   . TYR B  2 30  ? -61.782  -28.965 -39.303 1.00 114.43 ? 30   TYR B CD2   1 
ATOM   7176  C CE1   . TYR B  2 30  ? -60.869  -26.460 -38.558 1.00 112.60 ? 30   TYR B CE1   1 
ATOM   7177  C CE2   . TYR B  2 30  ? -61.106  -28.167 -40.226 1.00 115.14 ? 30   TYR B CE2   1 
ATOM   7178  C CZ    . TYR B  2 30  ? -60.653  -26.914 -39.850 1.00 121.72 ? 30   TYR B CZ    1 
ATOM   7179  O OH    . TYR B  2 30  ? -59.989  -26.133 -40.764 1.00 123.69 ? 30   TYR B OH    1 
ATOM   7180  N N     . THR B  2 31  ? -62.846  -32.167 -34.934 1.00 109.88 ? 31   THR B N     1 
ATOM   7181  C CA    . THR B  2 31  ? -63.575  -32.892 -33.885 1.00 110.90 ? 31   THR B CA    1 
ATOM   7182  C C     . THR B  2 31  ? -62.663  -33.302 -32.725 1.00 116.51 ? 31   THR B C     1 
ATOM   7183  O O     . THR B  2 31  ? -63.051  -33.139 -31.566 1.00 116.75 ? 31   THR B O     1 
ATOM   7184  C CB    . THR B  2 31  ? -64.359  -34.091 -34.442 1.00 119.54 ? 31   THR B CB    1 
ATOM   7185  O OG1   . THR B  2 31  ? -63.514  -34.865 -35.294 1.00 120.06 ? 31   THR B OG1   1 
ATOM   7186  C CG2   . THR B  2 31  ? -65.629  -33.681 -35.175 1.00 117.56 ? 31   THR B CG2   1 
ATOM   7187  N N     . ASN B  2 32  ? -61.463  -33.841 -33.029 1.00 113.89 ? 32   ASN B N     1 
ATOM   7188  C CA    . ASN B  2 32  ? -60.497  -34.282 -32.013 1.00 114.68 ? 32   ASN B CA    1 
ATOM   7189  C C     . ASN B  2 32  ? -59.724  -33.113 -31.406 1.00 116.98 ? 32   ASN B C     1 
ATOM   7190  O O     . ASN B  2 32  ? -59.532  -33.081 -30.189 1.00 116.48 ? 32   ASN B O     1 
ATOM   7191  C CB    . ASN B  2 32  ? -59.520  -35.319 -32.588 1.00 116.60 ? 32   ASN B CB    1 
ATOM   7192  C CG    . ASN B  2 32  ? -60.147  -36.629 -33.028 1.00 132.87 ? 32   ASN B CG    1 
ATOM   7193  O OD1   . ASN B  2 32  ? -61.040  -37.185 -32.374 1.00 126.39 ? 32   ASN B OD1   1 
ATOM   7194  N ND2   . ASN B  2 32  ? -59.648  -37.180 -34.128 1.00 121.47 ? 32   ASN B ND2   1 
ATOM   7195  N N     . PHE B  2 33  ? -59.290  -32.158 -32.255 1.00 112.57 ? 33   PHE B N     1 
ATOM   7196  C CA    . PHE B  2 33  ? -58.501  -30.992 -31.856 1.00 111.54 ? 33   PHE B CA    1 
ATOM   7197  C C     . PHE B  2 33  ? -59.308  -29.792 -31.354 1.00 114.10 ? 33   PHE B C     1 
ATOM   7198  O O     . PHE B  2 33  ? -58.857  -29.117 -30.429 1.00 113.26 ? 33   PHE B O     1 
ATOM   7199  C CB    . PHE B  2 33  ? -57.532  -30.575 -32.978 1.00 112.91 ? 33   PHE B CB    1 
ATOM   7200  C CG    . PHE B  2 33  ? -56.429  -31.569 -33.248 1.00 116.44 ? 33   PHE B CG    1 
ATOM   7201  C CD1   . PHE B  2 33  ? -55.164  -31.403 -32.684 1.00 120.54 ? 33   PHE B CD1   1 
ATOM   7202  C CD2   . PHE B  2 33  ? -56.653  -32.676 -34.059 1.00 119.77 ? 33   PHE B CD2   1 
ATOM   7203  C CE1   . PHE B  2 33  ? -54.142  -32.326 -32.933 1.00 123.43 ? 33   PHE B CE1   1 
ATOM   7204  C CE2   . PHE B  2 33  ? -55.634  -33.599 -34.302 1.00 124.68 ? 33   PHE B CE2   1 
ATOM   7205  C CZ    . PHE B  2 33  ? -54.384  -33.416 -33.739 1.00 123.62 ? 33   PHE B CZ    1 
ATOM   7206  N N     . LEU B  2 34  ? -60.474  -29.506 -31.953 1.00 110.40 ? 34   LEU B N     1 
ATOM   7207  C CA    . LEU B  2 34  ? -61.268  -28.341 -31.543 1.00 109.29 ? 34   LEU B CA    1 
ATOM   7208  C C     . LEU B  2 34  ? -62.522  -28.603 -30.681 1.00 113.81 ? 34   LEU B C     1 
ATOM   7209  O O     . LEU B  2 34  ? -63.065  -27.657 -30.100 1.00 112.52 ? 34   LEU B O     1 
ATOM   7210  C CB    . LEU B  2 34  ? -61.578  -27.395 -32.725 1.00 108.08 ? 34   LEU B CB    1 
ATOM   7211  C CG    . LEU B  2 34  ? -60.417  -26.872 -33.595 1.00 112.17 ? 34   LEU B CG    1 
ATOM   7212  C CD1   . LEU B  2 34  ? -60.883  -25.717 -34.448 1.00 111.23 ? 34   LEU B CD1   1 
ATOM   7213  C CD2   . LEU B  2 34  ? -59.237  -26.396 -32.761 1.00 113.94 ? 34   LEU B CD2   1 
ATOM   7214  N N     . GLY B  2 35  ? -62.953  -29.861 -30.593 1.00 111.71 ? 35   GLY B N     1 
ATOM   7215  C CA    . GLY B  2 35  ? -64.114  -30.255 -29.798 1.00 112.48 ? 35   GLY B CA    1 
ATOM   7216  C C     . GLY B  2 35  ? -65.455  -30.089 -30.485 1.00 116.22 ? 35   GLY B C     1 
ATOM   7217  O O     . GLY B  2 35  ? -66.476  -29.921 -29.814 1.00 115.94 ? 35   GLY B O     1 
ATOM   7218  N N     . PHE B  2 36  ? -65.465  -30.144 -31.823 1.00 113.08 ? 36   PHE B N     1 
ATOM   7219  C CA    . PHE B  2 36  ? -66.682  -30.049 -32.624 1.00 113.67 ? 36   PHE B CA    1 
ATOM   7220  C C     . PHE B  2 36  ? -67.361  -31.424 -32.718 1.00 120.27 ? 36   PHE B C     1 
ATOM   7221  O O     . PHE B  2 36  ? -66.806  -32.421 -32.249 1.00 120.62 ? 36   PHE B O     1 
ATOM   7222  C CB    . PHE B  2 36  ? -66.360  -29.519 -34.031 1.00 114.66 ? 36   PHE B CB    1 
ATOM   7223  C CG    . PHE B  2 36  ? -66.205  -28.023 -34.129 1.00 114.72 ? 36   PHE B CG    1 
ATOM   7224  C CD1   . PHE B  2 36  ? -67.313  -27.204 -34.329 1.00 117.99 ? 36   PHE B CD1   1 
ATOM   7225  C CD2   . PHE B  2 36  ? -64.949  -27.433 -34.059 1.00 115.65 ? 36   PHE B CD2   1 
ATOM   7226  C CE1   . PHE B  2 36  ? -67.168  -25.819 -34.435 1.00 117.51 ? 36   PHE B CE1   1 
ATOM   7227  C CE2   . PHE B  2 36  ? -64.803  -26.048 -34.162 1.00 117.21 ? 36   PHE B CE2   1 
ATOM   7228  C CZ    . PHE B  2 36  ? -65.914  -25.249 -34.346 1.00 115.24 ? 36   PHE B CZ    1 
ATOM   7229  N N     . ALA B  2 37  ? -68.567  -31.473 -33.323 1.00 118.21 ? 37   ALA B N     1 
ATOM   7230  C CA    . ALA B  2 37  ? -69.341  -32.701 -33.505 1.00 120.22 ? 37   ALA B CA    1 
ATOM   7231  C C     . ALA B  2 37  ? -70.193  -32.649 -34.767 1.00 124.24 ? 37   ALA B C     1 
ATOM   7232  O O     . ALA B  2 37  ? -70.756  -31.598 -35.092 1.00 122.51 ? 37   ALA B O     1 
ATOM   7233  C CB    . ALA B  2 37  ? -70.226  -32.947 -32.291 1.00 122.53 ? 37   ALA B CB    1 
ATOM   7234  N N     . ILE B  2 38  ? -70.298  -33.791 -35.468 1.00 122.74 ? 38   ILE B N     1 
ATOM   7235  C CA    . ILE B  2 38  ? -71.109  -33.909 -36.678 1.00 123.82 ? 38   ILE B CA    1 
ATOM   7236  C C     . ILE B  2 38  ? -72.593  -33.902 -36.303 1.00 131.62 ? 38   ILE B C     1 
ATOM   7237  O O     . ILE B  2 38  ? -72.990  -34.610 -35.373 1.00 132.71 ? 38   ILE B O     1 
ATOM   7238  C CB    . ILE B  2 38  ? -70.721  -35.176 -37.469 1.00 127.88 ? 38   ILE B CB    1 
ATOM   7239  N N     . ARG B  2 39  ? -73.398  -33.065 -36.988 1.00 129.69 ? 39   ARG B N     1 
ATOM   7240  C CA    . ARG B  2 39  ? -74.840  -32.951 -36.739 1.00 131.82 ? 39   ARG B CA    1 
ATOM   7241  C C     . ARG B  2 39  ? -75.570  -34.205 -37.235 1.00 139.94 ? 39   ARG B C     1 
ATOM   7242  O O     . ARG B  2 39  ? -75.222  -34.745 -38.292 1.00 139.32 ? 39   ARG B O     1 
ATOM   7243  C CB    . ARG B  2 39  ? -75.422  -31.680 -37.378 1.00 130.86 ? 39   ARG B CB    1 
ATOM   7244  N N     . LYS B  2 40  ? -76.566  -34.667 -36.443 1.00 139.97 ? 40   LYS B N     1 
ATOM   7245  C CA    . LYS B  2 40  ? -77.376  -35.869 -36.679 1.00 142.97 ? 40   LYS B CA    1 
ATOM   7246  C C     . LYS B  2 40  ? -78.127  -35.868 -38.009 1.00 149.48 ? 40   LYS B C     1 
ATOM   7247  O O     . LYS B  2 40  ? -78.717  -34.853 -38.386 1.00 148.64 ? 40   LYS B O     1 
ATOM   7248  C CB    . LYS B  2 40  ? -78.349  -36.103 -35.510 1.00 147.29 ? 40   LYS B CB    1 
ATOM   7249  N N     . ASN B  2 41  ? -78.105  -37.027 -38.704 1.00 149.03 ? 41   ASN B N     1 
ATOM   7250  C CA    . ASN B  2 41  ? -78.750  -37.296 -39.997 1.00 151.42 ? 41   ASN B CA    1 
ATOM   7251  C C     . ASN B  2 41  ? -78.342  -36.327 -41.122 1.00 155.69 ? 41   ASN B C     1 
ATOM   7252  O O     . ASN B  2 41  ? -79.111  -35.428 -41.483 1.00 155.82 ? 41   ASN B O     1 
ATOM   7253  C CB    . ASN B  2 41  ? -80.279  -37.441 -39.861 1.00 155.67 ? 41   ASN B CB    1 
ATOM   7254  N N     . SER B  2 42  ? -77.122  -36.525 -41.673 1.00 151.81 ? 42   SER B N     1 
ATOM   7255  C CA    . SER B  2 42  ? -76.560  -35.710 -42.761 1.00 150.41 ? 42   SER B CA    1 
ATOM   7256  C C     . SER B  2 42  ? -77.303  -35.946 -44.086 1.00 157.00 ? 42   SER B C     1 
ATOM   7257  O O     . SER B  2 42  ? -77.516  -37.100 -44.475 1.00 158.61 ? 42   SER B O     1 
ATOM   7258  C CB    . SER B  2 42  ? -75.067  -35.987 -42.926 1.00 151.90 ? 42   SER B CB    1 
ATOM   7259  N N     . ASN B  2 43  ? -77.711  -34.845 -44.761 1.00 153.42 ? 43   ASN B N     1 
ATOM   7260  C CA    . ASN B  2 43  ? -78.435  -34.873 -46.040 1.00 155.13 ? 43   ASN B CA    1 
ATOM   7261  C C     . ASN B  2 43  ? -77.608  -35.503 -47.167 1.00 158.03 ? 43   ASN B C     1 
ATOM   7262  O O     . ASN B  2 43  ? -78.163  -36.237 -47.985 1.00 160.03 ? 43   ASN B O     1 
ATOM   7263  C CB    . ASN B  2 43  ? -78.902  -33.472 -46.432 1.00 156.18 ? 43   ASN B CB    1 
ATOM   7264  N N     . GLN B  2 44  ? -76.285  -35.226 -47.197 1.00 151.09 ? 44   GLN B N     1 
ATOM   7265  C CA    . GLN B  2 44  ? -75.345  -35.764 -48.184 1.00 150.00 ? 44   GLN B CA    1 
ATOM   7266  C C     . GLN B  2 44  ? -74.181  -36.460 -47.471 1.00 150.80 ? 44   GLN B C     1 
ATOM   7267  O O     . GLN B  2 44  ? -73.355  -35.788 -46.845 1.00 148.50 ? 44   GLN B O     1 
ATOM   7268  C CB    . GLN B  2 44  ? -74.841  -34.651 -49.118 1.00 150.10 ? 44   GLN B CB    1 
ATOM   7269  N N     . LYS B  2 45  ? -74.142  -37.814 -47.554 1.00 147.12 ? 45   LYS B N     1 
ATOM   7270  C CA    . LYS B  2 45  ? -73.147  -38.712 -46.947 1.00 154.59 ? 45   LYS B CA    1 
ATOM   7271  C C     . LYS B  2 45  ? -73.122  -38.685 -45.411 1.00 174.83 ? 45   LYS B C     1 
ATOM   7272  O O     . LYS B  2 45  ? -72.677  -37.718 -44.792 1.00 134.31 ? 45   LYS B O     1 
ATOM   7273  C CB    . LYS B  2 45  ? -71.746  -38.539 -47.562 1.00 155.32 ? 45   LYS B CB    1 
ATOM   7274  N N     . LEU B  2 49  ? -72.772  -30.505 -41.091 1.00 99.36  ? 49   LEU B N     1 
ATOM   7275  C CA    . LEU B  2 49  ? -72.567  -29.362 -40.207 1.00 97.44  ? 49   LEU B CA    1 
ATOM   7276  C C     . LEU B  2 49  ? -71.791  -29.764 -38.946 1.00 102.80 ? 49   LEU B C     1 
ATOM   7277  O O     . LEU B  2 49  ? -72.171  -30.716 -38.263 1.00 103.32 ? 49   LEU B O     1 
ATOM   7278  C CB    . LEU B  2 49  ? -73.917  -28.693 -39.821 1.00 97.95  ? 49   LEU B CB    1 
ATOM   7279  C CG    . LEU B  2 49  ? -74.467  -27.501 -40.650 1.00 101.74 ? 49   LEU B CG    1 
ATOM   7280  C CD1   . LEU B  2 49  ? -73.462  -26.381 -40.821 1.00 99.35  ? 49   LEU B CD1   1 
ATOM   7281  C CD2   . LEU B  2 49  ? -75.029  -27.934 -41.970 1.00 105.13 ? 49   LEU B CD2   1 
ATOM   7282  N N     . GLN B  2 50  ? -70.707  -29.025 -38.639 1.00 99.85  ? 50   GLN B N     1 
ATOM   7283  C CA    . GLN B  2 50  ? -69.874  -29.238 -37.456 1.00 100.07 ? 50   GLN B CA    1 
ATOM   7284  C C     . GLN B  2 50  ? -70.147  -28.148 -36.399 1.00 106.99 ? 50   GLN B C     1 
ATOM   7285  O O     . GLN B  2 50  ? -69.684  -27.009 -36.530 1.00 105.79 ? 50   GLN B O     1 
ATOM   7286  C CB    . GLN B  2 50  ? -68.383  -29.316 -37.829 1.00 100.05 ? 50   GLN B CB    1 
ATOM   7287  N N     . LEU B  2 51  ? -70.945  -28.501 -35.378 1.00 106.75 ? 51   LEU B N     1 
ATOM   7288  C CA    . LEU B  2 51  ? -71.321  -27.619 -34.276 1.00 107.05 ? 51   LEU B CA    1 
ATOM   7289  C C     . LEU B  2 51  ? -70.512  -27.985 -33.036 1.00 113.82 ? 51   LEU B C     1 
ATOM   7290  O O     . LEU B  2 51  ? -70.221  -29.164 -32.819 1.00 114.28 ? 51   LEU B O     1 
ATOM   7291  C CB    . LEU B  2 51  ? -72.822  -27.749 -33.984 1.00 108.95 ? 51   LEU B CB    1 
ATOM   7292  N N     . GLU B  2 52  ? -70.153  -26.983 -32.220 1.00 112.14 ? 52   GLU B N     1 
ATOM   7293  C CA    . GLU B  2 52  ? -69.375  -27.222 -31.009 1.00 113.32 ? 52   GLU B CA    1 
ATOM   7294  C C     . GLU B  2 52  ? -70.186  -27.803 -29.840 1.00 121.76 ? 52   GLU B C     1 
ATOM   7295  O O     . GLU B  2 52  ? -70.010  -28.981 -29.526 1.00 122.88 ? 52   GLU B O     1 
ATOM   7296  C CB    . GLU B  2 52  ? -68.539  -25.999 -30.613 1.00 112.85 ? 52   GLU B CB    1 
ATOM   7297  C CG    . GLU B  2 52  ? -67.050  -26.255 -30.756 1.00 125.26 ? 52   GLU B CG    1 
ATOM   7298  C CD    . GLU B  2 52  ? -66.140  -25.147 -30.267 1.00 157.27 ? 52   GLU B CD    1 
ATOM   7299  O OE1   . GLU B  2 52  ? -66.245  -24.013 -30.788 1.00 158.46 ? 52   GLU B OE1   1 
ATOM   7300  O OE2   . GLU B  2 52  ? -65.284  -25.427 -29.397 1.00 157.62 ? 52   GLU B OE2   1 
ATOM   7301  N N     . GLU B  2 53  ? -71.075  -27.002 -29.210 1.00 120.54 ? 53   GLU B N     1 
ATOM   7302  C CA    . GLU B  2 53  ? -71.902  -27.444 -28.074 1.00 123.44 ? 53   GLU B CA    1 
ATOM   7303  C C     . GLU B  2 53  ? -73.220  -26.655 -27.920 1.00 130.50 ? 53   GLU B C     1 
ATOM   7304  O O     . GLU B  2 53  ? -73.415  -25.644 -28.601 1.00 129.36 ? 53   GLU B O     1 
ATOM   7305  C CB    . GLU B  2 53  ? -71.088  -27.400 -26.766 1.00 124.74 ? 53   GLU B CB    1 
ATOM   7306  N N     . ASP B  2 54  ? -74.118  -27.125 -27.014 1.00 130.54 ? 54   ASP B N     1 
ATOM   7307  C CA    . ASP B  2 54  ? -75.415  -26.508 -26.691 1.00 132.39 ? 54   ASP B CA    1 
ATOM   7308  C C     . ASP B  2 54  ? -75.249  -25.129 -26.023 1.00 136.36 ? 54   ASP B C     1 
ATOM   7309  O O     . ASP B  2 54  ? -74.198  -24.856 -25.434 1.00 134.97 ? 54   ASP B O     1 
ATOM   7310  C CB    . ASP B  2 54  ? -76.239  -27.435 -25.784 1.00 137.13 ? 54   ASP B CB    1 
ATOM   7311  N N     . GLN B  2 55  ? -76.293  -24.265 -26.122 1.00 133.84 ? 55   GLN B N     1 
ATOM   7312  C CA    . GLN B  2 55  ? -76.346  -22.886 -25.589 1.00 132.63 ? 55   GLN B CA    1 
ATOM   7313  C C     . GLN B  2 55  ? -75.247  -21.961 -26.174 1.00 132.68 ? 55   GLN B C     1 
ATOM   7314  O O     . GLN B  2 55  ? -74.877  -20.954 -25.553 1.00 130.68 ? 55   GLN B O     1 
ATOM   7315  C CB    . GLN B  2 55  ? -76.375  -22.864 -24.043 1.00 135.11 ? 55   GLN B CB    1 
ATOM   7316  N N     . ASN B  2 56  ? -74.753  -22.312 -27.388 1.00 127.42 ? 56   ASN B N     1 
ATOM   7317  C CA    . ASN B  2 56  ? -73.704  -21.595 -28.110 1.00 124.20 ? 56   ASN B CA    1 
ATOM   7318  C C     . ASN B  2 56  ? -74.164  -21.152 -29.511 1.00 126.64 ? 56   ASN B C     1 
ATOM   7319  O O     . ASN B  2 56  ? -75.366  -21.163 -29.798 1.00 127.12 ? 56   ASN B O     1 
ATOM   7320  C CB    . ASN B  2 56  ? -72.428  -22.446 -28.174 1.00 123.66 ? 56   ASN B CB    1 
ATOM   7321  N N     . ASN B  2 57  ? -73.201  -20.727 -30.361 1.00 121.43 ? 57   ASN B N     1 
ATOM   7322  C CA    . ASN B  2 57  ? -73.431  -20.260 -31.733 1.00 120.89 ? 57   ASN B CA    1 
ATOM   7323  C C     . ASN B  2 57  ? -72.225  -20.524 -32.670 1.00 121.79 ? 57   ASN B C     1 
ATOM   7324  O O     . ASN B  2 57  ? -72.028  -19.810 -33.664 1.00 120.35 ? 57   ASN B O     1 
ATOM   7325  C CB    . ASN B  2 57  ? -73.845  -18.781 -31.737 1.00 123.09 ? 57   ASN B CB    1 
ATOM   7326  N N     . VAL B  2 58  ? -71.440  -21.573 -32.362 1.00 117.23 ? 58   VAL B N     1 
ATOM   7327  C CA    . VAL B  2 58  ? -70.266  -21.965 -33.153 1.00 115.30 ? 58   VAL B CA    1 
ATOM   7328  C C     . VAL B  2 58  ? -70.646  -23.014 -34.176 1.00 118.26 ? 58   VAL B C     1 
ATOM   7329  O O     . VAL B  2 58  ? -71.244  -24.032 -33.816 1.00 119.53 ? 58   VAL B O     1 
ATOM   7330  C CB    . VAL B  2 58  ? -69.042  -22.425 -32.315 1.00 118.61 ? 58   VAL B CB    1 
ATOM   7331  C CG1   . VAL B  2 58  ? -67.779  -21.698 -32.762 1.00 116.39 ? 58   VAL B CG1   1 
ATOM   7332  C CG2   . VAL B  2 58  ? -69.277  -22.263 -30.811 1.00 118.92 ? 58   VAL B CG2   1 
ATOM   7333  N N     . SER B  2 59  ? -70.294  -22.768 -35.452 1.00 112.68 ? 59   SER B N     1 
ATOM   7334  C CA    . SER B  2 59  ? -70.593  -23.674 -36.564 1.00 112.62 ? 59   SER B CA    1 
ATOM   7335  C C     . SER B  2 59  ? -69.634  -23.537 -37.747 1.00 112.72 ? 59   SER B C     1 
ATOM   7336  O O     . SER B  2 59  ? -69.261  -22.430 -38.127 1.00 110.62 ? 59   SER B O     1 
ATOM   7337  C CB    . SER B  2 59  ? -72.039  -23.499 -37.027 1.00 118.02 ? 59   SER B CB    1 
ATOM   7338  O OG    . SER B  2 59  ? -72.492  -22.162 -36.862 1.00 126.32 ? 59   SER B OG    1 
ATOM   7339  N N     . ILE B  2 60  ? -69.245  -24.678 -38.324 1.00 108.87 ? 60   ILE B N     1 
ATOM   7340  C CA    . ILE B  2 60  ? -68.380  -24.777 -39.499 1.00 107.46 ? 60   ILE B CA    1 
ATOM   7341  C C     . ILE B  2 60  ? -69.042  -25.731 -40.505 1.00 111.58 ? 60   ILE B C     1 
ATOM   7342  O O     . ILE B  2 60  ? -69.275  -26.894 -40.172 1.00 112.53 ? 60   ILE B O     1 
ATOM   7343  C CB    . ILE B  2 60  ? -66.955  -25.231 -39.106 1.00 109.57 ? 60   ILE B CB    1 
ATOM   7344  N N     . GLN B  2 61  ? -69.396  -25.226 -41.708 1.00 107.13 ? 61   GLN B N     1 
ATOM   7345  C CA    . GLN B  2 61  ? -70.047  -26.012 -42.772 1.00 107.76 ? 61   GLN B CA    1 
ATOM   7346  C C     . GLN B  2 61  ? -69.016  -26.626 -43.740 1.00 109.43 ? 61   GLN B C     1 
ATOM   7347  O O     . GLN B  2 61  ? -68.152  -25.909 -44.251 1.00 108.27 ? 61   GLN B O     1 
ATOM   7348  C CB    . GLN B  2 61  ? -71.071  -25.155 -43.537 1.00 109.66 ? 61   GLN B CB    1 
ATOM   7349  N N     . LEU B  2 62  ? -69.105  -27.951 -43.982 1.00 104.89 ? 62   LEU B N     1 
ATOM   7350  C CA    . LEU B  2 62  ? -68.193  -28.672 -44.877 1.00 103.83 ? 62   LEU B CA    1 
ATOM   7351  C C     . LEU B  2 62  ? -68.937  -29.287 -46.062 1.00 107.82 ? 62   LEU B C     1 
ATOM   7352  O O     . LEU B  2 62  ? -69.879  -30.056 -45.862 1.00 108.43 ? 62   LEU B O     1 
ATOM   7353  C CB    . LEU B  2 62  ? -67.404  -29.745 -44.111 1.00 103.63 ? 62   LEU B CB    1 
ATOM   7354  N N     . ILE B  2 63  ? -68.515  -28.933 -47.295 1.00 103.84 ? 63   ILE B N     1 
ATOM   7355  C CA    . ILE B  2 63  ? -69.096  -29.419 -48.553 1.00 105.24 ? 63   ILE B CA    1 
ATOM   7356  C C     . ILE B  2 63  ? -68.032  -30.117 -49.414 1.00 110.25 ? 63   ILE B C     1 
ATOM   7357  O O     . ILE B  2 63  ? -66.921  -29.606 -49.536 1.00 108.66 ? 63   ILE B O     1 
ATOM   7358  C CB    . ILE B  2 63  ? -69.797  -28.275 -49.319 1.00 108.51 ? 63   ILE B CB    1 
ATOM   7359  N N     . LEU B  2 64  ? -68.377  -31.283 -50.006 1.00 109.33 ? 64   LEU B N     1 
ATOM   7360  C CA    . LEU B  2 64  ? -67.475  -32.096 -50.840 1.00 110.01 ? 64   LEU B CA    1 
ATOM   7361  C C     . LEU B  2 64  ? -67.445  -31.716 -52.331 1.00 113.74 ? 64   LEU B C     1 
ATOM   7362  O O     . LEU B  2 64  ? -66.859  -32.457 -53.128 1.00 113.88 ? 64   LEU B O     1 
ATOM   7363  C CB    . LEU B  2 64  ? -67.803  -33.589 -50.673 1.00 111.70 ? 64   LEU B CB    1 
ATOM   7364  N N     . ASP B  2 65  ? -68.051  -30.564 -52.700 1.00 109.95 ? 65   ASP B N     1 
ATOM   7365  C CA    . ASP B  2 65  ? -68.104  -30.063 -54.080 1.00 111.07 ? 65   ASP B CA    1 
ATOM   7366  C C     . ASP B  2 65  ? -66.715  -29.653 -54.593 1.00 113.59 ? 65   ASP B C     1 
ATOM   7367  O O     . ASP B  2 65  ? -66.009  -28.949 -53.870 1.00 111.04 ? 65   ASP B O     1 
ATOM   7368  C CB    . ASP B  2 65  ? -69.091  -28.892 -54.202 1.00 112.93 ? 65   ASP B CB    1 
ATOM   7369  N N     . PRO B  2 66  ? -66.302  -30.082 -55.821 1.00 111.23 ? 66   PRO B N     1 
ATOM   7370  C CA    . PRO B  2 66  ? -64.964  -29.711 -56.325 1.00 110.44 ? 66   PRO B CA    1 
ATOM   7371  C C     . PRO B  2 66  ? -64.816  -28.226 -56.675 1.00 114.06 ? 66   PRO B C     1 
ATOM   7372  O O     . PRO B  2 66  ? -64.830  -27.827 -57.848 1.00 114.75 ? 66   PRO B O     1 
ATOM   7373  C CB    . PRO B  2 66  ? -64.758  -30.644 -57.515 1.00 114.26 ? 66   PRO B CB    1 
ATOM   7374  C CG    . PRO B  2 66  ? -66.123  -30.938 -57.993 1.00 120.27 ? 66   PRO B CG    1 
ATOM   7375  C CD    . PRO B  2 66  ? -67.021  -30.933 -56.792 1.00 114.76 ? 66   PRO B CD    1 
ATOM   7376  N N     . GLU B  2 67  ? -64.664  -27.412 -55.609 1.00 108.59 ? 67   GLU B N     1 
ATOM   7377  C CA    . GLU B  2 67  ? -64.479  -25.965 -55.623 1.00 107.49 ? 67   GLU B CA    1 
ATOM   7378  C C     . GLU B  2 67  ? -63.075  -25.585 -55.099 1.00 109.67 ? 67   GLU B C     1 
ATOM   7379  O O     . GLU B  2 67  ? -62.616  -24.470 -55.359 1.00 108.82 ? 67   GLU B O     1 
ATOM   7380  C CB    . GLU B  2 67  ? -65.579  -25.281 -54.798 1.00 107.82 ? 67   GLU B CB    1 
ATOM   7381  N N     . HIS B  2 68  ? -62.398  -26.512 -54.373 1.00 105.28 ? 68   HIS B N     1 
ATOM   7382  C CA    . HIS B  2 68  ? -61.038  -26.336 -53.851 1.00 104.37 ? 68   HIS B CA    1 
ATOM   7383  C C     . HIS B  2 68  ? -60.167  -27.494 -54.346 1.00 110.37 ? 68   HIS B C     1 
ATOM   7384  O O     . HIS B  2 68  ? -60.536  -28.647 -54.130 1.00 111.76 ? 68   HIS B O     1 
ATOM   7385  C CB    . HIS B  2 68  ? -61.049  -26.277 -52.320 1.00 103.22 ? 68   HIS B CB    1 
ATOM   7386  N N     . ALA B  2 69  ? -59.045  -27.198 -55.045 1.00 106.92 ? 69   ALA B N     1 
ATOM   7387  C CA    . ALA B  2 69  ? -58.160  -28.219 -55.634 1.00 108.24 ? 69   ALA B CA    1 
ATOM   7388  C C     . ALA B  2 69  ? -57.155  -28.839 -54.659 1.00 110.26 ? 69   ALA B C     1 
ATOM   7389  O O     . ALA B  2 69  ? -56.668  -28.151 -53.759 1.00 107.87 ? 69   ALA B O     1 
ATOM   7390  C CB    . ALA B  2 69  ? -57.442  -27.662 -56.857 1.00 110.66 ? 69   ALA B CB    1 
ATOM   7391  N N     . ALA B  2 70  ? -56.851  -30.148 -54.847 1.00 107.40 ? 70   ALA B N     1 
ATOM   7392  C CA    . ALA B  2 70  ? -55.909  -30.915 -54.019 1.00 106.63 ? 70   ALA B CA    1 
ATOM   7393  C C     . ALA B  2 70  ? -54.468  -30.458 -54.225 1.00 109.33 ? 70   ALA B C     1 
ATOM   7394  O O     . ALA B  2 70  ? -53.690  -30.473 -53.272 1.00 107.95 ? 70   ALA B O     1 
ATOM   7395  C CB    . ALA B  2 70  ? -56.035  -32.404 -54.302 1.00 108.95 ? 70   ALA B CB    1 
ATOM   7396  N N     . SER B  2 71  ? -54.123  -30.040 -55.463 1.00 105.98 ? 71   SER B N     1 
ATOM   7397  C CA    . SER B  2 71  ? -52.793  -29.553 -55.831 1.00 106.05 ? 71   SER B CA    1 
ATOM   7398  C C     . SER B  2 71  ? -52.503  -28.179 -55.213 1.00 105.40 ? 71   SER B C     1 
ATOM   7399  O O     . SER B  2 71  ? -51.411  -27.978 -54.683 1.00 105.34 ? 71   SER B O     1 
ATOM   7400  C CB    . SER B  2 71  ? -52.645  -29.494 -57.348 1.00 111.24 ? 71   SER B CB    1 
ATOM   7401  N N     . VAL B  2 72  ? -53.485  -27.249 -55.274 1.00 97.74  ? 72   VAL B N     1 
ATOM   7402  C CA    . VAL B  2 72  ? -53.379  -25.881 -54.743 1.00 94.74  ? 72   VAL B CA    1 
ATOM   7403  C C     . VAL B  2 72  ? -53.221  -25.914 -53.205 1.00 95.59  ? 72   VAL B C     1 
ATOM   7404  O O     . VAL B  2 72  ? -52.262  -25.340 -52.683 1.00 94.93  ? 72   VAL B O     1 
ATOM   7405  C CB    . VAL B  2 72  ? -54.550  -24.948 -55.210 1.00 96.69  ? 72   VAL B CB    1 
ATOM   7406  C CG1   . VAL B  2 72  ? -54.331  -23.502 -54.758 1.00 94.74  ? 72   VAL B CG1   1 
ATOM   7407  C CG2   . VAL B  2 72  ? -54.756  -25.010 -56.723 1.00 98.33  ? 72   VAL B CG2   1 
ATOM   7408  N N     . SER B  2 73  ? -54.154  -26.614 -52.504 1.00 89.14  ? 73   SER B N     1 
ATOM   7409  C CA    . SER B  2 73  ? -54.200  -26.786 -51.049 1.00 85.47  ? 73   SER B CA    1 
ATOM   7410  C C     . SER B  2 73  ? -52.919  -27.413 -50.490 1.00 88.47  ? 73   SER B C     1 
ATOM   7411  O O     . SER B  2 73  ? -52.437  -26.951 -49.456 1.00 86.65  ? 73   SER B O     1 
ATOM   7412  C CB    . SER B  2 73  ? -55.412  -27.620 -50.648 1.00 87.20  ? 73   SER B CB    1 
ATOM   7413  N N     . GLN B  2 74  ? -52.354  -28.439 -51.181 1.00 86.16  ? 74   GLN B N     1 
ATOM   7414  C CA    . GLN B  2 74  ? -51.118  -29.111 -50.770 1.00 86.48  ? 74   GLN B CA    1 
ATOM   7415  C C     . GLN B  2 74  ? -49.934  -28.149 -50.840 1.00 89.00  ? 74   GLN B C     1 
ATOM   7416  O O     . GLN B  2 74  ? -49.134  -28.109 -49.902 1.00 88.01  ? 74   GLN B O     1 
ATOM   7417  C CB    . GLN B  2 74  ? -50.862  -30.365 -51.613 1.00 90.02  ? 74   GLN B CB    1 
ATOM   7418  N N     . ILE B  2 75  ? -49.854  -27.348 -51.931 1.00 85.73  ? 75   ILE B N     1 
ATOM   7419  C CA    . ILE B  2 75  ? -48.803  -26.348 -52.156 1.00 86.69  ? 75   ILE B CA    1 
ATOM   7420  C C     . ILE B  2 75  ? -48.890  -25.220 -51.125 1.00 93.54  ? 75   ILE B C     1 
ATOM   7421  O O     . ILE B  2 75  ? -47.852  -24.781 -50.628 1.00 94.70  ? 75   ILE B O     1 
ATOM   7422  C CB    . ILE B  2 75  ? -48.737  -25.880 -53.651 1.00 90.19  ? 75   ILE B CB    1 
ATOM   7423  C CG1   . ILE B  2 75  ? -47.965  -26.936 -54.511 1.00 93.74  ? 75   ILE B CG1   1 
ATOM   7424  C CG2   . ILE B  2 75  ? -48.135  -24.468 -53.839 1.00 87.91  ? 75   ILE B CG2   1 
ATOM   7425  C CD1   . ILE B  2 75  ? -48.406  -27.095 -56.037 1.00 90.27  ? 75   ILE B CD1   1 
ATOM   7426  N N     . ASP B  2 76  ? -50.119  -24.800 -50.760 1.00 90.27  ? 76   ASP B N     1 
ATOM   7427  C CA    . ASP B  2 76  ? -50.358  -23.745 -49.773 1.00 89.17  ? 76   ASP B CA    1 
ATOM   7428  C C     . ASP B  2 76  ? -49.916  -24.164 -48.350 1.00 96.54  ? 76   ASP B C     1 
ATOM   7429  O O     . ASP B  2 76  ? -49.377  -23.328 -47.606 1.00 96.04  ? 76   ASP B O     1 
ATOM   7430  C CB    . ASP B  2 76  ? -51.830  -23.291 -49.799 1.00 88.67  ? 76   ASP B CB    1 
ATOM   7431  N N     . GLN B  2 77  ? -50.128  -25.461 -47.987 1.00 94.58  ? 77   GLN B N     1 
ATOM   7432  C CA    . GLN B  2 77  ? -49.761  -26.032 -46.681 1.00 94.08  ? 77   GLN B CA    1 
ATOM   7433  C C     . GLN B  2 77  ? -48.251  -25.999 -46.465 1.00 99.15  ? 77   GLN B C     1 
ATOM   7434  O O     . GLN B  2 77  ? -47.792  -25.549 -45.413 1.00 97.83  ? 77   GLN B O     1 
