data_3OS8
# 
_entry.id   3OS8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3OS8         pdb_00003os8 10.2210/pdb3os8/pdb 
RCSB  RCSB061507   ?            ?                   
WWPDB D_1000061507 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OS9 . unspecified 
PDB 3OSA . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OS8 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bruning, J.'            1  
'Parent, A.A.'           2  
'Gil, G.'                3  
'Zhao, M.'               4  
'Nowak, J.'              5  
'Pace, M.C.'             6  
'Smith, C.L.'            7  
'Afonine, P.V.'          8  
'Adams, P.D.'            9  
'Katzenellenbogen, J.A.' 10 
'Nettles, K.W.'          11 
# 
_citation.id                        primary 
_citation.title                     'Coupling of receptor conformation and ligand orientation determine graded activity.' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            6 
_citation.page_first                837 
_citation.page_last                 843 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20924370 
_citation.pdbx_database_id_DOI      10.1038/nchembio.451 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bruning, J.B.'          1  ? 
primary 'Parent, A.A.'           2  ? 
primary 'Gil, G.'                3  ? 
primary 'Zhao, M.'               4  ? 
primary 'Nowak, J.'              5  ? 
primary 'Pace, M.C.'             6  ? 
primary 'Smith, C.L.'            7  ? 
primary 'Afonine, P.V.'          8  ? 
primary 'Adams, P.D.'            9  ? 
primary 'Katzenellenbogen, J.A.' 10 ? 
primary 'Nettles, K.W.'          11 ? 
# 
_cell.entry_id           3OS8 
_cell.length_a           53.698 
_cell.length_b           58.569 
_cell.length_c           93.461 
_cell.angle_alpha        80.40 
_cell.angle_beta         74.85 
_cell.angle_gamma        62.79 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OS8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Estrogen receptor'                                                29541.723 2   ? ? ? ? 
2 polymer     man 'Estrogen receptor'                                                29465.605 2   ? ? ? ? 
3 non-polymer syn '4-[1-benzyl-7-(trifluoromethyl)-1H-indazol-3-yl]benzene-1,3-diol' 384.351   4   ? ? ? ? 
4 water       nat water                                                              18.015    267 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ER, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1' 
2 'ER, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SNAKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTRHDQ
VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGK(CME)VEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSI
ILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCK
NVVPSYDLLLEMLDAHRLHAPT
;
;SNAKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTRHDQ
VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLN
SGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVP
SYDLLLEMLDAHRLHAPT
;
A,B ? 
2 'polypeptide(L)' no no  
;SNAKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTRHDQ
VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLN
SGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVP
SYDLLLEMLDAHRLHAPT
;
;SNAKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTRHDQ
VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLN
SGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVP
SYDLLLEMLDAHRLHAPT
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   LYS n 
1 5   ARG n 
1 6   SER n 
1 7   LYS n 
1 8   LYS n 
1 9   ASN n 
1 10  SER n 
1 11  LEU n 
1 12  ALA n 
1 13  LEU n 
1 14  SER n 
1 15  LEU n 
1 16  THR n 
1 17  ALA n 
1 18  ASP n 
1 19  GLN n 
1 20  MET n 
1 21  VAL n 
1 22  SER n 
1 23  ALA n 
1 24  LEU n 
1 25  LEU n 
1 26  ASP n 
1 27  ALA n 
1 28  GLU n 
1 29  PRO n 
1 30  PRO n 
1 31  ILE n 
1 32  LEU n 
1 33  TYR n 
1 34  SER n 
1 35  GLU n 
1 36  TYR n 
1 37  ASP n 
1 38  PRO n 
1 39  THR n 
1 40  ARG n 
1 41  PRO n 
1 42  PHE n 
1 43  SER n 
1 44  GLU n 
1 45  ALA n 
1 46  SER n 
1 47  MET n 
1 48  MET n 
1 49  GLY n 
1 50  LEU n 
1 51  LEU n 
1 52  THR n 
1 53  ASN n 
1 54  LEU n 
1 55  ALA n 
1 56  ASP n 
1 57  ARG n 
1 58  GLU n 
1 59  LEU n 
1 60  VAL n 
1 61  HIS n 
1 62  MET n 
1 63  ILE n 
1 64  ASN n 
1 65  TRP n 
1 66  ALA n 
1 67  LYS n 
1 68  ARG n 
1 69  VAL n 
1 70  PRO n 
1 71  GLY n 
1 72  PHE n 
1 73  VAL n 
1 74  ASP n 
1 75  LEU n 
1 76  THR n 
1 77  ARG n 
1 78  HIS n 
1 79  ASP n 
1 80  GLN n 
1 81  VAL n 
1 82  HIS n 
1 83  LEU n 
1 84  LEU n 
1 85  GLU n 
1 86  CYS n 
1 87  ALA n 
1 88  TRP n 
1 89  LEU n 
1 90  GLU n 
1 91  ILE n 
1 92  LEU n 
1 93  MET n 
1 94  ILE n 
1 95  GLY n 
1 96  LEU n 
1 97  VAL n 
1 98  TRP n 
1 99  ARG n 
1 100 SER n 
1 101 MET n 
1 102 GLU n 
1 103 HIS n 
1 104 PRO n 
1 105 GLY n 
1 106 LYS n 
1 107 LEU n 
1 108 LEU n 
1 109 PHE n 
1 110 ALA n 
1 111 PRO n 
1 112 ASN n 
1 113 LEU n 
1 114 LEU n 
1 115 LEU n 
1 116 ASP n 
1 117 ARG n 
1 118 ASN n 
1 119 GLN n 
1 120 GLY n 
1 121 LYS n 
1 122 CME n 
1 123 VAL n 
1 124 GLU n 
1 125 GLY n 
1 126 MET n 
1 127 VAL n 
1 128 GLU n 
1 129 ILE n 
1 130 PHE n 
1 131 ASP n 
1 132 MET n 
1 133 LEU n 
1 134 LEU n 
1 135 ALA n 
1 136 THR n 
1 137 SER n 
1 138 SER n 
1 139 ARG n 
1 140 PHE n 
1 141 ARG n 
1 142 MET n 
1 143 MET n 
1 144 ASN n 
1 145 LEU n 
1 146 GLN n 
1 147 GLY n 
1 148 GLU n 
1 149 GLU n 
1 150 PHE n 
1 151 VAL n 
1 152 CYS n 
1 153 LEU n 
1 154 LYS n 
1 155 SER n 
1 156 ILE n 
1 157 ILE n 
1 158 LEU n 
1 159 LEU n 
1 160 ASN n 
1 161 SER n 
1 162 GLY n 
1 163 VAL n 
1 164 TYR n 
1 165 THR n 
1 166 PHE n 
1 167 LEU n 
1 168 SER n 
1 169 SER n 
1 170 THR n 
1 171 LEU n 
1 172 LYS n 
1 173 SER n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 LYS n 
1 178 ASP n 
1 179 HIS n 
1 180 ILE n 
1 181 HIS n 
1 182 ARG n 
1 183 VAL n 
1 184 LEU n 
1 185 ASP n 
1 186 LYS n 
1 187 ILE n 
1 188 THR n 
1 189 ASP n 
1 190 THR n 
1 191 LEU n 
1 192 ILE n 
1 193 HIS n 
1 194 LEU n 
1 195 MET n 
1 196 ALA n 
1 197 LYS n 
1 198 ALA n 
1 199 GLY n 
1 200 LEU n 
1 201 THR n 
1 202 LEU n 
1 203 GLN n 
1 204 GLN n 
1 205 GLN n 
1 206 HIS n 
1 207 GLN n 
1 208 ARG n 
1 209 LEU n 
1 210 ALA n 
1 211 GLN n 
1 212 LEU n 
1 213 LEU n 
1 214 LEU n 
1 215 ILE n 
1 216 LEU n 
1 217 SER n 
1 218 HIS n 
1 219 ILE n 
1 220 ARG n 
1 221 HIS n 
1 222 MET n 
1 223 SER n 
1 224 ASN n 
1 225 LYS n 
1 226 GLY n 
1 227 MET n 
1 228 GLU n 
1 229 HIS n 
1 230 LEU n 
1 231 TYR n 
1 232 SER n 
1 233 MET n 
1 234 LYS n 
1 235 CYS n 
1 236 LYS n 
1 237 ASN n 
1 238 VAL n 
1 239 VAL n 
1 240 PRO n 
1 241 SER n 
1 242 TYR n 
1 243 ASP n 
1 244 LEU n 
1 245 LEU n 
1 246 LEU n 
1 247 GLU n 
1 248 MET n 
1 249 LEU n 
1 250 ASP n 
1 251 ALA n 
1 252 HIS n 
1 253 ARG n 
1 254 LEU n 
1 255 HIS n 
1 256 ALA n 
1 257 PRO n 
1 258 THR n 
2 1   SER n 
2 2   ASN n 
2 3   ALA n 
2 4   LYS n 
2 5   ARG n 
2 6   SER n 
2 7   LYS n 
2 8   LYS n 
2 9   ASN n 
2 10  SER n 
2 11  LEU n 
2 12  ALA n 
2 13  LEU n 
2 14  SER n 
2 15  LEU n 
2 16  THR n 
2 17  ALA n 
2 18  ASP n 
2 19  GLN n 
2 20  MET n 
2 21  VAL n 
2 22  SER n 
2 23  ALA n 
2 24  LEU n 
2 25  LEU n 
2 26  ASP n 
2 27  ALA n 
2 28  GLU n 
2 29  PRO n 
2 30  PRO n 
2 31  ILE n 
2 32  LEU n 
2 33  TYR n 
2 34  SER n 
2 35  GLU n 
2 36  TYR n 
2 37  ASP n 
2 38  PRO n 
2 39  THR n 
2 40  ARG n 
2 41  PRO n 
2 42  PHE n 
2 43  SER n 
2 44  GLU n 
2 45  ALA n 
2 46  SER n 
2 47  MET n 
2 48  MET n 
2 49  GLY n 
2 50  LEU n 
2 51  LEU n 
2 52  THR n 
2 53  ASN n 
2 54  LEU n 
2 55  ALA n 
2 56  ASP n 
2 57  ARG n 
2 58  GLU n 
2 59  LEU n 
2 60  VAL n 
2 61  HIS n 
2 62  MET n 
2 63  ILE n 
2 64  ASN n 
2 65  TRP n 
2 66  ALA n 
2 67  LYS n 
2 68  ARG n 
2 69  VAL n 
2 70  PRO n 
2 71  GLY n 
2 72  PHE n 
2 73  VAL n 
2 74  ASP n 
2 75  LEU n 
2 76  THR n 
2 77  ARG n 
2 78  HIS n 
2 79  ASP n 
2 80  GLN n 
2 81  VAL n 
2 82  HIS n 
2 83  LEU n 
2 84  LEU n 
2 85  GLU n 
2 86  CYS n 
2 87  ALA n 
2 88  TRP n 
2 89  LEU n 
2 90  GLU n 
2 91  ILE n 
2 92  LEU n 
2 93  MET n 
2 94  ILE n 
2 95  GLY n 
2 96  LEU n 
2 97  VAL n 
2 98  TRP n 
2 99  ARG n 
2 100 SER n 
2 101 MET n 
2 102 GLU n 
2 103 HIS n 
2 104 PRO n 
2 105 GLY n 
2 106 LYS n 
2 107 LEU n 
2 108 LEU n 
2 109 PHE n 
2 110 ALA n 
2 111 PRO n 
2 112 ASN n 
2 113 LEU n 
2 114 LEU n 
2 115 LEU n 
2 116 ASP n 
2 117 ARG n 
2 118 ASN n 
2 119 GLN n 
2 120 GLY n 
2 121 LYS n 
2 122 CYS n 
2 123 VAL n 
2 124 GLU n 
2 125 GLY n 
2 126 MET n 
2 127 VAL n 
2 128 GLU n 
2 129 ILE n 
2 130 PHE n 
2 131 ASP n 
2 132 MET n 
2 133 LEU n 
2 134 LEU n 
2 135 ALA n 
2 136 THR n 
2 137 SER n 
2 138 SER n 
2 139 ARG n 
2 140 PHE n 
2 141 ARG n 
2 142 MET n 
2 143 MET n 
2 144 ASN n 
2 145 LEU n 
2 146 GLN n 
2 147 GLY n 
2 148 GLU n 
2 149 GLU n 
2 150 PHE n 
2 151 VAL n 
2 152 CYS n 
2 153 LEU n 
2 154 LYS n 
2 155 SER n 
2 156 ILE n 
2 157 ILE n 
2 158 LEU n 
2 159 LEU n 
2 160 ASN n 
2 161 SER n 
2 162 GLY n 
2 163 VAL n 
2 164 TYR n 
2 165 THR n 
2 166 PHE n 
2 167 LEU n 
2 168 SER n 
2 169 SER n 
2 170 THR n 
2 171 LEU n 
2 172 LYS n 
2 173 SER n 
2 174 LEU n 
2 175 GLU n 
2 176 GLU n 
2 177 LYS n 
2 178 ASP n 
2 179 HIS n 
2 180 ILE n 
2 181 HIS n 
2 182 ARG n 
2 183 VAL n 
2 184 LEU n 
2 185 ASP n 
2 186 LYS n 
2 187 ILE n 
2 188 THR n 
2 189 ASP n 
2 190 THR n 
2 191 LEU n 
2 192 ILE n 
2 193 HIS n 
2 194 LEU n 
2 195 MET n 
2 196 ALA n 
2 197 LYS n 
2 198 ALA n 
2 199 GLY n 
2 200 LEU n 
2 201 THR n 
2 202 LEU n 
2 203 GLN n 
2 204 GLN n 
2 205 GLN n 
2 206 HIS n 
2 207 GLN n 
2 208 ARG n 
2 209 LEU n 
2 210 ALA n 
2 211 GLN n 
2 212 LEU n 
2 213 LEU n 
2 214 LEU n 
2 215 ILE n 
2 216 LEU n 
2 217 SER n 
2 218 HIS n 
2 219 ILE n 
2 220 ARG n 
2 221 HIS n 
2 222 MET n 
2 223 SER n 
2 224 ASN n 
2 225 LYS n 
2 226 GLY n 
2 227 MET n 
2 228 GLU n 
2 229 HIS n 
2 230 LEU n 
2 231 TYR n 
2 232 SER n 
2 233 MET n 
2 234 LYS n 
2 235 CYS n 
2 236 LYS n 
2 237 ASN n 
2 238 VAL n 
2 239 VAL n 
2 240 PRO n 
2 241 SER n 
2 242 TYR n 
2 243 ASP n 
2 244 LEU n 
2 245 LEU n 
2 246 LEU n 
2 247 GLU n 
2 248 MET n 
2 249 LEU n 
2 250 ASP n 
2 251 ALA n 
2 252 HIS n 
2 253 ARG n 
2 254 LEU n 
2 255 HIS n 
2 256 ALA n 
2 257 PRO n 
2 258 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'ESR1, ESR, NR3A1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'ESR1, ESR, NR3A1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ESR1_HUMAN P03372 1 
;KRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHL
LECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGV
YTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYD
LLLEMLDAHRLHAPT
;
299 ? 
2 UNP ESR1_HUMAN P03372 2 
;KRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHL
LECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGV
YTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYD
LLLEMLDAHRLHAPT
;
299 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OS8 A 4 ? 258 ? P03372 299 ? 553 ? 299 553 
2 1 3OS8 B 4 ? 258 ? P03372 299 ? 553 ? 299 553 
3 2 3OS8 C 4 ? 258 ? P03372 299 ? 553 ? 299 553 
4 2 3OS8 D 4 ? 258 ? P03372 299 ? 553 ? 299 553 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OS8 SER A 1   ? UNP P03372 ?   ?   'expression tag'      296 1  
1 3OS8 ASN A 2   ? UNP P03372 ?   ?   'expression tag'      297 2  
1 3OS8 ALA A 3   ? UNP P03372 ?   ?   'expression tag'      298 3  
1 3OS8 ARG A 77  ? UNP P03372 LEU 372 'engineered mutation' 372 4  
1 3OS8 SER A 241 ? UNP P03372 LEU 536 'engineered mutation' 536 5  
2 3OS8 SER B 1   ? UNP P03372 ?   ?   'expression tag'      296 6  
2 3OS8 ASN B 2   ? UNP P03372 ?   ?   'expression tag'      297 7  
2 3OS8 ALA B 3   ? UNP P03372 ?   ?   'expression tag'      298 8  
2 3OS8 ARG B 77  ? UNP P03372 LEU 372 'engineered mutation' 372 9  
2 3OS8 SER B 241 ? UNP P03372 LEU 536 'engineered mutation' 536 10 
3 3OS8 SER C 1   ? UNP P03372 ?   ?   'expression tag'      296 11 
3 3OS8 ASN C 2   ? UNP P03372 ?   ?   'expression tag'      297 12 
3 3OS8 ALA C 3   ? UNP P03372 ?   ?   'expression tag'      298 13 
3 3OS8 ARG C 77  ? UNP P03372 LEU 372 'engineered mutation' 372 14 
3 3OS8 SER C 241 ? UNP P03372 LEU 536 'engineered mutation' 536 15 
4 3OS8 SER D 1   ? UNP P03372 ?   ?   'expression tag'      296 16 
4 3OS8 ASN D 2   ? UNP P03372 ?   ?   'expression tag'      297 17 
4 3OS8 ALA D 3   ? UNP P03372 ?   ?   'expression tag'      298 18 
4 3OS8 ARG D 77  ? UNP P03372 LEU 372 'engineered mutation' 372 19 
4 3OS8 SER D 241 ? UNP P03372 LEU 536 'engineered mutation' 536 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                           ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ? 'C4 H7 N O4'       133.103 
CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE'                                 ? 'C5 H11 N O3 S2'   197.276 
CYS 'L-peptide linking' y CYSTEINE                                                           ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                            ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                              ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ? 'C6 H13 N O2'      131.173 
KN0 non-polymer         . '4-[1-benzyl-7-(trifluoromethyl)-1H-indazol-3-yl]benzene-1,3-diol' ? 'C21 H15 F3 N2 O2' 384.351 
LEU 'L-peptide linking' y LEUCINE                                                            ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                             ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                         ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                            ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                             ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                          ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                             ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3OS8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_details    'see publication, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9764 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9764 
# 
_reflns.entry_id                     3OS8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.2 
_reflns.d_resolution_high            2.03 
_reflns.number_obs                   49173 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3OS8 
_refine.ls_number_reflns_obs                     46210 
_refine.ls_number_reflns_all                     46210 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.2 
_refine.ls_d_res_high                            2.031 
_refine.ls_percent_reflns_obs                    73.36 
_refine.ls_R_factor_obs                          0.1881 
_refine.ls_R_factor_all                          0.1881 
_refine.ls_R_factor_R_work                       0.1860 
_refine.ls_R_factor_R_free                       0.2276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_number_reflns_R_free                  2347 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -3.0971 
_refine.aniso_B[2][2]                            -7.2271 
_refine.aniso_B[3][3]                            10.3243 
_refine.aniso_B[1][2]                            -0.9846 
_refine.aniso_B[1][3]                            -0.3940 
_refine.aniso_B[2][3]                            -0.5572 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.360 
_refine.solvent_model_param_bsol                 60.433 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7399 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         112 
_refine_hist.number_atoms_solvent             267 
_refine_hist.number_atoms_total               7778 
_refine_hist.d_res_high                       2.031 
_refine_hist.d_res_low                        38.2 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 7705  'X-RAY DIFFRACTION' ? 
f_angle_d          0.870  ? ? 10449 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.465 ? ? 2801  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.061  ? ? 1222  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1293  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1833 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 1833 0.025 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 C 1758 ?     ? POSITIONAL 2 3 'X-RAY DIFFRACTION' ? ? ? 
2 D 1758 0.022 ? POSITIONAL 2 4 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.0305 2.0720  627  0.2624 18.00 0.3453 . . 31  . . . . 'X-RAY DIFFRACTION' 
. 2.0720 2.1170  1013 0.2598 29.00 0.2896 . . 37  . . . . 'X-RAY DIFFRACTION' 
. 2.1170 2.1663  1347 0.2416 38.00 0.3418 . . 72  . . . . 'X-RAY DIFFRACTION' 
. 2.1663 2.2204  1694 0.2429 48.00 0.2416 . . 84  . . . . 'X-RAY DIFFRACTION' 
. 2.2204 2.2805  1958 0.2245 56.00 0.2974 . . 116 . . . . 'X-RAY DIFFRACTION' 
. 2.2805 2.3476  2275 0.2265 64.00 0.2559 . . 101 . . . . 'X-RAY DIFFRACTION' 
. 2.3476 2.4233  2536 0.2301 73.00 0.2813 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 2.4233 2.5099  2761 0.2159 79.00 0.2275 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 2.5099 2.6104  2942 0.2153 84.00 0.3070 . . 176 . . . . 'X-RAY DIFFRACTION' 
. 2.6104 2.7292  3114 0.2075 88.00 0.2367 . . 157 . . . . 'X-RAY DIFFRACTION' 
. 2.7292 2.8730  3163 0.1982 90.00 0.2492 . . 174 . . . . 'X-RAY DIFFRACTION' 
. 2.8730 3.0529  3291 0.1870 94.00 0.2220 . . 199 . . . . 'X-RAY DIFFRACTION' 
. 3.0529 3.2885  3340 0.1896 95.00 0.2124 . . 174 . . . . 'X-RAY DIFFRACTION' 
. 3.2885 3.6192  3413 0.1713 97.00 0.2344 . . 188 . . . . 'X-RAY DIFFRACTION' 
. 3.6192 4.1424  3451 0.1504 98.00 0.1828 . . 193 . . . . 'X-RAY DIFFRACTION' 
. 4.1424 5.2169  3448 0.1549 99.00 0.1923 . . 184 . . . . 'X-RAY DIFFRACTION' 
. 5.2169 38.2816 3490 0.1828 99.00 0.2213 . . 183 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain A and (resid 306:415 or resid 420:461 or resid 465:547 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain B and (resid 306:415 or resid 420:461 or resid 465:547 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain C and (resid 306:415 or resid 420:461 or resid 465:547 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain D and (resid 306:415 or resid 420:461 or resid 465:547 )' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3OS8 
_struct.title                     'Estrogen Receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OS8 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Estrogen Receptor complex, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 11  ? LEU A 15  ? LEU A 306 LEU A 310 5 ? 5  
HELX_P HELX_P2  2  THR A 16  ? ALA A 27  ? THR A 311 ALA A 322 1 ? 12 
HELX_P HELX_P3  3  SER A 43  ? VAL A 69  ? SER A 338 VAL A 364 1 ? 27 
HELX_P HELX_P4  4  GLY A 71  ? LEU A 75  ? GLY A 366 LEU A 370 5 ? 5  
HELX_P HELX_P5  5  THR A 76  ? MET A 101 ? THR A 371 MET A 396 1 ? 26 
HELX_P HELX_P6  6  VAL A 123 ? ASN A 144 ? VAL A 418 ASN A 439 1 ? 22 
HELX_P HELX_P7  7  GLN A 146 ? SER A 161 ? GLN A 441 SER A 456 1 ? 16 
HELX_P HELX_P8  8  GLY A 162 ? PHE A 166 ? GLY A 457 PHE A 461 5 ? 5  
HELX_P HELX_P9  9  THR A 170 ? GLY A 199 ? THR A 465 GLY A 494 1 ? 30 
HELX_P HELX_P10 10 THR A 201 ? SER A 232 ? THR A 496 SER A 527 1 ? 32 
HELX_P HELX_P11 11 SER A 241 ? ASP A 250 ? SER A 536 ASP A 545 1 ? 10 
HELX_P HELX_P12 12 LEU B 11  ? LEU B 15  ? LEU B 306 LEU B 310 5 ? 5  
HELX_P HELX_P13 13 THR B 16  ? ALA B 27  ? THR B 311 ALA B 322 1 ? 12 
HELX_P HELX_P14 14 SER B 43  ? VAL B 69  ? SER B 338 VAL B 364 1 ? 27 
HELX_P HELX_P15 15 GLY B 71  ? LEU B 75  ? GLY B 366 LEU B 370 5 ? 5  
HELX_P HELX_P16 16 THR B 76  ? SER B 100 ? THR B 371 SER B 395 1 ? 25 
HELX_P HELX_P17 17 VAL B 123 ? ASN B 144 ? VAL B 418 ASN B 439 1 ? 22 
HELX_P HELX_P18 18 GLN B 146 ? SER B 161 ? GLN B 441 SER B 456 1 ? 16 
HELX_P HELX_P19 19 GLY B 162 ? PHE B 166 ? GLY B 457 PHE B 461 5 ? 5  
HELX_P HELX_P20 20 THR B 170 ? GLY B 199 ? THR B 465 GLY B 494 1 ? 30 
HELX_P HELX_P21 21 THR B 201 ? SER B 232 ? THR B 496 SER B 527 1 ? 32 
HELX_P HELX_P22 22 SER B 241 ? ASP B 250 ? SER B 536 ASP B 545 1 ? 10 
HELX_P HELX_P23 23 SER C 10  ? LEU C 15  ? SER C 305 LEU C 310 1 ? 6  
HELX_P HELX_P24 24 THR C 16  ? GLU C 28  ? THR C 311 GLU C 323 1 ? 13 
HELX_P HELX_P25 25 SER C 46  ? LYS C 67  ? SER C 341 LYS C 362 1 ? 22 
HELX_P HELX_P26 26 GLY C 71  ? LEU C 75  ? GLY C 366 LEU C 370 5 ? 5  
HELX_P HELX_P27 27 THR C 76  ? SER C 100 ? THR C 371 SER C 395 1 ? 25 
HELX_P HELX_P28 28 ASN C 118 ? VAL C 123 ? ASN C 413 VAL C 418 1 ? 6  
HELX_P HELX_P29 29 MET C 126 ? MET C 143 ? MET C 421 MET C 438 1 ? 18 
HELX_P HELX_P30 30 GLN C 146 ? SER C 161 ? GLN C 441 SER C 456 1 ? 16 
HELX_P HELX_P31 31 GLY C 162 ? PHE C 166 ? GLY C 457 PHE C 461 5 ? 5  
HELX_P HELX_P32 32 THR C 170 ? GLY C 199 ? THR C 465 GLY C 494 1 ? 30 
HELX_P HELX_P33 33 THR C 201 ? MET C 233 ? THR C 496 MET C 528 1 ? 33 
HELX_P HELX_P34 34 CYS C 235 ? VAL C 239 ? CYS C 530 VAL C 534 5 ? 5  
HELX_P HELX_P35 35 SER C 241 ? ALA C 251 ? SER C 536 ALA C 546 1 ? 11 
HELX_P HELX_P36 36 LEU D 11  ? LEU D 15  ? LEU D 306 LEU D 310 5 ? 5  
HELX_P HELX_P37 37 THR D 16  ? GLU D 28  ? THR D 311 GLU D 323 1 ? 13 
HELX_P HELX_P38 38 SER D 46  ? LYS D 67  ? SER D 341 LYS D 362 1 ? 22 
HELX_P HELX_P39 39 GLY D 71  ? LEU D 75  ? GLY D 366 LEU D 370 5 ? 5  
HELX_P HELX_P40 40 THR D 76  ? SER D 100 ? THR D 371 SER D 395 1 ? 25 
HELX_P HELX_P41 41 VAL D 123 ? GLY D 125 ? VAL D 418 GLY D 420 5 ? 3  
HELX_P HELX_P42 42 MET D 126 ? MET D 143 ? MET D 421 MET D 438 1 ? 18 
HELX_P HELX_P43 43 GLN D 146 ? SER D 161 ? GLN D 441 SER D 456 1 ? 16 
HELX_P HELX_P44 44 GLY D 162 ? PHE D 166 ? GLY D 457 PHE D 461 5 ? 5  
HELX_P HELX_P45 45 LYS D 172 ? GLY D 199 ? LYS D 467 GLY D 494 1 ? 28 
HELX_P HELX_P46 46 THR D 201 ? MET D 233 ? THR D 496 MET D 528 1 ? 33 
HELX_P HELX_P47 47 CYS D 235 ? VAL D 239 ? CYS D 530 VAL D 534 5 ? 5  
HELX_P HELX_P48 48 SER D 241 ? HIS D 252 ? SER D 536 HIS D 547 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A LYS 121 C ? ? ? 1_555 A CME 122 N ? ? A LYS 416 A CME 417 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale2 covale both ? A CME 122 C ? ? ? 1_555 A VAL 123 N ? ? A CME 417 A VAL 418 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale3 covale both ? B LYS 121 C ? ? ? 1_555 B CME 122 N ? ? B LYS 416 B CME 417 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale4 covale both ? B CME 122 C ? ? ? 1_555 B VAL 123 N ? ? B CME 417 B VAL 418 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 40  A . ? ARG 335 A PRO 41  A ? PRO 336 A 1 4.33  
2 LEU 167 A . ? LEU 462 A SER 168 A ? SER 463 A 1 -2.55 
3 ARG 40  B . ? ARG 335 B PRO 41  B ? PRO 336 B 1 4.07  
4 PHE 166 B . ? PHE 461 B LEU 167 B ? LEU 462 B 1 -7.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 106 ? ALA A 110 ? LYS A 401 ALA A 405 
A 2 LEU A 113 ? ASP A 116 ? LEU A 408 ASP A 411 
B 1 LYS B 106 ? ALA B 110 ? LYS B 401 ALA B 405 
B 2 LEU B 113 ? ASP B 116 ? LEU B 408 ASP B 411 
C 1 LYS C 106 ? ALA C 110 ? LYS C 401 ALA C 405 
C 2 LEU C 113 ? ASP C 116 ? LEU C 408 ASP C 411 
D 1 LYS D 106 ? ALA D 110 ? LYS D 401 ALA D 405 
D 2 LEU D 113 ? ASP D 116 ? LEU D 408 ASP D 411 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 107 ? N LEU A 402 O LEU A 115 ? O LEU A 410 
B 1 2 N LEU B 107 ? N LEU B 402 O LEU B 115 ? O LEU B 410 
C 1 2 N LEU C 107 ? N LEU C 402 O LEU C 115 ? O LEU C 410 
D 1 2 N LEU D 107 ? N LEU D 402 O LEU D 115 ? O LEU D 410 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A KN0 1 ? 13 'BINDING SITE FOR RESIDUE KN0 A 1' 
AC2 Software B KN0 1 ? 12 'BINDING SITE FOR RESIDUE KN0 B 1' 
AC3 Software C KN0 1 ? 13 'BINDING SITE FOR RESIDUE KN0 C 1' 
AC4 Software D KN0 1 ? 13 'BINDING SITE FOR RESIDUE KN0 D 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 HOH I .   ? HOH A 62  . ? 1_555 ? 
2  AC1 13 MET A 48  ? MET A 343 . ? 1_555 ? 
3  AC1 13 LEU A 51  ? LEU A 346 . ? 1_555 ? 
4  AC1 13 GLU A 58  ? GLU A 353 . ? 1_555 ? 
5  AC1 13 LEU A 92  ? LEU A 387 . ? 1_555 ? 
6  AC1 13 MET A 93  ? MET A 388 . ? 1_555 ? 
7  AC1 13 LEU A 96  ? LEU A 391 . ? 1_555 ? 
8  AC1 13 ARG A 99  ? ARG A 394 . ? 1_555 ? 
9  AC1 13 PHE A 109 ? PHE A 404 . ? 1_555 ? 
10 AC1 13 MET A 126 ? MET A 421 . ? 1_555 ? 
11 AC1 13 ILE A 129 ? ILE A 424 . ? 1_555 ? 
12 AC1 13 GLY A 226 ? GLY A 521 . ? 1_555 ? 
13 AC1 13 LEU A 230 ? LEU A 525 . ? 1_555 ? 
14 AC2 12 HOH J .   ? HOH B 145 . ? 1_555 ? 
15 AC2 12 LEU B 51  ? LEU B 346 . ? 1_555 ? 
16 AC2 12 GLU B 58  ? GLU B 353 . ? 1_555 ? 
17 AC2 12 LEU B 92  ? LEU B 387 . ? 1_555 ? 
18 AC2 12 MET B 93  ? MET B 388 . ? 1_555 ? 
19 AC2 12 LEU B 96  ? LEU B 391 . ? 1_555 ? 
20 AC2 12 ARG B 99  ? ARG B 394 . ? 1_555 ? 
21 AC2 12 PHE B 109 ? PHE B 404 . ? 1_555 ? 
22 AC2 12 MET B 126 ? MET B 421 . ? 1_555 ? 
23 AC2 12 ILE B 129 ? ILE B 424 . ? 1_555 ? 
24 AC2 12 GLY B 226 ? GLY B 521 . ? 1_555 ? 
25 AC2 12 LEU B 230 ? LEU B 525 . ? 1_555 ? 
26 AC3 13 HOH K .   ? HOH C 75  . ? 1_555 ? 
27 AC3 13 MET C 48  ? MET C 343 . ? 1_555 ? 
28 AC3 13 LEU C 51  ? LEU C 346 . ? 1_555 ? 
29 AC3 13 THR C 52  ? THR C 347 . ? 1_555 ? 
30 AC3 13 ALA C 55  ? ALA C 350 . ? 1_555 ? 
31 AC3 13 GLU C 58  ? GLU C 353 . ? 1_555 ? 
32 AC3 13 LEU C 92  ? LEU C 387 . ? 1_555 ? 
33 AC3 13 ARG C 99  ? ARG C 394 . ? 1_555 ? 
34 AC3 13 MET C 126 ? MET C 421 . ? 1_555 ? 
35 AC3 13 ILE C 129 ? ILE C 424 . ? 1_555 ? 
36 AC3 13 LEU C 133 ? LEU C 428 . ? 1_555 ? 
37 AC3 13 GLY C 226 ? GLY C 521 . ? 1_555 ? 
38 AC3 13 VAL C 238 ? VAL C 533 . ? 1_555 ? 
39 AC4 13 HOH L .   ? HOH D 76  . ? 1_555 ? 
40 AC4 13 MET D 48  ? MET D 343 . ? 1_555 ? 
41 AC4 13 LEU D 51  ? LEU D 346 . ? 1_555 ? 
42 AC4 13 THR D 52  ? THR D 347 . ? 1_555 ? 
43 AC4 13 ALA D 55  ? ALA D 350 . ? 1_555 ? 
44 AC4 13 GLU D 58  ? GLU D 353 . ? 1_555 ? 
45 AC4 13 LEU D 92  ? LEU D 387 . ? 1_555 ? 
46 AC4 13 ARG D 99  ? ARG D 394 . ? 1_555 ? 
47 AC4 13 ILE D 129 ? ILE D 424 . ? 1_555 ? 
48 AC4 13 LEU D 133 ? LEU D 428 . ? 1_555 ? 
49 AC4 13 GLY D 226 ? GLY D 521 . ? 1_555 ? 
50 AC4 13 HIS D 229 ? HIS D 524 . ? 1_555 ? 
51 AC4 13 VAL D 238 ? VAL D 533 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OS8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OS8 
_atom_sites.fract_transf_matrix[1][1]   0.018623 
_atom_sites.fract_transf_matrix[1][2]   -0.009576 
_atom_sites.fract_transf_matrix[1][3]   -0.004522 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019199 
_atom_sites.fract_transf_matrix[2][3]   -0.001060 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011102 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 11  ? -13.691 29.760  -28.351 1.00 80.34  ? 306 LEU A N   1 
ATOM   2    C CA  . LEU A 1 11  ? -12.307 30.018  -28.726 1.00 76.61  ? 306 LEU A CA  1 
ATOM   3    C C   . LEU A 1 11  ? -11.418 30.150  -27.490 1.00 67.81  ? 306 LEU A C   1 
ATOM   4    O O   . LEU A 1 11  ? -11.901 30.400  -26.385 1.00 60.53  ? 306 LEU A O   1 
ATOM   5    C CB  . LEU A 1 11  ? -12.211 31.274  -29.597 1.00 77.95  ? 306 LEU A CB  1 
ATOM   6    N N   . ALA A 1 12  ? -10.115 29.987  -27.690 1.00 65.97  ? 307 ALA A N   1 
ATOM   7    C CA  . ALA A 1 12  ? -9.156  29.965  -26.586 1.00 61.86  ? 307 ALA A CA  1 
ATOM   8    C C   . ALA A 1 12  ? -9.186  31.220  -25.711 1.00 61.43  ? 307 ALA A C   1 
ATOM   9    O O   . ALA A 1 12  ? -8.992  31.140  -24.496 1.00 60.62  ? 307 ALA A O   1 
ATOM   10   C CB  . ALA A 1 12  ? -7.755  29.729  -27.114 1.00 60.35  ? 307 ALA A CB  1 
ATOM   11   N N   . LEU A 1 13  ? -9.425  32.374  -26.326 1.00 55.94  ? 308 LEU A N   1 
ATOM   12   C CA  . LEU A 1 13  ? -9.380  33.647  -25.606 1.00 53.21  ? 308 LEU A CA  1 
ATOM   13   C C   . LEU A 1 13  ? -10.518 33.828  -24.604 1.00 55.83  ? 308 LEU A C   1 
ATOM   14   O O   . LEU A 1 13  ? -10.500 34.767  -23.810 1.00 58.42  ? 308 LEU A O   1 
ATOM   15   C CB  . LEU A 1 13  ? -9.361  34.821  -26.584 1.00 53.04  ? 308 LEU A CB  1 
ATOM   16   C CG  . LEU A 1 13  ? -8.094  34.992  -27.422 1.00 52.47  ? 308 LEU A CG  1 
ATOM   17   C CD1 . LEU A 1 13  ? -8.177  36.262  -28.262 1.00 49.46  ? 308 LEU A CD1 1 
ATOM   18   C CD2 . LEU A 1 13  ? -6.867  35.018  -26.521 1.00 52.89  ? 308 LEU A CD2 1 
ATOM   19   N N   . SER A 1 14  ? -11.501 32.932  -24.639 1.00 53.41  ? 309 SER A N   1 
ATOM   20   C CA  . SER A 1 14  ? -12.648 33.025  -23.737 1.00 56.21  ? 309 SER A CA  1 
ATOM   21   C C   . SER A 1 14  ? -12.522 32.144  -22.495 1.00 54.08  ? 309 SER A C   1 
ATOM   22   O O   . SER A 1 14  ? -13.322 32.255  -21.562 1.00 54.73  ? 309 SER A O   1 
ATOM   23   C CB  . SER A 1 14  ? -13.945 32.698  -24.479 1.00 58.70  ? 309 SER A CB  1 
ATOM   24   O OG  . SER A 1 14  ? -14.436 33.849  -25.146 1.00 62.60  ? 309 SER A OG  1 
ATOM   25   N N   . LEU A 1 15  ? -11.517 31.275  -22.487 1.00 45.43  ? 310 LEU A N   1 
ATOM   26   C CA  . LEU A 1 15  ? -11.286 30.380  -21.356 1.00 49.89  ? 310 LEU A CA  1 
ATOM   27   C C   . LEU A 1 15  ? -10.997 31.136  -20.063 1.00 49.05  ? 310 LEU A C   1 
ATOM   28   O O   . LEU A 1 15  ? -10.316 32.164  -20.069 1.00 45.36  ? 310 LEU A O   1 
ATOM   29   C CB  . LEU A 1 15  ? -10.122 29.425  -21.653 1.00 48.66  ? 310 LEU A CB  1 
ATOM   30   C CG  . LEU A 1 15  ? -10.304 28.405  -22.777 1.00 47.71  ? 310 LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 15  ? -9.209  27.341  -22.705 1.00 51.92  ? 310 LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 15  ? -11.675 27.762  -22.695 1.00 44.34  ? 310 LEU A CD2 1 
ATOM   33   N N   . THR A 1 16  ? -11.509 30.617  -18.954 1.00 45.17  ? 311 THR A N   1 
ATOM   34   C CA  . THR A 1 16  ? -11.125 31.122  -17.643 1.00 43.15  ? 311 THR A CA  1 
ATOM   35   C C   . THR A 1 16  ? -9.775  30.527  -17.291 1.00 43.83  ? 311 THR A C   1 
ATOM   36   O O   . THR A 1 16  ? -9.279  29.641  -17.990 1.00 43.35  ? 311 THR A O   1 
ATOM   37   C CB  . THR A 1 16  ? -12.125 30.710  -16.556 1.00 46.59  ? 311 THR A CB  1 
ATOM   38   O OG1 . THR A 1 16  ? -12.033 29.295  -16.340 1.00 45.48  ? 311 THR A OG1 1 
ATOM   39   C CG2 . THR A 1 16  ? -13.548 31.077  -16.968 1.00 51.47  ? 311 THR A CG2 1 
ATOM   40   N N   . ALA A 1 17  ? -9.180  31.002  -16.203 1.00 44.37  ? 312 ALA A N   1 
ATOM   41   C CA  . ALA A 1 17  ? -7.914  30.445  -15.749 1.00 41.12  ? 312 ALA A CA  1 
ATOM   42   C C   . ALA A 1 17  ? -8.080  28.964  -15.421 1.00 44.20  ? 312 ALA A C   1 
ATOM   43   O O   . ALA A 1 17  ? -7.254  28.138  -15.808 1.00 47.58  ? 312 ALA A O   1 
ATOM   44   C CB  . ALA A 1 17  ? -7.400  31.209  -14.545 1.00 34.20  ? 312 ALA A CB  1 
ATOM   45   N N   . ASP A 1 18  ? -9.156  28.634  -14.711 1.00 44.17  ? 313 ASP A N   1 
ATOM   46   C CA  . ASP A 1 18  ? -9.441  27.247  -14.336 1.00 48.32  ? 313 ASP A CA  1 
ATOM   47   C C   . ASP A 1 18  ? -9.628  26.358  -15.560 1.00 43.10  ? 313 ASP A C   1 
ATOM   48   O O   . ASP A 1 18  ? -9.259  25.179  -15.549 1.00 38.19  ? 313 ASP A O   1 
ATOM   49   C CB  . ASP A 1 18  ? -10.683 27.166  -13.441 1.00 56.82  ? 313 ASP A CB  1 
ATOM   50   C CG  . ASP A 1 18  ? -10.440 27.729  -12.048 1.00 65.35  ? 313 ASP A CG  1 
ATOM   51   O OD1 . ASP A 1 18  ? -9.276  27.721  -11.595 1.00 64.76  ? 313 ASP A OD1 1 
ATOM   52   O OD2 . ASP A 1 18  ? -11.415 28.168  -11.402 1.00 72.52  ? 313 ASP A OD2 1 
ATOM   53   N N   . GLN A 1 19  ? -10.204 26.922  -16.616 1.00 41.90  ? 314 GLN A N   1 
ATOM   54   C CA  . GLN A 1 19  ? -10.447 26.156  -17.836 1.00 39.95  ? 314 GLN A CA  1 
ATOM   55   C C   . GLN A 1 19  ? -9.158  25.967  -18.617 1.00 36.76  ? 314 GLN A C   1 
ATOM   56   O O   . GLN A 1 19  ? -8.964  24.944  -19.271 1.00 37.80  ? 314 GLN A O   1 
ATOM   57   C CB  . GLN A 1 19  ? -11.497 26.843  -18.712 1.00 40.05  ? 314 GLN A CB  1 
ATOM   58   C CG  . GLN A 1 19  ? -12.923 26.740  -18.182 1.00 45.15  ? 314 GLN A CG  1 
ATOM   59   C CD  . GLN A 1 19  ? -13.889 27.613  -18.960 1.00 52.52  ? 314 GLN A CD  1 
ATOM   60   O OE1 . GLN A 1 19  ? -13.507 28.657  -19.490 1.00 55.15  ? 314 GLN A OE1 1 
ATOM   61   N NE2 . GLN A 1 19  ? -15.146 27.193  -19.029 1.00 56.25  ? 314 GLN A NE2 1 
ATOM   62   N N   . MET A 1 20  ? -8.277  26.962  -18.545 1.00 43.39  ? 315 MET A N   1 
ATOM   63   C CA  . MET A 1 20  ? -6.991  26.896  -19.227 1.00 40.41  ? 315 MET A CA  1 
ATOM   64   C C   . MET A 1 20  ? -6.099  25.837  -18.595 1.00 36.58  ? 315 MET A C   1 
ATOM   65   O O   . MET A 1 20  ? -5.473  25.043  -19.297 1.00 40.99  ? 315 MET A O   1 
ATOM   66   C CB  . MET A 1 20  ? -6.292  28.257  -19.197 1.00 43.81  ? 315 MET A CB  1 
ATOM   67   C CG  . MET A 1 20  ? -4.875  28.255  -19.774 1.00 43.73  ? 315 MET A CG  1 
ATOM   68   S SD  . MET A 1 20  ? -4.822  28.064  -21.567 1.00 53.42  ? 315 MET A SD  1 
ATOM   69   C CE  . MET A 1 20  ? -5.690  29.547  -22.088 1.00 40.43  ? 315 MET A CE  1 
ATOM   70   N N   . VAL A 1 21  ? -6.045  25.832  -17.267 1.00 36.04  ? 316 VAL A N   1 
ATOM   71   C CA  . VAL A 1 21  ? -5.263  24.843  -16.532 1.00 39.80  ? 316 VAL A CA  1 
ATOM   72   C C   . VAL A 1 21  ? -5.704  23.424  -16.859 1.00 40.61  ? 316 VAL A C   1 
ATOM   73   O O   . VAL A 1 21  ? -4.872  22.549  -17.108 1.00 38.10  ? 316 VAL A O   1 
ATOM   74   C CB  . VAL A 1 21  ? -5.374  25.058  -15.006 1.00 41.86  ? 316 VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 21  ? -4.600  23.984  -14.264 1.00 42.28  ? 316 VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 21  ? -4.862  26.440  -14.629 1.00 44.77  ? 316 VAL A CG2 1 
ATOM   77   N N   . SER A 1 22  ? -7.018  23.207  -16.855 1.00 42.58  ? 317 SER A N   1 
ATOM   78   C CA  . SER A 1 22  ? -7.594  21.891  -17.110 1.00 43.94  ? 317 SER A CA  1 
ATOM   79   C C   . SER A 1 22  ? -7.255  21.415  -18.513 1.00 41.94  ? 317 SER A C   1 
ATOM   80   O O   . SER A 1 22  ? -6.900  20.255  -18.719 1.00 44.92  ? 317 SER A O   1 
ATOM   81   C CB  . SER A 1 22  ? -9.116  21.940  -16.945 1.00 49.91  ? 317 SER A CB  1 
ATOM   82   O OG  . SER A 1 22  ? -9.473  22.483  -15.685 1.00 55.50  ? 317 SER A OG  1 
ATOM   83   N N   . ALA A 1 23  ? -7.378  22.319  -19.478 1.00 40.04  ? 318 ALA A N   1 
ATOM   84   C CA  . ALA A 1 23  ? -7.062  22.003  -20.864 1.00 40.09  ? 318 ALA A CA  1 
ATOM   85   C C   . ALA A 1 23  ? -5.596  21.605  -21.010 1.00 42.76  ? 318 ALA A C   1 
ATOM   86   O O   . ALA A 1 23  ? -5.273  20.638  -21.702 1.00 41.76  ? 318 ALA A O   1 
ATOM   87   C CB  . ALA A 1 23  ? -7.379  23.193  -21.759 1.00 40.84  ? 318 ALA A CB  1 
ATOM   88   N N   . LEU A 1 24  ? -4.710  22.353  -20.356 1.00 35.29  ? 319 LEU A N   1 
ATOM   89   C CA  . LEU A 1 24  ? -3.281  22.078  -20.439 1.00 39.70  ? 319 LEU A CA  1 
ATOM   90   C C   . LEU A 1 24  ? -2.903  20.761  -19.764 1.00 41.02  ? 319 LEU A C   1 
ATOM   91   O O   . LEU A 1 24  ? -2.116  19.986  -20.304 1.00 45.27  ? 319 LEU A O   1 
ATOM   92   C CB  . LEU A 1 24  ? -2.471  23.238  -19.852 1.00 38.41  ? 319 LEU A CB  1 
ATOM   93   C CG  . LEU A 1 24  ? -2.577  24.565  -20.613 1.00 33.35  ? 319 LEU A CG  1 
ATOM   94   C CD1 . LEU A 1 24  ? -1.634  25.585  -20.011 1.00 33.04  ? 319 LEU A CD1 1 
ATOM   95   C CD2 . LEU A 1 24  ? -2.276  24.365  -22.096 1.00 26.62  ? 319 LEU A CD2 1 
ATOM   96   N N   . LEU A 1 25  ? -3.465  20.504  -18.586 1.00 39.48  ? 320 LEU A N   1 
ATOM   97   C CA  . LEU A 1 25  ? -3.185  19.256  -17.881 1.00 39.46  ? 320 LEU A CA  1 
ATOM   98   C C   . LEU A 1 25  ? -3.647  18.047  -18.695 1.00 43.42  ? 320 LEU A C   1 
ATOM   99   O O   . LEU A 1 25  ? -2.921  17.064  -18.826 1.00 47.53  ? 320 LEU A O   1 
ATOM   100  C CB  . LEU A 1 25  ? -3.853  19.252  -16.500 1.00 43.83  ? 320 LEU A CB  1 
ATOM   101  C CG  . LEU A 1 25  ? -3.249  20.167  -15.429 1.00 43.58  ? 320 LEU A CG  1 
ATOM   102  C CD1 . LEU A 1 25  ? -4.164  20.262  -14.224 1.00 46.42  ? 320 LEU A CD1 1 
ATOM   103  C CD2 . LEU A 1 25  ? -1.875  19.662  -15.017 1.00 39.70  ? 320 LEU A CD2 1 
ATOM   104  N N   . ASP A 1 26  ? -4.858  18.126  -19.241 1.00 47.50  ? 321 ASP A N   1 
ATOM   105  C CA  . ASP A 1 26  ? -5.420  17.032  -20.034 1.00 52.14  ? 321 ASP A CA  1 
ATOM   106  C C   . ASP A 1 26  ? -4.594  16.775  -21.287 1.00 47.89  ? 321 ASP A C   1 
ATOM   107  O O   . ASP A 1 26  ? -4.532  15.650  -21.780 1.00 53.12  ? 321 ASP A O   1 
ATOM   108  C CB  . ASP A 1 26  ? -6.868  17.338  -20.423 1.00 58.64  ? 321 ASP A CB  1 
ATOM   109  C CG  . ASP A 1 26  ? -7.806  17.347  -19.226 1.00 66.66  ? 321 ASP A CG  1 
ATOM   110  O OD1 . ASP A 1 26  ? -7.385  16.904  -18.133 1.00 64.12  ? 321 ASP A OD1 1 
ATOM   111  O OD2 . ASP A 1 26  ? -8.964  17.798  -19.379 1.00 70.00  ? 321 ASP A OD2 1 
ATOM   112  N N   . ALA A 1 27  ? -3.951  17.820  -21.793 1.00 40.68  ? 322 ALA A N   1 
ATOM   113  C CA  . ALA A 1 27  ? -3.204  17.725  -23.046 1.00 41.20  ? 322 ALA A CA  1 
ATOM   114  C C   . ALA A 1 27  ? -1.823  17.100  -22.871 1.00 37.55  ? 322 ALA A C   1 
ATOM   115  O O   . ALA A 1 27  ? -1.119  16.858  -23.854 1.00 32.82  ? 322 ALA A O   1 
ATOM   116  C CB  . ALA A 1 27  ? -3.077  19.104  -23.688 1.00 33.34  ? 322 ALA A CB  1 
ATOM   117  N N   . GLU A 1 28  ? -1.434  16.849  -21.624 1.00 32.74  ? 323 GLU A N   1 
ATOM   118  C CA  . GLU A 1 28  ? -0.080  16.377  -21.340 1.00 35.77  ? 323 GLU A CA  1 
ATOM   119  C C   . GLU A 1 28  ? 0.272   15.125  -22.134 1.00 37.69  ? 323 GLU A C   1 
ATOM   120  O O   . GLU A 1 28  ? -0.542  14.205  -22.239 1.00 36.46  ? 323 GLU A O   1 
ATOM   121  C CB  . GLU A 1 28  ? 0.114   16.135  -19.837 1.00 35.62  ? 323 GLU A CB  1 
ATOM   122  C CG  . GLU A 1 28  ? 0.573   17.370  -19.066 1.00 37.13  ? 323 GLU A CG  1 
ATOM   123  C CD  . GLU A 1 28  ? 1.922   17.883  -19.537 1.00 37.82  ? 323 GLU A CD  1 
ATOM   124  O OE1 . GLU A 1 28  ? 2.952   17.459  -18.975 1.00 42.61  ? 323 GLU A OE1 1 
ATOM   125  O OE2 . GLU A 1 28  ? 1.956   18.707  -20.471 1.00 37.06  ? 323 GLU A OE2 1 
ATOM   126  N N   . PRO A 1 29  ? 1.489   15.093  -22.705 1.00 34.07  ? 324 PRO A N   1 
ATOM   127  C CA  . PRO A 1 29  ? 1.965   13.937  -23.466 1.00 36.56  ? 324 PRO A CA  1 
ATOM   128  C C   . PRO A 1 29  ? 2.400   12.827  -22.518 1.00 38.57  ? 324 PRO A C   1 
ATOM   129  O O   . PRO A 1 29  ? 2.585   13.083  -21.331 1.00 32.43  ? 324 PRO A O   1 
ATOM   130  C CB  . PRO A 1 29  ? 3.185   14.492  -24.199 1.00 37.96  ? 324 PRO A CB  1 
ATOM   131  C CG  . PRO A 1 29  ? 3.703   15.547  -23.284 1.00 34.69  ? 324 PRO A CG  1 
ATOM   132  C CD  . PRO A 1 29  ? 2.498   16.168  -22.648 1.00 31.79  ? 324 PRO A CD  1 
ATOM   133  N N   . PRO A 1 30  ? 2.563   11.603  -23.034 1.00 36.56  ? 325 PRO A N   1 
ATOM   134  C CA  . PRO A 1 30  ? 2.994   10.502  -22.173 1.00 37.52  ? 325 PRO A CA  1 
ATOM   135  C C   . PRO A 1 30  ? 4.500   10.525  -21.965 1.00 40.79  ? 325 PRO A C   1 
ATOM   136  O O   . PRO A 1 30  ? 5.220   11.166  -22.728 1.00 31.92  ? 325 PRO A O   1 
ATOM   137  C CB  . PRO A 1 30  ? 2.611   9.267   -22.986 1.00 41.47  ? 325 PRO A CB  1 
ATOM   138  C CG  . PRO A 1 30  ? 2.760   9.711   -24.399 1.00 42.19  ? 325 PRO A CG  1 
ATOM   139  C CD  . PRO A 1 30  ? 2.369   11.172  -24.429 1.00 36.33  ? 325 PRO A CD  1 
ATOM   140  N N   . ILE A 1 31  ? 4.967   9.837   -20.931 1.00 46.20  ? 326 ILE A N   1 
ATOM   141  C CA  . ILE A 1 31  ? 6.393   9.640   -20.751 1.00 50.04  ? 326 ILE A CA  1 
ATOM   142  C C   . ILE A 1 31  ? 6.796   8.377   -21.496 1.00 42.56  ? 326 ILE A C   1 
ATOM   143  O O   . ILE A 1 31  ? 6.197   7.325   -21.306 1.00 43.53  ? 326 ILE A O   1 
ATOM   144  C CB  . ILE A 1 31  ? 6.762   9.504   -19.270 1.00 52.44  ? 326 ILE A CB  1 
ATOM   145  C CG1 . ILE A 1 31  ? 6.393   10.784  -18.526 1.00 49.08  ? 326 ILE A CG1 1 
ATOM   146  C CG2 . ILE A 1 31  ? 8.249   9.198   -19.113 1.00 46.44  ? 326 ILE A CG2 1 
ATOM   147  C CD1 . ILE A 1 31  ? 6.556   10.675  -17.033 1.00 53.09  ? 326 ILE A CD1 1 
ATOM   148  N N   . LEU A 1 32  ? 7.798   8.493   -22.359 1.00 36.95  ? 327 LEU A N   1 
ATOM   149  C CA  . LEU A 1 32  ? 8.256   7.361   -23.143 1.00 37.84  ? 327 LEU A CA  1 
ATOM   150  C C   . LEU A 1 32  ? 9.506   6.738   -22.531 1.00 39.06  ? 327 LEU A C   1 
ATOM   151  O O   . LEU A 1 32  ? 10.190  7.350   -21.703 1.00 33.95  ? 327 LEU A O   1 
ATOM   152  C CB  . LEU A 1 32  ? 8.519   7.777   -24.593 1.00 36.60  ? 327 LEU A CB  1 
ATOM   153  C CG  . LEU A 1 32  ? 7.342   8.426   -25.329 1.00 38.91  ? 327 LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 32  ? 7.730   8.730   -26.767 1.00 36.41  ? 327 LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 32  ? 6.089   7.545   -25.270 1.00 36.01  ? 327 LEU A CD2 1 
ATOM   156  N N   . TYR A 1 33  ? 9.796   5.508   -22.933 1.00 32.82  ? 328 TYR A N   1 
ATOM   157  C CA  . TYR A 1 33  ? 10.989  4.828   -22.465 1.00 35.04  ? 328 TYR A CA  1 
ATOM   158  C C   . TYR A 1 33  ? 12.050  4.917   -23.538 1.00 34.96  ? 328 TYR A C   1 
ATOM   159  O O   . TYR A 1 33  ? 11.743  5.082   -24.722 1.00 34.63  ? 328 TYR A O   1 
ATOM   160  C CB  . TYR A 1 33  ? 10.680  3.363   -22.129 1.00 42.41  ? 328 TYR A CB  1 
ATOM   161  C CG  . TYR A 1 33  ? 9.824   3.199   -20.893 1.00 46.87  ? 328 TYR A CG  1 
ATOM   162  C CD1 . TYR A 1 33  ? 8.454   3.405   -20.943 1.00 56.40  ? 328 TYR A CD1 1 
ATOM   163  C CD2 . TYR A 1 33  ? 10.388  2.844   -19.675 1.00 47.72  ? 328 TYR A CD2 1 
ATOM   164  C CE1 . TYR A 1 33  ? 7.666   3.263   -19.816 1.00 61.01  ? 328 TYR A CE1 1 
ATOM   165  C CE2 . TYR A 1 33  ? 9.609   2.702   -18.539 1.00 50.34  ? 328 TYR A CE2 1 
ATOM   166  C CZ  . TYR A 1 33  ? 8.249   2.910   -18.617 1.00 58.29  ? 328 TYR A CZ  1 
ATOM   167  O OH  . TYR A 1 33  ? 7.457   2.766   -17.499 1.00 60.87  ? 328 TYR A OH  1 
ATOM   168  N N   . SER A 1 34  ? 13.304  4.824   -23.121 1.00 41.75  ? 329 SER A N   1 
ATOM   169  C CA  . SER A 1 34  ? 14.398  4.764   -24.064 1.00 42.06  ? 329 SER A CA  1 
ATOM   170  C C   . SER A 1 34  ? 14.450  3.349   -24.625 1.00 50.00  ? 329 SER A C   1 
ATOM   171  O O   . SER A 1 34  ? 13.885  2.427   -24.036 1.00 46.49  ? 329 SER A O   1 
ATOM   172  C CB  . SER A 1 34  ? 15.713  5.102   -23.363 1.00 38.35  ? 329 SER A CB  1 
ATOM   173  O OG  . SER A 1 34  ? 16.792  4.980   -24.263 1.00 43.61  ? 329 SER A OG  1 
ATOM   174  N N   . GLU A 1 35  ? 15.116  3.183   -25.764 1.00 49.94  ? 330 GLU A N   1 
ATOM   175  C CA  . GLU A 1 35  ? 15.308  1.865   -26.351 1.00 54.46  ? 330 GLU A CA  1 
ATOM   176  C C   . GLU A 1 35  ? 15.803  0.914   -25.269 1.00 53.23  ? 330 GLU A C   1 
ATOM   177  O O   . GLU A 1 35  ? 16.820  1.170   -24.630 1.00 48.30  ? 330 GLU A O   1 
ATOM   178  C CB  . GLU A 1 35  ? 16.320  1.929   -27.495 1.00 53.56  ? 330 GLU A CB  1 
ATOM   179  N N   . TYR A 1 36  ? 15.081  -0.181  -25.057 1.00 53.41  ? 331 TYR A N   1 
ATOM   180  C CA  . TYR A 1 36  ? 15.392  -1.073  -23.949 1.00 61.10  ? 331 TYR A CA  1 
ATOM   181  C C   . TYR A 1 36  ? 16.749  -1.753  -24.106 1.00 63.60  ? 331 TYR A C   1 
ATOM   182  O O   . TYR A 1 36  ? 17.142  -2.147  -25.205 1.00 68.47  ? 331 TYR A O   1 
ATOM   183  C CB  . TYR A 1 36  ? 14.285  -2.118  -23.767 1.00 73.53  ? 331 TYR A CB  1 
ATOM   184  C CG  . TYR A 1 36  ? 14.425  -2.972  -22.520 1.00 93.20  ? 331 TYR A CG  1 
ATOM   185  C CD1 . TYR A 1 36  ? 15.624  -3.048  -21.834 1.00 102.79 ? 331 TYR A CD1 1 
ATOM   186  C CD2 . TYR A 1 36  ? 13.358  -3.704  -22.033 1.00 106.99 ? 331 TYR A CD2 1 
ATOM   187  C CE1 . TYR A 1 36  ? 15.769  -3.823  -20.708 1.00 110.53 ? 331 TYR A CE1 1 
ATOM   188  C CE2 . TYR A 1 36  ? 13.493  -4.480  -20.902 1.00 114.61 ? 331 TYR A CE2 1 
ATOM   189  C CZ  . TYR A 1 36  ? 14.702  -4.537  -20.242 1.00 113.50 ? 331 TYR A CZ  1 
ATOM   190  O OH  . TYR A 1 36  ? 14.851  -5.308  -19.111 1.00 115.85 ? 331 TYR A OH  1 
ATOM   191  N N   . ASP A 1 37  ? 17.460  -1.866  -22.988 1.00 66.39  ? 332 ASP A N   1 
ATOM   192  C CA  . ASP A 1 37  ? 18.667  -2.683  -22.887 1.00 68.65  ? 332 ASP A CA  1 
ATOM   193  C C   . ASP A 1 37  ? 19.671  -2.362  -23.972 1.00 65.45  ? 332 ASP A C   1 
ATOM   194  O O   . ASP A 1 37  ? 19.949  -3.192  -24.833 1.00 70.13  ? 332 ASP A O   1 
ATOM   195  C CB  . ASP A 1 37  ? 18.320  -4.174  -22.924 1.00 78.95  ? 332 ASP A CB  1 
ATOM   196  C CG  . ASP A 1 37  ? 19.482  -5.053  -22.511 1.00 86.38  ? 332 ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 37  ? 20.583  -4.510  -22.260 1.00 90.40  ? 332 ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 37  ? 19.293  -6.287  -22.436 1.00 87.68  ? 332 ASP A OD2 1 
ATOM   199  N N   . PRO A 1 38  ? 20.220  -1.148  -23.937 1.00 64.78  ? 333 PRO A N   1 
ATOM   200  C CA  . PRO A 1 38  ? 21.297  -0.829  -24.869 1.00 63.59  ? 333 PRO A CA  1 
ATOM   201  C C   . PRO A 1 38  ? 22.616  -1.317  -24.287 1.00 61.20  ? 333 PRO A C   1 
ATOM   202  O O   . PRO A 1 38  ? 22.693  -1.587  -23.085 1.00 57.06  ? 333 PRO A O   1 
ATOM   203  C CB  . PRO A 1 38  ? 21.266  0.699   -24.911 1.00 60.59  ? 333 PRO A CB  1 
ATOM   204  C CG  . PRO A 1 38  ? 20.794  1.094   -23.543 1.00 61.00  ? 333 PRO A CG  1 
ATOM   205  C CD  . PRO A 1 38  ? 19.905  -0.024  -23.037 1.00 65.88  ? 333 PRO A CD  1 
ATOM   206  N N   . THR A 1 39  ? 23.638  -1.438  -25.126 1.00 63.24  ? 334 THR A N   1 
ATOM   207  C CA  . THR A 1 39  ? 24.963  -1.779  -24.635 1.00 65.39  ? 334 THR A CA  1 
ATOM   208  C C   . THR A 1 39  ? 25.384  -0.771  -23.576 1.00 60.25  ? 334 THR A C   1 
ATOM   209  O O   . THR A 1 39  ? 25.289  0.438   -23.784 1.00 54.24  ? 334 THR A O   1 
ATOM   210  C CB  . THR A 1 39  ? 26.012  -1.767  -25.765 1.00 68.15  ? 334 THR A CB  1 
ATOM   211  O OG1 . THR A 1 39  ? 25.635  -2.699  -26.785 1.00 73.20  ? 334 THR A OG1 1 
ATOM   212  C CG2 . THR A 1 39  ? 27.388  -2.139  -25.223 1.00 61.06  ? 334 THR A CG2 1 
ATOM   213  N N   . ARG A 1 40  ? 25.822  -1.275  -22.429 1.00 60.89  ? 335 ARG A N   1 
ATOM   214  C CA  . ARG A 1 40  ? 26.443  -0.436  -21.415 1.00 58.85  ? 335 ARG A CA  1 
ATOM   215  C C   . ARG A 1 40  ? 27.813  -1.029  -21.116 1.00 54.15  ? 335 ARG A C   1 
ATOM   216  O O   . ARG A 1 40  ? 27.950  -2.247  -21.039 1.00 55.18  ? 335 ARG A O   1 
ATOM   217  C CB  . ARG A 1 40  ? 25.587  -0.377  -20.149 1.00 61.38  ? 335 ARG A CB  1 
ATOM   218  C CG  . ARG A 1 40  ? 24.294  0.419   -20.275 1.00 69.50  ? 335 ARG A CG  1 
ATOM   219  C CD  . ARG A 1 40  ? 24.245  1.547   -19.243 1.00 76.79  ? 335 ARG A CD  1 
ATOM   220  N NE  . ARG A 1 40  ? 22.876  1.899   -18.871 1.00 82.81  ? 335 ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 40  ? 22.556  2.852   -18.001 1.00 83.15  ? 335 ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 40  ? 23.510  3.563   -17.412 1.00 79.80  ? 335 ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 40  ? 21.281  3.098   -17.722 1.00 84.95  ? 335 ARG A NH2 1 
ATOM   224  N N   . PRO A 1 41  ? 28.835  -0.175  -20.948 1.00 50.43  ? 336 PRO A N   1 
ATOM   225  C CA  . PRO A 1 41  ? 28.777  1.290   -20.932 1.00 47.40  ? 336 PRO A CA  1 
ATOM   226  C C   . PRO A 1 41  ? 28.448  1.877   -22.297 1.00 51.44  ? 336 PRO A C   1 
ATOM   227  O O   . PRO A 1 41  ? 28.557  1.183   -23.311 1.00 53.03  ? 336 PRO A O   1 
ATOM   228  C CB  . PRO A 1 41  ? 30.209  1.697   -20.540 1.00 48.56  ? 336 PRO A CB  1 
ATOM   229  C CG  . PRO A 1 41  ? 30.867  0.461   -20.051 1.00 50.22  ? 336 PRO A CG  1 
ATOM   230  C CD  . PRO A 1 41  ? 30.213  -0.661  -20.784 1.00 53.31  ? 336 PRO A CD  1 
ATOM   231  N N   . PHE A 1 42  ? 28.052  3.146   -22.312 1.00 46.81  ? 337 PHE A N   1 
ATOM   232  C CA  . PHE A 1 42  ? 27.756  3.846   -23.552 1.00 49.38  ? 337 PHE A CA  1 
ATOM   233  C C   . PHE A 1 42  ? 29.028  4.381   -24.180 1.00 55.60  ? 337 PHE A C   1 
ATOM   234  O O   . PHE A 1 42  ? 30.038  4.566   -23.499 1.00 56.70  ? 337 PHE A O   1 
ATOM   235  C CB  . PHE A 1 42  ? 26.847  5.048   -23.294 1.00 46.23  ? 337 PHE A CB  1 
ATOM   236  C CG  . PHE A 1 42  ? 25.530  4.706   -22.665 1.00 44.01  ? 337 PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 42  ? 24.571  3.997   -23.368 1.00 47.38  ? 337 PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 42  ? 25.239  5.127   -21.377 1.00 47.63  ? 337 PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 42  ? 23.350  3.699   -22.790 1.00 53.76  ? 337 PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 42  ? 24.020  4.835   -20.797 1.00 54.72  ? 337 PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 42  ? 23.074  4.120   -21.505 1.00 54.33  ? 337 PHE A CZ  1 
ATOM   242  N N   . SER A 1 43  ? 28.966  4.630   -25.485 1.00 60.68  ? 338 SER A N   1 
ATOM   243  C CA  . SER A 1 43  ? 29.945  5.470   -26.158 1.00 58.75  ? 338 SER A CA  1 
ATOM   244  C C   . SER A 1 43  ? 29.241  6.781   -26.482 1.00 62.20  ? 338 SER A C   1 
ATOM   245  O O   . SER A 1 43  ? 28.034  6.902   -26.272 1.00 62.12  ? 338 SER A O   1 
ATOM   246  C CB  . SER A 1 43  ? 30.461  4.801   -27.432 1.00 56.51  ? 338 SER A CB  1 
ATOM   247  O OG  . SER A 1 43  ? 29.414  4.588   -28.365 1.00 56.72  ? 338 SER A OG  1 
ATOM   248  N N   . GLU A 1 44  ? 29.989  7.761   -26.981 1.00 67.21  ? 339 GLU A N   1 
ATOM   249  C CA  . GLU A 1 44  ? 29.414  9.059   -27.327 1.00 71.40  ? 339 GLU A CA  1 
ATOM   250  C C   . GLU A 1 44  ? 28.304  8.908   -28.363 1.00 62.03  ? 339 GLU A C   1 
ATOM   251  O O   . GLU A 1 44  ? 27.243  9.523   -28.252 1.00 57.93  ? 339 GLU A O   1 
ATOM   252  C CB  . GLU A 1 44  ? 30.498  10.001  -27.854 1.00 78.47  ? 339 GLU A CB  1 
ATOM   253  N N   . ALA A 1 45  ? 28.556  8.075   -29.366 1.00 57.03  ? 340 ALA A N   1 
ATOM   254  C CA  . ALA A 1 45  ? 27.590  7.830   -30.427 1.00 54.36  ? 340 ALA A CA  1 
ATOM   255  C C   . ALA A 1 45  ? 26.371  7.059   -29.926 1.00 48.94  ? 340 ALA A C   1 
ATOM   256  O O   . ALA A 1 45  ? 25.239  7.396   -30.267 1.00 49.81  ? 340 ALA A O   1 
ATOM   257  C CB  . ALA A 1 45  ? 28.251  7.085   -31.582 1.00 54.73  ? 340 ALA A CB  1 
ATOM   258  N N   . SER A 1 46  ? 26.603  6.024   -29.122 1.00 44.84  ? 341 SER A N   1 
ATOM   259  C CA  . SER A 1 46  ? 25.507  5.184   -28.649 1.00 44.10  ? 341 SER A CA  1 
ATOM   260  C C   . SER A 1 46  ? 24.510  5.984   -27.817 1.00 42.18  ? 341 SER A C   1 
ATOM   261  O O   . SER A 1 46  ? 23.298  5.842   -27.982 1.00 45.41  ? 341 SER A O   1 
ATOM   262  C CB  . SER A 1 46  ? 26.027  3.987   -27.847 1.00 42.75  ? 341 SER A CB  1 
ATOM   263  O OG  . SER A 1 46  ? 26.350  4.362   -26.518 1.00 46.63  ? 341 SER A OG  1 
ATOM   264  N N   . MET A 1 47  ? 25.009  6.830   -26.923 1.00 41.80  ? 342 MET A N   1 
ATOM   265  C CA  . MET A 1 47  ? 24.104  7.634   -26.110 1.00 44.96  ? 342 MET A CA  1 
ATOM   266  C C   . MET A 1 47  ? 23.292  8.582   -26.993 1.00 45.16  ? 342 MET A C   1 
ATOM   267  O O   . MET A 1 47  ? 22.076  8.690   -26.847 1.00 42.65  ? 342 MET A O   1 
ATOM   268  C CB  . MET A 1 47  ? 24.858  8.416   -25.040 1.00 48.59  ? 342 MET A CB  1 
ATOM   269  C CG  . MET A 1 47  ? 23.960  8.878   -23.905 1.00 49.53  ? 342 MET A CG  1 
ATOM   270  S SD  . MET A 1 47  ? 24.717  10.150  -22.885 1.00 76.90  ? 342 MET A SD  1 
ATOM   271  C CE  . MET A 1 47  ? 24.791  11.513  -24.046 1.00 60.21  ? 342 MET A CE  1 
ATOM   272  N N   . MET A 1 48  ? 23.976  9.264   -27.907 1.00 46.27  ? 343 MET A N   1 
ATOM   273  C CA  . MET A 1 48  ? 23.318  10.156  -28.853 1.00 41.73  ? 343 MET A CA  1 
ATOM   274  C C   . MET A 1 48  ? 22.239  9.418   -29.635 1.00 41.52  ? 343 MET A C   1 
ATOM   275  O O   . MET A 1 48  ? 21.158  9.951   -29.876 1.00 43.94  ? 343 MET A O   1 
ATOM   276  C CB  . MET A 1 48  ? 24.334  10.774  -29.816 1.00 50.71  ? 343 MET A CB  1 
ATOM   277  C CG  . MET A 1 48  ? 25.173  11.894  -29.202 1.00 57.58  ? 343 MET A CG  1 
ATOM   278  S SD  . MET A 1 48  ? 24.143  13.155  -28.425 1.00 78.85  ? 343 MET A SD  1 
ATOM   279  C CE  . MET A 1 48  ? 22.924  13.429  -29.709 1.00 38.36  ? 343 MET A CE  1 
ATOM   280  N N   . GLY A 1 49  ? 22.542  8.187   -30.031 1.00 37.55  ? 344 GLY A N   1 
ATOM   281  C CA  . GLY A 1 49  ? 21.579  7.359   -30.735 1.00 41.39  ? 344 GLY A CA  1 
ATOM   282  C C   . GLY A 1 49  ? 20.344  7.135   -29.891 1.00 37.37  ? 344 GLY A C   1 
ATOM   283  O O   . GLY A 1 49  ? 19.220  7.163   -30.387 1.00 38.31  ? 344 GLY A O   1 
ATOM   284  N N   . LEU A 1 50  ? 20.558  6.921   -28.596 1.00 38.65  ? 345 LEU A N   1 
ATOM   285  C CA  . LEU A 1 50  ? 19.457  6.729   -27.664 1.00 35.59  ? 345 LEU A CA  1 
ATOM   286  C C   . LEU A 1 50  ? 18.653  8.012   -27.462 1.00 35.27  ? 345 LEU A C   1 
ATOM   287  O O   . LEU A 1 50  ? 17.423  7.987   -27.471 1.00 37.53  ? 345 LEU A O   1 
ATOM   288  C CB  . LEU A 1 50  ? 19.974  6.212   -26.322 1.00 37.40  ? 345 LEU A CB  1 
ATOM   289  C CG  . LEU A 1 50  ? 20.357  4.730   -26.300 1.00 46.11  ? 345 LEU A CG  1 
ATOM   290  C CD1 . LEU A 1 50  ? 20.900  4.344   -24.937 1.00 43.31  ? 345 LEU A CD1 1 
ATOM   291  C CD2 . LEU A 1 50  ? 19.159  3.863   -26.664 1.00 48.29  ? 345 LEU A CD2 1 
ATOM   292  N N   . LEU A 1 51  ? 19.347  9.130   -27.275 1.00 33.78  ? 346 LEU A N   1 
ATOM   293  C CA  . LEU A 1 51  ? 18.680  10.403  -27.031 1.00 35.53  ? 346 LEU A CA  1 
ATOM   294  C C   . LEU A 1 51  ? 17.899  10.840  -28.266 1.00 32.84  ? 346 LEU A C   1 
ATOM   295  O O   . LEU A 1 51  ? 16.768  11.310  -28.166 1.00 41.56  ? 346 LEU A O   1 
ATOM   296  C CB  . LEU A 1 51  ? 19.698  11.480  -26.645 1.00 37.38  ? 346 LEU A CB  1 
ATOM   297  C CG  . LEU A 1 51  ? 20.483  11.258  -25.357 1.00 38.42  ? 346 LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 51  ? 21.499  12.374  -25.154 1.00 42.74  ? 346 LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 51  ? 19.537  11.181  -24.179 1.00 37.18  ? 346 LEU A CD2 1 
ATOM   300  N N   . THR A 1 52  ? 18.519  10.685  -29.430 1.00 36.74  ? 347 THR A N   1 
ATOM   301  C CA  . THR A 1 52  ? 17.903  11.058  -30.697 1.00 37.71  ? 347 THR A CA  1 
ATOM   302  C C   . THR A 1 52  ? 16.658  10.229  -30.995 1.00 38.45  ? 347 THR A C   1 
ATOM   303  O O   . THR A 1 52  ? 15.617  10.762  -31.400 1.00 33.94  ? 347 THR A O   1 
ATOM   304  C CB  . THR A 1 52  ? 18.905  10.889  -31.853 1.00 44.26  ? 347 THR A CB  1 
ATOM   305  O OG1 . THR A 1 52  ? 19.824  11.990  -31.845 1.00 55.48  ? 347 THR A OG1 1 
ATOM   306  C CG2 . THR A 1 52  ? 18.180  10.850  -33.185 1.00 51.98  ? 347 THR A CG2 1 
ATOM   307  N N   . ASN A 1 53  ? 16.769  8.919   -30.797 1.00 32.72  ? 348 ASN A N   1 
ATOM   308  C CA  . ASN A 1 53  ? 15.635  8.031   -31.016 1.00 30.40  ? 348 ASN A CA  1 
ATOM   309  C C   . ASN A 1 53  ? 14.488  8.414   -30.106 1.00 30.29  ? 348 ASN A C   1 
ATOM   310  O O   . ASN A 1 53  ? 13.336  8.502   -30.532 1.00 36.85  ? 348 ASN A O   1 
ATOM   311  C CB  . ASN A 1 53  ? 16.021  6.577   -30.749 1.00 31.25  ? 348 ASN A CB  1 
ATOM   312  C CG  . ASN A 1 53  ? 14.826  5.649   -30.797 1.00 40.44  ? 348 ASN A CG  1 
ATOM   313  O OD1 . ASN A 1 53  ? 14.248  5.308   -29.765 1.00 39.81  ? 348 ASN A OD1 1 
ATOM   314  N ND2 . ASN A 1 53  ? 14.433  5.256   -32.003 1.00 38.89  ? 348 ASN A ND2 1 
ATOM   315  N N   . LEU A 1 54  ? 14.814  8.647   -28.840 1.00 28.98  ? 349 LEU A N   1 
ATOM   316  C CA  . LEU A 1 54  ? 13.823  9.063   -27.863 1.00 25.86  ? 349 LEU A CA  1 
ATOM   317  C C   . LEU A 1 54  ? 13.143  10.365  -28.292 1.00 31.52  ? 349 LEU A C   1 
ATOM   318  O O   . LEU A 1 54  ? 11.910  10.458  -28.322 1.00 32.75  ? 349 LEU A O   1 
ATOM   319  C CB  . LEU A 1 54  ? 14.471  9.219   -26.491 1.00 24.98  ? 349 LEU A CB  1 
ATOM   320  C CG  . LEU A 1 54  ? 13.553  9.699   -25.369 1.00 31.39  ? 349 LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 54  ? 12.370  8.755   -25.181 1.00 32.42  ? 349 LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 54  ? 14.344  9.840   -24.076 1.00 28.31  ? 349 LEU A CD2 1 
ATOM   323  N N   . ALA A 1 55  ? 13.945  11.368  -28.636 1.00 32.07  ? 350 ALA A N   1 
ATOM   324  C CA  . ALA A 1 55  ? 13.391  12.658  -29.050 1.00 32.20  ? 350 ALA A CA  1 
ATOM   325  C C   . ALA A 1 55  ? 12.490  12.506  -30.272 1.00 31.63  ? 350 ALA A C   1 
ATOM   326  O O   . ALA A 1 55  ? 11.418  13.107  -30.340 1.00 36.79  ? 350 ALA A O   1 
ATOM   327  C CB  . ALA A 1 55  ? 14.502  13.660  -29.327 1.00 31.64  ? 350 ALA A CB  1 
ATOM   328  N N   . ASP A 1 56  ? 12.928  11.696  -31.229 1.00 34.48  ? 351 ASP A N   1 
ATOM   329  C CA  . ASP A 1 56  ? 12.147  11.461  -32.439 1.00 44.81  ? 351 ASP A CA  1 
ATOM   330  C C   . ASP A 1 56  ? 10.767  10.911  -32.096 1.00 42.04  ? 351 ASP A C   1 
ATOM   331  O O   . ASP A 1 56  ? 9.758   11.312  -32.679 1.00 39.45  ? 351 ASP A O   1 
ATOM   332  C CB  . ASP A 1 56  ? 12.877  10.500  -33.385 1.00 53.80  ? 351 ASP A CB  1 
ATOM   333  C CG  . ASP A 1 56  ? 14.018  11.169  -34.130 1.00 73.05  ? 351 ASP A CG  1 
ATOM   334  O OD1 . ASP A 1 56  ? 14.110  12.415  -34.079 1.00 79.79  ? 351 ASP A OD1 1 
ATOM   335  O OD2 . ASP A 1 56  ? 14.822  10.452  -34.770 1.00 80.53  ? 351 ASP A OD2 1 
ATOM   336  N N   . ARG A 1 57  ? 10.724  9.994   -31.140 1.00 36.05  ? 352 ARG A N   1 
ATOM   337  C CA  . ARG A 1 57  ? 9.466   9.382   -30.756 1.00 31.35  ? 352 ARG A CA  1 
ATOM   338  C C   . ARG A 1 57  ? 8.588   10.346  -29.973 1.00 32.36  ? 352 ARG A C   1 
ATOM   339  O O   . ARG A 1 57  ? 7.361   10.296  -30.066 1.00 37.03  ? 352 ARG A O   1 
ATOM   340  C CB  . ARG A 1 57  ? 9.715   8.084   -29.981 1.00 33.59  ? 352 ARG A CB  1 
ATOM   341  C CG  . ARG A 1 57  ? 10.096  6.921   -30.882 1.00 30.10  ? 352 ARG A CG  1 
ATOM   342  C CD  . ARG A 1 57  ? 10.252  5.628   -30.111 1.00 26.07  ? 352 ARG A CD  1 
ATOM   343  N NE  . ARG A 1 57  ? 11.497  5.584   -29.352 1.00 34.53  ? 352 ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 57  ? 11.556  5.479   -28.029 1.00 34.26  ? 352 ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 57  ? 10.437  5.420   -27.320 1.00 24.44  ? 352 ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 57  ? 12.731  5.436   -27.419 1.00 35.47  ? 352 ARG A NH2 1 
ATOM   347  N N   . GLU A 1 58  ? 9.210   11.246  -29.223 1.00 31.39  ? 353 GLU A N   1 
ATOM   348  C CA  . GLU A 1 58  ? 8.448   12.241  -28.472 1.00 33.52  ? 353 GLU A CA  1 
ATOM   349  C C   . GLU A 1 58  ? 7.868   13.325  -29.371 1.00 35.95  ? 353 GLU A C   1 
ATOM   350  O O   . GLU A 1 58  ? 6.859   13.947  -29.033 1.00 30.45  ? 353 GLU A O   1 
ATOM   351  C CB  . GLU A 1 58  ? 9.318   12.897  -27.400 1.00 34.03  ? 353 GLU A CB  1 
ATOM   352  C CG  . GLU A 1 58  ? 9.752   11.954  -26.296 1.00 37.12  ? 353 GLU A CG  1 
ATOM   353  C CD  . GLU A 1 58  ? 10.508  12.674  -25.202 1.00 38.92  ? 353 GLU A CD  1 
ATOM   354  O OE1 . GLU A 1 58  ? 11.749  12.797  -25.317 1.00 33.48  ? 353 GLU A OE1 1 
ATOM   355  O OE2 . GLU A 1 58  ? 9.863   13.126  -24.232 1.00 44.48  ? 353 GLU A OE2 1 
ATOM   356  N N   . LEU A 1 59  ? 8.509   13.561  -30.510 1.00 36.48  ? 354 LEU A N   1 
ATOM   357  C CA  . LEU A 1 59  ? 8.079   14.642  -31.384 1.00 36.51  ? 354 LEU A CA  1 
ATOM   358  C C   . LEU A 1 59  ? 6.632   14.420  -31.812 1.00 34.28  ? 354 LEU A C   1 
ATOM   359  O O   . LEU A 1 59  ? 5.815   15.347  -31.813 1.00 34.04  ? 354 LEU A O   1 
ATOM   360  C CB  . LEU A 1 59  ? 8.988   14.743  -32.606 1.00 46.02  ? 354 LEU A CB  1 
ATOM   361  C CG  . LEU A 1 59  ? 9.022   16.120  -33.270 1.00 54.24  ? 354 LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 59  ? 9.338   17.193  -32.239 1.00 53.35  ? 354 LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 59  ? 10.038  16.140  -34.394 1.00 60.72  ? 354 LEU A CD2 1 
ATOM   364  N N   . VAL A 1 60  ? 6.315   13.181  -32.161 1.00 29.99  ? 355 VAL A N   1 
ATOM   365  C CA  . VAL A 1 60  ? 4.967   12.838  -32.583 1.00 32.04  ? 355 VAL A CA  1 
ATOM   366  C C   . VAL A 1 60  ? 3.967   13.248  -31.510 1.00 30.61  ? 355 VAL A C   1 
ATOM   367  O O   . VAL A 1 60  ? 2.966   13.907  -31.791 1.00 30.75  ? 355 VAL A O   1 
ATOM   368  C CB  . VAL A 1 60  ? 4.851   11.327  -32.846 1.00 37.06  ? 355 VAL A CB  1 
ATOM   369  C CG1 . VAL A 1 60  ? 3.529   11.015  -33.526 1.00 41.53  ? 355 VAL A CG1 1 
ATOM   370  C CG2 . VAL A 1 60  ? 6.032   10.859  -33.699 1.00 41.24  ? 355 VAL A CG2 1 
ATOM   371  N N   . HIS A 1 61  ? 4.257   12.868  -30.270 1.00 26.30  ? 356 HIS A N   1 
ATOM   372  C CA  . HIS A 1 61  ? 3.388   13.205  -29.151 1.00 22.77  ? 356 HIS A CA  1 
ATOM   373  C C   . HIS A 1 61  ? 3.359   14.698  -28.852 1.00 31.80  ? 356 HIS A C   1 
ATOM   374  O O   . HIS A 1 61  ? 2.387   15.204  -28.289 1.00 34.36  ? 356 HIS A O   1 
ATOM   375  C CB  . HIS A 1 61  ? 3.807   12.419  -27.915 1.00 28.47  ? 356 HIS A CB  1 
ATOM   376  C CG  . HIS A 1 61  ? 3.691   10.940  -28.091 1.00 29.77  ? 356 HIS A CG  1 
ATOM   377  N ND1 . HIS A 1 61  ? 2.492   10.266  -27.947 1.00 31.20  ? 356 HIS A ND1 1 
ATOM   378  C CD2 . HIS A 1 61  ? 4.607   10.002  -28.434 1.00 33.02  ? 356 HIS A CD2 1 
ATOM   379  C CE1 . HIS A 1 61  ? 2.688   8.973   -28.178 1.00 38.71  ? 356 HIS A CE1 1 
ATOM   380  N NE2 . HIS A 1 61  ? 3.961   8.794   -28.478 1.00 39.65  ? 356 HIS A NE2 1 
ATOM   381  N N   . MET A 1 62  ? 4.421   15.405  -29.226 1.00 33.52  ? 357 MET A N   1 
ATOM   382  C CA  . MET A 1 62  ? 4.491   16.842  -28.975 1.00 26.57  ? 357 MET A CA  1 
ATOM   383  C C   . MET A 1 62  ? 3.511   17.571  -29.886 1.00 28.31  ? 357 MET A C   1 
ATOM   384  O O   . MET A 1 62  ? 2.843   18.522  -29.463 1.00 27.29  ? 357 MET A O   1 
ATOM   385  C CB  . MET A 1 62  ? 5.923   17.369  -29.176 1.00 21.90  ? 357 MET A CB  1 
ATOM   386  C CG  . MET A 1 62  ? 6.127   18.810  -28.728 1.00 31.27  ? 357 MET A CG  1 
ATOM   387  S SD  . MET A 1 62  ? 7.713   19.500  -29.264 1.00 32.84  ? 357 MET A SD  1 
ATOM   388  C CE  . MET A 1 62  ? 8.879   18.422  -28.425 1.00 34.11  ? 357 MET A CE  1 
ATOM   389  N N   . ILE A 1 63  ? 3.422   17.122  -31.136 1.00 30.28  ? 358 ILE A N   1 
ATOM   390  C CA  . ILE A 1 63  ? 2.440   17.662  -32.071 1.00 35.44  ? 358 ILE A CA  1 
ATOM   391  C C   . ILE A 1 63  ? 1.032   17.524  -31.501 1.00 38.31  ? 358 ILE A C   1 
ATOM   392  O O   . ILE A 1 63  ? 0.249   18.481  -31.505 1.00 35.49  ? 358 ILE A O   1 
ATOM   393  C CB  . ILE A 1 63  ? 2.479   16.940  -33.435 1.00 40.14  ? 358 ILE A CB  1 
ATOM   394  C CG1 . ILE A 1 63  ? 3.893   16.950  -34.008 1.00 44.87  ? 358 ILE A CG1 1 
ATOM   395  C CG2 . ILE A 1 63  ? 1.519   17.598  -34.411 1.00 39.11  ? 358 ILE A CG2 1 
ATOM   396  C CD1 . ILE A 1 63  ? 4.497   18.314  -34.090 1.00 37.51  ? 358 ILE A CD1 1 
ATOM   397  N N   . ASN A 1 64  ? 0.712   16.324  -31.026 1.00 36.38  ? 359 ASN A N   1 
ATOM   398  C CA  . ASN A 1 64  ? -0.595  16.056  -30.444 1.00 33.21  ? 359 ASN A CA  1 
ATOM   399  C C   . ASN A 1 64  ? -0.856  17.018  -29.306 1.00 29.77  ? 359 ASN A C   1 
ATOM   400  O O   . ASN A 1 64  ? -1.930  17.608  -29.205 1.00 34.58  ? 359 ASN A O   1 
ATOM   401  C CB  . ASN A 1 64  ? -0.679  14.611  -29.928 1.00 32.52  ? 359 ASN A CB  1 
ATOM   402  C CG  . ASN A 1 64  ? -0.751  13.594  -31.049 1.00 39.02  ? 359 ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 64  ? -1.026  13.939  -32.202 1.00 37.64  ? 359 ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 64  ? -0.507  12.324  -30.716 1.00 32.47  ? 359 ASN A ND2 1 
ATOM   405  N N   . TRP A 1 65  ? 0.146   17.178  -28.453 1.00 33.70  ? 360 TRP A N   1 
ATOM   406  C CA  . TRP A 1 65  ? 0.051   18.111  -27.337 1.00 35.88  ? 360 TRP A CA  1 
ATOM   407  C C   . TRP A 1 65  ? -0.179  19.525  -27.837 1.00 30.82  ? 360 TRP A C   1 
ATOM   408  O O   . TRP A 1 65  ? -1.112  20.195  -27.401 1.00 32.37  ? 360 TRP A O   1 
ATOM   409  C CB  . TRP A 1 65  ? 1.318   18.061  -26.477 1.00 30.61  ? 360 TRP A CB  1 
ATOM   410  C CG  . TRP A 1 65  ? 1.473   19.250  -25.574 1.00 34.64  ? 360 TRP A CG  1 
ATOM   411  C CD1 . TRP A 1 65  ? 0.797   19.495  -24.409 1.00 30.21  ? 360 TRP A CD1 1 
ATOM   412  C CD2 . TRP A 1 65  ? 2.368   20.350  -25.762 1.00 32.81  ? 360 TRP A CD2 1 
ATOM   413  N NE1 . TRP A 1 65  ? 1.219   20.684  -23.865 1.00 30.28  ? 360 TRP A NE1 1 
ATOM   414  C CE2 . TRP A 1 65  ? 2.181   21.226  -24.671 1.00 28.39  ? 360 TRP A CE2 1 
ATOM   415  C CE3 . TRP A 1 65  ? 3.310   20.682  -26.738 1.00 36.46  ? 360 TRP A CE3 1 
ATOM   416  C CZ2 . TRP A 1 65  ? 2.898   22.413  -24.545 1.00 25.56  ? 360 TRP A CZ2 1 
ATOM   417  C CZ3 . TRP A 1 65  ? 4.025   21.861  -26.603 1.00 30.54  ? 360 TRP A CZ3 1 
ATOM   418  C CH2 . TRP A 1 65  ? 3.813   22.710  -25.517 1.00 29.32  ? 360 TRP A CH2 1 
ATOM   419  N N   . ALA A 1 66  ? 0.683   19.973  -28.744 1.00 30.90  ? 361 ALA A N   1 
ATOM   420  C CA  . ALA A 1 66  ? 0.622   21.328  -29.272 1.00 33.10  ? 361 ALA A CA  1 
ATOM   421  C C   . ALA A 1 66  ? -0.771  21.695  -29.777 1.00 36.41  ? 361 ALA A C   1 
ATOM   422  O O   . ALA A 1 66  ? -1.293  22.767  -29.464 1.00 42.88  ? 361 ALA A O   1 
ATOM   423  C CB  . ALA A 1 66  ? 1.650   21.502  -30.381 1.00 31.08  ? 361 ALA A CB  1 
ATOM   424  N N   . LYS A 1 67  ? -1.367  20.801  -30.557 1.00 36.39  ? 362 LYS A N   1 
ATOM   425  C CA  . LYS A 1 67  ? -2.697  21.027  -31.128 1.00 31.26  ? 362 LYS A CA  1 
ATOM   426  C C   . LYS A 1 67  ? -3.770  21.244  -30.064 1.00 33.32  ? 362 LYS A C   1 
ATOM   427  O O   . LYS A 1 67  ? -4.820  21.828  -30.338 1.00 37.51  ? 362 LYS A O   1 
ATOM   428  C CB  . LYS A 1 67  ? -3.090  19.844  -32.011 1.00 35.08  ? 362 LYS A CB  1 
ATOM   429  C CG  . LYS A 1 67  ? -2.274  19.704  -33.277 1.00 40.67  ? 362 LYS A CG  1 
ATOM   430  C CD  . LYS A 1 67  ? -2.429  18.302  -33.838 1.00 57.05  ? 362 LYS A CD  1 
ATOM   431  C CE  . LYS A 1 67  ? -2.363  18.304  -35.352 1.00 69.66  ? 362 LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 67  ? -3.447  19.142  -35.945 1.00 74.77  ? 362 LYS A NZ  1 
ATOM   433  N N   . ARG A 1 68  ? -3.507  20.764  -28.852 1.00 30.30  ? 363 ARG A N   1 
ATOM   434  C CA  . ARG A 1 68  ? -4.440  20.931  -27.742 1.00 33.08  ? 363 ARG A CA  1 
ATOM   435  C C   . ARG A 1 68  ? -4.134  22.149  -26.857 1.00 36.71  ? 363 ARG A C   1 
ATOM   436  O O   . ARG A 1 68  ? -4.890  22.458  -25.935 1.00 42.17  ? 363 ARG A O   1 
ATOM   437  C CB  . ARG A 1 68  ? -4.498  19.657  -26.906 1.00 35.68  ? 363 ARG A CB  1 
ATOM   438  C CG  . ARG A 1 68  ? -5.009  18.463  -27.691 1.00 44.81  ? 363 ARG A CG  1 
ATOM   439  C CD  . ARG A 1 68  ? -5.157  17.241  -26.817 1.00 53.53  ? 363 ARG A CD  1 
ATOM   440  N NE  . ARG A 1 68  ? -5.999  17.517  -25.659 1.00 63.26  ? 363 ARG A NE  1 
ATOM   441  C CZ  . ARG A 1 68  ? -6.384  16.597  -24.782 1.00 68.17  ? 363 ARG A CZ  1 
ATOM   442  N NH1 . ARG A 1 68  ? -6.005  15.334  -24.935 1.00 69.39  ? 363 ARG A NH1 1 
ATOM   443  N NH2 . ARG A 1 68  ? -7.149  16.941  -23.755 1.00 68.08  ? 363 ARG A NH2 1 
ATOM   444  N N   . VAL A 1 69  ? -3.027  22.831  -27.126 1.00 31.45  ? 364 VAL A N   1 
ATOM   445  C CA  . VAL A 1 69  ? -2.732  24.074  -26.421 1.00 28.15  ? 364 VAL A CA  1 
ATOM   446  C C   . VAL A 1 69  ? -3.714  25.119  -26.921 1.00 32.91  ? 364 VAL A C   1 
ATOM   447  O O   . VAL A 1 69  ? -3.739  25.432  -28.113 1.00 35.37  ? 364 VAL A O   1 
ATOM   448  C CB  . VAL A 1 69  ? -1.281  24.560  -26.670 1.00 29.49  ? 364 VAL A CB  1 
ATOM   449  C CG1 . VAL A 1 69  ? -1.040  25.912  -26.001 1.00 29.43  ? 364 VAL A CG1 1 
ATOM   450  C CG2 . VAL A 1 69  ? -0.280  23.539  -26.157 1.00 26.01  ? 364 VAL A CG2 1 
ATOM   451  N N   . PRO A 1 70  ? -4.547  25.652  -26.019 1.00 37.23  ? 365 PRO A N   1 
ATOM   452  C CA  . PRO A 1 70  ? -5.564  26.613  -26.455 1.00 36.57  ? 365 PRO A CA  1 
ATOM   453  C C   . PRO A 1 70  ? -4.966  27.718  -27.314 1.00 37.86  ? 365 PRO A C   1 
ATOM   454  O O   . PRO A 1 70  ? -4.009  28.380  -26.900 1.00 36.65  ? 365 PRO A O   1 
ATOM   455  C CB  . PRO A 1 70  ? -6.089  27.179  -25.133 1.00 40.26  ? 365 PRO A CB  1 
ATOM   456  C CG  . PRO A 1 70  ? -5.904  26.060  -24.160 1.00 39.70  ? 365 PRO A CG  1 
ATOM   457  C CD  . PRO A 1 70  ? -4.609  25.395  -24.570 1.00 38.06  ? 365 PRO A CD  1 
ATOM   458  N N   . GLY A 1 71  ? -5.516  27.907  -28.509 1.00 36.45  ? 366 GLY A N   1 
ATOM   459  C CA  . GLY A 1 71  ? -5.077  28.983  -29.383 1.00 37.08  ? 366 GLY A CA  1 
ATOM   460  C C   . GLY A 1 71  ? -4.098  28.561  -30.465 1.00 40.60  ? 366 GLY A C   1 
ATOM   461  O O   . GLY A 1 71  ? -3.944  29.260  -31.467 1.00 43.29  ? 366 GLY A O   1 
ATOM   462  N N   . PHE A 1 72  ? -3.439  27.420  -30.278 1.00 38.63  ? 367 PHE A N   1 
ATOM   463  C CA  . PHE A 1 72  ? -2.425  26.976  -31.234 1.00 38.68  ? 367 PHE A CA  1 
ATOM   464  C C   . PHE A 1 72  ? -2.992  26.710  -32.623 1.00 38.67  ? 367 PHE A C   1 
ATOM   465  O O   . PHE A 1 72  ? -2.411  27.136  -33.617 1.00 36.62  ? 367 PHE A O   1 
ATOM   466  C CB  . PHE A 1 72  ? -1.688  25.738  -30.725 1.00 33.83  ? 367 PHE A CB  1 
ATOM   467  C CG  . PHE A 1 72  ? -0.472  25.381  -31.534 1.00 32.08  ? 367 PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 72  ? 0.685   26.142  -31.441 1.00 33.39  ? 367 PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 72  ? -0.478  24.279  -32.378 1.00 33.24  ? 367 PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 72  ? 1.819   25.812  -32.173 1.00 28.29  ? 367 PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 72  ? 0.653   23.943  -33.121 1.00 32.77  ? 367 PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 72  ? 1.799   24.713  -33.016 1.00 34.55  ? 367 PHE A CZ  1 
ATOM   473  N N   . VAL A 1 73  ? -4.124  26.013  -32.692 1.00 39.03  ? 368 VAL A N   1 
ATOM   474  C CA  . VAL A 1 73  ? -4.719  25.670  -33.983 1.00 46.19  ? 368 VAL A CA  1 
ATOM   475  C C   . VAL A 1 73  ? -5.418  26.852  -34.663 1.00 45.53  ? 368 VAL A C   1 
ATOM   476  O O   . VAL A 1 73  ? -5.823  26.751  -35.820 1.00 47.24  ? 368 VAL A O   1 
ATOM   477  C CB  . VAL A 1 73  ? -5.718  24.492  -33.874 1.00 50.01  ? 368 VAL A CB  1 
ATOM   478  C CG1 . VAL A 1 73  ? -5.005  23.233  -33.395 1.00 50.44  ? 368 VAL A CG1 1 
ATOM   479  C CG2 . VAL A 1 73  ? -6.878  24.855  -32.954 1.00 40.94  ? 368 VAL A CG2 1 
ATOM   480  N N   . ASP A 1 74  ? -5.567  27.962  -33.947 1.00 40.87  ? 369 ASP A N   1 
ATOM   481  C CA  . ASP A 1 74  ? -6.136  29.170  -34.541 1.00 44.00  ? 369 ASP A CA  1 
ATOM   482  C C   . ASP A 1 74  ? -5.161  29.775  -35.544 1.00 45.45  ? 369 ASP A C   1 
ATOM   483  O O   . ASP A 1 74  ? -5.543  30.593  -36.383 1.00 44.12  ? 369 ASP A O   1 
ATOM   484  C CB  . ASP A 1 74  ? -6.480  30.198  -33.461 1.00 45.48  ? 369 ASP A CB  1 
ATOM   485  C CG  . ASP A 1 74  ? -7.589  29.728  -32.541 1.00 49.01  ? 369 ASP A CG  1 
ATOM   486  O OD1 . ASP A 1 74  ? -8.438  28.930  -32.994 1.00 53.99  ? 369 ASP A OD1 1 
ATOM   487  O OD2 . ASP A 1 74  ? -7.618  30.165  -31.370 1.00 49.85  ? 369 ASP A OD2 1 
ATOM   488  N N   . LEU A 1 75  ? -3.900  29.361  -35.452 1.00 46.28  ? 370 LEU A N   1 
ATOM   489  C CA  . LEU A 1 75  ? -2.842  29.876  -36.317 1.00 33.70  ? 370 LEU A CA  1 
ATOM   490  C C   . LEU A 1 75  ? -2.810  29.132  -37.644 1.00 40.22  ? 370 LEU A C   1 
ATOM   491  O O   . LEU A 1 75  ? -3.352  28.028  -37.763 1.00 42.91  ? 370 LEU A O   1 
ATOM   492  C CB  . LEU A 1 75  ? -1.485  29.742  -35.621 1.00 36.52  ? 370 LEU A CB  1 
ATOM   493  C CG  . LEU A 1 75  ? -1.318  30.433  -34.265 1.00 40.95  ? 370 LEU A CG  1 
ATOM   494  C CD1 . LEU A 1 75  ? -0.071  29.930  -33.535 1.00 39.01  ? 370 LEU A CD1 1 
ATOM   495  C CD2 . LEU A 1 75  ? -1.282  31.951  -34.425 1.00 37.22  ? 370 LEU A CD2 1 
ATOM   496  N N   . THR A 1 76  ? -2.175  29.730  -38.647 1.00 31.54  ? 371 THR A N   1 
ATOM   497  C CA  . THR A 1 76  ? -1.996  29.037  -39.914 1.00 37.72  ? 371 THR A CA  1 
ATOM   498  C C   . THR A 1 76  ? -1.030  27.877  -39.695 1.00 42.25  ? 371 THR A C   1 
ATOM   499  O O   . THR A 1 76  ? -0.261  27.873  -38.727 1.00 38.92  ? 371 THR A O   1 
ATOM   500  C CB  . THR A 1 76  ? -1.424  29.961  -41.002 1.00 41.90  ? 371 THR A CB  1 
ATOM   501  O OG1 . THR A 1 76  ? -0.077  30.319  -40.666 1.00 47.51  ? 371 THR A OG1 1 
ATOM   502  C CG2 . THR A 1 76  ? -2.268  31.218  -41.146 1.00 38.53  ? 371 THR A CG2 1 
ATOM   503  N N   . ARG A 1 77  ? -1.075  26.894  -40.591 1.00 41.76  ? 372 ARG A N   1 
ATOM   504  C CA  . ARG A 1 77  ? -0.188  25.741  -40.505 1.00 43.09  ? 372 ARG A CA  1 
ATOM   505  C C   . ARG A 1 77  ? 1.271   26.204  -40.529 1.00 41.74  ? 372 ARG A C   1 
ATOM   506  O O   . ARG A 1 77  ? 2.111   25.686  -39.792 1.00 39.24  ? 372 ARG A O   1 
ATOM   507  N N   . HIS A 1 78  ? 1.565   27.185  -41.376 1.00 37.76  ? 373 HIS A N   1 
ATOM   508  C CA  . HIS A 1 78  ? 2.923   27.699  -41.492 1.00 42.59  ? 373 HIS A CA  1 
ATOM   509  C C   . HIS A 1 78  ? 3.429   28.199  -40.147 1.00 35.93  ? 373 HIS A C   1 
ATOM   510  O O   . HIS A 1 78  ? 4.530   27.867  -39.727 1.00 35.28  ? 373 HIS A O   1 
ATOM   511  C CB  . HIS A 1 78  ? 3.001   28.821  -42.528 1.00 39.50  ? 373 HIS A CB  1 
ATOM   512  C CG  . HIS A 1 78  ? 4.374   29.400  -42.682 0.72 37.37  ? 373 HIS A CG  1 
ATOM   513  N ND1 . HIS A 1 78  ? 4.684   30.689  -42.306 0.45 36.75  ? 373 HIS A ND1 1 
ATOM   514  C CD2 . HIS A 1 78  ? 5.521   28.861  -43.159 1.00 36.38  ? 373 HIS A CD2 1 
ATOM   515  C CE1 . HIS A 1 78  ? 5.961   30.924  -42.557 0.84 33.16  ? 373 HIS A CE1 1 
ATOM   516  N NE2 . HIS A 1 78  ? 6.492   29.828  -43.072 0.42 34.85  ? 373 HIS A NE2 1 
ATOM   517  N N   . ASP A 1 79  ? 2.614   28.996  -39.470 1.00 35.85  ? 374 ASP A N   1 
ATOM   518  C CA  . ASP A 1 79  ? 2.994   29.544  -38.175 1.00 33.38  ? 374 ASP A CA  1 
ATOM   519  C C   . ASP A 1 79  ? 3.056   28.458  -37.112 1.00 35.46  ? 374 ASP A C   1 
ATOM   520  O O   . ASP A 1 79  ? 3.896   28.506  -36.216 1.00 30.29  ? 374 ASP A O   1 
ATOM   521  C CB  . ASP A 1 79  ? 2.038   30.663  -37.763 1.00 40.14  ? 374 ASP A CB  1 
ATOM   522  C CG  . ASP A 1 79  ? 2.242   31.931  -38.582 1.00 46.50  ? 374 ASP A CG  1 
ATOM   523  O OD1 . ASP A 1 79  ? 3.343   32.098  -39.151 1.00 46.90  ? 374 ASP A OD1 1 
ATOM   524  O OD2 . ASP A 1 79  ? 1.309   32.759  -38.656 1.00 43.67  ? 374 ASP A OD2 1 
ATOM   525  N N   . GLN A 1 80  ? 2.176   27.465  -37.220 1.00 35.38  ? 375 GLN A N   1 
ATOM   526  C CA  . GLN A 1 80  ? 2.212   26.342  -36.292 1.00 29.78  ? 375 GLN A CA  1 
ATOM   527  C C   . GLN A 1 80  ? 3.533   25.600  -36.426 1.00 31.44  ? 375 GLN A C   1 
ATOM   528  O O   . GLN A 1 80  ? 4.141   25.208  -35.425 1.00 30.65  ? 375 GLN A O   1 
ATOM   529  C CB  . GLN A 1 80  ? 1.025   25.401  -36.515 1.00 27.61  ? 375 GLN A CB  1 
ATOM   530  C CG  . GLN A 1 80  ? -0.323  26.023  -36.173 1.00 28.42  ? 375 GLN A CG  1 
ATOM   531  C CD  . GLN A 1 80  ? -1.484  25.067  -36.399 1.00 39.42  ? 375 GLN A CD  1 
ATOM   532  O OE1 . GLN A 1 80  ? -1.338  23.854  -36.275 1.00 37.81  ? 375 GLN A OE1 1 
ATOM   533  N NE2 . GLN A 1 80  ? -2.645  25.615  -36.737 1.00 38.73  ? 375 GLN A NE2 1 
ATOM   534  N N   . VAL A 1 81  ? 3.990   25.426  -37.664 1.00 31.37  ? 376 VAL A N   1 
ATOM   535  C CA  . VAL A 1 81  ? 5.260   24.748  -37.913 1.00 30.07  ? 376 VAL A CA  1 
ATOM   536  C C   . VAL A 1 81  ? 6.428   25.595  -37.400 1.00 29.84  ? 376 VAL A C   1 
ATOM   537  O O   . VAL A 1 81  ? 7.326   25.094  -36.728 1.00 32.67  ? 376 VAL A O   1 
ATOM   538  C CB  . VAL A 1 81  ? 5.470   24.446  -39.409 1.00 33.56  ? 376 VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 81  ? 6.861   23.889  -39.643 1.00 31.24  ? 376 VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 81  ? 4.424   23.462  -39.911 1.00 34.81  ? 376 VAL A CG2 1 
ATOM   541  N N   . HIS A 1 82  ? 6.400   26.881  -37.708 1.00 35.59  ? 377 HIS A N   1 
ATOM   542  C CA  . HIS A 1 82  ? 7.468   27.783  -37.295 1.00 33.87  ? 377 HIS A CA  1 
ATOM   543  C C   . HIS A 1 82  ? 7.666   27.769  -35.777 1.00 32.27  ? 377 HIS A C   1 
ATOM   544  O O   . HIS A 1 82  ? 8.798   27.763  -35.296 1.00 34.61  ? 377 HIS A O   1 
ATOM   545  C CB  . HIS A 1 82  ? 7.193   29.201  -37.808 1.00 32.71  ? 377 HIS A CB  1 
ATOM   546  C CG  . HIS A 1 82  ? 8.220   30.209  -37.385 0.87 30.03  ? 377 HIS A CG  1 
ATOM   547  N ND1 . HIS A 1 82  ? 9.508   30.207  -37.874 0.36 30.59  ? 377 HIS A ND1 1 
ATOM   548  C CD2 . HIS A 1 82  ? 8.144   31.247  -36.523 0.30 32.20  ? 377 HIS A CD2 1 
ATOM   549  C CE1 . HIS A 1 82  ? 10.185  31.201  -37.327 0.49 31.34  ? 377 HIS A CE1 1 
ATOM   550  N NE2 . HIS A 1 82  ? 9.380   31.852  -36.504 0.63 32.38  ? 377 HIS A NE2 1 
ATOM   551  N N   . LEU A 1 83  ? 6.571   27.752  -35.023 1.00 30.47  ? 378 LEU A N   1 
ATOM   552  C CA  . LEU A 1 83  ? 6.667   27.709  -33.564 1.00 32.10  ? 378 LEU A CA  1 
ATOM   553  C C   . LEU A 1 83  ? 7.296   26.402  -33.072 1.00 33.36  ? 378 LEU A C   1 
ATOM   554  O O   . LEU A 1 83  ? 8.120   26.410  -32.154 1.00 27.52  ? 378 LEU A O   1 
ATOM   555  C CB  . LEU A 1 83  ? 5.295   27.911  -32.914 1.00 33.60  ? 378 LEU A CB  1 
ATOM   556  C CG  . LEU A 1 83  ? 4.609   29.278  -33.093 1.00 36.20  ? 378 LEU A CG  1 
ATOM   557  C CD1 . LEU A 1 83  ? 3.257   29.284  -32.383 1.00 27.84  ? 378 LEU A CD1 1 
ATOM   558  C CD2 . LEU A 1 83  ? 5.483   30.426  -32.590 1.00 35.12  ? 378 LEU A CD2 1 
ATOM   559  N N   . LEU A 1 84  ? 6.906   25.285  -33.683 1.00 31.04  ? 379 LEU A N   1 
ATOM   560  C CA  . LEU A 1 84  ? 7.453   23.987  -33.310 1.00 30.83  ? 379 LEU A CA  1 
ATOM   561  C C   . LEU A 1 84  ? 8.924   23.846  -33.698 1.00 31.59  ? 379 LEU A C   1 
ATOM   562  O O   . LEU A 1 84  ? 9.738   23.336  -32.917 1.00 32.86  ? 379 LEU A O   1 
ATOM   563  C CB  . LEU A 1 84  ? 6.623   22.858  -33.934 1.00 33.65  ? 379 LEU A CB  1 
ATOM   564  C CG  . LEU A 1 84  ? 5.256   22.608  -33.294 1.00 29.67  ? 379 LEU A CG  1 
ATOM   565  C CD1 . LEU A 1 84  ? 4.388   21.780  -34.222 1.00 36.77  ? 379 LEU A CD1 1 
ATOM   566  C CD2 . LEU A 1 84  ? 5.416   21.924  -31.933 1.00 25.38  ? 379 LEU A CD2 1 
ATOM   567  N N   . GLU A 1 85  ? 9.257   24.275  -34.914 1.00 26.32  ? 380 GLU A N   1 
ATOM   568  C CA  . GLU A 1 85  ? 10.648  24.352  -35.350 1.00 34.46  ? 380 GLU A CA  1 
ATOM   569  C C   . GLU A 1 85  ? 11.522  24.988  -34.279 1.00 32.14  ? 380 GLU A C   1 
ATOM   570  O O   . GLU A 1 85  ? 12.551  24.432  -33.875 1.00 32.88  ? 380 GLU A O   1 
ATOM   571  C CB  . GLU A 1 85  ? 10.761  25.215  -36.610 1.00 38.82  ? 380 GLU A CB  1 
ATOM   572  C CG  . GLU A 1 85  ? 10.860  24.449  -37.900 1.00 50.31  ? 380 GLU A CG  1 
ATOM   573  C CD  . GLU A 1 85  ? 11.396  25.300  -39.031 1.00 55.21  ? 380 GLU A CD  1 
ATOM   574  O OE1 . GLU A 1 85  ? 10.872  26.416  -39.248 1.00 58.26  ? 380 GLU A OE1 1 
ATOM   575  O OE2 . GLU A 1 85  ? 12.346  24.853  -39.706 1.00 61.02  ? 380 GLU A OE2 1 
ATOM   576  N N   . CYS A 1 86  ? 11.117  26.174  -33.842 1.00 28.78  ? 381 CYS A N   1 
ATOM   577  C CA  . CYS A 1 86  ? 11.931  26.987  -32.938 1.00 29.09  ? 381 CYS A CA  1 
ATOM   578  C C   . CYS A 1 86  ? 11.967  26.430  -31.519 1.00 31.21  ? 381 CYS A C   1 
ATOM   579  O O   . CYS A 1 86  ? 12.923  26.666  -30.781 1.00 32.89  ? 381 CYS A O   1 
ATOM   580  C CB  . CYS A 1 86  ? 11.399  28.429  -32.896 1.00 29.96  ? 381 CYS A CB  1 
ATOM   581  S SG  . CYS A 1 86  ? 11.443  29.297  -34.488 0.67 36.50  ? 381 CYS A SG  1 
ATOM   582  N N   . ALA A 1 87  ? 10.928  25.686  -31.145 1.00 29.36  ? 382 ALA A N   1 
ATOM   583  C CA  . ALA A 1 87  ? 10.702  25.361  -29.734 1.00 29.71  ? 382 ALA A CA  1 
ATOM   584  C C   . ALA A 1 87  ? 10.871  23.894  -29.331 1.00 28.08  ? 382 ALA A C   1 
ATOM   585  O O   . ALA A 1 87  ? 10.942  23.588  -28.143 1.00 28.52  ? 382 ALA A O   1 
ATOM   586  C CB  . ALA A 1 87  ? 9.326   25.863  -29.302 1.00 23.60  ? 382 ALA A CB  1 
ATOM   587  N N   . TRP A 1 88  ? 10.930  22.985  -30.297 1.00 24.43  ? 383 TRP A N   1 
ATOM   588  C CA  . TRP A 1 88  ? 10.889  21.565  -29.938 1.00 28.72  ? 383 TRP A CA  1 
ATOM   589  C C   . TRP A 1 88  ? 11.905  21.155  -28.860 1.00 32.65  ? 383 TRP A C   1 
ATOM   590  O O   . TRP A 1 88  ? 11.552  20.460  -27.904 1.00 29.55  ? 383 TRP A O   1 
ATOM   591  C CB  . TRP A 1 88  ? 10.969  20.651  -31.170 1.00 30.01  ? 383 TRP A CB  1 
ATOM   592  C CG  . TRP A 1 88  ? 12.295  20.617  -31.847 1.00 36.93  ? 383 TRP A CG  1 
ATOM   593  C CD1 . TRP A 1 88  ? 12.724  21.434  -32.851 1.00 37.50  ? 383 TRP A CD1 1 
ATOM   594  C CD2 . TRP A 1 88  ? 13.369  19.710  -31.580 1.00 43.59  ? 383 TRP A CD2 1 
ATOM   595  N NE1 . TRP A 1 88  ? 14.004  21.097  -33.222 1.00 44.25  ? 383 TRP A NE1 1 
ATOM   596  C CE2 . TRP A 1 88  ? 14.425  20.040  -32.454 1.00 44.98  ? 383 TRP A CE2 1 
ATOM   597  C CE3 . TRP A 1 88  ? 13.545  18.654  -30.679 1.00 43.18  ? 383 TRP A CE3 1 
ATOM   598  C CZ2 . TRP A 1 88  ? 15.640  19.356  -32.456 1.00 43.43  ? 383 TRP A CZ2 1 
ATOM   599  C CZ3 . TRP A 1 88  ? 14.750  17.970  -30.685 1.00 43.32  ? 383 TRP A CZ3 1 
ATOM   600  C CH2 . TRP A 1 88  ? 15.782  18.325  -31.567 1.00 42.00  ? 383 TRP A CH2 1 
ATOM   601  N N   . LEU A 1 89  ? 13.153  21.596  -28.988 1.00 27.19  ? 384 LEU A N   1 
ATOM   602  C CA  . LEU A 1 89  ? 14.174  21.171  -28.031 1.00 21.50  ? 384 LEU A CA  1 
ATOM   603  C C   . LEU A 1 89  ? 13.955  21.801  -26.653 1.00 29.75  ? 384 LEU A C   1 
ATOM   604  O O   . LEU A 1 89  ? 14.098  21.135  -25.626 1.00 26.12  ? 384 LEU A O   1 
ATOM   605  C CB  . LEU A 1 89  ? 15.586  21.455  -28.555 1.00 26.11  ? 384 LEU A CB  1 
ATOM   606  C CG  . LEU A 1 89  ? 16.717  20.830  -27.734 1.00 29.00  ? 384 LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 89  ? 16.454  19.348  -27.512 1.00 30.66  ? 384 LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 89  ? 18.070  21.039  -28.387 1.00 25.10  ? 384 LEU A CD2 1 
ATOM   609  N N   . GLU A 1 90  ? 13.612  23.086  -26.632 1.00 26.82  ? 385 GLU A N   1 
ATOM   610  C CA  . GLU A 1 90  ? 13.259  23.747  -25.380 1.00 26.91  ? 385 GLU A CA  1 
ATOM   611  C C   . GLU A 1 90  ? 12.149  22.981  -24.677 1.00 28.97  ? 385 GLU A C   1 
ATOM   612  O O   . GLU A 1 90  ? 12.201  22.743  -23.468 1.00 29.77  ? 385 GLU A O   1 
ATOM   613  C CB  . GLU A 1 90  ? 12.773  25.173  -25.633 1.00 28.33  ? 385 GLU A CB  1 
ATOM   614  C CG  . GLU A 1 90  ? 13.860  26.185  -25.874 1.00 36.17  ? 385 GLU A CG  1 
ATOM   615  C CD  . GLU A 1 90  ? 13.282  27.570  -26.082 1.00 37.45  ? 385 GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 90  ? 13.173  28.323  -25.088 1.00 32.97  ? 385 GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 90  ? 12.915  27.890  -27.232 1.00 37.65  ? 385 GLU A OE2 1 
ATOM   618  N N   . ILE A 1 91  ? 11.132  22.610  -25.448 1.00 26.41  ? 386 ILE A N   1 
ATOM   619  C CA  . ILE A 1 91  ? 10.004  21.843  -24.923 1.00 28.51  ? 386 ILE A CA  1 
ATOM   620  C C   . ILE A 1 91  ? 10.457  20.498  -24.354 1.00 30.31  ? 386 ILE A C   1 
ATOM   621  O O   . ILE A 1 91  ? 10.052  20.113  -23.254 1.00 30.76  ? 386 ILE A O   1 
ATOM   622  C CB  . ILE A 1 91  ? 8.920   21.653  -26.002 1.00 26.78  ? 386 ILE A CB  1 
ATOM   623  C CG1 . ILE A 1 91  ? 8.294   23.010  -26.329 1.00 29.01  ? 386 ILE A CG1 1 
ATOM   624  C CG2 . ILE A 1 91  ? 7.844   20.686  -25.530 1.00 20.34  ? 386 ILE A CG2 1 
ATOM   625  C CD1 . ILE A 1 91  ? 7.406   22.991  -27.547 1.00 35.05  ? 386 ILE A CD1 1 
ATOM   626  N N   . LEU A 1 92  ? 11.311  19.791  -25.085 1.00 23.55  ? 387 LEU A N   1 
ATOM   627  C CA  . LEU A 1 92  ? 11.821  18.515  -24.581 1.00 25.96  ? 387 LEU A CA  1 
ATOM   628  C C   . LEU A 1 92  ? 12.641  18.731  -23.308 1.00 32.67  ? 387 LEU A C   1 
ATOM   629  O O   . LEU A 1 92  ? 12.528  17.964  -22.348 1.00 28.46  ? 387 LEU A O   1 
ATOM   630  C CB  . LEU A 1 92  ? 12.659  17.788  -25.637 1.00 24.26  ? 387 LEU A CB  1 
ATOM   631  C CG  . LEU A 1 92  ? 11.960  17.161  -26.853 1.00 28.76  ? 387 LEU A CG  1 
ATOM   632  C CD1 . LEU A 1 92  ? 12.996  16.568  -27.792 1.00 29.62  ? 387 LEU A CD1 1 
ATOM   633  C CD2 . LEU A 1 92  ? 10.945  16.091  -26.445 1.00 21.87  ? 387 LEU A CD2 1 
ATOM   634  N N   . MET A 1 93  ? 13.456  19.787  -23.298 1.00 22.54  ? 388 MET A N   1 
ATOM   635  C CA  . MET A 1 93  ? 14.328  20.063  -22.163 1.00 20.68  ? 388 MET A CA  1 
ATOM   636  C C   . MET A 1 93  ? 13.575  20.421  -20.886 1.00 30.95  ? 388 MET A C   1 
ATOM   637  O O   . MET A 1 93  ? 13.935  19.949  -19.802 1.00 27.53  ? 388 MET A O   1 
ATOM   638  C CB  . MET A 1 93  ? 15.344  21.159  -22.499 1.00 21.61  ? 388 MET A CB  1 
ATOM   639  C CG  . MET A 1 93  ? 16.458  20.685  -23.423 1.00 24.16  ? 388 MET A CG  1 
ATOM   640  S SD  . MET A 1 93  ? 17.547  22.022  -23.956 1.00 34.24  ? 388 MET A SD  1 
ATOM   641  C CE  . MET A 1 93  ? 18.927  21.080  -24.615 1.00 31.06  ? 388 MET A CE  1 
ATOM   642  N N   . ILE A 1 94  ? 12.539  21.252  -20.993 1.00 30.18  ? 389 ILE A N   1 
ATOM   643  C CA  . ILE A 1 94  ? 11.783  21.613  -19.792 1.00 27.73  ? 389 ILE A CA  1 
ATOM   644  C C   . ILE A 1 94  ? 11.081  20.371  -19.253 1.00 27.47  ? 389 ILE A C   1 
ATOM   645  O O   . ILE A 1 94  ? 11.020  20.157  -18.040 1.00 33.62  ? 389 ILE A O   1 
ATOM   646  C CB  . ILE A 1 94  ? 10.796  22.799  -20.001 1.00 33.53  ? 389 ILE A CB  1 
ATOM   647  C CG1 . ILE A 1 94  ? 10.312  23.326  -18.636 1.00 29.63  ? 389 ILE A CG1 1 
ATOM   648  C CG2 . ILE A 1 94  ? 9.632   22.396  -20.902 1.00 28.35  ? 389 ILE A CG2 1 
ATOM   649  C CD1 . ILE A 1 94  ? 9.336   24.502  -18.709 1.00 26.19  ? 389 ILE A CD1 1 
ATOM   650  N N   . GLY A 1 95  ? 10.584  19.533  -20.160 1.00 29.80  ? 390 GLY A N   1 
ATOM   651  C CA  . GLY A 1 95  ? 10.051  18.234  -19.779 1.00 30.00  ? 390 GLY A CA  1 
ATOM   652  C C   . GLY A 1 95  ? 11.070  17.422  -18.994 1.00 36.96  ? 390 GLY A C   1 
ATOM   653  O O   . GLY A 1 95  ? 10.749  16.839  -17.949 1.00 29.47  ? 390 GLY A O   1 
ATOM   654  N N   . LEU A 1 96  ? 12.308  17.398  -19.488 1.00 34.16  ? 391 LEU A N   1 
ATOM   655  C CA  . LEU A 1 96  ? 13.395  16.667  -18.840 1.00 32.66  ? 391 LEU A CA  1 
ATOM   656  C C   . LEU A 1 96  ? 13.697  17.220  -17.453 1.00 33.91  ? 391 LEU A C   1 
ATOM   657  O O   . LEU A 1 96  ? 13.894  16.471  -16.498 1.00 33.87  ? 391 LEU A O   1 
ATOM   658  C CB  . LEU A 1 96  ? 14.662  16.733  -19.691 1.00 26.92  ? 391 LEU A CB  1 
ATOM   659  C CG  . LEU A 1 96  ? 15.923  16.149  -19.048 1.00 30.78  ? 391 LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 96  ? 15.767  14.649  -18.894 1.00 32.23  ? 391 LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 96  ? 17.143  16.460  -19.892 1.00 27.27  ? 391 LEU A CD2 1 
ATOM   662  N N   . VAL A 1 97  ? 13.740  18.541  -17.351 1.00 29.42  ? 392 VAL A N   1 
ATOM   663  C CA  . VAL A 1 97  ? 14.048  19.192  -16.093 1.00 34.80  ? 392 VAL A CA  1 
ATOM   664  C C   . VAL A 1 97  ? 12.939  18.973  -15.057 1.00 37.74  ? 392 VAL A C   1 
ATOM   665  O O   . VAL A 1 97  ? 13.214  18.803  -13.868 1.00 40.51  ? 392 VAL A O   1 
ATOM   666  C CB  . VAL A 1 97  ? 14.315  20.680  -16.317 1.00 37.53  ? 392 VAL A CB  1 
ATOM   667  C CG1 . VAL A 1 97  ? 14.201  21.435  -15.022 1.00 45.47  ? 392 VAL A CG1 1 
ATOM   668  C CG2 . VAL A 1 97  ? 15.696  20.861  -16.951 1.00 29.87  ? 392 VAL A CG2 1 
ATOM   669  N N   . TRP A 1 98  ? 11.690  18.965  -15.515 1.00 37.65  ? 393 TRP A N   1 
ATOM   670  C CA  . TRP A 1 98  ? 10.561  18.622  -14.653 1.00 37.29  ? 393 TRP A CA  1 
ATOM   671  C C   . TRP A 1 98  ? 10.692  17.190  -14.111 1.00 37.37  ? 393 TRP A C   1 
ATOM   672  O O   . TRP A 1 98  ? 10.603  16.959  -12.907 1.00 40.37  ? 393 TRP A O   1 
ATOM   673  C CB  . TRP A 1 98  ? 9.239   18.798  -15.410 1.00 26.69  ? 393 TRP A CB  1 
ATOM   674  C CG  . TRP A 1 98  ? 8.030   18.299  -14.675 1.00 38.31  ? 393 TRP A CG  1 
ATOM   675  C CD1 . TRP A 1 98  ? 7.310   17.171  -14.953 1.00 43.59  ? 393 TRP A CD1 1 
ATOM   676  C CD2 . TRP A 1 98  ? 7.397   18.911  -13.543 1.00 45.92  ? 393 TRP A CD2 1 
ATOM   677  N NE1 . TRP A 1 98  ? 6.262   17.044  -14.064 1.00 44.43  ? 393 TRP A NE1 1 
ATOM   678  C CE2 . TRP A 1 98  ? 6.292   18.103  -13.189 1.00 47.24  ? 393 TRP A CE2 1 
ATOM   679  C CE3 . TRP A 1 98  ? 7.648   20.066  -12.792 1.00 50.01  ? 393 TRP A CE3 1 
ATOM   680  C CZ2 . TRP A 1 98  ? 5.450   18.409  -12.125 1.00 45.96  ? 393 TRP A CZ2 1 
ATOM   681  C CZ3 . TRP A 1 98  ? 6.807   20.371  -11.730 1.00 50.81  ? 393 TRP A CZ3 1 
ATOM   682  C CH2 . TRP A 1 98  ? 5.721   19.546  -11.408 1.00 43.63  ? 393 TRP A CH2 1 
ATOM   683  N N   . ARG A 1 99  ? 10.926  16.235  -15.002 1.00 37.73  ? 394 ARG A N   1 
ATOM   684  C CA  . ARG A 1 99  ? 11.059  14.833  -14.606 1.00 38.19  ? 394 ARG A CA  1 
ATOM   685  C C   . ARG A 1 99  ? 12.193  14.615  -13.609 1.00 43.89  ? 394 ARG A C   1 
ATOM   686  O O   . ARG A 1 99  ? 12.111  13.747  -12.737 1.00 40.65  ? 394 ARG A O   1 
ATOM   687  C CB  . ARG A 1 99  ? 11.313  13.952  -15.829 1.00 30.59  ? 394 ARG A CB  1 
ATOM   688  C CG  . ARG A 1 99  ? 10.212  13.985  -16.866 1.00 36.61  ? 394 ARG A CG  1 
ATOM   689  C CD  . ARG A 1 99  ? 10.270  12.768  -17.768 1.00 38.81  ? 394 ARG A CD  1 
ATOM   690  N NE  . ARG A 1 99  ? 11.405  12.766  -18.689 1.00 36.07  ? 394 ARG A NE  1 
ATOM   691  C CZ  . ARG A 1 99  ? 11.421  13.416  -19.849 1.00 34.95  ? 394 ARG A CZ  1 
ATOM   692  N NH1 . ARG A 1 99  ? 10.378  14.149  -20.210 1.00 37.15  ? 394 ARG A NH1 1 
ATOM   693  N NH2 . ARG A 1 99  ? 12.478  13.342  -20.645 1.00 32.11  ? 394 ARG A NH2 1 
ATOM   694  N N   . SER A 1 100 ? 13.257  15.401  -13.748 1.00 37.91  ? 395 SER A N   1 
ATOM   695  C CA  . SER A 1 100 ? 14.489  15.146  -13.006 1.00 41.29  ? 395 SER A CA  1 
ATOM   696  C C   . SER A 1 100 ? 14.509  15.778  -11.619 1.00 42.90  ? 395 SER A C   1 
ATOM   697  O O   . SER A 1 100 ? 15.443  15.552  -10.847 1.00 43.49  ? 395 SER A O   1 
ATOM   698  C CB  . SER A 1 100 ? 15.698  15.631  -13.807 1.00 39.28  ? 395 SER A CB  1 
ATOM   699  O OG  . SER A 1 100 ? 15.736  15.020  -15.083 1.00 37.47  ? 395 SER A OG  1 
ATOM   700  N N   . MET A 1 101 ? 13.481  16.560  -11.308 1.00 39.60  ? 396 MET A N   1 
ATOM   701  C CA  . MET A 1 101 ? 13.450  17.342  -10.067 1.00 43.24  ? 396 MET A CA  1 
ATOM   702  C C   . MET A 1 101 ? 13.776  16.559  -8.795  1.00 46.35  ? 396 MET A C   1 
ATOM   703  O O   . MET A 1 101 ? 14.558  17.023  -7.974  1.00 48.76  ? 396 MET A O   1 
ATOM   704  C CB  . MET A 1 101 ? 12.107  18.061  -9.904  1.00 42.63  ? 396 MET A CB  1 
ATOM   705  C CG  . MET A 1 101 ? 12.015  19.382  -10.637 1.00 40.34  ? 396 MET A CG  1 
ATOM   706  S SD  . MET A 1 101 ? 10.396  20.130  -10.410 1.00 51.07  ? 396 MET A SD  1 
ATOM   707  C CE  . MET A 1 101 ? 10.409  20.415  -8.643  1.00 43.44  ? 396 MET A CE  1 
ATOM   708  N N   . GLU A 1 102 ? 13.177  15.386  -8.617  1.00 52.16  ? 397 GLU A N   1 
ATOM   709  C CA  . GLU A 1 102 ? 13.452  14.612  -7.409  1.00 59.25  ? 397 GLU A CA  1 
ATOM   710  C C   . GLU A 1 102 ? 14.517  13.537  -7.617  1.00 59.45  ? 397 GLU A C   1 
ATOM   711  O O   . GLU A 1 102 ? 14.504  12.495  -6.963  1.00 59.06  ? 397 GLU A O   1 
ATOM   712  C CB  . GLU A 1 102 ? 12.170  14.033  -6.804  1.00 70.56  ? 397 GLU A CB  1 
ATOM   713  C CG  . GLU A 1 102 ? 11.124  13.598  -7.808  1.00 83.23  ? 397 GLU A CG  1 
ATOM   714  C CD  . GLU A 1 102 ? 9.759   13.414  -7.164  1.00 94.15  ? 397 GLU A CD  1 
ATOM   715  O OE1 . GLU A 1 102 ? 8.830   12.931  -7.847  1.00 94.53  ? 397 GLU A OE1 1 
ATOM   716  O OE2 . GLU A 1 102 ? 9.619   13.755  -5.969  1.00 99.09  ? 397 GLU A OE2 1 
ATOM   717  N N   . HIS A 1 103 ? 15.443  13.806  -8.530  1.00 59.52  ? 398 HIS A N   1 
ATOM   718  C CA  . HIS A 1 103 ? 16.623  12.971  -8.706  1.00 51.88  ? 398 HIS A CA  1 
ATOM   719  C C   . HIS A 1 103 ? 17.848  13.873  -8.763  1.00 48.93  ? 398 HIS A C   1 
ATOM   720  O O   . HIS A 1 103 ? 18.440  14.067  -9.825  1.00 46.64  ? 398 HIS A O   1 
ATOM   721  C CB  . HIS A 1 103 ? 16.514  12.140  -9.983  1.00 48.79  ? 398 HIS A CB  1 
ATOM   722  C CG  . HIS A 1 103 ? 15.269  11.316  -10.055 1.00 51.80  ? 398 HIS A CG  1 
ATOM   723  N ND1 . HIS A 1 103 ? 15.197  10.030  -9.565  1.00 48.22  ? 398 HIS A ND1 1 
ATOM   724  C CD2 . HIS A 1 103 ? 14.041  11.598  -10.552 1.00 48.98  ? 398 HIS A CD2 1 
ATOM   725  C CE1 . HIS A 1 103 ? 13.981  9.553   -9.762  1.00 49.87  ? 398 HIS A CE1 1 
ATOM   726  N NE2 . HIS A 1 103 ? 13.258  10.487  -10.356 1.00 52.13  ? 398 HIS A NE2 1 
ATOM   727  N N   . PRO A 1 104 ? 18.224  14.442  -7.612  1.00 51.91  ? 399 PRO A N   1 
ATOM   728  C CA  . PRO A 1 104 ? 19.375  15.349  -7.531  1.00 48.91  ? 399 PRO A CA  1 
ATOM   729  C C   . PRO A 1 104 ? 20.633  14.719  -8.112  1.00 49.45  ? 399 PRO A C   1 
ATOM   730  O O   . PRO A 1 104 ? 20.941  13.563  -7.818  1.00 48.29  ? 399 PRO A O   1 
ATOM   731  C CB  . PRO A 1 104 ? 19.542  15.562  -6.024  1.00 54.52  ? 399 PRO A CB  1 
ATOM   732  C CG  . PRO A 1 104 ? 18.180  15.324  -5.457  1.00 57.17  ? 399 PRO A CG  1 
ATOM   733  C CD  . PRO A 1 104 ? 17.568  14.251  -6.307  1.00 54.94  ? 399 PRO A CD  1 
ATOM   734  N N   . GLY A 1 105 ? 21.345  15.475  -8.939  1.00 50.07  ? 400 GLY A N   1 
ATOM   735  C CA  . GLY A 1 105 ? 22.575  14.997  -9.543  1.00 48.76  ? 400 GLY A CA  1 
ATOM   736  C C   . GLY A 1 105 ? 22.369  14.150  -10.786 1.00 45.68  ? 400 GLY A C   1 
ATOM   737  O O   . GLY A 1 105 ? 23.337  13.700  -11.399 1.00 48.30  ? 400 GLY A O   1 
ATOM   738  N N   . LYS A 1 106 ? 21.113  13.930  -11.162 1.00 39.63  ? 401 LYS A N   1 
ATOM   739  C CA  . LYS A 1 106 ? 20.806  13.075  -12.309 1.00 41.00  ? 401 LYS A CA  1 
ATOM   740  C C   . LYS A 1 106 ? 19.736  13.659  -13.224 1.00 42.04  ? 401 LYS A C   1 
ATOM   741  O O   . LYS A 1 106 ? 18.939  14.511  -12.817 1.00 40.92  ? 401 LYS A O   1 
ATOM   742  C CB  . LYS A 1 106 ? 20.364  11.684  -11.849 1.00 41.76  ? 401 LYS A CB  1 
ATOM   743  C CG  . LYS A 1 106 ? 21.416  10.914  -11.078 1.00 46.27  ? 401 LYS A CG  1 
ATOM   744  C CD  . LYS A 1 106 ? 20.842  9.625   -10.540 1.00 51.66  ? 401 LYS A CD  1 
ATOM   745  C CE  . LYS A 1 106 ? 21.769  8.994   -9.519  1.00 64.27  ? 401 LYS A CE  1 
ATOM   746  N NZ  . LYS A 1 106 ? 21.171  7.742   -8.961  1.00 73.85  ? 401 LYS A NZ  1 
ATOM   747  N N   . LEU A 1 107 ? 19.727  13.183  -14.465 1.00 38.35  ? 402 LEU A N   1 
ATOM   748  C CA  . LEU A 1 107 ? 18.728  13.594  -15.446 1.00 33.96  ? 402 LEU A CA  1 
ATOM   749  C C   . LEU A 1 107 ? 17.929  12.378  -15.899 1.00 39.42  ? 402 LEU A C   1 
ATOM   750  O O   . LEU A 1 107 ? 18.484  11.402  -16.414 1.00 33.66  ? 402 LEU A O   1 
ATOM   751  C CB  . LEU A 1 107 ? 19.398  14.274  -16.643 1.00 28.58  ? 402 LEU A CB  1 
ATOM   752  C CG  . LEU A 1 107 ? 20.017  15.646  -16.338 1.00 34.84  ? 402 LEU A CG  1 
ATOM   753  C CD1 . LEU A 1 107 ? 20.681  16.212  -17.576 1.00 26.07  ? 402 LEU A CD1 1 
ATOM   754  C CD2 . LEU A 1 107 ? 18.948  16.604  -15.818 1.00 35.13  ? 402 LEU A CD2 1 
ATOM   755  N N   . LEU A 1 108 ? 16.620  12.442  -15.693 1.00 31.82  ? 403 LEU A N   1 
ATOM   756  C CA  . LEU A 1 108 ? 15.730  11.342  -16.034 1.00 32.02  ? 403 LEU A CA  1 
ATOM   757  C C   . LEU A 1 108 ? 15.212  11.520  -17.457 1.00 30.83  ? 403 LEU A C   1 
ATOM   758  O O   . LEU A 1 108 ? 14.101  12.011  -17.669 1.00 34.07  ? 403 LEU A O   1 
ATOM   759  C CB  . LEU A 1 108 ? 14.573  11.287  -15.036 1.00 30.79  ? 403 LEU A CB  1 
ATOM   760  C CG  . LEU A 1 108 ? 13.764  10.000  -14.881 1.00 41.78  ? 403 LEU A CG  1 
ATOM   761  C CD1 . LEU A 1 108 ? 13.054  9.997   -13.545 1.00 49.26  ? 403 LEU A CD1 1 
ATOM   762  C CD2 . LEU A 1 108 ? 12.771  9.838   -16.012 1.00 47.48  ? 403 LEU A CD2 1 
ATOM   763  N N   . PHE A 1 109 ? 16.034  11.148  -18.436 1.00 27.44  ? 404 PHE A N   1 
ATOM   764  C CA  . PHE A 1 109 ? 15.644  11.274  -19.840 1.00 32.84  ? 404 PHE A CA  1 
ATOM   765  C C   . PHE A 1 109 ? 14.457  10.356  -20.114 1.00 34.37  ? 404 PHE A C   1 
ATOM   766  O O   . PHE A 1 109 ? 13.565  10.683  -20.899 1.00 36.94  ? 404 PHE A O   1 
ATOM   767  C CB  . PHE A 1 109 ? 16.820  10.932  -20.755 1.00 26.79  ? 404 PHE A CB  1 
ATOM   768  C CG  . PHE A 1 109 ? 17.965  11.906  -20.660 1.00 34.73  ? 404 PHE A CG  1 
ATOM   769  C CD1 . PHE A 1 109 ? 18.031  13.006  -21.502 1.00 34.34  ? 404 PHE A CD1 1 
ATOM   770  C CD2 . PHE A 1 109 ? 18.972  11.722  -19.727 1.00 34.83  ? 404 PHE A CD2 1 
ATOM   771  C CE1 . PHE A 1 109 ? 19.086  13.909  -21.416 1.00 34.30  ? 404 PHE A CE1 1 
ATOM   772  C CE2 . PHE A 1 109 ? 20.031  12.622  -19.633 1.00 42.12  ? 404 PHE A CE2 1 
ATOM   773  C CZ  . PHE A 1 109 ? 20.087  13.714  -20.481 1.00 33.77  ? 404 PHE A CZ  1 
ATOM   774  N N   . ALA A 1 110 ? 14.461  9.212   -19.438 1.00 28.52  ? 405 ALA A N   1 
ATOM   775  C CA  . ALA A 1 110 ? 13.368  8.239   -19.486 1.00 31.98  ? 405 ALA A CA  1 
ATOM   776  C C   . ALA A 1 110 ? 13.430  7.422   -18.199 1.00 35.24  ? 405 ALA A C   1 
ATOM   777  O O   . ALA A 1 110 ? 14.466  7.398   -17.536 1.00 37.10  ? 405 ALA A O   1 
ATOM   778  C CB  . ALA A 1 110 ? 13.504  7.343   -20.702 1.00 33.02  ? 405 ALA A CB  1 
ATOM   779  N N   . PRO A 1 111 ? 12.320  6.775   -17.818 1.00 37.26  ? 406 PRO A N   1 
ATOM   780  C CA  . PRO A 1 111 ? 12.357  6.037   -16.552 1.00 37.25  ? 406 PRO A CA  1 
ATOM   781  C C   . PRO A 1 111 ? 13.439  4.960   -16.544 1.00 39.60  ? 406 PRO A C   1 
ATOM   782  O O   . PRO A 1 111 ? 13.913  4.565   -15.479 1.00 41.89  ? 406 PRO A O   1 
ATOM   783  C CB  . PRO A 1 111 ? 10.961  5.412   -16.480 1.00 37.74  ? 406 PRO A CB  1 
ATOM   784  C CG  . PRO A 1 111 ? 10.097  6.358   -17.272 1.00 33.77  ? 406 PRO A CG  1 
ATOM   785  C CD  . PRO A 1 111 ? 10.964  6.817   -18.401 1.00 30.70  ? 406 PRO A CD  1 
ATOM   786  N N   . ASN A 1 112 ? 13.825  4.493   -17.728 1.00 36.27  ? 407 ASN A N   1 
ATOM   787  C CA  . ASN A 1 112 ? 14.863  3.477   -17.849 1.00 37.81  ? 407 ASN A CA  1 
ATOM   788  C C   . ASN A 1 112 ? 16.168  4.086   -18.331 1.00 41.88  ? 407 ASN A C   1 
ATOM   789  O O   . ASN A 1 112 ? 17.081  3.378   -18.745 1.00 42.69  ? 407 ASN A O   1 
ATOM   790  C CB  . ASN A 1 112 ? 14.421  2.361   -18.802 1.00 37.01  ? 407 ASN A CB  1 
ATOM   791  C CG  . ASN A 1 112 ? 14.182  2.865   -20.216 1.00 40.17  ? 407 ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 112 ? 13.783  4.016   -20.427 1.00 35.95  ? 407 ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 112 ? 14.431  2.008   -21.192 1.00 36.15  ? 407 ASN A ND2 1 
ATOM   794  N N   . LEU A 1 113 ? 16.254  5.412   -18.289 1.00 35.47  ? 408 LEU A N   1 
ATOM   795  C CA  . LEU A 1 113 ? 17.491  6.081   -18.660 1.00 33.00  ? 408 LEU A CA  1 
ATOM   796  C C   . LEU A 1 113 ? 17.758  7.253   -17.726 1.00 40.93  ? 408 LEU A C   1 
ATOM   797  O O   . LEU A 1 113 ? 17.544  8.413   -18.078 1.00 40.22  ? 408 LEU A O   1 
ATOM   798  C CB  . LEU A 1 113 ? 17.448  6.545   -20.115 1.00 32.82  ? 408 LEU A CB  1 
ATOM   799  C CG  . LEU A 1 113 ? 18.818  6.850   -20.714 1.00 39.11  ? 408 LEU A CG  1 
ATOM   800  C CD1 . LEU A 1 113 ? 19.663  5.595   -20.746 1.00 44.67  ? 408 LEU A CD1 1 
ATOM   801  C CD2 . LEU A 1 113 ? 18.691  7.435   -22.108 1.00 39.18  ? 408 LEU A CD2 1 
ATOM   802  N N   . LEU A 1 114 ? 18.215  6.924   -16.526 1.00 39.47  ? 409 LEU A N   1 