ATOM   7435  C CB    . GLN B  2 77  ? -50.324  -27.454 -46.521 1.00 95.75  ? 77   GLN B CB    1 
ATOM   7436  C CG    . GLN B  2 77  ? -51.801  -27.464 -46.133 1.00 109.19 ? 77   GLN B CG    1 
ATOM   7437  C CD    . GLN B  2 77  ? -52.500  -28.767 -46.427 1.00 136.30 ? 77   GLN B CD    1 
ATOM   7438  O OE1   . GLN B  2 77  ? -52.463  -29.290 -47.548 1.00 135.24 ? 77   GLN B OE1   1 
ATOM   7439  N NE2   . GLN B  2 77  ? -53.220  -29.284 -45.444 1.00 131.32 ? 77   GLN B NE2   1 
ATOM   7440  N N     . ASN B  2 78  ? -47.487  -26.428 -47.488 1.00 97.95  ? 78   ASN B N     1 
ATOM   7441  C CA    . ASN B  2 78  ? -46.025  -26.424 -47.486 1.00 100.17 ? 78   ASN B CA    1 
ATOM   7442  C C     . ASN B  2 78  ? -45.485  -24.987 -47.550 1.00 103.99 ? 78   ASN B C     1 
ATOM   7443  O O     . ASN B  2 78  ? -44.432  -24.715 -46.969 1.00 105.49 ? 78   ASN B O     1 
ATOM   7444  C CB    . ASN B  2 78  ? -45.479  -27.256 -48.649 1.00 102.48 ? 78   ASN B CB    1 
ATOM   7445  N N     . ILE B  2 79  ? -46.215  -24.071 -48.245 1.00 97.95  ? 79   ILE B N     1 
ATOM   7446  C CA    . ILE B  2 79  ? -45.862  -22.654 -48.415 1.00 96.60  ? 79   ILE B CA    1 
ATOM   7447  C C     . ILE B  2 79  ? -45.869  -21.922 -47.079 1.00 97.42  ? 79   ILE B C     1 
ATOM   7448  O O     . ILE B  2 79  ? -45.018  -21.058 -46.840 1.00 96.45  ? 79   ILE B O     1 
ATOM   7449  C CB    . ILE B  2 79  ? -46.769  -21.965 -49.462 1.00 98.41  ? 79   ILE B CB    1 
ATOM   7450  N N     . ARG B  2 80  ? -46.821  -22.303 -46.200 1.00 92.70  ? 80   ARG B N     1 
ATOM   7451  C CA    . ARG B  2 80  ? -46.974  -21.760 -44.850 1.00 90.73  ? 80   ARG B CA    1 
ATOM   7452  C C     . ARG B  2 80  ? -45.799  -22.192 -43.945 1.00 96.18  ? 80   ARG B C     1 
ATOM   7453  O O     . ARG B  2 80  ? -45.491  -21.489 -42.980 1.00 95.54  ? 80   ARG B O     1 
ATOM   7454  C CB    . ARG B  2 80  ? -48.335  -22.160 -44.247 1.00 88.00  ? 80   ARG B CB    1 
ATOM   7455  N N     . ASN B  2 81  ? -45.118  -23.319 -44.283 1.00 94.08  ? 81   ASN B N     1 
ATOM   7456  C CA    . ASN B  2 81  ? -43.956  -23.815 -43.541 1.00 94.99  ? 81   ASN B CA    1 
ATOM   7457  C C     . ASN B  2 81  ? -42.710  -22.954 -43.818 1.00 98.63  ? 81   ASN B C     1 
ATOM   7458  O O     . ASN B  2 81  ? -41.797  -23.321 -44.558 1.00 99.61  ? 81   ASN B O     1 
ATOM   7459  C CB    . ASN B  2 81  ? -43.747  -25.316 -43.732 1.00 95.92  ? 81   ASN B CB    1 
ATOM   7460  C CG    . ASN B  2 81  ? -44.871  -26.139 -43.135 1.00 107.34 ? 81   ASN B CG    1 
ATOM   7461  O OD1   . ASN B  2 81  ? -44.997  -26.278 -41.910 1.00 91.25  ? 81   ASN B OD1   1 
ATOM   7462  N ND2   . ASN B  2 81  ? -45.732  -26.681 -43.988 1.00 98.60  ? 81   ASN B ND2   1 
ATOM   7463  N N     . LEU B  2 82  ? -42.753  -21.754 -43.223 1.00 93.77  ? 82   LEU B N     1 
ATOM   7464  C CA    . LEU B  2 82  ? -41.775  -20.674 -43.207 1.00 94.26  ? 82   LEU B CA    1 
ATOM   7465  C C     . LEU B  2 82  ? -42.148  -19.833 -41.969 1.00 94.38  ? 82   LEU B C     1 
ATOM   7466  O O     . LEU B  2 82  ? -43.202  -19.185 -41.962 1.00 90.33  ? 82   LEU B O     1 
ATOM   7467  C CB    . LEU B  2 82  ? -41.877  -19.845 -44.500 1.00 94.23  ? 82   LEU B CB    1 
ATOM   7468  N N     . THR B  2 83  ? -41.333  -19.930 -40.892 1.00 91.72  ? 83   THR B N     1 
ATOM   7469  C CA    . THR B  2 83  ? -41.568  -19.239 -39.614 1.00 102.41 ? 83   THR B CA    1 
ATOM   7470  C C     . THR B  2 83  ? -40.466  -18.220 -39.286 1.00 107.08 ? 83   THR B C     1 
ATOM   7471  O O     . THR B  2 83  ? -40.093  -17.413 -40.139 1.00 59.12  ? 83   THR B O     1 
ATOM   7472  C CB    . THR B  2 83  ? -41.788  -20.255 -38.471 1.00 106.31 ? 83   THR B CB    1 
ATOM   7473  O OG1   . THR B  2 83  ? -40.579  -20.978 -38.232 1.00 109.11 ? 83   THR B OG1   1 
ATOM   7474  C CG2   . THR B  2 83  ? -42.950  -21.225 -38.742 1.00 99.34  ? 83   THR B CG2   1 
ATOM   7475  N N     . ILE B  2 94  ? -48.370  -15.235 -45.948 1.00 81.69  ? 94   ILE B N     1 
ATOM   7476  C CA    . ILE B  2 94  ? -49.568  -14.509 -45.494 1.00 78.97  ? 94   ILE B CA    1 
ATOM   7477  C C     . ILE B  2 94  ? -50.801  -14.989 -46.255 1.00 83.35  ? 94   ILE B C     1 
ATOM   7478  O O     . ILE B  2 94  ? -50.727  -15.271 -47.449 1.00 83.25  ? 94   ILE B O     1 
ATOM   7479  C CB    . ILE B  2 94  ? -49.422  -12.963 -45.538 1.00 81.01  ? 94   ILE B CB    1 
ATOM   7480  N N     . GLN B  2 95  ? -51.932  -15.080 -45.547 1.00 79.89  ? 95   GLN B N     1 
ATOM   7481  C CA    . GLN B  2 95  ? -53.219  -15.572 -46.036 1.00 80.01  ? 95   GLN B CA    1 
ATOM   7482  C C     . GLN B  2 95  ? -54.372  -15.122 -45.102 1.00 88.19  ? 95   GLN B C     1 
ATOM   7483  O O     . GLN B  2 95  ? -54.180  -14.981 -43.883 1.00 88.17  ? 95   GLN B O     1 
ATOM   7484  C CB    . GLN B  2 95  ? -53.169  -17.106 -46.051 1.00 81.54  ? 95   GLN B CB    1 
ATOM   7485  C CG    . GLN B  2 95  ? -54.200  -17.795 -46.928 1.00 88.71  ? 95   GLN B CG    1 
ATOM   7486  C CD    . GLN B  2 95  ? -54.355  -19.224 -46.485 1.00 87.83  ? 95   GLN B CD    1 
ATOM   7487  O OE1   . GLN B  2 95  ? -55.111  -19.516 -45.541 1.00 82.76  ? 95   GLN B OE1   1 
ATOM   7488  N NE2   . GLN B  2 95  ? -53.571  -20.130 -47.094 1.00 56.89  ? 95   GLN B NE2   1 
ATOM   7489  N N     . SER B  2 96  ? -55.576  -14.927 -45.685 1.00 87.32  ? 96   SER B N     1 
ATOM   7490  C CA    . SER B  2 96  ? -56.796  -14.568 -44.963 1.00 86.54  ? 96   SER B CA    1 
ATOM   7491  C C     . SER B  2 96  ? -57.186  -15.733 -44.042 1.00 91.10  ? 96   SER B C     1 
ATOM   7492  O O     . SER B  2 96  ? -57.056  -16.903 -44.429 1.00 93.20  ? 96   SER B O     1 
ATOM   7493  C CB    . SER B  2 96  ? -57.927  -14.235 -45.938 1.00 91.95  ? 96   SER B CB    1 
ATOM   7494  O OG    . SER B  2 96  ? -58.440  -15.373 -46.614 1.00 106.48 ? 96   SER B OG    1 
ATOM   7495  N N     . ASN B  2 97  ? -57.609  -15.412 -42.818 1.00 85.67  ? 97   ASN B N     1 
ATOM   7496  C CA    . ASN B  2 97  ? -57.944  -16.407 -41.805 1.00 85.18  ? 97   ASN B CA    1 
ATOM   7497  C C     . ASN B  2 97  ? -59.166  -16.045 -40.938 1.00 87.19  ? 97   ASN B C     1 
ATOM   7498  O O     . ASN B  2 97  ? -59.753  -14.958 -41.058 1.00 85.30  ? 97   ASN B O     1 
ATOM   7499  C CB    . ASN B  2 97  ? -56.721  -16.649 -40.913 1.00 86.25  ? 97   ASN B CB    1 
ATOM   7500  C CG    . ASN B  2 97  ? -56.130  -15.383 -40.366 1.00 105.59 ? 97   ASN B CG    1 
ATOM   7501  O OD1   . ASN B  2 97  ? -55.501  -14.607 -41.105 1.00 99.15  ? 97   ASN B OD1   1 
ATOM   7502  N ND2   . ASN B  2 97  ? -56.353  -15.135 -39.071 1.00 95.54  ? 97   ASN B ND2   1 
ATOM   7503  N N     . ILE B  2 98  ? -59.518  -16.989 -40.050 1.00 83.03  ? 98   ILE B N     1 
ATOM   7504  C CA    . ILE B  2 98  ? -60.616  -16.911 -39.107 1.00 81.43  ? 98   ILE B CA    1 
ATOM   7505  C C     . ILE B  2 98  ? -60.078  -17.181 -37.700 1.00 84.31  ? 98   ILE B C     1 
ATOM   7506  O O     . ILE B  2 98  ? -59.358  -18.163 -37.499 1.00 84.94  ? 98   ILE B O     1 
ATOM   7507  C CB    . ILE B  2 98  ? -61.768  -17.864 -39.570 1.00 84.74  ? 98   ILE B CB    1 
ATOM   7508  C CG1   . ILE B  2 98  ? -62.941  -17.070 -40.135 1.00 85.63  ? 98   ILE B CG1   1 
ATOM   7509  C CG2   . ILE B  2 98  ? -62.233  -18.892 -38.530 1.00 84.67  ? 98   ILE B CG2   1 
ATOM   7510  C CD1   . ILE B  2 98  ? -62.798  -16.760 -41.592 1.00 101.04 ? 98   ILE B CD1   1 
ATOM   7511  N N     . ALA B  2 99  ? -60.402  -16.296 -36.745 1.00 78.66  ? 99   ALA B N     1 
ATOM   7512  C CA    . ALA B  2 99  ? -59.985  -16.454 -35.362 1.00 78.14  ? 99   ALA B CA    1 
ATOM   7513  C C     . ALA B  2 99  ? -61.146  -16.869 -34.462 1.00 81.85  ? 99   ALA B C     1 
ATOM   7514  O O     . ALA B  2 99  ? -62.287  -16.483 -34.708 1.00 81.38  ? 99   ALA B O     1 
ATOM   7515  C CB    . ALA B  2 99  ? -59.345  -15.179 -34.860 1.00 78.21  ? 99   ALA B CB    1 
ATOM   7516  N N     . PHE B  2 100 ? -60.850  -17.668 -33.432 1.00 79.04  ? 100  PHE B N     1 
ATOM   7517  C CA    . PHE B  2 100 ? -61.833  -18.164 -32.471 1.00 79.86  ? 100  PHE B CA    1 
ATOM   7518  C C     . PHE B  2 100 ? -61.552  -17.630 -31.061 1.00 85.31  ? 100  PHE B C     1 
ATOM   7519  O O     . PHE B  2 100 ? -60.388  -17.473 -30.686 1.00 84.56  ? 100  PHE B O     1 
ATOM   7520  C CB    . PHE B  2 100 ? -61.811  -19.706 -32.427 1.00 82.81  ? 100  PHE B CB    1 
ATOM   7521  C CG    . PHE B  2 100 ? -62.199  -20.436 -33.694 1.00 84.50  ? 100  PHE B CG    1 
ATOM   7522  C CD1   . PHE B  2 100 ? -63.534  -20.664 -34.003 1.00 87.43  ? 100  PHE B CD1   1 
ATOM   7523  C CD2   . PHE B  2 100 ? -61.229  -20.967 -34.535 1.00 86.72  ? 100  PHE B CD2   1 
ATOM   7524  C CE1   . PHE B  2 100 ? -63.890  -21.373 -35.154 1.00 89.11  ? 100  PHE B CE1   1 
ATOM   7525  C CE2   . PHE B  2 100 ? -61.586  -21.664 -35.694 1.00 90.19  ? 100  PHE B CE2   1 
ATOM   7526  C CZ    . PHE B  2 100 ? -62.914  -21.863 -35.995 1.00 88.63  ? 100  PHE B CZ    1 
ATOM   7527  N N     . LYS B  2 101 ? -62.616  -17.378 -30.269 1.00 83.21  ? 101  LYS B N     1 
ATOM   7528  C CA    . LYS B  2 101 ? -62.471  -16.958 -28.873 1.00 83.25  ? 101  LYS B CA    1 
ATOM   7529  C C     . LYS B  2 101 ? -62.303  -18.262 -28.074 1.00 91.02  ? 101  LYS B C     1 
ATOM   7530  O O     . LYS B  2 101 ? -63.224  -19.082 -28.075 1.00 92.78  ? 101  LYS B O     1 
ATOM   7531  C CB    . LYS B  2 101 ? -63.714  -16.189 -28.378 1.00 84.61  ? 101  LYS B CB    1 
ATOM   7532  C CG    . LYS B  2 101 ? -63.880  -14.773 -28.930 1.00 91.85  ? 101  LYS B CG    1 
ATOM   7533  C CD    . LYS B  2 101 ? -64.997  -13.972 -28.203 1.00 98.95  ? 101  LYS B CD    1 
ATOM   7534  C CE    . LYS B  2 101 ? -66.424  -14.217 -28.681 1.00 109.39 ? 101  LYS B CE    1 
ATOM   7535  N NZ    . LYS B  2 101 ? -66.812  -13.363 -29.846 1.00 118.00 ? 101  LYS B NZ    1 
ATOM   7536  N N     . SER B  2 102 ? -61.118  -18.495 -27.462 1.00 87.63  ? 102  SER B N     1 
ATOM   7537  C CA    . SER B  2 102 ? -60.859  -19.712 -26.680 1.00 88.57  ? 102  SER B CA    1 
ATOM   7538  C C     . SER B  2 102 ? -59.974  -19.449 -25.475 1.00 92.31  ? 102  SER B C     1 
ATOM   7539  O O     . SER B  2 102 ? -58.911  -18.848 -25.624 1.00 91.69  ? 102  SER B O     1 
ATOM   7540  C CB    . SER B  2 102 ? -60.257  -20.809 -27.550 1.00 92.87  ? 102  SER B CB    1 
ATOM   7541  O OG    . SER B  2 102 ? -60.205  -22.028 -26.830 1.00 105.12 ? 102  SER B OG    1 
ATOM   7542  N N     . SER B  2 103 ? -60.423  -19.898 -24.280 1.00 89.83  ? 103  SER B N     1 
ATOM   7543  C CA    . SER B  2 103 ? -59.722  -19.742 -22.993 1.00 90.23  ? 103  SER B CA    1 
ATOM   7544  C C     . SER B  2 103 ? -58.584  -20.760 -22.856 1.00 94.32  ? 103  SER B C     1 
ATOM   7545  O O     . SER B  2 103 ? -58.706  -21.885 -23.360 1.00 94.67  ? 103  SER B O     1 
ATOM   7546  C CB    . SER B  2 103 ? -60.698  -19.879 -21.829 1.00 94.19  ? 103  SER B CB    1 
ATOM   7547  O OG    . SER B  2 103 ? -61.322  -21.155 -21.817 1.00 101.36 ? 103  SER B OG    1 
ATOM   7548  N N     . SER B  2 104 ? -57.490  -20.364 -22.153 1.00 89.77  ? 104  SER B N     1 
ATOM   7549  C CA    . SER B  2 104 ? -56.272  -21.163 -21.915 1.00 90.42  ? 104  SER B CA    1 
ATOM   7550  C C     . SER B  2 104 ? -55.715  -21.823 -23.183 1.00 92.86  ? 104  SER B C     1 
ATOM   7551  O O     . SER B  2 104 ? -55.838  -23.040 -23.380 1.00 93.74  ? 104  SER B O     1 
ATOM   7552  C CB    . SER B  2 104 ? -56.432  -22.139 -20.746 1.00 94.71  ? 104  SER B CB    1 
ATOM   7553  O OG    . SER B  2 104 ? -57.657  -22.853 -20.763 1.00 98.74  ? 104  SER B OG    1 
ATOM   7554  N N     . LEU B  2 105 ? -55.132  -20.975 -24.057 1.00 85.98  ? 105  LEU B N     1 
ATOM   7555  C CA    . LEU B  2 105 ? -54.547  -21.332 -25.352 1.00 84.24  ? 105  LEU B CA    1 
ATOM   7556  C C     . LEU B  2 105 ? -53.346  -22.263 -25.206 1.00 88.55  ? 105  LEU B C     1 
ATOM   7557  O O     . LEU B  2 105 ? -53.111  -23.097 -26.081 1.00 87.81  ? 105  LEU B O     1 
ATOM   7558  C CB    . LEU B  2 105 ? -54.145  -20.071 -26.123 1.00 82.39  ? 105  LEU B CB    1 
ATOM   7559  C CG    . LEU B  2 105 ? -55.240  -19.034 -26.321 1.00 84.98  ? 105  LEU B CG    1 
ATOM   7560  C CD1   . LEU B  2 105 ? -54.967  -17.824 -25.493 1.00 84.95  ? 105  LEU B CD1   1 
ATOM   7561  C CD2   . LEU B  2 105 ? -55.362  -18.636 -27.758 1.00 86.09  ? 105  LEU B CD2   1 
ATOM   7562  N N     . SER B  2 106 ? -52.593  -22.116 -24.095 1.00 86.15  ? 106  SER B N     1 
ATOM   7563  C CA    . SER B  2 106 ? -51.419  -22.916 -23.733 1.00 87.97  ? 106  SER B CA    1 
ATOM   7564  C C     . SER B  2 106 ? -51.671  -24.436 -23.874 1.00 94.40  ? 106  SER B C     1 
ATOM   7565  O O     . SER B  2 106 ? -50.833  -25.140 -24.449 1.00 95.37  ? 106  SER B O     1 
ATOM   7566  C CB    . SER B  2 106 ? -50.954  -22.565 -22.319 1.00 91.15  ? 106  SER B CB    1 
ATOM   7567  O OG    . SER B  2 106 ? -52.024  -22.159 -21.477 1.00 95.24  ? 106  SER B OG    1 
ATOM   7568  N N     . LYS B  2 107 ? -52.852  -24.914 -23.403 1.00 91.48  ? 107  LYS B N     1 
ATOM   7569  C CA    . LYS B  2 107 ? -53.284  -26.317 -23.451 1.00 92.90  ? 107  LYS B CA    1 
ATOM   7570  C C     . LYS B  2 107 ? -53.537  -26.816 -24.884 1.00 97.28  ? 107  LYS B C     1 
ATOM   7571  O O     . LYS B  2 107 ? -53.204  -27.959 -25.194 1.00 98.66  ? 107  LYS B O     1 
ATOM   7572  C CB    . LYS B  2 107 ? -54.525  -26.534 -22.571 1.00 95.01  ? 107  LYS B CB    1 
ATOM   7573  N N     . LEU B  2 108 ? -54.122  -25.964 -25.750 1.00 92.08  ? 108  LEU B N     1 
ATOM   7574  C CA    . LEU B  2 108 ? -54.406  -26.305 -27.150 1.00 90.90  ? 108  LEU B CA    1 
ATOM   7575  C C     . LEU B  2 108 ? -53.126  -26.343 -27.981 1.00 94.12  ? 108  LEU B C     1 
ATOM   7576  O O     . LEU B  2 108 ? -53.003  -27.211 -28.846 1.00 94.60  ? 108  LEU B O     1 
ATOM   7577  C CB    . LEU B  2 108 ? -55.419  -25.326 -27.775 1.00 88.72  ? 108  LEU B CB    1 
ATOM   7578  N N     . VAL B  2 109 ? -52.176  -25.404 -27.719 1.00 89.22  ? 109  VAL B N     1 
ATOM   7579  C CA    . VAL B  2 109 ? -50.881  -25.291 -28.412 1.00 89.31  ? 109  VAL B CA    1 
ATOM   7580  C C     . VAL B  2 109 ? -50.064  -26.582 -28.221 1.00 97.93  ? 109  VAL B C     1 
ATOM   7581  O O     . VAL B  2 109 ? -49.521  -27.110 -29.198 1.00 98.39  ? 109  VAL B O     1 
ATOM   7582  C CB    . VAL B  2 109 ? -50.124  -23.988 -28.018 1.00 91.05  ? 109  VAL B CB    1 
ATOM   7583  C CG1   . VAL B  2 109 ? -48.649  -24.030 -28.408 1.00 92.20  ? 109  VAL B CG1   1 
ATOM   7584  C CG2   . VAL B  2 109 ? -50.793  -22.769 -28.634 1.00 88.08  ? 109  VAL B CG2   1 
ATOM   7585  N N     . LYS B  2 110 ? -50.036  -27.111 -26.973 1.00 96.67  ? 110  LYS B N     1 
ATOM   7586  C CA    . LYS B  2 110 ? -49.352  -28.361 -26.619 1.00 99.00  ? 110  LYS B CA    1 
ATOM   7587  C C     . LYS B  2 110 ? -50.015  -29.544 -27.335 1.00 102.62 ? 110  LYS B C     1 
ATOM   7588  O O     . LYS B  2 110 ? -49.308  -30.364 -27.919 1.00 104.78 ? 110  LYS B O     1 
ATOM   7589  C CB    . LYS B  2 110 ? -49.347  -28.571 -25.093 1.00 102.57 ? 110  LYS B CB    1 
ATOM   7590  N N     . LEU B  2 111 ? -51.371  -29.590 -27.335 1.00 96.38  ? 111  LEU B N     1 
ATOM   7591  C CA    . LEU B  2 111 ? -52.194  -30.622 -27.977 1.00 95.97  ? 111  LEU B CA    1 
ATOM   7592  C C     . LEU B  2 111 ? -52.000  -30.681 -29.503 1.00 99.37  ? 111  LEU B C     1 
ATOM   7593  O O     . LEU B  2 111 ? -52.043  -31.770 -30.079 1.00 100.09 ? 111  LEU B O     1 
ATOM   7594  C CB    . LEU B  2 111 ? -53.672  -30.424 -27.628 1.00 94.25  ? 111  LEU B CB    1 
ATOM   7595  N N     . LEU B  2 112 ? -51.770  -29.516 -30.146 1.00 94.53  ? 112  LEU B N     1 
ATOM   7596  C CA    . LEU B  2 112 ? -51.515  -29.408 -31.585 1.00 94.27  ? 112  LEU B CA    1 
ATOM   7597  C C     . LEU B  2 112 ? -50.085  -29.845 -31.923 1.00 100.76 ? 112  LEU B C     1 
ATOM   7598  O O     . LEU B  2 112 ? -49.908  -30.691 -32.799 1.00 101.74 ? 112  LEU B O     1 
ATOM   7599  C CB    . LEU B  2 112 ? -51.735  -27.968 -32.083 1.00 92.16  ? 112  LEU B CB    1 
ATOM   7600  C CG    . LEU B  2 112 ? -53.161  -27.528 -32.348 1.00 95.07  ? 112  LEU B CG    1 
ATOM   7601  C CD1   . LEU B  2 112 ? -53.244  -26.020 -32.360 1.00 93.32  ? 112  LEU B CD1   1 
ATOM   7602  C CD2   . LEU B  2 112 ? -53.687  -28.089 -33.672 1.00 98.12  ? 112  LEU B CD2   1 
ATOM   7603  N N     . LYS B  2 113 ? -49.071  -29.241 -31.241 1.00 98.16  ? 113  LYS B N     1 
ATOM   7604  C CA    . LYS B  2 113 ? -47.636  -29.491 -31.419 1.00 100.35 ? 113  LYS B CA    1 
ATOM   7605  C C     . LYS B  2 113 ? -47.308  -30.972 -31.266 1.00 107.38 ? 113  LYS B C     1 
ATOM   7606  O O     . LYS B  2 113 ? -46.645  -31.541 -32.142 1.00 108.81 ? 113  LYS B O     1 
ATOM   7607  C CB    . LYS B  2 113 ? -46.804  -28.629 -30.453 1.00 103.43 ? 113  LYS B CB    1 
ATOM   7608  N N     . ASP B  2 114 ? -47.830  -31.606 -30.189 1.00 104.51 ? 114  ASP B N     1 
ATOM   7609  C CA    . ASP B  2 114 ? -47.654  -33.036 -29.901 1.00 106.87 ? 114  ASP B CA    1 
ATOM   7610  C C     . ASP B  2 114 ? -48.460  -33.942 -30.848 1.00 109.94 ? 114  ASP B C     1 
ATOM   7611  O O     . ASP B  2 114 ? -48.117  -35.114 -31.011 1.00 111.15 ? 114  ASP B O     1 
ATOM   7612  C CB    . ASP B  2 114 ? -47.949  -33.345 -28.424 1.00 109.32 ? 114  ASP B CB    1 
ATOM   7613  C CG    . ASP B  2 114 ? -46.844  -32.905 -27.478 1.00 116.32 ? 114  ASP B CG    1 
ATOM   7614  O OD1   . ASP B  2 114 ? -46.685  -31.678 -27.276 1.00 113.18 ? 114  ASP B OD1   1 
ATOM   7615  O OD2   . ASP B  2 114 ? -46.139  -33.787 -26.939 1.00 125.13 ? 114  ASP B OD2   1 
ATOM   7616  N N     . GLY B  2 115 ? -49.499  -33.375 -31.469 1.00 104.59 ? 115  GLY B N     1 
ATOM   7617  C CA    . GLY B  2 115 ? -50.347  -34.043 -32.453 1.00 104.09 ? 115  GLY B CA    1 
ATOM   7618  C C     . GLY B  2 115 ? -49.815  -33.924 -33.873 1.00 108.71 ? 115  GLY B C     1 
ATOM   7619  O O     . GLY B  2 115 ? -50.460  -34.387 -34.817 1.00 107.62 ? 115  GLY B O     1 
ATOM   7620  N N     . GLY B  2 116 ? -48.641  -33.299 -34.013 1.00 106.89 ? 116  GLY B N     1 
ATOM   7621  C CA    . GLY B  2 116 ? -47.941  -33.102 -35.278 1.00 107.73 ? 116  GLY B CA    1 
ATOM   7622  C C     . GLY B  2 116 ? -48.388  -31.912 -36.104 1.00 110.68 ? 116  GLY B C     1 
ATOM   7623  O O     . GLY B  2 116 ? -48.266  -31.939 -37.329 1.00 109.98 ? 116  GLY B O     1 
ATOM   7624  N N     . HIS B  2 117 ? -48.892  -30.853 -35.446 1.00 107.00 ? 117  HIS B N     1 
ATOM   7625  C CA    . HIS B  2 117 ? -49.368  -29.634 -36.110 1.00 104.88 ? 117  HIS B CA    1 
ATOM   7626  C C     . HIS B  2 117 ? -48.557  -28.400 -35.680 1.00 108.68 ? 117  HIS B C     1 
ATOM   7627  O O     . HIS B  2 117 ? -48.465  -28.128 -34.480 1.00 108.94 ? 117  HIS B O     1 
ATOM   7628  C CB    . HIS B  2 117 ? -50.868  -29.403 -35.834 1.00 103.21 ? 117  HIS B CB    1 
ATOM   7629  C CG    . HIS B  2 117 ? -51.766  -30.417 -36.461 1.00 106.53 ? 117  HIS B CG    1 
ATOM   7630  N ND1   . HIS B  2 117 ? -52.090  -30.357 -37.802 1.00 107.72 ? 117  HIS B ND1   1 
ATOM   7631  C CD2   . HIS B  2 117 ? -52.394  -31.479 -35.904 1.00 109.04 ? 117  HIS B CD2   1 
ATOM   7632  C CE1   . HIS B  2 117 ? -52.886  -31.391 -38.026 1.00 107.73 ? 117  HIS B CE1   1 
ATOM   7633  N NE2   . HIS B  2 117 ? -53.104  -32.090 -36.913 1.00 108.84 ? 117  HIS B NE2   1 
ATOM   7634  N N     . PRO B  2 118 ? -47.970  -27.631 -36.626 1.00 103.95 ? 118  PRO B N     1 
ATOM   7635  C CA    . PRO B  2 118 ? -47.221  -26.428 -36.223 1.00 102.90 ? 118  PRO B CA    1 
ATOM   7636  C C     . PRO B  2 118 ? -48.145  -25.274 -35.830 1.00 100.73 ? 118  PRO B C     1 
ATOM   7637  O O     . PRO B  2 118 ? -49.274  -25.171 -36.320 1.00 97.61  ? 118  PRO B O     1 
ATOM   7638  C CB    . PRO B  2 118 ? -46.367  -26.100 -37.454 1.00 106.20 ? 118  PRO B CB    1 
ATOM   7639  C CG    . PRO B  2 118 ? -46.655  -27.195 -38.474 1.00 111.40 ? 118  PRO B CG    1 
ATOM   7640  C CD    . PRO B  2 118 ? -47.963  -27.794 -38.092 1.00 105.51 ? 118  PRO B CD    1 
ATOM   7641  N N     . VAL B  2 119 ? -47.674  -24.436 -34.893 1.00 96.18  ? 119  VAL B N     1 
ATOM   7642  C CA    . VAL B  2 119 ? -48.437  -23.301 -34.358 1.00 93.30  ? 119  VAL B CA    1 
ATOM   7643  C C     . VAL B  2 119 ? -47.610  -22.002 -34.267 1.00 95.93  ? 119  VAL B C     1 
ATOM   7644  O O     . VAL B  2 119 ? -46.390  -22.060 -34.094 1.00 97.06  ? 119  VAL B O     1 
ATOM   7645  C CB    . VAL B  2 119 ? -49.190  -23.610 -33.021 1.00 97.09  ? 119  VAL B CB    1 
ATOM   7646  C CG1   . VAL B  2 119 ? -50.654  -23.204 -33.112 1.00 94.70  ? 119  VAL B CG1   1 
ATOM   7647  C CG2   . VAL B  2 119 ? -49.068  -25.078 -32.585 1.00 98.89  ? 119  VAL B CG2   1 
ATOM   7648  N N     . GLN B  2 120 ? -48.285  -20.835 -34.393 1.00 90.35  ? 120  GLN B N     1 
ATOM   7649  C CA    . GLN B  2 120 ? -47.704  -19.483 -34.318 1.00 89.65  ? 120  GLN B CA    1 
ATOM   7650  C C     . GLN B  2 120 ? -48.335  -18.780 -33.112 1.00 91.68  ? 120  GLN B C     1 
ATOM   7651  O O     . GLN B  2 120 ? -49.553  -18.860 -32.943 1.00 89.32  ? 120  GLN B O     1 
ATOM   7652  C CB    . GLN B  2 120 ? -48.001  -18.700 -35.618 1.00 89.93  ? 120  GLN B CB    1 
ATOM   7653  C CG    . GLN B  2 120 ? -47.169  -17.422 -35.811 1.00 102.16 ? 120  GLN B CG    1 
ATOM   7654  C CD    . GLN B  2 120 ? -47.434  -16.679 -37.113 1.00 123.06 ? 120  GLN B CD    1 
ATOM   7655  O OE1   . GLN B  2 120 ? -47.599  -17.269 -38.198 1.00 122.56 ? 120  GLN B OE1   1 
ATOM   7656  N NE2   . GLN B  2 120 ? -47.412  -15.351 -37.045 1.00 108.99 ? 120  GLN B NE2   1 
ATOM   7657  N N     . GLN B  2 121 ? -47.517  -18.116 -32.269 1.00 89.50  ? 121  GLN B N     1 
ATOM   7658  C CA    . GLN B  2 121 ? -47.990  -17.417 -31.058 1.00 88.46  ? 121  GLN B CA    1 
ATOM   7659  C C     . GLN B  2 121 ? -47.223  -16.123 -30.710 1.00 95.14  ? 121  GLN B C     1 
ATOM   7660  O O     . GLN B  2 121 ? -46.161  -15.887 -31.300 1.00 95.88  ? 121  GLN B O     1 
ATOM   7661  C CB    . GLN B  2 121 ? -48.067  -18.383 -29.858 1.00 90.13  ? 121  GLN B CB    1 
ATOM   7662  C CG    . GLN B  2 121 ? -46.758  -19.105 -29.526 1.00 86.88  ? 121  GLN B CG    1 
ATOM   7663  C CD    . GLN B  2 121 ? -46.951  -20.444 -28.848 1.00 92.97  ? 121  GLN B CD    1 
ATOM   7664  O OE1   . GLN B  2 121 ? -46.120  -21.340 -28.970 1.00 85.87  ? 121  GLN B OE1   1 
ATOM   7665  N NE2   . GLN B  2 121 ? -48.037  -20.622 -28.111 1.00 84.85  ? 121  GLN B NE2   1 
ATOM   7666  N N     . SER B  2 122 ? -47.754  -15.287 -29.757 1.00 92.04  ? 122  SER B N     1 
ATOM   7667  C CA    . SER B  2 122 ? -47.096  -14.030 -29.357 1.00 92.70  ? 122  SER B CA    1 
ATOM   7668  C C     . SER B  2 122 ? -45.855  -14.186 -28.415 1.00 101.84 ? 122  SER B C     1 
ATOM   7669  O O     . SER B  2 122 ? -44.747  -14.238 -28.959 1.00 103.64 ? 122  SER B O     1 
ATOM   7670  C CB    . SER B  2 122 ? -48.100  -12.976 -28.911 1.00 93.30  ? 122  SER B CB    1 
ATOM   7671  O OG    . SER B  2 122 ? -47.487  -11.700 -28.828 1.00 101.24 ? 122  SER B OG    1 
ATOM   7672  N N     . PRO B  2 123 ? -45.941  -14.333 -27.063 1.00 100.76 ? 123  PRO B N     1 
ATOM   7673  C CA    . PRO B  2 123 ? -44.707  -14.520 -26.271 1.00 103.08 ? 123  PRO B CA    1 
ATOM   7674  C C     . PRO B  2 123 ? -44.450  -15.984 -25.845 1.00 106.94 ? 123  PRO B C     1 
ATOM   7675  O O     . PRO B  2 123 ? -43.609  -16.209 -24.972 1.00 109.63 ? 123  PRO B O     1 
ATOM   7676  C CB    . PRO B  2 123 ? -44.973  -13.643 -25.039 1.00 104.39 ? 123  PRO B CB    1 
ATOM   7677  C CG    . PRO B  2 123 ? -46.502  -13.680 -24.867 1.00 107.03 ? 123  PRO B CG    1 
ATOM   7678  C CD    . PRO B  2 123 ? -47.108  -14.239 -26.162 1.00 101.69 ? 123  PRO B CD    1 
ATOM   7679  N N     . ASN B  2 124 ? -45.194  -16.971 -26.430 1.00 99.99  ? 124  ASN B N     1 
ATOM   7680  C CA    . ASN B  2 124 ? -45.187  -18.409 -26.093 1.00 100.47 ? 124  ASN B CA    1 
ATOM   7681  C C     . ASN B  2 124 ? -45.698  -18.636 -24.638 1.00 104.76 ? 124  ASN B C     1 
ATOM   7682  O O     . ASN B  2 124 ? -45.559  -19.724 -24.080 1.00 105.72 ? 124  ASN B O     1 
ATOM   7683  C CB    . ASN B  2 124 ? -43.828  -19.075 -26.378 1.00 100.79 ? 124  ASN B CB    1 
ATOM   7684  N N     . GLU B  2 125 ? -46.346  -17.591 -24.068 1.00 99.70  ? 125  GLU B N     1 
ATOM   7685  C CA    . GLU B  2 125 ? -46.902  -17.502 -22.720 1.00 98.71  ? 125  GLU B CA    1 
ATOM   7686  C C     . GLU B  2 125 ? -48.438  -17.701 -22.534 1.00 100.38 ? 125  GLU B C     1 
ATOM   7687  O O     . GLU B  2 125 ? -48.781  -18.155 -21.448 1.00 99.75  ? 125  GLU B O     1 
ATOM   7688  C CB    . GLU B  2 125 ? -46.444  -16.206 -22.047 1.00 99.75  ? 125  GLU B CB    1 
ATOM   7689  N N     . ILE B  2 126 ? -49.386  -17.372 -23.491 1.00 95.45  ? 126  ILE B N     1 
ATOM   7690  C CA    . ILE B  2 126 ? -49.325  -16.843 -24.880 1.00 93.67  ? 126  ILE B CA    1 
ATOM   7691  C C     . ILE B  2 126 ? -50.627  -16.072 -25.237 1.00 95.59  ? 126  ILE B C     1 
ATOM   7692  O O     . ILE B  2 126 ? -51.638  -16.274 -24.565 1.00 94.24  ? 126  ILE B O     1 
ATOM   7693  C CB    . ILE B  2 126 ? -49.086  -17.988 -25.896 1.00 97.04  ? 126  ILE B CB    1 
ATOM   7694  N N     . SER B  2 127 ? -50.615  -15.217 -26.301 1.00 91.58  ? 127  SER B N     1 
ATOM   7695  C CA    . SER B  2 127 ? -51.795  -14.438 -26.726 1.00 89.57  ? 127  SER B CA    1 
ATOM   7696  C C     . SER B  2 127 ? -52.592  -15.073 -27.911 1.00 94.74  ? 127  SER B C     1 
ATOM   7697  O O     . SER B  2 127 ? -53.480  -15.859 -27.596 1.00 94.60  ? 127  SER B O     1 
ATOM   7698  C CB    . SER B  2 127 ? -51.470  -12.954 -26.900 1.00 91.89  ? 127  SER B CB    1 
ATOM   7699  O OG    . SER B  2 127 ? -51.674  -12.197 -25.715 1.00 99.07  ? 127  SER B OG    1 
ATOM   7700  N N     . PRO B  2 128 ? -52.310  -14.882 -29.239 1.00 91.81  ? 128  PRO B N     1 
ATOM   7701  C CA    . PRO B  2 128 ? -53.093  -15.605 -30.264 1.00 90.10  ? 128  PRO B CA    1 
ATOM   7702  C C     . PRO B  2 128 ? -52.385  -16.871 -30.805 1.00 91.85  ? 128  PRO B C     1 
ATOM   7703  O O     . PRO B  2 128 ? -51.203  -16.816 -31.139 1.00 91.83  ? 128  PRO B O     1 
ATOM   7704  C CB    . PRO B  2 128 ? -53.282  -14.543 -31.362 1.00 90.93  ? 128  PRO B CB    1 
ATOM   7705  C CG    . PRO B  2 128 ? -52.131  -13.537 -31.150 1.00 96.89  ? 128  PRO B CG    1 
ATOM   7706  C CD    . PRO B  2 128 ? -51.361  -13.963 -29.900 1.00 94.19  ? 128  PRO B CD    1 
ATOM   7707  N N     . PHE B  2 129 ? -53.103  -18.010 -30.901 1.00 86.85  ? 129  PHE B N     1 
ATOM   7708  C CA    . PHE B  2 129 ? -52.567  -19.279 -31.433 1.00 86.84  ? 129  PHE B CA    1 
ATOM   7709  C C     . PHE B  2 129 ? -53.083  -19.524 -32.865 1.00 86.38  ? 129  PHE B C     1 
ATOM   7710  O O     . PHE B  2 129 ? -54.267  -19.306 -33.124 1.00 83.92  ? 129  PHE B O     1 
ATOM   7711  C CB    . PHE B  2 129 ? -52.923  -20.451 -30.509 1.00 89.46  ? 129  PHE B CB    1 
ATOM   7712  N N     . GLU B  2 130 ? -52.196  -19.931 -33.804 1.00 82.16  ? 130  GLU B N     1 
ATOM   7713  C CA    . GLU B  2 130 ? -52.591  -20.128 -35.210 1.00 81.19  ? 130  GLU B CA    1 
ATOM   7714  C C     . GLU B  2 130 ? -52.026  -21.421 -35.853 1.00 87.55  ? 130  GLU B C     1 
ATOM   7715  O O     . GLU B  2 130 ? -50.810  -21.520 -36.044 1.00 89.75  ? 130  GLU B O     1 
ATOM   7716  C CB    . GLU B  2 130 ? -52.210  -18.888 -36.069 1.00 81.56  ? 130  GLU B CB    1 
ATOM   7717  C CG    . GLU B  2 130 ? -52.441  -17.519 -35.428 1.00 85.14  ? 130  GLU B CG    1 
ATOM   7718  C CD    . GLU B  2 130 ? -53.290  -16.528 -36.203 1.00 85.75  ? 130  GLU B CD    1 
ATOM   7719  O OE1   . GLU B  2 130 ? -53.633  -16.829 -37.368 1.00 84.41  ? 130  GLU B OE1   1 
ATOM   7720  O OE2   . GLU B  2 130 ? -53.663  -15.476 -35.630 1.00 48.39  ? 130  GLU B OE2   1 
ATOM   7721  N N     . VAL B  2 131 ? -52.903  -22.393 -36.206 1.00 83.43  ? 131  VAL B N     1 
ATOM   7722  C CA    . VAL B  2 131 ? -52.519  -23.661 -36.864 1.00 84.94  ? 131  VAL B CA    1 
ATOM   7723  C C     . VAL B  2 131 ? -53.182  -23.807 -38.260 1.00 90.87  ? 131  VAL B C     1 
ATOM   7724  O O     . VAL B  2 131 ? -53.872  -22.879 -38.699 1.00 89.89  ? 131  VAL B O     1 
ATOM   7725  C CB    . VAL B  2 131 ? -52.740  -24.898 -35.962 1.00 89.06  ? 131  VAL B CB    1 
ATOM   7726  N N     . TYR B  2 132 ? -52.944  -24.944 -38.970 1.00 89.49  ? 132  TYR B N     1 
ATOM   7727  C CA    . TYR B  2 132 ? -53.491  -25.213 -40.313 1.00 89.39  ? 132  TYR B CA    1 
ATOM   7728  C C     . TYR B  2 132 ? -53.980  -26.660 -40.496 1.00 95.69  ? 132  TYR B C     1 
ATOM   7729  O O     . TYR B  2 132 ? -53.345  -27.595 -39.993 1.00 97.14  ? 132  TYR B O     1 
ATOM   7730  C CB    . TYR B  2 132 ? -52.464  -24.857 -41.399 1.00 91.02  ? 132  TYR B CB    1 
ATOM   7731  N N     . THR B  2 133 ? -55.109  -26.833 -41.230 1.00 92.33  ? 133  THR B N     1 
ATOM   7732  C CA    . THR B  2 133 ? -55.742  -28.124 -41.578 1.00 93.17  ? 133  THR B CA    1 
ATOM   7733  C C     . THR B  2 133 ? -55.668  -28.290 -43.118 1.00 98.25  ? 133  THR B C     1 
ATOM   7734  O O     . THR B  2 133 ? -54.763  -27.727 -43.742 1.00 97.76  ? 133  THR B O     1 
ATOM   7735  C CB    . THR B  2 133 ? -57.202  -28.095 -41.097 1.00 96.40  ? 133  THR B CB    1 
ATOM   7736  N N     . VAL B  2 134 ? -56.630  -29.019 -43.739 1.00 96.52  ? 134  VAL B N     1 
ATOM   7737  C CA    . VAL B  2 134 ? -56.750  -29.080 -45.209 1.00 97.43  ? 134  VAL B CA    1 
ATOM   7738  C C     . VAL B  2 134 ? -57.292  -27.682 -45.613 1.00 100.96 ? 134  VAL B C     1 
ATOM   7739  O O     . VAL B  2 134 ? -57.092  -27.215 -46.739 1.00 99.10  ? 134  VAL B O     1 
ATOM   7740  C CB    . VAL B  2 134 ? -57.687  -30.208 -45.669 1.00 101.84 ? 134  VAL B CB    1 
ATOM   7741  N N     . ASP B  2 135 ? -57.962  -27.024 -44.613 1.00 98.77  ? 135  ASP B N     1 
ATOM   7742  C CA    . ASP B  2 135 ? -58.492  -25.655 -44.545 1.00 97.21  ? 135  ASP B CA    1 
ATOM   7743  C C     . ASP B  2 135 ? -57.470  -24.883 -43.683 1.00 99.87  ? 135  ASP B C     1 
ATOM   7744  O O     . ASP B  2 135 ? -57.553  -24.924 -42.448 1.00 98.21  ? 135  ASP B O     1 
ATOM   7745  C CB    . ASP B  2 135 ? -59.883  -25.629 -43.884 1.00 97.90  ? 135  ASP B CB    1 
ATOM   7746  N N     . PRO B  2 136 ? -56.428  -24.282 -44.322 1.00 96.36  ? 136  PRO B N     1 
ATOM   7747  C CA    . PRO B  2 136 ? -55.367  -23.625 -43.540 1.00 94.89  ? 136  PRO B CA    1 
ATOM   7748  C C     . PRO B  2 136 ? -55.726  -22.305 -42.862 1.00 94.85  ? 136  PRO B C     1 
ATOM   7749  O O     . PRO B  2 136 ? -56.751  -21.694 -43.168 1.00 92.58  ? 136  PRO B O     1 
ATOM   7750  C CB    . PRO B  2 136 ? -54.218  -23.485 -44.541 1.00 98.10  ? 136  PRO B CB    1 
ATOM   7751  C CG    . PRO B  2 136 ? -54.862  -23.464 -45.875 1.00 103.35 ? 136  PRO B CG    1 
ATOM   7752  C CD    . PRO B  2 136 ? -56.141  -24.238 -45.774 1.00 98.90  ? 136  PRO B CD    1 
ATOM   7753  N N     . LEU B  2 137 ? -54.842  -21.876 -41.929 1.00 90.63  ? 137  LEU B N     1 
ATOM   7754  C CA    . LEU B  2 137 ? -54.910  -20.666 -41.109 1.00 88.21  ? 137  LEU B CA    1 
ATOM   7755  C C     . LEU B  2 137 ? -56.206  -20.602 -40.288 1.00 89.56  ? 137  LEU B C     1 
ATOM   7756  O O     . LEU B  2 137 ? -57.168  -19.918 -40.653 1.00 89.06  ? 137  LEU B O     1 
ATOM   7757  C CB    . LEU B  2 137 ? -54.627  -19.386 -41.920 1.00 87.98  ? 137  LEU B CB    1 
ATOM   7758  N N     . GLY B  2 138 ? -56.220  -21.406 -39.228 1.00 83.90  ? 138  GLY B N     1 
ATOM   7759  C CA    . GLY B  2 138 ? -57.295  -21.501 -38.252 1.00 81.45  ? 138  GLY B CA    1 
ATOM   7760  C C     . GLY B  2 138 ? -56.769  -20.873 -36.988 1.00 82.71  ? 138  GLY B C     1 
ATOM   7761  O O     . GLY B  2 138 ? -56.077  -21.530 -36.210 1.00 83.17  ? 138  GLY B O     1 
ATOM   7762  N N     . SER B  2 139 ? -57.001  -19.565 -36.837 1.00 77.42  ? 139  SER B N     1 
ATOM   7763  C CA    . SER B  2 139 ? -56.531  -18.759 -35.701 1.00 76.30  ? 139  SER B CA    1 
ATOM   7764  C C     . SER B  2 139 ? -57.383  -18.908 -34.443 1.00 75.88  ? 139  SER B C     1 
ATOM   7765  O O     . SER B  2 139 ? -58.541  -19.305 -34.521 1.00 75.02  ? 139  SER B O     1 
ATOM   7766  C CB    . SER B  2 139 ? -56.470  -17.286 -36.093 1.00 80.63  ? 139  SER B CB    1 
ATOM   7767  N N     . LEU B  2 140 ? -56.801  -18.570 -33.284 1.00 70.50  ? 140  LEU B N     1 
ATOM   7768  C CA    . LEU B  2 140 ? -57.456  -18.635 -31.977 1.00 69.49  ? 140  LEU B CA    1 
ATOM   7769  C C     . LEU B  2 140 ? -56.955  -17.475 -31.061 1.00 70.65  ? 140  LEU B C     1 
ATOM   7770  O O     . LEU B  2 140 ? -55.757  -17.413 -30.802 1.00 71.45  ? 140  LEU B O     1 
ATOM   7771  C CB    . LEU B  2 140 ? -57.215  -20.029 -31.322 1.00 70.70  ? 140  LEU B CB    1 
ATOM   7772  C CG    . LEU B  2 140 ? -57.854  -21.249 -32.016 1.00 75.53  ? 140  LEU B CG    1 
ATOM   7773  C CD1   . LEU B  2 140 ? -56.821  -22.065 -32.779 1.00 76.16  ? 140  LEU B CD1   1 
ATOM   7774  C CD2   . LEU B  2 140 ? -58.599  -22.107 -31.036 1.00 78.56  ? 140  LEU B CD2   1 
ATOM   7775  N N     . ILE B  2 141 ? -57.852  -16.540 -30.629 1.00 63.66  ? 141  ILE B N     1 
ATOM   7776  C CA    . ILE B  2 141 ? -57.509  -15.404 -29.743 1.00 62.69  ? 141  ILE B CA    1 
ATOM   7777  C C     . ILE B  2 141 ? -58.079  -15.641 -28.352 1.00 66.15  ? 141  ILE B C     1 
ATOM   7778  O O     . ILE B  2 141 ? -59.187  -16.170 -28.235 1.00 67.38  ? 141  ILE B O     1 
ATOM   7779  C CB    . ILE B  2 141 ? -57.922  -14.019 -30.308 1.00 64.24  ? 141  ILE B CB    1 
ATOM   7780  N N     . GLY B  2 142 ? -57.332  -15.252 -27.320 1.00 59.61  ? 142  GLY B N     1 
ATOM   7781  C CA    . GLY B  2 142 ? -57.736  -15.468 -25.935 1.00 59.35  ? 142  GLY B CA    1 
ATOM   7782  C C     . GLY B  2 142 ? -58.584  -14.425 -25.237 1.00 62.93  ? 142  GLY B C     1 
ATOM   7783  O O     . GLY B  2 142 ? -58.628  -14.446 -24.006 1.00 64.00  ? 142  GLY B O     1 
ATOM   7784  N N     . PHE B  2 143 ? -59.313  -13.547 -25.993 1.00 57.32  ? 143  PHE B N     1 
ATOM   7785  C CA    . PHE B  2 143 ? -60.172  -12.473 -25.444 1.00 53.93  ? 143  PHE B CA    1 
ATOM   7786  C C     . PHE B  2 143 ? -61.675  -12.644 -25.784 1.00 104.59 ? 143  PHE B C     1 
ATOM   7787  O O     . PHE B  2 143 ? -62.541  -11.933 -25.249 1.00 65.57  ? 143  PHE B O     1 
ATOM   7788  C CB    . PHE B  2 143 ? -59.673  -11.092 -25.916 1.00 53.77  ? 143  PHE B CB    1 
ATOM   7789  C CG    . PHE B  2 143 ? -58.187  -10.832 -25.823 1.00 54.34  ? 143  PHE B CG    1 
ATOM   7790  C CD1   . PHE B  2 143 ? -57.546  -10.791 -24.589 1.00 58.86  ? 143  PHE B CD1   1 
ATOM   7791  C CD2   . PHE B  2 143 ? -57.448  -10.530 -26.954 1.00 54.77  ? 143  PHE B CD2   1 
ATOM   7792  C CE1   . PHE B  2 143 ? -56.177  -10.543 -24.504 1.00 59.81  ? 143  PHE B CE1   1 
ATOM   7793  C CE2   . PHE B  2 143 ? -56.080  -10.253 -26.863 1.00 58.92  ? 143  PHE B CE2   1 
ATOM   7794  C CZ    . PHE B  2 143 ? -55.456  -10.249 -25.637 1.00 58.32  ? 143  PHE B CZ    1 
ATOM   7795  N N     . GLY B  2 145 ? -61.922  -8.872  -27.842 1.00 69.73  ? 145  GLY B N     1 
ATOM   7796  C CA    . GLY B  2 145 ? -61.853  -8.090  -29.075 1.00 70.38  ? 145  GLY B CA    1 
ATOM   7797  C C     . GLY B  2 145 ? -60.527  -7.400  -29.372 1.00 76.56  ? 145  GLY B C     1 
ATOM   7798  O O     . GLY B  2 145 ? -60.000  -7.553  -30.478 1.00 74.40  ? 145  GLY B O     1 
ATOM   7799  N N     . PHE B  2 146 ? -59.996  -6.606  -28.372 1.00 76.29  ? 146  PHE B N     1 
ATOM   7800  C CA    . PHE B  2 146 ? -58.725  -5.837  -28.362 1.00 75.72  ? 146  PHE B CA    1 
ATOM   7801  C C     . PHE B  2 146 ? -57.818  -6.091  -27.097 1.00 79.07  ? 146  PHE B C     1 
ATOM   7802  O O     . PHE B  2 146 ? -58.285  -6.661  -26.105 1.00 75.74  ? 146  PHE B O     1 
ATOM   7803  C CB    . PHE B  2 146 ? -58.990  -4.340  -28.564 1.00 76.74  ? 146  PHE B CB    1 
ATOM   7804  N N     . LYS B  2 147 ? -56.511  -5.687  -27.186 1.00 79.45  ? 147  LYS B N     1 
ATOM   7805  C CA    . LYS B  2 147 ? -55.408  -5.808  -26.202 1.00 82.11  ? 147  LYS B CA    1 
ATOM   7806  C C     . LYS B  2 147 ? -55.830  -5.543  -24.760 1.00 92.36  ? 147  LYS B C     1 
ATOM   7807  O O     . LYS B  2 147 ? -56.389  -4.470  -24.506 1.00 92.32  ? 147  LYS B O     1 
ATOM   7808  C CB    . LYS B  2 147 ? -54.260  -4.851  -26.573 1.00 84.14  ? 147  LYS B CB    1 
ATOM   7809  N N     . ASN B  2 148 ? -55.533  -6.506  -23.811 1.00 92.35  ? 148  ASN B N     1 
ATOM   7810  C CA    . ASN B  2 148 ? -55.934  -6.514  -22.369 1.00 92.96  ? 148  ASN B CA    1 
ATOM   7811  C C     . ASN B  2 148 ? -55.558  -7.891  -21.732 1.00 98.39  ? 148  ASN B C     1 
ATOM   7812  O O     . ASN B  2 148 ? -55.520  -8.843  -22.503 1.00 99.20  ? 148  ASN B O     1 
ATOM   7813  C CB    . ASN B  2 148 ? -57.501  -6.365  -22.334 1.00 92.04  ? 148  ASN B CB    1 
ATOM   7814  C CG    . ASN B  2 148 ? -58.288  -6.697  -21.086 1.00 99.61  ? 148  ASN B CG    1 
ATOM   7815  O OD1   . ASN B  2 148 ? -59.047  -7.671  -21.056 1.00 82.63  ? 148  ASN B OD1   1 
ATOM   7816  N ND2   . ASN B  2 148 ? -58.254  -5.812  -20.095 1.00 95.37  ? 148  ASN B ND2   1 
ATOM   7817  N N     . PRO B  2 149 ? -55.381  -8.101  -20.386 1.00 94.67  ? 149  PRO B N     1 
ATOM   7818  C CA    . PRO B  2 149 ? -55.203  -9.486  -19.890 1.00 95.02  ? 149  PRO B CA    1 
ATOM   7819  C C     . PRO B  2 149 ? -56.428  -10.359 -20.284 1.00 96.67  ? 149  PRO B C     1 
ATOM   7820  O O     . PRO B  2 149 ? -57.578  -9.972  -20.040 1.00 96.77  ? 149  PRO B O     1 
ATOM   7821  C CB    . PRO B  2 149 ? -55.101  -9.319  -18.363 1.00 98.03  ? 149  PRO B CB    1 
ATOM   7822  C CG    . PRO B  2 149 ? -54.779  -7.897  -18.133 1.00 102.26 ? 149  PRO B CG    1 
ATOM   7823  C CD    . PRO B  2 149 ? -55.390  -7.133  -19.267 1.00 96.56  ? 149  PRO B CD    1 
ATOM   7824  N N     . PHE B  2 150 ? -56.155  -11.509 -20.947 1.00 89.42  ? 150  PHE B N     1 
ATOM   7825  C CA    . PHE B  2 150 ? -57.042  -12.528 -21.527 1.00 86.93  ? 150  PHE B CA    1 
ATOM   7826  C C     . PHE B  2 150 ? -58.297  -13.004 -20.760 1.00 88.16  ? 150  PHE B C     1 
ATOM   7827  O O     . PHE B  2 150 ? -58.502  -12.655 -19.604 1.00 88.63  ? 150  PHE B O     1 
ATOM   7828  C CB    . PHE B  2 150 ? -56.184  -13.731 -21.965 1.00 89.52  ? 150  PHE B CB    1 
ATOM   7829  N N     . ALA B  2 151 ? -59.126  -13.835 -21.427 1.00 82.80  ? 151  ALA B N     1 
ATOM   7830  C CA    . ALA B  2 151 ? -60.332  -14.463 -20.882 1.00 82.18  ? 151  ALA B CA    1 
ATOM   7831  C C     . ALA B  2 151 ? -59.909  -15.567 -19.893 1.00 86.74  ? 151  ALA B C     1 
ATOM   7832  O O     . ALA B  2 151 ? -59.055  -16.386 -20.224 1.00 87.15  ? 151  ALA B O     1 
ATOM   7833  C CB    . ALA B  2 151 ? -61.167  -15.062 -22.016 1.00 82.10  ? 151  ALA B CB    1 
ATOM   7834  N N     . VAL B  2 152 ? -60.497  -15.577 -18.685 1.00 83.99  ? 152  VAL B N     1 
ATOM   7835  C CA    . VAL B  2 152 ? -60.217  -16.548 -17.618 1.00 86.07  ? 152  VAL B CA    1 
ATOM   7836  C C     . VAL B  2 152 ? -60.399  -18.016 -18.039 1.00 92.92  ? 152  VAL B C     1 
ATOM   7837  O O     . VAL B  2 152 ? -61.371  -18.344 -18.725 1.00 92.18  ? 152  VAL B O     1 
ATOM   7838  C CB    . VAL B  2 152 ? -61.033  -16.231 -16.352 1.00 90.71  ? 152  VAL B CB    1 
ATOM   7839  N N     . ASN B  2 153 ? -59.456  -18.890 -17.616 1.00 91.61  ? 153  ASN B N     1 
ATOM   7840  C CA    . ASN B  2 153 ? -59.434  -20.329 -17.911 1.00 92.21  ? 153  ASN B CA    1 
ATOM   7841  C C     . ASN B  2 153 ? -60.612  -21.086 -17.259 1.00 95.84  ? 153  ASN B C     1 
ATOM   7842  O O     . ASN B  2 153 ? -60.704  -21.149 -16.030 1.00 96.34  ? 153  ASN B O     1 
ATOM   7843  C CB    . ASN B  2 153 ? -58.091  -20.934 -17.499 1.00 94.67  ? 153  ASN B CB    1 
ATOM   7844  N N     . GLU B  2 154 ? -61.511  -21.650 -18.104 1.00 91.34  ? 154  GLU B N     1 
ATOM   7845  C CA    . GLU B  2 154 ? -62.732  -22.380 -17.720 1.00 92.13  ? 154  GLU B CA    1 
ATOM   7846  C C     . GLU B  2 154 ? -62.483  -23.674 -16.946 1.00 98.16  ? 154  GLU B C     1 
ATOM   7847  O O     . GLU B  2 154 ? -61.551  -24.415 -17.267 1.00 98.12  ? 154  GLU B O     1 
ATOM   7848  C CB    . GLU B  2 154 ? -63.613  -22.662 -18.949 1.00 92.47  ? 154  GLU B CB    1 
ATOM   7849  N N     . ARG B  2 155 ? -63.356  -23.949 -15.941 1.00 96.14  ? 155  ARG B N     1 
ATOM   7850  C CA    . ARG B  2 155 ? -63.365  -25.108 -15.038 1.00 113.35 ? 155  ARG B CA    1 
ATOM   7851  C C     . ARG B  2 155 ? -62.022  -25.387 -14.374 1.00 123.97 ? 155  ARG B C     1 
ATOM   7852  O O     . ARG B  2 155 ? -61.626  -24.662 -13.466 1.00 77.49  ? 155  ARG B O     1 
ATOM   7853  C CB    . ARG B  2 155 ? -63.913  -26.361 -15.733 1.00 114.53 ? 155  ARG B CB    1 
ATOM   7854  N N     . VAL B  2 180 ? -39.688  -53.794 6.019   1.00 93.18  ? 180  VAL B N     1 
ATOM   7855  C CA    . VAL B  2 180 ? -40.972  -53.184 6.355   1.00 93.00  ? 180  VAL B CA    1 
ATOM   7856  C C     . VAL B  2 180 ? -41.116  -52.977 7.883   1.00 97.26  ? 180  VAL B C     1 
ATOM   7857  O O     . VAL B  2 180 ? -41.399  -51.851 8.329   1.00 95.26  ? 180  VAL B O     1 
ATOM   7858  C CB    . VAL B  2 180 ? -42.177  -53.955 5.737   1.00 98.81  ? 180  VAL B CB    1 
ATOM   7859  C CG1   . VAL B  2 180 ? -43.493  -53.189 5.930   1.00 98.15  ? 180  VAL B CG1   1 
ATOM   7860  C CG2   . VAL B  2 180 ? -41.943  -54.260 4.257   1.00 99.37  ? 180  VAL B CG2   1 
ATOM   7861  N N     . ARG B  2 181 ? -40.926  -54.061 8.678   1.00 95.22  ? 181  ARG B N     1 
ATOM   7862  C CA    . ARG B  2 181 ? -41.078  -54.013 10.141  1.00 94.27  ? 181  ARG B CA    1 
ATOM   7863  C C     . ARG B  2 181 ? -39.805  -54.319 10.960  1.00 93.75  ? 181  ARG B C     1 
ATOM   7864  O O     . ARG B  2 181 ? -39.725  -53.943 12.136  1.00 94.30  ? 181  ARG B O     1 
ATOM   7865  C CB    . ARG B  2 181 ? -42.294  -54.849 10.602  1.00 97.40  ? 181  ARG B CB    1 
ATOM   7866  C CG    . ARG B  2 181 ? -42.263  -56.346 10.261  1.00 105.91 ? 181  ARG B CG    1 
ATOM   7867  C CD    . ARG B  2 181 ? -43.631  -57.004 10.463  1.00 111.87 ? 181  ARG B CD    1 
ATOM   7868  N NE    . ARG B  2 181 ? -44.201  -56.808 11.809  1.00 115.71 ? 181  ARG B NE    1 
ATOM   7869  C CZ    . ARG B  2 181 ? -44.450  -57.779 12.693  1.00 130.14 ? 181  ARG B CZ    1 
ATOM   7870  N NH1   . ARG B  2 181 ? -44.188  -59.049 12.393  1.00 117.16 ? 181  ARG B NH1   1 
ATOM   7871  N NH2   . ARG B  2 181 ? -44.969  -57.486 13.880  1.00 113.64 ? 181  ARG B NH2   1 
ATOM   7872  N N     . LYS B  2 182 ? -38.817  -54.964 10.313  1.00 84.53  ? 182  LYS B N     1 
ATOM   7873  C CA    . LYS B  2 182 ? -37.512  -55.418 10.830  1.00 81.16  ? 182  LYS B CA    1 
ATOM   7874  C C     . LYS B  2 182 ? -36.649  -54.495 11.730  1.00 75.40  ? 182  LYS B C     1 
ATOM   7875  O O     . LYS B  2 182 ? -36.467  -53.337 11.402  1.00 72.73  ? 182  LYS B O     1 
ATOM   7876  C CB    . LYS B  2 182 ? -36.667  -56.002 9.682   1.00 83.64  ? 182  LYS B CB    1 
ATOM   7877  C CG    . LYS B  2 182 ? -36.720  -55.238 8.360   1.00 79.68  ? 182  LYS B CG    1 
ATOM   7878  C CD    . LYS B  2 182 ? -36.748  -56.238 7.203   1.00 82.83  ? 182  LYS B CD    1 
ATOM   7879  C CE    . LYS B  2 182 ? -36.869  -55.569 5.863   1.00 79.33  ? 182  LYS B CE    1 
ATOM   7880  N NZ    . LYS B  2 182 ? -37.366  -56.500 4.828   1.00 75.66  ? 182  LYS B NZ    1 
ATOM   7881  N N     . THR B  2 183 ? -36.048  -55.057 12.809  1.00 67.86  ? 183  THR B N     1 
ATOM   7882  C CA    . THR B  2 183 ? -35.153  -54.368 13.759  1.00 64.04  ? 183  THR B CA    1 
ATOM   7883  C C     . THR B  2 183 ? -33.742  -54.162 13.164  1.00 61.21  ? 183  THR B C     1 
ATOM   7884  O O     . THR B  2 183 ? -33.081  -55.112 12.759  1.00 60.73  ? 183  THR B O     1 
ATOM   7885  C CB    . THR B  2 183 ? -35.119  -55.068 15.140  1.00 71.50  ? 183  THR B CB    1 
ATOM   7886  O OG1   . THR B  2 183 ? -34.388  -56.287 15.059  1.00 67.94  ? 183  THR B OG1   1 
ATOM   7887  C CG2   . THR B  2 183 ? -36.507  -55.344 15.696  1.00 74.29  ? 183  THR B CG2   1 
ATOM   7888  N N     . ILE B  2 184 ? -33.301  -52.913 13.121  1.00 53.33  ? 184  ILE B N     1 
ATOM   7889  C CA    . ILE B  2 184 ? -32.028  -52.480 12.548  1.00 50.86  ? 184  ILE B CA    1 
ATOM   7890  C C     . ILE B  2 184 ? -30.901  -52.475 13.593  1.00 53.66  ? 184  ILE B C     1 
ATOM   7891  O O     . ILE B  2 184 ? -31.160  -52.258 14.781  1.00 52.92  ? 184  ILE B O     1 
ATOM   7892  C CB    . ILE B  2 184 ? -32.231  -51.079 11.858  1.00 51.38  ? 184  ILE B CB    1 
ATOM   7893  C CG1   . ILE B  2 184 ? -33.163  -51.199 10.648  1.00 52.65  ? 184  ILE B CG1   1 
ATOM   7894  C CG2   . ILE B  2 184 ? -30.920  -50.418 11.437  1.00 49.00  ? 184  ILE B CG2   1 
ATOM   7895  C CD1   . ILE B  2 184 ? -33.902  -49.983 10.270  1.00 58.24  ? 184  ILE B CD1   1 
ATOM   7896  N N     . GLY B  2 185 ? -29.669  -52.709 13.121  1.00 48.43  ? 185  GLY B N     1 
ATOM   7897  C CA    . GLY B  2 185 ? -28.442  -52.661 13.906  1.00 45.94  ? 185  GLY B CA    1 
ATOM   7898  C C     . GLY B  2 185 ? -27.416  -51.781 13.219  1.00 44.29  ? 185  GLY B C     1 
ATOM   7899  O O     . GLY B  2 185 ? -27.082  -52.040 12.067  1.00 44.89  ? 185  GLY B O     1 
ATOM   7900  N N     . VAL B  2 186 ? -26.939  -50.717 13.895  1.00 36.17  ? 186  VAL B N     1 
ATOM   7901  C CA    . VAL B  2 186 ? -25.910  -49.788 13.370  1.00 33.59  ? 186  VAL B CA    1 
ATOM   7902  C C     . VAL B  2 186 ? -24.602  -50.005 14.046  1.00 37.80  ? 186  VAL B C     1 
ATOM   7903  O O     . VAL B  2 186 ? -24.554  -50.168 15.263  1.00 37.68  ? 186  VAL B O     1 
ATOM   7904  C CB    . VAL B  2 186 ? -26.208  -48.265 13.472  1.00 35.17  ? 186  VAL B CB    1 
ATOM   7905  C CG1   . VAL B  2 186 ? -26.092  -47.586 12.120  1.00 33.89  ? 186  VAL B CG1   1 
ATOM   7906  C CG2   . VAL B  2 186 ? -27.521  -47.951 14.181  1.00 34.73  ? 186  VAL B CG2   1 
ATOM   7907  N N     . MET B  2 187 ? -23.531  -49.876 13.275  1.00 35.83  ? 187  MET B N     1 
ATOM   7908  C CA    . MET B  2 187 ? -22.158  -49.960 13.764  1.00 37.08  ? 187  MET B CA    1 
ATOM   7909  C C     . MET B  2 187 ? -21.217  -49.067 12.962  1.00 42.33  ? 187  MET B C     1 
ATOM   7910  O O     . MET B  2 187 ? -21.509  -48.724 11.815  1.00 41.82  ? 187  MET B O     1 
ATOM   7911  C CB    . MET B  2 187 ? -21.642  -51.411 13.869  1.00 40.96  ? 187  MET B CB    1 
ATOM   7912  C CG    . MET B  2 187 ? -21.585  -52.156 12.542  1.00 45.65  ? 187  MET B CG    1 
ATOM   7913  S SD    . MET B  2 187 ? -20.339  -53.481 12.543  1.00 51.11  ? 187  MET B SD    1 
ATOM   7914  C CE    . MET B  2 187 ? -18.888  -52.550 12.192  1.00 46.73  ? 187  MET B CE    1 
ATOM   7915  N N     . THR B  2 188 ? -20.120  -48.650 13.593  1.00 39.90  ? 188  THR B N     1 
ATOM   7916  C CA    . THR B  2 188 ? -19.094  -47.844 12.945  1.00 39.64  ? 188  THR B CA    1 
ATOM   7917  C C     . THR B  2 188 ? -17.793  -48.627 13.011  1.00 46.85  ? 188  THR B C     1 
ATOM   7918  O O     . THR B  2 188 ? -17.519  -49.292 14.012  1.00 47.82  ? 188  THR B O     1 
ATOM   7919  C CB    . THR B  2 188 ? -18.937  -46.453 13.569  1.00 45.68  ? 188  THR B CB    1 
ATOM   7920  O OG1   . THR B  2 188 ? -18.794  -46.585 14.978  1.00 51.55  ? 188  THR B OG1   1 
ATOM   7921  C CG2   . THR B  2 188 ? -20.058  -45.497 13.212  1.00 41.46  ? 188  THR B CG2   1 
ATOM   7922  N N     . SER B  2 189 ? -16.997  -48.549 11.954  1.00 44.21  ? 189  SER B N     1 
ATOM   7923  C CA    . SER B  2 189 ? -15.728  -49.248 11.910  1.00 45.97  ? 189  SER B CA    1 
ATOM   7924  C C     . SER B  2 189 ? -14.628  -48.329 11.386  1.00 53.40  ? 189  SER B C     1 
ATOM   7925  O O     . SER B  2 189 ? -14.917  -47.277 10.775  1.00 52.34  ? 189  SER B O     1 
ATOM   7926  C CB    . SER B  2 189 ? -15.838  -50.508 11.065  1.00 50.42  ? 189  SER B CB    1 
ATOM   7927  O OG    . SER B  2 189 ? -15.028  -51.530 11.609  1.00 64.73  ? 189  SER B OG    1 
ATOM   7928  N N     . GLY B  2 190 ? -13.378  -48.723 11.667  1.00 51.56  ? 190  GLY B N     1 
ATOM   7929  C CA    . GLY B  2 190 ? -12.184  -47.981 11.266  1.00 51.06  ? 190  GLY B CA    1 
ATOM   7930  C C     . GLY B  2 190 ? -11.922  -46.722 12.074  1.00 52.68  ? 190  GLY B C     1 
ATOM   7931  O O     . GLY B  2 190 ? -12.589  -46.470 13.081  1.00 52.36  ? 190  GLY B O     1 
ATOM   7932  N N     . GLY B  2 191 ? -10.942  -45.940 11.627  1.00 47.14  ? 191  GLY B N     1 
ATOM   7933  C CA    . GLY B  2 191 ? -10.551  -44.691 12.266  1.00 45.84  ? 191  GLY B CA    1 
ATOM   7934  C C     . GLY B  2 191 ? -11.647  -43.643 12.260  1.00 49.36  ? 191  GLY B C     1 
ATOM   7935  O O     . GLY B  2 191 ? -12.501  -43.639 11.362  1.00 49.09  ? 191  GLY B O     1 
ATOM   7936  N N     . ASP B  2 192 ? -11.620  -42.751 13.289  1.00 45.36  ? 192  ASP B N     1 
ATOM   7937  C CA    . ASP B  2 192 ? -12.567  -41.659 13.505  1.00 43.81  ? 192  ASP B CA    1 
ATOM   7938  C C     . ASP B  2 192 ? -12.696  -40.848 12.229  1.00 48.27  ? 192  ASP B C     1 
ATOM   7939  O O     . ASP B  2 192 ? -11.690  -40.531 11.599  1.00 48.92  ? 192  ASP B O     1 
ATOM   7940  C CB    . ASP B  2 192 ? -12.125  -40.765 14.669  1.00 45.58  ? 192  ASP B CB    1 
ATOM   7941  C CG    . ASP B  2 192 ? -12.237  -41.406 16.038  1.00 67.70  ? 192  ASP B CG    1 
ATOM   7942  O OD1   . ASP B  2 192 ? -13.261  -41.161 16.735  1.00 67.60  ? 192  ASP B OD1   1 
ATOM   7943  O OD2   . ASP B  2 192 ? -11.284  -42.115 16.439  1.00 83.90  ? 192  ASP B OD2   1 
ATOM   7944  N N     . SER B  2 193 ? -13.930  -40.566 11.813  1.00 43.47  ? 193  SER B N     1 
ATOM   7945  C CA    . SER B  2 193 ? -14.206  -39.822 10.597  1.00 41.61  ? 193  SER B CA    1 
ATOM   7946  C C     . SER B  2 193 ? -15.299  -38.803 10.917  1.00 43.17  ? 193  SER B C     1 
ATOM   7947  O O     . SER B  2 193 ? -16.371  -39.232 11.329  1.00 44.11  ? 193  SER B O     1 
ATOM   7948  C CB    . SER B  2 193 ? -14.666  -40.795 9.516   1.00 46.54  ? 193  SER B CB    1 
ATOM   7949  O OG    . SER B  2 193 ? -14.651  -40.208 8.227   1.00 59.51  ? 193  SER B OG    1 
ATOM   7950  N N     . PRO B  2 194 ? -15.085  -37.462 10.814  1.00 36.99  ? 194  PRO B N     1 
ATOM   7951  C CA    . PRO B  2 194 ? -16.180  -36.528 11.150  1.00 35.27  ? 194  PRO B CA    1 
ATOM   7952  C C     . PRO B  2 194 ? -17.450  -36.783 10.318  1.00 38.83  ? 194  PRO B C     1 