ATOM   803  C CA  . LEU A 1 114 ? 18.543  7.907   -15.511 1.00 42.99  ? 409 LEU A CA  1 
ATOM   804  C C   . LEU A 1 114 ? 20.058  8.047   -15.463 1.00 47.03  ? 409 LEU A C   1 
ATOM   805  O O   . LEU A 1 114 ? 20.760  7.113   -15.077 1.00 46.48  ? 409 LEU A O   1 
ATOM   806  C CB  . LEU A 1 114 ? 18.007  7.438   -14.158 1.00 42.88  ? 409 LEU A CB  1 
ATOM   807  C CG  . LEU A 1 114 ? 18.207  8.331   -12.934 1.00 46.90  ? 409 LEU A CG  1 
ATOM   808  C CD1 . LEU A 1 114 ? 17.514  9.665   -13.136 1.00 43.89  ? 409 LEU A CD1 1 
ATOM   809  C CD2 . LEU A 1 114 ? 17.682  7.632   -11.683 1.00 46.55  ? 409 LEU A CD2 1 
ATOM   810  N N   . LEU A 1 115 ? 20.562  9.212   -15.858 1.00 45.65  ? 410 LEU A N   1 
ATOM   811  C CA  . LEU A 1 115 ? 22.006  9.405   -16.008 1.00 43.06  ? 410 LEU A CA  1 
ATOM   812  C C   . LEU A 1 115 ? 22.585  10.456  -15.064 1.00 42.29  ? 410 LEU A C   1 
ATOM   813  O O   . LEU A 1 115 ? 22.008  11.532  -14.892 1.00 37.57  ? 410 LEU A O   1 
ATOM   814  C CB  . LEU A 1 115 ? 22.329  9.804   -17.449 1.00 40.09  ? 410 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 115 ? 21.841  8.866   -18.553 1.00 41.36  ? 410 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 115 ? 22.189  9.435   -19.920 1.00 43.20  ? 410 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 115 ? 22.433  7.478   -18.374 1.00 38.32  ? 410 LEU A CD2 1 
ATOM   818  N N   . ASP A 1 116 ? 23.729  10.142  -14.461 1.00 48.49  ? 411 ASP A N   1 
ATOM   819  C CA  . ASP A 1 116 ? 24.502  11.150  -13.737 1.00 49.65  ? 411 ASP A CA  1 
ATOM   820  C C   . ASP A 1 116 ? 25.530  11.768  -14.683 1.00 48.50  ? 411 ASP A C   1 
ATOM   821  O O   . ASP A 1 116 ? 25.704  11.289  -15.800 1.00 51.48  ? 411 ASP A O   1 
ATOM   822  C CB  . ASP A 1 116 ? 25.159  10.574  -12.472 1.00 52.79  ? 411 ASP A CB  1 
ATOM   823  C CG  . ASP A 1 116 ? 26.179  9.487   -12.771 1.00 62.00  ? 411 ASP A CG  1 
ATOM   824  O OD1 . ASP A 1 116 ? 27.042  9.693   -13.654 1.00 61.91  ? 411 ASP A OD1 1 
ATOM   825  O OD2 . ASP A 1 116 ? 26.129  8.428   -12.103 1.00 64.71  ? 411 ASP A OD2 1 
ATOM   826  N N   . ARG A 1 117 ? 26.207  12.824  -14.245 1.00 47.90  ? 412 ARG A N   1 
ATOM   827  C CA  . ARG A 1 117 ? 27.026  13.621  -15.157 1.00 56.73  ? 412 ARG A CA  1 
ATOM   828  C C   . ARG A 1 117 ? 28.265  12.902  -15.704 1.00 62.67  ? 412 ARG A C   1 
ATOM   829  O O   . ARG A 1 117 ? 28.965  13.433  -16.564 1.00 69.49  ? 412 ARG A O   1 
ATOM   830  C CB  . ARG A 1 117 ? 27.392  14.974  -14.528 1.00 54.30  ? 412 ARG A CB  1 
ATOM   831  C CG  . ARG A 1 117 ? 28.843  15.129  -14.115 1.00 55.67  ? 412 ARG A CG  1 
ATOM   832  C CD  . ARG A 1 117 ? 29.101  16.542  -13.597 1.00 56.16  ? 412 ARG A CD  1 
ATOM   833  N NE  . ARG A 1 117 ? 29.942  17.321  -14.502 1.00 65.05  ? 412 ARG A NE  1 
ATOM   834  C CZ  . ARG A 1 117 ? 30.990  18.035  -14.108 1.00 80.36  ? 412 ARG A CZ  1 
ATOM   835  N NH1 . ARG A 1 117 ? 31.319  18.074  -12.822 1.00 89.64  ? 412 ARG A NH1 1 
ATOM   836  N NH2 . ARG A 1 117 ? 31.707  18.712  -14.998 1.00 83.11  ? 412 ARG A NH2 1 
ATOM   837  N N   . ASN A 1 118 ? 28.521  11.689  -15.224 1.00 60.95  ? 413 ASN A N   1 
ATOM   838  C CA  . ASN A 1 118 ? 29.669  10.920  -15.696 1.00 73.90  ? 413 ASN A CA  1 
ATOM   839  C C   . ASN A 1 118 ? 29.312  9.736   -16.591 1.00 84.54  ? 413 ASN A C   1 
ATOM   840  O O   . ASN A 1 118 ? 30.069  9.392   -17.498 1.00 91.74  ? 413 ASN A O   1 
ATOM   841  C CB  . ASN A 1 118 ? 30.516  10.437  -14.515 1.00 78.81  ? 413 ASN A CB  1 
ATOM   842  C CG  . ASN A 1 118 ? 31.468  11.502  -14.008 1.00 84.35  ? 413 ASN A CG  1 
ATOM   843  O OD1 . ASN A 1 118 ? 32.353  11.961  -14.734 1.00 86.03  ? 413 ASN A OD1 1 
ATOM   844  N ND2 . ASN A 1 118 ? 31.295  11.897  -12.753 1.00 86.35  ? 413 ASN A ND2 1 
ATOM   845  N N   . GLN A 1 119 ? 28.161  9.120   -16.331 1.00 88.20  ? 414 GLN A N   1 
ATOM   846  C CA  . GLN A 1 119 ? 27.762  7.883   -17.010 1.00 92.31  ? 414 GLN A CA  1 
ATOM   847  C C   . GLN A 1 119 ? 27.863  7.948   -18.529 1.00 98.41  ? 414 GLN A C   1 
ATOM   848  O O   . GLN A 1 119 ? 28.735  7.320   -19.127 1.00 103.58 ? 414 GLN A O   1 
ATOM   849  C CB  . GLN A 1 119 ? 26.341  7.483   -16.613 1.00 87.77  ? 414 GLN A CB  1 
ATOM   850  C CG  . GLN A 1 119 ? 26.178  7.150   -15.149 1.00 89.48  ? 414 GLN A CG  1 
ATOM   851  C CD  . GLN A 1 119 ? 24.792  6.638   -14.830 1.00 92.30  ? 414 GLN A CD  1 
ATOM   852  O OE1 . GLN A 1 119 ? 24.202  5.887   -15.608 1.00 96.76  ? 414 GLN A OE1 1 
ATOM   853  N NE2 . GLN A 1 119 ? 24.263  7.037   -13.680 1.00 91.77  ? 414 GLN A NE2 1 
ATOM   854  N N   . GLY A 1 120 ? 26.953  8.687   -19.153 1.00 96.83  ? 415 GLY A N   1 
ATOM   855  C CA  . GLY A 1 120 ? 26.970  8.832   -20.596 1.00 98.28  ? 415 GLY A CA  1 
ATOM   856  C C   . GLY A 1 120 ? 28.297  9.379   -21.089 1.00 99.84  ? 415 GLY A C   1 
ATOM   857  O O   . GLY A 1 120 ? 28.905  10.226  -20.439 1.00 102.08 ? 415 GLY A O   1 
ATOM   858  N N   . LYS A 1 121 ? 28.758  8.896   -22.237 1.00 104.08 ? 416 LYS A N   1 
ATOM   859  C CA  . LYS A 1 121 ? 29.979  9.422   -22.835 1.00 108.18 ? 416 LYS A CA  1 
ATOM   860  C C   . LYS A 1 121 ? 29.646  10.674  -23.644 1.00 106.23 ? 416 LYS A C   1 
ATOM   861  O O   . LYS A 1 121 ? 28.832  10.625  -24.566 1.00 105.08 ? 416 LYS A O   1 
ATOM   862  C CB  . LYS A 1 121 ? 30.648  8.365   -23.717 1.00 112.50 ? 416 LYS A CB  1 
HETATM 863  N N   . CME A 1 122 ? 30.270  11.796  -23.296 1.00 104.08 ? 417 CME A N   1 
HETATM 864  C CA  . CME A 1 122 ? 29.913  13.065  -23.904 1.00 101.16 ? 417 CME A CA  1 
HETATM 865  C CB  . CME A 1 122 ? 29.080  13.865  -22.959 1.00 100.21 ? 417 CME A CB  1 
HETATM 866  S SG  . CME A 1 122 ? 27.436  13.358  -22.539 1.00 104.88 ? 417 CME A SG  1 
HETATM 867  S SD  . CME A 1 122 ? 27.057  14.244  -20.772 1.00 100.88 ? 417 CME A SD  1 
HETATM 868  C CE  . CME A 1 122 ? 27.503  13.119  -19.464 1.00 67.40  ? 417 CME A CE  1 
HETATM 869  C CZ  . CME A 1 122 ? 26.555  12.005  -19.205 1.00 67.55  ? 417 CME A CZ  1 
HETATM 870  O OH  . CME A 1 122 ? 26.841  11.161  -18.166 1.00 68.72  ? 417 CME A OH  1 
HETATM 871  C C   . CME A 1 122 ? 31.076  13.945  -24.190 1.00 102.61 ? 417 CME A C   1 
HETATM 872  O O   . CME A 1 122 ? 32.078  13.924  -23.487 1.00 105.72 ? 417 CME A O   1 
ATOM   873  N N   . VAL A 1 123 ? 30.925  14.762  -25.227 1.00 100.84 ? 418 VAL A N   1 
ATOM   874  C CA  . VAL A 1 123 ? 31.843  15.858  -25.497 1.00 99.63  ? 418 VAL A CA  1 
ATOM   875  C C   . VAL A 1 123 ? 31.794  16.834  -24.322 1.00 94.65  ? 418 VAL A C   1 
ATOM   876  O O   . VAL A 1 123 ? 30.777  16.927  -23.635 1.00 91.56  ? 418 VAL A O   1 
ATOM   877  C CB  . VAL A 1 123 ? 31.433  16.604  -26.781 1.00 95.20  ? 418 VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 123 ? 32.553  17.522  -27.254 1.00 97.86  ? 418 VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 123 ? 31.031  15.615  -27.869 1.00 88.75  ? 418 VAL A CG2 1 
ATOM   880  N N   . GLU A 1 124 ? 32.882  17.561  -24.087 1.00 94.87  ? 419 GLU A N   1 
ATOM   881  C CA  . GLU A 1 124 ? 32.920  18.496  -22.965 1.00 90.62  ? 419 GLU A CA  1 
ATOM   882  C C   . GLU A 1 124 ? 31.933  19.651  -23.147 1.00 82.14  ? 419 GLU A C   1 
ATOM   883  O O   . GLU A 1 124 ? 31.516  20.280  -22.174 1.00 75.22  ? 419 GLU A O   1 
ATOM   884  C CB  . GLU A 1 124 ? 34.342  19.004  -22.699 1.00 94.96  ? 419 GLU A CB  1 
ATOM   885  C CG  . GLU A 1 124 ? 34.921  19.904  -23.772 1.00 101.08 ? 419 GLU A CG  1 
ATOM   886  C CD  . GLU A 1 124 ? 36.410  20.128  -23.583 1.00 109.53 ? 419 GLU A CD  1 
ATOM   887  O OE1 . GLU A 1 124 ? 36.916  21.192  -24.001 1.00 115.61 ? 419 GLU A OE1 1 
ATOM   888  O OE2 . GLU A 1 124 ? 37.074  19.240  -23.008 1.00 107.57 ? 419 GLU A OE2 1 
ATOM   889  N N   . GLY A 1 125 ? 31.552  19.922  -24.391 1.00 77.59  ? 420 GLY A N   1 
ATOM   890  C CA  . GLY A 1 125 ? 30.492  20.879  -24.649 1.00 72.00  ? 420 GLY A CA  1 
ATOM   891  C C   . GLY A 1 125 ? 29.169  20.319  -24.158 1.00 67.28  ? 420 GLY A C   1 
ATOM   892  O O   . GLY A 1 125 ? 28.279  21.053  -23.722 1.00 49.68  ? 420 GLY A O   1 
ATOM   893  N N   . MET A 1 126 ? 29.048  18.997  -24.227 1.00 63.19  ? 421 MET A N   1 
ATOM   894  C CA  . MET A 1 126 ? 27.849  18.307  -23.780 1.00 63.01  ? 421 MET A CA  1 
ATOM   895  C C   . MET A 1 126 ? 27.738  18.342  -22.263 1.00 62.96  ? 421 MET A C   1 
ATOM   896  O O   . MET A 1 126 ? 26.647  18.518  -21.720 1.00 61.45  ? 421 MET A O   1 
ATOM   897  C CB  . MET A 1 126 ? 27.860  16.858  -24.272 1.00 67.65  ? 421 MET A CB  1 
ATOM   898  C CG  . MET A 1 126 ? 27.801  16.725  -25.779 1.00 70.72  ? 421 MET A CG  1 
ATOM   899  S SD  . MET A 1 126 ? 26.106  16.725  -26.386 1.00 96.66  ? 421 MET A SD  1 
ATOM   900  C CE  . MET A 1 126 ? 25.596  15.078  -25.899 1.00 90.00  ? 421 MET A CE  1 
ATOM   901  N N   . VAL A 1 127 ? 28.864  18.175  -21.576 1.00 45.53  ? 422 VAL A N   1 
ATOM   902  C CA  . VAL A 1 127 ? 28.823  18.160  -20.118 1.00 48.47  ? 422 VAL A CA  1 
ATOM   903  C C   . VAL A 1 127 ? 28.421  19.512  -19.542 1.00 50.03  ? 422 VAL A C   1 
ATOM   904  O O   . VAL A 1 127 ? 27.795  19.578  -18.485 1.00 51.17  ? 422 VAL A O   1 
ATOM   905  C CB  . VAL A 1 127 ? 30.107  17.552  -19.443 1.00 56.17  ? 422 VAL A CB  1 
ATOM   906  C CG1 . VAL A 1 127 ? 31.145  17.051  -20.443 1.00 65.22  ? 422 VAL A CG1 1 
ATOM   907  C CG2 . VAL A 1 127 ? 30.642  18.385  -18.281 1.00 47.55  ? 422 VAL A CG2 1 
ATOM   908  N N   . GLU A 1 128 ? 28.742  20.581  -20.261 1.00 46.55  ? 423 GLU A N   1 
ATOM   909  C CA  . GLU A 1 128 ? 28.287  21.909  -19.872 1.00 53.03  ? 423 GLU A CA  1 
ATOM   910  C C   . GLU A 1 128 ? 26.766  21.968  -19.896 1.00 47.08  ? 423 GLU A C   1 
ATOM   911  O O   . GLU A 1 128 ? 26.139  22.434  -18.945 1.00 46.62  ? 423 GLU A O   1 
ATOM   912  C CB  . GLU A 1 128 ? 28.864  22.978  -20.800 1.00 61.58  ? 423 GLU A CB  1 
ATOM   913  C CG  . GLU A 1 128 ? 30.378  22.978  -20.885 1.00 77.03  ? 423 GLU A CG  1 
ATOM   914  C CD  . GLU A 1 128 ? 30.903  24.045  -21.826 1.00 91.97  ? 423 GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 128 ? 32.118  24.036  -22.121 1.00 99.91  ? 423 GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 128 ? 30.100  24.892  -22.274 1.00 95.30  ? 423 GLU A OE2 1 
ATOM   917  N N   . ILE A 1 129 ? 26.178  21.491  -20.988 1.00 39.97  ? 424 ILE A N   1 
ATOM   918  C CA  . ILE A 1 129 ? 24.721  21.471  -21.136 1.00 40.75  ? 424 ILE A CA  1 
ATOM   919  C C   . ILE A 1 129 ? 24.094  20.595  -20.063 1.00 40.03  ? 424 ILE A C   1 
ATOM   920  O O   . ILE A 1 129 ? 23.098  20.962  -19.446 1.00 44.66  ? 424 ILE A O   1 
ATOM   921  C CB  . ILE A 1 129 ? 24.300  20.934  -22.512 1.00 44.19  ? 424 ILE A CB  1 
ATOM   922  C CG1 . ILE A 1 129 ? 24.877  21.813  -23.626 1.00 47.39  ? 424 ILE A CG1 1 
ATOM   923  C CG2 . ILE A 1 129 ? 22.777  20.864  -22.609 1.00 45.60  ? 424 ILE A CG2 1 
ATOM   924  C CD1 . ILE A 1 129 ? 24.820  21.170  -25.006 1.00 47.94  ? 424 ILE A CD1 1 
ATOM   925  N N   . PHE A 1 130 ? 24.689  19.430  -19.846 1.00 37.06  ? 425 PHE A N   1 
ATOM   926  C CA  . PHE A 1 130 ? 24.225  18.525  -18.810 1.00 39.48  ? 425 PHE A CA  1 
ATOM   927  C C   . PHE A 1 130 ? 24.231  19.274  -17.479 1.00 34.36  ? 425 PHE A C   1 
ATOM   928  O O   . PHE A 1 130 ? 23.246  19.274  -16.747 1.00 38.99  ? 425 PHE A O   1 
ATOM   929  C CB  . PHE A 1 130 ? 25.132  17.293  -18.742 1.00 43.96  ? 425 PHE A CB  1 
ATOM   930  C CG  . PHE A 1 130 ? 24.534  16.133  -17.992 1.00 45.32  ? 425 PHE A CG  1 
ATOM   931  C CD1 . PHE A 1 130 ? 24.584  16.086  -16.608 1.00 47.72  ? 425 PHE A CD1 1 
ATOM   932  C CD2 . PHE A 1 130 ? 23.937  15.079  -18.672 1.00 41.39  ? 425 PHE A CD2 1 
ATOM   933  C CE1 . PHE A 1 130 ? 24.041  15.021  -15.916 1.00 44.23  ? 425 PHE A CE1 1 
ATOM   934  C CE2 . PHE A 1 130 ? 23.392  14.012  -17.984 1.00 38.62  ? 425 PHE A CE2 1 
ATOM   935  C CZ  . PHE A 1 130 ? 23.444  13.981  -16.604 1.00 39.48  ? 425 PHE A CZ  1 
ATOM   936  N N   . ASP A 1 131 ? 25.352  19.917  -17.178 1.00 31.37  ? 426 ASP A N   1 
ATOM   937  C CA  . ASP A 1 131 ? 25.485  20.697  -15.957 1.00 33.55  ? 426 ASP A CA  1 
ATOM   938  C C   . ASP A 1 131 ? 24.414  21.785  -15.868 1.00 38.23  ? 426 ASP A C   1 
ATOM   939  O O   . ASP A 1 131 ? 23.890  22.066  -14.790 1.00 41.73  ? 426 ASP A O   1 
ATOM   940  C CB  . ASP A 1 131 ? 26.879  21.318  -15.869 1.00 32.42  ? 426 ASP A CB  1 
ATOM   941  C CG  . ASP A 1 131 ? 27.951  20.301  -15.497 1.00 51.51  ? 426 ASP A CG  1 
ATOM   942  O OD1 . ASP A 1 131 ? 27.600  19.195  -15.021 1.00 49.88  ? 426 ASP A OD1 1 
ATOM   943  O OD2 . ASP A 1 131 ? 29.147  20.614  -15.676 1.00 52.63  ? 426 ASP A OD2 1 
ATOM   944  N N   . MET A 1 132 ? 24.085  22.392  -17.002 1.00 40.65  ? 427 MET A N   1 
ATOM   945  C CA  . MET A 1 132 ? 23.059  23.432  -17.027 1.00 44.00  ? 427 MET A CA  1 
ATOM   946  C C   . MET A 1 132 ? 21.665  22.861  -16.793 1.00 38.13  ? 427 MET A C   1 
ATOM   947  O O   . MET A 1 132 ? 20.838  23.482  -16.124 1.00 37.43  ? 427 MET A O   1 
ATOM   948  C CB  . MET A 1 132 ? 23.104  24.214  -18.341 1.00 45.18  ? 427 MET A CB  1 
ATOM   949  C CG  . MET A 1 132 ? 24.284  25.172  -18.448 1.00 48.28  ? 427 MET A CG  1 
ATOM   950  S SD  . MET A 1 132 ? 24.206  26.196  -19.931 1.00 54.81  ? 427 MET A SD  1 
ATOM   951  C CE  . MET A 1 132 ? 24.441  24.974  -21.223 1.00 44.48  ? 427 MET A CE  1 
ATOM   952  N N   . LEU A 1 133 ? 21.405  21.682  -17.349 1.00 27.84  ? 428 LEU A N   1 
ATOM   953  C CA  . LEU A 1 133 ? 20.108  21.031  -17.172 1.00 29.03  ? 428 LEU A CA  1 
ATOM   954  C C   . LEU A 1 133 ? 19.903  20.671  -15.703 1.00 33.26  ? 428 LEU A C   1 
ATOM   955  O O   . LEU A 1 133 ? 18.836  20.914  -15.132 1.00 33.26  ? 428 LEU A O   1 
ATOM   956  C CB  . LEU A 1 133 ? 20.003  19.787  -18.067 1.00 28.37  ? 428 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 133 ? 19.907  20.110  -19.562 1.00 25.59  ? 428 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 133 ? 20.233  18.904  -20.421 1.00 29.51  ? 428 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 133 ? 18.533  20.664  -19.904 1.00 22.81  ? 428 LEU A CD2 1 
ATOM   960  N N   . LEU A 1 134 ? 20.937  20.099  -15.091 1.00 34.48  ? 429 LEU A N   1 
ATOM   961  C CA  . LEU A 1 134 ? 20.925  19.798  -13.657 1.00 37.32  ? 429 LEU A CA  1 
ATOM   962  C C   . LEU A 1 134 ? 20.620  21.034  -12.811 1.00 36.66  ? 429 LEU A C   1 
ATOM   963  O O   . LEU A 1 134 ? 19.796  20.983  -11.897 1.00 38.84  ? 429 LEU A O   1 
ATOM   964  C CB  . LEU A 1 134 ? 22.271  19.201  -13.223 1.00 40.99  ? 429 LEU A CB  1 
ATOM   965  C CG  . LEU A 1 134 ? 22.512  17.728  -13.563 1.00 41.96  ? 429 LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 134 ? 23.935  17.330  -13.212 1.00 41.98  ? 429 LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 134 ? 21.505  16.842  -12.836 1.00 43.40  ? 429 LEU A CD2 1 
ATOM   968  N N   . ALA A 1 135 ? 21.286  22.142  -13.122 1.00 32.45  ? 430 ALA A N   1 
ATOM   969  C CA  . ALA A 1 135 ? 21.093  23.379  -12.371 1.00 33.47  ? 430 ALA A CA  1 
ATOM   970  C C   . ALA A 1 135 ? 19.641  23.837  -12.453 1.00 34.99  ? 430 ALA A C   1 
ATOM   971  O O   . ALA A 1 135 ? 19.016  24.158  -11.440 1.00 37.28  ? 430 ALA A O   1 
ATOM   972  C CB  . ALA A 1 135 ? 22.025  24.465  -12.876 1.00 31.05  ? 430 ALA A CB  1 
ATOM   973  N N   . THR A 1 136 ? 19.108  23.862  -13.668 1.00 35.88  ? 431 THR A N   1 
ATOM   974  C CA  . THR A 1 136 ? 17.730  24.270  -13.891 1.00 36.45  ? 431 THR A CA  1 
ATOM   975  C C   . THR A 1 136 ? 16.783  23.401  -13.074 1.00 34.49  ? 431 THR A C   1 
ATOM   976  O O   . THR A 1 136 ? 15.849  23.899  -12.445 1.00 32.83  ? 431 THR A O   1 
ATOM   977  C CB  . THR A 1 136 ? 17.361  24.156  -15.375 1.00 34.64  ? 431 THR A CB  1 
ATOM   978  O OG1 . THR A 1 136 ? 18.400  24.753  -16.164 1.00 33.47  ? 431 THR A OG1 1 
ATOM   979  C CG2 . THR A 1 136 ? 16.037  24.862  -15.654 1.00 27.37  ? 431 THR A CG2 1 
ATOM   980  N N   . SER A 1 137 ? 17.037  22.097  -13.079 1.00 34.24  ? 432 SER A N   1 
ATOM   981  C CA  . SER A 1 137 ? 16.199  21.167  -12.340 1.00 31.63  ? 432 SER A CA  1 
ATOM   982  C C   . SER A 1 137 ? 16.249  21.445  -10.837 1.00 37.26  ? 432 SER A C   1 
ATOM   983  O O   . SER A 1 137 ? 15.227  21.384  -10.152 1.00 41.50  ? 432 SER A O   1 
ATOM   984  C CB  . SER A 1 137 ? 16.622  19.727  -12.625 1.00 37.32  ? 432 SER A CB  1 
ATOM   985  O OG  . SER A 1 137 ? 15.691  18.821  -12.064 1.00 38.85  ? 432 SER A OG  1 
ATOM   986  N N   . SER A 1 138 ? 17.440  21.741  -10.326 1.00 38.51  ? 433 SER A N   1 
ATOM   987  C CA  . SER A 1 138 ? 17.592  22.098  -8.919  1.00 40.68  ? 433 SER A CA  1 
ATOM   988  C C   . SER A 1 138 ? 16.822  23.376  -8.606  1.00 41.40  ? 433 SER A C   1 
ATOM   989  O O   . SER A 1 138 ? 16.167  23.484  -7.569  1.00 46.00  ? 433 SER A O   1 
ATOM   990  C CB  . SER A 1 138 ? 19.066  22.287  -8.568  1.00 46.11  ? 433 SER A CB  1 
ATOM   991  O OG  . SER A 1 138 ? 19.789  21.101  -8.830  1.00 56.35  ? 433 SER A OG  1 
ATOM   992  N N   . ARG A 1 139 ? 16.909  24.346  -9.507  1.00 37.86  ? 434 ARG A N   1 
ATOM   993  C CA  . ARG A 1 139 ? 16.212  25.611  -9.323  1.00 43.46  ? 434 ARG A CA  1 
ATOM   994  C C   . ARG A 1 139 ? 14.714  25.373  -9.171  1.00 44.07  ? 434 ARG A C   1 
ATOM   995  O O   . ARG A 1 139 ? 14.077  25.925  -8.273  1.00 48.62  ? 434 ARG A O   1 
ATOM   996  C CB  . ARG A 1 139 ? 16.491  26.545  -10.499 1.00 47.86  ? 434 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 139 ? 15.813  27.899  -10.396 1.00 55.45  ? 434 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 139 ? 16.705  28.939  -9.736  1.00 62.69  ? 434 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 139 ? 16.031  30.234  -9.649  1.00 68.17  ? 434 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 139 ? 15.423  30.686  -8.559  1.00 66.08  ? 434 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 139 ? 15.413  29.950  -7.456  1.00 69.03  ? 434 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 139 ? 14.829  31.873  -8.571  1.00 57.84  ? 434 ARG A NH2 1 
ATOM   1003 N N   . PHE A 1 140 ? 14.154  24.545  -10.048 1.00 43.98  ? 435 PHE A N   1 
ATOM   1004 C CA  . PHE A 1 140 ? 12.726  24.228  -9.983  1.00 41.30  ? 435 PHE A CA  1 
ATOM   1005 C C   . PHE A 1 140 ? 12.401  23.514  -8.682  1.00 37.61  ? 435 PHE A C   1 
ATOM   1006 O O   . PHE A 1 140 ? 11.368  23.760  -8.064  1.00 38.42  ? 435 PHE A O   1 
ATOM   1007 C CB  . PHE A 1 140 ? 12.304  23.363  -11.171 1.00 41.59  ? 435 PHE A CB  1 
ATOM   1008 C CG  . PHE A 1 140 ? 12.067  24.143  -12.429 1.00 40.49  ? 435 PHE A CG  1 
ATOM   1009 C CD1 . PHE A 1 140 ? 11.741  25.482  -12.376 1.00 43.98  ? 435 PHE A CD1 1 
ATOM   1010 C CD2 . PHE A 1 140 ? 12.145  23.529  -13.662 1.00 43.51  ? 435 PHE A CD2 1 
ATOM   1011 C CE1 . PHE A 1 140 ? 11.512  26.198  -13.536 1.00 42.67  ? 435 PHE A CE1 1 
ATOM   1012 C CE2 . PHE A 1 140 ? 11.923  24.239  -14.825 1.00 39.70  ? 435 PHE A CE2 1 
ATOM   1013 C CZ  . PHE A 1 140 ? 11.608  25.573  -14.762 1.00 40.32  ? 435 PHE A CZ  1 
ATOM   1014 N N   . ARG A 1 141 ? 13.295  22.623  -8.272  1.00 39.83  ? 436 ARG A N   1 
ATOM   1015 C CA  . ARG A 1 141 ? 13.152  21.933  -7.004  1.00 43.23  ? 436 ARG A CA  1 
ATOM   1016 C C   . ARG A 1 141 ? 13.088  22.967  -5.886  1.00 46.01  ? 436 ARG A C   1 
ATOM   1017 O O   . ARG A 1 141 ? 12.188  22.935  -5.046  1.00 45.79  ? 436 ARG A O   1 
ATOM   1018 C CB  . ARG A 1 141 ? 14.333  20.988  -6.784  1.00 44.45  ? 436 ARG A CB  1 
ATOM   1019 C CG  . ARG A 1 141 ? 14.126  19.955  -5.680  1.00 44.99  ? 436 ARG A CG  1 
ATOM   1020 C CD  . ARG A 1 141 ? 15.409  19.177  -5.408  1.00 46.90  ? 436 ARG A CD  1 
ATOM   1021 N NE  . ARG A 1 141 ? 15.955  18.599  -6.632  1.00 60.92  ? 436 ARG A NE  1 
ATOM   1022 C CZ  . ARG A 1 141 ? 17.184  18.811  -7.094  1.00 61.88  ? 436 ARG A CZ  1 
ATOM   1023 N NH1 . ARG A 1 141 ? 18.030  19.593  -6.429  1.00 60.54  ? 436 ARG A NH1 1 
ATOM   1024 N NH2 . ARG A 1 141 ? 17.570  18.231  -8.223  1.00 60.63  ? 436 ARG A NH2 1 
ATOM   1025 N N   . MET A 1 142 ? 14.037  23.898  -5.893  1.00 38.28  ? 437 MET A N   1 
ATOM   1026 C CA  . MET A 1 142 ? 14.128  24.906  -4.845  1.00 45.84  ? 437 MET A CA  1 
ATOM   1027 C C   . MET A 1 142 ? 12.873  25.759  -4.792  1.00 50.37  ? 437 MET A C   1 
ATOM   1028 O O   . MET A 1 142 ? 12.383  26.084  -3.712  1.00 47.81  ? 437 MET A O   1 
ATOM   1029 C CB  . MET A 1 142 ? 15.349  25.800  -5.063  1.00 53.32  ? 437 MET A CB  1 
ATOM   1030 C CG  . MET A 1 142 ? 16.678  25.060  -5.025  1.00 61.82  ? 437 MET A CG  1 
ATOM   1031 S SD  . MET A 1 142 ? 16.923  24.142  -3.490  1.00 150.72 ? 437 MET A SD  1 
ATOM   1032 C CE  . MET A 1 142 ? 16.800  25.456  -2.280  1.00 106.35 ? 437 MET A CE  1 
ATOM   1033 N N   . MET A 1 143 ? 12.362  26.120  -5.966  1.00 42.54  ? 438 MET A N   1 
ATOM   1034 C CA  . MET A 1 143 ? 11.166  26.953  -6.062  1.00 45.85  ? 438 MET A CA  1 
ATOM   1035 C C   . MET A 1 143 ? 9.894   26.175  -5.781  1.00 37.69  ? 438 MET A C   1 
ATOM   1036 O O   . MET A 1 143 ? 8.814   26.751  -5.715  1.00 40.66  ? 438 MET A O   1 
ATOM   1037 C CB  . MET A 1 143 ? 11.051  27.577  -7.453  1.00 43.49  ? 438 MET A CB  1 
ATOM   1038 C CG  . MET A 1 143 ? 12.158  28.540  -7.807  1.00 42.22  ? 438 MET A CG  1 
ATOM   1039 S SD  . MET A 1 143 ? 11.783  29.351  -9.369  1.00 48.10  ? 438 MET A SD  1 
ATOM   1040 C CE  . MET A 1 143 ? 10.442  30.431  -8.865  1.00 38.48  ? 438 MET A CE  1 
ATOM   1041 N N   . ASN A 1 144 ? 10.018  24.861  -5.646  1.00 36.20  ? 439 ASN A N   1 
ATOM   1042 C CA  . ASN A 1 144 ? 8.850   24.020  -5.429  1.00 38.25  ? 439 ASN A CA  1 
ATOM   1043 C C   . ASN A 1 144 ? 7.847   24.170  -6.575  1.00 37.74  ? 439 ASN A C   1 
ATOM   1044 O O   . ASN A 1 144 ? 6.639   24.274  -6.353  1.00 35.27  ? 439 ASN A O   1 
ATOM   1045 C CB  . ASN A 1 144 ? 8.195   24.367  -4.092  1.00 44.82  ? 439 ASN A CB  1 
ATOM   1046 C CG  . ASN A 1 144 ? 7.088   23.406  -3.718  1.00 53.98  ? 439 ASN A CG  1 
ATOM   1047 O OD1 . ASN A 1 144 ? 7.203   22.198  -3.929  1.00 58.33  ? 439 ASN A OD1 1 
ATOM   1048 N ND2 . ASN A 1 144 ? 6.001   23.938  -3.159  1.00 52.70  ? 439 ASN A ND2 1 
ATOM   1049 N N   . LEU A 1 145 ? 8.362   24.187  -7.800  1.00 35.51  ? 440 LEU A N   1 
ATOM   1050 C CA  . LEU A 1 145 ? 7.526   24.345  -8.980  1.00 31.04  ? 440 LEU A CA  1 
ATOM   1051 C C   . LEU A 1 145 ? 6.370   23.354  -8.955  1.00 37.87  ? 440 LEU A C   1 
ATOM   1052 O O   . LEU A 1 145 ? 6.556   22.174  -8.644  1.00 37.40  ? 440 LEU A O   1 
ATOM   1053 C CB  . LEU A 1 145 ? 8.355   24.158  -10.261 1.00 31.72  ? 440 LEU A CB  1 
ATOM   1054 C CG  . LEU A 1 145 ? 7.583   24.277  -11.582 1.00 34.69  ? 440 LEU A CG  1 
ATOM   1055 C CD1 . LEU A 1 145 ? 7.088   25.700  -11.785 1.00 40.16  ? 440 LEU A CD1 1 
ATOM   1056 C CD2 . LEU A 1 145 ? 8.434   23.846  -12.757 1.00 34.77  ? 440 LEU A CD2 1 
ATOM   1057 N N   . GLN A 1 146 ? 5.177   23.839  -9.289  1.00 39.36  ? 441 GLN A N   1 
ATOM   1058 C CA  . GLN A 1 146 ? 3.980   22.994  -9.330  1.00 32.81  ? 441 GLN A CA  1 
ATOM   1059 C C   . GLN A 1 146 ? 3.618   22.534  -10.748 1.00 34.59  ? 441 GLN A C   1 
ATOM   1060 O O   . GLN A 1 146 ? 3.875   23.234  -11.727 1.00 34.96  ? 441 GLN A O   1 
ATOM   1061 C CB  . GLN A 1 146 ? 2.801   23.734  -8.703  1.00 39.08  ? 441 GLN A CB  1 
ATOM   1062 C CG  . GLN A 1 146 ? 3.036   24.125  -7.258  1.00 44.50  ? 441 GLN A CG  1 
ATOM   1063 C CD  . GLN A 1 146 ? 3.162   22.915  -6.354  1.00 51.90  ? 441 GLN A CD  1 
ATOM   1064 O OE1 . GLN A 1 146 ? 2.218   22.143  -6.200  1.00 61.32  ? 441 GLN A OE1 1 
ATOM   1065 N NE2 . GLN A 1 146 ? 4.334   22.740  -5.757  1.00 42.11  ? 441 GLN A NE2 1 
ATOM   1066 N N   . GLY A 1 147 ? 3.012   21.352  -10.849 1.00 38.50  ? 442 GLY A N   1 
ATOM   1067 C CA  . GLY A 1 147 ? 2.607   20.803  -12.130 1.00 32.52  ? 442 GLY A CA  1 
ATOM   1068 C C   . GLY A 1 147 ? 1.764   21.775  -12.934 1.00 35.71  ? 442 GLY A C   1 
ATOM   1069 O O   . GLY A 1 147 ? 1.960   21.932  -14.139 1.00 41.98  ? 442 GLY A O   1 
ATOM   1070 N N   . GLU A 1 148 ? 0.825   22.435  -12.265 1.00 31.24  ? 443 GLU A N   1 
ATOM   1071 C CA  . GLU A 1 148 ? -0.034  23.413  -12.926 1.00 29.13  ? 443 GLU A CA  1 
ATOM   1072 C C   . GLU A 1 148 ? 0.761   24.582  -13.497 1.00 32.40  ? 443 GLU A C   1 
ATOM   1073 O O   . GLU A 1 148 ? 0.363   25.165  -14.507 1.00 39.64  ? 443 GLU A O   1 
ATOM   1074 C CB  . GLU A 1 148 ? -1.097  23.943  -11.964 1.00 30.89  ? 443 GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 148 ? -2.146  22.924  -11.567 1.00 45.60  ? 443 GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 148 ? -1.736  22.100  -10.368 1.00 54.86  ? 443 GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 148 ? -0.643  22.350  -9.816  1.00 51.81  ? 443 GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 148 ? -2.512  21.204  -9.974  1.00 64.50  ? 443 GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 149 ? 1.864   24.936  -12.837 1.00 36.84  ? 444 GLU A N   1 
ATOM   1080 C CA  . GLU A 1 149 ? 2.732   26.021  -13.304 1.00 36.24  ? 444 GLU A CA  1 
ATOM   1081 C C   . GLU A 1 149 ? 3.599   25.547  -14.466 1.00 37.40  ? 444 GLU A C   1 
ATOM   1082 O O   . GLU A 1 149 ? 3.851   26.293  -15.417 1.00 30.25  ? 444 GLU A O   1 
ATOM   1083 C CB  . GLU A 1 149 ? 3.642   26.515  -12.178 1.00 35.26  ? 444 GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 149 ? 2.915   27.141  -11.003 1.00 38.65  ? 444 GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 149 ? 3.862   27.536  -9.873  1.00 37.85  ? 444 GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 149 ? 4.803   26.766  -9.575  1.00 37.57  ? 444 GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 149 ? 3.662   28.618  -9.278  1.00 34.25  ? 444 GLU A OE2 1 
ATOM   1088 N N   . PHE A 1 150 ? 4.051   24.298  -14.372 1.00 33.69  ? 445 PHE A N   1 
ATOM   1089 C CA  . PHE A 1 150 ? 4.859   23.678  -15.415 1.00 31.42  ? 445 PHE A CA  1 
ATOM   1090 C C   . PHE A 1 150 ? 4.163   23.680  -16.780 1.00 30.10  ? 445 PHE A C   1 
ATOM   1091 O O   . PHE A 1 150 ? 4.759   24.076  -17.783 1.00 30.06  ? 445 PHE A O   1 
ATOM   1092 C CB  . PHE A 1 150 ? 5.254   22.254  -14.996 1.00 26.62  ? 445 PHE A CB  1 
ATOM   1093 C CG  . PHE A 1 150 ? 5.701   21.371  -16.137 1.00 28.27  ? 445 PHE A CG  1 
ATOM   1094 C CD1 . PHE A 1 150 ? 6.991   21.451  -16.637 1.00 35.60  ? 445 PHE A CD1 1 
ATOM   1095 C CD2 . PHE A 1 150 ? 4.843   20.426  -16.671 1.00 34.96  ? 445 PHE A CD2 1 
ATOM   1096 C CE1 . PHE A 1 150 ? 7.403   20.630  -17.674 1.00 26.51  ? 445 PHE A CE1 1 
ATOM   1097 C CE2 . PHE A 1 150 ? 5.247   19.599  -17.705 1.00 35.31  ? 445 PHE A CE2 1 
ATOM   1098 C CZ  . PHE A 1 150 ? 6.525   19.696  -18.206 1.00 28.03  ? 445 PHE A CZ  1 
ATOM   1099 N N   . VAL A 1 151 ? 2.910   23.232  -16.822 1.00 33.61  ? 446 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 151 ? 2.181   23.181  -18.089 1.00 27.23  ? 446 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 151 ? 1.994   24.580  -18.674 1.00 31.86  ? 446 VAL A C   1 
ATOM   1102 O O   . VAL A 1 151 ? 2.055   24.771  -19.893 1.00 34.01  ? 446 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 151 ? 0.825   22.430  -17.970 1.00 33.84  ? 446 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 151 ? 1.065   20.944  -17.678 1.00 32.23  ? 446 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 151 ? -0.068  23.056  -16.904 1.00 30.13  ? 446 VAL A CG2 1 
ATOM   1106 N N   . CYS A 1 152 ? 1.791   25.566  -17.810 1.00 28.85  ? 447 CYS A N   1 
ATOM   1107 C CA  . CYS A 1 152 ? 1.738   26.949  -18.266 1.00 30.64  ? 447 CYS A CA  1 
ATOM   1108 C C   . CYS A 1 152 ? 3.059   27.371  -18.899 1.00 30.86  ? 447 CYS A C   1 
ATOM   1109 O O   . CYS A 1 152 ? 3.073   27.980  -19.976 1.00 30.23  ? 447 CYS A O   1 
ATOM   1110 C CB  . CYS A 1 152 ? 1.372   27.887  -17.112 1.00 34.07  ? 447 CYS A CB  1 
ATOM   1111 S SG  . CYS A 1 152 ? -0.374  27.780  -16.598 1.00 38.52  ? 447 CYS A SG  1 
ATOM   1112 N N   . LEU A 1 153 ? 4.169   27.057  -18.232 1.00 25.41  ? 448 LEU A N   1 
ATOM   1113 C CA  . LEU A 1 153 ? 5.490   27.464  -18.726 1.00 26.70  ? 448 LEU A CA  1 
ATOM   1114 C C   . LEU A 1 153 ? 5.829   26.788  -20.049 1.00 28.69  ? 448 LEU A C   1 
ATOM   1115 O O   . LEU A 1 153 ? 6.392   27.411  -20.951 1.00 27.95  ? 448 LEU A O   1 
ATOM   1116 C CB  . LEU A 1 153 ? 6.579   27.144  -17.701 1.00 31.95  ? 448 LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 153 ? 6.618   28.014  -16.445 1.00 36.84  ? 448 LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 153 ? 7.630   27.449  -15.470 1.00 36.72  ? 448 LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 153 ? 6.949   29.469  -16.796 1.00 33.51  ? 448 LEU A CD2 1 
ATOM   1120 N N   . LYS A 1 154 ? 5.492   25.506  -20.159 1.00 24.15  ? 449 LYS A N   1 
ATOM   1121 C CA  . LYS A 1 154 ? 5.749   24.767  -21.383 1.00 26.88  ? 449 LYS A CA  1 
ATOM   1122 C C   . LYS A 1 154 ? 4.954   25.356  -22.556 1.00 25.00  ? 449 LYS A C   1 
ATOM   1123 O O   . LYS A 1 154 ? 5.461   25.454  -23.672 1.00 28.31  ? 449 LYS A O   1 
ATOM   1124 C CB  . LYS A 1 154 ? 5.425   23.278  -21.192 1.00 26.54  ? 449 LYS A CB  1 
ATOM   1125 C CG  . LYS A 1 154 ? 5.932   22.388  -22.318 1.00 31.02  ? 449 LYS A CG  1 
ATOM   1126 C CD  . LYS A 1 154 ? 5.935   20.913  -21.935 1.00 31.34  ? 449 LYS A CD  1 
ATOM   1127 C CE  . LYS A 1 154 ? 4.554   20.432  -21.506 1.00 34.17  ? 449 LYS A CE  1 
ATOM   1128 N NZ  . LYS A 1 154 ? 4.423   18.942  -21.618 1.00 38.52  ? 449 LYS A NZ  1 
ATOM   1129 N N   . SER A 1 155 ? 3.709   25.746  -22.298 1.00 28.01  ? 450 SER A N   1 
ATOM   1130 C CA  . SER A 1 155 ? 2.870   26.367  -23.326 1.00 32.94  ? 450 SER A CA  1 
ATOM   1131 C C   . SER A 1 155 ? 3.390   27.747  -23.713 1.00 30.95  ? 450 SER A C   1 
ATOM   1132 O O   . SER A 1 155 ? 3.334   28.142  -24.880 1.00 31.78  ? 450 SER A O   1 
ATOM   1133 C CB  . SER A 1 155 ? 1.423   26.479  -22.847 1.00 34.83  ? 450 SER A CB  1 
ATOM   1134 O OG  . SER A 1 155 ? 0.834   25.192  -22.745 1.00 45.07  ? 450 SER A OG  1 
ATOM   1135 N N   . ILE A 1 156 ? 3.885   28.483  -22.728 1.00 24.00  ? 451 ILE A N   1 
ATOM   1136 C CA  . ILE A 1 156 ? 4.508   29.775  -22.997 1.00 27.08  ? 451 ILE A CA  1 
ATOM   1137 C C   . ILE A 1 156 ? 5.714   29.614  -23.924 1.00 28.96  ? 451 ILE A C   1 
ATOM   1138 O O   . ILE A 1 156 ? 5.891   30.390  -24.867 1.00 23.26  ? 451 ILE A O   1 
ATOM   1139 C CB  . ILE A 1 156 ? 4.923   30.469  -21.691 1.00 25.89  ? 451 ILE A CB  1 
ATOM   1140 C CG1 . ILE A 1 156 ? 3.677   31.028  -20.990 1.00 24.51  ? 451 ILE A CG1 1 
ATOM   1141 C CG2 . ILE A 1 156 ? 5.947   31.568  -21.968 1.00 24.15  ? 451 ILE A CG2 1 
ATOM   1142 C CD1 . ILE A 1 156 ? 3.963   31.632  -19.627 1.00 25.79  ? 451 ILE A CD1 1 
ATOM   1143 N N   . ILE A 1 157 ? 6.528   28.591  -23.675 1.00 25.61  ? 452 ILE A N   1 
ATOM   1144 C CA  . ILE A 1 157 ? 7.690   28.331  -24.522 1.00 21.74  ? 452 ILE A CA  1 
ATOM   1145 C C   . ILE A 1 157 ? 7.281   28.095  -25.969 1.00 25.73  ? 452 ILE A C   1 
ATOM   1146 O O   . ILE A 1 157 ? 7.916   28.587  -26.902 1.00 24.58  ? 452 ILE A O   1 
ATOM   1147 C CB  . ILE A 1 157 ? 8.456   27.092  -24.052 1.00 28.13  ? 452 ILE A CB  1 
ATOM   1148 C CG1 . ILE A 1 157 ? 9.169   27.378  -22.724 1.00 26.58  ? 452 ILE A CG1 1 
ATOM   1149 C CG2 . ILE A 1 157 ? 9.437   26.636  -25.127 1.00 23.17  ? 452 ILE A CG2 1 
ATOM   1150 C CD1 . ILE A 1 157 ? 9.918   26.190  -22.168 1.00 29.72  ? 452 ILE A CD1 1 
ATOM   1151 N N   . LEU A 1 158 ? 6.210   27.332  -26.143 1.00 24.75  ? 453 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 158 ? 5.702   26.976  -27.457 1.00 27.77  ? 453 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 158 ? 5.252   28.209  -28.232 1.00 30.57  ? 453 LEU A C   1 
ATOM   1154 O O   . LEU A 1 158 ? 5.579   28.379  -29.409 1.00 25.38  ? 453 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 158 ? 4.514   26.015  -27.310 1.00 29.74  ? 453 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 158 ? 3.751   25.705  -28.600 1.00 32.85  ? 453 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 158 ? 4.627   24.904  -29.543 1.00 29.97  ? 453 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 158 ? 2.460   24.965  -28.292 1.00 29.95  ? 453 LEU A CD2 1 
ATOM   1159 N N   . LEU A 1 159 ? 4.494   29.071  -27.567 1.00 29.35  ? 454 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 159 ? 3.949   30.257  -28.223 1.00 25.59  ? 454 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 159 ? 4.984   31.370  -28.354 1.00 31.15  ? 454 LEU A C   1 
ATOM   1162 O O   . LEU A 1 159 ? 4.975   32.115  -29.331 1.00 34.44  ? 454 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 159 ? 2.712   30.755  -27.478 1.00 26.43  ? 454 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 159 ? 1.577   29.718  -27.408 1.00 36.86  ? 454 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 159 ? 0.533   30.118  -26.381 1.00 39.46  ? 454 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 159 ? 0.950   29.515  -28.782 1.00 34.73  ? 454 LEU A CD2 1 
ATOM   1167 N N   . ASN A 1 160 ? 5.889   31.465  -27.386 1.00 31.32  ? 455 ASN A N   1 
ATOM   1168 C CA  . ASN A 1 160 ? 6.824   32.596  -27.336 1.00 35.29  ? 455 ASN A CA  1 
ATOM   1169 C C   . ASN A 1 160 ? 8.076   32.461  -28.199 1.00 36.95  ? 455 ASN A C   1 
ATOM   1170 O O   . ASN A 1 160 ? 8.535   33.435  -28.787 1.00 40.07  ? 455 ASN A O   1 
ATOM   1171 C CB  . ASN A 1 160 ? 7.254   32.879  -25.895 1.00 32.41  ? 455 ASN A CB  1 
ATOM   1172 C CG  . ASN A 1 160 ? 8.226   34.045  -25.801 1.00 34.03  ? 455 ASN A CG  1 
ATOM   1173 O OD1 . ASN A 1 160 ? 9.340   33.906  -25.295 1.00 38.58  ? 455 ASN A OD1 1 
ATOM   1174 N ND2 . ASN A 1 160 ? 7.811   35.195  -26.307 1.00 30.64  ? 455 ASN A ND2 1 
ATOM   1175 N N   . SER A 1 161 ? 8.634   31.260  -28.270 1.00 37.07  ? 456 SER A N   1 
ATOM   1176 C CA  . SER A 1 161 ? 9.977   31.094  -28.817 1.00 42.67  ? 456 SER A CA  1 
ATOM   1177 C C   . SER A 1 161 ? 10.175  31.527  -30.270 1.00 39.36  ? 456 SER A C   1 
ATOM   1178 O O   . SER A 1 161 ? 11.221  32.078  -30.622 1.00 45.61  ? 456 SER A O   1 
ATOM   1179 C CB  . SER A 1 161 ? 10.480  29.670  -28.598 1.00 43.30  ? 456 SER A CB  1 
ATOM   1180 O OG  . SER A 1 161 ? 10.745  29.468  -27.218 1.00 44.42  ? 456 SER A OG  1 
ATOM   1181 N N   . GLY A 1 162 ? 9.178   31.286  -31.108 1.00 32.26  ? 457 GLY A N   1 
ATOM   1182 C CA  . GLY A 1 162 ? 9.301   31.618  -32.518 1.00 39.25  ? 457 GLY A CA  1 
ATOM   1183 C C   . GLY A 1 162 ? 8.476   32.808  -32.982 1.00 43.88  ? 457 GLY A C   1 
ATOM   1184 O O   . GLY A 1 162 ? 8.418   33.096  -34.180 1.00 46.78  ? 457 GLY A O   1 
ATOM   1185 N N   . VAL A 1 163 ? 7.838   33.505  -32.048 1.00 42.44  ? 458 VAL A N   1 
ATOM   1186 C CA  . VAL A 1 163 ? 6.927   34.592  -32.425 1.00 53.06  ? 458 VAL A CA  1 
ATOM   1187 C C   . VAL A 1 163 ? 7.627   35.839  -32.989 1.00 60.35  ? 458 VAL A C   1 
ATOM   1188 O O   . VAL A 1 163 ? 7.121   36.470  -33.918 1.00 64.57  ? 458 VAL A O   1 
ATOM   1189 C CB  . VAL A 1 163 ? 5.994   35.003  -31.265 1.00 49.18  ? 458 VAL A CB  1 
ATOM   1190 C CG1 . VAL A 1 163 ? 6.798   35.600  -30.109 1.00 42.61  ? 458 VAL A CG1 1 
ATOM   1191 C CG2 . VAL A 1 163 ? 4.943   35.992  -31.763 1.00 50.74  ? 458 VAL A CG2 1 
ATOM   1192 N N   . TYR A 1 164 ? 8.782   36.192  -32.433 1.00 62.87  ? 459 TYR A N   1 
ATOM   1193 C CA  . TYR A 1 164 ? 9.480   37.410  -32.845 1.00 69.88  ? 459 TYR A CA  1 
ATOM   1194 C C   . TYR A 1 164 ? 10.095  37.284  -34.230 1.00 73.56  ? 459 TYR A C   1 
ATOM   1195 O O   . TYR A 1 164 ? 10.621  38.252  -34.771 1.00 83.66  ? 459 TYR A O   1 
ATOM   1196 C CB  . TYR A 1 164 ? 10.558  37.792  -31.828 1.00 69.61  ? 459 TYR A CB  1 
ATOM   1197 C CG  . TYR A 1 164 ? 10.037  37.852  -30.416 1.00 72.15  ? 459 TYR A CG  1 
ATOM   1198 C CD1 . TYR A 1 164 ? 10.287  36.816  -29.521 1.00 77.22  ? 459 TYR A CD1 1 
ATOM   1199 C CD2 . TYR A 1 164 ? 9.270   38.929  -29.983 1.00 67.90  ? 459 TYR A CD2 1 
ATOM   1200 C CE1 . TYR A 1 164 ? 9.804   36.857  -28.229 1.00 77.62  ? 459 TYR A CE1 1 
ATOM   1201 C CE2 . TYR A 1 164 ? 8.780   38.980  -28.694 1.00 67.99  ? 459 TYR A CE2 1 
ATOM   1202 C CZ  . TYR A 1 164 ? 9.049   37.942  -27.820 1.00 72.37  ? 459 TYR A CZ  1 
ATOM   1203 O OH  . TYR A 1 164 ? 8.563   37.985  -26.531 1.00 67.54  ? 459 TYR A OH  1 
ATOM   1204 N N   . THR A 1 165 ? 10.025  36.092  -34.807 1.00 116.61 ? 460 THR A N   1 
ATOM   1205 C CA  . THR A 1 165 ? 10.619  35.868  -36.116 1.00 111.15 ? 460 THR A CA  1 
ATOM   1206 C C   . THR A 1 165 ? 9.578   35.455  -37.155 1.00 113.87 ? 460 THR A C   1 
ATOM   1207 O O   . THR A 1 165 ? 9.838   34.601  -38.001 1.00 116.77 ? 460 THR A O   1 
ATOM   1208 C CB  . THR A 1 165 ? 11.762  34.831  -36.047 1.00 107.95 ? 460 THR A CB  1 
ATOM   1209 O OG1 . THR A 1 165 ? 11.246  33.565  -35.616 1.00 97.84  ? 460 THR A OG1 1 
ATOM   1210 C CG2 . THR A 1 165 ? 12.840  35.290  -35.070 1.00 94.40  ? 460 THR A CG2 1 
ATOM   1211 N N   . PHE A 1 166 ? 8.396   36.061  -37.085 1.00 115.97 ? 461 PHE A N   1 
ATOM   1212 C CA  . PHE A 1 166 ? 7.372   35.853  -38.106 1.00 116.12 ? 461 PHE A CA  1 
ATOM   1213 C C   . PHE A 1 166 ? 7.710   36.714  -39.298 1.00 121.72 ? 461 PHE A C   1 
ATOM   1214 O O   . PHE A 1 166 ? 7.699   36.261  -40.452 1.00 125.41 ? 461 PHE A O   1 
ATOM   1215 C CB  . PHE A 1 166 ? 5.994   36.256  -37.582 1.00 111.39 ? 461 PHE A CB  1 
ATOM   1216 C CG  . PHE A 1 166 ? 5.320   35.189  -36.783 1.00 105.87 ? 461 PHE A CG  1 
ATOM   1217 C CD1 . PHE A 1 166 ? 5.239   33.896  -37.270 1.00 103.94 ? 461 PHE A CD1 1 
ATOM   1218 C CD2 . PHE A 1 166 ? 4.758   35.474  -35.554 1.00 102.63 ? 461 PHE A CD2 1 
ATOM   1219 C CE1 . PHE A 1 166 ? 4.620   32.907  -36.540 1.00 98.69  ? 461 PHE A CE1 1 
ATOM   1220 C CE2 . PHE A 1 166 ? 4.138   34.489  -34.823 1.00 97.51  ? 461 PHE A CE2 1 
ATOM   1221 C CZ  . PHE A 1 166 ? 4.067   33.203  -35.317 1.00 95.87  ? 461 PHE A CZ  1 
ATOM   1222 N N   . LEU A 1 167 ? 7.993   37.968  -38.942 1.00 126.38 ? 462 LEU A N   1 
ATOM   1223 C CA  . LEU A 1 167 ? 8.408   39.071  -39.808 1.00 132.79 ? 462 LEU A CA  1 
ATOM   1224 C C   . LEU A 1 167 ? 8.187   38.930  -41.312 1.00 138.14 ? 462 LEU A C   1 
ATOM   1225 O O   . LEU A 1 167 ? 8.963   38.265  -41.998 1.00 139.63 ? 462 LEU A O   1 
ATOM   1226 C CB  . LEU A 1 167 ? 9.894   39.347  -39.568 1.00 20.00  ? 462 LEU A CB  1 
ATOM   1227 N N   . SER A 1 168 ? 7.141   39.574  -41.831 1.00 135.77 ? 463 SER A N   1 
ATOM   1228 C CA  . SER A 1 168 ? 6.176   40.352  -41.047 1.00 130.82 ? 463 SER A CA  1 
ATOM   1229 C C   . SER A 1 168 ? 5.152   40.966  -41.991 1.00 129.88 ? 463 SER A C   1 
ATOM   1230 O O   . SER A 1 168 ? 4.353   40.261  -42.605 1.00 129.10 ? 463 SER A O   1 
ATOM   1231 C CB  . SER A 1 168 ? 6.855   41.475  -40.257 1.00 128.21 ? 463 SER A CB  1 
ATOM   1232 N N   . SER A 1 169 ? 5.195   42.292  -42.099 1.00 127.71 ? 464 SER A N   1 
ATOM   1233 C CA  . SER A 1 169 ? 4.354   43.045  -43.027 1.00 125.53 ? 464 SER A CA  1 
ATOM   1234 C C   . SER A 1 169 ? 2.866   42.703  -42.929 1.00 122.98 ? 464 SER A C   1 
ATOM   1235 O O   . SER A 1 169 ? 2.222   43.008  -41.927 1.00 122.90 ? 464 SER A O   1 
ATOM   1236 C CB  . SER A 1 169 ? 4.851   42.878  -44.467 1.00 125.52 ? 464 SER A CB  1 
ATOM   1237 O OG  . SER A 1 169 ? 4.867   41.515  -44.856 1.00 124.37 ? 464 SER A OG  1 
ATOM   1238 N N   . THR A 1 170 ? 2.339   42.078  -43.981 1.00 118.94 ? 465 THR A N   1 
ATOM   1239 C CA  . THR A 1 170 ? 0.920   41.722  -44.090 1.00 115.56 ? 465 THR A CA  1 
ATOM   1240 C C   . THR A 1 170 ? 0.086   41.800  -42.805 1.00 113.94 ? 465 THR A C   1 
ATOM   1241 O O   . THR A 1 170 ? 0.505   41.345  -41.739 1.00 114.90 ? 465 THR A O   1 
ATOM   1242 C CB  . THR A 1 170 ? 0.739   40.319  -44.710 1.00 114.64 ? 465 THR A CB  1 
ATOM   1243 O OG1 . THR A 1 170 ? -0.573  39.828  -44.406 1.00 114.77 ? 465 THR A OG1 1 
ATOM   1244 C CG2 . THR A 1 170 ? 1.772   39.352  -44.156 1.00 112.35 ? 465 THR A CG2 1 
ATOM   1245 N N   . LEU A 1 171 ? -1.108  42.371  -42.937 1.00 112.02 ? 466 LEU A N   1 
ATOM   1246 C CA  . LEU A 1 171 ? -2.077  42.454  -41.848 1.00 110.64 ? 466 LEU A CA  1 
ATOM   1247 C C   . LEU A 1 171 ? -2.300  41.104  -41.172 1.00 108.37 ? 466 LEU A C   1 
ATOM   1248 O O   . LEU A 1 171 ? -2.425  41.027  -39.950 1.00 104.76 ? 466 LEU A O   1 
ATOM   1249 C CB  . LEU A 1 171 ? -3.406  43.003  -42.378 1.00 110.00 ? 466 LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 171 ? -4.684  42.738  -41.577 1.00 107.75 ? 466 LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 171 ? -4.598  43.334  -40.177 1.00 107.97 ? 466 LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 171 ? -5.893  43.283  -42.321 1.00 104.96 ? 466 LEU A CD2 1 
ATOM   1253 N N   . LYS A 1 172 ? -2.353  40.042  -41.970 1.00 69.67  ? 467 LYS A N   1 
ATOM   1254 C CA  . LYS A 1 172 ? -2.543  38.699  -41.435 1.00 69.58  ? 467 LYS A CA  1 
ATOM   1255 C C   . LYS A 1 172 ? -1.384  38.305  -40.520 1.00 68.97  ? 467 LYS A C   1 
ATOM   1256 O O   . LYS A 1 172 ? -1.595  37.726  -39.455 1.00 65.89  ? 467 LYS A O   1 
ATOM   1257 C CB  . LYS A 1 172 ? -2.700  37.679  -42.563 1.00 67.86  ? 467 LYS A CB  1 
ATOM   1258 C CG  . LYS A 1 172 ? -3.115  36.292  -42.088 1.00 74.69  ? 467 LYS A CG  1 
ATOM   1259 C CD  . LYS A 1 172 ? -3.318  35.339  -43.259 1.00 84.94  ? 467 LYS A CD  1 
ATOM   1260 C CE  . LYS A 1 172 ? -3.976  34.038  -42.817 1.00 90.16  ? 467 LYS A CE  1 
ATOM   1261 N NZ  . LYS A 1 172 ? -4.263  33.132  -43.969 1.00 89.79  ? 467 LYS A NZ  1 
ATOM   1262 N N   . SER A 1 173 ? -0.161  38.624  -40.939 1.00 68.06  ? 468 SER A N   1 
ATOM   1263 C CA  . SER A 1 173 ? 1.016   38.334  -40.129 1.00 68.95  ? 468 SER A CA  1 
ATOM   1264 C C   . SER A 1 173 ? 0.921   39.051  -38.790 1.00 65.99  ? 468 SER A C   1 
ATOM   1265 O O   . SER A 1 173 ? 1.279   38.500  -37.749 1.00 67.42  ? 468 SER A O   1 
ATOM   1266 C CB  . SER A 1 173 ? 2.293   38.752  -40.858 1.00 76.78  ? 468 SER A CB  1 
ATOM   1267 O OG  . SER A 1 173 ? 3.447   38.424  -40.098 1.00 85.78  ? 468 SER A OG  1 
ATOM   1268 N N   . LEU A 1 174 ? 0.433   40.285  -38.826 1.00 58.57  ? 469 LEU A N   1 
ATOM   1269 C CA  . LEU A 1 174 ? 0.234   41.065  -37.610 1.00 66.11  ? 469 LEU A CA  1 
ATOM   1270 C C   . LEU A 1 174 ? -0.842  40.442  -36.723 1.00 71.18  ? 469 LEU A C   1 
ATOM   1271 O O   . LEU A 1 174 ? -0.674  40.352  -35.507 1.00 74.85  ? 469 LEU A O   1 
ATOM   1272 C CB  . LEU A 1 174 ? -0.125  42.514  -37.952 1.00 69.73  ? 469 LEU A CB  1 
ATOM   1273 C CG  . LEU A 1 174 ? 1.018   43.365  -38.510 1.00 70.56  ? 469 LEU A CG  1 
ATOM   1274 C CD1 . LEU A 1 174 ? 0.499   44.694  -39.045 1.00 73.74  ? 469 LEU A CD1 1 
ATOM   1275 C CD2 . LEU A 1 174 ? 2.082   43.583  -37.444 1.00 72.02  ? 469 LEU A CD2 1 
ATOM   1276 N N   . GLU A 1 175 ? -1.945  40.015  -37.335 1.00 70.78  ? 470 GLU A N   1 
ATOM   1277 C CA  . GLU A 1 175 ? -3.014  39.346  -36.600 1.00 68.66  ? 470 GLU A CA  1 
ATOM   1278 C C   . GLU A 1 175 ? -2.477  38.125  -35.866 1.00 63.90  ? 470 GLU A C   1 
ATOM   1279 O O   . GLU A 1 175 ? -2.702  37.963  -34.667 1.00 63.56  ? 470 GLU A O   1 
ATOM   1280 C CB  . GLU A 1 175 ? -4.146  38.929  -37.538 1.00 73.96  ? 470 GLU A CB  1 
ATOM   1281 C CG  . GLU A 1 175 ? -4.975  40.078  -38.075 1.00 85.03  ? 470 GLU A CG  1 
ATOM   1282 C CD  . GLU A 1 175 ? -6.154  39.599  -38.900 1.00 93.42  ? 470 GLU A CD  1 
ATOM   1283 O OE1 . GLU A 1 175 ? -6.320  38.368  -39.039 1.00 94.25  ? 470 GLU A OE1 1 
ATOM   1284 O OE2 . GLU A 1 175 ? -6.915  40.450  -39.409 1.00 96.82  ? 470 GLU A OE2 1 
ATOM   1285 N N   . GLU A 1 176 ? -1.761  37.271  -36.593 1.00 57.79  ? 471 GLU A N   1 
ATOM   1286 C CA  . GLU A 1 176 ? -1.161  36.076  -36.005 1.00 54.05  ? 471 GLU A CA  1 
ATOM   1287 C C   . GLU A 1 176 ? -0.324  36.425  -34.775 1.00 56.55  ? 471 GLU A C   1 
ATOM   1288 O O   . GLU A 1 176 ? -0.459  35.796  -33.725 1.00 50.69  ? 471 GLU A O   1 
ATOM   1289 C CB  . GLU A 1 176 ? -0.301  35.340  -37.036 1.00 48.50  ? 471 GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 176 ? -1.074  34.811  -38.240 1.00 57.62  ? 471 GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 176 ? -1.795  33.501  -37.955 1.00 62.11  ? 471 GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 176 ? -1.128  32.442  -37.938 1.00 55.84  ? 471 GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 176 ? -3.031  33.529  -37.757 1.00 63.43  ? 471 GLU A OE2 1 
ATOM   1294 N N   . LYS A 1 177 ? 0.537   37.433  -34.908 1.00 55.77  ? 472 LYS A N   1 
ATOM   1295 C CA  . LYS A 1 177 ? 1.372   37.870  -33.795 1.00 54.23  ? 472 LYS A CA  1 
ATOM   1296 C C   . LYS A 1 177 ? 0.513   38.404  -32.658 1.00 55.44  ? 472 LYS A C   1 
ATOM   1297 O O   . LYS A 1 177 ? 0.776   38.132  -31.488 1.00 51.08  ? 472 LYS A O   1 
ATOM   1298 C CB  . LYS A 1 177 ? 2.379   38.935  -34.238 1.00 61.16  ? 472 LYS A CB  1 
ATOM   1299 C CG  . LYS A 1 177 ? 3.452   38.425  -35.186 1.00 68.01  ? 472 LYS A CG  1 
ATOM   1300 C CD  . LYS A 1 177 ? 4.754   39.195  -35.007 1.00 75.08  ? 472 LYS A CD  1 
ATOM   1301 C CE  . LYS A 1 177 ? 5.160   39.925  -36.281 1.00 79.41  ? 472 LYS A CE  1 
ATOM   1302 N NZ  . LYS A 1 177 ? 4.261   41.074  -36.590 1.00 82.95  ? 472 LYS A NZ  1 
ATOM   1303 N N   . ASP A 1 178 ? -0.522  39.161  -33.009 1.00 41.85  ? 473 ASP A N   1 
ATOM   1304 C CA  . ASP A 1 178 ? -1.422  39.720  -32.009 1.00 41.31  ? 473 ASP A CA  1 
ATOM   1305 C C   . ASP A 1 178 ? -2.164  38.628  -31.240 1.00 46.30  ? 473 ASP A C   1 
ATOM   1306 O O   . ASP A 1 178 ? -2.307  38.700  -30.018 1.00 50.39  ? 473 ASP A O   1 
ATOM   1307 C CB  . ASP A 1 178 ? -2.418  40.680  -32.658 1.00 48.95  ? 473 ASP A CB  1 
ATOM   1308 C CG  . ASP A 1 178 ? -2.623  41.936  -31.840 1.00 66.60  ? 473 ASP A CG  1 
ATOM   1309 O OD1 . ASP A 1 178 ? -2.368  43.036  -32.374 1.00 79.91  ? 473 ASP A OD1 1 
ATOM   1310 O OD2 . ASP A 1 178 ? -3.024  41.825  -30.660 1.00 68.04  ? 473 ASP A OD2 1 
ATOM   1311 N N   . HIS A 1 179 ? -2.638  37.618  -31.961 1.00 45.16  ? 474 HIS A N   1 
ATOM   1312 C CA  . HIS A 1 179 ? -3.346  36.505  -31.341 1.00 42.37  ? 474 HIS A CA  1 
ATOM   1313 C C   . HIS A 1 179 ? -2.435  35.731  -30.383 1.00 41.70  ? 474 HIS A C   1 
ATOM   1314 O O   . HIS A 1 179 ? -2.848  35.338  -29.289 1.00 40.99  ? 474 HIS A O   1 
ATOM   1315 C CB  . HIS A 1 179 ? -3.894  35.569  -32.414 1.00 38.42  ? 474 HIS A CB  1 
ATOM   1316 C CG  . HIS A 1 179 ? -4.583  34.361  -31.862 1.00 43.22  ? 474 HIS A CG  1 
ATOM   1317 N ND1 . HIS A 1 179 ? -5.813  34.428  -31.243 1.00 40.82  ? 474 HIS A ND1 1 
ATOM   1318 C CD2 . HIS A 1 179 ? -4.217  33.058  -31.836 1.00 43.10  ? 474 HIS A CD2 1 
ATOM   1319 C CE1 . HIS A 1 179 ? -6.175  33.217  -30.861 1.00 40.90  ? 474 HIS A CE1 1 
ATOM   1320 N NE2 . HIS A 1 179 ? -5.227  32.365  -31.209 1.00 40.62  ? 474 HIS A NE2 1 
ATOM   1321 N N   . ILE A 1 180 ? -1.192  35.514  -30.800 1.00 43.48  ? 475 ILE A N   1 
ATOM   1322 C CA  . ILE A 1 180 ? -0.216  34.830  -29.964 1.00 36.72  ? 475 ILE A CA  1 
ATOM   1323 C C   . ILE A 1 180 ? -0.002  35.571  -28.654 1.00 37.41  ? 475 ILE A C   1 
ATOM   1324 O O   . ILE A 1 180 ? 0.010   34.971  -27.577 1.00 35.28  ? 475 ILE A O   1 
ATOM   1325 C CB  . ILE A 1 180 ? 1.124   34.689  -30.683 1.00 41.01  ? 475 ILE A CB  1 
ATOM   1326 C CG1 . ILE A 1 180 ? 1.006   33.653  -31.797 1.00 43.58  ? 475 ILE A CG1 1 
ATOM   1327 C CG2 . ILE A 1 180 ? 2.221   34.296  -29.698 1.00 39.36  ? 475 ILE A CG2 1 
ATOM   1328 C CD1 . ILE A 1 180 ? 2.282   33.464  -32.577 1.00 40.13  ? 475 ILE A CD1 1 
ATOM   1329 N N   . HIS A 1 181 ? 0.154   36.886  -28.748 1.00 38.90  ? 476 HIS A N   1 
ATOM   1330 C CA  . HIS A 1 181 ? 0.406   37.695  -27.562 1.00 40.76  ? 476 HIS A CA  1 
ATOM   1331 C C   . HIS A 1 181 ? -0.797  37.695  -26.616 1.00 42.58  ? 476 HIS A C   1 
ATOM   1332 O O   . HIS A 1 181 ? -0.639  37.678  -25.391 1.00 44.98  ? 476 HIS A O   1 
ATOM   1333 C CB  . HIS A 1 181 ? 0.824   39.115  -27.949 1.00 51.23  ? 476 HIS A CB  1 
ATOM   1334 C CG  . HIS A 1 181 ? 2.196   39.193  -28.553 1.00 61.85  ? 476 HIS A CG  1 
ATOM   1335 N ND1 . HIS A 1 181 ? 3.335   38.819  -27.866 1.00 52.58  ? 476 HIS A ND1 1 
ATOM   1336 C CD2 . HIS A 1 181 ? 2.614   39.612  -29.771 1.00 64.42  ? 476 HIS A CD2 1 
ATOM   1337 C CE1 . HIS A 1 181 ? 4.391   38.994  -28.640 1.00 54.55  ? 476 HIS A CE1 1 
ATOM   1338 N NE2 . HIS A 1 181 ? 3.982   39.477  -29.800 1.00 64.02  ? 476 HIS A NE2 1 
ATOM   1339 N N   . ARG A 1 182 ? -1.998  37.688  -27.180 1.00 35.20  ? 477 ARG A N   1 
ATOM   1340 C CA  . ARG A 1 182 ? -3.202  37.625  -26.357 1.00 43.68  ? 477 ARG A CA  1 
ATOM   1341 C C   . ARG A 1 182 ? -3.320  36.286  -25.622 1.00 41.94  ? 477 ARG A C   1 
ATOM   1342 O O   . ARG A 1 182 ? -3.622  36.252  -24.425 1.00 38.04  ? 477 ARG A O   1 
ATOM   1343 C CB  . ARG A 1 182 ? -4.454  37.952  -27.181 1.00 45.02  ? 477 ARG A CB  1 
ATOM   1344 C CG  . ARG A 1 182 ? -4.668  39.460  -27.372 1.00 50.09  ? 477 ARG A CG  1 
ATOM   1345 C CD  . ARG A 1 182 ? -5.824  39.769  -28.319 1.00 63.26  ? 477 ARG A CD  1 
ATOM   1346 N NE  . ARG A 1 182 ? -5.394  39.819  -29.714 1.00 71.82  ? 477 ARG A NE  1 
ATOM   1347 N N   . VAL A 1 183 ? -3.052  35.189  -26.324 1.00 37.48  ? 478 VAL A N   1 
ATOM   1348 C CA  . VAL A 1 183 ? -3.001  33.880  -25.673 1.00 41.37  ? 478 VAL A CA  1 
ATOM   1349 C C   . VAL A 1 183 ? -1.901  33.820  -24.606 1.00 40.15  ? 478 VAL A C   1 
ATOM   1350 O O   . VAL A 1 183 ? -2.093  33.246  -23.526 1.00 30.28  ? 478 VAL A O   1 
ATOM   1351 C CB  . VAL A 1 183 ? -2.785  32.737  -26.682 1.00 39.50  ? 478 VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 183 ? -2.798  31.399  -25.960 1.00 40.53  ? 478 VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 183 ? -3.856  32.773  -27.764 1.00 33.34  ? 478 VAL A CG2 1 
ATOM   1354 N N   . LEU A 1 184 ? -0.747  34.413  -24.906 1.00 25.61  ? 479 LEU A N   1 
ATOM   1355 C CA  . LEU A 1 184 ? 0.315   34.517  -23.908 1.00 24.96  ? 479 LEU A CA  1 
ATOM   1356 C C   . LEU A 1 184 ? -0.195  35.235  -22.661 1.00 31.92  ? 479 LEU A C   1 
ATOM   1357 O O   . LEU A 1 184 ? 0.057   34.796  -21.536 1.00 30.23  ? 479 LEU A O   1 
ATOM   1358 C CB  . LEU A 1 184 ? 1.547   35.234  -24.487 1.00 29.09  ? 479 LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 184 ? 2.486   34.356  -25.334 1.00 28.53  ? 479 LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 184 ? 3.618   35.181  -25.952 1.00 24.87  ? 479 LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 184 ? 3.049   33.231  -24.485 1.00 26.96  ? 479 LEU A CD2 1 
ATOM   1362 N N   . ASP A 1 185 ? -0.921  36.334  -22.874 1.00 29.27  ? 480 ASP A N   1 
ATOM   1363 C CA  . ASP A 1 185 ? -1.504  37.118  -21.781 1.00 30.50  ? 480 ASP A CA  1 
ATOM   1364 C C   . ASP A 1 185 ? -2.440  36.262  -20.921 1.00 38.58  ? 480 ASP A C   1 
ATOM   1365 O O   . ASP A 1 185 ? -2.429  36.346  -19.687 1.00 32.22  ? 480 ASP A O   1 
ATOM   1366 C CB  . ASP A 1 185 ? -2.272  38.330  -22.324 1.00 34.96  ? 480 ASP A CB  1 
ATOM   1367 C CG  . ASP A 1 185 ? -1.357  39.493  -22.695 1.00 42.78  ? 480 ASP A CG  1 
ATOM   1368 O OD1 . ASP A 1 185 ? -0.206  39.539  -22.211 1.00 44.79  ? 480 ASP A OD1 1 
ATOM   1369 O OD2 . ASP A 1 185 ? -1.794  40.373  -23.464 1.00 50.11  ? 480 ASP A OD2 1 
ATOM   1370 N N   . LYS A 1 186 ? -3.260  35.441  -21.571 1.00 35.76  ? 481 LYS A N   1 
ATOM   1371 C CA  . LYS A 1 186 ? -4.192  34.586  -20.839 1.00 36.04  ? 481 LYS A CA  1 
ATOM   1372 C C   . LYS A 1 186 ? -3.439  33.561  -19.991 1.00 33.24  ? 481 LYS A C   1 
ATOM   1373 O O   . LYS A 1 186 ? -3.845  33.249  -18.872 1.00 35.00  ? 481 LYS A O   1 
ATOM   1374 C CB  . LYS A 1 186 ? -5.162  33.895  -21.800 1.00 42.29  ? 481 LYS A CB  1 
ATOM   1375 C CG  . LYS A 1 186 ? -6.058  32.846  -21.146 1.00 44.85  ? 481 LYS A CG  1 
ATOM   1376 C CD  . LYS A 1 186 ? -7.074  33.468  -20.207 1.00 45.22  ? 481 LYS A CD  1 
ATOM   1377 C CE  . LYS A 1 186 ? -8.029  34.374  -20.963 1.00 50.55  ? 481 LYS A CE  1 
ATOM   1378 N NZ  . LYS A 1 186 ? -9.165  34.810  -20.111 1.00 48.63  ? 481 LYS A NZ  1 
ATOM   1379 N N   . ILE A 1 187 ? -2.332  33.045  -20.513 1.00 32.52  ? 482 ILE A N   1 
ATOM   1380 C CA  . ILE A 1 187 ? -1.533  32.093  -19.743 1.00 29.98  ? 482 ILE A CA  1 
ATOM   1381 C C   . ILE A 1 187 ? -0.845  32.780  -18.564 1.00 33.25  ? 482 ILE A C   1 
ATOM   1382 O O   . ILE A 1 187 ? -0.745  32.203  -17.483 1.00 34.41  ? 482 ILE A O   1 
ATOM   1383 C CB  . ILE A 1 187 ? -0.511  31.354  -20.618 1.00 32.87  ? 482 ILE A CB  1 
ATOM   1384 C CG1 . ILE A 1 187 ? -1.232  30.563  -21.716 1.00 37.45  ? 482 ILE A CG1 1 
ATOM   1385 C CG2 . ILE A 1 187 ? 0.337   30.427  -19.760 1.00 28.94  ? 482 ILE A CG2 1 
ATOM   1386 C CD1 . ILE A 1 187 ? -0.296  29.749  -22.604 1.00 40.73  ? 482 ILE A CD1 1 
ATOM   1387 N N   . THR A 1 188 ? -0.393  34.018  -18.763 1.00 32.02  ? 483 THR A N   1 
ATOM   1388 C CA  . THR A 1 188 ? 0.121   34.816  -17.655 1.00 32.82  ? 483 THR A CA  1 
ATOM   1389 C C   . THR A 1 188 ? -0.943  34.981  -16.573 1.00 37.48  ? 483 THR A C   1 
ATOM   1390 O O   . THR A 1 188 ? -0.673  34.748  -15.392 1.00 32.59  ? 483 THR A O   1 
ATOM   1391 C CB  . THR A 1 188 ? 0.558   36.222  -18.112 1.00 36.06  ? 483 THR A CB  1 
ATOM   1392 O OG1 . THR A 1 188 ? 1.642   36.108  -19.037 1.00 42.10  ? 483 THR A OG1 1 
ATOM   1393 C CG2 . THR A 1 188 ? 0.997   37.046  -16.910 1.00 33.17  ? 483 THR A CG2 1 
ATOM   1394 N N   . ASP A 1 189 ? -2.143  35.396  -16.987 1.00 33.24  ? 484 ASP A N   1 
ATOM   1395 C CA  . ASP A 1 189 ? -3.294  35.487  -16.084 1.00 38.36  ? 484 ASP A CA  1 
ATOM   1396 C C   . ASP A 1 189 ? -3.443  34.199  -15.281 1.00 37.27  ? 484 ASP A C   1 
ATOM   1397 O O   . ASP A 1 189 ? -3.618  34.219  -14.063 1.00 36.68  ? 484 ASP A O   1 
ATOM   1398 C CB  . ASP A 1 189 ? -4.595  35.730  -16.868 1.00 37.77  ? 484 ASP A CB  1 
ATOM   1399 C CG  . ASP A 1 189 ? -4.648  37.095  -17.533 1.00 43.47  ? 484 ASP A CG  1 
ATOM   1400 O OD1 . ASP A 1 189 ? -3.751  37.922  -17.297 1.00 36.08  ? 484 ASP A OD1 1 
ATOM   1401 O OD2 . ASP A 1 189 ? -5.603  37.349  -18.299 1.00 54.56  ? 484 ASP A OD2 1 
ATOM   1402 N N   . THR A 1 190 ? -3.377  33.076  -15.983 1.00 36.99  ? 485 THR A N   1 
ATOM   1403 C CA  . THR A 1 190 ? -3.536  31.769  -15.368 1.00 33.10  ? 485 THR A CA  1 
ATOM   1404 C C   . THR A 1 190 ? -2.471  31.482  -14.311 1.00 33.39  ? 485 THR A C   1 
ATOM   1405 O O   . THR A 1 190 ? -2.786  31.036  -13.203 1.00 37.55  ? 485 THR A O   1 
ATOM   1406 C CB  . THR A 1 190 ? -3.529  30.688  -16.445 1.00 39.55  ? 485 THR A CB  1 
ATOM   1407 O OG1 . THR A 1 190 ? -4.577  30.969  -17.382 1.00 35.91  ? 485 THR A OG1 1 
ATOM   1408 C CG2 . THR A 1 190 ? -3.741  29.310  -15.834 1.00 39.88  ? 485 THR A CG2 1 
ATOM   1409 N N   . LEU A 1 191 ? -1.210  31.741  -14.647 1.00 31.83  ? 486 LEU A N   1 
ATOM   1410 C CA  . LEU A 1 191 ? -0.124  31.593  -13.676 1.00 29.05  ? 486 LEU A CA  1 
ATOM   1411 C C   . LEU A 1 191 ? -0.402  32.390  -12.406 1.00 35.76  ? 486 LEU A C   1 
ATOM   1412 O O   . LEU A 1 191 ? -0.303  31.867  -11.293 1.00 37.84  ? 486 LEU A O   1 
ATOM   1413 C CB  . LEU A 1 191 ? 1.217   32.032  -14.283 1.00 30.08  ? 486 LEU A CB  1 
ATOM   1414 C CG  . LEU A 1 191 ? 1.954   30.992  -15.137 1.00 33.81  ? 486 LEU A CG  1 
ATOM   1415 C CD1 . LEU A 1 191 ? 3.122   31.629  -15.874 1.00 32.53  ? 486 LEU A CD1 1 
ATOM   1416 C CD2 . LEU A 1 191 ? 2.432   29.829  -14.270 1.00 28.97  ? 486 LEU A CD2 1 
ATOM   1417 N N   . ILE A 1 192 ? -0.744  33.663  -12.575 1.00 38.35  ? 487 ILE A N   1 
ATOM   1418 C CA  . ILE A 1 192 ? -1.039  34.525  -11.435 1.00 32.89  ? 487 ILE A CA  1 
ATOM   1419 C C   . ILE A 1 192 ? -2.221  33.980  -10.638 1.00 39.04  ? 487 ILE A C   1 
ATOM   1420 O O   . ILE A 1 192 ? -2.179  33.921  -9.405  1.00 39.27  ? 487 ILE A O   1 
ATOM   1421 C CB  . ILE A 1 192 ? -1.337  35.969  -11.881 1.00 39.46  ? 487 ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 192 ? -0.093  36.586  -12.530 1.00 36.81  ? 487 ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 192 ? -1.787  36.816  -10.695 1.00 36.52  ? 487 ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 192 ? 1.101   36.649  -11.604 1.00 30.49  ? 487 ILE A CD1 1 
ATOM   1425 N N   . HIS A 1 193 ? -3.272  33.567  -11.342 1.00 40.90  ? 488 HIS A N   1 
ATOM   1426 C CA  . HIS A 1 193 ? -4.436  32.997  -10.673 1.00 43.56  ? 488 HIS A CA  1 
ATOM   1427 C C   . HIS A 1 193 ? -4.055  31.805  -9.797  1.00 39.77  ? 488 HIS A C   1 
ATOM   1428 O O   . HIS A 1 193 ? -4.512  31.694  -8.662  1.00 37.49  ? 488 HIS A O   1 
ATOM   1429 C CB  . HIS A 1 193 ? -5.507  32.583  -11.675 1.00 46.59  ? 488 HIS A CB  1 
ATOM   1430 C CG  . HIS A 1 193 ? -6.705  31.953  -11.038 1.00 53.93  ? 488 HIS A CG  1 
ATOM   1431 N ND1 . HIS A 1 193 ? -6.916  30.591  -11.032 1.00 56.82  ? 488 HIS A ND1 1 
ATOM   1432 C CD2 . HIS A 1 193 ? -7.747  32.498  -10.367 1.00 56.94  ? 488 HIS A CD2 1 
ATOM   1433 C CE1 . HIS A 1 193 ? -8.044  30.325  -10.396 1.00 55.04  ? 488 HIS A CE1 1 
ATOM   1434 N NE2 . HIS A 1 193 ? -8.566  31.465  -9.982  1.00 57.22  ? 488 HIS A NE2 1 
ATOM   1435 N N   . LEU A 1 194 ? -3.211  30.919  -10.322 1.00 37.40  ? 489 LEU A N   1 
ATOM   1436 C CA  . LEU A 1 194 ? -2.721  29.787  -9.535  1.00 36.54  ? 489 LEU A CA  1 
ATOM   1437 C C   . LEU A 1 194 ? -1.998  30.254  -8.270  1.00 41.80  ? 489 LEU A C   1 
ATOM   1438 O O   . LEU A 1 194 ? -2.235  29.732  -7.176  1.00 39.47  ? 489 LEU A O   1 
ATOM   1439 C CB  . LEU A 1 194 ? -1.784  28.904  -10.366 1.00 31.87  ? 489 LEU A CB  1 
ATOM   1440 C CG  . LEU A 1 194 ? -2.336  28.116  -11.558 1.00 30.74  ? 489 LEU A CG  1 
ATOM   1441 C CD1 . LEU A 1 194 ? -1.195  27.505  -12.354 1.00 32.48  ? 489 LEU A CD1 1 
ATOM   1442 C CD2 . LEU A 1 194 ? -3.308  27.038  -11.097 1.00 36.22  ? 489 LEU A CD2 1 
ATOM   1443 N N   . MET A 1 195 ? -1.115  31.238  -8.430  1.00 40.93  ? 490 MET A N   1 
ATOM   1444 C CA  . MET A 1 195 ? -0.317  31.759  -7.318  1.00 34.80  ? 490 MET A CA  1 
ATOM   1445 C C   . MET A 1 195 ? -1.178  32.418  -6.241  1.00 41.55  ? 490 MET A C   1 
ATOM   1446 O O   . MET A 1 195 ? -0.964  32.191  -5.047  1.00 48.34  ? 490 MET A O   1 
ATOM   1447 C CB  . MET A 1 195 ? 0.732   32.748  -7.829  1.00 37.78  ? 490 MET A CB  1 
ATOM   1448 C CG  . MET A 1 195 ? 1.718   32.123  -8.794  1.00 40.27  ? 490 MET A CG  1 
ATOM   1449 S SD  . MET A 1 195 ? 2.884   33.298  -9.502  1.00 38.35  ? 490 MET A SD  1 
ATOM   1450 C CE  . MET A 1 195 ? 3.640   32.255  -10.743 1.00 32.53  ? 490 MET A CE  1 
ATOM   1451 N N   . ALA A 1 196 ? -2.146  33.230  -6.661  1.00 31.13  ? 491 ALA A N   1 
ATOM   1452 C CA  . ALA A 1 196 ? -3.057  33.873  -5.716  1.00 41.46  ? 491 ALA A CA  1 
ATOM   1453 C C   . ALA A 1 196 ? -3.897  32.830  -4.996  1.00 48.23  ? 491 ALA A C   1 
ATOM   1454 O O   . ALA A 1 196 ? -4.013  32.836  -3.768  1.00 52.21  ? 491 ALA A O   1 
ATOM   1455 C CB  . ALA A 1 196 ? -3.958  34.853  -6.440  1.00 37.64  ? 491 ALA A CB  1 
ATOM   1456 N N   . LYS A 1 197 ? -4.487  31.941  -5.784  1.00 51.63  ? 492 LYS A N   1 
ATOM   1457 C CA  . LYS A 1 197 ? -5.266  30.820  -5.278  1.00 53.64  ? 492 LYS A CA  1 
ATOM   1458 C C   . LYS A 1 197 ? -4.480  30.069  -4.205  1.00 49.95  ? 492 LYS A C   1 
ATOM   1459 O O   . LYS A 1 197 ? -5.047  29.594  -3.217  1.00 49.68  ? 492 LYS A O   1 
ATOM   1460 C CB  . LYS A 1 197 ? -5.586  29.884  -6.443  1.00 60.22  ? 492 LYS A CB  1 
ATOM   1461 C CG  . LYS A 1 197 ? -6.663  28.852  -6.197  1.00 67.92  ? 492 LYS A CG  1 
ATOM   1462 C CD  . LYS A 1 197 ? -6.767  27.948  -7.421  1.00 75.30  ? 492 LYS A CD  1 
ATOM   1463 C CE  . LYS A 1 197 ? -7.896  26.944  -7.303  1.00 84.73  ? 492 LYS A CE  1 
ATOM   1464 N NZ  . LYS A 1 197 ? -7.907  26.025  -8.475  1.00 90.50  ? 492 LYS A NZ  1 
ATOM   1465 N N   . ALA A 1 198 ? -3.167  29.975  -4.400  1.00 45.62  ? 493 ALA A N   1 
ATOM   1466 C CA  . ALA A 1 198 ? -2.304  29.251  -3.475  1.00 42.99  ? 493 ALA A CA  1 
ATOM   1467 C C   . ALA A 1 198 ? -2.058  30.048  -2.202  1.00 49.00  ? 493 ALA A C   1 
ATOM   1468 O O   . ALA A 1 198 ? -1.634  29.494  -1.189  1.00 58.42  ? 493 ALA A O   1 
ATOM   1469 C CB  . ALA A 1 198 ? -0.987  28.881  -4.138  1.00 41.82  ? 493 ALA A CB  1 
ATOM   1470 N N   . GLY A 1 199 ? -2.322  31.349  -2.265  1.00 44.42  ? 494 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 199 ? -2.237  32.209  -1.097  1.00 52.62  ? 494 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 199 ? -1.012  33.097  -1.012  1.00 54.94  ? 494 GLY A C   1 
ATOM   1473 O O   . GLY A 1 199 ? -0.682  33.609  0.061   1.00 57.44  ? 494 GLY A O   1 
ATOM   1474 N N   . LEU A 1 200 ? -0.323  33.272  -2.133  1.00 49.21  ? 495 LEU A N   1 
ATOM   1475 C CA  . LEU A 1 200 ? 0.815   34.183  -2.178  1.00 44.72  ? 495 LEU A CA  1 
ATOM   1476 C C   . LEU A 1 200 ? 0.327   35.626  -2.217  1.00 42.99  ? 495 LEU A C   1 
ATOM   1477 O O   . LEU A 1 200 ? -0.710  35.919  -2.814  1.00 38.49  ? 495 LEU A O   1 
ATOM   1478 C CB  . LEU A 1 200 ? 1.683   33.903  -3.404  1.00 37.73  ? 495 LEU A CB  1 
ATOM   1479 C CG  . LEU A 1 200 ? 2.312   32.517  -3.522  1.00 39.99  ? 495 LEU A CG  1 
ATOM   1480 C CD1 . LEU A 1 200 ? 3.189   32.458  -4.764  1.00 37.18  ? 495 LEU A CD1 1 
ATOM   1481 C CD2 . LEU A 1 200 ? 3.117   32.194  -2.274  1.00 36.41  ? 495 LEU A CD2 1 
ATOM   1482 N N   . THR A 1 201 ? 1.065   36.529  -1.579  1.00 41.66  ? 496 THR A N   1 
ATOM   1483 C CA  . THR A 1 201 ? 0.726   37.945  -1.649  1.00 46.38  ? 496 THR A CA  1 
ATOM   1484 C C   . THR A 1 201 ? 0.920   38.430  -3.081  1.00 47.52  ? 496 THR A C   1 
ATOM   1485 O O   . THR A 1 201 ? 1.495   37.723  -3.910  1.00 48.86  ? 496 THR A O   1 
ATOM   1486 C CB  . THR A 1 201 ? 1.603   38.789  -0.713  1.00 48.25  ? 496 THR A CB  1 
ATOM   1487 O OG1 . THR A 1 201 ? 2.968   38.731  -1.150  1.00 47.59  ? 496 THR A OG1 1 
ATOM   1488 C CG2 . THR A 1 201 ? 1.509   38.267  0.710   1.00 51.65  ? 496 THR A CG2 1 
ATOM   1489 N N   . LEU A 1 202 ? 0.442   39.634  -3.368  1.00 42.78  ? 497 LEU A N   1 
ATOM   1490 C CA  . LEU A 1 202 ? 0.623   40.224  -4.687  1.00 44.49  ? 497 LEU A CA  1 
ATOM   1491 C C   . LEU A 1 202 ? 2.098   40.361  -5.036  1.00 42.89  ? 497 LEU A C   1 
ATOM   1492 O O   . LEU A 1 202 ? 2.505   40.101  -6.171  1.00 40.20  ? 497 LEU A O   1 
ATOM   1493 C CB  . LEU A 1 202 ? -0.055  41.595  -4.759  1.00 48.89  ? 497 LEU A CB  1 
ATOM   1494 C CG  . LEU A 1 202 ? -1.515  41.577  -5.209  1.00 58.03  ? 497 LEU A CG  1 
ATOM   1495 C CD1 . LEU A 1 202 ? -2.139  42.957  -5.054  1.00 61.09  ? 497 LEU A CD1 1 
ATOM   1496 C CD2 . LEU A 1 202 ? -1.610  41.091  -6.647  1.00 61.36  ? 497 LEU A CD2 1 
ATOM   1497 N N   . GLN A 1 203 ? 2.898   40.771  -4.055  1.00 41.94  ? 498 GLN A N   1 
ATOM   1498 C CA  . GLN A 1 203 ? 4.333   40.958  -4.262  1.00 37.85  ? 498 GLN A CA  1 
ATOM   1499 C C   . GLN A 1 203 ? 5.013   39.634  -4.579  1.00 34.19  ? 498 GLN A C   1 
ATOM   1500 O O   . GLN A 1 203 ? 5.819   39.544  -5.501  1.00 41.75  ? 498 GLN A O   1 
ATOM   1501 C CB  . GLN A 1 203 ? 4.972   41.587  -3.026  1.00 39.17  ? 498 GLN A CB  1 
ATOM   1502 C CG  . GLN A 1 203 ? 6.416   41.989  -3.220  1.00 44.77  ? 498 GLN A CG  1 
ATOM   1503 C CD  . GLN A 1 203 ? 7.038   42.499  -1.940  1.00 50.51  ? 498 GLN A CD  1 
ATOM   1504 O OE1 . GLN A 1 203 ? 6.525   42.248  -0.847  1.00 52.31  ? 498 GLN A OE1 1 
ATOM   1505 N NE2 . GLN A 1 203 ? 8.151   43.211  -2.063  1.00 50.64  ? 498 GLN A NE2 1 
ATOM   1506 N N   . GLN A 1 204 ? 4.680   38.604  -3.811  1.00 31.59  ? 499 GLN A N   1 
ATOM   1507 C CA  . GLN A 1 204 ? 5.233   37.269  -4.038  1.00 32.47  ? 499 GLN A CA  1 
ATOM   1508 C C   . GLN A 1 204 ? 4.778   36.707  -5.376  1.00 34.04  ? 499 GLN A C   1 
ATOM   1509 O O   . GLN A 1 204 ? 5.539   36.027  -6.062  1.00 41.20  ? 499 GLN A O   1 
ATOM   1510 C CB  . GLN A 1 204 ? 4.817   36.322  -2.918  1.00 32.49  ? 499 GLN A CB  1 
ATOM   1511 C CG  . GLN A 1 204 ? 5.207   36.800  -1.531  1.00 38.30  ? 499 GLN A CG  1 
ATOM   1512 C CD  . GLN A 1 204 ? 4.699   35.877  -0.443  1.00 48.80  ? 499 GLN A CD  1 
ATOM   1513 O OE1 . GLN A 1 204 ? 3.567   35.392  -0.500  1.00 50.03  ? 499 GLN A OE1 1 
ATOM   1514 N NE2 . GLN A 1 204 ? 5.536   35.627  0.557   1.00 52.51  ? 499 GLN A NE2 1 
ATOM   1515 N N   . GLN A 1 205 ? 3.532   36.986  -5.738  1.00 36.87  ? 500 GLN A N   1 
ATOM   1516 C CA  . GLN A 1 205 ? 2.997   36.558  -7.019  1.00 34.35  ? 500 GLN A CA  1 
ATOM   1517 C C   . GLN A 1 205 ? 3.816   37.131  -8.160  1.00 37.13  ? 500 GLN A C   1 
ATOM   1518 O O   . GLN A 1 205 ? 4.240   36.404  -9.057  1.00 33.15  ? 500 GLN A O   1 
ATOM   1519 C CB  . GLN A 1 205 ? 1.551   37.025  -7.173  1.00 37.51  ? 500 GLN A CB  1 
ATOM   1520 C CG  . GLN A 1 205 ? 0.545   36.330  -6.279  1.00 35.27  ? 500 GLN A CG  1 
ATOM   1521 C CD  . GLN A 1 205 ? -0.851  36.904  -6.453  1.00 39.10  ? 500 GLN A CD  1 
ATOM   1522 O OE1 . GLN A 1 205 ? -1.238  37.303  -7.554  1.00 32.83  ? 500 GLN A OE1 1 
ATOM   1523 N NE2 . GLN A 1 205 ? -1.607  36.961  -5.362  1.00 35.46  ? 500 GLN A NE2 1 
ATOM   1524 N N   . HIS A 1 206 ? 4.036   38.441  -8.126  1.00 37.34  ? 501 HIS A N   1 
ATOM   1525 C CA  A HIS A 1 206 ? 4.751   39.112  -9.208  0.51 36.82  ? 501 HIS A CA  1 
ATOM   1526 C CA  B HIS A 1 206 ? 4.755   39.125  -9.204  0.49 37.36  ? 501 HIS A CA  1 
ATOM   1527 C C   . HIS A 1 206 ? 6.227   38.721  -9.256  1.00 35.95  ? 501 HIS A C   1 
ATOM   1528 O O   . HIS A 1 206 ? 6.819   38.644  -10.330 1.00 35.02  ? 501 HIS A O   1 
ATOM   1529 C CB  A HIS A 1 206 ? 4.556   40.630  -9.139  0.51 38.69  ? 501 HIS A CB  1 
ATOM   1530 C CB  B HIS A 1 206 ? 4.583   40.655  -9.122  0.49 39.74  ? 501 HIS A CB  1 
ATOM   1531 C CG  A HIS A 1 206 ? 3.153   41.068  -9.464  0.51 39.17  ? 501 HIS A CG  1 
ATOM   1532 C CG  B HIS A 1 206 ? 5.507   41.336  -8.155  0.49 44.59  ? 501 HIS A CG  1 
ATOM   1533 N ND1 A HIS A 1 206 ? 2.355   40.360  -10.328 0.51 45.91  ? 501 HIS A ND1 1 
ATOM   1534 N ND1 B HIS A 1 206 ? 5.101   42.376  -7.344  0.49 45.11  ? 501 HIS A ND1 1 
ATOM   1535 C CD2 A HIS A 1 206 ? 2.438   42.129  -9.042  0.51 33.69  ? 501 HIS A CD2 1 
ATOM   1536 C CD2 B HIS A 1 206 ? 6.819   41.140  -7.883  0.49 44.08  ? 501 HIS A CD2 1 
ATOM   1537 C CE1 A HIS A 1 206 ? 1.177   40.979  -10.425 0.51 47.04  ? 501 HIS A CE1 1 
ATOM   1538 C CE1 B HIS A 1 206 ? 6.119   42.782  -6.610  0.49 40.72  ? 501 HIS A CE1 1 
ATOM   1539 N NE2 A HIS A 1 206 ? 1.206   42.043  -9.665  0.51 44.49  ? 501 HIS A NE2 1 
ATOM   1540 N NE2 B HIS A 1 206 ? 7.173   42.051  -6.912  0.49 38.26  ? 501 HIS A NE2 1 
ATOM   1541 N N   . GLN A 1 207 ? 6.803   38.434  -8.094  1.00 27.57  ? 502 GLN A N   1 
ATOM   1542 C CA  . GLN A 1 207 ? 8.192   38.003  -8.030  1.00 28.60  ? 502 GLN A CA  1 
ATOM   1543 C C   . GLN A 1 207 ? 8.348   36.575  -8.559  1.00 27.68  ? 502 GLN A C   1 
ATOM   1544 O O   . GLN A 1 207 ? 9.298   36.267  -9.284  1.00 27.92  ? 502 GLN A O   1 
ATOM   1545 C CB  . GLN A 1 207 ? 8.711   38.109  -6.595  1.00 29.62  ? 502 GLN A CB  1 
ATOM   1546 C CG  . GLN A 1 207 ? 8.879   39.541  -6.103  1.00 32.18  ? 502 GLN A CG  1 
ATOM   1547 C CD  . GLN A 1 207 ? 9.314   39.622  -4.656  1.00 35.68  ? 502 GLN A CD  1 
ATOM   1548 O OE1 . GLN A 1 207 ? 9.404   38.605  -3.968  1.00 35.63  ? 502 GLN A OE1 1 
ATOM   1549 N NE2 . GLN A 1 207 ? 9.583   40.845  -4.178  1.00 35.83  ? 502 GLN A NE2 1 
ATOM   1550 N N   . ARG A 1 208 ? 7.420   35.700  -8.195  1.00 28.48  ? 503 ARG A N   1 
ATOM   1551 C CA  . ARG A 1 208 ? 7.512   34.312  -8.619  1.00 24.72  ? 503 ARG A CA  1 
ATOM   1552 C C   . ARG A 1 208 ? 7.343   34.205  -10.126 1.00 24.38  ? 503 ARG A C   1 
ATOM   1553 O O   . ARG A 1 208 ? 8.079   33.484  -10.789 1.00 31.24  ? 503 ARG A O   1 
ATOM   1554 C CB  . ARG A 1 208 ? 6.465   33.453  -7.915  1.00 25.47  ? 503 ARG A CB  1 
ATOM   1555 C CG  . ARG A 1 208 ? 6.594   31.975  -8.235  1.00 27.52  ? 503 ARG A CG  1 
ATOM   1556 C CD  . ARG A 1 208 ? 5.679   31.143  -7.351  1.00 28.90  ? 503 ARG A CD  1 
ATOM   1557 N NE  . ARG A 1 208 ? 5.723   29.720  -7.672  1.00 32.02  ? 503 ARG A NE  1 
ATOM   1558 C CZ  . ARG A 1 208 ? 6.607   28.867  -7.166  1.00 37.51  ? 503 ARG A CZ  1 
ATOM   1559 N NH1 . ARG A 1 208 ? 7.539   29.298  -6.319  1.00 30.52  ? 503 ARG A NH1 1 
ATOM   1560 N NH2 . ARG A 1 208 ? 6.559   27.582  -7.502  1.00 33.99  ? 503 ARG A NH2 1 
ATOM   1561 N N   . LEU A 1 209 ? 6.361   34.923  -10.660 1.00 30.06  ? 504 LEU A N   1 
ATOM   1562 C CA  . LEU A 1 209 ? 6.143   34.955  -12.100 1.00 30.68  ? 504 LEU A CA  1 
ATOM   1563 C C   . LEU A 1 209 ? 7.431   35.306  -12.814 1.00 31.86  ? 504 LEU A C   1 
ATOM   1564 O O   . LEU A 1 209 ? 7.850   34.608  -13.741 1.00 32.61  ? 504 LEU A O   1 
ATOM   1565 C CB  . LEU A 1 209 ? 5.061   35.972  -12.462 1.00 28.21  ? 504 LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 209 ? 4.862   36.178  -13.964 1.00 32.78  ? 504 LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 209 ? 4.387   34.905  -14.645 1.00 29.98  ? 504 LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 209 ? 3.894   37.317  -14.217 1.00 32.92  ? 504 LEU A CD2 1 
ATOM   1569 N N   . ALA A 1 210 ? 8.075   36.381  -12.366 1.00 28.00  ? 505 ALA A N   1 
ATOM   1570 C CA  . ALA A 1 210 ? 9.313   36.827  -12.978 1.00 23.25  ? 505 ALA A CA  1 
ATOM   1571 C C   . ALA A 1 210 ? 10.402  35.771  -12.844 1.00 25.84  ? 505 ALA A C   1 
ATOM   1572 O O   . ALA A 1 210 ? 11.116  35.480  -13.803 1.00 27.99  ? 505 ALA A O   1 
ATOM   1573 C CB  . ALA A 1 210 ? 9.771   38.148  -12.346 1.00 26.56  ? 505 ALA A CB  1 
ATOM   1574 N N   . GLN A 1 211 ? 10.534  35.199  -11.651 1.00 19.87  ? 506 GLN A N   1 
ATOM   1575 C CA  . GLN A 1 211 ? 11.544  34.171  -11.426 1.00 28.01  ? 506 GLN A CA  1 
ATOM   1576 C C   . GLN A 1 211 ? 11.370  33.031  -12.425 1.00 31.87  ? 506 GLN A C   1 
ATOM   1577 O O   . GLN A 1 211 ? 12.349  32.520  -12.967 1.00 29.23  ? 506 GLN A O   1 
ATOM   1578 C CB  . GLN A 1 211 ? 11.476  33.642  -9.991  1.00 36.10  ? 506 GLN A CB  1 
ATOM   1579 C CG  . GLN A 1 211 ? 11.852  34.673  -8.932  1.00 44.41  ? 506 GLN A CG  1 
ATOM   1580 C CD  . GLN A 1 211 ? 11.409  34.271  -7.529  1.00 45.47  ? 506 GLN A CD  1 
ATOM   1581 O OE1 . GLN A 1 211 ? 10.849  33.194  -7.325  1.00 44.13  ? 506 GLN A OE1 1 
ATOM   1582 N NE2 . GLN A 1 211 ? 11.657  35.147  -6.556  1.00 41.30  ? 506 GLN A NE2 1 
ATOM   1583 N N   . LEU A 1 212 ? 10.120  32.645  -12.672 1.00 28.75  ? 507 LEU A N   1 
ATOM   1584 C CA  . LEU A 1 212 ? 9.828   31.535  -13.576 1.00 31.89  ? 507 LEU A CA  1 
ATOM   1585 C C   . LEU A 1 212 ? 10.167  31.884  -15.022 1.00 30.26  ? 507 LEU A C   1 
ATOM   1586 O O   . LEU A 1 212 ? 10.777  31.090  -15.728 1.00 31.77  ? 507 LEU A O   1 
ATOM   1587 C CB  . LEU A 1 212 ? 8.351   31.136  -13.485 1.00 33.36  ? 507 LEU A CB  1 
ATOM   1588 C CG  . LEU A 1 212 ? 7.870   30.459  -12.202 1.00 32.31  ? 507 LEU A CG  1 
ATOM   1589 C CD1 . LEU A 1 212 ? 6.374   30.183  -12.276 1.00 30.04  ? 507 LEU A CD1 1 
ATOM   1590 C CD2 . LEU A 1 212 ? 8.637   29.174  -11.968 1.00 31.30  ? 507 LEU A CD2 1 
ATOM   1591 N N   . LEU A 1 213 ? 9.763   33.073  -15.460 1.00 25.15  ? 508 LEU A N   1 
ATOM   1592 C CA  . LEU A 1 213 ? 9.976   33.485  -16.841 1.00 26.06  ? 508 LEU A CA  1 
ATOM   1593 C C   . LEU A 1 213 ? 11.454  33.697  -17.158 1.00 28.21  ? 508 LEU A C   1 
ATOM   1594 O O   . LEU A 1 213 ? 11.887  33.460  -18.278 1.00 31.66  ? 508 LEU A O   1 
ATOM   1595 C CB  . LEU A 1 213 ? 9.180   34.754  -17.154 1.00 24.38  ? 508 LEU A CB  1 
ATOM   1596 C CG  . LEU A 1 213 ? 7.672   34.634  -16.981 1.00 29.08  ? 508 LEU A CG  1 
ATOM   1597 C CD1 . LEU A 1 213 ? 6.987   35.906  -17.447 1.00 33.72  ? 508 LEU A CD1 1 
ATOM   1598 C CD2 . LEU A 1 213 ? 7.159   33.433  -17.760 1.00 23.30  ? 508 LEU A CD2 1 
ATOM   1599 N N   . LEU A 1 214 ? 12.219  34.168  -16.176 1.00 33.95  ? 509 LEU A N   1 
ATOM   1600 C CA  . LEU A 1 214 ? 13.654  34.366  -16.353 1.00 27.18  ? 509 LEU A CA  1 
ATOM   1601 C C   . LEU A 1 214 ? 14.349  33.030  -16.601 1.00 31.44  ? 509 LEU A C   1 
ATOM   1602 O O   . LEU A 1 214 ? 15.315  32.950  -17.354 1.00 32.11  ? 509 LEU A O   1 
ATOM   1603 C CB  . LEU A 1 214 ? 14.264  35.054  -15.132 1.00 27.77  ? 509 LEU A CB  1 
ATOM   1604 C CG  . LEU A 1 214 ? 13.953  36.546  -14.982 1.00 36.13  ? 509 LEU A CG  1 
ATOM   1605 C CD1 . LEU A 1 214 ? 14.730  37.125  -13.817 1.00 36.78  ? 509 LEU A CD1 1 
ATOM   1606 C CD2 . LEU A 1 214 ? 14.288  37.285  -16.269 1.00 33.63  ? 509 LEU A CD2 1 
ATOM   1607 N N   . ILE A 1 215 ? 13.847  31.978  -15.969 1.00 28.12  ? 510 ILE A N   1 
ATOM   1608 C CA  . ILE A 1 215 ? 14.389  30.639  -16.193 1.00 26.02  ? 510 ILE A CA  1 
ATOM   1609 C C   . ILE A 1 215 ? 14.209  30.221  -17.653 1.00 24.85  ? 510 ILE A C   1 
ATOM   1610 O O   . ILE A 1 215 ? 15.014  29.470  -18.194 1.00 25.76  ? 510 ILE A O   1 
ATOM   1611 C CB  . ILE A 1 215 ? 13.758  29.625  -15.249 1.00 24.12  ? 510 ILE A CB  1 
ATOM   1612 C CG1 . ILE A 1 215 ? 14.185  29.916  -13.813 1.00 31.87  ? 510 ILE A CG1 1 
ATOM   1613 C CG2 . ILE A 1 215 ? 14.177  28.213  -15.620 1.00 31.59  ? 510 ILE A CG2 1 
ATOM   1614 C CD1 . ILE A 1 215 ? 13.471  29.076  -12.785 1.00 35.72  ? 510 ILE A CD1 1 
ATOM   1615 N N   . LEU A 1 216 ? 13.172  30.734  -18.305 1.00 28.35  ? 511 LEU A N   1 
ATOM   1616 C CA  . LEU A 1 216 ? 12.944  30.392  -19.705 1.00 25.74  ? 511 LEU A CA  1 
ATOM   1617 C C   . LEU A 1 216 ? 14.088  30.853  -20.584 1.00 28.94  ? 511 LEU A C   1 
ATOM   1618 O O   . LEU A 1 216 ? 14.403  30.212  -21.590 1.00 31.06  ? 511 LEU A O   1 
ATOM   1619 C CB  . LEU A 1 216 ? 11.623  30.971  -20.217 1.00 24.54  ? 511 LEU A CB  1 
ATOM   1620 C CG  . LEU A 1 216 ? 10.389  30.422  -19.501 1.00 30.58  ? 511 LEU A CG  1 
ATOM   1621 C CD1 . LEU A 1 216 ? 9.107   30.873  -20.189 1.00 24.91  ? 511 LEU A CD1 1 
ATOM   1622 C CD2 . LEU A 1 216 ? 10.462  28.913  -19.451 1.00 30.14  ? 511 LEU A CD2 1 
ATOM   1623 N N   . SER A 1 217 ? 14.728  31.959  -20.212 1.00 30.24  ? 512 SER A N   1 
ATOM   1624 C CA  . SER A 1 217 ? 15.844  32.459  -21.013 1.00 30.98  ? 512 SER A CA  1 
ATOM   1625 C C   . SER A 1 217 ? 17.021  31.498  -20.952 1.00 26.09  ? 512 SER A C   1 
ATOM   1626 O O   . SER A 1 217 ? 17.718  31.289  -21.946 1.00 28.29  ? 512 SER A O   1 
ATOM   1627 C CB  . SER A 1 217 ? 16.256  33.875  -20.593 1.00 34.27  ? 512 SER A CB  1 
ATOM   1628 O OG  . SER A 1 217 ? 16.768  33.887  -19.278 1.00 47.03  ? 512 SER A OG  1 
ATOM   1629 N N   . HIS A 1 218 ? 17.230  30.903  -19.781 1.00 25.57  ? 513 HIS A N   1 
ATOM   1630 C CA  . HIS A 1 218 ? 18.248  29.869  -19.623 1.00 23.70  ? 513 HIS A CA  1 
ATOM   1631 C C   . HIS A 1 218 ? 17.890  28.647  -20.450 1.00 28.03  ? 513 HIS A C   1 
ATOM   1632 O O   . HIS A 1 218 ? 18.758  28.035  -21.080 1.00 36.23  ? 513 HIS A O   1 
ATOM   1633 C CB  . HIS A 1 218 ? 18.397  29.493  -18.155 1.00 31.81  ? 513 HIS A CB  1 
ATOM   1634 C CG  . HIS A 1 218 ? 18.754  30.655  -17.280 1.00 52.36  ? 513 HIS A CG  1 
ATOM   1635 N ND1 . HIS A 1 218 ? 20.003  31.236  -17.297 1.00 61.48  ? 513 HIS A ND1 1 
ATOM   1636 C CD2 . HIS A 1 218 ? 18.024  31.353  -16.380 1.00 60.04  ? 513 HIS A CD2 1 
ATOM   1637 C CE1 . HIS A 1 218 ? 20.030  32.242  -16.437 1.00 58.61  ? 513 HIS A CE1 1 
ATOM   1638 N NE2 . HIS A 1 218 ? 18.838  32.335  -15.873 1.00 58.31  ? 513 HIS A NE2 1 
ATOM   1639 N N   . ILE A 1 219 ? 16.612  28.284  -20.448 1.00 25.97  ? 514 ILE A N   1 
ATOM   1640 C CA  . ILE A 1 219 ? 16.169  27.131  -21.237 1.00 29.71  ? 514 ILE A CA  1 
ATOM   1641 C C   . ILE A 1 219 ? 16.425  27.395  -22.717 1.00 30.71  ? 514 ILE A C   1 
ATOM   1642 O O   . ILE A 1 219 ? 16.858  26.502  -23.441 1.00 32.06  ? 514 ILE A O   1 
ATOM   1643 C CB  . ILE A 1 219 ? 14.693  26.762  -20.962 1.00 28.05  ? 514 ILE A CB  1 
ATOM   1644 C CG1 . ILE A 1 219 ? 14.566  26.197  -19.540 1.00 31.29  ? 514 ILE A CG1 1 
ATOM   1645 C CG2 . ILE A 1 219 ? 14.203  25.733  -21.969 1.00 25.57  ? 514 ILE A CG2 1 
ATOM   1646 C CD1 . ILE A 1 219 ? 13.154  25.845  -19.118 1.00 34.02  ? 514 ILE A CD1 1 
ATOM   1647 N N   . ARG A 1 220 ? 16.196  28.636  -23.152 1.00 28.10  ? 515 ARG A N   1 
ATOM   1648 C CA  . ARG A 1 220 ? 16.484  29.011  -24.535 1.00 25.26  ? 515 ARG A CA  1 
ATOM   1649 C C   . ARG A 1 220 ? 17.982  28.860  -24.809 1.00 30.03  ? 515 ARG A C   1 
ATOM   1650 O O   . ARG A 1 220 ? 18.396  28.405  -25.878 1.00 25.65  ? 515 ARG A O   1 
ATOM   1651 C CB  . ARG A 1 220 ? 16.037  30.450  -24.818 1.00 30.52  ? 515 ARG A CB  1 
ATOM   1652 C CG  . ARG A 1 220 ? 16.391  30.947  -26.229 1.00 33.95  ? 515 ARG A CG  1 
ATOM   1653 C CD  . ARG A 1 220 ? 15.369  30.484  -27.267 1.00 32.99  ? 515 ARG A CD  1 
ATOM   1654 N NE  . ARG A 1 220 ? 14.107  31.192  -27.093 1.00 45.27  ? 515 ARG A NE  1 
ATOM   1655 C CZ  . ARG A 1 220 ? 13.495  31.896  -28.040 1.00 47.41  ? 515 ARG A CZ  1 
ATOM   1656 N NH1 . ARG A 1 220 ? 14.006  31.972  -29.262 1.00 45.76  ? 515 ARG A NH1 1 
ATOM   1657 N NH2 . ARG A 1 220 ? 12.356  32.512  -27.763 1.00 50.94  ? 515 ARG A NH2 1 
ATOM   1658 N N   . HIS A 1 221 ? 18.802  29.251  -23.838 1.00 28.14  ? 516 HIS A N   1 
ATOM   1659 C CA  . HIS A 1 221 ? 20.246  29.130  -23.990 1.00 30.37  ? 516 HIS A CA  1 
ATOM   1660 C C   . HIS A 1 221 ? 20.666  27.669  -24.165 1.00 32.29  ? 516 HIS A C   1 
ATOM   1661 O O   . HIS A 1 221 ? 21.409  27.327  -25.088 1.00 28.87  ? 516 HIS A O   1 
ATOM   1662 C CB  . HIS A 1 221 ? 20.964  29.754  -22.793 1.00 32.24  ? 516 HIS A CB  1 
ATOM   1663 C CG  . HIS A 1 221 ? 22.455  29.731  -22.913 1.00 40.63  ? 516 HIS A CG  1 
ATOM   1664 N ND1 . HIS A 1 221 ? 23.135  30.471  -23.853 1.00 42.25  ? 516 HIS A ND1 1 
ATOM   1665 C CD2 . HIS A 1 221 ? 23.396  29.054  -22.213 1.00 39.44  ? 516 HIS A CD2 1 
ATOM   1666 C CE1 . HIS A 1 221 ? 24.431  30.259  -23.724 1.00 36.29  ? 516 HIS A CE1 1 
ATOM   1667 N NE2 . HIS A 1 221 ? 24.619  29.403  -22.737 1.00 31.36  ? 516 HIS A NE2 1 
ATOM   1668 N N   . MET A 1 222 ? 20.182  26.808  -23.278 1.00 28.15  ? 517 MET A N   1 
ATOM   1669 C CA  . MET A 1 222 ? 20.510  25.384  -23.343 1.00 26.23  ? 517 MET A CA  1 
ATOM   1670 C C   . MET A 1 222 ? 20.093  24.788  -24.688 1.00 24.43  ? 517 MET A C   1 
ATOM   1671 O O   . MET A 1 222 ? 20.847  24.037  -25.307 1.00 25.16  ? 517 MET A O   1 
ATOM   1672 C CB  . MET A 1 222 ? 19.860  24.622  -22.180 1.00 25.36  ? 517 MET A CB  1 
ATOM   1673 C CG  . MET A 1 222 ? 20.463  24.963  -20.827 1.00 29.34  ? 517 MET A CG  1 
ATOM   1674 S SD  . MET A 1 222 ? 19.735  24.065  -19.443 1.00 34.36  ? 517 MET A SD  1 
ATOM   1675 C CE  . MET A 1 222 ? 18.033  24.594  -19.506 1.00 26.43  ? 517 MET A CE  1 
ATOM   1676 N N   . SER A 1 223 ? 18.901  25.145  -25.151 1.00 25.69  ? 518 SER A N   1 
ATOM   1677 C CA  . SER A 1 223 ? 18.430  24.679  -26.448 1.00 31.05  ? 518 SER A CA  1 
ATOM   1678 C C   . SER A 1 223 ? 19.349  25.155  -27.570 1.00 29.66  ? 518 SER A C   1 
ATOM   1679 O O   . SER A 1 223 ? 19.741  24.373  -28.440 1.00 27.02  ? 518 SER A O   1 
ATOM   1680 C CB  . SER A 1 223 ? 17.001  25.152  -26.697 1.00 34.43  ? 518 SER A CB  1 
ATOM   1681 O OG  . SER A 1 223 ? 16.652  24.997  -28.062 1.00 37.50  ? 518 SER A OG  1 
ATOM   1682 N N   . ASN A 1 224 ? 19.698  26.438  -27.553 1.00 27.03  ? 519 ASN A N   1 
ATOM   1683 C CA  . ASN A 1 224 ? 20.606  26.982  -28.559 1.00 21.92  ? 519 ASN A CA  1 
ATOM   1684 C C   . ASN A 1 224 ? 21.907  26.186  -28.614 1.00 32.60  ? 519 ASN A C   1 
ATOM   1685 O O   . ASN A 1 224 ? 22.404  25.865  -29.694 1.00 32.23  ? 519 ASN A O   1 
ATOM   1686 C CB  . ASN A 1 224 ? 20.901  28.457  -28.283 1.00 27.06  ? 519 ASN A CB  1 
ATOM   1687 C CG  . ASN A 1 224 ? 19.692  29.353  -28.540 1.00 36.02  ? 519 ASN A CG  1 
ATOM   1688 O OD1 . ASN A 1 224 ? 18.787  28.999  -29.295 1.00 39.15  ? 519 ASN A OD1 1 
ATOM   1689 N ND2 . ASN A 1 224 ? 19.676  30.513  -27.905 1.00 28.52  ? 519 ASN A ND2 1 
ATOM   1690 N N   . LYS A 1 225 ? 22.446  25.858  -27.441 1.00 25.45  ? 520 LYS A N   1 
ATOM   1691 C CA  . LYS A 1 225 ? 23.686  25.095  -27.362 1.00 27.48  ? 520 LYS A CA  1 
ATOM   1692 C C   . LYS A 1 225 ? 23.494  23.671  -27.889 1.00 34.74  ? 520 LYS A C   1 
ATOM   1693 O O   . LYS A 1 225 ? 24.332  23.151  -28.633 1.00 35.04  ? 520 LYS A O   1 
ATOM   1694 C CB  . LYS A 1 225 ? 24.220  25.071  -25.925 1.00 27.60  ? 520 LYS A CB  1 
ATOM   1695 C CG  . LYS A 1 225 ? 24.739  26.419  -25.428 1.00 31.00  ? 520 LYS A CG  1 
ATOM   1696 C CD  . LYS A 1 225 ? 25.367  27.206  -26.571 1.00 40.29  ? 520 LYS A CD  1 
ATOM   1697 C CE  . LYS A 1 225 ? 26.302  28.298  -26.075 1.00 57.32  ? 520 LYS A CE  1 
ATOM   1698 N NZ  . LYS A 1 225 ? 27.696  27.801  -25.876 1.00 62.82  ? 520 LYS A NZ  1 
ATOM   1699 N N   . GLY A 1 226 ? 22.389  23.045  -27.495 1.00 29.97  ? 521 GLY A N   1 
ATOM   1700 C CA  . GLY A 1 226 ? 22.070  21.700  -27.946 1.00 32.12  ? 521 GLY A CA  1 
ATOM   1701 C C   . GLY A 1 226 ? 21.821  21.646  -29.444 1.00 35.42  ? 521 GLY A C   1 
ATOM   1702 O O   . GLY A 1 226 ? 22.303  20.751  -30.136 1.00 41.06  ? 521 GLY A O   1 
ATOM   1703 N N   . MET A 1 227 ? 21.055  22.607  -29.946 1.00 35.21  ? 522 MET A N   1 
ATOM   1704 C CA  . MET A 1 227 ? 20.779  22.700  -31.372 1.00 41.17  ? 522 MET A CA  1 
ATOM   1705 C C   . MET A 1 227 ? 22.088  22.834  -32.133 1.00 43.92  ? 522 MET A C   1 
ATOM   1706 O O   . MET A 1 227 ? 22.251  22.275  -33.217 1.00 40.85  ? 522 MET A O   1 
ATOM   1707 C CB  . MET A 1 227 ? 19.894  23.913  -31.652 1.00 42.18  ? 522 MET A CB  1 
ATOM   1708 C CG  . MET A 1 227 ? 19.002  23.761  -32.856 1.00 52.81  ? 522 MET A CG  1 
ATOM   1709 S SD  . MET A 1 227 ? 17.834  22.426  -32.586 1.00 45.96  ? 522 MET A SD  1 
ATOM   1710 C CE  . MET A 1 227 ? 17.191  22.916  -30.998 1.00 66.63  ? 522 MET A CE  1 
ATOM   1711 N N   . GLU A 1 228 ? 23.021  23.576  -31.545 1.00 45.09  ? 523 GLU A N   1 
ATOM   1712 C CA  . GLU A 1 228 ? 24.337  23.801  -32.127 1.00 50.18  ? 523 GLU A CA  1 
ATOM   1713 C C   . GLU A 1 228 ? 25.075  22.486  -32.312 1.00 49.86  ? 523 GLU A C   1 
ATOM   1714 O O   . GLU A 1 228 ? 25.639  22.220  -33.374 1.00 52.87  ? 523 GLU A O   1 
ATOM   1715 C CB  . GLU A 1 228 ? 25.154  24.712  -31.213 1.00 60.28  ? 523 GLU A CB  1 
ATOM   1716 C CG  . GLU A 1 228 ? 26.032  25.714  -31.931 1.00 68.10  ? 523 GLU A CG  1 
ATOM   1717 C CD  . GLU A 1 228 ? 26.777  26.610  -30.963 1.00 70.79  ? 523 GLU A CD  1 
ATOM   1718 O OE1 . GLU A 1 228 ? 27.200  27.713  -31.369 1.00 74.72  ? 523 GLU A OE1 1 
ATOM   1719 O OE2 . GLU A 1 228 ? 26.933  26.205  -29.791 1.00 69.91  ? 523 GLU A OE2 1 
ATOM   1720 N N   . HIS A 1 229 ? 25.071  21.669  -31.264 1.00 49.41  ? 524 HIS A N   1 
ATOM   1721 C CA  . HIS A 1 229 ? 25.727  20.363  -31.299 1.00 52.26  ? 524 HIS A CA  1 
ATOM   1722 C C   . HIS A 1 229 ? 25.057  19.441  -32.318 1.00 52.92  ? 524 HIS A C   1 
ATOM   1723 O O   . HIS A 1 229 ? 25.733  18.748  -33.077 1.00 54.48  ? 524 HIS A O   1 
ATOM   1724 C CB  . HIS A 1 229 ? 25.704  19.726  -29.907 1.00 56.77  ? 524 HIS A CB  1 
ATOM   1725 C CG  . HIS A 1 229 ? 26.570  18.513  -29.780 1.00 68.62  ? 524 HIS A CG  1 
ATOM   1726 N ND1 . HIS A 1 229 ? 26.084  17.230  -29.918 1.00 72.19  ? 524 HIS A ND1 1 
ATOM   1727 C CD2 . HIS A 1 229 ? 27.894  18.387  -29.525 1.00 71.53  ? 524 HIS A CD2 1 
ATOM   1728 C CE1 . HIS A 1 229 ? 27.068  16.367  -29.755 1.00 72.21  ? 524 HIS A CE1 1 
ATOM   1729 N NE2 . HIS A 1 229 ? 28.179  17.044  -29.514 1.00 74.81  ? 524 HIS A NE2 1 
ATOM   1730 N N   . LEU A 1 230 ? 23.725  19.439  -32.327 1.00 48.90  ? 525 LEU A N   1 
ATOM   1731 C CA  . LEU A 1 230 ? 22.949  18.639  -33.275 1.00 46.68  ? 525 LEU A CA  1 
ATOM   1732 C C   . LEU A 1 230 ? 23.336  18.910  -34.728 1.00 54.53  ? 525 LEU A C   1 
ATOM   1733 O O   . LEU A 1 230 ? 23.398  17.990  -35.543 1.00 57.00  ? 525 LEU A O   1 
ATOM   1734 C CB  . LEU A 1 230 ? 21.451  18.888  -33.090 1.00 39.94  ? 525 LEU A CB  1 
ATOM   1735 C CG  . LEU A 1 230 ? 20.777  18.178  -31.917 1.00 38.60  ? 525 LEU A CG  1 
ATOM   1736 C CD1 . LEU A 1 230 ? 19.292  18.504  -31.876 1.00 33.36  ? 525 LEU A CD1 1 
ATOM   1737 C CD2 . LEU A 1 230 ? 20.992  16.684  -32.022 1.00 44.57  ? 525 LEU A CD2 1 
ATOM   1738 N N   . TYR A 1 231 ? 23.589  20.174  -35.050 1.00 56.08  ? 526 TYR A N   1 
ATOM   1739 C CA  . TYR A 1 231 ? 23.938  20.553  -36.416 1.00 60.53  ? 526 TYR A CA  1 
ATOM   1740 C C   . TYR A 1 231 ? 25.372  20.177  -36.780 1.00 61.60  ? 526 TYR A C   1 
ATOM   1741 O O   . TYR A 1 231 ? 25.717  20.103  -37.961 1.00 69.52  ? 526 TYR A O   1 
ATOM   1742 C CB  . TYR A 1 231 ? 23.714  22.051  -36.651 1.00 62.49  ? 526 TYR A CB  1 
ATOM   1743 C CG  . TYR A 1 231 ? 22.284  22.425  -36.984 1.00 68.97  ? 526 TYR A CG  1 
ATOM   1744 C CD1 . TYR A 1 231 ? 21.658  21.922  -38.119 1.00 70.93  ? 526 TYR A CD1 1 
ATOM   1745 C CD2 . TYR A 1 231 ? 21.567  23.298  -36.177 1.00 74.02  ? 526 TYR A CD2 1 
ATOM   1746 C CE1 . TYR A 1 231 ? 20.355  22.266  -38.430 1.00 72.46  ? 526 TYR A CE1 1 
ATOM   1747 C CE2 . TYR A 1 231 ? 20.263  23.648  -36.481 1.00 75.72  ? 526 TYR A CE2 1 
ATOM   1748 C CZ  . TYR A 1 231 ? 19.662  23.129  -37.608 1.00 75.88  ? 526 TYR A CZ  1 
ATOM   1749 O OH  . TYR A 1 231 ? 18.366  23.475  -37.917 1.00 78.14  ? 526 TYR A OH  1 
ATOM   1750 N N   . SER A 1 232 ? 26.202  19.934  -35.770 1.00 87.39  ? 527 SER A N   1 
ATOM   1751 C CA  . SER A 1 232 ? 27.601  19.583  -36.004 1.00 85.16  ? 527 SER A CA  1 
ATOM   1752 C C   . SER A 1 232 ? 27.789  18.081  -36.207 1.00 87.98  ? 527 SER A C   1 
ATOM   1753 O O   . SER A 1 232 ? 28.914  17.595  -36.323 1.00 91.27  ? 527 SER A O   1 
ATOM   1754 C CB  . SER A 1 232 ? 28.481  20.075  -34.851 1.00 73.99  ? 527 SER A CB  1 
ATOM   1755 O OG  . SER A 1 232 ? 28.238  19.330  -33.671 1.00 73.29  ? 527 SER A OG  1 
ATOM   1756 N N   . MET A 1 233 ? 26.680  17.351  -36.238 1.00 88.87  ? 528 MET A N   1 
ATOM   1757 C CA  . MET A 1 233 ? 26.710  15.915  -36.481 1.00 85.62  ? 528 MET A CA  1 
ATOM   1758 C C   . MET A 1 233 ? 26.488  15.630  -37.960 1.00 91.35  ? 528 MET A C   1 
ATOM   1759 O O   . MET A 1 233 ? 25.467  16.018  -38.528 1.00 89.12  ? 528 MET A O   1 
ATOM   1760 C CB  . MET A 1 233 ? 25.636  15.215  -35.650 1.00 81.24  ? 528 MET A CB  1 
ATOM   1761 C CG  . MET A 1 233 ? 25.878  15.257  -34.150 1.00 81.76  ? 528 MET A CG  1 
ATOM   1762 S SD  . MET A 1 233 ? 24.438  14.710  -33.210 1.00 79.74  ? 528 MET A SD  1 
ATOM   1763 C CE  . MET A 1 233 ? 23.383  14.135  -34.535 1.00 109.95 ? 528 MET A CE  1 
ATOM   1764 N N   . LYS A 1 234 ? 27.444  14.946  -38.580 1.00 102.77 ? 529 LYS A N   1 
ATOM   1765 C CA  . LYS A 1 234 ? 27.357  14.622  -40.001 1.00 110.41 ? 529 LYS A CA  1 
ATOM   1766 C C   . LYS A 1 234 ? 26.305  13.550  -40.280 1.00 119.03 ? 529 LYS A C   1 
ATOM   1767 O O   . LYS A 1 234 ? 26.432  12.781  -41.231 1.00 123.07 ? 529 LYS A O   1 
ATOM   1768 C CB  . LYS A 1 234 ? 28.720  14.167  -40.529 1.00 111.55 ? 529 LYS A CB  1 
ATOM   1769 N N   . CYS A 1 235 ? 25.270  13.501  -39.446 1.00 122.66 ? 530 CYS A N   1 
ATOM   1770 C CA  . CYS A 1 235 ? 24.185  12.543  -39.626 1.00 125.42 ? 530 CYS A CA  1 
ATOM   1771 C C   . CYS A 1 235 ? 23.021  13.157  -40.392 1.00 129.80 ? 530 CYS A C   1 
ATOM   1772 O O   . CYS A 1 235 ? 21.975  12.527  -40.563 1.00 132.31 ? 530 CYS A O   1 
ATOM   1773 C CB  . CYS A 1 235 ? 23.711  11.997  -38.278 1.00 123.20 ? 530 CYS A CB  1 
ATOM   1774 S SG  . CYS A 1 235 ? 24.593  10.510  -37.742 1.00 108.03 ? 530 CYS A SG  1 
ATOM   1775 N N   . LYS A 1 236 ? 23.212  14.392  -40.843 1.00 129.69 ? 531 LYS A N   1 
ATOM   1776 C CA  . LYS A 1 236 ? 22.232  15.082  -41.674 1.00 128.03 ? 531 LYS A CA  1 
ATOM   1777 C C   . LYS A 1 236 ? 20.834  15.092  -41.068 1.00 125.02 ? 531 LYS A C   1 
ATOM   1778 O O   . LYS A 1 236 ? 19.886  15.560  -41.701 1.00 123.08 ? 531 LYS A O   1 
ATOM   1779 C CB  . LYS A 1 236 ? 22.184  14.460  -43.070 1.00 128.64 ? 531 LYS A CB  1 
ATOM   1780 N N   . ASN A 1 237 ? 20.698  14.572  -39.851 1.00 129.96 ? 532 ASN A N   1 
ATOM   1781 C CA  . ASN A 1 237 ? 19.389  14.532  -39.222 1.00 126.62 ? 532 ASN A CA  1 
ATOM   1782 C C   . ASN A 1 237 ? 19.297  13.975  -37.801 1.00 122.65 ? 532 ASN A C   1 
ATOM   1783 O O   . ASN A 1 237 ? 19.753  12.881  -37.504 1.00 123.46 ? 532 ASN A O   1 
ATOM   1784 C CB  . ASN A 1 237 ? 18.385  13.776  -40.105 1.00 127.32 ? 532 ASN A CB  1 
ATOM   1785 C CG  . ASN A 1 237 ? 16.957  13.933  -39.616 1.00 130.22 ? 532 ASN A CG  1 
ATOM   1786 O OD1 . ASN A 1 237 ? 16.640  14.872  -38.877 1.00 127.20 ? 532 ASN A OD1 1 
ATOM   1787 N ND2 . ASN A 1 237 ? 16.086  13.022  -40.028 1.00 130.63 ? 532 ASN A ND2 1 
ATOM   1788 N N   . VAL A 1 238 ? 18.719  14.795  -36.938 1.00 117.09 ? 533 VAL A N   1 
ATOM   1789 C CA  . VAL A 1 238 ? 17.859  14.377  -35.847 1.00 110.18 ? 533 VAL A CA  1 
ATOM   1790 C C   . VAL A 1 238 ? 16.977  15.598  -35.676 1.00 101.87 ? 533 VAL A C   1 
ATOM   1791 O O   . VAL A 1 238 ? 15.945  15.563  -35.010 1.00 100.76 ? 533 VAL A O   1 
ATOM   1792 C CB  . VAL A 1 238 ? 18.623  14.061  -34.541 1.00 116.54 ? 533 VAL A CB  1 
ATOM   1793 C CG1 . VAL A 1 238 ? 20.104  13.836  -34.794 1.00 113.59 ? 533 VAL A CG1 1 
ATOM   1794 C CG2 . VAL A 1 238 ? 18.400  15.161  -33.510 1.00 114.64 ? 533 VAL A CG2 1 
ATOM   1795 N N   . VAL A 1 239 ? 17.409  16.674  -36.326 1.00 61.85  ? 534 VAL A N   1 
ATOM   1796 C CA  . VAL A 1 239 ? 16.666  17.924  -36.384 1.00 55.54  ? 534 VAL A CA  1 
ATOM   1797 C C   . VAL A 1 239 ? 15.510  17.782  -37.366 1.00 48.26  ? 534 VAL A C   1 
ATOM   1798 O O   . VAL A 1 239 ? 15.732  17.593  -38.566 1.00 45.85  ? 534 VAL A O   1 
ATOM   1799 C CB  . VAL A 1 239 ? 17.560  19.072  -36.888 1.00 54.56  ? 534 VAL A CB  1 
ATOM   1800 C CG1 . VAL A 1 239 ? 16.898  20.411  -36.627 1.00 56.37  ? 534 VAL A CG1 1 
ATOM   1801 C CG2 . VAL A 1 239 ? 18.927  19.007  -36.223 1.00 51.84  ? 534 VAL A CG2 1 
ATOM   1802 N N   . PRO A 1 240 ? 14.270  17.873  -36.868 1.00 49.07  ? 535 PRO A N   1 
ATOM   1803 C CA  . PRO A 1 240 ? 13.091  17.710  -37.727 1.00 49.65  ? 535 PRO A CA  1 
ATOM   1804 C C   . PRO A 1 240 ? 12.985  18.860  -38.714 1.00 48.31  ? 535 PRO A C   1 
ATOM   1805 O O   . PRO A 1 240 ? 13.153  20.010  -38.316 1.00 49.44  ? 535 PRO A O   1 
ATOM   1806 C CB  . PRO A 1 240 ? 11.930  17.769  -36.736 1.00 38.95  ? 535 PRO A CB  1 
ATOM   1807 C CG  . PRO A 1 240 ? 12.451  18.595  -35.608 1.00 40.99  ? 535 PRO A CG  1 
ATOM   1808 C CD  . PRO A 1 240 ? 13.900  18.223  -35.487 1.00 48.30  ? 535 PRO A CD  1 
ATOM   1809 N N   . SER A 1 241 ? 12.718  18.556  -39.979 1.00 45.05  ? 536 SER A N   1 
ATOM   1810 C CA  . SER A 1 241 ? 12.623  19.587  -41.006 1.00 40.33  ? 536 SER A CA  1 
ATOM   1811 C C   . SER A 1 241 ? 11.270  20.278  -40.952 1.00 43.63  ? 536 SER A C   1 
ATOM   1812 O O   . SER A 1 241 ? 10.348  19.809  -40.284 1.00 47.13  ? 536 SER A O   1 
ATOM   1813 C CB  . SER A 1 241 ? 12.833  18.976  -42.391 1.00 44.07  ? 536 SER A CB  1 
ATOM   1814 O OG  . SER A 1 241 ? 11.812  18.041  -42.690 1.00 45.85  ? 536 SER A OG  1 
ATOM   1815 N N   . TYR A 1 242 ? 11.162  21.398  -41.661 1.00 46.83  ? 537 TYR A N   1 
ATOM   1816 C CA  . TYR A 1 242 ? 9.896   22.109  -41.794 1.00 46.23  ? 537 TYR A CA  1 
ATOM   1817 C C   . TYR A 1 242 ? 8.856   21.195  -42.438 1.00 43.61  ? 537 TYR A C   1 
ATOM   1818 O O   . TYR A 1 242 ? 7.717   21.105  -41.977 1.00 42.70  ? 537 TYR A O   1 
ATOM   1819 C CB  . TYR A 1 242 ? 10.095  23.381  -42.626 1.00 46.79  ? 537 TYR A CB  1 
ATOM   1820 C CG  . TYR A 1 242 ? 8.834   24.166  -42.915 1.00 48.62  ? 537 TYR A CG  1 
ATOM   1821 C CD1 . TYR A 1 242 ? 8.051   23.873  -44.023 1.00 52.08  ? 537 TYR A CD1 1 
ATOM   1822 C CD2 . TYR A 1 242 ? 8.438   25.218  -42.096 1.00 47.30  ? 537 TYR A CD2 1 
ATOM   1823 C CE1 . TYR A 1 242 ? 6.904   24.594  -44.299 1.00 52.70  ? 537 TYR A CE1 1 
ATOM   1824 C CE2 . TYR A 1 242 ? 7.290   25.941  -42.364 1.00 48.00  ? 537 TYR A CE2 1 
ATOM   1825 C CZ  . TYR A 1 242 ? 6.529   25.623  -43.468 1.00 51.01  ? 537 TYR A CZ  1 
ATOM   1826 O OH  . TYR A 1 242 ? 5.389   26.337  -43.744 1.00 55.42  ? 537 TYR A OH  1 
ATOM   1827 N N   . ASP A 1 243 ? 9.265   20.500  -43.494 1.00 44.93  ? 538 ASP A N   1 
ATOM   1828 C CA  . ASP A 1 243 ? 8.361   19.623  -44.230 1.00 55.39  ? 538 ASP A CA  1 
ATOM   1829 C C   . ASP A 1 243 ? 7.890   18.465  -43.355 1.00 51.75  ? 538 ASP A C   1 
ATOM   1830 O O   . ASP A 1 243 ? 6.715   18.091  -43.377 1.00 52.10  ? 538 ASP A O   1 
ATOM   1831 C CB  . ASP A 1 243 ? 9.048   19.103  -45.495 1.00 62.82  ? 538 ASP A CB  1 
ATOM   1832 C CG  . ASP A 1 243 ? 9.680   20.218  -46.309 1.00 72.27  ? 538 ASP A CG  1 
ATOM   1833 O OD1 . ASP A 1 243 ? 10.926  20.278  -46.370 1.00 81.85  ? 538 ASP A OD1 1 
ATOM   1834 O OD2 . ASP A 1 243 ? 8.932   21.040  -46.881 1.00 73.19  ? 538 ASP A OD2 1 
ATOM   1835 N N   . LEU A 1 244 ? 8.809   17.907  -42.576 1.00 53.25  ? 539 LEU A N   1 
ATOM   1836 C CA  . LEU A 1 244 ? 8.466   16.821  -41.669 1.00 50.92  ? 539 LEU A CA  1 
ATOM   1837 C C   . LEU A 1 244 ? 7.420   17.280  -40.660 1.00 51.84  ? 539 LEU A C   1 
ATOM   1838 O O   . LEU A 1 244 ? 6.406   16.611  -40.456 1.00 51.57  ? 539 LEU A O   1 
ATOM   1839 C CB  . LEU A 1 244 ? 9.710   16.311  -40.940 1.00 50.40  ? 539 LEU A CB  1 
ATOM   1840 C CG  . LEU A 1 244 ? 9.395   15.297  -39.836 1.00 55.21  ? 539 LEU A CG  1 
ATOM   1841 C CD1 . LEU A 1 244 ? 8.775   14.039  -40.431 1.00 57.80  ? 539 LEU A CD1 1 
ATOM   1842 C CD2 . LEU A 1 244 ? 10.630  14.959  -39.020 1.00 54.99  ? 539 LEU A CD2 1 
ATOM   1843 N N   . LEU A 1 245 ? 7.670   18.429  -40.033 1.00 38.49  ? 540 LEU A N   1 
ATOM   1844 C CA  . LEU A 1 245 ? 6.758   18.961  -39.022 1.00 34.38  ? 540 LEU A CA  1 
ATOM   1845 C C   . LEU A 1 245 ? 5.388   19.278  -39.613 1.00 40.07  ? 540 LEU A C   1 
ATOM   1846 O O   . LEU A 1 245 ? 4.355   19.026  -38.989 1.00 37.94  ? 540 LEU A O   1 
ATOM   1847 C CB  . LEU A 1 245 ? 7.357   20.202  -38.355 1.00 27.00  ? 540 LEU A CB  1 
ATOM   1848 C CG  . LEU A 1 245 ? 8.505   19.903  -37.386 1.00 30.11  ? 540 LEU A CG  1 
ATOM   1849 C CD1 . LEU A 1 245 ? 9.281   21.163  -37.036 1.00 30.40  ? 540 LEU A CD1 1 
ATOM   1850 C CD2 . LEU A 1 245 ? 7.965   19.237  -36.127 1.00 35.08  ? 540 LEU A CD2 1 
ATOM   1851 N N   . LEU A 1 246 ? 5.386   19.830  -40.821 1.00 45.83  ? 541 LEU A N   1 
ATOM   1852 C CA  . LEU A 1 246 ? 4.144   20.143  -41.514 1.00 38.91  ? 541 LEU A CA  1 
ATOM   1853 C C   . LEU A 1 246 ? 3.364   18.861  -41.809 1.00 43.75  ? 541 LEU A C   1 
ATOM   1854 O O   . LEU A 1 246 ? 2.168   18.767  -41.533 1.00 42.66  ? 541 LEU A O   1 
ATOM   1855 C CB  . LEU A 1 246 ? 4.437   20.898  -42.812 1.00 41.98  ? 541 LEU A CB  1 
ATOM   1856 C CG  . LEU A 1 246 ? 3.256   21.380  -43.657 1.00 50.22  ? 541 LEU A CG  1 
ATOM   1857 C CD1 . LEU A 1 246 ? 2.349   22.297  -42.853 1.00 53.15  ? 541 LEU A CD1 1 
ATOM   1858 C CD2 . LEU A 1 246 ? 3.765   22.092  -44.898 1.00 57.53  ? 541 LEU A CD2 1 
ATOM   1859 N N   . GLU A 1 247 ? 4.049   17.874  -42.370 1.00 50.39  ? 542 GLU A N   1 
ATOM   1860 C CA  . GLU A 1 247 ? 3.427   16.579  -42.625 1.00 54.98  ? 542 GLU A CA  1 
ATOM   1861 C C   . GLU A 1 247 ? 2.739   16.089  -41.356 1.00 52.95  ? 542 GLU A C   1 
ATOM   1862 O O   . GLU A 1 247 ? 1.548   15.779  -41.361 1.00 55.11  ? 542 GLU A O   1 
ATOM   1863 C CB  . GLU A 1 247 ? 4.475   15.567  -43.093 1.00 60.80  ? 542 GLU A CB  1 
ATOM   1864 C CG  . GLU A 1 247 ? 3.920   14.464  -43.980 1.00 84.20  ? 542 GLU A CG  1 
ATOM   1865 C CD  . GLU A 1 247 ? 5.002   13.540  -44.521 1.00 101.97 ? 542 GLU A CD  1 
ATOM   1866 O OE1 . GLU A 1 247 ? 5.115   13.417  -45.761 1.00 105.47 ? 542 GLU A OE1 1 
ATOM   1867 O OE2 . GLU A 1 247 ? 5.737   12.937  -43.709 1.00 109.95 ? 542 GLU A OE2 1 
ATOM   1868 N N   . MET A 1 248 ? 3.492   16.054  -40.261 1.00 48.37  ? 543 MET A N   1 
ATOM   1869 C CA  . MET A 1 248 ? 2.985   15.557  -38.986 1.00 46.56  ? 543 MET A CA  1 
ATOM   1870 C C   . MET A 1 248 ? 1.783   16.332  -38.468 1.00 49.63  ? 543 MET A C   1 
ATOM   1871 O O   . MET A 1 248 ? 0.947   15.783  -37.744 1.00 52.33  ? 543 MET A O   1 
ATOM   1872 C CB  . MET A 1 248 ? 4.094   15.546  -37.932 1.00 48.44  ? 543 MET A CB  1 
ATOM   1873 C CG  . MET A 1 248 ? 4.644   14.156  -37.634 1.00 54.80  ? 543 MET A CG  1 
ATOM   1874 S SD  . MET A 1 248 ? 5.965   14.192  -36.414 1.00 81.40  ? 543 MET A SD  1 
ATOM   1875 C CE  . MET A 1 248 ? 7.181   15.154  -37.302 1.00 52.21  ? 543 MET A CE  1 
ATOM   1876 N N   . LEU A 1 249 ? 1.695   17.607  -38.836 1.00 44.47  ? 544 LEU A N   1 
ATOM   1877 C CA  . LEU A 1 249 ? 0.609   18.458  -38.363 1.00 47.46  ? 544 LEU A CA  1 
ATOM   1878 C C   . LEU A 1 249 ? -0.746  18.114  -38.984 1.00 52.58  ? 544 LEU A C   1 
ATOM   1879 O O   . LEU A 1 249 ? -1.778  18.193  -38.318 1.00 49.86  ? 544 LEU A O   1 
ATOM   1880 C CB  . LEU A 1 249 ? 0.944   19.934  -38.587 1.00 52.82  ? 544 LEU A CB  1 
ATOM   1881 C CG  . LEU A 1 249 ? 1.755   20.557  -37.456 1.00 53.42  ? 544 LEU A CG  1 
ATOM   1882 C CD1 . LEU A 1 249 ? 2.339   21.880  -37.883 1.00 64.00  ? 544 LEU A CD1 1 
ATOM   1883 C CD2 . LEU A 1 249 ? 0.886   20.721  -36.215 1.00 48.99  ? 544 LEU A CD2 1 
ATOM   1884 N N   . ASP A 1 250 ? -0.742  17.743  -40.260 1.00 56.51  ? 545 ASP A N   1 
ATOM   1885 C CA  . ASP A 1 250 ? -1.972  17.321  -40.915 1.00 72.93  ? 545 ASP A CA  1 
ATOM   1886 C C   . ASP A 1 250 ? -2.510  16.079  -40.209 1.00 80.05  ? 545 ASP A C   1 
ATOM   1887 O O   . ASP A 1 250 ? -2.005  14.976  -40.408 1.00 78.05  ? 545 ASP A O   1 
ATOM   1888 C CB  . ASP A 1 250 ? -1.735  17.051  -42.402 1.00 81.22  ? 545 ASP A CB  1 
ATOM   1889 C CG  . ASP A 1 250 ? -1.281  18.293  -43.156 1.00 86.65  ? 545 ASP A CG  1 
ATOM   1890 O OD1 . ASP A 1 250 ? -1.569  19.419  -42.694 1.00 83.22  ? 545 ASP A OD1 1 
ATOM   1891 O OD2 . ASP A 1 250 ? -0.634  18.143  -44.215 1.00 91.78  ? 545 ASP A OD2 1 
ATOM   1892 N N   . ALA A 1 251 ? -3.528  16.284  -39.373 1.00 91.43  ? 546 ALA A N   1 
ATOM   1893 C CA  . ALA A 1 251 ? -4.088  15.244  -38.506 1.00 93.21  ? 546 ALA A CA  1 
ATOM   1894 C C   . ALA A 1 251 ? -3.459  13.872  -38.717 1.00 97.03  ? 546 ALA A C   1 
ATOM   1895 O O   . ALA A 1 251 ? -3.961  13.060  -39.496 1.00 102.53 ? 546 ALA A O   1 
ATOM   1896 C CB  . ALA A 1 251 ? -5.603  15.171  -38.668 1.00 96.04  ? 546 ALA A CB  1 
ATOM   1897 N N   . LEU B 1 11  ? -13.705 22.556  -62.316 1.00 80.83  ? 306 LEU B N   1 
ATOM   1898 C CA  . LEU B 1 11  ? -12.314 22.309  -61.949 1.00 76.82  ? 306 LEU B CA  1 
ATOM   1899 C C   . LEU B 1 11  ? -11.428 22.183  -63.188 1.00 68.23  ? 306 LEU B C   1 
ATOM   1900 O O   . LEU B 1 11  ? -11.917 21.930  -64.292 1.00 60.34  ? 306 LEU B O   1 
ATOM   1901 C CB  . LEU B 1 11  ? -12.204 21.053  -61.077 1.00 77.48  ? 306 LEU B CB  1 
ATOM   1902 N N   . ALA B 1 12  ? -10.125 22.353  -62.993 1.00 65.31  ? 307 ALA B N   1 
ATOM   1903 C CA  . ALA B 1 12  ? -9.167  22.371  -64.096 1.00 61.50  ? 307 ALA B CA  1 
ATOM   1904 C C   . ALA B 1 12  ? -9.196  21.117  -64.969 1.00 60.20  ? 307 ALA B C   1 
ATOM   1905 O O   . ALA B 1 12  ? -9.000  21.197  -66.180 1.00 59.03  ? 307 ALA B O   1 
ATOM   1906 C CB  . ALA B 1 12  ? -7.764  22.602  -63.564 1.00 60.21  ? 307 ALA B CB  1 
ATOM   1907 N N   . LEU B 1 13  ? -9.439  19.963  -64.354 1.00 53.71  ? 308 LEU B N   1 
ATOM   1908 C CA  . LEU B 1 13  ? -9.383  18.690  -65.070 1.00 52.78  ? 308 LEU B CA  1 
ATOM   1909 C C   . LEU B 1 13  ? -10.522 18.501  -66.070 1.00 54.63  ? 308 LEU B C   1 
ATOM   1910 O O   . LEU B 1 13  ? -10.502 17.560  -66.862 1.00 56.75  ? 308 LEU B O   1 
ATOM   1911 C CB  . LEU B 1 13  ? -9.352  17.515  -64.089 1.00 53.34  ? 308 LEU B CB  1 
ATOM   1912 C CG  . LEU B 1 13  ? -8.084  17.350  -63.250 1.00 52.59  ? 308 LEU B CG  1 
ATOM   1913 C CD1 . LEU B 1 13  ? -8.161  16.075  -62.415 1.00 49.79  ? 308 LEU B CD1 1 
ATOM   1914 C CD2 . LEU B 1 13  ? -6.855  17.334  -64.149 1.00 52.88  ? 308 LEU B CD2 1 
ATOM   1915 N N   . SER B 1 14  ? -11.510 19.391  -66.033 1.00 53.24  ? 309 SER B N   1 
ATOM   1916 C CA  . SER B 1 14  ? -12.657 19.299  -66.935 1.00 56.54  ? 309 SER B CA  1 
ATOM   1917 C C   . SER B 1 14  ? -12.532 20.177  -68.176 1.00 53.54  ? 309 SER B C   1 
ATOM   1918 O O   . SER B 1 14  ? -13.331 20.063  -69.107 1.00 53.10  ? 309 SER B O   1 
ATOM   1919 C CB  . SER B 1 14  ? -13.953 19.629  -66.195 1.00 56.92  ? 309 SER B CB  1 
ATOM   1920 O OG  . SER B 1 14  ? -14.444 18.484  -65.521 1.00 63.11  ? 309 SER B OG  1 
ATOM   1921 N N   . LEU B 1 15  ? -11.532 21.051  -68.187 1.00 44.54  ? 310 LEU B N   1 
ATOM   1922 C CA  . LEU B 1 15  ? -11.313 21.944  -69.321 1.00 48.61  ? 310 LEU B CA  1 
ATOM   1923 C C   . LEU B 1 15  ? -11.014 21.190  -70.611 1.00 47.56  ? 310 LEU B C   1 
ATOM   1924 O O   . LEU B 1 15  ? -10.322 20.169  -70.602 1.00 41.67  ? 310 LEU B O   1 
ATOM   1925 C CB  . LEU B 1 15  ? -10.153 22.906  -69.033 1.00 49.55  ? 310 LEU B CB  1 
ATOM   1926 C CG  . LEU B 1 15  ? -10.335 23.919  -67.903 1.00 47.39  ? 310 LEU B CG  1 
ATOM   1927 C CD1 . LEU B 1 15  ? -9.241  24.978  -67.981 1.00 52.04  ? 310 LEU B CD1 1 
ATOM   1928 C CD2 . LEU B 1 15  ? -11.708 24.561  -67.986 1.00 44.29  ? 310 LEU B CD2 1 
ATOM   1929 N N   . THR B 1 16  ? -11.533 21.704  -71.722 1.00 42.96  ? 311 THR B N   1 
ATOM   1930 C CA  . THR B 1 16  ? -11.151 21.200  -73.033 1.00 42.31  ? 311 THR B CA  1 
ATOM   1931 C C   . THR B 1 16  ? -9.800  21.796  -73.388 1.00 43.58  ? 311 THR B C   1 
ATOM   1932 O O   . THR B 1 16  ? -9.306  22.693  -72.694 1.00 41.76  ? 311 THR B O   1 
ATOM   1933 C CB  . THR B 1 16  ? -12.168 21.602  -74.122 1.00 47.18  ? 311 THR B CB  1 
ATOM   1934 O OG1 . THR B 1 16  ? -12.098 23.015  -74.352 1.00 42.01  ? 311 THR B OG1 1 
ATOM   1935 C CG2 . THR B 1 16  ? -13.583 21.223  -73.703 1.00 50.93  ? 311 THR B CG2 1 
ATOM   1936 N N   . ALA B 1 17  ? -9.202  21.313  -74.470 1.00 44.10  ? 312 ALA B N   1 
ATOM   1937 C CA  . ALA B 1 17  ? -7.937  21.880  -74.929 1.00 40.67  ? 312 ALA B CA  1 
ATOM   1938 C C   . ALA B 1 17  ? -8.116  23.357  -75.261 1.00 43.95  ? 312 ALA B C   1 
ATOM   1939 O O   . ALA B 1 17  ? -7.294  24.195  -74.875 1.00 44.63  ? 312 ALA B O   1 
ATOM   1940 C CB  . ALA B 1 17  ? -7.420  21.124  -76.133 1.00 30.78  ? 312 ALA B CB  1 
ATOM   1941 N N   . ASP B 1 18  ? -9.197  23.674  -75.967 1.00 40.98  ? 313 ASP B N   1 
ATOM   1942 C CA  . ASP B 1 18  ? -9.485  25.057  -76.351 1.00 47.26  ? 313 ASP B CA  1 
ATOM   1943 C C   . ASP B 1 18  ? -9.664  25.951  -75.130 1.00 40.50  ? 313 ASP B C   1 
ATOM   1944 O O   . ASP B 1 18  ? -9.286  27.121  -75.146 1.00 35.24  ? 313 ASP B O   1 
ATOM   1945 C CB  . ASP B 1 18  ? -10.733 25.131  -77.241 1.00 55.48  ? 313 ASP B CB  1 
ATOM   1946 C CG  . ASP B 1 18  ? -10.493 24.578  -78.634 1.00 64.42  ? 313 ASP B CG  1 
ATOM   1947 O OD1 . ASP B 1 18  ? -9.333  24.596  -79.094 1.00 63.78  ? 313 ASP B OD1 1 
ATOM   1948 O OD2 . ASP B 1 18  ? -11.468 24.130  -79.273 1.00 72.79  ? 313 ASP B OD2 1 
ATOM   1949 N N   . GLN B 1 19  ? -10.244 25.394  -74.071 1.00 38.75  ? 314 GLN B N   1 
ATOM   1950 C CA  . GLN B 1 19  ? -10.486 26.159  -72.853 1.00 38.85  ? 314 GLN B CA  1 
ATOM   1951 C C   . GLN B 1 19  ? -9.197  26.362  -72.075 1.00 36.04  ? 314 GLN B C   1 
ATOM   1952 O O   . GLN B 1 19  ? -9.010  27.393  -71.430 1.00 34.96  ? 314 GLN B O   1 
ATOM   1953 C CB  . GLN B 1 19  ? -11.528 25.469  -71.969 1.00 39.59  ? 314 GLN B CB  1 
ATOM   1954 C CG  . GLN B 1 19  ? -12.962 25.574  -72.484 1.00 45.77  ? 314 GLN B CG  1 
ATOM   1955 C CD  . GLN B 1 19  ? -13.925 24.692  -71.709 1.00 51.99  ? 314 GLN B CD  1 
ATOM   1956 O OE1 . GLN B 1 19  ? -13.541 23.652  -71.174 1.00 52.41  ? 314 GLN B OE1 1 
ATOM   1957 N NE2 . GLN B 1 19  ? -15.184 25.105  -71.646 1.00 56.68  ? 314 GLN B NE2 1 
ATOM   1958 N N   . MET B 1 20  ? -8.313  25.371  -72.139 1.00 42.58  ? 315 MET B N   1 
ATOM   1959 C CA  . MET B 1 20  ? -7.025  25.440  -71.457 1.00 40.61  ? 315 MET B CA  1 
ATOM   1960 C C   . MET B 1 20  ? -6.142  26.505  -72.097 1.00 33.40  ? 315 MET B C   1 
ATOM   1961 O O   . MET B 1 20  ? -5.536  27.325  -71.405 1.00 38.22  ? 315 MET B O   1 
ATOM   1962 C CB  . MET B 1 20  ? -6.323  24.079  -71.491 1.00 41.09  ? 315 MET B CB  1 
ATOM   1963 C CG  . MET B 1 20  ? -4.908  24.093  -70.918 1.00 42.36  ? 315 MET B CG  1 
ATOM   1964 S SD  . MET B 1 20  ? -4.865  24.278  -69.124 1.00 50.36  ? 315 MET B SD  1 
ATOM   1965 C CE  . MET B 1 20  ? -5.695  22.775  -68.619 1.00 41.20  ? 315 MET B CE  1 
ATOM   1966 N N   . VAL B 1 21  ? -6.070  26.488  -73.423 1.00 33.35  ? 316 VAL B N   1 
ATOM   1967 C CA  . VAL B 1 21  ? -5.297  27.477  -74.165 1.00 37.64  ? 316 VAL B CA  1 
ATOM   1968 C C   . VAL B 1 21  ? -5.749  28.902  -73.846 1.00 39.78  ? 316 VAL B C   1 
ATOM   1969 O O   . VAL B 1 21  ? -4.920  29.783  -73.610 1.00 34.27  ? 316 VAL B O   1 
ATOM   1970 C CB  . VAL B 1 21  ? -5.416  27.256  -75.688 1.00 41.50  ? 316 VAL B CB  1 
ATOM   1971 C CG1 . VAL B 1 21  ? -4.651  28.337  -76.439 1.00 42.67  ? 316 VAL B CG1 1 
ATOM   1972 C CG2 . VAL B 1 21  ? -4.910  25.881  -76.069 1.00 42.78  ? 316 VAL B CG2 1 
ATOM   1973 N N   . SER B 1 22  ? -7.067  29.115  -73.848 1.00 41.12  ? 317 SER B N   1 
ATOM   1974 C CA  . SER B 1 22  ? -7.638  30.433  -73.601 1.00 43.17  ? 317 SER B CA  1 
ATOM   1975 C C   . SER B 1 22  ? -7.294  30.914  -72.202 1.00 40.45  ? 317 SER B C   1 
ATOM   1976 O O   . SER B 1 22  ? -6.936  32.076  -72.003 1.00 42.46  ? 317 SER B O   1 
ATOM   1977 C CB  . SER B 1 22  ? -9.162  30.398  -73.758 1.00 50.22  ? 317 SER B CB  1 
ATOM   1978 O OG  . SER B 1 22  ? -9.531  29.855  -75.013 1.00 58.67  ? 317 SER B OG  1 
ATOM   1979 N N   . ALA B 1 23  ? -7.416  30.014  -71.233 1.00 37.56  ? 318 ALA B N   1 
ATOM   1980 C CA  . ALA B 1 23  ? -7.112  30.335  -69.848 1.00 38.36  ? 318 ALA B CA  1 
ATOM   1981 C C   . ALA B 1 23  ? -5.650  30.737  -69.699 1.00 41.50  ? 318 ALA B C   1 
ATOM   1982 O O   . ALA B 1 23  ? -5.332  31.700  -69.007 1.00 41.06  ? 318 ALA B O   1 
ATOM   1983 C CB  . ALA B 1 23  ? -7.432  29.147  -68.949 1.00 37.79  ? 318 ALA B CB  1 
ATOM   1984 N N   . LEU B 1 24  ? -4.762  29.996  -70.355 1.00 38.21  ? 319 LEU B N   1 
ATOM   1985 C CA  . LEU B 1 24  ? -3.331  30.272  -70.270 1.00 39.60  ? 319 LEU B CA  1 
ATOM   1986 C C   . LEU B 1 24  ? -2.960  31.588  -70.952 1.00 39.67  ? 319 LEU B C   1 
ATOM   1987 O O   . LEU B 1 24  ? -2.180  32.371  -70.416 1.00 45.93  ? 319 LEU B O   1 
ATOM   1988 C CB  . LEU B 1 24  ? -2.523  29.116  -70.857 1.00 39.05  ? 319 LEU B CB  1 
ATOM   1989 C CG  . LEU B 1 24  ? -2.610  27.796  -70.090 1.00 32.91  ? 319 LEU B CG  1 
ATOM   1990 C CD1 . LEU B 1 24  ? -1.667  26.784  -70.698 1.00 31.83  ? 319 LEU B CD1 1 
ATOM   1991 C CD2 . LEU B 1 24  ? -2.273  28.015  -68.622 1.00 27.44  ? 319 LEU B CD2 1 
ATOM   1992 N N   . LEU B 1 25  ? -3.519  31.835  -72.131 1.00 39.72  ? 320 LEU B N   1 
ATOM   1993 C CA  . LEU B 1 25  ? -3.249  33.081  -72.841 1.00 37.39  ? 320 LEU B CA  1 
ATOM   1994 C C   . LEU B 1 25  ? -3.713  34.293  -72.031 1.00 42.07  ? 320 LEU B C   1 
ATOM   1995 O O   . LEU B 1 25  ? -2.990  35.283  -71.905 1.00 45.23  ? 320 LEU B O   1 
ATOM   1996 C CB  . LEU B 1 25  ? -3.920  33.072  -74.217 1.00 43.20  ? 320 LEU B CB  1 
ATOM   1997 C CG  . LEU B 1 25  ? -3.316  32.165  -75.290 1.00 43.18  ? 320 LEU B CG  1 
ATOM   1998 C CD1 . LEU B 1 25  ? -4.235  32.078  -76.487 1.00 45.51  ? 320 LEU B CD1 1 
ATOM   1999 C CD2 . LEU B 1 25  ? -1.946  32.674  -75.708 1.00 39.62  ? 320 LEU B CD2 1 
ATOM   2000 N N   . ASP B 1 26  ? -4.921  34.209  -71.484 1.00 44.62  ? 321 ASP B N   1 
ATOM   2001 C CA  . ASP B 1 26  ? -5.483  35.300  -70.689 1.00 52.42  ? 321 ASP B CA  1 
ATOM   2002 C C   . ASP B 1 26  ? -4.662  35.561  -69.434 1.00 47.28  ? 321 ASP B C   1 
ATOM   2003 O O   . ASP B 1 26  ? -4.635  36.677  -68.926 1.00 50.92  ? 321 ASP B O   1 
ATOM   2004 C CB  . ASP B 1 26  ? -6.932  34.992  -70.293 1.00 57.73  ? 321 ASP B CB  1 
ATOM   2005 C CG  . ASP B 1 26  ? -7.873  34.977  -71.482 1.00 67.10  ? 321 ASP B CG  1 
ATOM   2006 O OD1 . ASP B 1 26  ? -7.457  35.422  -72.577 1.00 64.41  ? 321 ASP B OD1 1 
ATOM   2007 O OD2 . ASP B 1 26  ? -9.030  34.518  -71.317 1.00 70.32  ? 321 ASP B OD2 1 
ATOM   2008 N N   . ALA B 1 27  ? -3.991  34.526  -68.942 1.00 39.20  ? 322 ALA B N   1 
ATOM   2009 C CA  . ALA B 1 27  ? -3.252  34.623  -67.688 1.00 40.66  ? 322 ALA B CA  1 
ATOM   2010 C C   . ALA B 1 27  ? -1.879  35.268  -67.856 1.00 36.20  ? 322 ALA B C   1 
ATOM   2011 O O   . ALA B 1 27  ? -1.201  35.540  -66.870 1.00 31.23  ? 322 ALA B O   1 
ATOM   2012 C CB  . ALA B 1 27  ? -3.111  33.242  -67.050 1.00 31.34  ? 322 ALA B CB  1 
ATOM   2013 N N   . GLU B 1 28  ? -1.476  35.499  -69.102 1.00 30.96  ? 323 GLU B N   1 
ATOM   2014 C CA  . GLU B 1 28  ? -0.134  35.978  -69.393 1.00 34.21  ? 323 GLU B CA  1 
ATOM   2015 C C   . GLU B 1 28  ? 0.210   37.239  -68.607 1.00 36.87  ? 323 GLU B C   1 
ATOM   2016 O O   . GLU B 1 28  ? -0.599  38.161  -68.513 1.00 33.41  ? 323 GLU B O   1 
ATOM   2017 C CB  . GLU B 1 28  ? 0.045   36.214  -70.897 1.00 35.66  ? 323 GLU B CB  1 
ATOM   2018 C CG  . GLU B 1 28  ? 0.499   34.981  -71.668 1.00 35.27  ? 323 GLU B CG  1 
ATOM   2019 C CD  . GLU B 1 28  ? 1.848   34.461  -71.190 1.00 38.14  ? 323 GLU B CD  1 
ATOM   2020 O OE1 . GLU B 1 28  ? 2.881   34.868  -71.759 1.00 41.91  ? 323 GLU B OE1 1 
ATOM   2021 O OE2 . GLU B 1 28  ? 1.872   33.651  -70.243 1.00 38.40  ? 323 GLU B OE2 1 
ATOM   2022 N N   . PRO B 1 29  ? 1.417   37.273  -68.028 1.00 34.06  ? 324 PRO B N   1 
ATOM   2023 C CA  . PRO B 1 29  ? 1.893   38.433  -67.270 1.00 35.52  ? 324 PRO B CA  1 
ATOM   2024 C C   . PRO B 1 29  ? 2.315   39.540  -68.222 1.00 36.86  ? 324 PRO B C   1 
ATOM   2025 O O   . PRO B 1 29  ? 2.491   39.283  -69.408 1.00 34.41  ? 324 PRO B O   1 
ATOM   2026 C CB  . PRO B 1 29  ? 3.119   37.881  -66.541 1.00 34.97  ? 324 PRO B CB  1 
ATOM   2027 C CG  . PRO B 1 29  ? 3.635   36.827  -67.451 1.00 33.81  ? 324 PRO B CG  1 
ATOM   2028 C CD  . PRO B 1 29  ? 2.433   36.207  -68.099 1.00 29.39  ? 324 PRO B CD  1 
ATOM   2029 N N   . PRO B 1 30  ? 2.487   40.764  -67.710 1.00 36.90  ? 325 PRO B N   1 
ATOM   2030 C CA  . PRO B 1 30  ? 2.910   41.862  -68.578 1.00 37.35  ? 325 PRO B CA  1 
ATOM   2031 C C   . PRO B 1 30  ? 4.415   41.843  -68.792 1.00 40.41  ? 325 PRO B C   1 
ATOM   2032 O O   . PRO B 1 30  ? 5.141   41.209  -68.027 1.00 36.39  ? 325 PRO B O   1 
ATOM   2033 C CB  . PRO B 1 30  ? 2.525   43.100  -67.768 1.00 41.45  ? 325 PRO B CB  1 
ATOM   2034 C CG  . PRO B 1 30  ? 2.671   42.664  -66.352 1.00 42.58  ? 325 PRO B CG  1 
ATOM   2035 C CD  . PRO B 1 30  ? 2.302   41.198  -66.315 1.00 36.35  ? 325 PRO B CD  1 
ATOM   2036 N N   . ILE B 1 31  ? 4.879   42.524  -69.832 1.00 44.36  ? 326 ILE B N   1 
ATOM   2037 C CA  . ILE B 1 31  ? 6.303   42.739  -70.009 1.00 49.32  ? 326 ILE B CA  1 
ATOM   2038 C C   . ILE B 1 31  ? 6.693   44.010  -69.264 1.00 43.21  ? 326 ILE B C   1 
ATOM   2039 O O   . ILE B 1 31  ? 6.076   45.059  -69.450 1.00 40.83  ? 326 ILE B O   1 
ATOM   2040 C CB  . ILE B 1 31  ? 6.668   42.877  -71.494 1.00 51.40  ? 326 ILE B CB  1 
ATOM   2041 C CG1 . ILE B 1 31  ? 6.301   41.594  -72.240 1.00 49.26  ? 326 ILE B CG1 1 
ATOM   2042 C CG2 . ILE B 1 31  ? 8.149   43.182  -71.658 1.00 45.36  ? 326 ILE B CG2 1 
ATOM   2043 C CD1 . ILE B 1 31  ? 6.460   41.701  -73.728 1.00 53.12  ? 326 ILE B CD1 1 
ATOM   2044 N N   . LEU B 1 32  ? 7.703   43.905  -68.409 1.00 35.65  ? 327 LEU B N   1 
ATOM   2045 C CA  . LEU B 1 32  ? 8.152   45.045  -67.628 1.00 37.52  ? 327 LEU B CA  1 
ATOM   2046 C C   . LEU B 1 32  ? 9.400   45.666  -68.240 1.00 37.61  ? 327 LEU B C   1 
ATOM   2047 O O   . LEU B 1 32  ? 10.091  45.049  -69.056 1.00 35.27  ? 327 LEU B O   1 
ATOM   2048 C CB  . LEU B 1 32  ? 8.416   44.637  -66.172 1.00 36.57  ? 327 LEU B CB  1 
ATOM   2049 C CG  . LEU B 1 32  ? 7.249   43.973  -65.434 1.00 38.21  ? 327 LEU B CG  1 
ATOM   2050 C CD1 . LEU B 1 32  ? 7.632   43.675  -63.995 1.00 34.56  ? 327 LEU B CD1 1 
ATOM   2051 C CD2 . LEU B 1 32  ? 5.989   44.850  -65.494 1.00 35.86  ? 327 LEU B CD2 1 
ATOM   2052 N N   . TYR B 1 33  ? 9.682   46.902  -67.849 1.00 30.64  ? 328 TYR B N   1 
ATOM   2053 C CA  . TYR B 1 33  ? 10.876  47.582  -68.317 1.00 37.09  ? 328 TYR B CA  1 
ATOM   2054 C C   . TYR B 1 33  ? 11.945  47.495  -67.245 1.00 35.00  ? 328 TYR B C   1 
ATOM   2055 O O   . TYR B 1 33  ? 11.641  47.322  -66.060 1.00 34.43  ? 328 TYR B O   1 
ATOM   2056 C CB  . TYR B 1 33  ? 10.571  49.045  -68.658 1.00 42.10  ? 328 TYR B CB  1 
ATOM   2057 C CG  . TYR B 1 33  ? 9.713   49.204  -69.890 1.00 46.62  ? 328 TYR B CG  1 
ATOM   2058 C CD1 . TYR B 1 33  ? 8.345   48.987  -69.835 1.00 56.57  ? 328 TYR B CD1 1 
ATOM   2059 C CD2 . TYR B 1 33  ? 10.272  49.565  -71.111 1.00 46.73  ? 328 TYR B CD2 1 
ATOM   2060 C CE1 . TYR B 1 33  ? 7.553   49.122  -70.963 1.00 61.91  ? 328 TYR B CE1 1 
ATOM   2061 C CE2 . TYR B 1 33  ? 9.488   49.702  -72.245 1.00 50.11  ? 328 TYR B CE2 1 
ATOM   2062 C CZ  . TYR B 1 33  ? 8.128   49.483  -72.164 1.00 58.75  ? 328 TYR B CZ  1 
ATOM   2063 O OH  . TYR B 1 33  ? 7.332   49.621  -73.280 1.00 60.47  ? 328 TYR B OH  1 
ATOM   2064 N N   . SER B 1 34  ? 13.195  47.594  -67.669 1.00 38.85  ? 329 SER B N   1 
ATOM   2065 C CA  . SER B 1 34  ? 14.298  47.661  -66.739 1.00 38.40  ? 329 SER B CA  1 
ATOM   2066 C C   . SER B 1 34  ? 14.357  49.076  -66.179 1.00 48.42  ? 329 SER B C   1 
ATOM   2067 O O   . SER B 1 34  ? 13.800  50.005  -66.768 1.00 44.68  ? 329 SER B O   1 
ATOM   2068 C CB  . SER B 1 34  ? 15.605  47.317  -67.449 1.00 32.82  ? 329 SER B CB  1 
ATOM   2069 O OG  . SER B 1 34  ? 16.696  47.397  -66.547 1.00 43.42  ? 329 SER B OG  1 
ATOM   2070 N N   . GLU B 1 35  ? 15.019  49.235  -65.037 1.00 49.55  ? 330 GLU B N   1 
ATOM   2071 C CA  . GLU B 1 35  ? 15.208  50.556  -64.455 1.00 55.31  ? 330 GLU B CA  1 
ATOM   2072 C C   . GLU B 1 35  ? 15.687  51.498  -65.548 1.00 51.35  ? 330 GLU B C   1 
ATOM   2073 O O   . GLU B 1 35  ? 16.674  51.222  -66.215 1.00 48.06  ? 330 GLU B O   1 
ATOM   2074 C CB  . GLU B 1 35  ? 16.223  50.507  -63.312 1.00 56.99  ? 330 GLU B CB  1 
ATOM   2075 C CG  . GLU B 1 35  ? 15.805  49.632  -62.141 1.00 74.17  ? 330 GLU B CG  1 
ATOM   2076 C CD  . GLU B 1 35  ? 16.704  49.812  -60.928 1.00 83.29  ? 330 GLU B CD  1 
ATOM   2077 O OE1 . GLU B 1 35  ? 17.733  50.518  -61.044 1.00 82.96  ? 330 GLU B OE1 1 
ATOM   2078 O OE2 . GLU B 1 35  ? 16.378  49.251  -59.858 1.00 87.94  ? 330 GLU B OE2 1 
ATOM   2079 N N   . TYR B 1 36  ? 14.974  52.600  -65.746 1.00 53.56  ? 331 TYR B N   1 
ATOM   2080 C CA  . TYR B 1 36  ? 15.272  53.488  -66.861 1.00 61.45  ? 331 TYR B CA  1 
ATOM   2081 C C   . TYR B 1 36  ? 16.629  54.172  -66.708 1.00 62.92  ? 331 TYR B C   1 
ATOM   2082 O O   . TYR B 1 36  ? 17.018  54.573  -65.612 1.00 67.99  ? 331 TYR B O   1 
ATOM   2083 C CB  . TYR B 1 36  ? 14.163  54.533  -67.039 1.00 73.52  ? 331 TYR B CB  1 
ATOM   2084 C CG  . TYR B 1 36  ? 14.296  55.384  -68.287 1.00 92.81  ? 331 TYR B CG  1 
ATOM   2085 C CD1 . TYR B 1 36  ? 15.493  55.462  -68.975 1.00 102.99 ? 331 TYR B CD1 1 
ATOM   2086 C CD2 . TYR B 1 36  ? 13.226  56.110  -68.774 1.00 106.73 ? 331 TYR B CD2 1 
ATOM   2087 C CE1 . TYR B 1 36  ? 15.633  56.234  -70.102 1.00 110.74 ? 331 TYR B CE1 1 
ATOM   2088 C CE2 . TYR B 1 36  ? 13.355  56.885  -69.910 1.00 114.32 ? 331 TYR B CE2 1 
ATOM   2089 C CZ  . TYR B 1 36  ? 14.564  56.944  -70.570 1.00 113.15 ? 331 TYR B CZ  1 
ATOM   2090 O OH  . TYR B 1 36  ? 14.713  57.712  -71.704 1.00 115.02 ? 331 TYR B OH  1 
ATOM   2091 N N   . ASP B 1 37  ? 17.340  54.281  -67.827 1.00 64.25  ? 332 ASP B N   1 
ATOM   2092 C CA  . ASP B 1 37  ? 18.542  55.101  -67.934 1.00 68.33  ? 332 ASP B CA  1 
ATOM   2093 C C   . ASP B 1 37  ? 19.547  54.791  -66.848 1.00 65.50  ? 332 ASP B C   1 
ATOM   2094 O O   . ASP B 1 37  ? 19.820  55.627  -65.988 1.00 69.08  ? 332 ASP B O   1 
ATOM   2095 C CB  . ASP B 1 37  ? 18.189  56.590  -67.900 1.00 78.66  ? 332 ASP B CB  1 
ATOM   2096 C CG  . ASP B 1 37  ? 19.345  57.473  -68.322 1.00 85.43  ? 332 ASP B CG  1 
ATOM   2097 O OD1 . ASP B 1 37  ? 20.446  56.941  -68.580 1.00 90.14  ? 332 ASP B OD1 1 
ATOM   2098 O OD2 . ASP B 1 37  ? 19.152  58.704  -68.398 1.00 87.65  ? 332 ASP B OD2 1 
ATOM   2099 N N   . PRO B 1 38  ? 20.101  53.577  -66.878 1.00 64.61  ? 333 PRO B N   1 
ATOM   2100 C CA  . PRO B 1 38  ? 21.180  53.262  -65.949 1.00 62.72  ? 333 PRO B CA  1 
ATOM   2101 C C   . PRO B 1 38  ? 22.493  53.751  -66.542 1.00 60.79  ? 333 PRO B C   1 
ATOM   2102 O O   . PRO B 1 38  ? 22.561  54.014  -67.746 1.00 54.39  ? 333 PRO B O   1 
ATOM   2103 C CB  . PRO B 1 38  ? 21.149  51.737  -65.903 1.00 60.85  ? 333 PRO B CB  1 
ATOM   2104 C CG  . PRO B 1 38  ? 20.670  51.339  -67.267 1.00 60.50  ? 333 PRO B CG  1 
ATOM   2105 C CD  . PRO B 1 38  ? 19.787  52.450  -67.775 1.00 64.86  ? 333 PRO B CD  1 
ATOM   2106 N N   . THR B 1 39  ? 23.518  53.882  -65.707 1.00 63.07  ? 334 THR B N   1 
ATOM   2107 C CA  . THR B 1 39  ? 24.841  54.227  -66.199 1.00 64.23  ? 334 THR B CA  1 
ATOM   2108 C C   . THR B 1 39  ? 25.267  53.216  -67.252 1.00 59.93  ? 334 THR B C   1 
ATOM   2109 O O   . THR B 1 39  ? 25.190  52.008  -67.033 1.00 54.54  ? 334 THR B O   1 
ATOM   2110 C CB  . THR B 1 39  ? 25.888  54.224  -65.067 1.00 68.30  ? 334 THR B CB  1 
ATOM   2111 O OG1 . THR B 1 39  ? 25.501  55.157  -64.051 1.00 72.53  ? 334 THR B OG1 1 
ATOM   2112 C CG2 . THR B 1 39  ? 27.267  54.603  -65.610 1.00 60.90  ? 334 THR B CG2 1 
ATOM   2113 N N   . ARG B 1 40  ? 25.693  53.716  -68.406 1.00 61.28  ? 335 ARG B N   1 
ATOM   2114 C CA  . ARG B 1 40  ? 26.319  52.877  -69.419 1.00 57.89  ? 335 ARG B CA  1 
ATOM   2115 C C   . ARG B 1 40  ? 27.681  53.479  -69.723 1.00 54.20  ? 335 ARG B C   1 
ATOM   2116 O O   . ARG B 1 40  ? 27.808  54.698  -69.800 1.00 54.89  ? 335 ARG B O   1 
ATOM   2117 C CB  . ARG B 1 40  ? 25.467  52.812  -70.684 1.00 61.01  ? 335 ARG B CB  1 
ATOM   2118 C CG  . ARG B 1 40  ? 24.174  52.020  -70.549 1.00 70.26  ? 335 ARG B CG  1 
ATOM   2119 C CD  . ARG B 1 40  ? 24.128  50.887  -71.575 1.00 77.32  ? 335 ARG B CD  1 
ATOM   2120 N NE  . ARG B 1 40  ? 22.760  50.528  -71.937 1.00 82.96  ? 335 ARG B NE  1 
ATOM   2121 C CZ  . ARG B 1 40  ? 22.440  49.573  -72.803 1.00 83.06  ? 335 ARG B CZ  1 
ATOM   2122 N NH1 . ARG B 1 40  ? 23.394  48.870  -73.397 1.00 80.22  ? 335 ARG B NH1 1 
ATOM   2123 N NH2 . ARG B 1 40  ? 21.162  49.319  -73.070 1.00 85.07  ? 335 ARG B NH2 1 
ATOM   2124 N N   . PRO B 1 41  ? 28.710  52.633  -69.893 1.00 49.37  ? 336 PRO B N   1 
ATOM   2125 C CA  . PRO B 1 41  ? 28.658  51.167  -69.900 1.00 47.27  ? 336 PRO B CA  1 
ATOM   2126 C C   . PRO B 1 41  ? 28.332  50.577  -68.531 1.00 51.41  ? 336 PRO B C   1 
ATOM   2127 O O   . PRO B 1 41  ? 28.449  51.270  -67.516 1.00 52.97  ? 336 PRO B O   1 
ATOM   2128 C CB  . PRO B 1 41  ? 30.093  50.763  -70.288 1.00 46.46  ? 336 PRO B CB  1 
ATOM   2129 C CG  . PRO B 1 41  ? 30.753  52.009  -70.772 1.00 52.04  ? 336 PRO B CG  1 
ATOM   2130 C CD  . PRO B 1 41  ? 30.084  53.130  -70.057 1.00 53.24  ? 336 PRO B CD  1 
ATOM   2131 N N   . PHE B 1 42  ? 27.940  49.306  -68.515 1.00 44.93  ? 337 PHE B N   1 
ATOM   2132 C CA  . PHE B 1 42  ? 27.653  48.601  -67.271 1.00 49.76  ? 337 PHE B CA  1 
ATOM   2133 C C   . PHE B 1 42  ? 28.928  48.071  -66.641 1.00 55.15  ? 337 PHE B C   1 
ATOM   2134 O O   . PHE B 1 42  ? 29.936  47.884  -67.321 1.00 57.20  ? 337 PHE B O   1 
ATOM   2135 C CB  . PHE B 1 42  ? 26.741  47.398  -67.520 1.00 45.59  ? 337 PHE B CB  1 
ATOM   2136 C CG  . PHE B 1 42  ? 25.424  47.739  -68.153 1.00 44.62  ? 337 PHE B CG  1 
ATOM   2137 C CD1 . PHE B 1 42  ? 24.465  48.451  -67.451 1.00 47.02  ? 337 PHE B CD1 1 
ATOM   2138 C CD2 . PHE B 1 42  ? 25.129  47.308  -69.437 1.00 47.96  ? 337 PHE B CD2 1 
ATOM   2139 C CE1 . PHE B 1 42  ? 23.247  48.746  -68.027 1.00 53.31  ? 337 PHE B CE1 1 
ATOM   2140 C CE2 . PHE B 1 42  ? 23.910  47.597  -70.016 1.00 54.29  ? 337 PHE B CE2 1 
ATOM   2141 C CZ  . PHE B 1 42  ? 22.969  48.319  -69.312 1.00 54.26  ? 337 PHE B CZ  1 
ATOM   2142 N N   . SER B 1 43  ? 28.872  47.831  -65.336 1.00 59.47  ? 338 SER B N   1 
ATOM   2143 C CA  . SER B 1 43  ? 29.855  46.995  -64.666 1.00 58.79  ? 338 SER B CA  1 
ATOM   2144 C C   . SER B 1 43  ? 29.153  45.686  -64.341 1.00 62.05  ? 338 SER B C   1 
ATOM   2145 O O   . SER B 1 43  ? 27.947  45.563  -64.555 1.00 61.69  ? 338 SER B O   1 
ATOM   2146 C CB  . SER B 1 43  ? 30.372  47.661  -63.392 1.00 57.17  ? 338 SER B CB  1 
ATOM   2147 O OG  . SER B 1 43  ? 29.327  47.880  -62.460 1.00 57.37  ? 338 SER B OG  1 
ATOM   2148 N N   . GLU B 1 44  ? 29.901  44.713  -63.832 1.00 66.78  ? 339 GLU B N   1 
ATOM   2149 C CA  . GLU B 1 44  ? 29.333  43.412  -63.479 1.00 72.09  ? 339 GLU B CA  1 
ATOM   2150 C C   . GLU B 1 44  ? 28.224  43.554  -62.443 1.00 61.55  ? 339 GLU B C   1 
ATOM   2151 O O   . GLU B 1 44  ? 27.172  42.922  -62.547 1.00 57.75  ? 339 GLU B O   1 
ATOM   2152 C CB  . GLU B 1 44  ? 30.424  42.483  -62.946 1.00 80.25  ? 339 GLU B CB  1 
ATOM   2153 C CG  . GLU B 1 44  ? 31.265  43.103  -61.840 1.00 95.48  ? 339 GLU B CG  1 
ATOM   2154 C CD  . GLU B 1 44  ? 31.923  42.063  -60.952 1.00 110.13 ? 339 GLU B CD  1 
ATOM   2155 O OE1 . GLU B 1 44  ? 32.882  42.415  -60.232 1.00 113.22 ? 339 GLU B OE1 1 
ATOM   2156 O OE2 . GLU B 1 44  ? 31.479  40.894  -60.973 1.00 113.71 ? 339 GLU B OE2 1 
ATOM   2157 N N   . ALA B 1 45  ? 28.474  44.393  -61.446 1.00 57.81  ? 340 ALA B N   1 
ATOM   2158 C CA  . ALA B 1 45  ? 27.513  44.644  -60.384 1.00 54.02  ? 340 ALA B CA  1 
ATOM   2159 C C   . ALA B 1 45  ? 26.289  45.410  -60.886 1.00 48.94  ? 340 ALA B C   1 
ATOM   2160 O O   . ALA B 1 45  ? 25.159  45.067  -60.546 1.00 51.81  ? 340 ALA B O   1 
ATOM   2161 C CB  . ALA B 1 45  ? 28.179  45.397  -59.236 1.00 53.11  ? 340 ALA B CB  1 
ATOM   2162 N N   . SER B 1 46  ? 26.511  46.446  -61.691 1.00 45.38  ? 341 SER B N   1 
ATOM   2163 C CA  . SER B 1 46  ? 25.409  47.280  -62.165 1.00 42.77  ? 341 SER B CA  1 
ATOM   2164 C C   . SER B 1 46  ? 24.411  46.477  -62.994 1.00 40.67  ? 341 SER B C   1 
ATOM   2165 O O   . SER B 1 46  ? 23.205  46.616  -62.819 1.00 45.10  ? 341 SER B O   1 
ATOM   2166 C CB  . SER B 1 46  ? 25.922  48.479  -62.969 1.00 42.77  ? 341 SER B CB  1 
ATOM   2167 O OG  . SER B 1 46  ? 26.255  48.106  -64.294 1.00 47.01  ? 341 SER B OG  1 
ATOM   2168 N N   . MET B 1 47  ? 24.907  45.635  -63.892 1.00 39.69  ? 342 MET B N   1 
ATOM   2169 C CA  . MET B 1 47  ? 24.009  44.819  -64.698 1.00 45.51  ? 342 MET B CA  1 
ATOM   2170 C C   . MET B 1 47  ? 23.213  43.865  -63.808 1.00 44.71  ? 342 MET B C   1 
ATOM   2171 O O   . MET B 1 47  ? 21.996  43.750  -63.941 1.00 43.06  ? 342 MET B O   1 
ATOM   2172 C CB  . MET B 1 47  ? 24.767  44.031  -65.762 1.00 49.15  ? 342 MET B CB  1 
ATOM   2173 C CG  . MET B 1 47  ? 23.876  43.568  -66.902 1.00 49.61  ? 342 MET B CG  1 
ATOM   2174 S SD  . MET B 1 47  ? 24.641  42.294  -67.917 1.00 76.18  ? 342 MET B SD  1 
ATOM   2175 C CE  . MET B 1 47  ? 24.715  40.935  -66.753 1.00 60.53  ? 342 MET B CE  1 
ATOM   2176 N N   . MET B 1 48  ? 23.907  43.190  -62.896 1.00 45.22  ? 343 MET B N   1 
ATOM   2177 C CA  . MET B 1 48  ? 23.254  42.297  -61.945 1.00 42.25  ? 343 MET B CA  1 
ATOM   2178 C C   . MET B 1 48  ? 22.174  43.025  -61.161 1.00 40.71  ? 343 MET B C   1 
ATOM   2179 O O   . MET B 1 48  ? 21.099  42.480  -60.914 1.00 43.43  ? 343 MET B O   1 
ATOM   2180 C CB  . MET B 1 48  ? 24.276  41.682  -60.983 1.00 50.92  ? 343 MET B CB  1 
ATOM   2181 C CG  . MET B 1 48  ? 25.110  40.558  -61.591 1.00 56.15  ? 343 MET B CG  1 
ATOM   2182 S SD  . MET B 1 48  ? 24.071  39.302  -62.369 1.00 80.58  ? 343 MET B SD  1 
ATOM   2183 C CE  . MET B 1 48  ? 22.846  39.040  -61.090 1.00 35.70  ? 343 MET B CE  1 
ATOM   2184 N N   . GLY B 1 49  ? 22.470  44.260  -60.766 1.00 40.25  ? 344 GLY B N   1 
ATOM   2185 C CA  . GLY B 1 49  ? 21.505  45.084  -60.060 1.00 41.73  ? 344 GLY B CA  1 
ATOM   2186 C C   . GLY B 1 49  ? 20.268  45.305  -60.905 1.00 37.58  ? 344 GLY B C   1 
ATOM   2187 O O   . GLY B 1 49  ? 19.143  45.281  -60.403 1.00 37.92  ? 344 GLY B O   1 
ATOM   2188 N N   . LEU B 1 50  ? 20.480  45.512  -62.201 1.00 35.72  ? 345 LEU B N   1 
ATOM   2189 C CA  . LEU B 1 50  ? 19.378  45.703  -63.131 1.00 36.88  ? 345 LEU B CA  1 
ATOM   2190 C C   . LEU B 1 50  ? 18.578  44.415  -63.326 1.00 33.34  ? 345 LEU B C   1 
ATOM   2191 O O   . LEU B 1 50  ? 17.350  44.430  -63.300 1.00 34.43  ? 345 LEU B O   1 
ATOM   2192 C CB  . LEU B 1 50  ? 19.888  46.226  -64.476 1.00 36.16  ? 345 LEU B CB  1 
ATOM   2193 C CG  . LEU B 1 50  ? 20.260  47.714  -64.516 1.00 46.64  ? 345 LEU B CG  1 
ATOM   2194 C CD1 . LEU B 1 50  ? 20.801  48.102  -65.881 1.00 40.67  ? 345 LEU B CD1 1 
ATOM   2195 C CD2 . LEU B 1 50  ? 19.057  48.575  -64.158 1.00 47.60  ? 345 LEU B CD2 1 
ATOM   2196 N N   . LEU B 1 51  ? 19.274  43.305  -63.524 1.00 30.63  ? 346 LEU B N   1 
ATOM   2197 C CA  . LEU B 1 51  ? 18.606  42.025  -63.756 1.00 36.59  ? 346 LEU B CA  1 
ATOM   2198 C C   . LEU B 1 51  ? 17.825  41.590  -62.524 1.00 32.91  ? 346 LEU B C   1 
ATOM   2199 O O   . LEU B 1 51  ? 16.691  41.138  -62.625 1.00 39.79  ? 346 LEU B O   1 
ATOM   2200 C CB  . LEU B 1 51  ? 19.630  40.952  -64.130 1.00 38.24  ? 346 LEU B CB  1 
ATOM   2201 C CG  . LEU B 1 51  ? 20.413  41.171  -65.419 1.00 37.30  ? 346 LEU B CG  1 
ATOM   2202 C CD1 . LEU B 1 51  ? 21.412  40.044  -65.607 1.00 41.78  ? 346 LEU B CD1 1 
ATOM   2203 C CD2 . LEU B 1 51  ? 19.473  41.254  -66.595 1.00 35.58  ? 346 LEU B CD2 1 
ATOM   2204 N N   . THR B 1 52  ? 18.450  41.732  -61.361 1.00 35.69  ? 347 THR B N   1 
ATOM   2205 C CA  . THR B 1 52  ? 17.837  41.369  -60.092 1.00 36.58  ? 347 THR B CA  1 
ATOM   2206 C C   . THR B 1 52  ? 16.596  42.200  -59.792 1.00 37.19  ? 347 THR B C   1 
ATOM   2207 O O   . THR B 1 52  ? 15.558  41.660  -59.400 1.00 32.64  ? 347 THR B O   1 
ATOM   2208 C CB  . THR B 1 52  ? 18.838  41.543  -58.939 1.00 44.55  ? 347 THR B CB  1 
ATOM   2209 O OG1 . THR B 1 52  ? 19.753  40.439  -58.938 1.00 55.23  ? 347 THR B OG1 1 
ATOM   2210 C CG2 . THR B 1 52  ? 18.115  41.597  -57.607 1.00 51.23  ? 347 THR B CG2 1 
ATOM   2211 N N   . ASN B 1 53  ? 16.709  43.515  -59.967 1.00 32.69  ? 348 ASN B N   1 
ATOM   2212 C CA  . ASN B 1 53  ? 15.568  44.403  -59.760 1.00 29.83  ? 348 ASN B CA  1 
ATOM   2213 C C   . ASN B 1 53  ? 14.421  44.012  -60.665 1.00 27.95  ? 348 ASN B C   1 
ATOM   2214 O O   . ASN B 1 53  ? 13.274  43.931  -60.232 1.00 33.86  ? 348 ASN B O   1 
ATOM   2215 C CB  . ASN B 1 53  ? 15.945  45.860  -60.020 1.00 31.33  ? 348 ASN B CB  1 
ATOM   2216 C CG  . ASN B 1 53  ? 14.740  46.775  -59.997 1.00 41.03  ? 348 ASN B CG  1 
ATOM   2217 O OD1 . ASN B 1 53  ? 14.172  47.097  -61.042 1.00 40.86  ? 348 ASN B OD1 1 
ATOM   2218 N ND2 . ASN B 1 53  ? 14.332  47.187  -58.801 1.00 39.59  ? 348 ASN B ND2 1 
ATOM   2219 N N   . LEU B 1 54  ? 14.744  43.768  -61.930 1.00 27.98  ? 349 LEU B N   1 
ATOM   2220 C CA  . LEU B 1 54  ? 13.750  43.361  -62.902 1.00 25.21  ? 349 LEU B CA  1 
ATOM   2221 C C   . LEU B 1 54  ? 13.068  42.060  -62.483 1.00 31.27  ? 349 LEU B C   1 
ATOM   2222 O O   . LEU B 1 54  ? 11.837  41.973  -62.453 1.00 33.48  ? 349 LEU B O   1 
ATOM   2223 C CB  . LEU B 1 54  ? 14.392  43.220  -64.277 1.00 23.93  ? 349 LEU B CB  1 
ATOM   2224 C CG  . LEU B 1 54  ? 13.480  42.733  -65.404 1.00 31.66  ? 349 LEU B CG  1 
ATOM   2225 C CD1 . LEU B 1 54  ? 12.295  43.679  -65.585 1.00 31.35  ? 349 LEU B CD1 1 
ATOM   2226 C CD2 . LEU B 1 54  ? 14.283  42.591  -66.700 1.00 28.79  ? 349 LEU B CD2 1 
ATOM   2227 N N   . ALA B 1 55  ? 13.868  41.056  -62.144 1.00 33.15  ? 350 ALA B N   1 
ATOM   2228 C CA  . ALA B 1 55  ? 13.328  39.767  -61.724 1.00 31.89  ? 350 ALA B CA  1 
ATOM   2229 C C   . ALA B 1 55  ? 12.436  39.914  -60.498 1.00 31.39  ? 350 ALA B C   1 
ATOM   2230 O O   . ALA B 1 55  ? 11.371  39.302  -60.422 1.00 35.89  ? 350 ALA B O   1 
ATOM   2231 C CB  . ALA B 1 55  ? 14.458  38.774  -61.451 1.00 31.60  ? 350 ALA B CB  1 
ATOM   2232 N N   . ASP B 1 56  ? 12.866  40.735  -59.543 1.00 33.11  ? 351 ASP B N   1 
ATOM   2233 C CA  . ASP B 1 56  ? 12.089  40.962  -58.327 1.00 44.78  ? 351 ASP B CA  1 
ATOM   2234 C C   . ASP B 1 56  ? 10.708  41.512  -58.659 1.00 41.36  ? 351 ASP B C   1 
ATOM   2235 O O   . ASP B 1 56  ? 9.703   41.114  -58.065 1.00 35.74  ? 351 ASP B O   1 
ATOM   2236 C CB  . ASP B 1 56  ? 12.819  41.925  -57.384 1.00 53.78  ? 351 ASP B CB  1 
ATOM   2237 C CG  . ASP B 1 56  ? 13.962  41.260  -56.641 1.00 72.48  ? 351 ASP B CG  1 
ATOM   2238 O OD1 . ASP B 1 56  ? 14.056  40.015  -56.684 1.00 79.08  ? 351 ASP B OD1 1 
ATOM   2239 O OD2 . ASP B 1 56  ? 14.765  41.980  -56.011 1.00 80.64  ? 351 ASP B OD2 1 
ATOM   2240 N N   . ARG B 1 57  ? 10.663  42.428  -59.616 1.00 34.11  ? 352 ARG B N   1 
ATOM   2241 C CA  . ARG B 1 57  ? 9.395   43.027  -60.007 1.00 31.75  ? 352 ARG B CA  1 
ATOM   2242 C C   . ARG B 1 57  ? 8.526   42.049  -60.792 1.00 30.73  ? 352 ARG B C   1 
ATOM   2243 O O   . ARG B 1 57  ? 7.304   42.094  -60.704 1.00 37.45  ? 352 ARG B O   1 
ATOM   2244 C CB  . ARG B 1 57  ? 9.631   44.323  -60.784 1.00 32.17  ? 352 ARG B CB  1 
ATOM   2245 C CG  . ARG B 1 57  ? 10.033  45.488  -59.889 1.00 32.01  ? 352 ARG B CG  1 
ATOM   2246 C CD  . ARG B 1 57  ? 10.165  46.790  -60.667 1.00 23.61  ? 352 ARG B CD  1 
ATOM   2247 N NE  . ARG B 1 57  ? 11.411  46.849  -61.430 1.00 35.42  ? 352 ARG B NE  1 
ATOM   2248 C CZ  . ARG B 1 57  ? 11.472  46.955  -62.756 1.00 36.59  ? 352 ARG B CZ  1 
ATOM   2249 N NH1 . ARG B 1 57  ? 10.355  47.000  -63.472 1.00 28.93  ? 352 ARG B NH1 1 
ATOM   2250 N NH2 . ARG B 1 57  ? 12.649  47.005  -63.369 1.00 33.56  ? 352 ARG B NH2 1 
ATOM   2251 N N   . GLU B 1 58  ? 9.152   41.144  -61.536 1.00 31.23  ? 353 GLU B N   1 
ATOM   2252 C CA  . GLU B 1 58  ? 8.384   40.155  -62.290 1.00 33.20  ? 353 GLU B CA  1 
ATOM   2253 C C   . GLU B 1 58  ? 7.806   39.076  -61.389 1.00 35.76  ? 353 GLU B C   1 
ATOM   2254 O O   . GLU B 1 58  ? 6.798   38.445  -61.726 1.00 32.00  ? 353 GLU B O   1 
ATOM   2255 C CB  . GLU B 1 58  ? 9.238   39.503  -63.372 1.00 32.83  ? 353 GLU B CB  1 
ATOM   2256 C CG  . GLU B 1 58  ? 9.678   40.456  -64.459 1.00 38.40  ? 353 GLU B CG  1 
ATOM   2257 C CD  . GLU B 1 58  ? 10.428  39.750  -65.563 1.00 40.86  ? 353 GLU B CD  1 
ATOM   2258 O OE1 . GLU B 1 58  ? 11.672  39.656  -65.465 1.00 36.81  ? 353 GLU B OE1 1 
ATOM   2259 O OE2 . GLU B 1 58  ? 9.775   39.286  -66.524 1.00 43.28  ? 353 GLU B OE2 1 
ATOM   2260 N N   . LEU B 1 59  ? 8.442   38.858  -60.244 1.00 35.82  ? 354 LEU B N   1 
ATOM   2261 C CA  . LEU B 1 59  ? 8.024   37.776  -59.368 1.00 35.44  ? 354 LEU B CA  1 
ATOM   2262 C C   . LEU B 1 59  ? 6.577   37.984  -58.936 1.00 34.23  ? 354 LEU B C   1 
ATOM   2263 O O   . LEU B 1 59  ? 5.767   37.053  -58.935 1.00 33.05  ? 354 LEU B O   1 
ATOM   2264 C CB  . LEU B 1 59  ? 8.945   37.680  -58.155 1.00 44.75  ? 354 LEU B CB  1 
ATOM   2265 C CG  . LEU B 1 59  ? 8.977   36.303  -57.487 1.00 53.43  ? 354 LEU B CG  1 
ATOM   2266 C CD1 . LEU B 1 59  ? 9.294   35.229  -58.515 1.00 52.59  ? 354 LEU B CD1 1 
ATOM   2267 C CD2 . LEU B 1 59  ? 9.990   36.280  -56.359 1.00 59.37  ? 354 LEU B CD2 1 
ATOM   2268 N N   . VAL B 1 60  ? 6.255   39.215  -58.569 1.00 29.76  ? 355 VAL B N   1 
ATOM   2269 C CA  . VAL B 1 60  ? 4.905   39.557  -58.157 1.00 30.54  ? 355 VAL B CA  1 
ATOM   2270 C C   . VAL B 1 60  ? 3.910   39.154  -59.233 1.00 29.62  ? 355 VAL B C   1 
ATOM   2271 O O   . VAL B 1 60  ? 2.914   38.487  -58.956 1.00 29.96  ? 355 VAL B O   1 
ATOM   2272 C CB  . VAL B 1 60  ? 4.788   41.070  -57.897 1.00 36.06  ? 355 VAL B CB  1 
ATOM   2273 C CG1 . VAL B 1 60  ? 3.473   41.384  -57.216 1.00 40.30  ? 355 VAL B CG1 1 
ATOM   2274 C CG2 . VAL B 1 60  ? 5.972   41.538  -57.048 1.00 41.13  ? 355 VAL B CG2 1 
ATOM   2275 N N   . HIS B 1 61  ? 4.196   39.539  -60.471 1.00 26.39  ? 356 HIS B N   1 
ATOM   2276 C CA  . HIS B 1 61  ? 3.326   39.191  -61.586 1.00 24.15  ? 356 HIS B CA  1 
ATOM   2277 C C   . HIS B 1 61  ? 3.301   37.699  -61.882 1.00 31.95  ? 356 HIS B C   1 
ATOM   2278 O O   . HIS B 1 61  ? 2.328   37.194  -62.451 1.00 34.02  ? 356 HIS B O   1 
ATOM   2279 C CB  . HIS B 1 61  ? 3.724   39.972  -62.829 1.00 29.37  ? 356 HIS B CB  1 
ATOM   2280 C CG  . HIS B 1 61  ? 3.617   41.462  -62.647 1.00 30.75  ? 356 HIS B CG  1 
ATOM   2281 N ND1 . HIS B 1 61  ? 2.428   42.129  -62.802 1.00 32.65  ? 356 HIS B ND1 1 
ATOM   2282 C CD2 . HIS B 1 61  ? 4.541   42.381  -62.305 1.00 31.73  ? 356 HIS B CD2 1 
ATOM   2283 C CE1 . HIS B 1 61  ? 2.630   43.432  -62.574 1.00 39.19  ? 356 HIS B CE1 1 
ATOM   2284 N NE2 . HIS B 1 61  ? 3.904   43.596  -62.267 1.00 39.17  ? 356 HIS B NE2 1 
ATOM   2285 N N   . MET B 1 62  ? 4.366   36.992  -61.506 1.00 32.04  ? 357 MET B N   1 
ATOM   2286 C CA  . MET B 1 62  ? 4.443   35.557  -61.768 1.00 25.24  ? 357 MET B CA  1 
ATOM   2287 C C   . MET B 1 62  ? 3.477   34.813  -60.851 1.00 28.44  ? 357 MET B C   1 
ATOM   2288 O O   . MET B 1 62  ? 2.854   33.827  -61.258 1.00 27.97  ? 357 MET B O   1 
ATOM   2289 C CB  . MET B 1 62  ? 5.877   35.039  -61.570 1.00 24.17  ? 357 MET B CB  1 
ATOM   2290 C CG  . MET B 1 62  ? 6.076   33.594  -62.027 1.00 31.26  ? 357 MET B CG  1 
ATOM   2291 S SD  . MET B 1 62  ? 7.656   32.882  -61.512 1.00 33.70  ? 357 MET B SD  1 
ATOM   2292 C CE  . MET B 1 62  ? 8.821   33.969  -62.324 1.00 34.09  ? 357 MET B CE  1 
ATOM   2293 N N   . ILE B 1 63  ? 3.362   35.287  -59.609 1.00 27.89  ? 358 ILE B N   1 
ATOM   2294 C CA  . ILE B 1 63  ? 2.399   34.738  -58.664 1.00 34.29  ? 358 ILE B CA  1 
ATOM   2295 C C   . ILE B 1 63  ? 0.994   34.869  -59.229 1.00 38.00  ? 358 ILE B C   1 
ATOM   2296 O O   . ILE B 1 63  ? 0.227   33.900  -59.245 1.00 35.69  ? 358 ILE B O   1 
ATOM   2297 C CB  . ILE B 1 63  ? 2.441   35.456  -57.304 1.00 40.54  ? 358 ILE B CB  1 
ATOM   2298 C CG1 . ILE B 1 63  ? 3.858   35.440  -56.726 1.00 45.24  ? 358 ILE B CG1 1 
ATOM   2299 C CG2 . ILE B 1 63  ? 1.463   34.822  -56.338 1.00 39.61  ? 358 ILE B CG2 1 
ATOM   2300 C CD1 . ILE B 1 63  ? 4.475   34.089  -56.655 1.00 38.76  ? 358 ILE B CD1 1 
ATOM   2301 N N   . ASN B 1 64  ? 0.661   36.071  -59.695 1.00 35.17  ? 359 ASN B N   1 
ATOM   2302 C CA  . ASN B 1 64  ? -0.647  36.329  -60.285 1.00 31.90  ? 359 ASN B CA  1 
ATOM   2303 C C   . ASN B 1 64  ? -0.903  35.353  -61.417 1.00 31.75  ? 359 ASN B C   1 
ATOM   2304 O O   . ASN B 1 64  ? -1.987  34.778  -61.523 1.00 35.80  ? 359 ASN B O   1 
ATOM   2305 C CB  . ASN B 1 64  ? -0.746  37.768  -60.810 1.00 33.41  ? 359 ASN B CB  1 
ATOM   2306 C CG  . ASN B 1 64  ? -0.820  38.795  -59.693 1.00 37.87  ? 359 ASN B CG  1 
ATOM   2307 O OD1 . ASN B 1 64  ? -1.107  38.457  -58.543 1.00 38.73  ? 359 ASN B OD1 1 
ATOM   2308 N ND2 . ASN B 1 64  ? -0.563  40.061  -60.028 1.00 32.67  ? 359 ASN B ND2 1 
ATOM   2309 N N   . TRP B 1 65  ? 0.107   35.171  -62.263 1.00 33.50  ? 360 TRP B N   1 
ATOM   2310 C CA  . TRP B 1 65  ? 0.003   34.245  -63.387 1.00 33.95  ? 360 TRP B CA  1 
ATOM   2311 C C   . TRP B 1 65  ? -0.217  32.825  -62.889 1.00 34.44  ? 360 TRP B C   1 
ATOM   2312 O O   . TRP B 1 65  ? -1.160  32.157  -63.303 1.00 32.36  ? 360 TRP B O   1 
ATOM   2313 C CB  . TRP B 1 65  ? 1.257   34.313  -64.260 1.00 30.84  ? 360 TRP B CB  1 
ATOM   2314 C CG  . TRP B 1 65  ? 1.424   33.121  -65.161 1.00 34.01  ? 360 TRP B CG  1 
ATOM   2315 C CD1 . TRP B 1 65  ? 0.748   32.862  -66.320 1.00 29.11  ? 360 TRP B CD1 1 
ATOM   2316 C CD2 . TRP B 1 65  ? 2.333   32.023  -64.977 1.00 32.72  ? 360 TRP B CD2 1 
ATOM   2317 N NE1 . TRP B 1 65  ? 1.177   31.675  -66.862 1.00 30.64  ? 360 TRP B NE1 1 
ATOM   2318 C CE2 . TRP B 1 65  ? 2.151   31.145  -66.055 1.00 26.99  ? 360 TRP B CE2 1 
ATOM   2319 C CE3 . TRP B 1 65  ? 3.283   31.708  -63.995 1.00 33.73  ? 360 TRP B CE3 1 
ATOM   2320 C CZ2 . TRP B 1 65  ? 2.871   29.960  -66.178 1.00 27.23  ? 360 TRP B CZ2 1 
ATOM   2321 C CZ3 . TRP B 1 65  ? 4.004   30.534  -64.126 1.00 29.55  ? 360 TRP B CZ3 1 
ATOM   2322 C CH2 . TRP B 1 65  ? 3.797   29.678  -65.210 1.00 30.31  ? 360 TRP B CH2 1 
ATOM   2323 N N   . ALA B 1 66  ? 0.664   32.379  -61.998 1.00 31.48  ? 361 ALA B N   1 
ATOM   2324 C CA  . ALA B 1 66  ? 0.605   31.034  -61.444 1.00 32.78  ? 361 ALA B CA  1 
ATOM   2325 C C   . ALA B 1 66  ? -0.789  30.663  -60.937 1.00 36.96  ? 361 ALA B C   1 
ATOM   2326 O O   . ALA B 1 66  ? -1.304  29.586  -61.247 1.00 40.28  ? 361 ALA B O   1 
ATOM   2327 C CB  . ALA B 1 66  ? 1.632   30.881  -60.327 1.00 30.21  ? 361 ALA B CB  1 
ATOM   2328 N N   . LYS B 1 67  ? -1.387  31.552  -60.153 1.00 34.70  ? 362 LYS B N   1 
ATOM   2329 C CA  . LYS B 1 67  ? -2.716  31.332  -59.585 1.00 30.80  ? 362 LYS B CA  1 
ATOM   2330 C C   . LYS B 1 67  ? -3.792  31.115  -60.645 1.00 33.45  ? 362 LYS B C   1 
ATOM   2331 O O   . LYS B 1 67  ? -4.844  30.543  -60.359 1.00 38.06  ? 362 LYS B O   1 
ATOM   2332 C CB  . LYS B 1 67  ? -3.113  32.517  -58.703 1.00 36.31  ? 362 LYS B CB  1 
ATOM   2333 C CG  . LYS B 1 67  ? -2.295  32.669  -57.437 1.00 40.27  ? 362 LYS B CG  1 
ATOM   2334 C CD  . LYS B 1 67  ? -2.454  34.073  -56.882 1.00 57.23  ? 362 LYS B CD  1 
ATOM   2335 C CE  . LYS B 1 67  ? -2.395  34.078  -55.367 1.00 69.95  ? 362 LYS B CE  1 
ATOM   2336 N NZ  . LYS B 1 67  ? -3.482  33.246  -54.775 1.00 74.07  ? 362 LYS B NZ  1 
ATOM   2337 N N   . ARG B 1 68  ? -3.527  31.579  -61.864 1.00 29.94  ? 363 ARG B N   1 
ATOM   2338 C CA  . ARG B 1 68  ? -4.473  31.416  -62.968 1.00 33.22  ? 363 ARG B CA  1 
ATOM   2339 C C   . ARG B 1 68  ? -4.172  30.206  -63.855 1.00 38.52  ? 363 ARG B C   1 
ATOM   2340 O O   . ARG B 1 68  ? -4.938  29.903  -64.775 1.00 41.55  ? 363 ARG B O   1 
ATOM   2341 C CB  . ARG B 1 68  ? -4.541  32.693  -63.806 1.00 36.52  ? 363 ARG B CB  1 
ATOM   2342 C CG  . ARG B 1 68  ? -5.065  33.890  -63.021 1.00 44.12  ? 363 ARG B CG  1 
ATOM   2343 C CD  . ARG B 1 68  ? -5.212  35.109  -63.901 1.00 53.72  ? 363 ARG B CD  1 
ATOM   2344 N NE  . ARG B 1 68  ? -6.057  34.832  -65.059 1.00 63.01  ? 363 ARG B NE  1 
ATOM   2345 C CZ  . ARG B 1 68  ? -6.448  35.749  -65.936 1.00 67.66  ? 363 ARG B CZ  1 
ATOM   2346 N NH1 . ARG B 1 68  ? -6.073  37.014  -65.788 1.00 69.58  ? 363 ARG B NH1 1 
ATOM   2347 N NH2 . ARG B 1 68  ? -7.216  35.402  -66.960 1.00 67.14  ? 363 ARG B NH2 1 
ATOM   2348 N N   . VAL B 1 69  ? -3.063  29.519  -63.586 1.00 31.39  ? 364 VAL B N   1 
ATOM   2349 C CA  . VAL B 1 69  ? -2.760  28.281  -64.294 1.00 26.90  ? 364 VAL B CA  1 
ATOM   2350 C C   . VAL B 1 69  ? -3.732  27.223  -63.789 1.00 33.89  ? 364 VAL B C   1 
ATOM   2351 O O   . VAL B 1 69  ? -3.744  26.904  -62.602 1.00 35.48  ? 364 VAL B O   1 
ATOM   2352 C CB  . VAL B 1 69  ? -1.302  27.805  -64.042 1.00 32.70  ? 364 VAL B CB  1 
ATOM   2353 C CG1 . VAL B 1 69  ? -1.046  26.462  -64.719 1.00 27.84  ? 364 VAL B CG1 1 
ATOM   2354 C CG2 . VAL B 1 69  ? -0.311  28.834  -64.533 1.00 26.05  ? 364 VAL B CG2 1 
ATOM   2355 N N   . PRO B 1 70  ? -4.579  26.695  -64.681 1.00 37.57  ? 365 PRO B N   1 
ATOM   2356 C CA  . PRO B 1 70  ? -5.587  25.726  -64.244 1.00 38.35  ? 365 PRO B CA  1 
ATOM   2357 C C   . PRO B 1 70  ? -4.982  24.622  -63.380 1.00 36.95  ? 365 PRO B C   1 
ATOM   2358 O O   . PRO B 1 70  ? -4.036  23.957  -63.795 1.00 37.58  ? 365 PRO B O   1 
ATOM   2359 C CB  . PRO B 1 70  ? -6.105  25.158  -65.565 1.00 39.99  ? 365 PRO B CB  1 
ATOM   2360 C CG  . PRO B 1 70  ? -5.954  26.293  -66.529 1.00 39.09  ? 365 PRO B CG  1 
ATOM   2361 C CD  . PRO B 1 70  ? -4.658  26.967  -66.127 1.00 38.42  ? 365 PRO B CD  1 
ATOM   2362 N N   . GLY B 1 71  ? -5.517  24.444  -62.178 1.00 33.89  ? 366 GLY B N   1 
ATOM   2363 C CA  . GLY B 1 71  ? -5.063  23.376  -61.307 1.00 37.74  ? 366 GLY B CA  1 
ATOM   2364 C C   . GLY B 1 71  ? -4.081  23.808  -60.233 1.00 40.25  ? 366 GLY B C   1 
ATOM   2365 O O   . GLY B 1 71  ? -3.910  23.119  -59.230 1.00 43.76  ? 366 GLY B O   1 
ATOM   2366 N N   . PHE B 1 72  ? -3.441  24.955  -60.423 1.00 37.51  ? 367 PHE B N   1 
ATOM   2367 C CA  . PHE B 1 72  ? -2.430  25.401  -59.469 1.00 38.91  ? 367 PHE B CA  1 
ATOM   2368 C C   . PHE B 1 72  ? -2.998  25.671  -58.078 1.00 40.50  ? 367 PHE B C   1 
ATOM   2369 O O   . PHE B 1 72  ? -2.407  25.264  -57.079 1.00 36.19  ? 367 PHE B O   1 
ATOM   2370 C CB  . PHE B 1 72  ? -1.703  26.645  -59.979 1.00 35.11  ? 367 PHE B CB  1 
ATOM   2371 C CG  . PHE B 1 72  ? -0.489  27.005  -59.176 1.00 32.41  ? 367 PHE B CG  1 
ATOM   2372 C CD1 . PHE B 1 72  ? 0.662   26.238  -59.258 1.00 31.47  ? 367 PHE B CD1 1 
ATOM   2373 C CD2 . PHE B 1 72  ? -0.496  28.102  -58.337 1.00 31.52  ? 367 PHE B CD2 1 
ATOM   2374 C CE1 . PHE B 1 72  ? 1.787   26.567  -58.526 1.00 29.37  ? 367 PHE B CE1 1 
ATOM   2375 C CE2 . PHE B 1 72  ? 0.629   28.433  -57.597 1.00 32.71  ? 367 PHE B CE2 1 
ATOM   2376 C CZ  . PHE B 1 72  ? 1.767   27.664  -57.694 1.00 33.42  ? 367 PHE B CZ  1 
ATOM   2377 N N   . VAL B 1 73  ? -4.140  26.355  -58.009 1.00 38.72  ? 368 VAL B N   1 
ATOM   2378 C CA  . VAL B 1 73  ? -4.730  26.699  -56.716 1.00 44.93  ? 368 VAL B CA  1 
ATOM   2379 C C   . VAL B 1 73  ? -5.417  25.515  -56.033 1.00 45.10  ? 368 VAL B C   1 
ATOM   2380 O O   . VAL B 1 73  ? -5.809  25.608  -54.870 1.00 46.40  ? 368 VAL B O   1 
ATOM   2381 C CB  . VAL B 1 73  ? -5.727  27.877  -56.824 1.00 49.66  ? 368 VAL B CB  1 
ATOM   2382 C CG1 . VAL B 1 73  ? -5.012  29.135  -57.300 1.00 50.24  ? 368 VAL B CG1 1 
ATOM   2383 C CG2 . VAL B 1 73  ? -6.884  27.517  -57.744 1.00 41.21  ? 368 VAL B CG2 1 
ATOM   2384 N N   . ASP B 1 74  ? -5.567  24.408  -56.750 1.00 40.91  ? 369 ASP B N   1 
ATOM   2385 C CA  . ASP B 1 74  ? -6.125  23.197  -56.150 1.00 44.76  ? 369 ASP B CA  1 
ATOM   2386 C C   . ASP B 1 74  ? -5.140  22.601  -55.149 1.00 44.38  ? 369 ASP B C   1 
ATOM   2387 O O   . ASP B 1 74  ? -5.510  21.785  -54.308 1.00 42.45  ? 369 ASP B O   1 
ATOM   2388 C CB  . ASP B 1 74  ? -6.467  22.164  -57.226 1.00 45.66  ? 369 ASP B CB  1 
ATOM   2389 C CG  . ASP B 1 74  ? -7.581  22.625  -58.145 1.00 48.28  ? 369 ASP B CG  1 
ATOM   2390 O OD1 . ASP B 1 74  ? -8.423  23.432  -57.697 1.00 53.74  ? 369 ASP B OD1 1 
ATOM   2391 O OD2 . ASP B 1 74  ? -7.617  22.176  -59.311 1.00 50.41  ? 369 ASP B OD2 1 
ATOM   2392 N N   . LEU B 1 75  ? -3.883  23.024  -55.244 1.00 44.63  ? 370 LEU B N   1 
ATOM   2393 C CA  . LEU B 1 75  ? -2.827  22.506  -54.385 1.00 33.13  ? 370 LEU B CA  1 
ATOM   2394 C C   . LEU B 1 75  ? -2.789  23.248  -53.055 1.00 38.62  ? 370 LEU B C   1 
ATOM   2395 O O   . LEU B 1 75  ? -3.334  24.343  -52.930 1.00 41.07  ? 370 LEU B O   1 
ATOM   2396 C CB  . LEU B 1 75  ? -1.472  22.631  -55.079 1.00 35.96  ? 370 LEU B CB  1 
ATOM   2397 C CG  . LEU B 1 75  ? -1.311  21.943  -56.435 1.00 39.39  ? 370 LEU B CG  1 
ATOM   2398 C CD1 . LEU B 1 75  ? -0.071  22.454  -57.167 1.00 39.08  ? 370 LEU B CD1 1 
ATOM   2399 C CD2 . LEU B 1 75  ? -1.267  20.424  -56.277 1.00 37.97  ? 370 LEU B CD2 1 
ATOM   2400 N N   . THR B 1 76  ? -2.144  22.652  -52.057 1.00 31.51  ? 371 THR B N   1 
ATOM   2401 C CA  . THR B 1 76  ? -1.962  23.347  -50.789 1.00 38.43  ? 371 THR B CA  1 
ATOM   2402 C C   . THR B 1 76  ? -1.007  24.524  -51.002 1.00 40.15  ? 371 THR B C   1 
ATOM   2403 O O   . THR B 1 76  ? -0.241  24.547  -51.969 1.00 38.24  ? 371 THR B O   1 
ATOM   2404 C CB  . THR B 1 76  ? -1.403  22.422  -49.700 1.00 39.76  ? 371 THR B CB  1 
ATOM   2405 O OG1 . THR B 1 76  ? -0.062  22.042  -50.033 1.00 44.82  ? 371 THR B OG1 1 
ATOM   2406 C CG2 . THR B 1 76  ? -2.266  21.176  -49.560 1.00 38.94  ? 371 THR B CG2 1 
ATOM   2407 N N   . ARG B 1 77  ? -1.065  25.503  -50.107 1.00 41.10  ? 372 ARG B N   1 
ATOM   2408 C CA  . ARG B 1 77  ? -0.187  26.663  -50.189 1.00 42.28  ? 372 ARG B CA  1 
ATOM   2409 C C   . ARG B 1 77  ? 1.272   26.206  -50.181 1.00 40.34  ? 372 ARG B C   1 
ATOM   2410 O O   . ARG B 1 77  ? 2.095   26.724  -50.933 1.00 40.15  ? 372 ARG B O   1 
ATOM   2411 N N   . HIS B 1 78  ? 1.582   25.230  -49.333 1.00 36.75  ? 373 HIS B N   1 
ATOM   2412 C CA  . HIS B 1 78  ? 2.943   24.726  -49.215 1.00 41.06  ? 373 HIS B CA  1 
ATOM   2413 C C   . HIS B 1 78  ? 3.445   24.224  -50.559 1.00 36.34  ? 373 HIS B C   1 
ATOM   2414 O O   . HIS B 1 78  ? 4.544   24.558  -50.977 1.00 34.38  ? 373 HIS B O   1 
ATOM   2415 C CB  . HIS B 1 78  ? 3.028   23.603  -48.177 1.00 38.08  ? 373 HIS B CB  1 
ATOM   2416 C CG  . HIS B 1 78  ? 4.398   23.024  -48.029 0.86 36.47  ? 373 HIS B CG  1 
ATOM   2417 N ND1 . HIS B 1 78  ? 4.713   21.732  -48.402 0.51 37.30  ? 373 HIS B ND1 1 
ATOM   2418 C CD2 . HIS B 1 78  ? 5.552   23.562  -47.556 1.00 35.13  ? 373 HIS B CD2 1 
ATOM   2419 C CE1 . HIS B 1 78  ? 5.989   21.501  -48.156 0.95 34.44  ? 373 HIS B CE1 1 
ATOM   2420 N NE2 . HIS B 1 78  ? 6.521   22.595  -47.648 0.55 35.49  ? 373 HIS B NE2 1 
ATOM   2421 N N   . ASP B 1 79  ? 2.633   23.421  -51.233 1.00 32.95  ? 374 ASP B N   1 
ATOM   2422 C CA  . ASP B 1 79  ? 3.015   22.870  -52.524 1.00 33.77  ? 374 ASP B CA  1 
ATOM   2423 C C   . ASP B 1 79  ? 3.073   23.962  -53.586 1.00 34.40  ? 374 ASP B C   1 
ATOM   2424 O O   . ASP B 1 79  ? 3.928   23.933  -54.467 1.00 32.72  ? 374 ASP B O   1 
ATOM   2425 C CB  . ASP B 1 79  ? 2.061   21.745  -52.936 1.00 38.30  ? 374 ASP B CB  1 
ATOM   2426 C CG  . ASP B 1 79  ? 2.263   20.484  -52.112 1.00 46.61  ? 374 ASP B CG  1 
ATOM   2427 O OD1 . ASP B 1 79  ? 3.371   20.308  -51.559 1.00 46.22  ? 374 ASP B OD1 1 
ATOM   2428 O OD2 . ASP B 1 79  ? 1.322   19.666  -52.021 1.00 44.56  ? 374 ASP B OD2 1 
ATOM   2429 N N   . GLN B 1 80  ? 2.178   24.939  -53.493 1.00 34.88  ? 375 GLN B N   1 
ATOM   2430 C CA  . GLN B 1 80  ? 2.218   26.065  -54.421 1.00 31.83  ? 375 GLN B CA  1 
ATOM   2431 C C   . GLN B 1 80  ? 3.546   26.803  -54.288 1.00 31.38  ? 375 GLN B C   1 
ATOM   2432 O O   . GLN B 1 80  ? 4.156   27.190  -55.287 1.00 28.07  ? 375 GLN B O   1 
ATOM   2433 C CB  . GLN B 1 80  ? 1.036   27.008  -54.197 1.00 24.17  ? 375 GLN B CB  1 
ATOM   2434 C CG  . GLN B 1 80  ? -0.319  26.365  -54.509 1.00 31.23  ? 375 GLN B CG  1 
ATOM   2435 C CD  . GLN B 1 80  ? -1.476  27.316  -54.315 1.00 39.45  ? 375 GLN B CD  1 
ATOM   2436 O OE1 . GLN B 1 80  ? -1.326  28.527  -54.463 1.00 40.16  ? 375 GLN B OE1 1 
ATOM   2437 N NE2 . GLN B 1 80  ? -2.642  26.772  -53.978 1.00 38.90  ? 375 GLN B NE2 1 
ATOM   2438 N N   . VAL B 1 81  ? 4.000   26.982  -53.052 1.00 30.62  ? 376 VAL B N   1 
ATOM   2439 C CA  . VAL B 1 81  ? 5.265   27.659  -52.806 1.00 30.42  ? 376 VAL B CA  1 
ATOM   2440 C C   . VAL B 1 81  ? 6.440   26.831  -53.315 1.00 28.64  ? 376 VAL B C   1 
ATOM   2441 O O   . VAL B 1 81  ? 7.344   27.352  -53.967 1.00 32.87  ? 376 VAL B O   1 
ATOM   2442 C CB  . VAL B 1 81  ? 5.474   27.968  -51.309 1.00 35.56  ? 376 VAL B CB  1 
ATOM   2443 C CG1 . VAL B 1 81  ? 6.866   28.542  -51.083 1.00 33.56  ? 376 VAL B CG1 1 
ATOM   2444 C CG2 . VAL B 1 81  ? 4.419   28.939  -50.810 1.00 33.99  ? 376 VAL B CG2 1 
ATOM   2445 N N   . HIS B 1 82  ? 6.412   25.537  -53.027 1.00 38.54  ? 377 HIS B N   1 
ATOM   2446 C CA  . HIS B 1 82  ? 7.482   24.636  -53.438 1.00 34.62  ? 377 HIS B CA  1 
ATOM   2447 C C   . HIS B 1 82  ? 7.670   24.643  -54.957 1.00 33.56  ? 377 HIS B C   1 
ATOM   2448 O O   . HIS B 1 82  ? 8.797   24.651  -55.441 1.00 33.61  ? 377 HIS B O   1 
ATOM   2449 C CB  . HIS B 1 82  ? 7.209   23.221  -52.922 1.00 31.54  ? 377 HIS B CB  1 
ATOM   2450 C CG  . HIS B 1 82  ? 8.236   22.215  -53.341 0.50 30.56  ? 377 HIS B CG  1 
ATOM   2451 N ND1 . HIS B 1 82  ? 9.523   22.221  -52.852 0.40 30.61  ? 377 HIS B ND1 1 
ATOM   2452 C CD2 . HIS B 1 82  ? 8.162   21.169  -54.196 0.67 32.52  ? 377 HIS B CD2 1 
ATOM   2453 C CE1 . HIS B 1 82  ? 10.202  21.224  -53.393 0.37 31.36  ? 377 HIS B CE1 1 
ATOM   2454 N NE2 . HIS B 1 82  ? 9.399   20.571  -54.214 0.62 32.69  ? 377 HIS B NE2 1 
ATOM   2455 N N   . LEU B 1 83  ? 6.571   24.652  -55.709 1.00 30.50  ? 378 LEU B N   1 
ATOM   2456 C CA  . LEU B 1 83  ? 6.669   24.702  -57.164 1.00 27.92  ? 378 LEU B CA  1 
ATOM   2457 C C   . LEU B 1 83  ? 7.284   26.019  -57.638 1.00 30.54  ? 378 LEU B C   1 
ATOM   2458 O O   . LEU B 1 83  ? 8.105   26.040  -58.553 1.00 25.57  ? 378 LEU B O   1 
ATOM   2459 C CB  . LEU B 1 83  ? 5.306   24.495  -57.816 1.00 33.47  ? 378 LEU B CB  1 
ATOM   2460 C CG  . LEU B 1 83  ? 4.624   23.129  -57.617 1.00 34.50  ? 378 LEU B CG  1 
ATOM   2461 C CD1 . LEU B 1 83  ? 3.256   23.114  -58.298 1.00 28.68  ? 378 LEU B CD1 1 
ATOM   2462 C CD2 . LEU B 1 83  ? 5.497   22.000  -58.128 1.00 32.30  ? 378 LEU B CD2 1 
ATOM   2463 N N   . LEU B 1 84  ? 6.892   27.122  -57.015 1.00 28.87  ? 379 LEU B N   1 
ATOM   2464 C CA  . LEU B 1 84  ? 7.419   28.421  -57.411 1.00 31.93  ? 379 LEU B CA  1 
ATOM   2465 C C   . LEU B 1 84  ? 8.893   28.564  -57.040 1.00 30.96  ? 379 LEU B C   1 
ATOM   2466 O O   . LEU B 1 84  ? 9.690   29.081  -57.830 1.00 33.02  ? 379 LEU B O   1 
ATOM   2467 C CB  . LEU B 1 84  ? 6.593   29.549  -56.792 1.00 35.88  ? 379 LEU B CB  1 
ATOM   2468 C CG  . LEU B 1 84  ? 5.222   29.783  -57.433 1.00 31.16  ? 379 LEU B CG  1 
ATOM   2469 C CD1 . LEU B 1 84  ? 4.357   30.614  -56.509 1.00 35.82  ? 379 LEU B CD1 1 
ATOM   2470 C CD2 . LEU B 1 84  ? 5.374   30.466  -58.798 1.00 25.31  ? 379 LEU B CD2 1 
ATOM   2471 N N   . GLU B 1 85  ? 9.241   28.115  -55.835 1.00 28.09  ? 380 GLU B N   1 
ATOM   2472 C CA  . GLU B 1 85  ? 10.634  28.054  -55.391 1.00 34.26  ? 380 GLU B CA  1 
ATOM   2473 C C   . GLU B 1 85  ? 11.515  27.417  -56.456 1.00 30.37  ? 380 GLU B C   1 
ATOM   2474 O O   . GLU B 1 85  ? 12.529  27.980  -56.867 1.00 32.31  ? 380 GLU B O   1 
ATOM   2475 C CB  . GLU B 1 85  ? 10.751  27.208  -54.123 1.00 38.74  ? 380 GLU B CB  1 
ATOM   2476 C CG  . GLU B 1 85  ? 10.868  27.985  -52.839 1.00 50.85  ? 380 GLU B CG  1 
ATOM   2477 C CD  . GLU B 1 85  ? 11.406  27.132  -51.701 1.00 54.97  ? 380 GLU B CD  1 
ATOM   2478 O OE1 . GLU B 1 85  ? 10.884  26.020  -51.484 1.00 59.22  ? 380 GLU B OE1 1 
ATOM   2479 O OE2 . GLU B 1 85  ? 12.353  27.573  -51.022 1.00 59.80  ? 380 GLU B OE2 1 
ATOM   2480 N N   . CYS B 1 86  ? 11.121  26.224  -56.889 1.00 29.48  ? 381 CYS B N   1 
ATOM   2481 C CA  . CYS B 1 86  ? 11.936  25.427  -57.801 1.00 28.98  ? 381 CYS B CA  1 
ATOM   2482 C C   . CYS B 1 86  ? 11.965  25.987  -59.217 1.00 28.71  ? 381 CYS B C   1 
ATOM   2483 O O   . CYS B 1 86  ? 12.913  25.748  -59.953 1.00 34.62  ? 381 CYS B O   1 
ATOM   2484 C CB  . CYS B 1 86  ? 11.430  23.977  -57.841 1.00 30.72  ? 381 CYS B CB  1 
ATOM   2485 S SG  . CYS B 1 86  ? 11.430  23.133  -56.240 0.61 35.99  ? 381 CYS B SG  1 
ATOM   2486 N N   . ALA B 1 87  ? 10.928  26.731  -59.594 1.00 30.68  ? 382 ALA B N   1 
ATOM   2487 C CA  . ALA B 1 87  ? 10.694  27.050  -61.006 1.00 28.48  ? 382 ALA B CA  1 
ATOM   2488 C C   . ALA B 1 87  ? 10.847  28.519  -61.410 1.00 27.29  ? 382 ALA B C   1 
ATOM   2489 O O   . ALA B 1 87  ? 10.918  28.822  -62.600 1.00 24.88  ? 382 ALA B O   1 
ATOM   2490 C CB  . ALA B 1 87  ? 9.313   26.545  -61.424 1.00 23.63  ? 382 ALA B CB  1 
ATOM   2491 N N   . TRP B 1 88  ? 10.888  29.435  -60.446 1.00 24.00  ? 383 TRP B N   1 
ATOM   2492 C CA  . TRP B 1 88  ? 10.844  30.855  -60.804 1.00 28.45  ? 383 TRP B CA  1 
ATOM   2493 C C   . TRP B 1 88  ? 11.855  31.264  -61.878 1.00 30.80  ? 383 TRP B C   1 
ATOM   2494 O O   . TRP B 1 88  ? 11.489  31.938  -62.837 1.00 29.70  ? 383 TRP B O   1 
ATOM   2495 C CB  . TRP B 1 88  ? 10.925  31.770  -59.574 1.00 30.96  ? 383 TRP B CB  1 
ATOM   2496 C CG  . TRP B 1 88  ? 12.261  31.808  -58.903 1.00 35.50  ? 383 TRP B CG  1 
ATOM   2497 C CD1 . TRP B 1 88  ? 12.698  30.995  -57.895 1.00 38.68  ? 383 TRP B CD1 1 
ATOM   2498 C CD2 . TRP B 1 88  ? 13.330  32.719  -59.176 1.00 42.69  ? 383 TRP B CD2 1 
ATOM   2499 N NE1 . TRP B 1 88  ? 13.978  31.338  -57.534 1.00 45.49  ? 383 TRP B NE1 1 
ATOM   2500 C CE2 . TRP B 1 88  ? 14.389  32.398  -58.304 1.00 43.53  ? 383 TRP B CE2 1 
ATOM   2501 C CE3 . TRP B 1 88  ? 13.500  33.774  -60.082 1.00 44.90  ? 383 TRP B CE3 1 
ATOM   2502 C CZ2 . TRP B 1 88  ? 15.600  33.087  -58.308 1.00 43.24  ? 383 TRP B CZ2 1 
ATOM   2503 C CZ3 . TRP B 1 88  ? 14.704  34.467  -60.081 1.00 42.93  ? 383 TRP B CZ3 1 
ATOM   2504 C CH2 . TRP B 1 88  ? 15.738  34.117  -59.200 1.00 41.95  ? 383 TRP B CH2 1 
ATOM   2505 N N   . LEU B 1 89  ? 13.109  30.839  -61.749 1.00 28.16  ? 384 LEU B N   1 
ATOM   2506 C CA  . LEU B 1 89  ? 14.132  31.262  -62.712 1.00 24.51  ? 384 LEU B CA  1 
ATOM   2507 C C   . LEU B 1 89  ? 13.922  30.627  -64.089 1.00 29.23  ? 384 LEU B C   1 
ATOM   2508 O O   . LEU B 1 89  ? 14.057  31.299  -65.110 1.00 27.10  ? 384 LEU B O   1 
ATOM   2509 C CB  . LEU B 1 89  ? 15.548  30.978  -62.187 1.00 26.38  ? 384 LEU B CB  1 
ATOM   2510 C CG  . LEU B 1 89  ? 16.672  31.579  -63.032 1.00 30.10  ? 384 LEU B CG  1 
ATOM   2511 C CD1 . LEU B 1 89  ? 16.422  33.068  -63.254 1.00 31.27  ? 384 LEU B CD1 1 
ATOM   2512 C CD2 . LEU B 1 89  ? 18.048  31.348  -62.403 1.00 26.99  ? 384 LEU B CD2 1 
ATOM   2513 N N   . GLU B 1 90  ? 13.610  29.331  -64.114 1.00 26.57  ? 385 GLU B N   1 
ATOM   2514 C CA  . GLU B 1 90  ? 13.239  28.671  -65.360 1.00 26.01  ? 385 GLU B CA  1 
ATOM   2515 C C   . GLU B 1 90  ? 12.117  29.431  -66.054 1.00 26.61  ? 385 GLU B C   1 
ATOM   2516 O O   . GLU B 1 90  ? 12.148  29.660  -67.265 1.00 26.87  ? 385 GLU B O   1 
ATOM   2517 C CB  . GLU B 1 90  ? 12.756  27.247  -65.094 1.00 27.34  ? 385 GLU B CB  1 
ATOM   2518 C CG  . GLU B 1 90  ? 13.839  26.221  -64.884 1.00 33.99  ? 385 GLU B CG  1 
ATOM   2519 C CD  . GLU B 1 90  ? 13.254  24.837  -64.656 1.00 37.20  ? 385 GLU B CD  1 
ATOM   2520 O OE1 . GLU B 1 90  ? 13.127  24.071  -65.637 1.00 34.35  ? 385 GLU B OE1 1 
ATOM   2521 O OE2 . GLU B 1 90  ? 12.904  24.521  -63.501 1.00 35.82  ? 385 GLU B OE2 1 
ATOM   2522 N N   . ILE B 1 91  ? 11.111  29.810  -65.275 1.00 25.72  ? 386 ILE B N   1 
ATOM   2523 C CA  . ILE B 1 91  ? 9.971   30.556  -65.807 1.00 29.19  ? 386 ILE B CA  1 
ATOM   2524 C C   . ILE B 1 91  ? 10.411  31.900  -66.387 1.00 31.30  ? 386 ILE B C   1 
ATOM   2525 O O   . ILE B 1 91  ? 10.018  32.263  -67.501 1.00 30.57  ? 386 ILE B O   1 
ATOM   2526 C CB  . ILE B 1 91  ? 8.882   30.742  -64.746 1.00 25.34  ? 386 ILE B CB  1 
ATOM   2527 C CG1 . ILE B 1 91  ? 8.260   29.385  -64.417 1.00 30.38  ? 386 ILE B CG1 1 
ATOM   2528 C CG2 . ILE B 1 91  ? 7.802   31.699  -65.244 1.00 22.66  ? 386 ILE B CG2 1 
ATOM   2529 C CD1 . ILE B 1 91  ? 7.376   29.408  -63.197 1.00 35.89  ? 386 ILE B CD1 1 
ATOM   2530 N N   . LEU B 1 92  ? 11.249  32.630  -65.654 1.00 25.11  ? 387 LEU B N   1 
ATOM   2531 C CA  . LEU B 1 92  ? 11.755  33.904  -66.169 1.00 25.97  ? 387 LEU B CA  1 
ATOM   2532 C C   . LEU B 1 92  ? 12.568  33.673  -67.444 1.00 30.88  ? 387 LEU B C   1 
ATOM   2533 O O   . LEU B 1 92  ? 12.448  34.425  -68.414 1.00 23.29  ? 387 LEU B O   1 
ATOM   2534 C CB  . LEU B 1 92  ? 12.606  34.645  -65.126 1.00 26.82  ? 387 LEU B CB  1 
ATOM   2535 C CG  . LEU B 1 92  ? 11.917  35.282  -63.905 1.00 32.17  ? 387 LEU B CG  1 
ATOM   2536 C CD1 . LEU B 1 92  ? 12.951  35.890  -62.965 1.00 28.42  ? 387 LEU B CD1 1 
ATOM   2537 C CD2 . LEU B 1 92  ? 10.889  36.339  -64.309 1.00 21.55  ? 387 LEU B CD2 1 
ATOM   2538 N N   . MET B 1 93  ? 13.378  32.615  -67.448 1.00 24.68  ? 388 MET B N   1 
ATOM   2539 C CA  . MET B 1 93  ? 14.258  32.335  -68.581 1.00 19.52  ? 388 MET B CA  1 
ATOM   2540 C C   . MET B 1 93  ? 13.518  31.971  -69.862 1.00 26.97  ? 388 MET B C   1 
ATOM   2541 O O   . MET B 1 93  ? 13.890  32.433  -70.943 1.00 28.48  ? 388 MET B O   1 
ATOM   2542 C CB  . MET B 1 93  ? 15.276  31.254  -68.232 1.00 19.49  ? 388 MET B CB  1 
ATOM   2543 C CG  . MET B 1 93  ? 16.403  31.743  -67.332 1.00 23.60  ? 388 MET B CG  1 
ATOM   2544 S SD  . MET B 1 93  ? 17.498  30.407  -66.802 1.00 28.35  ? 388 MET B SD  1 
ATOM   2545 C CE  . MET B 1 93  ? 18.876  31.356  -66.151 1.00 27.88  ? 388 MET B CE  1 
ATOM   2546 N N   . ILE B 1 94  ? 12.480  31.139  -69.762 1.00 26.04  ? 389 ILE B N   1 
ATOM   2547 C CA  . ILE B 1 94  ? 11.732  30.783  -70.963 1.00 25.69  ? 389 ILE B CA  1 
ATOM   2548 C C   . ILE B 1 94  ? 11.020  32.023  -71.500 1.00 25.66  ? 389 ILE B C   1 
ATOM   2549 O O   . ILE B 1 94  ? 10.949  32.240  -72.712 1.00 29.73  ? 389 ILE B O   1 
ATOM   2550 C CB  . ILE B 1 94  ? 10.737  29.600  -70.751 1.00 33.05  ? 389 ILE B CB  1 
ATOM   2551 C CG1 . ILE B 1 94  ? 10.274  29.056  -72.111 1.00 28.47  ? 389 ILE B CG1 1 
ATOM   2552 C CG2 . ILE B 1 94  ? 9.567   30.022  -69.857 1.00 26.72  ? 389 ILE B CG2 1 
ATOM   2553 C CD1 . ILE B 1 94  ? 9.316   27.824  -72.038 1.00 22.29  ? 389 ILE B CD1 1 
ATOM   2554 N N   . GLY B 1 95  ? 10.526  32.855  -70.589 1.00 25.36  ? 390 GLY B N   1 
ATOM   2555 C CA  . GLY B 1 95  ? 9.978   34.148  -70.968 1.00 31.26  ? 390 GLY B CA  1 
ATOM   2556 C C   . GLY B 1 95  ? 10.991  34.963  -71.757 1.00 34.42  ? 390 GLY B C   1 
ATOM   2557 O O   . GLY B 1 95  ? 10.662  35.537  -72.793 1.00 29.12  ? 390 GLY B O   1 
ATOM   2558 N N   . LEU B 1 96  ? 12.231  34.989  -71.272 1.00 32.16  ? 391 LEU B N   1 
ATOM   2559 C CA  . LEU B 1 96  ? 13.320  35.720  -71.925 1.00 32.37  ? 391 LEU B CA  1 
ATOM   2560 C C   . LEU B 1 96  ? 13.626  35.158  -73.305 1.00 33.98  ? 391 LEU B C   1 
ATOM   2561 O O   . LEU B 1 96  ? 13.851  35.898  -74.261 1.00 30.61  ? 391 LEU B O   1 
ATOM   2562 C CB  . LEU B 1 96  ? 14.593  35.650  -71.078 1.00 26.58  ? 391 LEU B CB  1 
ATOM   2563 C CG  . LEU B 1 96  ? 15.857  36.237  -71.713 1.00 29.62  ? 391 LEU B CG  1 
ATOM   2564 C CD1 . LEU B 1 96  ? 15.720  37.746  -71.861 1.00 30.95  ? 391 LEU B CD1 1 
ATOM   2565 C CD2 . LEU B 1 96  ? 17.087  35.908  -70.879 1.00 27.90  ? 391 LEU B CD2 1 
ATOM   2566 N N   . VAL B 1 97  ? 13.644  33.837  -73.401 1.00 28.59  ? 392 VAL B N   1 
ATOM   2567 C CA  . VAL B 1 97  ? 13.965  33.190  -74.657 1.00 34.09  ? 392 VAL B CA  1 
ATOM   2568 C C   . VAL B 1 97  ? 12.861  33.416  -75.690 1.00 35.05  ? 392 VAL B C   1 
ATOM   2569 O O   . VAL B 1 97  ? 13.135  33.604  -76.874 1.00 39.70  ? 392 VAL B O   1 
ATOM   2570 C CB  . VAL B 1 97  ? 14.262  31.706  -74.430 1.00 37.42  ? 392 VAL B CB  1 
ATOM   2571 C CG1 . VAL B 1 97  ? 14.135  30.933  -75.714 1.00 46.47  ? 392 VAL B CG1 1 
ATOM   2572 C CG2 . VAL B 1 97  ? 15.661  31.552  -73.818 1.00 29.41  ? 392 VAL B CG2 1 
ATOM   2573 N N   . TRP B 1 98  ? 11.615  33.423  -75.230 1.00 39.44  ? 393 TRP B N   1 
ATOM   2574 C CA  . TRP B 1 98  ? 10.480  33.761  -76.091 1.00 36.12  ? 393 TRP B CA  1 
ATOM   2575 C C   . TRP B 1 98  ? 10.597  35.190  -76.645 1.00 38.06  ? 393 TRP B C   1 
ATOM   2576 O O   . TRP B 1 98  ? 10.490  35.410  -77.851 1.00 37.34  ? 393 TRP B O   1 
ATOM   2577 C CB  . TRP B 1 98  ? 9.164   33.581  -75.326 1.00 24.50  ? 393 TRP B CB  1 
ATOM   2578 C CG  . TRP B 1 98  ? 7.944   34.071  -76.062 1.00 38.94  ? 393 TRP B CG  1 
ATOM   2579 C CD1 . TRP B 1 98  ? 7.219   35.190  -75.784 1.00 43.43  ? 393 TRP B CD1 1 
ATOM   2580 C CD2 . TRP B 1 98  ? 7.309   33.453  -77.191 1.00 45.73  ? 393 TRP B CD2 1 
ATOM   2581 N NE1 . TRP B 1 98  ? 6.172   35.309  -76.666 1.00 44.70  ? 393 TRP B NE1 1 
ATOM   2582 C CE2 . TRP B 1 98  ? 6.205   34.254  -77.541 1.00 47.31  ? 393 TRP B CE2 1 
ATOM   2583 C CE3 . TRP B 1 98  ? 7.566   32.302  -77.941 1.00 48.90  ? 393 TRP B CE3 1 
ATOM   2584 C CZ2 . TRP B 1 98  ? 5.361   33.943  -78.606 1.00 45.11  ? 393 TRP B CZ2 1 
ATOM   2585 C CZ3 . TRP B 1 98  ? 6.728   31.995  -78.998 1.00 50.61  ? 393 TRP B CZ3 1 
ATOM   2586 C CH2 . TRP B 1 98  ? 5.638   32.811  -79.320 1.00 42.83  ? 393 TRP B CH2 1 
ATOM   2587 N N   . ARG B 1 99  ? 10.831  36.152  -75.758 1.00 36.17  ? 394 ARG B N   1 
ATOM   2588 C CA  . ARG B 1 99  ? 10.973  37.550  -76.157 1.00 38.98  ? 394 ARG B CA  1 
ATOM   2589 C C   . ARG B 1 99  ? 12.101  37.764  -77.163 1.00 43.08  ? 394 ARG B C   1 
ATOM   2590 O O   . ARG B 1 99  ? 12.011  38.624  -78.045 1.00 39.63  ? 394 ARG B O   1 
ATOM   2591 C CB  . ARG B 1 99  ? 11.232  38.431  -74.935 1.00 32.12  ? 394 ARG B CB  1 
ATOM   2592 C CG  . ARG B 1 99  ? 10.124  38.402  -73.903 1.00 36.13  ? 394 ARG B CG  1 
ATOM   2593 C CD  . ARG B 1 99  ? 10.185  39.620  -72.991 1.00 39.07  ? 394 ARG B CD  1 
ATOM   2594 N NE  . ARG B 1 99  ? 11.318  39.632  -72.064 1.00 34.53  ? 394 ARG B NE  1 
ATOM   2595 C CZ  . ARG B 1 99  ? 11.348  38.967  -70.908 1.00 34.78  ? 394 ARG B CZ  1 
ATOM   2596 N NH1 . ARG B 1 99  ? 10.321  38.213  -70.545 1.00 39.11  ? 394 ARG B NH1 1 
ATOM   2597 N NH2 . ARG B 1 99  ? 12.403  39.049  -70.108 1.00 30.66  ? 394 ARG B NH2 1 
ATOM   2598 N N   . SER B 1 100 ? 13.165  36.981  -77.025 1.00 36.71  ? 395 SER B N   1 
ATOM   2599 C CA  . SER B 1 100 ? 14.397  37.236  -77.767 1.00 40.87  ? 395 SER B CA  1 
ATOM   2600 C C   . SER B 1 100 ? 14.420  36.601  -79.150 1.00 41.56  ? 395 SER B C   1 
ATOM   2601 O O   . SER B 1 100 ? 15.363  36.810  -79.916 1.00 42.31  ? 395 SER B O   1 
ATOM   2602 C CB  . SER B 1 100 ? 15.607  36.750  -76.966 1.00 38.86  ? 395 SER B CB  1 
ATOM   2603 O OG  . SER B 1 100 ? 15.649  37.356  -75.688 1.00 33.97  ? 395 SER B OG  1 
ATOM   2604 N N   . MET B 1 101 ? 13.385  35.832  -79.468 1.00 38.08  ? 396 MET B N   1 
ATOM   2605 C CA  . MET B 1 101 ? 13.364  35.036  -80.698 1.00 42.88  ? 396 MET B CA  1 
ATOM   2606 C C   . MET B 1 101 ? 13.689  35.811  -81.973 1.00 45.97  ? 396 MET B C   1 
ATOM   2607 O O   . MET B 1 101 ? 14.473  35.348  -82.795 1.00 46.98  ? 396 MET B O   1 
ATOM   2608 C CB  . MET B 1 101 ? 12.025  34.312  -80.860 1.00 40.22  ? 396 MET B CB  1 
ATOM   2609 C CG  . MET B 1 101 ? 11.944  33.004  -80.120 1.00 37.23  ? 396 MET B CG  1 
ATOM   2610 S SD  . MET B 1 101 ? 10.340  32.225  -80.341 1.00 46.73  ? 396 MET B SD  1 
ATOM   2611 C CE  . MET B 1 101 ? 10.342  31.943  -82.108 1.00 43.84  ? 396 MET B CE  1 
ATOM   2612 N N   . GLU B 1 102 ? 13.083  36.980  -82.152 1.00 52.42  ? 397 GLU B N   1 
ATOM   2613 C CA  . GLU B 1 102 ? 13.349  37.751  -83.361 1.00 59.19  ? 397 GLU B CA  1 
ATOM   2614 C C   . GLU B 1 102 ? 14.411  38.829  -83.155 1.00 59.19  ? 397 GLU B C   1 
ATOM   2615 O O   . GLU B 1 102 ? 14.394  39.869  -83.809 1.00 56.78  ? 397 GLU B O   1 
ATOM   2616 C CB  . GLU B 1 102 ? 12.061  38.325  -83.962 1.00 70.61  ? 397 GLU B CB  1 
ATOM   2617 C CG  . GLU B 1 102 ? 11.016  38.764  -82.954 1.00 83.35  ? 397 GLU B CG  1 
ATOM   2618 C CD  . GLU B 1 102 ? 9.646   38.946  -83.594 1.00 94.44  ? 397 GLU B CD  1 
ATOM   2619 O OE1 . GLU B 1 102 ? 8.719   39.433  -82.909 1.00 94.40  ? 397 GLU B OE1 1 
ATOM   2620 O OE2 . GLU B 1 102 ? 9.499   38.600  -84.788 1.00 99.28  ? 397 GLU B OE2 1 
ATOM   2621 N N   . HIS B 1 103 ? 15.338  38.561  -82.242 1.00 58.84  ? 398 HIS B N   1 
ATOM   2622 C CA  . HIS B 1 103 ? 16.514  39.401  -82.066 1.00 51.94  ? 398 HIS B CA  1 
ATOM   2623 C C   . HIS B 1 103 ? 17.741  38.505  -82.008 1.00 48.61  ? 398 HIS B C   1 
ATOM   2624 O O   . HIS B 1 103 ? 18.322  38.301  -80.939 1.00 47.49  ? 398 HIS B O   1 
ATOM   2625 C CB  . HIS B 1 103 ? 16.401  40.236  -80.792 1.00 49.59  ? 398 HIS B CB  1 
ATOM   2626 C CG  . HIS B 1 103 ? 15.155  41.062  -80.725 1.00 52.48  ? 398 HIS B CG  1 
ATOM   2627 N ND1 . HIS B 1 103 ? 15.086  42.348  -81.213 1.00 47.29  ? 398 HIS B ND1 1 
ATOM   2628 C CD2 . HIS B 1 103 ? 13.926  40.779  -80.233 1.00 49.56  ? 398 HIS B CD2 1 
ATOM   2629 C CE1 . HIS B 1 103 ? 13.871  42.826  -81.020 1.00 49.07  ? 398 HIS B CE1 1 
ATOM   2630 N NE2 . HIS B 1 103 ? 13.146  41.893  -80.429 1.00 51.76  ? 398 HIS B NE2 1 
ATOM   2631 N N   . PRO B 1 104 ? 18.126  37.944  -83.160 1.00 51.74  ? 399 PRO B N   1 
ATOM   2632 C CA  . PRO B 1 104 ? 19.277  37.042  -83.248 1.00 49.28  ? 399 PRO B CA  1 
ATOM   2633 C C   . PRO B 1 104 ? 20.537  37.677  -82.662 1.00 50.97  ? 399 PRO B C   1 
ATOM   2634 O O   . PRO B 1 104 ? 20.845  38.833  -82.959 1.00 48.87  ? 399 PRO B O   1 
ATOM   2635 C CB  . PRO B 1 104 ? 19.439  36.836  -84.756 1.00 54.40  ? 399 PRO B CB  1 
ATOM   2636 C CG  . PRO B 1 104 ? 18.076  37.055  -85.312 1.00 56.81  ? 399 PRO B CG  1 
ATOM   2637 C CD  . PRO B 1 104 ? 17.460  38.124  -84.462 1.00 56.66  ? 399 PRO B CD  1 
ATOM   2638 N N   . GLY B 1 105 ? 21.250  36.924  -81.830 1.00 50.42  ? 400 GLY B N   1 
ATOM   2639 C CA  . GLY B 1 105 ? 22.484  37.402  -81.236 1.00 48.62  ? 400 GLY B CA  1 
ATOM   2640 C C   . GLY B 1 105 ? 22.279  38.266  -80.005 1.00 45.47  ? 400 GLY B C   1 
ATOM   2641 O O   . GLY B 1 105 ? 23.247  38.732  -79.404 1.00 46.16  ? 400 GLY B O   1 
ATOM   2642 N N   . LYS B 1 106 ? 21.023  38.485  -79.627 1.00 38.91  ? 401 LYS B N   1 
ATOM   2643 C CA  . LYS B 1 106 ? 20.716  39.334  -78.476 1.00 40.83  ? 401 LYS B CA  1 
ATOM   2644 C C   . LYS B 1 106 ? 19.652  38.743  -77.556 1.00 41.62  ? 401 LYS B C   1 
ATOM   2645 O O   . LYS B 1 106 ? 18.858  37.890  -77.959 1.00 40.52  ? 401 LYS B O   1 
ATOM   2646 C CB  . LYS B 1 106 ? 20.266  40.723  -78.937 1.00 40.63  ? 401 LYS B CB  1 
ATOM   2647 C CG  . LYS B 1 106 ? 21.303  41.483  -79.724 1.00 44.90  ? 401 LYS B CG  1 
ATOM   2648 C CD  . LYS B 1 106 ? 20.725  42.776  -80.252 1.00 51.79  ? 401 LYS B CD  1 
ATOM   2649 C CE  . LYS B 1 106 ? 21.646  43.409  -81.278 1.00 64.11  ? 401 LYS B CE  1 
ATOM   2650 N NZ  . LYS B 1 106 ? 21.042  44.653  -81.843 1.00 74.02  ? 401 LYS B NZ  1 
ATOM   2651 N N   . LEU B 1 107 ? 19.647  39.217  -76.316 1.00 35.33  ? 402 LEU B N   1 
ATOM   2652 C CA  . LEU B 1 107 ? 18.651  38.813  -75.337 1.00 35.44  ? 402 LEU B CA  1 
ATOM   2653 C C   . LEU B 1 107 ? 17.844  40.027  -74.886 1.00 39.44  ? 402 LEU B C   1 
ATOM   2654 O O   . LEU B 1 107 ? 18.399  41.016  -74.398 1.00 33.33  ? 402 LEU B O   1 
ATOM   2655 C CB  . LEU B 1 107 ? 19.321  38.131  -74.140 1.00 31.39  ? 402 LEU B CB  1 
ATOM   2656 C CG  . LEU B 1 107 ? 19.935  36.757  -74.434 1.00 37.01  ? 402 LEU B CG  1 
ATOM   2657 C CD1 . LEU B 1 107 ? 20.630  36.202  -73.203 1.00 24.73  ? 402 LEU B CD1 1 
ATOM   2658 C CD2 . LEU B 1 107 ? 18.873  35.775  -74.942 1.00 34.58  ? 402 LEU B CD2 1 
ATOM   2659 N N   . LEU B 1 108 ? 16.533  39.948  -75.072 1.00 30.06  ? 403 LEU B N   1 
ATOM   2660 C CA  . LEU B 1 108 ? 15.638  41.042  -74.740 1.00 29.76  ? 403 LEU B CA  1 
ATOM   2661 C C   . LEU B 1 108 ? 15.121  40.872  -73.316 1.00 29.88  ? 403 LEU B C   1 
ATOM   2662 O O   . LEU B 1 108 ? 14.009  40.385  -73.098 1.00 33.29  ? 403 LEU B O   1 
ATOM   2663 C CB  . LEU B 1 108 ? 14.477  41.087  -75.737 1.00 31.85  ? 403 LEU B CB  1 
ATOM   2664 C CG  . LEU B 1 108 ? 13.664  42.373  -75.896 1.00 41.21  ? 403 LEU B CG  1 
ATOM   2665 C CD1 . LEU B 1 108 ? 12.951  42.373  -77.231 1.00 48.08  ? 403 LEU B CD1 1 
ATOM   2666 C CD2 . LEU B 1 108 ? 12.669  42.539  -74.767 1.00 47.11  ? 403 LEU B CD2 1 
ATOM   2667 N N   . PHE B 1 109 ? 15.941  41.253  -72.342 1.00 30.31  ? 404 PHE B N   1 
ATOM   2668 C CA  . PHE B 1 109 ? 15.552  41.135  -70.937 1.00 34.29  ? 404 PHE B CA  1 
ATOM   2669 C C   . PHE B 1 109 ? 14.360  42.047  -70.666 1.00 34.98  ? 404 PHE B C   1 
ATOM   2670 O O   . PHE B 1 109 ? 13.461  41.715  -69.886 1.00 34.24  ? 404 PHE B O   1 
ATOM   2671 C CB  . PHE B 1 109 ? 16.731  41.475  -70.014 1.00 29.50  ? 404 PHE B CB  1 
ATOM   2672 C CG  . PHE B 1 109 ? 17.881  40.505  -70.114 1.00 34.44  ? 404 PHE B CG  1 
ATOM   2673 C CD1 . PHE B 1 109 ? 17.951  39.403  -69.277 1.00 31.54  ? 404 PHE B CD1 1 
ATOM   2674 C CD2 . PHE B 1 109 ? 18.890  40.694  -71.046 1.00 33.49  ? 404 PHE B CD2 1 
ATOM   2675 C CE1 . PHE B 1 109 ? 19.006  38.506  -69.370 1.00 34.31  ? 404 PHE B CE1 1 
ATOM   2676 C CE2 . PHE B 1 109 ? 19.945  39.798  -71.146 1.00 39.94  ? 404 PHE B CE2 1 
ATOM   2677 C CZ  . PHE B 1 109 ? 20.007  38.707  -70.304 1.00 32.39  ? 404 PHE B CZ  1 
ATOM   2678 N N   . ALA B 1 110 ? 14.365  43.194  -71.337 1.00 30.14  ? 405 ALA B N   1 
ATOM   2679 C CA  . ALA B 1 110 ? 13.267  44.155  -71.300 1.00 33.48  ? 405 ALA B CA  1 
ATOM   2680 C C   . ALA B 1 110 ? 13.328  44.968  -72.587 1.00 34.79  ? 405 ALA B C   1 
ATOM   2681 O O   . ALA B 1 110 ? 14.363  44.991  -73.250 1.00 35.26  ? 405 ALA B O   1 
ATOM   2682 C CB  . ALA B 1 110 ? 13.394  45.064  -70.082 1.00 36.95  ? 405 ALA B CB  1 
ATOM   2683 N N   . PRO B 1 111 ? 12.217  45.620  -72.967 1.00 36.41  ? 406 PRO B N   1 
ATOM   2684 C CA  . PRO B 1 111 ? 12.247  46.363  -74.234 1.00 37.78  ? 406 PRO B CA  1 
ATOM   2685 C C   . PRO B 1 111 ? 13.318  47.456  -74.245 1.00 39.74  ? 406 PRO B C   1 
ATOM   2686 O O   . PRO B 1 111 ? 13.784  47.865  -75.310 1.00 43.12  ? 406 PRO B O   1 
ATOM   2687 C CB  . PRO B 1 111 ? 10.849  46.979  -74.307 1.00 37.99  ? 406 PRO B CB  1 
ATOM   2688 C CG  . PRO B 1 111 ? 9.992   46.047  -73.495 1.00 34.62  ? 406 PRO B CG  1 
ATOM   2689 C CD  . PRO B 1 111 ? 10.867  45.581  -72.376 1.00 28.19  ? 406 PRO B CD  1 
ATOM   2690 N N   . ASN B 1 112 ? 13.701  47.924  -73.063 1.00 35.18  ? 407 ASN B N   1 
ATOM   2691 C CA  . ASN B 1 112 ? 14.739  48.938  -72.945 1.00 38.54  ? 407 ASN B CA  1 
ATOM   2692 C C   . ASN B 1 112 ? 16.048  48.326  -72.468 1.00 41.97  ? 407 ASN B C   1 
ATOM   2693 O O   . ASN B 1 112 ? 16.963  49.038  -72.062 1.00 40.54  ? 407 ASN B O   1 
ATOM   2694 C CB  . ASN B 1 112 ? 14.306  50.051  -71.988 1.00 36.99  ? 407 ASN B CB  1 
ATOM   2695 C CG  . ASN B 1 112 ? 14.060  49.541  -70.577 1.00 39.66  ? 407 ASN B CG  1 
ATOM   2696 O OD1 . ASN B 1 112 ? 13.653  48.396  -70.382 1.00 32.64  ? 407 ASN B OD1 1 
ATOM   2697 N ND2 . ASN B 1 112 ? 14.312  50.385  -69.588 1.00 35.79  ? 407 ASN B ND2 1 
ATOM   2698 N N   . LEU B 1 113 ? 16.134  46.999  -72.504 1.00 32.06  ? 408 LEU B N   1 
ATOM   2699 C CA  . LEU B 1 113 ? 17.376  46.329  -72.138 1.00 32.27  ? 408 LEU B CA  1 
ATOM   2700 C C   . LEU B 1 113 ? 17.656  45.162  -73.067 1.00 42.22  ? 408 LEU B C   1 
ATOM   2701 O O   . LEU B 1 113 ? 17.467  44.002  -72.706 1.00 40.51  ? 408 LEU B O   1 
ATOM   2702 C CB  . LEU B 1 113 ? 17.346  45.856  -70.689 1.00 32.57  ? 408 LEU B CB  1 
ATOM   2703 C CG  . LEU B 1 113 ? 18.721  45.560  -70.090 1.00 37.85  ? 408 LEU B CG  1 
ATOM   2704 C CD1 . LEU B 1 113 ? 19.546  46.835  -70.051 1.00 43.86  ? 408 LEU B CD1 1 
ATOM   2705 C CD2 . LEU B 1 113 ? 18.591  44.966  -68.706 1.00 36.52  ? 408 LEU B CD2 1 
ATOM   2706 N N   . LEU B 1 114 ? 18.102  45.489  -74.273 1.00 39.73  ? 409 LEU B N   1 
ATOM   2707 C CA  . LEU B 1 114 ? 18.430  44.496  -75.283 1.00 40.05  ? 409 LEU B CA  1 
ATOM   2708 C C   . LEU B 1 114 ? 19.946  44.358  -75.334 1.00 45.93  ? 409 LEU B C   1 
ATOM   2709 O O   . LEU B 1 114 ? 20.643  45.292  -75.723 1.00 47.97  ? 409 LEU B O   1 
ATOM   2710 C CB  . LEU B 1 114 ? 17.886  44.954  -76.636 1.00 41.82  ? 409 LEU B CB  1 
ATOM   2711 C CG  . LEU B 1 114 ? 18.098  44.068  -77.858 1.00 45.56  ? 409 LEU B CG  1 
ATOM   2712 C CD1 . LEU B 1 114 ? 17.407  42.731  -77.661 1.00 42.15  ? 409 LEU B CD1 1 
ATOM   2713 C CD2 . LEU B 1 114 ? 17.579  44.763  -79.105 1.00 45.50  ? 409 LEU B CD2 1 
ATOM   2714 N N   . LEU B 1 115 ? 20.457  43.197  -74.938 1.00 44.06  ? 410 LEU B N   1 
ATOM   2715 C CA  . LEU B 1 115 ? 21.898  43.013  -74.788 1.00 40.45  ? 410 LEU B CA  1 
ATOM   2716 C C   . LEU B 1 115 ? 22.477  41.962  -75.732 1.00 44.00  ? 410 LEU B C   1 
ATOM   2717 O O   . LEU B 1 115 ? 21.897  40.883  -75.903 1.00 35.34  ? 410 LEU B O   1 
ATOM   2718 C CB  . LEU B 1 115 ? 22.219  42.610  -73.348 1.00 38.39  ? 410 LEU B CB  1 
ATOM   2719 C CG  . LEU B 1 115 ? 21.733  43.552  -72.243 1.00 40.37  ? 410 LEU B CG  1 
ATOM   2720 C CD1 . LEU B 1 115 ? 22.087  42.983  -70.880 1.00 43.30  ? 410 LEU B CD1 1 
ATOM   2721 C CD2 . LEU B 1 115 ? 22.331  44.941  -72.424 1.00 37.02  ? 410 LEU B CD2 1 
ATOM   2722 N N   . ASP B 1 116 ? 23.621  42.278  -76.340 1.00 45.85  ? 411 ASP B N   1 
ATOM   2723 C CA  . ASP B 1 116 ? 24.400  41.276  -77.063 1.00 49.31  ? 411 ASP B CA  1 
ATOM   2724 C C   . ASP B 1 116 ? 25.434  40.664  -76.116 1.00 48.59  ? 411 ASP B C   1 
ATOM   2725 O O   . ASP B 1 116 ? 25.603  41.140  -74.998 1.00 51.07  ? 411 ASP B O   1 
ATOM   2726 C CB  . ASP B 1 116 ? 25.053  41.853  -78.327 1.00 51.42  ? 411 ASP B CB  1 
ATOM   2727 C CG  . ASP B 1 116 ? 26.067  42.946  -78.027 1.00 62.02  ? 411 ASP B CG  1 
ATOM   2728 O OD1 . ASP B 1 116 ? 26.928  42.747  -77.140 1.00 60.53  ? 411 ASP B OD1 1 
ATOM   2729 O OD2 . ASP B 1 116 ? 26.006  44.005  -78.690 1.00 63.73  ? 411 ASP B OD2 1 
ATOM   2730 N N   . ARG B 1 117 ? 26.117  39.613  -76.556 1.00 48.73  ? 412 ARG B N   1 
ATOM   2731 C CA  . ARG B 1 117 ? 26.935  38.818  -75.639 1.00 57.72  ? 412 ARG B CA  1 
ATOM   2732 C C   . ARG B 1 117 ? 28.172  39.540  -75.096 1.00 62.67  ? 412 ARG B C   1 
ATOM   2733 O O   . ARG B 1 117 ? 28.879  39.008  -74.241 1.00 70.76  ? 412 ARG B O   1 
ATOM   2734 C CB  . ARG B 1 117 ? 27.308  37.465  -76.264 1.00 55.86  ? 412 ARG B CB  1 
ATOM   2735 C CG  . ARG B 1 117 ? 28.755  37.311  -76.691 1.00 55.56  ? 412 ARG B CG  1 
ATOM   2736 C CD  . ARG B 1 117 ? 29.009  35.892  -77.195 1.00 56.84  ? 412 ARG B CD  1 
ATOM   2737 N NE  . ARG B 1 117 ? 29.860  35.120  -76.293 1.00 65.52  ? 412 ARG B NE  1 
ATOM   2738 C CZ  . ARG B 1 117 ? 30.909  34.410  -76.690 1.00 80.77  ? 412 ARG B CZ  1 
ATOM   2739 N NH1 . ARG B 1 117 ? 31.232  34.369  -77.977 1.00 90.47  ? 412 ARG B NH1 1 
ATOM   2740 N NH2 . ARG B 1 117 ? 31.633  33.737  -75.805 1.00 83.36  ? 412 ARG B NH2 1 
ATOM   2741 N N   . ASN B 1 118 ? 28.422  40.752  -75.574 1.00 61.15  ? 413 ASN B N   1 
ATOM   2742 C CA  . ASN B 1 118 ? 29.573  41.522  -75.108 1.00 74.38  ? 413 ASN B CA  1 
ATOM   2743 C C   . ASN B 1 118 ? 29.213  42.707  -74.216 1.00 84.23  ? 413 ASN B C   1 
ATOM   2744 O O   . ASN B 1 118 ? 29.971  43.059  -73.312 1.00 90.47  ? 413 ASN B O   1 
ATOM   2745 C CB  . ASN B 1 118 ? 30.414  42.005  -76.294 1.00 78.30  ? 413 ASN B CB  1 
ATOM   2746 C CG  . ASN B 1 118 ? 31.370  40.942  -76.803 1.00 84.26  ? 413 ASN B CG  1 
ATOM   2747 O OD1 . ASN B 1 118 ? 32.258  40.487  -76.078 1.00 86.07  ? 413 ASN B OD1 1 
ATOM   2748 N ND2 . ASN B 1 118 ? 31.197  40.546  -78.057 1.00 86.23  ? 413 ASN B ND2 1 
ATOM   2749 N N   . GLN B 1 119 ? 28.056  43.313  -74.472 1.00 88.13  ? 414 GLN B N   1 
ATOM   2750 C CA  . GLN B 1 119 ? 27.656  44.553  -73.802 1.00 92.13  ? 414 GLN B CA  1 
ATOM   2751 C C   . GLN B 1 119 ? 27.760  44.487  -72.285 1.00 98.37  ? 414 GLN B C   1 
ATOM   2752 O O   . GLN B 1 119 ? 28.636  45.111  -71.686 1.00 104.16 ? 414 GLN B O   1 
ATOM   2753 C CB  . GLN B 1 119 ? 26.232  44.952  -74.195 1.00 87.70  ? 414 GLN B CB  1 
ATOM   2754 C CG  . GLN B 1 119 ? 26.065  45.285  -75.659 1.00 89.20  ? 414 GLN B CG  1 
ATOM   2755 C CD  . GLN B 1 119 ? 24.677  45.792  -75.977 1.00 91.89  ? 414 GLN B CD  1 
ATOM   2756 O OE1 . GLN B 1 119 ? 24.088  46.546  -75.203 1.00 96.13  ? 414 GLN B OE1 1 
ATOM   2757 N NE2 . GLN B 1 119 ? 24.144  45.382  -77.122 1.00 91.74  ? 414 GLN B NE2 1 
ATOM   2758 N N   . GLY B 1 120 ? 26.848  43.747  -71.667 1.00 96.48  ? 415 GLY B N   1 
ATOM   2759 C CA  . GLY B 1 120 ? 26.852  43.596  -70.227 1.00 97.98  ? 415 GLY B CA  1 
ATOM   2760 C C   . GLY B 1 120 ? 28.197  43.116  -69.728 1.00 98.83  ? 415 GLY B C   1 
ATOM   2761 O O   . GLY B 1 120 ? 28.828  42.253  -70.339 1.00 102.27 ? 415 GLY B O   1 
ATOM   2762 N N   . LYS B 1 121 ? 28.648  43.702  -68.628 1.00 94.05  ? 416 LYS B N   1 
ATOM   2763 C CA  . LYS B 1 121 ? 29.876  43.268  -67.989 1.00 91.47  ? 416 LYS B CA  1 
ATOM   2764 C C   . LYS B 1 121 ? 29.534  42.092  -67.090 1.00 92.90  ? 416 LYS B C   1 
ATOM   2765 O O   . LYS B 1 121 ? 28.886  42.257  -66.058 1.00 96.45  ? 416 LYS B O   1 
ATOM   2766 C CB  . LYS B 1 121 ? 30.494  44.409  -67.180 1.00 85.14  ? 416 LYS B CB  1 
HETATM 2767 N N   . CME B 1 122 ? 29.954  40.899  -67.491 1.00 90.99  ? 417 CME B N   1 
HETATM 2768 C CA  . CME B 1 122 ? 29.600  39.704  -66.754 1.00 88.90  ? 417 CME B CA  1 
HETATM 2769 C CB  . CME B 1 122 ? 28.406  39.052  -67.377 1.00 83.02  ? 417 CME B CB  1 
HETATM 2770 S SG  . CME B 1 122 ? 28.709  38.147  -68.876 1.00 136.11 ? 417 CME B SG  1 
HETATM 2771 S SD  . CME B 1 122 ? 27.136  38.366  -70.111 1.00 90.41  ? 417 CME B SD  1 
HETATM 2772 C CE  . CME B 1 122 ? 27.000  40.086  -70.554 1.00 66.48  ? 417 CME B CE  1 
HETATM 2773 C CZ  . CME B 1 122 ? 27.081  40.426  -71.996 1.00 66.94  ? 417 CME B CZ  1 
HETATM 2774 O OH  . CME B 1 122 ? 26.148  41.308  -72.477 1.00 72.19  ? 417 CME B OH  1 
HETATM 2775 C C   . CME B 1 122 ? 30.742  38.747  -66.705 1.00 88.75  ? 417 CME B C   1 
HETATM 2776 O O   . CME B 1 122 ? 31.631  38.773  -67.547 1.00 85.89  ? 417 CME B O   1 
ATOM   2777 N N   . VAL B 1 123 ? 30.708  37.873  -65.706 1.00 85.71  ? 418 VAL B N   1 
ATOM   2778 C CA  . VAL B 1 123 ? 31.759  36.889  -65.484 1.00 83.42  ? 418 VAL B CA  1 
ATOM   2779 C C   . VAL B 1 123 ? 31.722  35.735  -66.493 1.00 90.96  ? 418 VAL B C   1 
ATOM   2780 O O   . VAL B 1 123 ? 30.675  35.415  -67.050 1.00 91.94  ? 418 VAL B O   1 
ATOM   2781 C CB  . VAL B 1 123 ? 31.688  36.349  -64.037 1.00 75.38  ? 418 VAL B CB  1 
ATOM   2782 C CG1 . VAL B 1 123 ? 31.825  34.834  -64.004 1.00 66.70  ? 418 VAL B CG1 1 
ATOM   2783 C CG2 . VAL B 1 123 ? 32.741  37.030  -63.170 1.00 72.01  ? 418 VAL B CG2 1 
ATOM   2784 N N   . GLU B 1 124 ? 32.882  35.125  -66.722 1.00 93.74  ? 419 GLU B N   1 
ATOM   2785 C CA  . GLU B 1 124 ? 33.025  33.996  -67.641 1.00 92.90  ? 419 GLU B CA  1 
ATOM   2786 C C   . GLU B 1 124 ? 31.886  32.970  -67.568 1.00 85.77  ? 419 GLU B C   1 
ATOM   2787 O O   . GLU B 1 124 ? 31.354  32.549  -68.595 1.00 81.95  ? 419 GLU B O   1 
ATOM   2788 C CB  . GLU B 1 124 ? 34.370  33.307  -67.396 1.00 101.74 ? 419 GLU B CB  1 
ATOM   2789 C CG  . GLU B 1 124 ? 34.517  31.947  -68.048 1.00 107.89 ? 419 GLU B CG  1 
ATOM   2790 C CD  . GLU B 1 124 ? 35.821  31.270  -67.674 1.00 112.84 ? 419 GLU B CD  1 
ATOM   2791 O OE1 . GLU B 1 124 ? 35.911  30.031  -67.818 1.00 110.61 ? 419 GLU B OE1 1 
ATOM   2792 O OE2 . GLU B 1 124 ? 36.754  31.976  -67.229 1.00 113.71 ? 419 GLU B OE2 1 
ATOM   2793 N N   . GLY B 1 125 ? 31.524  32.563  -66.356 1.00 77.90  ? 420 GLY B N   1 
ATOM   2794 C CA  . GLY B 1 125 ? 30.454  31.601  -66.162 1.00 72.55  ? 420 GLY B CA  1 
ATOM   2795 C C   . GLY B 1 125 ? 29.128  32.148  -66.649 1.00 68.15  ? 420 GLY B C   1 
ATOM   2796 O O   . GLY B 1 125 ? 28.246  31.398  -67.077 1.00 51.62  ? 420 GLY B O   1 
ATOM   2797 N N   . MET B 1 126 ? 28.994  33.468  -66.582 1.00 61.37  ? 421 MET B N   1 
ATOM   2798 C CA  . MET B 1 126 ? 27.784  34.151  -67.020 1.00 62.05  ? 421 MET B CA  1 
ATOM   2799 C C   . MET B 1 126 ? 27.661  34.118  -68.538 1.00 63.87  ? 421 MET B C   1 
ATOM   2800 O O   . MET B 1 126 ? 26.574  33.931  -69.076 1.00 62.04  ? 421 MET B O   1 
ATOM   2801 C CB  . MET B 1 126 ? 27.790  35.599  -66.527 1.00 67.11  ? 421 MET B CB  1 
ATOM   2802 C CG  . MET B 1 126 ? 27.741  35.730  -65.016 1.00 70.95  ? 421 MET B CG  1 
ATOM   2803 S SD  . MET B 1 126 ? 26.050  35.733  -64.399 1.00 96.53  ? 421 MET B SD  1 
ATOM   2804 C CE  . MET B 1 126 ? 25.535  37.378  -64.886 1.00 89.58  ? 421 MET B CE  1 
ATOM   2805 N N   . VAL B 1 127 ? 28.785  34.309  -69.217 1.00 40.06  ? 422 VAL B N   1 
ATOM   2806 C CA  . VAL B 1 127 ? 28.846  34.285  -70.674 1.00 48.65  ? 422 VAL B CA  1 
ATOM   2807 C C   . VAL B 1 127 ? 28.361  32.947  -71.227 1.00 50.74  ? 422 VAL B C   1 
ATOM   2808 O O   . VAL B 1 127 ? 27.741  32.887  -72.291 1.00 51.34  ? 422 VAL B O   1 
ATOM   2809 C CB  . VAL B 1 127 ? 30.301  34.428  -71.119 1.00 54.20  ? 422 VAL B CB  1 
ATOM   2810 C CG1 . VAL B 1 127 ? 30.480  34.283  -72.620 1.00 49.44  ? 422 VAL B CG1 1 
ATOM   2811 C CG2 . VAL B 1 127 ? 30.997  35.628  -70.477 1.00 64.47  ? 422 VAL B CG2 1 
ATOM   2812 N N   . GLU B 1 128 ? 28.680  31.871  -70.513 1.00 44.26  ? 423 GLU B N   1 
ATOM   2813 C CA  . GLU B 1 128 ? 28.234  30.542  -70.903 1.00 52.01  ? 423 GLU B CA  1 
ATOM   2814 C C   . GLU B 1 128 ? 26.712  30.462  -70.877 1.00 46.12  ? 423 GLU B C   1 
ATOM   2815 O O   . GLU B 1 128 ? 26.092  29.987  -71.827 1.00 47.32  ? 423 GLU B O   1 
ATOM   2816 C CB  . GLU B 1 128 ? 28.836  29.481  -69.981 1.00 59.67  ? 423 GLU B CB  1 
ATOM   2817 N N   . ILE B 1 129 ? 26.119  30.932  -69.783 1.00 36.99  ? 424 ILE B N   1 
ATOM   2818 C CA  . ILE B 1 129 ? 24.667  30.964  -69.643 1.00 39.43  ? 424 ILE B CA  1 
ATOM   2819 C C   . ILE B 1 129 ? 24.033  31.853  -70.709 1.00 39.54  ? 424 ILE B C   1 
ATOM   2820 O O   . ILE B 1 129 ? 23.015  31.502  -71.305 1.00 42.15  ? 424 ILE B O   1 
ATOM   2821 C CB  . ILE B 1 129 ? 24.242  31.493  -68.264 1.00 45.11  ? 424 ILE B CB  1 
ATOM   2822 C CG1 . ILE B 1 129 ? 24.837  30.626  -67.151 1.00 46.09  ? 424 ILE B CG1 1 
ATOM   2823 C CG2 . ILE B 1 129 ? 22.717  31.552  -68.169 1.00 45.69  ? 424 ILE B CG2 1 
ATOM   2824 C CD1 . ILE B 1 129 ? 24.779  31.270  -65.771 1.00 47.51  ? 424 ILE B CD1 1 
ATOM   2825 N N   . PHE B 1 130 ? 24.637  33.012  -70.937 1.00 32.59  ? 425 PHE B N   1 
ATOM   2826 C CA  . PHE B 1 130 ? 24.166  33.916  -71.970 1.00 37.73  ? 425 PHE B CA  1 
ATOM   2827 C C   . PHE B 1 130 ? 24.166  33.171  -73.305 1.00 34.06  ? 425 PHE B C   1 
ATOM   2828 O O   . PHE B 1 130 ? 23.180  33.184  -74.041 1.00 38.69  ? 425 PHE B O   1 
ATOM   2829 C CB  . PHE B 1 130 ? 25.070  35.151  -72.041 1.00 44.41  ? 425 PHE B CB  1 
ATOM   2830 C CG  . PHE B 1 130 ? 24.469  36.305  -72.796 1.00 44.22  ? 425 PHE B CG  1 
ATOM   2831 C CD1 . PHE B 1 130 ? 24.506  36.340  -74.178 1.00 46.18  ? 425 PHE B CD1 1 
ATOM   2832 C CD2 . PHE B 1 130 ? 23.877  37.357  -72.121 1.00 40.94  ? 425 PHE B CD2 1 
ATOM   2833 C CE1 . PHE B 1 130 ? 23.958  37.397  -74.871 1.00 42.87  ? 425 PHE B CE1 1 
ATOM   2834 C CE2 . PHE B 1 130 ? 23.329  38.421  -72.812 1.00 39.32  ? 425 PHE B CE2 1 
ATOM   2835 C CZ  . PHE B 1 130 ? 23.370  38.439  -74.190 1.00 37.08  ? 425 PHE B CZ  1 
ATOM   2836 N N   . ASP B 1 131 ? 25.279  32.516  -73.603 1.00 26.13  ? 426 ASP B N   1 
ATOM   2837 C CA  . ASP B 1 131 ? 25.414  31.737  -74.823 1.00 31.05  ? 426 ASP B CA  1 
ATOM   2838 C C   . ASP B 1 131 ? 24.351  30.644  -74.909 1.00 37.90  ? 426 ASP B C   1 
ATOM   2839 O O   . ASP B 1 131 ? 23.833  30.356  -75.988 1.00 40.94  ? 426 ASP B O   1 
ATOM   2840 C CB  . ASP B 1 131 ? 26.808  31.119  -74.914 1.00 31.59  ? 426 ASP B CB  1 
ATOM   2841 C CG  . ASP B 1 131 ? 27.877  32.138  -75.280 1.00 49.50  ? 426 ASP B CG  1 
ATOM   2842 O OD1 . ASP B 1 131 ? 27.526  33.235  -75.767 1.00 48.47  ? 426 ASP B OD1 1 
ATOM   2843 O OD2 . ASP B 1 131 ? 29.072  31.832  -75.088 1.00 53.16  ? 426 ASP B OD2 1 
ATOM   2844 N N   . MET B 1 132 ? 24.025  30.037  -73.772 1.00 40.04  ? 427 MET B N   1 
ATOM   2845 C CA  . MET B 1 132 ? 23.003  28.990  -73.744 1.00 43.24  ? 427 MET B CA  1 
ATOM   2846 C C   . MET B 1 132 ? 21.605  29.553  -73.969 1.00 38.38  ? 427 MET B C   1 
ATOM   2847 O O   . MET B 1 132 ? 20.776  28.925  -74.629 1.00 35.40  ? 427 MET B O   1 
ATOM   2848 C CB  . MET B 1 132 ? 23.048  28.216  -72.426 1.00 44.19  ? 427 MET B CB  1 
ATOM   2849 C CG  . MET B 1 132 ? 24.232  27.265  -72.309 1.00 48.05  ? 427 MET B CG  1 
ATOM   2850 S SD  . MET B 1 132 ? 24.146  26.246  -70.822 1.00 51.16  ? 427 MET B SD  1 
ATOM   2851 C CE  . MET B 1 132 ? 24.416  27.459  -69.532 1.00 43.32  ? 427 MET B CE  1 
ATOM   2852 N N   . LEU B 1 133 ? 21.345  30.734  -73.409 1.00 26.33  ? 428 LEU B N   1 
ATOM   2853 C CA  . LEU B 1 133 ? 20.060  31.395  -73.592 1.00 29.02  ? 428 LEU B CA  1 
ATOM   2854 C C   . LEU B 1 133 ? 19.848  31.748  -75.065 1.00 31.62  ? 428 LEU B C   1 
ATOM   2855 O O   . LEU B 1 133 ? 18.771  31.512  -75.626 1.00 31.28  ? 428 LEU B O   1 
ATOM   2856 C CB  . LEU B 1 133 ? 19.959  32.636  -72.702 1.00 27.99  ? 428 LEU B CB  1 
ATOM   2857 C CG  . LEU B 1 133 ? 19.836  32.312  -71.204 1.00 26.17  ? 428 LEU B CG  1 
ATOM   2858 C CD1 . LEU B 1 133 ? 20.163  33.515  -70.344 1.00 27.75  ? 428 LEU B CD1 1 
ATOM   2859 C CD2 . LEU B 1 133 ? 18.451  31.774  -70.884 1.00 21.35  ? 428 LEU B CD2 1 
ATOM   2860 N N   . LEU B 1 134 ? 20.882  32.305  -75.687 1.00 32.70  ? 429 LEU B N   1 
ATOM   2861 C CA  . LEU B 1 134 ? 20.858  32.609  -77.118 1.00 35.33  ? 429 LEU B CA  1 
ATOM   2862 C C   . LEU B 1 134 ? 20.567  31.369  -77.961 1.00 37.77  ? 429 LEU B C   1 
ATOM   2863 O O   . LEU B 1 134 ? 19.747  31.413  -78.885 1.00 39.97  ? 429 LEU B O   1 
ATOM   2864 C CB  . LEU B 1 134 ? 22.189  33.220  -77.558 1.00 40.54  ? 429 LEU B CB  1 
ATOM   2865 C CG  . LEU B 1 134 ? 22.425  34.691  -77.211 1.00 41.15  ? 429 LEU B CG  1 
ATOM   2866 C CD1 . LEU B 1 134 ? 23.846  35.090  -77.559 1.00 39.53  ? 429 LEU B CD1 1 
ATOM   2867 C CD2 . LEU B 1 134 ? 21.413  35.581  -77.929 1.00 43.21  ? 429 LEU B CD2 1 
ATOM   2868 N N   . ALA B 1 135 ? 21.240  30.268  -77.642 1.00 29.82  ? 430 ALA B N   1 
ATOM   2869 C CA  . ALA B 1 135 ? 21.049  29.025  -78.388 1.00 32.19  ? 430 ALA B CA  1 
ATOM   2870 C C   . ALA B 1 135 ? 19.602  28.545  -78.295 1.00 33.08  ? 430 ALA B C   1 
ATOM   2871 O O   . ALA B 1 135 ? 18.979  28.228  -79.306 1.00 38.49  ? 430 ALA B O   1 
ATOM   2872 C CB  . ALA B 1 135 ? 22.005  27.955  -77.888 1.00 27.51  ? 430 ALA B CB  1 
ATOM   2873 N N   . THR B 1 136 ? 19.068  28.514  -77.079 1.00 32.02  ? 431 THR B N   1 
ATOM   2874 C CA  . THR B 1 136 ? 17.682  28.131  -76.858 1.00 34.90  ? 431 THR B CA  1 
ATOM   2875 C C   . THR B 1 136 ? 16.735  29.005  -77.678 1.00 32.84  ? 431 THR B C   1 
ATOM   2876 O O   . THR B 1 136 ? 15.801  28.508  -78.301 1.00 29.70  ? 431 THR B O   1 
ATOM   2877 C CB  . THR B 1 136 ? 17.315  28.232  -75.373 1.00 32.85  ? 431 THR B CB  1 
ATOM   2878 O OG1 . THR B 1 136 ? 18.355  27.640  -74.586 1.00 33.80  ? 431 THR B OG1 1 
ATOM   2879 C CG2 . THR B 1 136 ? 16.000  27.515  -75.089 1.00 26.14  ? 431 THR B CG2 1 
ATOM   2880 N N   . SER B 1 137 ? 16.989  30.309  -77.684 1.00 31.36  ? 432 SER B N   1 
ATOM   2881 C CA  . SER B 1 137 ? 16.150  31.242  -78.426 1.00 31.23  ? 432 SER B CA  1 
ATOM   2882 C C   . SER B 1 137 ? 16.182  30.955  -79.924 1.00 35.92  ? 432 SER B C   1 
ATOM   2883 O O   . SER B 1 137 ? 15.151  31.000  -80.599 1.00 39.57  ? 432 SER B O   1 
ATOM   2884 C CB  . SER B 1 137 ? 16.583  32.682  -78.158 1.00 36.88  ? 432 SER B CB  1 
ATOM   2885 O OG  . SER B 1 137 ? 15.647  33.587  -78.712 1.00 39.47  ? 432 SER B OG  1 
ATOM   2886 N N   . SER B 1 138 ? 17.370  30.659  -80.441 1.00 34.29  ? 433 SER B N   1 
ATOM   2887 C CA  . SER B 1 138 ? 17.512  30.292  -81.845 1.00 38.60  ? 433 SER B CA  1 
ATOM   2888 C C   . SER B 1 138 ? 16.742  29.010  -82.148 1.00 37.52  ? 433 SER B C   1 
ATOM   2889 O O   . SER B 1 138 ? 16.090  28.900  -83.181 1.00 42.52  ? 433 SER B O   1 
ATOM   2890 C CB  . SER B 1 138 ? 18.986  30.102  -82.197 1.00 45.42  ? 433 SER B CB  1 
ATOM   2891 O OG  . SER B 1 138 ? 19.712  31.293  -81.939 1.00 55.99  ? 433 SER B OG  1 
ATOM   2892 N N   . ARG B 1 139 ? 16.825  28.046  -81.241 1.00 32.56  ? 434 ARG B N   1 
ATOM   2893 C CA  . ARG B 1 139 ? 16.142  26.770  -81.421 1.00 43.62  ? 434 ARG B CA  1 
ATOM   2894 C C   . ARG B 1 139 ? 14.639  26.982  -81.561 1.00 43.37  ? 434 ARG B C   1 
ATOM   2895 O O   . ARG B 1 139 ? 14.005  26.428  -82.457 1.00 48.76  ? 434 ARG B O   1 
ATOM   2896 C CB  . ARG B 1 139 ? 16.438  25.840  -80.247 1.00 48.09  ? 434 ARG B CB  1 
ATOM   2897 C CG  . ARG B 1 139 ? 15.767  24.486  -80.344 1.00 56.18  ? 434 ARG B CG  1 
ATOM   2898 C CD  . ARG B 1 139 ? 16.660  23.448  -81.007 1.00 61.30  ? 434 ARG B CD  1 
ATOM   2899 N NE  . ARG B 1 139 ? 15.986  22.155  -81.087 1.00 67.33  ? 434 ARG B NE  1 
ATOM   2900 C CZ  . ARG B 1 139 ? 15.371  21.701  -82.174 1.00 66.31  ? 434 ARG B CZ  1 
ATOM   2901 N NH1 . ARG B 1 139 ? 15.360  22.432  -83.281 1.00 68.89  ? 434 ARG B NH1 1 
ATOM   2902 N NH2 . ARG B 1 139 ? 14.775  20.514  -82.157 1.00 58.06  ? 434 ARG B NH2 1 
ATOM   2903 N N   . PHE B 1 140 ? 14.075  27.799  -80.680 1.00 43.07  ? 435 PHE B N   1 
ATOM   2904 C CA  . PHE B 1 140 ? 12.659  28.135  -80.753 1.00 39.76  ? 435 PHE B CA  1 
ATOM   2905 C C   . PHE B 1 140 ? 12.336  28.851  -82.056 1.00 35.65  ? 435 PHE B C   1 
ATOM   2906 O O   . PHE B 1 140 ? 11.291  28.618  -82.668 1.00 33.78  ? 435 PHE B O   1 
ATOM   2907 C CB  . PHE B 1 140 ? 12.255  29.007  -79.567 1.00 39.07  ? 435 PHE B CB  1 
ATOM   2908 C CG  . PHE B 1 140 ? 12.022  28.232  -78.309 1.00 41.16  ? 435 PHE B CG  1 
ATOM   2909 C CD1 . PHE B 1 140 ? 11.699  26.884  -78.363 1.00 43.57  ? 435 PHE B CD1 1 
ATOM   2910 C CD2 . PHE B 1 140 ? 12.092  28.852  -77.075 1.00 43.39  ? 435 PHE B CD2 1 
ATOM   2911 C CE1 . PHE B 1 140 ? 11.472  26.168  -77.206 1.00 41.90  ? 435 PHE B CE1 1 
ATOM   2912 C CE2 . PHE B 1 140 ? 11.871  28.143  -75.912 1.00 38.89  ? 435 PHE B CE2 1 
ATOM   2913 C CZ  . PHE B 1 140 ? 11.559  26.798  -75.976 1.00 41.91  ? 435 PHE B CZ  1 
ATOM   2914 N N   . ARG B 1 141 ? 13.237  29.732  -82.474 1.00 40.40  ? 436 ARG B N   1 
ATOM   2915 C CA  . ARG B 1 141 ? 13.077  30.433  -83.740 1.00 43.67  ? 436 ARG B CA  1 
ATOM   2916 C C   . ARG B 1 141 ? 13.010  29.399  -84.860 1.00 44.90  ? 436 ARG B C   1 
ATOM   2917 O O   . ARG B 1 141 ? 12.111  29.432  -85.698 1.00 44.76  ? 436 ARG B O   1 
ATOM   2918 C CB  . ARG B 1 141 ? 14.251  31.389  -83.965 1.00 44.16  ? 436 ARG B CB  1 
ATOM   2919 C CG  . ARG B 1 141 ? 14.038  32.407  -85.079 1.00 42.88  ? 436 ARG B CG  1 
ATOM   2920 C CD  . ARG B 1 141 ? 15.313  33.203  -85.349 1.00 41.11  ? 436 ARG B CD  1 
ATOM   2921 N NE  . ARG B 1 141 ? 15.860  33.777  -84.122 1.00 59.57  ? 436 ARG B NE  1 
ATOM   2922 C CZ  . ARG B 1 141 ? 17.091  33.564  -83.665 1.00 60.78  ? 436 ARG B CZ  1 
ATOM   2923 N NH1 . ARG B 1 141 ? 17.937  32.791  -84.337 1.00 59.19  ? 436 ARG B NH1 1 
ATOM   2924 N NH2 . ARG B 1 141 ? 17.476  34.136  -82.533 1.00 59.92  ? 436 ARG B NH2 1 
ATOM   2925 N N   . MET B 1 142 ? 13.963  28.471  -84.851 1.00 35.29  ? 437 MET B N   1 
ATOM   2926 C CA  . MET B 1 142 ? 14.055  27.451  -85.887 1.00 43.53  ? 437 MET B CA  1 
ATOM   2927 C C   . MET B 1 142 ? 12.801  26.592  -85.930 1.00 49.49  ? 437 MET B C   1 
ATOM   2928 O O   . MET B 1 142 ? 12.310  26.250  -87.006 1.00 47.03  ? 437 MET B O   1 
ATOM   2929 C CB  . MET B 1 142 ? 15.281  26.562  -85.668 1.00 52.31  ? 437 MET B CB  1 
ATOM   2930 C CG  . MET B 1 142 ? 16.612  27.301  -85.721 1.00 61.04  ? 437 MET B CG  1 
ATOM   2931 S SD  . MET B 1 142 ? 16.852  28.220  -87.255 1.00 150.88 ? 437 MET B SD  1 
ATOM   2932 C CE  . MET B 1 142 ? 16.725  26.906  -88.465 1.00 106.02 ? 437 MET B CE  1 
ATOM   2933 N N   . MET B 1 143 ? 12.287  26.240  -84.755 1.00 43.40  ? 438 MET B N   1 
ATOM   2934 C CA  . MET B 1 143 ? 11.103  25.390  -84.667 1.00 44.20  ? 438 MET B CA  1 
ATOM   2935 C C   . MET B 1 143 ? 9.822   26.158  -84.947 1.00 40.54  ? 438 MET B C   1 
ATOM   2936 O O   . MET B 1 143 ? 8.746   25.564  -85.008 1.00 41.35  ? 438 MET B O   1 
ATOM   2937 C CB  . MET B 1 143 ? 10.988  24.764  -83.282 1.00 42.49  ? 438 MET B CB  1 
ATOM   2938 C CG  . MET B 1 143 ? 12.108  23.833  -82.909 1.00 41.89  ? 438 MET B CG  1 
ATOM   2939 S SD  . MET B 1 143 ? 11.710  23.052  -81.344 1.00 46.46  ? 438 MET B SD  1 
ATOM   2940 C CE  . MET B 1 143 ? 10.402  21.933  -81.857 1.00 37.19  ? 438 MET B CE  1 
ATOM   2941 N N   . ASN B 1 144 ? 9.935   27.473  -85.093 1.00 34.35  ? 439 ASN B N   1 
ATOM   2942 C CA  . ASN B 1 144 ? 8.764   28.311  -85.303 1.00 39.58  ? 439 ASN B CA  1 
ATOM   2943 C C   . ASN B 1 144 ? 7.775   28.158  -84.149 1.00 38.57  ? 439 ASN B C   1 
ATOM   2944 O O   . ASN B 1 144 ? 6.566   28.018  -84.356 1.00 38.08  ? 439 ASN B O   1 
ATOM   2945 C CB  . ASN B 1 144 ? 8.099   27.963  -86.636 1.00 44.38  ? 439 ASN B CB  1 
ATOM   2946 C CG  . ASN B 1 144 ? 6.993   28.924  -87.004 1.00 52.47  ? 439 ASN B CG  1 
ATOM   2947 O OD1 . ASN B 1 144 ? 7.112   30.132  -86.801 1.00 60.10  ? 439 ASN B OD1 1 
ATOM   2948 N ND2 . ASN B 1 144 ? 5.905   28.393  -87.552 1.00 51.34  ? 439 ASN B ND2 1 
ATOM   2949 N N   . LEU B 1 145 ? 8.300   28.176  -82.927 1.00 36.76  ? 440 LEU B N   1 
ATOM   2950 C CA  . LEU B 1 145 ? 7.472   28.012  -81.741 1.00 31.14  ? 440 LEU B CA  1 
ATOM   2951 C C   . LEU B 1 145 ? 6.309   28.996  -81.765 1.00 36.80  ? 440 LEU B C   1 
ATOM   2952 O O   . LEU B 1 145 ? 6.490   30.170  -82.077 1.00 38.60  ? 440 LEU B O   1 
ATOM   2953 C CB  . LEU B 1 145 ? 8.304   28.215  -80.466 1.00 32.10  ? 440 LEU B CB  1 
ATOM   2954 C CG  . LEU B 1 145 ? 7.527   28.088  -79.146 1.00 36.62  ? 440 LEU B CG  1 
ATOM   2955 C CD1 . LEU B 1 145 ? 7.053   26.652  -78.947 1.00 40.64  ? 440 LEU B CD1 1 
ATOM   2956 C CD2 . LEU B 1 145 ? 8.365   28.528  -77.967 1.00 35.19  ? 440 LEU B CD2 1 
ATOM   2957 N N   . GLN B 1 146 ? 5.118   28.512  -81.434 1.00 38.54  ? 441 GLN B N   1 
ATOM   2958 C CA  . GLN B 1 146 ? 3.926   29.359  -81.392 1.00 34.07  ? 441 GLN B CA  1 
ATOM   2959 C C   . GLN B 1 146 ? 3.572   29.821  -79.974 1.00 33.11  ? 441 GLN B C   1 
ATOM   2960 O O   . GLN B 1 146 ? 3.863   29.136  -78.988 1.00 31.13  ? 441 GLN B O   1 
ATOM   2961 C CB  . GLN B 1 146 ? 2.735   28.620  -82.012 1.00 39.47  ? 441 GLN B CB  1 
ATOM   2962 C CG  . GLN B 1 146 ? 2.962   28.217  -83.453 1.00 44.96  ? 441 GLN B CG  1 
ATOM   2963 C CD  . GLN B 1 146 ? 3.092   29.416  -84.366 1.00 52.31  ? 441 GLN B CD  1 
ATOM   2964 O OE1 . GLN B 1 146 ? 2.139   30.176  -84.539 1.00 62.27  ? 441 GLN B OE1 1 
ATOM   2965 N NE2 . GLN B 1 146 ? 4.272   29.593  -84.961 1.00 41.21  ? 441 GLN B NE2 1 
ATOM   2966 N N   . GLY B 1 147 ? 2.927   30.981  -79.883 1.00 36.32  ? 442 GLY B N   1 
ATOM   2967 C CA  . GLY B 1 147 ? 2.526   31.539  -78.604 1.00 32.89  ? 442 GLY B CA  1 
ATOM   2968 C C   . GLY B 1 147 ? 1.695   30.562  -77.796 1.00 34.36  ? 442 GLY B C   1 
ATOM   2969 O O   . GLY B 1 147 ? 1.882   30.413  -76.589 1.00 39.12  ? 442 GLY B O   1 
ATOM   2970 N N   . GLU B 1 148 ? 0.769   29.888  -78.467 1.00 28.68  ? 443 GLU B N   1 
ATOM   2971 C CA  . GLU B 1 148 ? -0.087  28.916  -77.802 1.00 27.46  ? 443 GLU B CA  1 
ATOM   2972 C C   . GLU B 1 148 ? 0.709   27.755  -77.221 1.00 31.34  ? 443 GLU B C   1 
ATOM   2973 O O   . GLU B 1 148 ? 0.317   27.179  -76.207 1.00 37.33  ? 443 GLU B O   1 
ATOM   2974 C CB  . GLU B 1 148 ? -1.158  28.382  -78.753 1.00 28.91  ? 443 GLU B CB  1 
ATOM   2975 C CG  . GLU B 1 148 ? -2.211  29.398  -79.147 1.00 44.18  ? 443 GLU B CG  1 
ATOM   2976 C CD  . GLU B 1 148 ? -1.804  30.221  -80.350 1.00 53.85  ? 443 GLU B CD  1 
ATOM   2977 O OE1 . GLU B 1 148 ? -0.713  29.969  -80.903 1.00 48.89  ? 443 GLU B OE1 1 
ATOM   2978 O OE2 . GLU B 1 148 ? -2.583  31.114  -80.745 1.00 63.85  ? 443 GLU B OE2 1 
ATOM   2979 N N   . GLU B 1 149 ? 1.808   27.400  -77.881 1.00 34.74  ? 444 GLU B N   1 
ATOM   2980 C CA  . GLU B 1 149 ? 2.680   26.319  -77.409 1.00 36.25  ? 444 GLU B CA  1 
ATOM   2981 C C   . GLU B 1 149 ? 3.545   26.800  -76.246 1.00 35.68  ? 444 GLU B C   1 
ATOM   2982 O O   . GLU B 1 149 ? 3.776   26.068  -75.281 1.00 30.45  ? 444 GLU B O   1 
ATOM   2983 C CB  . GLU B 1 149 ? 3.591   25.819  -78.533 1.00 32.93  ? 444 GLU B CB  1 
ATOM   2984 C CG  . GLU B 1 149 ? 2.858   25.207  -79.711 1.00 38.51  ? 444 GLU B CG  1 
ATOM   2985 C CD  . GLU B 1 149 ? 3.794   24.801  -80.838 1.00 37.41  ? 444 GLU B CD  1 
ATOM   2986 O OE1 . GLU B 1 149 ? 4.743   25.564  -81.139 1.00 36.20  ? 444 GLU B OE1 1 
ATOM   2987 O OE2 . GLU B 1 149 ? 3.571   23.726  -81.438 1.00 28.90  ? 444 GLU B OE2 1 
ATOM   2988 N N   . PHE B 1 150 ? 4.023   28.038  -76.360 1.00 35.68  ? 445 PHE B N   1 
ATOM   2989 C CA  . PHE B 1 150 ? 4.811   28.679  -75.311 1.00 30.47  ? 445 PHE B CA  1 
ATOM   2990 C C   . PHE B 1 150 ? 4.108   28.687  -73.952 1.00 28.74  ? 445 PHE B C   1 
ATOM   2991 O O   . PHE B 1 150 ? 4.706   28.314  -72.941 1.00 27.23  ? 445 PHE B O   1 
ATOM   2992 C CB  . PHE B 1 150 ? 5.180   30.099  -75.733 1.00 26.59  ? 445 PHE B CB  1 
ATOM   2993 C CG  . PHE B 1 150 ? 5.620   30.989  -74.593 1.00 30.18  ? 445 PHE B CG  1 
ATOM   2994 C CD1 . PHE B 1 150 ? 6.911   30.919  -74.094 1.00 37.48  ? 445 PHE B CD1 1 
ATOM   2995 C CD2 . PHE B 1 150 ? 4.753   31.919  -74.051 1.00 33.48  ? 445 PHE B CD2 1 
ATOM   2996 C CE1 . PHE B 1 150 ? 7.322   31.750  -73.056 1.00 28.27  ? 445 PHE B CE1 1 
ATOM   2997 C CE2 . PHE B 1 150 ? 5.156   32.751  -73.019 1.00 35.73  ? 445 PHE B CE2 1 
ATOM   2998 C CZ  . PHE B 1 150 ? 6.448   32.661  -72.521 1.00 29.49  ? 445 PHE B CZ  1 
ATOM   2999 N N   . VAL B 1 151 ? 2.852   29.122  -73.917 1.00 30.32  ? 446 VAL B N   1 
ATOM   3000 C CA  . VAL B 1 151 ? 2.124   29.174  -72.650 1.00 27.31  ? 446 VAL B CA  1 