ATOM   7953  O O     . PRO B  2 194 ? -17.356  -36.964 9.102   1.00 39.14  ? 194  PRO B O     1 
ATOM   7954  C CB    . PRO B  2 194 ? -15.562  -35.151 10.895  1.00 35.38  ? 194  PRO B CB    1 
ATOM   7955  C CG    . PRO B  2 194 ? -14.112  -35.364 10.934  1.00 39.19  ? 194  PRO B CG    1 
ATOM   7956  C CD    . PRO B  2 194 ? -13.889  -36.722 10.371  1.00 36.63  ? 194  PRO B CD    1 
ATOM   7957  N N     . GLY B  2 195 ? -18.600  -36.880 10.988  1.00 34.18  ? 195  GLY B N     1 
ATOM   7958  C CA    . GLY B  2 195 ? -19.861  -37.143 10.312  1.00 34.68  ? 195  GLY B CA    1 
ATOM   7959  C C     . GLY B  2 195 ? -20.450  -38.494 10.652  1.00 42.45  ? 195  GLY B C     1 
ATOM   7960  O O     . GLY B  2 195 ? -21.573  -38.802 10.239  1.00 43.19  ? 195  GLY B O     1 
ATOM   7961  N N     . MET B  2 196 ? -19.709  -39.306 11.427  1.00 40.02  ? 196  MET B N     1 
ATOM   7962  C CA    . MET B  2 196 ? -20.153  -40.631 11.861  1.00 39.48  ? 196  MET B CA    1 
ATOM   7963  C C     . MET B  2 196 ? -21.369  -40.492 12.817  1.00 44.03  ? 196  MET B C     1 
ATOM   7964  O O     . MET B  2 196 ? -22.345  -41.233 12.632  1.00 44.92  ? 196  MET B O     1 
ATOM   7965  C CB    . MET B  2 196 ? -18.994  -41.463 12.467  1.00 41.30  ? 196  MET B CB    1 
ATOM   7966  C CG    . MET B  2 196 ? -17.894  -41.777 11.464  1.00 44.43  ? 196  MET B CG    1 
ATOM   7967  S SD    . MET B  2 196 ? -17.186  -43.454 11.521  1.00 50.15  ? 196  MET B SD    1 
ATOM   7968  C CE    . MET B  2 196 ? -15.717  -43.189 12.316  1.00 45.60  ? 196  MET B CE    1 
ATOM   7969  N N     . ASN B  2 197 ? -21.342  -39.490 13.772  1.00 37.78  ? 197  ASN B N     1 
ATOM   7970  C CA    . ASN B  2 197 ? -22.453  -39.199 14.705  1.00 36.18  ? 197  ASN B CA    1 
ATOM   7971  C C     . ASN B  2 197 ? -23.695  -38.728 13.922  1.00 36.26  ? 197  ASN B C     1 
ATOM   7972  O O     . ASN B  2 197 ? -24.711  -39.418 14.015  1.00 36.37  ? 197  ASN B O     1 
ATOM   7973  C CB    . ASN B  2 197 ? -22.053  -38.216 15.818  1.00 35.81  ? 197  ASN B CB    1 
ATOM   7974  C CG    . ASN B  2 197 ? -21.020  -38.737 16.764  1.00 53.13  ? 197  ASN B CG    1 
ATOM   7975  O OD1   . ASN B  2 197 ? -21.148  -39.826 17.346  1.00 45.88  ? 197  ASN B OD1   1 
ATOM   7976  N ND2   . ASN B  2 197 ? -19.968  -37.958 16.936  1.00 41.92  ? 197  ASN B ND2   1 
ATOM   7977  N N     . PRO B  2 198 ? -23.609  -37.680 13.050  1.00 29.17  ? 198  PRO B N     1 
ATOM   7978  C CA    . PRO B  2 198 ? -24.754  -37.320 12.201  1.00 28.86  ? 198  PRO B CA    1 
ATOM   7979  C C     . PRO B  2 198 ? -25.381  -38.506 11.447  1.00 35.18  ? 198  PRO B C     1 
ATOM   7980  O O     . PRO B  2 198 ? -26.624  -38.598 11.354  1.00 38.23  ? 198  PRO B O     1 
ATOM   7981  C CB    . PRO B  2 198 ? -24.144  -36.328 11.219  1.00 29.55  ? 198  PRO B CB    1 
ATOM   7982  C CG    . PRO B  2 198 ? -23.109  -35.680 11.995  1.00 33.66  ? 198  PRO B CG    1 
ATOM   7983  C CD    . PRO B  2 198 ? -22.485  -36.767 12.790  1.00 29.78  ? 198  PRO B CD    1 
ATOM   7984  N N     . PHE B  2 199 ? -24.537  -39.418 10.924  1.00 28.82  ? 199  PHE B N     1 
ATOM   7985  C CA    . PHE B  2 199 ? -25.017  -40.615 10.243  1.00 28.68  ? 199  PHE B CA    1 
ATOM   7986  C C     . PHE B  2 199 ? -25.814  -41.488 11.216  1.00 28.51  ? 199  PHE B C     1 
ATOM   7987  O O     . PHE B  2 199 ? -26.951  -41.829 10.909  1.00 27.11  ? 199  PHE B O     1 
ATOM   7988  C CB    . PHE B  2 199 ? -23.862  -41.423 9.603   1.00 31.19  ? 199  PHE B CB    1 
ATOM   7989  C CG    . PHE B  2 199 ? -24.303  -42.714 8.930   1.00 33.62  ? 199  PHE B CG    1 
ATOM   7990  C CD1   . PHE B  2 199 ? -24.317  -43.918 9.631   1.00 36.68  ? 199  PHE B CD1   1 
ATOM   7991  C CD2   . PHE B  2 199 ? -24.722  -42.721 7.604   1.00 35.59  ? 199  PHE B CD2   1 
ATOM   7992  C CE1   . PHE B  2 199 ? -24.735  -45.107 9.016   1.00 37.49  ? 199  PHE B CE1   1 
ATOM   7993  C CE2   . PHE B  2 199 ? -25.138  -43.915 6.991   1.00 38.48  ? 199  PHE B CE2   1 
ATOM   7994  C CZ    . PHE B  2 199 ? -25.138  -45.096 7.702   1.00 36.52  ? 199  PHE B CZ    1 
ATOM   7995  N N     . VAL B  2 200 ? -25.218  -41.854 12.375  1.00 23.01  ? 200  VAL B N     1 
ATOM   7996  C CA    . VAL B  2 200 ? -25.895  -42.706 13.368  1.00 21.88  ? 200  VAL B CA    1 
ATOM   7997  C C     . VAL B  2 200 ? -27.215  -42.051 13.854  1.00 25.93  ? 200  VAL B C     1 
ATOM   7998  O O     . VAL B  2 200 ? -28.263  -42.710 13.811  1.00 26.09  ? 200  VAL B O     1 
ATOM   7999  C CB    . VAL B  2 200 ? -24.960  -43.241 14.488  1.00 23.35  ? 200  VAL B CB    1 
ATOM   8000  C CG1   . VAL B  2 200 ? -25.723  -44.052 15.516  1.00 23.78  ? 200  VAL B CG1   1 
ATOM   8001  C CG2   . VAL B  2 200 ? -23.826  -44.069 13.907  1.00 22.82  ? 200  VAL B CG2   1 
ATOM   8002  N N     . ARG B  2 201 ? -27.184  -40.741 14.170  1.00 21.65  ? 201  ARG B N     1 
ATOM   8003  C CA    . ARG B  2 201 ? -28.374  -39.974 14.555  1.00 22.59  ? 201  ARG B CA    1 
ATOM   8004  C C     . ARG B  2 201 ? -29.503  -40.220 13.547  1.00 27.67  ? 201  ARG B C     1 
ATOM   8005  O O     . ARG B  2 201 ? -30.612  -40.558 13.952  1.00 26.18  ? 201  ARG B O     1 
ATOM   8006  C CB    . ARG B  2 201 ? -28.041  -38.459 14.653  1.00 25.69  ? 201  ARG B CB    1 
ATOM   8007  C CG    . ARG B  2 201 ? -29.217  -37.553 15.057  1.00 38.27  ? 201  ARG B CG    1 
ATOM   8008  C CD    . ARG B  2 201 ? -28.761  -36.126 15.313  1.00 38.47  ? 201  ARG B CD    1 
ATOM   8009  N NE    . ARG B  2 201 ? -29.802  -35.109 15.084  1.00 39.10  ? 201  ARG B NE    1 
ATOM   8010  C CZ    . ARG B  2 201 ? -30.130  -34.621 13.888  1.00 49.37  ? 201  ARG B CZ    1 
ATOM   8011  N NH1   . ARG B  2 201 ? -29.545  -35.083 12.790  1.00 49.31  ? 201  ARG B NH1   1 
ATOM   8012  N NH2   . ARG B  2 201 ? -31.032  -33.658 13.782  1.00 22.78  ? 201  ARG B NH2   1 
ATOM   8013  N N     . ALA B  2 202 ? -29.177  -40.094 12.229  1.00 27.40  ? 202  ALA B N     1 
ATOM   8014  C CA    . ALA B  2 202 ? -30.075  -40.288 11.083  1.00 28.45  ? 202  ALA B CA    1 
ATOM   8015  C C     . ALA B  2 202 ? -30.650  -41.708 11.051  1.00 35.78  ? 202  ALA B C     1 
ATOM   8016  O O     . ALA B  2 202 ? -31.860  -41.861 10.969  1.00 34.32  ? 202  ALA B O     1 
ATOM   8017  C CB    . ALA B  2 202 ? -29.337  -39.986 9.791   1.00 28.81  ? 202  ALA B CB    1 
ATOM   8018  N N     . VAL B  2 203 ? -29.786  -42.741 11.177  1.00 35.44  ? 203  VAL B N     1 
ATOM   8019  C CA    . VAL B  2 203 ? -30.212  -44.140 11.177  1.00 36.60  ? 203  VAL B CA    1 
ATOM   8020  C C     . VAL B  2 203 ? -31.175  -44.427 12.355  1.00 42.39  ? 203  VAL B C     1 
ATOM   8021  O O     . VAL B  2 203 ? -32.229  -45.074 12.153  1.00 44.40  ? 203  VAL B O     1 
ATOM   8022  C CB    . VAL B  2 203 ? -29.011  -45.109 11.124  1.00 39.45  ? 203  VAL B CB    1 
ATOM   8023  C CG1   . VAL B  2 203 ? -29.455  -46.554 11.310  1.00 39.97  ? 203  VAL B CG1   1 
ATOM   8024  C CG2   . VAL B  2 203 ? -28.264  -44.950 9.814   1.00 39.00  ? 203  VAL B CG2   1 
ATOM   8025  N N     . VAL B  2 204 ? -30.819  -43.922 13.570  1.00 34.63  ? 204  VAL B N     1 
ATOM   8026  C CA    . VAL B  2 204 ? -31.628  -44.138 14.766  1.00 32.73  ? 204  VAL B CA    1 
ATOM   8027  C C     . VAL B  2 204 ? -33.029  -43.544 14.567  1.00 33.29  ? 204  VAL B C     1 
ATOM   8028  O O     . VAL B  2 204 ? -34.011  -44.270 14.723  1.00 34.68  ? 204  VAL B O     1 
ATOM   8029  C CB    . VAL B  2 204 ? -30.930  -43.695 16.084  1.00 34.90  ? 204  VAL B CB    1 
ATOM   8030  C CG1   . VAL B  2 204 ? -31.853  -43.889 17.288  1.00 35.62  ? 204  VAL B CG1   1 
ATOM   8031  C CG2   . VAL B  2 204 ? -29.623  -44.445 16.302  1.00 34.17  ? 204  VAL B CG2   1 
ATOM   8032  N N     . ARG B  2 205 ? -33.106  -42.278 14.127  1.00 25.18  ? 205  ARG B N     1 
ATOM   8033  C CA    . ARG B  2 205 ? -34.374  -41.580 13.921  1.00 24.27  ? 205  ARG B CA    1 
ATOM   8034  C C     . ARG B  2 205 ? -35.203  -42.105 12.741  1.00 36.42  ? 205  ARG B C     1 
ATOM   8035  O O     . ARG B  2 205 ? -36.403  -42.384 12.922  1.00 38.51  ? 205  ARG B O     1 
ATOM   8036  C CB    . ARG B  2 205 ? -34.180  -40.072 13.870  1.00 16.01  ? 205  ARG B CB    1 
ATOM   8037  C CG    . ARG B  2 205 ? -34.030  -39.528 15.259  1.00 13.86  ? 205  ARG B CG    1 
ATOM   8038  C CD    . ARG B  2 205 ? -33.529  -38.123 15.357  1.00 12.66  ? 205  ARG B CD    1 
ATOM   8039  N NE    . ARG B  2 205 ? -33.172  -37.832 16.748  1.00 28.92  ? 205  ARG B NE    1 
ATOM   8040  C CZ    . ARG B  2 205 ? -33.164  -36.621 17.301  1.00 50.40  ? 205  ARG B CZ    1 
ATOM   8041  N NH1   . ARG B  2 205 ? -33.487  -35.548 16.580  1.00 35.42  ? 205  ARG B NH1   1 
ATOM   8042  N NH2   . ARG B  2 205 ? -32.834  -36.473 18.573  1.00 44.08  ? 205  ARG B NH2   1 
ATOM   8043  N N     . ALA B  2 206 ? -34.562  -42.292 11.554  1.00 33.88  ? 206  ALA B N     1 
ATOM   8044  C CA    . ALA B  2 206 ? -35.218  -42.790 10.343  1.00 33.26  ? 206  ALA B CA    1 
ATOM   8045  C C     . ALA B  2 206 ? -35.882  -44.122 10.602  1.00 36.75  ? 206  ALA B C     1 
ATOM   8046  O O     . ALA B  2 206 ? -37.070  -44.252 10.304  1.00 36.15  ? 206  ALA B O     1 
ATOM   8047  C CB    . ALA B  2 206 ? -34.220  -42.909 9.199   1.00 33.83  ? 206  ALA B CB    1 
ATOM   8048  N N     . GLY B  2 207 ? -35.129  -45.056 11.210  1.00 33.39  ? 207  GLY B N     1 
ATOM   8049  C CA    . GLY B  2 207 ? -35.578  -46.406 11.557  1.00 33.89  ? 207  GLY B CA    1 
ATOM   8050  C C     . GLY B  2 207 ? -36.725  -46.393 12.540  1.00 35.59  ? 207  GLY B C     1 
ATOM   8051  O O     . GLY B  2 207 ? -37.692  -47.156 12.378  1.00 33.69  ? 207  GLY B O     1 
ATOM   8052  N N     . ILE B  2 208 ? -36.630  -45.477 13.557  1.00 30.34  ? 208  ILE B N     1 
ATOM   8053  C CA    . ILE B  2 208 ? -37.674  -45.261 14.577  1.00 28.99  ? 208  ILE B CA    1 
ATOM   8054  C C     . ILE B  2 208 ? -38.991  -44.785 13.900  1.00 36.15  ? 208  ILE B C     1 
ATOM   8055  O O     . ILE B  2 208 ? -40.057  -45.401 14.117  1.00 36.00  ? 208  ILE B O     1 
ATOM   8056  C CB    . ILE B  2 208 ? -37.181  -44.370 15.763  1.00 27.70  ? 208  ILE B CB    1 
ATOM   8057  C CG1   . ILE B  2 208 ? -36.366  -45.225 16.739  1.00 27.29  ? 208  ILE B CG1   1 
ATOM   8058  C CG2   . ILE B  2 208 ? -38.337  -43.702 16.487  1.00 24.56  ? 208  ILE B CG2   1 
ATOM   8059  C CD1   . ILE B  2 208 ? -35.539  -44.493 17.696  1.00 28.69  ? 208  ILE B CD1   1 
ATOM   8060  N N     . TYR B  2 209 ? -38.874  -43.735 13.045  1.00 32.03  ? 209  TYR B N     1 
ATOM   8061  C CA    . TYR B  2 209 ? -39.963  -43.158 12.257  1.00 32.90  ? 209  TYR B CA    1 
ATOM   8062  C C     . TYR B  2 209 ? -40.629  -44.228 11.375  1.00 37.49  ? 209  TYR B C     1 
ATOM   8063  O O     . TYR B  2 209 ? -41.859  -44.306 11.342  1.00 37.46  ? 209  TYR B O     1 
ATOM   8064  C CB    . TYR B  2 209 ? -39.408  -42.000 11.419  1.00 33.94  ? 209  TYR B CB    1 
ATOM   8065  C CG    . TYR B  2 209 ? -40.319  -41.420 10.360  1.00 36.58  ? 209  TYR B CG    1 
ATOM   8066  C CD1   . TYR B  2 209 ? -41.241  -40.438 10.673  1.00 38.78  ? 209  TYR B CD1   1 
ATOM   8067  C CD2   . TYR B  2 209 ? -40.152  -41.744 9.025   1.00 39.12  ? 209  TYR B CD2   1 
ATOM   8068  C CE1   . TYR B  2 209 ? -42.011  -39.822 9.686   1.00 41.69  ? 209  TYR B CE1   1 
ATOM   8069  C CE2   . TYR B  2 209 ? -40.930  -41.157 8.031   1.00 41.12  ? 209  TYR B CE2   1 
ATOM   8070  C CZ    . TYR B  2 209 ? -41.854  -40.189 8.359   1.00 48.09  ? 209  TYR B CZ    1 
ATOM   8071  O OH    . TYR B  2 209 ? -42.617  -39.655 7.344   1.00 47.51  ? 209  TYR B OH    1 
ATOM   8072  N N     . LYS B  2 210 ? -39.812  -45.083 10.714  1.00 33.40  ? 210  LYS B N     1 
ATOM   8073  C CA    . LYS B  2 210 ? -40.315  -46.172 9.874   1.00 34.00  ? 210  LYS B CA    1 
ATOM   8074  C C     . LYS B  2 210 ? -40.842  -47.342 10.708  1.00 39.78  ? 210  LYS B C     1 
ATOM   8075  O O     . LYS B  2 210 ? -41.227  -48.369 10.167  1.00 41.00  ? 210  LYS B O     1 
ATOM   8076  C CB    . LYS B  2 210 ? -39.290  -46.620 8.815   1.00 35.80  ? 210  LYS B CB    1 
ATOM   8077  C CG    . LYS B  2 210 ? -38.952  -45.575 7.755   1.00 43.05  ? 210  LYS B CG    1 
ATOM   8078  C CD    . LYS B  2 210 ? -40.073  -45.287 6.768   1.00 43.62  ? 210  LYS B CD    1 
ATOM   8079  C CE    . LYS B  2 210 ? -39.705  -44.119 5.875   1.00 55.01  ? 210  LYS B CE    1 
ATOM   8080  N NZ    . LYS B  2 210 ? -40.861  -43.569 5.111   1.00 68.30  ? 210  LYS B NZ    1 
ATOM   8081  N N     . GLY B  2 211 ? -40.915  -47.148 12.012  1.00 37.84  ? 211  GLY B N     1 
ATOM   8082  C CA    . GLY B  2 211 ? -41.502  -48.104 12.935  1.00 39.77  ? 211  GLY B CA    1 
ATOM   8083  C C     . GLY B  2 211 ? -40.694  -49.327 13.264  1.00 47.47  ? 211  GLY B C     1 
ATOM   8084  O O     . GLY B  2 211 ? -41.276  -50.402 13.413  1.00 50.93  ? 211  GLY B O     1 
ATOM   8085  N N     . CYS B  2 212 ? -39.363  -49.187 13.420  1.00 42.73  ? 212  CYS B N     1 
ATOM   8086  C CA    . CYS B  2 212 ? -38.531  -50.324 13.803  1.00 42.98  ? 212  CYS B CA    1 
ATOM   8087  C C     . CYS B  2 212 ? -37.450  -50.059 14.840  1.00 45.33  ? 212  CYS B C     1 
ATOM   8088  O O     . CYS B  2 212 ? -36.889  -48.970 14.868  1.00 44.00  ? 212  CYS B O     1 
ATOM   8089  C CB    . CYS B  2 212 ? -38.020  -51.122 12.609  1.00 44.20  ? 212  CYS B CB    1 
ATOM   8090  S SG    . CYS B  2 212 ? -37.463  -50.139 11.193  1.00 46.53  ? 212  CYS B SG    1 
ATOM   8091  N N     . LYS B  2 213 ? -37.194  -51.052 15.722  1.00 42.55  ? 213  LYS B N     1 
ATOM   8092  C CA    . LYS B  2 213 ? -36.218  -50.973 16.815  1.00 41.70  ? 213  LYS B CA    1 
ATOM   8093  C C     . LYS B  2 213 ? -34.824  -50.774 16.282  1.00 46.33  ? 213  LYS B C     1 
ATOM   8094  O O     . LYS B  2 213 ? -34.396  -51.524 15.406  1.00 49.01  ? 213  LYS B O     1 
ATOM   8095  C CB    . LYS B  2 213 ? -36.260  -52.232 17.699  1.00 45.03  ? 213  LYS B CB    1 
ATOM   8096  C CG    . LYS B  2 213 ? -37.253  -52.179 18.855  1.00 59.49  ? 213  LYS B CG    1 
ATOM   8097  C CD    . LYS B  2 213 ? -37.481  -53.566 19.477  1.00 80.76  ? 213  LYS B CD    1 
ATOM   8098  C CE    . LYS B  2 213 ? -36.442  -53.983 20.505  1.00 106.21 ? 213  LYS B CE    1 
ATOM   8099  N NZ    . LYS B  2 213 ? -36.685  -53.370 21.839  1.00 121.68 ? 213  LYS B NZ    1 
ATOM   8100  N N     . VAL B  2 214 ? -34.118  -49.753 16.784  1.00 40.07  ? 214  VAL B N     1 
ATOM   8101  C CA    . VAL B  2 214 ? -32.740  -49.508 16.374  1.00 37.94  ? 214  VAL B CA    1 
ATOM   8102  C C     . VAL B  2 214 ? -31.798  -49.888 17.532  1.00 45.02  ? 214  VAL B C     1 
ATOM   8103  O O     . VAL B  2 214 ? -32.018  -49.480 18.673  1.00 44.99  ? 214  VAL B O     1 
ATOM   8104  C CB    . VAL B  2 214 ? -32.515  -48.071 15.878  1.00 38.00  ? 214  VAL B CB    1 
ATOM   8105  C CG1   . VAL B  2 214 ? -31.116  -47.916 15.312  1.00 36.65  ? 214  VAL B CG1   1 
ATOM   8106  C CG2   . VAL B  2 214 ? -33.560  -47.670 14.840  1.00 37.68  ? 214  VAL B CG2   1 
ATOM   8107  N N     . PHE B  2 215 ? -30.783  -50.706 17.233  1.00 43.56  ? 215  PHE B N     1 
ATOM   8108  C CA    . PHE B  2 215 ? -29.736  -51.114 18.166  1.00 44.49  ? 215  PHE B CA    1 
ATOM   8109  C C     . PHE B  2 215 ? -28.400  -50.531 17.719  1.00 46.67  ? 215  PHE B C     1 
ATOM   8110  O O     . PHE B  2 215 ? -28.041  -50.641 16.545  1.00 45.65  ? 215  PHE B O     1 
ATOM   8111  C CB    . PHE B  2 215 ? -29.604  -52.628 18.206  1.00 49.27  ? 215  PHE B CB    1 
ATOM   8112  C CG    . PHE B  2 215 ? -30.674  -53.335 18.990  1.00 54.10  ? 215  PHE B CG    1 
ATOM   8113  C CD1   . PHE B  2 215 ? -30.516  -53.573 20.349  1.00 59.17  ? 215  PHE B CD1   1 
ATOM   8114  C CD2   . PHE B  2 215 ? -31.816  -53.824 18.360  1.00 57.93  ? 215  PHE B CD2   1 
ATOM   8115  C CE1   . PHE B  2 215 ? -31.498  -54.252 21.072  1.00 61.23  ? 215  PHE B CE1   1 
ATOM   8116  C CE2   . PHE B  2 215 ? -32.799  -54.497 19.085  1.00 61.75  ? 215  PHE B CE2   1 
ATOM   8117  C CZ    . PHE B  2 215 ? -32.634  -54.705 20.435  1.00 60.36  ? 215  PHE B CZ    1 
ATOM   8118  N N     . CYS B  2 216 ? -27.661  -49.923 18.643  1.00 42.73  ? 216  CYS B N     1 
ATOM   8119  C CA    . CYS B  2 216 ? -26.347  -49.378 18.332  1.00 41.82  ? 216  CYS B CA    1 
ATOM   8120  C C     . CYS B  2 216 ? -25.293  -50.371 18.785  1.00 47.29  ? 216  CYS B C     1 
ATOM   8121  O O     . CYS B  2 216 ? -25.204  -50.658 19.973  1.00 47.75  ? 216  CYS B O     1 
ATOM   8122  C CB    . CYS B  2 216 ? -26.156  -48.002 18.971  1.00 40.55  ? 216  CYS B CB    1 
ATOM   8123  S SG    . CYS B  2 216 ? -26.913  -46.637 18.034  1.00 42.58  ? 216  CYS B SG    1 
ATOM   8124  N N     . ILE B  2 217 ? -24.561  -50.963 17.831  1.00 45.31  ? 217  ILE B N     1 
ATOM   8125  C CA    . ILE B  2 217 ? -23.506  -51.944 18.108  1.00 46.61  ? 217  ILE B CA    1 
ATOM   8126  C C     . ILE B  2 217 ? -22.217  -51.191 18.460  1.00 50.84  ? 217  ILE B C     1 
ATOM   8127  O O     . ILE B  2 217 ? -21.490  -50.704 17.581  1.00 49.27  ? 217  ILE B O     1 
ATOM   8128  C CB    . ILE B  2 217 ? -23.322  -52.974 16.962  1.00 50.91  ? 217  ILE B CB    1 
ATOM   8129  C CG1   . ILE B  2 217 ? -24.629  -53.710 16.680  1.00 52.64  ? 217  ILE B CG1   1 
ATOM   8130  C CG2   . ILE B  2 217 ? -22.211  -53.978 17.272  1.00 53.85  ? 217  ILE B CG2   1 
ATOM   8131  C CD1   . ILE B  2 217 ? -25.061  -53.584 15.299  1.00 61.92  ? 217  ILE B CD1   1 
ATOM   8132  N N     . HIS B  2 218 ? -21.961  -51.089 19.768  1.00 48.22  ? 218  HIS B N     1 
ATOM   8133  C CA    . HIS B  2 218 ? -20.796  -50.431 20.336  1.00 47.21  ? 218  HIS B CA    1 
ATOM   8134  C C     . HIS B  2 218 ? -19.542  -51.221 20.075  1.00 55.29  ? 218  HIS B C     1 
ATOM   8135  O O     . HIS B  2 218 ? -19.551  -52.451 20.150  1.00 57.44  ? 218  HIS B O     1 
ATOM   8136  C CB    . HIS B  2 218 ? -20.993  -50.207 21.831  1.00 47.41  ? 218  HIS B CB    1 
ATOM   8137  C CG    . HIS B  2 218 ? -21.912  -49.070 22.107  1.00 48.71  ? 218  HIS B CG    1 
ATOM   8138  N ND1   . HIS B  2 218 ? -21.432  -47.838 22.513  1.00 48.77  ? 218  HIS B ND1   1 
ATOM   8139  C CD2   . HIS B  2 218 ? -23.250  -48.993 21.952  1.00 49.89  ? 218  HIS B CD2   1 
ATOM   8140  C CE1   . HIS B  2 218 ? -22.497  -47.064 22.612  1.00 47.58  ? 218  HIS B CE1   1 
ATOM   8141  N NE2   . HIS B  2 218 ? -23.611  -47.716 22.280  1.00 48.49  ? 218  HIS B NE2   1 
ATOM   8142  N N     . GLU B  2 219 ? -18.466  -50.507 19.757  1.00 52.31  ? 219  GLU B N     1 
ATOM   8143  C CA    . GLU B  2 219 ? -17.138  -51.051 19.437  1.00 52.84  ? 219  GLU B CA    1 
ATOM   8144  C C     . GLU B  2 219 ? -17.128  -51.904 18.150  1.00 56.72  ? 219  GLU B C     1 
ATOM   8145  O O     . GLU B  2 219 ? -16.417  -52.906 18.080  1.00 59.73  ? 219  GLU B O     1 
ATOM   8146  C CB    . GLU B  2 219 ? -16.462  -51.755 20.650  1.00 55.41  ? 219  GLU B CB    1 
ATOM   8147  C CG    . GLU B  2 219 ? -16.469  -50.982 21.963  1.00 68.15  ? 219  GLU B CG    1 
ATOM   8148  C CD    . GLU B  2 219 ? -16.033  -49.528 21.912  1.00 102.22 ? 219  GLU B CD    1 
ATOM   8149  O OE1   . GLU B  2 219 ? -14.910  -49.249 21.429  1.00 103.00 ? 219  GLU B OE1   1 
ATOM   8150  O OE2   . GLU B  2 219 ? -16.819  -48.668 22.372  1.00 102.29 ? 219  GLU B OE2   1 
ATOM   8151  N N     . GLY B  2 220 ? -17.906  -51.477 17.152  1.00 49.97  ? 220  GLY B N     1 
ATOM   8152  C CA    . GLY B  2 220 ? -18.012  -52.115 15.842  1.00 50.11  ? 220  GLY B CA    1 
ATOM   8153  C C     . GLY B  2 220 ? -18.081  -53.633 15.824  1.00 55.94  ? 220  GLY B C     1 
ATOM   8154  O O     . GLY B  2 220 ? -18.915  -54.241 16.506  1.00 54.71  ? 220  GLY B O     1 
ATOM   8155  N N     . TYR B  2 221 ? -17.173  -54.255 15.053  1.00 55.15  ? 221  TYR B N     1 
ATOM   8156  C CA    . TYR B  2 221 ? -17.091  -55.713 14.930  1.00 56.43  ? 221  TYR B CA    1 
ATOM   8157  C C     . TYR B  2 221 ? -16.824  -56.428 16.237  1.00 61.19  ? 221  TYR B C     1 
ATOM   8158  O O     . TYR B  2 221 ? -17.415  -57.482 16.453  1.00 62.97  ? 221  TYR B O     1 
ATOM   8159  C CB    . TYR B  2 221 ? -16.135  -56.145 13.814  1.00 57.68  ? 221  TYR B CB    1 
ATOM   8160  C CG    . TYR B  2 221 ? -16.661  -55.837 12.430  1.00 58.45  ? 221  TYR B CG    1 
ATOM   8161  C CD1   . TYR B  2 221 ? -17.871  -56.369 11.985  1.00 61.42  ? 221  TYR B CD1   1 
ATOM   8162  C CD2   . TYR B  2 221 ? -15.945  -55.025 11.556  1.00 57.16  ? 221  TYR B CD2   1 
ATOM   8163  C CE1   . TYR B  2 221 ? -18.364  -56.083 10.714  1.00 60.81  ? 221  TYR B CE1   1 
ATOM   8164  C CE2   . TYR B  2 221 ? -16.411  -54.762 10.271  1.00 57.26  ? 221  TYR B CE2   1 
ATOM   8165  C CZ    . TYR B  2 221 ? -17.622  -55.292 9.856   1.00 64.74  ? 221  TYR B CZ    1 
ATOM   8166  O OH    . TYR B  2 221 ? -18.088  -55.032 8.598   1.00 65.94  ? 221  TYR B OH    1 
ATOM   8167  N N     . GLU B  2 222 ? -16.007  -55.826 17.136  1.00 56.38  ? 222  GLU B N     1 
ATOM   8168  C CA    . GLU B  2 222 ? -15.716  -56.369 18.469  1.00 57.56  ? 222  GLU B CA    1 
ATOM   8169  C C     . GLU B  2 222 ? -17.025  -56.557 19.240  1.00 60.10  ? 222  GLU B C     1 
ATOM   8170  O O     . GLU B  2 222 ? -17.271  -57.619 19.803  1.00 59.71  ? 222  GLU B O     1 
ATOM   8171  C CB    . GLU B  2 222 ? -14.737  -55.450 19.233  1.00 58.44  ? 222  GLU B CB    1 
ATOM   8172  C CG    . GLU B  2 222 ? -14.711  -55.632 20.747  1.00 72.63  ? 222  GLU B CG    1 
ATOM   8173  C CD    . GLU B  2 222 ? -13.646  -54.819 21.457  1.00 99.41  ? 222  GLU B CD    1 
ATOM   8174  O OE1   . GLU B  2 222 ? -13.917  -53.647 21.810  1.00 90.47  ? 222  GLU B OE1   1 
ATOM   8175  O OE2   . GLU B  2 222 ? -12.536  -55.360 21.660  1.00 97.89  ? 222  GLU B OE2   1 
ATOM   8176  N N     . GLY B  2 223 ? -17.862  -55.533 19.199  1.00 55.89  ? 223  GLY B N     1 
ATOM   8177  C CA    . GLY B  2 223 ? -19.158  -55.531 19.854  1.00 55.34  ? 223  GLY B CA    1 
ATOM   8178  C C     . GLY B  2 223 ? -20.109  -56.523 19.243  1.00 59.50  ? 223  GLY B C     1 
ATOM   8179  O O     . GLY B  2 223 ? -20.900  -57.135 19.965  1.00 60.95  ? 223  GLY B O     1 
ATOM   8180  N N     . LEU B  2 224 ? -20.018  -56.695 17.908  1.00 54.34  ? 224  LEU B N     1 
ATOM   8181  C CA    . LEU B  2 224 ? -20.836  -57.624 17.128  1.00 54.80  ? 224  LEU B CA    1 
ATOM   8182  C C     . LEU B  2 224 ? -20.457  -59.090 17.440  1.00 59.81  ? 224  LEU B C     1 
ATOM   8183  O O     . LEU B  2 224 ? -21.349  -59.925 17.635  1.00 60.52  ? 224  LEU B O     1 
ATOM   8184  C CB    . LEU B  2 224 ? -20.689  -57.296 15.628  1.00 53.77  ? 224  LEU B CB    1 
ATOM   8185  C CG    . LEU B  2 224 ? -21.630  -57.961 14.622  1.00 57.51  ? 224  LEU B CG    1 
ATOM   8186  C CD1   . LEU B  2 224 ? -23.076  -57.633 14.895  1.00 58.24  ? 224  LEU B CD1   1 
ATOM   8187  C CD2   . LEU B  2 224 ? -21.263  -57.539 13.216  1.00 55.86  ? 224  LEU B CD2   1 
ATOM   8188  N N     . VAL B  2 225 ? -19.140  -59.375 17.546  1.00 55.55  ? 225  VAL B N     1 
ATOM   8189  C CA    . VAL B  2 225 ? -18.608  -60.710 17.861  1.00 57.01  ? 225  VAL B CA    1 
ATOM   8190  C C     . VAL B  2 225 ? -18.844  -61.071 19.342  1.00 61.95  ? 225  VAL B C     1 
ATOM   8191  O O     . VAL B  2 225 ? -19.260  -62.193 19.625  1.00 63.35  ? 225  VAL B O     1 
ATOM   8192  C CB    . VAL B  2 225 ? -17.127  -60.885 17.414  1.00 60.22  ? 225  VAL B CB    1 
ATOM   8193  C CG1   . VAL B  2 225 ? -16.561  -62.232 17.865  1.00 62.52  ? 225  VAL B CG1   1 
ATOM   8194  C CG2   . VAL B  2 225 ? -16.986  -60.735 15.902  1.00 58.90  ? 225  VAL B CG2   1 
ATOM   8195  N N     . ARG B  2 226 ? -18.582  -60.128 20.276  1.00 56.91  ? 226  ARG B N     1 
ATOM   8196  C CA    . ARG B  2 226 ? -18.782  -60.360 21.711  1.00 57.04  ? 226  ARG B CA    1 
ATOM   8197  C C     . ARG B  2 226 ? -20.258  -60.433 22.057  1.00 64.13  ? 226  ARG B C     1 
ATOM   8198  O O     . ARG B  2 226 ? -20.651  -61.258 22.887  1.00 66.52  ? 226  ARG B O     1 
ATOM   8199  C CB    . ARG B  2 226 ? -18.086  -59.298 22.568  1.00 52.53  ? 226  ARG B CB    1 
ATOM   8200  C CG    . ARG B  2 226 ? -16.569  -59.402 22.513  1.00 60.75  ? 226  ARG B CG    1 
ATOM   8201  C CD    . ARG B  2 226 ? -15.896  -58.407 23.423  1.00 69.78  ? 226  ARG B CD    1 
ATOM   8202  N NE    . ARG B  2 226 ? -14.509  -58.162 23.030  1.00 78.01  ? 226  ARG B NE    1 
ATOM   8203  C CZ    . ARG B  2 226 ? -13.542  -57.836 23.880  1.00 101.39 ? 226  ARG B CZ    1 
ATOM   8204  N NH1   . ARG B  2 226 ? -13.795  -57.742 25.180  1.00 95.58  ? 226  ARG B NH1   1 
ATOM   8205  N NH2   . ARG B  2 226 ? -12.311  -57.616 23.441  1.00 94.37  ? 226  ARG B NH2   1 
ATOM   8206  N N     . GLY B  2 227 ? -21.059  -59.587 21.408  1.00 59.74  ? 227  GLY B N     1 
ATOM   8207  C CA    . GLY B  2 227 ? -22.503  -59.511 21.607  1.00 59.44  ? 227  GLY B CA    1 
ATOM   8208  C C     . GLY B  2 227 ? -22.932  -59.090 22.997  1.00 62.64  ? 227  GLY B C     1 
ATOM   8209  O O     . GLY B  2 227 ? -22.128  -58.584 23.788  1.00 62.60  ? 227  GLY B O     1 
ATOM   8210  N N     . GLY B  2 228 ? -24.204  -59.307 23.284  1.00 58.34  ? 228  GLY B N     1 
ATOM   8211  C CA    . GLY B  2 228 ? -24.792  -58.991 24.578  1.00 58.30  ? 228  GLY B CA    1 
ATOM   8212  C C     . GLY B  2 228 ? -25.292  -57.575 24.734  1.00 60.93  ? 228  GLY B C     1 