ATOM   3001 C C   . VAL B 1 151 ? 1.939   27.784  -72.052 1.00 31.82  ? 446 VAL B C   1 
ATOM   3002 O O   . VAL B 1 151 ? 2.008   27.605  -70.831 1.00 31.85  ? 446 VAL B O   1 
ATOM   3003 C CB  . VAL B 1 151 ? 0.769   29.930  -72.765 1.00 33.84  ? 446 VAL B CB  1 
ATOM   3004 C CG1 . VAL B 1 151 ? 1.014   31.411  -73.027 1.00 29.81  ? 446 VAL B CG1 1 
ATOM   3005 C CG2 . VAL B 1 151 ? -0.118  29.322  -73.846 1.00 28.18  ? 446 VAL B CG2 1 
ATOM   3006 N N   . CYS B 1 152 ? 1.729   26.789  -72.912 1.00 28.95  ? 447 CYS B N   1 
ATOM   3007 C CA  . CYS B 1 152 ? 1.689   25.409  -72.448 1.00 31.10  ? 447 CYS B CA  1 
ATOM   3008 C C   . CYS B 1 152 ? 3.016   25.001  -71.815 1.00 29.38  ? 447 CYS B C   1 
ATOM   3009 O O   . CYS B 1 152 ? 3.035   24.415  -70.732 1.00 30.33  ? 447 CYS B O   1 
ATOM   3010 C CB  . CYS B 1 152 ? 1.315   24.454  -73.590 1.00 33.18  ? 447 CYS B CB  1 
ATOM   3011 S SG  . CYS B 1 152 ? -0.448  24.547  -74.089 1.00 35.16  ? 447 CYS B SG  1 
ATOM   3012 N N   . LEU B 1 153 ? 4.122   25.308  -72.490 1.00 24.13  ? 448 LEU B N   1 
ATOM   3013 C CA  . LEU B 1 153 ? 5.450   24.914  -71.989 1.00 26.12  ? 448 LEU B CA  1 
ATOM   3014 C C   . LEU B 1 153 ? 5.790   25.587  -70.664 1.00 30.96  ? 448 LEU B C   1 
ATOM   3015 O O   . LEU B 1 153 ? 6.365   24.964  -69.764 1.00 28.85  ? 448 LEU B O   1 
ATOM   3016 C CB  . LEU B 1 153 ? 6.542   25.224  -73.008 1.00 28.88  ? 448 LEU B CB  1 
ATOM   3017 C CG  . LEU B 1 153 ? 6.584   24.364  -74.271 1.00 35.83  ? 448 LEU B CG  1 
ATOM   3018 C CD1 . LEU B 1 153 ? 7.594   24.946  -75.247 1.00 34.12  ? 448 LEU B CD1 1 
ATOM   3019 C CD2 . LEU B 1 153 ? 6.924   22.913  -73.935 1.00 34.49  ? 448 LEU B CD2 1 
ATOM   3020 N N   . LYS B 1 154 ? 5.446   26.866  -70.552 1.00 24.07  ? 449 LYS B N   1 
ATOM   3021 C CA  . LYS B 1 154 ? 5.711   27.603  -69.331 1.00 25.05  ? 449 LYS B CA  1 
ATOM   3022 C C   . LYS B 1 154 ? 4.916   27.017  -68.158 1.00 26.74  ? 449 LYS B C   1 
ATOM   3023 O O   . LYS B 1 154 ? 5.418   26.924  -67.042 1.00 26.73  ? 449 LYS B O   1 
ATOM   3024 C CB  . LYS B 1 154 ? 5.397   29.098  -69.528 1.00 27.37  ? 449 LYS B CB  1 
ATOM   3025 C CG  . LYS B 1 154 ? 5.929   29.997  -68.419 1.00 27.20  ? 449 LYS B CG  1 
ATOM   3026 C CD  . LYS B 1 154 ? 5.897   31.478  -68.816 1.00 32.80  ? 449 LYS B CD  1 
ATOM   3027 C CE  . LYS B 1 154 ? 4.494   31.942  -69.216 1.00 34.62  ? 449 LYS B CE  1 
ATOM   3028 N NZ  . LYS B 1 154 ? 4.360   33.435  -69.145 1.00 37.10  ? 449 LYS B NZ  1 
ATOM   3029 N N   . SER B 1 155 ? 3.670   26.618  -68.415 1.00 28.59  ? 450 SER B N   1 
ATOM   3030 C CA  . SER B 1 155 ? 2.837   25.999  -67.382 1.00 31.91  ? 450 SER B CA  1 
ATOM   3031 C C   . SER B 1 155 ? 3.362   24.623  -66.983 1.00 30.50  ? 450 SER B C   1 
ATOM   3032 O O   . SER B 1 155 ? 3.321   24.244  -65.809 1.00 27.13  ? 450 SER B O   1 
ATOM   3033 C CB  . SER B 1 155 ? 1.386   25.879  -67.852 1.00 34.70  ? 450 SER B CB  1 
ATOM   3034 O OG  . SER B 1 155 ? 0.800   27.167  -67.960 1.00 46.03  ? 450 SER B OG  1 
ATOM   3035 N N   . ILE B 1 156 ? 3.852   23.878  -67.966 1.00 21.91  ? 451 ILE B N   1 
ATOM   3036 C CA  . ILE B 1 156 ? 4.488   22.594  -67.703 1.00 26.06  ? 451 ILE B CA  1 
ATOM   3037 C C   . ILE B 1 156 ? 5.697   22.767  -66.787 1.00 29.11  ? 451 ILE B C   1 
ATOM   3038 O O   . ILE B 1 156 ? 5.903   21.981  -65.858 1.00 25.73  ? 451 ILE B O   1 
ATOM   3039 C CB  . ILE B 1 156 ? 4.906   21.908  -69.016 1.00 25.78  ? 451 ILE B CB  1 
ATOM   3040 C CG1 . ILE B 1 156 ? 3.666   21.326  -69.710 1.00 22.34  ? 451 ILE B CG1 1 
ATOM   3041 C CG2 . ILE B 1 156 ? 5.944   20.827  -68.744 1.00 23.28  ? 451 ILE B CG2 1 
ATOM   3042 C CD1 . ILE B 1 156 ? 3.950   20.732  -71.085 1.00 23.15  ? 451 ILE B CD1 1 
ATOM   3043 N N   . ILE B 1 157 ? 6.486   23.810  -67.032 1.00 27.13  ? 452 ILE B N   1 
ATOM   3044 C CA  . ILE B 1 157 ? 7.663   24.069  -66.209 1.00 23.08  ? 452 ILE B CA  1 
ATOM   3045 C C   . ILE B 1 157 ? 7.259   24.289  -64.760 1.00 30.35  ? 452 ILE B C   1 
ATOM   3046 O O   . ILE B 1 157 ? 7.901   23.787  -63.831 1.00 26.58  ? 452 ILE B O   1 
ATOM   3047 C CB  . ILE B 1 157 ? 8.403   25.317  -66.681 1.00 25.61  ? 452 ILE B CB  1 
ATOM   3048 C CG1 . ILE B 1 157 ? 9.105   25.048  -68.012 1.00 25.53  ? 452 ILE B CG1 1 
ATOM   3049 C CG2 . ILE B 1 157 ? 9.388   25.777  -65.614 1.00 24.86  ? 452 ILE B CG2 1 
ATOM   3050 C CD1 . ILE B 1 157 ? 9.834   26.241  -68.556 1.00 28.29  ? 452 ILE B CD1 1 
ATOM   3051 N N   . LEU B 1 158 ? 6.184   25.055  -64.586 1.00 24.74  ? 453 LEU B N   1 
ATOM   3052 C CA  . LEU B 1 158 ? 5.683   25.413  -63.272 1.00 28.04  ? 453 LEU B CA  1 
ATOM   3053 C C   . LEU B 1 158 ? 5.264   24.182  -62.486 1.00 33.33  ? 453 LEU B C   1 
ATOM   3054 O O   . LEU B 1 158 ? 5.610   24.030  -61.313 1.00 29.12  ? 453 LEU B O   1 
ATOM   3055 C CB  . LEU B 1 158 ? 4.484   26.355  -63.419 1.00 28.79  ? 453 LEU B CB  1 
ATOM   3056 C CG  . LEU B 1 158 ? 3.725   26.671  -62.128 1.00 32.91  ? 453 LEU B CG  1 
ATOM   3057 C CD1 . LEU B 1 158 ? 4.607   27.469  -61.183 1.00 32.27  ? 453 LEU B CD1 1 
ATOM   3058 C CD2 . LEU B 1 158 ? 2.427   27.416  -62.432 1.00 28.32  ? 453 LEU B CD2 1 
ATOM   3059 N N   . LEU B 1 159 ? 4.504   23.307  -63.139 1.00 31.33  ? 454 LEU B N   1 
ATOM   3060 C CA  . LEU B 1 159 ? 3.961   22.127  -62.472 1.00 27.60  ? 454 LEU B CA  1 
ATOM   3061 C C   . LEU B 1 159 ? 4.993   21.007  -62.356 1.00 30.18  ? 454 LEU B C   1 
ATOM   3062 O O   . LEU B 1 159 ? 4.994   20.261  -61.377 1.00 34.03  ? 454 LEU B O   1 
ATOM   3063 C CB  . LEU B 1 159 ? 2.706   21.630  -63.203 1.00 27.07  ? 454 LEU B CB  1 
ATOM   3064 C CG  . LEU B 1 159 ? 1.567   22.659  -63.283 1.00 34.92  ? 454 LEU B CG  1 
ATOM   3065 C CD1 . LEU B 1 159 ? 0.524   22.255  -64.313 1.00 40.48  ? 454 LEU B CD1 1 
ATOM   3066 C CD2 . LEU B 1 159 ? 0.934   22.867  -61.916 1.00 30.23  ? 454 LEU B CD2 1 
ATOM   3067 N N   . ASN B 1 160 ? 5.888   20.906  -63.335 1.00 29.59  ? 455 ASN B N   1 
ATOM   3068 C CA  . ASN B 1 160 ? 6.839   19.790  -63.380 1.00 35.14  ? 455 ASN B CA  1 
ATOM   3069 C C   . ASN B 1 160 ? 8.089   19.935  -62.515 1.00 39.08  ? 455 ASN B C   1 
ATOM   3070 O O   . ASN B 1 160 ? 8.556   18.963  -61.924 1.00 38.70  ? 455 ASN B O   1 
ATOM   3071 C CB  . ASN B 1 160 ? 7.280   19.503  -64.818 1.00 31.89  ? 455 ASN B CB  1 
ATOM   3072 C CG  . ASN B 1 160 ? 8.248   18.342  -64.904 1.00 32.62  ? 455 ASN B CG  1 
ATOM   3073 O OD1 . ASN B 1 160 ? 9.356   18.476  -65.417 1.00 38.15  ? 455 ASN B OD1 1 
ATOM   3074 N ND2 . ASN B 1 160 ? 7.835   17.191  -64.391 1.00 28.39  ? 455 ASN B ND2 1 
ATOM   3075 N N   . SER B 1 161 ? 8.635   21.141  -62.442 1.00 36.38  ? 456 SER B N   1 
ATOM   3076 C CA  . SER B 1 161 ? 9.980   21.310  -61.903 1.00 41.88  ? 456 SER B CA  1 
ATOM   3077 C C   . SER B 1 161 ? 10.182  20.874  -60.450 1.00 37.85  ? 456 SER B C   1 
ATOM   3078 O O   . SER B 1 161 ? 11.225  20.315  -60.105 1.00 46.21  ? 456 SER B O   1 
ATOM   3079 C CB  . SER B 1 161 ? 10.475  22.738  -62.127 1.00 43.44  ? 456 SER B CB  1 
ATOM   3080 O OG  . SER B 1 161 ? 10.722  22.941  -63.509 1.00 44.84  ? 456 SER B OG  1 
ATOM   3081 N N   . GLY B 1 162 ? 9.195   21.118  -59.601 1.00 31.81  ? 457 GLY B N   1 
ATOM   3082 C CA  . GLY B 1 162 ? 9.324   20.785  -58.194 1.00 37.48  ? 457 GLY B CA  1 
ATOM   3083 C C   . GLY B 1 162 ? 8.506   19.588  -57.731 1.00 44.66  ? 457 GLY B C   1 
ATOM   3084 O O   . GLY B 1 162 ? 8.467   19.290  -56.536 1.00 47.12  ? 457 GLY B O   1 
ATOM   3085 N N   . VAL B 1 163 ? 7.862   18.888  -58.663 1.00 41.23  ? 458 VAL B N   1 
ATOM   3086 C CA  . VAL B 1 163 ? 6.950   17.806  -58.282 1.00 52.42  ? 458 VAL B CA  1 
ATOM   3087 C C   . VAL B 1 163 ? 7.650   16.564  -57.717 1.00 60.10  ? 458 VAL B C   1 
ATOM   3088 O O   . VAL B 1 163 ? 7.146   15.936  -56.788 1.00 64.81  ? 458 VAL B O   1 
ATOM   3089 C CB  . VAL B 1 163 ? 6.015   17.389  -59.441 1.00 49.00  ? 458 VAL B CB  1 
ATOM   3090 C CG1 . VAL B 1 163 ? 6.816   16.784  -60.589 1.00 41.97  ? 458 VAL B CG1 1 
ATOM   3091 C CG2 . VAL B 1 163 ? 4.961   16.408  -58.941 1.00 50.05  ? 458 VAL B CG2 1 
ATOM   3092 N N   . TYR B 1 164 ? 8.807   16.214  -58.272 1.00 63.80  ? 459 TYR B N   1 
ATOM   3093 C CA  . TYR B 1 164 ? 9.510   15.002  -57.859 1.00 69.42  ? 459 TYR B CA  1 
ATOM   3094 C C   . TYR B 1 164 ? 10.130  15.138  -56.477 1.00 75.24  ? 459 TYR B C   1 
ATOM   3095 O O   . TYR B 1 164 ? 10.662  14.176  -55.933 1.00 83.81  ? 459 TYR B O   1 
ATOM   3096 C CB  . TYR B 1 164 ? 10.587  14.626  -58.877 1.00 69.31  ? 459 TYR B CB  1 
ATOM   3097 C CG  . TYR B 1 164 ? 10.064  14.559  -60.289 1.00 71.63  ? 459 TYR B CG  1 
ATOM   3098 C CD1 . TYR B 1 164 ? 10.309  15.591  -61.188 1.00 76.62  ? 459 TYR B CD1 1 
ATOM   3099 C CD2 . TYR B 1 164 ? 9.304   13.478  -60.717 1.00 67.69  ? 459 TYR B CD2 1 
ATOM   3100 C CE1 . TYR B 1 164 ? 9.826   15.542  -62.479 1.00 77.33  ? 459 TYR B CE1 1 
ATOM   3101 C CE2 . TYR B 1 164 ? 8.813   13.418  -62.006 1.00 68.11  ? 459 TYR B CE2 1 
ATOM   3102 C CZ  . TYR B 1 164 ? 9.076   14.451  -62.883 1.00 71.67  ? 459 TYR B CZ  1 
ATOM   3103 O OH  . TYR B 1 164 ? 8.586   14.396  -64.167 1.00 66.71  ? 459 TYR B OH  1 
ATOM   3104 N N   . THR B 1 165 ? 10.061  16.333  -55.907 1.00 114.39 ? 460 THR B N   1 
ATOM   3105 C CA  . THR B 1 165 ? 10.656  16.561  -54.599 1.00 110.00 ? 460 THR B CA  1 
ATOM   3106 C C   . THR B 1 165 ? 9.613   16.963  -53.559 1.00 113.53 ? 460 THR B C   1 
ATOM   3107 O O   . THR B 1 165 ? 9.858   17.830  -52.719 1.00 116.41 ? 460 THR B O   1 
ATOM   3108 C CB  . THR B 1 165 ? 11.795  17.600  -54.668 1.00 107.35 ? 460 THR B CB  1 
ATOM   3109 O OG1 . THR B 1 165 ? 11.274  18.863  -55.100 1.00 97.00  ? 460 THR B OG1 1 
ATOM   3110 C CG2 . THR B 1 165 ? 12.874  17.140  -55.644 1.00 91.75  ? 460 THR B CG2 1 
ATOM   3111 N N   . PHE B 1 166 ? 8.449   16.322  -53.624 1.00 116.03 ? 461 PHE B N   1 
ATOM   3112 C CA  . PHE B 1 166 ? 7.423   16.493  -52.599 1.00 116.32 ? 461 PHE B CA  1 
ATOM   3113 C C   . PHE B 1 166 ? 7.749   15.779  -51.272 1.00 122.03 ? 461 PHE B C   1 
ATOM   3114 O O   . PHE B 1 166 ? 7.674   16.405  -50.227 1.00 125.99 ? 461 PHE B O   1 
ATOM   3115 C CB  . PHE B 1 166 ? 6.028   16.117  -53.114 1.00 111.51 ? 461 PHE B CB  1 
ATOM   3116 C CG  . PHE B 1 166 ? 5.356   17.206  -53.914 1.00 105.91 ? 461 PHE B CG  1 
ATOM   3117 C CD1 . PHE B 1 166 ? 5.274   18.499  -53.424 1.00 103.89 ? 461 PHE B CD1 1 
ATOM   3118 C CD2 . PHE B 1 166 ? 4.789   16.928  -55.143 1.00 102.51 ? 461 PHE B CD2 1 
ATOM   3119 C CE1 . PHE B 1 166 ? 4.652   19.493  -54.156 1.00 98.89  ? 461 PHE B CE1 1 
ATOM   3120 C CE2 . PHE B 1 166 ? 4.167   17.915  -55.873 1.00 97.41  ? 461 PHE B CE2 1 
ATOM   3121 C CZ  . PHE B 1 166 ? 4.097   19.198  -55.380 1.00 95.67  ? 461 PHE B CZ  1 
ATOM   3122 N N   . LEU B 1 167 ? 8.096   14.495  -51.242 1.00 126.28 ? 462 LEU B N   1 
ATOM   3123 C CA  . LEU B 1 167 ? 8.085   13.551  -52.336 1.00 129.11 ? 462 LEU B CA  1 
ATOM   3124 C C   . LEU B 1 167 ? 8.054   12.219  -51.604 1.00 134.18 ? 462 LEU B C   1 
ATOM   3125 O O   . LEU B 1 167 ? 8.941   11.383  -51.778 1.00 131.17 ? 462 LEU B O   1 
ATOM   3126 C CB  . LEU B 1 167 ? 9.371   13.653  -53.150 1.00 129.63 ? 462 LEU B CB  1 
ATOM   3127 N N   . SER B 1 168 ? 7.047   12.042  -50.750 1.00 130.39 ? 463 SER B N   1 
ATOM   3128 C CA  . SER B 1 168 ? 6.980   10.865  -49.893 1.00 126.66 ? 463 SER B CA  1 
ATOM   3129 C C   . SER B 1 168 ? 5.746   10.835  -48.995 1.00 122.23 ? 463 SER B C   1 
ATOM   3130 O O   . SER B 1 168 ? 5.072   11.848  -48.799 1.00 120.83 ? 463 SER B O   1 
ATOM   3131 C CB  . SER B 1 168 ? 8.235   10.781  -49.019 1.00 124.47 ? 463 SER B CB  1 
ATOM   3132 N N   . SER B 1 169 ? 5.462   9.648   -48.466 1.00 122.23 ? 464 SER B N   1 
ATOM   3133 C CA  . SER B 1 169 ? 4.507   9.461   -47.376 1.00 121.87 ? 464 SER B CA  1 
ATOM   3134 C C   . SER B 1 169 ? 3.056   9.825   -47.678 1.00 121.23 ? 464 SER B C   1 
ATOM   3135 O O   . SER B 1 169 ? 2.559   9.639   -48.788 1.00 121.54 ? 464 SER B O   1 
ATOM   3136 C CB  . SER B 1 169 ? 4.968   10.229  -46.130 1.00 123.33 ? 464 SER B CB  1 
ATOM   3137 O OG  . SER B 1 169 ? 6.206   9.739   -45.647 1.00 126.52 ? 464 SER B OG  1 
ATOM   3138 N N   . THR B 1 170 ? 2.406   10.340  -46.639 1.00 118.69 ? 465 THR B N   1 
ATOM   3139 C CA  . THR B 1 170 ? 0.985   10.696  -46.594 1.00 115.57 ? 465 THR B CA  1 
ATOM   3140 C C   . THR B 1 170 ? 0.159   10.604  -47.880 1.00 113.83 ? 465 THR B C   1 
ATOM   3141 O O   . THR B 1 170 ? 0.576   11.057  -48.945 1.00 114.79 ? 465 THR B O   1 
ATOM   3142 C CB  . THR B 1 170 ? 0.797   12.101  -45.980 1.00 114.87 ? 465 THR B CB  1 
ATOM   3143 O OG1 . THR B 1 170 ? -0.516  12.586  -46.285 1.00 115.26 ? 465 THR B OG1 1 
ATOM   3144 C CG2 . THR B 1 170 ? 1.829   13.066  -46.538 1.00 112.43 ? 465 THR B CG2 1 
ATOM   3145 N N   . LEU B 1 171 ? -1.034  10.030  -47.743 1.00 112.07 ? 466 LEU B N   1 
ATOM   3146 C CA  . LEU B 1 171 ? -2.010  9.944   -48.827 1.00 110.48 ? 466 LEU B CA  1 
ATOM   3147 C C   . LEU B 1 171 ? -2.242  11.294  -49.506 1.00 106.80 ? 466 LEU B C   1 
ATOM   3148 O O   . LEU B 1 171 ? -2.373  11.370  -50.728 1.00 104.30 ? 466 LEU B O   1 
ATOM   3149 C CB  . LEU B 1 171 ? -3.335  9.391   -48.291 1.00 110.07 ? 466 LEU B CB  1 
ATOM   3150 C CG  . LEU B 1 171 ? -4.618  9.648   -49.086 1.00 107.83 ? 466 LEU B CG  1 
ATOM   3151 C CD1 . LEU B 1 171 ? -4.534  9.050   -50.484 1.00 107.75 ? 466 LEU B CD1 1 
ATOM   3152 C CD2 . LEU B 1 171 ? -5.825  9.100   -48.338 1.00 104.78 ? 466 LEU B CD2 1 
ATOM   3153 N N   . LYS B 1 172 ? -2.298  12.356  -48.708 1.00 71.45  ? 467 LYS B N   1 
ATOM   3154 C CA  . LYS B 1 172 ? -2.489  13.700  -49.238 1.00 69.09  ? 467 LYS B CA  1 
ATOM   3155 C C   . LYS B 1 172 ? -1.332  14.097  -50.154 1.00 68.81  ? 467 LYS B C   1 
ATOM   3156 O O   . LYS B 1 172 ? -1.546  14.673  -51.222 1.00 65.02  ? 467 LYS B O   1 
ATOM   3157 C CB  . LYS B 1 172 ? -2.640  14.712  -48.101 1.00 67.21  ? 467 LYS B CB  1 
ATOM   3158 N N   . SER B 1 173 ? -0.108  13.785  -49.735 1.00 68.61  ? 468 SER B N   1 
ATOM   3159 C CA  . SER B 1 173 ? 1.066   14.069  -50.551 1.00 69.25  ? 468 SER B CA  1 
ATOM   3160 C C   . SER B 1 173 ? 0.970   13.344  -51.891 1.00 65.77  ? 468 SER B C   1 
ATOM   3161 O O   . SER B 1 173 ? 1.321   13.894  -52.936 1.00 67.31  ? 468 SER B O   1 
ATOM   3162 C CB  . SER B 1 173 ? 2.348   13.661  -49.823 1.00 77.50  ? 468 SER B CB  1 
ATOM   3163 O OG  . SER B 1 173 ? 3.498   13.985  -50.591 1.00 85.90  ? 468 SER B OG  1 
ATOM   3164 N N   . LEU B 1 174 ? 0.490   12.106  -51.851 1.00 58.08  ? 469 LEU B N   1 
ATOM   3165 C CA  . LEU B 1 174 ? 0.285   11.326  -53.066 1.00 64.97  ? 469 LEU B CA  1 
ATOM   3166 C C   . LEU B 1 174 ? -0.795  11.942  -53.953 1.00 70.29  ? 469 LEU B C   1 
ATOM   3167 O O   . LEU B 1 174 ? -0.633  12.027  -55.170 1.00 74.04  ? 469 LEU B O   1 
ATOM   3168 C CB  . LEU B 1 174 ? -0.068  9.876   -52.723 1.00 69.41  ? 469 LEU B CB  1 
ATOM   3169 C CG  . LEU B 1 174 ? 1.077   9.033   -52.161 1.00 69.75  ? 469 LEU B CG  1 
ATOM   3170 C CD1 . LEU B 1 174 ? 0.564   7.706   -51.626 1.00 74.22  ? 469 LEU B CD1 1 
ATOM   3171 C CD2 . LEU B 1 174 ? 2.141   8.817   -53.225 1.00 72.11  ? 469 LEU B CD2 1 
ATOM   3172 N N   . GLU B 1 175 ? -1.897  12.366  -53.340 1.00 69.89  ? 470 GLU B N   1 
ATOM   3173 C CA  . GLU B 1 175 ? -2.968  13.033  -54.073 1.00 68.41  ? 470 GLU B CA  1 
ATOM   3174 C C   . GLU B 1 175 ? -2.434  14.253  -54.812 1.00 63.89  ? 470 GLU B C   1 
ATOM   3175 O O   . GLU B 1 175 ? -2.662  14.412  -56.011 1.00 63.09  ? 470 GLU B O   1 
ATOM   3176 C CB  . GLU B 1 175 ? -4.097  13.451  -53.132 1.00 73.33  ? 470 GLU B CB  1 
ATOM   3177 C CG  . GLU B 1 175 ? -4.919  12.301  -52.585 1.00 85.54  ? 470 GLU B CG  1 
ATOM   3178 C CD  . GLU B 1 175 ? -6.100  12.779  -51.763 1.00 93.19  ? 470 GLU B CD  1 
ATOM   3179 O OE1 . GLU B 1 175 ? -6.270  14.010  -51.629 1.00 93.87  ? 470 GLU B OE1 1 
ATOM   3180 O OE2 . GLU B 1 175 ? -6.857  11.925  -51.255 1.00 96.85  ? 470 GLU B OE2 1 
ATOM   3181 N N   . GLU B 1 176 ? -1.720  15.110  -54.088 1.00 58.15  ? 471 GLU B N   1 
ATOM   3182 C CA  . GLU B 1 176 ? -1.125  16.306  -54.677 1.00 53.72  ? 471 GLU B CA  1 
ATOM   3183 C C   . GLU B 1 176 ? -0.290  15.957  -55.910 1.00 55.20  ? 471 GLU B C   1 
ATOM   3184 O O   . GLU B 1 176 ? -0.434  16.578  -56.964 1.00 46.56  ? 471 GLU B O   1 
ATOM   3185 C CB  . GLU B 1 176 ? -0.267  17.044  -53.645 1.00 46.75  ? 471 GLU B CB  1 
ATOM   3186 C CG  . GLU B 1 176 ? -1.042  17.570  -52.445 1.00 56.52  ? 471 GLU B CG  1 
ATOM   3187 C CD  . GLU B 1 176 ? -1.769  18.875  -52.735 1.00 61.53  ? 471 GLU B CD  1 
ATOM   3188 O OE1 . GLU B 1 176 ? -1.105  19.936  -52.768 1.00 54.96  ? 471 GLU B OE1 1 
ATOM   3189 O OE2 . GLU B 1 176 ? -3.005  18.840  -52.921 1.00 63.64  ? 471 GLU B OE2 1 
ATOM   3190 N N   . LYS B 1 177 ? 0.582   14.959  -55.773 1.00 55.49  ? 472 LYS B N   1 
ATOM   3191 C CA  . LYS B 1 177 ? 1.410   14.517  -56.888 1.00 53.23  ? 472 LYS B CA  1 
ATOM   3192 C C   . LYS B 1 177 ? 0.552   13.982  -58.028 1.00 52.58  ? 472 LYS B C   1 
ATOM   3193 O O   . LYS B 1 177 ? 0.819   14.252  -59.200 1.00 47.78  ? 472 LYS B O   1 
ATOM   3194 C CB  . LYS B 1 177 ? 2.415   13.453  -56.442 1.00 61.15  ? 472 LYS B CB  1 
ATOM   3195 C CG  . LYS B 1 177 ? 3.490   13.967  -55.501 1.00 68.11  ? 472 LYS B CG  1 
ATOM   3196 C CD  . LYS B 1 177 ? 4.793   13.203  -55.687 1.00 74.82  ? 472 LYS B CD  1 
ATOM   3197 C CE  . LYS B 1 177 ? 5.203   12.482  -54.414 1.00 79.20  ? 472 LYS B CE  1 
ATOM   3198 N NZ  . LYS B 1 177 ? 4.306   11.331  -54.104 1.00 83.06  ? 472 LYS B NZ  1 
ATOM   3199 N N   . ASP B 1 178 ? -0.488  13.231  -57.677 1.00 41.79  ? 473 ASP B N   1 
ATOM   3200 C CA  . ASP B 1 178 ? -1.381  12.656  -58.676 1.00 40.78  ? 473 ASP B CA  1 
ATOM   3201 C C   . ASP B 1 178 ? -2.133  13.745  -59.444 1.00 46.35  ? 473 ASP B C   1 
ATOM   3202 O O   . ASP B 1 178 ? -2.271  13.676  -60.668 1.00 48.44  ? 473 ASP B O   1 
ATOM   3203 C CB  . ASP B 1 178 ? -2.366  11.694  -58.018 1.00 49.19  ? 473 ASP B CB  1 
ATOM   3204 C CG  . ASP B 1 178 ? -2.579  10.436  -58.833 1.00 67.53  ? 473 ASP B CG  1 
ATOM   3205 O OD1 . ASP B 1 178 ? -2.325  9.336   -58.296 1.00 79.24  ? 473 ASP B OD1 1 
ATOM   3206 O OD2 . ASP B 1 178 ? -2.984  10.547  -60.013 1.00 69.20  ? 473 ASP B OD2 1 
ATOM   3207 N N   . HIS B 1 179 ? -2.614  14.750  -58.719 1.00 45.49  ? 474 HIS B N   1 
ATOM   3208 C CA  . HIS B 1 179 ? -3.316  15.870  -59.331 1.00 42.24  ? 474 HIS B CA  1 
ATOM   3209 C C   . HIS B 1 179 ? -2.413  16.632  -60.302 1.00 41.86  ? 474 HIS B C   1 
ATOM   3210 O O   . HIS B 1 179 ? -2.829  16.997  -61.403 1.00 40.67  ? 474 HIS B O   1 
ATOM   3211 C CB  . HIS B 1 179 ? -3.853  16.814  -58.260 1.00 38.63  ? 474 HIS B CB  1 
ATOM   3212 C CG  . HIS B 1 179 ? -4.557  18.013  -58.815 1.00 42.71  ? 474 HIS B CG  1 
ATOM   3213 N ND1 . HIS B 1 179 ? -5.788  17.934  -59.430 1.00 41.69  ? 474 HIS B ND1 1 
ATOM   3214 C CD2 . HIS B 1 179 ? -4.199  19.317  -58.851 1.00 43.30  ? 474 HIS B CD2 1 
ATOM   3215 C CE1 . HIS B 1 179 ? -6.161  19.139  -59.815 1.00 41.96  ? 474 HIS B CE1 1 
ATOM   3216 N NE2 . HIS B 1 179 ? -5.217  19.999  -59.478 1.00 42.15  ? 474 HIS B NE2 1 
ATOM   3217 N N   . ILE B 1 180 ? -1.172  16.864  -59.889 1.00 43.50  ? 475 ILE B N   1 
ATOM   3218 C CA  . ILE B 1 180 ? -0.201  17.547  -60.731 1.00 36.46  ? 475 ILE B CA  1 
ATOM   3219 C C   . ILE B 1 180 ? 0.027   16.795  -62.037 1.00 37.83  ? 475 ILE B C   1 
ATOM   3220 O O   . ILE B 1 180 ? 0.083   17.391  -63.114 1.00 33.69  ? 475 ILE B O   1 
ATOM   3221 C CB  . ILE B 1 180 ? 1.140   17.697  -60.015 1.00 39.69  ? 475 ILE B CB  1 
ATOM   3222 C CG1 . ILE B 1 180 ? 1.029   18.752  -58.917 1.00 42.12  ? 475 ILE B CG1 1 
ATOM   3223 C CG2 . ILE B 1 180 ? 2.236   18.077  -61.005 1.00 41.51  ? 475 ILE B CG2 1 
ATOM   3224 C CD1 . ILE B 1 180 ? 2.287   18.902  -58.105 1.00 38.33  ? 475 ILE B CD1 1 
ATOM   3225 N N   . HIS B 1 181 ? 0.160   15.478  -61.938 1.00 36.76  ? 476 HIS B N   1 
ATOM   3226 C CA  . HIS B 1 181 ? 0.421   14.669  -63.120 1.00 39.52  ? 476 HIS B CA  1 
ATOM   3227 C C   . HIS B 1 181 ? -0.777  14.671  -64.069 1.00 42.91  ? 476 HIS B C   1 
ATOM   3228 O O   . HIS B 1 181 ? -0.612  14.703  -65.292 1.00 43.96  ? 476 HIS B O   1 
ATOM   3229 C CB  . HIS B 1 181 ? 0.843   13.248  -62.737 1.00 51.75  ? 476 HIS B CB  1 
ATOM   3230 C CG  . HIS B 1 181 ? 2.216   13.173  -62.136 1.00 61.56  ? 476 HIS B CG  1 
ATOM   3231 N ND1 . HIS B 1 181 ? 3.350   13.562  -62.818 1.00 53.54  ? 476 HIS B ND1 1 
ATOM   3232 C CD2 . HIS B 1 181 ? 2.636   12.747  -60.921 1.00 64.43  ? 476 HIS B CD2 1 
ATOM   3233 C CE1 . HIS B 1 181 ? 4.407   13.390  -62.047 1.00 55.91  ? 476 HIS B CE1 1 
ATOM   3234 N NE2 . HIS B 1 181 ? 4.004   12.894  -60.890 1.00 65.04  ? 476 HIS B NE2 1 
ATOM   3235 N N   . ARG B 1 182 ? -1.982  14.664  -63.507 1.00 38.25  ? 477 ARG B N   1 
ATOM   3236 C CA  . ARG B 1 182 ? -3.187  14.729  -64.327 1.00 43.73  ? 477 ARG B CA  1 
ATOM   3237 C C   . ARG B 1 182 ? -3.305  16.069  -65.063 1.00 44.20  ? 477 ARG B C   1 
ATOM   3238 O O   . ARG B 1 182 ? -3.602  16.107  -66.263 1.00 38.10  ? 477 ARG B O   1 
ATOM   3239 C CB  . ARG B 1 182 ? -4.438  14.400  -63.501 1.00 44.70  ? 477 ARG B CB  1 
ATOM   3240 C CG  . ARG B 1 182 ? -4.654  12.896  -63.310 1.00 51.55  ? 477 ARG B CG  1 
ATOM   3241 C CD  . ARG B 1 182 ? -5.794  12.586  -62.343 1.00 63.13  ? 477 ARG B CD  1 
ATOM   3242 N NE  . ARG B 1 182 ? -5.343  12.546  -60.954 1.00 72.25  ? 477 ARG B NE  1 
ATOM   3243 C CZ  . ARG B 1 182 ? -6.151  12.418  -59.905 1.00 85.88  ? 477 ARG B CZ  1 
ATOM   3244 N NH1 . ARG B 1 182 ? -7.465  12.322  -60.081 1.00 91.50  ? 477 ARG B NH1 1 
ATOM   3245 N NH2 . ARG B 1 182 ? -5.647  12.390  -58.676 1.00 85.56  ? 477 ARG B NH2 1 
ATOM   3246 N N   . VAL B 1 183 ? -3.034  17.164  -64.361 1.00 38.24  ? 478 VAL B N   1 
ATOM   3247 C CA  . VAL B 1 183 ? -2.992  18.475  -65.011 1.00 42.02  ? 478 VAL B CA  1 
ATOM   3248 C C   . VAL B 1 183 ? -1.909  18.531  -66.097 1.00 38.20  ? 478 VAL B C   1 
ATOM   3249 O O   . VAL B 1 183 ? -2.142  19.034  -67.201 1.00 32.77  ? 478 VAL B O   1 
ATOM   3250 C CB  . VAL B 1 183 ? -2.775  19.615  -63.999 1.00 39.16  ? 478 VAL B CB  1 
ATOM   3251 C CG1 . VAL B 1 183 ? -2.804  20.953  -64.719 1.00 42.19  ? 478 VAL B CG1 1 
ATOM   3252 C CG2 . VAL B 1 183 ? -3.844  19.568  -62.916 1.00 33.32  ? 478 VAL B CG2 1 
ATOM   3253 N N   . LEU B 1 184 ? -0.722  18.016  -65.782 1.00 24.60  ? 479 LEU B N   1 
ATOM   3254 C CA  . LEU B 1 184 ? 0.325   17.857  -66.791 1.00 24.35  ? 479 LEU B CA  1 
ATOM   3255 C C   . LEU B 1 184 ? -0.192  17.125  -68.035 1.00 29.75  ? 479 LEU B C   1 
ATOM   3256 O O   . LEU B 1 184 ? 0.049   17.557  -69.167 1.00 30.10  ? 479 LEU B O   1 
ATOM   3257 C CB  . LEU B 1 184 ? 1.546   17.131  -66.205 1.00 25.94  ? 479 LEU B CB  1 
ATOM   3258 C CG  . LEU B 1 184 ? 2.483   18.015  -65.367 1.00 26.92  ? 479 LEU B CG  1 
ATOM   3259 C CD1 . LEU B 1 184 ? 3.613   17.202  -64.742 1.00 23.06  ? 479 LEU B CD1 1 
ATOM   3260 C CD2 . LEU B 1 184 ? 3.038   19.133  -66.230 1.00 26.03  ? 479 LEU B CD2 1 
ATOM   3261 N N   . ASP B 1 185 ? -0.901  16.018  -67.815 1.00 25.05  ? 480 ASP B N   1 
ATOM   3262 C CA  . ASP B 1 185 ? -1.492  15.234  -68.904 1.00 29.10  ? 480 ASP B CA  1 
ATOM   3263 C C   . ASP B 1 185 ? -2.437  16.080  -69.760 1.00 37.39  ? 480 ASP B C   1 
ATOM   3264 O O   . ASP B 1 185 ? -2.424  15.999  -70.995 1.00 29.85  ? 480 ASP B O   1 
ATOM   3265 C CB  . ASP B 1 185 ? -2.252  14.018  -68.355 1.00 34.97  ? 480 ASP B CB  1 
ATOM   3266 C CG  . ASP B 1 185 ? -1.335  12.857  -67.987 1.00 41.86  ? 480 ASP B CG  1 
ATOM   3267 O OD1 . ASP B 1 185 ? -0.196  12.802  -68.485 1.00 43.01  ? 480 ASP B OD1 1 
ATOM   3268 O OD2 . ASP B 1 185 ? -1.758  11.985  -67.203 1.00 50.37  ? 480 ASP B OD2 1 
ATOM   3269 N N   . LYS B 1 186 ? -3.273  16.882  -69.108 1.00 34.92  ? 481 LYS B N   1 
ATOM   3270 C CA  . LYS B 1 186 ? -4.196  17.746  -69.839 1.00 35.26  ? 481 LYS B CA  1 
ATOM   3271 C C   . LYS B 1 186 ? -3.438  18.774  -70.690 1.00 32.31  ? 481 LYS B C   1 
ATOM   3272 O O   . LYS B 1 186 ? -3.852  19.101  -71.801 1.00 35.34  ? 481 LYS B O   1 
ATOM   3273 C CB  . LYS B 1 186 ? -5.171  18.437  -68.880 1.00 42.11  ? 481 LYS B CB  1 
ATOM   3274 C CG  . LYS B 1 186 ? -6.064  19.491  -69.541 1.00 45.41  ? 481 LYS B CG  1 
ATOM   3275 C CD  . LYS B 1 186 ? -7.088  18.867  -70.475 1.00 44.85  ? 481 LYS B CD  1 
ATOM   3276 C CE  . LYS B 1 186 ? -8.026  17.947  -69.714 1.00 49.87  ? 481 LYS B CE  1 
ATOM   3277 N NZ  . LYS B 1 186 ? -9.163  17.494  -70.563 1.00 49.05  ? 481 LYS B NZ  1 
ATOM   3278 N N   . ILE B 1 187 ? -2.327  19.284  -70.176 1.00 30.37  ? 482 ILE B N   1 
ATOM   3279 C CA  . ILE B 1 187 ? -1.537  20.236  -70.950 1.00 28.44  ? 482 ILE B CA  1 
ATOM   3280 C C   . ILE B 1 187 ? -0.846  19.554  -72.135 1.00 31.90  ? 482 ILE B C   1 
ATOM   3281 O O   . ILE B 1 187 ? -0.730  20.132  -73.216 1.00 29.63  ? 482 ILE B O   1 
ATOM   3282 C CB  . ILE B 1 187 ? -0.511  20.982  -70.080 1.00 31.66  ? 482 ILE B CB  1 
ATOM   3283 C CG1 . ILE B 1 187 ? -1.238  21.798  -69.005 1.00 35.79  ? 482 ILE B CG1 1 
ATOM   3284 C CG2 . ILE B 1 187 ? 0.350   21.887  -70.952 1.00 27.39  ? 482 ILE B CG2 1 
ATOM   3285 C CD1 . ILE B 1 187 ? -0.323  22.602  -68.111 1.00 41.22  ? 482 ILE B CD1 1 
ATOM   3286 N N   . THR B 1 188 ? -0.392  18.321  -71.933 1.00 31.40  ? 483 THR B N   1 
ATOM   3287 C CA  . THR B 1 188 ? 0.118   17.520  -73.040 1.00 32.31  ? 483 THR B CA  1 
ATOM   3288 C C   . THR B 1 188 ? -0.945  17.344  -74.123 1.00 35.73  ? 483 THR B C   1 
ATOM   3289 O O   . THR B 1 188 ? -0.674  17.563  -75.306 1.00 29.75  ? 483 THR B O   1 
ATOM   3290 C CB  . THR B 1 188 ? 0.553   16.128  -72.571 1.00 37.57  ? 483 THR B CB  1 
ATOM   3291 O OG1 . THR B 1 188 ? 1.654   16.257  -71.665 1.00 44.53  ? 483 THR B OG1 1 
ATOM   3292 C CG2 . THR B 1 188 ? 0.968   15.280  -73.765 1.00 33.01  ? 483 THR B CG2 1 
ATOM   3293 N N   . ASP B 1 189 ? -2.147  16.936  -73.707 1.00 31.05  ? 484 ASP B N   1 
ATOM   3294 C CA  . ASP B 1 189 ? -3.304  16.842  -74.607 1.00 37.49  ? 484 ASP B CA  1 
ATOM   3295 C C   . ASP B 1 189 ? -3.465  18.140  -75.407 1.00 38.15  ? 484 ASP B C   1 
ATOM   3296 O O   . ASP B 1 189 ? -3.668  18.131  -76.623 1.00 33.41  ? 484 ASP B O   1 
ATOM   3297 C CB  . ASP B 1 189 ? -4.601  16.595  -73.814 1.00 37.59  ? 484 ASP B CB  1 
ATOM   3298 C CG  . ASP B 1 189 ? -4.645  15.229  -73.143 1.00 44.10  ? 484 ASP B CG  1 
ATOM   3299 O OD1 . ASP B 1 189 ? -3.739  14.402  -73.378 1.00 31.97  ? 484 ASP B OD1 1 
ATOM   3300 O OD2 . ASP B 1 189 ? -5.601  14.979  -72.374 1.00 53.03  ? 484 ASP B OD2 1 
ATOM   3301 N N   . THR B 1 190 ? -3.383  19.260  -74.701 1.00 35.50  ? 485 THR B N   1 
ATOM   3302 C CA  . THR B 1 190 ? -3.559  20.564  -75.313 1.00 32.37  ? 485 THR B CA  1 
ATOM   3303 C C   . THR B 1 190 ? -2.507  20.852  -76.381 1.00 32.13  ? 485 THR B C   1 
ATOM   3304 O O   . THR B 1 190 ? -2.840  21.261  -77.495 1.00 35.61  ? 485 THR B O   1 
ATOM   3305 C CB  . THR B 1 190 ? -3.552  21.643  -74.239 1.00 39.07  ? 485 THR B CB  1 
ATOM   3306 O OG1 . THR B 1 190 ? -4.594  21.355  -73.297 1.00 34.34  ? 485 THR B OG1 1 
ATOM   3307 C CG2 . THR B 1 190 ? -3.777  23.012  -74.851 1.00 40.12  ? 485 THR B CG2 1 
ATOM   3308 N N   . LEU B 1 191 ? -1.238  20.629  -76.046 1.00 31.27  ? 486 LEU B N   1 
ATOM   3309 C CA  . LEU B 1 191 ? -0.156  20.758  -77.019 1.00 26.98  ? 486 LEU B CA  1 
ATOM   3310 C C   . LEU B 1 191 ? -0.431  19.948  -78.285 1.00 34.72  ? 486 LEU B C   1 
ATOM   3311 O O   . LEU B 1 191 ? -0.323  20.467  -79.398 1.00 34.04  ? 486 LEU B O   1 
ATOM   3312 C CB  . LEU B 1 191 ? 1.179   20.321  -76.406 1.00 30.17  ? 486 LEU B CB  1 
ATOM   3313 C CG  . LEU B 1 191 ? 1.918   21.361  -75.568 1.00 31.35  ? 486 LEU B CG  1 
ATOM   3314 C CD1 . LEU B 1 191 ? 3.095   20.740  -74.830 1.00 31.71  ? 486 LEU B CD1 1 
ATOM   3315 C CD2 . LEU B 1 191 ? 2.387   22.517  -76.452 1.00 26.08  ? 486 LEU B CD2 1 
ATOM   3316 N N   . ILE B 1 192 ? -0.776  18.673  -78.110 1.00 34.50  ? 487 ILE B N   1 
ATOM   3317 C CA  . ILE B 1 192 ? -1.066  17.805  -79.243 1.00 30.28  ? 487 ILE B CA  1 
ATOM   3318 C C   . ILE B 1 192 ? -2.249  18.342  -80.038 1.00 35.14  ? 487 ILE B C   1 
ATOM   3319 O O   . ILE B 1 192 ? -2.202  18.404  -81.266 1.00 34.39  ? 487 ILE B O   1 
ATOM   3320 C CB  . ILE B 1 192 ? -1.358  16.352  -78.806 1.00 37.66  ? 487 ILE B CB  1 
ATOM   3321 C CG1 . ILE B 1 192 ? -0.117  15.726  -78.168 1.00 36.31  ? 487 ILE B CG1 1 
ATOM   3322 C CG2 . ILE B 1 192 ? -1.795  15.520  -79.999 1.00 35.43  ? 487 ILE B CG2 1 
ATOM   3323 C CD1 . ILE B 1 192 ? 1.078   15.665  -79.104 1.00 31.22  ? 487 ILE B CD1 1 
ATOM   3324 N N   . HIS B 1 193 ? -3.303  18.747  -79.335 1.00 38.81  ? 488 HIS B N   1 
ATOM   3325 C CA  . HIS B 1 193 ? -4.471  19.313  -80.005 1.00 42.36  ? 488 HIS B CA  1 
ATOM   3326 C C   . HIS B 1 193 ? -4.092  20.499  -80.890 1.00 38.87  ? 488 HIS B C   1 
ATOM   3327 O O   . HIS B 1 193 ? -4.538  20.584  -82.028 1.00 37.50  ? 488 HIS B O   1 
ATOM   3328 C CB  . HIS B 1 193 ? -5.546  19.724  -79.004 1.00 45.71  ? 488 HIS B CB  1 
ATOM   3329 C CG  . HIS B 1 193 ? -6.747  20.352  -79.641 1.00 52.77  ? 488 HIS B CG  1 
ATOM   3330 N ND1 . HIS B 1 193 ? -6.957  21.715  -79.649 1.00 56.98  ? 488 HIS B ND1 1 
ATOM   3331 C CD2 . HIS B 1 193 ? -7.789  19.806  -80.307 1.00 56.31  ? 488 HIS B CD2 1 
ATOM   3332 C CE1 . HIS B 1 193 ? -8.086  21.979  -80.281 1.00 56.16  ? 488 HIS B CE1 1 
ATOM   3333 N NE2 . HIS B 1 193 ? -8.611  20.838  -80.691 1.00 56.53  ? 488 HIS B NE2 1 
ATOM   3334 N N   . LEU B 1 194 ? -3.262  21.402  -80.369 1.00 37.74  ? 489 LEU B N   1 
ATOM   3335 C CA  . LEU B 1 194 ? -2.784  22.539  -81.158 1.00 34.47  ? 489 LEU B CA  1 
ATOM   3336 C C   . LEU B 1 194 ? -2.064  22.079  -82.426 1.00 40.47  ? 489 LEU B C   1 
ATOM   3337 O O   . LEU B 1 194 ? -2.304  22.610  -83.517 1.00 35.13  ? 489 LEU B O   1 
ATOM   3338 C CB  . LEU B 1 194 ? -1.843  23.423  -80.335 1.00 30.64  ? 489 LEU B CB  1 
ATOM   3339 C CG  . LEU B 1 194 ? -2.391  24.212  -79.141 1.00 30.43  ? 489 LEU B CG  1 
ATOM   3340 C CD1 . LEU B 1 194 ? -1.249  24.825  -78.330 1.00 30.94  ? 489 LEU B CD1 1 
ATOM   3341 C CD2 . LEU B 1 194 ? -3.357  25.293  -79.606 1.00 34.20  ? 489 LEU B CD2 1 
ATOM   3342 N N   . MET B 1 195 ? -1.176  21.097  -82.272 1.00 38.17  ? 490 MET B N   1 
ATOM   3343 C CA  . MET B 1 195 ? -0.377  20.585  -83.383 1.00 34.02  ? 490 MET B CA  1 
ATOM   3344 C C   . MET B 1 195 ? -1.234  19.924  -84.462 1.00 38.86  ? 490 MET B C   1 
ATOM   3345 O O   . MET B 1 195 ? -1.030  20.159  -85.651 1.00 45.34  ? 490 MET B O   1 
ATOM   3346 C CB  . MET B 1 195 ? 0.686   19.606  -82.873 1.00 37.07  ? 490 MET B CB  1 
ATOM   3347 C CG  . MET B 1 195 ? 1.676   20.237  -81.918 1.00 40.67  ? 490 MET B CG  1 
ATOM   3348 S SD  . MET B 1 195 ? 2.850   19.069  -81.223 1.00 36.12  ? 490 MET B SD  1 
ATOM   3349 C CE  . MET B 1 195 ? 3.616   20.105  -79.975 1.00 33.33  ? 490 MET B CE  1 
ATOM   3350 N N   . ALA B 1 196 ? -2.182  19.093  -84.045 1.00 28.40  ? 491 ALA B N   1 
ATOM   3351 C CA  . ALA B 1 196 ? -3.092  18.438  -84.983 1.00 40.41  ? 491 ALA B CA  1 
ATOM   3352 C C   . ALA B 1 196 ? -3.940  19.479  -85.698 1.00 47.62  ? 491 ALA B C   1 
ATOM   3353 O O   . ALA B 1 196 ? -4.059  19.473  -86.923 1.00 49.64  ? 491 ALA B O   1 
ATOM   3354 C CB  . ALA B 1 196 ? -3.981  17.457  -84.255 1.00 35.35  ? 491 ALA B CB  1 
ATOM   3355 N N   . LYS B 1 197 ? -4.530  20.368  -84.908 1.00 50.40  ? 492 LYS B N   1 
ATOM   3356 C CA  . LYS B 1 197 ? -5.324  21.478  -85.411 1.00 53.25  ? 492 LYS B CA  1 
ATOM   3357 C C   . LYS B 1 197 ? -4.549  22.224  -86.490 1.00 49.43  ? 492 LYS B C   1 
ATOM   3358 O O   . LYS B 1 197 ? -5.125  22.686  -87.476 1.00 46.85  ? 492 LYS B O   1 
ATOM   3359 C CB  . LYS B 1 197 ? -5.643  22.414  -84.247 1.00 60.02  ? 492 LYS B CB  1 
ATOM   3360 C CG  . LYS B 1 197 ? -6.718  23.447  -84.492 1.00 67.76  ? 492 LYS B CG  1 
ATOM   3361 C CD  . LYS B 1 197 ? -6.821  24.353  -83.271 1.00 75.75  ? 492 LYS B CD  1 
ATOM   3362 C CE  . LYS B 1 197 ? -7.956  25.350  -83.384 1.00 85.14  ? 492 LYS B CE  1 
ATOM   3363 N NZ  . LYS B 1 197 ? -7.965  26.273  -82.213 1.00 90.63  ? 492 LYS B NZ  1 
ATOM   3364 N N   . ALA B 1 198 ? -3.236  22.326  -86.300 1.00 45.19  ? 493 ALA B N   1 
ATOM   3365 C CA  . ALA B 1 198 ? -2.383  23.061  -87.226 1.00 43.52  ? 493 ALA B CA  1 
ATOM   3366 C C   . ALA B 1 198 ? -2.136  22.264  -88.499 1.00 47.08  ? 493 ALA B C   1 
ATOM   3367 O O   . ALA B 1 198 ? -1.713  22.817  -89.511 1.00 55.04  ? 493 ALA B O   1 
ATOM   3368 C CB  . ALA B 1 198 ? -1.062  23.437  -86.560 1.00 41.25  ? 493 ALA B CB  1 
ATOM   3369 N N   . GLY B 1 199 ? -2.402  20.964  -88.446 1.00 43.62  ? 494 GLY B N   1 
ATOM   3370 C CA  . GLY B 1 199 ? -2.301  20.124  -89.624 1.00 50.07  ? 494 GLY B CA  1 
ATOM   3371 C C   . GLY B 1 199 ? -1.076  19.227  -89.690 1.00 52.82  ? 494 GLY B C   1 
ATOM   3372 O O   . GLY B 1 199 ? -0.756  18.698  -90.752 1.00 54.62  ? 494 GLY B O   1 
ATOM   3373 N N   . LEU B 1 200 ? -0.385  19.055  -88.568 1.00 47.63  ? 495 LEU B N   1 
ATOM   3374 C CA  . LEU B 1 200 ? 0.752   18.142  -88.516 1.00 42.80  ? 495 LEU B CA  1 
ATOM   3375 C C   . LEU B 1 200 ? 0.264   16.696  -88.475 1.00 42.15  ? 495 LEU B C   1 
ATOM   3376 O O   . LEU B 1 200 ? -0.761  16.401  -87.862 1.00 32.27  ? 495 LEU B O   1 
ATOM   3377 C CB  . LEU B 1 200 ? 1.619   18.430  -87.289 1.00 35.67  ? 495 LEU B CB  1 
ATOM   3378 C CG  . LEU B 1 200 ? 2.256   19.818  -87.182 1.00 39.47  ? 495 LEU B CG  1 
ATOM   3379 C CD1 . LEU B 1 200 ? 3.134   19.900  -85.935 1.00 35.92  ? 495 LEU B CD1 1 
ATOM   3380 C CD2 . LEU B 1 200 ? 3.062   20.125  -88.432 1.00 32.20  ? 495 LEU B CD2 1 
ATOM   3381 N N   . THR B 1 201 ? 0.993   15.797  -89.127 1.00 42.89  ? 496 THR B N   1 
ATOM   3382 C CA  . THR B 1 201 ? 0.673   14.376  -89.045 1.00 45.41  ? 496 THR B CA  1 
ATOM   3383 C C   . THR B 1 201 ? 0.873   13.902  -87.609 1.00 47.43  ? 496 THR B C   1 
ATOM   3384 O O   . THR B 1 201 ? 1.441   14.620  -86.783 1.00 46.24  ? 496 THR B O   1 
ATOM   3385 C CB  . THR B 1 201 ? 1.556   13.539  -89.985 1.00 47.11  ? 496 THR B CB  1 
ATOM   3386 O OG1 . THR B 1 201 ? 2.926   13.615  -89.565 1.00 46.07  ? 496 THR B OG1 1 
ATOM   3387 C CG2 . THR B 1 201 ? 1.438   14.050  -91.408 1.00 49.50  ? 496 THR B CG2 1 
ATOM   3388 N N   . LEU B 1 202 ? 0.399   12.697  -87.311 1.00 43.30  ? 497 LEU B N   1 
ATOM   3389 C CA  . LEU B 1 202 ? 0.599   12.107  -85.992 1.00 44.19  ? 497 LEU B CA  1 
ATOM   3390 C C   . LEU B 1 202 ? 2.082   11.984  -85.654 1.00 42.13  ? 497 LEU B C   1 
ATOM   3391 O O   . LEU B 1 202 ? 2.492   12.255  -84.525 1.00 37.93  ? 497 LEU B O   1 
ATOM   3392 C CB  . LEU B 1 202 ? -0.070  10.734  -85.909 1.00 48.33  ? 497 LEU B CB  1 
ATOM   3393 C CG  . LEU B 1 202 ? -1.532  10.746  -85.463 1.00 58.31  ? 497 LEU B CG  1 
ATOM   3394 C CD1 . LEU B 1 202 ? -2.154  9.362   -85.614 1.00 61.47  ? 497 LEU B CD1 1 
ATOM   3395 C CD2 . LEU B 1 202 ? -1.635  11.236  -84.027 1.00 61.39  ? 497 LEU B CD2 1 
ATOM   3396 N N   . GLN B 1 203 ? 2.878   11.576  -86.638 1.00 38.45  ? 498 GLN B N   1 
ATOM   3397 C CA  . GLN B 1 203 ? 4.309   11.383  -86.435 1.00 38.37  ? 498 GLN B CA  1 
ATOM   3398 C C   . GLN B 1 203 ? 5.000   12.705  -86.128 1.00 34.73  ? 498 GLN B C   1 
ATOM   3399 O O   . GLN B 1 203 ? 5.829   12.786  -85.225 1.00 40.97  ? 498 GLN B O   1 
ATOM   3400 C CB  . GLN B 1 203 ? 4.943   10.744  -87.664 1.00 39.03  ? 498 GLN B CB  1 
ATOM   3401 C CG  . GLN B 1 203 ? 6.402   10.373  -87.479 1.00 45.64  ? 498 GLN B CG  1 
ATOM   3402 C CD  . GLN B 1 203 ? 7.017   9.835   -88.752 1.00 51.42  ? 498 GLN B CD  1 
ATOM   3403 O OE1 . GLN B 1 203 ? 6.497   10.062  -89.847 1.00 51.80  ? 498 GLN B OE1 1 
ATOM   3404 N NE2 . GLN B 1 203 ? 8.135   9.126   -88.620 1.00 52.07  ? 498 GLN B NE2 1 
ATOM   3405 N N   . GLN B 1 204 ? 4.654   13.739  -86.886 1.00 28.48  ? 499 GLN B N   1 
ATOM   3406 C CA  . GLN B 1 204 ? 5.206   15.073  -86.658 1.00 32.98  ? 499 GLN B CA  1 
ATOM   3407 C C   . GLN B 1 204 ? 4.745   15.619  -85.313 1.00 33.08  ? 499 GLN B C   1 
ATOM   3408 O O   . GLN B 1 204 ? 5.504   16.279  -84.615 1.00 39.81  ? 499 GLN B O   1 
ATOM   3409 C CB  . GLN B 1 204 ? 4.776   16.026  -87.775 1.00 31.21  ? 499 GLN B CB  1 
ATOM   3410 C CG  . GLN B 1 204 ? 5.182   15.558  -89.163 1.00 37.07  ? 499 GLN B CG  1 
ATOM   3411 C CD  . GLN B 1 204 ? 4.658   16.463  -90.254 1.00 48.77  ? 499 GLN B CD  1 
ATOM   3412 O OE1 . GLN B 1 204 ? 3.520   16.932  -90.200 1.00 48.77  ? 499 GLN B OE1 1 
ATOM   3413 N NE2 . GLN B 1 204 ? 5.488   16.714  -91.256 1.00 54.21  ? 499 GLN B NE2 1 
ATOM   3414 N N   . GLN B 1 205 ? 3.497   15.340  -84.957 1.00 35.13  ? 500 GLN B N   1 
ATOM   3415 C CA  . GLN B 1 205 ? 2.966   15.768  -83.675 1.00 34.02  ? 500 GLN B CA  1 
ATOM   3416 C C   . GLN B 1 205 ? 3.796   15.198  -82.535 1.00 37.53  ? 500 GLN B C   1 
ATOM   3417 O O   . GLN B 1 205 ? 4.234   15.926  -81.640 1.00 33.91  ? 500 GLN B O   1 
ATOM   3418 C CB  . GLN B 1 205 ? 1.519   15.307  -83.507 1.00 36.37  ? 500 GLN B CB  1 
ATOM   3419 C CG  . GLN B 1 205 ? 0.506   15.996  -84.400 1.00 33.70  ? 500 GLN B CG  1 
ATOM   3420 C CD  . GLN B 1 205 ? -0.883  15.419  -84.220 1.00 38.34  ? 500 GLN B CD  1 
ATOM   3421 O OE1 . GLN B 1 205 ? -1.266  15.029  -83.114 1.00 32.66  ? 500 GLN B OE1 1 
ATOM   3422 N NE2 . GLN B 1 205 ? -1.642  15.352  -85.307 1.00 35.33  ? 500 GLN B NE2 1 
ATOM   3423 N N   . HIS B 1 206 ? 4.020   13.891  -82.567 1.00 36.18  ? 501 HIS B N   1 
ATOM   3424 C CA  A HIS B 1 206 ? 4.734   13.233  -81.482 0.49 36.78  ? 501 HIS B CA  1 
ATOM   3425 C CA  B HIS B 1 206 ? 4.739   13.213  -81.493 0.51 37.40  ? 501 HIS B CA  1 
ATOM   3426 C C   . HIS B 1 206 ? 6.214   13.622  -81.447 1.00 34.54  ? 501 HIS B C   1 
ATOM   3427 O O   . HIS B 1 206 ? 6.813   13.711  -80.376 1.00 32.90  ? 501 HIS B O   1 
ATOM   3428 C CB  A HIS B 1 206 ? 4.539   11.716  -81.549 0.49 39.48  ? 501 HIS B CB  1 
ATOM   3429 C CB  B HIS B 1 206 ? 4.571   11.687  -81.572 0.51 40.59  ? 501 HIS B CB  1 
ATOM   3430 C CG  A HIS B 1 206 ? 3.148   11.277  -81.227 0.49 39.64  ? 501 HIS B CG  1 
ATOM   3431 C CG  B HIS B 1 206 ? 5.491   11.009  -82.544 0.51 44.90  ? 501 HIS B CG  1 
ATOM   3432 N ND1 A HIS B 1 206 ? 2.328   11.984  -80.368 0.49 45.63  ? 501 HIS B ND1 1 
ATOM   3433 N ND1 B HIS B 1 206 ? 5.091   9.964   -83.352 0.51 45.06  ? 501 HIS B ND1 1 
ATOM   3434 C CD2 A HIS B 1 206 ? 2.415   10.207  -81.631 0.49 34.58  ? 501 HIS B CD2 1 
ATOM   3435 C CD2 B HIS B 1 206 ? 6.806   11.205  -82.817 0.51 44.25  ? 501 HIS B CD2 1 
ATOM   3436 C CE1 A HIS B 1 206 ? 1.163   11.377  -80.261 0.49 46.53  ? 501 HIS B CE1 1 
ATOM   3437 C CE1 B HIS B 1 206 ? 6.108   9.559   -84.087 0.51 40.73  ? 501 HIS B CE1 1 
ATOM   3438 N NE2 A HIS B 1 206 ? 1.194   10.289  -81.025 0.49 43.26  ? 501 HIS B NE2 1 
ATOM   3439 N NE2 B HIS B 1 206 ? 7.161   10.295  -83.785 0.51 38.25  ? 501 HIS B NE2 1 
ATOM   3440 N N   . GLN B 1 207 ? 6.785   13.907  -82.612 1.00 25.39  ? 502 GLN B N   1 
ATOM   3441 C CA  . GLN B 1 207 ? 8.173   14.341  -82.679 1.00 29.48  ? 502 GLN B CA  1 
ATOM   3442 C C   . GLN B 1 207 ? 8.336   15.767  -82.149 1.00 26.16  ? 502 GLN B C   1 
ATOM   3443 O O   . GLN B 1 207 ? 9.278   16.064  -81.409 1.00 25.29  ? 502 GLN B O   1 
ATOM   3444 C CB  . GLN B 1 207 ? 8.692   14.243  -84.116 1.00 28.72  ? 502 GLN B CB  1 
ATOM   3445 C CG  . GLN B 1 207 ? 8.869   12.813  -84.602 1.00 35.02  ? 502 GLN B CG  1 
ATOM   3446 C CD  . GLN B 1 207 ? 9.300   12.731  -86.053 1.00 37.11  ? 502 GLN B CD  1 
ATOM   3447 O OE1 . GLN B 1 207 ? 9.369   13.745  -86.745 1.00 35.90  ? 502 GLN B OE1 1 
ATOM   3448 N NE2 . GLN B 1 207 ? 9.587   11.511  -86.527 1.00 35.42  ? 502 GLN B NE2 1 
ATOM   3449 N N   . ARG B 1 208 ? 7.416   16.643  -82.528 1.00 24.28  ? 503 ARG B N   1 
ATOM   3450 C CA  . ARG B 1 208 ? 7.486   18.039  -82.099 1.00 25.46  ? 503 ARG B CA  1 
ATOM   3451 C C   . ARG B 1 208 ? 7.315   18.173  -80.592 1.00 22.96  ? 503 ARG B C   1 
ATOM   3452 O O   . ARG B 1 208 ? 8.056   18.909  -79.933 1.00 31.38  ? 503 ARG B O   1 
ATOM   3453 C CB  . ARG B 1 208 ? 6.441   18.885  -82.824 1.00 23.90  ? 503 ARG B CB  1 
ATOM   3454 C CG  . ARG B 1 208 ? 6.535   20.366  -82.482 1.00 25.04  ? 503 ARG B CG  1 
ATOM   3455 C CD  . ARG B 1 208 ? 5.608   21.190  -83.365 1.00 27.70  ? 503 ARG B CD  1 
ATOM   3456 N NE  . ARG B 1 208 ? 5.666   22.614  -83.046 1.00 31.64  ? 503 ARG B NE  1 
ATOM   3457 C CZ  . ARG B 1 208 ? 6.548   23.463  -83.558 1.00 35.35  ? 503 ARG B CZ  1 
ATOM   3458 N NH1 . ARG B 1 208 ? 7.464   23.027  -84.413 1.00 29.32  ? 503 ARG B NH1 1 
ATOM   3459 N NH2 . ARG B 1 208 ? 6.512   24.748  -83.210 1.00 35.15  ? 503 ARG B NH2 1 
ATOM   3460 N N   . LEU B 1 209 ? 6.330   17.469  -80.049 1.00 28.92  ? 504 LEU B N   1 
ATOM   3461 C CA  . LEU B 1 209 ? 6.125   17.414  -78.603 1.00 33.00  ? 504 LEU B CA  1 
ATOM   3462 C C   . LEU B 1 209 ? 7.423   17.052  -77.891 1.00 33.11  ? 504 LEU B C   1 
ATOM   3463 O O   . LEU B 1 209 ? 7.846   17.726  -76.948 1.00 29.26  ? 504 LEU B O   1 
ATOM   3464 C CB  . LEU B 1 209 ? 5.045   16.388  -78.244 1.00 23.70  ? 504 LEU B CB  1 
ATOM   3465 C CG  . LEU B 1 209 ? 4.851   16.166  -76.739 1.00 32.71  ? 504 LEU B CG  1 
ATOM   3466 C CD1 . LEU B 1 209 ? 4.390   17.436  -76.046 1.00 30.19  ? 504 LEU B CD1 1 
ATOM   3467 C CD2 . LEU B 1 209 ? 3.875   15.033  -76.484 1.00 33.20  ? 504 LEU B CD2 1 
ATOM   3468 N N   . ALA B 1 210 ? 8.061   15.985  -78.355 1.00 27.71  ? 505 ALA B N   1 
ATOM   3469 C CA  . ALA B 1 210 ? 9.304   15.530  -77.746 1.00 24.89  ? 505 ALA B CA  1 
ATOM   3470 C C   . ALA B 1 210 ? 10.389  16.596  -77.868 1.00 26.37  ? 505 ALA B C   1 
ATOM   3471 O O   . ALA B 1 210 ? 11.105  16.879  -76.903 1.00 28.92  ? 505 ALA B O   1 
ATOM   3472 C CB  . ALA B 1 210 ? 9.760   14.224  -78.397 1.00 25.43  ? 505 ALA B CB  1 
ATOM   3473 N N   . GLN B 1 211 ? 10.515  17.184  -79.056 1.00 21.59  ? 506 GLN B N   1 
ATOM   3474 C CA  . GLN B 1 211 ? 11.521  18.204  -79.285 1.00 26.46  ? 506 GLN B CA  1 
ATOM   3475 C C   . GLN B 1 211 ? 11.341  19.349  -78.290 1.00 32.34  ? 506 GLN B C   1 
ATOM   3476 O O   . GLN B 1 211 ? 12.314  19.865  -77.749 1.00 30.44  ? 506 GLN B O   1 
ATOM   3477 C CB  . GLN B 1 211 ? 11.450  18.727  -80.724 1.00 34.94  ? 506 GLN B CB  1 
ATOM   3478 C CG  . GLN B 1 211 ? 11.810  17.694  -81.781 1.00 43.94  ? 506 GLN B CG  1 
ATOM   3479 C CD  . GLN B 1 211 ? 11.370  18.100  -83.183 1.00 46.97  ? 506 GLN B CD  1 
ATOM   3480 O OE1 . GLN B 1 211 ? 10.804  19.178  -83.383 1.00 42.72  ? 506 GLN B OE1 1 
ATOM   3481 N NE2 . GLN B 1 211 ? 11.619  17.225  -84.161 1.00 39.11  ? 506 GLN B NE2 1 
ATOM   3482 N N   . LEU B 1 212 ? 10.089  19.725  -78.043 1.00 29.36  ? 507 LEU B N   1 
ATOM   3483 C CA  . LEU B 1 212 ? 9.781   20.835  -77.149 1.00 31.64  ? 507 LEU B CA  1 
ATOM   3484 C C   . LEU B 1 212 ? 10.130  20.508  -75.704 1.00 31.20  ? 507 LEU B C   1 
ATOM   3485 O O   . LEU B 1 212 ? 10.729  21.320  -75.005 1.00 30.78  ? 507 LEU B O   1 
ATOM   3486 C CB  . LEU B 1 212 ? 8.300   21.204  -77.237 1.00 33.32  ? 507 LEU B CB  1 
ATOM   3487 C CG  . LEU B 1 212 ? 7.811   21.892  -78.518 1.00 30.74  ? 507 LEU B CG  1 
ATOM   3488 C CD1 . LEU B 1 212 ? 6.309   22.145  -78.444 1.00 26.86  ? 507 LEU B CD1 1 
ATOM   3489 C CD2 . LEU B 1 212 ? 8.564   23.184  -78.737 1.00 32.08  ? 507 LEU B CD2 1 
ATOM   3490 N N   . LEU B 1 213 ? 9.745   19.320  -75.260 1.00 22.66  ? 508 LEU B N   1 
ATOM   3491 C CA  . LEU B 1 213 ? 9.962   18.910  -73.873 1.00 26.16  ? 508 LEU B CA  1 
ATOM   3492 C C   . LEU B 1 213 ? 11.439  18.708  -73.558 1.00 26.52  ? 508 LEU B C   1 
ATOM   3493 O O   . LEU B 1 213 ? 11.873  18.960  -72.441 1.00 31.01  ? 508 LEU B O   1 
ATOM   3494 C CB  . LEU B 1 213 ? 9.178   17.628  -73.567 1.00 22.86  ? 508 LEU B CB  1 
ATOM   3495 C CG  . LEU B 1 213 ? 7.670   17.743  -73.736 1.00 30.15  ? 508 LEU B CG  1 
ATOM   3496 C CD1 . LEU B 1 213 ? 6.970   16.466  -73.277 1.00 31.50  ? 508 LEU B CD1 1 
ATOM   3497 C CD2 . LEU B 1 213 ? 7.166   18.943  -72.958 1.00 23.86  ? 508 LEU B CD2 1 
ATOM   3498 N N   . LEU B 1 214 ? 12.201  18.233  -74.541 1.00 30.29  ? 509 LEU B N   1 
ATOM   3499 C CA  . LEU B 1 214 ? 13.633  18.036  -74.373 1.00 26.54  ? 509 LEU B CA  1 
ATOM   3500 C C   . LEU B 1 214 ? 14.331  19.370  -74.137 1.00 29.43  ? 509 LEU B C   1 
ATOM   3501 O O   . LEU B 1 214 ? 15.327  19.445  -73.421 1.00 31.87  ? 509 LEU B O   1 
ATOM   3502 C CB  . LEU B 1 214 ? 14.236  17.346  -75.593 1.00 26.46  ? 509 LEU B CB  1 
ATOM   3503 C CG  . LEU B 1 214 ? 13.934  15.856  -75.745 1.00 36.80  ? 509 LEU B CG  1 
ATOM   3504 C CD1 . LEU B 1 214 ? 14.736  15.288  -76.903 1.00 36.95  ? 509 LEU B CD1 1 
ATOM   3505 C CD2 . LEU B 1 214 ? 14.246  15.115  -74.455 1.00 36.36  ? 509 LEU B CD2 1 
ATOM   3506 N N   . ILE B 1 215 ? 13.805  20.424  -74.745 1.00 26.95  ? 510 ILE B N   1 
ATOM   3507 C CA  . ILE B 1 215 ? 14.357  21.762  -74.535 1.00 26.81  ? 510 ILE B CA  1 
ATOM   3508 C C   . ILE B 1 215 ? 14.176  22.186  -73.078 1.00 22.26  ? 510 ILE B C   1 
ATOM   3509 O O   . ILE B 1 215 ? 14.970  22.951  -72.542 1.00 27.79  ? 510 ILE B O   1 
ATOM   3510 C CB  . ILE B 1 215 ? 13.713  22.782  -75.484 1.00 22.62  ? 510 ILE B CB  1 
ATOM   3511 C CG1 . ILE B 1 215 ? 14.141  22.487  -76.921 1.00 31.78  ? 510 ILE B CG1 1 
ATOM   3512 C CG2 . ILE B 1 215 ? 14.128  24.185  -75.116 1.00 31.32  ? 510 ILE B CG2 1 
ATOM   3513 C CD1 . ILE B 1 215 ? 13.414  23.305  -77.947 1.00 36.06  ? 510 ILE B CD1 1 
ATOM   3514 N N   . LEU B 1 216 ? 13.139  21.671  -72.426 1.00 28.46  ? 511 LEU B N   1 
ATOM   3515 C CA  . LEU B 1 216 ? 12.913  22.003  -71.020 1.00 26.60  ? 511 LEU B CA  1 
ATOM   3516 C C   . LEU B 1 216 ? 14.067  21.534  -70.148 1.00 29.23  ? 511 LEU B C   1 
ATOM   3517 O O   . LEU B 1 216 ? 14.376  22.158  -69.136 1.00 28.69  ? 511 LEU B O   1 
ATOM   3518 C CB  . LEU B 1 216 ? 11.594  21.417  -70.509 1.00 23.71  ? 511 LEU B CB  1 
ATOM   3519 C CG  . LEU B 1 216 ? 10.352  21.970  -71.218 1.00 30.22  ? 511 LEU B CG  1 
ATOM   3520 C CD1 . LEU B 1 216 ? 9.074   21.498  -70.539 1.00 25.55  ? 511 LEU B CD1 1 
ATOM   3521 C CD2 . LEU B 1 216 ? 10.414  23.484  -71.254 1.00 30.62  ? 511 LEU B CD2 1 
ATOM   3522 N N   . SER B 1 217 ? 14.712  20.431  -70.528 1.00 30.24  ? 512 SER B N   1 
ATOM   3523 C CA  . SER B 1 217 ? 15.831  19.939  -69.724 1.00 31.83  ? 512 SER B CA  1 
ATOM   3524 C C   . SER B 1 217 ? 17.008  20.909  -69.792 1.00 28.85  ? 512 SER B C   1 
ATOM   3525 O O   . SER B 1 217 ? 17.715  21.112  -68.803 1.00 30.68  ? 512 SER B O   1 
ATOM   3526 C CB  . SER B 1 217 ? 16.251  18.521  -70.133 1.00 36.24  ? 512 SER B CB  1 
ATOM   3527 O OG  . SER B 1 217 ? 16.761  18.497  -71.452 1.00 48.69  ? 512 SER B OG  1 
ATOM   3528 N N   . HIS B 1 218 ? 17.205  21.513  -70.962 1.00 24.64  ? 513 HIS B N   1 
ATOM   3529 C CA  . HIS B 1 218 ? 18.217  22.549  -71.118 1.00 27.69  ? 513 HIS B CA  1 
ATOM   3530 C C   . HIS B 1 218 ? 17.858  23.780  -70.295 1.00 27.92  ? 513 HIS B C   1 
ATOM   3531 O O   . HIS B 1 218 ? 18.725  24.402  -69.677 1.00 34.47  ? 513 HIS B O   1 
ATOM   3532 C CB  . HIS B 1 218 ? 18.375  22.922  -72.587 1.00 32.42  ? 513 HIS B CB  1 
ATOM   3533 C CG  . HIS B 1 218 ? 18.730  21.761  -73.457 1.00 52.42  ? 513 HIS B CG  1 
ATOM   3534 N ND1 . HIS B 1 218 ? 19.976  21.179  -73.437 1.00 62.33  ? 513 HIS B ND1 1 
ATOM   3535 C CD2 . HIS B 1 218 ? 17.998  21.063  -74.357 1.00 59.20  ? 513 HIS B CD2 1 
ATOM   3536 C CE1 . HIS B 1 218 ? 20.001  20.172  -74.297 1.00 59.34  ? 513 HIS B CE1 1 
ATOM   3537 N NE2 . HIS B 1 218 ? 18.814  20.080  -74.861 1.00 58.49  ? 513 HIS B NE2 1 
ATOM   3538 N N   . ILE B 1 219 ? 16.573  24.123  -70.274 1.00 26.92  ? 514 ILE B N   1 
ATOM   3539 C CA  . ILE B 1 219 ? 16.134  25.278  -69.507 1.00 28.78  ? 514 ILE B CA  1 
ATOM   3540 C C   . ILE B 1 219 ? 16.369  25.042  -68.024 1.00 29.83  ? 514 ILE B C   1 
ATOM   3541 O O   . ILE B 1 219 ? 16.760  25.957  -67.300 1.00 30.56  ? 514 ILE B O   1 
ATOM   3542 C CB  . ILE B 1 219 ? 14.652  25.641  -69.781 1.00 26.06  ? 514 ILE B CB  1 
ATOM   3543 C CG1 . ILE B 1 219 ? 14.514  26.199  -71.200 1.00 29.71  ? 514 ILE B CG1 1 
ATOM   3544 C CG2 . ILE B 1 219 ? 14.169  26.672  -68.772 1.00 23.06  ? 514 ILE B CG2 1 
ATOM   3545 C CD1 . ILE B 1 219 ? 13.108  26.531  -71.616 1.00 34.52  ? 514 ILE B CD1 1 
ATOM   3546 N N   . ARG B 1 220 ? 16.157  23.805  -67.583 1.00 24.01  ? 515 ARG B N   1 
ATOM   3547 C CA  . ARG B 1 220 ? 16.449  23.426  -66.207 1.00 26.65  ? 515 ARG B CA  1 
ATOM   3548 C C   . ARG B 1 220 ? 17.950  23.579  -65.939 1.00 27.75  ? 515 ARG B C   1 
ATOM   3549 O O   . ARG B 1 220 ? 18.355  24.033  -64.872 1.00 28.63  ? 515 ARG B O   1 
ATOM   3550 C CB  . ARG B 1 220 ? 16.009  21.978  -65.933 1.00 29.60  ? 515 ARG B CB  1 
ATOM   3551 C CG  . ARG B 1 220 ? 16.381  21.473  -64.534 1.00 34.57  ? 515 ARG B CG  1 
ATOM   3552 C CD  . ARG B 1 220 ? 15.367  21.927  -63.485 1.00 35.55  ? 515 ARG B CD  1 
ATOM   3553 N NE  . ARG B 1 220 ? 14.112  21.212  -63.643 1.00 43.46  ? 515 ARG B NE  1 
ATOM   3554 C CZ  . ARG B 1 220 ? 13.506  20.521  -62.684 1.00 48.13  ? 515 ARG B CZ  1 
ATOM   3555 N NH1 . ARG B 1 220 ? 14.022  20.468  -61.464 1.00 45.03  ? 515 ARG B NH1 1 
ATOM   3556 N NH2 . ARG B 1 220 ? 12.366  19.896  -62.951 1.00 50.71  ? 515 ARG B NH2 1 
ATOM   3557 N N   . HIS B 1 221 ? 18.771  23.205  -66.913 1.00 24.93  ? 516 HIS B N   1 
ATOM   3558 C CA  . HIS B 1 221 ? 20.216  23.293  -66.752 1.00 29.30  ? 516 HIS B CA  1 
ATOM   3559 C C   . HIS B 1 221 ? 20.637  24.754  -66.572 1.00 33.33  ? 516 HIS B C   1 
ATOM   3560 O O   . HIS B 1 221 ? 21.348  25.090  -65.631 1.00 29.08  ? 516 HIS B O   1 
ATOM   3561 C CB  . HIS B 1 221 ? 20.932  22.668  -67.946 1.00 29.14  ? 516 HIS B CB  1 
ATOM   3562 C CG  . HIS B 1 221 ? 22.428  22.704  -67.836 1.00 40.22  ? 516 HIS B CG  1 
ATOM   3563 N ND1 . HIS B 1 221 ? 23.119  21.956  -66.909 1.00 42.37  ? 516 HIS B ND1 1 
ATOM   3564 C CD2 . HIS B 1 221 ? 23.357  23.402  -68.524 1.00 38.17  ? 516 HIS B CD2 1 
ATOM   3565 C CE1 . HIS B 1 221 ? 24.412  22.187  -67.032 1.00 36.04  ? 516 HIS B CE1 1 
ATOM   3566 N NE2 . HIS B 1 221 ? 24.585  23.065  -68.014 1.00 30.27  ? 516 HIS B NE2 1 
ATOM   3567 N N   . MET B 1 222 ? 20.183  25.615  -67.478 1.00 28.54  ? 517 MET B N   1 
ATOM   3568 C CA  . MET B 1 222 ? 20.482  27.040  -67.407 1.00 25.97  ? 517 MET B CA  1 
ATOM   3569 C C   . MET B 1 222 ? 20.070  27.638  -66.061 1.00 24.89  ? 517 MET B C   1 
ATOM   3570 O O   . MET B 1 222 ? 20.836  28.368  -65.438 1.00 25.62  ? 517 MET B O   1 
ATOM   3571 C CB  . MET B 1 222 ? 19.805  27.783  -68.566 1.00 24.46  ? 517 MET B CB  1 
ATOM   3572 C CG  . MET B 1 222 ? 20.406  27.448  -69.924 1.00 29.77  ? 517 MET B CG  1 
ATOM   3573 S SD  . MET B 1 222 ? 19.715  28.395  -71.296 1.00 31.27  ? 517 MET B SD  1 
ATOM   3574 C CE  . MET B 1 222 ? 18.012  27.836  -71.288 1.00 26.60  ? 517 MET B CE  1 
ATOM   3575 N N   . SER B 1 223 ? 18.862  27.322  -65.615 1.00 29.01  ? 518 SER B N   1 
ATOM   3576 C CA  . SER B 1 223 ? 18.395  27.774  -64.308 1.00 31.30  ? 518 SER B CA  1 
ATOM   3577 C C   . SER B 1 223 ? 19.323  27.306  -63.186 1.00 28.99  ? 518 SER B C   1 
ATOM   3578 O O   . SER B 1 223 ? 19.734  28.102  -62.345 1.00 25.38  ? 518 SER B O   1 
ATOM   3579 C CB  . SER B 1 223 ? 16.968  27.297  -64.053 1.00 34.90  ? 518 SER B CB  1 
ATOM   3580 O OG  . SER B 1 223 ? 16.604  27.485  -62.696 1.00 35.43  ? 518 SER B OG  1 
ATOM   3581 N N   . ASN B 1 224 ? 19.657  26.020  -63.178 1.00 27.70  ? 519 ASN B N   1 
ATOM   3582 C CA  . ASN B 1 224 ? 20.584  25.488  -62.186 1.00 22.74  ? 519 ASN B CA  1 
ATOM   3583 C C   . ASN B 1 224 ? 21.880  26.292  -62.147 1.00 33.41  ? 519 ASN B C   1 
ATOM   3584 O O   . ASN B 1 224 ? 22.371  26.634  -61.075 1.00 31.65  ? 519 ASN B O   1 
ATOM   3585 C CB  . ASN B 1 224 ? 20.887  24.013  -62.457 1.00 27.04  ? 519 ASN B CB  1 
ATOM   3586 C CG  . ASN B 1 224 ? 19.680  23.114  -62.211 1.00 35.60  ? 519 ASN B CG  1 
ATOM   3587 O OD1 . ASN B 1 224 ? 18.775  23.465  -61.452 1.00 40.43  ? 519 ASN B OD1 1 
ATOM   3588 N ND2 . ASN B 1 224 ? 19.665  21.954  -62.851 1.00 29.69  ? 519 ASN B ND2 1 
ATOM   3589 N N   . LYS B 1 225 ? 22.429  26.595  -63.321 1.00 28.65  ? 520 LYS B N   1 
ATOM   3590 C CA  . LYS B 1 225 ? 23.663  27.355  -63.394 1.00 27.71  ? 520 LYS B CA  1 
ATOM   3591 C C   . LYS B 1 225 ? 23.461  28.778  -62.870 1.00 34.48  ? 520 LYS B C   1 
ATOM   3592 O O   . LYS B 1 225 ? 24.301  29.310  -62.137 1.00 32.80  ? 520 LYS B O   1 
ATOM   3593 C CB  . LYS B 1 225 ? 24.204  27.380  -64.828 1.00 30.30  ? 520 LYS B CB  1 
ATOM   3594 C CG  . LYS B 1 225 ? 24.701  26.029  -65.326 1.00 31.99  ? 520 LYS B CG  1 
ATOM   3595 C CD  . LYS B 1 225 ? 25.351  25.253  -64.187 1.00 41.11  ? 520 LYS B CD  1 
ATOM   3596 C CE  . LYS B 1 225 ? 26.282  24.161  -64.693 1.00 57.26  ? 520 LYS B CE  1 
ATOM   3597 N NZ  . LYS B 1 225 ? 27.677  24.653  -64.871 1.00 63.23  ? 520 LYS B NZ  1 
ATOM   3598 N N   . GLY B 1 226 ? 22.344  29.388  -63.257 1.00 30.51  ? 521 GLY B N   1 
ATOM   3599 C CA  . GLY B 1 226 ? 22.017  30.732  -62.824 1.00 31.95  ? 521 GLY B CA  1 
ATOM   3600 C C   . GLY B 1 226 ? 21.778  30.797  -61.327 1.00 34.00  ? 521 GLY B C   1 
ATOM   3601 O O   . GLY B 1 226 ? 22.245  31.709  -60.647 1.00 42.57  ? 521 GLY B O   1 
ATOM   3602 N N   . MET B 1 227 ? 21.037  29.829  -60.814 1.00 32.74  ? 522 MET B N   1 
ATOM   3603 C CA  . MET B 1 227 ? 20.762  29.752  -59.389 1.00 41.58  ? 522 MET B CA  1 
ATOM   3604 C C   . MET B 1 227 ? 22.079  29.635  -58.634 1.00 45.06  ? 522 MET B C   1 
ATOM   3605 O O   . MET B 1 227 ? 22.254  30.227  -57.566 1.00 41.10  ? 522 MET B O   1 
ATOM   3606 C CB  . MET B 1 227 ? 19.887  28.539  -59.096 1.00 42.83  ? 522 MET B CB  1 
ATOM   3607 C CG  . MET B 1 227 ? 18.998  28.699  -57.888 1.00 53.19  ? 522 MET B CG  1 
ATOM   3608 S SD  . MET B 1 227 ? 17.809  30.014  -58.161 1.00 45.19  ? 522 MET B SD  1 
ATOM   3609 C CE  . MET B 1 227 ? 17.170  29.515  -59.752 1.00 65.81  ? 522 MET B CE  1 
ATOM   3610 N N   . GLU B 1 228 ? 23.006  28.879  -59.215 1.00 43.39  ? 523 GLU B N   1 
ATOM   3611 C CA  . GLU B 1 228 ? 24.324  28.661  -58.639 1.00 48.88  ? 523 GLU B CA  1 
ATOM   3612 C C   . GLU B 1 228 ? 25.063  29.974  -58.457 1.00 49.75  ? 523 GLU B C   1 
ATOM   3613 O O   . GLU B 1 228 ? 25.636  30.233  -57.399 1.00 53.60  ? 523 GLU B O   1 
ATOM   3614 C CB  . GLU B 1 228 ? 25.138  27.749  -59.554 1.00 60.83  ? 523 GLU B CB  1 
ATOM   3615 C CG  . GLU B 1 228 ? 26.028  26.758  -58.837 1.00 68.00  ? 523 GLU B CG  1 
ATOM   3616 C CD  . GLU B 1 228 ? 26.757  25.852  -59.807 1.00 70.82  ? 523 GLU B CD  1 
ATOM   3617 O OE1 . GLU B 1 228 ? 27.177  24.749  -59.398 1.00 74.83  ? 523 GLU B OE1 1 
ATOM   3618 O OE2 . GLU B 1 228 ? 26.904  26.244  -60.984 1.00 69.80  ? 523 GLU B OE2 1 
ATOM   3619 N N   . HIS B 1 229 ? 25.054  30.793  -59.506 1.00 48.77  ? 524 HIS B N   1 
ATOM   3620 C CA  . HIS B 1 229 ? 25.697  32.105  -59.477 1.00 52.35  ? 524 HIS B CA  1 
ATOM   3621 C C   . HIS B 1 229 ? 25.023  33.030  -58.461 1.00 52.91  ? 524 HIS B C   1 
ATOM   3622 O O   . HIS B 1 229 ? 25.698  33.730  -57.708 1.00 54.81  ? 524 HIS B O   1 
ATOM   3623 C CB  . HIS B 1 229 ? 25.665  32.740  -60.869 1.00 56.59  ? 524 HIS B CB  1 
ATOM   3624 C CG  . HIS B 1 229 ? 26.526  33.956  -61.000 1.00 68.85  ? 524 HIS B CG  1 
ATOM   3625 N ND1 . HIS B 1 229 ? 26.036  35.237  -60.866 1.00 72.20  ? 524 HIS B ND1 1 
ATOM   3626 C CD2 . HIS B 1 229 ? 27.851  34.087  -61.258 1.00 71.89  ? 524 HIS B CD2 1 
ATOM   3627 C CE1 . HIS B 1 229 ? 27.018  36.104  -61.034 1.00 72.79  ? 524 HIS B CE1 1 
ATOM   3628 N NE2 . HIS B 1 229 ? 28.131  35.430  -61.273 1.00 74.81  ? 524 HIS B NE2 1 
ATOM   3629 N N   . LEU B 1 230 ? 23.691  33.027  -58.451 1.00 47.92  ? 525 LEU B N   1 
ATOM   3630 C CA  . LEU B 1 230 ? 22.913  33.823  -57.502 1.00 47.69  ? 525 LEU B CA  1 
ATOM   3631 C C   . LEU B 1 230 ? 23.306  33.564  -56.050 1.00 54.78  ? 525 LEU B C   1 
ATOM   3632 O O   . LEU B 1 230 ? 23.370  34.490  -55.239 1.00 57.83  ? 525 LEU B O   1 
ATOM   3633 C CB  . LEU B 1 230 ? 21.415  33.571  -57.681 1.00 38.26  ? 525 LEU B CB  1 
ATOM   3634 C CG  . LEU B 1 230 ? 20.742  34.279  -58.857 1.00 38.48  ? 525 LEU B CG  1 
ATOM   3635 C CD1 . LEU B 1 230 ? 19.254  33.951  -58.908 1.00 35.05  ? 525 LEU B CD1 1 
ATOM   3636 C CD2 . LEU B 1 230 ? 20.955  35.768  -58.761 1.00 44.93  ? 525 LEU B CD2 1 
ATOM   3637 N N   . TYR B 1 231 ? 23.563  32.302  -55.723 1.00 57.31  ? 526 TYR B N   1 
ATOM   3638 C CA  . TYR B 1 231 ? 23.917  31.925  -54.356 1.00 61.58  ? 526 TYR B CA  1 
ATOM   3639 C C   . TYR B 1 231 ? 25.349  32.309  -53.995 1.00 64.12  ? 526 TYR B C   1 
ATOM   3640 O O   . TYR B 1 231 ? 25.691  32.396  -52.816 1.00 69.24  ? 526 TYR B O   1 
ATOM   3641 C CB  . TYR B 1 231 ? 23.700  30.425  -54.123 1.00 61.54  ? 526 TYR B CB  1 
ATOM   3642 C CG  . TYR B 1 231 ? 22.274  30.045  -53.784 1.00 68.36  ? 526 TYR B CG  1 
ATOM   3643 C CD1 . TYR B 1 231 ? 21.650  30.547  -52.648 1.00 71.07  ? 526 TYR B CD1 1 
ATOM   3644 C CD2 . TYR B 1 231 ? 21.558  29.167  -54.586 1.00 73.52  ? 526 TYR B CD2 1 
ATOM   3645 C CE1 . TYR B 1 231 ? 20.349  30.196  -52.330 1.00 72.46  ? 526 TYR B CE1 1 
ATOM   3646 C CE2 . TYR B 1 231 ? 20.257  28.809  -54.275 1.00 75.60  ? 526 TYR B CE2 1 
ATOM   3647 C CZ  . TYR B 1 231 ? 19.658  29.327  -53.147 1.00 75.85  ? 526 TYR B CZ  1 
ATOM   3648 O OH  . TYR B 1 231 ? 18.365  28.975  -52.834 1.00 78.15  ? 526 TYR B OH  1 
ATOM   3649 N N   . SER B 1 232 ? 26.180  32.541  -55.007 1.00 82.46  ? 527 SER B N   1 
ATOM   3650 C CA  . SER B 1 232 ? 27.579  32.897  -54.779 1.00 82.77  ? 527 SER B CA  1 
ATOM   3651 C C   . SER B 1 232 ? 27.761  34.401  -54.581 1.00 88.24  ? 527 SER B C   1 
ATOM   3652 O O   . SER B 1 232 ? 28.885  34.890  -54.463 1.00 91.53  ? 527 SER B O   1 
ATOM   3653 C CB  . SER B 1 232 ? 28.456  32.411  -55.933 1.00 66.33  ? 527 SER B CB  1 
ATOM   3654 O OG  . SER B 1 232 ? 28.209  33.162  -57.109 1.00 66.94  ? 527 SER B OG  1 
ATOM   3655 N N   . MET B 1 233 ? 26.649  35.129  -54.552 1.00 88.72  ? 528 MET B N   1 
ATOM   3656 C CA  . MET B 1 233 ? 26.676  36.566  -54.312 1.00 85.69  ? 528 MET B CA  1 
ATOM   3657 C C   . MET B 1 233 ? 26.458  36.857  -52.833 1.00 91.27  ? 528 MET B C   1 
ATOM   3658 O O   . MET B 1 233 ? 25.440  36.467  -52.261 1.00 89.67  ? 528 MET B O   1 
ATOM   3659 C CB  . MET B 1 233 ? 25.600  37.263  -55.143 1.00 80.21  ? 528 MET B CB  1 
ATOM   3660 C CG  . MET B 1 233 ? 25.840  37.212  -56.642 1.00 80.62  ? 528 MET B CG  1 
ATOM   3661 S SD  . MET B 1 233 ? 24.393  37.738  -57.579 1.00 77.65  ? 528 MET B SD  1 
ATOM   3662 C CE  . MET B 1 233 ? 23.339  38.326  -56.257 1.00 109.45 ? 528 MET B CE  1 
ATOM   3663 N N   . LYS B 1 234 ? 27.413  37.548  -52.219 1.00 103.02 ? 529 LYS B N   1 
ATOM   3664 C CA  . LYS B 1 234 ? 27.327  37.876  -50.798 1.00 110.62 ? 529 LYS B CA  1 
ATOM   3665 C C   . LYS B 1 234 ? 26.271  38.944  -50.517 1.00 118.98 ? 529 LYS B C   1 
ATOM   3666 O O   . LYS B 1 234 ? 26.395  39.714  -49.566 1.00 122.77 ? 529 LYS B O   1 
ATOM   3667 C CB  . LYS B 1 234 ? 28.689  38.334  -50.270 1.00 111.70 ? 529 LYS B CB  1 
ATOM   3668 N N   . CYS B 1 235 ? 25.233  38.986  -51.348 1.00 122.72 ? 530 CYS B N   1 
ATOM   3669 C CA  . CYS B 1 235 ? 24.149  39.944  -51.170 1.00 125.30 ? 530 CYS B CA  1 
ATOM   3670 C C   . CYS B 1 235 ? 22.989  39.326  -50.398 1.00 129.87 ? 530 CYS B C   1 
ATOM   3671 O O   . CYS B 1 235 ? 21.942  39.954  -50.227 1.00 132.45 ? 530 CYS B O   1 
ATOM   3672 C CB  . CYS B 1 235 ? 23.664  40.469  -52.522 1.00 123.10 ? 530 CYS B CB  1 
ATOM   3673 N N   . LYS B 1 236 ? 23.184  38.090  -49.948 1.00 129.80 ? 531 LYS B N   1 
ATOM   3674 C CA  . LYS B 1 236 ? 22.206  37.398  -49.113 1.00 127.68 ? 531 LYS B CA  1 
ATOM   3675 C C   . LYS B 1 236 ? 20.804  37.381  -49.712 1.00 123.57 ? 531 LYS B C   1 
ATOM   3676 O O   . LYS B 1 236 ? 19.859  36.914  -49.069 1.00 123.01 ? 531 LYS B O   1 
ATOM   3677 C CB  . LYS B 1 236 ? 22.161  38.022  -47.716 1.00 128.59 ? 531 LYS B CB  1 
ATOM   3678 N N   . ASN B 1 237 ? 20.663  37.886  -50.935 1.00 131.13 ? 532 ASN B N   1 
ATOM   3679 C CA  . ASN B 1 237 ? 19.348  37.938  -51.555 1.00 126.43 ? 532 ASN B CA  1 
ATOM   3680 C C   . ASN B 1 237 ? 19.246  38.488  -52.970 1.00 122.69 ? 532 ASN B C   1 
ATOM   3681 O O   . ASN B 1 237 ? 19.706  39.587  -53.278 1.00 123.46 ? 532 ASN B O   1 
ATOM   3682 C CB  . ASN B 1 237 ? 18.367  38.704  -50.663 1.00 126.49 ? 532 ASN B CB  1 
ATOM   3683 N N   . VAL B 1 238 ? 18.669  37.657  -53.825 1.00 117.15 ? 533 VAL B N   1 
ATOM   3684 C CA  . VAL B 1 238 ? 17.821  38.075  -54.931 1.00 110.11 ? 533 VAL B CA  1 
ATOM   3685 C C   . VAL B 1 238 ? 16.941  36.852  -55.097 1.00 98.55  ? 533 VAL B C   1 
ATOM   3686 O O   . VAL B 1 238 ? 15.907  36.884  -55.765 1.00 100.67 ? 533 VAL B O   1 
ATOM   3687 C CB  . VAL B 1 238 ? 18.575  38.391  -56.241 1.00 116.47 ? 533 VAL B CB  1 
ATOM   3688 C CG1 . VAL B 1 238 ? 20.057  38.621  -55.988 1.00 113.43 ? 533 VAL B CG1 1 
ATOM   3689 C CG2 . VAL B 1 238 ? 18.355  37.290  -57.270 1.00 114.78 ? 533 VAL B CG2 1 
ATOM   3690 N N   . VAL B 1 239 ? 17.369  35.777  -54.437 1.00 65.10  ? 534 VAL B N   1 
ATOM   3691 C CA  . VAL B 1 239 ? 16.632  34.527  -54.377 1.00 55.52  ? 534 VAL B CA  1 
ATOM   3692 C C   . VAL B 1 239 ? 15.480  34.667  -53.391 1.00 49.11  ? 534 VAL B C   1 
ATOM   3693 O O   . VAL B 1 239 ? 15.707  34.840  -52.193 1.00 45.73  ? 534 VAL B O   1 
ATOM   3694 C CB  . VAL B 1 239 ? 17.533  33.387  -53.880 1.00 54.26  ? 534 VAL B CB  1 
ATOM   3695 C CG1 . VAL B 1 239 ? 16.870  32.045  -54.132 1.00 56.96  ? 534 VAL B CG1 1 
ATOM   3696 C CG2 . VAL B 1 239 ? 18.895  33.451  -54.549 1.00 52.01  ? 534 VAL B CG2 1 
ATOM   3697 N N   . PRO B 1 240 ? 14.236  34.582  -53.890 1.00 48.22  ? 535 PRO B N   1 
ATOM   3698 C CA  . PRO B 1 240 ? 13.058  34.732  -53.029 1.00 47.47  ? 535 PRO B CA  1 
ATOM   3699 C C   . PRO B 1 240 ? 12.969  33.579  -52.046 1.00 47.89  ? 535 PRO B C   1 
ATOM   3700 O O   . PRO B 1 240 ? 13.147  32.433  -52.449 1.00 47.87  ? 535 PRO B O   1 
ATOM   3701 C CB  . PRO B 1 240 ? 11.892  34.653  -54.017 1.00 40.96  ? 535 PRO B CB  1 
ATOM   3702 C CG  . PRO B 1 240 ? 12.415  33.828  -55.143 1.00 40.95  ? 535 PRO B CG  1 
ATOM   3703 C CD  . PRO B 1 240 ? 13.866  34.225  -55.270 1.00 49.09  ? 535 PRO B CD  1 
ATOM   3704 N N   . SER B 1 241 ? 12.702  33.879  -50.779 1.00 43.91  ? 536 SER B N   1 
ATOM   3705 C CA  . SER B 1 241 ? 12.616  32.850  -49.753 1.00 39.78  ? 536 SER B CA  1 
ATOM   3706 C C   . SER B 1 241 ? 11.259  32.158  -49.797 1.00 43.11  ? 536 SER B C   1 
ATOM   3707 O O   . SER B 1 241 ? 10.329  32.629  -50.454 1.00 47.07  ? 536 SER B O   1 
ATOM   3708 C CB  . SER B 1 241 ? 12.818  33.470  -48.376 1.00 41.63  ? 536 SER B CB  1 
ATOM   3709 O OG  . SER B 1 241 ? 11.781  34.387  -48.095 1.00 43.13  ? 536 SER B OG  1 
ATOM   3710 N N   . TYR B 1 242 ? 11.152  31.043  -49.084 1.00 45.88  ? 537 TYR B N   1 
ATOM   3711 C CA  . TYR B 1 242 ? 9.886   30.328  -48.948 1.00 46.96  ? 537 TYR B CA  1 
ATOM   3712 C C   . TYR B 1 242 ? 8.840   31.238  -48.299 1.00 44.39  ? 537 TYR B C   1 
ATOM   3713 O O   . TYR B 1 242 ? 7.696   31.318  -48.750 1.00 40.18  ? 537 TYR B O   1 
ATOM   3714 C CB  . TYR B 1 242 ? 10.093  29.056  -48.118 1.00 47.60  ? 537 TYR B CB  1 
ATOM   3715 C CG  . TYR B 1 242 ? 8.834   28.270  -47.818 1.00 48.42  ? 537 TYR B CG  1 
ATOM   3716 C CD1 . TYR B 1 242 ? 8.052   28.568  -46.709 1.00 51.49  ? 537 TYR B CD1 1 
ATOM   3717 C CD2 . TYR B 1 242 ? 8.441   27.211  -48.631 1.00 46.74  ? 537 TYR B CD2 1 
ATOM   3718 C CE1 . TYR B 1 242 ? 6.906   27.847  -46.432 1.00 52.68  ? 537 TYR B CE1 1 
ATOM   3719 C CE2 . TYR B 1 242 ? 7.296   26.486  -48.360 1.00 46.89  ? 537 TYR B CE2 1 
ATOM   3720 C CZ  . TYR B 1 242 ? 6.536   26.808  -47.260 1.00 50.49  ? 537 TYR B CZ  1 
ATOM   3721 O OH  . TYR B 1 242 ? 5.397   26.090  -46.983 1.00 55.27  ? 537 TYR B OH  1 
ATOM   3722 N N   . ASP B 1 243 ? 9.248   31.937  -47.246 1.00 46.25  ? 538 ASP B N   1 
ATOM   3723 C CA  . ASP B 1 243 ? 8.347   32.815  -46.512 1.00 53.86  ? 538 ASP B CA  1 
ATOM   3724 C C   . ASP B 1 243 ? 7.877   33.969  -47.393 1.00 50.04  ? 538 ASP B C   1 
ATOM   3725 O O   . ASP B 1 243 ? 6.705   34.347  -47.370 1.00 49.98  ? 538 ASP B O   1 
ATOM   3726 C CB  . ASP B 1 243 ? 9.038   33.342  -45.254 1.00 61.82  ? 538 ASP B CB  1 
ATOM   3727 C CG  . ASP B 1 243 ? 9.678   32.231  -44.436 1.00 72.05  ? 538 ASP B CG  1 
ATOM   3728 O OD1 . ASP B 1 243 ? 10.924  32.177  -44.376 1.00 82.22  ? 538 ASP B OD1 1 
ATOM   3729 O OD2 . ASP B 1 243 ? 8.938   31.404  -43.863 1.00 72.77  ? 538 ASP B OD2 1 
ATOM   3730 N N   . LEU B 1 244 ? 8.792   34.523  -48.178 1.00 52.27  ? 539 LEU B N   1 
ATOM   3731 C CA  . LEU B 1 244 ? 8.442   35.606  -49.086 1.00 50.21  ? 539 LEU B CA  1 
ATOM   3732 C C   . LEU B 1 244 ? 7.395   35.142  -50.093 1.00 50.81  ? 539 LEU B C   1 
ATOM   3733 O O   . LEU B 1 244 ? 6.379   35.807  -50.301 1.00 51.59  ? 539 LEU B O   1 
ATOM   3734 C CB  . LEU B 1 244 ? 9.678   36.126  -49.816 1.00 50.09  ? 539 LEU B CB  1 
ATOM   3735 C CG  . LEU B 1 244 ? 9.361   37.136  -50.919 1.00 55.48  ? 539 LEU B CG  1 
ATOM   3736 C CD1 . LEU B 1 244 ? 8.743   38.391  -50.325 1.00 56.76  ? 539 LEU B CD1 1 
ATOM   3737 C CD2 . LEU B 1 244 ? 10.598  37.476  -51.734 1.00 56.03  ? 539 LEU B CD2 1 
ATOM   3738 N N   . LEU B 1 245 ? 7.651   33.996  -50.717 1.00 37.23  ? 540 LEU B N   1 
ATOM   3739 C CA  . LEU B 1 245 ? 6.740   33.456  -51.718 1.00 34.11  ? 540 LEU B CA  1 
ATOM   3740 C C   . LEU B 1 245 ? 5.376   33.136  -51.124 1.00 39.97  ? 540 LEU B C   1 
ATOM   3741 O O   . LEU B 1 245 ? 4.340   33.373  -51.752 1.00 39.73  ? 540 LEU B O   1 
ATOM   3742 C CB  . LEU B 1 245 ? 7.343   32.210  -52.376 1.00 29.37  ? 540 LEU B CB  1 
ATOM   3743 C CG  . LEU B 1 245 ? 8.481   32.526  -53.359 1.00 33.44  ? 540 LEU B CG  1 
ATOM   3744 C CD1 . LEU B 1 245 ? 9.277   31.276  -53.716 1.00 31.69  ? 540 LEU B CD1 1 
ATOM   3745 C CD2 . LEU B 1 245 ? 7.925   33.188  -54.610 1.00 35.90  ? 540 LEU B CD2 1 
ATOM   3746 N N   . LEU B 1 246 ? 5.379   32.606  -49.905 1.00 43.34  ? 541 LEU B N   1 
ATOM   3747 C CA  . LEU B 1 246 ? 4.137   32.280  -49.213 1.00 38.38  ? 541 LEU B CA  1 
ATOM   3748 C C   . LEU B 1 246 ? 3.351   33.552  -48.926 1.00 43.82  ? 541 LEU B C   1 
ATOM   3749 O O   . LEU B 1 246 ? 2.153   33.631  -49.197 1.00 42.86  ? 541 LEU B O   1 
ATOM   3750 C CB  . LEU B 1 246 ? 4.430   31.527  -47.914 1.00 41.17  ? 541 LEU B CB  1 
ATOM   3751 C CG  . LEU B 1 246 ? 3.251   31.042  -47.072 1.00 50.01  ? 541 LEU B CG  1 
ATOM   3752 C CD1 . LEU B 1 246 ? 2.348   30.115  -47.873 1.00 52.76  ? 541 LEU B CD1 1 
ATOM   3753 C CD2 . LEU B 1 246 ? 3.762   30.335  -45.827 1.00 57.67  ? 541 LEU B CD2 1 
ATOM   3754 N N   . GLU B 1 247 ? 4.031   34.548  -48.371 1.00 51.63  ? 542 GLU B N   1 
ATOM   3755 C CA  . GLU B 1 247 ? 3.404   35.836  -48.120 1.00 54.49  ? 542 GLU B CA  1 
ATOM   3756 C C   . GLU B 1 247 ? 2.713   36.317  -49.390 1.00 53.00  ? 542 GLU B C   1 
ATOM   3757 O O   . GLU B 1 247 ? 1.525   36.630  -49.383 1.00 56.39  ? 542 GLU B O   1 
ATOM   3758 C CB  . GLU B 1 247 ? 4.443   36.858  -47.662 1.00 58.69  ? 542 GLU B CB  1 
ATOM   3759 N N   . MET B 1 248 ? 3.464   36.346  -50.486 1.00 49.33  ? 543 MET B N   1 
ATOM   3760 C CA  . MET B 1 248 ? 2.953   36.849  -51.757 1.00 48.22  ? 543 MET B CA  1 
ATOM   3761 C C   . MET B 1 248 ? 1.757   36.063  -52.273 1.00 48.96  ? 543 MET B C   1 
ATOM   3762 O O   . MET B 1 248 ? 0.931   36.593  -53.016 1.00 51.73  ? 543 MET B O   1 
ATOM   3763 C CB  . MET B 1 248 ? 4.062   36.870  -52.812 1.00 50.77  ? 543 MET B CB  1 
ATOM   3764 C CG  . MET B 1 248 ? 4.608   38.266  -53.105 1.00 52.99  ? 543 MET B CG  1 
ATOM   3765 S SD  . MET B 1 248 ? 5.932   38.244  -54.326 1.00 81.79  ? 543 MET B SD  1 
ATOM   3766 C CE  . MET B 1 248 ? 7.152   37.270  -53.455 1.00 54.69  ? 543 MET B CE  1 
ATOM   3767 N N   . LEU B 1 249 ? 1.664   34.798  -51.880 1.00 46.35  ? 544 LEU B N   1 
ATOM   3768 C CA  . LEU B 1 249 ? 0.584   33.946  -52.364 1.00 48.78  ? 544 LEU B CA  1 
ATOM   3769 C C   . LEU B 1 249 ? -0.771  34.292  -51.745 1.00 52.47  ? 544 LEU B C   1 
ATOM   3770 O O   . LEU B 1 249 ? -1.805  34.215  -52.410 1.00 49.49  ? 544 LEU B O   1 
ATOM   3771 C CB  . LEU B 1 249 ? 0.923   32.469  -52.149 1.00 52.44  ? 544 LEU B CB  1 
ATOM   3772 C CG  . LEU B 1 249 ? 1.737   31.843  -53.283 1.00 52.86  ? 544 LEU B CG  1 
ATOM   3773 C CD1 . LEU B 1 249 ? 2.335   30.525  -52.850 1.00 62.85  ? 544 LEU B CD1 1 
ATOM   3774 C CD2 . LEU B 1 249 ? 0.872   31.666  -54.523 1.00 47.44  ? 544 LEU B CD2 1 
ATOM   3775 N N   . ASP B 1 250 ? -0.767  34.663  -50.470 1.00 58.37  ? 545 ASP B N   1 
ATOM   3776 C CA  . ASP B 1 250 ? -1.998  35.074  -49.809 1.00 72.69  ? 545 ASP B CA  1 
ATOM   3777 C C   . ASP B 1 250 ? -2.533  36.311  -50.517 1.00 79.75  ? 545 ASP B C   1 
ATOM   3778 O O   . ASP B 1 250 ? -2.021  37.411  -50.325 1.00 77.76  ? 545 ASP B O   1 
ATOM   3779 C CB  . ASP B 1 250 ? -1.755  35.351  -48.325 1.00 81.38  ? 545 ASP B CB  1 
ATOM   3780 C CG  . ASP B 1 250 ? -1.295  34.113  -47.567 1.00 86.44  ? 545 ASP B CG  1 
ATOM   3781 O OD1 . ASP B 1 250 ? -1.588  32.987  -48.025 1.00 84.09  ? 545 ASP B OD1 1 
ATOM   3782 O OD2 . ASP B 1 250 ? -0.648  34.266  -46.509 1.00 91.12  ? 545 ASP B OD2 1 
ATOM   3783 N N   . ALA B 1 251 ? -3.556  36.107  -51.346 1.00 91.37  ? 546 ALA B N   1 
ATOM   3784 C CA  . ALA B 1 251 ? -4.123  37.141  -52.217 1.00 93.23  ? 546 ALA B CA  1 
ATOM   3785 C C   . ALA B 1 251 ? -3.503  38.518  -52.019 1.00 97.26  ? 546 ALA B C   1 
ATOM   3786 O O   . ALA B 1 251 ? -4.003  39.328  -51.237 1.00 102.52 ? 546 ALA B O   1 
ATOM   3787 C CB  . ALA B 1 251 ? -5.635  37.210  -52.052 1.00 95.62  ? 546 ALA B CB  1 
ATOM   3788 N N   . SER C 2 10  ? 22.834  44.725  -0.712  1.00 72.06  ? 305 SER C N   1 
ATOM   3789 C CA  . SER C 2 10  ? 22.154  44.859  0.574   1.00 82.99  ? 305 SER C CA  1 
ATOM   3790 C C   . SER C 2 10  ? 21.653  46.290  0.735   1.00 87.14  ? 305 SER C C   1 
ATOM   3791 O O   . SER C 2 10  ? 20.485  46.531  1.038   1.00 90.12  ? 305 SER C O   1 
ATOM   3792 C CB  . SER C 2 10  ? 23.098  44.487  1.716   1.00 87.51  ? 305 SER C CB  1 
ATOM   3793 O OG  . SER C 2 10  ? 22.408  44.458  2.952   1.00 92.35  ? 305 SER C OG  1 
ATOM   3794 N N   . LEU C 2 11  ? 22.574  47.227  0.554   1.00 84.34  ? 306 LEU C N   1 
ATOM   3795 C CA  . LEU C 2 11  ? 22.264  48.612  0.240   1.00 77.00  ? 306 LEU C CA  1 
ATOM   3796 C C   . LEU C 2 11  ? 21.260  48.623  -0.907  1.00 65.64  ? 306 LEU C C   1 
ATOM   3797 O O   . LEU C 2 11  ? 20.271  49.360  -0.887  1.00 61.87  ? 306 LEU C O   1 
ATOM   3798 C CB  . LEU C 2 11  ? 23.544  49.322  -0.199  1.00 80.11  ? 306 LEU C CB  1 
ATOM   3799 N N   . ALA C 2 12  ? 21.528  47.790  -1.908  1.00 50.07  ? 307 ALA C N   1 
ATOM   3800 C CA  . ALA C 2 12  ? 20.621  47.609  -3.034  1.00 45.67  ? 307 ALA C CA  1 
ATOM   3801 C C   . ALA C 2 12  ? 19.255  47.113  -2.574  1.00 45.60  ? 307 ALA C C   1 
ATOM   3802 O O   . ALA C 2 12  ? 18.226  47.459  -3.157  1.00 44.10  ? 307 ALA C O   1 
ATOM   3803 C CB  . ALA C 2 12  ? 21.218  46.631  -4.032  1.00 46.87  ? 307 ALA C CB  1 
ATOM   3804 N N   . LEU C 2 13  ? 19.253  46.296  -1.526  1.00 51.84  ? 308 LEU C N   1 
ATOM   3805 C CA  . LEU C 2 13  ? 18.026  45.673  -1.049  1.00 48.81  ? 308 LEU C CA  1 
ATOM   3806 C C   . LEU C 2 13  ? 17.135  46.660  -0.312  1.00 49.89  ? 308 LEU C C   1 
ATOM   3807 O O   . LEU C 2 13  ? 15.965  46.380  -0.064  1.00 52.64  ? 308 LEU C O   1 
ATOM   3808 C CB  . LEU C 2 13  ? 18.345  44.472  -0.156  1.00 47.28  ? 308 LEU C CB  1 
ATOM   3809 C CG  . LEU C 2 13  ? 19.205  43.394  -0.821  1.00 55.22  ? 308 LEU C CG  1 
ATOM   3810 C CD1 . LEU C 2 13  ? 19.393  42.191  0.098   1.00 57.61  ? 308 LEU C CD1 1 
ATOM   3811 C CD2 . LEU C 2 13  ? 18.583  42.972  -2.138  1.00 55.55  ? 308 LEU C CD2 1 
ATOM   3812 N N   . SER C 2 14  ? 17.685  47.821  0.030   1.00 51.66  ? 309 SER C N   1 
ATOM   3813 C CA  . SER C 2 14  ? 16.920  48.827  0.755   1.00 51.46  ? 309 SER C CA  1 
ATOM   3814 C C   . SER C 2 14  ? 16.336  49.897  -0.167  1.00 48.99  ? 309 SER C C   1 
ATOM   3815 O O   . SER C 2 14  ? 15.475  50.675  0.246   1.00 50.88  ? 309 SER C O   1 
ATOM   3816 C CB  . SER C 2 14  ? 17.781  49.485  1.832   1.00 52.79  ? 309 SER C CB  1 
ATOM   3817 O OG  . SER C 2 14  ? 18.696  50.405  1.259   1.00 58.76  ? 309 SER C OG  1 
ATOM   3818 N N   . LEU C 2 15  ? 16.802  49.933  -1.412  1.00 41.89  ? 310 LEU C N   1 
ATOM   3819 C CA  . LEU C 2 15  ? 16.351  50.947  -2.363  1.00 39.43  ? 310 LEU C CA  1 
ATOM   3820 C C   . LEU C 2 15  ? 14.856  50.855  -2.639  1.00 41.30  ? 310 LEU C C   1 
ATOM   3821 O O   . LEU C 2 15  ? 14.296  49.767  -2.685  1.00 42.18  ? 310 LEU C O   1 
ATOM   3822 C CB  . LEU C 2 15  ? 17.121  50.831  -3.682  1.00 32.43  ? 310 LEU C CB  1 
ATOM   3823 C CG  . LEU C 2 15  ? 18.617  51.149  -3.643  1.00 37.22  ? 310 LEU C CG  1 
ATOM   3824 C CD1 . LEU C 2 15  ? 19.234  51.009  -5.022  1.00 37.23  ? 310 LEU C CD1 1 
ATOM   3825 C CD2 . LEU C 2 15  ? 18.840  52.549  -3.111  1.00 35.00  ? 310 LEU C CD2 1 
ATOM   3826 N N   . THR C 2 16  ? 14.206  51.999  -2.812  1.00 38.81  ? 311 THR C N   1 
ATOM   3827 C CA  . THR C 2 16  ? 12.828  52.015  -3.273  1.00 39.87  ? 311 THR C CA  1 
ATOM   3828 C C   . THR C 2 16  ? 12.841  51.905  -4.789  1.00 40.10  ? 311 THR C C   1 
ATOM   3829 O O   . THR C 2 16  ? 13.893  52.033  -5.416  1.00 37.31  ? 311 THR C O   1 
ATOM   3830 C CB  . THR C 2 16  ? 12.119  53.328  -2.916  1.00 40.75  ? 311 THR C CB  1 
ATOM   3831 O OG1 . THR C 2 16  ? 12.780  54.414  -3.579  1.00 37.36  ? 311 THR C OG1 1 
ATOM   3832 C CG2 . THR C 2 16  ? 12.124  53.560  -1.406  1.00 39.84  ? 311 THR C CG2 1 
ATOM   3833 N N   . ALA C 2 17  ? 11.667  51.688  -5.370  1.00 38.22  ? 312 ALA C N   1 
ATOM   3834 C CA  . ALA C 2 17  ? 11.522  51.616  -6.817  1.00 36.68  ? 312 ALA C CA  1 
ATOM   3835 C C   . ALA C 2 17  ? 12.055  52.874  -7.497  1.00 35.79  ? 312 ALA C C   1 
ATOM   3836 O O   . ALA C 2 17  ? 12.700  52.802  -8.539  1.00 35.45  ? 312 ALA C O   1 
ATOM   3837 C CB  . ALA C 2 17  ? 10.063  51.401  -7.180  1.00 42.68  ? 312 ALA C CB  1 
ATOM   3838 N N   . ASP C 2 18  ? 11.779  54.030  -6.908  1.00 34.60  ? 313 ASP C N   1 
ATOM   3839 C CA  . ASP C 2 18  ? 12.230  55.302  -7.479  1.00 37.61  ? 313 ASP C CA  1 
ATOM   3840 C C   . ASP C 2 18  ? 13.748  55.439  -7.424  1.00 35.85  ? 313 ASP C C   1 
ATOM   3841 O O   . ASP C 2 18  ? 14.377  55.854  -8.400  1.00 38.19  ? 313 ASP C O   1 
ATOM   3842 C CB  . ASP C 2 18  ? 11.552  56.487  -6.775  1.00 39.10  ? 313 ASP C CB  1 
ATOM   3843 C CG  . ASP C 2 18  ? 10.065  56.598  -7.108  1.00 52.66  ? 313 ASP C CG  1 
ATOM   3844 O OD1 . ASP C 2 18  ? 9.373   57.446  -6.500  1.00 54.58  ? 313 ASP C OD1 1 
ATOM   3845 O OD2 . ASP C 2 18  ? 9.588   55.841  -7.982  1.00 59.11  ? 313 ASP C OD2 1 
ATOM   3846 N N   . GLN C 2 19  ? 14.336  55.084  -6.284  1.00 33.16  ? 314 GLN C N   1 
ATOM   3847 C CA  . GLN C 2 19  ? 15.790  55.121  -6.134  1.00 31.33  ? 314 GLN C CA  1 
ATOM   3848 C C   . GLN C 2 19  ? 16.488  54.181  -7.108  1.00 36.62  ? 314 GLN C C   1 
ATOM   3849 O O   . GLN C 2 19  ? 17.545  54.515  -7.649  1.00 34.29  ? 314 GLN C O   1 
ATOM   3850 C CB  . GLN C 2 19  ? 16.186  54.745  -4.713  1.00 31.30  ? 314 GLN C CB  1 
ATOM   3851 C CG  . GLN C 2 19  ? 15.838  55.789  -3.671  1.00 40.02  ? 314 GLN C CG  1 
ATOM   3852 C CD  . GLN C 2 19  ? 16.107  55.279  -2.273  1.00 51.59  ? 314 GLN C CD  1 
ATOM   3853 O OE1 . GLN C 2 19  ? 15.764  54.140  -1.941  1.00 47.54  ? 314 GLN C OE1 1 
ATOM   3854 N NE2 . GLN C 2 19  ? 16.748  56.103  -1.454  1.00 57.25  ? 314 GLN C NE2 1 
ATOM   3855 N N   . MET C 2 20  ? 15.906  52.999  -7.314  1.00 33.61  ? 315 MET C N   1 
ATOM   3856 C CA  . MET C 2 20  ? 16.493  52.016  -8.216  1.00 31.82  ? 315 MET C CA  1 
ATOM   3857 C C   . MET C 2 20  ? 16.545  52.577  -9.629  1.00 29.78  ? 315 MET C C   1 
ATOM   3858 O O   . MET C 2 20  ? 17.568  52.482  -10.301 1.00 32.04  ? 315 MET C O   1 
ATOM   3859 C CB  . MET C 2 20  ? 15.688  50.710  -8.187  1.00 34.03  ? 315 MET C CB  1 
ATOM   3860 C CG  . MET C 2 20  ? 16.164  49.643  -9.178  1.00 39.56  ? 315 MET C CG  1 
ATOM   3861 S SD  . MET C 2 20  ? 17.703  48.828  -8.695  1.00 46.73  ? 315 MET C SD  1 
ATOM   3862 C CE  . MET C 2 20  ? 17.175  47.975  -7.203  1.00 33.20  ? 315 MET C CE  1 
ATOM   3863 N N   . VAL C 2 21  ? 15.434  53.158  -10.069 1.00 32.51  ? 316 VAL C N   1 
ATOM   3864 C CA  . VAL C 2 21  ? 15.336  53.752  -11.400 1.00 35.69  ? 316 VAL C CA  1 
ATOM   3865 C C   . VAL C 2 21  ? 16.324  54.896  -11.555 1.00 39.18  ? 316 VAL C C   1 
ATOM   3866 O O   . VAL C 2 21  ? 17.061  54.972  -12.542 1.00 37.63  ? 316 VAL C O   1 
ATOM   3867 C CB  . VAL C 2 21  ? 13.925  54.305  -11.664 1.00 41.41  ? 316 VAL C CB  1 
ATOM   3868 C CG1 . VAL C 2 21  ? 13.904  55.105  -12.953 1.00 38.98  ? 316 VAL C CG1 1 
ATOM   3869 C CG2 . VAL C 2 21  ? 12.909  53.165  -11.704 1.00 42.42  ? 316 VAL C CG2 1 
ATOM   3870 N N   . SER C 2 22  ? 16.322  55.795  -10.578 1.00 39.32  ? 317 SER C N   1 
ATOM   3871 C CA  . SER C 2 22  ? 17.244  56.922  -10.570 1.00 41.76  ? 317 SER C CA  1 
ATOM   3872 C C   . SER C 2 22  ? 18.692  56.459  -10.709 1.00 37.38  ? 317 SER C C   1 
ATOM   3873 O O   . SER C 2 22  ? 19.441  56.977  -11.535 1.00 39.24  ? 317 SER C O   1 
ATOM   3874 C CB  . SER C 2 22  ? 17.071  57.735  -9.284  1.00 48.33  ? 317 SER C CB  1 
ATOM   3875 O OG  . SER C 2 22  ? 18.186  58.586  -9.077  1.00 55.26  ? 317 SER C OG  1 
ATOM   3876 N N   . ALA C 2 23  ? 19.086  55.485  -9.898  1.00 35.36  ? 318 ALA C N   1 
ATOM   3877 C CA  . ALA C 2 23  ? 20.437  54.937  -9.971  1.00 33.51  ? 318 ALA C CA  1 
ATOM   3878 C C   . ALA C 2 23  ? 20.732  54.396  -11.368 1.00 35.72  ? 318 ALA C C   1 
ATOM   3879 O O   . ALA C 2 23  ? 21.805  54.627  -11.925 1.00 40.50  ? 318 ALA C O   1 
ATOM   3880 C CB  . ALA C 2 23  ? 20.624  53.834  -8.929  1.00 34.22  ? 318 ALA C CB  1 
ATOM   3881 N N   . LEU C 2 24  ? 19.770  53.677  -11.936 1.00 36.23  ? 319 LEU C N   1 
ATOM   3882 C CA  . LEU C 2 24  ? 19.968  53.061  -13.240 1.00 37.52  ? 319 LEU C CA  1 
ATOM   3883 C C   . LEU C 2 24  ? 20.046  54.103  -14.355 1.00 34.19  ? 319 LEU C C   1 
ATOM   3884 O O   . LEU C 2 24  ? 20.887  54.008  -15.244 1.00 29.96  ? 319 LEU C O   1 
ATOM   3885 C CB  . LEU C 2 24  ? 18.867  52.040  -13.524 1.00 36.86  ? 319 LEU C CB  1 
ATOM   3886 C CG  . LEU C 2 24  ? 18.940  50.790  -12.644 1.00 36.29  ? 319 LEU C CG  1 
ATOM   3887 C CD1 . LEU C 2 24  ? 17.899  49.792  -13.078 1.00 31.52  ? 319 LEU C CD1 1 
ATOM   3888 C CD2 . LEU C 2 24  ? 20.337  50.175  -12.712 1.00 39.09  ? 319 LEU C CD2 1 
ATOM   3889 N N   . LEU C 2 25  ? 19.169  55.097  -14.309 1.00 33.03  ? 320 LEU C N   1 
ATOM   3890 C CA  . LEU C 2 25  ? 19.205  56.163  -15.301 1.00 36.45  ? 320 LEU C CA  1 
ATOM   3891 C C   . LEU C 2 25  ? 20.537  56.899  -15.209 1.00 43.43  ? 320 LEU C C   1 
ATOM   3892 O O   . LEU C 2 25  ? 21.143  57.246  -16.225 1.00 48.66  ? 320 LEU C O   1 
ATOM   3893 C CB  . LEU C 2 25  ? 18.036  57.134  -15.108 1.00 34.62  ? 320 LEU C CB  1 
ATOM   3894 C CG  . LEU C 2 25  ? 16.635  56.597  -15.414 1.00 35.50  ? 320 LEU C CG  1 
ATOM   3895 C CD1 . LEU C 2 25  ? 15.552  57.597  -15.006 1.00 32.71  ? 320 LEU C CD1 1 
ATOM   3896 C CD2 . LEU C 2 25  ? 16.504  56.242  -16.893 1.00 36.15  ? 320 LEU C CD2 1 
ATOM   3897 N N   . ASP C 2 26  ? 20.996  57.120  -13.982 1.00 40.79  ? 321 ASP C N   1 
ATOM   3898 C CA  . ASP C 2 26  ? 22.258  57.817  -13.749 1.00 45.49  ? 321 ASP C CA  1 
ATOM   3899 C C   . ASP C 2 26  ? 23.454  57.049  -14.294 1.00 42.74  ? 321 ASP C C   1 
ATOM   3900 O O   . ASP C 2 26  ? 24.463  57.646  -14.661 1.00 43.92  ? 321 ASP C O   1 
ATOM   3901 C CB  . ASP C 2 26  ? 22.458  58.088  -12.256 1.00 56.34  ? 321 ASP C CB  1 
ATOM   3902 C CG  . ASP C 2 26  ? 21.573  59.212  -11.743 1.00 66.49  ? 321 ASP C CG  1 
ATOM   3903 O OD1 . ASP C 2 26  ? 20.834  59.816  -12.556 1.00 60.66  ? 321 ASP C OD1 1 
ATOM   3904 O OD2 . ASP C 2 26  ? 21.617  59.491  -10.525 1.00 75.48  ? 321 ASP C OD2 1 
ATOM   3905 N N   . ALA C 2 27  ? 23.335  55.727  -14.349 1.00 39.14  ? 322 ALA C N   1 
ATOM   3906 C CA  . ALA C 2 27  ? 24.449  54.879  -14.757 1.00 39.26  ? 322 ALA C CA  1 
ATOM   3907 C C   . ALA C 2 27  ? 24.526  54.671  -16.266 1.00 37.84  ? 322 ALA C C   1 
ATOM   3908 O O   . ALA C 2 27  ? 25.499  54.115  -16.766 1.00 37.14  ? 322 ALA C O   1 
ATOM   3909 C CB  . ALA C 2 27  ? 24.369  53.535  -14.045 1.00 32.19  ? 322 ALA C CB  1 
ATOM   3910 N N   . GLU C 2 28  ? 23.501  55.108  -16.988 1.00 35.93  ? 323 GLU C N   1 
ATOM   3911 C CA  . GLU C 2 28  ? 23.431  54.862  -18.429 1.00 34.97  ? 323 GLU C CA  1 
ATOM   3912 C C   . GLU C 2 28  ? 24.702  55.312  -19.127 1.00 34.25  ? 323 GLU C C   1 
ATOM   3913 O O   . GLU C 2 28  ? 25.163  56.425  -18.909 1.00 34.49  ? 323 GLU C O   1 
ATOM   3914 C CB  . GLU C 2 28  ? 22.234  55.587  -19.045 1.00 27.75  ? 323 GLU C CB  1 
ATOM   3915 C CG  . GLU C 2 28  ? 20.952  54.781  -19.041 1.00 36.26  ? 323 GLU C CG  1 
ATOM   3916 C CD  . GLU C 2 28  ? 21.066  53.539  -19.899 1.00 37.68  ? 323 GLU C CD  1 
ATOM   3917 O OE1 . GLU C 2 28  ? 20.749  53.614  -21.107 1.00 43.11  ? 323 GLU C OE1 1 
ATOM   3918 O OE2 . GLU C 2 28  ? 21.494  52.496  -19.363 1.00 29.28  ? 323 GLU C OE2 1 
ATOM   3919 N N   . PRO C 2 29  ? 25.263  54.456  -19.989 1.00 33.56  ? 324 PRO C N   1 
ATOM   3920 C CA  . PRO C 2 29  ? 26.432  54.868  -20.769 1.00 31.78  ? 324 PRO C CA  1 
ATOM   3921 C C   . PRO C 2 29  ? 25.988  55.863  -21.831 1.00 31.88  ? 324 PRO C C   1 
ATOM   3922 O O   . PRO C 2 29  ? 24.796  55.949  -22.122 1.00 34.69  ? 324 PRO C O   1 
ATOM   3923 C CB  . PRO C 2 29  ? 26.889  53.566  -21.439 1.00 27.00  ? 324 PRO C CB  1 
ATOM   3924 C CG  . PRO C 2 29  ? 25.880  52.512  -21.073 1.00 37.15  ? 324 PRO C CG  1 
ATOM   3925 C CD  . PRO C 2 29  ? 24.690  53.195  -20.484 1.00 31.49  ? 324 PRO C CD  1 
ATOM   3926 N N   . PRO C 2 30  ? 26.929  56.608  -22.412 1.00 36.91  ? 325 PRO C N   1 
ATOM   3927 C CA  . PRO C 2 30  ? 26.535  57.525  -23.480 1.00 35.78  ? 325 PRO C CA  1 
ATOM   3928 C C   . PRO C 2 30  ? 26.369  56.762  -24.789 1.00 34.20  ? 325 PRO C C   1 
ATOM   3929 O O   . PRO C 2 30  ? 26.799  55.616  -24.885 1.00 25.29  ? 325 PRO C O   1 
ATOM   3930 C CB  . PRO C 2 30  ? 27.729  58.478  -23.568 1.00 41.53  ? 325 PRO C CB  1 
ATOM   3931 C CG  . PRO C 2 30  ? 28.893  57.639  -23.138 1.00 40.82  ? 325 PRO C CG  1 
ATOM   3932 C CD  . PRO C 2 30  ? 28.366  56.695  -22.097 1.00 40.49  ? 325 PRO C CD  1 
ATOM   3933 N N   . ILE C 2 31  ? 25.754  57.388  -25.784 1.00 34.03  ? 326 ILE C N   1 
ATOM   3934 C CA  . ILE C 2 31  ? 25.637  56.781  -27.102 1.00 30.57  ? 326 ILE C CA  1 
ATOM   3935 C C   . ILE C 2 31  ? 26.859  57.166  -27.921 1.00 39.13  ? 326 ILE C C   1 
ATOM   3936 O O   . ILE C 2 31  ? 27.078  58.343  -28.204 1.00 38.64  ? 326 ILE C O   1 
ATOM   3937 C CB  . ILE C 2 31  ? 24.362  57.261  -27.825 1.00 35.66  ? 326 ILE C CB  1 
ATOM   3938 C CG1 . ILE C 2 31  ? 23.117  56.803  -27.060 1.00 42.06  ? 326 ILE C CG1 1 
ATOM   3939 C CG2 . ILE C 2 31  ? 24.335  56.750  -29.257 1.00 38.42  ? 326 ILE C CG2 1 
ATOM   3940 C CD1 . ILE C 2 31  ? 21.822  57.464  -27.528 1.00 41.13  ? 326 ILE C CD1 1 
ATOM   3941 N N   . LEU C 2 32  ? 27.664  56.176  -28.293 1.00 36.09  ? 327 LEU C N   1 
ATOM   3942 C CA  . LEU C 2 32  ? 28.920  56.445  -28.990 1.00 40.04  ? 327 LEU C CA  1 
ATOM   3943 C C   . LEU C 2 32  ? 28.755  56.554  -30.507 1.00 37.37  ? 327 LEU C C   1 
ATOM   3944 O O   . LEU C 2 32  ? 27.816  56.014  -31.077 1.00 32.86  ? 327 LEU C O   1 
ATOM   3945 C CB  . LEU C 2 32  ? 29.950  55.368  -28.647 1.00 39.23  ? 327 LEU C CB  1 
ATOM   3946 C CG  . LEU C 2 32  ? 30.179  55.152  -27.153 1.00 36.35  ? 327 LEU C CG  1 
ATOM   3947 C CD1 . LEU C 2 32  ? 31.374  54.238  -26.945 1.00 36.82  ? 327 LEU C CD1 1 
ATOM   3948 C CD2 . LEU C 2 32  ? 30.390  56.495  -26.444 1.00 34.44  ? 327 LEU C CD2 1 
ATOM   3949 N N   . TYR C 2 33  ? 29.670  57.266  -31.156 1.00 39.94  ? 328 TYR C N   1 
ATOM   3950 C CA  . TYR C 2 33  ? 29.657  57.377  -32.611 1.00 35.70  ? 328 TYR C CA  1 
ATOM   3951 C C   . TYR C 2 33  ? 30.608  56.363  -33.237 1.00 36.54  ? 328 TYR C C   1 
ATOM   3952 O O   . TYR C 2 33  ? 31.658  56.050  -32.676 1.00 38.81  ? 328 TYR C O   1 
ATOM   3953 C CB  . TYR C 2 33  ? 30.047  58.790  -33.052 1.00 41.87  ? 328 TYR C CB  1 
ATOM   3954 C CG  . TYR C 2 33  ? 28.913  59.793  -32.997 1.00 42.85  ? 328 TYR C CG  1 
ATOM   3955 C CD1 . TYR C 2 33  ? 28.419  60.247  -31.779 1.00 36.51  ? 328 TYR C CD1 1 
ATOM   3956 C CD2 . TYR C 2 33  ? 28.348  60.298  -34.163 1.00 41.40  ? 328 TYR C CD2 1 
ATOM   3957 C CE1 . TYR C 2 33  ? 27.390  61.165  -31.721 1.00 35.36  ? 328 TYR C CE1 1 
ATOM   3958 C CE2 . TYR C 2 33  ? 27.315  61.220  -34.116 1.00 33.58  ? 328 TYR C CE2 1 
ATOM   3959 C CZ  . TYR C 2 33  ? 26.837  61.643  -32.894 1.00 37.64  ? 328 TYR C CZ  1 
ATOM   3960 O OH  . TYR C 2 33  ? 25.810  62.554  -32.842 1.00 47.24  ? 328 TYR C OH  1 
ATOM   3961 N N   . SER C 2 34  ? 30.231  55.840  -34.396 1.00 36.88  ? 329 SER C N   1 
ATOM   3962 C CA  . SER C 2 34  ? 31.124  54.983  -35.152 1.00 52.27  ? 329 SER C CA  1 
ATOM   3963 C C   . SER C 2 34  ? 32.245  55.851  -35.692 1.00 64.60  ? 329 SER C C   1 
ATOM   3964 O O   . SER C 2 34  ? 31.979  56.853  -36.348 1.00 64.33  ? 329 SER C O   1 
ATOM   3965 C CB  . SER C 2 34  ? 30.374  54.339  -36.314 1.00 57.39  ? 329 SER C CB  1 
ATOM   3966 O OG  . SER C 2 34  ? 31.275  53.742  -37.224 1.00 63.60  ? 329 SER C OG  1 
ATOM   3967 N N   . GLU C 2 35  ? 33.496  55.496  -35.416 1.00 78.52  ? 330 GLU C N   1 
ATOM   3968 C CA  . GLU C 2 35  ? 34.597  56.287  -35.969 1.00 86.79  ? 330 GLU C CA  1 
ATOM   3969 C C   . GLU C 2 35  ? 35.038  55.797  -37.349 1.00 94.96  ? 330 GLU C C   1 
ATOM   3970 O O   . GLU C 2 35  ? 36.022  55.076  -37.479 1.00 99.78  ? 330 GLU C O   1 
ATOM   3971 C CB  . GLU C 2 35  ? 35.774  56.460  -34.988 1.00 85.81  ? 330 GLU C CB  1 
ATOM   3972 C CG  . GLU C 2 35  ? 36.405  55.193  -34.428 1.00 87.01  ? 330 GLU C CG  1 
ATOM   3973 C CD  . GLU C 2 35  ? 37.557  55.504  -33.476 1.00 85.38  ? 330 GLU C CD  1 
ATOM   3974 O OE1 . GLU C 2 35  ? 37.810  54.701  -32.549 1.00 84.53  ? 330 GLU C OE1 1 
ATOM   3975 O OE2 . GLU C 2 35  ? 38.204  56.562  -33.652 1.00 81.36  ? 330 GLU C OE2 1 
ATOM   3976 N N   . TYR C 2 36  ? 34.253  56.187  -38.356 1.00 101.47 ? 331 TYR C N   1 
ATOM   3977 C CA  . TYR C 2 36  ? 34.543  55.986  -39.783 1.00 107.57 ? 331 TYR C CA  1 
ATOM   3978 C C   . TYR C 2 36  ? 33.275  55.730  -40.607 1.00 111.58 ? 331 TYR C C   1 
ATOM   3979 O O   . TYR C 2 36  ? 33.348  55.552  -41.822 1.00 112.87 ? 331 TYR C O   1 
ATOM   3980 C CB  . TYR C 2 36  ? 35.553  54.857  -40.010 1.00 109.24 ? 331 TYR C CB  1 
ATOM   3981 N N   . ASP C 2 37  ? 32.126  55.714  -39.936 1.00 110.08 ? 332 ASP C N   1 
ATOM   3982 C CA  . ASP C 2 37  ? 30.831  55.524  -40.591 1.00 109.22 ? 332 ASP C CA  1 
ATOM   3983 C C   . ASP C 2 37  ? 30.920  54.696  -41.871 1.00 112.92 ? 332 ASP C C   1 
ATOM   3984 O O   . ASP C 2 37  ? 31.014  55.241  -42.974 1.00 115.35 ? 332 ASP C O   1 
ATOM   3985 C CB  . ASP C 2 37  ? 30.173  56.872  -40.890 1.00 105.67 ? 332 ASP C CB  1 
ATOM   3986 N N   . SER C 2 46  ? 33.681  44.648  -43.766 1.00 78.32  ? 341 SER C N   1 
ATOM   3987 C CA  . SER C 2 46  ? 33.745  46.023  -43.281 1.00 83.58  ? 341 SER C CA  1 
ATOM   3988 C C   . SER C 2 46  ? 32.794  46.229  -42.109 1.00 79.86  ? 341 SER C C   1 
ATOM   3989 O O   . SER C 2 46  ? 33.125  46.903  -41.135 1.00 79.13  ? 341 SER C O   1 
ATOM   3990 C CB  . SER C 2 46  ? 33.424  47.012  -44.406 1.00 89.46  ? 341 SER C CB  1 
ATOM   3991 O OG  . SER C 2 46  ? 32.201  46.687  -45.043 1.00 93.21  ? 341 SER C OG  1 
ATOM   3992 N N   . MET C 2 47  ? 31.607  45.646  -42.219 1.00 77.52  ? 342 MET C N   1 
ATOM   3993 C CA  . MET C 2 47  ? 30.640  45.668  -41.135 1.00 74.68  ? 342 MET C CA  1 
ATOM   3994 C C   . MET C 2 47  ? 31.297  45.188  -39.850 1.00 72.61  ? 342 MET C C   1 
ATOM   3995 O O   . MET C 2 47  ? 31.108  45.776  -38.788 1.00 69.07  ? 342 MET C O   1 
ATOM   3996 C CB  . MET C 2 47  ? 29.458  44.763  -41.469 1.00 74.72  ? 342 MET C CB  1 
ATOM   3997 C CG  . MET C 2 47  ? 28.465  44.605  -40.335 1.00 74.34  ? 342 MET C CG  1 
ATOM   3998 S SD  . MET C 2 47  ? 27.470  46.083  -40.070 1.00 119.21 ? 342 MET C SD  1 
ATOM   3999 C CE  . MET C 2 47  ? 26.360  45.999  -41.470 1.00 100.58 ? 342 MET C CE  1 
ATOM   4000 N N   . MET C 2 48  ? 32.071  44.113  -39.959 1.00 67.20  ? 343 MET C N   1 
ATOM   4001 C CA  . MET C 2 48  ? 32.795  43.568  -38.820 1.00 68.61  ? 343 MET C CA  1 
ATOM   4002 C C   . MET C 2 48  ? 33.810  44.574  -38.294 1.00 67.85  ? 343 MET C C   1 
ATOM   4003 O O   . MET C 2 48  ? 34.026  44.680  -37.089 1.00 68.15  ? 343 MET C O   1 
ATOM   4004 C CB  . MET C 2 48  ? 33.489  42.257  -39.197 1.00 74.41  ? 343 MET C CB  1 
ATOM   4005 C CG  . MET C 2 48  ? 32.536  41.083  -39.364 1.00 78.61  ? 343 MET C CG  1 
ATOM   4006 S SD  . MET C 2 48  ? 31.628  40.721  -37.847 1.00 102.69 ? 343 MET C SD  1 
ATOM   4007 C CE  . MET C 2 48  ? 32.972  40.332  -36.729 1.00 69.05  ? 343 MET C CE  1 
ATOM   4008 N N   . GLY C 2 49  ? 34.432  45.312  -39.206 1.00 61.99  ? 344 GLY C N   1 
ATOM   4009 C CA  . GLY C 2 49  ? 35.362  46.356  -38.823 1.00 60.15  ? 344 GLY C CA  1 
ATOM   4010 C C   . GLY C 2 49  ? 34.679  47.409  -37.972 1.00 55.07  ? 344 GLY C C   1 
ATOM   4011 O O   . GLY C 2 49  ? 35.235  47.884  -36.982 1.00 53.22  ? 344 GLY C O   1 
ATOM   4012 N N   . LEU C 2 50  ? 33.458  47.765  -38.351 1.00 55.45  ? 345 LEU C N   1 
ATOM   4013 C CA  . LEU C 2 50  ? 32.728  48.817  -37.655 1.00 59.87  ? 345 LEU C CA  1 
ATOM   4014 C C   . LEU C 2 50  ? 32.174  48.366  -36.308 1.00 61.41  ? 345 LEU C C   1 
ATOM   4015 O O   . LEU C 2 50  ? 32.285  49.085  -35.317 1.00 67.75  ? 345 LEU C O   1 
ATOM   4016 C CB  . LEU C 2 50  ? 31.619  49.383  -38.541 1.00 62.17  ? 345 LEU C CB  1 
ATOM   4017 C CG  . LEU C 2 50  ? 32.144  50.223  -39.705 1.00 70.55  ? 345 LEU C CG  1 
ATOM   4018 C CD1 . LEU C 2 50  ? 31.010  50.983  -40.365 1.00 75.68  ? 345 LEU C CD1 1 
ATOM   4019 C CD2 . LEU C 2 50  ? 33.224  51.185  -39.218 1.00 69.03  ? 345 LEU C CD2 1 
ATOM   4020 N N   . LEU C 2 51  ? 31.575  47.183  -36.272 1.00 48.95  ? 346 LEU C N   1 
ATOM   4021 C CA  . LEU C 2 51  ? 31.073  46.644  -35.017 1.00 48.72  ? 346 LEU C CA  1 
ATOM   4022 C C   . LEU C 2 51  ? 32.215  46.520  -34.017 1.00 46.63  ? 346 LEU C C   1 
ATOM   4023 O O   . LEU C 2 51  ? 32.081  46.910  -32.857 1.00 45.24  ? 346 LEU C O   1 
ATOM   4024 C CB  . LEU C 2 51  ? 30.412  45.280  -35.233 1.00 50.35  ? 346 LEU C CB  1 
ATOM   4025 C CG  . LEU C 2 51  ? 29.136  45.269  -36.075 1.00 53.37  ? 346 LEU C CG  1 
ATOM   4026 C CD1 . LEU C 2 51  ? 28.492  43.890  -36.040 1.00 54.11  ? 346 LEU C CD1 1 
ATOM   4027 C CD2 . LEU C 2 51  ? 28.168  46.319  -35.571 1.00 49.17  ? 346 LEU C CD2 1 
ATOM   4028 N N   . THR C 2 52  ? 33.339  45.987  -34.487 1.00 45.29  ? 347 THR C N   1 
ATOM   4029 C CA  . THR C 2 52  ? 34.514  45.780  -33.650 1.00 45.82  ? 347 THR C CA  1 
ATOM   4030 C C   . THR C 2 52  ? 35.005  47.081  -33.019 1.00 49.30  ? 347 THR C C   1 
ATOM   4031 O O   . THR C 2 52  ? 35.229  47.146  -31.810 1.00 54.80  ? 347 THR C O   1 
ATOM   4032 C CB  . THR C 2 52  ? 35.666  45.141  -34.447 1.00 44.61  ? 347 THR C CB  1 
ATOM   4033 O OG1 . THR C 2 52  ? 35.264  43.851  -34.922 1.00 51.27  ? 347 THR C OG1 1 
ATOM   4034 C CG2 . THR C 2 52  ? 36.898  44.990  -33.569 1.00 42.69  ? 347 THR C CG2 1 
ATOM   4035 N N   . ASN C 2 53  ? 35.179  48.110  -33.842 1.00 41.09  ? 348 ASN C N   1 
ATOM   4036 C CA  . ASN C 2 53  ? 35.624  49.411  -33.349 1.00 42.15  ? 348 ASN C CA  1 
ATOM   4037 C C   . ASN C 2 53  ? 34.663  49.986  -32.320 1.00 46.01  ? 348 ASN C C   1 
ATOM   4038 O O   . ASN C 2 53  ? 35.083  50.535  -31.306 1.00 46.03  ? 348 ASN C O   1 
ATOM   4039 C CB  . ASN C 2 53  ? 35.792  50.394  -34.507 1.00 46.13  ? 348 ASN C CB  1 
ATOM   4040 C CG  . ASN C 2 53  ? 35.914  51.832  -34.036 1.00 56.21  ? 348 ASN C CG  1 
ATOM   4041 O OD1 . ASN C 2 53  ? 35.039  52.663  -34.295 1.00 57.36  ? 348 ASN C OD1 1 
ATOM   4042 N ND2 . ASN C 2 53  ? 37.000  52.132  -33.334 1.00 57.50  ? 348 ASN C ND2 1 
ATOM   4043 N N   . LEU C 2 54  ? 33.368  49.844  -32.589 1.00 39.20  ? 349 LEU C N   1 
ATOM   4044 C CA  . LEU C 2 54  ? 32.328  50.389  -31.729 1.00 37.48  ? 349 LEU C CA  1 
ATOM   4045 C C   . LEU C 2 54  ? 32.201  49.588  -30.433 1.00 40.52  ? 349 LEU C C   1 
ATOM   4046 O O   . LEU C 2 54  ? 32.191  50.158  -29.338 1.00 36.09  ? 349 LEU C O   1 
ATOM   4047 C CB  . LEU C 2 54  ? 30.999  50.409  -32.481 1.00 36.25  ? 349 LEU C CB  1 
ATOM   4048 C CG  . LEU C 2 54  ? 29.763  50.990  -31.798 1.00 39.57  ? 349 LEU C CG  1 
ATOM   4049 C CD1 . LEU C 2 54  ? 29.967  52.457  -31.470 1.00 33.99  ? 349 LEU C CD1 1 
ATOM   4050 C CD2 . LEU C 2 54  ? 28.548  50.805  -32.695 1.00 42.56  ? 349 LEU C CD2 1 
ATOM   4051 N N   . ALA C 2 55  ? 32.117  48.267  -30.563 1.00 36.22  ? 350 ALA C N   1 
ATOM   4052 C CA  . ALA C 2 55  ? 31.992  47.383  -29.411 1.00 34.01  ? 350 ALA C CA  1 
ATOM   4053 C C   . ALA C 2 55  ? 33.164  47.518  -28.443 1.00 37.20  ? 350 ALA C C   1 
ATOM   4054 O O   . ALA C 2 55  ? 32.973  47.517  -27.226 1.00 38.70  ? 350 ALA C O   1 
ATOM   4055 C CB  . ALA C 2 55  ? 31.846  45.933  -29.868 1.00 32.52  ? 350 ALA C CB  1 
ATOM   4056 N N   . ASP C 2 56  ? 34.374  47.623  -28.984 1.00 36.62  ? 351 ASP C N   1 
ATOM   4057 C CA  . ASP C 2 56  ? 35.569  47.822  -28.162 1.00 41.14  ? 351 ASP C CA  1 
ATOM   4058 C C   . ASP C 2 56  ? 35.441  49.052  -27.267 1.00 39.39  ? 351 ASP C C   1 
ATOM   4059 O O   . ASP C 2 56  ? 35.775  49.008  -26.084 1.00 39.95  ? 351 ASP C O   1 
ATOM   4060 C CB  . ASP C 2 56  ? 36.821  47.951  -29.039 1.00 46.39  ? 351 ASP C CB  1 
ATOM   4061 C CG  . ASP C 2 56  ? 37.297  46.614  -29.574 1.00 56.53  ? 351 ASP C CG  1 
ATOM   4062 O OD1 . ASP C 2 56  ? 36.807  45.572  -29.091 1.00 51.66  ? 351 ASP C OD1 1 
ATOM   4063 O OD2 . ASP C 2 56  ? 38.159  46.605  -30.477 1.00 59.59  ? 351 ASP C OD2 1 
ATOM   4064 N N   . ARG C 2 57  ? 34.962  50.151  -27.835 1.00 38.23  ? 352 ARG C N   1 
ATOM   4065 C CA  . ARG C 2 57  ? 34.786  51.372  -27.053 1.00 29.92  ? 352 ARG C CA  1 
ATOM   4066 C C   . ARG C 2 57  ? 33.587  51.277  -26.106 1.00 34.61  ? 352 ARG C C   1 
ATOM   4067 O O   . ARG C 2 57  ? 33.615  51.827  -25.007 1.00 30.12  ? 352 ARG C O   1 
ATOM   4068 C CB  . ARG C 2 57  ? 34.677  52.592  -27.971 1.00 30.65  ? 352 ARG C CB  1 
ATOM   4069 C CG  . ARG C 2 57  ? 36.020  53.051  -28.542 1.00 35.89  ? 352 ARG C CG  1 
ATOM   4070 C CD  . ARG C 2 57  ? 35.859  54.218  -29.517 1.00 37.75  ? 352 ARG C CD  1 
ATOM   4071 N NE  . ARG C 2 57  ? 35.134  53.829  -30.731 1.00 43.04  ? 352 ARG C NE  1 
ATOM   4072 C CZ  . ARG C 2 57  ? 34.098  54.496  -31.235 1.00 38.63  ? 352 ARG C CZ  1 
ATOM   4073 N NH1 . ARG C 2 57  ? 33.657  55.595  -30.638 1.00 33.07  ? 352 ARG C NH1 1 
ATOM   4074 N NH2 . ARG C 2 57  ? 33.506  54.069  -32.341 1.00 40.73  ? 352 ARG C NH2 1 
ATOM   4075 N N   . GLU C 2 58  ? 32.549  50.554  -26.519 1.00 35.68  ? 353 GLU C N   1 
ATOM   4076 C CA  . GLU C 2 58  ? 31.363  50.391  -25.679 1.00 33.01  ? 353 GLU C CA  1 
ATOM   4077 C C   . GLU C 2 58  ? 31.633  49.541  -24.434 1.00 36.73  ? 353 GLU C C   1 
ATOM   4078 O O   . GLU C 2 58  ? 31.070  49.788  -23.357 1.00 34.07  ? 353 GLU C O   1 
ATOM   4079 C CB  . GLU C 2 58  ? 30.202  49.803  -26.479 1.00 30.83  ? 353 GLU C CB  1 
ATOM   4080 C CG  . GLU C 2 58  ? 29.506  50.808  -27.381 1.00 34.67  ? 353 GLU C CG  1 
ATOM   4081 C CD  . GLU C 2 58  ? 28.247  50.244  -28.025 1.00 36.49  ? 353 GLU C CD  1 
ATOM   4082 O OE1 . GLU C 2 58  ? 28.370  49.497  -29.016 1.00 33.09  ? 353 GLU C OE1 1 
ATOM   4083 O OE2 . GLU C 2 58  ? 27.135  50.563  -27.553 1.00 35.22  ? 353 GLU C OE2 1 
ATOM   4084 N N   . LEU C 2 59  ? 32.499  48.545  -24.584 1.00 28.28  ? 354 LEU C N   1 
ATOM   4085 C CA  . LEU C 2 59  ? 32.812  47.625  -23.498 1.00 31.17  ? 354 LEU C CA  1 
ATOM   4086 C C   . LEU C 2 59  ? 33.304  48.384  -22.274 1.00 33.13  ? 354 LEU C C   1 
ATOM   4087 O O   . LEU C 2 59  ? 32.903  48.098  -21.142 1.00 31.16  ? 354 LEU C O   1 
ATOM   4088 C CB  . LEU C 2 59  ? 33.867  46.614  -23.947 1.00 35.83  ? 354 LEU C CB  1 
ATOM   4089 C CG  . LEU C 2 59  ? 34.227  45.507  -22.946 1.00 43.58  ? 354 LEU C CG  1 
ATOM   4090 C CD1 . LEU C 2 59  ? 33.012  44.632  -22.608 1.00 38.03  ? 354 LEU C CD1 1 
ATOM   4091 C CD2 . LEU C 2 59  ? 35.369  44.661  -23.493 1.00 44.76  ? 354 LEU C CD2 1 
ATOM   4092 N N   . VAL C 2 60  ? 34.171  49.358  -22.514 1.00 34.33  ? 355 VAL C N   1 
ATOM   4093 C CA  . VAL C 2 60  ? 34.742  50.156  -21.440 1.00 32.86  ? 355 VAL C CA  1 
ATOM   4094 C C   . VAL C 2 60  ? 33.639  50.829  -20.632 1.00 33.32  ? 355 VAL C C   1 
ATOM   4095 O O   . VAL C 2 60  ? 33.664  50.818  -19.402 1.00 33.39  ? 355 VAL C O   1 
ATOM   4096 C CB  . VAL C 2 60  ? 35.698  51.219  -22.013 1.00 39.82  ? 355 VAL C CB  1 
ATOM   4097 C CG1 . VAL C 2 60  ? 36.437  51.923  -20.889 1.00 36.03  ? 355 VAL C CG1 1 
ATOM   4098 C CG2 . VAL C 2 60  ? 36.676  50.565  -23.008 1.00 31.10  ? 355 VAL C CG2 1 
ATOM   4099 N N   . HIS C 2 61  ? 32.662  51.400  -21.335 1.00 33.89  ? 356 HIS C N   1 
ATOM   4100 C CA  . HIS C 2 61  ? 31.508  52.038  -20.697 1.00 32.36  ? 356 HIS C CA  1 
ATOM   4101 C C   . HIS C 2 61  ? 30.605  51.023  -20.011 1.00 29.97  ? 356 HIS C C   1 
ATOM   4102 O O   . HIS C 2 61  ? 30.024  51.292  -18.962 1.00 34.60  ? 356 HIS C O   1 
ATOM   4103 C CB  . HIS C 2 61  ? 30.696  52.831  -21.724 1.00 26.61  ? 356 HIS C CB  1 
ATOM   4104 C CG  . HIS C 2 61  ? 31.383  54.076  -22.206 1.00 36.09  ? 356 HIS C CG  1 
ATOM   4105 N ND1 . HIS C 2 61  ? 31.522  55.199  -21.421 1.00 37.92  ? 356 HIS C ND1 1 
ATOM   4106 C CD2 . HIS C 2 61  ? 31.959  54.372  -23.395 1.00 35.94  ? 356 HIS C CD2 1 
ATOM   4107 C CE1 . HIS C 2 61  ? 32.161  56.137  -22.103 1.00 42.12  ? 356 HIS C CE1 1 
ATOM   4108 N NE2 . HIS C 2 61  ? 32.435  55.657  -23.306 1.00 44.45  ? 356 HIS C NE2 1 
ATOM   4109 N N   . MET C 2 62  ? 30.485  49.845  -20.609 1.00 34.00  ? 357 MET C N   1 
ATOM   4110 C CA  . MET C 2 62  ? 29.624  48.814  -20.048 1.00 25.25  ? 357 MET C CA  1 
ATOM   4111 C C   . MET C 2 62  ? 30.132  48.374  -18.669 1.00 28.94  ? 357 MET C C   1 
ATOM   4112 O O   . MET C 2 62  ? 29.355  48.260  -17.712 1.00 27.42  ? 357 MET C O   1 
ATOM   4113 C CB  . MET C 2 62  ? 29.553  47.628  -20.998 1.00 23.38  ? 357 MET C CB  1 
ATOM   4114 C CG  . MET C 2 62  ? 28.466  46.641  -20.645 1.00 35.27  ? 357 MET C CG  1 
ATOM   4115 S SD  . MET C 2 62  ? 28.703  45.068  -21.477 1.00 30.22  ? 357 MET C SD  1 
ATOM   4116 C CE  . MET C 2 62  ? 28.513  45.528  -23.199 1.00 21.41  ? 357 MET C CE  1 
ATOM   4117 N N   . ILE C 2 63  ? 31.436  48.130  -18.572 1.00 27.76  ? 358 ILE C N   1 
ATOM   4118 C CA  . ILE C 2 63  ? 32.063  47.766  -17.301 1.00 33.57  ? 358 ILE C CA  1 
ATOM   4119 C C   . ILE C 2 63  ? 31.743  48.792  -16.219 1.00 37.80  ? 358 ILE C C   1 
ATOM   4120 O O   . ILE C 2 63  ? 31.392  48.442  -15.092 1.00 39.57  ? 358 ILE C O   1 
ATOM   4121 C CB  . ILE C 2 63  ? 33.599  47.653  -17.432 1.00 36.68  ? 358 ILE C CB  1 
ATOM   4122 C CG1 . ILE C 2 63  ? 34.006  46.265  -17.929 1.00 44.67  ? 358 ILE C CG1 1 
ATOM   4123 C CG2 . ILE C 2 63  ? 34.261  47.895  -16.088 1.00 42.59  ? 358 ILE C CG2 1 
ATOM   4124 C CD1 . ILE C 2 63  ? 33.428  45.897  -19.270 1.00 49.70  ? 358 ILE C CD1 1 
ATOM   4125 N N   . ASN C 2 64  ? 31.860  50.069  -16.564 1.00 40.37  ? 359 ASN C N   1 
ATOM   4126 C CA  . ASN C 2 64  ? 31.586  51.119  -15.591 1.00 43.51  ? 359 ASN C CA  1 
ATOM   4127 C C   . ASN C 2 64  ? 30.100  51.281  -15.304 1.00 36.37  ? 359 ASN C C   1 
ATOM   4128 O O   . ASN C 2 64  ? 29.706  51.586  -14.178 1.00 38.64  ? 359 ASN C O   1 
ATOM   4129 C CB  . ASN C 2 64  ? 32.243  52.432  -16.010 1.00 53.83  ? 359 ASN C CB  1 
ATOM   4130 C CG  . ASN C 2 64  ? 33.751  52.394  -15.844 1.00 63.25  ? 359 ASN C CG  1 
ATOM   4131 O OD1 . ASN C 2 64  ? 34.264  52.460  -14.723 1.00 60.16  ? 359 ASN C OD1 1 
ATOM   4132 N ND2 . ASN C 2 64  ? 34.468  52.263  -16.956 1.00 68.94  ? 359 ASN C ND2 1 
ATOM   4133 N N   . TRP C 2 65  ? 29.270  51.056  -16.313 1.00 28.99  ? 360 TRP C N   1 
ATOM   4134 C CA  . TRP C 2 65  ? 27.836  50.972  -16.068 1.00 31.84  ? 360 TRP C CA  1 
ATOM   4135 C C   . TRP C 2 65  ? 27.534  49.817  -15.106 1.00 32.83  ? 360 TRP C C   1 
ATOM   4136 O O   . TRP C 2 65  ? 26.810  49.987  -14.126 1.00 32.38  ? 360 TRP C O   1 
ATOM   4137 C CB  . TRP C 2 65  ? 27.066  50.772  -17.370 1.00 29.99  ? 360 TRP C CB  1 
ATOM   4138 C CG  . TRP C 2 65  ? 25.694  50.239  -17.149 1.00 35.40  ? 360 TRP C CG  1 
ATOM   4139 C CD1 . TRP C 2 65  ? 24.601  50.936  -16.717 1.00 30.64  ? 360 TRP C CD1 1 
ATOM   4140 C CD2 . TRP C 2 65  ? 25.258  48.887  -17.345 1.00 31.49  ? 360 TRP C CD2 1 
ATOM   4141 N NE1 . TRP C 2 65  ? 23.513  50.100  -16.635 1.00 28.63  ? 360 TRP C NE1 1 
ATOM   4142 C CE2 . TRP C 2 65  ? 23.891  48.842  -17.012 1.00 28.93  ? 360 TRP C CE2 1 
ATOM   4143 C CE3 . TRP C 2 65  ? 25.895  47.720  -17.771 1.00 30.92  ? 360 TRP C CE3 1 
ATOM   4144 C CZ2 . TRP C 2 65  ? 23.149  47.662  -17.091 1.00 28.04  ? 360 TRP C CZ2 1 
ATOM   4145 C CZ3 . TRP C 2 65  ? 25.153  46.554  -17.854 1.00 36.72  ? 360 TRP C CZ3 1 
ATOM   4146 C CH2 . TRP C 2 65  ? 23.793  46.534  -17.516 1.00 32.16  ? 360 TRP C CH2 1 
ATOM   4147 N N   . ALA C 2 66  ? 28.094  48.645  -15.388 1.00 29.22  ? 361 ALA C N   1 
ATOM   4148 C CA  . ALA C 2 66  ? 27.829  47.466  -14.566 1.00 28.81  ? 361 ALA C CA  1 
ATOM   4149 C C   . ALA C 2 66  ? 28.166  47.705  -13.094 1.00 33.89  ? 361 ALA C C   1 
ATOM   4150 O O   . ALA C 2 66  ? 27.400  47.330  -12.204 1.00 34.63  ? 361 ALA C O   1 
ATOM   4151 C CB  . ALA C 2 66  ? 28.591  46.265  -15.093 1.00 33.51  ? 361 ALA C CB  1 
ATOM   4152 N N   . LYS C 2 67  ? 29.318  48.311  -12.832 1.00 30.40  ? 362 LYS C N   1 
ATOM   4153 C CA  . LYS C 2 67  ? 29.731  48.552  -11.454 1.00 35.27  ? 362 LYS C CA  1 
ATOM   4154 C C   . LYS C 2 67  ? 28.766  49.488  -10.733 1.00 36.04  ? 362 LYS C C   1 
ATOM   4155 O O   . LYS C 2 67  ? 28.791  49.589  -9.509  1.00 35.58  ? 362 LYS C O   1 
ATOM   4156 C CB  . LYS C 2 67  ? 31.166  49.091  -11.401 1.00 40.52  ? 362 LYS C CB  1 
ATOM   4157 C CG  . LYS C 2 67  ? 32.220  48.010  -11.574 1.00 43.15  ? 362 LYS C CG  1 
ATOM   4158 C CD  . LYS C 2 67  ? 33.415  48.501  -12.396 1.00 56.89  ? 362 LYS C CD  1 
ATOM   4159 C CE  . LYS C 2 67  ? 34.393  49.306  -11.553 1.00 65.93  ? 362 LYS C CE  1 
ATOM   4160 N NZ  . LYS C 2 67  ? 35.589  49.735  -12.338 1.00 64.69  ? 362 LYS C NZ  1 
ATOM   4161 N N   . ARG C 2 68  ? 27.898  50.150  -11.496 1.00 30.34  ? 363 ARG C N   1 
ATOM   4162 C CA  . ARG C 2 68  ? 26.925  51.072  -10.922 1.00 29.47  ? 363 ARG C CA  1 
ATOM   4163 C C   . ARG C 2 68  ? 25.523  50.472  -10.756 1.00 36.53  ? 363 ARG C C   1 
ATOM   4164 O O   . ARG C 2 68  ? 24.652  51.088  -10.145 1.00 35.50  ? 363 ARG C O   1 
ATOM   4165 C CB  . ARG C 2 68  ? 26.878  52.369  -11.735 1.00 32.74  ? 363 ARG C CB  1 
ATOM   4166 C CG  . ARG C 2 68  ? 28.198  53.135  -11.698 1.00 43.35  ? 363 ARG C CG  1 
ATOM   4167 C CD  . ARG C 2 68  ? 28.105  54.465  -12.425 1.00 49.00  ? 363 ARG C CD  1 
ATOM   4168 N NE  . ARG C 2 68  ? 27.125  55.356  -11.805 1.00 58.32  ? 363 ARG C NE  1 
ATOM   4169 C CZ  . ARG C 2 68  ? 26.871  56.592  -12.224 1.00 64.10  ? 363 ARG C CZ  1 
ATOM   4170 N NH1 . ARG C 2 68  ? 27.526  57.088  -13.268 1.00 63.70  ? 363 ARG C NH1 1 
ATOM   4171 N NH2 . ARG C 2 68  ? 25.962  57.331  -11.600 1.00 61.83  ? 363 ARG C NH2 1 
ATOM   4172 N N   . VAL C 2 69  ? 25.311  49.272  -11.290 1.00 31.50  ? 364 VAL C N   1 
ATOM   4173 C CA  . VAL C 2 69  ? 24.050  48.565  -11.082 1.00 29.34  ? 364 VAL C CA  1 
ATOM   4174 C C   . VAL C 2 69  ? 23.964  48.132  -9.624  1.00 35.21  ? 364 VAL C C   1 
ATOM   4175 O O   . VAL C 2 69  ? 24.846  47.436  -9.129  1.00 36.15  ? 364 VAL C O   1 
ATOM   4176 C CB  . VAL C 2 69  ? 23.950  47.312  -11.976 1.00 27.29  ? 364 VAL C CB  1 
ATOM   4177 C CG1 . VAL C 2 69  ? 22.738  46.490  -11.593 1.00 26.86  ? 364 VAL C CG1 1 
ATOM   4178 C CG2 . VAL C 2 69  ? 23.896  47.699  -13.449 1.00 27.82  ? 364 VAL C CG2 1 
ATOM   4179 N N   . PRO C 2 70  ? 22.905  48.548  -8.921  1.00 42.33  ? 365 PRO C N   1 
ATOM   4180 C CA  . PRO C 2 70  ? 22.804  48.221  -7.493  1.00 39.29  ? 365 PRO C CA  1 
ATOM   4181 C C   . PRO C 2 70  ? 22.924  46.724  -7.228  1.00 41.16  ? 365 PRO C C   1 
ATOM   4182 O O   . PRO C 2 70  ? 22.273  45.914  -7.893  1.00 38.06  ? 365 PRO C O   1 
ATOM   4183 C CB  . PRO C 2 70  ? 21.409  48.726  -7.114  1.00 41.29  ? 365 PRO C CB  1 
ATOM   4184 C CG  . PRO C 2 70  ? 21.139  49.829  -8.086  1.00 38.40  ? 365 PRO C CG  1 
ATOM   4185 C CD  . PRO C 2 70  ? 21.773  49.372  -9.382  1.00 44.64  ? 365 PRO C CD  1 
ATOM   4186 N N   . GLY C 2 71  ? 23.767  46.366  -6.262  1.00 40.64  ? 366 GLY C N   1 
ATOM   4187 C CA  . GLY C 2 71  ? 23.985  44.977  -5.906  1.00 40.06  ? 366 GLY C CA  1 
ATOM   4188 C C   . GLY C 2 71  ? 25.149  44.325  -6.625  1.00 39.18  ? 366 GLY C C   1 
ATOM   4189 O O   . GLY C 2 71  ? 25.660  43.301  -6.176  1.00 49.15  ? 366 GLY C O   1 
ATOM   4190 N N   . PHE C 2 72  ? 25.576  44.910  -7.738  1.00 34.18  ? 367 PHE C N   1 
ATOM   4191 C CA  . PHE C 2 72  ? 26.595  44.278  -8.573  1.00 34.21  ? 367 PHE C CA  1 
ATOM   4192 C C   . PHE C 2 72  ? 27.972  44.216  -7.911  1.00 40.27  ? 367 PHE C C   1 
ATOM   4193 O O   . PHE C 2 72  ? 28.648  43.186  -7.973  1.00 40.98  ? 367 PHE C O   1 
ATOM   4194 C CB  . PHE C 2 72  ? 26.683  44.959  -9.941  1.00 32.64  ? 367 PHE C CB  1 
ATOM   4195 C CG  . PHE C 2 72  ? 27.546  44.220  -10.925 1.00 33.24  ? 367 PHE C CG  1 
ATOM   4196 C CD1 . PHE C 2 72  ? 27.074  43.078  -11.558 1.00 30.00  ? 367 PHE C CD1 1 
ATOM   4197 C CD2 . PHE C 2 72  ? 28.829  44.658  -11.209 1.00 30.20  ? 367 PHE C CD2 1 
ATOM   4198 C CE1 . PHE C 2 72  ? 27.864  42.395  -12.456 1.00 27.66  ? 367 PHE C CE1 1 
ATOM   4199 C CE2 . PHE C 2 72  ? 29.622  43.980  -12.106 1.00 35.32  ? 367 PHE C CE2 1 
ATOM   4200 C CZ  . PHE C 2 72  ? 29.140  42.842  -12.731 1.00 29.75  ? 367 PHE C CZ  1 
ATOM   4201 N N   . VAL C 2 73  ? 28.393  45.311  -7.279  1.00 35.69  ? 368 VAL C N   1 
ATOM   4202 C CA  . VAL C 2 73  ? 29.712  45.338  -6.654  1.00 34.02  ? 368 VAL C CA  1 
ATOM   4203 C C   . VAL C 2 73  ? 29.724  44.598  -5.318  1.00 42.99  ? 368 VAL C C   1 
ATOM   4204 O O   . VAL C 2 73  ? 30.776  44.457  -4.700  1.00 43.96  ? 368 VAL C O   1 
ATOM   4205 C CB  . VAL C 2 73  ? 30.253  46.776  -6.450  1.00 46.55  ? 368 VAL C CB  1 
ATOM   4206 C CG1 . VAL C 2 73  ? 30.360  47.510  -7.783  1.00 45.91  ? 368 VAL C CG1 1 
ATOM   4207 C CG2 . VAL C 2 73  ? 29.384  47.540  -5.467  1.00 44.03  ? 368 VAL C CG2 1 
ATOM   4208 N N   . ASP C 2 74  ? 28.556  44.128  -4.876  1.00 37.32  ? 369 ASP C N   1 
ATOM   4209 C CA  . ASP C 2 74  ? 28.475  43.294  -3.679  1.00 33.51  ? 369 ASP C CA  1 
ATOM   4210 C C   . ASP C 2 74  ? 29.014  41.895  -3.961  1.00 35.85  ? 369 ASP C C   1 
ATOM   4211 O O   . ASP C 2 74  ? 29.308  41.133  -3.035  1.00 41.63  ? 369 ASP C O   1 
ATOM   4212 C CB  . ASP C 2 74  ? 27.037  43.197  -3.177  1.00 35.26  ? 369 ASP C CB  1 
ATOM   4213 C CG  . ASP C 2 74  ? 26.517  44.517  -2.657  1.00 47.42  ? 369 ASP C CG  1 
ATOM   4214 O OD1 . ASP C 2 74  ? 27.349  45.358  -2.259  1.00 48.40  ? 369 ASP C OD1 1 
ATOM   4215 O OD2 . ASP C 2 74  ? 25.283  44.714  -2.645  1.00 51.14  ? 369 ASP C OD2 1 
ATOM   4216 N N   . LEU C 2 75  ? 29.135  41.564  -5.244  1.00 32.90  ? 370 LEU C N   1 
ATOM   4217 C CA  . LEU C 2 75  ? 29.595  40.241  -5.655  1.00 38.15  ? 370 LEU C CA  1 
ATOM   4218 C C   . LEU C 2 75  ? 31.115  40.183  -5.671  1.00 39.45  ? 370 LEU C C   1 
ATOM   4219 O O   . LEU C 2 75  ? 31.782  41.215  -5.747  1.00 38.19  ? 370 LEU C O   1 
ATOM   4220 C CB  . LEU C 2 75  ? 29.052  39.897  -7.049  1.00 37.64  ? 370 LEU C CB  1 
ATOM   4221 C CG  . LEU C 2 75  ? 27.532  39.934  -7.227  1.00 41.72  ? 370 LEU C CG  1 
ATOM   4222 C CD1 . LEU C 2 75  ? 27.152  39.836  -8.702  1.00 40.46  ? 370 LEU C CD1 1 
ATOM   4223 C CD2 . LEU C 2 75  ? 26.857  38.831  -6.413  1.00 40.78  ? 370 LEU C CD2 1 
ATOM   4224 N N   . THR C 2 76  ? 31.663  38.976  -5.604  1.00 39.55  ? 371 THR C N   1 
ATOM   4225 C CA  . THR C 2 76  ? 33.101  38.793  -5.758  1.00 44.52  ? 371 THR C CA  1 
ATOM   4226 C C   . THR C 2 76  ? 33.519  39.257  -7.153  1.00 42.12  ? 371 THR C C   1 
ATOM   4227 O O   . THR C 2 76  ? 32.707  39.263  -8.078  1.00 43.23  ? 371 THR C O   1 
ATOM   4228 C CB  . THR C 2 76  ? 33.512  37.317  -5.563  1.00 46.01  ? 371 THR C CB  1 
ATOM   4229 O OG1 . THR C 2 76  ? 33.027  36.528  -6.658  1.00 51.98  ? 371 THR C OG1 1 
ATOM   4230 C CG2 . THR C 2 76  ? 32.945  36.769  -4.254  1.00 38.38  ? 371 THR C CG2 1 
ATOM   4231 N N   . ARG C 2 77  ? 34.778  39.653  -7.303  1.00 41.67  ? 372 ARG C N   1 
ATOM   4232 C CA  . ARG C 2 77  ? 35.289  40.076  -8.604  1.00 42.93  ? 372 ARG C CA  1 
ATOM   4233 C C   . ARG C 2 77  ? 35.104  38.961  -9.631  1.00 40.09  ? 372 ARG C C   1 
ATOM   4234 O O   . ARG C 2 77  ? 34.777  39.215  -10.789 1.00 41.39  ? 372 ARG C O   1 
ATOM   4235 N N   . HIS C 2 78  ? 35.309  37.723  -9.197  1.00 38.87  ? 373 HIS C N   1 
ATOM   4236 C CA  . HIS C 2 78  ? 35.165  36.573  -10.080 1.00 42.95  ? 373 HIS C CA  1 
ATOM   4237 C C   . HIS C 2 78  ? 33.740  36.441  -10.614 1.00 46.11  ? 373 HIS C C   1 
ATOM   4238 O O   . HIS C 2 78  ? 33.539  36.164  -11.794 1.00 49.74  ? 373 HIS C O   1 
ATOM   4239 C CB  . HIS C 2 78  ? 35.571  35.287  -9.357  1.00 49.37  ? 373 HIS C CB  1 
ATOM   4240 C CG  . HIS C 2 78  ? 35.141  34.038  -10.065 0.57 54.08  ? 373 HIS C CG  1 
ATOM   4241 N ND1 . HIS C 2 78  ? 33.904  33.466  -9.875  0.72 54.65  ? 373 HIS C ND1 1 
ATOM   4242 C CD2 . HIS C 2 78  ? 35.785  33.258  -10.964 1.00 55.53  ? 373 HIS C CD2 1 
ATOM   4243 C CE1 . HIS C 2 78  ? 33.802  32.383  -10.629 0.86 57.04  ? 373 HIS C CE1 1 
ATOM   4244 N NE2 . HIS C 2 78  ? 34.930  32.237  -11.298 0.73 57.18  ? 373 HIS C NE2 1 
ATOM   4245 N N   . ASP C 2 79  ? 32.758  36.636  -9.740  1.00 38.53  ? 374 ASP C N   1 
ATOM   4246 C CA  . ASP C 2 79  ? 31.355  36.527  -10.127 1.00 35.50  ? 374 ASP C CA  1 
ATOM   4247 C C   . ASP C 2 79  ? 30.911  37.679  -11.018 1.00 42.19  ? 374 ASP C C   1 
ATOM   4248 O O   . ASP C 2 79  ? 30.056  37.507  -11.885 1.00 38.72  ? 374 ASP C O   1 
ATOM   4249 C CB  . ASP C 2 79  ? 30.462  36.452  -8.892  1.00 39.03  ? 374 ASP C CB  1 
ATOM   4250 C CG  . ASP C 2 79  ? 30.494  35.088  -8.240  1.00 48.57  ? 374 ASP C CG  1 
ATOM   4251 O OD1 . ASP C 2 79  ? 30.845  34.112  -8.935  1.00 51.31  ? 374 ASP C OD1 1 
ATOM   4252 O OD2 . ASP C 2 79  ? 30.164  34.989  -7.040  1.00 48.01  ? 374 ASP C OD2 1 
ATOM   4253 N N   . GLN C 2 80  ? 31.483  38.858  -10.798 1.00 35.46  ? 375 GLN C N   1 
ATOM   4254 C CA  . GLN C 2 80  ? 31.171  40.005  -11.639 1.00 34.83  ? 375 GLN C CA  1 
ATOM   4255 C C   . GLN C 2 80  ? 31.624  39.734  -13.073 1.00 33.41  ? 375 GLN C C   1 
ATOM   4256 O O   . GLN C 2 80  ? 30.925  40.059  -14.031 1.00 34.66  ? 375 GLN C O   1 
ATOM   4257 C CB  . GLN C 2 80  ? 31.840  41.272  -11.090 1.00 35.98  ? 375 GLN C CB  1 
ATOM   4258 C CG  . GLN C 2 80  ? 31.330  41.704  -9.719  1.00 31.94  ? 375 GLN C CG  1 
ATOM   4259 C CD  . GLN C 2 80  ? 32.089  42.901  -9.163  1.00 40.79  ? 375 GLN C CD  1 
ATOM   4260 O OE1 . GLN C 2 80  ? 32.506  43.786  -9.910  1.00 36.97  ? 375 GLN C OE1 1 
ATOM   4261 N NE2 . GLN C 2 80  ? 32.274  42.929  -7.846  1.00 35.62  ? 375 GLN C NE2 1 
ATOM   4262 N N   . VAL C 2 81  ? 32.798  39.127  -13.210 1.00 34.32  ? 376 VAL C N   1 
ATOM   4263 C CA  . VAL C 2 81  ? 33.347  38.809  -14.521 1.00 33.18  ? 376 VAL C CA  1 
ATOM   4264 C C   . VAL C 2 81  ? 32.494  37.781  -15.249 1.00 34.16  ? 376 VAL C C   1 
ATOM   4265 O O   . VAL C 2 81  ? 32.298  37.871  -16.461 1.00 40.48  ? 376 VAL C O   1 
ATOM   4266 C CB  . VAL C 2 81  ? 34.776  38.259  -14.417 1.00 36.09  ? 376 VAL C CB  1 
ATOM   4267 C CG1 . VAL C 2 81  ? 35.249  37.764  -15.775 1.00 32.75  ? 376 VAL C CG1 1 
ATOM   4268 C CG2 . VAL C 2 81  ? 35.707  39.323  -13.870 1.00 32.25  ? 376 VAL C CG2 1 
ATOM   4269 N N   . HIS C 2 82  ? 31.988  36.803  -14.509 1.00 30.88  ? 377 HIS C N   1 
ATOM   4270 C CA  . HIS C 2 82  ? 31.190  35.745  -15.112 1.00 40.92  ? 377 HIS C CA  1 
ATOM   4271 C C   . HIS C 2 82  ? 29.869  36.294  -15.653 1.00 38.86  ? 377 HIS C C   1 
ATOM   4272 O O   . HIS C 2 82  ? 29.431  35.931  -16.750 1.00 36.05  ? 377 HIS C O   1 
ATOM   4273 C CB  . HIS C 2 82  ? 30.933  34.619  -14.107 1.00 37.20  ? 377 HIS C CB  1 
ATOM   4274 C CG  . HIS C 2 82  ? 30.077  33.515  -14.644 0.48 39.95  ? 377 HIS C CG  1 
ATOM   4275 N ND1 . HIS C 2 82  ? 30.506  32.655  -15.634 0.79 43.45  ? 377 HIS C ND1 1 
ATOM   4276 C CD2 . HIS C 2 82  ? 28.820  33.124  -14.323 0.80 39.67  ? 377 HIS C CD2 1 
ATOM   4277 C CE1 . HIS C 2 82  ? 29.548  31.786  -15.901 0.27 39.44  ? 377 HIS C CE1 1 
ATOM   4278 N NE2 . HIS C 2 82  ? 28.515  32.046  -15.120 0.72 37.03  ? 377 HIS C NE2 1 
ATOM   4279 N N   . LEU C 2 83  ? 29.234  37.163  -14.877 1.00 31.77  ? 378 LEU C N   1 
ATOM   4280 C CA  . LEU C 2 83  ? 28.000  37.804  -15.303 1.00 28.38  ? 378 LEU C CA  1 
ATOM   4281 C C   . LEU C 2 83  ? 28.221  38.583  -16.593 1.00 27.24  ? 378 LEU C C   1 
ATOM   4282 O O   . LEU C 2 83  ? 27.453  38.451  -17.542 1.00 29.65  ? 378 LEU C O   1 
ATOM   4283 C CB  . LEU C 2 83  ? 27.494  38.750  -14.216 1.00 26.34  ? 378 LEU C CB  1 
ATOM   4284 C CG  . LEU C 2 83  ? 26.939  38.086  -12.958 1.00 30.01  ? 378 LEU C CG  1 
ATOM   4285 C CD1 . LEU C 2 83  ? 26.419  39.145  -12.004 1.00 26.04  ? 378 LEU C CD1 1 
ATOM   4286 C CD2 . LEU C 2 83  ? 25.841  37.113  -13.336 1.00 32.08  ? 378 LEU C CD2 1 
ATOM   4287 N N   . LEU C 2 84  ? 29.271  39.401  -16.620 1.00 25.76  ? 379 LEU C N   1 
ATOM   4288 C CA  . LEU C 2 84  ? 29.581  40.215  -17.794 1.00 31.61  ? 379 LEU C CA  1 
ATOM   4289 C C   . LEU C 2 84  ? 29.961  39.338  -18.977 1.00 33.99  ? 379 LEU C C   1 
ATOM   4290 O O   . LEU C 2 84  ? 29.593  39.617  -20.119 1.00 35.79  ? 379 LEU C O   1 
ATOM   4291 C CB  . LEU C 2 84  ? 30.731  41.185  -17.499 1.00 27.54  ? 379 LEU C CB  1 
ATOM   4292 C CG  . LEU C 2 84  ? 30.397  42.498  -16.788 1.00 38.28  ? 379 LEU C CG  1 
ATOM   4293 C CD1 . LEU C 2 84  ? 31.666  43.151  -16.246 1.00 36.02  ? 379 LEU C CD1 1 
ATOM   4294 C CD2 . LEU C 2 84  ? 29.648  43.447  -17.721 1.00 28.85  ? 379 LEU C CD2 1 
ATOM   4295 N N   . GLU C 2 85  ? 30.724  38.288  -18.702 1.00 34.53  ? 380 GLU C N   1 
ATOM   4296 C CA  . GLU C 2 85  ? 31.148  37.368  -19.745 1.00 40.06  ? 380 GLU C CA  1 
ATOM   4297 C C   . GLU C 2 85  ? 29.922  36.802  -20.463 1.00 34.75  ? 380 GLU C C   1 
ATOM   4298 O O   . GLU C 2 85  ? 29.879  36.747  -21.691 1.00 34.12  ? 380 GLU C O   1 
ATOM   4299 C CB  . GLU C 2 85  ? 31.992  36.240  -19.143 1.00 43.35  ? 380 GLU C CB  1 
ATOM   4300 C CG  . GLU C 2 85  ? 33.071  35.720  -20.068 1.00 52.46  ? 380 GLU C CG  1 
ATOM   4301 C CD  . GLU C 2 85  ? 33.795  34.513  -19.500 1.00 54.71  ? 380 GLU C CD  1 
ATOM   4302 O OE1 . GLU C 2 85  ? 33.794  34.342  -18.261 1.00 54.00  ? 380 GLU C OE1 1 
ATOM   4303 O OE2 . GLU C 2 85  ? 34.365  33.739  -20.298 1.00 55.43  ? 380 GLU C OE2 1 
ATOM   4304 N N   . CYS C 2 86  ? 28.917  36.406  -19.690 1.00 29.94  ? 381 CYS C N   1 
ATOM   4305 C CA  . CYS C 2 86  ? 27.699  35.823  -20.253 1.00 34.54  ? 381 CYS C CA  1 
ATOM   4306 C C   . CYS C 2 86  ? 26.750  36.857  -20.891 1.00 38.13  ? 381 CYS C C   1 
ATOM   4307 O O   . CYS C 2 86  ? 26.049  36.552  -21.854 1.00 32.15  ? 381 CYS C O   1 
ATOM   4308 C CB  . CYS C 2 86  ? 26.963  34.991  -19.192 1.00 29.87  ? 381 CYS C CB  1 
ATOM   4309 S SG  . CYS C 2 86  ? 27.878  33.503  -18.646 0.85 41.01  ? 381 CYS C SG  1 
ATOM   4310 N N   . ALA C 2 87  ? 26.755  38.084  -20.378 1.00 30.36  ? 382 ALA C N   1 
ATOM   4311 C CA  . ALA C 2 87  ? 25.748  39.073  -20.766 1.00 26.56  ? 382 ALA C CA  1 
ATOM   4312 C C   . ALA C 2 87  ? 26.191  40.051  -21.853 1.00 30.49  ? 382 ALA C C   1 
ATOM   4313 O O   . ALA C 2 87  ? 25.353  40.665  -22.516 1.00 33.96  ? 382 ALA C O   1 
ATOM   4314 C CB  . ALA C 2 87  ? 25.273  39.843  -19.528 1.00 21.92  ? 382 ALA C CB  1 
ATOM   4315 N N   . TRP C 2 88  ? 27.502  40.196  -22.036 1.00 31.59  ? 383 TRP C N   1 
ATOM   4316 C CA  . TRP C 2 88  ? 28.040  41.308  -22.817 1.00 34.36  ? 383 TRP C CA  1 
ATOM   4317 C C   . TRP C 2 88  ? 27.352  41.526  -24.172 1.00 36.89  ? 383 TRP C C   1 
ATOM   4318 O O   . TRP C 2 88  ? 26.988  42.653  -24.502 1.00 35.56  ? 383 TRP C O   1 
ATOM   4319 C CB  . TRP C 2 88  ? 29.571  41.213  -22.975 1.00 33.71  ? 383 TRP C CB  1 
ATOM   4320 C CG  . TRP C 2 88  ? 30.024  40.265  -24.032 1.00 35.97  ? 383 TRP C CG  1 
ATOM   4321 C CD1 . TRP C 2 88  ? 30.250  38.938  -23.886 1.00 47.76  ? 383 TRP C CD1 1 
ATOM   4322 C CD2 . TRP C 2 88  ? 30.311  40.575  -25.403 1.00 37.41  ? 383 TRP C CD2 1 
ATOM   4323 N NE1 . TRP C 2 88  ? 30.655  38.390  -25.082 1.00 49.95  ? 383 TRP C NE1 1 
ATOM   4324 C CE2 . TRP C 2 88  ? 30.695  39.377  -26.033 1.00 45.26  ? 383 TRP C CE2 1 
ATOM   4325 C CE3 . TRP C 2 88  ? 30.272  41.747  -26.161 1.00 43.99  ? 383 TRP C CE3 1 
ATOM   4326 C CZ2 . TRP C 2 88  ? 31.043  39.313  -27.381 1.00 40.53  ? 383 TRP C CZ2 1 
ATOM   4327 C CZ3 . TRP C 2 88  ? 30.618  41.684  -27.502 1.00 50.37  ? 383 TRP C CZ3 1 
ATOM   4328 C CH2 . TRP C 2 88  ? 31.000  40.475  -28.097 1.00 44.46  ? 383 TRP C CH2 1 
ATOM   4329 N N   . LEU C 2 89  ? 27.163  40.469  -24.958 1.00 25.71  ? 384 LEU C N   1 
ATOM   4330 C CA  . LEU C 2 89  ? 26.575  40.655  -26.286 1.00 23.33  ? 384 LEU C CA  1 
ATOM   4331 C C   . LEU C 2 89  ? 25.073  40.959  -26.195 1.00 28.58  ? 384 LEU C C   1 
ATOM   4332 O O   . LEU C 2 89  ? 24.524  41.687  -27.023 1.00 31.05  ? 384 LEU C O   1 
ATOM   4333 C CB  . LEU C 2 89  ? 26.835  39.431  -27.183 1.00 29.03  ? 384 LEU C CB  1 
ATOM   4334 C CG  . LEU C 2 89  ? 26.389  39.549  -28.647 1.00 28.94  ? 384 LEU C CG  1 
ATOM   4335 C CD1 . LEU C 2 89  ? 27.009  40.778  -29.305 1.00 28.44  ? 384 LEU C CD1 1 
ATOM   4336 C CD2 . LEU C 2 89  ? 26.717  38.282  -29.436 1.00 30.76  ? 384 LEU C CD2 1 
ATOM   4337 N N   . GLU C 2 90  ? 24.407  40.396  -25.192 1.00 29.01  ? 385 GLU C N   1 
ATOM   4338 C CA  . GLU C 2 90  ? 22.990  40.680  -24.983 1.00 24.27  ? 385 GLU C CA  1 
ATOM   4339 C C   . GLU C 2 90  ? 22.810  42.153  -24.658 1.00 26.37  ? 385 GLU C C   1 
ATOM   4340 O O   . GLU C 2 90  ? 21.883  42.807  -25.142 1.00 32.94  ? 385 GLU C O   1 
ATOM   4341 C CB  . GLU C 2 90  ? 22.425  39.839  -23.843 1.00 28.62  ? 385 GLU C CB  1 
ATOM   4342 C CG  . GLU C 2 90  ? 22.216  38.367  -24.177 1.00 30.07  ? 385 GLU C CG  1 
ATOM   4343 C CD  . GLU C 2 90  ? 21.547  37.619  -23.040 1.00 34.54  ? 385 GLU C CD  1 
ATOM   4344 O OE1 . GLU C 2 90  ? 20.306  37.677  -22.943 1.00 43.95  ? 385 GLU C OE1 1 
ATOM   4345 O OE2 . GLU C 2 90  ? 22.258  36.992  -22.232 1.00 40.62  ? 385 GLU C OE2 1 
ATOM   4346 N N   . ILE C 2 91  ? 23.710  42.678  -23.836 1.00 30.12  ? 386 ILE C N   1 
ATOM   4347 C CA  . ILE C 2 91  ? 23.634  44.075  -23.419 1.00 28.02  ? 386 ILE C CA  1 
ATOM   4348 C C   . ILE C 2 91  ? 23.877  45.012  -24.594 1.00 29.32  ? 386 ILE C C   1 
ATOM   4349 O O   . ILE C 2 91  ? 23.157  45.999  -24.770 1.00 27.57  ? 386 ILE C O   1 
ATOM   4350 C CB  . ILE C 2 91  ? 24.586  44.358  -22.244 1.00 26.26  ? 386 ILE C CB  1 
ATOM   4351 C CG1 . ILE C 2 91  ? 24.067  43.640  -20.995 1.00 26.86  ? 386 ILE C CG1 1 
ATOM   4352 C CG2 . ILE C 2 91  ? 24.668  45.856  -21.963 1.00 22.50  ? 386 ILE C CG2 1 
ATOM   4353 C CD1 . ILE C 2 91  ? 25.113  43.427  -19.926 1.00 37.03  ? 386 ILE C CD1 1 
ATOM   4354 N N   . LEU C 2 92  ? 24.873  44.692  -25.416 1.00 33.82  ? 387 LEU C N   1 
ATOM   4355 C CA  . LEU C 2 92  ? 25.129  45.479  -26.622 1.00 31.75  ? 387 LEU C CA  1 
ATOM   4356 C C   . LEU C 2 92  ? 23.895  45.459  -27.508 1.00 31.24  ? 387 LEU C C   1 
ATOM   4357 O O   . LEU C 2 92  ? 23.432  46.499  -27.976 1.00 28.54  ? 387 LEU C O   1 
ATOM   4358 C CB  . LEU C 2 92  ? 26.325  44.926  -27.400 1.00 29.19  ? 387 LEU C CB  1 
ATOM   4359 C CG  . LEU C 2 92  ? 27.703  45.132  -26.780 1.00 29.29  ? 387 LEU C CG  1 
ATOM   4360 C CD1 . LEU C 2 92  ? 28.753  44.528  -27.682 1.00 26.82  ? 387 LEU C CD1 1 
ATOM   4361 C CD2 . LEU C 2 92  ? 27.953  46.618  -26.571 1.00 31.91  ? 387 LEU C CD2 1 
ATOM   4362 N N   . MET C 2 93  ? 23.360  44.262  -27.720 1.00 30.84  ? 388 MET C N   1 
ATOM   4363 C CA  . MET C 2 93  ? 22.204  44.081  -28.595 1.00 31.80  ? 388 MET C CA  1 
ATOM   4364 C C   . MET C 2 93  ? 20.928  44.760  -28.119 1.00 30.17  ? 388 MET C C   1 
ATOM   4365 O O   . MET C 2 93  ? 20.179  45.314  -28.928 1.00 30.63  ? 388 MET C O   1 
ATOM   4366 C CB  . MET C 2 93  ? 21.932  42.596  -28.831 1.00 26.37  ? 388 MET C CB  1 
ATOM   4367 C CG  . MET C 2 93  ? 22.866  41.964  -29.825 1.00 29.87  ? 388 MET C CG  1 
ATOM   4368 S SD  . MET C 2 93  ? 22.465  40.227  -30.050 1.00 33.48  ? 388 MET C SD  1 
ATOM   4369 C CE  . MET C 2 93  ? 23.454  39.842  -31.492 1.00 22.55  ? 388 MET C CE  1 
ATOM   4370 N N   . ILE C 2 94  ? 20.653  44.719  -26.819 1.00 27.42  ? 389 ILE C N   1 
ATOM   4371 C CA  . ILE C 2 94  ? 19.447  45.390  -26.343 1.00 27.83  ? 389 ILE C CA  1 
ATOM   4372 C C   . ILE C 2 94  ? 19.598  46.911  -26.428 1.00 28.24  ? 389 ILE C C   1 
ATOM   4373 O O   . ILE C 2 94  ? 18.625  47.625  -26.670 1.00 30.22  ? 389 ILE C O   1 
ATOM   4374 C CB  . ILE C 2 94  ? 19.004  44.939  -24.927 1.00 25.65  ? 389 ILE C CB  1 
ATOM   4375 C CG1 . ILE C 2 94  ? 17.517  45.279  -24.730 1.00 25.65  ? 389 ILE C CG1 1 
ATOM   4376 C CG2 . ILE C 2 94  ? 19.905  45.549  -23.854 1.00 27.50  ? 389 ILE C CG2 1 
ATOM   4377 C CD1 . ILE C 2 94  ? 16.933  44.873  -23.383 1.00 23.04  ? 389 ILE C CD1 1 
ATOM   4378 N N   . GLY C 2 95  ? 20.822  47.404  -26.250 1.00 33.12  ? 390 GLY C N   1 
ATOM   4379 C CA  . GLY C 2 95  ? 21.082  48.825  -26.415 1.00 30.14  ? 390 GLY C CA  1 
ATOM   4380 C C   . GLY C 2 95  ? 20.765  49.245  -27.840 1.00 32.54  ? 390 GLY C C   1 
ATOM   4381 O O   . GLY C 2 95  ? 20.132  50.282  -28.076 1.00 25.79  ? 390 GLY C O   1 
ATOM   4382 N N   . LEU C 2 96  ? 21.195  48.422  -28.795 1.00 28.85  ? 391 LEU C N   1 
ATOM   4383 C CA  . LEU C 2 96  ? 20.946  48.674  -30.212 1.00 27.89  ? 391 LEU C CA  1 
ATOM   4384 C C   . LEU C 2 96  ? 19.454  48.706  -30.525 1.00 32.20  ? 391 LEU C C   1 
ATOM   4385 O O   . LEU C 2 96  ? 18.973  49.620  -31.193 1.00 30.09  ? 391 LEU C O   1 
ATOM   4386 C CB  . LEU C 2 96  ? 21.621  47.598  -31.058 1.00 29.22  ? 391 LEU C CB  1 
ATOM   4387 C CG  . LEU C 2 96  ? 21.316  47.575  -32.556 1.00 29.32  ? 391 LEU C CG  1 
ATOM   4388 C CD1 . LEU C 2 96  ? 21.756  48.871  -33.215 1.00 29.09  ? 391 LEU C CD1 1 
ATOM   4389 C CD2 . LEU C 2 96  ? 22.003  46.382  -33.192 1.00 29.11  ? 391 LEU C CD2 1 
ATOM   4390 N N   . VAL C 2 97  ? 18.737  47.694  -30.045 1.00 29.26  ? 392 VAL C N   1 
ATOM   4391 C CA  . VAL C 2 97  ? 17.292  47.593  -30.228 1.00 30.17  ? 392 VAL C CA  1 
ATOM   4392 C C   . VAL C 2 97  ? 16.579  48.821  -29.664 1.00 35.49  ? 392 VAL C C   1 
ATOM   4393 O O   . VAL C 2 97  ? 15.672  49.373  -30.293 1.00 31.74  ? 392 VAL C O   1 
ATOM   4394 C CB  . VAL C 2 97  ? 16.742  46.314  -29.562 1.00 27.98  ? 392 VAL C CB  1 
ATOM   4395 C CG1 . VAL C 2 97  ? 15.251  46.413  -29.363 1.00 31.97  ? 392 VAL C CG1 1 
ATOM   4396 C CG2 . VAL C 2 97  ? 17.099  45.093  -30.399 1.00 30.45  ? 392 VAL C CG2 1 
ATOM   4397 N N   . TRP C 2 98  ? 16.998  49.253  -28.479 1.00 33.74  ? 393 TRP C N   1 
ATOM   4398 C CA  . TRP C 2 98  ? 16.426  50.444  -27.853 1.00 32.34  ? 393 TRP C CA  1 
ATOM   4399 C C   . TRP C 2 98  ? 16.688  51.686  -28.700 1.00 29.40  ? 393 TRP C C   1 
ATOM   4400 O O   . TRP C 2 98  ? 15.779  52.478  -28.938 1.00 36.41  ? 393 TRP C O   1 
ATOM   4401 C CB  . TRP C 2 98  ? 16.993  50.621  -26.441 1.00 32.37  ? 393 TRP C CB  1 
ATOM   4402 C CG  . TRP C 2 98  ? 16.702  51.956  -25.801 1.00 28.87  ? 393 TRP C CG  1 
ATOM   4403 C CD1 . TRP C 2 98  ? 17.596  52.945  -25.542 1.00 31.96  ? 393 TRP C CD1 1 
ATOM   4404 C CD2 . TRP C 2 98  ? 15.428  52.426  -25.323 1.00 28.13  ? 393 TRP C CD2 1 
ATOM   4405 N NE1 . TRP C 2 98  ? 16.962  54.007  -24.931 1.00 28.92  ? 393 TRP C NE1 1 
ATOM   4406 C CE2 . TRP C 2 98  ? 15.632  53.711  -24.787 1.00 30.73  ? 393 TRP C CE2 1 
ATOM   4407 C CE3 . TRP C 2 98  ? 14.138  51.882  -25.294 1.00 31.47  ? 393 TRP C CE3 1 
ATOM   4408 C CZ2 . TRP C 2 98  ? 14.597  54.462  -24.236 1.00 30.60  ? 393 TRP C CZ2 1 
ATOM   4409 C CZ3 . TRP C 2 98  ? 13.113  52.632  -24.747 1.00 29.79  ? 393 TRP C CZ3 1 
ATOM   4410 C CH2 . TRP C 2 98  ? 13.348  53.905  -24.225 1.00 25.02  ? 393 TRP C CH2 1 
ATOM   4411 N N   . ARG C 2 99  ? 17.928  51.840  -29.161 1.00 30.25  ? 394 ARG C N   1 
ATOM   4412 C CA  . ARG C 2 99  ? 18.317  52.983  -29.987 1.00 34.41  ? 394 ARG C CA  1 
ATOM   4413 C C   . ARG C 2 99  ? 17.561  53.025  -31.305 1.00 35.26  ? 394 ARG C C   1 
ATOM   4414 O O   . ARG C 2 99  ? 17.341  54.097  -31.861 1.00 33.61  ? 394 ARG C O   1 
ATOM   4415 C CB  . ARG C 2 99  ? 19.815  52.943  -30.311 1.00 33.56  ? 394 ARG C CB  1 
ATOM   4416 C CG  . ARG C 2 99  ? 20.728  53.080  -29.119 1.00 42.09  ? 394 ARG C CG  1 
ATOM   4417 C CD  . ARG C 2 99  ? 22.138  53.472  -29.546 1.00 40.87  ? 394 ARG C CD  1 
ATOM   4418 N NE  . ARG C 2 99  ? 22.840  52.452  -30.329 1.00 32.00  ? 394 ARG C NE  1 
ATOM   4419 C CZ  . ARG C 2 99  ? 23.529  51.441  -29.801 1.00 32.15  ? 394 ARG C CZ  1 
ATOM   4420 N NH1 . ARG C 2 99  ? 23.587  51.284  -28.484 1.00 27.31  ? 394 ARG C NH1 1 
ATOM   4421 N NH2 . ARG C 2 99  ? 24.157  50.580  -30.590 1.00 33.82  ? 394 ARG C NH2 1 
ATOM   4422 N N   . SER C 2 100 ? 17.190  51.854  -31.816 1.00 33.05  ? 395 SER C N   1 
ATOM   4423 C CA  . SER C 2 100 ? 16.598  51.757  -33.147 1.00 35.75  ? 395 SER C CA  1 
ATOM   4424 C C   . SER C 2 100 ? 15.081  51.863  -33.073 1.00 39.47  ? 395 SER C C   1 
ATOM   4425 O O   . SER C 2 100 ? 14.392  51.879  -34.098 1.00 41.69  ? 395 SER C O   1 
ATOM   4426 C CB  . SER C 2 100 ? 16.999  50.435  -33.808 1.00 37.57  ? 395 SER C CB  1 
ATOM   4427 O OG  . SER C 2 100 ? 18.410  50.260  -33.776 1.00 35.35  ? 395 SER C OG  1 
ATOM   4428 N N   . MET C 2 101 ? 14.569  51.941  -31.851 1.00 36.20  ? 396 MET C N   1 
ATOM   4429 C CA  . MET C 2 101 ? 13.140  51.832  -31.608 1.00 46.52  ? 396 MET C CA  1 
ATOM   4430 C C   . MET C 2 101 ? 12.341  52.795  -32.477 1.00 45.91  ? 396 MET C C   1 
ATOM   4431 O O   . MET C 2 101 ? 11.341  52.413  -33.083 1.00 43.98  ? 396 MET C O   1 
ATOM   4432 C CB  . MET C 2 101 ? 12.839  52.074  -30.129 1.00 50.45  ? 396 MET C CB  1 
ATOM   4433 C CG  . MET C 2 101 ? 11.509  51.533  -29.677 1.00 45.55  ? 396 MET C CG  1 
ATOM   4434 S SD  . MET C 2 101 ? 11.359  51.634  -27.890 1.00 53.98  ? 396 MET C SD  1 
ATOM   4435 C CE  . MET C 2 101 ? 10.074  52.866  -27.705 1.00 46.18  ? 396 MET C CE  1 
ATOM   4436 N N   . GLU C 2 102 ? 12.792  54.041  -32.543 1.00 54.12  ? 397 GLU C N   1 
ATOM   4437 C CA  . GLU C 2 102 ? 12.063  55.068  -33.278 1.00 57.75  ? 397 GLU C CA  1 
ATOM   4438 C C   . GLU C 2 102 ? 12.473  55.147  -34.751 1.00 54.11  ? 397 GLU C C   1 
ATOM   4439 O O   . GLU C 2 102 ? 12.216  56.146  -35.418 1.00 50.25  ? 397 GLU C O   1 
ATOM   4440 C CB  . GLU C 2 102 ? 12.236  56.433  -32.603 1.00 66.06  ? 397 GLU C CB  1 
ATOM   4441 C CG  . GLU C 2 102 ? 13.677  56.934  -32.543 1.00 79.00  ? 397 GLU C CG  1 
ATOM   4442 C CD  . GLU C 2 102 ? 14.430  56.457  -31.307 1.00 85.87  ? 397 GLU C CD  1 
ATOM   4443 O OE1 . GLU C 2 102 ? 14.697  57.296  -30.416 1.00 93.31  ? 397 GLU C OE1 1 
ATOM   4444 O OE2 . GLU C 2 102 ? 14.757  55.251  -31.225 1.00 76.77  ? 397 GLU C OE2 1 
ATOM   4445 N N   . HIS C 2 103 ? 13.105  54.091  -35.255 1.00 49.74  ? 398 HIS C N   1 
ATOM   4446 C CA  . HIS C 2 103 ? 13.539  54.053  -36.651 1.00 45.94  ? 398 HIS C CA  1 
ATOM   4447 C C   . HIS C 2 103 ? 13.102  52.755  -37.320 1.00 46.78  ? 398 HIS C C   1 
ATOM   4448 O O   . HIS C 2 103 ? 13.931  51.884  -37.590 1.00 45.22  ? 398 HIS C O   1 
ATOM   4449 C CB  . HIS C 2 103 ? 15.061  54.178  -36.744 1.00 42.57  ? 398 HIS C CB  1 
ATOM   4450 C CG  . HIS C 2 103 ? 15.611  55.397  -36.072 1.00 51.35  ? 398 HIS C CG  1 
ATOM   4451 N ND1 . HIS C 2 103 ? 15.757  56.601  -36.724 1.00 54.28  ? 398 HIS C ND1 1 
ATOM   4452 C CD2 . HIS C 2 103 ? 16.058  55.592  -34.810 1.00 53.76  ? 398 HIS C CD2 1 
ATOM   4453 C CE1 . HIS C 2 103 ? 16.267  57.491  -35.889 1.00 55.38  ? 398 HIS C CE1 1 
ATOM   4454 N NE2 . HIS C 2 103 ? 16.459  56.905  -34.723 1.00 57.93  ? 398 HIS C NE2 1 
ATOM   4455 N N   . PRO C 2 104 ? 11.796  52.620  -37.594 1.00 44.91  ? 399 PRO C N   1 
ATOM   4456 C CA  . PRO C 2 104 ? 11.285  51.360  -38.141 1.00 34.69  ? 399 PRO C CA  1 
ATOM   4457 C C   . PRO C 2 104 ? 12.033  50.960  -39.403 1.00 42.77  ? 399 PRO C C   1 
ATOM   4458 O O   . PRO C 2 104 ? 12.264  51.806  -40.270 1.00 43.94  ? 399 PRO C O   1 
ATOM   4459 C CB  . PRO C 2 104 ? 9.826   51.685  -38.466 1.00 42.14  ? 399 PRO C CB  1 
ATOM   4460 C CG  . PRO C 2 104 ? 9.486   52.844  -37.587 1.00 46.15  ? 399 PRO C CG  1 
ATOM   4461 C CD  . PRO C 2 104 ? 10.744  53.643  -37.467 1.00 46.05  ? 399 PRO C CD  1 
ATOM   4462 N N   . GLY C 2 105 ? 12.419  49.689  -39.491 1.00 38.37  ? 400 GLY C N   1 
ATOM   4463 C CA  . GLY C 2 105 ? 13.114  49.179  -40.663 1.00 39.92  ? 400 GLY C CA  1 
ATOM   4464 C C   . GLY C 2 105 ? 14.612  49.431  -40.662 1.00 45.51  ? 400 GLY C C   1 
ATOM   4465 O O   . GLY C 2 105 ? 15.323  49.017  -41.579 1.00 48.92  ? 400 GLY C O   1 
ATOM   4466 N N   . LYS C 2 106 ? 15.102  50.110  -39.630 1.00 45.43  ? 401 LYS C N   1 
ATOM   4467 C CA  . LYS C 2 106 ? 16.520  50.446  -39.559 1.00 43.64  ? 401 LYS C CA  1 
ATOM   4468 C C   . LYS C 2 106 ? 17.127  50.117  -38.200 1.00 41.03  ? 401 LYS C C   1 
ATOM   4469 O O   . LYS C 2 106 ? 16.449  50.162  -37.174 1.00 39.78  ? 401 LYS C O   1 
ATOM   4470 C CB  . LYS C 2 106 ? 16.737  51.929  -39.879 1.00 43.96  ? 401 LYS C CB  1 
ATOM   4471 C CG  . LYS C 2 106 ? 16.167  52.359  -41.221 1.00 51.45  ? 401 LYS C CG  1 
ATOM   4472 C CD  . LYS C 2 106 ? 16.623  53.763  -41.592 1.00 64.37  ? 401 LYS C CD  1 
ATOM   4473 C CE  . LYS C 2 106 ? 16.013  54.224  -42.912 1.00 70.99  ? 401 LYS C CE  1 
ATOM   4474 N NZ  . LYS C 2 106 ? 16.294  53.278  -44.031 1.00 73.29  ? 401 LYS C NZ  1 
ATOM   4475 N N   . LEU C 2 107 ? 18.412  49.778  -38.211 1.00 39.44  ? 402 LEU C N   1 
ATOM   4476 C CA  . LEU C 2 107 ? 19.166  49.570  -36.987 1.00 41.87  ? 402 LEU C CA  1 
ATOM   4477 C C   . LEU C 2 107 ? 20.157  50.717  -36.788 1.00 47.58  ? 402 LEU C C   1 
ATOM   4478 O O   . LEU C 2 107 ? 21.023  50.970  -37.635 1.00 41.64  ? 402 LEU C O   1 
ATOM   4479 C CB  . LEU C 2 107 ? 19.902  48.228  -37.016 1.00 42.21  ? 402 LEU C CB  1 
ATOM   4480 C CG  . LEU C 2 107 ? 19.026  46.975  -36.936 1.00 38.16  ? 402 LEU C CG  1 
ATOM   4481 C CD1 . LEU C 2 107 ? 19.864  45.717  -37.062 1.00 34.58  ? 402 LEU C CD1 1 
ATOM   4482 C CD2 . LEU C 2 107 ? 18.244  46.968  -35.640 1.00 38.22  ? 402 LEU C CD2 1 
ATOM   4483 N N   . LEU C 2 108 ? 20.018  51.413  -35.666 1.00 40.41  ? 403 LEU C N   1 
ATOM   4484 C CA  . LEU C 2 108 ? 20.877  52.551  -35.372 1.00 40.06  ? 403 LEU C CA  1 
ATOM   4485 C C   . LEU C 2 108 ? 22.071  52.103  -34.543 1.00 38.94  ? 403 LEU C C   1 
ATOM   4486 O O   . LEU C 2 108 ? 22.084  52.251  -33.317 1.00 33.61  ? 403 LEU C O   1 
ATOM   4487 C CB  . LEU C 2 108 ? 20.088  53.632  -34.642 1.00 34.73  ? 403 LEU C CB  1 
ATOM   4488 C CG  . LEU C 2 108 ? 20.718  55.031  -34.589 1.00 42.11  ? 403 LEU C CG  1 
ATOM   4489 C CD1 . LEU C 2 108 ? 19.650  56.076  -34.576 1.00 34.00  ? 403 LEU C CD1 1 
ATOM   4490 C CD2 . LEU C 2 108 ? 21.623  55.173  -33.373 1.00 42.50  ? 403 LEU C CD2 1 
ATOM   4491 N N   . PHE C 2 109 ? 23.066  51.528  -35.214 1.00 36.15  ? 404 PHE C N   1 
ATOM   4492 C CA  . PHE C 2 109 ? 24.299  51.130  -34.543 1.00 32.48  ? 404 PHE C CA  1 
ATOM   4493 C C   . PHE C 2 109 ? 24.945  52.350  -33.883 1.00 36.15  ? 404 PHE C C   1 
ATOM   4494 O O   . PHE C 2 109 ? 25.494  52.260  -32.783 1.00 34.41  ? 404 PHE C O   1 
ATOM   4495 C CB  . PHE C 2 109 ? 25.255  50.451  -35.521 1.00 32.93  ? 404 PHE C CB  1 
ATOM   4496 C CG  . PHE C 2 109 ? 24.802  49.081  -35.946 1.00 32.91  ? 404 PHE C CG  1 
ATOM   4497 C CD1 . PHE C 2 109 ? 25.128  47.967  -35.190 1.00 32.66  ? 404 PHE C CD1 1 
ATOM   4498 C CD2 . PHE C 2 109 ? 24.040  48.911  -37.088 1.00 37.56  ? 404 PHE C CD2 1 
ATOM   4499 C CE1 . PHE C 2 109 ? 24.709  46.704  -35.570 1.00 37.77  ? 404 PHE C CE1 1 
ATOM   4500 C CE2 . PHE C 2 109 ? 23.619  47.655  -37.477 1.00 42.85  ? 404 PHE C CE2 1 
ATOM   4501 C CZ  . PHE C 2 109 ? 23.954  46.549  -36.716 1.00 42.50  ? 404 PHE C CZ  1 
ATOM   4502 N N   . ALA C 2 110 ? 24.855  53.487  -34.568 1.00 37.47  ? 405 ALA C N   1 
ATOM   4503 C CA  . ALA C 2 110 ? 25.283  54.784  -34.030 1.00 34.30  ? 405 ALA C CA  1 
ATOM   4504 C C   . ALA C 2 110 ? 24.583  55.892  -34.809 1.00 33.79  ? 405 ALA C C   1 
ATOM   4505 O O   . ALA C 2 110 ? 24.025  55.636  -35.873 1.00 41.73  ? 405 ALA C O   1 
ATOM   4506 C CB  . ALA C 2 110 ? 26.781  54.928  -34.126 1.00 29.88  ? 405 ALA C CB  1 
ATOM   4507 N N   . PRO C 2 111 ? 24.596  57.128  -34.281 1.00 41.45  ? 406 PRO C N   1 
ATOM   4508 C CA  . PRO C 2 111 ? 23.922  58.247  -34.955 1.00 42.69  ? 406 PRO C CA  1 
ATOM   4509 C C   . PRO C 2 111 ? 24.408  58.468  -36.391 1.00 41.87  ? 406 PRO C C   1 
ATOM   4510 O O   . PRO C 2 111 ? 23.662  58.991  -37.223 1.00 41.14  ? 406 PRO C O   1 
ATOM   4511 C CB  . PRO C 2 111 ? 24.286  59.448  -34.078 1.00 37.99  ? 406 PRO C CB  1 
ATOM   4512 C CG  . PRO C 2 111 ? 24.521  58.860  -32.725 1.00 35.65  ? 406 PRO C CG  1 
ATOM   4513 C CD  . PRO C 2 111 ? 25.154  57.524  -32.974 1.00 38.16  ? 406 PRO C CD  1 
ATOM   4514 N N   . ASN C 2 112 ? 25.642  58.072  -36.675 1.00 30.97  ? 407 ASN C N   1 
ATOM   4515 C CA  . ASN C 2 112 ? 26.192  58.203  -38.019 1.00 37.56  ? 407 ASN C CA  1 
ATOM   4516 C C   . ASN C 2 112 ? 26.306  56.852  -38.705 1.00 49.67  ? 407 ASN C C   1 
ATOM   4517 O O   . ASN C 2 112 ? 26.960  56.720  -39.739 1.00 54.82  ? 407 ASN C O   1 
ATOM   4518 C CB  . ASN C 2 112 ? 27.559  58.885  -37.984 1.00 34.56  ? 407 ASN C CB  1 
ATOM   4519 C CG  . ASN C 2 112 ? 28.538  58.179  -37.074 1.00 39.03  ? 407 ASN C CG  1 
ATOM   4520 O OD1 . ASN C 2 112 ? 28.157  57.328  -36.268 1.00 43.73  ? 407 ASN C OD1 1 
ATOM   4521 N ND2 . ASN C 2 112 ? 29.809  58.532  -37.192 1.00 42.64  ? 407 ASN C ND2 1 
ATOM   4522 N N   . LEU C 2 113 ? 25.672  55.845  -38.116 1.00 48.78  ? 408 LEU C N   1 
ATOM   4523 C CA  . LEU C 2 113 ? 25.683  54.503  -38.680 1.00 43.07  ? 408 LEU C CA  1 
ATOM   4524 C C   . LEU C 2 113 ? 24.307  53.870  -38.531 1.00 43.91  ? 408 LEU C C   1 
ATOM   4525 O O   . LEU C 2 113 ? 24.078  53.055  -37.639 1.00 42.58  ? 408 LEU C O   1 
ATOM   4526 C CB  . LEU C 2 113 ? 26.747  53.645  -37.996 1.00 43.05  ? 408 LEU C CB  1 
ATOM   4527 C CG  . LEU C 2 113 ? 27.016  52.298  -38.664 1.00 49.24  ? 408 LEU C CG  1 
ATOM   4528 C CD1 . LEU C 2 113 ? 27.255  52.494  -40.153 1.00 49.86  ? 408 LEU C CD1 1 
ATOM   4529 C CD2 . LEU C 2 113 ? 28.191  51.595  -38.004 1.00 50.50  ? 408 LEU C CD2 1 
ATOM   4530 N N   . LEU C 2 114 ? 23.394  54.270  -39.407 1.00 48.85  ? 409 LEU C N   1 
ATOM   4531 C CA  . LEU C 2 114 ? 22.029  53.766  -39.399 1.00 51.34  ? 409 LEU C CA  1 
ATOM   4532 C C   . LEU C 2 114 ? 21.830  52.878  -40.615 1.00 57.11  ? 409 LEU C C   1 
ATOM   4533 O O   . LEU C 2 114 ? 21.954  53.340  -41.749 1.00 60.63  ? 409 LEU C O   1 
ATOM   4534 C CB  . LEU C 2 114 ? 21.047  54.935  -39.439 1.00 54.01  ? 409 LEU C CB  1 
ATOM   4535 C CG  . LEU C 2 114 ? 19.550  54.628  -39.507 1.00 55.40  ? 409 LEU C CG  1 
ATOM   4536 C CD1 . LEU C 2 114 ? 19.093  53.908  -38.250 1.00 57.42  ? 409 LEU C CD1 1 
ATOM   4537 C CD2 . LEU C 2 114 ? 18.764  55.918  -39.712 1.00 57.16  ? 409 LEU C CD2 1 
ATOM   4538 N N   . LEU C 2 115 ? 21.523  51.603  -40.382 1.00 53.82  ? 410 LEU C N   1 
ATOM   4539 C CA  . LEU C 2 115 ? 21.448  50.632  -41.471 1.00 53.19  ? 410 LEU C CA  1 
ATOM   4540 C C   . LEU C 2 115 ? 20.047  50.071  -41.701 1.00 55.62  ? 410 LEU C C   1 
ATOM   4541 O O   . LEU C 2 115 ? 19.301  49.833  -40.756 1.00 53.02  ? 410 LEU C O   1 
ATOM   4542 C CB  . LEU C 2 115 ? 22.422  49.484  -41.218 1.00 50.49  ? 410 LEU C CB  1 
ATOM   4543 C CG  . LEU C 2 115 ? 23.864  49.913  -40.946 1.00 56.52  ? 410 LEU C CG  1 
ATOM   4544 C CD1 . LEU C 2 115 ? 24.754  48.699  -40.818 1.00 59.79  ? 410 LEU C CD1 1 
ATOM   4545 C CD2 . LEU C 2 115 ? 24.369  50.827  -42.044 1.00 58.96  ? 410 LEU C CD2 1 
ATOM   4546 N N   . ASP C 2 116 ? 19.698  49.860  -42.966 1.00 61.09  ? 411 ASP C N   1 
ATOM   4547 C CA  . ASP C 2 116 ? 18.440  49.203  -43.304 1.00 63.24  ? 411 ASP C CA  1 
ATOM   4548 C C   . ASP C 2 116 ? 18.703  47.742  -43.628 1.00 64.45  ? 411 ASP C C   1 
ATOM   4549 O O   . ASP C 2 116 ? 19.854  47.308  -43.680 1.00 56.85  ? 411 ASP C O   1 
ATOM   4550 C CB  . ASP C 2 116 ? 17.735  49.903  -44.472 1.00 70.15  ? 411 ASP C CB  1 
ATOM   4551 C CG  . ASP C 2 116 ? 18.359  49.580  -45.823 1.00 77.58  ? 411 ASP C CG  1 
ATOM   4552 O OD1 . ASP C 2 116 ? 19.402  48.893  -45.872 1.00 76.12  ? 411 ASP C OD1 1 
ATOM   4553 O OD2 . ASP C 2 116 ? 17.795  50.020  -46.848 1.00 82.74  ? 411 ASP C OD2 1 
ATOM   4554 N N   . ARG C 2 117 ? 17.632  46.991  -43.854 1.00 78.29  ? 412 ARG C N   1 
ATOM   4555 C CA  . ARG C 2 117 ? 17.733  45.553  -44.062 1.00 77.01  ? 412 ARG C CA  1 
ATOM   4556 C C   . ARG C 2 117 ? 18.676  45.150  -45.197 1.00 82.73  ? 412 ARG C C   1 
ATOM   4557 O O   . ARG C 2 117 ? 19.365  44.133  -45.106 1.00 84.17  ? 412 ARG C O   1 
ATOM   4558 C CB  . ARG C 2 117 ? 16.348  44.956  -44.302 1.00 72.61  ? 412 ARG C CB  1 
ATOM   4559 C CG  . ARG C 2 117 ? 16.386  43.478  -44.600 1.00 67.33  ? 412 ARG C CG  1 
ATOM   4560 C CD  . ARG C 2 117 ? 15.023  42.841  -44.482 1.00 62.38  ? 412 ARG C CD  1 
ATOM   4561 N NE  . ARG C 2 117 ? 15.149  41.390  -44.414 1.00 71.29  ? 412 ARG C NE  1 
ATOM   4562 C CZ  . ARG C 2 117 ? 15.369  40.611  -45.467 1.00 71.40  ? 412 ARG C CZ  1 
ATOM   4563 N NH1 . ARG C 2 117 ? 15.480  41.146  -46.676 1.00 73.29  ? 412 ARG C NH1 1 
ATOM   4564 N NH2 . ARG C 2 117 ? 15.480  39.301  -45.311 1.00 63.46  ? 412 ARG C NH2 1 
ATOM   4565 N N   . ASN C 2 118 ? 18.707  45.945  -46.263 1.00 87.15  ? 413 ASN C N   1 
ATOM   4566 C CA  . ASN C 2 118 ? 19.478  45.587  -47.454 1.00 94.29  ? 413 ASN C CA  1 
ATOM   4567 C C   . ASN C 2 118 ? 20.986  45.777  -47.328 1.00 94.32  ? 413 ASN C C   1 
ATOM   4568 O O   . ASN C 2 118 ? 21.762  44.970  -47.840 1.00 98.55  ? 413 ASN C O   1 
ATOM   4569 C CB  . ASN C 2 118 ? 18.939  46.307  -48.689 1.00 102.34 ? 413 ASN C CB  1 
ATOM   4570 C CG  . ASN C 2 118 ? 17.745  45.601  -49.288 1.00 111.65 ? 413 ASN C CG  1 
ATOM   4571 O OD1 . ASN C 2 118 ? 17.715  44.372  -49.370 1.00 113.73 ? 413 ASN C OD1 1 
ATOM   4572 N ND2 . ASN C 2 118 ? 16.749  46.372  -49.708 1.00 116.53 ? 413 ASN C ND2 1 
ATOM   4573 N N   . GLN C 2 119 ? 21.404  46.844  -46.658 1.00 109.00 ? 414 GLN C N   1 
ATOM   4574 C CA  . GLN C 2 119 ? 22.809  46.993  -46.315 1.00 104.22 ? 414 GLN C CA  1 
ATOM   4575 C C   . GLN C 2 119 ? 23.149  45.882  -45.333 1.00 105.91 ? 414 GLN C C   1 
ATOM   4576 O O   . GLN C 2 119 ? 24.315  45.547  -45.127 1.00 110.32 ? 414 GLN C O   1 
ATOM   4577 C CB  . GLN C 2 119 ? 23.068  48.357  -45.682 1.00 97.14  ? 414 GLN C CB  1 
ATOM   4578 C CG  . GLN C 2 119 ? 22.645  49.525  -46.547 1.00 92.04  ? 414 GLN C CG  1 
ATOM   4579 C CD  . GLN C 2 119 ? 22.103  50.681  -45.730 1.00 92.66  ? 414 GLN C CD  1 
ATOM   4580 O OE1 . GLN C 2 119 ? 21.956  50.580  -44.512 1.00 91.42  ? 414 GLN C OE1 1 
ATOM   4581 N NE2 . GLN C 2 119 ? 21.796  51.786  -46.398 1.00 93.95  ? 414 GLN C NE2 1 
ATOM   4582 N N   . GLY C 2 120 ? 22.108  45.312  -44.733 1.00 100.91 ? 415 GLY C N   1 
ATOM   4583 C CA  . GLY C 2 120 ? 22.259  44.202  -43.813 1.00 103.24 ? 415 GLY C CA  1 
ATOM   4584 C C   . GLY C 2 120 ? 22.316  42.873  -44.540 1.00 107.11 ? 415 GLY C C   1 
ATOM   4585 O O   . GLY C 2 120 ? 22.415  41.815  -43.918 1.00 111.79 ? 415 GLY C O   1 
ATOM   4586 N N   . LYS C 2 121 ? 22.250  42.930  -45.866 1.00 105.87 ? 416 LYS C N   1 
ATOM   4587 C CA  . LYS C 2 121 ? 22.396  41.737  -46.688 1.00 106.03 ? 416 LYS C CA  1 
ATOM   4588 C C   . LYS C 2 121 ? 23.838  41.614  -47.169 1.00 110.01 ? 416 LYS C C   1 
ATOM   4589 O O   . LYS C 2 121 ? 24.408  40.520  -47.165 1.00 112.50 ? 416 LYS C O   1 
ATOM   4590 C CB  . LYS C 2 121 ? 21.433  41.777  -47.876 1.00 103.07 ? 416 LYS C CB  1 
ATOM   4591 N N   . CYS C 2 122 ? 24.425  42.740  -47.575 1.00 109.74 ? 417 CYS C N   1 
ATOM   4592 C CA  . CYS C 2 122 ? 25.822  42.766  -48.000 1.00 109.41 ? 417 CYS C CA  1 
ATOM   4593 C C   . CYS C 2 122 ? 26.665  42.099  -46.926 1.00 108.44 ? 417 CYS C C   1 
ATOM   4594 O O   . CYS C 2 122 ? 27.658  41.431  -47.216 1.00 111.34 ? 417 CYS C O   1 
ATOM   4595 C CB  . CYS C 2 122 ? 26.304  44.202  -48.236 1.00 108.90 ? 417 CYS C CB  1 
ATOM   4596 S SG  . CYS C 2 122 ? 27.086  45.006  -46.807 1.00 116.67 ? 417 CYS C SG  1 
ATOM   4597 N N   . VAL C 2 123 ? 26.253  42.285  -45.679 1.00 102.25 ? 418 VAL C N   1 
ATOM   4598 C CA  . VAL C 2 123 ? 26.890  41.616  -44.558 1.00 98.68  ? 418 VAL C CA  1 
ATOM   4599 C C   . VAL C 2 123 ? 26.369  40.184  -44.479 1.00 98.13  ? 418 VAL C C   1 
ATOM   4600 O O   . VAL C 2 123 ? 25.184  39.952  -44.246 1.00 100.07 ? 418 VAL C O   1 
ATOM   4601 C CB  . VAL C 2 123 ? 26.659  42.394  -43.256 1.00 92.64  ? 418 VAL C CB  1 
ATOM   4602 C CG1 . VAL C 2 123 ? 27.137  43.811  -43.448 1.00 88.32  ? 418 VAL C CG1 1 
ATOM   4603 C CG2 . VAL C 2 123 ? 25.191  42.395  -42.876 1.00 89.79  ? 418 VAL C CG2 1 
ATOM   4604 N N   . GLU C 2 124 ? 27.275  39.235  -44.689 1.00 96.57  ? 419 GLU C N   1 
ATOM   4605 C CA  . GLU C 2 124 ? 26.928  37.840  -44.963 1.00 98.67  ? 419 GLU C CA  1 
ATOM   4606 C C   . GLU C 2 124 ? 25.803  37.234  -44.117 1.00 100.04 ? 419 GLU C C   1 
ATOM   4607 O O   . GLU C 2 124 ? 24.632  37.561  -44.300 1.00 100.41 ? 419 GLU C O   1 
ATOM   4608 C CB  . GLU C 2 124 ? 28.180  36.960  -44.885 1.00 101.39 ? 419 GLU C CB  1 
ATOM   4609 N N   . GLY C 2 125 ? 26.167  36.329  -43.213 1.00 99.71  ? 420 GLY C N   1 
ATOM   4610 C CA  . GLY C 2 125 ? 25.193  35.585  -42.429 1.00 100.80 ? 420 GLY C CA  1 
ATOM   4611 C C   . GLY C 2 125 ? 24.553  36.362  -41.292 1.00 101.22 ? 420 GLY C C   1 
ATOM   4612 O O   . GLY C 2 125 ? 24.014  35.775  -40.353 1.00 98.99  ? 420 GLY C O   1 
ATOM   4613 N N   . MET C 2 126 ? 24.604  37.686  -41.375 1.00 67.36  ? 421 MET C N   1 
ATOM   4614 C CA  . MET C 2 126 ? 24.025  38.526  -40.339 1.00 66.29  ? 421 MET C CA  1 
ATOM   4615 C C   . MET C 2 126 ? 22.579  38.898  -40.647 1.00 63.27  ? 421 MET C C   1 
ATOM   4616 O O   . MET C 2 126 ? 21.869  39.412  -39.784 1.00 65.72  ? 421 MET C O   1 
ATOM   4617 C CB  . MET C 2 126 ? 24.845  39.802  -40.154 1.00 67.07  ? 421 MET C CB  1 
ATOM   4618 C CG  . MET C 2 126 ? 26.260  39.578  -39.670 1.00 67.03  ? 421 MET C CG  1 
ATOM   4619 S SD  . MET C 2 126 ? 26.916  41.077  -38.920 1.00 105.73 ? 421 MET C SD  1 
ATOM   4620 C CE  . MET C 2 126 ? 28.671  40.856  -39.178 1.00 94.26  ? 421 MET C CE  1 
ATOM   4621 N N   . VAL C 2 127 ? 22.147  38.642  -41.876 1.00 56.37  ? 422 VAL C N   1 
ATOM   4622 C CA  . VAL C 2 127 ? 20.818  39.053  -42.313 1.00 55.56  ? 422 VAL C CA  1 
ATOM   4623 C C   . VAL C 2 127 ? 19.735  38.523  -41.383 1.00 52.69  ? 422 VAL C C   1 
ATOM   4624 O O   . VAL C 2 127 ? 18.792  39.236  -41.042 1.00 53.95  ? 422 VAL C O   1 
ATOM   4625 C CB  . VAL C 2 127 ? 20.526  38.575  -43.739 1.00 64.53  ? 422 VAL C CB  1 
ATOM   4626 C CG1 . VAL C 2 127 ? 19.568  39.538  -44.430 1.00 62.21  ? 422 VAL C CG1 1 
ATOM   4627 C CG2 . VAL C 2 127 ? 21.820  38.451  -44.518 1.00 68.24  ? 422 VAL C CG2 1 
ATOM   4628 N N   . GLU C 2 128 ? 19.871  37.268  -40.976 1.00 43.70  ? 423 GLU C N   1 
ATOM   4629 C CA  . GLU C 2 128 ? 18.908  36.673  -40.060 1.00 46.69  ? 423 GLU C CA  1 
ATOM   4630 C C   . GLU C 2 128 ? 18.938  37.360  -38.703 1.00 36.88  ? 423 GLU C C   1 
ATOM   4631 O O   . GLU C 2 128 ? 17.895  37.670  -38.136 1.00 40.03  ? 423 GLU C O   1 
ATOM   4632 C CB  . GLU C 2 128 ? 19.152  35.169  -39.908 1.00 57.39  ? 423 GLU C CB  1 
ATOM   4633 C CG  . GLU C 2 128 ? 18.410  34.325  -40.933 1.00 77.72  ? 423 GLU C CG  1 
ATOM   4634 C CD  . GLU C 2 128 ? 18.655  32.837  -40.764 1.00 96.04  ? 423 GLU C CD  1 
ATOM   4635 O OE1 . GLU C 2 128 ? 19.595  32.466  -40.028 1.00 99.56  ? 423 GLU C OE1 1 
ATOM   4636 O OE2 . GLU C 2 128 ? 17.908  32.038  -41.369 1.00 104.02 ? 423 GLU C OE2 1 
ATOM   4637 N N   . ILE C 2 129 ? 20.136  37.606  -38.186 1.00 37.62  ? 424 ILE C N   1 
ATOM   4638 C CA  . ILE C 2 129 ? 20.276  38.299  -36.907 1.00 42.65  ? 424 ILE C CA  1 
ATOM   4639 C C   . ILE C 2 129 ? 19.765  39.738  -37.009 1.00 43.26  ? 424 ILE C C   1 
ATOM   4640 O O   . ILE C 2 129 ? 19.120  40.252  -36.089 1.00 40.77  ? 424 ILE C O   1 
ATOM   4641 C CB  . ILE C 2 129 ? 21.733  38.274  -36.427 1.00 43.56  ? 424 ILE C CB  1 
ATOM   4642 C CG1 . ILE C 2 129 ? 22.154  36.831  -36.133 1.00 47.05  ? 424 ILE C CG1 1 
ATOM   4643 C CG2 . ILE C 2 129 ? 21.909  39.148  -35.201 1.00 39.37  ? 424 ILE C CG2 1 
ATOM   4644 C CD1 . ILE C 2 129 ? 23.647  36.636  -36.002 1.00 49.92  ? 424 ILE C CD1 1 
ATOM   4645 N N   . PHE C 2 130 ? 20.061  40.373  -38.139 1.00 36.64  ? 425 PHE C N   1 
ATOM   4646 C CA  . PHE C 2 130 ? 19.566  41.708  -38.450 1.00 41.07  ? 425 PHE C CA  1 
ATOM   4647 C C   . PHE C 2 130 ? 18.046  41.725  -38.340 1.00 38.58  ? 425 PHE C C   1 
ATOM   4648 O O   . PHE C 2 130 ? 17.471  42.589  -37.678 1.00 35.39  ? 425 PHE C O   1 
ATOM   4649 C CB  . PHE C 2 130 ? 19.982  42.085  -39.872 1.00 52.40  ? 425 PHE C CB  1 
ATOM   4650 C CG  . PHE C 2 130 ? 20.244  43.549  -40.067 1.00 67.87  ? 425 PHE C CG  1 
ATOM   4651 C CD1 . PHE C 2 130 ? 19.208  44.423  -40.341 1.00 76.09  ? 425 PHE C CD1 1 
ATOM   4652 C CD2 . PHE C 2 130 ? 21.535  44.046  -39.998 1.00 75.06  ? 425 PHE C CD2 1 
ATOM   4653 C CE1 . PHE C 2 130 ? 19.452  45.770  -40.526 1.00 78.43  ? 425 PHE C CE1 1 
ATOM   4654 C CE2 . PHE C 2 130 ? 21.787  45.391  -40.185 1.00 78.36  ? 425 PHE C CE2 1 
ATOM   4655 C CZ  . PHE C 2 130 ? 20.743  46.255  -40.448 1.00 78.91  ? 425 PHE C CZ  1 
ATOM   4656 N N   . ASP C 2 131 ? 17.404  40.753  -38.983 1.00 33.30  ? 426 ASP C N   1 
ATOM   4657 C CA  . ASP C 2 131 ? 15.946  40.650  -38.983 1.00 30.74  ? 426 ASP C CA  1 
ATOM   4658 C C   . ASP C 2 131 ? 15.385  40.470  -37.580 1.00 32.85  ? 426 ASP C C   1 
ATOM   4659 O O   . ASP C 2 131 ? 14.398  41.107  -37.212 1.00 37.85  ? 426 ASP C O   1 
ATOM   4660 C CB  . ASP C 2 131 ? 15.492  39.494  -39.879 1.00 37.22  ? 426 ASP C CB  1 
ATOM   4661 C CG  . ASP C 2 131 ? 15.444  39.878  -41.347 1.00 49.27  ? 426 ASP C CG  1 
ATOM   4662 O OD1 . ASP C 2 131 ? 15.493  41.091  -41.647 1.00 49.86  ? 426 ASP C OD1 1 
ATOM   4663 O OD2 . ASP C 2 131 ? 15.353  38.967  -42.194 1.00 51.76  ? 426 ASP C OD2 1 
ATOM   4664 N N   . MET C 2 132 ? 16.018  39.601  -36.799 1.00 28.86  ? 427 MET C N   1 
ATOM   4665 C CA  . MET C 2 132 ? 15.597  39.363  -35.427 1.00 29.46  ? 427 MET C CA  1 
ATOM   4666 C C   . MET C 2 132 ? 15.701  40.644  -34.613 1.00 29.85  ? 427 MET C C   1 
ATOM   4667 O O   . MET C 2 132 ? 14.816  40.957  -33.808 1.00 32.42  ? 427 MET C O   1 
ATOM   4668 C CB  . MET C 2 132 ? 16.450  38.263  -34.786 1.00 25.79  ? 427 MET C CB  1 
ATOM   4669 C CG  . MET C 2 132 ? 16.297  36.903  -35.463 1.00 35.82  ? 427 MET C CG  1 
ATOM   4670 S SD  . MET C 2 132 ? 17.177  35.598  -34.576 1.00 54.00  ? 427 MET C SD  1 
ATOM   4671 C CE  . MET C 2 132 ? 18.877  36.102  -34.793 1.00 58.88  ? 427 MET C CE  1 
ATOM   4672 N N   . LEU C 2 133 ? 16.789  41.382  -34.817 1.00 28.86  ? 428 LEU C N   1 
ATOM   4673 C CA  . LEU C 2 133 ? 16.986  42.653  -34.122 1.00 29.70  ? 428 LEU C CA  1 
ATOM   4674 C C   . LEU C 2 133 ? 15.874  43.635  -34.496 1.00 30.93  ? 428 LEU C C   1 
ATOM   4675 O O   . LEU C 2 133 ? 15.264  44.258  -33.627 1.00 32.71  ? 428 LEU C O   1 
ATOM   4676 C CB  . LEU C 2 133 ? 18.375  43.238  -34.439 1.00 28.26  ? 428 LEU C CB  1 
ATOM   4677 C CG  . LEU C 2 133 ? 19.569  42.494  -33.820 1.00 31.44  ? 428 LEU C CG  1 
ATOM   4678 C CD1 . LEU C 2 133 ? 20.890  42.882  -34.479 1.00 31.38  ? 428 LEU C CD1 1 
ATOM   4679 C CD2 . LEU C 2 133 ? 19.634  42.703  -32.310 1.00 22.80  ? 428 LEU C CD2 1 
ATOM   4680 N N   . LEU C 2 134 ? 15.600  43.757  -35.793 1.00 34.65  ? 429 LEU C N   1 
ATOM   4681 C CA  . LEU C 2 134 ? 14.511  44.602  -36.262 1.00 34.50  ? 429 LEU C CA  1 
ATOM   4682 C C   . LEU C 2 134 ? 13.184  44.201  -35.632 1.00 38.76  ? 429 LEU C C   1 
ATOM   4683 O O   . LEU C 2 134 ? 12.390  45.060  -35.223 1.00 35.95  ? 429 LEU C O   1 
ATOM   4684 C CB  . LEU C 2 134 ? 14.401  44.539  -37.783 1.00 36.85  ? 429 LEU C CB  1 
ATOM   4685 C CG  . LEU C 2 134 ? 15.394  45.413  -38.549 1.00 36.91  ? 429 LEU C CG  1 
ATOM   4686 C CD1 . LEU C 2 134 ? 15.330  45.116  -40.043 1.00 38.19  ? 429 LEU C CD1 1 
ATOM   4687 C CD2 . LEU C 2 134 ? 15.126  46.899  -38.272 1.00 31.72  ? 429 LEU C CD2 1 
ATOM   4688 N N   . ALA C 2 135 ? 12.940  42.896  -35.553 1.00 30.95  ? 430 ALA C N   1 
ATOM   4689 C CA  . ALA C 2 135 ? 11.686  42.406  -34.999 1.00 33.83  ? 430 ALA C CA  1 
ATOM   4690 C C   . ALA C 2 135 ? 11.561  42.774  -33.525 1.00 32.25  ? 430 ALA C C   1 
ATOM   4691 O O   . ALA C 2 135 ? 10.474  43.089  -33.046 1.00 35.20  ? 430 ALA C O   1 
ATOM   4692 C CB  . ALA C 2 135 ? 11.563  40.885  -35.200 1.00 29.76  ? 430 ALA C CB  1 
ATOM   4693 N N   . THR C 2 136 ? 12.679  42.750  -32.807 1.00 22.91  ? 431 THR C N   1 
ATOM   4694 C CA  . THR C 2 136 ? 12.663  43.104  -31.387 1.00 34.71  ? 431 THR C CA  1 
ATOM   4695 C C   . THR C 2 136 ? 12.398  44.598  -31.183 1.00 34.88  ? 431 THR C C   1 
ATOM   4696 O O   . THR C 2 136 ? 11.638  45.000  -30.296 1.00 30.96  ? 431 THR C O   1 
ATOM   4697 C CB  . THR C 2 136 ? 13.983  42.728  -30.708 1.00 32.16  ? 431 THR C CB  1 
ATOM   4698 O OG1 . THR C 2 136 ? 14.295  41.367  -31.011 1.00 35.41  ? 431 THR C OG1 1 
ATOM   4699 C CG2 . THR C 2 136 ? 13.872  42.886  -29.199 1.00 34.41  ? 431 THR C CG2 1 
ATOM   4700 N N   . SER C 2 137 ? 13.024  45.419  -32.014 1.00 33.56  ? 432 SER C N   1 
ATOM   4701 C CA  . SER C 2 137 ? 12.850  46.860  -31.928 1.00 35.63  ? 432 SER C CA  1 
ATOM   4702 C C   . SER C 2 137 ? 11.393  47.219  -32.177 1.00 39.47  ? 432 SER C C   1 
ATOM   4703 O O   . SER C 2 137 ? 10.827  48.100  -31.525 1.00 41.73  ? 432 SER C O   1 
ATOM   4704 C CB  . SER C 2 137 ? 13.746  47.560  -32.946 1.00 30.80  ? 432 SER C CB  1 
ATOM   4705 O OG  . SER C 2 137 ? 13.453  48.942  -32.997 1.00 45.61  ? 432 SER C OG  1 
ATOM   4706 N N   . SER C 2 138 ? 10.788  46.518  -33.128 1.00 41.28  ? 433 SER C N   1 
ATOM   4707 C CA  . SER C 2 138 ? 9.397   46.738  -33.479 1.00 38.96  ? 433 SER C CA  1 
ATOM   4708 C C   . SER C 2 138 ? 8.459   46.295  -32.363 1.00 38.23  ? 433 SER C C   1 
ATOM   4709 O O   . SER C 2 138 ? 7.376   46.858  -32.180 1.00 37.27  ? 433 SER C O   1 
ATOM   4710 C CB  . SER C 2 138 ? 9.065   45.992  -34.766 1.00 41.18  ? 433 SER C CB  1 
ATOM   4711 O OG  . SER C 2 138 ? 7.667   45.915  -34.941 1.00 54.88  ? 433 SER C OG  1 
ATOM   4712 N N   . ARG C 2 139 ? 8.868   45.268  -31.630 1.00 33.66  ? 434 ARG C N   1 
ATOM   4713 C CA  . ARG C 2 139 ? 8.114   44.824  -30.467 1.00 34.42  ? 434 ARG C CA  1 
ATOM   4714 C C   . ARG C 2 139 ? 8.162   45.922  -29.395 1.00 35.26  ? 434 ARG C C   1 
ATOM   4715 O O   . ARG C 2 139 ? 7.143   46.268  -28.791 1.00 40.71  ? 434 ARG C O   1 
ATOM   4716 C CB  . ARG C 2 139 ? 8.704   43.517  -29.940 1.00 36.24  ? 434 ARG C CB  1 
ATOM   4717 C CG  . ARG C 2 139 ? 8.036   42.977  -28.687 1.00 46.84  ? 434 ARG C CG  1 
ATOM   4718 C CD  . ARG C 2 139 ? 6.564   42.671  -28.910 1.00 50.96  ? 434 ARG C CD  1 
ATOM   4719 N NE  . ARG C 2 139 ? 5.946   42.124  -27.705 1.00 54.59  ? 434 ARG C NE  1 
ATOM   4720 C CZ  . ARG C 2 139 ? 4.661   42.263  -27.395 1.00 58.34  ? 434 ARG C CZ  1 
ATOM   4721 N NH1 . ARG C 2 139 ? 3.852   42.940  -28.200 1.00 56.18  ? 434 ARG C NH1 1 
ATOM   4722 N NH2 . ARG C 2 139 ? 4.190   41.731  -26.275 1.00 57.96  ? 434 ARG C NH2 1 
ATOM   4723 N N   . PHE C 2 140 ? 9.351   46.470  -29.166 1.00 30.19  ? 435 PHE C N   1 
ATOM   4724 C CA  . PHE C 2 140 ? 9.521   47.565  -28.215 1.00 36.86  ? 435 PHE C CA  1 
ATOM   4725 C C   . PHE C 2 140 ? 8.605   48.719  -28.580 1.00 32.95  ? 435 PHE C C   1 
ATOM   4726 O O   . PHE C 2 140 ? 7.980   49.328  -27.716 1.00 31.14  ? 435 PHE C O   1 
ATOM   4727 C CB  . PHE C 2 140 ? 10.966  48.060  -28.222 1.00 41.81  ? 435 PHE C CB  1 
ATOM   4728 C CG  . PHE C 2 140 ? 11.891  47.242  -27.375 1.00 50.65  ? 435 PHE C CG  1 
ATOM   4729 C CD1 . PHE C 2 140 ? 11.534  45.969  -26.962 1.00 46.29  ? 435 PHE C CD1 1 
ATOM   4730 C CD2 . PHE C 2 140 ? 13.120  47.753  -26.985 1.00 49.21  ? 435 PHE C CD2 1 
ATOM   4731 C CE1 . PHE C 2 140 ? 12.392  45.215  -26.176 1.00 43.20  ? 435 PHE C CE1 1 
ATOM   4732 C CE2 . PHE C 2 140 ? 13.980  47.006  -26.201 1.00 49.76  ? 435 PHE C CE2 1 
ATOM   4733 C CZ  . PHE C 2 140 ? 13.619  45.732  -25.799 1.00 39.68  ? 435 PHE C CZ  1 
ATOM   4734 N N   . ARG C 2 141 ? 8.542   49.008  -29.876 1.00 34.54  ? 436 ARG C N   1 
ATOM   4735 C CA  . ARG C 2 141 ? 7.736   50.103  -30.404 1.00 42.82  ? 436 ARG C CA  1 
ATOM   4736 C C   . ARG C 2 141 ? 6.249   49.885  -30.130 1.00 39.63  ? 436 ARG C C   1 
ATOM   4737 O O   . ARG C 2 141 ? 5.560   50.787  -29.655 1.00 38.57  ? 436 ARG C O   1 
ATOM   4738 C CB  . ARG C 2 141 ? 7.982   50.241  -31.908 1.00 44.83  ? 436 ARG C CB  1 
ATOM   4739 C CG  . ARG C 2 141 ? 7.569   51.571  -32.504 1.00 53.05  ? 436 ARG C CG  1 
ATOM   4740 C CD  . ARG C 2 141 ? 7.961   51.644  -33.973 1.00 55.99  ? 436 ARG C CD  1 
ATOM   4741 N NE  . ARG C 2 141 ? 9.347   51.232  -34.172 1.00 64.32  ? 436 ARG C NE  1 
ATOM   4742 C CZ  . ARG C 2 141 ? 9.732   50.231  -34.958 1.00 67.60  ? 436 ARG C CZ  1 
ATOM   4743 N NH1 . ARG C 2 141 ? 8.832   49.535  -35.640 1.00 65.38  ? 436 ARG C NH1 1 
ATOM   4744 N NH2 . ARG C 2 141 ? 11.019  49.929  -35.068 1.00 68.44  ? 436 ARG C NH2 1 
ATOM   4745 N N   . MET C 2 142 ? 5.758   48.685  -30.420 1.00 35.86  ? 437 MET C N   1 
ATOM   4746 C CA  . MET C 2 142 ? 4.337   48.400  -30.248 1.00 41.66  ? 437 MET C CA  1 
ATOM   4747 C C   . MET C 2 142 ? 3.955   48.345  -28.772 1.00 41.45  ? 437 MET C C   1 
ATOM   4748 O O   . MET C 2 142 ? 2.791   48.521  -28.420 1.00 43.58  ? 437 MET C O   1 
ATOM   4749 C CB  . MET C 2 142 ? 3.938   47.107  -30.972 1.00 44.18  ? 437 MET C CB  1 
ATOM   4750 C CG  . MET C 2 142 ? 4.630   45.853  -30.461 1.00 53.85  ? 437 MET C CG  1 
ATOM   4751 S SD  . MET C 2 142 ? 4.112   44.339  -31.302 1.00 136.88 ? 437 MET C SD  1 
ATOM   4752 C CE  . MET C 2 142 ? 5.044   44.416  -32.832 1.00 65.61  ? 437 MET C CE  1 
ATOM   4753 N N   . MET C 2 143 ? 4.940   48.114  -27.909 1.00 33.08  ? 438 MET C N   1 
ATOM   4754 C CA  . MET C 2 143 ? 4.688   48.056  -26.473 1.00 31.78  ? 438 MET C CA  1 
ATOM   4755 C C   . MET C 2 143 ? 4.836   49.422  -25.812 1.00 38.23  ? 438 MET C C   1 
ATOM   4756 O O   . MET C 2 143 ? 4.557   49.573  -24.620 1.00 39.04  ? 438 MET C O   1 
ATOM   4757 C CB  . MET C 2 143 ? 5.644   47.077  -25.793 1.00 33.52  ? 438 MET C CB  1 
ATOM   4758 C CG  . MET C 2 143 ? 5.428   45.625  -26.169 1.00 39.54  ? 438 MET C CG  1 
ATOM   4759 S SD  . MET C 2 143 ? 6.473   44.556  -25.164 1.00 43.48  ? 438 MET C SD  1 
ATOM   4760 C CE  . MET C 2 143 ? 5.810   44.886  -23.530 1.00 30.87  ? 438 MET C CE  1 
ATOM   4761 N N   . ASN C 2 144 ? 5.292   50.410  -26.579 1.00 37.77  ? 439 ASN C N   1 
ATOM   4762 C CA  . ASN C 2 144 ? 5.637   51.700  -26.008 1.00 32.00  ? 439 ASN C CA  1 
ATOM   4763 C C   . ASN C 2 144 ? 6.594   51.506  -24.832 1.00 34.50  ? 439 ASN C C   1 
ATOM   4764 O O   . ASN C 2 144 ? 6.371   52.040  -23.743 1.00 31.02  ? 439 ASN C O   1 
ATOM   4765 C CB  . ASN C 2 144 ? 4.376   52.431  -25.531 1.00 43.91  ? 439 ASN C CB  1 
ATOM   4766 C CG  . ASN C 2 144 ? 3.391   52.720  -26.662 1.00 53.84  ? 439 ASN C CG  1 
ATOM   4767 O OD1 . ASN C 2 144 ? 3.779   52.903  -27.818 1.00 57.67  ? 439 ASN C OD1 1 
ATOM   4768 N ND2 . ASN C 2 144 ? 2.108   52.770  -26.323 1.00 56.71  ? 439 ASN C ND2 1 
ATOM   4769 N N   . LEU C 2 145 ? 7.647   50.720  -25.037 1.00 35.16  ? 440 LEU C N   1 
ATOM   4770 C CA  . LEU C 2 145 ? 8.644   50.510  -23.989 1.00 32.26  ? 440 LEU C CA  1 
ATOM   4771 C C   . LEU C 2 145 ? 9.224   51.839  -23.517 1.00 34.69  ? 440 LEU C C   1 
ATOM   4772 O O   . LEU C 2 145 ? 9.581   52.695  -24.330 1.00 35.67  ? 440 LEU C O   1 
ATOM   4773 C CB  . LEU C 2 145 ? 9.771   49.600  -24.474 1.00 32.54  ? 440 LEU C CB  1 
ATOM   4774 C CG  . LEU C 2 145 ? 10.882  49.431  -23.431 1.00 32.64  ? 440 LEU C CG  1 
ATOM   4775 C CD1 . LEU C 2 145 ? 10.363  48.624  -22.259 1.00 36.20  ? 440 LEU C CD1 1 
ATOM   4776 C CD2 . LEU C 2 145 ? 12.117  48.779  -24.024 1.00 31.84  ? 440 LEU C CD2 1 
ATOM   4777 N N   . GLN C 2 146 ? 9.320   52.002  -22.202 1.00 37.45  ? 441 GLN C N   1 
ATOM   4778 C CA  . GLN C 2 146 ? 9.806   53.244  -21.601 1.00 33.76  ? 441 GLN C CA  1 
ATOM   4779 C C   . GLN C 2 146 ? 11.281  53.161  -21.197 1.00 31.53  ? 441 GLN C C   1 
ATOM   4780 O O   . GLN C 2 146 ? 11.793  52.084  -20.886 1.00 28.27  ? 441 GLN C O   1 
ATOM   4781 C CB  . GLN C 2 146 ? 8.950   53.602  -20.382 1.00 30.54  ? 441 GLN C CB  1 
ATOM   4782 C CG  . GLN C 2 146 ? 7.460   53.702  -20.692 1.00 36.59  ? 441 GLN C CG  1 
ATOM   4783 C CD  . GLN C 2 146 ? 7.139   54.854  -21.628 1.00 43.26  ? 441 GLN C CD  1 
ATOM   4784 O OE1 . GLN C 2 146 ? 7.266   56.021  -21.258 1.00 47.30  ? 441 GLN C OE1 1 
ATOM   4785 N NE2 . GLN C 2 146 ? 6.722   54.533  -22.846 1.00 39.75  ? 441 GLN C NE2 1 
ATOM   4786 N N   . GLY C 2 147 ? 11.960  54.306  -21.201 1.00 32.40  ? 442 GLY C N   1 
ATOM   4787 C CA  . GLY C 2 147 ? 13.354  54.361  -20.799 1.00 28.41  ? 442 GLY C CA  1 
ATOM   4788 C C   . GLY C 2 147 ? 13.581  53.732  -19.433 1.00 33.08  ? 442 GLY C C   1 
ATOM   4789 O O   . GLY C 2 147 ? 14.541  52.988  -19.230 1.00 36.61  ? 442 GLY C O   1 
ATOM   4790 N N   . GLU C 2 148 ? 12.687  54.025  -18.492 1.00 37.04  ? 443 GLU C N   1 
ATOM   4791 C CA  . GLU C 2 148 ? 12.784  53.479  -17.139 1.00 31.60  ? 443 GLU C CA  1 
ATOM   4792 C C   . GLU C 2 148 ? 12.671  51.957  -17.132 1.00 31.88  ? 443 GLU C C   1 
ATOM   4793 O O   . GLU C 2 148 ? 13.367  51.281  -16.382 1.00 36.91  ? 443 GLU C O   1 
ATOM   4794 C CB  . GLU C 2 148 ? 11.709  54.083  -16.232 1.00 35.05  ? 443 GLU C CB  1 
ATOM   4795 C CG  . GLU C 2 148 ? 11.918  55.552  -15.888 1.00 41.89  ? 443 GLU C CG  1 
ATOM   4796 C CD  . GLU C 2 148 ? 11.280  56.496  -16.890 1.00 54.05  ? 443 GLU C CD  1 
ATOM   4797 O OE1 . GLU C 2 148 ? 10.674  56.020  -17.875 1.00 49.13  ? 443 GLU C OE1 1 
ATOM   4798 O OE2 . GLU C 2 148 ? 11.385  57.726  -16.690 1.00 68.08  ? 443 GLU C OE2 1 
ATOM   4799 N N   . GLU C 2 149 ? 11.787  51.426  -17.969 1.00 28.05  ? 444 GLU C N   1 
ATOM   4800 C CA  . GLU C 2 149 ? 11.611  49.982  -18.068 1.00 29.44  ? 444 GLU C CA  1 
ATOM   4801 C C   . GLU C 2 149 ? 12.831  49.384  -18.746 1.00 32.65  ? 444 GLU C C   1 
ATOM   4802 O O   . GLU C 2 149 ? 13.335  48.336  -18.335 1.00 35.02  ? 444 GLU C O   1 
ATOM   4803 C CB  . GLU C 2 149 ? 10.345  49.647  -18.860 1.00 27.43  ? 444 GLU C CB  1 
ATOM   4804 C CG  . GLU C 2 149 ? 9.052   50.118  -18.204 1.00 31.39  ? 444 GLU C CG  1 
ATOM   4805 C CD  . GLU C 2 149 ? 7.837   49.940  -19.108 1.00 33.48  ? 444 GLU C CD  1 
ATOM   4806 O OE1 . GLU C 2 149 ? 7.960   50.163  -20.334 1.00 33.47  ? 444 GLU C OE1 1 
ATOM   4807 O OE2 . GLU C 2 149 ? 6.759   49.578  -18.593 1.00 30.16  ? 444 GLU C OE2 1 
ATOM   4808 N N   . PHE C 2 150 ? 13.323  50.073  -19.771 1.00 30.94  ? 445 PHE C N   1 
ATOM   4809 C CA  . PHE C 2 150 ? 14.502  49.622  -20.494 1.00 31.29  ? 445 PHE C CA  1 
ATOM   4810 C C   . PHE C 2 150 ? 15.725  49.407  -19.601 1.00 29.29  ? 445 PHE C C   1 
ATOM   4811 O O   . PHE C 2 150 ? 16.410  48.388  -19.717 1.00 23.85  ? 445 PHE C O   1 
ATOM   4812 C CB  . PHE C 2 150 ? 14.860  50.600  -21.612 1.00 26.72  ? 445 PHE C CB  1 
ATOM   4813 C CG  . PHE C 2 150 ? 16.230  50.387  -22.176 1.00 29.76  ? 445 PHE C CG  1 
ATOM   4814 C CD1 . PHE C 2 150 ? 16.511  49.268  -22.939 1.00 36.09  ? 445 PHE C CD1 1 
ATOM   4815 C CD2 . PHE C 2 150 ? 17.246  51.295  -21.932 1.00 31.59  ? 445 PHE C CD2 1 
ATOM   4816 C CE1 . PHE C 2 150 ? 17.775  49.059  -23.452 1.00 40.74  ? 445 PHE C CE1 1 
ATOM   4817 C CE2 . PHE C 2 150 ? 18.511  51.095  -22.451 1.00 32.79  ? 445 PHE C CE2 1 
ATOM   4818 C CZ  . PHE C 2 150 ? 18.777  49.976  -23.210 1.00 36.92  ? 445 PHE C CZ  1 
ATOM   4819 N N   . VAL C 2 151 ? 16.017  50.361  -18.727 1.00 29.26  ? 446 VAL C N   1 
ATOM   4820 C CA  . VAL C 2 151 ? 17.209  50.239  -17.897 1.00 22.84  ? 446 VAL C CA  1 
ATOM   4821 C C   . VAL C 2 151 ? 17.058  49.068  -16.932 1.00 27.87  ? 446 VAL C C   1 
ATOM   4822 O O   . VAL C 2 151 ? 18.039  48.404  -16.587 1.00 29.56  ? 446 VAL C O   1 
ATOM   4823 C CB  . VAL C 2 151 ? 17.533  51.543  -17.135 1.00 21.56  ? 446 VAL C CB  1 
ATOM   4824 C CG1 . VAL C 2 151 ? 17.894  52.651  -18.118 1.00 25.33  ? 446 VAL C CG1 1 
ATOM   4825 C CG2 . VAL C 2 151 ? 16.369  51.961  -16.256 1.00 27.11  ? 446 VAL C CG2 1 
ATOM   4826 N N   . CYS C 2 152 ? 15.828  48.812  -16.507 1.00 23.77  ? 447 CYS C N   1 
ATOM   4827 C CA  . CYS C 2 152 ? 15.544  47.668  -15.647 1.00 29.15  ? 447 CYS C CA  1 
ATOM   4828 C C   . CYS C 2 152 ? 15.819  46.363  -16.382 1.00 29.48  ? 447 CYS C C   1 
ATOM   4829 O O   . CYS C 2 152 ? 16.399  45.435  -15.819 1.00 29.03  ? 447 CYS C O   1 
ATOM   4830 C CB  . CYS C 2 152 ? 14.093  47.695  -15.168 1.00 35.81  ? 447 CYS C CB  1 
ATOM   4831 S SG  . CYS C 2 152 ? 13.720  48.960  -13.941 1.00 36.52  ? 447 CYS C SG  1 
ATOM   4832 N N   . LEU C 2 153 ? 15.401  46.295  -17.642 1.00 26.34  ? 448 LEU C N   1 
ATOM   4833 C CA  . LEU C 2 153 ? 15.586  45.081  -18.433 1.00 28.00  ? 448 LEU C CA  1 
ATOM   4834 C C   . LEU C 2 153 ? 17.068  44.790  -18.607 1.00 28.93  ? 448 LEU C C   1 
ATOM   4835 O O   . LEU C 2 153 ? 17.516  43.669  -18.413 1.00 33.87  ? 448 LEU C O   1 
ATOM   4836 C CB  . LEU C 2 153 ? 14.913  45.221  -19.799 1.00 31.46  ? 448 LEU C CB  1 
ATOM   4837 C CG  . LEU C 2 153 ? 13.388  45.085  -19.808 1.00 36.84  ? 448 LEU C CG  1 
ATOM   4838 C CD1 . LEU C 2 153 ? 12.870  45.208  -21.226 1.00 39.78  ? 448 LEU C CD1 1 
ATOM   4839 C CD2 . LEU C 2 153 ? 12.973  43.754  -19.203 1.00 30.06  ? 448 LEU C CD2 1 
ATOM   4840 N N   . LYS C 2 154 ? 17.827  45.817  -18.963 1.00 26.66  ? 449 LYS C N   1 
ATOM   4841 C CA  . LYS C 2 154 ? 19.257  45.677  -19.149 1.00 31.86  ? 449 LYS C CA  1 
ATOM   4842 C C   . LYS C 2 154 ? 19.930  45.158  -17.884 1.00 31.86  ? 449 LYS C C   1 
ATOM   4843 O O   . LYS C 2 154 ? 20.785  44.272  -17.945 1.00 33.47  ? 449 LYS C O   1 
ATOM   4844 C CB  . LYS C 2 154 ? 19.854  47.022  -19.558 1.00 41.15  ? 449 LYS C CB  1 
ATOM   4845 C CG  . LYS C 2 154 ? 21.065  46.904  -20.451 1.00 44.07  ? 449 LYS C CG  1 
ATOM   4846 C CD  . LYS C 2 154 ? 21.347  48.217  -21.152 1.00 35.81  ? 449 LYS C CD  1 
ATOM   4847 C CE  . LYS C 2 154 ? 21.502  49.354  -20.165 1.00 29.82  ? 449 LYS C CE  1 
ATOM   4848 N NZ  . LYS C 2 154 ? 22.196  50.506  -20.822 1.00 29.66  ? 449 LYS C NZ  1 
ATOM   4849 N N   . SER C 2 155 ? 19.539  45.705  -16.737 1.00 26.37  ? 450 SER C N   1 
ATOM   4850 C CA  . SER C 2 155 ? 20.065  45.248  -15.450 1.00 30.33  ? 450 SER C CA  1 
ATOM   4851 C C   . SER C 2 155 ? 19.708  43.794  -15.179 1.00 27.75  ? 450 SER C C   1 
ATOM   4852 O O   . SER C 2 155 ? 20.502  43.040  -14.619 1.00 30.93  ? 450 SER C O   1 
ATOM   4853 C CB  . SER C 2 155 ? 19.520  46.113  -14.314 1.00 37.30  ? 450 SER C CB  1 
ATOM   4854 O OG  . SER C 2 155 ? 19.927  47.464  -14.470 1.00 51.33  ? 450 SER C OG  1 
ATOM   4855 N N   . ILE C 2 156 ? 18.491  43.409  -15.548 1.00 26.51  ? 451 ILE C N   1 
ATOM   4856 C CA  . ILE C 2 156 ? 18.050  42.035  -15.368 1.00 25.25  ? 451 ILE C CA  1 
ATOM   4857 C C   . ILE C 2 156 ? 18.929  41.087  -16.173 1.00 26.56  ? 451 ILE C C   1 
ATOM   4858 O O   . ILE C 2 156 ? 19.320  40.026  -15.680 1.00 29.89  ? 451 ILE C O   1 
ATOM   4859 C CB  . ILE C 2 156 ? 16.559  41.871  -15.753 1.00 24.90  ? 451 ILE C CB  1 
ATOM   4860 C CG1 . ILE C 2 156 ? 15.671  42.521  -14.694 1.00 22.25  ? 451 ILE C CG1 1 
ATOM   4861 C CG2 . ILE C 2 156 ? 16.201  40.398  -15.922 1.00 24.12  ? 451 ILE C CG2 1 
ATOM   4862 C CD1 . ILE C 2 156 ? 14.188  42.560  -15.067 1.00 24.68  ? 451 ILE C CD1 1 
ATOM   4863 N N   . ILE C 2 157 ? 19.251  41.480  -17.403 1.00 22.32  ? 452 ILE C N   1 
ATOM   4864 C CA  . ILE C 2 157 ? 20.101  40.681  -18.278 1.00 27.01  ? 452 ILE C CA  1 
ATOM   4865 C C   . ILE C 2 157 ? 21.467  40.468  -17.638 1.00 30.92  ? 452 ILE C C   1 
ATOM   4866 O O   . ILE C 2 157 ? 22.023  39.372  -17.676 1.00 32.63  ? 452 ILE C O   1 
ATOM   4867 C CB  . ILE C 2 157 ? 20.302  41.377  -19.650 1.00 30.46  ? 452 ILE C CB  1 
ATOM   4868 C CG1 . ILE C 2 157 ? 19.003  41.370  -20.458 1.00 27.43  ? 452 ILE C CG1 1 
ATOM   4869 C CG2 . ILE C 2 157 ? 21.426  40.697  -20.444 1.00 19.35  ? 452 ILE C CG2 1 
ATOM   4870 C CD1 . ILE C 2 157 ? 19.135  42.039  -21.806 1.00 30.11  ? 452 ILE C CD1 1 
ATOM   4871 N N   . LEU C 2 158 ? 22.002  41.529  -17.044 1.00 27.25  ? 453 LEU C N   1 
ATOM   4872 C CA  . LEU C 2 158 ? 23.303  41.466  -16.399 1.00 25.19  ? 453 LEU C CA  1 
ATOM   4873 C C   . LEU C 2 158 ? 23.314  40.440  -15.275 1.00 31.21  ? 453 LEU C C   1 
ATOM   4874 O O   . LEU C 2 158 ? 24.198  39.582  -15.209 1.00 36.56  ? 453 LEU C O   1 
ATOM   4875 C CB  . LEU C 2 158 ? 23.685  42.852  -15.851 1.00 26.44  ? 453 LEU C CB  1 
ATOM   4876 C CG  . LEU C 2 158 ? 25.010  42.955  -15.100 1.00 24.13  ? 453 LEU C CG  1 
ATOM   4877 C CD1 . LEU C 2 158 ? 26.164  42.501  -15.999 1.00 25.04  ? 453 LEU C CD1 1 
ATOM   4878 C CD2 . LEU C 2 158 ? 25.240  44.372  -14.585 1.00 27.47  ? 453 LEU C CD2 1 
ATOM   4879 N N   . LEU C 2 159 ? 22.320  40.529  -14.393 1.00 28.34  ? 454 LEU C N   1 
ATOM   4880 C CA  . LEU C 2 159 ? 22.272  39.675  -13.206 1.00 28.02  ? 454 LEU C CA  1 
ATOM   4881 C C   . LEU C 2 159 ? 21.756  38.265  -13.477 1.00 31.68  ? 454 LEU C C   1 
ATOM   4882 O O   . LEU C 2 159 ? 22.028  37.349  -12.704 1.00 36.52  ? 454 LEU C O   1 
ATOM   4883 C CB  . LEU C 2 159 ? 21.405  40.319  -12.123 1.00 28.10  ? 454 LEU C CB  1 
ATOM   4884 C CG  . LEU C 2 159 ? 21.857  41.687  -11.570 1.00 35.63  ? 454 LEU C CG  1 
ATOM   4885 C CD1 . LEU C 2 159 ? 20.755  42.291  -10.706 1.00 41.35  ? 454 LEU C CD1 1 
ATOM   4886 C CD2 . LEU C 2 159 ? 23.144  41.550  -10.788 1.00 34.05  ? 454 LEU C CD2 1 
ATOM   4887 N N   . ASN C 2 160 ? 21.013  38.088  -14.566 1.00 31.81  ? 455 ASN C N   1 
ATOM   4888 C CA  . ASN C 2 160 ? 20.363  36.802  -14.833 1.00 33.74  ? 455 ASN C CA  1 
ATOM   4889 C C   . ASN C 2 160 ? 21.099  35.854  -15.782 1.00 37.83  ? 455 ASN C C   1 
ATOM   4890 O O   . ASN C 2 160 ? 21.022  34.641  -15.625 1.00 41.52  ? 455 ASN C O   1 
ATOM   4891 C CB  . ASN C 2 160 ? 18.932  37.004  -15.346 1.00 30.41  ? 455 ASN C CB  1 
ATOM   4892 C CG  . ASN C 2 160 ? 18.197  35.679  -15.571 1.00 31.37  ? 455 ASN C CG  1 
ATOM   4893 O OD1 . ASN C 2 160 ? 17.745  35.380  -16.681 1.00 34.87  ? 455 ASN C OD1 1 
ATOM   4894 N ND2 . ASN C 2 160 ? 18.086  34.881  -14.516 1.00 32.11  ? 455 ASN C ND2 1 
ATOM   4895 N N   . SER C 2 161 ? 21.789  36.394  -16.777 1.00 31.67  ? 456 SER C N   1 
ATOM   4896 C CA  . SER C 2 161 ? 22.308  35.544  -17.846 1.00 41.78  ? 456 SER C CA  1 
ATOM   4897 C C   . SER C 2 161 ? 23.356  34.536  -17.377 1.00 41.62  ? 456 SER C C   1 
ATOM   4898 O O   . SER C 2 161 ? 23.409  33.414  -17.878 1.00 43.31  ? 456 SER C O   1 
ATOM   4899 C CB  . SER C 2 161 ? 22.835  36.388  -19.008 1.00 39.14  ? 456 SER C CB  1 
ATOM   4900 O OG  . SER C 2 161 ? 21.762  37.077  -19.635 1.00 45.95  ? 456 SER C OG  1 
ATOM   4901 N N   . GLY C 2 162 ? 24.169  34.919  -16.401 1.00 32.54  ? 457 GLY C N   1 
ATOM   4902 C CA  . GLY C 2 162 ? 25.240  34.048  -15.953 1.00 44.87  ? 457 GLY C CA  1 
ATOM   4903 C C   . GLY C 2 162 ? 25.068  33.412  -14.586 1.00 45.64  ? 457 GLY C C   1 
ATOM   4904 O O   . GLY C 2 162 ? 25.954  32.699  -14.133 1.00 53.79  ? 457 GLY C O   1 
ATOM   4905 N N   . VAL C 2 163 ? 23.937  33.653  -13.930 1.00 43.91  ? 458 VAL C N   1 
ATOM   4906 C CA  . VAL C 2 163 ? 23.760  33.206  -12.545 1.00 48.41  ? 458 VAL C CA  1 
ATOM   4907 C C   . VAL C 2 163 ? 23.592  31.689  -12.390 1.00 62.53  ? 458 VAL C C   1 
ATOM   4908 O O   . VAL C 2 163 ? 23.913  31.132  -11.340 1.00 63.93  ? 458 VAL C O   1 
ATOM   4909 C CB  . VAL C 2 163 ? 22.592  33.940  -11.846 1.00 48.55  ? 458 VAL C CB  1 
ATOM   4910 C CG1 . VAL C 2 163 ? 21.291  33.716  -12.594 1.00 50.62  ? 458 VAL C CG1 1 
ATOM   4911 C CG2 . VAL C 2 163 ? 22.460  33.498  -10.392 1.00 50.35  ? 458 VAL C CG2 1 
ATOM   4912 N N   . TYR C 2 164 ? 23.099  31.023  -13.430 1.00 90.95  ? 459 TYR C N   1 
ATOM   4913 C CA  . TYR C 2 164 ? 22.840  29.586  -13.350 1.00 96.49  ? 459 TYR C CA  1 
ATOM   4914 C C   . TYR C 2 164 ? 24.081  28.740  -13.621 1.00 95.34  ? 459 TYR C C   1 
ATOM   4915 O O   . TYR C 2 164 ? 24.050  27.520  -13.475 1.00 96.34  ? 459 TYR C O   1 
ATOM   4916 C CB  . TYR C 2 164 ? 21.687  29.186  -14.277 1.00 102.22 ? 459 TYR C CB  1 
ATOM   4917 C CG  . TYR C 2 164 ? 20.342  29.684  -13.796 1.00 111.26 ? 459 TYR C CG  1 
ATOM   4918 C CD1 . TYR C 2 164 ? 20.110  31.039  -13.625 1.00 116.90 ? 459 TYR C CD1 1 
ATOM   4919 C CD2 . TYR C 2 164 ? 19.309  28.802  -13.503 1.00 114.37 ? 459 TYR C CD2 1 
ATOM   4920 C CE1 . TYR C 2 164 ? 18.890  31.509  -13.180 1.00 119.30 ? 459 TYR C CE1 1 
ATOM   4921 C CE2 . TYR C 2 164 ? 18.080  29.263  -13.059 1.00 117.50 ? 459 TYR C CE2 1 
ATOM   4922 C CZ  . TYR C 2 164 ? 17.880  30.621  -12.901 1.00 120.00 ? 459 TYR C CZ  1 
ATOM   4923 O OH  . TYR C 2 164 ? 16.668  31.099  -12.462 1.00 121.97 ? 459 TYR C OH  1 
ATOM   4924 N N   . THR C 2 165 ? 25.172  29.391  -14.009 1.00 95.64  ? 460 THR C N   1 
ATOM   4925 C CA  . THR C 2 165 ? 26.431  28.693  -14.239 1.00 93.34  ? 460 THR C CA  1 
ATOM   4926 C C   . THR C 2 165 ? 27.533  29.254  -13.351 1.00 92.80  ? 460 THR C C   1 
ATOM   4927 O O   . THR C 2 165 ? 28.641  29.515  -13.814 1.00 95.51  ? 460 THR C O   1 
ATOM   4928 C CB  . THR C 2 165 ? 26.867  28.768  -15.716 1.00 89.04  ? 460 THR C CB  1 
ATOM   4929 O OG1 . THR C 2 165 ? 26.910  30.137  -16.135 1.00 89.58  ? 460 THR C OG1 1 
ATOM   4930 C CG2 . THR C 2 165 ? 25.893  28.007  -16.603 1.00 92.62  ? 460 THR C CG2 1 
ATOM   4931 N N   . PHE C 2 166 ? 27.222  29.437  -12.072 1.00 91.57  ? 461 PHE C N   1 
ATOM   4932 C CA  . PHE C 2 166 ? 28.195  29.961  -11.118 1.00 93.12  ? 461 PHE C CA  1 
ATOM   4933 C C   . PHE C 2 166 ? 29.125  28.872  -10.597 1.00 92.72  ? 461 PHE C C   1 
ATOM   4934 O O   . PHE C 2 166 ? 30.328  29.096  -10.468 1.00 100.27 ? 461 PHE C O   1 
ATOM   4935 C CB  . PHE C 2 166 ? 27.492  30.659  -9.954  1.00 94.08  ? 461 PHE C CB  1 
ATOM   4936 C CG  . PHE C 2 166 ? 27.449  32.155  -10.081 1.00 91.81  ? 461 PHE C CG  1 
ATOM   4937 C CD1 . PHE C 2 166 ? 27.077  32.943  -9.008  1.00 91.29  ? 461 PHE C CD1 1 
ATOM   4938 C CD2 . PHE C 2 166 ? 27.790  32.773  -11.271 1.00 89.70  ? 461 PHE C CD2 1 
ATOM   4939 C CE1 . PHE C 2 166 ? 27.038  34.317  -9.122  1.00 90.57  ? 461 PHE C CE1 1 
ATOM   4940 C CE2 . PHE C 2 166 ? 27.754  34.146  -11.389 1.00 85.73  ? 461 PHE C CE2 1 
ATOM   4941 C CZ  . PHE C 2 166 ? 27.378  34.918  -10.314 1.00 86.79  ? 461 PHE C CZ  1 
ATOM   4942 N N   . LEU C 2 167 ? 28.544  27.711  -10.292 1.00 108.32 ? 462 LEU C N   1 
ATOM   4943 C CA  . LEU C 2 167 ? 29.264  26.509  -9.851  1.00 103.02 ? 462 LEU C CA  1 
ATOM   4944 C C   . LEU C 2 167 ? 28.877  26.086  -8.431  1.00 104.99 ? 462 LEU C C   1 
ATOM   4945 O O   . LEU C 2 167 ? 29.406  25.105  -7.904  1.00 110.79 ? 462 LEU C O   1 
ATOM   4946 C CB  . LEU C 2 167 ? 30.775  26.740  -9.929  1.00 20.00  ? 462 LEU C CB  1 
ATOM   4947 N N   . SER C 2 168 ? 27.947  26.820  -7.826  1.00 98.96  ? 463 SER C N   1 
ATOM   4948 C CA  . SER C 2 168 ? 27.496  26.531  -6.465  1.00 94.87  ? 463 SER C CA  1 
ATOM   4949 C C   . SER C 2 168 ? 28.663  26.133  -5.560  1.00 98.71  ? 463 SER C C   1 
ATOM   4950 O O   . SER C 2 168 ? 29.613  26.896  -5.394  1.00 104.63 ? 463 SER C O   1 
ATOM   4951 C CB  . SER C 2 168 ? 26.425  25.436  -6.472  1.00 89.43  ? 463 SER C CB  1 
ATOM   4952 O OG  . SER C 2 168 ? 26.025  25.102  -5.152  1.00 84.46  ? 463 SER C OG  1 
ATOM   4953 N N   . SER C 2 169 ? 28.582  24.935  -4.988  1.00 92.65  ? 464 SER C N   1 
ATOM   4954 C CA  . SER C 2 169 ? 29.622  24.401  -4.109  1.00 89.31  ? 464 SER C CA  1 
ATOM   4955 C C   . SER C 2 169 ? 29.853  25.242  -2.851  1.00 86.72  ? 464 SER C C   1 
ATOM   4956 O O   . SER C 2 169 ? 29.106  25.126  -1.880  1.00 90.35  ? 464 SER C O   1 
ATOM   4957 C CB  . SER C 2 169 ? 30.937  24.175  -4.867  1.00 85.17  ? 464 SER C CB  1 
ATOM   4958 O OG  . SER C 2 169 ? 31.527  25.395  -5.277  1.00 79.53  ? 464 SER C OG  1 
ATOM   4959 N N   . THR C 2 170 ? 30.885  26.083  -2.870  1.00 75.59  ? 465 THR C N   1 
ATOM   4960 C CA  . THR C 2 170 ? 31.265  26.861  -1.692  1.00 61.57  ? 465 THR C CA  1 
ATOM   4961 C C   . THR C 2 170 ? 30.085  27.632  -1.121  1.00 50.56  ? 465 THR C C   1 
ATOM   4962 O O   . THR C 2 170 ? 29.133  27.946  -1.837  1.00 42.68  ? 465 THR C O   1 
ATOM   4963 C CB  . THR C 2 170 ? 32.405  27.853  -2.001  1.00 58.03  ? 465 THR C CB  1 
ATOM   4964 O OG1 . THR C 2 170 ? 31.960  28.816  -2.963  1.00 49.29  ? 465 THR C OG1 1 
ATOM   4965 C CG2 . THR C 2 170 ? 33.621  27.118  -2.548  1.00 60.62  ? 465 THR C CG2 1 
ATOM   4966 N N   . LEU C 2 171 ? 30.146  27.937  0.171   1.00 53.00  ? 466 LEU C N   1 
ATOM   4967 C CA  . LEU C 2 171 ? 29.098  28.731  0.797   1.00 53.35  ? 466 LEU C CA  1 
ATOM   4968 C C   . LEU C 2 171 ? 28.974  30.093  0.119   1.00 56.04  ? 466 LEU C C   1 
ATOM   4969 O O   . LEU C 2 171 ? 27.868  30.607  -0.064  1.00 41.55  ? 466 LEU C O   1 
ATOM   4970 C CB  . LEU C 2 171 ? 29.369  28.920  2.291   1.00 51.86  ? 466 LEU C CB  1 
ATOM   4971 C CG  . LEU C 2 171 ? 28.378  29.845  3.007   1.00 48.65  ? 466 LEU C CG  1 
ATOM   4972 C CD1 . LEU C 2 171 ? 26.976  29.229  3.010   1.00 38.62  ? 466 LEU C CD1 1 
ATOM   4973 C CD2 . LEU C 2 171 ? 28.834  30.137  4.423   1.00 51.94  ? 466 LEU C CD2 1 
ATOM   4974 N N   . LYS C 2 172 ? 30.112  30.671  -0.255  1.00 77.45  ? 467 LYS C N   1 
ATOM   4975 C CA  . LYS C 2 172 ? 30.129  32.006  -0.841  1.00 74.12  ? 467 LYS C CA  1 
ATOM   4976 C C   . LYS C 2 172 ? 29.337  32.062  -2.139  1.00 74.73  ? 467 LYS C C   1 
ATOM   4977 O O   . LYS C 2 172 ? 28.523  32.955  -2.328  1.00 66.32  ? 467 LYS C O   1 
ATOM   4978 C CB  . LYS C 2 172 ? 31.561  32.487  -1.078  1.00 78.36  ? 467 LYS C CB  1 
ATOM   4979 C CG  . LYS C 2 172 ? 31.663  33.960  -1.458  1.00 71.75  ? 467 LYS C CG  1 
ATOM   4980 C CD  . LYS C 2 172 ? 30.911  34.839  -0.469  1.00 73.13  ? 467 LYS C CD  1 
ATOM   4981 C CE  . LYS C 2 172 ? 31.101  36.316  -0.776  1.00 72.64  ? 467 LYS C CE  1 
ATOM   4982 N NZ  . LYS C 2 172 ? 30.191  37.173  0.039   1.00 70.59  ? 467 LYS C NZ  1 
ATOM   4983 N N   . SER C 2 173 ? 29.573  31.103  -3.028  1.00 64.00  ? 468 SER C N   1 
ATOM   4984 C CA  . SER C 2 173 ? 28.872  31.070  -4.305  1.00 68.30  ? 468 SER C CA  1 
ATOM   4985 C C   . SER C 2 173 ? 27.364  30.919  -4.124  1.00 78.38  ? 468 SER C C   1 
ATOM   4986 O O   . SER C 2 173 ? 26.585  31.444  -4.918  1.00 86.99  ? 468 SER C O   1 
ATOM   4987 C CB  . SER C 2 173 ? 29.413  29.954  -5.196  1.00 69.51  ? 468 SER C CB  1 
ATOM   4988 O OG  . SER C 2 173 ? 28.888  30.062  -6.511  1.00 79.61  ? 468 SER C OG  1 
ATOM   4989 N N   . LEU C 2 174 ? 26.959  30.201  -3.080  1.00 76.74  ? 469 LEU C N   1 
ATOM   4990 C CA  . LEU C 2 174 ? 25.543  30.053  -2.750  1.00 79.92  ? 469 LEU C CA  1 
ATOM   4991 C C   . LEU C 2 174 ? 24.964  31.371  -2.253  1.00 71.75  ? 469 LEU C C   1 
ATOM   4992 O O   . LEU C 2 174 ? 23.857  31.760  -2.623  1.00 65.14  ? 469 LEU C O   1 
ATOM   4993 C CB  . LEU C 2 174 ? 25.346  28.975  -1.684  1.00 82.33  ? 469 LEU C CB  1 
ATOM   4994 C CG  . LEU C 2 174 ? 25.226  27.532  -2.172  1.00 78.07  ? 469 LEU C CG  1 
ATOM   4995 C CD1 . LEU C 2 174 ? 24.968  26.614  -1.001  1.00 77.36  ? 469 LEU C CD1 1 
ATOM   4996 C CD2 . LEU C 2 174 ? 24.113  27.412  -3.200  1.00 75.14  ? 469 LEU C CD2 1 
ATOM   4997 N N   . GLU C 2 175 ? 25.724  32.040  -1.396  1.00 65.73  ? 470 GLU C N   1 
ATOM   4998 C CA  . GLU C 2 175 ? 25.348  33.345  -0.869  1.00 69.84  ? 470 GLU C CA  1 
ATOM   4999 C C   . GLU C 2 175 ? 25.309  34.385  -1.989  1.00 62.40  ? 470 GLU C C   1 
ATOM   5000 O O   . GLU C 2 175 ? 24.516  35.320  -1.951  1.00 61.08  ? 470 GLU C O   1 
ATOM   5001 C CB  . GLU C 2 175 ? 26.340  33.759  0.220   1.00 72.41  ? 470 GLU C CB  1 
ATOM   5002 C CG  . GLU C 2 175 ? 26.105  35.123  0.822   1.00 76.14  ? 470 GLU C CG  1 
ATOM   5003 C CD  . GLU C 2 175 ? 27.090  35.422  1.935   1.00 87.07  ? 470 GLU C CD  1 
ATOM   5004 O OE1 . GLU C 2 175 ? 27.374  36.612  2.185   1.00 89.11  ? 470 GLU C OE1 1 
ATOM   5005 O OE2 . GLU C 2 175 ? 27.587  34.460  2.555   1.00 92.23  ? 470 GLU C OE2 1 
ATOM   5006 N N   . GLU C 2 176 ? 26.167  34.207  -2.988  1.00 61.11  ? 471 GLU C N   1 
ATOM   5007 C CA  . GLU C 2 176 ? 26.212  35.097  -4.142  1.00 61.27  ? 471 GLU C CA  1 
ATOM   5008 C C   . GLU C 2 176 ? 24.945  34.970  -4.980  1.00 55.91  ? 471 GLU C C   1 
ATOM   5009 O O   . GLU C 2 176 ? 24.411  35.969  -5.464  1.00 48.30  ? 471 GLU C O   1 
ATOM   5010 C CB  . GLU C 2 176 ? 27.427  34.783  -5.010  1.00 63.01  ? 471 GLU C CB  1 
ATOM   5011 C CG  . GLU C 2 176 ? 28.758  35.076  -4.346  1.00 72.75  ? 471 GLU C CG  1 
ATOM   5012 C CD  . GLU C 2 176 ? 29.106  36.550  -4.364  1.00 75.71  ? 471 GLU C CD  1 
ATOM   5013 O OE1 . GLU C 2 176 ? 29.545  37.038  -5.424  1.00 71.79  ? 471 GLU C OE1 1 
ATOM   5014 O OE2 . GLU C 2 176 ? 28.947  37.219  -3.320  1.00 81.58  ? 471 GLU C OE2 1 
ATOM   5015 N N   . LYS C 2 177 ? 24.478  33.736  -5.153  1.00 49.38  ? 472 LYS C N   1 
ATOM   5016 C CA  . LYS C 2 177 ? 23.275  33.466  -5.931  1.00 53.63  ? 472 LYS C CA  1 
ATOM   5017 C C   . LYS C 2 177 ? 22.034  34.009  -5.243  1.00 45.11  ? 472 LYS C C   1 
ATOM   5018 O O   . LYS C 2 177 ? 21.166  34.580  -5.892  1.00 44.71  ? 472 LYS C O   1 
ATOM   5019 C CB  . LYS C 2 177 ? 23.105  31.963  -6.179  1.00 67.15  ? 472 LYS C CB  1 
ATOM   5020 C CG  . LYS C 2 177 ? 24.062  31.367  -7.199  1.00 77.03  ? 472 LYS C CG  1 
ATOM   5021 C CD  . LYS C 2 177 ? 23.590  29.983  -7.633  1.00 83.31  ? 472 LYS C CD  1 
ATOM   5022 C CE  . LYS C 2 177 ? 24.526  29.350  -8.652  1.00 91.50  ? 472 LYS C CE  1 
ATOM   5023 N NZ  . LYS C 2 177 ? 25.767  28.802  -8.034  1.00 96.01  ? 472 LYS C NZ  1 
ATOM   5024 N N   . ASP C 2 178 ? 21.947  33.815  -3.931  1.00 40.93  ? 473 ASP C N   1 
ATOM   5025 C CA  . ASP C 2 178 ? 20.838  34.353  -3.158  1.00 49.93  ? 473 ASP C CA  1 
ATOM   5026 C C   . ASP C 2 178 ? 20.762  35.854  -3.383  1.00 47.50  ? 473 ASP C C   1 
ATOM   5027 O O   . ASP C 2 178 ? 19.698  36.403  -3.677  1.00 39.93  ? 473 ASP C O   1 
ATOM   5028 C CB  . ASP C 2 178 ? 21.025  34.067  -1.666  1.00 71.70  ? 473 ASP C CB  1 
ATOM   5029 C CG  . ASP C 2 178 ? 20.448  32.730  -1.250  1.00 93.36  ? 473 ASP C CG  1 
ATOM   5030 O OD1 . ASP C 2 178 ? 19.234  32.674  -0.954  1.00 103.73 ? 473 ASP C OD1 1 
ATOM   5031 O OD2 . ASP C 2 178 ? 21.207  31.736  -1.210  1.00 96.74  ? 473 ASP C OD2 1 
ATOM   5032 N N   . HIS C 2 179 ? 21.909  36.509  -3.256  1.00 35.29  ? 474 HIS C N   1 
ATOM   5033 C CA  . HIS C 2 179 ? 21.978  37.953  -3.389  1.00 40.52  ? 474 HIS C CA  1 
ATOM   5034 C C   . HIS C 2 179 ? 21.513  38.422  -4.764  1.00 45.82  ? 474 HIS C C   1 
ATOM   5035 O O   . HIS C 2 179 ? 20.768  39.395  -4.878  1.00 35.38  ? 474 HIS C O   1 
ATOM   5036 C CB  . HIS C 2 179 ? 23.393  38.452  -3.120  1.00 39.31  ? 474 HIS C CB  1 
ATOM   5037 C CG  . HIS C 2 179 ? 23.531  39.934  -3.247  1.00 48.24  ? 474 HIS C CG  1 
ATOM   5038 N ND1 . HIS C 2 179 ? 22.931  40.811  -2.371  1.00 54.03  ? 474 HIS C ND1 1 
ATOM   5039 C CD2 . HIS C 2 179 ? 24.191  40.694  -4.153  1.00 43.59  ? 474 HIS C CD2 1 
ATOM   5040 C CE1 . HIS C 2 179 ? 23.221  42.049  -2.725  1.00 53.92  ? 474 HIS C CE1 1 
ATOM   5041 N NE2 . HIS C 2 179 ? 23.984  42.005  -3.805  1.00 51.35  ? 474 HIS C NE2 1 
ATOM   5042 N N   . ILE C 2 180 ? 21.961  37.731  -5.807  1.00 38.74  ? 475 ILE C N   1 
ATOM   5043 C CA  . ILE C 2 180 ? 21.522  38.041  -7.161  1.00 41.06  ? 475 ILE C CA  1 
ATOM   5044 C C   . ILE C 2 180 ? 20.004  37.889  -7.292  1.00 39.75  ? 475 ILE C C   1 
ATOM   5045 O O   . ILE C 2 180 ? 19.330  38.736  -7.878  1.00 36.59  ? 475 ILE C O   1 
ATOM   5046 C CB  . ILE C 2 180 ? 22.239  37.151  -8.192  1.00 41.54  ? 475 ILE C CB  1 
ATOM   5047 C CG1 . ILE C 2 180 ? 23.653  37.686  -8.436  1.00 44.76  ? 475 ILE C CG1 1 
ATOM   5048 C CG2 . ILE C 2 180 ? 21.451  37.091  -9.497  1.00 27.44  ? 475 ILE C CG2 1 
ATOM   5049 C CD1 . ILE C 2 180 ? 24.656  36.613  -8.748  1.00 44.19  ? 475 ILE C CD1 1 
ATOM   5050 N N   . HIS C 2 181 ? 19.463  36.819  -6.725  1.00 32.32  ? 476 HIS C N   1 
ATOM   5051 C CA  A HIS C 2 181 ? 18.030  36.597  -6.808  0.63 33.08  ? 476 HIS C CA  1 
ATOM   5052 C CA  B HIS C 2 181 ? 18.026  36.562  -6.754  0.37 34.84  ? 476 HIS C CA  1 
ATOM   5053 C C   . HIS C 2 181 ? 17.247  37.674  -6.064  1.00 38.39  ? 476 HIS C C   1 
ATOM   5054 O O   . HIS C 2 181 ? 16.207  38.128  -6.546  1.00 35.09  ? 476 HIS C O   1 
ATOM   5055 C CB  A HIS C 2 181 ? 17.661  35.192  -6.325  0.63 38.36  ? 476 HIS C CB  1 
ATOM   5056 C CB  B HIS C 2 181 ? 17.713  35.221  -6.081  0.37 38.43  ? 476 HIS C CB  1 
ATOM   5057 C CG  A HIS C 2 181 ? 18.134  34.104  -7.242  0.63 40.56  ? 476 HIS C CG  1 
ATOM   5058 C CG  B HIS C 2 181 ? 16.371  35.175  -5.418  0.37 38.16  ? 476 HIS C CG  1 
ATOM   5059 N ND1 A HIS C 2 181 ? 17.925  34.137  -8.601  0.63 43.06  ? 476 HIS C ND1 1 
ATOM   5060 N ND1 B HIS C 2 181 ? 15.205  34.945  -6.116  0.37 38.59  ? 476 HIS C ND1 1 
ATOM   5061 C CD2 A HIS C 2 181 ? 18.799  32.951  -6.988  0.63 38.44  ? 476 HIS C CD2 1 
ATOM   5062 C CD2 B HIS C 2 181 ? 16.010  35.327  -4.122  0.37 34.79  ? 476 HIS C CD2 1 
ATOM   5063 C CE1 A HIS C 2 181 ? 18.449  33.056  -9.153  0.63 39.45  ? 476 HIS C CE1 1 
ATOM   5064 C CE1 B HIS C 2 181 ? 14.183  34.961  -5.278  0.37 34.52  ? 476 HIS C CE1 1 
ATOM   5065 N NE2 A HIS C 2 181 ? 18.979  32.318  -8.194  0.63 39.78  ? 476 HIS C NE2 1 
ATOM   5066 N NE2 B HIS C 2 181 ? 14.645  35.193  -4.062  0.37 28.00  ? 476 HIS C NE2 1 
ATOM   5067 N N   . ARG C 2 182 ? 17.756  38.103  -4.914  1.00 32.39  ? 477 ARG C N   1 
ATOM   5068 C CA  . ARG C 2 182 ? 17.102  39.157  -4.155  1.00 36.73  ? 477 ARG C CA  1 
ATOM   5069 C C   . ARG C 2 182 ? 17.108  40.489  -4.908  1.00 33.74  ? 477 ARG C C   1 
ATOM   5070 O O   . ARG C 2 182 ? 16.115  41.223  -4.896  1.00 41.43  ? 477 ARG C O   1 
ATOM   5071 C CB  . ARG C 2 182 ? 17.719  39.284  -2.760  1.00 39.96  ? 477 ARG C CB  1 
ATOM   5072 C CG  . ARG C 2 182 ? 17.342  38.135  -1.838  1.00 41.55  ? 477 ARG C CG  1 
ATOM   5073 C CD  . ARG C 2 182 ? 18.348  37.929  -0.714  1.00 54.98  ? 477 ARG C CD  1 
ATOM   5074 N NE  . ARG C 2 182 ? 18.067  38.756  0.453   1.00 61.54  ? 477 ARG C NE  1 
ATOM   5075 N N   . VAL C 2 183 ? 18.214  40.804  -5.572  1.00 34.37  ? 478 VAL C N   1 
ATOM   5076 C CA  . VAL C 2 183 ? 18.284  42.046  -6.341  1.00 37.59  ? 478 VAL C CA  1 
ATOM   5077 C C   . VAL C 2 183 ? 17.290  41.996  -7.497  1.00 37.29  ? 478 VAL C C   1 
ATOM   5078 O O   . VAL C 2 183 ? 16.578  42.971  -7.759  1.00 33.86  ? 478 VAL C O   1 
ATOM   5079 C CB  . VAL C 2 183 ? 19.702  42.324  -6.876  1.00 37.00  ? 478 VAL C CB  1 
ATOM   5080 C CG1 . VAL C 2 183 ? 19.709  43.592  -7.704  1.00 36.56  ? 478 VAL C CG1 1 
ATOM   5081 C CG2 . VAL C 2 183 ? 20.688  42.435  -5.723  1.00 28.60  ? 478 VAL C CG2 1 
ATOM   5082 N N   . LEU C 2 184 ? 17.231  40.846  -8.171  1.00 28.95  ? 479 LEU C N   1 
ATOM   5083 C CA  . LEU C 2 184 ? 16.276  40.645  -9.258  1.00 27.72  ? 479 LEU C CA  1 
ATOM   5084 C C   . LEU C 2 184 ? 14.839  40.865  -8.797  1.00 29.11  ? 479 LEU C C   1 
ATOM   5085 O O   . LEU C 2 184 ? 14.032  41.463  -9.511  1.00 29.59  ? 479 LEU C O   1 
ATOM   5086 C CB  . LEU C 2 184 ? 16.433  39.245  -9.858  1.00 26.02  ? 479 LEU C CB  1 
ATOM   5087 C CG  . LEU C 2 184 ? 17.646  39.058  -10.778 1.00 33.87  ? 479 LEU C CG  1 
ATOM   5088 C CD1 . LEU C 2 184 ? 17.851  37.580  -11.124 1.00 33.25  ? 479 LEU C CD1 1 
ATOM   5089 C CD2 . LEU C 2 184 ? 17.473  39.891  -12.044 1.00 27.96  ? 479 LEU C CD2 1 
ATOM   5090 N N   . ASP C 2 185 ? 14.515  40.368  -7.605  1.00 33.54  ? 480 ASP C N   1 
ATOM   5091 C CA  . ASP C 2 185 ? 13.193  40.583  -7.028  1.00 29.40  ? 480 ASP C CA  1 
ATOM   5092 C C   . ASP C 2 185 ? 12.935  42.084  -6.861  1.00 28.12  ? 480 ASP C C   1 
ATOM   5093 O O   . ASP C 2 185 ? 11.830  42.576  -7.103  1.00 28.28  ? 480 ASP C O   1 
ATOM   5094 C CB  . ASP C 2 185 ? 13.061  39.867  -5.678  1.00 26.64  ? 480 ASP C CB  1 
ATOM   5095 C CG  . ASP C 2 185 ? 12.858  38.360  -5.821  1.00 38.01  ? 480 ASP C CG  1 
ATOM   5096 O OD1 . ASP C 2 185 ? 12.511  37.888  -6.924  1.00 35.24  ? 480 ASP C OD1 1 
ATOM   5097 O OD2 . ASP C 2 185 ? 13.039  37.641  -4.818  1.00 37.32  ? 480 ASP C OD2 1 
ATOM   5098 N N   . LYS C 2 186 ? 13.965  42.813  -6.454  1.00 23.68  ? 481 LYS C N   1 
ATOM   5099 C CA  . LYS C 2 186 ? 13.826  44.256  -6.275  1.00 29.70  ? 481 LYS C CA  1 
ATOM   5100 C C   . LYS C 2 186 ? 13.582  44.948  -7.615  1.00 36.99  ? 481 LYS C C   1 
ATOM   5101 O O   . LYS C 2 186 ? 12.828  45.917  -7.693  1.00 34.52  ? 481 LYS C O   1 
ATOM   5102 C CB  . LYS C 2 186 ? 15.048  44.847  -5.573  1.00 29.25  ? 481 LYS C CB  1 
ATOM   5103 C CG  . LYS C 2 186 ? 14.832  46.279  -5.084  1.00 51.77  ? 481 LYS C CG  1 
ATOM   5104 C CD  . LYS C 2 186 ? 13.424  46.438  -4.527  1.00 58.55  ? 481 LYS C CD  1 
ATOM   5105 C CE  . LYS C 2 186 ? 13.411  47.249  -3.250  1.00 51.06  ? 481 LYS C CE  1 
ATOM   5106 N NZ  . LYS C 2 186 ? 14.326  46.681  -2.222  1.00 47.18  ? 481 LYS C NZ  1 
ATOM   5107 N N   . ILE C 2 187 ? 14.211  44.441  -8.671  1.00 31.24  ? 482 ILE C N   1 
ATOM   5108 C CA  . ILE C 2 187 ? 13.974  44.987  -10.002 1.00 32.60  ? 482 ILE C CA  1 
ATOM   5109 C C   . ILE C 2 187 ? 12.564  44.644  -10.490 1.00 32.35  ? 482 ILE C C   1 
ATOM   5110 O O   . ILE C 2 187 ? 11.920  45.441  -11.187 1.00 25.58  ? 482 ILE C O   1 
ATOM   5111 C CB  . ILE C 2 187 ? 15.040  44.535  -10.998 1.00 32.06  ? 482 ILE C CB  1 
ATOM   5112 C CG1 . ILE C 2 187 ? 16.426  44.910  -10.472 1.00 33.08  ? 482 ILE C CG1 1 
ATOM   5113 C CG2 . ILE C 2 187 ? 14.815  45.196  -12.340 1.00 35.97  ? 482 ILE C CG2 1 
ATOM   5114 C CD1 . ILE C 2 187 ? 17.566  44.438  -11.342 1.00 37.24  ? 482 ILE C CD1 1 
ATOM   5115 N N   . THR C 2 188 ? 12.071  43.469  -10.110 1.00 30.17  ? 483 THR C N   1 
ATOM   5116 C CA  . THR C 2 188 ? 10.687  43.118  -10.404 1.00 31.93  ? 483 THR C CA  1 
ATOM   5117 C C   . THR C 2 188 ? 9.736   44.098  -9.723  1.00 33.68  ? 483 THR C C   1 
ATOM   5118 O O   . THR C 2 188 ? 8.800   44.601  -10.343 1.00 31.10  ? 483 THR C O   1 
ATOM   5119 C CB  . THR C 2 188 ? 10.335  41.693  -9.949  1.00 30.54  ? 483 THR C CB  1 
ATOM   5120 O OG1 . THR C 2 188 ? 11.143  40.746  -10.662 1.00 32.42  ? 483 THR C OG1 1 
ATOM   5121 C CG2 . THR C 2 188 ? 8.864   41.403  -10.230 1.00 28.39  ? 483 THR C CG2 1 
ATOM   5122 N N   . ASP C 2 189 ? 9.979   44.361  -8.442  1.00 33.60  ? 484 ASP C N   1 
ATOM   5123 C CA  . ASP C 2 189 ? 9.185   45.332  -7.693  1.00 35.27  ? 484 ASP C CA  1 
ATOM   5124 C C   . ASP C 2 189 ? 9.187   46.676  -8.407  1.00 40.15  ? 484 ASP C C   1 
ATOM   5125 O O   . ASP C 2 189 ? 8.149   47.336  -8.537  1.00 40.90  ? 484 ASP C O   1 
ATOM   5126 C CB  . ASP C 2 189 ? 9.750   45.523  -6.283  1.00 38.39  ? 484 ASP C CB  1 
ATOM   5127 C CG  . ASP C 2 189 ? 9.688   44.262  -5.447  1.00 42.20  ? 484 ASP C CG  1 
ATOM   5128 O OD1 . ASP C 2 189 ? 9.048   43.282  -5.885  1.00 39.70  ? 484 ASP C OD1 1 
ATOM   5129 O OD2 . ASP C 2 189 ? 10.285  44.254  -4.347  1.00 39.43  ? 484 ASP C OD2 1 
ATOM   5130 N N   . THR C 2 190 ? 10.370  47.078  -8.858  1.00 32.83  ? 485 THR C N   1 
ATOM   5131 C CA  . THR C 2 190 ? 10.551  48.366  -9.512  1.00 32.35  ? 485 THR C CA  1 
ATOM   5132 C C   . THR C 2 190 ? 9.706   48.447  -10.778 1.00 32.29  ? 485 THR C C   1 
ATOM   5133 O O   . THR C 2 190 ? 8.940   49.385  -10.958 1.00 36.40  ? 485 THR C O   1 
ATOM   5134 C CB  . THR C 2 190 ? 12.027  48.607  -9.844  1.00 32.14  ? 485 THR C CB  1 
ATOM   5135 O OG1 . THR C 2 190 ? 12.796  48.549  -8.636  1.00 30.47  ? 485 THR C OG1 1 
ATOM   5136 C CG2 . THR C 2 190 ? 12.214  49.969  -10.486 1.00 31.41  ? 485 THR C CG2 1 
ATOM   5137 N N   . LEU C 2 191 ? 9.840   47.450  -11.645 1.00 35.26  ? 486 LEU C N   1 
ATOM   5138 C CA  . LEU C 2 191 ? 9.050   47.393  -12.867 1.00 35.54  ? 486 LEU C CA  1 
ATOM   5139 C C   . LEU C 2 191 ? 7.563   47.528  -12.576 1.00 34.27  ? 486 LEU C C   1 
ATOM   5140 O O   . LEU C 2 191 ? 6.879   48.347  -13.189 1.00 37.97  ? 486 LEU C O   1 
ATOM   5141 C CB  . LEU C 2 191 ? 9.325   46.092  -13.621 1.00 32.01  ? 486 LEU C CB  1 
ATOM   5142 C CG  . LEU C 2 191 ? 10.592  46.125  -14.475 1.00 35.00  ? 486 LEU C CG  1 
ATOM   5143 C CD1 . LEU C 2 191 ? 11.001  44.723  -14.890 1.00 37.74  ? 486 LEU C CD1 1 
ATOM   5144 C CD2 . LEU C 2 191 ? 10.401  47.024  -15.693 1.00 30.48  ? 486 LEU C CD2 1 
ATOM   5145 N N   . ILE C 2 192 ? 7.071   46.734  -11.630 1.00 30.18  ? 487 ILE C N   1 
ATOM   5146 C CA  . ILE C 2 192 ? 5.662   46.782  -11.257 1.00 31.45  ? 487 ILE C CA  1 
ATOM   5147 C C   . ILE C 2 192 ? 5.263   48.165  -10.752 1.00 34.04  ? 487 ILE C C   1 
ATOM   5148 O O   . ILE C 2 192 ? 4.197   48.673  -11.092 1.00 36.99  ? 487 ILE C O   1 
ATOM   5149 C CB  . ILE C 2 192 ? 5.328   45.739  -10.187 1.00 31.66  ? 487 ILE C CB  1 
ATOM   5150 C CG1 . ILE C 2 192 ? 5.493   44.332  -10.756 1.00 31.45  ? 487 ILE C CG1 1 
ATOM   5151 C CG2 . ILE C 2 192 ? 3.902   45.938  -9.683  1.00 33.00  ? 487 ILE C CG2 1 
ATOM   5152 C CD1 . ILE C 2 192 ? 4.399   43.942  -11.737 1.00 33.27  ? 487 ILE C CD1 1 
ATOM   5153 N N   . HIS C 2 193 ? 6.126   48.777  -9.951  1.00 31.49  ? 488 HIS C N   1 
ATOM   5154 C CA  . HIS C 2 193 ? 5.862   50.119  -9.445  1.00 36.03  ? 488 HIS C CA  1 
ATOM   5155 C C   . HIS C 2 193 ? 5.696   51.121  -10.580 1.00 39.36  ? 488 HIS C C   1 
ATOM   5156 O O   . HIS C 2 193 ? 4.748   51.905  -10.593 1.00 40.03  ? 488 HIS C O   1 
ATOM   5157 C CB  . HIS C 2 193 ? 6.977   50.579  -8.508  1.00 37.42  ? 488 HIS C CB  1 
ATOM   5158 C CG  . HIS C 2 193 ? 6.743   51.932  -7.916  1.00 45.23  ? 488 HIS C CG  1 
ATOM   5159 N ND1 . HIS C 2 193 ? 7.404   53.061  -8.351  1.00 49.67  ? 488 HIS C ND1 1 
ATOM   5160 C CD2 . HIS C 2 193 ? 5.905   52.341  -6.932  1.00 46.11  ? 488 HIS C CD2 1 
ATOM   5161 C CE1 . HIS C 2 193 ? 6.994   54.106  -7.653  1.00 52.05  ? 488 HIS C CE1 1 
ATOM   5162 N NE2 . HIS C 2 193 ? 6.085   53.696  -6.786  1.00 51.94  ? 488 HIS C NE2 1 
ATOM   5163 N N   . LEU C 2 194 ? 6.623   51.094  -11.530 1.00 37.83  ? 489 LEU C N   1 
ATOM   5164 C CA  . LEU C 2 194 ? 6.562   51.992  -12.680 1.00 37.60  ? 489 LEU C CA  1 
ATOM   5165 C C   . LEU C 2 194 ? 5.231   51.854  -13.415 1.00 39.70  ? 489 LEU C C   1 
ATOM   5166 O O   . LEU C 2 194 ? 4.640   52.848  -13.830 1.00 50.06  ? 489 LEU C O   1 
ATOM   5167 C CB  . LEU C 2 194 ? 7.735   51.726  -13.635 1.00 37.20  ? 489 LEU C CB  1 
ATOM   5168 C CG  . LEU C 2 194 ? 9.126   52.160  -13.154 1.00 37.29  ? 489 LEU C CG  1 
ATOM   5169 C CD1 . LEU C 2 194 ? 10.227  51.477  -13.948 1.00 30.81  ? 489 LEU C CD1 1 
ATOM   5170 C CD2 . LEU C 2 194 ? 9.263   53.681  -13.239 1.00 34.53  ? 489 LEU C CD2 1 
ATOM   5171 N N   . MET C 2 195 ? 4.763   50.618  -13.564 1.00 36.62  ? 490 MET C N   1 
ATOM   5172 C CA  . MET C 2 195 ? 3.514   50.341  -14.271 1.00 31.51  ? 490 MET C CA  1 
ATOM   5173 C C   . MET C 2 195 ? 2.288   50.819  -13.494 1.00 36.72  ? 490 MET C C   1 
ATOM   5174 O O   . MET C 2 195 ? 1.359   51.386  -14.073 1.00 48.86  ? 490 MET C O   1 
ATOM   5175 C CB  . MET C 2 195 ? 3.391   48.843  -14.582 1.00 27.37  ? 490 MET C CB  1 
ATOM   5176 C CG  . MET C 2 195 ? 4.544   48.287  -15.397 1.00 32.26  ? 490 MET C CG  1 
ATOM   5177 S SD  . MET C 2 195 ? 4.472   46.491  -15.643 1.00 37.32  ? 490 MET C SD  1 
ATOM   5178 C CE  . MET C 2 195 ? 6.071   46.190  -16.377 1.00 29.73  ? 490 MET C CE  1 
ATOM   5179 N N   . ALA C 2 196 ? 2.277   50.574  -12.188 1.00 35.27  ? 491 ALA C N   1 
ATOM   5180 C CA  . ALA C 2 196 ? 1.191   51.045  -11.334 1.00 38.72  ? 491 ALA C CA  1 
ATOM   5181 C C   . ALA C 2 196 ? 1.165   52.569  -11.355 1.00 43.69  ? 491 ALA C C   1 
ATOM   5182 O O   . ALA C 2 196 ? 0.111   53.190  -11.465 1.00 46.49  ? 491 ALA C O   1 
ATOM   5183 C CB  . ALA C 2 196 ? 1.386   50.536  -9.912  1.00 37.72  ? 491 ALA C CB  1 
ATOM   5184 N N   . LYS C 2 197 ? 2.349   53.158  -11.241 1.00 41.40  ? 492 LYS C N   1 
ATOM   5185 C CA  . LYS C 2 197 ? 2.524   54.601  -11.298 1.00 45.91  ? 492 LYS C CA  1 
ATOM   5186 C C   . LYS C 2 197 ? 1.974   55.162  -12.612 1.00 44.23  ? 492 LYS C C   1 
ATOM   5187 O O   . LYS C 2 197 ? 1.374   56.236  -12.633 1.00 44.35  ? 492 LYS C O   1 
ATOM   5188 C CB  . LYS C 2 197 ? 4.012   54.922  -11.157 1.00 50.12  ? 492 LYS C CB  1 
ATOM   5189 C CG  . LYS C 2 197 ? 4.371   56.350  -10.804 1.00 62.85  ? 492 LYS C CG  1 
ATOM   5190 C CD  . LYS C 2 197 ? 5.857   56.586  -11.088 1.00 67.76  ? 492 LYS C CD  1 
ATOM   5191 C CE  . LYS C 2 197 ? 6.684   56.719  -9.818  1.00 75.39  ? 492 LYS C CE  1 
ATOM   5192 N NZ  . LYS C 2 197 ? 6.677   58.123  -9.307  1.00 81.65  ? 492 LYS C NZ  1 
ATOM   5193 N N   . ALA C 2 198 ? 2.167   54.423  -13.703 1.00 40.65  ? 493 ALA C N   1 
ATOM   5194 C CA  . ALA C 2 198 ? 1.712   54.860  -15.024 1.00 34.78  ? 493 ALA C CA  1 
ATOM   5195 C C   . ALA C 2 198 ? 0.212   54.667  -15.233 1.00 45.50  ? 493 ALA C C   1 
ATOM   5196 O O   . ALA C 2 198 ? -0.347  55.153  -16.216 1.00 48.26  ? 493 ALA C O   1 
ATOM   5197 C CB  . ALA C 2 198 ? 2.483   54.149  -16.115 1.00 34.69  ? 493 ALA C CB  1 
ATOM   5198 N N   . GLY C 2 199 ? -0.434  53.948  -14.322 1.00 40.44  ? 494 GLY C N   1 
ATOM   5199 C CA  . GLY C 2 199 ? -1.878  53.790  -14.369 1.00 36.39  ? 494 GLY C CA  1 
ATOM   5200 C C   . GLY C 2 199 ? -2.380  52.434  -14.836 1.00 42.72  ? 494 GLY C C   1 
ATOM   5201 O O   . GLY C 2 199 ? -3.584  52.253  -15.040 1.00 41.93  ? 494 GLY C O   1 
ATOM   5202 N N   . LEU C 2 200 ? -1.476  51.473  -15.015 1.00 37.79  ? 495 LEU C N   1 
ATOM   5203 C CA  . LEU C 2 200 ? -1.897  50.132  -15.435 1.00 35.53  ? 495 LEU C CA  1 
ATOM   5204 C C   . LEU C 2 200 ? -2.694  49.477  -14.316 1.00 38.85  ? 495 LEU C C   1 
ATOM   5205 O O   . LEU C 2 200 ? -2.378  49.653  -13.137 1.00 41.49  ? 495 LEU C O   1 
ATOM   5206 C CB  . LEU C 2 200 ? -0.695  49.239  -15.761 1.00 32.16  ? 495 LEU C CB  1 
ATOM   5207 C CG  . LEU C 2 200 ? 0.417   49.651  -16.732 1.00 39.65  ? 495 LEU C CG  1 
ATOM   5208 C CD1 . LEU C 2 200 ? 0.755   48.500  -17.668 1.00 41.95  ? 495 LEU C CD1 1 