ATOM   8213  O O     . GLY B  2 228 ? -25.084  -56.734 23.860  1.00 58.39  ? 228  GLY B O     1 
ATOM   8214  N N     . GLU B  2 229 ? -25.954  -57.310 25.871  1.00 59.92  ? 229  GLU B N     1 
ATOM   8215  C CA    . GLU B  2 229 ? -26.501  -55.999 26.233  1.00 59.08  ? 229  GLU B CA    1 
ATOM   8216  C C     . GLU B  2 229 ? -25.363  -55.036 26.435  1.00 63.74  ? 229  GLU B C     1 
ATOM   8217  O O     . GLU B  2 229 ? -25.545  -53.835 26.231  1.00 63.95  ? 229  GLU B O     1 
ATOM   8218  C CB    . GLU B  2 229 ? -27.343  -56.075 27.520  1.00 61.33  ? 229  GLU B CB    1 
ATOM   8219  N N     . LYS B  2 230 ? -24.175  -55.571 26.811  1.00 59.69  ? 230  LYS B N     1 
ATOM   8220  C CA    . LYS B  2 230 ? -22.926  -54.827 27.039  1.00 57.98  ? 230  LYS B CA    1 
ATOM   8221  C C     . LYS B  2 230 ? -22.523  -54.010 25.800  1.00 59.89  ? 230  LYS B C     1 
ATOM   8222  O O     . LYS B  2 230 ? -22.102  -52.868 25.953  1.00 57.86  ? 230  LYS B O     1 
ATOM   8223  C CB    . LYS B  2 230 ? -21.799  -55.805 27.436  1.00 60.45  ? 230  LYS B CB    1 
ATOM   8224  C CG    . LYS B  2 230 ? -20.518  -55.163 27.942  1.00 57.52  ? 230  LYS B CG    1 
ATOM   8225  C CD    . LYS B  2 230 ? -19.492  -56.236 28.330  1.00 65.89  ? 230  LYS B CD    1 
ATOM   8226  C CE    . LYS B  2 230 ? -18.075  -55.715 28.422  1.00 70.72  ? 230  LYS B CE    1 
ATOM   8227  N NZ    . LYS B  2 230 ? -17.066  -56.807 28.300  1.00 73.66  ? 230  LYS B NZ    1 
ATOM   8228  N N     . TYR B  2 231 ? -22.683  -54.585 24.585  1.00 56.39  ? 231  TYR B N     1 
ATOM   8229  C CA    . TYR B  2 231 ? -22.310  -53.942 23.326  1.00 54.62  ? 231  TYR B CA    1 
ATOM   8230  C C     . TYR B  2 231 ? -23.475  -53.641 22.405  1.00 56.48  ? 231  TYR B C     1 
ATOM   8231  O O     . TYR B  2 231 ? -23.345  -52.762 21.554  1.00 55.01  ? 231  TYR B O     1 
ATOM   8232  C CB    . TYR B  2 231 ? -21.282  -54.793 22.574  1.00 57.22  ? 231  TYR B CB    1 
ATOM   8233  C CG    . TYR B  2 231 ? -19.980  -54.994 23.315  1.00 60.51  ? 231  TYR B CG    1 
ATOM   8234  C CD1   . TYR B  2 231 ? -18.921  -54.104 23.158  1.00 60.98  ? 231  TYR B CD1   1 
ATOM   8235  C CD2   . TYR B  2 231 ? -19.785  -56.103 24.130  1.00 63.76  ? 231  TYR B CD2   1 
ATOM   8236  C CE1   . TYR B  2 231 ? -17.711  -54.296 23.820  1.00 61.31  ? 231  TYR B CE1   1 
ATOM   8237  C CE2   . TYR B  2 231 ? -18.578  -56.309 24.791  1.00 65.85  ? 231  TYR B CE2   1 
ATOM   8238  C CZ    . TYR B  2 231 ? -17.546  -55.397 24.641  1.00 72.14  ? 231  TYR B CZ    1 
ATOM   8239  O OH    . TYR B  2 231 ? -16.365  -55.611 25.305  1.00 77.56  ? 231  TYR B OH    1 
ATOM   8240  N N     . ILE B  2 232 ? -24.583  -54.394 22.512  1.00 52.66  ? 232  ILE B N     1 
ATOM   8241  C CA    . ILE B  2 232 ? -25.732  -54.164 21.631  1.00 51.39  ? 232  ILE B CA    1 
ATOM   8242  C C     . ILE B  2 232 ? -26.898  -53.536 22.390  1.00 52.40  ? 232  ILE B C     1 
ATOM   8243  O O     . ILE B  2 232 ? -27.747  -54.243 22.941  1.00 52.74  ? 232  ILE B O     1 
ATOM   8244  C CB    . ILE B  2 232 ? -26.119  -55.397 20.782  1.00 56.23  ? 232  ILE B CB    1 
ATOM   8245  C CG1   . ILE B  2 232 ? -24.877  -56.045 20.136  1.00 57.35  ? 232  ILE B CG1   1 
ATOM   8246  C CG2   . ILE B  2 232 ? -27.133  -54.984 19.720  1.00 57.07  ? 232  ILE B CG2   1 
ATOM   8247  C CD1   . ILE B  2 232 ? -25.018  -57.466 19.848  1.00 72.31  ? 232  ILE B CD1   1 
ATOM   8248  N N     . LYS B  2 233 ? -26.912  -52.192 22.436  1.00 45.11  ? 233  LYS B N     1 
ATOM   8249  C CA    . LYS B  2 233 ? -27.916  -51.447 23.177  1.00 43.33  ? 233  LYS B CA    1 
ATOM   8250  C C     . LYS B  2 233 ? -29.032  -50.869 22.333  1.00 45.33  ? 233  LYS B C     1 
ATOM   8251  O O     . LYS B  2 233 ? -28.764  -50.327 21.263  1.00 44.49  ? 233  LYS B O     1 
ATOM   8252  C CB    . LYS B  2 233 ? -27.267  -50.409 24.132  1.00 44.52  ? 233  LYS B CB    1 
ATOM   8253  C CG    . LYS B  2 233 ? -26.364  -49.335 23.490  1.00 60.52  ? 233  LYS B CG    1 
ATOM   8254  C CD    . LYS B  2 233 ? -27.119  -48.024 23.007  1.00 63.35  ? 233  LYS B CD    1 
ATOM   8255  C CE    . LYS B  2 233 ? -26.477  -46.719 23.428  1.00 51.44  ? 233  LYS B CE    1 
ATOM   8256  N NZ    . LYS B  2 233 ? -26.169  -45.821 22.278  1.00 43.17  ? 233  LYS B NZ    1 
ATOM   8257  N N     . GLU B  2 234 ? -30.287  -50.974 22.811  1.00 42.10  ? 234  GLU B N     1 
ATOM   8258  C CA    . GLU B  2 234 ? -31.428  -50.405 22.100  1.00 41.48  ? 234  GLU B CA    1 
ATOM   8259  C C     . GLU B  2 234 ? -31.345  -48.897 22.272  1.00 48.53  ? 234  GLU B C     1 
ATOM   8260  O O     . GLU B  2 234 ? -31.122  -48.421 23.397  1.00 51.10  ? 234  GLU B O     1 
ATOM   8261  C CB    . GLU B  2 234 ? -32.744  -50.940 22.634  1.00 43.52  ? 234  GLU B CB    1 
ATOM   8262  C CG    . GLU B  2 234 ? -33.756  -51.196 21.540  1.00 57.23  ? 234  GLU B CG    1 
ATOM   8263  C CD    . GLU B  2 234 ? -35.032  -50.397 21.681  1.00 96.01  ? 234  GLU B CD    1 
ATOM   8264  O OE1   . GLU B  2 234 ? -35.915  -50.825 22.459  1.00 83.80  ? 234  GLU B OE1   1 
ATOM   8265  O OE2   . GLU B  2 234 ? -35.155  -49.349 21.004  1.00 108.07 ? 234  GLU B OE2   1 
ATOM   8266  N N     . THR B  2 235 ? -31.438  -48.150 21.146  1.00 42.37  ? 235  THR B N     1 
ATOM   8267  C CA    . THR B  2 235 ? -31.312  -46.690 21.120  1.00 39.00  ? 235  THR B CA    1 
ATOM   8268  C C     . THR B  2 235 ? -32.647  -46.030 20.843  1.00 41.78  ? 235  THR B C     1 
ATOM   8269  O O     . THR B  2 235 ? -33.390  -46.496 19.986  1.00 41.95  ? 235  THR B O     1 
ATOM   8270  C CB    . THR B  2 235 ? -30.187  -46.299 20.153  1.00 36.87  ? 235  THR B CB    1 
ATOM   8271  O OG1   . THR B  2 235 ? -29.032  -47.083 20.474  1.00 37.94  ? 235  THR B OG1   1 
ATOM   8272  C CG2   . THR B  2 235 ? -29.835  -44.821 20.215  1.00 26.63  ? 235  THR B CG2   1 
ATOM   8273  N N     . GLN B  2 236 ? -32.950  -44.963 21.597  1.00 38.54  ? 236  GLN B N     1 
ATOM   8274  C CA    . GLN B  2 236 ? -34.171  -44.156 21.514  1.00 38.22  ? 236  GLN B CA    1 
ATOM   8275  C C     . GLN B  2 236 ? -33.909  -42.884 20.711  1.00 42.29  ? 236  GLN B C     1 
ATOM   8276  O O     . GLN B  2 236 ? -32.754  -42.524 20.498  1.00 40.92  ? 236  GLN B O     1 
ATOM   8277  C CB    . GLN B  2 236 ? -34.649  -43.778 22.923  1.00 39.89  ? 236  GLN B CB    1 
ATOM   8278  C CG    . GLN B  2 236 ? -34.838  -44.951 23.889  1.00 66.51  ? 236  GLN B CG    1 
ATOM   8279  C CD    . GLN B  2 236 ? -35.827  -45.995 23.410  1.00 104.02 ? 236  GLN B CD    1 
ATOM   8280  O OE1   . GLN B  2 236 ? -36.860  -45.688 22.790  1.00 99.72  ? 236  GLN B OE1   1 
ATOM   8281  N NE2   . GLN B  2 236 ? -35.537  -47.262 23.713  1.00 105.31 ? 236  GLN B NE2   1 
ATOM   8282  N N     . TRP B  2 237 ? -34.982  -42.198 20.278  1.00 40.04  ? 237  TRP B N     1 
ATOM   8283  C CA    . TRP B  2 237 ? -34.951  -40.966 19.476  1.00 38.54  ? 237  TRP B CA    1 
ATOM   8284  C C     . TRP B  2 237 ? -34.168  -39.828 20.158  1.00 42.72  ? 237  TRP B C     1 
ATOM   8285  O O     . TRP B  2 237 ? -33.413  -39.118 19.493  1.00 40.52  ? 237  TRP B O     1 
ATOM   8286  C CB    . TRP B  2 237 ? -36.397  -40.543 19.134  1.00 37.14  ? 237  TRP B CB    1 
ATOM   8287  C CG    . TRP B  2 237 ? -36.540  -39.354 18.229  1.00 37.98  ? 237  TRP B CG    1 
ATOM   8288  C CD1   . TRP B  2 237 ? -36.309  -38.043 18.552  1.00 40.57  ? 237  TRP B CD1   1 
ATOM   8289  C CD2   . TRP B  2 237 ? -37.078  -39.348 16.898  1.00 37.82  ? 237  TRP B CD2   1 
ATOM   8290  N NE1   . TRP B  2 237 ? -36.585  -37.234 17.472  1.00 39.88  ? 237  TRP B NE1   1 
ATOM   8291  C CE2   . TRP B  2 237 ? -37.063  -38.011 16.442  1.00 41.19  ? 237  TRP B CE2   1 
ATOM   8292  C CE3   . TRP B  2 237 ? -37.483  -40.347 16.013  1.00 40.29  ? 237  TRP B CE3   1 
ATOM   8293  C CZ2   . TRP B  2 237 ? -37.464  -37.654 15.147  1.00 40.03  ? 237  TRP B CZ2   1 
ATOM   8294  C CZ3   . TRP B  2 237 ? -37.899  -39.990 14.740  1.00 41.66  ? 237  TRP B CZ3   1 
ATOM   8295  C CH2   . TRP B  2 237 ? -37.886  -38.658 14.318  1.00 41.05  ? 237  TRP B CH2   1 
ATOM   8296  N N     . HIS B  2 238 ? -34.366  -39.653 21.473  1.00 42.17  ? 238  HIS B N     1 
ATOM   8297  C CA    . HIS B  2 238 ? -33.759  -38.595 22.302  1.00 42.67  ? 238  HIS B CA    1 
ATOM   8298  C C     . HIS B  2 238 ? -32.320  -38.921 22.722  1.00 44.42  ? 238  HIS B C     1 
ATOM   8299  O O     . HIS B  2 238 ? -31.650  -38.053 23.274  1.00 43.16  ? 238  HIS B O     1 
ATOM   8300  C CB    . HIS B  2 238 ? -34.638  -38.321 23.539  1.00 45.29  ? 238  HIS B CB    1 
ATOM   8301  C CG    . HIS B  2 238 ? -35.000  -39.582 24.278  1.00 52.14  ? 238  HIS B CG    1 
ATOM   8302  N ND1   . HIS B  2 238 ? -36.176  -40.291 23.989  1.00 55.72  ? 238  HIS B ND1   1 
ATOM   8303  C CD2   . HIS B  2 238 ? -34.304  -40.266 25.223  1.00 55.75  ? 238  HIS B CD2   1 
ATOM   8304  C CE1   . HIS B  2 238 ? -36.172  -41.341 24.798  1.00 56.57  ? 238  HIS B CE1   1 
ATOM   8305  N NE2   . HIS B  2 238 ? -35.059  -41.380 25.546  1.00 57.01  ? 238  HIS B NE2   1 
ATOM   8306  N N     . ASP B  2 239 ? -31.862  -40.169 22.480  1.00 39.95  ? 239  ASP B N     1 
ATOM   8307  C CA    . ASP B  2 239 ? -30.524  -40.650 22.828  1.00 38.86  ? 239  ASP B CA    1 
ATOM   8308  C C     . ASP B  2 239 ? -29.443  -40.164 21.857  1.00 41.34  ? 239  ASP B C     1 
ATOM   8309  O O     . ASP B  2 239 ? -28.247  -40.210 22.178  1.00 41.39  ? 239  ASP B O     1 
ATOM   8310  C CB    . ASP B  2 239 ? -30.511  -42.184 22.900  1.00 41.80  ? 239  ASP B CB    1 
ATOM   8311  C CG    . ASP B  2 239 ? -31.233  -42.765 24.093  1.00 57.66  ? 239  ASP B CG    1 
ATOM   8312  O OD1   . ASP B  2 239 ? -31.482  -43.998 24.091  1.00 60.11  ? 239  ASP B OD1   1 
ATOM   8313  O OD2   . ASP B  2 239 ? -31.531  -41.992 25.047  1.00 63.98  ? 239  ASP B OD2   1 
ATOM   8314  N N     . VAL B  2 240 ? -29.855  -39.719 20.674  1.00 35.89  ? 240  VAL B N     1 
ATOM   8315  C CA    . VAL B  2 240 ? -28.932  -39.256 19.656  1.00 34.77  ? 240  VAL B CA    1 
ATOM   8316  C C     . VAL B  2 240 ? -29.033  -37.732 19.526  1.00 42.46  ? 240  VAL B C     1 
ATOM   8317  O O     . VAL B  2 240 ? -28.688  -37.166 18.486  1.00 43.05  ? 240  VAL B O     1 
ATOM   8318  C CB    . VAL B  2 240 ? -29.096  -40.029 18.328  1.00 38.18  ? 240  VAL B CB    1 
ATOM   8319  C CG1   . VAL B  2 240 ? -28.722  -41.492 18.517  1.00 38.25  ? 240  VAL B CG1   1 
ATOM   8320  C CG2   . VAL B  2 240 ? -30.521  -39.901 17.753  1.00 38.54  ? 240  VAL B CG2   1 
ATOM   8321  N N     . ARG B  2 241 ? -29.494  -37.066 20.622  1.00 39.84  ? 241  ARG B N     1 
ATOM   8322  C CA    . ARG B  2 241 ? -29.659  -35.616 20.738  1.00 37.89  ? 241  ARG B CA    1 
ATOM   8323  C C     . ARG B  2 241 ? -28.347  -34.857 20.616  1.00 40.92  ? 241  ARG B C     1 
ATOM   8324  O O     . ARG B  2 241 ? -27.377  -35.154 21.331  1.00 40.94  ? 241  ARG B O     1 
ATOM   8325  C CB    . ARG B  2 241 ? -30.386  -35.234 22.035  1.00 34.77  ? 241  ARG B CB    1 
ATOM   8326  C CG    . ARG B  2 241 ? -31.801  -34.796 21.762  1.00 42.10  ? 241  ARG B CG    1 
ATOM   8327  C CD    . ARG B  2 241 ? -32.452  -34.088 22.933  1.00 50.44  ? 241  ARG B CD    1 
ATOM   8328  N NE    . ARG B  2 241 ? -33.893  -33.910 22.706  1.00 46.70  ? 241  ARG B NE    1 
ATOM   8329  C CZ    . ARG B  2 241 ? -34.740  -33.384 23.586  1.00 58.81  ? 241  ARG B CZ    1 
ATOM   8330  N NH1   . ARG B  2 241 ? -34.306  -32.955 24.762  1.00 52.63  ? 241  ARG B NH1   1 
ATOM   8331  N NH2   . ARG B  2 241 ? -36.028  -33.289 23.300  1.00 46.95  ? 241  ARG B NH2   1 
ATOM   8332  N N     . GLY B  2 242 ? -28.359  -33.889 19.693  1.00 35.32  ? 242  GLY B N     1 
ATOM   8333  C CA    . GLY B  2 242 ? -27.267  -32.984 19.390  1.00 33.65  ? 242  GLY B CA    1 
ATOM   8334  C C     . GLY B  2 242 ? -25.997  -33.657 18.944  1.00 37.66  ? 242  GLY B C     1 
ATOM   8335  O O     . GLY B  2 242 ? -24.903  -33.117 19.135  1.00 40.67  ? 242  GLY B O     1 
ATOM   8336  N N     . TRP B  2 243 ? -26.123  -34.827 18.353  1.00 31.96  ? 243  TRP B N     1 
ATOM   8337  C CA    . TRP B  2 243 ? -24.985  -35.581 17.847  1.00 31.11  ? 243  TRP B CA    1 
ATOM   8338  C C     . TRP B  2 243 ? -24.412  -34.946 16.587  1.00 35.52  ? 243  TRP B C     1 
ATOM   8339  O O     . TRP B  2 243 ? -23.270  -35.239 16.240  1.00 35.82  ? 243  TRP B O     1 
ATOM   8340  C CB    . TRP B  2 243 ? -25.371  -37.041 17.596  1.00 30.29  ? 243  TRP B CB    1 
ATOM   8341  C CG    . TRP B  2 243 ? -25.357  -37.906 18.817  1.00 30.68  ? 243  TRP B CG    1 
ATOM   8342  C CD1   . TRP B  2 243 ? -25.596  -37.523 20.102  1.00 33.31  ? 243  TRP B CD1   1 
ATOM   8343  C CD2   . TRP B  2 243 ? -25.216  -39.328 18.839  1.00 31.09  ? 243  TRP B CD2   1 
ATOM   8344  N NE1   . TRP B  2 243 ? -25.554  -38.614 20.937  1.00 33.77  ? 243  TRP B NE1   1 
ATOM   8345  C CE2   . TRP B  2 243 ? -25.329  -39.740 20.187  1.00 35.57  ? 243  TRP B CE2   1 
ATOM   8346  C CE3   . TRP B  2 243 ? -24.995  -40.306 17.846  1.00 31.95  ? 243  TRP B CE3   1 
ATOM   8347  C CZ2   . TRP B  2 243 ? -25.212  -41.088 20.574  1.00 35.02  ? 243  TRP B CZ2   1 
ATOM   8348  C CZ3   . TRP B  2 243 ? -24.874  -41.643 18.236  1.00 33.30  ? 243  TRP B CZ3   1 
ATOM   8349  C CH2   . TRP B  2 243 ? -24.984  -42.019 19.580  1.00 34.01  ? 243  TRP B CH2   1 
ATOM   8350  N N     . LEU B  2 244 ? -25.167  -34.037 15.929  1.00 32.26  ? 244  LEU B N     1 
ATOM   8351  C CA    . LEU B  2 244 ? -24.670  -33.336 14.743  1.00 30.79  ? 244  LEU B CA    1 
ATOM   8352  C C     . LEU B  2 244 ? -23.335  -32.649 15.058  1.00 33.91  ? 244  LEU B C     1 
ATOM   8353  O O     . LEU B  2 244 ? -22.355  -32.852 14.330  1.00 36.88  ? 244  LEU B O     1 
ATOM   8354  C CB    . LEU B  2 244 ? -25.684  -32.309 14.238  1.00 29.41  ? 244  LEU B CB    1 
ATOM   8355  C CG    . LEU B  2 244 ? -26.944  -32.859 13.632  1.00 33.81  ? 244  LEU B CG    1 
ATOM   8356  C CD1   . LEU B  2 244 ? -28.053  -31.868 13.758  1.00 33.67  ? 244  LEU B CD1   1 
ATOM   8357  C CD2   . LEU B  2 244 ? -26.739  -33.229 12.164  1.00 36.88  ? 244  LEU B CD2   1 
ATOM   8358  N N     . VAL B  2 245 ? -23.283  -31.925 16.183  1.00 25.64  ? 245  VAL B N     1 
ATOM   8359  C CA    . VAL B  2 245 ? -22.112  -31.198 16.616  1.00 25.04  ? 245  VAL B CA    1 
ATOM   8360  C C     . VAL B  2 245 ? -20.982  -32.121 17.087  1.00 31.82  ? 245  VAL B C     1 
ATOM   8361  O O     . VAL B  2 245 ? -19.824  -31.858 16.756  1.00 32.78  ? 245  VAL B O     1 
ATOM   8362  C CB    . VAL B  2 245 ? -22.457  -30.101 17.623  1.00 28.66  ? 245  VAL B CB    1 
ATOM   8363  C CG1   . VAL B  2 245 ? -21.184  -29.448 18.167  1.00 30.22  ? 245  VAL B CG1   1 
ATOM   8364  C CG2   . VAL B  2 245 ? -23.344  -29.047 16.989  1.00 27.20  ? 245  VAL B CG2   1 
ATOM   8365  N N     . GLU B  2 246 ? -21.312  -33.212 17.817  1.00 27.53  ? 246  GLU B N     1 
ATOM   8366  C CA    . GLU B  2 246 ? -20.339  -34.202 18.307  1.00 26.64  ? 246  GLU B CA    1 
ATOM   8367  C C     . GLU B  2 246 ? -19.377  -34.757 17.229  1.00 29.41  ? 246  GLU B C     1 
ATOM   8368  O O     . GLU B  2 246 ? -19.823  -35.116 16.138  1.00 29.91  ? 246  GLU B O     1 
ATOM   8369  C CB    . GLU B  2 246 ? -21.068  -35.367 18.962  1.00 28.08  ? 246  GLU B CB    1 
ATOM   8370  C CG    . GLU B  2 246 ? -20.975  -35.346 20.463  1.00 28.42  ? 246  GLU B CG    1 
ATOM   8371  C CD    . GLU B  2 246 ? -22.332  -35.213 21.089  1.00 30.16  ? 246  GLU B CD    1 
ATOM   8372  O OE1   . GLU B  2 246 ? -22.861  -36.226 21.605  1.00 30.48  ? 246  GLU B OE1   1 
ATOM   8373  O OE2   . GLU B  2 246 ? -22.901  -34.105 20.991  1.00 20.96  ? 246  GLU B OE2   1 
ATOM   8374  N N     . GLY B  2 247 ? -18.088  -34.814 17.557  1.00 24.94  ? 247  GLY B N     1 
ATOM   8375  C CA    . GLY B  2 247 ? -17.051  -35.357 16.683  1.00 26.05  ? 247  GLY B CA    1 
ATOM   8376  C C     . GLY B  2 247 ? -16.760  -36.813 16.991  1.00 33.93  ? 247  GLY B C     1 
ATOM   8377  O O     . GLY B  2 247 ? -17.117  -37.290 18.067  1.00 33.14  ? 247  GLY B O     1 
ATOM   8378  N N     . GLY B  2 248 ? -16.133  -37.518 16.040  1.00 34.71  ? 248  GLY B N     1 
ATOM   8379  C CA    . GLY B  2 248 ? -15.766  -38.936 16.136  1.00 36.71  ? 248  GLY B CA    1 
ATOM   8380  C C     . GLY B  2 248 ? -16.963  -39.858 16.110  1.00 43.75  ? 248  GLY B C     1 
ATOM   8381  O O     . GLY B  2 248 ? -17.893  -39.619 15.333  1.00 43.73  ? 248  GLY B O     1 
ATOM   8382  N N     . THR B  2 249 ? -16.957  -40.918 16.964  1.00 42.85  ? 249  THR B N     1 
ATOM   8383  C CA    . THR B  2 249 ? -18.101  -41.845 17.083  1.00 44.19  ? 249  THR B CA    1 
ATOM   8384  C C     . THR B  2 249 ? -18.511  -42.134 18.509  1.00 49.95  ? 249  THR B C     1 
ATOM   8385  O O     . THR B  2 249 ? -17.774  -42.817 19.230  1.00 52.80  ? 249  THR B O     1 
ATOM   8386  C CB    . THR B  2 249 ? -17.919  -43.163 16.345  1.00 54.83  ? 249  THR B CB    1 
ATOM   8387  O OG1   . THR B  2 249 ? -17.577  -42.889 15.000  1.00 62.91  ? 249  THR B OG1   1 
ATOM   8388  C CG2   . THR B  2 249 ? -19.183  -43.959 16.350  1.00 54.12  ? 249  THR B CG2   1 
ATOM   8389  N N     . ASN B  2 250 ? -19.724  -41.698 18.887  1.00 43.55  ? 250  ASN B N     1 
ATOM   8390  C CA    . ASN B  2 250 ? -20.259  -41.934 20.216  1.00 42.78  ? 250  ASN B CA    1 
ATOM   8391  C C     . ASN B  2 250 ? -20.474  -43.435 20.490  1.00 48.98  ? 250  ASN B C     1 
ATOM   8392  O O     . ASN B  2 250 ? -20.292  -43.867 21.623  1.00 50.04  ? 250  ASN B O     1 
ATOM   8393  C CB    . ASN B  2 250 ? -21.507  -41.102 20.454  1.00 39.11  ? 250  ASN B CB    1 
ATOM   8394  C CG    . ASN B  2 250 ? -21.322  -39.595 20.381  1.00 54.95  ? 250  ASN B CG    1 
ATOM   8395  O OD1   . ASN B  2 250 ? -22.277  -38.843 20.177  1.00 49.04  ? 250  ASN B OD1   1 
ATOM   8396  N ND2   . ASN B  2 250 ? -20.107  -39.101 20.538  1.00 48.47  ? 250  ASN B ND2   1 
ATOM   8397  N N     . ILE B  2 251 ? -20.780  -44.232 19.442  1.00 46.30  ? 251  ILE B N     1 
ATOM   8398  C CA    . ILE B  2 251 ? -20.924  -45.697 19.502  1.00 47.18  ? 251  ILE B CA    1 
ATOM   8399  C C     . ILE B  2 251 ? -19.525  -46.335 19.773  1.00 53.50  ? 251  ILE B C     1 
ATOM   8400  O O     . ILE B  2 251 ? -19.392  -47.210 20.635  1.00 55.65  ? 251  ILE B O     1 
ATOM   8401  C CB    . ILE B  2 251 ? -21.522  -46.211 18.167  1.00 49.93  ? 251  ILE B CB    1 
ATOM   8402  C CG1   . ILE B  2 251 ? -23.017  -46.164 18.164  1.00 50.12  ? 251  ILE B CG1   1 
ATOM   8403  C CG2   . ILE B  2 251 ? -21.046  -47.606 17.801  1.00 53.72  ? 251  ILE B CG2   1 
ATOM   8404  C CD1   . ILE B  2 251 ? -23.534  -46.631 16.798  1.00 62.80  ? 251  ILE B CD1   1 
ATOM   8405  N N     . GLY B  2 252 ? -18.522  -45.897 19.014  1.00 48.54  ? 252  GLY B N     1 
ATOM   8406  C CA    . GLY B  2 252 ? -17.167  -46.404 19.099  1.00 48.70  ? 252  GLY B CA    1 
ATOM   8407  C C     . GLY B  2 252 ? -16.844  -47.415 18.020  1.00 54.31  ? 252  GLY B C     1 
ATOM   8408  O O     . GLY B  2 252 ? -17.737  -48.056 17.470  1.00 53.12  ? 252  GLY B O     1 
ATOM   8409  N N     . THR B  2 253 ? -15.549  -47.537 17.700  1.00 54.38  ? 253  THR B N     1 
ATOM   8410  C CA    . THR B  2 253 ? -14.989  -48.457 16.710  1.00 56.27  ? 253  THR B CA    1 
ATOM   8411  C C     . THR B  2 253 ? -13.912  -49.255 17.388  1.00 65.86  ? 253  THR B C     1 
ATOM   8412  O O     . THR B  2 253 ? -13.260  -48.751 18.311  1.00 66.94  ? 253  THR B O     1 
ATOM   8413  C CB    . THR B  2 253 ? -14.373  -47.728 15.496  1.00 65.20  ? 253  THR B CB    1 
ATOM   8414  O OG1   . THR B  2 253 ? -13.197  -47.017 15.887  1.00 66.91  ? 253  THR B OG1   1 
ATOM   8415  C CG2   . THR B  2 253 ? -15.339  -46.792 14.799  1.00 64.59  ? 253  THR B CG2   1 
ATOM   8416  N N     . ALA B  2 254 ? -13.713  -50.495 16.922  1.00 65.67  ? 254  ALA B N     1 
ATOM   8417  C CA    . ALA B  2 254 ? -12.707  -51.420 17.427  1.00 67.86  ? 254  ALA B CA    1 
ATOM   8418  C C     . ALA B  2 254 ? -12.329  -52.399 16.333  1.00 77.41  ? 254  ALA B C     1 
ATOM   8419  O O     . ALA B  2 254 ? -13.182  -52.846 15.556  1.00 77.17  ? 254  ALA B O     1 
ATOM   8420  C CB    . ALA B  2 254 ? -13.220  -52.164 18.653  1.00 69.35  ? 254  ALA B CB    1 
ATOM   8421  N N     . ARG B  2 255 ? -11.027  -52.707 16.254  1.00 77.66  ? 255  ARG B N     1 
ATOM   8422  C CA    . ARG B  2 255 ? -10.488  -53.657 15.285  1.00 78.87  ? 255  ARG B CA    1 
ATOM   8423  C C     . ARG B  2 255 ? -10.660  -55.051 15.867  1.00 84.62  ? 255  ARG B C     1 
ATOM   8424  O O     . ARG B  2 255 ? -10.094  -55.364 16.920  1.00 85.89  ? 255  ARG B O     1 
ATOM   8425  C CB    . ARG B  2 255 ? -9.024   -53.337 14.876  1.00 79.45  ? 255  ARG B CB    1 
ATOM   8426  C CG    . ARG B  2 255 ? -8.087   -52.922 16.017  1.00 93.47  ? 255  ARG B CG    1 
ATOM   8427  C CD    . ARG B  2 255 ? -6.644   -53.337 15.768  1.00 108.67 ? 255  ARG B CD    1 
ATOM   8428  N NE    . ARG B  2 255 ? -6.443   -54.775 15.970  1.00 115.64 ? 255  ARG B NE    1 
ATOM   8429  C CZ    . ARG B  2 255 ? -5.895   -55.317 17.053  1.00 127.49 ? 255  ARG B CZ    1 
ATOM   8430  N NH1   . ARG B  2 255 ? -5.464   -54.547 18.046  1.00 105.46 ? 255  ARG B NH1   1 
ATOM   8431  N NH2   . ARG B  2 255 ? -5.764   -56.633 17.147  1.00 123.09 ? 255  ARG B NH2   1 
ATOM   8432  N N     . CYS B  2 256 ? -11.532  -55.854 15.243  1.00 80.88  ? 256  CYS B N     1 
ATOM   8433  C CA    . CYS B  2 256 ? -11.803  -57.201 15.727  1.00 81.64  ? 256  CYS B CA    1 
ATOM   8434  C C     . CYS B  2 256 ? -11.009  -58.240 14.956  1.00 84.59  ? 256  CYS B C     1 
ATOM   8435  O O     . CYS B  2 256 ? -11.243  -58.481 13.769  1.00 83.98  ? 256  CYS B O     1 
ATOM   8436  C CB    . CYS B  2 256 ? -13.296  -57.508 15.737  1.00 81.92  ? 256  CYS B CB    1 
ATOM   8437  S SG    . CYS B  2 256 ? -13.715  -59.095 16.496  1.00 88.19  ? 256  CYS B SG    1 
ATOM   8438  N N     . LYS B  2 257 ? -10.038  -58.816 15.655  1.00 80.56  ? 257  LYS B N     1 
ATOM   8439  C CA    . LYS B  2 257 ? -9.135   -59.848 15.183  1.00 81.57  ? 257  LYS B CA    1 
ATOM   8440  C C     . LYS B  2 257 ? -9.902   -61.141 14.844  1.00 85.53  ? 257  LYS B C     1 
ATOM   8441  O O     . LYS B  2 257 ? -9.610   -61.774 13.826  1.00 85.85  ? 257  LYS B O     1 
ATOM   8442  C CB    . LYS B  2 257 ? -8.001   -60.087 16.225  1.00 84.89  ? 257  LYS B CB    1 
ATOM   8443  C CG    . LYS B  2 257 ? -8.414   -60.696 17.596  1.00 93.75  ? 257  LYS B CG    1 
ATOM   8444  C CD    . LYS B  2 257 ? -9.166   -59.744 18.565  1.00 92.64  ? 257  LYS B CD    1 
ATOM   8445  C CE    . LYS B  2 257 ? -10.532  -60.269 18.957  1.00 81.18  ? 257  LYS B CE    1 
ATOM   8446  N NZ    . LYS B  2 257 ? -11.219  -59.353 19.900  1.00 78.59  ? 257  LYS B NZ    1 
ATOM   8447  N N     . GLU B  2 258 ? -10.896  -61.503 15.687  1.00 80.84  ? 258  GLU B N     1 
ATOM   8448  C CA    . GLU B  2 258 ? -11.710  -62.713 15.557  1.00 81.69  ? 258  GLU B CA    1 
ATOM   8449  C C     . GLU B  2 258 ? -12.589  -62.717 14.308  1.00 81.90  ? 258  GLU B C     1 
ATOM   8450  O O     . GLU B  2 258 ? -12.711  -63.759 13.664  1.00 82.98  ? 258  GLU B O     1 
ATOM   8451  C CB    . GLU B  2 258 ? -12.557  -62.920 16.816  1.00 83.87  ? 258  GLU B CB    1 
ATOM   8452  C CG    . GLU B  2 258 ? -12.732  -64.381 17.205  1.00 102.77 ? 258  GLU B CG    1 
ATOM   8453  C CD    . GLU B  2 258 ? -13.812  -64.633 18.242  1.00 136.29 ? 258  GLU B CD    1 
ATOM   8454  O OE1   . GLU B  2 258 ? -13.868  -63.880 19.243  1.00 134.28 ? 258  GLU B OE1   1 
ATOM   8455  O OE2   . GLU B  2 258 ? -14.600  -65.589 18.056  1.00 135.70 ? 258  GLU B OE2   1 
ATOM   8456  N N     . PHE B  2 259 ? -13.185  -61.552 13.958  1.00 73.85  ? 259  PHE B N     1 
ATOM   8457  C CA    . PHE B  2 259 ? -14.053  -61.386 12.787  1.00 71.35  ? 259  PHE B CA    1 
ATOM   8458  C C     . PHE B  2 259 ? -13.290  -61.574 11.466  1.00 73.97  ? 259  PHE B C     1 
ATOM   8459  O O     . PHE B  2 259 ? -13.920  -61.820 10.439  1.00 72.26  ? 259  PHE B O     1 
ATOM   8460  C CB    . PHE B  2 259 ? -14.784  -60.031 12.835  1.00 70.52  ? 259  PHE B CB    1 
ATOM   8461  C CG    . PHE B  2 259 ? -15.998  -59.920 11.933  1.00 71.32  ? 259  PHE B CG    1 
ATOM   8462  C CD1   . PHE B  2 259 ? -15.919  -59.267 10.710  1.00 73.09  ? 259  PHE B CD1   1 
ATOM   8463  C CD2   . PHE B  2 259 ? -17.226  -60.456 12.318  1.00 72.88  ? 259  PHE B CD2   1 
ATOM   8464  C CE1   . PHE B  2 259 ? -17.035  -59.181 9.874   1.00 73.08  ? 259  PHE B CE1   1 
ATOM   8465  C CE2   . PHE B  2 259 ? -18.344  -60.350 11.489  1.00 74.19  ? 259  PHE B CE2   1 
ATOM   8466  C CZ    . PHE B  2 259 ? -18.240  -59.713 10.277  1.00 71.45  ? 259  PHE B CZ    1 
ATOM   8467  N N     . ARG B  2 260 ? -11.931  -61.497 11.505  1.00 72.03  ? 260  ARG B N     1 
ATOM   8468  C CA    . ARG B  2 260 ? -11.049  -61.694 10.346  1.00 73.03  ? 260  ARG B CA    1 
ATOM   8469  C C     . ARG B  2 260 ? -11.063  -63.173 9.940   1.00 82.33  ? 260  ARG B C     1 
ATOM   8470  O O     . ARG B  2 260 ? -10.776  -63.502 8.787   1.00 83.59  ? 260  ARG B O     1 
ATOM   8471  C CB    . ARG B  2 260 ? -9.608   -61.214 10.634  1.00 71.91  ? 260  ARG B CB    1 