ATOM   5209 C CD2 . LEU C 2 200 ? 0.071   50.896  -17.512 1.00 39.38  ? 495 LEU C CD2 1 
ATOM   5210 N N   . THR C 2 201 ? -3.727  48.724  -14.681 1.00 40.04  ? 496 THR C N   1 
ATOM   5211 C CA  . THR C 2 201 ? -4.439  47.889  -13.716 1.00 40.04  ? 496 THR C CA  1 
ATOM   5212 C C   . THR C 2 201 ? -3.550  46.727  -13.268 1.00 42.38  ? 496 THR C C   1 
ATOM   5213 O O   . THR C 2 201 ? -2.591  46.372  -13.952 1.00 36.99  ? 496 THR C O   1 
ATOM   5214 C CB  . THR C 2 201 ? -5.709  47.290  -14.325 1.00 41.81  ? 496 THR C CB  1 
ATOM   5215 O OG1 . THR C 2 201 ? -5.347  46.371  -15.369 1.00 39.72  ? 496 THR C OG1 1 
ATOM   5216 C CG2 . THR C 2 201 ? -6.603  48.390  -14.887 1.00 44.41  ? 496 THR C CG2 1 
ATOM   5217 N N   . LEU C 2 202 ? -3.881  46.129  -12.127 1.00 41.96  ? 497 LEU C N   1 
ATOM   5218 C CA  . LEU C 2 202 ? -3.125  44.994  -11.620 1.00 41.87  ? 497 LEU C CA  1 
ATOM   5219 C C   . LEU C 2 202 ? -2.908  43.949  -12.705 1.00 41.52  ? 497 LEU C C   1 
ATOM   5220 O O   . LEU C 2 202 ? -1.801  43.438  -12.872 1.00 47.54  ? 497 LEU C O   1 
ATOM   5221 C CB  . LEU C 2 202 ? -3.823  44.352  -10.420 1.00 50.16  ? 497 LEU C CB  1 
ATOM   5222 C CG  . LEU C 2 202 ? -3.599  45.010  -9.061  1.00 58.65  ? 497 LEU C CG  1 
ATOM   5223 C CD1 . LEU C 2 202 ? -4.148  44.117  -7.958  1.00 62.19  ? 497 LEU C CD1 1 
ATOM   5224 C CD2 . LEU C 2 202 ? -2.119  45.272  -8.844  1.00 57.88  ? 497 LEU C CD2 1 
ATOM   5225 N N   . GLN C 2 203 ? -3.969  43.637  -13.439 1.00 39.47  ? 498 GLN C N   1 
ATOM   5226 C CA  . GLN C 2 203 ? -3.896  42.650  -14.506 1.00 40.76  ? 498 GLN C CA  1 
ATOM   5227 C C   . GLN C 2 203 ? -2.915  43.083  -15.580 1.00 37.66  ? 498 GLN C C   1 
ATOM   5228 O O   . GLN C 2 203 ? -2.064  42.305  -15.993 1.00 38.65  ? 498 GLN C O   1 
ATOM   5229 C CB  . GLN C 2 203 ? -5.278  42.412  -15.121 1.00 46.05  ? 498 GLN C CB  1 
ATOM   5230 C CG  . GLN C 2 203 ? -5.290  41.368  -16.231 1.00 50.71  ? 498 GLN C CG  1 
ATOM   5231 C CD  . GLN C 2 203 ? -6.691  41.039  -16.700 1.00 55.72  ? 498 GLN C CD  1 
ATOM   5232 O OE1 . GLN C 2 203 ? -7.489  41.932  -16.976 1.00 65.43  ? 498 GLN C OE1 1 
ATOM   5233 N NE2 . GLN C 2 203 ? -6.997  39.751  -16.797 1.00 54.25  ? 498 GLN C NE2 1 
ATOM   5234 N N   . GLN C 2 204 ? -3.033  44.328  -16.022 1.00 35.78  ? 499 GLN C N   1 
ATOM   5235 C CA  . GLN C 2 204 ? -2.149  44.857  -17.056 1.00 40.49  ? 499 GLN C CA  1 
ATOM   5236 C C   . GLN C 2 204 ? -0.700  44.912  -16.585 1.00 40.80  ? 499 GLN C C   1 
ATOM   5237 O O   . GLN C 2 204 ? 0.220   44.807  -17.390 1.00 40.17  ? 499 GLN C O   1 
ATOM   5238 C CB  . GLN C 2 204 ? -2.611  46.245  -17.502 1.00 40.32  ? 499 GLN C CB  1 
ATOM   5239 C CG  . GLN C 2 204 ? -3.967  46.236  -18.181 1.00 40.88  ? 499 GLN C CG  1 
ATOM   5240 C CD  . GLN C 2 204 ? -4.438  47.625  -18.546 1.00 52.96  ? 499 GLN C CD  1 
ATOM   5241 O OE1 . GLN C 2 204 ? -3.981  48.623  -17.979 1.00 52.47  ? 499 GLN C OE1 1 
ATOM   5242 N NE2 . GLN C 2 204 ? -5.359  47.701  -19.499 1.00 57.64  ? 499 GLN C NE2 1 
ATOM   5243 N N   . GLN C 2 205 ? -0.497  45.076  -15.281 1.00 36.31  ? 500 GLN C N   1 
ATOM   5244 C CA  . GLN C 2 205 ? 0.851   45.095  -14.728 1.00 36.66  ? 500 GLN C CA  1 
ATOM   5245 C C   . GLN C 2 205 ? 1.524   43.732  -14.859 1.00 40.47  ? 500 GLN C C   1 
ATOM   5246 O O   . GLN C 2 205 ? 2.687   43.644  -15.263 1.00 38.33  ? 500 GLN C O   1 
ATOM   5247 C CB  . GLN C 2 205 ? 0.838   45.529  -13.266 1.00 33.18  ? 500 GLN C CB  1 
ATOM   5248 C CG  . GLN C 2 205 ? 0.395   46.959  -13.047 1.00 31.04  ? 500 GLN C CG  1 
ATOM   5249 C CD  . GLN C 2 205 ? 0.204   47.271  -11.580 1.00 38.38  ? 500 GLN C CD  1 
ATOM   5250 O OE1 . GLN C 2 205 ? 0.882   46.704  -10.719 1.00 37.25  ? 500 GLN C OE1 1 
ATOM   5251 N NE2 . GLN C 2 205 ? -0.723  48.178  -11.283 1.00 34.70  ? 500 GLN C NE2 1 
ATOM   5252 N N   . HIS C 2 206 ? 0.804   42.667  -14.512 1.00 33.77  ? 501 HIS C N   1 
ATOM   5253 C CA  A HIS C 2 206 ? 1.355   41.317  -14.595 0.51 33.38  ? 501 HIS C CA  1 
ATOM   5254 C CA  B HIS C 2 206 ? 1.399   41.342  -14.591 0.49 32.44  ? 501 HIS C CA  1 
ATOM   5255 C C   . HIS C 2 206 ? 1.578   40.912  -16.048 1.00 30.87  ? 501 HIS C C   1 
ATOM   5256 O O   . HIS C 2 206 ? 2.506   40.178  -16.363 1.00 34.62  ? 501 HIS C O   1 
ATOM   5257 C CB  A HIS C 2 206 ? 0.472   40.281  -13.862 0.51 38.52  ? 501 HIS C CB  1 
ATOM   5258 C CB  B HIS C 2 206 ? 0.580   40.326  -13.791 0.49 36.52  ? 501 HIS C CB  1 
ATOM   5259 C CG  A HIS C 2 206 ? -0.766  39.878  -14.608 0.51 42.13  ? 501 HIS C CG  1 
ATOM   5260 C CG  B HIS C 2 206 ? 0.455   40.670  -12.335 0.49 38.75  ? 501 HIS C CG  1 
ATOM   5261 N ND1 A HIS C 2 206 ? -1.903  39.421  -13.966 0.51 36.51  ? 501 HIS C ND1 1 
ATOM   5262 N ND1 B HIS C 2 206 ? 1.544   41.025  -11.564 0.49 44.28  ? 501 HIS C ND1 1 
ATOM   5263 C CD2 A HIS C 2 206 ? -1.049  39.845  -15.933 0.51 45.61  ? 501 HIS C CD2 1 
ATOM   5264 C CD2 B HIS C 2 206 ? -0.619  40.713  -11.518 0.49 34.65  ? 501 HIS C CD2 1 
ATOM   5265 C CE1 A HIS C 2 206 ? -2.827  39.130  -14.870 0.51 32.66  ? 501 HIS C CE1 1 
ATOM   5266 C CE1 B HIS C 2 206 ? 1.139   41.274  -10.332 0.49 44.61  ? 501 HIS C CE1 1 
ATOM   5267 N NE2 A HIS C 2 206 ? -2.336  39.386  -16.063 0.51 39.84  ? 501 HIS C NE2 1 
ATOM   5268 N NE2 B HIS C 2 206 ? -0.165  41.093  -10.272 0.49 42.56  ? 501 HIS C NE2 1 
ATOM   5269 N N   . GLN C 2 207 ? 0.711   41.393  -16.933 1.00 28.72  ? 502 GLN C N   1 
ATOM   5270 C CA  . GLN C 2 207 ? 0.788   41.021  -18.344 1.00 35.14  ? 502 GLN C CA  1 
ATOM   5271 C C   . GLN C 2 207 ? 1.991   41.670  -18.993 1.00 31.44  ? 502 GLN C C   1 
ATOM   5272 O O   . GLN C 2 207 ? 2.734   41.023  -19.729 1.00 37.13  ? 502 GLN C O   1 
ATOM   5273 C CB  . GLN C 2 207 ? -0.490  41.421  -19.088 1.00 38.76  ? 502 GLN C CB  1 
ATOM   5274 C CG  . GLN C 2 207 ? -1.632  40.429  -18.912 1.00 38.05  ? 502 GLN C CG  1 
ATOM   5275 C CD  . GLN C 2 207 ? -2.938  40.932  -19.487 1.00 38.23  ? 502 GLN C CD  1 
ATOM   5276 O OE1 . GLN C 2 207 ? -3.981  40.296  -19.330 1.00 37.76  ? 502 GLN C OE1 1 
ATOM   5277 N NE2 . GLN C 2 207 ? -2.890  42.082  -20.153 1.00 40.11  ? 502 GLN C NE2 1 
ATOM   5278 N N   . ARG C 2 208 ? 2.184   42.954  -18.717 1.00 29.96  ? 503 ARG C N   1 
ATOM   5279 C CA  . ARG C 2 208 ? 3.278   43.692  -19.320 1.00 26.89  ? 503 ARG C CA  1 
ATOM   5280 C C   . ARG C 2 208 ? 4.609   43.202  -18.760 1.00 23.69  ? 503 ARG C C   1 
ATOM   5281 O O   . ARG C 2 208 ? 5.595   43.109  -19.486 1.00 30.34  ? 503 ARG C O   1 
ATOM   5282 C CB  . ARG C 2 208 ? 3.116   45.199  -19.087 1.00 24.56  ? 503 ARG C CB  1 
ATOM   5283 C CG  . ARG C 2 208 ? 4.218   46.020  -19.731 1.00 32.20  ? 503 ARG C CG  1 
ATOM   5284 C CD  . ARG C 2 208 ? 3.969   47.515  -19.559 1.00 30.01  ? 503 ARG C CD  1 
ATOM   5285 N NE  . ARG C 2 208 ? 4.977   48.334  -20.226 1.00 28.06  ? 503 ARG C NE  1 
ATOM   5286 C CZ  . ARG C 2 208 ? 4.960   48.632  -21.524 1.00 35.08  ? 503 ARG C CZ  1 
ATOM   5287 N NH1 . ARG C 2 208 ? 3.990   48.169  -22.300 1.00 30.70  ? 503 ARG C NH1 1 
ATOM   5288 N NH2 . ARG C 2 208 ? 5.905   49.401  -22.047 1.00 31.48  ? 503 ARG C NH2 1 
ATOM   5289 N N   . LEU C 2 209 ? 4.634   42.900  -17.466 1.00 25.93  ? 504 LEU C N   1 
ATOM   5290 C CA  . LEU C 2 209 ? 5.818   42.324  -16.846 1.00 28.59  ? 504 LEU C CA  1 
ATOM   5291 C C   . LEU C 2 209 ? 6.230   41.073  -17.601 1.00 31.03  ? 504 LEU C C   1 
ATOM   5292 O O   . LEU C 2 209 ? 7.398   40.915  -17.952 1.00 32.80  ? 504 LEU C O   1 
ATOM   5293 C CB  . LEU C 2 209 ? 5.549   41.972  -15.383 1.00 35.72  ? 504 LEU C CB  1 
ATOM   5294 C CG  . LEU C 2 209 ? 6.685   41.221  -14.677 1.00 33.54  ? 504 LEU C CG  1 
ATOM   5295 C CD1 . LEU C 2 209 ? 7.934   42.094  -14.614 1.00 30.17  ? 504 LEU C CD1 1 
ATOM   5296 C CD2 . LEU C 2 209 ? 6.273   40.790  -13.287 1.00 31.43  ? 504 LEU C CD2 1 
ATOM   5297 N N   . ALA C 2 210 ? 5.261   40.195  -17.858 1.00 28.89  ? 505 ALA C N   1 
ATOM   5298 C CA  . ALA C 2 210 ? 5.515   38.943  -18.565 1.00 27.56  ? 505 ALA C CA  1 
ATOM   5299 C C   . ALA C 2 210 ? 6.019   39.193  -19.977 1.00 28.11  ? 505 ALA C C   1 
ATOM   5300 O O   . ALA C 2 210 ? 6.969   38.556  -20.424 1.00 28.99  ? 505 ALA C O   1 
ATOM   5301 C CB  . ALA C 2 210 ? 4.242   38.093  -18.608 1.00 28.53  ? 505 ALA C CB  1 
ATOM   5302 N N   . GLN C 2 211 ? 5.382   40.129  -20.675 1.00 27.94  ? 506 GLN C N   1 
ATOM   5303 C CA  . GLN C 2 211 ? 5.741   40.414  -22.061 1.00 30.61  ? 506 GLN C CA  1 
ATOM   5304 C C   . GLN C 2 211 ? 7.177   40.908  -22.126 1.00 33.81  ? 506 GLN C C   1 
ATOM   5305 O O   . GLN C 2 211 ? 7.933   40.550  -23.030 1.00 35.39  ? 506 GLN C O   1 
ATOM   5306 C CB  . GLN C 2 211 ? 4.795   41.467  -22.654 1.00 31.32  ? 506 GLN C CB  1 
ATOM   5307 C CG  . GLN C 2 211 ? 3.320   41.045  -22.696 1.00 31.09  ? 506 GLN C CG  1 
ATOM   5308 C CD  . GLN C 2 211 ? 2.370   42.240  -22.780 1.00 42.78  ? 506 GLN C CD  1 
ATOM   5309 O OE1 . GLN C 2 211 ? 2.806   43.390  -22.821 1.00 45.80  ? 506 GLN C OE1 1 
ATOM   5310 N NE2 . GLN C 2 211 ? 1.067   41.968  -22.801 1.00 43.05  ? 506 GLN C NE2 1 
ATOM   5311 N N   . LEU C 2 212 ? 7.554   41.721  -21.147 1.00 26.88  ? 507 LEU C N   1 
ATOM   5312 C CA  . LEU C 2 212 ? 8.897   42.294  -21.126 1.00 31.55  ? 507 LEU C CA  1 
ATOM   5313 C C   . LEU C 2 212 ? 9.939   41.202  -20.894 1.00 31.18  ? 507 LEU C C   1 
ATOM   5314 O O   . LEU C 2 212 ? 10.940  41.133  -21.600 1.00 25.60  ? 507 LEU C O   1 
ATOM   5315 C CB  . LEU C 2 212 ? 9.012   43.373  -20.044 1.00 36.44  ? 507 LEU C CB  1 
ATOM   5316 C CG  . LEU C 2 212 ? 8.240   44.681  -20.256 1.00 33.43  ? 507 LEU C CG  1 
ATOM   5317 C CD1 . LEU C 2 212 ? 8.358   45.548  -19.026 1.00 23.92  ? 507 LEU C CD1 1 
ATOM   5318 C CD2 . LEU C 2 212 ? 8.750   45.426  -21.479 1.00 34.05  ? 507 LEU C CD2 1 
ATOM   5319 N N   . LEU C 2 213 ? 9.691   40.346  -19.908 1.00 23.05  ? 508 LEU C N   1 
ATOM   5320 C CA  . LEU C 2 213 ? 10.641  39.302  -19.567 1.00 27.54  ? 508 LEU C CA  1 
ATOM   5321 C C   . LEU C 2 213 ? 10.766  38.243  -20.668 1.00 27.35  ? 508 LEU C C   1 
ATOM   5322 O O   . LEU C 2 213 ? 11.844  37.681  -20.875 1.00 31.43  ? 508 LEU C O   1 
ATOM   5323 C CB  . LEU C 2 213 ? 10.274  38.655  -18.231 1.00 31.78  ? 508 LEU C CB  1 
ATOM   5324 C CG  . LEU C 2 213 ? 10.296  39.616  -17.040 1.00 32.74  ? 508 LEU C CG  1 
ATOM   5325 C CD1 . LEU C 2 213 ? 9.959   38.885  -15.745 1.00 31.47  ? 508 LEU C CD1 1 
ATOM   5326 C CD2 . LEU C 2 213 ? 11.645  40.270  -16.932 1.00 23.24  ? 508 LEU C CD2 1 
ATOM   5327 N N   . LEU C 2 214 ? 9.678   37.987  -21.385 1.00 27.39  ? 509 LEU C N   1 
ATOM   5328 C CA  . LEU C 2 214 ? 9.700   36.974  -22.439 1.00 30.73  ? 509 LEU C CA  1 
ATOM   5329 C C   . LEU C 2 214 ? 10.555  37.423  -23.621 1.00 34.42  ? 509 LEU C C   1 
ATOM   5330 O O   . LEU C 2 214 ? 11.132  36.602  -24.326 1.00 31.19  ? 509 LEU C O   1 
ATOM   5331 C CB  . LEU C 2 214 ? 8.278   36.615  -22.893 1.00 28.29  ? 509 LEU C CB  1 
ATOM   5332 C CG  . LEU C 2 214 ? 7.517   35.678  -21.949 1.00 29.38  ? 509 LEU C CG  1 
ATOM   5333 C CD1 . LEU C 2 214 ? 6.086   35.480  -22.409 1.00 30.38  ? 509 LEU C CD1 1 
ATOM   5334 C CD2 . LEU C 2 214 ? 8.235   34.337  -21.845 1.00 33.21  ? 509 LEU C CD2 1 
ATOM   5335 N N   . ILE C 2 215 ? 10.636  38.730  -23.832 1.00 29.12  ? 510 ILE C N   1 
ATOM   5336 C CA  . ILE C 2 215 ? 11.510  39.269  -24.869 1.00 32.40  ? 510 ILE C CA  1 
ATOM   5337 C C   . ILE C 2 215 ? 12.967  38.929  -24.572 1.00 30.44  ? 510 ILE C C   1 
ATOM   5338 O O   . ILE C 2 215 ? 13.777  38.804  -25.489 1.00 32.89  ? 510 ILE C O   1 
ATOM   5339 C CB  . ILE C 2 215 ? 11.329  40.794  -25.029 1.00 36.92  ? 510 ILE C CB  1 
ATOM   5340 C CG1 . ILE C 2 215 ? 9.954   41.083  -25.629 1.00 45.42  ? 510 ILE C CG1 1 
ATOM   5341 C CG2 . ILE C 2 215 ? 12.417  41.370  -25.915 1.00 34.95  ? 510 ILE C CG2 1 
ATOM   5342 C CD1 . ILE C 2 215 ? 9.437   42.478  -25.340 1.00 47.83  ? 510 ILE C CD1 1 
ATOM   5343 N N   . LEU C 2 216 ? 13.289  38.740  -23.294 1.00 24.25  ? 511 LEU C N   1 
ATOM   5344 C CA  . LEU C 2 216 ? 14.657  38.399  -22.905 1.00 23.50  ? 511 LEU C CA  1 
ATOM   5345 C C   . LEU C 2 216 ? 15.081  37.035  -23.434 1.00 31.32  ? 511 LEU C C   1 
ATOM   5346 O O   . LEU C 2 216 ? 16.256  36.817  -23.736 1.00 28.70  ? 511 LEU C O   1 
ATOM   5347 C CB  . LEU C 2 216 ? 14.837  38.477  -21.384 1.00 27.73  ? 511 LEU C CB  1 
ATOM   5348 C CG  . LEU C 2 216 ? 14.520  39.847  -20.750 1.00 34.00  ? 511 LEU C CG  1 
ATOM   5349 C CD1 . LEU C 2 216 ? 15.007  39.902  -19.304 1.00 28.23  ? 511 LEU C CD1 1 
ATOM   5350 C CD2 . LEU C 2 216 ? 15.129  40.992  -21.553 1.00 28.96  ? 511 LEU C CD2 1 
ATOM   5351 N N   . SER C 2 217 ? 14.132  36.110  -23.561 1.00 28.03  ? 512 SER C N   1 
ATOM   5352 C CA  . SER C 2 217 ? 14.454  34.825  -24.157 1.00 28.88  ? 512 SER C CA  1 
ATOM   5353 C C   . SER C 2 217 ? 14.960  35.053  -25.572 1.00 25.01  ? 512 SER C C   1 
ATOM   5354 O O   . SER C 2 217 ? 15.924  34.426  -26.005 1.00 24.64  ? 512 SER C O   1 
ATOM   5355 C CB  . SER C 2 217 ? 13.230  33.899  -24.182 1.00 34.87  ? 512 SER C CB  1 
ATOM   5356 O OG  . SER C 2 217 ? 12.929  33.421  -22.882 1.00 44.27  ? 512 SER C OG  1 
ATOM   5357 N N   . HIS C 2 218 ? 14.305  35.965  -26.286 1.00 23.47  ? 513 HIS C N   1 
ATOM   5358 C CA  . HIS C 2 218 ? 14.669  36.247  -27.670 1.00 26.67  ? 513 HIS C CA  1 
ATOM   5359 C C   . HIS C 2 218 ? 16.021  36.953  -27.760 1.00 27.88  ? 513 HIS C C   1 
ATOM   5360 O O   . HIS C 2 218 ? 16.784  36.739  -28.701 1.00 26.82  ? 513 HIS C O   1 
ATOM   5361 C CB  . HIS C 2 218 ? 13.576  37.084  -28.343 1.00 37.95  ? 513 HIS C CB  1 
ATOM   5362 C CG  . HIS C 2 218 ? 13.830  37.363  -29.793 1.00 49.22  ? 513 HIS C CG  1 
ATOM   5363 N ND1 . HIS C 2 218 ? 13.986  36.361  -30.727 1.00 55.23  ? 513 HIS C ND1 1 
ATOM   5364 C CD2 . HIS C 2 218 ? 13.934  38.531  -30.472 1.00 47.40  ? 513 HIS C CD2 1 
ATOM   5365 C CE1 . HIS C 2 218 ? 14.185  36.899  -31.918 1.00 54.06  ? 513 HIS C CE1 1 
ATOM   5366 N NE2 . HIS C 2 218 ? 14.157  38.216  -31.789 1.00 49.02  ? 513 HIS C NE2 1 
ATOM   5367 N N   . ILE C 2 219 ? 16.318  37.798  -26.779 1.00 24.92  ? 514 ILE C N   1 
ATOM   5368 C CA  . ILE C 2 219 ? 17.591  38.518  -26.780 1.00 26.94  ? 514 ILE C CA  1 
ATOM   5369 C C   . ILE C 2 219 ? 18.728  37.527  -26.550 1.00 29.52  ? 514 ILE C C   1 
ATOM   5370 O O   . ILE C 2 219 ? 19.769  37.597  -27.203 1.00 27.57  ? 514 ILE C O   1 
ATOM   5371 C CB  . ILE C 2 219 ? 17.603  39.646  -25.731 1.00 23.94  ? 514 ILE C CB  1 
ATOM   5372 C CG1 . ILE C 2 219 ? 16.629  40.754  -26.162 1.00 26.35  ? 514 ILE C CG1 1 
ATOM   5373 C CG2 . ILE C 2 219 ? 19.002  40.219  -25.569 1.00 24.17  ? 514 ILE C CG2 1 
ATOM   5374 C CD1 . ILE C 2 219 ? 16.558  41.904  -25.198 1.00 36.26  ? 514 ILE C CD1 1 
ATOM   5375 N N   . ARG C 2 220 ? 18.509  36.591  -25.634 1.00 27.82  ? 515 ARG C N   1 
ATOM   5376 C CA  . ARG C 2 220 ? 19.444  35.489  -25.420 1.00 25.56  ? 515 ARG C CA  1 
ATOM   5377 C C   . ARG C 2 220 ? 19.656  34.736  -26.724 1.00 25.77  ? 515 ARG C C   1 
ATOM   5378 O O   . ARG C 2 220 ? 20.779  34.395  -27.082 1.00 26.69  ? 515 ARG C O   1 
ATOM   5379 C CB  . ARG C 2 220 ? 18.903  34.524  -24.369 1.00 21.95  ? 515 ARG C CB  1 
ATOM   5380 C CG  . ARG C 2 220 ? 19.878  33.428  -23.988 1.00 33.95  ? 515 ARG C CG  1 
ATOM   5381 C CD  . ARG C 2 220 ? 21.145  34.031  -23.387 1.00 34.00  ? 515 ARG C CD  1 
ATOM   5382 N NE  . ARG C 2 220 ? 21.666  33.212  -22.300 1.00 52.22  ? 515 ARG C NE  1 
ATOM   5383 C CZ  . ARG C 2 220 ? 21.210  33.254  -21.054 1.00 49.55  ? 515 ARG C CZ  1 
ATOM   5384 N NH1 . ARG C 2 220 ? 20.217  34.075  -20.738 1.00 52.37  ? 515 ARG C NH1 1 
ATOM   5385 N NH2 . ARG C 2 220 ? 21.744  32.474  -20.128 1.00 48.55  ? 515 ARG C NH2 1 
ATOM   5386 N N   . HIS C 2 221 ? 18.564  34.478  -27.435 1.00 35.48  ? 516 HIS C N   1 
ATOM   5387 C CA  . HIS C 2 221 ? 18.632  33.739  -28.692 1.00 34.00  ? 516 HIS C CA  1 
ATOM   5388 C C   . HIS C 2 221 ? 19.510  34.483  -29.700 1.00 26.24  ? 516 HIS C C   1 
ATOM   5389 O O   . HIS C 2 221 ? 20.413  33.905  -30.304 1.00 26.84  ? 516 HIS C O   1 
ATOM   5390 C CB  . HIS C 2 221 ? 17.222  33.514  -29.250 1.00 29.69  ? 516 HIS C CB  1 
ATOM   5391 C CG  . HIS C 2 221 ? 17.190  32.677  -30.491 1.00 42.61  ? 516 HIS C CG  1 
ATOM   5392 N ND1 . HIS C 2 221 ? 17.260  31.301  -30.458 1.00 45.71  ? 516 HIS C ND1 1 
ATOM   5393 C CD2 . HIS C 2 221 ? 17.096  33.018  -31.797 1.00 48.32  ? 516 HIS C CD2 1 
ATOM   5394 C CE1 . HIS C 2 221 ? 17.208  30.830  -31.692 1.00 45.64  ? 516 HIS C CE1 1 
ATOM   5395 N NE2 . HIS C 2 221 ? 17.108  31.853  -32.524 1.00 49.46  ? 516 HIS C NE2 1 
ATOM   5396 N N   . MET C 2 222 ? 19.245  35.772  -29.868 1.00 30.28  ? 517 MET C N   1 
ATOM   5397 C CA  . MET C 2 222 ? 20.036  36.612  -30.774 1.00 28.74  ? 517 MET C CA  1 
ATOM   5398 C C   . MET C 2 222 ? 21.519  36.647  -30.384 1.00 27.87  ? 517 MET C C   1 
ATOM   5399 O O   . MET C 2 222 ? 22.401  36.578  -31.237 1.00 25.24  ? 517 MET C O   1 
ATOM   5400 C CB  . MET C 2 222 ? 19.463  38.030  -30.814 1.00 22.76  ? 517 MET C CB  1 
ATOM   5401 C CG  . MET C 2 222 ? 18.084  38.113  -31.426 1.00 28.39  ? 517 MET C CG  1 
ATOM   5402 S SD  . MET C 2 222 ? 17.577  39.818  -31.683 1.00 35.89  ? 517 MET C SD  1 
ATOM   5403 C CE  . MET C 2 222 ? 17.345  40.346  -29.989 1.00 26.20  ? 517 MET C CE  1 
ATOM   5404 N N   . SER C 2 223 ? 21.790  36.746  -29.090 1.00 27.70  ? 518 SER C N   1 
ATOM   5405 C CA  . SER C 2 223 ? 23.167  36.724  -28.612 1.00 30.99  ? 518 SER C CA  1 
ATOM   5406 C C   . SER C 2 223 ? 23.838  35.403  -28.986 1.00 35.55  ? 518 SER C C   1 
ATOM   5407 O O   . SER C 2 223 ? 24.987  35.382  -29.426 1.00 31.83  ? 518 SER C O   1 
ATOM   5408 C CB  . SER C 2 223 ? 23.209  36.931  -27.098 1.00 30.46  ? 518 SER C CB  1 
ATOM   5409 O OG  . SER C 2 223 ? 24.508  36.714  -26.593 1.00 34.13  ? 518 SER C OG  1 
ATOM   5410 N N   . ASN C 2 224 ? 23.118  34.299  -28.814 1.00 33.11  ? 519 ASN C N   1 
ATOM   5411 C CA  . ASN C 2 224 ? 23.669  32.997  -29.146 1.00 29.31  ? 519 ASN C CA  1 
ATOM   5412 C C   . ASN C 2 224 ? 23.965  32.864  -30.639 1.00 29.32  ? 519 ASN C C   1 
ATOM   5413 O O   . ASN C 2 224 ? 25.044  32.427  -31.014 1.00 32.41  ? 519 ASN C O   1 
ATOM   5414 C CB  . ASN C 2 224 ? 22.759  31.868  -28.644 1.00 38.14  ? 519 ASN C CB  1 
ATOM   5415 C CG  . ASN C 2 224 ? 22.919  31.612  -27.152 1.00 36.12  ? 519 ASN C CG  1 
ATOM   5416 O OD1 . ASN C 2 224 ? 23.974  31.871  -26.583 1.00 43.40  ? 519 ASN C OD1 1 
ATOM   5417 N ND2 . ASN C 2 224 ? 21.876  31.094  -26.520 1.00 38.06  ? 519 ASN C ND2 1 
ATOM   5418 N N   . LYS C 2 225 ? 23.021  33.260  -31.489 1.00 29.11  ? 520 LYS C N   1 
ATOM   5419 C CA  . LYS C 2 225 ? 23.273  33.257  -32.930 1.00 34.79  ? 520 LYS C CA  1 
ATOM   5420 C C   . LYS C 2 225 ? 24.482  34.131  -33.247 1.00 41.28  ? 520 LYS C C   1 
ATOM   5421 O O   . LYS C 2 225 ? 25.341  33.754  -34.040 1.00 38.45  ? 520 LYS C O   1 
ATOM   5422 C CB  . LYS C 2 225 ? 22.054  33.743  -33.708 1.00 34.34  ? 520 LYS C CB  1 
ATOM   5423 C CG  . LYS C 2 225 ? 20.842  32.830  -33.586 1.00 45.56  ? 520 LYS C CG  1 
ATOM   5424 C CD  . LYS C 2 225 ? 21.186  31.400  -33.983 1.00 49.92  ? 520 LYS C CD  1 
ATOM   5425 C CE  . LYS C 2 225 ? 20.818  31.124  -35.434 1.00 57.99  ? 520 LYS C CE  1 
ATOM   5426 N NZ  . LYS C 2 225 ? 21.168  29.736  -35.851 1.00 63.61  ? 520 LYS C NZ  1 
ATOM   5427 N N   . GLY C 2 226 ? 24.543  35.301  -32.617 1.00 37.66  ? 521 GLY C N   1 
ATOM   5428 C CA  . GLY C 2 226 ? 25.662  36.206  -32.806 1.00 34.45  ? 521 GLY C CA  1 
ATOM   5429 C C   . GLY C 2 226 ? 26.990  35.523  -32.528 1.00 36.91  ? 521 GLY C C   1 
ATOM   5430 O O   . GLY C 2 226 ? 27.901  35.568  -33.351 1.00 35.42  ? 521 GLY C O   1 
ATOM   5431 N N   . MET C 2 227 ? 27.093  34.886  -31.363 1.00 38.29  ? 522 MET C N   1 
ATOM   5432 C CA  . MET C 2 227 ? 28.296  34.147  -30.985 1.00 40.65  ? 522 MET C CA  1 
ATOM   5433 C C   . MET C 2 227 ? 28.597  33.057  -31.999 1.00 43.57  ? 522 MET C C   1 
ATOM   5434 O O   . MET C 2 227 ? 29.739  32.888  -32.428 1.00 46.02  ? 522 MET C O   1 
ATOM   5435 C CB  . MET C 2 227 ? 28.126  33.509  -29.607 1.00 36.67  ? 522 MET C CB  1 
ATOM   5436 C CG  . MET C 2 227 ? 28.053  34.508  -28.475 1.00 34.37  ? 522 MET C CG  1 
ATOM   5437 S SD  . MET C 2 227 ? 29.571  35.459  -28.353 1.00 45.83  ? 522 MET C SD  1 
ATOM   5438 C CE  . MET C 2 227 ? 29.352  36.192  -26.738 1.00 84.18  ? 522 MET C CE  1 
ATOM   5439 N N   . GLU C 2 228 ? 27.565  32.308  -32.362 1.00 37.69  ? 523 GLU C N   1 
ATOM   5440 C CA  . GLU C 2 228 ? 27.679  31.266  -33.371 1.00 43.70  ? 523 GLU C CA  1 
ATOM   5441 C C   . GLU C 2 228 ? 28.298  31.860  -34.633 1.00 44.78  ? 523 GLU C C   1 
ATOM   5442 O O   . GLU C 2 228 ? 29.210  31.281  -35.220 1.00 43.41  ? 523 GLU C O   1 
ATOM   5443 C CB  . GLU C 2 228 ? 26.288  30.700  -33.675 1.00 52.87  ? 523 GLU C CB  1 
ATOM   5444 C CG  . GLU C 2 228 ? 26.261  29.456  -34.543 1.00 68.03  ? 523 GLU C CG  1 
ATOM   5445 C CD  . GLU C 2 228 ? 24.844  28.949  -34.769 1.00 79.83  ? 523 GLU C CD  1 
ATOM   5446 O OE1 . GLU C 2 228 ? 24.654  28.048  -35.615 1.00 86.64  ? 523 GLU C OE1 1 
ATOM   5447 O OE2 . GLU C 2 228 ? 23.916  29.457  -34.099 1.00 78.35  ? 523 GLU C OE2 1 
ATOM   5448 N N   . HIS C 2 229 ? 27.807  33.031  -35.032 1.00 40.67  ? 524 HIS C N   1 
ATOM   5449 C CA  . HIS C 2 229 ? 28.280  33.685  -36.247 1.00 49.80  ? 524 HIS C CA  1 
ATOM   5450 C C   . HIS C 2 229 ? 29.719  34.180  -36.125 1.00 50.29  ? 524 HIS C C   1 
ATOM   5451 O O   . HIS C 2 229 ? 30.478  34.133  -37.093 1.00 55.18  ? 524 HIS C O   1 
ATOM   5452 C CB  . HIS C 2 229 ? 27.359  34.842  -36.635 1.00 60.71  ? 524 HIS C CB  1 
ATOM   5453 C CG  . HIS C 2 229 ? 27.751  35.525  -37.909 1.00 72.79  ? 524 HIS C CG  1 
ATOM   5454 N ND1 . HIS C 2 229 ? 28.426  36.726  -37.934 1.00 75.81  ? 524 HIS C ND1 1 
ATOM   5455 C CD2 . HIS C 2 229 ? 27.568  35.168  -39.202 1.00 79.90  ? 524 HIS C CD2 1 
ATOM   5456 C CE1 . HIS C 2 229 ? 28.637  37.084  -39.189 1.00 76.88  ? 524 HIS C CE1 1 
ATOM   5457 N NE2 . HIS C 2 229 ? 28.128  36.156  -39.978 1.00 79.95  ? 524 HIS C NE2 1 
ATOM   5458 N N   . LEU C 2 230 ? 30.090  34.661  -34.943 1.00 44.29  ? 525 LEU C N   1 
ATOM   5459 C CA  . LEU C 2 230 ? 31.466  35.101  -34.703 1.00 42.25  ? 525 LEU C CA  1 
ATOM   5460 C C   . LEU C 2 230 ? 32.451  33.950  -34.888 1.00 52.04  ? 525 LEU C C   1 
ATOM   5461 O O   . LEU C 2 230 ? 33.507  34.114  -35.495 1.00 58.06  ? 525 LEU C O   1 
ATOM   5462 C CB  . LEU C 2 230 ? 31.611  35.685  -33.297 1.00 47.96  ? 525 LEU C CB  1 
ATOM   5463 C CG  . LEU C 2 230 ? 30.976  37.056  -33.049 1.00 50.50  ? 525 LEU C CG  1 
ATOM   5464 C CD1 . LEU C 2 230 ? 31.094  37.452  -31.588 1.00 48.93  ? 525 LEU C CD1 1 
ATOM   5465 C CD2 . LEU C 2 230 ? 31.628  38.099  -33.937 1.00 52.28  ? 525 LEU C CD2 1 
ATOM   5466 N N   . TYR C 2 231 ? 32.101  32.781  -34.365 1.00 55.30  ? 526 TYR C N   1 
ATOM   5467 C CA  . TYR C 2 231 ? 32.982  31.625  -34.456 1.00 62.25  ? 526 TYR C CA  1 
ATOM   5468 C C   . TYR C 2 231 ? 33.137  31.139  -35.893 1.00 63.38  ? 526 TYR C C   1 
ATOM   5469 O O   . TYR C 2 231 ? 34.239  30.801  -36.319 1.00 67.54  ? 526 TYR C O   1 
ATOM   5470 C CB  . TYR C 2 231 ? 32.487  30.497  -33.551 1.00 66.21  ? 526 TYR C CB  1 
ATOM   5471 C CG  . TYR C 2 231 ? 32.805  30.709  -32.087 1.00 73.66  ? 526 TYR C CG  1 
ATOM   5472 C CD1 . TYR C 2 231 ? 33.589  29.802  -31.387 1.00 82.39  ? 526 TYR C CD1 1 
ATOM   5473 C CD2 . TYR C 2 231 ? 32.330  31.823  -31.409 1.00 76.60  ? 526 TYR C CD2 1 
ATOM   5474 C CE1 . TYR C 2 231 ? 33.880  29.994  -30.046 1.00 84.85  ? 526 TYR C CE1 1 
ATOM   5475 C CE2 . TYR C 2 231 ? 32.614  32.024  -30.074 1.00 82.04  ? 526 TYR C CE2 1 
ATOM   5476 C CZ  . TYR C 2 231 ? 33.389  31.109  -29.396 1.00 86.00  ? 526 TYR C CZ  1 
ATOM   5477 O OH  . TYR C 2 231 ? 33.672  31.314  -28.066 1.00 87.47  ? 526 TYR C OH  1 
ATOM   5478 N N   . SER C 2 232 ? 32.041  31.116  -36.644 1.00 65.49  ? 527 SER C N   1 
ATOM   5479 C CA  . SER C 2 232 ? 32.095  30.672  -38.034 1.00 74.13  ? 527 SER C CA  1 
ATOM   5480 C C   . SER C 2 232 ? 32.801  31.702  -38.914 1.00 74.90  ? 527 SER C C   1 
ATOM   5481 O O   . SER C 2 232 ? 33.282  31.376  -39.998 1.00 75.80  ? 527 SER C O   1 
ATOM   5482 C CB  . SER C 2 232 ? 30.692  30.387  -38.576 1.00 78.15  ? 527 SER C CB  1 
ATOM   5483 O OG  . SER C 2 232 ? 30.034  31.588  -38.945 1.00 80.11  ? 527 SER C OG  1 
ATOM   5484 N N   . MET C 2 233 ? 32.851  32.945  -38.444 1.00 73.42  ? 528 MET C N   1 
ATOM   5485 C CA  . MET C 2 233 ? 33.546  34.013  -39.160 1.00 72.89  ? 528 MET C CA  1 
ATOM   5486 C C   . MET C 2 233 ? 35.034  34.037  -38.830 1.00 72.80  ? 528 MET C C   1 
ATOM   5487 O O   . MET C 2 233 ? 35.769  34.901  -39.313 1.00 71.37  ? 528 MET C O   1 
ATOM   5488 C CB  . MET C 2 233 ? 32.930  35.378  -38.835 1.00 71.66  ? 528 MET C CB  1 
ATOM   5489 C CG  . MET C 2 233 ? 31.637  35.671  -39.576 1.00 72.67  ? 528 MET C CG  1 
ATOM   5490 S SD  . MET C 2 233 ? 31.809  35.426  -41.355 1.00 106.93 ? 528 MET C SD  1 
ATOM   5491 C CE  . MET C 2 233 ? 31.457  37.071  -41.967 1.00 119.84 ? 528 MET C CE  1 
ATOM   5492 N N   . LYS C 2 234 ? 35.470  33.088  -38.006 1.00 73.43  ? 529 LYS C N   1 
ATOM   5493 C CA  . LYS C 2 234 ? 36.853  33.042  -37.540 1.00 79.37  ? 529 LYS C CA  1 
ATOM   5494 C C   . LYS C 2 234 ? 37.158  34.252  -36.658 1.00 73.82  ? 529 LYS C C   1 
ATOM   5495 O O   . LYS C 2 234 ? 38.316  34.626  -36.479 1.00 71.14  ? 529 LYS C O   1 
ATOM   5496 C CB  . LYS C 2 234 ? 37.826  32.977  -38.723 1.00 82.11  ? 529 LYS C CB  1 
ATOM   5497 N N   . CYS C 2 235 ? 36.107  34.850  -36.104 1.00 75.04  ? 530 CYS C N   1 
ATOM   5498 C CA  . CYS C 2 235 ? 36.238  36.045  -35.276 1.00 71.76  ? 530 CYS C CA  1 
ATOM   5499 C C   . CYS C 2 235 ? 36.144  35.742  -33.783 1.00 69.24  ? 530 CYS C C   1 
ATOM   5500 O O   . CYS C 2 235 ? 35.649  36.565  -33.010 1.00 64.67  ? 530 CYS C O   1 
ATOM   5501 C CB  . CYS C 2 235 ? 35.169  37.075  -35.651 1.00 66.60  ? 530 CYS C CB  1 
ATOM   5502 S SG  . CYS C 2 235 ? 35.232  37.638  -37.367 1.00 90.04  ? 530 CYS C SG  1 
ATOM   5503 N N   . LYS C 2 236 ? 36.617  34.568  -33.378 1.00 70.93  ? 531 LYS C N   1 
ATOM   5504 C CA  . LYS C 2 236 ? 36.582  34.180  -31.973 1.00 77.24  ? 531 LYS C CA  1 
ATOM   5505 C C   . LYS C 2 236 ? 37.285  35.225  -31.106 1.00 78.74  ? 531 LYS C C   1 
ATOM   5506 O O   . LYS C 2 236 ? 36.976  35.378  -29.923 1.00 76.72  ? 531 LYS C O   1 
ATOM   5507 C CB  . LYS C 2 236 ? 37.250  32.816  -31.777 1.00 83.37  ? 531 LYS C CB  1 
ATOM   5508 C CG  . LYS C 2 236 ? 36.748  31.719  -32.705 1.00 87.81  ? 531 LYS C CG  1 
ATOM   5509 C CD  . LYS C 2 236 ? 37.595  30.459  -32.557 1.00 91.18  ? 531 LYS C CD  1 
ATOM   5510 C CE  . LYS C 2 236 ? 37.272  29.419  -33.625 1.00 92.29  ? 531 LYS C CE  1 
ATOM   5511 N NZ  . LYS C 2 236 ? 36.044  28.635  -33.318 1.00 91.41  ? 531 LYS C NZ  1 
ATOM   5512 N N   . ASN C 2 237 ? 38.222  35.946  -31.715 1.00 82.23  ? 532 ASN C N   1 
ATOM   5513 C CA  . ASN C 2 237 ? 39.094  36.881  -31.005 1.00 84.41  ? 532 ASN C CA  1 
ATOM   5514 C C   . ASN C 2 237 ? 38.430  38.147  -30.452 1.00 78.03  ? 532 ASN C C   1 
ATOM   5515 O O   . ASN C 2 237 ? 38.946  38.759  -29.518 1.00 75.78  ? 532 ASN C O   1 
ATOM   5516 C CB  . ASN C 2 237 ? 40.305  37.248  -31.878 1.00 93.58  ? 532 ASN C CB  1 
ATOM   5517 C CG  . ASN C 2 237 ? 39.934  37.494  -33.337 1.00 100.25 ? 532 ASN C CG  1 
ATOM   5518 O OD1 . ASN C 2 237 ? 40.808  37.613  -34.196 1.00 104.82 ? 532 ASN C OD1 1 
ATOM   5519 N ND2 . ASN C 2 237 ? 38.640  37.570  -33.621 1.00 101.53 ? 532 ASN C ND2 1 
ATOM   5520 N N   . VAL C 2 238 ? 37.290  38.535  -31.016 1.00 73.41  ? 533 VAL C N   1 
ATOM   5521 C CA  . VAL C 2 238 ? 36.641  39.779  -30.608 1.00 70.75  ? 533 VAL C CA  1 
ATOM   5522 C C   . VAL C 2 238 ? 35.849  39.616  -29.315 1.00 59.36  ? 533 VAL C C   1 
ATOM   5523 O O   . VAL C 2 238 ? 35.330  40.587  -28.761 1.00 57.62  ? 533 VAL C O   1 
ATOM   5524 C CB  . VAL C 2 238 ? 35.703  40.328  -31.700 1.00 77.93  ? 533 VAL C CB  1 
ATOM   5525 C CG1 . VAL C 2 238 ? 35.447  41.805  -31.461 1.00 80.64  ? 533 VAL C CG1 1 
ATOM   5526 C CG2 . VAL C 2 238 ? 36.307  40.117  -33.076 1.00 82.45  ? 533 VAL C CG2 1 
ATOM   5527 N N   . VAL C 2 239 ? 35.752  38.385  -28.836 1.00 49.57  ? 534 VAL C N   1 
ATOM   5528 C CA  . VAL C 2 239 ? 35.020  38.120  -27.609 1.00 49.94  ? 534 VAL C CA  1 
ATOM   5529 C C   . VAL C 2 239 ? 35.886  38.471  -26.403 1.00 50.06  ? 534 VAL C C   1 
ATOM   5530 O O   . VAL C 2 239 ? 37.044  38.061  -26.328 1.00 50.63  ? 534 VAL C O   1 
ATOM   5531 C CB  . VAL C 2 239 ? 34.592  36.646  -27.525 1.00 52.46  ? 534 VAL C CB  1 
ATOM   5532 C CG1 . VAL C 2 239 ? 33.800  36.400  -26.254 1.00 50.82  ? 534 VAL C CG1 1 
ATOM   5533 C CG2 . VAL C 2 239 ? 33.781  36.257  -28.762 1.00 48.25  ? 534 VAL C CG2 1 
ATOM   5534 N N   . PRO C 2 240 ? 35.331  39.250  -25.464 1.00 45.15  ? 535 PRO C N   1 
ATOM   5535 C CA  . PRO C 2 240 ? 36.036  39.578  -24.220 1.00 50.87  ? 535 PRO C CA  1 
ATOM   5536 C C   . PRO C 2 240 ? 36.324  38.315  -23.410 1.00 44.30  ? 535 PRO C C   1 
ATOM   5537 O O   . PRO C 2 240 ? 35.397  37.576  -23.074 1.00 51.50  ? 535 PRO C O   1 
ATOM   5538 C CB  . PRO C 2 240 ? 35.029  40.459  -23.468 1.00 47.70  ? 535 PRO C CB  1 
ATOM   5539 C CG  . PRO C 2 240 ? 34.114  40.986  -24.514 1.00 48.08  ? 535 PRO C CG  1 
ATOM   5540 C CD  . PRO C 2 240 ? 34.020  39.916  -25.552 1.00 44.31  ? 535 PRO C CD  1 
ATOM   5541 N N   . SER C 2 241 ? 37.591  38.069  -23.101 1.00 43.71  ? 536 SER C N   1 
ATOM   5542 C CA  . SER C 2 241 ? 37.962  36.890  -22.337 1.00 40.40  ? 536 SER C CA  1 
ATOM   5543 C C   . SER C 2 241 ? 37.729  37.142  -20.856 1.00 46.24  ? 536 SER C C   1 
ATOM   5544 O O   . SER C 2 241 ? 37.599  38.294  -20.425 1.00 41.06  ? 536 SER C O   1 
ATOM   5545 C CB  . SER C 2 241 ? 39.428  36.527  -22.577 1.00 45.99  ? 536 SER C CB  1 
ATOM   5546 O OG  . SER C 2 241 ? 40.295  37.482  -21.983 1.00 48.61  ? 536 SER C OG  1 
ATOM   5547 N N   . TYR C 2 242 ? 37.679  36.061  -20.084 1.00 46.34  ? 537 TYR C N   1 
ATOM   5548 C CA  . TYR C 2 242 ? 37.538  36.148  -18.635 1.00 48.06  ? 537 TYR C CA  1 
ATOM   5549 C C   . TYR C 2 242 ? 38.586  37.092  -18.041 1.00 51.18  ? 537 TYR C C   1 
ATOM   5550 O O   . TYR C 2 242 ? 38.258  38.005  -17.280 1.00 46.92  ? 537 TYR C O   1 
ATOM   5551 C CB  . TYR C 2 242 ? 37.660  34.756  -18.009 1.00 48.65  ? 537 TYR C CB  1 
ATOM   5552 C CG  . TYR C 2 242 ? 37.610  34.754  -16.496 1.00 49.90  ? 537 TYR C CG  1 
ATOM   5553 C CD1 . TYR C 2 242 ? 38.762  34.960  -15.741 1.00 51.21  ? 537 TYR C CD1 1 
ATOM   5554 C CD2 . TYR C 2 242 ? 36.414  34.534  -15.821 1.00 47.91  ? 537 TYR C CD2 1 
ATOM   5555 C CE1 . TYR C 2 242 ? 38.723  34.955  -14.357 1.00 52.36  ? 537 TYR C CE1 1 
ATOM   5556 C CE2 . TYR C 2 242 ? 36.363  34.528  -14.436 1.00 50.20  ? 537 TYR C CE2 1 
ATOM   5557 C CZ  . TYR C 2 242 ? 37.521  34.740  -13.711 1.00 57.55  ? 537 TYR C CZ  1 
ATOM   5558 O OH  . TYR C 2 242 ? 37.478  34.734  -12.336 1.00 61.73  ? 537 TYR C OH  1 
ATOM   5559 N N   . ASP C 2 243 ? 39.847  36.875  -18.405 1.00 53.32  ? 538 ASP C N   1 
ATOM   5560 C CA  . ASP C 2 243 ? 40.941  37.685  -17.872 1.00 56.20  ? 538 ASP C CA  1 
ATOM   5561 C C   . ASP C 2 243 ? 40.886  39.151  -18.310 1.00 50.23  ? 538 ASP C C   1 
ATOM   5562 O O   . ASP C 2 243 ? 41.120  40.043  -17.498 1.00 51.02  ? 538 ASP C O   1 
ATOM   5563 C CB  . ASP C 2 243 ? 42.294  37.060  -18.217 1.00 56.51  ? 538 ASP C CB  1 
ATOM   5564 C CG  . ASP C 2 243 ? 42.581  35.814  -17.398 1.00 65.72  ? 538 ASP C CG  1 
ATOM   5565 O OD1 . ASP C 2 243 ? 42.922  34.772  -17.998 1.00 66.98  ? 538 ASP C OD1 1 
ATOM   5566 O OD2 . ASP C 2 243 ? 42.452  35.872  -16.154 1.00 66.73  ? 538 ASP C OD2 1 
ATOM   5567 N N   . LEU C 2 244 ? 40.589  39.400  -19.584 1.00 47.50  ? 539 LEU C N   1 
ATOM   5568 C CA  . LEU C 2 244 ? 40.408  40.771  -20.061 1.00 49.50  ? 539 LEU C CA  1 
ATOM   5569 C C   . LEU C 2 244 ? 39.377  41.502  -19.210 1.00 46.57  ? 539 LEU C C   1 
ATOM   5570 O O   . LEU C 2 244 ? 39.600  42.632  -18.776 1.00 42.09  ? 539 LEU C O   1 
ATOM   5571 C CB  . LEU C 2 244 ? 39.962  40.795  -21.524 1.00 49.62  ? 539 LEU C CB  1 
ATOM   5572 C CG  . LEU C 2 244 ? 39.560  42.193  -22.014 1.00 52.23  ? 539 LEU C CG  1 
ATOM   5573 C CD1 . LEU C 2 244 ? 40.731  43.169  -21.889 1.00 42.25  ? 539 LEU C CD1 1 
ATOM   5574 C CD2 . LEU C 2 244 ? 39.034  42.158  -23.446 1.00 50.47  ? 539 LEU C CD2 1 
ATOM   5575 N N   . LEU C 2 245 ? 38.245  40.844  -18.984 1.00 44.21  ? 540 LEU C N   1 
ATOM   5576 C CA  . LEU C 2 245 ? 37.165  41.407  -18.186 1.00 40.69  ? 540 LEU C CA  1 
ATOM   5577 C C   . LEU C 2 245 ? 37.602  41.630  -16.743 1.00 43.13  ? 540 LEU C C   1 
ATOM   5578 O O   . LEU C 2 245 ? 37.255  42.638  -16.127 1.00 39.62  ? 540 LEU C O   1 
ATOM   5579 C CB  . LEU C 2 245 ? 35.939  40.487  -18.235 1.00 35.65  ? 540 LEU C CB  1 
ATOM   5580 C CG  . LEU C 2 245 ? 35.171  40.534  -19.555 1.00 35.81  ? 540 LEU C CG  1 
ATOM   5581 C CD1 . LEU C 2 245 ? 34.160  39.392  -19.653 1.00 34.76  ? 540 LEU C CD1 1 
ATOM   5582 C CD2 . LEU C 2 245 ? 34.479  41.885  -19.701 1.00 32.69  ? 540 LEU C CD2 1 
ATOM   5583 N N   . LEU C 2 246 ? 38.372  40.690  -16.207 1.00 45.39  ? 541 LEU C N   1 
ATOM   5584 C CA  . LEU C 2 246 ? 38.836  40.806  -14.831 1.00 45.72  ? 541 LEU C CA  1 
ATOM   5585 C C   . LEU C 2 246 ? 39.750  42.016  -14.648 1.00 48.16  ? 541 LEU C C   1 
ATOM   5586 O O   . LEU C 2 246 ? 39.671  42.712  -13.638 1.00 47.90  ? 541 LEU C O   1 
ATOM   5587 C CB  . LEU C 2 246 ? 39.539  39.525  -14.374 1.00 45.65  ? 541 LEU C CB  1 
ATOM   5588 C CG  . LEU C 2 246 ? 40.062  39.559  -12.933 1.00 48.42  ? 541 LEU C CG  1 
ATOM   5589 C CD1 . LEU C 2 246 ? 38.955  39.962  -11.961 1.00 45.93  ? 541 LEU C CD1 1 
ATOM   5590 C CD2 . LEU C 2 246 ? 40.676  38.219  -12.541 1.00 48.01  ? 541 LEU C CD2 1 
ATOM   5591 N N   . GLU C 2 247 ? 40.615  42.270  -15.623 1.00 47.62  ? 542 GLU C N   1 
ATOM   5592 C CA  . GLU C 2 247 ? 41.542  43.393  -15.512 1.00 55.12  ? 542 GLU C CA  1 
ATOM   5593 C C   . GLU C 2 247 ? 40.846  44.746  -15.683 1.00 51.62  ? 542 GLU C C   1 
ATOM   5594 O O   . GLU C 2 247 ? 41.207  45.723  -15.029 1.00 51.24  ? 542 GLU C O   1 
ATOM   5595 C CB  . GLU C 2 247 ? 42.720  43.236  -16.477 1.00 62.67  ? 542 GLU C CB  1 
ATOM   5596 C CG  . GLU C 2 247 ? 42.361  42.644  -17.826 1.00 71.18  ? 542 GLU C CG  1 
ATOM   5597 C CD  . GLU C 2 247 ? 43.514  41.868  -18.448 1.00 84.75  ? 542 GLU C CD  1 
ATOM   5598 O OE1 . GLU C 2 247 ? 44.251  42.451  -19.276 1.00 89.34  ? 542 GLU C OE1 1 
ATOM   5599 O OE2 . GLU C 2 247 ? 43.685  40.675  -18.106 1.00 87.18  ? 542 GLU C OE2 1 
ATOM   5600 N N   . MET C 2 248 ? 39.838  44.792  -16.548 1.00 49.42  ? 543 MET C N   1 
ATOM   5601 C CA  . MET C 2 248 ? 39.053  46.010  -16.737 1.00 54.17  ? 543 MET C CA  1 
ATOM   5602 C C   . MET C 2 248 ? 38.282  46.362  -15.474 1.00 50.65  ? 543 MET C C   1 
ATOM   5603 O O   . MET C 2 248 ? 38.190  47.531  -15.099 1.00 51.80  ? 543 MET C O   1 
ATOM   5604 C CB  . MET C 2 248 ? 38.087  45.863  -17.913 1.00 52.91  ? 543 MET C CB  1 
ATOM   5605 C CG  . MET C 2 248 ? 38.781  45.799  -19.262 1.00 59.45  ? 543 MET C CG  1 
ATOM   5606 S SD  . MET C 2 248 ? 37.665  45.857  -20.684 1.00 66.67  ? 543 MET C SD  1 
ATOM   5607 C CE  . MET C 2 248 ? 36.963  44.217  -20.604 1.00 114.88 ? 543 MET C CE  1 
ATOM   5608 N N   . LEU C 2 249 ? 37.724  45.346  -14.824 1.00 43.46  ? 544 LEU C N   1 
ATOM   5609 C CA  . LEU C 2 249 ? 36.995  45.545  -13.577 1.00 47.18  ? 544 LEU C CA  1 
ATOM   5610 C C   . LEU C 2 249 ? 37.917  46.043  -12.475 1.00 50.62  ? 544 LEU C C   1 
ATOM   5611 O O   . LEU C 2 249 ? 37.586  46.985  -11.756 1.00 52.20  ? 544 LEU C O   1 
ATOM   5612 C CB  . LEU C 2 249 ? 36.315  44.247  -13.143 1.00 47.94  ? 544 LEU C CB  1 
ATOM   5613 C CG  . LEU C 2 249 ? 35.032  43.904  -13.899 1.00 49.50  ? 544 LEU C CG  1 
ATOM   5614 C CD1 . LEU C 2 249 ? 34.771  42.410  -13.876 1.00 52.94  ? 544 LEU C CD1 1 
ATOM   5615 C CD2 . LEU C 2 249 ? 33.847  44.674  -13.320 1.00 45.35  ? 544 LEU C CD2 1 
ATOM   5616 N N   . ASP C 2 250 ? 39.078  45.409  -12.354 1.00 54.94  ? 545 ASP C N   1 
ATOM   5617 C CA  . ASP C 2 250 ? 40.045  45.754  -11.313 1.00 68.73  ? 545 ASP C CA  1 
ATOM   5618 C C   . ASP C 2 250 ? 40.565  47.190  -11.398 1.00 73.45  ? 545 ASP C C   1 
ATOM   5619 O O   . ASP C 2 250 ? 41.099  47.717  -10.422 1.00 80.74  ? 545 ASP C O   1 
ATOM   5620 C CB  . ASP C 2 250 ? 41.212  44.765  -11.325 1.00 79.67  ? 545 ASP C CB  1 
ATOM   5621 C CG  . ASP C 2 250 ? 40.784  43.357  -10.948 1.00 88.80  ? 545 ASP C CG  1 
ATOM   5622 O OD1 . ASP C 2 250 ? 39.706  43.211  -10.327 1.00 84.68  ? 545 ASP C OD1 1 
ATOM   5623 O OD2 . ASP C 2 250 ? 41.522  42.398  -11.273 1.00 93.59  ? 545 ASP C OD2 1 
ATOM   5624 N N   . ALA C 2 251 ? 40.406  47.818  -12.559 1.00 74.58  ? 546 ALA C N   1 
ATOM   5625 C CA  . ALA C 2 251 ? 40.880  49.185  -12.765 1.00 83.37  ? 546 ALA C CA  1 
ATOM   5626 C C   . ALA C 2 251 ? 40.219  50.176  -11.808 1.00 91.39  ? 546 ALA C C   1 
ATOM   5627 O O   . ALA C 2 251 ? 40.751  50.470  -10.736 1.00 99.21  ? 546 ALA C O   1 
ATOM   5628 C CB  . ALA C 2 251 ? 40.660  49.615  -14.207 1.00 80.50  ? 546 ALA C CB  1 
ATOM   5629 N N   . SER D 2 10  ? 23.375  8.112   -92.188 1.00 106.28 ? 305 SER D N   1 
ATOM   5630 C CA  . SER D 2 10  ? 22.655  7.165   -93.033 1.00 106.14 ? 305 SER D CA  1 
ATOM   5631 C C   . SER D 2 10  ? 22.941  5.713   -92.661 1.00 99.68  ? 305 SER D C   1 
ATOM   5632 O O   . SER D 2 10  ? 23.515  4.954   -93.440 1.00 102.51 ? 305 SER D O   1 
ATOM   5633 C CB  . SER D 2 10  ? 22.945  7.413   -94.517 1.00 111.72 ? 305 SER D CB  1 
ATOM   5634 O OG  . SER D 2 10  ? 24.317  7.689   -94.732 1.00 117.09 ? 305 SER D OG  1 
ATOM   5635 N N   . LEU D 2 11  ? 22.557  5.352   -91.444 1.00 85.81  ? 306 LEU D N   1 
ATOM   5636 C CA  . LEU D 2 11  ? 22.422  3.958   -91.045 1.00 77.20  ? 306 LEU D CA  1 
ATOM   5637 C C   . LEU D 2 11  ? 21.415  3.937   -89.909 1.00 66.07  ? 306 LEU D C   1 
ATOM   5638 O O   . LEU D 2 11  ? 20.432  3.196   -89.940 1.00 62.11  ? 306 LEU D O   1 
ATOM   5639 C CB  . LEU D 2 11  ? 23.762  3.374   -90.591 1.00 81.53  ? 306 LEU D CB  1 
ATOM   5640 C CG  . LEU D 2 11  ? 24.495  4.103   -89.448 1.00 89.81  ? 306 LEU D CG  1 
ATOM   5641 C CD1 . LEU D 2 11  ? 25.879  3.511   -89.225 1.00 88.38  ? 306 LEU D CD1 1 
ATOM   5642 C CD2 . LEU D 2 11  ? 24.605  5.607   -89.697 1.00 88.36  ? 306 LEU D CD2 1 
ATOM   5643 N N   . ALA D 2 12  ? 21.665  4.784   -88.915 1.00 51.79  ? 307 ALA D N   1 
ATOM   5644 C CA  . ALA D 2 12  ? 20.767  4.942   -87.786 1.00 46.47  ? 307 ALA D CA  1 
ATOM   5645 C C   . ALA D 2 12  ? 19.405  5.432   -88.251 1.00 45.06  ? 307 ALA D C   1 
ATOM   5646 O O   . ALA D 2 12  ? 18.378  5.087   -87.672 1.00 44.79  ? 307 ALA D O   1 
ATOM   5647 C CB  . ALA D 2 12  ? 21.365  5.920   -86.786 1.00 47.52  ? 307 ALA D CB  1 
ATOM   5648 N N   . LEU D 2 13  ? 19.404  6.244   -89.304 1.00 52.78  ? 308 LEU D N   1 
ATOM   5649 C CA  . LEU D 2 13  ? 18.177  6.868   -89.780 1.00 50.26  ? 308 LEU D CA  1 
ATOM   5650 C C   . LEU D 2 13  ? 17.289  5.882   -90.519 1.00 49.28  ? 308 LEU D C   1 
ATOM   5651 O O   . LEU D 2 13  ? 16.120  6.164   -90.769 1.00 53.31  ? 308 LEU D O   1 
ATOM   5652 C CB  . LEU D 2 13  ? 18.493  8.070   -90.673 1.00 47.34  ? 308 LEU D CB  1 
ATOM   5653 C CG  . LEU D 2 13  ? 19.333  9.158   -89.998 1.00 55.57  ? 308 LEU D CG  1 
ATOM   5654 C CD1 . LEU D 2 13  ? 19.507  10.359  -90.912 1.00 56.68  ? 308 LEU D CD1 1 
ATOM   5655 C CD2 . LEU D 2 13  ? 18.700  9.573   -88.678 1.00 55.49  ? 308 LEU D CD2 1 
ATOM   5656 N N   . SER D 2 14  ? 17.842  4.722   -90.862 1.00 52.74  ? 309 SER D N   1 
ATOM   5657 C CA  . SER D 2 14  ? 17.081  3.709   -91.590 1.00 52.08  ? 309 SER D CA  1 
ATOM   5658 C C   . SER D 2 14  ? 16.504  2.634   -90.674 1.00 47.99  ? 309 SER D C   1 
ATOM   5659 O O   . SER D 2 14  ? 15.644  1.859   -91.090 1.00 51.00  ? 309 SER D O   1 
ATOM   5660 C CB  . SER D 2 14  ? 17.940  3.060   -92.677 1.00 52.59  ? 309 SER D CB  1 
ATOM   5661 O OG  . SER D 2 14  ? 18.854  2.133   -92.118 1.00 59.26  ? 309 SER D OG  1 
ATOM   5662 N N   . LEU D 2 15  ? 16.972  2.594   -89.431 1.00 42.57  ? 310 LEU D N   1 
ATOM   5663 C CA  . LEU D 2 15  ? 16.530  1.569   -88.485 1.00 40.48  ? 310 LEU D CA  1 
ATOM   5664 C C   . LEU D 2 15  ? 15.037  1.654   -88.210 1.00 40.75  ? 310 LEU D C   1 
ATOM   5665 O O   . LEU D 2 15  ? 14.474  2.740   -88.153 1.00 40.81  ? 310 LEU D O   1 
ATOM   5666 C CB  . LEU D 2 15  ? 17.290  1.693   -87.161 1.00 33.97  ? 310 LEU D CB  1 
ATOM   5667 C CG  . LEU D 2 15  ? 18.789  1.396   -87.199 1.00 36.31  ? 310 LEU D CG  1 
ATOM   5668 C CD1 . LEU D 2 15  ? 19.393  1.529   -85.812 1.00 38.32  ? 310 LEU D CD1 1 
ATOM   5669 C CD2 . LEU D 2 15  ? 19.017  0.008   -87.735 1.00 36.20  ? 310 LEU D CD2 1 
ATOM   5670 N N   . THR D 2 16  ? 14.393  0.502   -88.046 1.00 40.91  ? 311 THR D N   1 
ATOM   5671 C CA  . THR D 2 16  ? 13.014  0.470   -87.579 1.00 40.74  ? 311 THR D CA  1 
ATOM   5672 C C   . THR D 2 16  ? 13.020  0.586   -86.058 1.00 40.41  ? 311 THR D C   1 
ATOM   5673 O O   . THR D 2 16  ? 14.071  0.457   -85.424 1.00 37.23  ? 311 THR D O   1 
ATOM   5674 C CB  . THR D 2 16  ? 12.337  -0.850  -87.937 1.00 41.72  ? 311 THR D CB  1 
ATOM   5675 O OG1 . THR D 2 16  ? 13.052  -1.921  -87.306 1.00 36.58  ? 311 THR D OG1 1 
ATOM   5676 C CG2 . THR D 2 16  ? 12.334  -1.061  -89.446 1.00 39.74  ? 311 THR D CG2 1 
ATOM   5677 N N   . ALA D 2 17  ? 11.846  0.820   -85.482 1.00 37.00  ? 312 ALA D N   1 
ATOM   5678 C CA  . ALA D 2 17  ? 11.688  0.857   -84.036 1.00 35.75  ? 312 ALA D CA  1 
ATOM   5679 C C   . ALA D 2 17  ? 12.232  -0.406  -83.365 1.00 38.75  ? 312 ALA D C   1 
ATOM   5680 O O   . ALA D 2 17  ? 12.874  -0.327  -82.317 1.00 37.64  ? 312 ALA D O   1 
ATOM   5681 C CB  . ALA D 2 17  ? 10.228  1.052   -83.677 1.00 42.66  ? 312 ALA D CB  1 
ATOM   5682 N N   . ASP D 2 18  ? 11.973  -1.567  -83.964 1.00 32.42  ? 313 ASP D N   1 
ATOM   5683 C CA  . ASP D 2 18  ? 12.440  -2.834  -83.404 1.00 36.35  ? 313 ASP D CA  1 
ATOM   5684 C C   . ASP D 2 18  ? 13.963  -2.952  -83.452 1.00 35.24  ? 313 ASP D C   1 
ATOM   5685 O O   . ASP D 2 18  ? 14.592  -3.348  -82.474 1.00 37.21  ? 313 ASP D O   1 
ATOM   5686 C CB  . ASP D 2 18  ? 11.773  -4.030  -84.106 1.00 37.47  ? 313 ASP D CB  1 
ATOM   5687 C CG  . ASP D 2 18  ? 10.286  -4.154  -83.774 1.00 51.58  ? 313 ASP D CG  1 
ATOM   5688 O OD1 . ASP D 2 18  ? 9.602   -4.992  -84.402 1.00 52.95  ? 313 ASP D OD1 1 
ATOM   5689 O OD2 . ASP D 2 18  ? 9.804   -3.413  -82.889 1.00 59.32  ? 313 ASP D OD2 1 
ATOM   5690 N N   . GLN D 2 19  ? 14.553  -2.595  -84.587 1.00 32.34  ? 314 GLN D N   1 
ATOM   5691 C CA  . GLN D 2 19  ? 16.007  -2.606  -84.722 1.00 31.39  ? 314 GLN D CA  1 
ATOM   5692 C C   . GLN D 2 19  ? 16.692  -1.659  -83.733 1.00 37.93  ? 314 GLN D C   1 
ATOM   5693 O O   . GLN D 2 19  ? 17.750  -1.974  -83.178 1.00 37.56  ? 314 GLN D O   1 
ATOM   5694 C CB  . GLN D 2 19  ? 16.416  -2.222  -86.136 1.00 32.95  ? 314 GLN D CB  1 
ATOM   5695 C CG  . GLN D 2 19  ? 16.088  -3.255  -87.190 1.00 38.99  ? 314 GLN D CG  1 
ATOM   5696 C CD  . GLN D 2 19  ? 16.384  -2.736  -88.577 1.00 49.84  ? 314 GLN D CD  1 
ATOM   5697 O OE1 . GLN D 2 19  ? 16.058  -1.593  -88.908 1.00 47.54  ? 314 GLN D OE1 1 
ATOM   5698 N NE2 . GLN D 2 19  ? 17.019  -3.565  -89.395 1.00 54.75  ? 314 GLN D NE2 1 
ATOM   5699 N N   . MET D 2 20  ? 16.101  -0.487  -83.534 1.00 32.75  ? 315 MET D N   1 
ATOM   5700 C CA  . MET D 2 20  ? 16.661  0.491   -82.616 1.00 31.56  ? 315 MET D CA  1 
ATOM   5701 C C   . MET D 2 20  ? 16.692  -0.081  -81.198 1.00 31.71  ? 315 MET D C   1 
ATOM   5702 O O   . MET D 2 20  ? 17.696  0.027   -80.490 1.00 29.54  ? 315 MET D O   1 
ATOM   5703 C CB  . MET D 2 20  ? 15.842  1.790   -82.655 1.00 34.31  ? 315 MET D CB  1 
ATOM   5704 C CG  . MET D 2 20  ? 16.289  2.854   -81.644 1.00 39.25  ? 315 MET D CG  1 
ATOM   5705 S SD  . MET D 2 20  ? 17.803  3.736   -82.105 1.00 48.33  ? 315 MET D SD  1 
ATOM   5706 C CE  . MET D 2 20  ? 17.276  4.519   -83.632 1.00 32.72  ? 315 MET D CE  1 
ATOM   5707 N N   . VAL D 2 21  ? 15.585  -0.689  -80.788 1.00 32.01  ? 316 VAL D N   1 
ATOM   5708 C CA  . VAL D 2 21  ? 15.486  -1.280  -79.457 1.00 36.50  ? 316 VAL D CA  1 
ATOM   5709 C C   . VAL D 2 21  ? 16.491  -2.412  -79.294 1.00 38.75  ? 316 VAL D C   1 
ATOM   5710 O O   . VAL D 2 21  ? 17.209  -2.486  -78.297 1.00 35.29  ? 316 VAL D O   1 
ATOM   5711 C CB  . VAL D 2 21  ? 14.085  -1.846  -79.203 1.00 42.11  ? 316 VAL D CB  1 
ATOM   5712 C CG1 . VAL D 2 21  ? 14.071  -2.651  -77.915 1.00 41.22  ? 316 VAL D CG1 1 
ATOM   5713 C CG2 . VAL D 2 21  ? 13.055  -0.723  -79.159 1.00 43.83  ? 316 VAL D CG2 1 
ATOM   5714 N N   . SER D 2 22  ? 16.517  -3.301  -80.282 1.00 38.75  ? 317 SER D N   1 
ATOM   5715 C CA  . SER D 2 22  ? 17.449  -4.417  -80.293 1.00 41.97  ? 317 SER D CA  1 
ATOM   5716 C C   . SER D 2 22  ? 18.898  -3.947  -80.150 1.00 39.65  ? 317 SER D C   1 
ATOM   5717 O O   . SER D 2 22  ? 19.656  -4.470  -79.330 1.00 41.90  ? 317 SER D O   1 
ATOM   5718 C CB  . SER D 2 22  ? 17.286  -5.223  -81.582 1.00 47.99  ? 317 SER D CB  1 
ATOM   5719 O OG  . SER D 2 22  ? 18.407  -6.066  -81.786 1.00 54.93  ? 317 SER D OG  1 
ATOM   5720 N N   . ALA D 2 23  ? 19.283  -2.963  -80.956 1.00 35.40  ? 318 ALA D N   1 
ATOM   5721 C CA  . ALA D 2 23  ? 20.628  -2.398  -80.878 1.00 33.52  ? 318 ALA D CA  1 
ATOM   5722 C C   . ALA D 2 23  ? 20.918  -1.869  -79.479 1.00 36.36  ? 318 ALA D C   1 
ATOM   5723 O O   . ALA D 2 23  ? 21.988  -2.114  -78.915 1.00 40.64  ? 318 ALA D O   1 
ATOM   5724 C CB  . ALA D 2 23  ? 20.795  -1.281  -81.901 1.00 34.42  ? 318 ALA D CB  1 
ATOM   5725 N N   . LEU D 2 24  ? 19.955  -1.151  -78.914 1.00 35.97  ? 319 LEU D N   1 
ATOM   5726 C CA  . LEU D 2 24  ? 20.141  -0.539  -77.602 1.00 38.10  ? 319 LEU D CA  1 
ATOM   5727 C C   . LEU D 2 24  ? 20.221  -1.584  -76.487 1.00 36.64  ? 319 LEU D C   1 
ATOM   5728 O O   . LEU D 2 24  ? 21.058  -1.480  -75.594 1.00 28.05  ? 319 LEU D O   1 
ATOM   5729 C CB  . LEU D 2 24  ? 19.029  0.476   -77.324 1.00 36.87  ? 319 LEU D CB  1 
ATOM   5730 C CG  . LEU D 2 24  ? 19.095  1.736   -78.195 1.00 36.31  ? 319 LEU D CG  1 
ATOM   5731 C CD1 . LEU D 2 24  ? 18.047  2.732   -77.761 1.00 33.06  ? 319 LEU D CD1 1 
ATOM   5732 C CD2 . LEU D 2 24  ? 20.484  2.358   -78.110 1.00 40.35  ? 319 LEU D CD2 1 
ATOM   5733 N N   . LEU D 2 25  ? 19.350  -2.589  -76.541 1.00 34.32  ? 320 LEU D N   1 
ATOM   5734 C CA  . LEU D 2 25  ? 19.392  -3.660  -75.554 1.00 36.58  ? 320 LEU D CA  1 
ATOM   5735 C C   . LEU D 2 25  ? 20.729  -4.384  -75.639 1.00 42.36  ? 320 LEU D C   1 
ATOM   5736 O O   . LEU D 2 25  ? 21.330  -4.722  -74.618 1.00 48.09  ? 320 LEU D O   1 
ATOM   5737 C CB  . LEU D 2 25  ? 18.234  -4.639  -75.755 1.00 34.25  ? 320 LEU D CB  1 
ATOM   5738 C CG  . LEU D 2 25  ? 16.827  -4.117  -75.450 1.00 36.23  ? 320 LEU D CG  1 
ATOM   5739 C CD1 . LEU D 2 25  ? 15.764  -5.123  -75.870 1.00 34.22  ? 320 LEU D CD1 1 
ATOM   5740 C CD2 . LEU D 2 25  ? 16.686  -3.777  -73.973 1.00 37.56  ? 320 LEU D CD2 1 
ATOM   5741 N N   . ASP D 2 26  ? 21.198  -4.602  -76.863 1.00 41.66  ? 321 ASP D N   1 
ATOM   5742 C CA  . ASP D 2 26  ? 22.467  -5.287  -77.093 1.00 45.21  ? 321 ASP D CA  1 
ATOM   5743 C C   . ASP D 2 26  ? 23.653  -4.506  -76.541 1.00 42.04  ? 321 ASP D C   1 
ATOM   5744 O O   . ASP D 2 26  ? 24.670  -5.087  -76.162 1.00 45.75  ? 321 ASP D O   1 
ATOM   5745 C CB  . ASP D 2 26  ? 22.674  -5.553  -78.590 1.00 56.65  ? 321 ASP D CB  1 
ATOM   5746 C CG  . ASP D 2 26  ? 21.800  -6.682  -79.113 1.00 66.10  ? 321 ASP D CG  1 
ATOM   5747 O OD1 . ASP D 2 26  ? 21.063  -7.296  -78.311 1.00 59.98  ? 321 ASP D OD1 1 
ATOM   5748 O OD2 . ASP D 2 26  ? 21.852  -6.953  -80.333 1.00 75.33  ? 321 ASP D OD2 1 
ATOM   5749 N N   . ALA D 2 27  ? 23.524  -3.188  -76.495 1.00 38.16  ? 322 ALA D N   1 
ATOM   5750 C CA  . ALA D 2 27  ? 24.638  -2.340  -76.079 1.00 40.35  ? 322 ALA D CA  1 
ATOM   5751 C C   . ALA D 2 27  ? 24.714  -2.144  -74.565 1.00 39.13  ? 322 ALA D C   1 
ATOM   5752 O O   . ALA D 2 27  ? 25.700  -1.608  -74.060 1.00 36.72  ? 322 ALA D O   1 
ATOM   5753 C CB  . ALA D 2 27  ? 24.567  -0.994  -76.784 1.00 32.86  ? 322 ALA D CB  1 
ATOM   5754 N N   . GLU D 2 28  ? 23.678  -2.571  -73.846 1.00 35.70  ? 323 GLU D N   1 
ATOM   5755 C CA  . GLU D 2 28  ? 23.606  -2.336  -72.402 1.00 33.69  ? 323 GLU D CA  1 
ATOM   5756 C C   . GLU D 2 28  ? 24.876  -2.783  -71.699 1.00 33.84  ? 323 GLU D C   1 
ATOM   5757 O O   . GLU D 2 28  ? 25.339  -3.890  -71.916 1.00 32.84  ? 323 GLU D O   1 
ATOM   5758 C CB  . GLU D 2 28  ? 22.414  -3.067  -71.783 1.00 28.24  ? 323 GLU D CB  1 
ATOM   5759 C CG  . GLU D 2 28  ? 21.123  -2.277  -71.785 1.00 36.18  ? 323 GLU D CG  1 
ATOM   5760 C CD  . GLU D 2 28  ? 21.214  -1.041  -70.917 1.00 38.38  ? 323 GLU D CD  1 
ATOM   5761 O OE1 . GLU D 2 28  ? 20.892  -1.126  -69.713 1.00 42.62  ? 323 GLU D OE1 1 
ATOM   5762 O OE2 . GLU D 2 28  ? 21.617  0.016   -71.441 1.00 30.31  ? 323 GLU D OE2 1 
ATOM   5763 N N   . PRO D 2 29  ? 25.430  -1.925  -70.832 1.00 31.73  ? 324 PRO D N   1 
ATOM   5764 C CA  . PRO D 2 29  ? 26.594  -2.337  -70.048 1.00 33.22  ? 324 PRO D CA  1 
ATOM   5765 C C   . PRO D 2 29  ? 26.150  -3.341  -68.995 1.00 33.76  ? 324 PRO D C   1 
ATOM   5766 O O   . PRO D 2 29  ? 24.962  -3.425  -68.691 1.00 33.78  ? 324 PRO D O   1 
ATOM   5767 C CB  . PRO D 2 29  ? 27.048  -1.039  -69.365 1.00 27.83  ? 324 PRO D CB  1 
ATOM   5768 C CG  . PRO D 2 29  ? 26.024  0.022   -69.742 1.00 39.13  ? 324 PRO D CG  1 
ATOM   5769 C CD  . PRO D 2 29  ? 24.851  -0.670  -70.337 1.00 30.58  ? 324 PRO D CD  1 
ATOM   5770 N N   . PRO D 2 30  ? 27.093  -4.102  -68.437 1.00 37.98  ? 325 PRO D N   1 
ATOM   5771 C CA  . PRO D 2 30  ? 26.710  -5.024  -67.369 1.00 35.03  ? 325 PRO D CA  1 
ATOM   5772 C C   . PRO D 2 30  ? 26.529  -4.269  -66.060 1.00 34.76  ? 325 PRO D C   1 
ATOM   5773 O O   . PRO D 2 30  ? 26.944  -3.116  -65.962 1.00 28.85  ? 325 PRO D O   1 
ATOM   5774 C CB  . PRO D 2 30  ? 27.920  -5.956  -67.276 1.00 39.99  ? 325 PRO D CB  1 
ATOM   5775 C CG  . PRO D 2 30  ? 29.069  -5.112  -67.701 1.00 39.68  ? 325 PRO D CG  1 
ATOM   5776 C CD  . PRO D 2 30  ? 28.532  -4.170  -68.747 1.00 41.27  ? 325 PRO D CD  1 
ATOM   5777 N N   . ILE D 2 31  ? 25.918  -4.906  -65.067 1.00 32.98  ? 326 ILE D N   1 
ATOM   5778 C CA  . ILE D 2 31  ? 25.796  -4.300  -63.742 1.00 31.66  ? 326 ILE D CA  1 
ATOM   5779 C C   . ILE D 2 31  ? 27.024  -4.668  -62.920 1.00 38.74  ? 326 ILE D C   1 
ATOM   5780 O O   . ILE D 2 31  ? 27.249  -5.842  -62.630 1.00 39.78  ? 326 ILE D O   1 
ATOM   5781 C CB  . ILE D 2 31  ? 24.533  -4.788  -63.020 1.00 35.83  ? 326 ILE D CB  1 
ATOM   5782 C CG1 . ILE D 2 31  ? 23.281  -4.335  -63.781 1.00 40.89  ? 326 ILE D CG1 1 
ATOM   5783 C CG2 . ILE D 2 31  ? 24.504  -4.275  -61.585 1.00 38.17  ? 326 ILE D CG2 1 
ATOM   5784 C CD1 . ILE D 2 31  ? 22.004  -5.019  -63.313 1.00 41.87  ? 326 ILE D CD1 1 
ATOM   5785 N N   . LEU D 2 32  ? 27.827  -3.674  -62.557 1.00 33.84  ? 327 LEU D N   1 
ATOM   5786 C CA  . LEU D 2 32  ? 29.077  -3.943  -61.849 1.00 40.44  ? 327 LEU D CA  1 
ATOM   5787 C C   . LEU D 2 32  ? 28.886  -4.069  -60.338 1.00 37.86  ? 327 LEU D C   1 
ATOM   5788 O O   . LEU D 2 32  ? 27.923  -3.549  -59.780 1.00 32.01  ? 327 LEU D O   1 
ATOM   5789 C CB  . LEU D 2 32  ? 30.110  -2.862  -62.169 1.00 40.21  ? 327 LEU D CB  1 
ATOM   5790 C CG  . LEU D 2 32  ? 30.346  -2.627  -63.661 1.00 38.34  ? 327 LEU D CG  1 
ATOM   5791 C CD1 . LEU D 2 32  ? 31.527  -1.686  -63.865 1.00 37.76  ? 327 LEU D CD1 1 
ATOM   5792 C CD2 . LEU D 2 32  ? 30.569  -3.959  -64.386 1.00 34.13  ? 327 LEU D CD2 1 
ATOM   5793 N N   . TYR D 2 33  ? 29.803  -4.774  -59.683 1.00 38.82  ? 328 TYR D N   1 
ATOM   5794 C CA  . TYR D 2 33  ? 29.796  -4.869  -58.227 1.00 35.98  ? 328 TYR D CA  1 
ATOM   5795 C C   . TYR D 2 33  ? 30.744  -3.853  -57.604 1.00 35.70  ? 328 TYR D C   1 
ATOM   5796 O O   . TYR D 2 33  ? 31.801  -3.563  -58.156 1.00 39.14  ? 328 TYR D O   1 
ATOM   5797 C CB  . TYR D 2 33  ? 30.205  -6.275  -57.778 1.00 42.41  ? 328 TYR D CB  1 
ATOM   5798 C CG  . TYR D 2 33  ? 29.090  -7.293  -57.845 1.00 42.34  ? 328 TYR D CG  1 
ATOM   5799 C CD1 . TYR D 2 33  ? 28.618  -7.756  -59.067 1.00 38.08  ? 328 TYR D CD1 1 
ATOM   5800 C CD2 . TYR D 2 33  ? 28.518  -7.799  -56.686 1.00 41.53  ? 328 TYR D CD2 1 
ATOM   5801 C CE1 . TYR D 2 33  ? 27.606  -8.693  -59.132 1.00 37.06  ? 328 TYR D CE1 1 
ATOM   5802 C CE2 . TYR D 2 33  ? 27.504  -8.732  -56.742 1.00 35.15  ? 328 TYR D CE2 1 
ATOM   5803 C CZ  . TYR D 2 33  ? 27.051  -9.171  -57.965 1.00 37.70  ? 328 TYR D CZ  1 
ATOM   5804 O OH  . TYR D 2 33  ? 26.040  -10.099 -58.019 1.00 49.15  ? 328 TYR D OH  1 
ATOM   5805 N N   . SER D 2 34  ? 30.362  -3.320  -56.451 1.00 38.99  ? 329 SER D N   1 
ATOM   5806 C CA  . SER D 2 34  ? 31.254  -2.476  -55.680 1.00 50.51  ? 329 SER D CA  1 
ATOM   5807 C C   . SER D 2 34  ? 32.382  -3.343  -55.139 1.00 64.72  ? 329 SER D C   1 
ATOM   5808 O O   . SER D 2 34  ? 32.124  -4.351  -54.487 1.00 63.67  ? 329 SER D O   1 
ATOM   5809 C CB  . SER D 2 34  ? 30.492  -1.846  -54.517 1.00 55.74  ? 329 SER D CB  1 
ATOM   5810 O OG  . SER D 2 34  ? 31.378  -1.244  -53.592 1.00 61.89  ? 329 SER D OG  1 
ATOM   5811 N N   . GLU D 2 35  ? 33.632  -2.973  -55.404 1.00 78.46  ? 330 GLU D N   1 
ATOM   5812 C CA  . GLU D 2 35  ? 34.735  -3.756  -54.854 1.00 86.95  ? 330 GLU D CA  1 
ATOM   5813 C C   . GLU D 2 35  ? 35.171  -3.258  -53.472 1.00 94.73  ? 330 GLU D C   1 
ATOM   5814 O O   . GLU D 2 35  ? 36.146  -2.524  -53.336 1.00 99.54  ? 330 GLU D O   1 
ATOM   5815 C CB  . GLU D 2 35  ? 35.919  -3.909  -55.824 1.00 85.92  ? 330 GLU D CB  1 
ATOM   5816 C CG  . GLU D 2 35  ? 36.536  -2.636  -56.382 1.00 87.40  ? 330 GLU D CG  1 
ATOM   5817 C CD  . GLU D 2 35  ? 37.692  -2.934  -57.337 1.00 85.59  ? 330 GLU D CD  1 
ATOM   5818 O OE1 . GLU D 2 35  ? 37.937  -2.131  -58.265 1.00 85.11  ? 330 GLU D OE1 1 
ATOM   5819 O OE2 . GLU D 2 35  ? 38.352  -3.983  -57.161 1.00 80.96  ? 330 GLU D OE2 1 
ATOM   5820 N N   . TYR D 2 36  ? 34.395  -3.660  -52.464 1.00 100.94 ? 331 TYR D N   1 
ATOM   5821 C CA  . TYR D 2 36  ? 34.686  -3.469  -51.035 1.00 107.25 ? 331 TYR D CA  1 
ATOM   5822 C C   . TYR D 2 36  ? 33.407  -3.220  -50.219 1.00 111.25 ? 331 TYR D C   1 
ATOM   5823 O O   . TYR D 2 36  ? 33.475  -3.049  -49.004 1.00 112.20 ? 331 TYR D O   1 
ATOM   5824 C CB  . TYR D 2 36  ? 35.674  -2.326  -50.799 1.00 109.32 ? 331 TYR D CB  1 
ATOM   5825 N N   . ASP D 2 37  ? 32.253  -3.217  -50.888 1.00 109.66 ? 332 ASP D N   1 
ATOM   5826 C CA  . ASP D 2 37  ? 30.956  -3.036  -50.234 1.00 108.99 ? 332 ASP D CA  1 
ATOM   5827 C C   . ASP D 2 37  ? 31.037  -2.211  -48.952 1.00 112.86 ? 332 ASP D C   1 
ATOM   5828 O O   . ASP D 2 37  ? 31.135  -2.762  -47.850 1.00 115.20 ? 332 ASP D O   1 
ATOM   5829 C CB  . ASP D 2 37  ? 30.309  -4.390  -49.941 1.00 105.44 ? 332 ASP D CB  1 
ATOM   5830 N N   . SER D 2 46  ? 33.744  7.852   -47.027 1.00 78.49  ? 341 SER D N   1 
ATOM   5831 C CA  . SER D 2 46  ? 33.801  6.479   -47.513 1.00 83.96  ? 341 SER D CA  1 
ATOM   5832 C C   . SER D 2 46  ? 32.840  6.269   -48.681 1.00 79.75  ? 341 SER D C   1 
ATOM   5833 O O   . SER D 2 46  ? 33.169  5.598   -49.659 1.00 78.65  ? 341 SER D O   1 
ATOM   5834 C CB  . SER D 2 46  ? 33.494  5.496   -46.375 1.00 89.31  ? 341 SER D CB  1 
ATOM   5835 O OG  . SER D 2 46  ? 32.257  5.806   -45.754 1.00 93.23  ? 341 SER D OG  1 
ATOM   5836 N N   . MET D 2 47  ? 31.648  6.840   -48.565 1.00 76.96  ? 342 MET D N   1 
ATOM   5837 C CA  . MET D 2 47  ? 30.681  6.812   -49.649 1.00 74.45  ? 342 MET D CA  1 
ATOM   5838 C C   . MET D 2 47  ? 31.344  7.301   -50.929 1.00 72.60  ? 342 MET D C   1 
ATOM   5839 O O   . MET D 2 47  ? 31.178  6.708   -51.995 1.00 66.38  ? 342 MET D O   1 
ATOM   5840 C CB  . MET D 2 47  ? 29.491  7.706   -49.315 1.00 74.94  ? 342 MET D CB  1 
ATOM   5841 C CG  . MET D 2 47  ? 28.507  7.861   -50.456 1.00 74.20  ? 342 MET D CG  1 
ATOM   5842 S SD  . MET D 2 47  ? 27.511  6.385   -50.720 1.00 119.96 ? 342 MET D SD  1 
ATOM   5843 C CE  . MET D 2 47  ? 26.416  6.469   -49.307 1.00 101.14 ? 342 MET D CE  1 
ATOM   5844 N N   . MET D 2 48  ? 32.104  8.386   -50.809 1.00 67.40  ? 343 MET D N   1 
ATOM   5845 C CA  . MET D 2 48  ? 32.828  8.945   -51.944 1.00 69.22  ? 343 MET D CA  1 
ATOM   5846 C C   . MET D 2 48  ? 33.854  7.955   -52.478 1.00 67.78  ? 343 MET D C   1 
ATOM   5847 O O   . MET D 2 48  ? 34.073  7.862   -53.685 1.00 68.42  ? 343 MET D O   1 
ATOM   5848 C CB  . MET D 2 48  ? 33.508  10.263  -51.560 1.00 74.38  ? 343 MET D CB  1 
ATOM   5849 C CG  . MET D 2 48  ? 32.544  11.426  -51.398 1.00 78.24  ? 343 MET D CG  1 
ATOM   5850 S SD  . MET D 2 48  ? 31.636  11.776  -52.919 1.00 102.77 ? 343 MET D SD  1 
ATOM   5851 C CE  . MET D 2 48  ? 32.978  12.189  -54.030 1.00 69.88  ? 343 MET D CE  1 
ATOM   5852 N N   . GLY D 2 49  ? 34.482  7.217   -51.570 1.00 62.01  ? 344 GLY D N   1 
ATOM   5853 C CA  . GLY D 2 49  ? 35.415  6.178   -51.959 1.00 59.68  ? 344 GLY D CA  1 
ATOM   5854 C C   . GLY D 2 49  ? 34.735  5.125   -52.816 1.00 55.01  ? 344 GLY D C   1 
ATOM   5855 O O   . GLY D 2 49  ? 35.291  4.652   -53.807 1.00 51.78  ? 344 GLY D O   1 
ATOM   5856 N N   . LEU D 2 50  ? 33.516  4.761   -52.439 1.00 54.94  ? 345 LEU D N   1 
ATOM   5857 C CA  . LEU D 2 50  ? 32.806  3.699   -53.140 1.00 61.34  ? 345 LEU D CA  1 
ATOM   5858 C C   . LEU D 2 50  ? 32.256  4.153   -54.487 1.00 62.97  ? 345 LEU D C   1 
ATOM   5859 O O   . LEU D 2 50  ? 32.375  3.439   -55.481 1.00 68.53  ? 345 LEU D O   1 
ATOM   5860 C CB  . LEU D 2 50  ? 31.696  3.116   -52.263 1.00 62.30  ? 345 LEU D CB  1 
ATOM   5861 C CG  . LEU D 2 50  ? 32.226  2.278   -51.100 1.00 70.88  ? 345 LEU D CG  1 
ATOM   5862 C CD1 . LEU D 2 50  ? 31.098  1.503   -50.442 1.00 75.78  ? 345 LEU D CD1 1 
ATOM   5863 C CD2 . LEU D 2 50  ? 33.317  1.330   -51.587 1.00 68.99  ? 345 LEU D CD2 1 
ATOM   5864 N N   . LEU D 2 51  ? 31.656  5.337   -54.521 1.00 47.65  ? 346 LEU D N   1 
ATOM   5865 C CA  . LEU D 2 51  ? 31.141  5.871   -55.771 1.00 48.72  ? 346 LEU D CA  1 
ATOM   5866 C C   . LEU D 2 51  ? 32.281  6.008   -56.770 1.00 46.49  ? 346 LEU D C   1 
ATOM   5867 O O   . LEU D 2 51  ? 32.151  5.633   -57.935 1.00 44.29  ? 346 LEU D O   1 
ATOM   5868 C CB  . LEU D 2 51  ? 30.460  7.223   -55.552 1.00 51.02  ? 346 LEU D CB  1 
ATOM   5869 C CG  . LEU D 2 51  ? 29.183  7.219   -54.711 1.00 52.67  ? 346 LEU D CG  1 
ATOM   5870 C CD1 . LEU D 2 51  ? 28.522  8.588   -54.738 1.00 52.92  ? 346 LEU D CD1 1 
ATOM   5871 C CD2 . LEU D 2 51  ? 28.222  6.155   -55.215 1.00 48.09  ? 346 LEU D CD2 1 
ATOM   5872 N N   . THR D 2 52  ? 33.401  6.540   -56.295 1.00 44.97  ? 347 THR D N   1 
ATOM   5873 C CA  . THR D 2 52  ? 34.574  6.763   -57.131 1.00 45.60  ? 347 THR D CA  1 
ATOM   5874 C C   . THR D 2 52  ? 35.077  5.472   -57.769 1.00 49.31  ? 347 THR D C   1 
ATOM   5875 O O   . THR D 2 52  ? 35.312  5.415   -58.977 1.00 54.43  ? 347 THR D O   1 
ATOM   5876 C CB  . THR D 2 52  ? 35.716  7.414   -56.326 1.00 44.62  ? 347 THR D CB  1 
ATOM   5877 O OG1 . THR D 2 52  ? 35.291  8.698   -55.858 1.00 48.94  ? 347 THR D OG1 1 
ATOM   5878 C CG2 . THR D 2 52  ? 36.953  7.577   -57.190 1.00 42.26  ? 347 THR D CG2 1 
ATOM   5879 N N   . ASN D 2 53  ? 35.241  4.436   -56.953 1.00 38.87  ? 348 ASN D N   1 
ATOM   5880 C CA  . ASN D 2 53  ? 35.708  3.145   -57.446 1.00 42.84  ? 348 ASN D CA  1 
ATOM   5881 C C   . ASN D 2 53  ? 34.757  2.560   -58.482 1.00 45.34  ? 348 ASN D C   1 
ATOM   5882 O O   . ASN D 2 53  ? 35.183  2.005   -59.494 1.00 44.35  ? 348 ASN D O   1 
ATOM   5883 C CB  . ASN D 2 53  ? 35.877  2.160   -56.290 1.00 45.03  ? 348 ASN D CB  1 
ATOM   5884 C CG  . ASN D 2 53  ? 36.018  0.729   -56.763 1.00 55.47  ? 348 ASN D CG  1 
ATOM   5885 O OD1 . ASN D 2 53  ? 35.148  -0.111  -56.513 1.00 56.56  ? 348 ASN D OD1 1 
ATOM   5886 N ND2 . ASN D 2 53  ? 37.110  0.444   -57.463 1.00 57.90  ? 348 ASN D ND2 1 
ATOM   5887 N N   . LEU D 2 54  ? 33.463  2.702   -58.215 1.00 41.44  ? 349 LEU D N   1 
ATOM   5888 C CA  . LEU D 2 54  ? 32.419  2.151   -59.071 1.00 38.61  ? 349 LEU D CA  1 
ATOM   5889 C C   . LEU D 2 54  ? 32.268  2.955   -60.365 1.00 39.85  ? 349 LEU D C   1 
ATOM   5890 O O   . LEU D 2 54  ? 32.220  2.386   -61.460 1.00 33.48  ? 349 LEU D O   1 
ATOM   5891 C CB  . LEU D 2 54  ? 31.098  2.114   -58.306 1.00 35.45  ? 349 LEU D CB  1 
ATOM   5892 C CG  . LEU D 2 54  ? 29.870  1.523   -58.998 1.00 39.84  ? 349 LEU D CG  1 
ATOM   5893 C CD1 . LEU D 2 54  ? 30.095  0.069   -59.321 1.00 32.42  ? 349 LEU D CD1 1 
ATOM   5894 C CD2 . LEU D 2 54  ? 28.637  1.693   -58.116 1.00 42.29  ? 349 LEU D CD2 1 
ATOM   5895 N N   . ALA D 2 55  ? 32.205  4.277   -60.233 1.00 35.02  ? 350 ALA D N   1 
ATOM   5896 C CA  . ALA D 2 55  ? 32.070  5.163   -61.385 1.00 32.79  ? 350 ALA D CA  1 
ATOM   5897 C C   . ALA D 2 55  ? 33.240  5.029   -62.357 1.00 39.32  ? 350 ALA D C   1 
ATOM   5898 O O   . ALA D 2 55  ? 33.043  5.018   -63.574 1.00 39.37  ? 350 ALA D O   1 
ATOM   5899 C CB  . ALA D 2 55  ? 31.924  6.610   -60.930 1.00 32.20  ? 350 ALA D CB  1 
ATOM   5900 N N   . ASP D 2 56  ? 34.455  4.933   -61.818 1.00 37.59  ? 351 ASP D N   1 
ATOM   5901 C CA  . ASP D 2 56  ? 35.655  4.744   -62.633 1.00 37.79  ? 351 ASP D CA  1 
ATOM   5902 C C   . ASP D 2 56  ? 35.534  3.512   -63.527 1.00 38.96  ? 351 ASP D C   1 
ATOM   5903 O O   . ASP D 2 56  ? 35.852  3.559   -64.714 1.00 40.84  ? 351 ASP D O   1 
ATOM   5904 C CB  . ASP D 2 56  ? 36.904  4.626   -61.751 1.00 44.98  ? 351 ASP D CB  1 
ATOM   5905 C CG  . ASP D 2 56  ? 37.363  5.968   -61.207 1.00 55.32  ? 351 ASP D CG  1 
ATOM   5906 O OD1 . ASP D 2 56  ? 36.875  7.010   -61.697 1.00 49.84  ? 351 ASP D OD1 1 
ATOM   5907 O OD2 . ASP D 2 56  ? 38.211  5.980   -60.291 1.00 59.27  ? 351 ASP D OD2 1 
ATOM   5908 N N   . ARG D 2 57  ? 35.078  2.406   -62.955 1.00 37.72  ? 352 ARG D N   1 
ATOM   5909 C CA  . ARG D 2 57  ? 34.890  1.187   -63.741 1.00 31.64  ? 352 ARG D CA  1 
ATOM   5910 C C   . ARG D 2 57  ? 33.690  1.283   -64.687 1.00 35.04  ? 352 ARG D C   1 
ATOM   5911 O O   . ARG D 2 57  ? 33.710  0.720   -65.779 1.00 31.58  ? 352 ARG D O   1 
ATOM   5912 C CB  . ARG D 2 57  ? 34.783  -0.038  -62.830 1.00 29.38  ? 352 ARG D CB  1 
ATOM   5913 C CG  . ARG D 2 57  ? 36.134  -0.488  -62.256 1.00 35.16  ? 352 ARG D CG  1 
ATOM   5914 C CD  . ARG D 2 57  ? 35.991  -1.645  -61.290 1.00 34.61  ? 352 ARG D CD  1 
ATOM   5915 N NE  . ARG D 2 57  ? 35.263  -1.267  -60.083 1.00 40.79  ? 352 ARG D NE  1 
ATOM   5916 C CZ  . ARG D 2 57  ? 34.240  -1.955  -59.581 1.00 38.49  ? 352 ARG D CZ  1 
ATOM   5917 N NH1 . ARG D 2 57  ? 33.818  -3.055  -60.185 1.00 32.89  ? 352 ARG D NH1 1 
ATOM   5918 N NH2 . ARG D 2 57  ? 33.638  -1.547  -58.474 1.00 41.30  ? 352 ARG D NH2 1 
ATOM   5919 N N   . GLU D 2 58  ? 32.652  2.005   -64.279 1.00 33.52  ? 353 GLU D N   1 
ATOM   5920 C CA  . GLU D 2 58  ? 31.472  2.153   -65.128 1.00 32.79  ? 353 GLU D CA  1 
ATOM   5921 C C   . GLU D 2 58  ? 31.739  3.005   -66.372 1.00 37.68  ? 353 GLU D C   1 
ATOM   5922 O O   . GLU D 2 58  ? 31.186  2.739   -67.450 1.00 31.26  ? 353 GLU D O   1 
ATOM   5923 C CB  . GLU D 2 58  ? 30.297  2.726   -64.335 1.00 31.17  ? 353 GLU D CB  1 
ATOM   5924 C CG  . GLU D 2 58  ? 29.613  1.701   -63.449 1.00 34.55  ? 353 GLU D CG  1 
ATOM   5925 C CD  . GLU D 2 58  ? 28.368  2.244   -62.778 1.00 36.94  ? 353 GLU D CD  1 
ATOM   5926 O OE1 . GLU D 2 58  ? 28.502  2.985   -61.787 1.00 37.47  ? 353 GLU D OE1 1 
ATOM   5927 O OE2 . GLU D 2 58  ? 27.254  1.922   -63.240 1.00 39.54  ? 353 GLU D OE2 1 
ATOM   5928 N N   . LEU D 2 59  ? 32.593  4.017   -66.219 1.00 28.30  ? 354 LEU D N   1 
ATOM   5929 C CA  . LEU D 2 59  ? 32.902  4.942   -67.300 1.00 32.83  ? 354 LEU D CA  1 
ATOM   5930 C C   . LEU D 2 59  ? 33.409  4.193   -68.525 1.00 33.66  ? 354 LEU D C   1 
ATOM   5931 O O   . LEU D 2 59  ? 33.019  4.481   -69.662 1.00 28.93  ? 354 LEU D O   1 
ATOM   5932 C CB  . LEU D 2 59  ? 33.957  5.959   -66.846 1.00 33.93  ? 354 LEU D CB  1 
ATOM   5933 C CG  . LEU D 2 59  ? 34.314  7.072   -67.841 1.00 42.49  ? 354 LEU D CG  1 
ATOM   5934 C CD1 . LEU D 2 59  ? 33.093  7.925   -68.186 1.00 39.10  ? 354 LEU D CD1 1 
ATOM   5935 C CD2 . LEU D 2 59  ? 35.439  7.942   -67.282 1.00 43.73  ? 354 LEU D CD2 1 
ATOM   5936 N N   . VAL D 2 60  ? 34.284  3.227   -68.284 1.00 33.31  ? 355 VAL D N   1 
ATOM   5937 C CA  . VAL D 2 60  ? 34.863  2.440   -69.355 1.00 32.43  ? 355 VAL D CA  1 
ATOM   5938 C C   . VAL D 2 60  ? 33.772  1.741   -70.165 1.00 33.05  ? 355 VAL D C   1 
ATOM   5939 O O   . VAL D 2 60  ? 33.815  1.731   -71.394 1.00 37.14  ? 355 VAL D O   1 
ATOM   5940 C CB  . VAL D 2 60  ? 35.827  1.388   -68.777 1.00 39.32  ? 355 VAL D CB  1 
ATOM   5941 C CG1 . VAL D 2 60  ? 36.562  0.681   -69.903 1.00 34.54  ? 355 VAL D CG1 1 
ATOM   5942 C CG2 . VAL D 2 60  ? 36.800  2.057   -67.799 1.00 30.58  ? 355 VAL D CG2 1 
ATOM   5943 N N   . HIS D 2 61  ? 32.792  1.170   -69.469 1.00 30.17  ? 356 HIS D N   1 
ATOM   5944 C CA  . HIS D 2 61  ? 31.651  0.521   -70.123 1.00 31.94  ? 356 HIS D CA  1 
ATOM   5945 C C   . HIS D 2 61  ? 30.746  1.539   -70.814 1.00 31.40  ? 356 HIS D C   1 
ATOM   5946 O O   . HIS D 2 61  ? 30.183  1.271   -71.879 1.00 30.32  ? 356 HIS D O   1 
ATOM   5947 C CB  . HIS D 2 61  ? 30.835  -0.292  -69.115 1.00 26.87  ? 356 HIS D CB  1 
ATOM   5948 C CG  . HIS D 2 61  ? 31.531  -1.526  -68.625 1.00 37.69  ? 356 HIS D CG  1 
ATOM   5949 N ND1 . HIS D 2 61  ? 31.671  -2.659  -69.398 1.00 36.53  ? 356 HIS D ND1 1 
ATOM   5950 C CD2 . HIS D 2 61  ? 32.104  -1.814  -67.430 1.00 37.52  ? 356 HIS D CD2 1 
ATOM   5951 C CE1 . HIS D 2 61  ? 32.315  -3.584  -68.707 1.00 40.75  ? 356 HIS D CE1 1 
ATOM   5952 N NE2 . HIS D 2 61  ? 32.585  -3.096  -67.509 1.00 41.30  ? 356 HIS D NE2 1 
ATOM   5953 N N   . MET D 2 62  ? 30.609  2.712   -70.206 1.00 33.10  ? 357 MET D N   1 
ATOM   5954 C CA  . MET D 2 62  ? 29.742  3.743   -70.758 1.00 23.33  ? 357 MET D CA  1 
ATOM   5955 C C   . MET D 2 62  ? 30.249  4.190   -72.132 1.00 28.88  ? 357 MET D C   1 
ATOM   5956 O O   . MET D 2 62  ? 29.478  4.286   -73.086 1.00 31.20  ? 357 MET D O   1 
ATOM   5957 C CB  . MET D 2 62  ? 29.668  4.920   -69.794 1.00 25.73  ? 357 MET D CB  1 
ATOM   5958 C CG  . MET D 2 62  ? 28.577  5.912   -70.133 1.00 35.74  ? 357 MET D CG  1 
ATOM   5959 S SD  . MET D 2 62  ? 28.795  7.487   -69.295 1.00 33.84  ? 357 MET D SD  1 
ATOM   5960 C CE  . MET D 2 62  ? 28.573  7.047   -67.572 1.00 22.94  ? 357 MET D CE  1 
ATOM   5961 N N   . ILE D 2 63  ? 31.548  4.460   -72.222 1.00 28.66  ? 358 ILE D N   1 
ATOM   5962 C CA  . ILE D 2 63  ? 32.188  4.821   -73.489 1.00 33.88  ? 358 ILE D CA  1 
ATOM   5963 C C   . ILE D 2 63  ? 31.892  3.804   -74.581 1.00 38.01  ? 358 ILE D C   1 
ATOM   5964 O O   . ILE D 2 63  ? 31.569  4.164   -75.713 1.00 42.56  ? 358 ILE D O   1 
ATOM   5965 C CB  . ILE D 2 63  ? 33.722  4.929   -73.349 1.00 34.39  ? 358 ILE D CB  1 
ATOM   5966 C CG1 . ILE D 2 63  ? 34.130  6.312   -72.837 1.00 43.96  ? 358 ILE D CG1 1 
ATOM   5967 C CG2 . ILE D 2 63  ? 34.380  4.711   -74.688 1.00 42.18  ? 358 ILE D CG2 1 
ATOM   5968 C CD1 . ILE D 2 63  ? 33.531  6.686   -71.510 1.00 49.76  ? 358 ILE D CD1 1 
ATOM   5969 N N   . ASN D 2 64  ? 32.002  2.526   -74.243 1.00 40.28  ? 359 ASN D N   1 
ATOM   5970 C CA  . ASN D 2 64  ? 31.737  1.478   -75.221 1.00 42.63  ? 359 ASN D CA  1 
ATOM   5971 C C   . ASN D 2 64  ? 30.251  1.307   -75.510 1.00 36.31  ? 359 ASN D C   1 
ATOM   5972 O O   . ASN D 2 64  ? 29.862  1.003   -76.642 1.00 40.50  ? 359 ASN D O   1 
ATOM   5973 C CB  . ASN D 2 64  ? 32.401  0.166   -74.805 1.00 54.14  ? 359 ASN D CB  1 
ATOM   5974 C CG  . ASN D 2 64  ? 33.915  0.217   -74.960 1.00 63.38  ? 359 ASN D CG  1 
ATOM   5975 O OD1 . ASN D 2 64  ? 34.441  0.166   -76.075 1.00 61.07  ? 359 ASN D OD1 1 
ATOM   5976 N ND2 . ASN D 2 64  ? 34.621  0.337   -73.842 1.00 69.03  ? 359 ASN D ND2 1 
ATOM   5977 N N   . TRP D 2 65  ? 29.415  1.516   -74.499 1.00 29.21  ? 360 TRP D N   1 
ATOM   5978 C CA  . TRP D 2 65  ? 27.976  1.594   -74.743 1.00 31.66  ? 360 TRP D CA  1 
ATOM   5979 C C   . TRP D 2 65  ? 27.657  2.742   -75.702 1.00 34.43  ? 360 TRP D C   1 
ATOM   5980 O O   . TRP D 2 65  ? 26.921  2.562   -76.675 1.00 31.59  ? 360 TRP D O   1 
ATOM   5981 C CB  . TRP D 2 65  ? 27.199  1.774   -73.442 1.00 27.87  ? 360 TRP D CB  1 
ATOM   5982 C CG  . TRP D 2 65  ? 25.823  2.297   -73.660 1.00 35.44  ? 360 TRP D CG  1 
ATOM   5983 C CD1 . TRP D 2 65  ? 24.733  1.593   -74.088 1.00 30.61  ? 360 TRP D CD1 1 
ATOM   5984 C CD2 . TRP D 2 65  ? 25.381  3.643   -73.464 1.00 31.52  ? 360 TRP D CD2 1 
ATOM   5985 N NE1 . TRP D 2 65  ? 23.637  2.420   -74.167 1.00 28.39  ? 360 TRP D NE1 1 
ATOM   5986 C CE2 . TRP D 2 65  ? 24.011  3.685   -73.791 1.00 28.60  ? 360 TRP D CE2 1 
ATOM   5987 C CE3 . TRP D 2 65  ? 26.010  4.822   -73.043 1.00 31.07  ? 360 TRP D CE3 1 
ATOM   5988 C CZ2 . TRP D 2 65  ? 23.260  4.858   -73.712 1.00 30.54  ? 360 TRP D CZ2 1 
ATOM   5989 C CZ3 . TRP D 2 65  ? 25.260  5.984   -72.963 1.00 36.17  ? 360 TRP D CZ3 1 
ATOM   5990 C CH2 . TRP D 2 65  ? 23.901  5.992   -73.294 1.00 31.59  ? 360 TRP D CH2 1 
ATOM   5991 N N   . ALA D 2 66  ? 28.219  3.915   -75.432 1.00 28.50  ? 361 ALA D N   1 
ATOM   5992 C CA  . ALA D 2 66  ? 27.929  5.092   -76.238 1.00 27.87  ? 361 ALA D CA  1 
ATOM   5993 C C   . ALA D 2 66  ? 28.280  4.887   -77.709 1.00 32.67  ? 361 ALA D C   1 
ATOM   5994 O O   . ALA D 2 66  ? 27.525  5.277   -78.598 1.00 34.40  ? 361 ALA D O   1 
ATOM   5995 C CB  . ALA D 2 66  ? 28.670  6.313   -75.679 1.00 34.47  ? 361 ALA D CB  1 
ATOM   5996 N N   . LYS D 2 67  ? 29.434  4.288   -77.972 1.00 33.25  ? 362 LYS D N   1 
ATOM   5997 C CA  . LYS D 2 67  ? 29.857  4.057   -79.353 1.00 36.71  ? 362 LYS D CA  1 
ATOM   5998 C C   . LYS D 2 67  ? 28.898  3.117   -80.082 1.00 36.91  ? 362 LYS D C   1 
ATOM   5999 O O   . LYS D 2 67  ? 28.936  3.011   -81.306 1.00 36.90  ? 362 LYS D O   1 
ATOM   6000 C CB  . LYS D 2 67  ? 31.294  3.530   -79.400 1.00 39.72  ? 362 LYS D CB  1 
ATOM   6001 C CG  . LYS D 2 67  ? 32.338  4.622   -79.214 1.00 42.99  ? 362 LYS D CG  1 
ATOM   6002 C CD  . LYS D 2 67  ? 33.537  4.148   -78.399 1.00 56.52  ? 362 LYS D CD  1 
ATOM   6003 C CE  . LYS D 2 67  ? 34.548  3.385   -79.249 1.00 65.96  ? 362 LYS D CE  1 
ATOM   6004 N NZ  . LYS D 2 67  ? 35.732  2.954   -78.447 1.00 65.00  ? 362 LYS D NZ  1 
ATOM   6005 N N   . ARG D 2 68  ? 28.028  2.455   -79.323 1.00 28.54  ? 363 ARG D N   1 
ATOM   6006 C CA  . ARG D 2 68  ? 27.062  1.521   -79.898 1.00 30.56  ? 363 ARG D CA  1 
ATOM   6007 C C   . ARG D 2 68  ? 25.660  2.120   -80.058 1.00 36.13  ? 363 ARG D C   1 
ATOM   6008 O O   . ARG D 2 68  ? 24.786  1.507   -80.669 1.00 39.28  ? 363 ARG D O   1 
ATOM   6009 C CB  . ARG D 2 68  ? 27.023  0.218   -79.087 1.00 32.69  ? 363 ARG D CB  1 
ATOM   6010 C CG  . ARG D 2 68  ? 28.353  -0.542  -79.115 1.00 43.26  ? 363 ARG D CG  1 
ATOM   6011 C CD  . ARG D 2 68  ? 28.280  -1.886  -78.399 1.00 49.38  ? 363 ARG D CD  1 
ATOM   6012 N NE  . ARG D 2 68  ? 27.311  -2.786  -79.021 1.00 59.07  ? 363 ARG D NE  1 
ATOM   6013 C CZ  . ARG D 2 68  ? 27.080  -4.033  -78.618 1.00 63.83  ? 363 ARG D CZ  1 
ATOM   6014 N NH1 . ARG D 2 68  ? 27.749  -4.536  -77.586 1.00 63.19  ? 363 ARG D NH1 1 
ATOM   6015 N NH2 . ARG D 2 68  ? 26.176  -4.775  -79.247 1.00 60.98  ? 363 ARG D NH2 1 
ATOM   6016 N N   . VAL D 2 69  ? 25.447  3.318   -79.515 1.00 28.11  ? 364 VAL D N   1 
ATOM   6017 C CA  . VAL D 2 69  ? 24.188  4.030   -79.723 1.00 29.20  ? 364 VAL D CA  1 
ATOM   6018 C C   . VAL D 2 69  ? 24.093  4.460   -81.185 1.00 35.98  ? 364 VAL D C   1 
ATOM   6019 O O   . VAL D 2 69  ? 24.970  5.163   -81.682 1.00 36.56  ? 364 VAL D O   1 
ATOM   6020 C CB  . VAL D 2 69  ? 24.081  5.277   -78.819 1.00 28.45  ? 364 VAL D CB  1 
ATOM   6021 C CG1 . VAL D 2 69  ? 22.857  6.116   -79.193 1.00 26.39  ? 364 VAL D CG1 1 
ATOM   6022 C CG2 . VAL D 2 69  ? 24.028  4.875   -77.346 1.00 28.02  ? 364 VAL D CG2 1 
ATOM   6023 N N   . PRO D 2 70  ? 23.034  4.030   -81.890 1.00 41.62  ? 365 PRO D N   1 
ATOM   6024 C CA  . PRO D 2 70  ? 22.933  4.356   -83.317 1.00 38.49  ? 365 PRO D CA  1 
ATOM   6025 C C   . PRO D 2 70  ? 23.057  5.851   -83.576 1.00 40.81  ? 365 PRO D C   1 
ATOM   6026 O O   . PRO D 2 70  ? 22.421  6.656   -82.896 1.00 39.22  ? 365 PRO D O   1 
ATOM   6027 C CB  . PRO D 2 70  ? 21.536  3.865   -83.687 1.00 39.74  ? 365 PRO D CB  1 
ATOM   6028 C CG  . PRO D 2 70  ? 21.276  2.752   -82.727 1.00 39.82  ? 365 PRO D CG  1 
ATOM   6029 C CD  . PRO D 2 70  ? 21.915  3.189   -81.435 1.00 44.02  ? 365 PRO D CD  1 
ATOM   6030 N N   . GLY D 2 71  ? 23.885  6.213   -84.550 1.00 39.49  ? 366 GLY D N   1 
ATOM   6031 C CA  . GLY D 2 71  ? 24.097  7.606   -84.898 1.00 39.15  ? 366 GLY D CA  1 
ATOM   6032 C C   . GLY D 2 71  ? 25.254  8.269   -84.173 1.00 39.79  ? 366 GLY D C   1 
ATOM   6033 O O   . GLY D 2 71  ? 25.754  9.301   -84.616 1.00 48.45  ? 366 GLY D O   1 
ATOM   6034 N N   . PHE D 2 72  ? 25.689  7.682   -83.061 1.00 36.80  ? 367 PHE D N   1 
ATOM   6035 C CA  . PHE D 2 72  ? 26.703  8.321   -82.224 1.00 33.00  ? 367 PHE D CA  1 
ATOM   6036 C C   . PHE D 2 72  ? 28.084  8.391   -82.875 1.00 39.25  ? 367 PHE D C   1 
ATOM   6037 O O   . PHE D 2 72  ? 28.764  9.420   -82.799 1.00 42.33  ? 367 PHE D O   1 
ATOM   6038 C CB  . PHE D 2 72  ? 26.797  7.634   -80.862 1.00 34.16  ? 367 PHE D CB  1 
ATOM   6039 C CG  . PHE D 2 72  ? 27.645  8.373   -79.874 1.00 33.63  ? 367 PHE D CG  1 
ATOM   6040 C CD1 . PHE D 2 72  ? 27.166  9.517   -79.253 1.00 32.25  ? 367 PHE D CD1 1 
ATOM   6041 C CD2 . PHE D 2 72  ? 28.923  7.939   -79.572 1.00 30.30  ? 367 PHE D CD2 1 
ATOM   6042 C CE1 . PHE D 2 72  ? 27.945  10.205  -78.342 1.00 28.16  ? 367 PHE D CE1 1 
ATOM   6043 C CE2 . PHE D 2 72  ? 29.704  8.624   -78.662 1.00 34.84  ? 367 PHE D CE2 1 
ATOM   6044 C CZ  . PHE D 2 72  ? 29.216  9.757   -78.046 1.00 29.64  ? 367 PHE D CZ  1 
ATOM   6045 N N   . VAL D 2 73  ? 28.509  7.308   -83.516 1.00 34.36  ? 368 VAL D N   1 
ATOM   6046 C CA  . VAL D 2 73  ? 29.834  7.295   -84.132 1.00 37.56  ? 368 VAL D CA  1 
ATOM   6047 C C   . VAL D 2 73  ? 29.844  8.038   -85.463 1.00 43.41  ? 368 VAL D C   1 
ATOM   6048 O O   . VAL D 2 73  ? 30.898  8.186   -86.081 1.00 44.07  ? 368 VAL D O   1 
ATOM   6049 C CB  . VAL D 2 73  ? 30.378  5.860   -84.345 1.00 45.04  ? 368 VAL D CB  1 
ATOM   6050 C CG1 . VAL D 2 73  ? 30.471  5.116   -83.018 1.00 47.10  ? 368 VAL D CG1 1 
ATOM   6051 C CG2 . VAL D 2 73  ? 29.515  5.101   -85.340 1.00 44.54  ? 368 VAL D CG2 1 
ATOM   6052 N N   . ASP D 2 74  ? 28.672  8.496   -85.904 1.00 38.07  ? 369 ASP D N   1 
ATOM   6053 C CA  . ASP D 2 74  ? 28.579  9.345   -87.097 1.00 32.57  ? 369 ASP D CA  1 
ATOM   6054 C C   . ASP D 2 74  ? 29.094  10.745  -86.808 1.00 34.42  ? 369 ASP D C   1 
ATOM   6055 O O   . ASP D 2 74  ? 29.391  11.510  -87.728 1.00 45.06  ? 369 ASP D O   1 
ATOM   6056 C CB  . ASP D 2 74  ? 27.137  9.427   -87.600 1.00 34.61  ? 369 ASP D CB  1 
ATOM   6057 C CG  . ASP D 2 74  ? 26.634  8.101   -88.127 1.00 48.18  ? 369 ASP D CG  1 
ATOM   6058 O OD1 . ASP D 2 74  ? 27.485  7.270   -88.517 1.00 48.26  ? 369 ASP D OD1 1 
ATOM   6059 O OD2 . ASP D 2 74  ? 25.399  7.892   -88.143 1.00 51.01  ? 369 ASP D OD2 1 
ATOM   6060 N N   . LEU D 2 75  ? 29.189  11.082  -85.527 1.00 34.19  ? 370 LEU D N   1 
ATOM   6061 C CA  . LEU D 2 75  ? 29.646  12.402  -85.112 1.00 38.29  ? 370 LEU D CA  1 
ATOM   6062 C C   . LEU D 2 75  ? 31.166  12.469  -85.089 1.00 39.05  ? 370 LEU D C   1 
ATOM   6063 O O   . LEU D 2 75  ? 31.836  11.446  -85.026 1.00 39.29  ? 370 LEU D O   1 
ATOM   6064 C CB  . LEU D 2 75  ? 29.103  12.729  -83.718 1.00 39.72  ? 370 LEU D CB  1 
ATOM   6065 C CG  . LEU D 2 75  ? 27.585  12.657  -83.543 1.00 42.13  ? 370 LEU D CG  1 
ATOM   6066 C CD1 . LEU D 2 75  ? 27.211  12.745  -82.068 1.00 40.21  ? 370 LEU D CD1 1 
ATOM   6067 C CD2 . LEU D 2 75  ? 26.895  13.753  -84.349 1.00 41.71  ? 370 LEU D CD2 1 
ATOM   6068 N N   . THR D 2 76  ? 31.709  13.683  -85.134 1.00 41.58  ? 371 THR D N   1 
ATOM   6069 C CA  . THR D 2 76  ? 33.146  13.870  -84.992 1.00 44.17  ? 371 THR D CA  1 
ATOM   6070 C C   . THR D 2 76  ? 33.565  13.404  -83.600 1.00 42.11  ? 371 THR D C   1 
ATOM   6071 O O   . THR D 2 76  ? 32.749  13.380  -82.680 1.00 43.84  ? 371 THR D O   1 
ATOM   6072 C CB  . THR D 2 76  ? 33.547  15.347  -85.181 1.00 47.15  ? 371 THR D CB  1 
ATOM   6073 O OG1 . THR D 2 76  ? 33.045  16.126  -84.087 1.00 52.11  ? 371 THR D OG1 1 
ATOM   6074 C CG2 . THR D 2 76  ? 32.981  15.896  -86.490 1.00 39.07  ? 371 THR D CG2 1 
ATOM   6075 N N   . ARG D 2 77  ? 34.829  13.027  -83.448 1.00 44.47  ? 372 ARG D N   1 
ATOM   6076 C CA  . ARG D 2 77  ? 35.336  12.591  -82.149 1.00 44.27  ? 372 ARG D CA  1 
ATOM   6077 C C   . ARG D 2 77  ? 35.152  13.700  -81.116 1.00 40.27  ? 372 ARG D C   1 
ATOM   6078 O O   . ARG D 2 77  ? 34.845  13.442  -79.951 1.00 42.27  ? 372 ARG D O   1 
ATOM   6079 N N   . HIS D 2 78  ? 35.331  14.940  -81.552 1.00 40.85  ? 373 HIS D N   1 
ATOM   6080 C CA  . HIS D 2 78  ? 35.184  16.082  -80.664 1.00 43.20  ? 373 HIS D CA  1 
ATOM   6081 C C   . HIS D 2 78  ? 33.762  16.192  -80.133 1.00 46.38  ? 373 HIS D C   1 
ATOM   6082 O O   . HIS D 2 78  ? 33.550  16.445  -78.946 1.00 50.90  ? 373 HIS D O   1 
ATOM   6083 C CB  . HIS D 2 78  ? 35.574  17.375  -81.383 1.00 50.57  ? 373 HIS D CB  1 
ATOM   6084 C CG  . HIS D 2 78  ? 35.137  18.617  -80.669 0.54 53.95  ? 373 HIS D CG  1 
ATOM   6085 N ND1 . HIS D 2 78  ? 33.894  19.181  -80.852 0.59 55.50  ? 373 HIS D ND1 1 
ATOM   6086 C CD2 . HIS D 2 78  ? 35.777  19.400  -79.767 0.85 55.89  ? 373 HIS D CD2 1 
ATOM   6087 C CE1 . HIS D 2 78  ? 33.784  20.259  -80.093 0.91 57.53  ? 373 HIS D CE1 1 
ATOM   6088 N NE2 . HIS D 2 78  ? 34.915  20.412  -79.426 0.84 57.76  ? 373 HIS D NE2 1 
ATOM   6089 N N   . ASP D 2 79  ? 32.784  16.009  -81.014 1.00 41.00  ? 374 ASP D N   1 
ATOM   6090 C CA  . ASP D 2 79  ? 31.383  16.101  -80.621 1.00 34.68  ? 374 ASP D CA  1 
ATOM   6091 C C   . ASP D 2 79  ? 30.963  14.947  -79.724 1.00 40.69  ? 374 ASP D C   1 
ATOM   6092 O O   . ASP D 2 79  ? 30.146  15.120  -78.827 1.00 39.80  ? 374 ASP D O   1 
ATOM   6093 C CB  . ASP D 2 79  ? 30.482  16.162  -81.851 1.00 41.23  ? 374 ASP D CB  1 
ATOM   6094 C CG  . ASP D 2 79  ? 30.495  17.521  -82.504 1.00 50.46  ? 374 ASP D CG  1 
ATOM   6095 O OD1 . ASP D 2 79  ? 30.835  18.506  -81.810 1.00 54.01  ? 374 ASP D OD1 1 
ATOM   6096 O OD2 . ASP D 2 79  ? 30.169  17.606  -83.705 1.00 51.70  ? 374 ASP D OD2 1 
ATOM   6097 N N   . GLN D 2 80  ? 31.520  13.768  -79.973 1.00 38.63  ? 375 GLN D N   1 
ATOM   6098 C CA  . GLN D 2 80  ? 31.231  12.619  -79.131 1.00 36.71  ? 375 GLN D CA  1 
ATOM   6099 C C   . GLN D 2 80  ? 31.678  12.907  -77.698 1.00 34.25  ? 375 GLN D C   1 
ATOM   6100 O O   . GLN D 2 80  ? 30.964  12.605  -76.745 1.00 37.80  ? 375 GLN D O   1 
ATOM   6101 C CB  . GLN D 2 80  ? 31.917  11.367  -79.676 1.00 38.19  ? 375 GLN D CB  1 
ATOM   6102 C CG  . GLN D 2 80  ? 31.416  10.935  -81.049 1.00 35.11  ? 375 GLN D CG  1 
ATOM   6103 C CD  . GLN D 2 80  ? 32.192  9.755   -81.607 1.00 40.92  ? 375 GLN D CD  1 
ATOM   6104 O OE1 . GLN D 2 80  ? 32.597  8.858   -80.866 1.00 38.19  ? 375 GLN D OE1 1 
ATOM   6105 N NE2 . GLN D 2 80  ? 32.407  9.755   -82.921 1.00 35.18  ? 375 GLN D NE2 1 
ATOM   6106 N N   . VAL D 2 81  ? 32.852  13.512  -77.556 1.00 34.95  ? 376 VAL D N   1 
ATOM   6107 C CA  . VAL D 2 81  ? 33.396  13.818  -76.240 1.00 33.46  ? 376 VAL D CA  1 
ATOM   6108 C C   . VAL D 2 81  ? 32.533  14.825  -75.502 1.00 33.41  ? 376 VAL D C   1 
ATOM   6109 O O   . VAL D 2 81  ? 32.336  14.714  -74.293 1.00 42.77  ? 376 VAL D O   1 
ATOM   6110 C CB  . VAL D 2 81  ? 34.822  14.383  -76.339 1.00 36.29  ? 376 VAL D CB  1 
ATOM   6111 C CG1 . VAL D 2 81  ? 35.297  14.848  -74.975 1.00 34.50  ? 376 VAL D CG1 1 
ATOM   6112 C CG2 . VAL D 2 81  ? 35.766  13.345  -76.915 1.00 32.12  ? 376 VAL D CG2 1 
ATOM   6113 N N   . HIS D 2 82  ? 32.023  15.810  -76.231 1.00 34.83  ? 377 HIS D N   1 
ATOM   6114 C CA  . HIS D 2 82  ? 31.196  16.850  -75.627 1.00 41.18  ? 377 HIS D CA  1 
ATOM   6115 C C   . HIS D 2 82  ? 29.883  16.280  -75.098 1.00 39.25  ? 377 HIS D C   1 
ATOM   6116 O O   . HIS D 2 82  ? 29.427  16.640  -74.009 1.00 37.86  ? 377 HIS D O   1 
ATOM   6117 C CB  . HIS D 2 82  ? 30.922  17.969  -76.632 1.00 37.58  ? 377 HIS D CB  1 
ATOM   6118 C CG  . HIS D 2 82  ? 30.061  19.069  -76.092 0.42 39.85  ? 377 HIS D CG  1 
ATOM   6119 N ND1 . HIS D 2 82  ? 30.483  19.921  -75.094 0.77 43.09  ? 377 HIS D ND1 1 
ATOM   6120 C CD2 . HIS D 2 82  ? 28.806  19.461  -76.417 0.62 40.42  ? 377 HIS D CD2 1 
ATOM   6121 C CE1 . HIS D 2 82  ? 29.523  20.790  -74.825 0.42 39.34  ? 377 HIS D CE1 1 
ATOM   6122 N NE2 . HIS D 2 82  ? 28.497  20.533  -75.615 0.72 37.87  ? 377 HIS D NE2 1 
ATOM   6123 N N   . LEU D 2 83  ? 29.270  15.398  -75.877 1.00 30.00  ? 378 LEU D N   1 
ATOM   6124 C CA  . LEU D 2 83  ? 28.033  14.753  -75.455 1.00 29.86  ? 378 LEU D CA  1 
ATOM   6125 C C   . LEU D 2 83  ? 28.262  13.974  -74.167 1.00 28.00  ? 378 LEU D C   1 
ATOM   6126 O O   . LEU D 2 83  ? 27.493  14.097  -73.211 1.00 30.73  ? 378 LEU D O   1 
ATOM   6127 C CB  . LEU D 2 83  ? 27.522  13.812  -76.545 1.00 27.95  ? 378 LEU D CB  1 
ATOM   6128 C CG  . LEU D 2 83  ? 26.972  14.484  -77.801 1.00 31.41  ? 378 LEU D CG  1 
ATOM   6129 C CD1 . LEU D 2 83  ? 26.446  13.439  -78.779 1.00 27.45  ? 378 LEU D CD1 1 
ATOM   6130 C CD2 . LEU D 2 83  ? 25.872  15.447  -77.411 1.00 32.09  ? 378 LEU D CD2 1 
ATOM   6131 N N   . LEU D 2 84  ? 29.324  13.176  -74.146 1.00 23.76  ? 379 LEU D N   1 
ATOM   6132 C CA  . LEU D 2 84  ? 29.637  12.361  -72.974 1.00 32.58  ? 379 LEU D CA  1 
ATOM   6133 C C   . LEU D 2 84  ? 30.002  13.237  -71.788 1.00 34.30  ? 379 LEU D C   1 
ATOM   6134 O O   . LEU D 2 84  ? 29.635  12.949  -70.649 1.00 35.85  ? 379 LEU D O   1 
ATOM   6135 C CB  . LEU D 2 84  ? 30.788  11.391  -73.266 1.00 27.77  ? 379 LEU D CB  1 
ATOM   6136 C CG  . LEU D 2 84  ? 30.470  10.074  -73.980 1.00 38.91  ? 379 LEU D CG  1 
ATOM   6137 C CD1 . LEU D 2 84  ? 31.745  9.441   -74.532 1.00 34.59  ? 379 LEU D CD1 1 
ATOM   6138 C CD2 . LEU D 2 84  ? 29.734  9.102   -73.052 1.00 29.12  ? 379 LEU D CD2 1 
ATOM   6139 N N   . GLU D 2 85  ? 30.749  14.302  -72.058 1.00 35.28  ? 380 GLU D N   1 
ATOM   6140 C CA  . GLU D 2 85  ? 31.156  15.220  -71.008 1.00 40.03  ? 380 GLU D CA  1 
ATOM   6141 C C   . GLU D 2 85  ? 29.923  15.757  -70.285 1.00 35.53  ? 380 GLU D C   1 
ATOM   6142 O O   . GLU D 2 85  ? 29.868  15.767  -69.058 1.00 35.29  ? 380 GLU D O   1 
ATOM   6143 C CB  . GLU D 2 85  ? 31.985  16.364  -71.597 1.00 42.33  ? 380 GLU D CB  1 
ATOM   6144 C CG  . GLU D 2 85  ? 33.057  16.880  -70.666 1.00 52.41  ? 380 GLU D CG  1 
ATOM   6145 C CD  . GLU D 2 85  ? 33.789  18.088  -71.226 1.00 53.59  ? 380 GLU D CD  1 
ATOM   6146 O OE1 . GLU D 2 85  ? 33.804  18.267  -72.462 1.00 54.41  ? 380 GLU D OE1 1 
ATOM   6147 O OE2 . GLU D 2 85  ? 34.355  18.856  -70.424 1.00 54.45  ? 380 GLU D OE2 1 
ATOM   6148 N N   . CYS D 2 86  ? 28.926  16.181  -71.057 1.00 29.50  ? 381 CYS D N   1 
ATOM   6149 C CA  . CYS D 2 86  ? 27.698  16.733  -70.492 1.00 34.27  ? 381 CYS D CA  1 
ATOM   6150 C C   . CYS D 2 86  ? 26.771  15.674  -69.865 1.00 37.31  ? 381 CYS D C   1 
ATOM   6151 O O   . CYS D 2 86  ? 26.078  15.954  -68.893 1.00 32.85  ? 381 CYS D O   1 
ATOM   6152 C CB  . CYS D 2 86  ? 26.945  17.551  -71.551 1.00 29.55  ? 381 CYS D CB  1 
ATOM   6153 S SG  . CYS D 2 86  ? 27.865  18.992  -72.192 0.76 41.59  ? 381 CYS D SG  1 
ATOM   6154 N N   . ALA D 2 87  ? 26.773  14.462  -70.405 1.00 28.89  ? 382 ALA D N   1 
ATOM   6155 C CA  . ALA D 2 87  ? 25.777  13.458  -70.016 1.00 28.01  ? 382 ALA D CA  1 
ATOM   6156 C C   . ALA D 2 87  ? 26.225  12.489  -68.920 1.00 29.87  ? 382 ALA D C   1 
ATOM   6157 O O   . ALA D 2 87  ? 25.385  11.886  -68.252 1.00 34.60  ? 382 ALA D O   1 
ATOM   6158 C CB  . ALA D 2 87  ? 25.317  12.674  -71.246 1.00 23.37  ? 382 ALA D CB  1 
ATOM   6159 N N   . TRP D 2 88  ? 27.535  12.343  -68.733 1.00 30.50  ? 383 TRP D N   1 
ATOM   6160 C CA  . TRP D 2 88  ? 28.077  11.230  -67.948 1.00 33.86  ? 383 TRP D CA  1 
ATOM   6161 C C   . TRP D 2 88  ? 27.386  10.998  -66.600 1.00 34.19  ? 383 TRP D C   1 
ATOM   6162 O O   . TRP D 2 88  ? 27.002  9.875   -66.290 1.00 32.89  ? 383 TRP D O   1 
ATOM   6163 C CB  . TRP D 2 88  ? 29.604  11.335  -67.787 1.00 36.32  ? 383 TRP D CB  1 
ATOM   6164 C CG  . TRP D 2 88  ? 30.048  12.284  -66.729 1.00 37.20  ? 383 TRP D CG  1 
ATOM   6165 C CD1 . TRP D 2 88  ? 30.265  13.620  -66.870 1.00 47.98  ? 383 TRP D CD1 1 
ATOM   6166 C CD2 . TRP D 2 88  ? 30.335  11.972  -65.361 1.00 36.84  ? 383 TRP D CD2 1 
ATOM   6167 N NE1 . TRP D 2 88  ? 30.666  14.163  -65.676 1.00 48.42  ? 383 TRP D NE1 1 
ATOM   6168 C CE2 . TRP D 2 88  ? 30.712  13.172  -64.729 1.00 45.54  ? 383 TRP D CE2 1 
ATOM   6169 C CE3 . TRP D 2 88  ? 30.305  10.799  -64.608 1.00 43.27  ? 383 TRP D CE3 1 
ATOM   6170 C CZ2 . TRP D 2 88  ? 31.060  13.232  -63.379 1.00 40.49  ? 383 TRP D CZ2 1 
ATOM   6171 C CZ3 . TRP D 2 88  ? 30.651  10.859  -63.269 1.00 50.23  ? 383 TRP D CZ3 1 
ATOM   6172 C CH2 . TRP D 2 88  ? 31.025  12.067  -62.669 1.00 44.79  ? 383 TRP D CH2 1 
ATOM   6173 N N   . LEU D 2 89  ? 27.200  12.046  -65.804 1.00 25.24  ? 384 LEU D N   1 
ATOM   6174 C CA  . LEU D 2 89  ? 26.614  11.852  -64.478 1.00 21.74  ? 384 LEU D CA  1 
ATOM   6175 C C   . LEU D 2 89  ? 25.119  11.528  -64.570 1.00 28.88  ? 384 LEU D C   1 
ATOM   6176 O O   . LEU D 2 89  ? 24.586  10.789  -63.746 1.00 25.64  ? 384 LEU D O   1 
ATOM   6177 C CB  . LEU D 2 89  ? 26.867  13.076  -63.577 1.00 26.77  ? 384 LEU D CB  1 
ATOM   6178 C CG  . LEU D 2 89  ? 26.420  12.953  -62.116 1.00 26.74  ? 384 LEU D CG  1 
ATOM   6179 C CD1 . LEU D 2 89  ? 27.045  11.738  -61.454 1.00 27.02  ? 384 LEU D CD1 1 
ATOM   6180 C CD2 . LEU D 2 89  ? 26.733  14.215  -61.319 1.00 29.77  ? 384 LEU D CD2 1 
ATOM   6181 N N   . GLU D 2 90  ? 24.444  12.087  -65.573 1.00 30.52  ? 385 GLU D N   1 
ATOM   6182 C CA  . GLU D 2 90  ? 23.025  11.806  -65.773 1.00 24.18  ? 385 GLU D CA  1 
ATOM   6183 C C   . GLU D 2 90  ? 22.850  10.334  -66.107 1.00 25.94  ? 385 GLU D C   1 
ATOM   6184 O O   . GLU D 2 90  ? 21.926  9.681   -65.627 1.00 31.97  ? 385 GLU D O   1 
ATOM   6185 C CB  . GLU D 2 90  ? 22.454  12.648  -66.914 1.00 27.40  ? 385 GLU D CB  1 
ATOM   6186 C CG  . GLU D 2 90  ? 22.254  14.126  -66.592 1.00 28.24  ? 385 GLU D CG  1 
ATOM   6187 C CD  . GLU D 2 90  ? 21.583  14.866  -67.733 1.00 36.92  ? 385 GLU D CD  1 
ATOM   6188 O OE1 . GLU D 2 90  ? 20.335  14.808  -67.832 1.00 42.95  ? 385 GLU D OE1 1 
ATOM   6189 O OE2 . GLU D 2 90  ? 22.304  15.498  -68.536 1.00 42.49  ? 385 GLU D OE2 1 
ATOM   6190 N N   . ILE D 2 91  ? 23.750  9.817   -66.936 1.00 27.69  ? 386 ILE D N   1 
ATOM   6191 C CA  . ILE D 2 91  ? 23.687  8.428   -67.372 1.00 28.88  ? 386 ILE D CA  1 
ATOM   6192 C C   . ILE D 2 91  ? 23.952  7.481   -66.212 1.00 29.90  ? 386 ILE D C   1 
ATOM   6193 O O   . ILE D 2 91  ? 23.277  6.455   -66.074 1.00 31.35  ? 386 ILE D O   1 
ATOM   6194 C CB  . ILE D 2 91  ? 24.655  8.165   -68.540 1.00 26.11  ? 386 ILE D CB  1 
ATOM   6195 C CG1 . ILE D 2 91  ? 24.148  8.897   -69.788 1.00 28.60  ? 386 ILE D CG1 1 
ATOM   6196 C CG2 . ILE D 2 91  ? 24.748  6.686   -68.836 1.00 21.86  ? 386 ILE D CG2 1 
ATOM   6197 C CD1 . ILE D 2 91  ? 25.199  9.096   -70.857 1.00 37.76  ? 386 ILE D CD1 1 
ATOM   6198 N N   . LEU D 2 92  ? 24.918  7.832   -65.367 1.00 32.85  ? 387 LEU D N   1 
ATOM   6199 C CA  . LEU D 2 92  ? 25.201  7.036   -64.176 1.00 33.62  ? 387 LEU D CA  1 
ATOM   6200 C C   . LEU D 2 92  ? 23.978  7.030   -63.286 1.00 31.47  ? 387 LEU D C   1 
ATOM   6201 O O   . LEU D 2 92  ? 23.533  5.979   -62.823 1.00 31.08  ? 387 LEU D O   1 
ATOM   6202 C CB  . LEU D 2 92  ? 26.396  7.604   -63.402 1.00 26.98  ? 387 LEU D CB  1 
ATOM   6203 C CG  . LEU D 2 92  ? 27.783  7.391   -64.007 1.00 30.84  ? 387 LEU D CG  1 
ATOM   6204 C CD1 . LEU D 2 92  ? 28.848  7.968   -63.083 1.00 25.79  ? 387 LEU D CD1 1 
ATOM   6205 C CD2 . LEU D 2 92  ? 28.025  5.918   -64.245 1.00 33.49  ? 387 LEU D CD2 1 
ATOM   6206 N N   . MET D 2 93  ? 23.426  8.219   -63.067 1.00 31.67  ? 388 MET D N   1 
ATOM   6207 C CA  . MET D 2 93  ? 22.267  8.385   -62.193 1.00 31.16  ? 388 MET D CA  1 
ATOM   6208 C C   . MET D 2 93  ? 20.999  7.687   -62.672 1.00 29.07  ? 388 MET D C   1 
ATOM   6209 O O   . MET D 2 93  ? 20.262  7.121   -61.861 1.00 28.09  ? 388 MET D O   1 
ATOM   6210 C CB  . MET D 2 93  ? 21.977  9.863   -61.959 1.00 26.18  ? 388 MET D CB  1 
ATOM   6211 C CG  . MET D 2 93  ? 22.904  10.510  -60.961 1.00 30.24  ? 388 MET D CG  1 
ATOM   6212 S SD  . MET D 2 93  ? 22.475  12.238  -60.720 1.00 34.75  ? 388 MET D SD  1 
ATOM   6213 C CE  . MET D 2 93  ? 23.473  12.627  -59.290 1.00 24.39  ? 388 MET D CE  1 
ATOM   6214 N N   . ILE D 2 94  ? 20.722  7.732   -63.972 1.00 24.94  ? 389 ILE D N   1 
ATOM   6215 C CA  . ILE D 2 94  ? 19.522  7.051   -64.461 1.00 24.89  ? 389 ILE D CA  1 
ATOM   6216 C C   . ILE D 2 94  ? 19.689  5.534   -64.388 1.00 26.15  ? 389 ILE D C   1 
ATOM   6217 O O   . ILE D 2 94  ? 18.720  4.806   -64.177 1.00 29.84  ? 389 ILE D O   1 
ATOM   6218 C CB  . ILE D 2 94  ? 19.079  7.502   -65.884 1.00 24.23  ? 389 ILE D CB  1 
ATOM   6219 C CG1 . ILE D 2 94  ? 17.597  7.142   -66.096 1.00 27.85  ? 389 ILE D CG1 1 
ATOM   6220 C CG2 . ILE D 2 94  ? 19.988  6.891   -66.949 1.00 24.89  ? 389 ILE D CG2 1 
ATOM   6221 C CD1 . ILE D 2 94  ? 17.010  7.567   -67.434 1.00 23.48  ? 389 ILE D CD1 1 
ATOM   6222 N N   . GLY D 2 95  ? 20.923  5.057   -64.543 1.00 32.19  ? 390 GLY D N   1 
ATOM   6223 C CA  . GLY D 2 95  ? 21.198  3.636   -64.391 1.00 28.53  ? 390 GLY D CA  1 
ATOM   6224 C C   . GLY D 2 95  ? 20.856  3.209   -62.974 1.00 30.96  ? 390 GLY D C   1 
ATOM   6225 O O   . GLY D 2 95  ? 20.203  2.188   -62.748 1.00 26.79  ? 390 GLY D O   1 
ATOM   6226 N N   . LEU D 2 96  ? 21.287  4.020   -62.013 1.00 28.12  ? 391 LEU D N   1 
ATOM   6227 C CA  . LEU D 2 96  ? 21.030  3.759   -60.600 1.00 25.89  ? 391 LEU D CA  1 
ATOM   6228 C C   . LEU D 2 96  ? 19.536  3.727   -60.289 1.00 33.26  ? 391 LEU D C   1 
ATOM   6229 O O   . LEU D 2 96  ? 19.053  2.820   -59.604 1.00 29.01  ? 391 LEU D O   1 
ATOM   6230 C CB  . LEU D 2 96  ? 21.711  4.824   -59.748 1.00 28.25  ? 391 LEU D CB  1 
ATOM   6231 C CG  . LEU D 2 96  ? 21.389  4.857   -58.254 1.00 31.76  ? 391 LEU D CG  1 
ATOM   6232 C CD1 . LEU D 2 96  ? 21.831  3.571   -57.585 1.00 29.68  ? 391 LEU D CD1 1 
ATOM   6233 C CD2 . LEU D 2 96  ? 22.077  6.054   -57.616 1.00 27.53  ? 391 LEU D CD2 1 
ATOM   6234 N N   . VAL D 2 97  ? 18.813  4.731   -60.783 1.00 28.52  ? 392 VAL D N   1 
ATOM   6235 C CA  . VAL D 2 97  ? 17.371  4.822   -60.591 1.00 30.05  ? 392 VAL D CA  1 
ATOM   6236 C C   . VAL D 2 97  ? 16.671  3.590   -61.163 1.00 33.14  ? 392 VAL D C   1 
ATOM   6237 O O   . VAL D 2 97  ? 15.775  3.023   -60.537 1.00 32.20  ? 392 VAL D O   1 
ATOM   6238 C CB  . VAL D 2 97  ? 16.807  6.103   -61.254 1.00 28.42  ? 392 VAL D CB  1 
ATOM   6239 C CG1 . VAL D 2 97  ? 15.316  5.985   -61.471 1.00 30.98  ? 392 VAL D CG1 1 
ATOM   6240 C CG2 . VAL D 2 97  ? 17.144  7.331   -60.414 1.00 29.76  ? 392 VAL D CG2 1 
ATOM   6241 N N   . TRP D 2 98  ? 17.090  3.174   -62.351 1.00 31.73  ? 393 TRP D N   1 
ATOM   6242 C CA  . TRP D 2 98  ? 16.529  1.977   -62.981 1.00 33.04  ? 393 TRP D CA  1 
ATOM   6243 C C   . TRP D 2 98  ? 16.806  0.737   -62.139 1.00 27.78  ? 393 TRP D C   1 
ATOM   6244 O O   . TRP D 2 98  ? 15.911  -0.076  -61.920 1.00 36.24  ? 393 TRP D O   1 
ATOM   6245 C CB  . TRP D 2 98  ? 17.100  1.811   -64.393 1.00 32.61  ? 393 TRP D CB  1 
ATOM   6246 C CG  . TRP D 2 98  ? 16.819  0.481   -65.034 1.00 28.59  ? 393 TRP D CG  1 
ATOM   6247 C CD1 . TRP D 2 98  ? 17.721  -0.502  -65.291 1.00 30.69  ? 393 TRP D CD1 1 
ATOM   6248 C CD2 . TRP D 2 98  ? 15.552  0.005   -65.516 1.00 29.06  ? 393 TRP D CD2 1 
ATOM   6249 N NE1 . TRP D 2 98  ? 17.097  -1.571  -65.899 1.00 32.55  ? 393 TRP D NE1 1 
ATOM   6250 C CE2 . TRP D 2 98  ? 15.766  -1.283  -66.050 1.00 32.03  ? 393 TRP D CE2 1 
ATOM   6251 C CE3 . TRP D 2 98  ? 14.258  0.541   -65.546 1.00 30.46  ? 393 TRP D CE3 1 
ATOM   6252 C CZ2 . TRP D 2 98  ? 14.739  -2.044  -66.604 1.00 31.48  ? 393 TRP D CZ2 1 
ATOM   6253 C CZ3 . TRP D 2 98  ? 13.240  -0.216  -66.100 1.00 30.98  ? 393 TRP D CZ3 1 
ATOM   6254 C CH2 . TRP D 2 98  ? 13.487  -1.499  -66.618 1.00 29.21  ? 393 TRP D CH2 1 
ATOM   6255 N N   . ARG D 2 99  ? 18.042  0.606   -61.658 1.00 30.08  ? 394 ARG D N   1 
ATOM   6256 C CA  . ARG D 2 99  ? 18.448  -0.544  -60.846 1.00 35.03  ? 394 ARG D CA  1 
ATOM   6257 C C   . ARG D 2 99  ? 17.695  -0.600  -59.528 1.00 33.57  ? 394 ARG D C   1 
ATOM   6258 O O   . ARG D 2 99  ? 17.492  -1.672  -58.974 1.00 33.24  ? 394 ARG D O   1 
ATOM   6259 C CB  . ARG D 2 99  ? 19.949  -0.486  -60.528 1.00 36.18  ? 394 ARG D CB  1 
ATOM   6260 C CG  . ARG D 2 99  ? 20.870  -0.618  -61.718 1.00 41.42  ? 394 ARG D CG  1 
ATOM   6261 C CD  . ARG D 2 99  ? 22.277  -1.001  -61.281 1.00 41.78  ? 394 ARG D CD  1 
ATOM   6262 N NE  . ARG D 2 99  ? 22.961  0.027   -60.490 1.00 34.30  ? 394 ARG D NE  1 
ATOM   6263 C CZ  . ARG D 2 99  ? 23.632  1.049   -61.012 1.00 35.07  ? 394 ARG D CZ  1 
ATOM   6264 N NH1 . ARG D 2 99  ? 23.697  1.203   -62.330 1.00 31.81  ? 394 ARG D NH1 1 
ATOM   6265 N NH2 . ARG D 2 99  ? 24.239  1.925   -60.218 1.00 34.71  ? 394 ARG D NH2 1 
ATOM   6266 N N   . SER D 2 100 ? 17.306  0.563   -59.016 1.00 33.48  ? 395 SER D N   1 
ATOM   6267 C CA  . SER D 2 100 ? 16.705  0.653   -57.690 1.00 37.14  ? 395 SER D CA  1 
ATOM   6268 C C   . SER D 2 100 ? 15.186  0.542   -57.769 1.00 39.31  ? 395 SER D C   1 
ATOM   6269 O O   . SER D 2 100 ? 14.494  0.525   -56.749 1.00 41.93  ? 395 SER D O   1 
ATOM   6270 C CB  . SER D 2 100 ? 17.089  1.980   -57.023 1.00 36.72  ? 395 SER D CB  1 
ATOM   6271 O OG  . SER D 2 100 ? 18.490  2.192   -57.073 1.00 34.90  ? 395 SER D OG  1 
ATOM   6272 N N   . MET D 2 101 ? 14.675  0.468   -58.989 1.00 35.37  ? 396 MET D N   1 
ATOM   6273 C CA  . MET D 2 101 ? 13.244  0.552   -59.233 1.00 45.49  ? 396 MET D CA  1 
ATOM   6274 C C   . MET D 2 101 ? 12.454  -0.431  -58.379 1.00 46.67  ? 396 MET D C   1 
ATOM   6275 O O   . MET D 2 101 ? 11.449  -0.067  -57.773 1.00 45.29  ? 396 MET D O   1 
ATOM   6276 C CB  . MET D 2 101 ? 12.956  0.319   -60.718 1.00 50.59  ? 396 MET D CB  1 
ATOM   6277 C CG  . MET D 2 101 ? 11.625  0.859   -61.181 1.00 45.99  ? 396 MET D CG  1 
ATOM   6278 S SD  . MET D 2 101 ? 11.476  0.771   -62.972 1.00 53.96  ? 396 MET D SD  1 
ATOM   6279 C CE  . MET D 2 101 ? 10.220  -0.494  -63.162 1.00 46.58  ? 396 MET D CE  1 
ATOM   6280 N N   . GLU D 2 102 ? 12.916  -1.673  -58.321 1.00 51.27  ? 397 GLU D N   1 
ATOM   6281 C CA  . GLU D 2 102 ? 12.202  -2.710  -57.587 1.00 58.28  ? 397 GLU D CA  1 
ATOM   6282 C C   . GLU D 2 102 ? 12.610  -2.791  -56.112 1.00 54.35  ? 397 GLU D C   1 
ATOM   6283 O O   . GLU D 2 102 ? 12.351  -3.792  -55.449 1.00 50.91  ? 397 GLU D O   1 
ATOM   6284 C CB  . GLU D 2 102 ? 12.388  -4.072  -58.266 1.00 66.25  ? 397 GLU D CB  1 
ATOM   6285 C CG  . GLU D 2 102 ? 13.835  -4.564  -58.324 1.00 79.31  ? 397 GLU D CG  1 
ATOM   6286 C CD  . GLU D 2 102 ? 14.588  -4.077  -59.557 1.00 85.88  ? 397 GLU D CD  1 
ATOM   6287 O OE1 . GLU D 2 102 ? 14.859  -4.910  -60.453 1.00 93.08  ? 397 GLU D OE1 1 
ATOM   6288 O OE2 . GLU D 2 102 ? 14.909  -2.868  -59.631 1.00 76.21  ? 397 GLU D OE2 1 
ATOM   6289 N N   . HIS D 2 103 ? 13.233  -1.733  -55.602 1.00 48.80  ? 398 HIS D N   1 
ATOM   6290 C CA  . HIS D 2 103 ? 13.663  -1.696  -54.206 1.00 45.89  ? 398 HIS D CA  1 
ATOM   6291 C C   . HIS D 2 103 ? 13.215  -0.404  -53.529 1.00 46.56  ? 398 HIS D C   1 
ATOM   6292 O O   . HIS D 2 103 ? 14.041  0.466   -53.236 1.00 43.54  ? 398 HIS D O   1 
ATOM   6293 C CB  . HIS D 2 103 ? 15.187  -1.807  -54.109 1.00 43.00  ? 398 HIS D CB  1 
ATOM   6294 C CG  . HIS D 2 103 ? 15.752  -3.018  -54.788 1.00 52.08  ? 398 HIS D CG  1 
ATOM   6295 N ND1 . HIS D 2 103 ? 15.910  -4.222  -54.142 1.00 55.22  ? 398 HIS D ND1 1 
ATOM   6296 C CD2 . HIS D 2 103 ? 16.204  -3.200  -56.050 1.00 52.24  ? 398 HIS D CD2 1 
ATOM   6297 C CE1 . HIS D 2 103 ? 16.430  -5.104  -54.981 1.00 56.59  ? 398 HIS D CE1 1 
ATOM   6298 N NE2 . HIS D 2 103 ? 16.617  -4.507  -56.145 1.00 57.37  ? 398 HIS D NE2 1 
ATOM   6299 N N   . PRO D 2 104 ? 11.906  -0.276  -53.266 1.00 44.47  ? 399 PRO D N   1 
ATOM   6300 C CA  . PRO D 2 104 ? 11.386  0.980   -52.711 1.00 34.83  ? 399 PRO D CA  1 
ATOM   6301 C C   . PRO D 2 104 ? 12.129  1.383   -51.444 1.00 40.91  ? 399 PRO D C   1 
ATOM   6302 O O   . PRO D 2 104 ? 12.377  0.537   -50.576 1.00 42.41  ? 399 PRO D O   1 
ATOM   6303 C CB  . PRO D 2 104 ? 9.924   0.646   -52.393 1.00 42.29  ? 399 PRO D CB  1 
ATOM   6304 C CG  . PRO D 2 104 ? 9.596   -0.509  -53.284 1.00 45.45  ? 399 PRO D CG  1 
ATOM   6305 C CD  . PRO D 2 104 ? 10.861  -1.305  -53.395 1.00 44.64  ? 399 PRO D CD  1 
ATOM   6306 N N   . GLY D 2 105 ? 12.498  2.657   -51.354 1.00 36.72  ? 400 GLY D N   1 
ATOM   6307 C CA  . GLY D 2 105 ? 13.188  3.178   -50.187 1.00 39.58  ? 400 GLY D CA  1 
ATOM   6308 C C   . GLY D 2 105 ? 14.684  2.920   -50.178 1.00 43.97  ? 400 GLY D C   1 
ATOM   6309 O O   . GLY D 2 105 ? 15.386  3.333   -49.255 1.00 48.57  ? 400 GLY D O   1 
ATOM   6310 N N   . LYS D 2 106 ? 15.181  2.244   -51.207 1.00 44.32  ? 401 LYS D N   1 
ATOM   6311 C CA  . LYS D 2 106 ? 16.603  1.925   -51.274 1.00 43.69  ? 401 LYS D CA  1 
ATOM   6312 C C   . LYS D 2 106 ? 17.209  2.272   -52.626 1.00 39.53  ? 401 LYS D C   1 
ATOM   6313 O O   . LYS D 2 106 ? 16.534  2.232   -53.654 1.00 40.74  ? 401 LYS D O   1 
ATOM   6314 C CB  . LYS D 2 106 ? 16.834  0.445   -50.964 1.00 44.57  ? 401 LYS D CB  1 
ATOM   6315 C CG  . LYS D 2 106 ? 16.257  -0.005  -49.626 1.00 51.79  ? 401 LYS D CG  1 
ATOM   6316 C CD  . LYS D 2 106 ? 16.729  -1.406  -49.261 1.00 63.51  ? 401 LYS D CD  1 
ATOM   6317 C CE  . LYS D 2 106 ? 16.127  -1.873  -47.943 1.00 70.92  ? 401 LYS D CE  1 
ATOM   6318 N NZ  . LYS D 2 106 ? 16.407  -0.927  -46.823 1.00 73.08  ? 401 LYS D NZ  1 
ATOM   6319 N N   . LEU D 2 107 ? 18.488  2.624   -52.609 1.00 39.96  ? 402 LEU D N   1 
ATOM   6320 C CA  . LEU D 2 107 ? 19.249  2.832   -53.830 1.00 41.65  ? 402 LEU D CA  1 
ATOM   6321 C C   . LEU D 2 107 ? 20.246  1.692   -54.028 1.00 44.35  ? 402 LEU D C   1 
ATOM   6322 O O   . LEU D 2 107 ? 21.107  1.438   -53.178 1.00 38.82  ? 402 LEU D O   1 
ATOM   6323 C CB  . LEU D 2 107 ? 19.976  4.179   -53.792 1.00 40.98  ? 402 LEU D CB  1 
ATOM   6324 C CG  . LEU D 2 107 ? 19.091  5.423   -53.863 1.00 38.65  ? 402 LEU D CG  1 
ATOM   6325 C CD1 . LEU D 2 107 ? 19.929  6.685   -53.731 1.00 36.36  ? 402 LEU D CD1 1 
ATOM   6326 C CD2 . LEU D 2 107 ? 18.308  5.437   -55.165 1.00 38.54  ? 402 LEU D CD2 1 
ATOM   6327 N N   . LEU D 2 108 ? 20.121  1.006   -55.156 1.00 40.28  ? 403 LEU D N   1 
ATOM   6328 C CA  . LEU D 2 108 ? 20.992  -0.119  -55.459 1.00 40.33  ? 403 LEU D CA  1 
ATOM   6329 C C   . LEU D 2 108 ? 22.181  0.346   -56.286 1.00 39.31  ? 403 LEU D C   1 
ATOM   6330 O O   . LEU D 2 108 ? 22.192  0.214   -57.514 1.00 33.49  ? 403 LEU D O   1 
ATOM   6331 C CB  . LEU D 2 108 ? 20.214  -1.217  -56.191 1.00 36.16  ? 403 LEU D CB  1 
ATOM   6332 C CG  . LEU D 2 108 ? 20.843  -2.614  -56.252 1.00 41.73  ? 403 LEU D CG  1 
ATOM   6333 C CD1 . LEU D 2 108 ? 19.763  -3.662  -56.268 1.00 33.55  ? 403 LEU D CD1 1 
ATOM   6334 C CD2 . LEU D 2 108 ? 21.746  -2.754  -57.469 1.00 43.21  ? 403 LEU D CD2 1 
ATOM   6335 N N   . PHE D 2 109 ? 23.175  0.916   -55.609 1.00 36.74  ? 404 PHE D N   1 
ATOM   6336 C CA  . PHE D 2 109 ? 24.403  1.323   -56.282 1.00 32.68  ? 404 PHE D CA  1 
ATOM   6337 C C   . PHE D 2 109 ? 25.057  0.108   -56.934 1.00 33.28  ? 404 PHE D C   1 
ATOM   6338 O O   . PHE D 2 109 ? 25.596  0.199   -58.042 1.00 32.74  ? 404 PHE D O   1 
ATOM   6339 C CB  . PHE D 2 109 ? 25.355  2.013   -55.306 1.00 34.24  ? 404 PHE D CB  1 
ATOM   6340 C CG  . PHE D 2 109 ? 24.885  3.376   -54.870 1.00 33.09  ? 404 PHE D CG  1 
ATOM   6341 C CD1 . PHE D 2 109 ? 25.198  4.500   -55.613 1.00 32.37  ? 404 PHE D CD1 1 
ATOM   6342 C CD2 . PHE D 2 109 ? 24.120  3.527   -53.731 1.00 36.47  ? 404 PHE D CD2 1 
ATOM   6343 C CE1 . PHE D 2 109 ? 24.763  5.751   -55.228 1.00 37.63  ? 404 PHE D CE1 1 
ATOM   6344 C CE2 . PHE D 2 109 ? 23.684  4.779   -53.337 1.00 43.02  ? 404 PHE D CE2 1 
ATOM   6345 C CZ  . PHE D 2 109 ? 24.008  5.892   -54.088 1.00 42.65  ? 404 PHE D CZ  1 
ATOM   6346 N N   . ALA D 2 110 ? 24.984  -1.027  -56.245 1.00 35.98  ? 405 ALA D N   1 
ATOM   6347 C CA  . ALA D 2 110 ? 25.411  -2.319  -56.794 1.00 34.41  ? 405 ALA D CA  1 
ATOM   6348 C C   . ALA D 2 110 ? 24.724  -3.438  -56.021 1.00 33.67  ? 405 ALA D C   1 
ATOM   6349 O O   . ALA D 2 110 ? 24.175  -3.199  -54.950 1.00 41.26  ? 405 ALA D O   1 
ATOM   6350 C CB  . ALA D 2 110 ? 26.925  -2.462  -56.707 1.00 31.37  ? 405 ALA D CB  1 
ATOM   6351 N N   . PRO D 2 111 ? 24.740  -4.667  -56.563 1.00 41.19  ? 406 PRO D N   1 
ATOM   6352 C CA  . PRO D 2 111 ? 24.072  -5.791  -55.893 1.00 42.71  ? 406 PRO D CA  1 
ATOM   6353 C C   . PRO D 2 111 ? 24.557  -6.018  -54.456 1.00 41.96  ? 406 PRO D C   1 
ATOM   6354 O O   . PRO D 2 111 ? 23.803  -6.531  -53.628 1.00 37.04  ? 406 PRO D O   1 
ATOM   6355 C CB  . PRO D 2 111 ? 24.441  -6.986  -56.773 1.00 38.30  ? 406 PRO D CB  1 
ATOM   6356 C CG  . PRO D 2 111 ? 24.677  -6.389  -58.131 1.00 35.90  ? 406 PRO D CG  1 
ATOM   6357 C CD  . PRO D 2 111 ? 25.306  -5.054  -57.869 1.00 36.92  ? 406 PRO D CD  1 
ATOM   6358 N N   . ASN D 2 112 ? 25.798  -5.635  -54.168 1.00 32.45  ? 407 ASN D N   1 
ATOM   6359 C CA  . ASN D 2 112 ? 26.344  -5.749  -52.820 1.00 37.08  ? 407 ASN D CA  1 
ATOM   6360 C C   . ASN D 2 112 ? 26.449  -4.392  -52.134 1.00 50.30  ? 407 ASN D C   1 
ATOM   6361 O O   . ASN D 2 112 ? 27.105  -4.252  -51.101 1.00 54.18  ? 407 ASN D O   1 
ATOM   6362 C CB  . ASN D 2 112 ? 27.719  -6.418  -52.848 1.00 36.30  ? 407 ASN D CB  1 
ATOM   6363 C CG  . ASN D 2 112 ? 28.697  -5.703  -53.759 1.00 40.46  ? 407 ASN D CG  1 
ATOM   6364 O OD1 . ASN D 2 112 ? 28.312  -4.852  -54.562 1.00 44.08  ? 407 ASN D OD1 1 
ATOM   6365 N ND2 . ASN D 2 112 ? 29.974  -6.049  -53.642 1.00 42.73  ? 407 ASN D ND2 1 
ATOM   6366 N N   . LEU D 2 113 ? 25.805  -3.390  -52.723 1.00 48.32  ? 408 LEU D N   1 
ATOM   6367 C CA  . LEU D 2 113 ? 25.805  -2.046  -52.160 1.00 42.98  ? 408 LEU D CA  1 
ATOM   6368 C C   . LEU D 2 113 ? 24.424  -1.417  -52.303 1.00 43.90  ? 408 LEU D C   1 
ATOM   6369 O O   . LEU D 2 113 ? 24.191  -0.592  -53.186 1.00 42.39  ? 408 LEU D O   1 
ATOM   6370 C CB  . LEU D 2 113 ? 26.861  -1.178  -52.843 1.00 41.05  ? 408 LEU D CB  1 
ATOM   6371 C CG  . LEU D 2 113 ? 27.122  0.159   -52.155 1.00 47.66  ? 408 LEU D CG  1 
ATOM   6372 C CD1 . LEU D 2 113 ? 27.358  -0.061  -50.669 1.00 48.60  ? 408 LEU D CD1 1 
ATOM   6373 C CD2 . LEU D 2 113 ? 28.297  0.874   -52.798 1.00 50.28  ? 408 LEU D CD2 1 
ATOM   6374 N N   . LEU D 2 114 ? 23.511  -1.832  -51.432 1.00 47.97  ? 409 LEU D N   1 
ATOM   6375 C CA  . LEU D 2 114 ? 22.141  -1.345  -51.437 1.00 50.35  ? 409 LEU D CA  1 
ATOM   6376 C C   . LEU D 2 114 ? 21.934  -0.463  -50.216 1.00 57.47  ? 409 LEU D C   1 
ATOM   6377 O O   . LEU D 2 114 ? 22.057  -0.929  -49.083 1.00 60.72  ? 409 LEU D O   1 
ATOM   6378 C CB  . LEU D 2 114 ? 21.171  -2.522  -51.399 1.00 52.48  ? 409 LEU D CB  1 
ATOM   6379 C CG  . LEU D 2 114 ? 19.674  -2.228  -51.338 1.00 54.80  ? 409 LEU D CG  1 
ATOM   6380 C CD1 . LEU D 2 114 ? 19.214  -1.512  -52.598 1.00 56.89  ? 409 LEU D CD1 1 
ATOM   6381 C CD2 . LEU D 2 114 ? 18.900  -3.522  -51.144 1.00 55.90  ? 409 LEU D CD2 1 
ATOM   6382 N N   . LEU D 2 115 ? 21.623  0.811   -50.442 1.00 52.60  ? 410 LEU D N   1 
ATOM   6383 C CA  . LEU D 2 115 ? 21.535  1.774   -49.348 1.00 52.54  ? 410 LEU D CA  1 
ATOM   6384 C C   . LEU D 2 115 ? 20.126  2.313   -49.121 1.00 56.45  ? 410 LEU D C   1 
ATOM   6385 O O   . LEU D 2 115 ? 19.374  2.535   -50.069 1.00 52.52  ? 410 LEU D O   1 
ATOM   6386 C CB  . LEU D 2 115 ? 22.495  2.935   -49.593 1.00 49.47  ? 410 LEU D CB  1 
ATOM   6387 C CG  . LEU D 2 115 ? 23.939  2.520   -49.864 1.00 55.73  ? 410 LEU D CG  1 
ATOM   6388 C CD1 . LEU D 2 115 ? 24.821  3.740   -49.989 1.00 58.83  ? 410 LEU D CD1 1 
ATOM   6389 C CD2 . LEU D 2 115 ? 24.449  1.606   -48.768 1.00 58.89  ? 410 LEU D CD2 1 
ATOM   6390 N N   . ASP D 2 116 ? 19.776  2.523   -47.855 1.00 60.48  ? 411 ASP D N   1 
ATOM   6391 C CA  . ASP D 2 116 ? 18.514  3.166   -47.520 1.00 62.96  ? 411 ASP D CA  1 
ATOM   6392 C C   . ASP D 2 116 ? 18.765  4.630   -47.195 1.00 63.24  ? 411 ASP D C   1 
ATOM   6393 O O   . ASP D 2 116 ? 19.912  5.077   -47.145 1.00 55.47  ? 411 ASP D O   1 
ATOM   6394 C CB  . ASP D 2 116 ? 17.813  2.458   -46.356 1.00 70.51  ? 411 ASP D CB  1 
ATOM   6395 C CG  . ASP D 2 116 ? 18.432  2.780   -45.004 1.00 77.14  ? 411 ASP D CG  1 
ATOM   6396 O OD1 . ASP D 2 116 ? 19.469  3.473   -44.949 1.00 75.00  ? 411 ASP D OD1 1 
ATOM   6397 O OD2 . ASP D 2 116 ? 17.868  2.333   -43.984 1.00 82.65  ? 411 ASP D OD2 1 
ATOM   6398 N N   . ARG D 2 117 ? 17.686  5.368   -46.967 1.00 79.96  ? 412 ARG D N   1 
ATOM   6399 C CA  . ARG D 2 117 ? 17.773  6.807   -46.754 1.00 78.02  ? 412 ARG D CA  1 
ATOM   6400 C C   . ARG D 2 117 ? 18.707  7.215   -45.613 1.00 82.85  ? 412 ARG D C   1 
ATOM   6401 O O   . ARG D 2 117 ? 19.391  8.236   -45.697 1.00 84.71  ? 412 ARG D O   1 
ATOM   6402 C CB  . ARG D 2 117 ? 16.380  7.391   -46.520 1.00 72.46  ? 412 ARG D CB  1 
ATOM   6403 C CG  . ARG D 2 117 ? 16.407  8.865   -46.207 1.00 67.57  ? 412 ARG D CG  1 
ATOM   6404 C CD  . ARG D 2 117 ? 15.039  9.497   -46.331 1.00 62.86  ? 412 ARG D CD  1 
ATOM   6405 N NE  . ARG D 2 117 ? 15.157  10.950  -46.391 1.00 70.73  ? 412 ARG D NE  1 
ATOM   6406 C CZ  . ARG D 2 117 ? 15.367  11.726  -45.333 1.00 72.51  ? 412 ARG D CZ  1 
ATOM   6407 N NH1 . ARG D 2 117 ? 15.477  11.190  -44.123 1.00 73.04  ? 412 ARG D NH1 1 
ATOM   6408 N NH2 . ARG D 2 117 ? 15.469  13.040  -45.486 1.00 65.73  ? 412 ARG D NH2 1 
ATOM   6409 N N   . ASN D 2 118 ? 18.737  6.418   -44.549 1.00 86.91  ? 413 ASN D N   1 
ATOM   6410 C CA  . ASN D 2 118 ? 19.505  6.776   -43.356 1.00 95.18  ? 413 ASN D CA  1 
ATOM   6411 C C   . ASN D 2 118 ? 21.016  6.599   -43.480 1.00 97.28  ? 413 ASN D C   1 
ATOM   6412 O O   . ASN D 2 118 ? 21.784  7.409   -42.960 1.00 98.90  ? 413 ASN D O   1 
ATOM   6413 C CB  . ASN D 2 118 ? 18.971  6.044   -42.125 1.00 102.21 ? 413 ASN D CB  1 
ATOM   6414 C CG  . ASN D 2 118 ? 17.768  6.737   -41.524 1.00 112.09 ? 413 ASN D CG  1 
ATOM   6415 O OD1 . ASN D 2 118 ? 17.728  7.966   -41.438 1.00 114.27 ? 413 ASN D OD1 1 
ATOM   6416 N ND2 . ASN D 2 118 ? 16.781  5.955   -41.105 1.00 116.78 ? 413 ASN D ND2 1 
ATOM   6417 N N   . GLN D 2 119 ? 21.443  5.539   -44.156 1.00 105.47 ? 414 GLN D N   1 
ATOM   6418 C CA  . GLN D 2 119 ? 22.851  5.401   -44.492 1.00 103.64 ? 414 GLN D CA  1 
ATOM   6419 C C   . GLN D 2 119 ? 23.185  6.520   -45.468 1.00 105.79 ? 414 GLN D C   1 
ATOM   6420 O O   . GLN D 2 119 ? 24.350  6.862   -45.674 1.00 110.27 ? 414 GLN D O   1 
ATOM   6421 C CB  . GLN D 2 119 ? 23.124  4.042   -45.130 1.00 97.17  ? 414 GLN D CB  1 
ATOM   6422 C CG  . GLN D 2 119 ? 22.711  2.864   -44.272 1.00 92.26  ? 414 GLN D CG  1 
ATOM   6423 C CD  . GLN D 2 119 ? 22.175  1.711   -45.096 1.00 92.26  ? 414 GLN D CD  1 
ATOM   6424 O OE1 . GLN D 2 119 ? 22.026  1.819   -46.313 1.00 90.12  ? 414 GLN D OE1 1 
ATOM   6425 N NE2 . GLN D 2 119 ? 21.874  0.601   -44.436 1.00 94.02  ? 414 GLN D NE2 1 
ATOM   6426 N N   . GLY D 2 120 ? 22.142  7.086   -46.064 1.00 100.94 ? 415 GLY D N   1 
ATOM   6427 C CA  . GLY D 2 120 ? 22.289  8.202   -46.976 1.00 103.26 ? 415 GLY D CA  1 
ATOM   6428 C C   . GLY D 2 120 ? 22.314  9.534   -46.250 1.00 107.40 ? 415 GLY D C   1 
ATOM   6429 O O   . GLY D 2 120 ? 22.435  10.587  -46.874 1.00 112.01 ? 415 GLY D O   1 
ATOM   6430 N N   . LYS D 2 121 ? 22.190  9.490   -44.926 1.00 110.34 ? 416 LYS D N   1 
ATOM   6431 C CA  . LYS D 2 121 ? 22.260  10.699  -44.111 1.00 114.82 ? 416 LYS D CA  1 
ATOM   6432 C C   . LYS D 2 121 ? 23.684  10.936  -43.615 1.00 119.62 ? 416 LYS D C   1 
ATOM   6433 O O   . LYS D 2 121 ? 24.106  12.079  -43.441 1.00 125.98 ? 416 LYS D O   1 
ATOM   6434 C CB  . LYS D 2 121 ? 21.292  10.613  -42.929 1.00 115.36 ? 416 LYS D CB  1 
ATOM   6435 N N   . CYS D 2 122 ? 24.416  9.849   -43.388 1.00 118.89 ? 417 CYS D N   1 
ATOM   6436 C CA  . CYS D 2 122 ? 25.817  9.934   -42.990 1.00 119.93 ? 417 CYS D CA  1 
ATOM   6437 C C   . CYS D 2 122 ? 26.590  10.737  -44.024 1.00 120.24 ? 417 CYS D C   1 
ATOM   6438 O O   . CYS D 2 122 ? 27.533  11.458  -43.696 1.00 120.92 ? 417 CYS D O   1 
ATOM   6439 C CB  . CYS D 2 122 ? 26.426  8.537   -42.859 1.00 118.08 ? 417 CYS D CB  1 
ATOM   6440 S SG  . CYS D 2 122 ? 25.652  7.495   -41.603 1.00 168.13 ? 417 CYS D SG  1 
ATOM   6441 N N   . VAL D 2 123 ? 26.183  10.601  -45.281 1.00 114.71 ? 418 VAL D N   1 
ATOM   6442 C CA  . VAL D 2 123 ? 26.788  11.352  -46.369 1.00 111.31 ? 418 VAL D CA  1 
ATOM   6443 C C   . VAL D 2 123 ? 26.353  12.811  -46.306 1.00 112.90 ? 418 VAL D C   1 
ATOM   6444 O O   . VAL D 2 123 ? 25.261  13.163  -46.753 1.00 110.73 ? 418 VAL D O   1 
ATOM   6445 C CB  . VAL D 2 123 ? 26.400  10.767  -47.729 1.00 104.17 ? 418 VAL D CB  1 
ATOM   6446 C CG1 . VAL D 2 123 ? 27.646  10.517  -48.554 1.00 101.13 ? 418 VAL D CG1 1 
ATOM   6447 C CG2 . VAL D 2 123 ? 25.611  9.480   -47.539 1.00 97.82  ? 418 VAL D CG2 1 
ATOM   6448 N N   . GLU D 2 124 ? 27.225  13.645  -45.748 1.00 80.99  ? 419 GLU D N   1 
ATOM   6449 C CA  . GLU D 2 124 ? 26.944  15.060  -45.513 1.00 89.83  ? 419 GLU D CA  1 
ATOM   6450 C C   . GLU D 2 124 ? 25.795  15.630  -46.345 1.00 97.16  ? 419 GLU D C   1 
ATOM   6451 O O   . GLU D 2 124 ? 24.639  15.617  -45.914 1.00 99.84  ? 419 GLU D O   1 
ATOM   6452 C CB  . GLU D 2 124 ? 28.210  15.896  -45.727 1.00 91.03  ? 419 GLU D CB  1 
ATOM   6453 N N   . GLY D 2 125 ? 26.118  16.128  -47.535 1.00 99.52  ? 420 GLY D N   1 
ATOM   6454 C CA  . GLY D 2 125 ? 25.147  16.852  -48.337 1.00 100.60 ? 420 GLY D CA  1 
ATOM   6455 C C   . GLY D 2 125 ? 24.515  16.069  -49.472 1.00 97.21  ? 420 GLY D C   1 
ATOM   6456 O O   . GLY D 2 125 ? 23.967  16.654  -50.407 1.00 98.45  ? 420 GLY D O   1 
ATOM   6457 N N   . MET D 2 126 ? 24.578  14.745  -49.394 1.00 72.45  ? 421 MET D N   1 
ATOM   6458 C CA  . MET D 2 126 ? 24.007  13.905  -50.437 1.00 66.65  ? 421 MET D CA  1 
ATOM   6459 C C   . MET D 2 126 ? 22.569  13.513  -50.131 1.00 62.65  ? 421 MET D C   1 
ATOM   6460 O O   . MET D 2 126 ? 21.869  12.990  -50.995 1.00 64.49  ? 421 MET D O   1 
ATOM   6461 C CB  . MET D 2 126 ? 24.838  12.641  -50.630 1.00 66.79  ? 421 MET D CB  1 
ATOM   6462 C CG  . MET D 2 126 ? 26.251  12.879  -51.108 1.00 66.69  ? 421 MET D CG  1 
ATOM   6463 S SD  . MET D 2 126 ? 26.914  11.387  -51.866 1.00 105.61 ? 421 MET D SD  1 
ATOM   6464 C CE  . MET D 2 126 ? 28.667  11.626  -51.608 1.00 94.56  ? 421 MET D CE  1 
ATOM   6465 N N   . VAL D 2 127 ? 22.133  13.758  -48.902 1.00 54.92  ? 422 VAL D N   1 
ATOM   6466 C CA  . VAL D 2 127 ? 20.806  13.339  -48.470 1.00 54.95  ? 422 VAL D CA  1 
ATOM   6467 C C   . VAL D 2 127 ? 19.722  13.865  -49.404 1.00 51.45  ? 422 VAL D C   1 
ATOM   6468 O O   . VAL D 2 127 ? 18.789  13.148  -49.747 1.00 53.23  ? 422 VAL D O   1 
ATOM   6469 C CB  . VAL D 2 127 ? 20.505  13.812  -47.040 1.00 64.62  ? 422 VAL D CB  1 
ATOM   6470 C CG1 . VAL D 2 127 ? 19.557  12.841  -46.350 1.00 61.24  ? 422 VAL D CG1 1 
ATOM   6471 C CG2 . VAL D 2 127 ? 21.801  13.957  -46.254 1.00 68.40  ? 422 VAL D CG2 1 
ATOM   6472 N N   . GLU D 2 128 ? 19.846  15.123  -49.809 1.00 45.64  ? 423 GLU D N   1 
ATOM   6473 C CA  . GLU D 2 128 ? 18.875  15.718  -50.716 1.00 46.22  ? 423 GLU D CA  1 
ATOM   6474 C C   . GLU D 2 128 ? 18.908  15.044  -52.081 1.00 37.66  ? 423 GLU D C   1 
ATOM   6475 O O   . GLU D 2 128 ? 17.866  14.752  -52.656 1.00 37.42  ? 423 GLU D O   1 
ATOM   6476 C CB  . GLU D 2 128 ? 19.109  17.224  -50.854 1.00 56.79  ? 423 GLU D CB  1 
ATOM   6477 C CG  . GLU D 2 128 ? 18.359  18.055  -49.825 1.00 76.80  ? 423 GLU D CG  1 
ATOM   6478 C CD  . GLU D 2 128 ? 18.588  19.546  -49.995 1.00 96.48  ? 423 GLU D CD  1 
ATOM   6479 O OE1 . GLU D 2 128 ? 19.525  19.928  -50.729 1.00 100.57 ? 423 GLU D OE1 1 
ATOM   6480 O OE2 . GLU D 2 128 ? 17.830  20.339  -49.393 1.00 104.33 ? 423 GLU D OE2 1 
ATOM   6481 N N   . ILE D 2 129 ? 20.109  14.798  -52.593 1.00 37.92  ? 424 ILE D N   1 
ATOM   6482 C CA  . ILE D 2 129 ? 20.264  14.112  -53.871 1.00 42.98  ? 424 ILE D CA  1 
ATOM   6483 C C   . ILE D 2 129 ? 19.772  12.668  -53.773 1.00 43.20  ? 424 ILE D C   1 
ATOM   6484 O O   . ILE D 2 129 ? 19.135  12.150  -54.691 1.00 40.82  ? 424 ILE D O   1 
ATOM   6485 C CB  . ILE D 2 129 ? 21.725  14.147  -54.342 1.00 44.40  ? 424 ILE D CB  1 
ATOM   6486 C CG1 . ILE D 2 129 ? 22.137  15.590  -54.640 1.00 48.09  ? 424 ILE D CG1 1 
ATOM   6487 C CG2 . ILE D 2 129 ? 21.912  13.273  -55.573 1.00 40.75  ? 424 ILE D CG2 1 
ATOM   6488 C CD1 . ILE D 2 129 ? 23.628  15.790  -54.768 1.00 51.36  ? 424 ILE D CD1 1 
ATOM   6489 N N   . PHE D 2 130 ? 20.070  12.033  -52.646 1.00 35.93  ? 425 PHE D N   1 
ATOM   6490 C CA  . PHE D 2 130 ? 19.582  10.695  -52.340 1.00 41.13  ? 425 PHE D CA  1 
ATOM   6491 C C   . PHE D 2 130 ? 18.063  10.668  -52.455 1.00 38.46  ? 425 PHE D C   1 
ATOM   6492 O O   . PHE D 2 130 ? 17.494  9.800   -53.115 1.00 38.00  ? 425 PHE D O   1 
ATOM   6493 C CB  . PHE D 2 130 ? 19.996  10.312  -50.918 1.00 52.25  ? 425 PHE D CB  1 
ATOM   6494 C CG  . PHE D 2 130 ? 20.270  8.853   -50.731 1.00 66.89  ? 425 PHE D CG  1 
ATOM   6495 C CD1 . PHE D 2 130 ? 19.239  7.969   -50.466 1.00 75.68  ? 425 PHE D CD1 1 
ATOM   6496 C CD2 . PHE D 2 130 ? 21.564  8.367   -50.793 1.00 74.97  ? 425 PHE D CD2 1 
ATOM   6497 C CE1 . PHE D 2 130 ? 19.493  6.622   -50.285 1.00 78.62  ? 425 PHE D CE1 1 
ATOM   6498 C CE2 . PHE D 2 130 ? 21.825  7.022   -50.611 1.00 78.85  ? 425 PHE D CE2 1 
ATOM   6499 C CZ  . PHE D 2 130 ? 20.788  6.148   -50.359 1.00 79.15  ? 425 PHE D CZ  1 
ATOM   6500 N N   . ASP D 2 131 ? 17.413  11.635  -51.812 1.00 32.89  ? 426 ASP D N   1 
ATOM   6501 C CA  . ASP D 2 131 ? 15.956  11.727  -51.816 1.00 32.38  ? 426 ASP D CA  1 
ATOM   6502 C C   . ASP D 2 131 ? 15.390  11.913  -53.216 1.00 33.93  ? 426 ASP D C   1 
ATOM   6503 O O   . ASP D 2 131 ? 14.401  11.276  -53.587 1.00 37.87  ? 426 ASP D O   1 
ATOM   6504 C CB  . ASP D 2 131 ? 15.493  12.874  -50.914 1.00 37.21  ? 426 ASP D CB  1 
ATOM   6505 C CG  . ASP D 2 131 ? 15.426  12.470  -49.452 1.00 48.75  ? 426 ASP D CG  1 
ATOM   6506 O OD1 . ASP D 2 131 ? 15.460  11.249  -49.169 1.00 47.70  ? 426 ASP D OD1 1 
ATOM   6507 O OD2 . ASP D 2 131 ? 15.332  13.372  -48.592 1.00 52.80  ? 426 ASP D OD2 1 
ATOM   6508 N N   . MET D 2 132 ? 16.014  12.793  -53.991 1.00 26.63  ? 427 MET D N   1 
ATOM   6509 C CA  . MET D 2 132 ? 15.591  13.020  -55.367 1.00 29.12  ? 427 MET D CA  1 
ATOM   6510 C C   . MET D 2 132 ? 15.706  11.739  -56.186 1.00 29.99  ? 427 MET D C   1 
ATOM   6511 O O   . MET D 2 132 ? 14.825  11.422  -56.991 1.00 31.90  ? 427 MET D O   1 
ATOM   6512 C CB  . MET D 2 132 ? 16.412  14.142  -56.010 1.00 27.95  ? 427 MET D CB  1 
ATOM   6513 C CG  . MET D 2 132 ? 16.258  15.491  -55.323 1.00 34.54  ? 427 MET D CG  1 
ATOM   6514 S SD  . MET D 2 132 ? 17.139  16.801  -56.193 1.00 54.65  ? 427 MET D SD  1 
ATOM   6515 C CE  . MET D 2 132 ? 18.843  16.302  -55.977 1.00 60.14  ? 427 MET D CE  1 
ATOM   6516 N N   . LEU D 2 133 ? 16.801  11.010  -55.984 1.00 30.50  ? 428 LEU D N   1 
ATOM   6517 C CA  . LEU D 2 133 ? 17.010  9.746   -56.681 1.00 29.81  ? 428 LEU D CA  1 
ATOM   6518 C C   . LEU D 2 133 ? 15.911  8.749   -56.315 1.00 30.16  ? 428 LEU D C   1 
ATOM   6519 O O   . LEU D 2 133 ? 15.329  8.106   -57.185 1.00 30.97  ? 428 LEU D O   1 
ATOM   6520 C CB  . LEU D 2 133 ? 18.398  9.172   -56.353 1.00 29.85  ? 428 LEU D CB  1 
ATOM   6521 C CG  . LEU D 2 133 ? 19.590  9.927   -56.965 1.00 32.02  ? 428 LEU D CG  1 
ATOM   6522 C CD1 . LEU D 2 133 ? 20.905  9.536   -56.307 1.00 30.65  ? 428 LEU D CD1 1 
ATOM   6523 C CD2 . LEU D 2 133 ? 19.657  9.700   -58.472 1.00 25.00  ? 428 LEU D CD2 1 
ATOM   6524 N N   . LEU D 2 134 ? 15.634  8.620   -55.021 1.00 34.40  ? 429 LEU D N   1 
ATOM   6525 C CA  . LEU D 2 134 ? 14.551  7.764   -54.557 1.00 33.17  ? 429 LEU D CA  1 
ATOM   6526 C C   . LEU D 2 134 ? 13.222  8.161   -55.190 1.00 37.18  ? 429 LEU D C   1 
ATOM   6527 O O   . LEU D 2 134 ? 12.441  7.303   -55.612 1.00 33.92  ? 429 LEU D O   1 
ATOM   6528 C CB  . LEU D 2 134 ? 14.441  7.818   -53.034 1.00 35.82  ? 429 LEU D CB  1 
ATOM   6529 C CG  . LEU D 2 134 ? 15.448  6.957   -52.267 1.00 34.95  ? 429 LEU D CG  1 
ATOM   6530 C CD1 . LEU D 2 134 ? 15.393  7.244   -50.770 1.00 36.11  ? 429 LEU D CD1 1 
ATOM   6531 C CD2 . LEU D 2 134 ? 15.205  5.470   -52.550 1.00 33.06  ? 429 LEU D CD2 1 
ATOM   6532 N N   . ALA D 2 135 ? 12.971  9.463   -55.265 1.00 29.99  ? 430 ALA D N   1 
ATOM   6533 C CA  . ALA D 2 135 ? 11.713  9.951   -55.811 1.00 34.00  ? 430 ALA D CA  1 
ATOM   6534 C C   . ALA D 2 135 ? 11.583  9.591   -57.285 1.00 33.15  ? 430 ALA D C   1 
ATOM   6535 O O   . ALA D 2 135 ? 10.490  9.291   -57.761 1.00 34.77  ? 430 ALA D O   1 
ATOM   6536 C CB  . ALA D 2 135 ? 11.594  11.468  -55.612 1.00 26.62  ? 430 ALA D CB  1 
ATOM   6537 N N   . THR D 2 136 ? 12.703  9.610   -58.003 1.00 24.79  ? 431 THR D N   1 
ATOM   6538 C CA  . THR D 2 136 ? 12.697  9.266   -59.423 1.00 33.82  ? 431 THR D CA  1 
ATOM   6539 C C   . THR D 2 136 ? 12.455  7.773   -59.637 1.00 35.09  ? 431 THR D C   1 
ATOM   6540 O O   . THR D 2 136 ? 11.706  7.371   -60.527 1.00 31.68  ? 431 THR D O   1 
ATOM   6541 C CB  . THR D 2 136 ? 14.012  9.668   -60.093 1.00 31.68  ? 431 THR D CB  1 
ATOM   6542 O OG1 . THR D 2 136 ? 14.294  11.034  -59.774 1.00 38.20  ? 431 THR D OG1 1 
ATOM   6543 C CG2 . THR D 2 136 ? 13.908  9.520   -61.599 1.00 32.60  ? 431 THR D CG2 1 
ATOM   6544 N N   . SER D 2 137 ? 13.094  6.954   -58.813 1.00 34.40  ? 432 SER D N   1 
ATOM   6545 C CA  . SER D 2 137 ? 12.932  5.514   -58.904 1.00 35.07  ? 432 SER D CA  1 
ATOM   6546 C C   . SER D 2 137 ? 11.472  5.146   -58.672 1.00 37.20  ? 432 SER D C   1 
ATOM   6547 O O   . SER D 2 137 ? 10.923  4.278   -59.345 1.00 41.34  ? 432 SER D O   1 
ATOM   6548 C CB  . SER D 2 137 ? 13.816  4.825   -57.869 1.00 32.38  ? 432 SER D CB  1 
ATOM   6549 O OG  . SER D 2 137 ? 13.540  3.438   -57.825 1.00 45.51  ? 432 SER D OG  1 
ATOM   6550 N N   . SER D 2 138 ? 10.854  5.827   -57.714 1.00 38.02  ? 433 SER D N   1 
ATOM   6551 C CA  . SER D 2 138 ? 9.466   5.592   -57.362 1.00 38.52  ? 433 SER D CA  1 
ATOM   6552 C C   . SER D 2 138 ? 8.526   6.035   -58.477 1.00 38.18  ? 433 SER D C   1 
ATOM   6553 O O   . SER D 2 138 ? 7.445   5.469   -58.667 1.00 37.52  ? 433 SER D O   1 
ATOM   6554 C CB  . SER D 2 138 ? 9.132   6.339   -56.073 1.00 41.49  ? 433 SER D CB  1 
ATOM   6555 O OG  . SER D 2 138 ? 7.729   6.416   -55.892 1.00 54.37  ? 433 SER D OG  1 
ATOM   6556 N N   . ARG D 2 139 ? 8.936   7.058   -59.210 1.00 32.50  ? 434 ARG D N   1 
ATOM   6557 C CA  . ARG D 2 139 ? 8.174   7.507   -60.361 1.00 34.86  ? 434 ARG D CA  1 
ATOM   6558 C C   . ARG D 2 139 ? 8.237   6.426   -61.442 1.00 35.44  ? 434 ARG D C   1 
ATOM   6559 O O   . ARG D 2 139 ? 7.226   6.084   -62.055 1.00 37.76  ? 434 ARG D O   1 
ATOM   6560 C CB  . ARG D 2 139 ? 8.740   8.829   -60.880 1.00 34.29  ? 434 ARG D CB  1 
ATOM   6561 C CG  . ARG D 2 139 ? 8.073   9.348   -62.138 1.00 46.51  ? 434 ARG D CG  1 
ATOM   6562 C CD  . ARG D 2 139 ? 6.603   9.670   -61.911 1.00 49.68  ? 434 ARG D CD  1 
ATOM   6563 N NE  . ARG D 2 139 ? 5.984   10.220  -63.114 1.00 53.06  ? 434 ARG D NE  1 
ATOM   6564 C CZ  . ARG D 2 139 ? 4.700   10.072  -63.429 1.00 58.71  ? 434 ARG D CZ  1 
ATOM   6565 N NH1 . ARG D 2 139 ? 3.892   9.388   -62.629 1.00 55.27  ? 434 ARG D NH1 1 
ATOM   6566 N NH2 . ARG D 2 139 ? 4.222   10.604  -64.545 1.00 58.95  ? 434 ARG D NH2 1 
ATOM   6567 N N   . PHE D 2 140 ? 9.431   5.888   -61.668 1.00 30.15  ? 435 PHE D N   1 
ATOM   6568 C CA  . PHE D 2 140 ? 9.607   4.792   -62.619 1.00 37.12  ? 435 PHE D CA  1 
ATOM   6569 C C   . PHE D 2 140 ? 8.705   3.630   -62.256 1.00 34.12  ? 435 PHE D C   1 
ATOM   6570 O O   . PHE D 2 140 ? 8.090   3.008   -63.122 1.00 35.29  ? 435 PHE D O   1 
ATOM   6571 C CB  . PHE D 2 140 ? 11.057  4.308   -62.619 1.00 42.63  ? 435 PHE D CB  1 
ATOM   6572 C CG  . PHE D 2 140 ? 11.974  5.135   -63.460 1.00 49.82  ? 435 PHE D CG  1 
ATOM   6573 C CD1 . PHE D 2 140 ? 11.609  6.405   -63.868 1.00 47.08  ? 435 PHE D CD1 1 
ATOM   6574 C CD2 . PHE D 2 140 ? 13.208  4.639   -63.846 1.00 48.85  ? 435 PHE D CD2 1 
ATOM   6575 C CE1 . PHE D 2 140 ? 12.462  7.173   -64.644 1.00 43.52  ? 435 PHE D CE1 1 
ATOM   6576 C CE2 . PHE D 2 140 ? 14.061  5.398   -64.624 1.00 49.58  ? 435 PHE D CE2 1 
ATOM   6577 C CZ  . PHE D 2 140 ? 13.690  6.668   -65.019 1.00 40.22  ? 435 PHE D CZ  1 
ATOM   6578 N N   . ARG D 2 141 ? 8.635   3.345   -60.961 1.00 36.34  ? 436 ARG D N   1 
ATOM   6579 C CA  . ARG D 2 141 ? 7.845   2.234   -60.444 1.00 42.30  ? 436 ARG D CA  1 
ATOM   6580 C C   . ARG D 2 141 ? 6.360   2.433   -60.721 1.00 39.49  ? 436 ARG D C   1 
ATOM   6581 O O   . ARG D 2 141 ? 5.685   1.525   -61.198 1.00 38.61  ? 436 ARG D O   1 
ATOM   6582 C CB  . ARG D 2 141 ? 8.079   2.093   -58.940 1.00 44.51  ? 436 ARG D CB  1 
ATOM   6583 C CG  . ARG D 2 141 ? 7.683   0.753   -58.357 1.00 53.10  ? 436 ARG D CG  1 
ATOM   6584 C CD  . ARG D 2 141 ? 8.072   0.674   -56.889 1.00 56.27  ? 436 ARG D CD  1 
ATOM   6585 N NE  . ARG D 2 141 ? 9.454   1.098   -56.686 1.00 64.73  ? 436 ARG D NE  1 
ATOM   6586 C CZ  . ARG D 2 141 ? 9.827   2.100   -55.894 1.00 67.65  ? 436 ARG D CZ  1 
ATOM   6587 N NH1 . ARG D 2 141 ? 8.918   2.786   -55.209 1.00 65.22  ? 436 ARG D NH1 1 
ATOM   6588 N NH2 . ARG D 2 141 ? 11.111  2.410   -55.782 1.00 67.93  ? 436 ARG D NH2 1 
ATOM   6589 N N   . MET D 2 142 ? 5.851   3.624   -60.423 1.00 37.92  ? 437 MET D N   1 
ATOM   6590 C CA  . MET D 2 142 ? 4.429   3.901   -60.607 1.00 41.77  ? 437 MET D CA  1 
ATOM   6591 C C   . MET D 2 142 ? 4.053   3.959   -62.085 1.00 41.28  ? 437 MET D C   1 
ATOM   6592 O O   . MET D 2 142 ? 2.892   3.769   -62.446 1.00 43.16  ? 437 MET D O   1 
ATOM   6593 C CB  . MET D 2 142 ? 4.018   5.192   -59.883 1.00 44.72  ? 437 MET D CB  1 
ATOM   6594 C CG  . MET D 2 142 ? 4.705   6.451   -60.381 1.00 54.48  ? 437 MET D CG  1 
ATOM   6595 S SD  . MET D 2 142 ? 4.177   7.961   -59.533 1.00 136.92 ? 437 MET D SD  1 
ATOM   6596 C CE  . MET D 2 142 ? 5.109   7.885   -58.002 1.00 64.81  ? 437 MET D CE  1 
ATOM   6597 N N   . MET D 2 143 ? 5.040   4.214   -62.941 1.00 34.74  ? 438 MET D N   1 
ATOM   6598 C CA  . MET D 2 143 ? 4.798   4.265   -64.380 1.00 33.68  ? 438 MET D CA  1 
ATOM   6599 C C   . MET D 2 143 ? 4.972   2.906   -65.050 1.00 37.62  ? 438 MET D C   1 
ATOM   6600 O O   . MET D 2 143 ? 4.717   2.761   -66.250 1.00 37.53  ? 438 MET D O   1 
ATOM   6601 C CB  . MET D 2 143 ? 5.736   5.267   -65.049 1.00 33.78  ? 438 MET D CB  1 
ATOM   6602 C CG  . MET D 2 143 ? 5.488   6.707   -64.680 1.00 39.51  ? 438 MET D CG  1 
ATOM   6603 S SD  . MET D 2 143 ? 6.521   7.799   -65.668 1.00 43.59  ? 438 MET D SD  1 
ATOM   6604 C CE  . MET D 2 143 ? 5.893   7.464   -67.313 1.00 31.88  ? 438 MET D CE  1 
ATOM   6605 N N   . ASN D 2 144 ? 5.415   1.916   -64.282 1.00 34.27  ? 439 ASN D N   1 
ATOM   6606 C CA  . ASN D 2 144 ? 5.770   0.628   -64.852 1.00 30.48  ? 439 ASN D CA  1 
ATOM   6607 C C   . ASN D 2 144 ? 6.724   0.817   -66.024 1.00 36.07  ? 439 ASN D C   1 
ATOM   6608 O O   . ASN D 2 144 ? 6.508   0.255   -67.103 1.00 30.20  ? 439 ASN D O   1 
ATOM   6609 C CB  . ASN D 2 144 ? 4.526   -0.127  -65.331 1.00 41.74  ? 439 ASN D CB  1 
ATOM   6610 C CG  . ASN D 2 144 ? 3.535   -0.406  -64.208 1.00 55.06  ? 439 ASN D CG  1 
ATOM   6611 O OD1 . ASN D 2 144 ? 3.920   -0.586  -63.050 1.00 58.37  ? 439 ASN D OD1 1 
ATOM   6612 N ND2 . ASN D 2 144 ? 2.249   -0.448  -64.550 1.00 56.78  ? 439 ASN D ND2 1 
ATOM   6613 N N   . LEU D 2 145 ? 7.763   1.626   -65.822 1.00 34.95  ? 440 LEU D N   1 
ATOM   6614 C CA  . LEU D 2 145 ? 8.758   1.850   -66.865 1.00 32.42  ? 440 LEU D CA  1 
ATOM   6615 C C   . LEU D 2 145 ? 9.349   0.527   -67.337 1.00 36.43  ? 440 LEU D C   1 
ATOM   6616 O O   . LEU D 2 145 ? 9.705   -0.331  -66.527 1.00 33.11  ? 440 LEU D O   1 
ATOM   6617 C CB  . LEU D 2 145 ? 9.882   2.760   -66.370 1.00 34.38  ? 440 LEU D CB  1 
ATOM   6618 C CG  . LEU D 2 145 ? 10.995  2.938   -67.404 1.00 33.54  ? 440 LEU D CG  1 
ATOM   6619 C CD1 . LEU D 2 145 ? 10.484  3.742   -68.583 1.00 34.76  ? 440 LEU D CD1 1 
ATOM   6620 C CD2 . LEU D 2 145 ? 12.217  3.597   -66.794 1.00 31.83  ? 440 LEU D CD2 1 
ATOM   6621 N N   . GLN D 2 146 ? 9.458   0.377   -68.653 1.00 38.44  ? 441 GLN D N   1 
ATOM   6622 C CA  . GLN D 2 146 ? 9.952   -0.850  -69.261 1.00 33.00  ? 441 GLN D CA  1 
ATOM   6623 C C   . GLN D 2 146 ? 11.427  -0.750  -69.658 1.00 33.51  ? 441 GLN D C   1 
ATOM   6624 O O   . GLN D 2 146 ? 11.931  0.337   -69.963 1.00 28.13  ? 441 GLN D O   1 
ATOM   6625 C CB  . GLN D 2 146 ? 9.099   -1.198  -70.480 1.00 32.62  ? 441 GLN D CB  1 
ATOM   6626 C CG  . GLN D 2 146 ? 7.616   -1.322  -70.168 1.00 37.20  ? 441 GLN D CG  1 
ATOM   6627 C CD  . GLN D 2 146 ? 7.312   -2.491  -69.241 1.00 44.43  ? 441 GLN D CD  1 
ATOM   6628 O OE1 . GLN D 2 146 ? 7.470   -3.655  -69.614 1.00 46.18  ? 441 GLN D OE1 1 
ATOM   6629 N NE2 . GLN D 2 146 ? 6.886   -2.183  -68.023 1.00 40.30  ? 441 GLN D NE2 1 
ATOM   6630 N N   . GLY D 2 147 ? 12.116  -1.888  -69.650 1.00 32.63  ? 442 GLY D N   1 
ATOM   6631 C CA  . GLY D 2 147 ? 13.514  -1.921  -70.049 1.00 32.46  ? 442 GLY D CA  1 
ATOM   6632 C C   . GLY D 2 147 ? 13.721  -1.280  -71.417 1.00 32.68  ? 442 GLY D C   1 
ATOM   6633 O O   . GLY D 2 147 ? 14.669  -0.533  -71.620 1.00 36.51  ? 442 GLY D O   1 
ATOM   6634 N N   . GLU D 2 148 ? 12.828  -1.583  -72.358 1.00 37.78  ? 443 GLU D N   1 
ATOM   6635 C CA  . GLU D 2 148 ? 12.930  -1.048  -73.710 1.00 31.60  ? 443 GLU D CA  1 
ATOM   6636 C C   . GLU D 2 148 ? 12.813  0.474   -73.709 1.00 32.16  ? 443 GLU D C   1 
ATOM   6637 O O   . GLU D 2 148 ? 13.525  1.158   -74.436 1.00 37.32  ? 443 GLU D O   1 
ATOM   6638 C CB  . GLU D 2 148 ? 11.870  -1.652  -74.627 1.00 34.12  ? 443 GLU D CB  1 
ATOM   6639 C CG  . GLU D 2 148 ? 12.097  -3.123  -74.973 1.00 40.74  ? 443 GLU D CG  1 
ATOM   6640 C CD  . GLU D 2 148 ? 11.464  -4.073  -73.976 1.00 54.49  ? 443 GLU D CD  1 
ATOM   6641 O OE1 . GLU D 2 148 ? 10.855  -3.597  -72.990 1.00 48.31  ? 443 GLU D OE1 1 
ATOM   6642 O OE2 . GLU D 2 148 ? 11.573  -5.304  -74.183 1.00 68.28  ? 443 GLU D OE2 1 
ATOM   6643 N N   . GLU D 2 149 ? 11.909  0.998   -72.892 1.00 29.14  ? 444 GLU D N   1 
ATOM   6644 C CA  . GLU D 2 149 ? 11.737  2.443   -72.780 1.00 28.45  ? 444 GLU D CA  1 
ATOM   6645 C C   . GLU D 2 149 ? 12.959  3.041   -72.095 1.00 30.21  ? 444 GLU D C   1 
ATOM   6646 O O   . GLU D 2 149 ? 13.449  4.096   -72.489 1.00 35.56  ? 444 GLU D O   1 
ATOM   6647 C CB  . GLU D 2 149 ? 10.467  2.773   -71.997 1.00 27.42  ? 444 GLU D CB  1 
ATOM   6648 C CG  . GLU D 2 149 ? 9.174   2.266   -72.645 1.00 30.15  ? 444 GLU D CG  1 
ATOM   6649 C CD  . GLU D 2 149 ? 7.972   2.428   -71.736 1.00 33.76  ? 444 GLU D CD  1 
ATOM   6650 O OE1 . GLU D 2 149 ? 8.104   2.169   -70.516 1.00 35.63  ? 444 GLU D OE1 1 
ATOM   6651 O OE2 . GLU D 2 149 ? 6.895   2.823   -72.231 1.00 31.41  ? 444 GLU D OE2 1 
ATOM   6652 N N   . PHE D 2 150 ? 13.461  2.344   -71.083 1.00 32.32  ? 445 PHE D N   1 
ATOM   6653 C CA  . PHE D 2 150 ? 14.628  2.802   -70.346 1.00 32.62  ? 445 PHE D CA  1 
ATOM   6654 C C   . PHE D 2 150 ? 15.847  3.039   -71.234 1.00 28.26  ? 445 PHE D C   1 
ATOM   6655 O O   . PHE D 2 150 ? 16.518  4.063   -71.119 1.00 26.89  ? 445 PHE D O   1 
ATOM   6656 C CB  . PHE D 2 150 ? 14.996  1.809   -69.245 1.00 27.55  ? 445 PHE D CB  1 
ATOM   6657 C CG  . PHE D 2 150 ? 16.361  2.045   -68.667 1.00 30.26  ? 445 PHE D CG  1 
ATOM   6658 C CD1 . PHE D 2 150 ? 16.618  3.176   -67.904 1.00 35.29  ? 445 PHE D CD1 1 
ATOM   6659 C CD2 . PHE D 2 150 ? 17.384  1.149   -68.893 1.00 30.66  ? 445 PHE D CD2 1 
ATOM   6660 C CE1 . PHE D 2 150 ? 17.876  3.396   -67.379 1.00 41.84  ? 445 PHE D CE1 1 
ATOM   6661 C CE2 . PHE D 2 150 ? 18.640  1.361   -68.364 1.00 34.02  ? 445 PHE D CE2 1 
ATOM   6662 C CZ  . PHE D 2 150 ? 18.888  2.486   -67.608 1.00 36.29  ? 445 PHE D CZ  1 
ATOM   6663 N N   . VAL D 2 151 ? 16.159  2.083   -72.098 1.00 32.70  ? 446 VAL D N   1 
ATOM   6664 C CA  . VAL D 2 151 ? 17.346  2.223   -72.931 1.00 24.62  ? 446 VAL D CA  1 
ATOM   6665 C C   . VAL D 2 151 ? 17.173  3.400   -73.889 1.00 27.59  ? 446 VAL D C   1 
ATOM   6666 O O   . VAL D 2 151 ? 18.146  4.066   -74.240 1.00 27.41  ? 446 VAL D O   1 
ATOM   6667 C CB  . VAL D 2 151 ? 17.687  0.930   -73.701 1.00 25.20  ? 446 VAL D CB  1 
ATOM   6668 C CG1 . VAL D 2 151 ? 18.070  -0.178  -72.722 1.00 30.86  ? 446 VAL D CG1 1 
ATOM   6669 C CG2 . VAL D 2 151 ? 16.527  0.489   -74.578 1.00 29.51  ? 446 VAL D CG2 1 
ATOM   6670 N N   . CYS D 2 152 ? 15.933  3.661   -74.298 1.00 26.38  ? 447 CYS D N   1 
ATOM   6671 C CA  . CYS D 2 152 ? 15.652  4.799   -75.172 1.00 26.20  ? 447 CYS D CA  1 
ATOM   6672 C C   . CYS D 2 152 ? 15.917  6.112   -74.441 1.00 29.55  ? 447 CYS D C   1 
ATOM   6673 O O   . CYS D 2 152 ? 16.503  7.037   -75.004 1.00 31.56  ? 447 CYS D O   1 
ATOM   6674 C CB  . CYS D 2 152 ? 14.208  4.762   -75.678 1.00 36.13  ? 447 CYS D CB  1 
ATOM   6675 S SG  . CYS D 2 152 ? 13.845  3.459   -76.889 1.00 35.48  ? 447 CYS D SG  1 
ATOM   6676 N N   . LEU D 2 153 ? 15.474  6.189   -73.190 1.00 26.58  ? 448 LEU D N   1 
ATOM   6677 C CA  . LEU D 2 153 ? 15.672  7.383   -72.384 1.00 27.53  ? 448 LEU D CA  1 
ATOM   6678 C C   . LEU D 2 153 ? 17.156  7.669   -72.208 1.00 28.55  ? 448 LEU D C   1 
ATOM   6679 O O   . LEU D 2 153 ? 17.610  8.791   -72.411 1.00 30.10  ? 448 LEU D O   1 
ATOM   6680 C CB  . LEU D 2 153 ? 14.994  7.230   -71.021 1.00 30.98  ? 448 LEU D CB  1 
ATOM   6681 C CG  . LEU D 2 153 ? 13.466  7.336   -71.011 1.00 34.99  ? 448 LEU D CG  1 
ATOM   6682 C CD1 . LEU D 2 153 ? 12.949  7.216   -69.594 1.00 38.27  ? 448 LEU D CD1 1 
ATOM   6683 C CD2 . LEU D 2 153 ? 13.026  8.651   -71.630 1.00 31.05  ? 448 LEU D CD2 1 
ATOM   6684 N N   . LYS D 2 154 ? 17.913  6.642   -71.845 1.00 26.49  ? 449 LYS D N   1 
ATOM   6685 C CA  . LYS D 2 154 ? 19.345  6.790   -71.664 1.00 31.15  ? 449 LYS D CA  1 
ATOM   6686 C C   . LYS D 2 154 ? 20.016  7.333   -72.917 1.00 32.14  ? 449 LYS D C   1 
ATOM   6687 O O   . LYS D 2 154 ? 20.868  8.221   -72.841 1.00 30.80  ? 449 LYS D O   1 
ATOM   6688 C CB  . LYS D 2 154 ? 19.959  5.447   -71.270 1.00 40.74  ? 449 LYS D CB  1 
ATOM   6689 C CG  . LYS D 2 154 ? 21.159  5.581   -70.368 1.00 42.73  ? 449 LYS D CG  1 
ATOM   6690 C CD  . LYS D 2 154 ? 21.463  4.280   -69.664 1.00 35.66  ? 449 LYS D CD  1 
ATOM   6691 C CE  . LYS D 2 154 ? 21.662  3.151   -70.648 1.00 30.21  ? 449 LYS D CE  1 
ATOM   6692 N NZ  . LYS D 2 154 ? 22.389  2.026   -69.986 1.00 34.44  ? 449 LYS D NZ  1 
ATOM   6693 N N   . SER D 2 155 ? 19.630  6.798   -74.071 1.00 26.63  ? 450 SER D N   1 
ATOM   6694 C CA  . SER D 2 155 ? 20.164  7.261   -75.351 1.00 30.61  ? 450 SER D CA  1 
ATOM   6695 C C   . SER D 2 155 ? 19.792  8.716   -75.609 1.00 29.26  ? 450 SER D C   1 
ATOM   6696 O O   . SER D 2 155 ? 20.593  9.487   -76.138 1.00 32.64  ? 450 SER D O   1 
ATOM   6697 C CB  . SER D 2 155 ? 19.628  6.401   -76.500 1.00 35.85  ? 450 SER D CB  1 
ATOM   6698 O OG  . SER D 2 155 ? 20.021  5.043   -76.336 1.00 51.77  ? 450 SER D OG  1 
ATOM   6699 N N   . ILE D 2 156 ? 18.559  9.080   -75.268 1.00 25.66  ? 451 ILE D N   1 
ATOM   6700 C CA  . ILE D 2 156 ? 18.112  10.453  -75.435 1.00 26.94  ? 451 ILE D CA  1 
ATOM   6701 C C   . ILE D 2 156 ? 18.991  11.396  -74.620 1.00 23.76  ? 451 ILE D C   1 
ATOM   6702 O O   . ILE D 2 156 ? 19.396  12.452  -75.105 1.00 29.74  ? 451 ILE D O   1 
ATOM   6703 C CB  . ILE D 2 156 ? 16.621  10.615  -75.052 1.00 27.37  ? 451 ILE D CB  1 
ATOM   6704 C CG1 . ILE D 2 156 ? 15.738  9.955   -76.117 1.00 23.49  ? 451 ILE D CG1 1 
ATOM   6705 C CG2 . ILE D 2 156 ? 16.263  12.082  -74.899 1.00 22.25  ? 451 ILE D CG2 1 
ATOM   6706 C CD1 . ILE D 2 156 ? 14.269  9.879   -75.745 1.00 25.23  ? 451 ILE D CD1 1 
ATOM   6707 N N   . ILE D 2 157 ? 19.295  10.998  -73.389 1.00 19.68  ? 452 ILE D N   1 
ATOM   6708 C CA  . ILE D 2 157 ? 20.143  11.797  -72.508 1.00 26.96  ? 452 ILE D CA  1 
ATOM   6709 C C   . ILE D 2 157 ? 21.505  12.041  -73.143 1.00 32.34  ? 452 ILE D C   1 
ATOM   6710 O O   . ILE D 2 157 ? 22.040  13.151  -73.100 1.00 38.17  ? 452 ILE D O   1 
ATOM   6711 C CB  . ILE D 2 157 ? 20.349  11.098  -71.148 1.00 30.46  ? 452 ILE D CB  1 
ATOM   6712 C CG1 . ILE D 2 157 ? 19.047  11.084  -70.346 1.00 26.67  ? 452 ILE D CG1 1 
ATOM   6713 C CG2 . ILE D 2 157 ? 21.455  11.775  -70.359 1.00 19.40  ? 452 ILE D CG2 1 
ATOM   6714 C CD1 . ILE D 2 157 ? 19.189  10.440  -68.983 1.00 31.13  ? 452 ILE D CD1 1 
ATOM   6715 N N   . LEU D 2 158 ? 22.062  10.992  -73.735 1.00 30.22  ? 453 LEU D N   1 
ATOM   6716 C CA  . LEU D 2 158 ? 23.365  11.071  -74.379 1.00 26.85  ? 453 LEU D CA  1 
ATOM   6717 C C   . LEU D 2 158 ? 23.359  12.107  -75.492 1.00 31.96  ? 453 LEU D C   1 
ATOM   6718 O O   . LEU D 2 158 ? 24.231  12.973  -75.552 1.00 37.80  ? 453 LEU D O   1 
ATOM   6719 C CB  . LEU D 2 158 ? 23.745  9.699   -74.948 1.00 26.57  ? 453 LEU D CB  1 
ATOM   6720 C CG  . LEU D 2 158 ? 25.077  9.601   -75.687 1.00 25.18  ? 453 LEU D CG  1 
ATOM   6721 C CD1 . LEU D 2 158 ? 26.225  10.069  -74.783 1.00 27.54  ? 453 LEU D CD1 1 
ATOM   6722 C CD2 . LEU D 2 158 ? 25.318  8.182   -76.183 1.00 27.22  ? 453 LEU D CD2 1 
ATOM   6723 N N   . LEU D 2 159 ? 22.368  12.013  -76.374 1.00 28.37  ? 454 LEU D N   1 
ATOM   6724 C CA  . LEU D 2 159 ? 22.316  12.862  -77.561 1.00 28.65  ? 454 LEU D CA  1 
ATOM   6725 C C   . LEU D 2 159 ? 21.796  14.267  -77.283 1.00 32.93  ? 454 LEU D C   1 
ATOM   6726 O O   . LEU D 2 159 ? 22.065  15.188  -78.051 1.00 38.09  ? 454 LEU D O   1 
ATOM   6727 C CB  . LEU D 2 159 ? 21.459  12.215  -78.650 1.00 27.45  ? 454 LEU D CB  1 
ATOM   6728 C CG  . LEU D 2 159 ? 21.918  10.866  -79.208 1.00 35.88  ? 454 LEU D CG  1 
ATOM   6729 C CD1 . LEU D 2 159 ? 20.836  10.264  -80.101 1.00 41.33  ? 454 LEU D CD1 1 
ATOM   6730 C CD2 . LEU D 2 159 ? 23.217  11.009  -79.967 1.00 35.17  ? 454 LEU D CD2 1 
ATOM   6731 N N   . ASN D 2 160 ? 21.046  14.436  -76.199 1.00 31.86  ? 455 ASN D N   1 
ATOM   6732 C CA  . ASN D 2 160 ? 20.383  15.715  -75.939 1.00 34.63  ? 455 ASN D CA  1 
ATOM   6733 C C   . ASN D 2 160 ? 21.103  16.657  -74.974 1.00 37.72  ? 455 ASN D C   1 
ATOM   6734 O O   . ASN D 2 160 ? 20.983  17.870  -75.096 1.00 44.58  ? 455 ASN D O   1 
ATOM   6735 C CB  . ASN D 2 160 ? 18.951  15.503  -75.436 1.00 29.53  ? 455 ASN D CB  1 
ATOM   6736 C CG  . ASN D 2 160 ? 18.213  16.820  -75.196 1.00 32.07  ? 455 ASN D CG  1 
ATOM   6737 O OD1 . ASN D 2 160 ? 17.748  17.100  -74.087 1.00 34.97  ? 455 ASN D OD1 1 
ATOM   6738 N ND2 . ASN D 2 160 ? 18.113  17.636  -76.237 1.00 33.82  ? 455 ASN D ND2 1 
ATOM   6739 N N   . SER D 2 161 ? 21.833  16.113  -74.010 1.00 32.41  ? 456 SER D N   1 
ATOM   6740 C CA  . SER D 2 161 ? 22.332  16.946  -72.920 1.00 42.86  ? 456 SER D CA  1 
ATOM   6741 C C   . SER D 2 161 ? 23.367  17.977  -73.364 1.00 41.99  ? 456 SER D C   1 
ATOM   6742 O O   . SER D 2 161 ? 23.423  19.081  -72.826 1.00 46.82  ? 456 SER D O   1 
ATOM   6743 C CB  . SER D 2 161 ? 22.866  16.088  -71.772 1.00 38.77  ? 456 SER D CB  1 
ATOM   6744 O OG  . SER D 2 161 ? 21.798  15.385  -71.152 1.00 47.30  ? 456 SER D OG  1 
ATOM   6745 N N   . GLY D 2 162 ? 24.168  17.626  -74.360 1.00 35.59  ? 457 GLY D N   1 
ATOM   6746 C CA  . GLY D 2 162 ? 25.237  18.504  -74.793 1.00 45.98  ? 457 GLY D CA  1 
ATOM   6747 C C   . GLY D 2 162 ? 25.058  19.144  -76.159 1.00 49.99  ? 457 GLY D C   1 
ATOM   6748 O O   . GLY D 2 162 ? 25.936  19.877  -76.609 1.00 57.34  ? 457 GLY D O   1 
ATOM   6749 N N   . VAL D 2 163 ? 23.931  18.887  -76.818 1.00 46.93  ? 458 VAL D N   1 
ATOM   6750 C CA  . VAL D 2 163 ? 23.752  19.335  -78.203 1.00 49.06  ? 458 VAL D CA  1 
ATOM   6751 C C   . VAL D 2 163 ? 23.572  20.851  -78.357 1.00 58.12  ? 458 VAL D C   1 
ATOM   6752 O O   . VAL D 2 163 ? 23.888  21.412  -79.407 1.00 64.58  ? 458 VAL D O   1 
ATOM   6753 C CB  . VAL D 2 163 ? 22.593  18.586  -78.911 1.00 49.04  ? 458 VAL D CB  1 
ATOM   6754 C CG1 . VAL D 2 163 ? 21.289  18.785  -78.166 1.00 52.01  ? 458 VAL D CG1 1 
ATOM   6755 C CG2 . VAL D 2 163 ? 22.456  19.047  -80.361 1.00 52.43  ? 458 VAL D CG2 1 
ATOM   6756 N N   . TYR D 2 164 ? 23.075  21.511  -77.316 1.00 96.87  ? 459 TYR D N   1 
ATOM   6757 C CA  . TYR D 2 164 ? 22.805  22.946  -77.392 1.00 96.73  ? 459 TYR D CA  1 
ATOM   6758 C C   . TYR D 2 164 ? 24.037  23.802  -77.113 1.00 95.63  ? 459 TYR D C   1 
ATOM   6759 O O   . TYR D 2 164 ? 23.999  25.024  -77.256 1.00 96.56  ? 459 TYR D O   1 
ATOM   6760 C CB  . TYR D 2 164 ? 21.647  23.330  -76.466 1.00 103.10 ? 459 TYR D CB  1 
ATOM   6761 C CG  . TYR D 2 164 ? 20.306  22.824  -76.950 1.00 111.69 ? 459 TYR D CG  1 
ATOM   6762 C CD1 . TYR D 2 164 ? 20.085  21.467  -77.125 1.00 117.33 ? 459 TYR D CD1 1 
ATOM   6763 C CD2 . TYR D 2 164 ? 19.266  23.699  -77.239 1.00 114.43 ? 459 TYR D CD2 1 
ATOM   6764 C CE1 . TYR D 2 164 ? 18.869  20.989  -77.572 1.00 119.45 ? 459 TYR D CE1 1 
ATOM   6765 C CE2 . TYR D 2 164 ? 18.039  23.229  -77.685 1.00 117.40 ? 459 TYR D CE2 1 
ATOM   6766 C CZ  . TYR D 2 164 ? 17.850  21.871  -77.848 1.00 120.05 ? 459 TYR D CZ  1 
ATOM   6767 O OH  . TYR D 2 164 ? 16.643  21.387  -78.289 1.00 122.06 ? 459 TYR D OH  1 
ATOM   6768 N N   . THR D 2 165 ? 25.132  23.157  -76.723 1.00 96.39  ? 460 THR D N   1 
ATOM   6769 C CA  . THR D 2 165 ? 26.385  23.865  -76.485 1.00 94.26  ? 460 THR D CA  1 
ATOM   6770 C C   . THR D 2 165 ? 27.496  23.318  -77.375 1.00 93.80  ? 460 THR D C   1 
ATOM   6771 O O   . THR D 2 165 ? 28.611  23.066  -76.915 1.00 96.33  ? 460 THR D O   1 
ATOM   6772 C CB  . THR D 2 165 ? 26.818  23.788  -75.004 1.00 90.53  ? 460 THR D CB  1 
ATOM   6773 O OG1 . THR D 2 165 ? 26.867  22.419  -74.584 1.00 91.65  ? 460 THR D OG1 1 
ATOM   6774 C CG2 . THR D 2 165 ? 25.836  24.541  -74.116 1.00 93.83  ? 460 THR D CG2 1 
ATOM   6775 N N   . PHE D 2 166 ? 27.186  23.137  -78.655 1.00 92.36  ? 461 PHE D N   1 
ATOM   6776 C CA  . PHE D 2 166 ? 28.166  22.628  -79.612 1.00 94.14  ? 461 PHE D CA  1 
ATOM   6777 C C   . PHE D 2 166 ? 29.084  23.731  -80.128 1.00 94.96  ? 461 PHE D C   1 
ATOM   6778 O O   . PHE D 2 166 ? 30.292  23.529  -80.258 1.00 102.57 ? 461 PHE D O   1 
ATOM   6779 C CB  . PHE D 2 166 ? 27.469  21.929  -80.782 1.00 94.59  ? 461 PHE D CB  1 
ATOM   6780 C CG  . PHE D 2 166 ? 27.433  20.433  -80.658 1.00 92.85  ? 461 PHE D CG  1 
ATOM   6781 C CD1 . PHE D 2 166 ? 27.065  19.644  -81.737 1.00 92.77  ? 461 PHE D CD1 1 
ATOM   6782 C CD2 . PHE D 2 166 ? 27.776  19.814  -79.467 1.00 91.12  ? 461 PHE D CD2 1 
ATOM   6783 C CE1 . PHE D 2 166 ? 27.035  18.269  -81.628 1.00 92.12  ? 461 PHE D CE1 1 
ATOM   6784 C CE2 . PHE D 2 166 ? 27.749  18.438  -79.352 1.00 90.17  ? 461 PHE D CE2 1 
ATOM   6785 C CZ  . PHE D 2 166 ? 27.377  17.664  -80.434 1.00 90.00  ? 461 PHE D CZ  1 
ATOM   6786 N N   . LYS D 2 172 ? 30.133  21.996  -90.453 1.00 100.34 ? 467 LYS D N   1 
ATOM   6787 C CA  . LYS D 2 172 ? 30.146  20.650  -89.890 1.00 99.20  ? 467 LYS D CA  1 
ATOM   6788 C C   . LYS D 2 172 ? 29.339  20.574  -88.597 1.00 97.82  ? 467 LYS D C   1 
ATOM   6789 O O   . LYS D 2 172 ? 28.530  19.665  -88.414 1.00 96.55  ? 467 LYS D O   1 
ATOM   6790 C CB  . LYS D 2 172 ? 31.580  20.178  -89.644 1.00 99.85  ? 467 LYS D CB  1 
ATOM   6791 N N   . SER D 2 173 ? 29.559  21.531  -87.702 1.00 98.09  ? 468 SER D N   1 
ATOM   6792 C CA  . SER D 2 173 ? 28.860  21.546  -86.421 1.00 96.86  ? 468 SER D CA  1 
ATOM   6793 C C   . SER D 2 173 ? 27.351  21.695  -86.602 1.00 95.93  ? 468 SER D C   1 
ATOM   6794 O O   . SER D 2 173 ? 26.569  21.174  -85.804 1.00 94.58  ? 468 SER D O   1 
ATOM   6795 C CB  . SER D 2 173 ? 29.396  22.660  -85.520 1.00 97.47  ? 468 SER D CB  1 
ATOM   6796 O OG  . SER D 2 173 ? 28.860  22.548  -84.209 1.00 96.27  ? 468 SER D OG  1 
ATOM   6797 N N   . LEU D 2 174 ? 26.948  22.414  -87.647 1.00 96.65  ? 469 LEU D N   1 
ATOM   6798 C CA  . LEU D 2 174 ? 25.531  22.551  -87.981 1.00 95.87  ? 469 LEU D CA  1 
ATOM   6799 C C   . LEU D 2 174 ? 24.964  21.231  -88.484 1.00 94.90  ? 469 LEU D C   1 
ATOM   6800 O O   . LEU D 2 174 ? 23.861  20.826  -88.110 1.00 93.62  ? 469 LEU D O   1 
ATOM   6801 C CB  . LEU D 2 174 ? 25.325  23.628  -89.045 1.00 96.97  ? 469 LEU D CB  1 
ATOM   6802 C CG  . LEU D 2 174 ? 25.171  25.064  -88.550 1.00 97.49  ? 469 LEU D CG  1 
ATOM   6803 C CD1 . LEU D 2 174 ? 24.842  25.967  -89.710 1.00 98.44  ? 469 LEU D CD1 1 
ATOM   6804 C CD2 . LEU D 2 174 ? 24.080  25.147  -87.502 1.00 96.15  ? 469 LEU D CD2 1 
ATOM   6805 N N   . GLU D 2 175 ? 25.727  20.575  -89.349 1.00 68.55  ? 470 GLU D N   1 
ATOM   6806 C CA  . GLU D 2 175 ? 25.362  19.267  -89.881 1.00 71.73  ? 470 GLU D CA  1 
ATOM   6807 C C   . GLU D 2 175 ? 25.328  18.217  -88.770 1.00 65.85  ? 470 GLU D C   1 
ATOM   6808 O O   . GLU D 2 175 ? 24.561  17.255  -88.832 1.00 63.19  ? 470 GLU D O   1 
ATOM   6809 C CB  . GLU D 2 175 ? 26.364  18.865  -90.965 1.00 73.72  ? 470 GLU D CB  1 
ATOM   6810 C CG  . GLU D 2 175 ? 26.143  17.494  -91.569 1.00 76.40  ? 470 GLU D CG  1 
ATOM   6811 C CD  . GLU D 2 175 ? 27.129  17.205  -92.683 1.00 88.07  ? 470 GLU D CD  1 
ATOM   6812 O OE1 . GLU D 2 175 ? 27.419  16.016  -92.935 1.00 89.12  ? 470 GLU D OE1 1 
ATOM   6813 O OE2 . GLU D 2 175 ? 27.620  18.175  -93.304 1.00 94.51  ? 470 GLU D OE2 1 
ATOM   6814 N N   . GLU D 2 176 ? 26.172  18.412  -87.758 1.00 66.20  ? 471 GLU D N   1 
ATOM   6815 C CA  . GLU D 2 176 ? 26.239  17.511  -86.611 1.00 64.23  ? 471 GLU D CA  1 
ATOM   6816 C C   . GLU D 2 176 ? 24.972  17.615  -85.778 1.00 57.16  ? 471 GLU D C   1 
ATOM   6817 O O   . GLU D 2 176 ? 24.444  16.607  -85.310 1.00 52.61  ? 471 GLU D O   1 
ATOM   6818 C CB  . GLU D 2 176 ? 27.453  17.847  -85.741 1.00 66.19  ? 471 GLU D CB  1 
ATOM   6819 C CG  . GLU D 2 176 ? 28.794  17.553  -86.401 1.00 74.11  ? 471 GLU D CG  1 
ATOM   6820 C CD  . GLU D 2 176 ? 29.145  16.079  -86.381 1.00 77.49  ? 471 GLU D CD  1 
ATOM   6821 O OE1 . GLU D 2 176 ? 29.573  15.586  -85.315 1.00 75.01  ? 471 GLU D OE1 1 
ATOM   6822 O OE2 . GLU D 2 176 ? 28.999  15.414  -87.431 1.00 84.45  ? 471 GLU D OE2 1 
ATOM   6823 N N   . LYS D 2 177 ? 24.494  18.842  -85.595 1.00 52.44  ? 472 LYS D N   1 
ATOM   6824 C CA  . LYS D 2 177 ? 23.284  19.096  -84.822 1.00 56.14  ? 472 LYS D CA  1 
ATOM   6825 C C   . LYS D 2 177 ? 22.045  18.547  -85.523 1.00 50.01  ? 472 LYS D C   1 
ATOM   6826 O O   . LYS D 2 177 ? 21.160  17.987  -84.880 1.00 46.76  ? 472 LYS D O   1 
ATOM   6827 C CB  . LYS D 2 177 ? 23.105  20.597  -84.563 1.00 69.27  ? 472 LYS D CB  1 
ATOM   6828 C CG  . LYS D 2 177 ? 24.054  21.197  -83.534 1.00 78.34  ? 472 LYS D CG  1 
ATOM   6829 C CD  . LYS D 2 177 ? 23.565  22.573  -83.091 1.00 84.21  ? 472 LYS D CD  1 
ATOM   6830 C CE  . LYS D 2 177 ? 24.501  23.217  -82.072 1.00 92.25  ? 472 LYS D CE  1 
ATOM   6831 N NZ  . LYS D 2 177 ? 25.733  23.797  -82.694 1.00 96.79  ? 472 LYS D NZ  1 
ATOM   6832 N N   . ASP D 2 178 ? 21.975  18.729  -86.839 1.00 49.55  ? 473 ASP D N   1 
ATOM   6833 C CA  . ASP D 2 178 ? 20.860  18.198  -87.610 1.00 52.63  ? 473 ASP D CA  1 
ATOM   6834 C C   . ASP D 2 178 ? 20.792  16.698  -87.402 1.00 49.78  ? 473 ASP D C   1 
ATOM   6835 O O   . ASP D 2 178 ? 19.729  16.141  -87.133 1.00 44.72  ? 473 ASP D O   1 
ATOM   6836 C CB  . ASP D 2 178 ? 21.046  18.492  -89.098 1.00 72.91  ? 473 ASP D CB  1 
ATOM   6837 C CG  . ASP D 2 178 ? 20.461  19.826  -89.507 1.00 93.94  ? 473 ASP D CG  1 
ATOM   6838 O OD1 . ASP D 2 178 ? 19.245  19.877  -89.795 1.00 103.34 ? 473 ASP D OD1 1 
ATOM   6839 O OD2 . ASP D 2 178 ? 21.218  20.823  -89.547 1.00 97.61  ? 473 ASP D OD2 1 
ATOM   6840 N N   . HIS D 2 179 ? 21.946  16.050  -87.527 1.00 48.67  ? 474 HIS D N   1 
ATOM   6841 C CA  . HIS D 2 179 ? 22.028  14.604  -87.398 1.00 47.28  ? 474 HIS D CA  1 
ATOM   6842 C C   . HIS D 2 179 ? 21.569  14.136  -86.022 1.00 48.30  ? 474 HIS D C   1 
ATOM   6843 O O   . HIS D 2 179 ? 20.830  13.161  -85.904 1.00 41.16  ? 474 HIS D O   1 
ATOM   6844 C CB  . HIS D 2 179 ? 23.449  14.125  -87.664 1.00 49.50  ? 474 HIS D CB  1 
ATOM   6845 C CG  . HIS D 2 179 ? 23.611  12.646  -87.549 1.00 49.50  ? 474 HIS D CG  1 
ATOM   6846 N ND1 . HIS D 2 179 ? 23.035  11.763  -88.438 1.00 55.73  ? 474 HIS D ND1 1 
ATOM   6847 C CD2 . HIS D 2 179 ? 24.283  11.887  -86.648 1.00 48.23  ? 474 HIS D CD2 1 
ATOM   6848 C CE1 . HIS D 2 179 ? 23.346  10.528  -88.093 1.00 54.31  ? 474 HIS D CE1 1 
ATOM   6849 N NE2 . HIS D 2 179 ? 24.104  10.575  -87.011 1.00 52.44  ? 474 HIS D NE2 1 
ATOM   6850 N N   . ILE D 2 180 ? 22.011  14.831  -84.982 1.00 42.32  ? 475 ILE D N   1 
ATOM   6851 C CA  . ILE D 2 180 ? 21.576  14.511  -83.629 1.00 43.63  ? 475 ILE D CA  1 
ATOM   6852 C C   . ILE D 2 180 ? 20.060  14.634  -83.500 1.00 41.27  ? 475 ILE D C   1 
ATOM   6853 O O   . ILE D 2 180 ? 19.403  13.767  -82.926 1.00 35.16  ? 475 ILE D O   1 
ATOM   6854 C CB  . ILE D 2 180 ? 22.285  15.393  -82.593 1.00 41.52  ? 475 ILE D CB  1 
ATOM   6855 C CG1 . ILE D 2 180 ? 23.696  14.860  -82.353 1.00 46.91  ? 475 ILE D CG1 1 
ATOM   6856 C CG2 . ILE D 2 180 ? 21.494  15.442  -81.289 1.00 34.30  ? 475 ILE D CG2 1 
ATOM   6857 C CD1 . ILE D 2 180 ? 24.698  15.938  -82.015 1.00 43.24  ? 475 ILE D CD1 1 
ATOM   6858 N N   . HIS D 2 181 ? 19.500  15.704  -84.054 1.00 37.49  ? 476 HIS D N   1 
ATOM   6859 C CA  . HIS D 2 181 ? 18.062  15.908  -83.960 1.00 48.27  ? 476 HIS D CA  1 
ATOM   6860 C C   . HIS D 2 181 ? 17.278  14.832  -84.707 1.00 41.20  ? 476 HIS D C   1 
ATOM   6861 O O   . HIS D 2 181 ? 16.253  14.349  -84.221 1.00 36.92  ? 476 HIS D O   1 
ATOM   6862 C CB  . HIS D 2 181 ? 17.680  17.317  -84.416 1.00 54.77  ? 476 HIS D CB  1 
ATOM   6863 C CG  . HIS D 2 181 ? 18.129  18.386  -83.468 1.00 70.59  ? 476 HIS D CG  1 
ATOM   6864 N ND1 . HIS D 2 181 ? 17.667  18.469  -82.174 1.00 74.23  ? 476 HIS D ND1 1 
ATOM   6865 C CD2 . HIS D 2 181 ? 19.008  19.407  -83.622 1.00 76.14  ? 476 HIS D CD2 1 
ATOM   6866 C CE1 . HIS D 2 181 ? 18.236  19.499  -81.569 1.00 76.63  ? 476 HIS D CE1 1 
ATOM   6867 N NE2 . HIS D 2 181 ? 19.053  20.083  -82.428 1.00 78.02  ? 476 HIS D NE2 1 
ATOM   6868 N N   . ARG D 2 182 ? 17.779  14.434  -85.871 1.00 32.23  ? 477 ARG D N   1 
ATOM   6869 C CA  . ARG D 2 182 ? 17.157  13.366  -86.637 1.00 38.92  ? 477 ARG D CA  1 
ATOM   6870 C C   . ARG D 2 182 ? 17.181  12.026  -85.893 1.00 33.86  ? 477 ARG D C   1 
ATOM   6871 O O   . ARG D 2 182 ? 16.196  11.281  -85.909 1.00 43.97  ? 477 ARG D O   1 
ATOM   6872 C CB  . ARG D 2 182 ? 17.798  13.255  -88.028 1.00 41.44  ? 477 ARG D CB  1 
ATOM   6873 C CG  . ARG D 2 182 ? 17.416  14.408  -88.948 1.00 44.38  ? 477 ARG D CG  1 
ATOM   6874 C CD  . ARG D 2 182 ? 18.428  14.621  -90.071 1.00 55.92  ? 477 ARG D CD  1 
ATOM   6875 N NE  . ARG D 2 182 ? 18.153  13.799  -91.245 1.00 61.93  ? 477 ARG D NE  1 
ATOM   6876 N N   . VAL D 2 183 ? 18.290  11.720  -85.231 1.00 34.58  ? 478 VAL D N   1 
ATOM   6877 C CA  . VAL D 2 183 ? 18.368  10.480  -84.459 1.00 38.00  ? 478 VAL D CA  1 
ATOM   6878 C C   . VAL D 2 183 ? 17.367  10.520  -83.307 1.00 36.48  ? 478 VAL D C   1 
ATOM   6879 O O   . VAL D 2 183 ? 16.646  9.551   -83.065 1.00 33.63  ? 478 VAL D O   1 
ATOM   6880 C CB  . VAL D 2 183 ? 19.792  10.217  -83.922 1.00 36.53  ? 478 VAL D CB  1 
ATOM   6881 C CG1 . VAL D 2 183 ? 19.817  8.945   -83.093 1.00 37.75  ? 478 VAL D CG1 1 
ATOM   6882 C CG2 . VAL D 2 183 ? 20.773  10.112  -85.074 1.00 29.79  ? 478 VAL D CG2 1 
ATOM   6883 N N   . LEU D 2 184 ? 17.312  11.655  -82.613 1.00 27.07  ? 479 LEU D N   1 
ATOM   6884 C CA  . LEU D 2 184 ? 16.339  11.842  -81.539 1.00 27.88  ? 479 LEU D CA  1 
ATOM   6885 C C   . LEU D 2 184 ? 14.911  11.596  -82.019 1.00 31.15  ? 479 LEU D C   1 
ATOM   6886 O O   . LEU D 2 184 ? 14.115  10.967  -81.328 1.00 30.63  ? 479 LEU D O   1 
ATOM   6887 C CB  . LEU D 2 184 ? 16.469  13.231  -80.917 1.00 22.83  ? 479 LEU D CB  1 
ATOM   6888 C CG  . LEU D 2 184 ? 17.701  13.426  -80.021 1.00 34.32  ? 479 LEU D CG  1 
ATOM   6889 C CD1 . LEU D 2 184 ? 17.920  14.909  -79.678 1.00 33.70  ? 479 LEU D CD1 1 
ATOM   6890 C CD2 . LEU D 2 184 ? 17.580  12.587  -78.749 1.00 24.70  ? 479 LEU D CD2 1 
ATOM   6891 N N   . ASP D 2 185 ? 14.586  12.103  -83.204 1.00 35.19  ? 480 ASP D N   1 
ATOM   6892 C CA  . ASP D 2 185 ? 13.262  11.890  -83.777 1.00 29.04  ? 480 ASP D CA  1 
ATOM   6893 C C   . ASP D 2 185 ? 13.004  10.393  -83.951 1.00 27.91  ? 480 ASP D C   1 
ATOM   6894 O O   . ASP D 2 185 ? 11.896  9.904   -83.718 1.00 27.58  ? 480 ASP D O   1 
ATOM   6895 C CB  . ASP D 2 185 ? 13.130  12.610  -85.122 1.00 24.73  ? 480 ASP D CB  1 
ATOM   6896 C CG  . ASP D 2 185 ? 12.911  14.105  -84.964 1.00 38.04  ? 480 ASP D CG  1 
ATOM   6897 O OD1 . ASP D 2 185 ? 12.531  14.545  -83.851 1.00 31.96  ? 480 ASP D OD1 1 
ATOM   6898 O OD2 . ASP D 2 185 ? 13.114  14.841  -85.953 1.00 38.99  ? 480 ASP D OD2 1 
ATOM   6899 N N   . LYS D 2 186 ? 14.035  9.670   -84.362 1.00 23.06  ? 481 LYS D N   1 
ATOM   6900 C CA  . LYS D 2 186 ? 13.916  8.226   -84.538 1.00 29.96  ? 481 LYS D CA  1 
ATOM   6901 C C   . LYS D 2 186 ? 13.696  7.524   -83.197 1.00 36.06  ? 481 LYS D C   1 
ATOM   6902 O O   . LYS D 2 186 ? 12.942  6.555   -83.110 1.00 38.76  ? 481 LYS D O   1 
ATOM   6903 C CB  . LYS D 2 186 ? 15.137  7.658   -85.259 1.00 29.13  ? 481 LYS D CB  1 
ATOM   6904 C CG  . LYS D 2 186 ? 14.940  6.224   -85.736 1.00 52.95  ? 481 LYS D CG  1 
ATOM   6905 C CD  . LYS D 2 186 ? 13.536  6.039   -86.290 1.00 58.05  ? 481 LYS D CD  1 
ATOM   6906 C CE  . LYS D 2 186 ? 13.541  5.240   -87.573 1.00 51.85  ? 481 LYS D CE  1 
ATOM   6907 N NZ  . LYS D 2 186 ? 14.456  5.828   -88.589 1.00 47.24  ? 481 LYS D NZ  1 
ATOM   6908 N N   . ILE D 2 187 ? 14.336  8.021   -82.147 1.00 31.56  ? 482 ILE D N   1 
ATOM   6909 C CA  . ILE D 2 187 ? 14.092  7.485   -80.815 1.00 34.03  ? 482 ILE D CA  1 
ATOM   6910 C C   . ILE D 2 187 ? 12.687  7.823   -80.313 1.00 33.75  ? 482 ILE D C   1 
ATOM   6911 O O   . ILE D 2 187 ? 12.074  7.039   -79.583 1.00 28.64  ? 482 ILE D O   1 
ATOM   6912 C CB  . ILE D 2 187 ? 15.158  7.943   -79.815 1.00 33.28  ? 482 ILE D CB  1 
ATOM   6913 C CG1 . ILE D 2 187 ? 16.544  7.572   -80.340 1.00 33.38  ? 482 ILE D CG1 1 
ATOM   6914 C CG2 . ILE D 2 187 ? 14.944  7.266   -78.469 1.00 36.47  ? 482 ILE D CG2 1 
ATOM   6915 C CD1 . ILE D 2 187 ? 17.683  8.064   -79.469 1.00 36.03  ? 482 ILE D CD1 1 
ATOM   6916 N N   . THR D 2 188 ? 12.168  8.981   -80.711 1.00 31.83  ? 483 THR D N   1 
ATOM   6917 C CA  . THR D 2 188 ? 10.783  9.315   -80.406 1.00 33.20  ? 483 THR D CA  1 
ATOM   6918 C C   . THR D 2 188 ? 9.841   8.323   -81.086 1.00 32.73  ? 483 THR D C   1 
ATOM   6919 O O   . THR D 2 188 ? 8.918   7.804   -80.460 1.00 30.56  ? 483 THR D O   1 
ATOM   6920 C CB  . THR D 2 188 ? 10.421  10.743  -80.859 1.00 29.94  ? 483 THR D CB  1 
ATOM   6921 O OG1 . THR D 2 188 ? 11.238  11.692  -80.163 1.00 33.39  ? 483 THR D OG1 1 
ATOM   6922 C CG2 . THR D 2 188 ? 8.950   11.040  -80.578 1.00 23.44  ? 483 THR D CG2 1 
ATOM   6923 N N   . ASP D 2 189 ? 10.078  8.073   -82.372 1.00 34.07  ? 484 ASP D N   1 
ATOM   6924 C CA  . ASP D 2 189 ? 9.299   7.099   -83.131 1.00 36.25  ? 484 ASP D CA  1 
ATOM   6925 C C   . ASP D 2 189 ? 9.324   5.752   -82.432 1.00 39.30  ? 484 ASP D C   1 
ATOM   6926 O O   . ASP D 2 189 ? 8.302   5.077   -82.313 1.00 43.22  ? 484 ASP D O   1 
ATOM   6927 C CB  . ASP D 2 189 ? 9.879   6.927   -84.541 1.00 40.07  ? 484 ASP D CB  1 
ATOM   6928 C CG  . ASP D 2 189 ? 9.777   8.189   -85.381 1.00 43.90  ? 484 ASP D CG  1 
ATOM   6929 O OD1 . ASP D 2 189 ? 9.085   9.142   -84.953 1.00 40.27  ? 484 ASP D OD1 1 
ATOM   6930 O OD2 . ASP D 2 189 ? 10.389  8.222   -86.475 1.00 40.86  ? 484 ASP D OD2 1 
ATOM   6931 N N   . THR D 2 190 ? 10.513  5.359   -81.984 1.00 33.02  ? 485 THR D N   1 
ATOM   6932 C CA  . THR D 2 190 ? 10.703  4.076   -81.326 1.00 30.75  ? 485 THR D CA  1 
ATOM   6933 C C   . THR D 2 190 ? 9.845   3.985   -80.074 1.00 32.90  ? 485 THR D C   1 
ATOM   6934 O O   . THR D 2 190 ? 9.089   3.029   -79.900 1.00 35.79  ? 485 THR D O   1 
ATOM   6935 C CB  . THR D 2 190 ? 12.178  3.850   -80.968 1.00 33.76  ? 485 THR D CB  1 
ATOM   6936 O OG1 . THR D 2 190 ? 12.978  3.943   -82.155 1.00 28.80  ? 485 THR D OG1 1 
ATOM   6937 C CG2 . THR D 2 190 ? 12.369  2.481   -80.341 1.00 30.28  ? 485 THR D CG2 1 
ATOM   6938 N N   . LEU D 2 191 ? 9.952   4.985   -79.207 1.00 29.66  ? 486 LEU D N   1 
ATOM   6939 C CA  . LEU D 2 191 ? 9.157   5.011   -77.983 1.00 32.80  ? 486 LEU D CA  1 
ATOM   6940 C C   . LEU D 2 191 ? 7.670   4.849   -78.279 1.00 33.72  ? 486 LEU D C   1 
ATOM   6941 O O   . LEU D 2 191 ? 6.990   4.029   -77.656 1.00 34.52  ? 486 LEU D O   1 
ATOM   6942 C CB  . LEU D 2 191 ? 9.410   6.299   -77.195 1.00 28.87  ? 486 LEU D CB  1 
ATOM   6943 C CG  . LEU D 2 191 ? 10.688  6.290   -76.347 1.00 36.06  ? 486 LEU D CG  1 
ATOM   6944 C CD1 . LEU D 2 191 ? 11.098  7.703   -75.924 1.00 35.46  ? 486 LEU D CD1 1 
ATOM   6945 C CD2 . LEU D 2 191 ? 10.528  5.382   -75.134 1.00 29.42  ? 486 LEU D CD2 1 
ATOM   6946 N N   . ILE D 2 192 ? 7.170   5.629   -79.232 1.00 30.06  ? 487 ILE D N   1 
ATOM   6947 C CA  . ILE D 2 192 ? 5.756   5.593   -79.591 1.00 29.06  ? 487 ILE D CA  1 
ATOM   6948 C C   . ILE D 2 192 ? 5.378   4.202   -80.088 1.00 34.52  ? 487 ILE D C   1 
ATOM   6949 O O   . ILE D 2 192 ? 4.331   3.669   -79.729 1.00 35.94  ? 487 ILE D O   1 
ATOM   6950 C CB  . ILE D 2 192 ? 5.425   6.643   -80.661 1.00 30.51  ? 487 ILE D CB  1 
ATOM   6951 C CG1 . ILE D 2 192 ? 5.585   8.052   -80.083 1.00 32.13  ? 487 ILE D CG1 1 
ATOM   6952 C CG2 . ILE D 2 192 ? 4.009   6.455   -81.183 1.00 31.63  ? 487 ILE D CG2 1 
ATOM   6953 C CD1 . ILE D 2 192 ? 4.502   8.432   -79.086 1.00 32.17  ? 487 ILE D CD1 1 
ATOM   6954 N N   . HIS D 2 193 ? 6.248   3.606   -80.895 1.00 31.56  ? 488 HIS D N   1 
ATOM   6955 C CA  . HIS D 2 193 ? 6.010   2.265   -81.413 1.00 37.09  ? 488 HIS D CA  1 
ATOM   6956 C C   . HIS D 2 193 ? 5.868   1.248   -80.286 1.00 41.53  ? 488 HIS D C   1 
ATOM   6957 O O   . HIS D 2 193 ? 4.948   0.433   -80.288 1.00 40.75  ? 488 HIS D O   1 
ATOM   6958 C CB  . HIS D 2 193 ? 7.134   1.834   -82.354 1.00 36.05  ? 488 HIS D CB  1 
ATOM   6959 C CG  . HIS D 2 193 ? 6.917   0.480   -82.955 1.00 45.08  ? 488 HIS D CG  1 
ATOM   6960 N ND1 . HIS D 2 193 ? 7.579   -0.645  -82.514 1.00 49.08  ? 488 HIS D ND1 1 
ATOM   6961 C CD2 . HIS D 2 193 ? 6.092   0.069   -83.946 1.00 44.82  ? 488 HIS D CD2 1 
ATOM   6962 C CE1 . HIS D 2 193 ? 7.182   -1.691  -83.217 1.00 51.74  ? 488 HIS D CE1 1 
ATOM   6963 N NE2 . HIS D 2 193 ? 6.278   -1.284  -84.093 1.00 51.81  ? 488 HIS D NE2 1 
ATOM   6964 N N   . LEU D 2 194 ? 6.784   1.296   -79.325 1.00 37.79  ? 489 LEU D N   1 
ATOM   6965 C CA  . LEU D 2 194 ? 6.729   0.394   -78.178 1.00 35.88  ? 489 LEU D CA  1 
ATOM   6966 C C   . LEU D 2 194 ? 5.396   0.519   -77.448 1.00 40.75  ? 489 LEU D C   1 
ATOM   6967 O O   . LEU D 2 194 ? 4.816   -0.484  -77.031 1.00 49.19  ? 489 LEU D O   1 
ATOM   6968 C CB  . LEU D 2 194 ? 7.887   0.672   -77.218 1.00 36.30  ? 489 LEU D CB  1 
ATOM   6969 C CG  . LEU D 2 194 ? 9.288   0.267   -77.693 1.00 35.48  ? 489 LEU D CG  1 
ATOM   6970 C CD1 . LEU D 2 194 ? 10.359  0.981   -76.892 1.00 30.29  ? 489 LEU D CD1 1 
ATOM   6971 C CD2 . LEU D 2 194 ? 9.468   -1.244  -77.608 1.00 35.36  ? 489 LEU D CD2 1 
ATOM   6972 N N   . MET D 2 195 ? 4.911   1.752   -77.301 1.00 34.14  ? 490 MET D N   1 
ATOM   6973 C CA  . MET D 2 195 ? 3.656   2.010   -76.592 1.00 31.01  ? 490 MET D CA  1 
ATOM   6974 C C   . MET D 2 195 ? 2.436   1.526   -77.376 1.00 34.93  ? 490 MET D C   1 
ATOM   6975 O O   . MET D 2 195 ? 1.518   0.932   -76.805 1.00 48.37  ? 490 MET D O   1 
ATOM   6976 C CB  . MET D 2 195 ? 3.513   3.502   -76.264 1.00 26.05  ? 490 MET D CB  1 
ATOM   6977 C CG  . MET D 2 195 ? 4.672   4.058   -75.454 1.00 31.19  ? 490 MET D CG  1 
ATOM   6978 S SD  . MET D 2 195 ? 4.565   5.835   -75.192 1.00 36.74  ? 490 MET D SD  1 
ATOM   6979 C CE  . MET D 2 195 ? 6.177   6.167   -74.484 1.00 26.92  ? 490 MET D CE  1 
ATOM   6980 N N   . ALA D 2 196 ? 2.422   1.791   -78.678 1.00 33.21  ? 491 ALA D N   1 
ATOM   6981 C CA  . ALA D 2 196 ? 1.339   1.318   -79.534 1.00 38.68  ? 491 ALA D CA  1 
ATOM   6982 C C   . ALA D 2 196 ? 1.327   -0.206  -79.527 1.00 43.71  ? 491 ALA D C   1 
ATOM   6983 O O   . ALA D 2 196 ? 0.273   -0.836  -79.434 1.00 45.68  ? 491 ALA D O   1 
ATOM   6984 C CB  . ALA D 2 196 ? 1.524   1.839   -80.948 1.00 38.42  ? 491 ALA D CB  1 
ATOM   6985 N N   . LYS D 2 197 ? 2.520   -0.785  -79.616 1.00 39.11  ? 492 LYS D N   1 
ATOM   6986 C CA  . LYS D 2 197 ? 2.697   -2.229  -79.575 1.00 45.86  ? 492 LYS D CA  1 
ATOM   6987 C C   . LYS D 2 197 ? 2.167   -2.811  -78.267 1.00 44.42  ? 492 LYS D C   1 
ATOM   6988 O O   . LYS D 2 197 ? 1.592   -3.901  -78.250 1.00 44.21  ? 492 LYS D O   1 
ATOM   6989 C CB  . LYS D 2 197 ? 4.176   -2.577  -79.745 1.00 49.58  ? 492 LYS D CB  1 
ATOM   6990 N N   . ALA D 2 198 ? 2.364   -2.083  -77.173 1.00 38.11  ? 493 ALA D N   1 
ATOM   6991 C CA  . ALA D 2 198 ? 1.899   -2.528  -75.860 1.00 33.90  ? 493 ALA D CA  1 
ATOM   6992 C C   . ALA D 2 198 ? 0.391   -2.338  -75.658 1.00 45.14  ? 493 ALA D C   1 
ATOM   6993 O O   . ALA D 2 198 ? -0.165  -2.816  -74.670 1.00 48.10  ? 493 ALA D O   1 
ATOM   6994 C CB  . ALA D 2 198 ? 2.667   -1.836  -74.759 1.00 35.51  ? 493 ALA D CB  1 
ATOM   6995 N N   . GLY D 2 199 ? -0.262  -1.641  -76.584 1.00 37.30  ? 494 GLY D N   1 
ATOM   6996 C CA  . GLY D 2 199 ? -1.703  -1.471  -76.526 1.00 35.64  ? 494 GLY D CA  1 
ATOM   6997 C C   . GLY D 2 199 ? -2.216  -0.121  -76.040 1.00 41.36  ? 494 GLY D C   1 
ATOM   6998 O O   . GLY D 2 199 ? -3.417  0.042   -75.818 1.00 41.65  ? 494 GLY D O   1 
ATOM   6999 N N   . LEU D 2 200 ? -1.325  0.850   -75.862 1.00 37.10  ? 495 LEU D N   1 
ATOM   7000 C CA  . LEU D 2 200 ? -1.758  2.183   -75.437 1.00 35.60  ? 495 LEU D CA  1 
ATOM   7001 C C   . LEU D 2 200 ? -2.560  2.838   -76.553 1.00 35.46  ? 495 LEU D C   1 
ATOM   7002 O O   . LEU D 2 200 ? -2.241  2.675   -77.731 1.00 40.66  ? 495 LEU D O   1 
ATOM   7003 C CB  . LEU D 2 200 ? -0.558  3.082   -75.112 1.00 31.21  ? 495 LEU D CB  1 
ATOM   7004 C CG  . LEU D 2 200 ? 0.553   2.671   -74.137 1.00 38.80  ? 495 LEU D CG  1 
ATOM   7005 C CD1 . LEU D 2 200 ? 0.879   3.830   -73.201 1.00 42.58  ? 495 LEU D CD1 1 
ATOM   7006 C CD2 . LEU D 2 200 ? 0.212   1.424   -73.355 1.00 39.43  ? 495 LEU D CD2 1 
ATOM   7007 N N   . THR D 2 201 ? -3.597  3.580   -76.187 1.00 36.36  ? 496 THR D N   1 
ATOM   7008 C CA  . THR D 2 201 ? -4.321  4.401   -77.157 1.00 41.13  ? 496 THR D CA  1 
ATOM   7009 C C   . THR D 2 201 ? -3.441  5.568   -77.597 1.00 42.77  ? 496 THR D C   1 
ATOM   7010 O O   . THR D 2 201 ? -2.478  5.917   -76.914 1.00 37.60  ? 496 THR D O   1 
ATOM   7011 C CB  . THR D 2 201 ? -5.596  4.992   -76.549 1.00 40.30  ? 496 THR D CB  1 
ATOM   7012 O OG1 . THR D 2 201 ? -5.239  5.916   -75.509 1.00 40.25  ? 496 THR D OG1 1 
ATOM   7013 C CG2 . THR D 2 201 ? -6.471  3.884   -75.976 1.00 44.92  ? 496 THR D CG2 1 
ATOM   7014 N N   . LEU D 2 202 ? -3.781  6.177   -78.729 1.00 41.27  ? 497 LEU D N   1 
ATOM   7015 C CA  . LEU D 2 202 ? -3.031  7.320   -79.230 1.00 42.45  ? 497 LEU D CA  1 
ATOM   7016 C C   . LEU D 2 202 ? -2.826  8.363   -78.140 1.00 39.15  ? 497 LEU D C   1 
ATOM   7017 O O   . LEU D 2 202 ? -1.732  8.889   -77.975 1.00 46.51  ? 497 LEU D O   1 
ATOM   7018 C CB  . LEU D 2 202 ? -3.730  7.956   -80.431 1.00 50.87  ? 497 LEU D CB  1 
ATOM   7019 C CG  . LEU D 2 202 ? -3.496  7.310   -81.796 1.00 58.11  ? 497 LEU D CG  1 
ATOM   7020 C CD1 . LEU D 2 202 ? -4.058  8.199   -82.897 1.00 61.85  ? 497 LEU D CD1 1 
ATOM   7021 C CD2 . LEU D 2 202 ? -2.015  7.066   -82.011 1.00 57.77  ? 497 LEU D CD2 1 
ATOM   7022 N N   . GLN D 2 203 ? -3.885  8.650   -77.397 1.00 36.78  ? 498 GLN D N   1 
ATOM   7023 C CA  . GLN D 2 203 ? -3.822  9.643   -76.335 1.00 40.00  ? 498 GLN D CA  1 
ATOM   7024 C C   . GLN D 2 203 ? -2.840  9.217   -75.255 1.00 38.29  ? 498 GLN D C   1 
ATOM   7025 O O   . GLN D 2 203 ? -1.995  10.005  -74.825 1.00 38.47  ? 498 GLN D O   1 
ATOM   7026 C CB  . GLN D 2 203 ? -5.206  9.872   -75.724 1.00 45.13  ? 498 GLN D CB  1 
ATOM   7027 C CG  . GLN D 2 203 ? -5.227  10.903  -74.604 1.00 50.50  ? 498 GLN D CG  1 
ATOM   7028 C CD  . GLN D 2 203 ? -6.634  11.222  -74.143 1.00 56.57  ? 498 GLN D CD  1 
ATOM   7029 O OE1 . GLN D 2 203 ? -7.432  10.321  -73.894 1.00 65.38  ? 498 GLN D OE1 1 
ATOM   7030 N NE2 . GLN D 2 203 ? -6.947  12.511  -74.029 1.00 53.72  ? 498 GLN D NE2 1 
ATOM   7031 N N   . GLN D 2 204 ? -2.950  7.967   -74.821 1.00 34.00  ? 499 GLN D N   1 
ATOM   7032 C CA  . GLN D 2 204 ? -2.064  7.436   -73.791 1.00 40.02  ? 499 GLN D CA  1 
ATOM   7033 C C   . GLN D 2 204 ? -0.611  7.392   -74.252 1.00 40.43  ? 499 GLN D C   1 
ATOM   7034 O O   . GLN D 2 204 ? 0.306   7.500   -73.437 1.00 41.27  ? 499 GLN D O   1 
ATOM   7035 C CB  . GLN D 2 204 ? -2.520  6.038   -73.358 1.00 38.60  ? 499 GLN D CB  1 
ATOM   7036 C CG  . GLN D 2 204 ? -3.861  6.036   -72.659 1.00 42.09  ? 499 GLN D CG  1 
ATOM   7037 C CD  . GLN D 2 204 ? -4.331  4.640   -72.316 1.00 52.33  ? 499 GLN D CD  1 
ATOM   7038 O OE1 . GLN D 2 204 ? -3.873  3.656   -72.900 1.00 49.52  ? 499 GLN D OE1 1 
ATOM   7039 N NE2 . GLN D 2 204 ? -5.250  4.545   -71.363 1.00 57.74  ? 499 GLN D NE2 1 
ATOM   7040 N N   . GLN D 2 205 ? -0.404  7.230   -75.556 1.00 34.86  ? 500 GLN D N   1 
ATOM   7041 C CA  . GLN D 2 205 ? 0.944   7.242   -76.118 1.00 35.64  ? 500 GLN D CA  1 
ATOM   7042 C C   . GLN D 2 205 ? 1.600   8.615   -75.983 1.00 39.67  ? 500 GLN D C   1 
ATOM   7043 O O   . GLN D 2 205 ? 2.759   8.715   -75.590 1.00 38.23  ? 500 GLN D O   1 
ATOM   7044 C CB  . GLN D 2 205 ? 0.931   6.820   -77.587 1.00 34.26  ? 500 GLN D CB  1 
ATOM   7045 C CG  . GLN D 2 205 ? 0.483   5.389   -77.820 1.00 30.90  ? 500 GLN D CG  1 
ATOM   7046 C CD  . GLN D 2 205 ? 0.311   5.075   -79.292 1.00 38.32  ? 500 GLN D CD  1 
ATOM   7047 O OE1 . GLN D 2 205 ? 0.970   5.670   -80.146 1.00 38.36  ? 500 GLN D OE1 1 
ATOM   7048 N NE2 . GLN D 2 205 ? -0.584  4.137   -79.598 1.00 34.15  ? 500 GLN D NE2 1 
ATOM   7049 N N   . HIS D 2 206 ? 0.868   9.675   -76.316 1.00 34.57  ? 501 HIS D N   1 
ATOM   7050 C CA  A HIS D 2 206 ? 1.410   11.033  -76.224 0.59 33.48  ? 501 HIS D CA  1 
ATOM   7051 C CA  B HIS D 2 206 ? 1.447   11.006  -76.231 0.41 32.70  ? 501 HIS D CA  1 
ATOM   7052 C C   . HIS D 2 206 ? 1.621   11.446  -74.775 1.00 28.72  ? 501 HIS D C   1 
ATOM   7053 O O   . HIS D 2 206 ? 2.542   12.188  -74.460 1.00 33.27  ? 501 HIS D O   1 
ATOM   7054 C CB  A HIS D 2 206 ? 0.525   12.059  -76.963 0.59 37.54  ? 501 HIS D CB  1 
ATOM   7055 C CB  B HIS D 2 206 ? 0.628   12.019  -77.040 0.41 35.73  ? 501 HIS D CB  1 
ATOM   7056 C CG  A HIS D 2 206 ? -0.718  12.455  -76.221 0.59 40.94  ? 501 HIS D CG  1 
ATOM   7057 C CG  B HIS D 2 206 ? 0.513   11.674  -78.494 0.41 38.74  ? 501 HIS D CG  1 
ATOM   7058 N ND1 A HIS D 2 206 ? -1.855  12.903  -76.861 0.59 36.61  ? 501 HIS D ND1 1 
ATOM   7059 N ND1 B HIS D 2 206 ? 1.605   11.332  -79.261 0.41 44.92  ? 501 HIS D ND1 1 
ATOM   7060 C CD2 A HIS D 2 206 ? -1.005  12.479  -74.897 0.59 45.30  ? 501 HIS D CD2 1 
ATOM   7061 C CD2 B HIS D 2 206 ? -0.562  11.614  -79.315 0.41 34.23  ? 501 HIS D CD2 1 
ATOM   7062 C CE1 A HIS D 2 206 ? -2.786  13.182  -75.964 0.59 34.06  ? 501 HIS D CE1 1 
ATOM   7063 C CE1 B HIS D 2 206 ? 1.206   11.075  -80.496 0.41 45.21  ? 501 HIS D CE1 1 
ATOM   7064 N NE2 A HIS D 2 206 ? -2.294  12.928  -74.766 0.59 40.87  ? 501 HIS D NE2 1 
ATOM   7065 N NE2 B HIS D 2 206 ? -0.098  11.238  -80.557 0.41 42.34  ? 501 HIS D NE2 1 
ATOM   7066 N N   . GLN D 2 207 ? 0.753   10.965  -73.891 1.00 24.93  ? 502 GLN D N   1 
ATOM   7067 C CA  . GLN D 2 207 ? 0.837   11.316  -72.477 1.00 32.65  ? 502 GLN D CA  1 
ATOM   7068 C C   . GLN D 2 207 ? 2.047   10.666  -71.837 1.00 31.22  ? 502 GLN D C   1 
ATOM   7069 O O   . GLN D 2 207 ? 2.796   11.311  -71.101 1.00 33.72  ? 502 GLN D O   1 
ATOM   7070 C CB  . GLN D 2 207 ? -0.436  10.904  -71.730 1.00 39.57  ? 502 GLN D CB  1 
ATOM   7071 C CG  . GLN D 2 207 ? -1.596  11.877  -71.911 1.00 38.41  ? 502 GLN D CG  1 
ATOM   7072 C CD  . GLN D 2 207 ? -2.899  11.354  -71.348 1.00 36.69  ? 502 GLN D CD  1 
ATOM   7073 O OE1 . GLN D 2 207 ? -3.952  11.978  -71.506 1.00 37.66  ? 502 GLN D OE1 1 
ATOM   7074 N NE2 . GLN D 2 207 ? -2.842  10.205  -70.688 1.00 38.73  ? 502 GLN D NE2 1 
ATOM   7075 N N   . ARG D 2 208 ? 2.245   9.387   -72.126 1.00 27.61  ? 503 ARG D N   1 
ATOM   7076 C CA  . ARG D 2 208 ? 3.342   8.645   -71.521 1.00 25.74  ? 503 ARG D CA  1 
ATOM   7077 C C   . ARG D 2 208 ? 4.676   9.144   -72.065 1.00 24.40  ? 503 ARG D C   1 
ATOM   7078 O O   . ARG D 2 208 ? 5.661   9.208   -71.337 1.00 25.10  ? 503 ARG D O   1 
ATOM   7079 C CB  . ARG D 2 208 ? 3.191   7.139   -71.763 1.00 23.87  ? 503 ARG D CB  1 
ATOM   7080 C CG  . ARG D 2 208 ? 4.315   6.314   -71.144 1.00 27.68  ? 503 ARG D CG  1 
ATOM   7081 C CD  . ARG D 2 208 ? 4.047   4.823   -71.291 1.00 26.91  ? 503 ARG D CD  1 
ATOM   7082 N NE  . ARG D 2 208 ? 5.052   3.990   -70.635 1.00 26.29  ? 503 ARG D NE  1 
ATOM   7083 C CZ  . ARG D 2 208 ? 5.062   3.712   -69.332 1.00 31.48  ? 503 ARG D CZ  1 
ATOM   7084 N NH1 . ARG D 2 208 ? 4.127   4.215   -68.545 1.00 27.92  ? 503 ARG D NH1 1 
ATOM   7085 N NH2 . ARG D 2 208 ? 6.003   2.931   -68.816 1.00 32.01  ? 503 ARG D NH2 1 
ATOM   7086 N N   . LEU D 2 209 ? 4.700   9.481   -73.351 1.00 26.89  ? 504 LEU D N   1 
ATOM   7087 C CA  . LEU D 2 209 ? 5.886   10.045  -73.967 1.00 27.65  ? 504 LEU D CA  1 
ATOM   7088 C C   . LEU D 2 209 ? 6.289   11.292  -73.198 1.00 30.01  ? 504 LEU D C   1 
ATOM   7089 O O   . LEU D 2 209 ? 7.451   11.453  -72.828 1.00 31.66  ? 504 LEU D O   1 
ATOM   7090 C CB  . LEU D 2 209 ? 5.616   10.412  -75.429 1.00 35.73  ? 504 LEU D CB  1 
ATOM   7091 C CG  . LEU D 2 209 ? 6.740   11.178  -76.139 1.00 31.96  ? 504 LEU D CG  1 
ATOM   7092 C CD1 . LEU D 2 209 ? 8.004   10.332  -76.199 1.00 29.21  ? 504 LEU D CD1 1 
ATOM   7093 C CD2 . LEU D 2 209 ? 6.317   11.607  -77.530 1.00 30.65  ? 504 LEU D CD2 1 
ATOM   7094 N N   . ALA D 2 210 ? 5.314   12.162  -72.949 1.00 28.48  ? 505 ALA D N   1 
ATOM   7095 C CA  . ALA D 2 210 ? 5.546   13.415  -72.229 1.00 24.82  ? 505 ALA D CA  1 
ATOM   7096 C C   . ALA D 2 210 ? 6.043   13.172  -70.812 1.00 27.09  ? 505 ALA D C   1 
ATOM   7097 O O   . ALA D 2 210 ? 6.992   13.815  -70.356 1.00 27.66  ? 505 ALA D O   1 
ATOM   7098 C CB  . ALA D 2 210 ? 4.276   14.253  -72.204 1.00 28.26  ? 505 ALA D CB  1 
ATOM   7099 N N   . GLN D 2 211 ? 5.415   12.227  -70.123 1.00 27.20  ? 506 GLN D N   1 
ATOM   7100 C CA  . GLN D 2 211 ? 5.782   11.923  -68.740 1.00 29.68  ? 506 GLN D CA  1 
ATOM   7101 C C   . GLN D 2 211 ? 7.222   11.441  -68.676 1.00 35.71  ? 506 GLN D C   1 
ATOM   7102 O O   . GLN D 2 211 ? 7.973   11.812  -67.770 1.00 38.11  ? 506 GLN D O   1 
ATOM   7103 C CB  . GLN D 2 211 ? 4.845   10.865  -68.142 1.00 31.52  ? 506 GLN D CB  1 
ATOM   7104 C CG  . GLN D 2 211 ? 3.365   11.273  -68.121 1.00 31.54  ? 506 GLN D CG  1 
ATOM   7105 C CD  . GLN D 2 211 ? 2.430   10.066  -68.044 1.00 40.93  ? 506 GLN D CD  1 
ATOM   7106 O OE1 . GLN D 2 211 ? 2.879   8.921   -67.985 1.00 43.44  ? 506 GLN D OE1 1 
ATOM   7107 N NE2 . GLN D 2 211 ? 1.130   10.323  -68.044 1.00 41.15  ? 506 GLN D NE2 1 
ATOM   7108 N N   . LEU D 2 212 ? 7.612   10.626  -69.653 1.00 27.86  ? 507 LEU D N   1 
ATOM   7109 C CA  . LEU D 2 212 ? 8.963   10.086  -69.685 1.00 31.76  ? 507 LEU D CA  1 
ATOM   7110 C C   . LEU D 2 212 ? 9.993   11.189  -69.909 1.00 30.52  ? 507 LEU D C   1 
ATOM   7111 O O   . LEU D 2 212 ? 10.999  11.259  -69.207 1.00 26.08  ? 507 LEU D O   1 
ATOM   7112 C CB  . LEU D 2 212 ? 9.098   9.013   -70.770 1.00 35.87  ? 507 LEU D CB  1 
ATOM   7113 C CG  . LEU D 2 212 ? 8.307   7.717   -70.562 1.00 30.67  ? 507 LEU D CG  1 
ATOM   7114 C CD1 . LEU D 2 212 ? 8.401   6.868   -71.800 1.00 23.92  ? 507 LEU D CD1 1 
ATOM   7115 C CD2 . LEU D 2 212 ? 8.822   6.961   -69.349 1.00 32.30  ? 507 LEU D CD2 1 
ATOM   7116 N N   . LEU D 2 213 ? 9.740   12.046  -70.896 1.00 24.99  ? 508 LEU D N   1 
ATOM   7117 C CA  . LEU D 2 213 ? 10.675  13.108  -71.236 1.00 25.18  ? 508 LEU D CA  1 
ATOM   7118 C C   . LEU D 2 213 ? 10.792  14.164  -70.141 1.00 26.53  ? 508 LEU D C   1 
ATOM   7119 O O   . LEU D 2 213 ? 11.857  14.763  -69.960 1.00 29.62  ? 508 LEU D O   1 
ATOM   7120 C CB  . LEU D 2 213 ? 10.293  13.751  -72.566 1.00 30.37  ? 508 LEU D CB  1 
ATOM   7121 C CG  . LEU D 2 213 ? 10.351  12.802  -73.762 1.00 32.88  ? 508 LEU D CG  1 
ATOM   7122 C CD1 . LEU D 2 213 ? 10.005  13.550  -75.035 1.00 33.97  ? 508 LEU D CD1 1 
ATOM   7123 C CD2 . LEU D 2 213 ? 11.728  12.201  -73.874 1.00 23.56  ? 508 LEU D CD2 1 
ATOM   7124 N N   . LEU D 2 214 ? 9.707   14.403  -69.409 1.00 24.69  ? 509 LEU D N   1 
ATOM   7125 C CA  . LEU D 2 214 ? 9.725   15.422  -68.352 1.00 29.48  ? 509 LEU D CA  1 
ATOM   7126 C C   . LEU D 2 214 ? 10.578  14.970  -67.171 1.00 35.23  ? 509 LEU D C   1 
ATOM   7127 O O   . LEU D 2 214 ? 11.148  15.792  -66.456 1.00 30.51  ? 509 LEU D O   1 
ATOM   7128 C CB  . LEU D 2 214 ? 8.310   15.774  -67.883 1.00 24.99  ? 509 LEU D CB  1 
ATOM   7129 C CG  . LEU D 2 214 ? 7.524   16.693  -68.829 1.00 31.30  ? 509 LEU D CG  1 
ATOM   7130 C CD1 . LEU D 2 214 ? 6.084   16.867  -68.364 1.00 30.50  ? 509 LEU D CD1 1 
ATOM   7131 C CD2 . LEU D 2 214 ? 8.217   18.048  -68.944 1.00 32.89  ? 509 LEU D CD2 1 
ATOM   7132 N N   . ILE D 2 215 ? 10.667  13.660  -66.970 1.00 27.80  ? 510 ILE D N   1 
ATOM   7133 C CA  . ILE D 2 215 ? 11.533  13.126  -65.927 1.00 32.37  ? 510 ILE D CA  1 
ATOM   7134 C C   . ILE D 2 215 ? 12.983  13.470  -66.223 1.00 29.35  ? 510 ILE D C   1 
ATOM   7135 O O   . ILE D 2 215 ? 13.793  13.591  -65.310 1.00 32.67  ? 510 ILE D O   1 
ATOM   7136 C CB  . ILE D 2 215 ? 11.364  11.603  -65.768 1.00 36.48  ? 510 ILE D CB  1 
ATOM   7137 C CG1 . ILE D 2 215 ? 9.990   11.292  -65.170 1.00 44.90  ? 510 ILE D CG1 1 
ATOM   7138 C CG2 . ILE D 2 215 ? 12.453  11.038  -64.871 1.00 34.53  ? 510 ILE D CG2 1 
ATOM   7139 C CD1 . ILE D 2 215 ? 9.480   9.901   -65.471 1.00 47.98  ? 510 ILE D CD1 1 
ATOM   7140 N N   . LEU D 2 216 ? 13.305  13.647  -67.502 1.00 27.43  ? 511 LEU D N   1 
ATOM   7141 C CA  . LEU D 2 216 ? 14.668  14.003  -67.892 1.00 25.80  ? 511 LEU D CA  1 
ATOM   7142 C C   . LEU D 2 216 ? 15.084  15.375  -67.353 1.00 32.17  ? 511 LEU D C   1 
ATOM   7143 O O   . LEU D 2 216 ? 16.252  15.599  -67.044 1.00 28.90  ? 511 LEU D O   1 
ATOM   7144 C CB  . LEU D 2 216 ? 14.845  13.927  -69.413 1.00 27.26  ? 511 LEU D CB  1 
ATOM   7145 C CG  . LEU D 2 216 ? 14.554  12.546  -70.036 1.00 32.39  ? 511 LEU D CG  1 
ATOM   7146 C CD1 . LEU D 2 216 ? 14.991  12.484  -71.492 1.00 27.57  ? 511 LEU D CD1 1 
ATOM   7147 C CD2 . LEU D 2 216 ? 15.216  11.424  -69.239 1.00 25.55  ? 511 LEU D CD2 1 
ATOM   7148 N N   . SER D 2 217 ? 14.134  16.295  -67.231 1.00 30.17  ? 512 SER D N   1 
ATOM   7149 C CA  . SER D 2 217 ? 14.441  17.582  -66.615 1.00 31.34  ? 512 SER D CA  1 
ATOM   7150 C C   . SER D 2 217 ? 14.941  17.352  -65.196 1.00 25.77  ? 512 SER D C   1 
ATOM   7151 O O   . SER D 2 217 ? 15.866  18.018  -64.738 1.00 26.92  ? 512 SER D O   1 
ATOM   7152 C CB  . SER D 2 217 ? 13.211  18.494  -66.587 1.00 31.93  ? 512 SER D CB  1 
ATOM   7153 O OG  . SER D 2 217 ? 12.895  18.961  -67.885 1.00 44.41  ? 512 SER D OG  1 
ATOM   7154 N N   . HIS D 2 218 ? 14.318  16.402  -64.503 1.00 23.84  ? 513 HIS D N   1 
ATOM   7155 C CA  . HIS D 2 218 ? 14.663  16.137  -63.112 1.00 28.52  ? 513 HIS D CA  1 
ATOM   7156 C C   . HIS D 2 218 ? 16.014  15.444  -63.013 1.00 31.38  ? 513 HIS D C   1 
ATOM   7157 O O   . HIS D 2 218 ? 16.776  15.666  -62.070 1.00 31.23  ? 513 HIS D O   1 
ATOM   7158 C CB  . HIS D 2 218 ? 13.573  15.298  -62.443 1.00 39.01  ? 513 HIS D CB  1 
ATOM   7159 C CG  . HIS D 2 218 ? 13.826  15.021  -60.994 1.00 48.74  ? 513 HIS D CG  1 
ATOM   7160 N ND1 . HIS D 2 218 ? 13.976  16.025  -60.059 1.00 54.63  ? 513 HIS D ND1 1 
ATOM   7161 C CD2 . HIS D 2 218 ? 13.942  13.856  -60.315 1.00 48.13  ? 513 HIS D CD2 1 
ATOM   7162 C CE1 . HIS D 2 218 ? 14.175  15.487  -58.867 1.00 52.35  ? 513 HIS D CE1 1 
ATOM   7163 N NE2 . HIS D 2 218 ? 14.158  14.173  -58.996 1.00 49.09  ? 513 HIS D NE2 1 
ATOM   7164 N N   . ILE D 2 219 ? 16.317  14.604  -63.995 1.00 27.29  ? 514 ILE D N   1 
ATOM   7165 C CA  . ILE D 2 219 ? 17.596  13.909  -64.006 1.00 28.06  ? 514 ILE D CA  1 
ATOM   7166 C C   . ILE D 2 219 ? 18.720  14.910  -64.227 1.00 29.06  ? 514 ILE D C   1 
ATOM   7167 O O   . ILE D 2 219 ? 19.755  14.843  -63.569 1.00 29.08  ? 514 ILE D O   1 
ATOM   7168 C CB  . ILE D 2 219 ? 17.627  12.800  -65.061 1.00 26.76  ? 514 ILE D CB  1 
ATOM   7169 C CG1 . ILE D 2 219 ? 16.654  11.685  -64.652 1.00 26.52  ? 514 ILE D CG1 1 
ATOM   7170 C CG2 . ILE D 2 219 ? 19.034  12.234  -65.211 1.00 23.92  ? 514 ILE D CG2 1 
ATOM   7171 C CD1 . ILE D 2 219 ? 16.613  10.544  -65.610 1.00 35.02  ? 514 ILE D CD1 1 
ATOM   7172 N N   . ARG D 2 220 ? 18.497  15.850  -65.143 1.00 27.37  ? 515 ARG D N   1 
ATOM   7173 C CA  . ARG D 2 220 ? 19.430  16.949  -65.355 1.00 24.54  ? 515 ARG D CA  1 
ATOM   7174 C C   . ARG D 2 220 ? 19.638  17.715  -64.057 1.00 26.86  ? 515 ARG D C   1 
ATOM   7175 O O   . ARG D 2 220 ? 20.763  18.072  -63.709 1.00 32.53  ? 515 ARG D O   1 
ATOM   7176 C CB  . ARG D 2 220 ? 18.898  17.901  -66.426 1.00 25.22  ? 515 ARG D CB  1 
ATOM   7177 C CG  . ARG D 2 220 ? 19.848  19.017  -66.783 1.00 33.72  ? 515 ARG D CG  1 
ATOM   7178 C CD  . ARG D 2 220 ? 21.128  18.451  -67.364 1.00 37.65  ? 515 ARG D CD  1 
ATOM   7179 N NE  . ARG D 2 220 ? 21.639  19.276  -68.454 1.00 53.24  ? 515 ARG D NE  1 
ATOM   7180 C CZ  . ARG D 2 220 ? 21.185  19.229  -69.703 1.00 49.50  ? 515 ARG D CZ  1 
ATOM   7181 N NH1 . ARG D 2 220 ? 20.205  18.399  -70.026 1.00 51.10  ? 515 ARG D NH1 1 
ATOM   7182 N NH2 . ARG D 2 220 ? 21.711  20.015  -70.628 1.00 48.28  ? 515 ARG D NH2 1 
ATOM   7183 N N   . HIS D 2 221 ? 18.549  17.961  -63.339 1.00 33.30  ? 516 HIS D N   1 
ATOM   7184 C CA  . HIS D 2 221 ? 18.612  18.694  -62.076 1.00 34.74  ? 516 HIS D CA  1 
ATOM   7185 C C   . HIS D 2 221 ? 19.495  17.962  -61.066 1.00 30.79  ? 516 HIS D C   1 
ATOM   7186 O O   . HIS D 2 221 ? 20.375  18.559  -60.436 1.00 24.40  ? 516 HIS D O   1 
ATOM   7187 C CB  . HIS D 2 221 ? 17.204  18.897  -61.508 1.00 31.24  ? 516 HIS D CB  1 
ATOM   7188 C CG  . HIS D 2 221 ? 17.169  19.728  -60.266 1.00 41.87  ? 516 HIS D CG  1 
ATOM   7189 N ND1 . HIS D 2 221 ? 17.241  21.103  -60.292 1.00 44.88  ? 516 HIS D ND1 1 
ATOM   7190 C CD2 . HIS D 2 221 ? 17.070  19.381  -58.962 1.00 47.99  ? 516 HIS D CD2 1 
ATOM   7191 C CE1 . HIS D 2 221 ? 17.187  21.568  -59.057 1.00 45.32  ? 516 HIS D CE1 1 
ATOM   7192 N NE2 . HIS D 2 221 ? 17.088  20.541  -58.230 1.00 49.45  ? 516 HIS D NE2 1 
ATOM   7193 N N   . MET D 2 222 ? 19.253  16.665  -60.921 1.00 28.38  ? 517 MET D N   1 
ATOM   7194 C CA  . MET D 2 222 ? 20.017  15.830  -60.001 1.00 29.47  ? 517 MET D CA  1 
ATOM   7195 C C   . MET D 2 222 ? 21.499  15.798  -60.381 1.00 28.76  ? 517 MET D C   1 
ATOM   7196 O O   . MET D 2 222 ? 22.375  15.849  -59.518 1.00 28.24  ? 517 MET D O   1 
ATOM   7197 C CB  . MET D 2 222 ? 19.442  14.411  -59.989 1.00 22.47  ? 517 MET D CB  1 
ATOM   7198 C CG  . MET D 2 222 ? 18.064  14.320  -59.365 1.00 29.53  ? 517 MET D CG  1 
ATOM   7199 S SD  . MET D 2 222 ? 17.538  12.622  -59.114 1.00 35.81  ? 517 MET D SD  1 
ATOM   7200 C CE  . MET D 2 222 ? 17.384  12.077  -60.812 1.00 27.39  ? 517 MET D CE  1 
ATOM   7201 N N   . SER D 2 223 ? 21.777  15.712  -61.677 1.00 25.15  ? 518 SER D N   1 
ATOM   7202 C CA  . SER D 2 223 ? 23.153  15.746  -62.153 1.00 28.61  ? 518 SER D CA  1 
ATOM   7203 C C   . SER D 2 223 ? 23.806  17.077  -61.769 1.00 35.04  ? 518 SER D C   1 
ATOM   7204 O O   . SER D 2 223 ? 24.953  17.116  -61.320 1.00 35.40  ? 518 SER D O   1 
ATOM   7205 C CB  . SER D 2 223 ? 23.190  15.553  -63.668 1.00 29.24  ? 518 SER D CB  1 
ATOM   7206 O OG  . SER D 2 223 ? 24.491  15.764  -64.172 1.00 34.65  ? 518 SER D OG  1 
ATOM   7207 N N   . ASN D 2 224 ? 23.072  18.172  -61.936 1.00 31.46  ? 519 ASN D N   1 
ATOM   7208 C CA  . ASN D 2 224 ? 23.627  19.481  -61.605 1.00 30.19  ? 519 ASN D CA  1 
ATOM   7209 C C   . ASN D 2 224 ? 23.923  19.611  -60.112 1.00 30.88  ? 519 ASN D C   1 
ATOM   7210 O O   . ASN D 2 224 ? 24.996  20.068  -59.732 1.00 34.24  ? 519 ASN D O   1 
ATOM   7211 C CB  . ASN D 2 224 ? 22.718  20.605  -62.102 1.00 38.24  ? 519 ASN D CB  1 
ATOM   7212 C CG  . ASN D 2 224 ? 22.873  20.856  -63.592 1.00 37.32  ? 519 ASN D CG  1 
ATOM   7213 O OD1 . ASN D 2 224 ? 23.932  20.607  -64.164 1.00 44.40  ? 519 ASN D OD1 1 
ATOM   7214 N ND2 . ASN D 2 224 ? 21.823  21.359  -64.223 1.00 37.23  ? 519 ASN D ND2 1 
ATOM   7215 N N   . LYS D 2 225 ? 22.985  19.187  -59.268 1.00 30.37  ? 520 LYS D N   1 
ATOM   7216 C CA  . LYS D 2 225 ? 23.226  19.193  -57.827 1.00 35.75  ? 520 LYS D CA  1 
ATOM   7217 C C   . LYS D 2 225 ? 24.440  18.341  -57.503 1.00 41.30  ? 520 LYS D C   1 
ATOM   7218 O O   . LYS D 2 225 ? 25.297  18.737  -56.711 1.00 40.17  ? 520 LYS D O   1 
ATOM   7219 C CB  . LYS D 2 225 ? 22.006  18.694  -57.054 1.00 37.34  ? 520 LYS D CB  1 
ATOM   7220 C CG  . LYS D 2 225 ? 20.783  19.604  -57.165 1.00 44.43  ? 520 LYS D CG  1 
ATOM   7221 C CD  . LYS D 2 225 ? 21.113  21.030  -56.757 1.00 51.23  ? 520 LYS D CD  1 
ATOM   7222 C CE  . LYS D 2 225 ? 20.740  21.297  -55.303 1.00 57.87  ? 520 LYS D CE  1 
ATOM   7223 N NZ  . LYS D 2 225 ? 21.097  22.690  -54.894 1.00 64.44  ? 520 LYS D NZ  1 
ATOM   7224 N N   . GLY D 2 226 ? 24.511  17.169  -58.128 1.00 38.77  ? 521 GLY D N   1 
ATOM   7225 C CA  . GLY D 2 226 ? 25.643  16.282  -57.944 1.00 31.64  ? 521 GLY D CA  1 
ATOM   7226 C C   . GLY D 2 226 ? 26.962  16.987  -58.216 1.00 38.43  ? 521 GLY D C   1 
ATOM   7227 O O   . GLY D 2 226 ? 27.877  16.959  -57.384 1.00 38.13  ? 521 GLY D O   1 
ATOM   7228 N N   . MET D 2 227 ? 27.063  17.614  -59.385 1.00 39.05  ? 522 MET D N   1 
ATOM   7229 C CA  . MET D 2 227 ? 28.263  18.359  -59.760 1.00 40.81  ? 522 MET D CA  1 
ATOM   7230 C C   . MET D 2 227 ? 28.548  19.446  -58.738 1.00 43.50  ? 522 MET D C   1 
ATOM   7231 O O   . MET D 2 227 ? 29.686  19.629  -58.304 1.00 44.53  ? 522 MET D O   1 
ATOM   7232 C CB  . MET D 2 227 ? 28.101  18.997  -61.140 1.00 35.55  ? 522 MET D CB  1 
ATOM   7233 C CG  . MET D 2 227 ? 28.041  18.006  -62.273 1.00 34.72  ? 522 MET D CG  1 
ATOM   7234 S SD  . MET D 2 227 ? 29.571  17.069  -62.406 1.00 47.81  ? 522 MET D SD  1 
ATOM   7235 C CE  . MET D 2 227 ? 29.340  16.333  -64.019 1.00 84.55  ? 522 MET D CE  1 
ATOM   7236 N N   . GLU D 2 228 ? 27.499  20.169  -58.366 1.00 39.02  ? 523 GLU D N   1 
ATOM   7237 C CA  . GLU D 2 228 ? 27.604  21.214  -57.356 1.00 43.82  ? 523 GLU D CA  1 
ATOM   7238 C C   . GLU D 2 228 ? 28.233  20.625  -56.101 1.00 44.99  ? 523 GLU D C   1 
ATOM   7239 O O   . GLU D 2 228 ? 29.145  21.209  -55.511 1.00 42.79  ? 523 GLU D O   1 
ATOM   7240 C CB  . GLU D 2 228 ? 26.213  21.769  -57.049 1.00 51.03  ? 523 GLU D CB  1 
ATOM   7241 C CG  . GLU D 2 228 ? 26.182  23.007  -56.177 1.00 68.08  ? 523 GLU D CG  1 
ATOM   7242 C CD  . GLU D 2 228 ? 24.762  23.509  -55.955 1.00 80.27  ? 523 GLU D CD  1 
ATOM   7243 O OE1 . GLU D 2 228 ? 24.565  24.406  -55.105 1.00 87.26  ? 523 GLU D OE1 1 
ATOM   7244 O OE2 . GLU D 2 228 ? 23.839  23.002  -56.633 1.00 79.01  ? 523 GLU D OE2 1 
ATOM   7245 N N   . HIS D 2 229 ? 27.758  19.446  -55.712 1.00 42.29  ? 524 HIS D N   1 
ATOM   7246 C CA  . HIS D 2 229 ? 28.234  18.794  -54.498 1.00 50.37  ? 524 HIS D CA  1 
ATOM   7247 C C   . HIS D 2 229 ? 29.679  18.317  -54.621 1.00 50.93  ? 524 HIS D C   1 
ATOM   7248 O O   . HIS D 2 229 ? 30.438  18.372  -53.652 1.00 55.10  ? 524 HIS D O   1 
ATOM   7249 C CB  . HIS D 2 229 ? 27.322  17.627  -54.118 1.00 61.06  ? 524 HIS D CB  1 
ATOM   7250 C CG  . HIS D 2 229 ? 27.718  16.945  -52.846 1.00 72.56  ? 524 HIS D CG  1 
ATOM   7251 N ND1 . HIS D 2 229 ? 28.402  15.749  -52.824 1.00 75.10  ? 524 HIS D ND1 1 
ATOM   7252 C CD2 . HIS D 2 229 ? 27.532  17.297  -51.552 1.00 79.93  ? 524 HIS D CD2 1 
ATOM   7253 C CE1 . HIS D 2 229 ? 28.617  15.389  -51.570 1.00 77.05  ? 524 HIS D CE1 1 
ATOM   7254 N NE2 . HIS D 2 229 ? 28.100  16.312  -50.779 1.00 79.88  ? 524 HIS D NE2 1 
ATOM   7255 N N   . LEU D 2 230 ? 30.059  17.850  -55.806 1.00 44.18  ? 525 LEU D N   1 
ATOM   7256 C CA  . LEU D 2 230 ? 31.433  17.416  -56.042 1.00 42.23  ? 525 LEU D CA  1 
ATOM   7257 C C   . LEU D 2 230 ? 32.409  18.572  -55.844 1.00 51.69  ? 525 LEU D C   1 
ATOM   7258 O O   . LEU D 2 230 ? 33.463  18.412  -55.229 1.00 55.95  ? 525 LEU D O   1 
ATOM   7259 C CB  . LEU D 2 230 ? 31.589  16.843  -57.451 1.00 46.79  ? 525 LEU D CB  1 
ATOM   7260 C CG  . LEU D 2 230 ? 30.969  15.469  -57.704 1.00 50.94  ? 525 LEU D CG  1 
ATOM   7261 C CD1 . LEU D 2 230 ? 31.097  15.085  -59.165 1.00 49.57  ? 525 LEU D CD1 1 
ATOM   7262 C CD2 . LEU D 2 230 ? 31.624  14.427  -56.816 1.00 52.42  ? 525 LEU D CD2 1 
ATOM   7263 N N   . TYR D 2 231 ? 32.057  19.738  -56.372 1.00 55.60  ? 526 TYR D N   1 
ATOM   7264 C CA  . TYR D 2 231 ? 32.925  20.904  -56.270 1.00 62.04  ? 526 TYR D CA  1 
ATOM   7265 C C   . TYR D 2 231 ? 33.073  21.385  -54.829 1.00 63.38  ? 526 TYR D C   1 
ATOM   7266 O O   . TYR D 2 231 ? 34.172  21.729  -54.400 1.00 67.25  ? 526 TYR D O   1 
ATOM   7267 C CB  . TYR D 2 231 ? 32.422  22.032  -57.169 1.00 66.55  ? 526 TYR D CB  1 
ATOM   7268 C CG  . TYR D 2 231 ? 32.743  21.828  -58.633 1.00 73.90  ? 526 TYR D CG  1 
ATOM   7269 C CD1 . TYR D 2 231 ? 33.517  22.747  -59.330 1.00 82.38  ? 526 TYR D CD1 1 
ATOM   7270 C CD2 . TYR D 2 231 ? 32.285  20.710  -59.315 1.00 76.62  ? 526 TYR D CD2 1 
ATOM   7271 C CE1 . TYR D 2 231 ? 33.813  22.562  -60.669 1.00 84.54  ? 526 TYR D CE1 1 
ATOM   7272 C CE2 . TYR D 2 231 ? 32.575  20.516  -60.650 1.00 81.50  ? 526 TYR D CE2 1 
ATOM   7273 C CZ  . TYR D 2 231 ? 33.339  21.443  -61.323 1.00 85.45  ? 526 TYR D CZ  1 
ATOM   7274 O OH  . TYR D 2 231 ? 33.628  21.245  -62.653 1.00 86.53  ? 526 TYR D OH  1 
ATOM   7275 N N   . SER D 2 232 ? 31.974  21.397  -54.080 1.00 65.67  ? 527 SER D N   1 
ATOM   7276 C CA  . SER D 2 232 ? 32.016  21.835  -52.687 1.00 74.11  ? 527 SER D CA  1 
ATOM   7277 C C   . SER D 2 232 ? 32.722  20.807  -51.806 1.00 75.16  ? 527 SER D C   1 
ATOM   7278 O O   . SER D 2 232 ? 33.192  21.133  -50.715 1.00 75.54  ? 527 SER D O   1 
ATOM   7279 C CB  . SER D 2 232 ? 30.609  22.106  -52.151 1.00 77.87  ? 527 SER D CB  1 
ATOM   7280 O OG  . SER D 2 232 ? 29.966  20.899  -51.783 1.00 80.04  ? 527 SER D OG  1 
ATOM   7281 N N   . MET D 2 233 ? 32.788  19.568  -52.283 1.00 73.39  ? 528 MET D N   1 
ATOM   7282 C CA  . MET D 2 233 ? 33.489  18.503  -51.570 1.00 72.86  ? 528 MET D CA  1 
ATOM   7283 C C   . MET D 2 233 ? 34.979  18.492  -51.898 1.00 72.05  ? 528 MET D C   1 
ATOM   7284 O O   . MET D 2 233 ? 35.717  17.632  -51.418 1.00 70.09  ? 528 MET D O   1 
ATOM   7285 C CB  . MET D 2 233 ? 32.883  17.134  -51.905 1.00 71.41  ? 528 MET D CB  1 
ATOM   7286 C CG  . MET D 2 233 ? 31.594  16.825  -51.168 1.00 72.29  ? 528 MET D CG  1 
ATOM   7287 S SD  . MET D 2 233 ? 31.764  17.063  -49.390 1.00 107.18 ? 528 MET D SD  1 
ATOM   7288 C CE  . MET D 2 233 ? 31.423  15.414  -48.783 1.00 119.65 ? 528 MET D CE  1 
ATOM   7289 N N   . LYS D 2 234 ? 35.411  19.446  -52.719 1.00 73.24  ? 529 LYS D N   1 
ATOM   7290 C CA  . LYS D 2 234 ? 36.796  19.503  -53.177 1.00 79.17  ? 529 LYS D CA  1 
ATOM   7291 C C   . LYS D 2 234 ? 37.113  18.299  -54.068 1.00 73.86  ? 529 LYS D C   1 
ATOM   7292 O O   . LYS D 2 234 ? 38.273  17.935  -54.256 1.00 69.96  ? 529 LYS D O   1 
ATOM   7293 C CB  . LYS D 2 234 ? 37.759  19.579  -51.982 1.00 83.22  ? 529 LYS D CB  1 
ATOM   7294 C CG  . LYS D 2 234 ? 39.224  19.769  -52.353 1.00 93.33  ? 529 LYS D CG  1 
ATOM   7295 C CD  . LYS D 2 234 ? 40.071  20.138  -51.140 1.00 99.94  ? 529 LYS D CD  1 
ATOM   7296 C CE  . LYS D 2 234 ? 41.537  20.302  -51.520 1.00 99.51  ? 529 LYS D CE  1 
ATOM   7297 N NZ  . LYS D 2 234 ? 42.332  20.949  -50.441 1.00 97.70  ? 529 LYS D NZ  1 
ATOM   7298 N N   . CYS D 2 235 ? 36.066  17.693  -54.623 1.00 74.99  ? 530 CYS D N   1 
ATOM   7299 C CA  . CYS D 2 235 ? 36.208  16.502  -55.457 1.00 71.44  ? 530 CYS D CA  1 
ATOM   7300 C C   . CYS D 2 235 ? 36.126  16.811  -56.953 1.00 69.32  ? 530 CYS D C   1 
ATOM   7301 O O   . CYS D 2 235 ? 35.645  15.989  -57.736 1.00 65.07  ? 530 CYS D O   1 
ATOM   7302 C CB  . CYS D 2 235 ? 35.138  15.469  -55.096 1.00 65.63  ? 530 CYS D CB  1 
ATOM   7303 S SG  . CYS D 2 235 ? 35.151  14.936  -53.378 1.00 88.88  ? 530 CYS D SG  1 
ATOM   7304 N N   . LYS D 2 236 ? 36.593  17.991  -57.350 1.00 72.30  ? 531 LYS D N   1 
ATOM   7305 C CA  . LYS D 2 236 ? 36.551  18.387  -58.755 1.00 77.63  ? 531 LYS D CA  1 
ATOM   7306 C C   . LYS D 2 236 ? 37.264  17.354  -59.626 1.00 78.64  ? 531 LYS D C   1 
ATOM   7307 O O   . LYS D 2 236 ? 36.966  17.206  -60.812 1.00 76.79  ? 531 LYS D O   1 
ATOM   7308 C CB  . LYS D 2 236 ? 37.201  19.762  -58.947 1.00 83.25  ? 531 LYS D CB  1 
ATOM   7309 C CG  . LYS D 2 236 ? 36.690  20.849  -58.013 1.00 87.27  ? 531 LYS D CG  1 
ATOM   7310 C CD  . LYS D 2 236 ? 37.527  22.117  -58.149 1.00 91.21  ? 531 LYS D CD  1 
ATOM   7311 C CE  . LYS D 2 236 ? 37.193  23.152  -57.078 1.00 92.28  ? 531 LYS D CE  1 
ATOM   7312 N NZ  . LYS D 2 236 ? 35.958  23.931  -57.386 1.00 91.40  ? 531 LYS D NZ  1 
ATOM   7313 N N   . ASN D 2 237 ? 38.201  16.636  -59.016 1.00 81.76  ? 532 ASN D N   1 
ATOM   7314 C CA  . ASN D 2 237 ? 39.085  15.714  -59.726 1.00 84.25  ? 532 ASN D CA  1 
ATOM   7315 C C   . ASN D 2 237 ? 38.436  14.441  -60.282 1.00 77.91  ? 532 ASN D C   1 
ATOM   7316 O O   . ASN D 2 237 ? 38.963  13.833  -61.214 1.00 75.09  ? 532 ASN D O   1 
ATOM   7317 C CB  . ASN D 2 237 ? 40.299  15.359  -58.853 1.00 93.77  ? 532 ASN D CB  1 
ATOM   7318 C CG  . ASN D 2 237 ? 39.928  15.099  -57.397 1.00 100.24 ? 532 ASN D CG  1 
ATOM   7319 O OD1 . ASN D 2 237 ? 40.801  14.981  -56.537 1.00 104.54 ? 532 ASN D OD1 1 
ATOM   7320 N ND2 . ASN D 2 237 ? 38.633  15.010  -57.116 1.00 101.93 ? 532 ASN D ND2 1 
ATOM   7321 N N   . VAL D 2 238 ? 37.297  14.041  -59.724 1.00 74.31  ? 533 VAL D N   1 
ATOM   7322 C CA  . VAL D 2 238 ? 36.657  12.795  -60.140 1.00 71.24  ? 533 VAL D CA  1 
ATOM   7323 C C   . VAL D 2 238 ? 35.869  12.959  -61.435 1.00 59.79  ? 533 VAL D C   1 
ATOM   7324 O O   . VAL D 2 238 ? 35.358  11.986  -61.994 1.00 58.66  ? 533 VAL D O   1 
ATOM   7325 C CB  . VAL D 2 238 ? 35.720  12.232  -59.054 1.00 77.78  ? 533 VAL D CB  1 
ATOM   7326 C CG1 . VAL D 2 238 ? 35.476  10.756  -59.301 1.00 80.33  ? 533 VAL D CG1 1 
ATOM   7327 C CG2 . VAL D 2 238 ? 36.320  12.440  -57.673 1.00 82.78  ? 533 VAL D CG2 1 
ATOM   7328 N N   . VAL D 2 239 ? 35.767  14.193  -61.910 1.00 49.91  ? 534 VAL D N   1 
ATOM   7329 C CA  . VAL D 2 239 ? 35.036  14.458  -63.139 1.00 49.66  ? 534 VAL D CA  1 
ATOM   7330 C C   . VAL D 2 239 ? 35.906  14.116  -64.348 1.00 49.19  ? 534 VAL D C   1 
ATOM   7331 O O   . VAL D 2 239 ? 37.066  14.526  -64.419 1.00 51.53  ? 534 VAL D O   1 
ATOM   7332 C CB  . VAL D 2 239 ? 34.576  15.928  -63.213 1.00 52.99  ? 534 VAL D CB  1 
ATOM   7333 C CG1 . VAL D 2 239 ? 33.784  16.173  -64.488 1.00 50.96  ? 534 VAL D CG1 1 
ATOM   7334 C CG2 . VAL D 2 239 ? 33.748  16.286  -61.983 1.00 47.72  ? 534 VAL D CG2 1 
ATOM   7335 N N   . PRO D 2 240 ? 35.357  13.335  -65.290 1.00 46.01  ? 535 PRO D N   1 
ATOM   7336 C CA  . PRO D 2 240 ? 36.066  13.016  -66.532 1.00 51.53  ? 535 PRO D CA  1 
ATOM   7337 C C   . PRO D 2 240 ? 36.342  14.280  -67.340 1.00 44.77  ? 535 PRO D C   1 
ATOM   7338 O O   . PRO D 2 240 ? 35.411  15.005  -67.674 1.00 50.20  ? 535 PRO D O   1 
ATOM   7339 C CB  . PRO D 2 240 ? 35.072  12.126  -67.285 1.00 47.40  ? 535 PRO D CB  1 
ATOM   7340 C CG  . PRO D 2 240 ? 34.179  11.576  -66.236 1.00 48.26  ? 535 PRO D CG  1 
ATOM   7341 C CD  . PRO D 2 240 ? 34.057  12.650  -65.204 1.00 44.56  ? 535 PRO D CD  1 
ATOM   7342 N N   . SER D 2 241 ? 37.607  14.538  -67.649 1.00 42.98  ? 536 SER D N   1 
ATOM   7343 C CA  . SER D 2 241 ? 37.961  15.730  -68.405 1.00 41.85  ? 536 SER D CA  1 
ATOM   7344 C C   . SER D 2 241 ? 37.725  15.488  -69.888 1.00 45.78  ? 536 SER D C   1 
ATOM   7345 O O   . SER D 2 241 ? 37.564  14.343  -70.325 1.00 38.75  ? 536 SER D O   1 
ATOM   7346 C CB  . SER D 2 241 ? 39.417  16.114  -68.164 1.00 43.37  ? 536 SER D CB  1 
ATOM   7347 O OG  . SER D 2 241 ? 40.293  15.181  -68.774 1.00 46.95  ? 536 SER D OG  1 
ATOM   7348 N N   . TYR D 2 242 ? 37.704  16.574  -70.655 1.00 45.11  ? 537 TYR D N   1 
ATOM   7349 C CA  . TYR D 2 242 ? 37.555  16.494  -72.102 1.00 47.50  ? 537 TYR D CA  1 
ATOM   7350 C C   . TYR D 2 242 ? 38.604  15.554  -72.696 1.00 50.88  ? 537 TYR D C   1 
ATOM   7351 O O   . TYR D 2 242 ? 38.283  14.642  -73.463 1.00 46.52  ? 537 TYR D O   1 
ATOM   7352 C CB  . TYR D 2 242 ? 37.675  17.890  -72.720 1.00 47.83  ? 537 TYR D CB  1 
ATOM   7353 C CG  . TYR D 2 242 ? 37.622  17.903  -74.230 1.00 48.69  ? 537 TYR D CG  1 
ATOM   7354 C CD1 . TYR D 2 242 ? 38.771  17.700  -74.983 1.00 50.11  ? 537 TYR D CD1 1 
ATOM   7355 C CD2 . TYR D 2 242 ? 36.426  18.128  -74.902 1.00 47.17  ? 537 TYR D CD2 1 
ATOM   7356 C CE1 . TYR D 2 242 ? 38.733  17.712  -76.363 1.00 51.97  ? 537 TYR D CE1 1 
ATOM   7357 C CE2 . TYR D 2 242 ? 36.376  18.141  -76.285 1.00 50.26  ? 537 TYR D CE2 1 
ATOM   7358 C CZ  . TYR D 2 242 ? 37.535  17.934  -77.009 1.00 57.34  ? 537 TYR D CZ  1 
ATOM   7359 O OH  . TYR D 2 242 ? 37.504  17.945  -78.385 1.00 61.13  ? 537 TYR D OH  1 
ATOM   7360 N N   . ASP D 2 243 ? 39.861  15.772  -72.326 1.00 53.98  ? 538 ASP D N   1 
ATOM   7361 C CA  . ASP D 2 243 ? 40.959  14.970  -72.862 1.00 57.04  ? 538 ASP D CA  1 
ATOM   7362 C C   . ASP D 2 243 ? 40.903  13.497  -72.434 1.00 49.80  ? 538 ASP D C   1 
ATOM   7363 O O   . ASP D 2 243 ? 41.118  12.607  -73.252 1.00 47.99  ? 538 ASP D O   1 
ATOM   7364 C CB  . ASP D 2 243 ? 42.308  15.603  -72.514 1.00 56.28  ? 538 ASP D CB  1 
ATOM   7365 C CG  . ASP D 2 243 ? 42.584  16.855  -73.323 1.00 64.56  ? 538 ASP D CG  1 
ATOM   7366 O OD1 . ASP D 2 243 ? 42.924  17.893  -72.719 1.00 67.18  ? 538 ASP D OD1 1 
ATOM   7367 O OD2 . ASP D 2 243 ? 42.450  16.805  -74.564 1.00 64.89  ? 538 ASP D OD2 1 
ATOM   7368 N N   . LEU D 2 244 ? 40.607  13.243  -71.162 1.00 48.03  ? 539 LEU D N   1 
ATOM   7369 C CA  . LEU D 2 244 ? 40.438  11.873  -70.689 1.00 49.81  ? 539 LEU D CA  1 
ATOM   7370 C C   . LEU D 2 244 ? 39.406  11.139  -71.539 1.00 45.14  ? 539 LEU D C   1 
ATOM   7371 O O   . LEU D 2 244 ? 39.620  10.006  -71.970 1.00 38.59  ? 539 LEU D O   1 
ATOM   7372 C CB  . LEU D 2 244 ? 39.999  11.844  -69.226 1.00 50.34  ? 539 LEU D CB  1 
ATOM   7373 C CG  . LEU D 2 244 ? 39.606  10.444  -68.743 1.00 51.56  ? 539 LEU D CG  1 
ATOM   7374 C CD1 . LEU D 2 244 ? 40.782  9.476   -68.877 1.00 39.62  ? 539 LEU D CD1 1 
ATOM   7375 C CD2 . LEU D 2 244 ? 39.081  10.466  -67.313 1.00 50.13  ? 539 LEU D CD2 1 
ATOM   7376 N N   . LEU D 2 245 ? 38.282  11.803  -71.778 1.00 41.56  ? 540 LEU D N   1 
ATOM   7377 C CA  . LEU D 2 245 ? 37.209  11.233  -72.577 1.00 42.45  ? 540 LEU D CA  1 
ATOM   7378 C C   . LEU D 2 245 ? 37.647  11.010  -74.019 1.00 43.66  ? 540 LEU D C   1 
ATOM   7379 O O   . LEU D 2 245 ? 37.306  9.993   -74.632 1.00 37.30  ? 540 LEU D O   1 
ATOM   7380 C CB  . LEU D 2 245 ? 35.967  12.132  -72.522 1.00 37.07  ? 540 LEU D CB  1 
ATOM   7381 C CG  . LEU D 2 245 ? 35.207  12.064  -71.195 1.00 35.43  ? 540 LEU D CG  1 
ATOM   7382 C CD1 . LEU D 2 245 ? 34.191  13.190  -71.080 1.00 34.69  ? 540 LEU D CD1 1 
ATOM   7383 C CD2 . LEU D 2 245 ? 34.528  10.705  -71.057 1.00 30.41  ? 540 LEU D CD2 1 
ATOM   7384 N N   . LEU D 2 246 ? 38.411  11.955  -74.555 1.00 45.08  ? 541 LEU D N   1 
ATOM   7385 C CA  . LEU D 2 246 ? 38.887  11.856  -75.929 1.00 44.58  ? 541 LEU D CA  1 
ATOM   7386 C C   . LEU D 2 246 ? 39.815  10.660  -76.119 1.00 47.65  ? 541 LEU D C   1 
ATOM   7387 O O   . LEU D 2 246 ? 39.747  9.976   -77.139 1.00 50.64  ? 541 LEU D O   1 
ATOM   7388 C CB  . LEU D 2 246 ? 39.586  13.147  -76.368 1.00 46.04  ? 541 LEU D CB  1 
ATOM   7389 C CG  . LEU D 2 246 ? 40.109  13.123  -77.809 1.00 47.81  ? 541 LEU D CG  1 
ATOM   7390 C CD1 . LEU D 2 246 ? 39.004  12.717  -78.780 1.00 47.77  ? 541 LEU D CD1 1 
ATOM   7391 C CD2 . LEU D 2 246 ? 40.706  14.466  -78.201 1.00 49.10  ? 541 LEU D CD2 1 
ATOM   7392 N N   . GLU D 2 247 ? 40.674  10.403  -75.139 1.00 49.00  ? 542 GLU D N   1 
ATOM   7393 C CA  . GLU D 2 247 ? 41.613  9.288   -75.245 1.00 53.51  ? 542 GLU D CA  1 
ATOM   7394 C C   . GLU D 2 247 ? 40.924  7.931   -75.078 1.00 50.50  ? 542 GLU D C   1 
ATOM   7395 O O   . GLU D 2 247 ? 41.290  6.953   -75.733 1.00 50.21  ? 542 GLU D O   1 
ATOM   7396 C CB  . GLU D 2 247 ? 42.788  9.453   -74.276 1.00 62.10  ? 542 GLU D CB  1 
ATOM   7397 C CG  . GLU D 2 247 ? 42.426  10.038  -72.926 1.00 70.61  ? 542 GLU D CG  1 
ATOM   7398 C CD  . GLU D 2 247 ? 43.576  10.815  -72.302 1.00 83.60  ? 542 GLU D CD  1 
ATOM   7399 O OE1 . GLU D 2 247 ? 44.311  10.233  -71.474 1.00 87.93  ? 542 GLU D OE1 1 
ATOM   7400 O OE2 . GLU D 2 247 ? 43.745  12.006  -72.643 1.00 86.21  ? 542 GLU D OE2 1 
ATOM   7401 N N   . MET D 2 248 ? 39.917  7.877   -74.213 1.00 48.41  ? 543 MET D N   1 
ATOM   7402 C CA  . MET D 2 248 ? 39.140  6.652   -74.030 1.00 53.50  ? 543 MET D CA  1 
ATOM   7403 C C   . MET D 2 248 ? 38.373  6.289   -75.296 1.00 49.58  ? 543 MET D C   1 
ATOM   7404 O O   . MET D 2 248 ? 38.301  5.121   -75.678 1.00 50.70  ? 543 MET D O   1 
ATOM   7405 C CB  . MET D 2 248 ? 38.177  6.790   -72.853 1.00 52.51  ? 543 MET D CB  1 
ATOM   7406 C CG  . MET D 2 248 ? 38.873  6.862   -71.510 1.00 58.38  ? 543 MET D CG  1 
ATOM   7407 S SD  . MET D 2 248 ? 37.755  6.777   -70.102 1.00 67.08  ? 543 MET D SD  1 
ATOM   7408 C CE  . MET D 2 248 ? 37.043  8.415   -70.171 1.00 115.02 ? 543 MET D CE  1 
ATOM   7409 N N   . LEU D 2 249 ? 37.803  7.299   -75.942 1.00 42.76  ? 544 LEU D N   1 
ATOM   7410 C CA  . LEU D 2 249 ? 37.090  7.104   -77.197 1.00 47.07  ? 544 LEU D CA  1 
ATOM   7411 C C   . LEU D 2 249 ? 38.018  6.618   -78.301 1.00 51.24  ? 544 LEU D C   1 
ATOM   7412 O O   . LEU D 2 249 ? 37.692  5.683   -79.029 1.00 53.30  ? 544 LEU D O   1 
ATOM   7413 C CB  . LEU D 2 249 ? 36.401  8.397   -77.627 1.00 48.21  ? 544 LEU D CB  1 
ATOM   7414 C CG  . LEU D 2 249 ? 35.121  8.719   -76.866 1.00 48.27  ? 544 LEU D CG  1 
ATOM   7415 C CD1 . LEU D 2 249 ? 34.848  10.208  -76.882 1.00 53.92  ? 544 LEU D CD1 1 
ATOM   7416 C CD2 . LEU D 2 249 ? 33.946  7.936   -77.447 1.00 46.25  ? 544 LEU D CD2 1 