ATOM   8472  C CG    . ARG B  2 260 ? -9.458   -59.695 10.818  1.00 81.88  ? 260  ARG B CG    1 
ATOM   8473  C CD    . ARG B  2 260 ? -8.007   -59.240 10.978  1.00 98.93  ? 260  ARG B CD    1 
ATOM   8474  N NE    . ARG B  2 260 ? -7.754   -58.592 12.274  1.00 110.79 ? 260  ARG B NE    1 
ATOM   8475  C CZ    . ARG B  2 260 ? -7.580   -57.281 12.454  1.00 116.64 ? 260  ARG B CZ    1 
ATOM   8476  N NH1   . ARG B  2 260 ? -7.611   -56.449 11.418  1.00 93.95  ? 260  ARG B NH1   1 
ATOM   8477  N NH2   . ARG B  2 260 ? -7.359   -56.796 13.671  1.00 97.29  ? 260  ARG B NH2   1 
ATOM   8478  N N     . GLU B  2 261 ? -11.424  -64.056 10.896  1.00 81.39  ? 261  GLU B N     1 
ATOM   8479  C CA    . GLU B  2 261 ? -11.534  -65.511 10.752  1.00 83.66  ? 261  GLU B CA    1 
ATOM   8480  C C     . GLU B  2 261 ? -13.008  -65.930 10.772  1.00 90.11  ? 261  GLU B C     1 
ATOM   8481  O O     . GLU B  2 261 ? -13.857  -65.174 11.237  1.00 89.25  ? 261  GLU B O     1 
ATOM   8482  C CB    . GLU B  2 261 ? -10.775  -66.204 11.905  1.00 86.04  ? 261  GLU B CB    1 
ATOM   8483  N N     . ARG B  2 262 ? -13.306  -67.146 10.299  1.00 90.12  ? 262  ARG B N     1 
ATOM   8484  C CA    . ARG B  2 262 ? -14.654  -67.718 10.311  1.00 91.53  ? 262  ARG B CA    1 
ATOM   8485  C C     . ARG B  2 262 ? -15.127  -67.962 11.760  1.00 97.59  ? 262  ARG B C     1 
ATOM   8486  O O     . ARG B  2 262 ? -16.325  -68.077 12.012  1.00 97.97  ? 262  ARG B O     1 
ATOM   8487  C CB    . ARG B  2 262 ? -14.677  -69.037 9.519   1.00 94.21  ? 262  ARG B CB    1 
ATOM   8488  N N     . SER B  2 263 ? -14.168  -68.033 12.700  1.00 95.17  ? 263  SER B N     1 
ATOM   8489  C CA    . SER B  2 263 ? -14.366  -68.251 14.135  1.00 95.36  ? 263  SER B CA    1 
ATOM   8490  C C     . SER B  2 263 ? -15.264  -67.160 14.724  1.00 93.83  ? 263  SER B C     1 
ATOM   8491  O O     . SER B  2 263 ? -16.270  -67.469 15.369  1.00 94.13  ? 263  SER B O     1 
ATOM   8492  C CB    . SER B  2 263 ? -13.014  -68.291 14.855  1.00 100.61 ? 263  SER B CB    1 
ATOM   8493  O OG    . SER B  2 263 ? -12.107  -69.210 14.253  1.00 109.95 ? 263  SER B OG    1 
ATOM   8494  N N     . GLY B  2 264 ? -14.907  -65.909 14.448  1.00 85.23  ? 264  GLY B N     1 
ATOM   8495  C CA    . GLY B  2 264 ? -15.632  -64.727 14.898  1.00 81.51  ? 264  GLY B CA    1 
ATOM   8496  C C     . GLY B  2 264 ? -16.857  -64.412 14.065  1.00 80.76  ? 264  GLY B C     1 
ATOM   8497  O O     . GLY B  2 264 ? -17.906  -64.081 14.626  1.00 79.50  ? 264  GLY B O     1 
ATOM   8498  N N     . ARG B  2 265 ? -16.740  -64.529 12.714  1.00 74.47  ? 265  ARG B N     1 
ATOM   8499  C CA    . ARG B  2 265 ? -17.836  -64.293 11.759  1.00 72.16  ? 265  ARG B CA    1 
ATOM   8500  C C     . ARG B  2 265 ? -19.100  -65.095 12.119  1.00 75.64  ? 265  ARG B C     1 
ATOM   8501  O O     . ARG B  2 265 ? -20.215  -64.620 11.904  1.00 73.75  ? 265  ARG B O     1 
ATOM   8502  C CB    . ARG B  2 265 ? -17.391  -64.611 10.325  1.00 69.85  ? 265  ARG B CB    1 
ATOM   8503  C CG    . ARG B  2 265 ? -16.782  -63.428 9.600   1.00 70.83  ? 265  ARG B CG    1 
ATOM   8504  C CD    . ARG B  2 265 ? -16.620  -63.707 8.119   1.00 76.84  ? 265  ARG B CD    1 
ATOM   8505  N NE    . ARG B  2 265 ? -15.394  -64.454 7.818   1.00 90.89  ? 265  ARG B NE    1 
ATOM   8506  C CZ    . ARG B  2 265 ? -14.327  -63.946 7.204   1.00 101.95 ? 265  ARG B CZ    1 
ATOM   8507  N NH1   . ARG B  2 265 ? -14.317  -62.678 6.811   1.00 83.58  ? 265  ARG B NH1   1 
ATOM   8508  N NH2   . ARG B  2 265 ? -13.263  -64.705 6.974   1.00 90.14  ? 265  ARG B NH2   1 
ATOM   8509  N N     . LEU B  2 266 ? -18.913  -66.295 12.687  1.00 73.73  ? 266  LEU B N     1 
ATOM   8510  C CA    . LEU B  2 266 ? -19.987  -67.172 13.123  1.00 75.41  ? 266  LEU B CA    1 
ATOM   8511  C C     . LEU B  2 266 ? -20.574  -66.662 14.440  1.00 79.01  ? 266  LEU B C     1 
ATOM   8512  O O     . LEU B  2 266 ? -21.793  -66.583 14.564  1.00 77.66  ? 266  LEU B O     1 
ATOM   8513  C CB    . LEU B  2 266 ? -19.451  -68.614 13.268  1.00 78.49  ? 266  LEU B CB    1 
ATOM   8514  C CG    . LEU B  2 266 ? -20.470  -69.766 13.375  1.00 84.75  ? 266  LEU B CG    1 
ATOM   8515  C CD1   . LEU B  2 266 ? -21.033  -70.140 12.024  1.00 85.07  ? 266  LEU B CD1   1 
ATOM   8516  C CD2   . LEU B  2 266 ? -19.829  -70.975 13.978  1.00 89.20  ? 266  LEU B CD2   1 
ATOM   8517  N N     . LYS B  2 267 ? -19.706  -66.294 15.409  1.00 77.13  ? 267  LYS B N     1 
ATOM   8518  C CA    . LYS B  2 267 ? -20.089  -65.781 16.731  1.00 77.26  ? 267  LYS B CA    1 
ATOM   8519  C C     . LYS B  2 267 ? -20.958  -64.525 16.580  1.00 80.83  ? 267  LYS B C     1 
ATOM   8520  O O     . LYS B  2 267 ? -21.981  -64.400 17.264  1.00 81.03  ? 267  LYS B O     1 
ATOM   8521  C CB    . LYS B  2 267 ? -18.835  -65.520 17.598  1.00 79.71  ? 267  LYS B CB    1 
ATOM   8522  C CG    . LYS B  2 267 ? -19.081  -65.577 19.108  1.00 89.42  ? 267  LYS B CG    1 
ATOM   8523  C CD    . LYS B  2 267 ? -17.813  -65.245 19.891  1.00 97.11  ? 267  LYS B CD    1 
ATOM   8524  C CE    . LYS B  2 267 ? -18.095  -64.881 21.332  1.00 102.66 ? 267  LYS B CE    1 
ATOM   8525  N NZ    . LYS B  2 267 ? -16.916  -64.248 21.993  1.00 101.08 ? 267  LYS B NZ    1 
ATOM   8526  N N     . ALA B  2 268 ? -20.570  -63.637 15.634  1.00 76.19  ? 268  ALA B N     1 
ATOM   8527  C CA    . ALA B  2 268 ? -21.255  -62.388 15.282  1.00 74.27  ? 268  ALA B CA    1 
ATOM   8528  C C     . ALA B  2 268 ? -22.646  -62.673 14.723  1.00 78.70  ? 268  ALA B C     1 
ATOM   8529  O O     . ALA B  2 268 ? -23.612  -62.010 15.108  1.00 78.11  ? 268  ALA B O     1 
ATOM   8530  C CB    . ALA B  2 268 ? -20.432  -61.616 14.257  1.00 73.63  ? 268  ALA B CB    1 
ATOM   8531  N N     . CYS B  2 269 ? -22.734  -63.674 13.824  1.00 75.70  ? 269  CYS B N     1 
ATOM   8532  C CA    . CYS B  2 269 ? -23.958  -64.147 13.189  1.00 75.84  ? 269  CYS B CA    1 
ATOM   8533  C C     . CYS B  2 269 ? -24.957  -64.607 14.257  1.00 81.12  ? 269  CYS B C     1 
ATOM   8534  O O     . CYS B  2 269 ? -26.122  -64.220 14.180  1.00 80.96  ? 269  CYS B O     1 
ATOM   8535  C CB    . CYS B  2 269 ? -23.637  -65.258 12.190  1.00 77.73  ? 269  CYS B CB    1 
ATOM   8536  S SG    . CYS B  2 269 ? -25.086  -66.107 11.500  1.00 83.08  ? 269  CYS B SG    1 
ATOM   8537  N N     . LYS B  2 270 ? -24.489  -65.390 15.268  1.00 78.75  ? 270  LYS B N     1 
ATOM   8538  C CA    . LYS B  2 270 ? -25.299  -65.897 16.397  1.00 79.21  ? 270  LYS B CA    1 
ATOM   8539  C C     . LYS B  2 270 ? -25.889  -64.726 17.177  1.00 78.54  ? 270  LYS B C     1 
ATOM   8540  O O     . LYS B  2 270 ? -27.100  -64.693 17.404  1.00 76.75  ? 270  LYS B O     1 
ATOM   8541  C CB    . LYS B  2 270 ? -24.460  -66.747 17.382  1.00 83.42  ? 270  LYS B CB    1 
ATOM   8542  C CG    . LYS B  2 270 ? -23.778  -67.963 16.800  1.00 100.37 ? 270  LYS B CG    1 
ATOM   8543  C CD    . LYS B  2 270 ? -22.552  -68.326 17.631  1.00 113.92 ? 270  LYS B CD    1 
ATOM   8544  C CE    . LYS B  2 270 ? -21.626  -69.285 16.918  1.00 125.23 ? 270  LYS B CE    1 
ATOM   8545  N NZ    . LYS B  2 270 ? -20.254  -69.283 17.495  1.00 130.06 ? 270  LYS B NZ    1 
ATOM   8546  N N     . ASN B  2 271 ? -25.018  -63.759 17.563  1.00 72.81  ? 271  ASN B N     1 
ATOM   8547  C CA    . ASN B  2 271 ? -25.375  -62.570 18.328  1.00 71.15  ? 271  ASN B CA    1 
ATOM   8548  C C     . ASN B  2 271 ? -26.473  -61.732 17.704  1.00 72.12  ? 271  ASN B C     1 
ATOM   8549  O O     . ASN B  2 271 ? -27.304  -61.200 18.433  1.00 71.39  ? 271  ASN B O     1 
ATOM   8550  C CB    . ASN B  2 271 ? -24.150  -61.743 18.652  1.00 75.70  ? 271  ASN B CB    1 
ATOM   8551  C CG    . ASN B  2 271 ? -23.364  -62.313 19.801  1.00 113.59 ? 271  ASN B CG    1 
ATOM   8552  O OD1   . ASN B  2 271 ? -23.892  -62.542 20.902  1.00 115.10 ? 271  ASN B OD1   1 
ATOM   8553  N ND2   . ASN B  2 271 ? -22.071  -62.498 19.592  1.00 104.51 ? 271  ASN B ND2   1 
ATOM   8554  N N     . MET B  2 272 ? -26.515  -61.671 16.365  1.00 66.82  ? 272  MET B N     1 
ATOM   8555  C CA    . MET B  2 272 ? -27.545  -60.952 15.621  1.00 65.38  ? 272  MET B CA    1 
ATOM   8556  C C     . MET B  2 272 ? -28.902  -61.663 15.730  1.00 72.02  ? 272  MET B C     1 
ATOM   8557  O O     . MET B  2 272 ? -29.920  -61.011 15.947  1.00 70.60  ? 272  MET B O     1 
ATOM   8558  C CB    . MET B  2 272 ? -27.133  -60.809 14.154  1.00 67.09  ? 272  MET B CB    1 
ATOM   8559  C CG    . MET B  2 272 ? -26.019  -59.834 13.943  1.00 68.89  ? 272  MET B CG    1 
ATOM   8560  S SD    . MET B  2 272 ? -25.578  -59.650 12.207  1.00 72.60  ? 272  MET B SD    1 
ATOM   8561  C CE    . MET B  2 272 ? -26.934  -58.685 11.629  1.00 68.36  ? 272  MET B CE    1 
ATOM   8562  N N     . ILE B  2 273 ? -28.902  -63.002 15.591  1.00 72.46  ? 273  ILE B N     1 
ATOM   8563  C CA    . ILE B  2 273 ? -30.090  -63.851 15.673  1.00 74.68  ? 273  ILE B CA    1 
ATOM   8564  C C     . ILE B  2 273 ? -30.629  -63.892 17.122  1.00 83.05  ? 273  ILE B C     1 
ATOM   8565  O O     . ILE B  2 273 ? -31.848  -63.942 17.330  1.00 83.65  ? 273  ILE B O     1 
ATOM   8566  C CB    . ILE B  2 273 ? -29.800  -65.247 15.039  1.00 79.35  ? 273  ILE B CB    1 
ATOM   8567  C CG1   . ILE B  2 273 ? -29.337  -65.064 13.575  1.00 79.44  ? 273  ILE B CG1   1 
ATOM   8568  C CG2   . ILE B  2 273 ? -31.018  -66.169 15.097  1.00 80.76  ? 273  ILE B CG2   1 
ATOM   8569  C CD1   . ILE B  2 273 ? -28.596  -66.229 12.956  1.00 90.38  ? 273  ILE B CD1   1 
ATOM   8570  N N     . ASP B  2 274 ? -29.719  -63.811 18.113  1.00 81.12  ? 274  ASP B N     1 
ATOM   8571  C CA    . ASP B  2 274 ? -30.059  -63.787 19.539  1.00 81.32  ? 274  ASP B CA    1 
ATOM   8572  C C     . ASP B  2 274 ? -30.679  -62.443 19.920  1.00 80.18  ? 274  ASP B C     1 
ATOM   8573  O O     . ASP B  2 274 ? -31.676  -62.411 20.646  1.00 79.72  ? 274  ASP B O     1 
ATOM   8574  C CB    . ASP B  2 274 ? -28.822  -64.097 20.409  1.00 84.30  ? 274  ASP B CB    1 
ATOM   8575  C CG    . ASP B  2 274 ? -28.386  -65.554 20.355  1.00 101.27 ? 274  ASP B CG    1 
ATOM   8576  O OD1   . ASP B  2 274 ? -29.255  -66.449 20.561  1.00 103.87 ? 274  ASP B OD1   1 
ATOM   8577  O OD2   . ASP B  2 274 ? -27.175  -65.803 20.142  1.00 108.78 ? 274  ASP B OD2   1 
ATOM   8578  N N     . MET B  2 275 ? -30.119  -61.344 19.381  1.00 72.85  ? 275  MET B N     1 
ATOM   8579  C CA    . MET B  2 275 ? -30.592  -59.974 19.605  1.00 69.80  ? 275  MET B CA    1 
ATOM   8580  C C     . MET B  2 275 ? -31.851  -59.678 18.779  1.00 70.26  ? 275  MET B C     1 
ATOM   8581  O O     . MET B  2 275 ? -32.503  -58.648 18.991  1.00 67.29  ? 275  MET B O     1 
ATOM   8582  C CB    . MET B  2 275 ? -29.477  -58.987 19.234  1.00 70.35  ? 275  MET B CB    1 
ATOM   8583  C CG    . MET B  2 275 ? -29.038  -58.078 20.368  1.00 73.08  ? 275  MET B CG    1 
ATOM   8584  S SD    . MET B  2 275 ? -28.618  -58.804 21.967  1.00 79.02  ? 275  MET B SD    1 
ATOM   8585  C CE    . MET B  2 275 ? -27.261  -59.967 21.483  1.00 77.61  ? 275  MET B CE    1 
ATOM   8586  N N     . GLY B  2 276 ? -32.163  -60.577 17.842  1.00 66.75  ? 276  GLY B N     1 
ATOM   8587  C CA    . GLY B  2 276 ? -33.297  -60.438 16.941  1.00 66.08  ? 276  GLY B CA    1 
ATOM   8588  C C     . GLY B  2 276 ? -33.088  -59.400 15.847  1.00 66.22  ? 276  GLY B C     1 
ATOM   8589  O O     . GLY B  2 276 ? -34.052  -58.995 15.192  1.00 65.92  ? 276  GLY B O     1 
ATOM   8590  N N     . ILE B  2 277 ? -31.825  -58.968 15.635  1.00 59.72  ? 277  ILE B N     1 
ATOM   8591  C CA    . ILE B  2 277 ? -31.446  -58.006 14.604  1.00 57.73  ? 277  ILE B CA    1 
ATOM   8592  C C     . ILE B  2 277 ? -31.645  -58.608 13.213  1.00 62.66  ? 277  ILE B C     1 
ATOM   8593  O O     . ILE B  2 277 ? -30.972  -59.578 12.841  1.00 63.64  ? 277  ILE B O     1 
ATOM   8594  C CB    . ILE B  2 277 ? -30.022  -57.437 14.833  1.00 59.83  ? 277  ILE B CB    1 
ATOM   8595  C CG1   . ILE B  2 277 ? -30.028  -56.487 16.040  1.00 59.01  ? 277  ILE B CG1   1 
ATOM   8596  C CG2   . ILE B  2 277 ? -29.508  -56.709 13.576  1.00 59.92  ? 277  ILE B CG2   1 
ATOM   8597  C CD1   . ILE B  2 277 ? -28.741  -56.260 16.656  1.00 69.80  ? 277  ILE B CD1   1 
ATOM   8598  N N     . ASP B  2 278 ? -32.598  -58.041 12.463  1.00 58.24  ? 278  ASP B N     1 
ATOM   8599  C CA    . ASP B  2 278 ? -32.942  -58.514 11.126  1.00 58.44  ? 278  ASP B CA    1 
ATOM   8600  C C     . ASP B  2 278 ? -32.130  -57.827 10.020  1.00 60.15  ? 278  ASP B C     1 
ATOM   8601  O O     . ASP B  2 278 ? -32.148  -58.295 8.886   1.00 61.14  ? 278  ASP B O     1 
ATOM   8602  C CB    . ASP B  2 278 ? -34.457  -58.358 10.860  1.00 60.18  ? 278  ASP B CB    1 
ATOM   8603  C CG    . ASP B  2 278 ? -35.395  -58.929 11.908  1.00 67.25  ? 278  ASP B CG    1 
ATOM   8604  O OD1   . ASP B  2 278 ? -36.231  -58.156 12.437  1.00 63.37  ? 278  ASP B OD1   1 
ATOM   8605  O OD2   . ASP B  2 278 ? -35.327  -60.163 12.165  1.00 76.71  ? 278  ASP B OD2   1 
ATOM   8606  N N     . ALA B  2 279 ? -31.421  -56.741 10.342  1.00 54.64  ? 279  ALA B N     1 
ATOM   8607  C CA    . ALA B  2 279 ? -30.669  -55.961 9.362   1.00 53.86  ? 279  ALA B CA    1 
ATOM   8608  C C     . ALA B  2 279 ? -29.467  -55.233 9.968   1.00 57.94  ? 279  ALA B C     1 
ATOM   8609  O O     . ALA B  2 279 ? -29.578  -54.657 11.063  1.00 57.94  ? 279  ALA B O     1 
ATOM   8610  C CB    . ALA B  2 279 ? -31.591  -54.946 8.703   1.00 53.72  ? 279  ALA B CB    1 
ATOM   8611  N N     . LEU B  2 280 ? -28.334  -55.200 9.220   1.00 51.98  ? 280  LEU B N     1 
ATOM   8612  C CA    . LEU B  2 280 ? -27.105  -54.540 9.651   1.00 48.96  ? 280  LEU B CA    1 
ATOM   8613  C C     . LEU B  2 280 ? -26.714  -53.342 8.780   1.00 50.01  ? 280  LEU B C     1 
ATOM   8614  O O     . LEU B  2 280 ? -26.762  -53.409 7.557   1.00 50.04  ? 280  LEU B O     1 
ATOM   8615  C CB    . LEU B  2 280 ? -25.956  -55.559 9.735   1.00 49.71  ? 280  LEU B CB    1 
ATOM   8616  C CG    . LEU B  2 280 ? -24.730  -55.150 10.575  1.00 52.89  ? 280  LEU B CG    1 
ATOM   8617  C CD1   . LEU B  2 280 ? -24.983  -55.342 12.044  1.00 52.87  ? 280  LEU B CD1   1 
ATOM   8618  C CD2   . LEU B  2 280 ? -23.524  -55.956 10.186  1.00 54.78  ? 280  LEU B CD2   1 
ATOM   8619  N N     . ILE B  2 281 ? -26.325  -52.249 9.421   1.00 44.56  ? 281  ILE B N     1 
ATOM   8620  C CA    . ILE B  2 281 ? -25.873  -51.046 8.738   1.00 42.31  ? 281  ILE B CA    1 
ATOM   8621  C C     . ILE B  2 281 ? -24.448  -50.771 9.222   1.00 47.89  ? 281  ILE B C     1 
ATOM   8622  O O     . ILE B  2 281 ? -24.227  -50.460 10.391  1.00 47.01  ? 281  ILE B O     1 
ATOM   8623  C CB    . ILE B  2 281 ? -26.823  -49.812 8.896   1.00 42.26  ? 281  ILE B CB    1 
ATOM   8624  C CG1   . ILE B  2 281 ? -28.245  -50.123 8.388   1.00 42.90  ? 281  ILE B CG1   1 
ATOM   8625  C CG2   . ILE B  2 281 ? -26.240  -48.602 8.175   1.00 39.55  ? 281  ILE B CG2   1 
ATOM   8626  C CD1   . ILE B  2 281 ? -29.244  -48.965 8.400   1.00 45.08  ? 281  ILE B CD1   1 
ATOM   8627  N N     . VAL B  2 282 ? -23.486  -50.901 8.322   1.00 45.74  ? 282  VAL B N     1 
ATOM   8628  C CA    . VAL B  2 282 ? -22.084  -50.633 8.633   1.00 44.37  ? 282  VAL B CA    1 
ATOM   8629  C C     . VAL B  2 282 ? -21.709  -49.252 8.051   1.00 46.03  ? 282  VAL B C     1 
ATOM   8630  O O     . VAL B  2 282 ? -21.996  -48.964 6.883   1.00 46.60  ? 282  VAL B O     1 
ATOM   8631  C CB    . VAL B  2 282 ? -21.142  -51.770 8.123   1.00 48.71  ? 282  VAL B CB    1 
ATOM   8632  C CG1   . VAL B  2 282 ? -19.706  -51.562 8.572   1.00 47.30  ? 282  VAL B CG1   1 
ATOM   8633  C CG2   . VAL B  2 282 ? -21.639  -53.141 8.569   1.00 50.42  ? 282  VAL B CG2   1 
ATOM   8634  N N     . CYS B  2 283 ? -21.091  -48.405 8.879   1.00 38.62  ? 283  CYS B N     1 
ATOM   8635  C CA    . CYS B  2 283 ? -20.558  -47.121 8.480   1.00 35.56  ? 283  CYS B CA    1 
ATOM   8636  C C     . CYS B  2 283 ? -19.057  -47.151 8.805   1.00 38.39  ? 283  CYS B C     1 
ATOM   8637  O O     . CYS B  2 283 ? -18.654  -47.048 9.963   1.00 38.08  ? 283  CYS B O     1 
ATOM   8638  C CB    . CYS B  2 283 ? -21.273  -45.990 9.201   1.00 34.97  ? 283  CYS B CB    1 
ATOM   8639  S SG    . CYS B  2 283 ? -20.730  -44.326 8.705   1.00 37.73  ? 283  CYS B SG    1 
ATOM   8640  N N     . GLY B  2 284 ? -18.248  -47.371 7.786   1.00 34.75  ? 284  GLY B N     1 
ATOM   8641  C CA    . GLY B  2 284 ? -16.804  -47.454 7.950   1.00 34.90  ? 284  GLY B CA    1 
ATOM   8642  C C     . GLY B  2 284 ? -16.051  -47.358 6.643   1.00 41.46  ? 284  GLY B C     1 
ATOM   8643  O O     . GLY B  2 284 ? -16.622  -46.973 5.617   1.00 42.57  ? 284  GLY B O     1 
ATOM   8644  N N     . GLY B  2 285 ? -14.776  -47.730 6.696   1.00 38.78  ? 285  GLY B N     1 
ATOM   8645  C CA    . GLY B  2 285 ? -13.838  -47.698 5.577   1.00 39.41  ? 285  GLY B CA    1 
ATOM   8646  C C     . GLY B  2 285 ? -13.869  -48.880 4.639   1.00 46.89  ? 285  GLY B C     1 
ATOM   8647  O O     . GLY B  2 285 ? -14.811  -49.678 4.656   1.00 44.23  ? 285  GLY B O     1 
ATOM   8648  N N     . ASP B  2 286 ? -12.812  -48.976 3.808   1.00 49.33  ? 286  ASP B N     1 
ATOM   8649  C CA    . ASP B  2 286 ? -12.600  -49.987 2.765   1.00 52.71  ? 286  ASP B CA    1 
ATOM   8650  C C     . ASP B  2 286 ? -12.715  -51.422 3.284   1.00 58.37  ? 286  ASP B C     1 
ATOM   8651  O O     . ASP B  2 286 ? -13.715  -52.079 3.013   1.00 57.91  ? 286  ASP B O     1 
ATOM   8652  C CB    . ASP B  2 286 ? -11.250  -49.774 2.041   1.00 56.20  ? 286  ASP B CB    1 
ATOM   8653  C CG    . ASP B  2 286 ? -10.784  -48.343 1.876   1.00 76.23  ? 286  ASP B CG    1 
ATOM   8654  O OD1   . ASP B  2 286 ? -11.651  -47.443 1.740   1.00 78.47  ? 286  ASP B OD1   1 
ATOM   8655  O OD2   . ASP B  2 286 ? -9.548   -48.120 1.879   1.00 84.46  ? 286  ASP B OD2   1 
ATOM   8656  N N     . GLY B  2 287 ? -11.713  -51.872 4.043   1.00 57.02  ? 287  GLY B N     1 
ATOM   8657  C CA    . GLY B  2 287 ? -11.670  -53.208 4.640   1.00 59.17  ? 287  GLY B CA    1 
ATOM   8658  C C     . GLY B  2 287 ? -12.839  -53.471 5.572   1.00 63.11  ? 287  GLY B C     1 
ATOM   8659  O O     . GLY B  2 287 ? -13.402  -54.567 5.600   1.00 63.75  ? 287  GLY B O     1 
ATOM   8660  N N     . SER B  2 288 ? -13.228  -52.425 6.303   1.00 58.14  ? 288  SER B N     1 
ATOM   8661  C CA    . SER B  2 288 ? -14.361  -52.371 7.220   1.00 56.92  ? 288  SER B CA    1 
ATOM   8662  C C     . SER B  2 288 ? -15.647  -52.845 6.476   1.00 59.98  ? 288  SER B C     1 
ATOM   8663  O O     . SER B  2 288 ? -16.374  -53.691 6.998   1.00 59.40  ? 288  SER B O     1 
ATOM   8664  C CB    . SER B  2 288 ? -14.482  -50.952 7.783   1.00 57.11  ? 288  SER B CB    1 
ATOM   8665  O OG    . SER B  2 288 ? -13.199  -50.368 8.014   1.00 60.95  ? 288  SER B OG    1 
ATOM   8666  N N     . LEU B  2 289 ? -15.834  -52.394 5.207   1.00 56.26  ? 289  LEU B N     1 
ATOM   8667  C CA    . LEU B  2 289 ? -16.939  -52.784 4.324   1.00 56.36  ? 289  LEU B CA    1 
ATOM   8668  C C     . LEU B  2 289 ? -16.641  -54.077 3.534   1.00 65.14  ? 289  LEU B C     1 
ATOM   8669  O O     . LEU B  2 289 ? -17.596  -54.789 3.196   1.00 66.14  ? 289  LEU B O     1 
ATOM   8670  C CB    . LEU B  2 289 ? -17.322  -51.654 3.348   1.00 54.68  ? 289  LEU B CB    1 
ATOM   8671  C CG    . LEU B  2 289 ? -17.994  -50.400 3.906   1.00 57.14  ? 289  LEU B CG    1 
ATOM   8672  C CD1   . LEU B  2 289 ? -18.232  -49.400 2.816   1.00 55.91  ? 289  LEU B CD1   1 
ATOM   8673  C CD2   . LEU B  2 289 ? -19.315  -50.705 4.597   1.00 60.55  ? 289  LEU B CD2   1 
ATOM   8674  N N     . THR B  2 290 ? -15.335  -54.373 3.209   1.00 63.21  ? 290  THR B N     1 
ATOM   8675  C CA    . THR B  2 290 ? -14.956  -55.614 2.504   1.00 65.28  ? 290  THR B CA    1 
ATOM   8676  C C     . THR B  2 290 ? -15.259  -56.803 3.432   1.00 72.08  ? 290  THR B C     1 
ATOM   8677  O O     . THR B  2 290 ? -15.773  -57.818 2.972   1.00 74.17  ? 290  THR B O     1 
ATOM   8678  C CB    . THR B  2 290 ? -13.482  -55.653 1.995   1.00 77.82  ? 290  THR B CB    1 
ATOM   8679  O OG1   . THR B  2 290 ? -12.572  -56.007 3.035   1.00 82.14  ? 290  THR B OG1   1 
ATOM   8680  C CG2   . THR B  2 290 ? -13.030  -54.392 1.267   1.00 75.80  ? 290  THR B CG2   1 
ATOM   8681  N N     . GLY B  2 291 ? -14.958  -56.638 4.727   1.00 69.14  ? 291  GLY B N     1 
ATOM   8682  C CA    . GLY B  2 291 ? -15.212  -57.612 5.791   1.00 70.71  ? 291  GLY B CA    1 
ATOM   8683  C C     . GLY B  2 291 ? -16.697  -57.856 6.013   1.00 76.01  ? 291  GLY B C     1 
ATOM   8684  O O     . GLY B  2 291 ? -17.097  -58.965 6.384   1.00 77.54  ? 291  GLY B O     1 
ATOM   8685  N N     . ALA B  2 292 ? -17.520  -56.815 5.775   1.00 71.09  ? 292  ALA B N     1 
ATOM   8686  C CA    . ALA B  2 292 ? -18.972  -56.870 5.855   1.00 71.42  ? 292  ALA B CA    1 
ATOM   8687  C C     . ALA B  2 292 ? -19.486  -57.614 4.625   1.00 77.35  ? 292  ALA B C     1 
ATOM   8688  O O     . ALA B  2 292 ? -20.461  -58.362 4.719   1.00 78.06  ? 292  ALA B O     1 
ATOM   8689  C CB    . ALA B  2 292 ? -19.538  -55.460 5.872   1.00 70.43  ? 292  ALA B CB    1 
ATOM   8690  N N     . ASP B  2 293 ? -18.822  -57.397 3.473   1.00 74.46  ? 293  ASP B N     1 
ATOM   8691  C CA    . ASP B  2 293 ? -19.140  -58.022 2.191   1.00 75.96  ? 293  ASP B CA    1 
ATOM   8692  C C     . ASP B  2 293 ? -18.849  -59.534 2.244   1.00 81.32  ? 293  ASP B C     1 
ATOM   8693  O O     . ASP B  2 293 ? -19.661  -60.333 1.770   1.00 81.48  ? 293  ASP B O     1 
ATOM   8694  C CB    . ASP B  2 293 ? -18.346  -57.339 1.062   1.00 77.41  ? 293  ASP B CB    1 
ATOM   8695  C CG    . ASP B  2 293 ? -18.726  -57.791 -0.327  1.00 88.48  ? 293  ASP B CG    1 
ATOM   8696  O OD1   . ASP B  2 293 ? -19.922  -57.667 -0.684  1.00 89.49  ? 293  ASP B OD1   1 
ATOM   8697  O OD2   . ASP B  2 293 ? -17.827  -58.252 -1.065  1.00 94.40  ? 293  ASP B OD2   1 
ATOM   8698  N N     . ARG B  2 294 ? -17.696  -59.916 2.845   1.00 77.79  ? 294  ARG B N     1 
ATOM   8699  C CA    . ARG B  2 294 ? -17.287  -61.309 3.044   1.00 79.01  ? 294  ARG B CA    1 
ATOM   8700  C C     . ARG B  2 294 ? -18.290  -62.000 3.981   1.00 84.00  ? 294  ARG B C     1 
ATOM   8701  O O     . ARG B  2 294 ? -18.670  -63.144 3.738   1.00 84.81  ? 294  ARG B O     1 
ATOM   8702  C CB    . ARG B  2 294 ? -15.871  -61.376 3.630   1.00 76.22  ? 294  ARG B CB    1 
ATOM   8703  C CG    . ARG B  2 294 ? -14.781  -61.324 2.575   1.00 87.41  ? 294  ARG B CG    1 
ATOM   8704  C CD    . ARG B  2 294 ? -13.745  -62.410 2.802   1.00 104.61 ? 294  ARG B CD    1 
ATOM   8705  N NE    . ARG B  2 294 ? -14.161  -63.692 2.223   1.00 115.90 ? 294  ARG B NE    1 
ATOM   8706  C CZ    . ARG B  2 294 ? -13.608  -64.865 2.516   1.00 131.08 ? 294  ARG B CZ    1 
ATOM   8707  N NH1   . ARG B  2 294 ? -12.620  -64.940 3.401   1.00 120.75 ? 294  ARG B NH1   1 
ATOM   8708  N NH2   . ARG B  2 294 ? -14.045  -65.972 1.936   1.00 118.12 ? 294  ARG B NH2   1 
ATOM   8709  N N     . PHE B  2 295 ? -18.750  -61.269 5.025   1.00 79.52  ? 295  PHE B N     1 
ATOM   8710  C CA    . PHE B  2 295 ? -19.732  -61.717 6.010   1.00 79.39  ? 295  PHE B CA    1 
ATOM   8711  C C     . PHE B  2 295 ? -21.085  -61.961 5.335   1.00 82.23  ? 295  PHE B C     1 
ATOM   8712  O O     . PHE B  2 295 ? -21.844  -62.835 5.762   1.00 81.63  ? 295  PHE B O     1 
ATOM   8713  C CB    . PHE B  2 295 ? -19.846  -60.673 7.136   1.00 79.39  ? 295  PHE B CB    1 
ATOM   8714  C CG    . PHE B  2 295 ? -20.849  -60.972 8.227   1.00 82.09  ? 295  PHE B CG    1 
ATOM   8715  C CD1   . PHE B  2 295 ? -21.957  -60.158 8.416   1.00 84.11  ? 295  PHE B CD1   1 
ATOM   8716  C CD2   . PHE B  2 295 ? -20.683  -62.066 9.070   1.00 87.36  ? 295  PHE B CD2   1 
ATOM   8717  C CE1   . PHE B  2 295 ? -22.882  -60.437 9.428   1.00 86.10  ? 295  PHE B CE1   1 
ATOM   8718  C CE2   . PHE B  2 295 ? -21.617  -62.347 10.078  1.00 90.77  ? 295  PHE B CE2   1 
ATOM   8719  C CZ    . PHE B  2 295 ? -22.702  -61.527 10.257  1.00 87.31  ? 295  PHE B CZ    1 
ATOM   8720  N N     . ARG B  2 296 ? -21.364  -61.194 4.266   1.00 78.18  ? 296  ARG B N     1 
ATOM   8721  C CA    . ARG B  2 296 ? -22.587  -61.287 3.473   1.00 78.75  ? 296  ARG B CA    1 
ATOM   8722  C C     . ARG B  2 296 ? -22.609  -62.606 2.670   1.00 86.31  ? 296  ARG B C     1 
ATOM   8723  O O     . ARG B  2 296 ? -23.599  -63.342 2.729   1.00 87.26  ? 296  ARG B O     1 
ATOM   8724  C CB    . ARG B  2 296 ? -22.742  -60.022 2.601   1.00 75.72  ? 296  ARG B CB    1 
ATOM   8725  C CG    . ARG B  2 296 ? -23.741  -60.106 1.455   1.00 83.08  ? 296  ARG B CG    1 
ATOM   8726  C CD    . ARG B  2 296 ? -23.268  -59.324 0.237   1.00 92.61  ? 296  ARG B CD    1 
ATOM   8727  N NE    . ARG B  2 296 ? -22.003  -59.830 -0.304  1.00 102.79 ? 296  ARG B NE    1 
ATOM   8728  C CZ    . ARG B  2 296 ? -21.906  -60.812 -1.194  1.00 116.35 ? 296  ARG B CZ    1 
ATOM   8729  N NH1   . ARG B  2 296 ? -22.997  -61.404 -1.660  1.00 100.95 ? 296  ARG B NH1   1 
ATOM   8730  N NH2   . ARG B  2 296 ? -20.715  -61.211 -1.623  1.00 107.07 ? 296  ARG B NH2   1 
ATOM   8731  N N     . SER B  2 297 ? -21.508  -62.914 1.953   1.00 83.96  ? 297  SER B N     1 
ATOM   8732  C CA    . SER B  2 297 ? -21.379  -64.149 1.168   1.00 85.72  ? 297  SER B CA    1 
ATOM   8733  C C     . SER B  2 297 ? -21.294  -65.373 2.083   1.00 91.04  ? 297  SER B C     1 
ATOM   8734  O O     . SER B  2 297 ? -21.861  -66.414 1.753   1.00 94.14  ? 297  SER B O     1 
ATOM   8735  C CB    . SER B  2 297 ? -20.177  -64.090 0.224   1.00 88.98  ? 297  SER B CB    1 
ATOM   8736  O OG    . SER B  2 297 ? -18.932  -63.984 0.900   1.00 96.45  ? 297  SER B OG    1 
ATOM   8737  N N     . GLU B  2 298 ? -20.618  -65.238 3.244   1.00 84.20  ? 298  GLU B N     1 
ATOM   8738  C CA    . GLU B  2 298 ? -20.476  -66.313 4.228   1.00 83.55  ? 298  GLU B CA    1 
ATOM   8739  C C     . GLU B  2 298 ? -21.713  -66.456 5.132   1.00 83.21  ? 298  GLU B C     1 
ATOM   8740  O O     . GLU B  2 298 ? -21.735  -67.387 5.941   1.00 83.27  ? 298  GLU B O     1 
ATOM   8741  C CB    . GLU B  2 298 ? -19.195  -66.136 5.064   1.00 84.17  ? 298  GLU B CB    1 
ATOM   8742  C CG    . GLU B  2 298 ? -17.914  -66.521 4.331   1.00 94.65  ? 298  GLU B CG    1 
ATOM   8743  C CD    . GLU B  2 298 ? -16.632  -66.588 5.145   1.00 119.49 ? 298  GLU B CD    1 
ATOM   8744  O OE1   . GLU B  2 298 ? -15.539  -66.546 4.534   1.00 107.95 ? 298  GLU B OE1   1 
ATOM   8745  O OE2   . GLU B  2 298 ? -16.713  -66.703 6.389   1.00 121.14 ? 298  GLU B OE2   1 
ATOM   8746  N N     . TRP B  2 299 ? -22.747  -65.558 4.988   1.00 76.28  ? 299  TRP B N     1 
ATOM   8747  C CA    . TRP B  2 299 ? -23.986  -65.615 5.794   1.00 75.14  ? 299  TRP B CA    1 
ATOM   8748  C C     . TRP B  2 299 ? -24.627  -66.996 5.839   1.00 84.79  ? 299  TRP B C     1 
ATOM   8749  O O     . TRP B  2 299 ? -24.899  -67.445 6.953   1.00 85.68  ? 299  TRP B O     1 
ATOM   8750  C CB    . TRP B  2 299 ? -24.993  -64.480 5.515   1.00 70.84  ? 299  TRP B CB    1 
ATOM   8751  C CG    . TRP B  2 299 ? -26.192  -64.511 6.431   1.00 70.49  ? 299  TRP B CG    1 
ATOM   8752  C CD1   . TRP B  2 299 ? -27.417  -65.042 6.155   1.00 74.43  ? 299  TRP B CD1   1 
ATOM   8753  C CD2   . TRP B  2 299 ? -26.250  -64.056 7.793   1.00 68.43  ? 299  TRP B CD2   1 
ATOM   8754  N NE1   . TRP B  2 299 ? -28.243  -64.923 7.249   1.00 73.00  ? 299  TRP B NE1   1 
ATOM   8755  C CE2   . TRP B  2 299 ? -27.551  -64.325 8.270   1.00 72.44  ? 299  TRP B CE2   1 
ATOM   8756  C CE3   . TRP B  2 299 ? -25.345  -63.399 8.642   1.00 67.58  ? 299  TRP B CE3   1 
ATOM   8757  C CZ2   . TRP B  2 299 ? -27.958  -63.998 9.570   1.00 70.52  ? 299  TRP B CZ2   1 
ATOM   8758  C CZ3   . TRP B  2 299 ? -25.750  -63.078 9.928   1.00 68.00  ? 299  TRP B CZ3   1 
ATOM   8759  C CH2   . TRP B  2 299 ? -27.041  -63.382 10.381  1.00 69.18  ? 299  TRP B CH2   1 
ATOM   8760  N N     . PRO B  2 300 ? -24.764  -67.750 4.708   1.00 85.07  ? 300  PRO B N     1 
ATOM   8761  C CA    . PRO B  2 300 ? -25.263  -69.138 4.802   1.00 87.96  ? 300  PRO B CA    1 
ATOM   8762  C C     . PRO B  2 300 ? -24.344  -70.067 5.633   1.00 92.67  ? 300  PRO B C     1 
ATOM   8763  O O     . PRO B  2 300 ? -23.535  -70.861 5.134   1.00 91.01  ? 300  PRO B O     1 
ATOM   8764  C CB    . PRO B  2 300 ? -25.406  -69.559 3.333   1.00 91.05  ? 300  PRO B CB    1 
ATOM   8765  C CG    . PRO B  2 300 ? -25.518  -68.239 2.581   1.00 92.90  ? 300  PRO B CG    1 
ATOM   8766  C CD    . PRO B  2 300 ? -24.536  -67.383 3.297   1.00 86.29  ? 300  PRO B CD    1 
ATOM   8767  N N     . SER B  2 301 ? -24.485  -69.888 6.958   1.00 91.13  ? 301  SER B N     1 
ATOM   8768  C CA    . SER B  2 301 ? -23.870  -70.596 8.069   1.00 92.44  ? 301  SER B CA    1 
ATOM   8769  C C     . SER B  2 301 ? -25.078  -71.048 8.913   1.00 97.56  ? 301  SER B C     1 
ATOM   8770  O O     . SER B  2 301 ? -25.468  -70.424 9.914   1.00 94.03  ? 301  SER B O     1 
ATOM   8771  C CB    . SER B  2 301 ? -22.940  -69.677 8.849   1.00 94.07  ? 301  SER B CB    1 
ATOM   8772  O OG    . SER B  2 301 ? -23.615  -68.506 9.269   1.00 104.94 ? 301  SER B OG    1 
ATOM   8773  N N     . LEU B  2 302 ? -25.732  -72.099 8.382   1.00 97.70  ? 302  LEU B N     1 
ATOM   8774  C CA    . LEU B  2 302 ? -26.915  -72.768 8.907   1.00 99.09  ? 302  LEU B CA    1 
ATOM   8775  C C     . LEU B  2 302 ? -26.607  -73.520 10.196  1.00 103.33 ? 302  LEU B C     1 
ATOM   8776  O O     . LEU B  2 302 ? -27.507  -73.736 11.012  1.00 104.01 ? 302  LEU B O     1 
ATOM   8777  C CB    . LEU B  2 302 ? -27.518  -73.712 7.825   1.00 101.69 ? 302  LEU B CB    1 
ATOM   8778  C CG    . LEU B  2 302 ? -26.774  -74.999 7.296   1.00 109.31 ? 302  LEU B CG    1 
ATOM   8779  C CD1   . LEU B  2 302 ? -25.284  -74.772 6.941   1.00 108.89 ? 302  LEU B CD1   1 
ATOM   8780  C CD2   . LEU B  2 302 ? -27.012  -76.218 8.172   1.00 113.37 ? 302  LEU B CD2   1 
ATOM   8781  N N     . ILE B  2 303 ? -25.327  -73.939 10.341  1.00 98.36  ? 303  ILE B N     1 
ATOM   8782  C CA    . ILE B  2 303 ? -24.729  -74.680 11.451  1.00 98.64  ? 303  ILE B CA    1 
ATOM   8783  C C     . ILE B  2 303 ? -25.701  -75.292 12.479  1.00 104.60 ? 303  ILE B C     1 
ATOM   8784  O O     . ILE B  2 303 ? -26.281  -74.587 13.323  1.00 102.77 ? 303  ILE B O     1 
ATOM   8785  C CB    . ILE B  2 303 ? -23.436  -74.017 12.038  1.00 99.11  ? 303  ILE B CB    1 
ATOM   8786  C CG1   . ILE B  2 303 ? -22.293  -74.101 10.972  1.00 98.00  ? 303  ILE B CG1   1 
ATOM   8787  C CG2   . ILE B  2 303 ? -23.022  -74.642 13.407  1.00 101.54 ? 303  ILE B CG2   1 
ATOM   8788  C CD1   . ILE B  2 303 ? -20.804  -73.890 11.432  1.00 93.48  ? 303  ILE B CD1   1 
ATOM   8789  N N     . GLU B  2 304 ? -25.894  -76.624 12.332  1.00 103.40 ? 304  GLU B N     1 
ATOM   8790  C CA    . GLU B  2 304 ? -26.721  -77.467 13.176  1.00 104.37 ? 304  GLU B CA    1 
ATOM   8791  C C     . GLU B  2 304 ? -25.913  -77.764 14.429  1.00 107.71 ? 304  GLU B C     1 
ATOM   8792  O O     . GLU B  2 304 ? -24.854  -78.387 14.356  1.00 108.81 ? 304  GLU B O     1 
ATOM   8793  C CB    . GLU B  2 304 ? -27.111  -78.755 12.436  1.00 108.46 ? 304  GLU B CB    1 
ATOM   8794  N N     . GLU B  2 305 ? -26.378  -77.229 15.565  1.00 102.06 ? 305  GLU B N     1 
ATOM   8795  C CA    . GLU B  2 305 ? -25.783  -77.362 16.893  1.00 100.30 ? 305  GLU B CA    1 
ATOM   8796  C C     . GLU B  2 305 ? -26.777  -76.857 17.961  1.00 119.83 ? 305  GLU B C     1 
ATOM   8797  O O     . GLU B  2 305 ? -28.001  -76.989 17.813  1.00 76.45  ? 305  GLU B O     1 
ATOM   8798  C CB    . GLU B  2 305 ? -24.443  -76.601 16.977  1.00 99.55  ? 305  GLU B CB    1 
ATOM   8799  N N     . GLN B  2 314 ? -36.163  -75.418 14.132  1.00 116.03 ? 314  GLN B N     1 
ATOM   8800  C CA    . GLN B  2 314 ? -35.501  -74.605 13.110  1.00 113.70 ? 314  GLN B CA    1 
ATOM   8801  C C     . GLN B  2 314 ? -35.935  -73.125 13.135  1.00 113.81 ? 314  GLN B C     1 
ATOM   8802  O O     . GLN B  2 314 ? -35.326  -72.312 12.446  1.00 111.10 ? 314  GLN B O     1 
ATOM   8803  C CB    . GLN B  2 314 ? -35.728  -75.225 11.717  1.00 116.44 ? 314  GLN B CB    1 
ATOM   8804  N N     . GLN B  2 315 ? -36.980  -72.792 13.937  1.00 109.67 ? 315  GLN B N     1 
ATOM   8805  C CA    . GLN B  2 315 ? -37.636  -71.478 14.115  1.00 106.20 ? 315  GLN B CA    1 
ATOM   8806  C C     . GLN B  2 315 ? -36.815  -70.242 13.792  1.00 104.67 ? 315  GLN B C     1 
ATOM   8807  O O     . GLN B  2 315 ? -37.302  -69.366 13.074  1.00 102.97 ? 315  GLN B O     1 
ATOM   8808  C CB    . GLN B  2 315 ? -38.264  -71.354 15.512  1.00 107.64 ? 315  GLN B CB    1 
ATOM   8809  N N     . GLN B  2 316 ? -35.582  -70.166 14.331  1.00 98.45  ? 316  GLN B N     1 
ATOM   8810  C CA    . GLN B  2 316 ? -34.664  -69.040 14.139  1.00 94.58  ? 316  GLN B CA    1 
ATOM   8811  C C     . GLN B  2 316 ? -34.039  -69.024 12.743  1.00 98.66  ? 316  GLN B C     1 
ATOM   8812  O O     . GLN B  2 316 ? -33.955  -67.959 12.132  1.00 95.99  ? 316  GLN B O     1 
ATOM   8813  C CB    . GLN B  2 316 ? -33.596  -69.017 15.238  1.00 94.75  ? 316  GLN B CB    1 
ATOM   8814  C CG    . GLN B  2 316 ? -34.163  -68.708 16.625  1.00 92.46  ? 316  GLN B CG    1 
ATOM   8815  C CD    . GLN B  2 316 ? -33.095  -68.581 17.680  1.00 104.45 ? 316  GLN B CD    1 
ATOM   8816  O OE1   . GLN B  2 316 ? -32.550  -69.574 18.161  1.00 93.27  ? 316  GLN B OE1   1 
ATOM   8817  N NE2   . GLN B  2 316 ? -32.800  -67.353 18.103  1.00 106.28 ? 316  GLN B NE2   1 
ATOM   8818  N N     . PHE B  2 317 ? -33.613  -70.199 12.237  1.00 99.17  ? 317  PHE B N     1 
ATOM   8819  C CA    . PHE B  2 317 ? -33.015  -70.376 10.905  1.00 100.18 ? 317  PHE B CA    1 
ATOM   8820  C C     . PHE B  2 317 ? -34.019  -70.065 9.792   1.00 103.56 ? 317  PHE B C     1 
ATOM   8821  O O     . PHE B  2 317 ? -33.624  -69.652 8.704   1.00 101.87 ? 317  PHE B O     1 
ATOM   8822  C CB    . PHE B  2 317 ? -32.437  -71.799 10.745  1.00 105.38 ? 317  PHE B CB    1 
ATOM   8823  C CG    . PHE B  2 317 ? -32.041  -72.200 9.338   1.00 108.63 ? 317  PHE B CG    1 
ATOM   8824  C CD1   . PHE B  2 317 ? -30.990  -71.566 8.683   1.00 110.41 ? 317  PHE B CD1   1 
ATOM   8825  C CD2   . PHE B  2 317 ? -32.705  -73.225 8.678   1.00 114.44 ? 317  PHE B CD2   1 
ATOM   8826  C CE1   . PHE B  2 317 ? -30.636  -71.926 7.381   1.00 112.48 ? 317  PHE B CE1   1 
ATOM   8827  C CE2   . PHE B  2 317 ? -32.336  -73.601 7.383   1.00 118.56 ? 317  PHE B CE2   1 
ATOM   8828  C CZ    . PHE B  2 317 ? -31.308  -72.944 6.741   1.00 114.87 ? 317  PHE B CZ    1 
ATOM   8829  N N     . ASN B  2 318 ? -35.312  -70.265 10.070  1.00 101.66 ? 318  ASN B N     1 
ATOM   8830  C CA    . ASN B  2 318 ? -36.382  -69.971 9.130   1.00 101.99 ? 318  ASN B CA    1 
ATOM   8831  C C     . ASN B  2 318 ? -36.562  -68.439 9.045   1.00 104.62 ? 318  ASN B C     1 
ATOM   8832  O O     . ASN B  2 318 ? -36.431  -67.881 7.954   1.00 103.02 ? 318  ASN B O     1 
ATOM   8833  C CB    . ASN B  2 318 ? -37.686  -70.683 9.540   1.00 103.52 ? 318  ASN B CB    1 
ATOM   8834  C CG    . ASN B  2 318 ? -37.567  -72.173 9.772   1.00 128.09 ? 318  ASN B CG    1 
ATOM   8835  O OD1   . ASN B  2 318 ? -36.828  -72.892 9.089   1.00 124.80 ? 318  ASN B OD1   1 
ATOM   8836  N ND2   . ASN B  2 318 ? -38.331  -72.677 10.723  1.00 122.70 ? 318  ASN B ND2   1 
ATOM   8837  N N     . THR B  2 319 ? -36.791  -67.764 10.202  1.00 101.41 ? 319  THR B N     1 
ATOM   8838  C CA    . THR B  2 319 ? -36.973  -66.308 10.287  1.00 99.60  ? 319  THR B CA    1 
ATOM   8839  C C     . THR B  2 319 ? -35.722  -65.533 9.846   1.00 103.06 ? 319  THR B C     1 
ATOM   8840  O O     . THR B  2 319 ? -35.774  -64.816 8.842   1.00 102.64 ? 319  THR B O     1 
ATOM   8841  C CB    . THR B  2 319 ? -37.512  -65.856 11.676  1.00 107.43 ? 319  THR B CB    1 
ATOM   8842  O OG1   . THR B  2 319 ? -36.604  -66.233 12.707  1.00 104.04 ? 319  THR B OG1   1 
ATOM   8843  C CG2   . THR B  2 319 ? -38.904  -66.405 11.986  1.00 109.12 ? 319  THR B CG2   1 
ATOM   8844  N N     . HIS B  2 320 ? -34.594  -65.717 10.560  1.00 98.77  ? 320  HIS B N     1 
ATOM   8845  C CA    . HIS B  2 320 ? -33.332  -65.023 10.283  1.00 96.80  ? 320  HIS B CA    1 
ATOM   8846  C C     . HIS B  2 320 ? -32.476  -65.713 9.188   1.00 97.55  ? 320  HIS B C     1 
ATOM   8847  O O     . HIS B  2 320 ? -31.266  -65.864 9.342   1.00 95.24  ? 320  HIS B O     1 
ATOM   8848  C CB    . HIS B  2 320 ? -32.552  -64.811 11.597  1.00 97.77  ? 320  HIS B CB    1 
ATOM   8849  C CG    . HIS B  2 320 ? -33.355  -64.165 12.695  1.00 101.06 ? 320  HIS B CG    1 
ATOM   8850  N ND1   . HIS B  2 320 ? -33.416  -62.776 12.836  1.00 100.89 ? 320  HIS B ND1   1 
ATOM   8851  C CD2   . HIS B  2 320 ? -34.085  -64.736 13.685  1.00 104.35 ? 320  HIS B CD2   1 
ATOM   8852  C CE1   . HIS B  2 320 ? -34.182  -62.555 13.896  1.00 100.33 ? 320  HIS B CE1   1 
ATOM   8853  N NE2   . HIS B  2 320 ? -34.612  -63.703 14.440  1.00 102.66 ? 320  HIS B NE2   1 
ATOM   8854  N N     . GLN B  2 321 ? -33.114  -66.083 8.066   1.00 94.36  ? 321  GLN B N     1 
ATOM   8855  C CA    . GLN B  2 321 ? -32.495  -66.789 6.939   1.00 94.93  ? 321  GLN B CA    1 
ATOM   8856  C C     . GLN B  2 321 ? -31.599  -65.949 6.033   1.00 95.25  ? 321  GLN B C     1 
ATOM   8857  O O     . GLN B  2 321 ? -30.640  -66.494 5.479   1.00 95.08  ? 321  GLN B O     1 
ATOM   8858  C CB    . GLN B  2 321 ? -33.570  -67.488 6.102   1.00 98.39  ? 321  GLN B CB    1 
ATOM   8859  C CG    . GLN B  2 321 ? -33.104  -68.793 5.463   1.00 116.78 ? 321  GLN B CG    1 
ATOM   8860  C CD    . GLN B  2 321 ? -33.997  -69.232 4.333   1.00 133.28 ? 321  GLN B CD    1 
ATOM   8861  O OE1   . GLN B  2 321 ? -35.238  -69.211 4.426   1.00 124.65 ? 321  GLN B OE1   1 
ATOM   8862  N NE2   . GLN B  2 321 ? -33.375  -69.654 3.240   1.00 127.43 ? 321  GLN B NE2   1 
ATOM   8863  N N     . ASN B  2 322 ? -31.934  -64.652 5.832   1.00 88.72  ? 322  ASN B N     1 
ATOM   8864  C CA    . ASN B  2 322 ? -31.181  -63.743 4.960   1.00 86.46  ? 322  ASN B CA    1 
ATOM   8865  C C     . ASN B  2 322 ? -30.595  -62.548 5.687   1.00 87.31  ? 322  ASN B C     1 
ATOM   8866  O O     . ASN B  2 322 ? -31.234  -62.001 6.597   1.00 86.59  ? 322  ASN B O     1 
ATOM   8867  C CB    . ASN B  2 322 ? -32.056  -63.246 3.814   1.00 87.61  ? 322  ASN B CB    1 
ATOM   8868  C CG    . ASN B  2 322 ? -32.164  -64.205 2.662   1.00 116.15 ? 322  ASN B CG    1 
ATOM   8869  O OD1   . ASN B  2 322 ? -31.163  -64.687 2.107   1.00 110.47 ? 322  ASN B OD1   1 
ATOM   8870  N ND2   . ASN B  2 322 ? -33.392  -64.478 2.259   1.00 109.30 ? 322  ASN B ND2   1 
ATOM   8871  N N     . LEU B  2 323 ? -29.394  -62.108 5.247   1.00 80.88  ? 323  LEU B N     1 
ATOM   8872  C CA    . LEU B  2 323 ? -28.722  -60.944 5.825   1.00 77.06  ? 323  LEU B CA    1 
ATOM   8873  C C     . LEU B  2 323 ? -29.028  -59.648 5.070   1.00 76.18  ? 323  LEU B C     1 
ATOM   8874  O O     . LEU B  2 323 ? -28.557  -59.450 3.942   1.00 76.37  ? 323  LEU B O     1 
ATOM   8875  C CB    . LEU B  2 323 ? -27.198  -61.161 5.940   1.00 76.74  ? 323  LEU B CB    1 
ATOM   8876  C CG    . LEU B  2 323 ? -26.360  -59.964 6.417   1.00 78.60  ? 323  LEU B CG    1 
ATOM   8877  C CD1   . LEU B  2 323 ? -26.580  -59.661 7.916   1.00 77.64  ? 323  LEU B CD1   1 
ATOM   8878  C CD2   . LEU B  2 323 ? -24.909  -60.183 6.108   1.00 80.84  ? 323  LEU B CD2   1 
ATOM   8879  N N     . ASN B  2 324 ? -29.799  -58.759 5.709   1.00 67.65  ? 324  ASN B N     1 
ATOM   8880  C CA    . ASN B  2 324 ? -30.090  -57.450 5.140   1.00 64.05  ? 324  ASN B CA    1 
ATOM   8881  C C     . ASN B  2 324 ? -28.910  -56.631 5.600   1.00 62.51  ? 324  ASN B C     1 
ATOM   8882  O O     . ASN B  2 324 ? -28.708  -56.452 6.803   1.00 61.57  ? 324  ASN B O     1 
ATOM   8883  C CB    . ASN B  2 324 ? -31.411  -56.856 5.665   1.00 64.92  ? 324  ASN B CB    1 
ATOM   8884  C CG    . ASN B  2 324 ? -32.642  -57.745 5.567   1.00 105.55 ? 324  ASN B CG    1 
ATOM   8885  O OD1   . ASN B  2 324 ? -32.582  -58.991 5.561   1.00 107.95 ? 324  ASN B OD1   1 
ATOM   8886  N ND2   . ASN B  2 324 ? -33.804  -57.116 5.556   1.00 96.20  ? 324  ASN B ND2   1 
ATOM   8887  N N     . ILE B  2 325 ? -28.048  -56.255 4.660   1.00 55.02  ? 325  ILE B N     1 
ATOM   8888  C CA    . ILE B  2 325 ? -26.866  -55.462 4.971   1.00 50.68  ? 325  ILE B CA    1 
ATOM   8889  C C     . ILE B  2 325 ? -26.759  -54.238 4.070   1.00 50.66  ? 325  ILE B C     1 
ATOM   8890  O O     . ILE B  2 325 ? -27.089  -54.302 2.892   1.00 50.42  ? 325  ILE B O     1 
ATOM   8891  C CB    . ILE B  2 325 ? -25.580  -56.316 5.072   1.00 54.12  ? 325  ILE B CB    1 
ATOM   8892  C CG1   . ILE B  2 325 ? -24.543  -55.665 6.006   1.00 52.96  ? 325  ILE B CG1   1 
ATOM   8893  C CG2   . ILE B  2 325 ? -25.004  -56.684 3.705   1.00 56.71  ? 325  ILE B CG2   1 
ATOM   8894  C CD1   . ILE B  2 325 ? -23.239  -56.456 6.313   1.00 61.69  ? 325  ILE B CD1   1 
ATOM   8895  N N     . CYS B  2 326 ? -26.369  -53.107 4.653   1.00 44.94  ? 326  CYS B N     1 
ATOM   8896  C CA    . CYS B  2 326 ? -26.161  -51.864 3.933   1.00 43.00  ? 326  CYS B CA    1 
ATOM   8897  C C     . CYS B  2 326 ? -24.891  -51.213 4.421   1.00 49.58  ? 326  CYS B C     1 
ATOM   8898  O O     . CYS B  2 326 ? -24.606  -51.250 5.627   1.00 50.19  ? 326  CYS B O     1 
ATOM   8899  C CB    . CYS B  2 326 ? -27.352  -50.928 4.070   1.00 40.98  ? 326  CYS B CB    1 
ATOM   8900  S SG    . CYS B  2 326 ? -27.222  -49.440 3.045   1.00 42.44  ? 326  CYS B SG    1 
ATOM   8901  N N     . GLY B  2 327 ? -24.147  -50.633 3.479   1.00 45.38  ? 327  GLY B N     1 
ATOM   8902  C CA    . GLY B  2 327 ? -22.892  -49.957 3.763   1.00 43.52  ? 327  GLY B CA    1 
ATOM   8903  C C     . GLY B  2 327 ? -22.915  -48.487 3.434   1.00 45.03  ? 327  GLY B C     1 
ATOM   8904  O O     . GLY B  2 327 ? -23.664  -48.048 2.567   1.00 44.96  ? 327  GLY B O     1 
ATOM   8905  N N     . ALA B  2 328 ? -22.099  -47.725 4.146   1.00 41.19  ? 328  ALA B N     1 
ATOM   8906  C CA    . ALA B  2 328 ? -21.896  -46.285 3.970   1.00 40.31  ? 328  ALA B CA    1 
ATOM   8907  C C     . ALA B  2 328 ? -20.448  -46.029 4.268   1.00 44.66  ? 328  ALA B C     1 
ATOM   8908  O O     . ALA B  2 328 ? -19.897  -46.579 5.238   1.00 42.56  ? 328  ALA B O     1 
ATOM   8909  C CB    . ALA B  2 328 ? -22.763  -45.497 4.921   1.00 40.02  ? 328  ALA B CB    1 
ATOM   8910  N N     . VAL B  2 329 ? -19.802  -45.238 3.413   1.00 42.55  ? 329  VAL B N     1 
ATOM   8911  C CA    . VAL B  2 329 ? -18.375  -45.033 3.635   1.00 41.98  ? 329  VAL B CA    1 
ATOM   8912  C C     . VAL B  2 329 ? -18.054  -43.956 4.659   1.00 42.86  ? 329  VAL B C     1 
ATOM   8913  O O     . VAL B  2 329 ? -18.292  -42.765 4.418   1.00 41.50  ? 329  VAL B O     1 
ATOM   8914  C CB    . VAL B  2 329 ? -17.484  -44.982 2.365   1.00 45.47  ? 329  VAL B CB    1 
ATOM   8915  C CG1   . VAL B  2 329 ? -16.043  -45.337 2.699   1.00 44.98  ? 329  VAL B CG1   1 
ATOM   8916  C CG2   . VAL B  2 329 ? -18.021  -45.895 1.273   1.00 46.31  ? 329  VAL B CG2   1 
ATOM   8917  N N     . GLY B  2 330 ? -17.513  -44.408 5.783   1.00 37.53  ? 330  GLY B N     1 
ATOM   8918  C CA    . GLY B  2 330 ? -17.060  -43.558 6.867   1.00 36.60  ? 330  GLY B CA    1 
ATOM   8919  C C     . GLY B  2 330 ? -15.551  -43.477 6.833   1.00 42.14  ? 330  GLY B C     1 
ATOM   8920  O O     . GLY B  2 330 ? -14.881  -44.181 7.594   1.00 42.76  ? 330  GLY B O     1 
ATOM   8921  N N     . SER B  2 331 ? -15.002  -42.661 5.899   1.00 39.09  ? 331  SER B N     1 
ATOM   8922  C CA    . SER B  2 331 ? -13.558  -42.432 5.749   1.00 38.39  ? 331  SER B CA    1 
ATOM   8923  C C     . SER B  2 331 ? -13.171  -41.013 5.326   1.00 36.79  ? 331  SER B C     1 
ATOM   8924  O O     . SER B  2 331 ? -13.901  -40.354 4.584   1.00 35.02  ? 331  SER B O     1 
ATOM   8925  C CB    . SER B  2 331 ? -12.903  -43.480 4.854   1.00 45.56  ? 331  SER B CB    1 
ATOM   8926  O OG    . SER B  2 331 ? -12.804  -43.079 3.497   1.00 61.19  ? 331  SER B OG    1 
ATOM   8927  N N     . ILE B  2 332 ? -12.013  -40.558 5.827   1.00 31.57  ? 332  ILE B N     1 
ATOM   8928  C CA    . ILE B  2 332 ? -11.407  -39.251 5.545   1.00 29.50  ? 332  ILE B CA    1 
ATOM   8929  C C     . ILE B  2 332 ? -10.598  -39.319 4.238   1.00 36.07  ? 332  ILE B C     1 
ATOM   8930  O O     . ILE B  2 332 ? -10.447  -38.310 3.554   1.00 34.92  ? 332  ILE B O     1 
ATOM   8931  C CB    . ILE B  2 332 ? -10.551  -38.741 6.733   1.00 30.44  ? 332  ILE B CB    1 
ATOM   8932  C CG1   . ILE B  2 332 ? -9.369   -39.694 7.058   1.00 31.49  ? 332  ILE B CG1   1 
ATOM   8933  C CG2   . ILE B  2 332 ? -11.424  -38.466 7.961   1.00 28.20  ? 332  ILE B CG2   1 
ATOM   8934  C CD1   . ILE B  2 332 ? -8.110   -39.055 7.668   1.00 36.88  ? 332  ILE B CD1   1 
ATOM   8935  N N     . ASP B  2 333 ? -10.126  -40.538 3.899   1.00 35.13  ? 333  ASP B N     1 
ATOM   8936  C CA    . ASP B  2 333 ? -9.303   -40.943 2.757   1.00 36.35  ? 333  ASP B CA    1 
ATOM   8937  C C     . ASP B  2 333 ? -9.904   -40.622 1.383   1.00 42.29  ? 333  ASP B C     1 
ATOM   8938  O O     . ASP B  2 333 ? -9.181   -40.166 0.498   1.00 44.96  ? 333  ASP B O     1 
ATOM   8939  C CB    . ASP B  2 333 ? -9.053   -42.475 2.848   1.00 39.27  ? 333  ASP B CB    1 
ATOM   8940  C CG    . ASP B  2 333 ? -7.675   -42.986 2.449   1.00 49.42  ? 333  ASP B CG    1 
ATOM   8941  O OD1   . ASP B  2 333 ? -6.785   -42.145 2.181   1.00 49.85  ? 333  ASP B OD1   1 
ATOM   8942  O OD2   . ASP B  2 333 ? -7.476   -44.237 2.438   1.00 54.59  ? 333  ASP B OD2   1 
ATOM   8943  N N     . ASN B  2 334 ? -11.214  -40.888 1.207   1.00 36.34  ? 334  ASN B N     1 
ATOM   8944  C CA    . ASN B  2 334 ? -11.975  -40.825 -0.043  1.00 35.10  ? 334  ASN B CA    1 
ATOM   8945  C C     . ASN B  2 334 ? -11.434  -41.862 -1.079  1.00 39.76  ? 334  ASN B C     1 
ATOM   8946  O O     . ASN B  2 334 ? -11.451  -41.652 -2.306  1.00 38.72  ? 334  ASN B O     1 
ATOM   8947  C CB    . ASN B  2 334 ? -12.167  -39.409 -0.589  1.00 29.25  ? 334  ASN B CB    1 
ATOM   8948  C CG    . ASN B  2 334 ? -13.353  -39.293 -1.531  1.00 41.11  ? 334  ASN B CG    1 
ATOM   8949  O OD1   . ASN B  2 334 ? -14.182  -40.207 -1.678  1.00 25.16  ? 334  ASN B OD1   1 
ATOM   8950  N ND2   . ASN B  2 334 ? -13.458  -38.163 -2.207  1.00 31.73  ? 334  ASN B ND2   1 
ATOM   8951  N N     . ASP B  2 335 ? -11.006  -43.012 -0.534  1.00 37.08  ? 335  ASP B N     1 
ATOM   8952  C CA    . ASP B  2 335 ? -10.434  -44.134 -1.263  1.00 39.81  ? 335  ASP B CA    1 
ATOM   8953  C C     . ASP B  2 335 ? -11.457  -45.064 -1.935  1.00 45.87  ? 335  ASP B C     1 
ATOM   8954  O O     . ASP B  2 335 ? -11.102  -45.703 -2.934  1.00 46.09  ? 335  ASP B O     1 
ATOM   8955  C CB    . ASP B  2 335 ? -9.508   -44.940 -0.338  1.00 43.15  ? 335  ASP B CB    1 
ATOM   8956  C CG    . ASP B  2 335 ? -8.778   -46.063 -1.028  1.00 56.36  ? 335  ASP B CG    1 
ATOM   8957  O OD1   . ASP B  2 335 ? -7.824   -45.773 -1.783  1.00 59.80  ? 335  ASP B OD1   1 
ATOM   8958  O OD2   . ASP B  2 335 ? -9.204   -47.219 -0.875  1.00 60.82  ? 335  ASP B OD2   1 
ATOM   8959  N N     . MET B  2 336 ? -12.704  -45.164 -1.386  1.00 42.42  ? 336  MET B N     1 
ATOM   8960  C CA    . MET B  2 336 ? -13.767  -45.999 -1.951  1.00 42.39  ? 336  MET B CA    1 
ATOM   8961  C C     . MET B  2 336 ? -14.169  -45.522 -3.318  1.00 47.52  ? 336  MET B C     1 
ATOM   8962  O O     . MET B  2 336 ? -14.394  -44.321 -3.540  1.00 44.22  ? 336  MET B O     1 
ATOM   8963  C CB    . MET B  2 336 ? -14.949  -46.155 -1.028  1.00 44.38  ? 336  MET B CB    1 
ATOM   8964  C CG    . MET B  2 336 ? -14.756  -47.233 -0.004  1.00 50.08  ? 336  MET B CG    1 
ATOM   8965  S SD    . MET B  2 336 ? -14.925  -48.941 -0.556  1.00 58.13  ? 336  MET B SD    1 
ATOM   8966  C CE    . MET B  2 336 ? -16.123  -48.761 -1.829  1.00 55.44  ? 336  MET B CE    1 
ATOM   8967  N N     . SER B  2 337 ? -14.185  -46.472 -4.255  1.00 48.47  ? 337  SER B N     1 
ATOM   8968  C CA    . SER B  2 337 ? -14.365  -46.239 -5.685  1.00 49.92  ? 337  SER B CA    1 
ATOM   8969  C C     . SER B  2 337 ? -15.735  -45.906 -6.244  1.00 53.56  ? 337  SER B C     1 
ATOM   8970  O O     . SER B  2 337 ? -15.798  -45.114 -7.204  1.00 53.29  ? 337  SER B O     1 
ATOM   8971  C CB    . SER B  2 337 ? -13.667  -47.312 -6.515  1.00 55.26  ? 337  SER B CB    1 
ATOM   8972  O OG    . SER B  2 337 ? -13.981  -48.606 -6.036  1.00 64.72  ? 337  SER B OG    1 
ATOM   8973  N N     . SER B  2 338 ? -16.813  -46.486 -5.698  1.00 48.76  ? 338  SER B N     1 
ATOM   8974  C CA    . SER B  2 338 ? -18.101  -46.176 -6.288  1.00 49.52  ? 338  SER B CA    1 
ATOM   8975  C C     . SER B  2 338 ? -18.831  -44.885 -5.818  1.00 55.26  ? 338  SER B C     1 
ATOM   8976  O O     . SER B  2 338 ? -19.900  -44.549 -6.346  1.00 56.94  ? 338  SER B O     1 
ATOM   8977  C CB    . SER B  2 338 ? -18.987  -47.407 -6.332  1.00 55.55  ? 338  SER B CB    1 
ATOM   8978  O OG    . SER B  2 338 ? -18.369  -48.452 -7.064  1.00 64.96  ? 338  SER B OG    1 
ATOM   8979  N N     . THR B  2 339 ? -18.222  -44.131 -4.884  1.00 50.05  ? 339  THR B N     1 
ATOM   8980  C CA    . THR B  2 339 ? -18.744  -42.859 -4.373  1.00 47.73  ? 339  THR B CA    1 
ATOM   8981  C C     . THR B  2 339 ? -17.801  -41.697 -4.715  1.00 50.29  ? 339  THR B C     1 
ATOM   8982  O O     . THR B  2 339 ? -16.581  -41.884 -4.808  1.00 50.10  ? 339  THR B O     1 
ATOM   8983  C CB    . THR B  2 339 ? -19.086  -42.956 -2.874  1.00 56.80  ? 339  THR B CB    1 
ATOM   8984  O OG1   . THR B  2 339 ? -19.737  -41.745 -2.448  1.00 61.39  ? 339  THR B OG1   1 
ATOM   8985  C CG2   . THR B  2 339 ? -17.868  -43.283 -1.987  1.00 52.55  ? 339  THR B CG2   1 
ATOM   8986  N N     . ASP B  2 340 ? -18.364  -40.501 -4.887  1.00 46.33  ? 340  ASP B N     1 
ATOM   8987  C CA    . ASP B  2 340 ? -17.556  -39.334 -5.218  1.00 46.35  ? 340  ASP B CA    1 
ATOM   8988  C C     . ASP B  2 340 ? -16.902  -38.756 -3.981  1.00 49.75  ? 340  ASP B C     1 
ATOM   8989  O O     . ASP B  2 340 ? -15.739  -38.341 -4.043  1.00 51.51  ? 340  ASP B O     1 
ATOM   8990  C CB    . ASP B  2 340 ? -18.350  -38.285 -6.031  1.00 48.67  ? 340  ASP B CB    1 
ATOM   8991  C CG    . ASP B  2 340 ? -18.541  -38.622 -7.514  1.00 67.64  ? 340  ASP B CG    1 
ATOM   8992  O OD1   . ASP B  2 340 ? -19.559  -38.192 -8.094  1.00 68.50  ? 340  ASP B OD1   1 
ATOM   8993  O OD2   . ASP B  2 340 ? -17.646  -39.285 -8.103  1.00 75.93  ? 340  ASP B OD2   1 
ATOM   8994  N N     . ALA B  2 341 ? -17.630  -38.774 -2.849  1.00 42.68  ? 341  ALA B N     1 
ATOM   8995  C CA    . ALA B  2 341 ? -17.155  -38.303 -1.557  1.00 40.30  ? 341  ALA B CA    1 
ATOM   8996  C C     . ALA B  2 341 ? -17.571  -39.296 -0.436  1.00 43.30  ? 341  ALA B C     1 
ATOM   8997  O O     . ALA B  2 341 ? -18.723  -39.763 -0.392  1.00 43.32  ? 341  ALA B O     1 
ATOM   8998  C CB    . ALA B  2 341 ? -17.695  -36.911 -1.283  1.00 39.41  ? 341  ALA B CB    1 
ATOM   8999  N N     . THR B  2 342 ? -16.608  -39.663 0.422   1.00 36.86  ? 342  THR B N     1 
ATOM   9000  C CA    . THR B  2 342 ? -16.853  -40.537 1.569   1.00 35.37  ? 342  THR B CA    1 
ATOM   9001  C C     . THR B  2 342 ? -17.154  -39.635 2.773   1.00 37.78  ? 342  THR B C     1 
ATOM   9002  O O     . THR B  2 342 ? -16.797  -38.454 2.746   1.00 36.13  ? 342  THR B O     1 
ATOM   9003  C CB    . THR B  2 342 ? -15.653  -41.434 1.821   1.00 34.47  ? 342  THR B CB    1 
ATOM   9004  O OG1   . THR B  2 342 ? -14.513  -40.606 2.049   1.00 29.41  ? 342  THR B OG1   1 
ATOM   9005  C CG2   . THR B  2 342 ? -15.392  -42.386 0.671   1.00 30.98  ? 342  THR B CG2   1 
ATOM   9006  N N     . ILE B  2 343 ? -17.831  -40.167 3.811   1.00 34.67  ? 343  ILE B N     1 
ATOM   9007  C CA    . ILE B  2 343 ? -18.178  -39.358 4.991   1.00 33.15  ? 343  ILE B CA    1 
ATOM   9008  C C     . ILE B  2 343 ? -16.941  -39.092 5.839   1.00 37.77  ? 343  ILE B C     1 
ATOM   9009  O O     . ILE B  2 343 ? -16.313  -40.045 6.318   1.00 37.92  ? 343  ILE B O     1 
ATOM   9010  C CB    . ILE B  2 343 ? -19.376  -39.911 5.804   1.00 35.25  ? 343  ILE B CB    1 
ATOM   9011  C CG1   . ILE B  2 343 ? -20.606  -40.125 4.882   1.00 35.99  ? 343  ILE B CG1   1 
ATOM   9012  C CG2   . ILE B  2 343 ? -19.709  -38.973 6.977   1.00 32.13  ? 343  ILE B CG2   1 
ATOM   9013  C CD1   . ILE B  2 343 ? -21.629  -41.160 5.363   1.00 44.18  ? 343  ILE B CD1   1 
ATOM   9014  N N     . GLY B  2 344 ? -16.612  -37.801 5.972   1.00 33.05  ? 344  GLY B N     1 
ATOM   9015  C CA    . GLY B  2 344 ? -15.456  -37.301 6.701   1.00 32.94  ? 344  GLY B CA    1 
ATOM   9016  C C     . GLY B  2 344 ? -14.374  -36.692 5.824   1.00 39.25  ? 344  GLY B C     1 
ATOM   9017  O O     . GLY B  2 344 ? -13.518  -35.947 6.326   1.00 40.93  ? 344  GLY B O     1 
ATOM   9018  N N     . ALA B  2 345 ? -14.392  -37.016 4.512   1.00 34.26  ? 345  ALA B N     1 
ATOM   9019  C CA    . ALA B  2 345 ? -13.423  -36.554 3.530   1.00 34.34  ? 345  ALA B CA    1 
ATOM   9020  C C     . ALA B  2 345 ? -13.295  -35.020 3.458   1.00 40.51  ? 345  ALA B C     1 
ATOM   9021  O O     . ALA B  2 345 ? -12.179  -34.502 3.559   1.00 42.30  ? 345  ALA B O     1 
ATOM   9022  C CB    . ALA B  2 345 ? -13.758  -37.128 2.166   1.00 35.80  ? 345  ALA B CB    1 
ATOM   9023  N N     . PHE B  2 346 ? -14.420  -34.290 3.308   1.00 35.47  ? 346  PHE B N     1 
ATOM   9024  C CA    . PHE B  2 346 ? -14.389  -32.824 3.215   1.00 32.22  ? 346  PHE B CA    1 
ATOM   9025  C C     . PHE B  2 346 ? -14.034  -32.117 4.527   1.00 35.71  ? 346  PHE B C     1 
ATOM   9026  O O     . PHE B  2 346 ? -13.433  -31.042 4.478   1.00 37.52  ? 346  PHE B O     1 
ATOM   9027  C CB    . PHE B  2 346 ? -15.652  -32.263 2.541   1.00 32.31  ? 346  PHE B CB    1 
ATOM   9028  C CG    . PHE B  2 346 ? -15.589  -32.285 1.021   1.00 32.97  ? 346  PHE B CG    1 
ATOM   9029  C CD1   . PHE B  2 346 ? -15.022  -31.226 0.313   1.00 32.93  ? 346  PHE B CD1   1 
ATOM   9030  C CD2   . PHE B  2 346 ? -16.084  -33.376 0.298   1.00 34.32  ? 346  PHE B CD2   1 
ATOM   9031  C CE1   . PHE B  2 346 ? -14.949  -31.257 -1.079  1.00 33.14  ? 346  PHE B CE1   1 
ATOM   9032  C CE2   . PHE B  2 346 ? -16.023  -33.393 -1.098  1.00 35.64  ? 346  PHE B CE2   1 
ATOM   9033  C CZ    . PHE B  2 346 ? -15.458  -32.332 -1.775  1.00 32.81  ? 346  PHE B CZ    1 
ATOM   9034  N N     . SER B  2 347 ? -14.369  -32.719 5.692   1.00 29.75  ? 347  SER B N     1 
ATOM   9035  C CA    . SER B  2 347 ? -13.997  -32.169 7.012   1.00 27.99  ? 347  SER B CA    1 
ATOM   9036  C C     . SER B  2 347 ? -12.491  -32.312 7.179   1.00 28.30  ? 347  SER B C     1 
ATOM   9037  O O     . SER B  2 347 ? -11.840  -31.378 7.633   1.00 23.60  ? 347  SER B O     1 
ATOM   9038  C CB    . SER B  2 347 ? -14.695  -32.905 8.156   1.00 31.28  ? 347  SER B CB    1 
ATOM   9039  O OG    . SER B  2 347 ? -16.105  -32.773 8.128   1.00 35.55  ? 347  SER B OG    1 
ATOM   9040  N N     . SER B  2 348 ? -11.938  -33.488 6.792   1.00 28.27  ? 348  SER B N     1 
ATOM   9041  C CA    . SER B  2 348 ? -10.503  -33.752 6.863   1.00 29.63  ? 348  SER B CA    1 
ATOM   9042  C C     . SER B  2 348 ? -9.777   -32.760 5.946   1.00 34.96  ? 348  SER B C     1 
ATOM   9043  O O     . SER B  2 348 ? -8.852   -32.085 6.403   1.00 36.37  ? 348  SER B O     1 
ATOM   9044  C CB    . SER B  2 348 ? -10.190  -35.183 6.457   1.00 34.02  ? 348  SER B CB    1 
ATOM   9045  O OG    . SER B  2 348 ? -8.881   -35.523 6.885   1.00 41.10  ? 348  SER B OG    1 
ATOM   9046  N N     . LEU B  2 349 ? -10.262  -32.606 4.688   1.00 29.46  ? 349  LEU B N     1 
ATOM   9047  C CA    . LEU B  2 349 ? -9.745   -31.651 3.701   1.00 28.12  ? 349  LEU B CA    1 
ATOM   9048  C C     . LEU B  2 349 ? -9.748   -30.232 4.278   1.00 35.40  ? 349  LEU B C     1 
ATOM   9049  O O     . LEU B  2 349 ? -8.804   -29.474 4.061   1.00 37.49  ? 349  LEU B O     1 
ATOM   9050  C CB    . LEU B  2 349 ? -10.588  -31.719 2.404   1.00 26.84  ? 349  LEU B CB    1 
ATOM   9051  C CG    . LEU B  2 349 ? -10.333  -30.650 1.326   1.00 28.39  ? 349  LEU B CG    1 
ATOM   9052  C CD1   . LEU B  2 349 ? -8.940   -30.766 0.732   1.00 29.70  ? 349  LEU B CD1   1 
ATOM   9053  C CD2   . LEU B  2 349 ? -11.375  -30.693 0.257   1.00 22.80  ? 349  LEU B CD2   1 
ATOM   9054  N N     . ASP B  2 350 ? -10.793  -29.902 5.047   1.00 31.45  ? 350  ASP B N     1 
ATOM   9055  C CA    . ASP B  2 350 ? -10.964  -28.619 5.699   1.00 31.14  ? 350  ASP B CA    1 
ATOM   9056  C C     . ASP B  2 350 ? -9.905   -28.386 6.769   1.00 34.94  ? 350  ASP B C     1 
ATOM   9057  O O     . ASP B  2 350 ? -9.418   -27.258 6.870   1.00 34.31  ? 350  ASP B O     1 
ATOM   9058  C CB    . ASP B  2 350 ? -12.367  -28.541 6.310   1.00 33.74  ? 350  ASP B CB    1 
ATOM   9059  C CG    . ASP B  2 350 ? -12.666  -27.276 7.089   1.00 49.01  ? 350  ASP B CG    1 
ATOM   9060  O OD1   . ASP B  2 350 ? -13.069  -26.272 6.453   1.00 51.17  ? 350  ASP B OD1   1 
ATOM   9061  O OD2   . ASP B  2 350 ? -12.541  -27.302 8.345   1.00 53.90  ? 350  ASP B OD2   1 
ATOM   9062  N N     . ARG B  2 351 ? -9.567   -29.434 7.581   1.00 31.81  ? 351  ARG B N     1 
ATOM   9063  C CA    . ARG B  2 351 ? -8.562   -29.334 8.654   1.00 32.22  ? 351  ARG B CA    1 
ATOM   9064  C C     . ARG B  2 351 ? -7.212   -28.968 8.059   1.00 37.34  ? 351  ARG B C     1 
ATOM   9065  O O     . ARG B  2 351 ? -6.546   -28.066 8.579   1.00 36.47  ? 351  ARG B O     1 
ATOM   9066  C CB    . ARG B  2 351 ? -8.393   -30.655 9.436   1.00 33.52  ? 351  ARG B CB    1 
ATOM   9067  C CG    . ARG B  2 351 ? -9.641   -31.293 10.040  1.00 40.85  ? 351  ARG B CG    1 
ATOM   9068  C CD    . ARG B  2 351 ? -10.236  -30.502 11.179  1.00 44.25  ? 351  ARG B CD    1 
ATOM   9069  N NE    . ARG B  2 351 ? -11.417  -29.762 10.735  1.00 37.88  ? 351  ARG B NE    1 
ATOM   9070  C CZ    . ARG B  2 351 ? -12.665  -30.150 10.968  1.00 48.17  ? 351  ARG B CZ    1 
ATOM   9071  N NH1   . ARG B  2 351 ? -12.906  -31.271 11.657  1.00 26.95  ? 351  ARG B NH1   1 
ATOM   9072  N NH2   . ARG B  2 351 ? -13.686  -29.416 10.532  1.00 31.59  ? 351  ARG B NH2   1 
ATOM   9073  N N     . ILE B  2 352 ? -6.835   -29.673 6.949   1.00 34.65  ? 352  ILE B N     1 
ATOM   9074  C CA    . ILE B  2 352 ? -5.589   -29.515 6.184   1.00 35.31  ? 352  ILE B CA    1 
ATOM   9075  C C     . ILE B  2 352 ? -5.476   -28.089 5.664   1.00 40.68  ? 352  ILE B C     1 
ATOM   9076  O O     . ILE B  2 352 ? -4.455   -27.434 5.894   1.00 41.42  ? 352  ILE B O     1 
ATOM   9077  C CB    . ILE B  2 352 ? -5.467   -30.550 5.019   1.00 38.35  ? 352  ILE B CB    1 
ATOM   9078  C CG1   . ILE B  2 352 ? -5.590   -31.991 5.513   1.00 39.24  ? 352  ILE B CG1   1 
ATOM   9079  C CG2   . ILE B  2 352 ? -4.163   -30.358 4.255   1.00 38.25  ? 352  ILE B CG2   1 
ATOM   9080  C CD1   . ILE B  2 352 ? -5.948   -32.961 4.467   1.00 47.21  ? 352  ILE B CD1   1 
ATOM   9081  N N     . CYS B  2 353 ? -6.528   -27.615 4.971   1.00 36.26  ? 353  CYS B N     1 
ATOM   9082  C CA    . CYS B  2 353 ? -6.547   -26.286 4.397   1.00 35.99  ? 353  CYS B CA    1 
ATOM   9083  C C     . CYS B  2 353 ? -6.507   -25.214 5.460   1.00 35.89  ? 353  CYS B C     1 
ATOM   9084  O O     . CYS B  2 353 ? -5.829   -24.213 5.257   1.00 34.34  ? 353  CYS B O     1 
ATOM   9085  C CB    . CYS B  2 353 ? -7.707   -26.115 3.428   1.00 37.65  ? 353  CYS B CB    1 
ATOM   9086  S SG    . CYS B  2 353 ? -7.589   -27.173 1.955   1.00 43.56  ? 353  CYS B SG    1 
ATOM   9087  N N     . ARG B  2 354 ? -7.110   -25.475 6.644   1.00 30.72  ? 354  ARG B N     1 
ATOM   9088  C CA    . ARG B  2 354 ? -7.088   -24.537 7.769   1.00 28.53  ? 354  ARG B CA    1 
ATOM   9089  C C     . ARG B  2 354 ? -5.636   -24.306 8.191   1.00 32.14  ? 354  ARG B C     1 
ATOM   9090  O O     . ARG B  2 354 ? -5.252   -23.159 8.424   1.00 31.22  ? 354  ARG B O     1 
ATOM   9091  C CB    . ARG B  2 354 ? -7.960   -25.041 8.934   1.00 24.94  ? 354  ARG B CB    1 
ATOM   9092  C CG    . ARG B  2 354 ? -8.132   -24.042 10.084  1.00 35.66  ? 354  ARG B CG    1 
ATOM   9093  C CD    . ARG B  2 354 ? -9.240   -23.061 9.837   1.00 51.62  ? 354  ARG B CD    1 
ATOM   9094  N NE    . ARG B  2 354 ? -10.471  -23.467 10.506  1.00 74.30  ? 354  ARG B NE    1 
ATOM   9095  C CZ    . ARG B  2 354 ? -10.919  -22.901 11.619  1.00 102.31 ? 354  ARG B CZ    1 
ATOM   9096  N NH1   . ARG B  2 354 ? -10.241  -21.910 12.187  1.00 92.40  ? 354  ARG B NH1   1 
ATOM   9097  N NH2   . ARG B  2 354 ? -12.056  -23.314 12.169  1.00 96.41  ? 354  ARG B NH2   1 
ATOM   9098  N N     . ALA B  2 355 ? -4.814   -25.384 8.202   1.00 28.70  ? 355  ALA B N     1 
ATOM   9099  C CA    . ALA B  2 355 ? -3.405   -25.292 8.566   1.00 28.17  ? 355  ALA B CA    1 
ATOM   9100  C C     . ALA B  2 355 ? -2.641   -24.547 7.481   1.00 31.74  ? 355  ALA B C     1 
ATOM   9101  O O     . ALA B  2 355 ? -1.952   -23.571 7.800   1.00 32.01  ? 355  ALA B O     1 
ATOM   9102  C CB    . ALA B  2 355 ? -2.819   -26.662 8.786   1.00 29.17  ? 355  ALA B CB    1 
ATOM   9103  N N     . ILE B  2 356 ? -2.825   -24.941 6.196   1.00 26.18  ? 356  ILE B N     1 
ATOM   9104  C CA    . ILE B  2 356 ? -2.140   -24.287 5.068   1.00 24.75  ? 356  ILE B CA    1 
ATOM   9105  C C     . ILE B  2 356 ? -2.434   -22.789 5.030   1.00 32.53  ? 356  ILE B C     1 
ATOM   9106  O O     . ILE B  2 356 ? -1.502   -21.976 4.879   1.00 33.44  ? 356  ILE B O     1 
ATOM   9107  C CB    . ILE B  2 356 ? -2.292   -25.008 3.705   1.00 25.11  ? 356  ILE B CB    1 
ATOM   9108  C CG1   . ILE B  2 356 ? -1.961   -26.518 3.861   1.00 24.84  ? 356  ILE B CG1   1 
ATOM   9109  C CG2   . ILE B  2 356 ? -1.350   -24.373 2.693   1.00 25.33  ? 356  ILE B CG2   1 
ATOM   9110  C CD1   . ILE B  2 356 ? -2.335   -27.394 2.731   1.00 31.82  ? 356  ILE B CD1   1 
ATOM   9111  N N     . ASP B  2 357 ? -3.705   -22.425 5.275   1.00 29.35  ? 357  ASP B N     1 
ATOM   9112  C CA    . ASP B  2 357 ? -4.132   -21.034 5.305   1.00 29.14  ? 357  ASP B CA    1 
ATOM   9113  C C     . ASP B  2 357 ? -3.338   -20.254 6.328   1.00 32.93  ? 357  ASP B C     1 
ATOM   9114  O O     . ASP B  2 357 ? -2.766   -19.218 5.972   1.00 34.54  ? 357  ASP B O     1 
ATOM   9115  C CB    . ASP B  2 357 ? -5.643   -20.936 5.538   1.00 31.39  ? 357  ASP B CB    1 
ATOM   9116  C CG    . ASP B  2 357 ? -6.519   -21.391 4.356   1.00 48.21  ? 357  ASP B CG    1 
ATOM   9117  O OD1   . ASP B  2 357 ? -5.985   -21.468 3.188   1.00 49.04  ? 357  ASP B OD1   1 
ATOM   9118  O OD2   . ASP B  2 357 ? -7.728   -21.689 4.589   1.00 51.29  ? 357  ASP B OD2   1 
ATOM   9119  N N     . TYR B  2 358 ? -3.204   -20.801 7.564   1.00 27.58  ? 358  TYR B N     1 
ATOM   9120  C CA    . TYR B  2 358 ? -2.400   -20.202 8.640   1.00 25.91  ? 358  TYR B CA    1 
ATOM   9121  C C     . TYR B  2 358 ? -0.933   -20.074 8.225   1.00 31.86  ? 358  TYR B C     1 
ATOM   9122  O O     . TYR B  2 358 ? -0.313   -19.057 8.515   1.00 30.86  ? 358  TYR B O     1 
ATOM   9123  C CB    . TYR B  2 358 ? -2.510   -21.019 9.930   1.00 25.47  ? 358  TYR B CB    1 
ATOM   9124  C CG    . TYR B  2 358 ? -3.739   -20.701 10.754  1.00 27.57  ? 358  TYR B CG    1 
ATOM   9125  C CD1   . TYR B  2 358 ? -4.061   -19.382 11.090  1.00 29.55  ? 358  TYR B CD1   1 
ATOM   9126  C CD2   . TYR B  2 358 ? -4.538   -21.718 11.273  1.00 27.64  ? 358  TYR B CD2   1 
ATOM   9127  C CE1   . TYR B  2 358 ? -5.176   -19.081 11.875  1.00 26.82  ? 358  TYR B CE1   1 
ATOM   9128  C CE2   . TYR B  2 358 ? -5.650   -21.429 12.070  1.00 27.76  ? 358  TYR B CE2   1 
ATOM   9129  C CZ    . TYR B  2 358 ? -5.966   -20.106 12.363  1.00 32.98  ? 358  TYR B CZ    1 
ATOM   9130  O OH    . TYR B  2 358 ? -7.039   -19.785 13.157  1.00 32.76  ? 358  TYR B OH    1 
ATOM   9131  N N     . ILE B  2 359 ? -0.378   -21.099 7.534   1.00 30.09  ? 359  ILE B N     1 
ATOM   9132  C CA    . ILE B  2 359 ? 1.013    -21.058 7.076   1.00 30.41  ? 359  ILE B CA    1 
ATOM   9133  C C     . ILE B  2 359 ? 1.199    -19.906 6.078   1.00 35.64  ? 359  ILE B C     1 
ATOM   9134  O O     . ILE B  2 359 ? 2.155    -19.141 6.248   1.00 37.82  ? 359  ILE B O     1 
ATOM   9135  C CB    . ILE B  2 359 ? 1.539    -22.402 6.515   1.00 33.12  ? 359  ILE B CB    1 
ATOM   9136  C CG1   . ILE B  2 359 ? 1.308    -23.535 7.491   1.00 33.17  ? 359  ILE B CG1   1 
ATOM   9137  C CG2   . ILE B  2 359 ? 3.029    -22.295 6.171   1.00 34.84  ? 359  ILE B CG2   1 
ATOM   9138  C CD1   . ILE B  2 359 ? 1.243    -24.922 6.859   1.00 42.82  ? 359  ILE B CD1   1 
ATOM   9139  N N     . ASP B  2 360 ? 0.287    -19.776 5.069   1.00 29.41  ? 360  ASP B N     1 
ATOM   9140  C CA    . ASP B  2 360 ? 0.345    -18.729 4.042   1.00 29.69  ? 360  ASP B CA    1 
ATOM   9141  C C     . ASP B  2 360 ? 0.190    -17.301 4.630   1.00 30.89  ? 360  ASP B C     1 
ATOM   9142  O O     . ASP B  2 360 ? 0.660    -16.325 4.029   1.00 28.48  ? 360  ASP B O     1 
ATOM   9143  C CB    . ASP B  2 360 ? -0.752   -18.927 2.973   1.00 32.63  ? 360  ASP B CB    1 
ATOM   9144  C CG    . ASP B  2 360 ? -0.885   -20.284 2.299   1.00 49.04  ? 360  ASP B CG    1 
ATOM   9145  O OD1   . ASP B  2 360 ? 0.161    -20.925 2.041   1.00 50.65  ? 360  ASP B OD1   1 
ATOM   9146  O OD2   . ASP B  2 360 ? -2.045   -20.660 1.930   1.00 56.44  ? 360  ASP B OD2   1 
ATOM   9147  N N     . ALA B  2 361 ? -0.500   -17.188 5.790   1.00 27.84  ? 361  ALA B N     1 
ATOM   9148  C CA    . ALA B  2 361 ? -0.793   -15.924 6.489   1.00 27.20  ? 361  ALA B CA    1 
ATOM   9149  C C     . ALA B  2 361 ? 0.409    -15.325 7.238   1.00 35.94  ? 361  ALA B C     1 
ATOM   9150  O O     . ALA B  2 361 ? 0.293    -15.074 8.434   1.00 36.08  ? 361  ALA B O     1 
ATOM   9151  C CB    . ALA B  2 361 ? -1.952   -16.133 7.445   1.00 26.21  ? 361  ALA B CB    1 
ATOM   9152  N N     . THR B  2 362 ? 1.554    -15.101 6.542   1.00 36.32  ? 362  THR B N     1 
ATOM   9153  C CA    . THR B  2 362 ? 2.827    -14.580 7.078   1.00 39.08  ? 362  THR B CA    1 
ATOM   9154  C C     . THR B  2 362 ? 3.660    -13.917 5.956   1.00 50.15  ? 362  THR B C     1 
ATOM   9155  O O     . THR B  2 362 ? 3.149    -13.762 4.836   1.00 51.71  ? 362  THR B O     1 
ATOM   9156  C CB    . THR B  2 362 ? 3.668    -15.706 7.742   1.00 50.50  ? 362  THR B CB    1 
ATOM   9157  O OG1   . THR B  2 362 ? 3.574    -16.931 7.007   1.00 48.98  ? 362  THR B OG1   1 
ATOM   9158  C CG2   . THR B  2 362 ? 3.326    -15.925 9.188   1.00 51.77  ? 362  THR B CG2   1 
ATOM   9159  N N     . ALA B  2 363 ? 4.949    -13.544 6.256   1.00 48.60  ? 363  ALA B N     1 
ATOM   9160  C CA    . ALA B  2 363 ? 5.889    -12.897 5.335   1.00 82.59  ? 363  ALA B CA    1 
ATOM   9161  C C     . ALA B  2 363 ? 6.401    -13.854 4.263   1.00 99.77  ? 363  ALA B C     1 
ATOM   9162  O O     . ALA B  2 363 ? 6.869    -13.410 3.212   1.00 58.58  ? 363  ALA B O     1 
ATOM   9163  C CB    . ALA B  2 363 ? 7.053    -12.320 6.116   1.00 84.49  ? 363  ALA B CB    1 
ATOM   9164  N N     . SER B  2 365 ? 9.218    -13.903 2.914   1.00 77.62  ? 365  SER B N     1 
ATOM   9165  C CA    . SER B  2 365 ? 10.577   -14.099 3.414   1.00 78.93  ? 365  SER B CA    1 
ATOM   9166  C C     . SER B  2 365 ? 11.328   -15.152 2.589   1.00 84.21  ? 365  SER B C     1 
ATOM   9167  O O     . SER B  2 365 ? 10.770   -16.225 2.317   1.00 83.89  ? 365  SER B O     1 
ATOM   9168  C CB    . SER B  2 365 ? 10.555   -14.470 4.893   1.00 81.98  ? 365  SER B CB    1 
ATOM   9169  O OG    . SER B  2 365 ? 9.259    -14.879 5.304   1.00 89.38  ? 365  SER B OG    1 
ATOM   9170  N N     . HIS B  2 366 ? 12.576   -14.832 2.155   1.00 81.48  ? 366  HIS B N     1 
ATOM   9171  C CA    . HIS B  2 366 ? 13.385   -15.754 1.342   1.00 81.69  ? 366  HIS B CA    1 
ATOM   9172  C C     . HIS B  2 366 ? 13.948   -16.895 2.186   1.00 77.88  ? 366  HIS B C     1 
ATOM   9173  O O     . HIS B  2 366 ? 13.993   -16.798 3.416   1.00 76.43  ? 366  HIS B O     1 
ATOM   9174  C CB    . HIS B  2 366 ? 14.508   -15.030 0.550   1.00 85.31  ? 366  HIS B CB    1 
ATOM   9175  C CG    . HIS B  2 366 ? 14.846   -15.658 -0.783  1.00 90.14  ? 366  HIS B CG    1 
ATOM   9176  N ND1   . HIS B  2 366 ? 15.467   -16.900 -0.871  1.00 92.80  ? 366  HIS B ND1   1 
ATOM   9177  C CD2   . HIS B  2 366 ? 14.678   -15.174 -2.036  1.00 92.58  ? 366  HIS B CD2   1 
ATOM   9178  C CE1   . HIS B  2 366 ? 15.619   -17.140 -2.164  1.00 92.78  ? 366  HIS B CE1   1 
ATOM   9179  N NE2   . HIS B  2 366 ? 15.162   -16.133 -2.904  1.00 93.06  ? 366  HIS B NE2   1 
ATOM   9180  N N     . SER B  2 367 ? 14.349   -17.983 1.493   1.00 69.57  ? 367  SER B N     1 
ATOM   9181  C CA    . SER B  2 367 ? 14.928   -19.226 2.000   1.00 67.44  ? 367  SER B CA    1 
ATOM   9182  C C     . SER B  2 367 ? 14.003   -19.963 2.973   1.00 67.43  ? 367  SER B C     1 
ATOM   9183  O O     . SER B  2 367 ? 14.468   -20.553 3.957   1.00 68.97  ? 367  SER B O     1 
ATOM   9184  C CB    . SER B  2 367 ? 16.319   -18.988 2.565   1.00 70.01  ? 367  SER B CB    1 
ATOM   9185  O OG    . SER B  2 367 ? 17.136   -18.461 1.535   1.00 77.44  ? 367  SER B OG    1 
ATOM   9186  N N     . ARG B  2 368 ? 12.681   -19.939 2.673   1.00 57.02  ? 368  ARG B N     1 
ATOM   9187  C CA    . ARG B  2 368 ? 11.678   -20.600 3.490   1.00 52.30  ? 368  ARG B CA    1 
ATOM   9188  C C     . ARG B  2 368 ? 10.861   -21.565 2.686   1.00 49.01  ? 368  ARG B C     1 
ATOM   9189  O O     . ARG B  2 368 ? 10.331   -21.207 1.633   1.00 47.29  ? 368  ARG B O     1 
ATOM   9190  C CB    . ARG B  2 368 ? 10.749   -19.591 4.199   1.00 49.06  ? 368  ARG B CB    1 
ATOM   9191  C CG    . ARG B  2 368 ? 11.395   -18.614 5.200   1.00 49.81  ? 368  ARG B CG    1 
ATOM   9192  C CD    . ARG B  2 368 ? 12.351   -19.182 6.235   1.00 47.49  ? 368  ARG B CD    1 
ATOM   9193  N NE    . ARG B  2 368 ? 11.959   -20.485 6.767   1.00 46.72  ? 368  ARG B NE    1 
ATOM   9194  C CZ    . ARG B  2 368 ? 11.265   -20.664 7.886   1.00 47.94  ? 368  ARG B CZ    1 
ATOM   9195  N NH1   . ARG B  2 368 ? 10.848   -19.614 8.595   1.00 12.77  ? 368  ARG B NH1   1 
ATOM   9196  N NH2   . ARG B  2 368 ? 10.980   -21.894 8.307   1.00 32.44  ? 368  ARG B NH2   1 
ATOM   9197  N N     . ALA B  2 369 ? 10.736   -22.785 3.203   1.00 42.28  ? 369  ALA B N     1 
ATOM   9198  C CA    . ALA B  2 369 ? 9.926    -23.845 2.623   1.00 40.67  ? 369  ALA B CA    1 
ATOM   9199  C C     . ALA B  2 369 ? 9.068    -24.430 3.737   1.00 42.94  ? 369  ALA B C     1 
ATOM   9200  O O     . ALA B  2 369 ? 9.495    -24.453 4.894   1.00 43.31  ? 369  ALA B O     1 
ATOM   9201  C CB    . ALA B  2 369 ? 10.818   -24.928 2.027   1.00 42.12  ? 369  ALA B CB    1 
ATOM   9202  N N     . PHE B  2 370 ? 7.861    -24.894 3.410   1.00 36.49  ? 370  PHE B N     1 
ATOM   9203  C CA    . PHE B  2 370 ? 7.008    -25.477 4.432   1.00 34.76  ? 370  PHE B CA    1 
ATOM   9204  C C     . PHE B  2 370 ? 6.422    -26.804 3.992   1.00 37.22  ? 370  PHE B C     1 
ATOM   9205  O O     . PHE B  2 370 ? 5.927    -26.918 2.867   1.00 37.44  ? 370  PHE B O     1 
ATOM   9206  C CB    . PHE B  2 370 ? 5.933    -24.472 4.889   1.00 35.62  ? 370  PHE B CB    1 
ATOM   9207  C CG    . PHE B  2 370 ? 6.530    -23.184 5.405   1.00 36.73  ? 370  PHE B CG    1 
ATOM   9208  C CD1   . PHE B  2 370 ? 7.152    -23.135 6.644   1.00 38.93  ? 370  PHE B CD1   1 
ATOM   9209  C CD2   . PHE B  2 370 ? 6.531    -22.037 4.623   1.00 38.63  ? 370  PHE B CD2   1 
ATOM   9210  C CE1   . PHE B  2 370 ? 7.756    -21.960 7.093   1.00 39.96  ? 370  PHE B CE1   1 
ATOM   9211  C CE2   . PHE B  2 370 ? 7.119    -20.857 5.085   1.00 41.52  ? 370  PHE B CE2   1 
ATOM   9212  C CZ    . PHE B  2 370 ? 7.718    -20.825 6.322   1.00 39.22  ? 370  PHE B CZ    1 
ATOM   9213  N N     . ILE B  2 371 ? 6.511    -27.825 4.869   1.00 32.31  ? 371  ILE B N     1 
ATOM   9214  C CA    . ILE B  2 371 ? 5.986    -29.169 4.588   1.00 30.45  ? 371  ILE B CA    1 
ATOM   9215  C C     . ILE B  2 371 ? 4.726    -29.447 5.390   1.00 33.72  ? 371  ILE B C     1 
ATOM   9216  O O     . ILE B  2 371 ? 4.744    -29.349 6.623   1.00 33.36  ? 371  ILE B O     1 
ATOM   9217  C CB    . ILE B  2 371 ? 7.003    -30.319 4.786   1.00 32.70  ? 371  ILE B CB    1 
ATOM   9218  C CG1   . ILE B  2 371 ? 8.281    -30.104 3.981   1.00 32.13  ? 371  ILE B CG1   1 
ATOM   9219  C CG2   . ILE B  2 371 ? 6.352    -31.645 4.399   1.00 32.97  ? 371  ILE B CG2   1 
ATOM   9220  C CD1   . ILE B  2 371 ? 9.416    -30.929 4.420   1.00 20.75  ? 371  ILE B CD1   1 
ATOM   9221  N N     . VAL B  2 372 ? 3.650    -29.845 4.685   1.00 28.15  ? 372  VAL B N     1 
ATOM   9222  C CA    . VAL B  2 372 ? 2.409    -30.201 5.327   1.00 26.56  ? 372  VAL B CA    1 
ATOM   9223  C C     . VAL B  2 372 ? 2.241    -31.693 5.158   1.00 33.83  ? 372  VAL B C     1 
ATOM   9224  O O     . VAL B  2 372 ? 1.970    -32.171 4.055   1.00 34.36  ? 372  VAL B O     1 
ATOM   9225  C CB    . VAL B  2 372 ? 1.183    -29.402 4.838   1.00 29.47  ? 372  VAL B CB    1 
ATOM   9226  C CG1   . VAL B  2 372 ? 0.044    -29.521 5.837   1.00 28.76  ? 372  VAL B CG1   1 
ATOM   9227  C CG2   . VAL B  2 372 ? 1.520    -27.930 4.601   1.00 28.98  ? 372  VAL B CG2   1 
ATOM   9228  N N     . GLU B  2 373 ? 2.479    -32.429 6.255   1.00 31.70  ? 373  GLU B N     1 
ATOM   9229  C CA    . GLU B  2 373 ? 2.365    -33.878 6.341   1.00 31.45  ? 373  GLU B CA    1 
ATOM   9230  C C     . GLU B  2 373 ? 0.870    -34.195 6.529   1.00 35.96  ? 373  GLU B C     1 
ATOM   9231  O O     . GLU B  2 373 ? 0.272    -33.861 7.550   1.00 35.29  ? 373  GLU B O     1 
ATOM   9232  C CB    . GLU B  2 373 ? 3.228    -34.403 7.505   1.00 32.72  ? 373  GLU B CB    1 
ATOM   9233  C CG    . GLU B  2 373 ? 3.448    -35.905 7.482   1.00 45.39  ? 373  GLU B CG    1 
ATOM   9234  C CD    . GLU B  2 373 ? 4.238    -36.477 8.651   1.00 74.35  ? 373  GLU B CD    1 
ATOM   9235  O OE1   . GLU B  2 373 ? 3.888    -37.587 9.118   1.00 81.39  ? 373  GLU B OE1   1 
ATOM   9236  O OE2   . GLU B  2 373 ? 5.220    -35.833 9.085   1.00 67.16  ? 373  GLU B OE2   1 
ATOM   9237  N N     . VAL B  2 374 ? 0.289    -34.827 5.524   1.00 33.47  ? 374  VAL B N     1 
ATOM   9238  C CA    . VAL B  2 374 ? -1.117   -35.175 5.439   1.00 33.09  ? 374  VAL B CA    1 
ATOM   9239  C C     . VAL B  2 374 ? -1.405   -36.675 5.648   1.00 40.84  ? 374  VAL B C     1 
ATOM   9240  O O     . VAL B  2 374 ? -0.745   -37.558 5.087   1.00 39.70  ? 374  VAL B O     1 
ATOM   9241  C CB    . VAL B  2 374 ? -1.657   -34.603 4.105   1.00 36.52  ? 374  VAL B CB    1 
ATOM   9242  C CG1   . VAL B  2 374 ? -2.943   -35.278 3.638   1.00 36.09  ? 374  VAL B CG1   1 
ATOM   9243  C CG2   . VAL B  2 374 ? -1.826   -33.089 4.212   1.00 35.78  ? 374  VAL B CG2   1 
ATOM   9244  N N     . MET B  2 375 ? -2.424   -36.929 6.476   1.00 40.38  ? 375  MET B N     1 
ATOM   9245  C CA    . MET B  2 375 ? -2.977   -38.233 6.830   1.00 41.11  ? 375  MET B CA    1 
ATOM   9246  C C     . MET B  2 375 ? -3.839   -38.694 5.649   1.00 47.61  ? 375  MET B C     1 
ATOM   9247  O O     . MET B  2 375 ? -4.589   -37.892 5.088   1.00 47.21  ? 375  MET B O     1 
ATOM   9248  C CB    . MET B  2 375 ? -3.868   -38.027 8.062   1.00 42.69  ? 375  MET B CB    1 
ATOM   9249  C CG    . MET B  2 375 ? -4.067   -39.264 8.876   1.00 47.04  ? 375