ATOM   7417 N N   . ASP D 2 250 ? 39.176  7.258   -78.415 1.00 55.04  ? 545 ASP D N   1 
ATOM   7418 C CA  . ASP D 2 250 ? 40.144  6.930   -79.457 1.00 68.35  ? 545 ASP D CA  1 
ATOM   7419 C C   . ASP D 2 250 ? 40.675  5.498   -79.374 1.00 74.47  ? 545 ASP D C   1 
ATOM   7420 O O   . ASP D 2 250 ? 41.224  4.982   -80.350 1.00 81.43  ? 545 ASP D O   1 
ATOM   7421 C CB  . ASP D 2 250 ? 41.306  7.925   -79.438 1.00 79.41  ? 545 ASP D CB  1 
ATOM   7422 C CG  . ASP D 2 250 ? 40.870  9.333   -79.806 1.00 89.43  ? 545 ASP D CG  1 
ATOM   7423 O OD1 . ASP D 2 250 ? 39.789  9.475   -80.427 1.00 85.80  ? 545 ASP D OD1 1 
ATOM   7424 O OD2 . ASP D 2 250 ? 41.603  10.295  -79.475 1.00 94.27  ? 545 ASP D OD2 1 
ATOM   7425 N N   . ALA D 2 251 ? 40.512  4.862   -78.217 1.00 75.39  ? 546 ALA D N   1 
ATOM   7426 C CA  . ALA D 2 251 ? 41.002  3.499   -78.012 1.00 83.35  ? 546 ALA D CA  1 
ATOM   7427 C C   . ALA D 2 251 ? 40.379  2.492   -78.979 1.00 91.50  ? 546 ALA D C   1 
ATOM   7428 O O   . ALA D 2 251 ? 40.917  2.235   -80.056 1.00 98.61  ? 546 ALA D O   1 
ATOM   7429 C CB  . ALA D 2 251 ? 40.783  3.066   -76.572 1.00 80.33  ? 546 ALA D CB  1 
ATOM   7430 N N   . HIS D 2 252 ? 39.251  1.910   -78.590 1.00 90.54  ? 547 HIS D N   1 
ATOM   7431 C CA  . HIS D 2 252 ? 38.593  0.918   -79.434 1.00 92.94  ? 547 HIS D CA  1 
ATOM   7432 C C   . HIS D 2 252 ? 37.812  1.579   -80.568 1.00 93.51  ? 547 HIS D C   1 
ATOM   7433 O O   . HIS D 2 252 ? 38.379  2.314   -81.380 1.00 91.82  ? 547 HIS D O   1 
ATOM   7434 C CB  . HIS D 2 252 ? 37.671  0.025   -78.603 1.00 89.42  ? 547 HIS D CB  1 
HETATM 7435 C CAA . KN0 E 3 .   ? 20.291  15.609  -28.570 1.00 52.21  ? 1   KN0 A CAA 1 
HETATM 7436 C CAB . KN0 E 3 .   ? 19.117  14.867  -28.602 1.00 50.31  ? 1   KN0 A CAB 1 
HETATM 7437 C CAC . KN0 E 3 .   ? 18.240  14.913  -27.525 1.00 45.82  ? 1   KN0 A CAC 1 
HETATM 7438 C CAD . KN0 E 3 .   ? 18.537  15.699  -26.421 1.00 42.57  ? 1   KN0 A CAD 1 
HETATM 7439 C CAE . KN0 E 3 .   ? 19.712  16.445  -26.385 1.00 47.70  ? 1   KN0 A CAE 1 
HETATM 7440 C CAF . KN0 E 3 .   ? 20.603  16.396  -27.464 1.00 50.36  ? 1   KN0 A CAF 1 
HETATM 7441 C CAG . KN0 E 3 .   ? 17.921  15.929  -25.194 1.00 42.03  ? 1   KN0 A CAG 1 
HETATM 7442 N NAH . KN0 E 3 .   ? 18.666  16.827  -24.552 1.00 41.86  ? 1   KN0 A NAH 1 
HETATM 7443 N NAI . KN0 E 3 .   ? 19.687  17.076  -25.204 1.00 48.16  ? 1   KN0 A NAI 1 
HETATM 7444 C CAJ . KN0 E 3 .   ? 16.666  15.445  -24.821 1.00 30.83  ? 1   KN0 A CAJ 1 
HETATM 7445 C CAK . KN0 E 3 .   ? 20.734  17.977  -24.695 1.00 40.70  ? 1   KN0 A CAK 1 
HETATM 7446 C CAL . KN0 E 3 .   ? 16.070  14.372  -25.480 1.00 33.27  ? 1   KN0 A CAL 1 
HETATM 7447 C CAM . KN0 E 3 .   ? 14.822  13.905  -25.065 1.00 28.10  ? 1   KN0 A CAM 1 
HETATM 7448 C CAN . KN0 E 3 .   ? 14.170  14.497  -23.986 1.00 32.39  ? 1   KN0 A CAN 1 
HETATM 7449 C CAO . KN0 E 3 .   ? 14.772  15.552  -23.320 1.00 30.87  ? 1   KN0 A CAO 1 
HETATM 7450 C CAP . KN0 E 3 .   ? 16.022  16.003  -23.716 1.00 33.83  ? 1   KN0 A CAP 1 
HETATM 7451 O OAQ . KN0 E 3 .   ? 16.553  17.049  -23.042 1.00 39.39  ? 1   KN0 A OAQ 1 
HETATM 7452 O OAR . KN0 E 3 .   ? 12.950  14.063  -23.555 1.00 23.94  ? 1   KN0 A OAR 1 
HETATM 7453 C CAS . KN0 E 3 .   ? 21.739  17.089  -23.935 1.00 45.24  ? 1   KN0 A CAS 1 
HETATM 7454 C CAT . KN0 E 3 .   ? 22.971  17.586  -23.523 1.00 33.70  ? 1   KN0 A CAT 1 
HETATM 7455 C CAU . KN0 E 3 .   ? 23.867  16.771  -22.843 1.00 41.82  ? 1   KN0 A CAU 1 
HETATM 7456 C CAV . KN0 E 3 .   ? 23.538  15.446  -22.577 1.00 51.48  ? 1   KN0 A CAV 1 
HETATM 7457 C CAW . KN0 E 3 .   ? 22.309  14.944  -22.990 1.00 50.70  ? 1   KN0 A CAW 1 
HETATM 7458 C CAX . KN0 E 3 .   ? 21.415  15.761  -23.671 1.00 46.78  ? 1   KN0 A CAX 1 
HETATM 7459 C CAY . KN0 E 3 .   ? 21.911  17.211  -27.502 1.00 49.00  ? 1   KN0 A CAY 1 
HETATM 7460 F FAZ . KN0 E 3 .   ? 22.581  16.952  -28.624 1.00 47.62  ? 1   KN0 A FAZ 1 
HETATM 7461 F FBA . KN0 E 3 .   ? 22.694  16.986  -26.457 1.00 44.89  ? 1   KN0 A FBA 1 
HETATM 7462 F FBB . KN0 E 3 .   ? 21.573  18.492  -27.515 1.00 41.07  ? 1   KN0 A FBB 1 
HETATM 7463 C CAA . KN0 F 3 .   ? 20.112  36.612  -62.113 1.00 50.52  ? 1   KN0 B CAA 1 
HETATM 7464 C CAB . KN0 F 3 .   ? 18.925  37.337  -62.039 1.00 51.91  ? 1   KN0 B CAB 1 
HETATM 7465 C CAC . KN0 F 3 .   ? 18.064  37.375  -63.128 1.00 46.55  ? 1   KN0 B CAC 1 
HETATM 7466 C CAD . KN0 F 3 .   ? 18.396  36.684  -64.287 1.00 41.50  ? 1   KN0 B CAD 1 
HETATM 7467 C CAE . KN0 F 3 .   ? 19.587  35.961  -64.367 1.00 39.72  ? 1   KN0 B CAE 1 
HETATM 7468 C CAF . KN0 F 3 .   ? 20.457  35.922  -63.274 1.00 40.86  ? 1   KN0 B CAF 1 
HETATM 7469 C CAG . KN0 F 3 .   ? 17.817  36.554  -65.543 1.00 34.15  ? 1   KN0 B CAG 1 
HETATM 7470 N NAH . KN0 F 3 .   ? 18.582  35.717  -66.239 1.00 39.82  ? 1   KN0 B NAH 1 
HETATM 7471 N NAI . KN0 F 3 .   ? 19.597  35.431  -65.595 1.00 41.77  ? 1   KN0 B NAI 1 
HETATM 7472 C CAJ . KN0 F 3 .   ? 16.565  37.035  -65.904 1.00 32.35  ? 1   KN0 B CAJ 1 
HETATM 7473 C CAK . KN0 F 3 .   ? 20.654  34.578  -66.164 1.00 37.48  ? 1   KN0 B CAK 1 
HETATM 7474 C CAL . KN0 F 3 .   ? 15.963  38.107  -65.246 1.00 29.45  ? 1   KN0 B CAL 1 
HETATM 7475 C CAM . KN0 F 3 .   ? 14.717  38.569  -65.674 1.00 32.27  ? 1   KN0 B CAM 1 
HETATM 7476 C CAN . KN0 F 3 .   ? 14.093  37.991  -66.778 1.00 32.87  ? 1   KN0 B CAN 1 
HETATM 7477 C CAO . KN0 F 3 .   ? 14.709  36.949  -67.449 1.00 34.77  ? 1   KN0 B CAO 1 
HETATM 7478 C CAP . KN0 F 3 .   ? 15.956  36.500  -67.037 1.00 39.07  ? 1   KN0 B CAP 1 
HETATM 7479 O OAQ . KN0 F 3 .   ? 16.524  35.460  -67.699 1.00 34.91  ? 1   KN0 B OAQ 1 
HETATM 7480 O OAR . KN0 F 3 .   ? 12.880  38.432  -67.214 1.00 31.46  ? 1   KN0 B OAR 1 
HETATM 7481 C CAS . KN0 F 3 .   ? 21.703  35.464  -66.859 1.00 35.81  ? 1   KN0 B CAS 1 
HETATM 7482 C CAT . KN0 F 3 .   ? 21.390  36.766  -67.244 1.00 37.08  ? 1   KN0 B CAT 1 
HETATM 7483 C CAU . KN0 F 3 .   ? 22.347  37.562  -67.866 1.00 40.87  ? 1   KN0 B CAU 1 
HETATM 7484 C CAV . KN0 F 3 .   ? 23.626  37.064  -68.100 1.00 47.82  ? 1   KN0 B CAV 1 
HETATM 7485 C CAW . KN0 F 3 .   ? 23.946  35.765  -67.709 1.00 44.37  ? 1   KN0 B CAW 1 
HETATM 7486 C CAX . KN0 F 3 .   ? 22.985  34.973  -67.089 1.00 41.09  ? 1   KN0 B CAX 1 
HETATM 7487 C CAY . KN0 F 3 .   ? 21.773  35.123  -63.298 1.00 44.55  ? 1   KN0 B CAY 1 
HETATM 7488 F FAZ . KN0 F 3 .   ? 22.378  35.220  -62.117 1.00 43.13  ? 1   KN0 B FAZ 1 
HETATM 7489 F FBA . KN0 F 3 .   ? 22.607  35.525  -64.249 1.00 48.47  ? 1   KN0 B FBA 1 
HETATM 7490 F FBB . KN0 F 3 .   ? 21.471  33.851  -63.514 1.00 51.29  ? 1   KN0 B FBB 1 
HETATM 7491 C CAA . KN0 G 3 .   ? 24.922  41.204  -35.114 1.00 49.45  ? 1   KN0 C CAA 1 
HETATM 7492 C CAB . KN0 G 3 .   ? 24.249  42.376  -34.788 1.00 52.72  ? 1   KN0 C CAB 1 
HETATM 7493 C CAC . KN0 G 3 .   ? 24.816  43.291  -33.904 1.00 50.53  ? 1   KN0 C CAC 1 
HETATM 7494 C CAD . KN0 G 3 .   ? 26.067  43.023  -33.356 1.00 49.03  ? 1   KN0 C CAD 1 
HETATM 7495 C CAE . KN0 G 3 .   ? 26.739  41.851  -33.679 1.00 49.31  ? 1   KN0 C CAE 1 
HETATM 7496 C CAF . KN0 G 3 .   ? 26.174  40.934  -34.565 1.00 49.40  ? 1   KN0 C CAF 1 
HETATM 7497 C CAG . KN0 G 3 .   ? 26.898  43.659  -32.440 1.00 47.53  ? 1   KN0 C CAG 1 
HETATM 7498 N NAH . KN0 G 3 .   ? 27.998  42.927  -32.344 1.00 45.65  ? 1   KN0 C NAH 1 
HETATM 7499 N NAI . KN0 G 3 .   ? 27.888  41.898  -33.008 1.00 48.03  ? 1   KN0 C NAI 1 
HETATM 7500 C CAJ . KN0 G 3 .   ? 26.693  44.916  -31.866 1.00 53.72  ? 1   KN0 C CAJ 1 
HETATM 7501 C CAK . KN0 G 3 .   ? 28.934  40.866  -33.028 1.00 55.21  ? 1   KN0 C CAK 1 
HETATM 7502 C CAL . KN0 G 3 .   ? 25.419  45.472  -31.751 1.00 45.18  ? 1   KN0 C CAL 1 
HETATM 7503 C CAM . KN0 G 3 .   ? 25.251  46.699  -31.114 1.00 39.31  ? 1   KN0 C CAM 1 
HETATM 7504 C CAN . KN0 G 3 .   ? 26.349  47.357  -30.560 1.00 42.03  ? 1   KN0 C CAN 1 
HETATM 7505 C CAO . KN0 G 3 .   ? 27.604  46.791  -30.634 1.00 47.13  ? 1   KN0 C CAO 1 
HETATM 7506 C CAP . KN0 G 3 .   ? 27.765  45.558  -31.244 1.00 57.25  ? 1   KN0 C CAP 1 
HETATM 7507 O OAQ . KN0 G 3 .   ? 29.021  45.042  -31.314 1.00 63.19  ? 1   KN0 C OAQ 1 
HETATM 7508 O OAR . KN0 G 3 .   ? 26.209  48.554  -29.932 1.00 45.25  ? 1   KN0 C OAR 1 
HETATM 7509 C CAS . KN0 G 3 .   ? 30.304  41.519  -32.873 1.00 53.13  ? 1   KN0 C CAS 1 
HETATM 7510 C CAT . KN0 G 3 .   ? 30.819  41.784  -31.611 1.00 54.02  ? 1   KN0 C CAT 1 
HETATM 7511 C CAU . KN0 G 3 .   ? 32.069  42.375  -31.495 1.00 60.99  ? 1   KN0 C CAU 1 
HETATM 7512 C CAV . KN0 G 3 .   ? 32.791  42.696  -32.641 1.00 67.56  ? 1   KN0 C CAV 1 
HETATM 7513 C CAW . KN0 G 3 .   ? 32.274  42.424  -33.901 1.00 64.22  ? 1   KN0 C CAW 1 
HETATM 7514 C CAX . KN0 G 3 .   ? 31.023  41.836  -34.016 1.00 54.74  ? 1   KN0 C CAX 1 
HETATM 7515 C CAY . KN0 G 3 .   ? 26.900  39.623  -34.947 1.00 57.68  ? 1   KN0 C CAY 1 
HETATM 7516 F FAZ . KN0 G 3 .   ? 26.078  38.880  -35.686 1.00 68.01  ? 1   KN0 C FAZ 1 
HETATM 7517 F FBA . KN0 G 3 .   ? 27.247  38.946  -33.852 1.00 54.49  ? 1   KN0 C FBA 1 
HETATM 7518 F FBB . KN0 G 3 .   ? 28.007  39.868  -35.649 1.00 50.44  ? 1   KN0 C FBB 1 
HETATM 7519 C CAA . KN0 H 3 .   ? 25.101  11.357  -55.650 1.00 43.88  ? 1   KN0 D CAA 1 
HETATM 7520 C CAB . KN0 H 3 .   ? 24.446  10.176  -55.971 1.00 43.81  ? 1   KN0 D CAB 1 
HETATM 7521 C CAC . KN0 H 3 .   ? 25.020  9.273   -56.858 1.00 36.31  ? 1   KN0 D CAC 1 
HETATM 7522 C CAD . KN0 H 3 .   ? 26.256  9.558   -57.418 1.00 39.09  ? 1   KN0 D CAD 1 
HETATM 7523 C CAE . KN0 H 3 .   ? 26.920  10.739  -57.099 1.00 45.80  ? 1   KN0 D CAE 1 
HETATM 7524 C CAF . KN0 H 3 .   ? 26.346  11.645  -56.202 1.00 46.56  ? 1   KN0 D CAF 1 
HETATM 7525 C CAG . KN0 H 3 .   ? 27.077  8.920   -58.341 1.00 46.21  ? 1   KN0 D CAG 1 
HETATM 7526 N NAH . KN0 H 3 .   ? 28.175  9.662   -58.448 1.00 50.69  ? 1   KN0 D NAH 1 
HETATM 7527 N NAI . KN0 H 3 .   ? 28.064  10.697  -57.786 1.00 42.35  ? 1   KN0 D NAI 1 
HETATM 7528 C CAJ . KN0 H 3 .   ? 26.846  7.657   -58.896 1.00 53.23  ? 1   KN0 D CAJ 1 
HETATM 7529 C CAK . KN0 H 3 .   ? 29.106  11.725  -57.780 1.00 44.30  ? 1   KN0 D CAK 1 
HETATM 7530 C CAL . KN0 H 3 .   ? 25.557  7.134   -58.979 1.00 46.75  ? 1   KN0 D CAL 1 
HETATM 7531 C CAM . KN0 H 3 .   ? 25.335  5.901   -59.592 1.00 49.06  ? 1   KN0 D CAM 1 
HETATM 7532 C CAN . KN0 H 3 .   ? 26.394  5.200   -60.159 1.00 47.92  ? 1   KN0 D CAN 1 
HETATM 7533 C CAO . KN0 H 3 .   ? 27.669  5.733   -60.119 1.00 52.64  ? 1   KN0 D CAO 1 
HETATM 7534 C CAP . KN0 H 3 .   ? 27.885  6.975   -59.532 1.00 59.92  ? 1   KN0 D CAP 1 
HETATM 7535 O OAQ . KN0 H 3 .   ? 29.154  7.455   -59.491 1.00 65.72  ? 1   KN0 D OAQ 1 
HETATM 7536 O OAR . KN0 H 3 .   ? 26.196  4.000   -60.764 1.00 49.95  ? 1   KN0 D OAR 1 
HETATM 7537 C CAS . KN0 H 3 .   ? 30.451  11.011  -57.882 1.00 47.15  ? 1   KN0 D CAS 1 
HETATM 7538 C CAT . KN0 H 3 .   ? 30.973  10.631  -59.113 1.00 40.91  ? 1   KN0 D CAT 1 
HETATM 7539 C CAU . KN0 H 3 .   ? 32.202  9.983   -59.159 1.00 44.01  ? 1   KN0 D CAU 1 
HETATM 7540 C CAV . KN0 H 3 .   ? 32.898  9.710   -57.984 1.00 42.44  ? 1   KN0 D CAV 1 
HETATM 7541 C CAW . KN0 H 3 .   ? 32.367  10.086  -56.758 1.00 46.36  ? 1   KN0 D CAW 1 
HETATM 7542 C CAX . KN0 H 3 .   ? 31.140  10.734  -56.707 1.00 47.43  ? 1   KN0 D CAX 1 
HETATM 7543 C CAY . KN0 H 3 .   ? 27.033  12.972  -55.807 1.00 56.50  ? 1   KN0 D CAY 1 
HETATM 7544 F FAZ . KN0 H 3 .   ? 26.311  13.555  -54.850 1.00 61.51  ? 1   KN0 D FAZ 1 
HETATM 7545 F FBA . KN0 H 3 .   ? 27.098  13.780  -56.864 1.00 50.07  ? 1   KN0 D FBA 1 
HETATM 7546 F FBB . KN0 H 3 .   ? 28.271  12.773  -55.343 1.00 52.16  ? 1   KN0 D FBB 1 
HETATM 7547 O O   . HOH I 4 .   ? -5.041  24.672  -30.357 1.00 47.47  ? 21  HOH A O   1 
HETATM 7548 O O   . HOH I 4 .   ? 0.404   20.522  -21.127 1.00 26.91  ? 30  HOH A O   1 
HETATM 7549 O O   . HOH I 4 .   ? -0.082  11.516  -27.870 1.00 38.39  ? 33  HOH A O   1 
HETATM 7550 O O   . HOH I 4 .   ? 8.333   17.523  -23.088 1.00 34.27  ? 34  HOH A O   1 
HETATM 7551 O O   . HOH I 4 .   ? 10.404  31.378  -24.840 1.00 34.53  ? 35  HOH A O   1 
HETATM 7552 O O   . HOH I 4 .   ? 25.931  14.093  -12.028 1.00 37.58  ? 36  HOH A O   1 
HETATM 7553 O O   . HOH I 4 .   ? 8.923   11.199  -22.135 1.00 32.83  ? 46  HOH A O   1 
HETATM 7554 O O   . HOH I 4 .   ? -12.999 34.558  -20.149 1.00 41.36  ? 48  HOH A O   1 
HETATM 7555 O O   . HOH I 4 .   ? -0.909  8.939   -27.510 1.00 41.58  ? 54  HOH A O   1 
HETATM 7556 O O   . HOH I 4 .   ? 11.005  10.072  -21.083 1.00 28.57  ? 58  HOH A O   1 
HETATM 7557 O O   . HOH I 4 .   ? 6.641   17.338  -25.436 1.00 32.80  ? 60  HOH A O   1 
HETATM 7558 O O   . HOH I 4 .   ? 10.587  15.582  -22.712 1.00 36.88  ? 62  HOH A O   1 
HETATM 7559 O O   . HOH I 4 .   ? 27.426  28.503  -22.608 1.00 43.91  ? 67  HOH A O   1 
HETATM 7560 O O   . HOH I 4 .   ? 11.554  33.962  -32.321 1.00 54.41  ? 80  HOH A O   1 
HETATM 7561 O O   . HOH I 4 .   ? 8.139   28.783  -30.571 1.00 35.79  ? 89  HOH A O   1 
HETATM 7562 O O   . HOH I 4 .   ? 6.899   17.480  -20.808 1.00 33.32  ? 90  HOH A O   1 
HETATM 7563 O O   . HOH I 4 .   ? 4.721   18.723  -24.507 1.00 33.45  ? 93  HOH A O   1 
HETATM 7564 O O   . HOH I 4 .   ? 12.368  30.344  -23.314 1.00 40.77  ? 94  HOH A O   1 
HETATM 7565 O O   . HOH I 4 .   ? -5.695  37.852  -23.193 1.00 36.63  ? 96  HOH A O   1 
HETATM 7566 O O   . HOH I 4 .   ? 17.921  16.654  -11.248 1.00 38.65  ? 97  HOH A O   1 
HETATM 7567 O O   . HOH I 4 .   ? 1.536   38.650  -20.449 1.00 39.37  ? 100 HOH A O   1 
HETATM 7568 O O   . HOH I 4 .   ? 14.193  24.758  -29.157 1.00 36.74  ? 106 HOH A O   1 
HETATM 7569 O O   . HOH I 4 .   ? 28.185  27.926  -28.543 1.00 47.58  ? 109 HOH A O   1 
HETATM 7570 O O   . HOH I 4 .   ? 7.370   14.899  -19.039 1.00 48.28  ? 110 HOH A O   1 
HETATM 7571 O O   . HOH I 4 .   ? 9.041   31.747  -5.623  1.00 57.42  ? 118 HOH A O   1 
HETATM 7572 O O   . HOH I 4 .   ? 15.892  5.571   -27.214 1.00 40.36  ? 122 HOH A O   1 
HETATM 7573 O O   . HOH I 4 .   ? 27.010  23.268  -28.189 1.00 45.54  ? 126 HOH A O   1 
HETATM 7574 O O   . HOH I 4 .   ? 7.393   4.941   -27.970 1.00 16.16  ? 129 HOH A O   1 
HETATM 7575 O O   . HOH I 4 .   ? -8.013  36.197  -17.665 1.00 50.92  ? 132 HOH A O   1 
HETATM 7576 O O   . HOH I 4 .   ? 5.040   6.457   -29.652 1.00 27.97  ? 133 HOH A O   1 
HETATM 7577 O O   . HOH I 4 .   ? 13.954  29.409  -34.336 1.00 40.94  ? 135 HOH A O   1 
HETATM 7578 O O   . HOH I 4 .   ? 6.211   14.799  -26.348 1.00 36.41  ? 143 HOH A O   1 
HETATM 7579 O O   . HOH I 4 .   ? 7.089   13.121  -21.194 1.00 39.77  ? 151 HOH A O   1 
HETATM 7580 O O   . HOH I 4 .   ? 19.592  18.325  -9.821  1.00 52.46  ? 154 HOH A O   1 
HETATM 7581 O O   . HOH I 4 .   ? -5.230  34.566  -36.907 1.00 46.55  ? 162 HOH A O   1 
HETATM 7582 O O   . HOH I 4 .   ? -16.210 33.527  -21.772 1.00 41.69  ? 165 HOH A O   1 
HETATM 7583 O O   . HOH I 4 .   ? 30.583  26.844  -28.047 1.00 53.48  ? 167 HOH A O   1 
HETATM 7584 O O   . HOH I 4 .   ? -9.374  20.082  -27.277 1.00 46.93  ? 170 HOH A O   1 
HETATM 7585 O O   . HOH I 4 .   ? 6.200   7.941   -31.366 1.00 41.70  ? 171 HOH A O   1 
HETATM 7586 O O   . HOH I 4 .   ? 25.016  21.645  -12.241 1.00 41.15  ? 176 HOH A O   1 
HETATM 7587 O O   . HOH I 4 .   ? 23.211  21.168  -10.018 1.00 58.60  ? 177 HOH A O   1 
HETATM 7588 O O   . HOH I 4 .   ? 17.202  26.814  -30.054 1.00 44.39  ? 181 HOH A O   1 
HETATM 7589 O O   . HOH I 4 .   ? -3.990  14.081  -26.974 1.00 39.78  ? 183 HOH A O   1 
HETATM 7590 O O   . HOH I 4 .   ? -4.733  40.488  -23.368 1.00 47.15  ? 184 HOH A O   1 
HETATM 7591 O O   . HOH I 4 .   ? -5.172  24.459  -38.028 1.00 53.78  ? 186 HOH A O   1 
HETATM 7592 O O   . HOH I 4 .   ? 2.498   19.542  -8.510  1.00 51.36  ? 192 HOH A O   1 
HETATM 7593 O O   . HOH I 4 .   ? -8.131  22.378  -25.465 1.00 63.36  ? 194 HOH A O   1 
HETATM 7594 O O   . HOH I 4 .   ? 4.679   6.187   -19.219 1.00 44.00  ? 195 HOH A O   1 
HETATM 7595 O O   . HOH I 4 .   ? -4.089  40.595  -10.141 1.00 47.26  ? 197 HOH A O   1 
HETATM 7596 O O   . HOH I 4 .   ? 5.258   39.930  0.616   1.00 53.25  ? 198 HOH A O   1 
HETATM 7597 O O   . HOH I 4 .   ? 0.616   13.970  -26.659 1.00 34.58  ? 203 HOH A O   1 
HETATM 7598 O O   . HOH I 4 .   ? -10.992 31.206  -12.964 1.00 50.00  ? 205 HOH A O   1 
HETATM 7599 O O   . HOH I 4 .   ? -1.584  15.020  -25.848 1.00 48.41  ? 209 HOH A O   1 
HETATM 7600 O O   . HOH I 4 .   ? -3.658  38.510  -8.511  1.00 41.21  ? 216 HOH A O   1 
HETATM 7601 O O   . HOH I 4 .   ? -10.362 33.274  -14.436 1.00 59.28  ? 217 HOH A O   1 
HETATM 7602 O O   . HOH I 4 .   ? 10.489  9.951   -10.676 1.00 63.27  ? 228 HOH A O   1 
HETATM 7603 O O   . HOH I 4 .   ? 7.795   34.721  -4.444  1.00 48.14  ? 231 HOH A O   1 
HETATM 7604 O O   . HOH I 4 .   ? 29.828  22.957  -16.508 1.00 53.22  ? 235 HOH A O   1 
HETATM 7605 O O   . HOH I 4 .   ? -4.028  16.225  -30.667 1.00 47.92  ? 253 HOH A O   1 
HETATM 7606 O O   . HOH I 4 .   ? 0.046   27.979  -43.920 1.00 48.92  ? 256 HOH A O   1 
HETATM 7607 O O   . HOH J 4 .   ? 8.428   34.680  -67.625 1.00 27.89  ? 3   HOH B O   1 
HETATM 7608 O O   . HOH J 4 .   ? -0.120  40.680  -62.758 1.00 30.81  ? 6   HOH B O   1 
HETATM 7609 O O   . HOH J 4 .   ? -14.409 24.090  -75.589 1.00 48.44  ? 7   HOH B O   1 
HETATM 7610 O O   . HOH J 4 .   ? 19.021  48.085  -74.716 1.00 47.98  ? 11  HOH B O   1 
HETATM 7611 O O   . HOH J 4 .   ? -5.631  14.619  -67.216 1.00 42.12  ? 12  HOH B O   1 
HETATM 7612 O O   . HOH J 4 .   ? 11.435  51.414  -65.558 1.00 30.80  ? 13  HOH B O   1 
HETATM 7613 O O   . HOH J 4 .   ? 8.225   23.717  -60.061 1.00 31.57  ? 15  HOH B O   1 
HETATM 7614 O O   . HOH J 4 .   ? 6.097   37.531  -64.635 1.00 36.11  ? 28  HOH B O   1 
HETATM 7615 O O   . HOH J 4 .   ? 8.778   41.125  -68.344 1.00 30.96  ? 32  HOH B O   1 
HETATM 7616 O O   . HOH J 4 .   ? 18.650  50.353  -70.176 1.00 52.07  ? 37  HOH B O   1 
HETATM 7617 O O   . HOH J 4 .   ? 6.733   34.937  -69.624 1.00 31.76  ? 38  HOH B O   1 
HETATM 7618 O O   . HOH J 4 .   ? 14.053  27.780  -61.461 1.00 29.22  ? 42  HOH B O   1 
HETATM 7619 O O   . HOH J 4 .   ? -3.770  13.823  -82.421 1.00 34.69  ? 43  HOH B O   1 
HETATM 7620 O O   . HOH J 4 .   ? -5.256  27.841  -60.436 1.00 39.63  ? 44  HOH B O   1 
HETATM 7621 O O   . HOH J 4 .   ? 10.802  42.347  -69.631 1.00 33.80  ? 47  HOH B O   1 
HETATM 7622 O O   . HOH J 4 .   ? 17.897  35.697  -79.244 1.00 35.50  ? 52  HOH B O   1 
HETATM 7623 O O   . HOH J 4 .   ? 10.346  21.082  -65.816 1.00 40.25  ? 53  HOH B O   1 
HETATM 7624 O O   . HOH J 4 .   ? 25.819  38.277  -78.804 1.00 38.10  ? 59  HOH B O   1 
HETATM 7625 O O   . HOH J 4 .   ? -12.930 18.030  -70.818 1.00 35.29  ? 61  HOH B O   1 
HETATM 7626 O O   . HOH J 4 .   ? 7.057   39.299  -69.342 1.00 36.53  ? 66  HOH B O   1 
HETATM 7627 O O   . HOH J 4 .   ? 0.136   31.796  -69.497 1.00 29.35  ? 68  HOH B O   1 
HETATM 7628 O O   . HOH J 4 .   ? 17.120  25.691  -60.514 1.00 40.92  ? 69  HOH B O   1 
HETATM 7629 O O   . HOH J 4 .   ? 15.767  46.798  -63.303 1.00 26.68  ? 71  HOH B O   1 
HETATM 7630 O O   . HOH J 4 .   ? 4.692   33.711  -66.434 1.00 28.88  ? 78  HOH B O   1 
HETATM 7631 O O   . HOH J 4 .   ? 7.528   37.300  -71.566 1.00 41.06  ? 81  HOH B O   1 
HETATM 7632 O O   . HOH J 4 .   ? 12.353  22.166  -67.201 1.00 45.93  ? 86  HOH B O   1 
HETATM 7633 O O   . HOH J 4 .   ? -6.104  14.402  -69.690 1.00 46.26  ? 87  HOH B O   1 
HETATM 7634 O O   . HOH J 4 .   ? 0.518   38.444  -64.082 1.00 26.08  ? 92  HOH B O   1 
HETATM 7635 O O   . HOH J 4 .   ? 6.725   35.069  -65.506 1.00 29.84  ? 95  HOH B O   1 
HETATM 7636 O O   . HOH J 4 .   ? -5.379  16.127  -77.490 1.00 33.79  ? 103 HOH B O   1 
HETATM 7637 O O   . HOH J 4 .   ? -1.573  11.645  -89.133 1.00 47.88  ? 104 HOH B O   1 
HETATM 7638 O O   . HOH J 4 .   ? 1.578   13.759  -70.216 1.00 34.37  ? 107 HOH B O   1 
HETATM 7639 O O   . HOH J 4 .   ? -1.478  36.933  -64.585 1.00 34.42  ? 108 HOH B O   1 
HETATM 7640 O O   . HOH J 4 .   ? -3.342  17.127  -88.298 1.00 34.69  ? 112 HOH B O   1 
HETATM 7641 O O   . HOH J 4 .   ? -1.880  36.361  -74.343 1.00 43.50  ? 114 HOH B O   1 
HETATM 7642 O O   . HOH J 4 .   ? -5.161  28.023  -52.747 1.00 52.24  ? 124 HOH B O   1 
HETATM 7643 O O   . HOH J 4 .   ? 7.378   47.486  -62.894 1.00 16.75  ? 128 HOH B O   1 
HETATM 7644 O O   . HOH J 4 .   ? 13.884  22.912  -56.307 1.00 33.53  ? 130 HOH B O   1 
HETATM 7645 O O   . HOH J 4 .   ? 7.909   48.142  -65.620 1.00 22.62  ? 131 HOH B O   1 
HETATM 7646 O O   . HOH J 4 .   ? -8.019  15.919  -72.898 1.00 40.87  ? 138 HOH B O   1 
HETATM 7647 O O   . HOH J 4 .   ? 5.149   45.980  -61.351 1.00 27.27  ? 141 HOH B O   1 
HETATM 7648 O O   . HOH J 4 .   ? 8.001   20.464  -86.006 1.00 37.32  ? 142 HOH B O   1 
HETATM 7649 O O   . HOH J 4 .   ? 10.535  36.965  -67.923 1.00 34.42  ? 145 HOH B O   1 
HETATM 7650 O O   . HOH J 4 .   ? 8.746   50.862  -66.071 1.00 27.22  ? 147 HOH B O   1 
HETATM 7651 O O   . HOH J 4 .   ? -6.497  34.818  -59.592 1.00 47.18  ? 149 HOH B O   1 
HETATM 7652 O O   . HOH J 4 .   ? 9.361   16.392  -86.522 1.00 43.91  ? 160 HOH B O   1 
HETATM 7653 O O   . HOH J 4 .   ? 6.764   12.737  -65.374 1.00 52.30  ? 161 HOH B O   1 
HETATM 7654 O O   . HOH J 4 .   ? -8.585  28.301  -77.595 1.00 40.51  ? 164 HOH B O   1 
HETATM 7655 O O   . HOH J 4 .   ? 10.626  11.726  -89.736 1.00 51.24  ? 169 HOH B O   1 
HETATM 7656 O O   . HOH J 4 .   ? 4.470   46.281  -71.483 1.00 43.44  ? 174 HOH B O   1 
HETATM 7657 O O   . HOH J 4 .   ? -2.984  38.429  -68.809 1.00 45.35  ? 178 HOH B O   1 
HETATM 7658 O O   . HOH J 4 .   ? 1.036   20.382  -48.021 1.00 46.60  ? 180 HOH B O   1 
HETATM 7659 O O   . HOH J 4 .   ? 6.074   44.418  -59.408 1.00 33.61  ? 187 HOH B O   1 
HETATM 7660 O O   . HOH J 4 .   ? -4.605  11.304  -67.225 1.00 59.29  ? 188 HOH B O   1 
HETATM 7661 O O   . HOH J 4 .   ? -7.438  26.483  -61.132 1.00 40.53  ? 189 HOH B O   1 
HETATM 7662 O O   . HOH J 4 .   ? -3.901  38.126  -63.789 1.00 41.67  ? 191 HOH B O   1 
HETATM 7663 O O   . HOH J 4 .   ? 19.697  34.031  -81.023 1.00 48.44  ? 202 HOH B O   1 
HETATM 7664 O O   . HOH J 4 .   ? 21.415  47.714  -75.067 1.00 45.63  ? 204 HOH B O   1 
HETATM 7665 O O   . HOH J 4 .   ? -4.152  36.070  -60.155 1.00 41.87  ? 211 HOH B O   1 
HETATM 7666 O O   . HOH J 4 .   ? 1.803   9.918   -89.030 1.00 44.68  ? 214 HOH B O   1 
HETATM 7667 O O   . HOH J 4 .   ? 3.505   15.103  -68.560 1.00 42.47  ? 219 HOH B O   1 
HETATM 7668 O O   . HOH J 4 .   ? -7.567  30.309  -64.677 1.00 47.57  ? 222 HOH B O   1 
HETATM 7669 O O   . HOH J 4 .   ? -4.286  13.946  -85.758 1.00 46.71  ? 224 HOH B O   1 
HETATM 7670 O O   . HOH J 4 .   ? 2.920   17.601  -69.685 1.00 45.62  ? 225 HOH B O   1 
HETATM 7671 O O   . HOH J 4 .   ? 1.051   17.327  -92.577 1.00 51.34  ? 226 HOH B O   1 
HETATM 7672 O O   . HOH J 4 .   ? -7.495  13.119  -65.407 1.00 51.09  ? 229 HOH B O   1 
HETATM 7673 O O   . HOH J 4 .   ? 10.377  29.056  -43.333 1.00 53.00  ? 230 HOH B O   1 
HETATM 7674 O O   . HOH J 4 .   ? 17.558  43.067  -82.172 1.00 52.83  ? 234 HOH B O   1 
HETATM 7675 O O   . HOH J 4 .   ? 3.220   10.202  -91.372 1.00 54.85  ? 239 HOH B O   1 
HETATM 7676 O O   . HOH J 4 .   ? 31.326  38.021  -78.979 1.00 47.90  ? 241 HOH B O   1 
HETATM 7677 O O   . HOH J 4 .   ? -1.013  43.580  -62.370 1.00 38.47  ? 249 HOH B O   1 
HETATM 7678 O O   . HOH J 4 .   ? 27.395  23.690  -68.047 1.00 47.76  ? 255 HOH B O   1 
HETATM 7679 O O   . HOH J 4 .   ? -3.404  42.352  -51.560 1.00 59.10  ? 257 HOH B O   1 
HETATM 7680 O O   . HOH J 4 .   ? 16.585  33.681  -49.394 1.00 54.40  ? 263 HOH B O   1 
HETATM 7681 O O   . HOH J 4 .   ? 25.111  30.480  -78.877 1.00 48.16  ? 265 HOH B O   1 
HETATM 7682 O O   . HOH J 4 .   ? 13.874  29.748  -48.213 1.00 44.24  ? 266 HOH B O   1 
HETATM 7683 O O   . HOH K 4 .   ? 14.265  49.504  -35.702 1.00 29.16  ? 9   HOH C O   1 
HETATM 7684 O O   . HOH K 4 .   ? 9.343   54.257  -4.998  1.00 40.89  ? 10  HOH C O   1 
HETATM 7685 O O   . HOH K 4 .   ? 25.033  37.487  -16.683 1.00 29.70  ? 14  HOH C O   1 
HETATM 7686 O O   . HOH K 4 .   ? 11.567  38.261  -9.288  1.00 33.81  ? 16  HOH C O   1 
HETATM 7687 O O   . HOH K 4 .   ? 25.899  37.786  -24.362 1.00 32.54  ? 17  HOH C O   1 
HETATM 7688 O O   . HOH K 4 .   ? 18.701  36.947  -18.999 1.00 43.47  ? 18  HOH C O   1 
HETATM 7689 O O   . HOH K 4 .   ? 10.997  57.037  -22.223 1.00 44.93  ? 22  HOH C O   1 
HETATM 7690 O O   . HOH K 4 .   ? 23.892  55.466  -10.333 1.00 49.17  ? 25  HOH C O   1 
HETATM 7691 O O   . HOH K 4 .   ? 6.640   39.859  -25.129 1.00 41.83  ? 26  HOH C O   1 
HETATM 7692 O O   . HOH K 4 .   ? 34.521  56.445  -25.091 1.00 28.75  ? 31  HOH C O   1 
HETATM 7693 O O   . HOH K 4 .   ? 37.099  37.020  -6.903  1.00 49.83  ? 39  HOH C O   1 
HETATM 7694 O O   . HOH K 4 .   ? 21.087  51.781  -16.728 1.00 34.26  ? 49  HOH C O   1 
HETATM 7695 O O   . HOH K 4 .   ? 14.850  32.731  -11.829 1.00 33.84  ? 50  HOH C O   1 
HETATM 7696 O O   . HOH K 4 .   ? 24.057  31.027  -16.795 1.00 35.85  ? 51  HOH C O   1 
HETATM 7697 O O   . HOH K 4 .   ? 18.131  37.249  -21.567 1.00 36.84  ? 56  HOH C O   1 
HETATM 7698 O O   . HOH K 4 .   ? 14.953  34.981  -10.644 1.00 54.55  ? 64  HOH C O   1 
HETATM 7699 O O   . HOH K 4 .   ? 27.031  47.997  -7.862  1.00 33.66  ? 65  HOH C O   1 
HETATM 7700 O O   . HOH K 4 .   ? 25.020  49.450  -20.508 1.00 31.39  ? 72  HOH C O   1 
HETATM 7701 O O   . HOH K 4 .   ? 22.577  50.399  -23.672 1.00 27.02  ? 73  HOH C O   1 
HETATM 7702 O O   . HOH K 4 .   ? 24.752  49.052  -27.542 1.00 28.23  ? 75  HOH C O   1 
HETATM 7703 O O   . HOH K 4 .   ? 35.529  53.703  -24.758 1.00 35.65  ? 77  HOH C O   1 
HETATM 7704 O O   . HOH K 4 .   ? 9.221   51.335  -3.576  1.00 46.31  ? 84  HOH C O   1 
HETATM 7705 O O   . HOH K 4 .   ? 32.193  27.865  -5.935  1.00 41.10  ? 85  HOH C O   1 
HETATM 7706 O O   . HOH K 4 .   ? 26.790  53.344  -28.030 1.00 27.10  ? 88  HOH C O   1 
HETATM 7707 O O   . HOH K 4 .   ? 20.693  49.100  -16.793 1.00 45.19  ? 98  HOH C O   1 
HETATM 7708 O O   . HOH K 4 .   ? 32.734  29.790  1.268   1.00 41.83  ? 101 HOH C O   1 
HETATM 7709 O O   . HOH K 4 .   ? 33.751  33.769  -6.458  1.00 50.09  ? 102 HOH C O   1 
HETATM 7710 O O   . HOH K 4 .   ? 38.308  53.131  -25.220 1.00 42.11  ? 113 HOH C O   1 
HETATM 7711 O O   . HOH K 4 .   ? 24.804  34.067  -25.356 1.00 43.71  ? 116 HOH C O   1 
HETATM 7712 O O   . HOH K 4 .   ? 24.360  48.796  -24.648 1.00 33.08  ? 120 HOH C O   1 
HETATM 7713 O O   . HOH K 4 .   ? 24.828  53.414  -25.590 1.00 41.10  ? 121 HOH C O   1 
HETATM 7714 O O   . HOH K 4 .   ? 26.133  48.997  -22.688 1.00 27.29  ? 123 HOH C O   1 
HETATM 7715 O O   . HOH K 4 .   ? -5.572  54.027  -13.635 1.00 54.04  ? 125 HOH C O   1 
HETATM 7716 O O   . HOH K 4 .   ? 25.963  53.865  -30.665 1.00 42.78  ? 146 HOH C O   1 
HETATM 7717 O O   . HOH K 4 .   ? 31.255  39.376  -2.104  1.00 46.63  ? 148 HOH C O   1 
HETATM 7718 O O   . HOH K 4 .   ? 10.407  46.263  -2.767  1.00 50.75  ? 153 HOH C O   1 
HETATM 7719 O O   . HOH K 4 .   ? 12.464  34.992  -20.617 1.00 37.02  ? 155 HOH C O   1 
HETATM 7720 O O   . HOH K 4 .   ? 1.165   46.971  -7.894  1.00 44.60  ? 156 HOH C O   1 
HETATM 7721 O O   . HOH K 4 .   ? 14.360  41.227  -2.510  1.00 47.11  ? 158 HOH C O   1 
HETATM 7722 O O   . HOH K 4 .   ? 27.016  51.076  -25.086 1.00 50.01  ? 168 HOH C O   1 
HETATM 7723 O O   . HOH K 4 .   ? 28.428  50.541  -22.959 1.00 42.48  ? 173 HOH C O   1 
HETATM 7724 O O   . HOH K 4 .   ? 33.708  44.942  -6.356  1.00 53.52  ? 175 HOH C O   1 
HETATM 7725 O O   . HOH K 4 .   ? 24.481  53.418  -8.275  1.00 44.79  ? 179 HOH C O   1 
HETATM 7726 O O   . HOH K 4 .   ? 32.907  51.787  -35.513 1.00 48.20  ? 185 HOH C O   1 
HETATM 7727 O O   . HOH K 4 .   ? 3.550   48.503  -6.901  1.00 46.24  ? 193 HOH C O   1 
HETATM 7728 O O   . HOH K 4 .   ? 34.790  45.704  -9.556  1.00 47.35  ? 196 HOH C O   1 
HETATM 7729 O O   . HOH K 4 .   ? 18.557  40.104  3.183   1.00 62.41  ? 199 HOH C O   1 
HETATM 7730 O O   . HOH K 4 .   ? 27.259  38.826  -0.918  1.00 44.54  ? 200 HOH C O   1 
HETATM 7731 O O   . HOH K 4 .   ? 25.034  62.937  -36.001 1.00 44.31  ? 206 HOH C O   1 
HETATM 7732 O O   . HOH K 4 .   ? 25.739  40.478  0.138   1.00 53.96  ? 208 HOH C O   1 
HETATM 7733 O O   . HOH K 4 .   ? 21.798  29.937  -3.387  1.00 48.33  ? 212 HOH C O   1 
HETATM 7734 O O   . HOH K 4 .   ? 13.308  38.656  -2.233  1.00 54.99  ? 213 HOH C O   1 
HETATM 7735 O O   . HOH K 4 .   ? 32.397  26.950  1.544   1.00 49.57  ? 215 HOH C O   1 
HETATM 7736 O O   . HOH K 4 .   ? 27.257  33.602  -24.170 1.00 45.08  ? 218 HOH C O   1 
HETATM 7737 O O   . HOH K 4 .   ? 31.682  44.413  -46.936 1.00 60.33  ? 232 HOH C O   1 
HETATM 7738 O O   . HOH K 4 .   ? 13.319  59.494  -38.581 1.00 61.11  ? 237 HOH C O   1 
HETATM 7739 O O   . HOH K 4 .   ? 30.235  44.332  -44.445 1.00 62.34  ? 242 HOH C O   1 
HETATM 7740 O O   . HOH K 4 .   ? 39.413  51.032  -27.317 1.00 43.60  ? 243 HOH C O   1 
HETATM 7741 O O   . HOH K 4 .   ? -0.598  45.444  -20.318 1.00 43.81  ? 247 HOH C O   1 
HETATM 7742 O O   . HOH K 4 .   ? 39.339  48.632  -31.611 1.00 49.58  ? 248 HOH C O   1 
HETATM 7743 O O   . HOH K 4 .   ? 26.458  26.400  -35.519 1.00 48.31  ? 251 HOH C O   1 
HETATM 7744 O O   . HOH K 4 .   ? 22.464  62.852  -35.626 1.00 55.51  ? 254 HOH C O   1 
HETATM 7745 O O   . HOH K 4 .   ? -6.955  43.915  -12.395 1.00 45.63  ? 258 HOH C O   1 
HETATM 7746 O O   . HOH K 4 .   ? 30.275  57.054  -45.398 1.00 52.48  ? 259 HOH C O   1 
HETATM 7747 O O   . HOH K 4 .   ? 19.632  32.687  -37.572 1.00 55.98  ? 262 HOH C O   1 
HETATM 7748 O O   . HOH K 4 .   ? 13.387  37.650  -11.182 1.00 44.96  ? 267 HOH C O   1 
HETATM 7749 O O   . HOH L 4 .   ? 11.209  -4.581  -68.684 1.00 37.45  ? 2   HOH D O   1 
HETATM 7750 O O   . HOH L 4 .   ? 27.178  4.794   -82.922 1.00 32.07  ? 4   HOH D O   1 
HETATM 7751 O O   . HOH L 4 .   ? 21.308  0.623   -74.161 1.00 28.20  ? 5   HOH D O   1 
HETATM 7752 O O   . HOH L 4 .   ? 11.441  14.069  -81.579 1.00 27.45  ? 8   HOH D O   1 
HETATM 7753 O O   . HOH L 4 .   ? 26.744  -0.993  -62.766 1.00 28.86  ? 19  HOH D O   1 
HETATM 7754 O O   . HOH L 4 .   ? 25.249  2.960   -70.429 1.00 36.41  ? 20  HOH D O   1 
HETATM 7755 O O   . HOH L 4 .   ? 39.526  13.408  -65.621 1.00 49.81  ? 23  HOH D O   1 
HETATM 7756 O O   . HOH L 4 .   ? 35.210  21.327  -72.777 1.00 50.56  ? 24  HOH D O   1 
HETATM 7757 O O   . HOH L 4 .   ? 14.181  2.914   -54.907 1.00 33.21  ? 27  HOH D O   1 
HETATM 7758 O O   . HOH L 4 .   ? 24.923  15.111  -73.931 1.00 35.39  ? 29  HOH D O   1 
HETATM 7759 O O   . HOH L 4 .   ? 25.817  14.608  -66.626 1.00 40.99  ? 40  HOH D O   1 
HETATM 7760 O O   . HOH L 4 .   ? 12.061  9.631   -88.215 1.00 41.48  ? 41  HOH D O   1 
HETATM 7761 O O   . HOH L 4 .   ? 26.167  -1.311  -60.086 1.00 35.33  ? 45  HOH D O   1 
HETATM 7762 O O   . HOH L 4 .   ? 14.959  19.673  -79.129 1.00 36.16  ? 55  HOH D O   1 
HETATM 7763 O O   . HOH L 4 .   ? 24.459  -2.776  -80.612 1.00 55.08  ? 57  HOH D O   1 
HETATM 7764 O O   . HOH L 4 .   ? 28.427  1.859   -67.578 1.00 36.04  ? 63  HOH D O   1 
HETATM 7765 O O   . HOH L 4 .   ? 18.022  15.284  -68.893 1.00 51.01  ? 70  HOH D O   1 
HETATM 7766 O O   . HOH L 4 .   ? 22.447  0.017   -64.879 1.00 46.65  ? 74  HOH D O   1 
HETATM 7767 O O   . HOH L 4 .   ? 24.952  3.310   -63.289 1.00 24.34  ? 76  HOH D O   1 
HETATM 7768 O O   . HOH L 4 .   ? 20.669  3.321   -74.200 1.00 37.14  ? 79  HOH D O   1 
HETATM 7769 O O   . HOH L 4 .   ? 22.505  2.145   -67.020 1.00 27.24  ? 82  HOH D O   1 
HETATM 7770 O O   . HOH L 4 .   ? 23.947  21.224  -74.146 1.00 38.92  ? 83  HOH D O   1 
HETATM 7771 O O   . HOH L 4 .   ? -2.373  0.820   -79.587 1.00 44.03  ? 91  HOH D O   1 
HETATM 7772 O O   . HOH L 4 .   ? -5.973  4.896   -80.194 1.00 51.44  ? 99  HOH D O   1 
HETATM 7773 O O   . HOH L 4 .   ? 31.591  -0.332  -78.765 1.00 61.12  ? 105 HOH D O   1 
HETATM 7774 O O   . HOH L 4 .   ? 39.486  -1.815  -60.311 1.00 57.25  ? 111 HOH D O   1 
HETATM 7775 O O   . HOH L 4 .   ? 1.073   5.323   -82.797 1.00 37.52  ? 115 HOH D O   1 
HETATM 7776 O O   . HOH L 4 .   ? 43.053  15.624  -68.678 1.00 55.63  ? 117 HOH D O   1 
HETATM 7777 O O   . HOH L 4 .   ? 29.951  -2.856  -71.869 1.00 49.55  ? 119 HOH D O   1 
HETATM 7778 O O   . HOH L 4 .   ? 11.923  -4.247  -88.027 1.00 41.25  ? 127 HOH D O   1 
HETATM 7779 O O   . HOH L 4 .   ? 27.604  20.229  -70.056 1.00 36.37  ? 134 HOH D O   1 
HETATM 7780 O O   . HOH L 4 .   ? 26.446  3.387   -68.194 1.00 38.50  ? 136 HOH D O   1 
HETATM 7781 O O   . HOH L 4 .   ? 25.019  -0.891  -65.075 1.00 42.04  ? 137 HOH D O   1 
HETATM 7782 O O   . HOH L 4 .   ? 9.438   1.105   -86.904 1.00 45.04  ? 139 HOH D O   1 
HETATM 7783 O O   . HOH L 4 .   ? 15.069  -2.895  -62.545 1.00 48.25  ? 140 HOH D O   1 
HETATM 7784 O O   . HOH L 4 .   ? 13.665  13.810  -88.417 1.00 47.42  ? 144 HOH D O   1 
HETATM 7785 O O   . HOH L 4 .   ? 27.064  1.083   -65.617 1.00 52.67  ? 150 HOH D O   1 
HETATM 7786 O O   . HOH L 4 .   ? 11.733  17.122  -87.142 1.00 54.49  ? 152 HOH D O   1 
HETATM 7787 O O   . HOH L 4 .   ? 32.507  0.520   -55.243 1.00 44.88  ? 157 HOH D O   1 
HETATM 7788 O O   . HOH L 4 .   ? 14.275  11.128  -88.217 1.00 41.74  ? 159 HOH D O   1 
HETATM 7789 O O   . HOH L 4 .   ? 12.420  17.570  -70.102 1.00 32.01  ? 163 HOH D O   1 
HETATM 7790 O O   . HOH L 4 .   ? 22.613  22.252  -71.931 1.00 51.51  ? 166 HOH D O   1 
HETATM 7791 O O   . HOH L 4 .   ? 24.789  18.091  -65.296 1.00 38.09  ? 172 HOH D O   1 
HETATM 7792 O O   . HOH L 4 .   ? -3.547  11.781  -80.725 1.00 44.32  ? 182 HOH D O   1 
HETATM 7793 O O   . HOH L 4 .   ? 12.120  4.562   -54.267 1.00 43.21  ? 190 HOH D O   1 
HETATM 7794 O O   . HOH L 4 .   ? 34.498  0.422   -78.561 1.00 48.24  ? 201 HOH D O   1 
HETATM 7795 O O   . HOH L 4 .   ? 35.975  20.732  -70.367 1.00 62.05  ? 207 HOH D O   1 
HETATM 7796 O O   . HOH L 4 .   ? 8.443   3.948   -86.576 1.00 50.94  ? 210 HOH D O   1 
HETATM 7797 O O   . HOH L 4 .   ? 7.060   -0.345  -87.702 1.00 59.18  ? 220 HOH D O   1 
HETATM 7798 O O   . HOH L 4 .   ? 20.114  -5.851  -72.527 1.00 59.51  ? 221 HOH D O   1 
HETATM 7799 O O   . HOH L 4 .   ? 25.987  3.439   -84.868 1.00 59.35  ? 223 HOH D O   1 
HETATM 7800 O O   . HOH L 4 .   ? 1.835   6.235   -67.999 1.00 48.40  ? 227 HOH D O   1 
HETATM 7801 O O   . HOH L 4 .   ? 43.889  7.874   -70.448 1.00 56.07  ? 233 HOH D O   1 
HETATM 7802 O O   . HOH L 4 .   ? 6.111   -2.770  -76.564 1.00 42.77  ? 236 HOH D O   1 
HETATM 7803 O O   . HOH L 4 .   ? 20.421  1.682   -95.487 1.00 47.30  ? 238 HOH D O   1 
HETATM 7804 O O   . HOH L 4 .   ? 30.227  -7.584  -51.083 1.00 55.97  ? 240 HOH D O   1 
HETATM 7805 O O   . HOH L 4 .   ? 42.722  17.656  -78.095 1.00 46.69  ? 244 HOH D O   1 
HETATM 7806 O O   . HOH L 4 .   ? 42.957  19.052  -76.099 1.00 44.30  ? 245 HOH D O   1 
HETATM 7807 O O   . HOH L 4 .   ? 1.399   6.725   -64.892 1.00 48.00  ? 246 HOH D O   1 
HETATM 7808 O O   . HOH L 4 .   ? -1.497  8.110   -68.966 1.00 54.30  ? 250 HOH D O   1 
HETATM 7809 O O   . HOH L 4 .   ? 6.416   -1.838  -73.843 1.00 57.00  ? 252 HOH D O   1 
HETATM 7810 O O   . HOH L 4 .   ? -0.330  6.556   -70.763 1.00 46.82  ? 260 HOH D O   1 
HETATM 7811 O O   . HOH L 4 .   ? 33.350  19.266  -84.460 1.00 49.42  ? 261 HOH D O   1 
HETATM 7812 O O   . HOH L 4 .   ? 13.483  14.681  -79.684 1.00 45.34  ? 264 HOH D O   1 
HETATM 7813 O O   . HOH L 4 .   ? 24.438  3.778   -66.048 1.00 27.60  ? 554 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LEU A 11  ? 0.8634 1.1466 1.0424 0.0486  -0.0270 -0.1014 306 LEU A N   
2    C CA  . LEU A 11  ? 0.8323 1.0771 1.0016 0.0619  -0.0305 -0.0811 306 LEU A CA  
3    C C   . LEU A 11  ? 0.7315 0.9522 0.8926 0.0547  -0.0254 -0.0721 306 LEU A C   
4    O O   . LEU A 11  ? 0.6315 0.8689 0.7995 0.0451  -0.0207 -0.0820 306 LEU A O   
5    C CB  . LEU A 11  ? 0.8413 1.0930 1.0274 0.0896  -0.0394 -0.0784 306 LEU A CB  
6    N N   . ALA A 12  ? 0.7262 0.9077 0.8726 0.0597  -0.0265 -0.0531 307 ALA A N   
7    C CA  . ALA A 12  ? 0.6868 0.8413 0.8224 0.0520  -0.0215 -0.0427 307 ALA A CA  
8    C C   . ALA A 12  ? 0.6720 0.8382 0.8241 0.0611  -0.0220 -0.0468 307 ALA A C   
9    O O   . ALA A 12  ? 0.6648 0.8259 0.8126 0.0485  -0.0160 -0.0474 307 ALA A O   
10   C CB  . ALA A 12  ? 0.6873 0.7990 0.8066 0.0597  -0.0239 -0.0214 307 ALA A CB  
11   N N   . LEU A 13  ? 0.5909 0.7727 0.7618 0.0830  -0.0292 -0.0495 308 LEU A N   
12   C CA  . LEU A 13  ? 0.5477 0.7391 0.7349 0.0942  -0.0304 -0.0521 308 LEU A CA  
13   C C   . LEU A 13  ? 0.5651 0.7915 0.7645 0.0821  -0.0257 -0.0710 308 LEU A C   
14   O O   . LEU A 13  ? 0.5915 0.8255 0.8027 0.0876  -0.0254 -0.0740 308 LEU A O   
15   C CB  . LEU A 13  ? 0.5373 0.7365 0.7415 0.1212  -0.0393 -0.0501 308 LEU A CB  
16   C CG  . LEU A 13  ? 0.5449 0.7083 0.7405 0.1373  -0.0445 -0.0302 308 LEU A CG  
17   C CD1 . LEU A 13  ? 0.4965 0.6715 0.7113 0.1640  -0.0528 -0.0300 308 LEU A CD1 
18   C CD2 . LEU A 13  ? 0.5656 0.6947 0.7491 0.1332  -0.0410 -0.0160 308 LEU A CD2 
19   N N   . SER A 14  ? 0.5284 0.7760 0.7250 0.0656  -0.0220 -0.0836 309 SER A N   
20   C CA  . SER A 14  ? 0.5486 0.8308 0.7564 0.0533  -0.0174 -0.1020 309 SER A CA  
21   C C   . SER A 14  ? 0.5297 0.8023 0.7230 0.0287  -0.0082 -0.1029 309 SER A C   
22   O O   . SER A 14  ? 0.5269 0.8242 0.7283 0.0178  -0.0037 -0.1165 309 SER A O   
23   C CB  . SER A 14  ? 0.5657 0.8822 0.7824 0.0509  -0.0191 -0.1176 309 SER A CB  
24   O OG  . SER A 14  ? 0.6005 0.9399 0.8381 0.0724  -0.0263 -0.1236 309 SER A OG  
25   N N   . LEU A 15  ? 0.4392 0.6759 0.6111 0.0201  -0.0054 -0.0881 310 LEU A N   
26   C CA  . LEU A 15  ? 0.5051 0.7291 0.6613 -0.0029 0.0035  -0.0870 310 LEU A CA  
27   C C   . LEU A 15  ? 0.4927 0.7160 0.6549 -0.0036 0.0066  -0.0875 310 LEU A C   
28   O O   . LEU A 15  ? 0.4472 0.6593 0.6168 0.0139  0.0021  -0.0793 310 LEU A O   
29   C CB  . LEU A 15  ? 0.5114 0.6938 0.6435 -0.0089 0.0052  -0.0691 310 LEU A CB  
30   C CG  . LEU A 15  ? 0.5044 0.6825 0.6258 -0.0132 0.0039  -0.0675 310 LEU A CG  
31   C CD1 . LEU A 15  ? 0.5795 0.7176 0.6756 -0.0247 0.0079  -0.0513 310 LEU A CD1 
32   C CD2 . LEU A 15  ? 0.4487 0.6610 0.5749 -0.0289 0.0077  -0.0861 310 LEU A CD2 
33   N N   . THR A 16  ? 0.4408 0.6758 0.5996 -0.0239 0.0144  -0.0969 311 THR A N   
34   C CA  . THR A 16  ? 0.4165 0.6463 0.5768 -0.0278 0.0184  -0.0958 311 THR A CA  
35   C C   . THR A 16  ? 0.4466 0.6337 0.5853 -0.0341 0.0218  -0.0776 311 THR A C   
36   O O   . THR A 16  ? 0.4532 0.6180 0.5758 -0.0379 0.0217  -0.0677 311 THR A O   
37   C CB  . THR A 16  ? 0.4502 0.7066 0.6133 -0.0481 0.0260  -0.1119 311 THR A CB  
38   O OG1 . THR A 16  ? 0.4475 0.6900 0.5904 -0.0699 0.0329  -0.1094 311 THR A OG1 
39   C CG2 . THR A 16  ? 0.4913 0.7907 0.6737 -0.0447 0.0234  -0.1307 311 THR A CG2 
40   N N   . ALA A 17  ? 0.4573 0.6331 0.5955 -0.0353 0.0247  -0.0732 312 ALA A N   
41   C CA  . ALA A 17  ? 0.4362 0.5725 0.5539 -0.0423 0.0284  -0.0565 312 ALA A CA  
42   C C   . ALA A 17  ? 0.4838 0.6132 0.5823 -0.0669 0.0364  -0.0575 312 ALA A C   
43   O O   . ALA A 17  ? 0.5432 0.6418 0.6227 -0.0715 0.0375  -0.0440 312 ALA A O   
44   C CB  . ALA A 17  ? 0.3492 0.4793 0.4710 -0.0408 0.0308  -0.0540 312 ALA A CB  
45   N N   . ASP A 18  ? 0.4722 0.6303 0.5758 -0.0827 0.0419  -0.0736 313 ASP A N   
46   C CA  . ASP A 18  ? 0.5312 0.6865 0.6183 -0.1069 0.0499  -0.0765 313 ASP A CA  
47   C C   . ASP A 18  ? 0.4694 0.6205 0.5477 -0.1088 0.0479  -0.0746 313 ASP A C   
48   O O   . ASP A 18  ? 0.4205 0.5513 0.4791 -0.1240 0.0529  -0.0679 313 ASP A O   
49   C CB  . ASP A 18  ? 0.6236 0.8147 0.7207 -0.1215 0.0555  -0.0957 313 ASP A CB  
50   C CG  . ASP A 18  ? 0.7304 0.9217 0.8309 -0.1253 0.0598  -0.0968 313 ASP A CG  
51   O OD1 . ASP A 18  ? 0.7376 0.8970 0.8260 -0.1247 0.0613  -0.0822 313 ASP A OD1 
52   O OD2 . ASP A 18  ? 0.8055 1.0290 0.9209 -0.1291 0.0617  -0.1124 313 ASP A OD2 
53   N N   . GLN A 19  ? 0.4428 0.6134 0.5358 -0.0934 0.0405  -0.0805 314 GLN A N   
54   C CA  . GLN A 19  ? 0.4207 0.5900 0.5073 -0.0937 0.0379  -0.0797 314 GLN A CA  
55   C C   . GLN A 19  ? 0.3981 0.5282 0.4702 -0.0836 0.0340  -0.0597 314 GLN A C   
56   O O   . GLN A 19  ? 0.4214 0.5365 0.4784 -0.0911 0.0350  -0.0540 314 GLN A O   
57   C CB  . GLN A 19  ? 0.4034 0.6073 0.5108 -0.0800 0.0312  -0.0928 314 GLN A CB  
58   C CG  . GLN A 19  ? 0.4505 0.6948 0.5701 -0.0925 0.0351  -0.1137 314 GLN A CG  
59   C CD  . GLN A 19  ? 0.5252 0.8035 0.6670 -0.0766 0.0281  -0.1261 314 GLN A CD  
60   O OE1 . GLN A 19  ? 0.5558 0.8313 0.7084 -0.0549 0.0209  -0.1207 314 GLN A OE1 
61   N NE2 . GLN A 19  ? 0.5592 0.8701 0.7081 -0.0872 0.0303  -0.1428 314 GLN A NE2 
62   N N   . MET A 20  ? 0.4862 0.5997 0.5629 -0.0665 0.0296  -0.0490 315 MET A N   
63   C CA  . MET A 20  ? 0.4653 0.5409 0.5292 -0.0555 0.0257  -0.0293 315 MET A CA  
64   C C   . MET A 20  ? 0.4359 0.4783 0.4756 -0.0728 0.0328  -0.0173 315 MET A C   
65   O O   . MET A 20  ? 0.5057 0.5228 0.5291 -0.0747 0.0324  -0.0057 315 MET A O   
66   C CB  . MET A 20  ? 0.5072 0.5743 0.5829 -0.0337 0.0198  -0.0216 315 MET A CB  
67   C CG  . MET A 20  ? 0.5243 0.5505 0.5868 -0.0223 0.0161  -0.0004 315 MET A CG  
68   S SD  . MET A 20  ? 0.6492 0.6698 0.7106 -0.0073 0.0081  0.0056  315 MET A SD  
69   C CE  . MET A 20  ? 0.4628 0.5194 0.5539 0.0152  0.0001  -0.0067 315 MET A CE  
70   N N   . VAL A 21  ? 0.4296 0.4726 0.4671 -0.0852 0.0394  -0.0201 316 VAL A N   
71   C CA  . VAL A 21  ? 0.4945 0.5083 0.5096 -0.1027 0.0470  -0.0099 316 VAL A CA  
72   C C   . VAL A 21  ? 0.5097 0.5233 0.5101 -0.1214 0.0519  -0.0130 316 VAL A C   
73   O O   . VAL A 21  ? 0.4950 0.4774 0.4753 -0.1278 0.0541  0.0004  316 VAL A O   
74   C CB  . VAL A 21  ? 0.5172 0.5388 0.5346 -0.1143 0.0537  -0.0158 316 VAL A CB  
75   C CG1 . VAL A 21  ? 0.5401 0.5323 0.5339 -0.1329 0.0618  -0.0055 316 VAL A CG1 
76   C CG2 . VAL A 21  ? 0.5502 0.5698 0.5811 -0.0963 0.0492  -0.0120 316 VAL A CG2 
77   N N   . SER A 22  ? 0.5236 0.5074 0.5868 -0.0946 0.0453  0.0965  317 SER A N   
78   C CA  . SER A 22  ? 0.5253 0.5079 0.6365 -0.1023 0.0549  0.0717  317 SER A CA  
79   C C   . SER A 22  ? 0.4801 0.5037 0.6096 -0.0973 0.0351  0.0478  317 SER A C   
80   O O   . SER A 22  ? 0.5154 0.5302 0.6611 -0.0995 0.0386  0.0358  317 SER A O   
81   C CB  . SER A 22  ? 0.5842 0.5740 0.7381 -0.1113 0.0670  0.0579  317 SER A CB  
82   O OG  . SER A 22  ? 0.6726 0.6267 0.8093 -0.1159 0.0844  0.0801  317 SER A OG  
83   N N   . ALA A 23  ? 0.4420 0.5105 0.5689 -0.0905 0.0146  0.0408  318 ALA A N   
84   C CA  . ALA A 23  ? 0.4236 0.5342 0.5656 -0.0851 -0.0059 0.0186  318 ALA A CA  
85   C C   . ALA A 23  ? 0.4728 0.5710 0.5811 -0.0783 -0.0147 0.0281  318 ALA A C   
86   O O   . ALA A 23  ? 0.4500 0.5585 0.5780 -0.0785 -0.0198 0.0102  318 ALA A O   
87   C CB  . ALA A 23  ? 0.4187 0.5764 0.5566 -0.0781 -0.0260 0.0139  318 ALA A CB  
88   N N   . LEU A 24  ? 0.4024 0.4784 0.4599 -0.0725 -0.0161 0.0563  319 LEU A N   
89   C CA  . LEU A 24  ? 0.4745 0.5378 0.4962 -0.0655 -0.0246 0.0675  319 LEU A CA  
90   C C   . LEU A 24  ? 0.5023 0.5247 0.5316 -0.0714 -0.0073 0.0686  319 LEU A C   
91   O O   . LEU A 24  ? 0.5551 0.5805 0.5845 -0.0686 -0.0146 0.0604  319 LEU A O   
92   C CB  . LEU A 24  ? 0.4816 0.5308 0.4472 -0.0581 -0.0294 0.0978  319 LEU A CB  
93   C CG  . LEU A 24  ? 0.4087 0.4990 0.3593 -0.0501 -0.0491 0.0983  319 LEU A CG  
94   C CD1 . LEU A 24  ? 0.4297 0.5027 0.3231 -0.0428 -0.0529 0.1283  319 LEU A CD1 
95   C CD2 . LEU A 24  ? 0.3038 0.4391 0.2685 -0.0438 -0.0718 0.0756  319 LEU A CD2 
96   N N   . LEU A 25  ? 0.4933 0.4774 0.5293 -0.0796 0.0159  0.0787  320 LEU A N   
97   C CA  . LEU A 25  ? 0.5039 0.4473 0.5482 -0.0855 0.0342  0.0801  320 LEU A CA  
98   C C   . LEU A 25  ? 0.5313 0.4930 0.6257 -0.0905 0.0349  0.0491  320 LEU A C   
99   O O   . LEU A 25  ? 0.5872 0.5362 0.6823 -0.0901 0.0362  0.0449  320 LEU A O   
100  C CB  . LEU A 25  ? 0.5727 0.4741 0.6185 -0.0937 0.0593  0.0949  320 LEU A CB  
101  C CG  . LEU A 25  ? 0.5970 0.4673 0.5914 -0.0902 0.0641  0.1284  320 LEU A CG  
102  C CD1 . LEU A 25  ? 0.6412 0.4780 0.6446 -0.0992 0.0875  0.1387  320 LEU A CD1 
103  C CD2 . LEU A 25  ? 0.5699 0.4100 0.5283 -0.0856 0.0648  0.1448  320 LEU A CD2 
104  N N   . ASP A 26  ? 0.5590 0.5506 0.6951 -0.0953 0.0342  0.0275  321 ASP A N   
105  C CA  . ASP A 26  ? 0.5943 0.6061 0.7809 -0.1008 0.0352  -0.0035 321 ASP A CA  
106  C C   . ASP A 26  ? 0.5300 0.5753 0.7141 -0.0935 0.0131  -0.0170 321 ASP A C   
107  O O   . ASP A 26  ? 0.5855 0.6348 0.7981 -0.0969 0.0150  -0.0363 321 ASP A O   
108  C CB  . ASP A 26  ? 0.6525 0.6942 0.8813 -0.1064 0.0365  -0.0231 321 ASP A CB  
109  C CG  . ASP A 26  ? 0.7615 0.7692 1.0022 -0.1154 0.0607  -0.0146 321 ASP A CG  
110  O OD1 . ASP A 26  ? 0.7511 0.7114 0.9737 -0.1183 0.0780  0.0031  321 ASP A OD1 
111  O OD2 . ASP A 26  ? 0.7877 0.8160 1.0560 -0.1194 0.0623  -0.0256 321 ASP A OD2 
112  N N   . ALA A 27  ? 0.4425 0.5111 0.5919 -0.0837 -0.0075 -0.0067 322 ALA A N   
113  C CA  . ALA A 27  ? 0.4386 0.5424 0.5844 -0.0762 -0.0303 -0.0195 322 ALA A CA  
114  C C   . ALA A 27  ? 0.4110 0.4891 0.5266 -0.0721 -0.0316 -0.0078 322 ALA A C   
115  O O   . ALA A 27  ? 0.3439 0.4462 0.4568 -0.0665 -0.0488 -0.0183 322 ALA A O   
116  C CB  . ALA A 27  ? 0.3354 0.4751 0.4564 -0.0671 -0.0518 -0.0139 322 ALA A CB  
117  N N   . GLU A 28  ? 0.3739 0.4033 0.4668 -0.0746 -0.0136 0.0141  323 GLU A N   
118  C CA  . GLU A 28  ? 0.4326 0.4350 0.4916 -0.0700 -0.0145 0.0290  323 GLU A CA  
119  C C   . GLU A 28  ? 0.4447 0.4569 0.5305 -0.0715 -0.0179 0.0073  323 GLU A C   
120  O O   . GLU A 28  ? 0.4139 0.4267 0.5447 -0.0799 -0.0059 -0.0130 323 GLU A O   
121  C CB  . GLU A 28  ? 0.4560 0.4033 0.4942 -0.0740 0.0085  0.0530  323 GLU A CB  
122  C CG  . GLU A 28  ? 0.4970 0.4285 0.4853 -0.0684 0.0066  0.0831  323 GLU A CG  
123  C CD  . GLU A 28  ? 0.5170 0.4588 0.4610 -0.0573 -0.0136 0.0953  323 GLU A CD  
124  O OE1 . GLU A 28  ? 0.5981 0.5079 0.5131 -0.0548 -0.0088 0.1114  323 GLU A OE1 
125  O OE2 . GLU A 28  ? 0.4961 0.4778 0.4341 -0.0510 -0.0341 0.0888  323 GLU A OE2 
126  N N   . PRO A 29  ? 0.4055 0.4255 0.4637 -0.0634 -0.0342 0.0114  324 PRO A N   
127  C CA  . PRO A 29  ? 0.4273 0.4556 0.5064 -0.0641 -0.0385 -0.0072 324 PRO A CA  
128  C C   . PRO A 29  ? 0.4693 0.4495 0.5465 -0.0690 -0.0175 0.0020  324 PRO A C   
129  O O   . PRO A 29  ? 0.4134 0.3552 0.4635 -0.0695 -0.0036 0.0260  324 PRO A O   
130  C CB  . PRO A 29  ? 0.4512 0.4987 0.4923 -0.0531 -0.0623 0.0001  324 PRO A CB  
131  C CG  . PRO A 29  ? 0.4343 0.4585 0.4254 -0.0476 -0.0613 0.0310  324 PRO A CG  
132  C CD  . PRO A 29  ? 0.3941 0.4150 0.3989 -0.0531 -0.0492 0.0342  324 PRO A CD  
133  N N   . PRO A 30  ? 0.4337 0.4160 0.5393 -0.0725 -0.0149 -0.0167 325 PRO A N   
134  C CA  . PRO A 30  ? 0.4613 0.3985 0.5659 -0.0767 0.0052  -0.0086 325 PRO A CA  
135  C C   . PRO A 30  ? 0.5252 0.4424 0.5823 -0.0685 -0.0023 0.0124  325 PRO A C   
136  O O   . PRO A 30  ? 0.4122 0.3555 0.4451 -0.0601 -0.0244 0.0143  325 PRO A O   
137  C CB  . PRO A 30  ? 0.4894 0.4433 0.6428 -0.0829 0.0080  -0.0385 325 PRO A CB  
138  C CG  . PRO A 30  ? 0.4796 0.4847 0.6386 -0.0774 -0.0182 -0.0555 325 PRO A CG  
139  C CD  . PRO A 30  ? 0.4049 0.4310 0.5444 -0.0726 -0.0300 -0.0460 325 PRO A CD  
140  N N   . ILE A 31  ? 0.6136 0.4846 0.6573 -0.0708 0.0162  0.0280  326 ILE A N   
141  C CA  . ILE A 31  ? 0.6822 0.5329 0.6860 -0.0637 0.0108  0.0453  326 ILE A CA  
142  C C   . ILE A 31  ? 0.5768 0.4341 0.6061 -0.0656 0.0095  0.0258  326 ILE A C   
143  O O   . ILE A 31  ? 0.5811 0.4252 0.6476 -0.0738 0.0270  0.0120  326 ILE A O   
144  C CB  . ILE A 31  ? 0.7400 0.5374 0.7152 -0.0648 0.0311  0.0725  326 ILE A CB  
145  C CG1 . ILE A 31  ? 0.7085 0.4993 0.6571 -0.0631 0.0323  0.0925  326 ILE A CG1 
146  C CG2 . ILE A 31  ? 0.6838 0.4606 0.6201 -0.0576 0.0259  0.0891  326 ILE A CG2 
147  C CD1 . ILE A 31  ? 0.7843 0.5236 0.7094 -0.0654 0.0540  0.1177  326 ILE A CD1 
148  N N   . LEU A 32  ? 0.5053 0.3835 0.5151 -0.0580 -0.0112 0.0242  327 LEU A N   
149  C CA  . LEU A 32  ? 0.5064 0.3932 0.5380 -0.0592 -0.0145 0.0061  327 LEU A CA  
150  C C   . LEU A 32  ? 0.5451 0.3939 0.5453 -0.0557 -0.0081 0.0247  327 LEU A C   
151  O O   . LEU A 32  ? 0.5037 0.3269 0.4594 -0.0502 -0.0071 0.0517  327 LEU A O   
152  C CB  . LEU A 32  ? 0.4731 0.4093 0.5083 -0.0538 -0.0415 -0.0108 327 LEU A CB  
153  C CG  . LEU A 32  ? 0.4782 0.4566 0.5437 -0.0562 -0.0505 -0.0302 327 LEU A CG  
154  C CD1 . LEU A 32  ? 0.4303 0.4553 0.4976 -0.0504 -0.0771 -0.0465 327 LEU A CD1 
155  C CD2 . LEU A 32  ? 0.4231 0.4017 0.5433 -0.0675 -0.0322 -0.0521 327 LEU A CD2 
156  N N   . TYR A 33  ? 0.4594 0.3045 0.4832 -0.0589 -0.0032 0.0102  328 TYR A N   
157  C CA  . TYR A 33  ? 0.5074 0.3192 0.5048 -0.0555 0.0022  0.0256  328 TYR A CA  
158  C C   . TYR A 33  ? 0.5034 0.3414 0.4835 -0.0479 -0.0217 0.0209  328 TYR A C   
159  O O   . TYR A 33  ? 0.4778 0.3582 0.4798 -0.0478 -0.0383 -0.0006 328 TYR A O   
160  C CB  . TYR A 33  ? 0.5972 0.3839 0.6301 -0.0639 0.0249  0.0143  328 TYR A CB  
161  C CG  . TYR A 33  ? 0.6620 0.4138 0.7052 -0.0707 0.0507  0.0231  328 TYR A CG  
162  C CD1 . TYR A 33  ? 0.7654 0.5328 0.8446 -0.0778 0.0576  0.0079  328 TYR A CD1 
163  C CD2 . TYR A 33  ? 0.6977 0.4011 0.7146 -0.0699 0.0681  0.0467  328 TYR A CD2 
164  C CE1 . TYR A 33  ? 0.8314 0.5665 0.9202 -0.0841 0.0812  0.0158  328 TYR A CE1 
165  C CE2 . TYR A 33  ? 0.7387 0.4096 0.7645 -0.0761 0.0917  0.0549  328 TYR A CE2 
166  C CZ  . TYR A 33  ? 0.8221 0.5087 0.8841 -0.0833 0.0983  0.0393  328 TYR A CZ  
167  O OH  . TYR A 33  ? 0.8624 0.5164 0.9340 -0.0896 0.1219  0.0469  328 TYR A OH  
168  N N   . SER A 34  ? 0.2876 0.5221 0.7765 -0.0936 0.2543  -0.0506 329 SER A N   
169  C CA  . SER A 34  ? 0.2569 0.5657 0.7755 -0.0793 0.1998  -0.0663 329 SER A CA  
170  C C   . SER A 34  ? 0.3361 0.6460 0.9176 -0.0830 0.2044  -0.0901 329 SER A C   
171  O O   . SER A 34  ? 0.3198 0.5512 0.8953 -0.0917 0.2450  -0.0861 329 SER A O   
172  C CB  . SER A 34  ? 0.2613 0.5171 0.6787 -0.0545 0.1616  -0.0362 329 SER A CB  
173  O OG  . SER A 34  ? 0.2954 0.6203 0.7413 -0.0405 0.1092  -0.0516 329 SER A OG  
174  N N   . GLU A 35  ? 0.2855 0.6846 0.9274 -0.0767 0.1629  -0.1150 330 GLU A N   
175  C CA  . GLU A 35  ? 0.3214 0.7265 1.0214 -0.0779 0.1609  -0.1378 330 GLU A CA  
176  C C   . GLU A 35  ? 0.3732 0.6531 0.9962 -0.0672 0.1727  -0.1137 330 GLU A C   
177  O O   . GLU A 35  ? 0.3554 0.5861 0.8936 -0.0476 0.1448  -0.0882 330 GLU A O   
178  C CB  . GLU A 35  ? 0.2630 0.7643 1.0077 -0.0656 0.1047  -0.1588 330 GLU A CB  
179  N N   . TYR A 36  ? 0.3831 0.6111 1.0351 -0.0801 0.2141  -0.1215 331 TYR A N   
180  C CA  . TYR A 36  ? 0.5469 0.6497 1.1250 -0.0725 0.2320  -0.0976 331 TYR A CA  
181  C C   . TYR A 36  ? 0.5910 0.6802 1.1455 -0.0516 0.1884  -0.0965 331 TYR A C   
182  O O   . TYR A 36  ? 0.6024 0.7711 1.2283 -0.0496 0.1599  -0.1244 331 TYR A O   
183  C CB  . TYR A 36  ? 0.7055 0.7617 1.3267 -0.0921 0.2858  -0.1086 331 TYR A CB  
184  C CG  . TYR A 36  ? 1.0261 0.9467 1.5682 -0.0870 0.3116  -0.0821 331 TYR A CG  
185  C CD1 . TYR A 36  ? 1.1991 1.0542 1.6524 -0.0647 0.2814  -0.0565 331 TYR A CD1 
186  C CD2 . TYR A 36  ? 1.2168 1.0751 1.7733 -0.1046 0.3659  -0.0829 331 TYR A CD2 
187  C CE1 . TYR A 36  ? 1.3623 1.0942 1.7433 -0.0599 0.3037  -0.0325 331 TYR A CE1 
188  C CE2 . TYR A 36  ? 1.3785 1.1134 1.8626 -0.1001 0.3888  -0.0588 331 TYR A CE2 
189  C CZ  . TYR A 36  ? 1.4149 1.0866 1.8111 -0.0777 0.3575  -0.0336 331 TYR A CZ  
190  O OH  . TYR A 36  ? 1.5104 1.0583 1.8333 -0.0730 0.3796  -0.0093 331 TYR A OH  
191  N N   . ASP A 37  ? 0.6943 0.6815 1.1467 -0.0359 0.1834  -0.0638 332 ASP A N   
192  C CA  . ASP A 37  ? 0.7476 0.6950 1.1658 -0.0167 0.1509  -0.0585 332 ASP A CA  
193  C C   . ASP A 37  ? 0.6610 0.7092 1.1168 -0.0033 0.0933  -0.0766 332 ASP A C   
194  O O   . ASP A 37  ? 0.6830 0.7766 1.2051 -0.0030 0.0776  -0.1027 332 ASP A O   
195  C CB  . ASP A 37  ? 0.8799 0.7816 1.3382 -0.0250 0.1785  -0.0728 332 ASP A CB  
196  C CG  . ASP A 37  ? 1.0148 0.8477 1.4194 -0.0055 0.1532  -0.0606 332 ASP A CG  
197  O OD1 . ASP A 37  ? 1.0895 0.9157 1.4296 0.0148  0.1124  -0.0425 332 ASP A OD1 
198  O OD2 . ASP A 37  ? 1.0398 0.8252 1.4665 -0.0104 0.1740  -0.0690 332 ASP A OD2 
199  N N   . PRO A 38  ? 0.6546 0.7386 1.0681 0.0078  0.0613  -0.0629 333 PRO A N   
200  C CA  . PRO A 38  ? 0.6024 0.7739 1.0400 0.0227  0.0038  -0.0767 333 PRO A CA  
201  C C   . PRO A 38  ? 0.6212 0.7228 0.9814 0.0461  -0.0280 -0.0563 333 PRO A C   
202  O O   . PRO A 38  ? 0.6341 0.6231 0.9110 0.0515  -0.0076 -0.0272 333 PRO A O   
203  C CB  . PRO A 38  ? 0.5540 0.7798 0.9685 0.0241  -0.0124 -0.0666 333 PRO A CB  
204  C CG  . PRO A 38  ? 0.6227 0.7457 0.9493 0.0221  0.0233  -0.0323 333 PRO A CG  
205  C CD  . PRO A 38  ? 0.7058 0.7509 1.0463 0.0076  0.0757  -0.0341 333 PRO A CD  
206  N N   . THR A 39  ? 0.6161 0.7832 1.0037 0.0597  -0.0771 -0.0716 334 THR A N   
207  C CA  . THR A 39  ? 0.6867 0.7968 1.0011 0.0832  -0.1123 -0.0526 334 THR A CA  
208  C C   . THR A 39  ? 0.6770 0.7282 0.8840 0.0956  -0.1202 -0.0151 334 THR A C   
209  O O   . THR A 39  ? 0.5827 0.6922 0.7861 0.0948  -0.1333 -0.0119 334 THR A O   
210  C CB  . THR A 39  ? 0.6749 0.8803 1.0342 0.0963  -0.1686 -0.0743 334 THR A CB  
211  O OG1 . THR A 39  ? 0.6857 0.9489 1.1466 0.0850  -0.1624 -0.1100 334 THR A OG1 
212  C CG2 . THR A 39  ? 0.6317 0.7748 0.9133 0.1209  -0.2045 -0.0542 334 THR A CG2 
213  N N   . ARG A 40  ? 0.7532 0.6874 0.8729 0.1066  -0.1113 0.0133  335 ARG A N   
214  C CA  . ARG A 40  ? 0.7838 0.6567 0.7955 0.1219  -0.1254 0.0498  335 ARG A CA  
215  C C   . ARG A 40  ? 0.7596 0.5831 0.7149 0.1452  -0.1630 0.0622  335 ARG A C   
216  O O   . ARG A 40  ? 0.7847 0.5604 0.7515 0.1462  -0.1539 0.0558  335 ARG A O   
217  C CB  . ARG A 40  ? 0.8718 0.6394 0.8208 0.1125  -0.0743 0.0768  335 ARG A CB  
218  C CG  . ARG A 40  ? 0.9481 0.7569 0.9355 0.0915  -0.0387 0.0706  335 ARG A CG  
219  C CD  . ARG A 40  ? 1.0883 0.8457 0.9837 0.0963  -0.0317 0.1050  335 ARG A CD  
220  N NE  . ARG A 40  ? 1.1654 0.9067 1.0744 0.0754  0.0196  0.1073  335 ARG A NE  
221  C CZ  . ARG A 40  ? 1.2064 0.9055 1.0474 0.0748  0.0354  0.1342  335 ARG A CZ  
222  N NH1 . ARG A 40  ? 1.2031 0.8719 0.9572 0.0940  0.0036  0.1614  335 ARG A NH1 
223  N NH2 . ARG A 40  ? 1.2267 0.9142 1.0868 0.0550  0.0830  0.1338  335 ARG A NH2 
224  N N   . PRO A 41  ? 0.7290 0.5640 0.6232 0.1640  -0.2057 0.0799  336 PRO A N   
225  C CA  . PRO A 41  ? 0.6832 0.5657 0.5520 0.1649  -0.2189 0.0912  336 PRO A CA  
226  C C   . PRO A 41  ? 0.6558 0.6768 0.6221 0.1548  -0.2362 0.0586  336 PRO A C   
227  O O   . PRO A 41  ? 0.6274 0.7128 0.6747 0.1517  -0.2495 0.0281  336 PRO A O   
228  C CB  . PRO A 41  ? 0.7335 0.5920 0.5195 0.1907  -0.2677 0.1140  336 PRO A CB  
229  C CG  . PRO A 41  ? 0.7945 0.5678 0.5460 0.2021  -0.2700 0.1213  336 PRO A CG  
230  C CD  . PRO A 41  ? 0.7930 0.5941 0.6385 0.1870  -0.2470 0.0895  336 PRO A CD  
231  N N   . PHE A 42  ? 0.5852 0.6504 0.5429 0.1497  -0.2361 0.0653  337 PHE A N   
232  C CA  . PHE A 42  ? 0.5458 0.7418 0.5886 0.1406  -0.2540 0.0370  337 PHE A CA  
233  C C   . PHE A 42  ? 0.6245 0.8398 0.6481 0.1420  -0.2664 0.0182  337 PHE A C   
234  O O   . PHE A 42  ? 0.6836 0.8368 0.6341 0.1536  -0.2750 0.0338  337 PHE A O   
235  C CB  . PHE A 42  ? 0.5026 0.7181 0.5358 0.1282  -0.2308 0.0465  337 PHE A CB  
236  C CG  . PHE A 42  ? 0.4932 0.6465 0.5323 0.1087  -0.1697 0.0507  337 PHE A CG  
237  C CD1 . PHE A 42  ? 0.4909 0.6840 0.6251 0.0892  -0.1397 0.0207  337 PHE A CD1 
238  C CD2 . PHE A 42  ? 0.6009 0.6580 0.5509 0.1097  -0.1423 0.0846  337 PHE A CD2 
239  C CE1 . PHE A 42  ? 0.5886 0.7256 0.7286 0.0710  -0.0833 0.0244  337 PHE A CE1 
240  C CE2 . PHE A 42  ? 0.7076 0.7087 0.6629 0.0915  -0.0860 0.0885  337 PHE A CE2 
241  C CZ  . PHE A 42  ? 0.6575 0.6987 0.7080 0.0721  -0.0565 0.0583  337 PHE A CZ  
242  N N   . SER A 43  ? 0.6722 0.7500 0.8831 0.0668  0.0180  0.0520  338 SER A N   
243  C CA  . SER A 43  ? 0.6406 0.7185 0.8732 0.0594  0.0132  0.0600  338 SER A CA  
244  C C   . SER A 43  ? 0.6845 0.7609 0.9179 0.0528  -0.0078 0.0567  338 SER A C   
245  O O   . SER A 43  ? 0.6901 0.7645 0.9058 0.0533  -0.0155 0.0491  338 SER A O   
246  C CB  . SER A 43  ? 0.6181 0.6857 0.8434 0.0474  0.0370  0.0689  338 SER A CB  
247  O OG  . SER A 43  ? 0.6335 0.6898 0.8319 0.0360  0.0450  0.0671  338 SER A OG  
248  N N   . GLU A 44  ? 0.7407 0.8182 0.9948 0.0468  -0.0172 0.0625  339 GLU A N   
249  C CA  . GLU A 44  ? 0.7930 0.8695 1.0503 0.0403  -0.0371 0.0602  339 GLU A CA  
250  C C   . GLU A 44  ? 0.6871 0.7523 0.9175 0.0279  -0.0294 0.0590  339 GLU A C   
251  O O   . GLU A 44  ? 0.6386 0.7031 0.8594 0.0267  -0.0434 0.0528  339 GLU A O   
252  C CB  . GLU A 44  ? 0.8732 0.9519 1.1565 0.0346  -0.0445 0.0679  339 GLU A CB  
253  N N   . ALA A 45  ? 0.6306 0.6871 0.8490 0.0185  -0.0067 0.0653  340 ALA A N   
254  C CA  . ALA A 45  ? 0.6093 0.6546 0.8016 0.0056  0.0031  0.0652  340 ALA A CA  
255  C C   . ALA A 45  ? 0.5503 0.5934 0.7159 0.0104  0.0074  0.0570  340 ALA A C   
256  O O   . ALA A 45  ? 0.5684 0.6070 0.7170 0.0043  0.0011  0.0531  340 ALA A O   
257  C CB  . ALA A 45  ? 0.6189 0.6552 0.8055 -0.0053 0.0272  0.0740  340 ALA A CB  
258  N N   . SER A 46  ? 0.4984 0.5448 0.6606 0.0213  0.0182  0.0548  341 SER A N   
259  C CA  . SER A 46  ? 0.4983 0.5425 0.6350 0.0262  0.0242  0.0474  341 SER A CA  
260  C C   . SER A 46  ? 0.4726 0.5222 0.6078 0.0330  0.0008  0.0385  341 SER A C   
261  O O   . SER A 46  ? 0.5230 0.5675 0.6349 0.0296  0.0005  0.0336  341 SER A O   
262  C CB  . SER A 46  ? 0.4798 0.5280 0.6166 0.0378  0.0387  0.0468  341 SER A CB  
263  O OG  . SER A 46  ? 0.5184 0.5789 0.6743 0.0526  0.0224  0.0424  341 SER A OG  
264  N N   . MET A 47  ? 0.4563 0.5161 0.6159 0.0424  -0.0186 0.0366  342 MET A N   
265  C CA  . MET A 47  ? 0.4947 0.5595 0.6539 0.0490  -0.0411 0.0282  342 MET A CA  
266  C C   . MET A 47  ? 0.5019 0.5606 0.6535 0.0367  -0.0512 0.0284  342 MET A C   
267  O O   . MET A 47  ? 0.4768 0.5331 0.6105 0.0367  -0.0579 0.0223  342 MET A O   
268  C CB  . MET A 47  ? 0.5274 0.6038 0.7151 0.0604  -0.0600 0.0265  342 MET A CB  
269  C CG  . MET A 47  ? 0.5382 0.6204 0.7233 0.0710  -0.0793 0.0166  342 MET A CG  
270  S SD  . MET A 47  ? 0.8697 0.9639 1.0880 0.0804  -0.1052 0.0149  342 MET A SD  
271  C CE  . MET A 47  ? 0.6566 0.7461 0.8852 0.0659  -0.1164 0.0202  342 MET A CE  
272  N N   . MET A 48  ? 0.5120 0.5685 0.6776 0.0264  -0.0522 0.0357  343 MET A N   
273  C CA  . MET A 48  ? 0.4582 0.5091 0.6182 0.0136  -0.0604 0.0372  343 MET A CA  
274  C C   . MET A 48  ? 0.4694 0.5103 0.5977 0.0042  -0.0458 0.0365  343 MET A C   
275  O O   . MET A 48  ? 0.5052 0.5433 0.6210 -0.0009 -0.0554 0.0332  343 MET A O   
276  C CB  . MET A 48  ? 0.5663 0.6157 0.7449 0.0035  -0.0591 0.0462  343 MET A CB  
277  C CG  . MET A 48  ? 0.6396 0.6984 0.8496 0.0099  -0.0791 0.0467  343 MET A CG  
278  S SD  . MET A 48  ? 0.9062 0.9703 1.1196 0.0153  -0.1078 0.0381  343 MET A SD  
279  C CE  . MET A 48  ? 0.4044 0.4584 0.5946 -0.0010 -0.1050 0.0394  343 MET A CE  
280  N N   . GLY A 49  ? 0.4254 0.4608 0.5405 0.0018  -0.0222 0.0397  344 GLY A N   
281  C CA  . GLY A 49  ? 0.4877 0.5134 0.5716 -0.0068 -0.0064 0.0391  344 GLY A CA  
282  C C   . GLY A 49  ? 0.4421 0.4695 0.5083 0.0014  -0.0140 0.0300  344 GLY A C   
283  O O   . GLY A 49  ? 0.4632 0.4846 0.5079 -0.0063 -0.0140 0.0280  344 GLY A O   
284  N N   . LEU A 50  ? 0.4524 0.4882 0.5280 0.0171  -0.0206 0.0245  345 LEU A N   
285  C CA  . LEU A 50  ? 0.4177 0.4558 0.4787 0.0267  -0.0289 0.0156  345 LEU A CA  
286  C C   . LEU A 50  ? 0.4113 0.4520 0.4766 0.0261  -0.0530 0.0115  345 LEU A C   
287  O O   . LEU A 50  ? 0.4481 0.4852 0.4928 0.0244  -0.0565 0.0070  345 LEU A O   
288  C CB  . LEU A 50  ? 0.4340 0.4812 0.5060 0.0436  -0.0303 0.0111  345 LEU A CB  
289  C CG  . LEU A 50  ? 0.5490 0.5936 0.6094 0.0466  -0.0059 0.0127  345 LEU A CG  
290  C CD1 . LEU A 50  ? 0.5056 0.5604 0.5797 0.0635  -0.0094 0.0087  345 LEU A CD1 
291  C CD2 . LEU A 50  ? 0.5905 0.6267 0.6177 0.0420  0.0068  0.0095  345 LEU A CD2 
292  N N   . LEU A 51  ? 0.3816 0.4284 0.4735 0.0276  -0.0696 0.0133  346 LEU A N   
293  C CA  . LEU A 51  ? 0.4006 0.4502 0.4992 0.0277  -0.0929 0.0096  346 LEU A CA  
294  C C   . LEU A 51  ? 0.3741 0.4156 0.4583 0.0119  -0.0919 0.0131  346 LEU A C   
295  O O   . LEU A 51  ? 0.4886 0.5289 0.5614 0.0109  -0.1030 0.0089  346 LEU A O   
296  C CB  . LEU A 51  ? 0.4107 0.4681 0.5415 0.0318  -0.1093 0.0114  346 LEU A CB  
297  C CG  . LEU A 51  ? 0.4149 0.4818 0.5630 0.0475  -0.1141 0.0080  346 LEU A CG  
298  C CD1 . LEU A 51  ? 0.4570 0.5307 0.6363 0.0491  -0.1297 0.0109  346 LEU A CD1 
299  C CD2 . LEU A 51  ? 0.4012 0.4719 0.5398 0.0596  -0.1252 -0.0017 346 LEU A CD2 
300  N N   . THR A 52  ? 0.4249 0.4610 0.5102 -0.0005 -0.0783 0.0212  347 THR A N   
301  C CA  . THR A 52  ? 0.4439 0.4724 0.5166 -0.0168 -0.0756 0.0256  347 THR A CA  
302  C C   . THR A 52  ? 0.4666 0.4880 0.5064 -0.0213 -0.0644 0.0229  347 THR A C   
303  O O   . THR A 52  ? 0.4144 0.4329 0.4422 -0.0284 -0.0724 0.0220  347 THR A O   
304  C CB  . THR A 52  ? 0.5260 0.5499 0.6056 -0.0286 -0.0607 0.0349  347 THR A CB  
305  O OG1 . THR A 52  ? 0.6564 0.6860 0.7655 -0.0283 -0.0748 0.0383  347 THR A OG1 
306  C CG2 . THR A 52  ? 0.6337 0.6484 0.6929 -0.0457 -0.0516 0.0392  347 THR A CG2 
307  N N   . ASN A 53  ? 0.3998 0.4183 0.4250 -0.0172 -0.0458 0.0218  348 ASN A N   
308  C CA  . ASN A 53  ? 0.3832 0.3950 0.3767 -0.0206 -0.0340 0.0190  348 ASN A CA  
309  C C   . ASN A 53  ? 0.3832 0.3987 0.3691 -0.0118 -0.0509 0.0110  348 ASN A C   
310  O O   . ASN A 53  ? 0.4746 0.4853 0.4404 -0.0189 -0.0525 0.0099  348 ASN A O   
311  C CB  . ASN A 53  ? 0.3986 0.4081 0.3806 -0.0150 -0.0126 0.0184  348 ASN A CB  
312  C CG  . ASN A 53  ? 0.5278 0.5313 0.4776 -0.0165 -0.0018 0.0144  348 ASN A CG  
313  O OD1 . ASN A 53  ? 0.5208 0.5281 0.4636 -0.0043 -0.0070 0.0072  348 ASN A OD1 
314  N ND2 . ASN A 53  ? 0.5180 0.5120 0.4476 -0.0317 0.0128  0.0191  348 ASN A ND2 
315  N N   . LEU A 54  ? 0.3582 0.3823 0.3605 0.0037  -0.0636 0.0055  349 LEU A N   
316  C CA  . LEU A 54  ? 0.3188 0.3470 0.3168 0.0135  -0.0808 -0.0024 349 LEU A CA  
317  C C   . LEU A 54  ? 0.3894 0.4170 0.3911 0.0058  -0.0988 -0.0016 349 LEU A C   
318  O O   . LEU A 54  ? 0.4121 0.4368 0.3954 0.0036  -0.1036 -0.0047 349 LEU A O   
319  C CB  . LEU A 54  ? 0.2975 0.3353 0.3163 0.0304  -0.0922 -0.0076 349 LEU A CB  
320  C CG  . LEU A 54  ? 0.3777 0.4203 0.3948 0.0418  -0.1110 -0.0162 349 LEU A CG  
321  C CD1 . LEU A 54  ? 0.4022 0.4403 0.3893 0.0440  -0.1022 -0.0209 349 LEU A CD1 
322  C CD2 . LEU A 54  ? 0.3280 0.3803 0.3672 0.0575  -0.1211 -0.0205 349 LEU A CD2 
323  N N   . ALA A 55  ? 0.3873 0.4179 0.4132 0.0015  -0.1084 0.0028  350 ALA A N   
324  C CA  . ALA A 55  ? 0.3868 0.4176 0.4189 -0.0058 -0.1256 0.0041  350 ALA A CA  
325  C C   . ALA A 55  ? 0.3902 0.4126 0.3991 -0.0216 -0.1163 0.0083  350 ALA A C   
326  O O   . ALA A 55  ? 0.4588 0.4802 0.4590 -0.0247 -0.1276 0.0065  350 ALA A O   
327  C CB  . ALA A 55  ? 0.3686 0.4035 0.4302 -0.0088 -0.1348 0.0089  350 ALA A CB  
328  N N   . ASP A 56  ? 0.5310 0.3399 0.4392 -0.0087 0.0484  -0.0009 351 ASP A N   
329  C CA  . ASP A 56  ? 0.6730 0.4663 0.5633 -0.0138 0.0413  -0.0045 351 ASP A CA  
330  C C   . ASP A 56  ? 0.6329 0.4372 0.5272 -0.0254 0.0323  -0.0067 351 ASP A C   
331  O O   . ASP A 56  ? 0.5988 0.4087 0.4913 -0.0298 0.0233  -0.0097 351 ASP A O   
332  C CB  . ASP A 56  ? 0.8071 0.5660 0.6710 -0.0122 0.0471  -0.0035 351 ASP A CB  
333  C CG  . ASP A 56  ? 1.0576 0.8040 0.9140 -0.0007 0.0535  -0.0014 351 ASP A CG  
334  O OD1 . ASP A 56  ? 1.1328 0.8959 1.0031 0.0050  0.0519  -0.0016 351 ASP A OD1 
335  O OD2 . ASP A 56  ? 1.1680 0.8875 1.0042 0.0031  0.0601  0.0009  351 ASP A OD2 
336  N N   . ARG A 57  ? 0.5538 0.3621 0.4540 -0.0303 0.0350  -0.0047 352 ARG A N   
337  C CA  . ARG A 57  ? 0.4893 0.3079 0.3939 -0.0415 0.0269  -0.0057 352 ARG A CA  
338  C C   . ARG A 57  ? 0.4829 0.3355 0.4113 -0.0421 0.0202  -0.0057 352 ARG A C   
339  O O   . ARG A 57  ? 0.5377 0.4009 0.4685 -0.0501 0.0108  -0.0068 352 ARG A O   
340  C CB  . ARG A 57  ? 0.5202 0.3322 0.4239 -0.0460 0.0324  -0.0031 352 ARG A CB  
341  C CG  . ARG A 57  ? 0.4970 0.2736 0.3730 -0.0491 0.0357  -0.0037 352 ARG A CG  
342  C CD  . ARG A 57  ? 0.4484 0.2187 0.3233 -0.0541 0.0410  -0.0011 352 ARG A CD  
343  N NE  . ARG A 57  ? 0.5526 0.3246 0.4346 -0.0452 0.0532  0.0028  352 ARG A NE  
344  C CZ  . ARG A 57  ? 0.5349 0.3289 0.4378 -0.0449 0.0567  0.0055  352 ARG A CZ  
345  N NH1 . ARG A 57  ? 0.3979 0.2141 0.3168 -0.0524 0.0490  0.0050  352 ARG A NH1 
346  N NH2 . ARG A 57  ? 0.5484 0.3430 0.4563 -0.0368 0.0679  0.0093  352 ARG A NH2 
347  N N   . GLU A 58  ? 0.4595 0.3288 0.4045 -0.0336 0.0248  -0.0042 353 GLU A N   
348  C CA  . GLU A 58  ? 0.4692 0.3693 0.4353 -0.0326 0.0191  -0.0040 353 GLU A CA  
349  C C   . GLU A 58  ? 0.4995 0.4038 0.4626 -0.0308 0.0124  -0.0067 353 GLU A C   
350  O O   . GLU A 58  ? 0.4184 0.3452 0.3935 -0.0328 0.0053  -0.0067 353 GLU A O   
351  C CB  . GLU A 58  ? 0.4648 0.3800 0.4482 -0.0240 0.0259  -0.0019 353 GLU A CB  
352  C CG  . GLU A 58  ? 0.5004 0.4187 0.4915 -0.0254 0.0321  0.0011  353 GLU A CG  
353  C CD  . GLU A 58  ? 0.5113 0.4472 0.5204 -0.0173 0.0377  0.0032  353 GLU A CD  
354  O OE1 . GLU A 58  ? 0.4476 0.3720 0.4525 -0.0108 0.0459  0.0045  353 GLU A OE1 
355  O OE2 . GLU A 58  ? 0.5674 0.5284 0.5944 -0.0173 0.0337  0.0038  353 GLU A OE2 
356  N N   . LEU A 59  ? 0.5185 0.4018 0.4657 -0.0264 0.0150  -0.0084 354 LEU A N   
357  C CA  . LEU A 59  ? 0.5185 0.4055 0.4631 -0.0234 0.0098  -0.0108 354 LEU A CA  
358  C C   . LEU A 59  ? 0.4893 0.3831 0.4302 -0.0328 -0.0006 -0.0122 354 LEU A C   
359  O O   . LEU A 59  ? 0.4767 0.3901 0.4267 -0.0322 -0.0065 -0.0126 354 LEU A O   
360  C CB  . LEU A 59  ? 0.6538 0.5148 0.5801 -0.0175 0.0144  -0.0121 354 LEU A CB  
361  C CG  . LEU A 59  ? 0.7550 0.6221 0.6836 -0.0100 0.0128  -0.0136 354 LEU A CG  
362  C CD1 . LEU A 59  ? 0.7291 0.6189 0.6789 -0.0033 0.0152  -0.0121 354 LEU A CD1 
363  C CD2 . LEU A 59  ? 0.8514 0.6928 0.7630 -0.0032 0.0182  -0.0139 354 LEU A CD2 
364  N N   . VAL A 60  ? 0.4449 0.3225 0.3721 -0.0417 -0.0027 -0.0126 355 VAL A N   
365  C CA  . VAL A 60  ? 0.4706 0.3533 0.3933 -0.0521 -0.0129 -0.0133 355 VAL A CA  
366  C C   . VAL A 60  ? 0.4343 0.3499 0.3787 -0.0550 -0.0184 -0.0106 355 VAL A C   
367  O O   . VAL A 60  ? 0.4294 0.3610 0.3779 -0.0571 -0.0258 -0.0105 355 VAL A O   
368  C CB  . VAL A 60  ? 0.5469 0.4077 0.4535 -0.0619 -0.0138 -0.0135 355 VAL A CB  
369  C CG1 . VAL A 60  ? 0.6057 0.4680 0.5042 -0.0730 -0.0249 -0.0145 355 VAL A CG1 
370  C CG2 . VAL A 60  ? 0.6181 0.4456 0.5034 -0.0570 -0.0062 -0.0152 355 VAL A CG2 
371  N N   . HIS A 61  ? 0.3716 0.2977 0.3300 -0.0544 -0.0142 -0.0079 356 HIS A N   
372  C CA  . HIS A 61  ? 0.3097 0.2666 0.2889 -0.0559 -0.0186 -0.0047 356 HIS A CA  
373  C C   . HIS A 61  ? 0.4127 0.3902 0.4053 -0.0465 -0.0186 -0.0046 356 HIS A C   
374  O O   . HIS A 61  ? 0.4324 0.4350 0.4382 -0.0474 -0.0243 -0.0021 356 HIS A O   
375  C CB  . HIS A 61  ? 0.3766 0.3384 0.3669 -0.0565 -0.0132 -0.0020 356 HIS A CB  
376  C CG  . HIS A 61  ? 0.4029 0.3468 0.3815 -0.0664 -0.0136 -0.0016 356 HIS A CG  
377  N ND1 . HIS A 61  ? 0.4173 0.3703 0.3980 -0.0772 -0.0219 0.0005  356 HIS A ND1 
378  C CD2 . HIS A 61  ? 0.4583 0.3748 0.4216 -0.0670 -0.0068 -0.0028 356 HIS A CD2 
379  C CE1 . HIS A 61  ? 0.5240 0.4553 0.4915 -0.0845 -0.0203 0.0002  356 HIS A CE1 
380  N NE2 . HIS A 61  ? 0.5472 0.4558 0.5034 -0.0782 -0.0109 -0.0019 356 HIS A NE2 
381  N N   . MET A 62  ? 0.4394 0.4061 0.4281 -0.0374 -0.0122 -0.0068 357 MET A N   
382  C CA  . MET A 62  ? 0.3421 0.3254 0.3421 -0.0283 -0.0118 -0.0070 357 MET A CA  
383  C C   . MET A 62  ? 0.3636 0.3534 0.3585 -0.0295 -0.0191 -0.0081 357 MET A C   
384  O O   . MET A 62  ? 0.3394 0.3516 0.3458 -0.0262 -0.0225 -0.0066 357 MET A O   
385  C CB  . MET A 62  ? 0.2887 0.2578 0.2856 -0.0188 -0.0032 -0.0085 357 MET A CB  
386  C CG  . MET A 62  ? 0.3976 0.3832 0.4073 -0.0095 -0.0021 -0.0085 357 MET A CG  
387  S SD  . MET A 62  ? 0.4254 0.3928 0.4294 0.0006  0.0065  -0.0098 357 MET A SD  
388  C CE  . MET A 62  ? 0.4442 0.4016 0.4502 0.0004  0.0150  -0.0075 357 MET A CE  
389  N N   . ILE A 63  ? 0.4012 0.3712 0.3780 -0.0339 -0.0213 -0.0104 358 ILE A N   
390  C CA  . ILE A 63  ? 0.4668 0.4424 0.4375 -0.0363 -0.0285 -0.0113 358 ILE A CA  
391  C C   . ILE A 63  ? 0.4916 0.4916 0.4722 -0.0438 -0.0367 -0.0076 358 ILE A C   
392  O O   . ILE A 63  ? 0.4469 0.4669 0.4346 -0.0411 -0.0407 -0.0061 358 ILE A O   
393  C CB  . ILE A 63  ? 0.5424 0.4919 0.4909 -0.0417 -0.0304 -0.0142 358 ILE A CB  
394  C CG1 . ILE A 63  ? 0.6143 0.5385 0.5519 -0.0340 -0.0219 -0.0167 358 ILE A CG1 
395  C CG2 . ILE A 63  ? 0.5288 0.4855 0.4716 -0.0433 -0.0373 -0.0151 358 ILE A CG2 
396  C CD1 . ILE A 63  ? 0.5167 0.4474 0.4613 -0.0224 -0.0176 -0.0174 358 ILE A CD1 
397  N N   . ASN A 64  ? 0.4676 0.4659 0.4486 -0.0528 -0.0389 -0.0057 359 ASN A N   
398  C CA  . ASN A 64  ? 0.4165 0.4378 0.4075 -0.0605 -0.0467 -0.0011 359 ASN A CA  
399  C C   . ASN A 64  ? 0.3568 0.4063 0.3679 -0.0529 -0.0459 0.0023  359 ASN A C   
400  O O   . ASN A 64  ? 0.4081 0.4797 0.4260 -0.0535 -0.0519 0.0057  359 ASN A O   
401  C CB  . ASN A 64  ? 0.4103 0.4247 0.4008 -0.0701 -0.0476 0.0007  359 ASN A CB  
402  C CG  . ASN A 64  ? 0.5084 0.4966 0.4777 -0.0797 -0.0507 -0.0019 359 ASN A CG  
403  O OD1 . ASN A 64  ? 0.4980 0.4779 0.4543 -0.0808 -0.0544 -0.0044 359 ASN A OD1 
404  N ND2 . ASN A 64  ? 0.4313 0.4060 0.3964 -0.0866 -0.0492 -0.0015 359 ASN A ND2 
405  N N   . TRP A 65  ? 0.4042 0.4525 0.4238 -0.0454 -0.0383 0.0016  360 TRP A N   
406  C CA  . TRP A 65  ? 0.4179 0.4900 0.4551 -0.0372 -0.0369 0.0042  360 TRP A CA  
407  C C   . TRP A 65  ? 0.3513 0.4317 0.3880 -0.0296 -0.0379 0.0032  360 TRP A C   
408  O O   . TRP A 65  ? 0.3601 0.4638 0.4060 -0.0276 -0.0422 0.0068  360 TRP A O   
409  C CB  . TRP A 65  ? 0.3509 0.4169 0.3951 -0.0305 -0.0282 0.0029  360 TRP A CB  
410  C CG  . TRP A 65  ? 0.3912 0.4757 0.4493 -0.0203 -0.0259 0.0040  360 TRP A CG  
411  C CD1 . TRP A 65  ? 0.3217 0.4310 0.3952 -0.0183 -0.0284 0.0082  360 TRP A CD1 
412  C CD2 . TRP A 65  ? 0.3703 0.4488 0.4275 -0.0107 -0.0209 0.0010  360 TRP A CD2 
413  N NE1 . TRP A 65  ? 0.3172 0.4352 0.3982 -0.0079 -0.0253 0.0075  360 TRP A NE1 
414  C CE2 . TRP A 65  ? 0.3026 0.4022 0.3741 -0.0035 -0.0208 0.0031  360 TRP A CE2 
415  C CE3 . TRP A 65  ? 0.4275 0.4849 0.4730 -0.0072 -0.0166 -0.0029 360 TRP A CE3 
416  C CZ2 . TRP A 65  ? 0.2661 0.3651 0.3400 0.0060  -0.0168 0.0010  360 TRP A CZ2 
417  C CZ3 . TRP A 65  ? 0.3508 0.4093 0.4003 0.0025  -0.0126 -0.0044 360 TRP A CZ3 
418  C CH2 . TRP A 65  ? 0.3241 0.4027 0.3873 0.0086  -0.0128 -0.0026 360 TRP A CH2 
419  N N   . ALA A 66  ? 0.3623 0.4236 0.3882 -0.0249 -0.0337 -0.0013 361 ALA A N   
420  C CA  . ALA A 66  ? 0.3888 0.4553 0.4136 -0.0170 -0.0335 -0.0026 361 ALA A CA  
421  C C   . ALA A 66  ? 0.4259 0.5085 0.4491 -0.0206 -0.0413 -0.0001 361 ALA A C   
422  O O   . ALA A 66  ? 0.4991 0.6005 0.5298 -0.0145 -0.0424 0.0020  361 ALA A O   
423  C CB  . ALA A 66  ? 0.3760 0.4175 0.3873 -0.0133 -0.0287 -0.0073 361 ALA A CB  
424  N N   . LYS A 67  ? 0.4317 0.5067 0.4444 -0.0307 -0.0465 0.0001  362 LYS A N   
425  C CA  . LYS A 67  ? 0.3627 0.4524 0.3727 -0.0357 -0.0543 0.0030  362 LYS A CA  
426  C C   . LYS A 67  ? 0.3737 0.4935 0.3988 -0.0363 -0.0587 0.0097  362 LYS A C   
427  O O   . LYS A 67  ? 0.4205 0.5581 0.4465 -0.0365 -0.0637 0.0134  362 LYS A O   
428  C CB  . LYS A 67  ? 0.4206 0.4955 0.4168 -0.0479 -0.0596 0.0022  362 LYS A CB  
429  C CG  . LYS A 67  ? 0.5067 0.5531 0.4853 -0.0471 -0.0566 -0.0037 362 LYS A CG  
430  C CD  . LYS A 67  ? 0.7250 0.7526 0.6899 -0.0592 -0.0606 -0.0047 362 LYS A CD  
431  C CE  . LYS A 67  ? 0.8976 0.9057 0.8434 -0.0606 -0.0623 -0.0088 362 LYS A CE  
432  N NZ  . LYS A 67  ? 0.9560 0.9827 0.9022 -0.0609 -0.0682 -0.0069 362 LYS A NZ  
433  N N   . ARG A 68  ? 0.3297 0.4555 0.3663 -0.0360 -0.0567 0.0118  363 ARG A N   
434  C CA  . ARG A 68  ? 0.3504 0.5043 0.4020 -0.0353 -0.0602 0.0186  363 ARG A CA  
435  C C   . ARG A 68  ? 0.3883 0.5558 0.4508 -0.0224 -0.0556 0.0193  363 ARG A C   
436  O O   . ARG A 68  ? 0.4458 0.6368 0.5198 -0.0195 -0.0581 0.0251  363 ARG A O   
437  C CB  . ARG A 68  ? 0.3806 0.5358 0.4392 -0.0428 -0.0615 0.0214  363 ARG A CB  
438  C CG  . ARG A 68  ? 0.5035 0.6477 0.5516 -0.0565 -0.0674 0.0218  363 ARG A CG  
439  C CD  . ARG A 68  ? 0.6102 0.7574 0.6662 -0.0639 -0.0687 0.0252  363 ARG A CD  
440  N NE  . ARG A 68  ? 0.7175 0.8949 0.7910 -0.0611 -0.0716 0.0326  363 ARG A NE  
441  C CZ  . ARG A 68  ? 0.7731 0.9605 0.8568 -0.0666 -0.0738 0.0375  363 ARG A CZ  
442  N NH1 . ARG A 68  ? 0.7966 0.9656 0.8745 -0.0757 -0.0733 0.0354  363 ARG A NH1 
443  N NH2 . ARG A 68  ? 0.7573 0.9728 0.8568 -0.0626 -0.0763 0.0448  363 ARG A NH2 
444  N N   . VAL A 69  ? 0.3281 0.4804 0.3864 -0.0145 -0.0491 0.0137  364 VAL A N   
445  C CA  . VAL A 69  ? 0.2801 0.4428 0.3465 -0.0027 -0.0452 0.0138  364 VAL A CA  
446  C C   . VAL A 69  ? 0.3363 0.5141 0.4001 0.0011  -0.0487 0.0166  364 VAL A C   
447  O O   . VAL A 69  ? 0.3744 0.5424 0.4272 0.0003  -0.0492 0.0138  364 VAL A O   
448  C CB  . VAL A 69  ? 0.3055 0.4475 0.3676 0.0041  -0.0378 0.0076  364 VAL A CB  
449  C CG1 . VAL A 69  ? 0.2989 0.4510 0.3680 0.0157  -0.0346 0.0076  364 VAL A CG1 
450  C CG2 . VAL A 69  ? 0.2653 0.3934 0.3297 0.0010  -0.0336 0.0057  364 VAL A CG2 
451  N N   . PRO A 70  ? 0.3797 0.5816 0.4533 0.0056  -0.0510 0.0224  365 PRO A N   
452  C CA  . PRO A 70  ? 0.3669 0.5848 0.4378 0.0095  -0.0540 0.0263  365 PRO A CA  
453  C C   . PRO A 70  ? 0.3903 0.5958 0.4525 0.0169  -0.0495 0.0210  365 PRO A C   
454  O O   . PRO A 70  ? 0.3769 0.5741 0.4413 0.0250  -0.0440 0.0172  365 PRO A O   
455  C CB  . PRO A 70  ? 0.4022 0.6427 0.4847 0.0172  -0.0541 0.0322  365 PRO A CB  
456  C CG  . PRO A 70  ? 0.3912 0.6337 0.4833 0.0121  -0.0549 0.0339  365 PRO A CG  
457  C CD  . PRO A 70  ? 0.3810 0.5968 0.4681 0.0082  -0.0506 0.0263  365 PRO A CD  
458  N N   . GLY A 71  ? 0.3759 0.5805 0.4285 0.0139  -0.0521 0.0209  366 GLY A N   
459  C CA  . GLY A 71  ? 0.3897 0.5848 0.4345 0.0213  -0.0481 0.0166  366 GLY A CA  
460  C C   . GLY A 71  ? 0.4464 0.6151 0.4812 0.0180  -0.0456 0.0097  366 GLY A C   
461  O O   . GLY A 71  ? 0.4855 0.6470 0.5123 0.0219  -0.0436 0.0069  366 GLY A O   
462  N N   . PHE A 72  ? 0.4862 0.5371 0.4445 -0.0268 -0.0251 0.0025  367 PHE A N   
463  C CA  . PHE A 72  ? 0.4893 0.5319 0.4485 -0.0226 -0.0246 0.0038  367 PHE A CA  
464  C C   . PHE A 72  ? 0.4897 0.5325 0.4469 -0.0154 -0.0253 -0.0017 367 PHE A C   
465  O O   . PHE A 72  ? 0.4672 0.5039 0.4202 -0.0079 -0.0232 -0.0018 367 PHE A O   
466  C CB  . PHE A 72  ? 0.4273 0.4654 0.3926 -0.0287 -0.0268 0.0075  367 PHE A CB  
467  C CG  . PHE A 72  ? 0.4076 0.4372 0.3740 -0.0250 -0.0265 0.0094  367 PHE A CG  
468  C CD1 . PHE A 72  ? 0.4263 0.4503 0.3921 -0.0229 -0.0238 0.0124  367 PHE A CD1 
469  C CD2 . PHE A 72  ? 0.4220 0.4498 0.3910 -0.0235 -0.0290 0.0077  367 PHE A CD2 
470  C CE1 . PHE A 72  ? 0.3637 0.3801 0.3312 -0.0198 -0.0231 0.0137  367 PHE A CE1 
471  C CE2 . PHE A 72  ? 0.4183 0.4385 0.3882 -0.0200 -0.0290 0.0095  367 PHE A CE2 
472  C CZ  . PHE A 72  ? 0.4431 0.4576 0.4121 -0.0184 -0.0258 0.0124  367 PHE A CZ  
473  N N   . VAL A 73  ? 0.4909 0.5405 0.4514 -0.0172 -0.0280 -0.0066 368 VAL A N   
474  C CA  . VAL A 73  ? 0.5815 0.6320 0.5414 -0.0096 -0.0296 -0.0131 368 VAL A CA  
475  C C   . VAL A 73  ? 0.5755 0.6280 0.5263 -0.0006 -0.0282 -0.0187 368 VAL A C   
476  O O   . VAL A 73  ? 0.5986 0.6500 0.5464 0.0082  -0.0293 -0.0245 368 VAL A O   
477  C CB  . VAL A 73  ? 0.6248 0.6821 0.5931 -0.0141 -0.0329 -0.0179 368 VAL A CB  
478  C CG1 . VAL A 73  ? 0.6294 0.6825 0.6047 -0.0214 -0.0344 -0.0127 368 VAL A CG1 
479  C CG2 . VAL A 73  ? 0.5064 0.5731 0.4759 -0.0195 -0.0326 -0.0213 368 VAL A CG2 
480  N N   . ASP A 74  ? 0.5174 0.5723 0.4630 -0.0023 -0.0261 -0.0174 369 ASP A N   
481  C CA  . ASP A 74  ? 0.5604 0.6159 0.4953 0.0063  -0.0247 -0.0223 369 ASP A CA  
482  C C   . ASP A 74  ? 0.5853 0.6294 0.5121 0.0154  -0.0210 -0.0199 369 ASP A C   
483  O O   . ASP A 74  ? 0.5730 0.6141 0.4891 0.0251  -0.0195 -0.0245 369 ASP A O   
484  C CB  . ASP A 74  ? 0.5784 0.6396 0.5100 0.0019  -0.0238 -0.0208 369 ASP A CB  
485  C CG  . ASP A 74  ? 0.6173 0.6897 0.5553 -0.0059 -0.0267 -0.0241 369 ASP A CG  
486  O OD1 . ASP A 74  ? 0.6773 0.7542 0.6199 -0.0053 -0.0291 -0.0307 369 ASP A OD1 
487  O OD2 . ASP A 74  ? 0.6263 0.7027 0.5651 -0.0124 -0.0263 -0.0203 369 ASP A OD2 
488  N N   . LEU A 75  ? 0.5965 0.6337 0.5281 0.0124  -0.0192 -0.0131 370 LEU A N   
489  C CA  . LEU A 75  ? 0.4430 0.4688 0.3688 0.0197  -0.0146 -0.0102 370 LEU A CA  
490  C C   . LEU A 75  ? 0.5278 0.5483 0.4521 0.0280  -0.0157 -0.0133 370 LEU A C   
491  O O   . LEU A 75  ? 0.5579 0.5836 0.4889 0.0262  -0.0206 -0.0164 370 LEU A O   
492  C CB  . LEU A 75  ? 0.4778 0.4990 0.4106 0.0130  -0.0126 -0.0027 370 LEU A CB  
493  C CG  . LEU A 75  ? 0.5316 0.5571 0.4670 0.0056  -0.0118 0.0008  370 LEU A CG  
494  C CD1 . LEU A 75  ? 0.5053 0.5272 0.4497 -0.0010 -0.0118 0.0064  370 LEU A CD1 
495  C CD2 . LEU A 75  ? 0.4884 0.5108 0.4148 0.0111  -0.0071 0.0005  370 LEU A CD2 
496  N N   . THR A 76  ? 0.4243 0.4341 0.3400 0.0374  -0.0110 -0.0125 371 THR A N   
497  C CA  . THR A 76  ? 0.5052 0.5088 0.4191 0.0462  -0.0119 -0.0145 371 THR A CA  
498  C C   . THR A 76  ? 0.5591 0.5617 0.4845 0.0394  -0.0140 -0.0094 371 THR A C   
499  O O   . THR A 76  ? 0.5146 0.5177 0.4465 0.0302  -0.0129 -0.0041 371 THR A O   
500  C CB  . THR A 76  ? 0.5669 0.5573 0.4680 0.0579  -0.0051 -0.0139 371 THR A CB  
501  O OG1 . THR A 76  ? 0.6391 0.6226 0.5434 0.0534  0.0005  -0.0067 371 THR A OG1 
502  C CG2 . THR A 76  ? 0.5289 0.5185 0.4164 0.0647  -0.0026 -0.0186 371 THR A CG2 
503  N N   . ARG A 77  ? 0.5527 0.5539 0.4803 0.0446  -0.0175 -0.0116 372 ARG A N   
504  C CA  . ARG A 77  ? 0.5667 0.5666 0.5039 0.0392  -0.0202 -0.0073 372 ARG A CA  
505  C C   . ARG A 77  ? 0.5531 0.5435 0.4894 0.0386  -0.0145 -0.0011 372 ARG A C   
506  O O   . ARG A 77  ? 0.5185 0.5092 0.4630 0.0299  -0.0156 0.0031  372 ARG A O   
507  N N   . HIS A 78  ? 0.5092 0.4904 0.4353 0.0482  -0.0081 -0.0012 373 HIS A N   
508  C CA  . HIS A 78  ? 0.5736 0.5451 0.4995 0.0482  -0.0014 0.0038  373 HIS A CA  
509  C C   . HIS A 78  ? 0.4858 0.4608 0.4185 0.0374  0.0004  0.0071  373 HIS A C   
510  O O   . HIS A 78  ? 0.4757 0.4484 0.4164 0.0316  0.0010  0.0105  373 HIS A O   
511  C CB  . HIS A 78  ? 0.5426 0.5030 0.4551 0.0602  0.0066  0.0029  373 HIS A CB  
512  C CG  . HIS A 78  ? 0.5188 0.4688 0.4321 0.0601  0.0149  0.0075  373 HIS A CG  
513  N ND1 . HIS A 78  ? 0.5137 0.4593 0.4233 0.0593  0.0226  0.0089  373 HIS A ND1 
514  C CD2 . HIS A 78  ? 0.5068 0.4503 0.4251 0.0606  0.0169  0.0104  373 HIS A CD2 
515  C CE1 . HIS A 78  ? 0.4700 0.4066 0.3832 0.0592  0.0295  0.0122  373 HIS A CE1 
516  N NE2 . HIS A 78  ? 0.4902 0.4254 0.4084 0.0599  0.0262  0.0131  373 HIS A NE2 
517  N N   . ASP A 79  ? 0.4841 0.4646 0.4133 0.0353  0.0008  0.0054  374 ASP A N   
518  C CA  . ASP A 79  ? 0.4496 0.4339 0.3847 0.0263  0.0020  0.0082  374 ASP A CA  
519  C C   . ASP A 79  ? 0.4700 0.4617 0.4158 0.0159  -0.0047 0.0096  374 ASP A C   
520  O O   . ASP A 79  ? 0.4022 0.3937 0.3549 0.0094  -0.0042 0.0126  374 ASP A O   
521  C CB  . ASP A 79  ? 0.5363 0.5249 0.4640 0.0274  0.0034  0.0060  374 ASP A CB  
522  C CG  . ASP A 79  ? 0.6237 0.6027 0.5403 0.0366  0.0113  0.0055  374 ASP A CG  
523  O OD1 . ASP A 79  ? 0.6319 0.6009 0.5491 0.0396  0.0172  0.0081  374 ASP A OD1 
524  O OD2 . ASP A 79  ? 0.5905 0.5714 0.4973 0.0409  0.0120  0.0023  374 ASP A OD2 
525  N N   . GLN A 80  ? 0.4665 0.4642 0.4135 0.0149  -0.0107 0.0071  375 GLN A N   
526  C CA  . GLN A 80  ? 0.3909 0.3938 0.3466 0.0056  -0.0164 0.0085  375 GLN A CA  
527  C C   . GLN A 80  ? 0.4123 0.4089 0.3736 0.0037  -0.0170 0.0116  375 GLN A C   
528  O O   . GLN A 80  ? 0.4002 0.3972 0.3673 -0.0037 -0.0190 0.0139  375 GLN A O   
529  C CB  . GLN A 80  ? 0.3608 0.3705 0.3176 0.0053  -0.0218 0.0046  375 GLN A CB  
530  C CG  . GLN A 80  ? 0.3698 0.3873 0.3228 0.0054  -0.0220 0.0006  375 GLN A CG  
531  C CD  . GLN A 80  ? 0.5056 0.5301 0.4621 0.0050  -0.0269 -0.0044 375 GLN A CD  
532  O OE1 . GLN A 80  ? 0.4826 0.5078 0.4461 0.0005  -0.0307 -0.0036 375 GLN A OE1 
533  N NE2 . GLN A 80  ? 0.4967 0.5264 0.4485 0.0099  -0.0270 -0.0104 375 GLN A NE2 
534  N N   . VAL A 81  ? 0.4144 0.4046 0.3731 0.0112  -0.0154 0.0112  376 VAL A N   
535  C CA  . VAL A 81  ? 0.3982 0.3825 0.3619 0.0102  -0.0160 0.0136  376 VAL A CA  
536  C C   . VAL A 81  ? 0.3960 0.3753 0.3627 0.0079  -0.0106 0.0158  376 VAL A C   
537  O O   . VAL A 81  ? 0.4298 0.4081 0.4033 0.0020  -0.0128 0.0170  376 VAL A O   
538  C CB  . VAL A 81  ? 0.4457 0.4241 0.4055 0.0198  -0.0151 0.0128  376 VAL A CB  
539  C CG1 . VAL A 81  ? 0.4166 0.3890 0.3815 0.0187  -0.0151 0.0152  376 VAL A CG1 
540  C CG2 . VAL A 81  ? 0.4597 0.4435 0.4192 0.0224  -0.0216 0.0099  376 VAL A CG2 
541  N N   . HIS A 82  ? 0.4716 0.4475 0.4333 0.0128  -0.0035 0.0156  377 HIS A N   
542  C CA  . HIS A 82  ? 0.4499 0.4212 0.4157 0.0112  0.0025  0.0169  377 HIS A CA  
543  C C   . HIS A 82  ? 0.4254 0.4022 0.3985 0.0023  -0.0009 0.0175  377 HIS A C   
544  O O   . HIS A 82  ? 0.4535 0.4274 0.4343 -0.0008 0.0000  0.0178  377 HIS A O   
545  C CB  . HIS A 82  ? 0.4394 0.4063 0.3973 0.0178  0.0106  0.0165  377 HIS A CB  
546  C CG  . HIS A 82  ? 0.4051 0.3675 0.3684 0.0162  0.0175  0.0174  377 HIS A CG  
547  N ND1 . HIS A 82  ? 0.4131 0.3674 0.3819 0.0175  0.0226  0.0178  377 HIS A ND1 
548  C CD2 . HIS A 82  ? 0.4311 0.3963 0.3961 0.0135  0.0201  0.0174  377 HIS A CD2 
549  C CE1 . HIS A 82  ? 0.4213 0.3736 0.3960 0.0155  0.0284  0.0177  377 HIS A CE1 
550  N NE2 . HIS A 82  ? 0.4330 0.3918 0.4054 0.0133  0.0267  0.0176  377 HIS A NE2 
551  N N   . LEU A 83  ? 0.4009 0.3854 0.3716 -0.0011 -0.0048 0.0172  378 LEU A N   
552  C CA  . LEU A 83  ? 0.4182 0.4073 0.3942 -0.0085 -0.0081 0.0179  378 LEU A CA  
553  C C   . LEU A 83  ? 0.4327 0.4207 0.4142 -0.0137 -0.0140 0.0184  378 LEU A C   
554  O O   . LEU A 83  ? 0.3573 0.3439 0.3445 -0.0173 -0.0151 0.0184  378 LEU A O   
555  C CB  . LEU A 83  ? 0.4359 0.4332 0.4076 -0.0108 -0.0107 0.0175  378 LEU A CB  
556  C CG  . LEU A 83  ? 0.4701 0.4697 0.4356 -0.0066 -0.0062 0.0166  378 LEU A CG  
557  C CD1 . LEU A 83  ? 0.3623 0.3710 0.3245 -0.0098 -0.0099 0.0156  378 LEU A CD1 
558  C CD2 . LEU A 83  ? 0.4562 0.4529 0.4253 -0.0064 -0.0014 0.0177  378 LEU A CD2 
559  N N   . LEU A 84  ? 0.4037 0.3921 0.3834 -0.0134 -0.0181 0.0181  379 LEU A N   
560  C CA  . LEU A 84  ? 0.4006 0.3871 0.3838 -0.0179 -0.0239 0.0185  379 LEU A CA  
561  C C   . LEU A 84  ? 0.4110 0.3906 0.3989 -0.0163 -0.0227 0.0181  379 LEU A C   
562  O O   . LEU A 84  ? 0.4265 0.4038 0.4184 -0.0204 -0.0261 0.0175  379 LEU A O   
563  C CB  . LEU A 84  ? 0.4363 0.4253 0.4171 -0.0176 -0.0284 0.0180  379 LEU A CB  
564  C CG  . LEU A 84  ? 0.3842 0.3802 0.3629 -0.0215 -0.0309 0.0176  379 LEU A CG  
565  C CD1 . LEU A 84  ? 0.4735 0.4724 0.4513 -0.0190 -0.0338 0.0157  379 LEU A CD1 
566  C CD2 . LEU A 84  ? 0.3295 0.3251 0.3098 -0.0292 -0.0346 0.0189  379 LEU A CD2 
567  N N   . GLU A 85  ? 0.3458 0.3215 0.3326 -0.0100 -0.0179 0.0178  380 GLU A N   
568  C CA  . GLU A 85  ? 0.4494 0.4186 0.4414 -0.0082 -0.0150 0.0171  380 GLU A CA  
569  C C   . GLU A 85  ? 0.4180 0.3862 0.4170 -0.0118 -0.0132 0.0157  380 GLU A C   
570  O O   . GLU A 85  ? 0.4264 0.3919 0.4311 -0.0144 -0.0162 0.0138  380 GLU A O   
571  C CB  . GLU A 85  ? 0.5073 0.4717 0.4961 -0.0005 -0.0070 0.0174  380 GLU A CB  
572  C CG  . GLU A 85  ? 0.6550 0.6158 0.6406 0.0049  -0.0081 0.0178  380 GLU A CG  
573  C CD  . GLU A 85  ? 0.7205 0.6734 0.7037 0.0126  0.0010  0.0180  380 GLU A CD  
574  O OE1 . GLU A 85  ? 0.7615 0.7128 0.7392 0.0166  0.0075  0.0182  380 GLU A OE1 
575  O OE2 . GLU A 85  ? 0.7950 0.7426 0.7810 0.0147  0.0019  0.0179  380 GLU A OE2 
576  N N   . CYS A 86  ? 0.3748 0.3453 0.3733 -0.0112 -0.0086 0.0159  381 CYS A N   
577  C CA  . CYS A 86  ? 0.3764 0.3462 0.3827 -0.0131 -0.0060 0.0141  381 CYS A CA  
578  C C   . CYS A 86  ? 0.4015 0.3743 0.4102 -0.0184 -0.0131 0.0133  381 CYS A C   
579  O O   . CYS A 86  ? 0.4207 0.3918 0.4371 -0.0195 -0.0135 0.0104  381 CYS A O   
580  C CB  . CYS A 86  ? 0.3875 0.3591 0.3919 -0.0105 0.0005  0.0149  381 CYS A CB  
581  S SG  . CYS A 86  ? 0.4742 0.4391 0.4735 -0.0029 0.0106  0.0156  381 CYS A SG  
582  N N   . ALA A 87  ? 0.3789 0.3557 0.3810 -0.0212 -0.0185 0.0152  382 ALA A N   
583  C CA  . ALA A 87  ? 0.3827 0.3617 0.3844 -0.0256 -0.0237 0.0152  382 ALA A CA  
584  C C   . ALA A 87  ? 0.3638 0.3401 0.3631 -0.0291 -0.0309 0.0150  382 ALA A C   
585  O O   . ALA A 87  ? 0.3700 0.3453 0.3683 -0.0317 -0.0348 0.0145  382 ALA A O   
586  C CB  . ALA A 87  ? 0.3049 0.2906 0.3011 -0.0266 -0.0232 0.0175  382 ALA A CB  
587  N N   . TRP A 88  ? 0.3189 0.2931 0.3163 -0.0286 -0.0327 0.0153  383 TRP A N   
588  C CA  . TRP A 88  ? 0.3753 0.3470 0.3690 -0.0321 -0.0396 0.0155  383 TRP A CA  
589  C C   . TRP A 88  ? 0.4264 0.3927 0.4214 -0.0339 -0.0439 0.0128  383 TRP A C   
590  O O   . TRP A 88  ? 0.3895 0.3539 0.3792 -0.0370 -0.0482 0.0134  383 TRP A O   
591  C CB  . TRP A 88  ? 0.3924 0.3627 0.3850 -0.0306 -0.0416 0.0158  383 TRP A CB  
592  C CG  . TRP A 88  ? 0.4800 0.4455 0.4775 -0.0278 -0.0409 0.0135  383 TRP A CG  
593  C CD1 . TRP A 88  ? 0.4862 0.4510 0.4874 -0.0231 -0.0348 0.0131  383 TRP A CD1 
594  C CD2 . TRP A 88  ? 0.5657 0.5260 0.5644 -0.0292 -0.0464 0.0108  383 TRP A CD2 
595  N NE1 . TRP A 88  ? 0.5718 0.5318 0.5777 -0.0220 -0.0356 0.0104  383 TRP A NE1 
596  C CE2 . TRP A 88  ? 0.5822 0.5399 0.5868 -0.0257 -0.0432 0.0086  383 TRP A CE2 
597  C CE3 . TRP A 88  ? 0.5631 0.5199 0.5576 -0.0329 -0.0534 0.0098  383 TRP A CE3 
598  C CZ2 . TRP A 88  ? 0.5632 0.5162 0.5707 -0.0260 -0.0474 0.0049  383 TRP A CZ2 
599  C CZ3 . TRP A 88  ? 0.5662 0.5176 0.5622 -0.0327 -0.0580 0.0061  383 TRP A CZ3 
600  C CH2 . TRP A 88  ? 0.5476 0.4978 0.5505 -0.0293 -0.0552 0.0035  383 TRP A CH2 
601  N N   . LEU A 89  ? 0.3560 0.3191 0.3580 -0.0314 -0.0424 0.0092  384 LEU A N   
602  C CA  . LEU A 89  ? 0.2853 0.2429 0.2888 -0.0319 -0.0473 0.0049  384 LEU A CA  
603  C C   . LEU A 89  ? 0.3896 0.3480 0.3927 -0.0320 -0.0476 0.0043  384 LEU A C   
604  O O   . LEU A 89  ? 0.3470 0.3007 0.3448 -0.0329 -0.0529 0.0029  384 LEU A O   
605  C CB  . LEU A 89  ? 0.3416 0.2962 0.3542 -0.0291 -0.0457 -0.0001 384 LEU A CB  
606  C CG  . LEU A 89  ? 0.3798 0.3284 0.3938 -0.0288 -0.0519 -0.0062 384 LEU A CG  
607  C CD1 . LEU A 89  ? 0.4059 0.3501 0.4090 -0.0314 -0.0595 -0.0049 384 LEU A CD1 
608  C CD2 . LEU A 89  ? 0.3277 0.2740 0.3518 -0.0265 -0.0501 -0.0119 384 LEU A CD2 
609  N N   . GLU A 90  ? 0.3492 0.3128 0.3569 -0.0304 -0.0419 0.0053  385 GLU A N   
610  C CA  . GLU A 90  ? 0.3499 0.3155 0.3571 -0.0301 -0.0423 0.0055  385 GLU A CA  
611  C C   . GLU A 90  ? 0.3796 0.3452 0.3761 -0.0334 -0.0458 0.0094  385 GLU A C   
612  O O   . GLU A 90  ? 0.3922 0.3543 0.3846 -0.0332 -0.0495 0.0085  385 GLU A O   
613  C CB  . GLU A 90  ? 0.3642 0.3363 0.3759 -0.0285 -0.0358 0.0072  385 GLU A CB  
614  C CG  . GLU A 90  ? 0.4598 0.4314 0.4832 -0.0251 -0.0315 0.0030  385 GLU A CG  
615  C CD  . GLU A 90  ? 0.4734 0.4505 0.4992 -0.0236 -0.0251 0.0051  385 GLU A CD  
616  O OE1 . GLU A 90  ? 0.4147 0.3948 0.4432 -0.0225 -0.0257 0.0045  385 GLU A OE1 
617  O OE2 . GLU A 90  ? 0.4761 0.4542 0.5001 -0.0229 -0.0198 0.0073  385 GLU A OE2 
618  N N   . ILE A 91  ? 0.3475 0.3166 0.3394 -0.0359 -0.0444 0.0132  386 ILE A N   
619  C CA  . ILE A 91  ? 0.3769 0.3464 0.3601 -0.0396 -0.0465 0.0165  386 ILE A CA  
620  C C   . ILE A 91  ? 0.4046 0.3654 0.3816 -0.0414 -0.0523 0.0155  386 ILE A C   
621  O O   . ILE A 91  ? 0.4138 0.3710 0.3838 -0.0429 -0.0542 0.0166  386 ILE A O   
622  C CB  . ILE A 91  ? 0.3536 0.3288 0.3352 -0.0413 -0.0442 0.0191  386 ILE A CB  
623  C CG1 . ILE A 91  ? 0.3783 0.3612 0.3628 -0.0391 -0.0389 0.0200  386 ILE A CG1 
624  C CG2 . ILE A 91  ? 0.2744 0.2495 0.2491 -0.0458 -0.0463 0.0215  386 ILE A CG2 
625  C CD1 . ILE A 91  ? 0.4536 0.4413 0.4369 -0.0385 -0.0365 0.0209  386 ILE A CD1 
626  N N   . LEU A 92  ? 0.3198 0.2765 0.2984 -0.0408 -0.0549 0.0132  387 LEU A N   
627  C CA  . LEU A 92  ? 0.3558 0.3034 0.3273 -0.0420 -0.0608 0.0116  387 LEU A CA  
628  C C   . LEU A 92  ? 0.4434 0.3845 0.4132 -0.0390 -0.0636 0.0078  387 LEU A C   
629  O O   . LEU A 92  ? 0.3960 0.3294 0.3560 -0.0397 -0.0672 0.0079  387 LEU A O   
630  C CB  . LEU A 92  ? 0.3343 0.2793 0.3082 -0.0414 -0.0636 0.0093  387 LEU A CB  
631  C CG  . LEU A 92  ? 0.3901 0.3391 0.3637 -0.0434 -0.0632 0.0124  387 LEU A CG  
632  C CD1 . LEU A 92  ? 0.4010 0.3471 0.3774 -0.0416 -0.0664 0.0098  387 LEU A CD1 
633  C CD2 . LEU A 92  ? 0.3063 0.2532 0.2715 -0.0477 -0.0655 0.0155  387 LEU A CD2 
634  N N   . MET A 93  ? 0.3112 0.2548 0.2905 -0.0352 -0.0618 0.0040  388 MET A N   
635  C CA  . MET A 93  ? 0.2891 0.2273 0.2692 -0.0311 -0.0650 -0.0012 388 MET A CA  
636  C C   . MET A 93  ? 0.4215 0.3592 0.3954 -0.0303 -0.0648 0.0013  388 MET A C   
637  O O   . MET A 93  ? 0.3835 0.3125 0.3499 -0.0275 -0.0693 -0.0013 388 MET A O   
638  C CB  . MET A 93  ? 0.2951 0.2369 0.2893 -0.0273 -0.0624 -0.0064 388 MET A CB  
639  C CG  . MET A 93  ? 0.3264 0.2655 0.3262 -0.0268 -0.0638 -0.0111 388 MET A CG  
640  S SD  . MET A 93  ? 0.4465 0.3901 0.4645 -0.0233 -0.0584 -0.0169 388 MET A SD  
641  C CE  . MET A 93  ? 0.4071 0.3448 0.4284 -0.0225 -0.0626 -0.0238 388 MET A CE  
642  N N   . ILE A 94  ? 0.4081 0.3544 0.3841 -0.0320 -0.0599 0.0060  389 ILE A N   
643  C CA  . ILE A 94  ? 0.3791 0.3255 0.3492 -0.0313 -0.0597 0.0087  389 ILE A CA  
644  C C   . ILE A 94  ? 0.3829 0.3218 0.3392 -0.0345 -0.0618 0.0120  389 ILE A C   
645  O O   . ILE A 94  ? 0.4659 0.3978 0.4138 -0.0322 -0.0639 0.0119  389 ILE A O   
646  C CB  . ILE A 94  ? 0.4471 0.4049 0.4221 -0.0324 -0.0544 0.0126  389 ILE A CB  
647  C CG1 . ILE A 94  ? 0.3990 0.3569 0.3697 -0.0301 -0.0551 0.0141  389 ILE A CG1 
648  C CG2 . ILE A 94  ? 0.3809 0.3438 0.3526 -0.0378 -0.0514 0.0172  389 ILE A CG2 
649  C CD1 . ILE A 94  ? 0.3506 0.3197 0.3249 -0.0309 -0.0509 0.0175  389 ILE A CD1 
650  N N   . GLY A 95  ? 0.4128 0.3526 0.3668 -0.0394 -0.0610 0.0145  390 GLY A N   
651  C CA  . GLY A 95  ? 0.4221 0.3536 0.3641 -0.0429 -0.0626 0.0169  390 GLY A CA  
652  C C   . GLY A 95  ? 0.5178 0.4356 0.4511 -0.0394 -0.0682 0.0129  390 GLY A C   
653  O O   . GLY A 95  ? 0.4300 0.3385 0.3512 -0.0390 -0.0691 0.0143  390 GLY A O   
654  N N   . LEU A 96  ? 0.4809 0.3971 0.4199 -0.0363 -0.0717 0.0075  391 LEU A N   
655  C CA  . LEU A 96  ? 0.4687 0.3722 0.4000 -0.0320 -0.0779 0.0019  391 LEU A CA  
656  C C   . LEU A 96  ? 0.4878 0.3857 0.4151 -0.0257 -0.0795 -0.0010 391 LEU A C   
657  O O   . LEU A 96  ? 0.4961 0.3810 0.4097 -0.0226 -0.0831 -0.0026 391 LEU A O   
658  C CB  . LEU A 96  ? 0.3923 0.2973 0.3334 -0.0299 -0.0808 -0.0043 391 LEU A CB  
659  C CG  . LEU A 96  ? 0.4469 0.3403 0.3822 -0.0244 -0.0878 -0.0123 391 LEU A CG  
660  C CD1 . LEU A 96  ? 0.4746 0.3564 0.3937 -0.0266 -0.0919 -0.0110 391 LEU A CD1 
661  C CD2 . LEU A 96  ? 0.3969 0.2942 0.3452 -0.0224 -0.0894 -0.0191 391 LEU A CD2 
662  N N   . VAL A 97  ? 0.4239 0.3311 0.3628 -0.0230 -0.0768 -0.0018 392 VAL A N   
663  C CA  . VAL A 97  ? 0.4937 0.3973 0.4313 -0.0160 -0.0787 -0.0050 392 VAL A CA  
664  C C   . VAL A 97  ? 0.5370 0.4358 0.4611 -0.0165 -0.0770 0.0009  392 VAL A C   
665  O O   . VAL A 97  ? 0.5789 0.4673 0.4931 -0.0102 -0.0803 -0.0015 392 VAL A O   
666  C CB  . VAL A 97  ? 0.5187 0.4342 0.4731 -0.0136 -0.0760 -0.0071 392 VAL A CB  
667  C CG1 . VAL A 97  ? 0.6201 0.5346 0.5730 -0.0073 -0.0771 -0.0079 392 VAL A CG1 
668  C CG2 . VAL A 97  ? 0.4174 0.3335 0.3841 -0.0108 -0.0783 -0.0153 392 VAL A CG2 
669  N N   . TRP A 98  ? 0.5337 0.4397 0.4573 -0.0235 -0.0718 0.0082  393 TRP A N   
670  C CA  . TRP A 98  ? 0.5347 0.4362 0.4460 -0.0254 -0.0691 0.0140  393 TRP A CA  
671  C C   . TRP A 98  ? 0.5470 0.4317 0.4412 -0.0253 -0.0716 0.0138  393 TRP A C   
672  O O   . TRP A 98  ? 0.5931 0.4665 0.4744 -0.0207 -0.0724 0.0142  393 TRP A O   
673  C CB  . TRP A 98  ? 0.3950 0.3082 0.3108 -0.0334 -0.0632 0.0201  393 TRP A CB  
674  C CG  . TRP A 98  ? 0.5474 0.4563 0.4519 -0.0370 -0.0595 0.0256  393 TRP A CG  
675  C CD1 . TRP A 98  ? 0.6182 0.5224 0.5156 -0.0433 -0.0571 0.0287  393 TRP A CD1 
676  C CD2 . TRP A 98  ? 0.6455 0.5543 0.5451 -0.0343 -0.0574 0.0284  393 TRP A CD2 
677  N NE1 . TRP A 98  ? 0.6328 0.5337 0.5217 -0.0453 -0.0529 0.0331  393 TRP A NE1 
678  C CE2 . TRP A 98  ? 0.6673 0.5710 0.5568 -0.0397 -0.0531 0.0332  393 TRP A CE2 
679  C CE3 . TRP A 98  ? 0.6947 0.6075 0.5981 -0.0277 -0.0588 0.0272  393 TRP A CE3 
680  C CZ2 . TRP A 98  ? 0.6539 0.5560 0.5363 -0.0388 -0.0497 0.0370  393 TRP A CZ2 
681  C CZ3 . TRP A 98  ? 0.7075 0.6193 0.6036 -0.0263 -0.0564 0.0312  393 TRP A CZ3 
682  C CH2 . TRP A 98  ? 0.6220 0.5282 0.5074 -0.0319 -0.0517 0.0361  393 TRP A CH2 
683  N N   . ARG A 99  ? 0.5528 0.4349 0.4460 -0.0296 -0.0729 0.0132  394 ARG A N   
684  C CA  . ARG A 99  ? 0.5694 0.4353 0.4462 -0.0300 -0.0753 0.0130  394 ARG A CA  
685  C C   . ARG A 99  ? 0.6500 0.5013 0.5163 -0.0206 -0.0814 0.0064  394 ARG A C   
686  O O   . ARG A 99  ? 0.6204 0.4555 0.4686 -0.0182 -0.0823 0.0069  394 ARG A O   
687  C CB  . ARG A 99  ? 0.4717 0.3389 0.3515 -0.0352 -0.0771 0.0123  394 ARG A CB  
688  C CG  . ARG A 99  ? 0.5407 0.4207 0.4296 -0.0434 -0.0720 0.0177  394 ARG A CG  
689  C CD  . ARG A 99  ? 0.5704 0.4472 0.4569 -0.0480 -0.0741 0.0179  394 ARG A CD  
690  N NE  . ARG A 99  ? 0.5320 0.4120 0.4264 -0.0458 -0.0791 0.0130  394 ARG A NE  
691  C CZ  . ARG A 99  ? 0.5084 0.4019 0.4175 -0.0473 -0.0776 0.0130  394 ARG A CZ  
692  N NH1 . ARG A 99  ? 0.5298 0.4349 0.4467 -0.0503 -0.0720 0.0170  394 ARG A NH1 
693  N NH2 . ARG A 99  ? 0.4700 0.3648 0.3853 -0.0452 -0.0816 0.0086  394 ARG A NH2 
694  N N   . SER A 100 ? 0.5688 0.4252 0.4464 -0.0149 -0.0854 -0.0004 395 SER A N   
695  C CA  . SER A 100 ? 0.6182 0.4619 0.4885 -0.0056 -0.0923 -0.0090 395 SER A CA  
696  C C   . SER A 100 ? 0.6427 0.4803 0.5069 0.0035  -0.0933 -0.0107 395 SER A C   
697  O O   . SER A 100 ? 0.6570 0.4824 0.5131 0.0129  -0.0993 -0.0184 395 SER A O   
698  C CB  . SER A 100 ? 0.5848 0.4364 0.4715 -0.0034 -0.0962 -0.0169 395 SER A CB  
699  O OG  . SER A 100 ? 0.5587 0.4150 0.4500 -0.0107 -0.0958 -0.0154 395 SER A OG  
700  N N   . MET A 101 ? 0.5969 0.4429 0.4647 0.0013  -0.0878 -0.0041 396 MET A N   
701  C CA  . MET A 101 ? 0.6449 0.4882 0.5098 0.0102  -0.0886 -0.0052 396 MET A CA  
702  C C   . MET A 101 ? 0.6988 0.5208 0.5417 0.0193  -0.0925 -0.0082 396 MET A C   
703  O O   . MET A 101 ? 0.7311 0.5479 0.5735 0.0305  -0.0976 -0.0152 396 MET A O   
704  C CB  . MET A 101 ? 0.6326 0.4865 0.5007 0.0053  -0.0819 0.0036  396 MET A CB  
705  C CG  . MET A 101 ? 0.5898 0.4636 0.4792 0.0027  -0.0799 0.0039  396 MET A CG  
706  S SD  . MET A 101 ? 0.7216 0.6068 0.6121 -0.0027 -0.0728 0.0135  396 MET A SD  
707  C CE  . MET A 101 ? 0.6329 0.5069 0.5107 0.0086  -0.0754 0.0130  396 MET A CE  
708  N N   . GLU A 102 ? 0.8620 0.5567 0.5633 -0.0109 -0.0625 0.0898  397 GLU A N   
709  C CA  . GLU A 102 ? 0.9737 0.6285 0.6488 -0.0020 -0.0716 0.0877  397 GLU A CA  
710  C C   . GLU A 102 ? 0.9761 0.6239 0.6589 0.0018  -0.0808 0.0769  397 GLU A C   
711  O O   . GLU A 102 ? 0.9873 0.6070 0.6497 0.0055  -0.0842 0.0747  397 GLU A O   
712  C CB  . GLU A 102 ? 1.1337 0.7678 0.7794 -0.0051 -0.0622 0.0951  397 GLU A CB  
713  C CG  . GLU A 102 ? 1.2848 0.9414 0.9361 -0.0174 -0.0468 0.0986  397 GLU A CG  
714  C CD  . GLU A 102 ? 1.4383 1.0773 1.0616 -0.0206 -0.0368 0.1079  397 GLU A CD  
715  O OE1 . GLU A 102 ? 1.4386 1.0910 1.0623 -0.0301 -0.0242 0.1110  397 GLU A OE1 
716  O OE2 . GLU A 102 ? 1.5174 1.1291 1.1183 -0.0134 -0.0416 0.1122  397 GLU A OE2 
717  N N   . HIS A 103 ? 0.9586 0.6321 0.6710 0.0010  -0.0850 0.0701  398 HIS A N   
718  C CA  . HIS A 103 ? 0.8603 0.5283 0.5827 0.0056  -0.0956 0.0594  398 HIS A CA  
719  C C   . HIS A 103 ? 0.8127 0.4904 0.5560 0.0122  -0.1071 0.0542  398 HIS A C   
720  O O   . HIS A 103 ? 0.7646 0.4712 0.5362 0.0086  -0.1070 0.0492  398 HIS A O   
721  C CB  . HIS A 103 ? 0.8070 0.4995 0.5471 -0.0036 -0.0878 0.0552  398 HIS A CB  
722  C CG  . HIS A 103 ? 0.8529 0.5398 0.5753 -0.0110 -0.0754 0.0605  398 HIS A CG  
723  N ND1 . HIS A 103 ? 0.8227 0.4835 0.5259 -0.0089 -0.0774 0.0576  398 HIS A ND1 
724  C CD2 . HIS A 103 ? 0.8119 0.5159 0.5331 -0.0204 -0.0608 0.0685  398 HIS A CD2 
725  C CE1 . HIS A 103 ? 0.8472 0.5093 0.5382 -0.0167 -0.0646 0.0636  398 HIS A CE1 
726  N NE2 . HIS A 103 ? 0.8637 0.5517 0.5652 -0.0238 -0.0544 0.0703  398 HIS A NE2 
727  N N   . PRO A 104 ? 0.8632 0.5167 0.5923 0.0220  -0.1169 0.0555  399 PRO A N   
728  C CA  . PRO A 104 ? 0.8173 0.4771 0.5641 0.0292  -0.1285 0.0509  399 PRO A CA  
729  C C   . PRO A 104 ? 0.8150 0.4818 0.5822 0.0317  -0.1376 0.0395  399 PRO A C   
730  O O   . PRO A 104 ? 0.8107 0.4572 0.5670 0.0346  -0.1423 0.0341  399 PRO A O   
731  C CB  . PRO A 104 ? 0.9093 0.5321 0.6302 0.0401  -0.1384 0.0529  399 PRO A CB  
732  C CG  . PRO A 104 ? 0.9574 0.5643 0.6505 0.0365  -0.1282 0.0622  399 PRO A CG  
733  C CD  . PRO A 104 ? 0.9247 0.5429 0.6198 0.0270  -0.1176 0.0613  399 PRO A CD  
734  N N   . GLY A 105 ? 0.8034 0.4988 0.6002 0.0305  -0.1398 0.0359  400 GLY A N   
735  C CA  . GLY A 105 ? 0.7765 0.4811 0.5951 0.0328  -0.1484 0.0251  400 GLY A CA  
736  C C   . GLY A 105 ? 0.7245 0.4525 0.5585 0.0231  -0.1397 0.0218  400 GLY A C   
737  O O   . GLY A 105 ? 0.7480 0.4860 0.6012 0.0240  -0.1457 0.0129  400 GLY A O   
738  N N   . LYS A 106 ? 0.6477 0.3846 0.4734 0.0140  -0.1255 0.0289  401 LYS A N   
739  C CA  . LYS A 106 ? 0.6540 0.4118 0.4921 0.0046  -0.1165 0.0263  401 LYS A CA  
740  C C   . LYS A 106 ? 0.6534 0.4421 0.5017 -0.0065 -0.1011 0.0338  401 LYS A C   
741  O O   . LYS A 106 ? 0.6430 0.4310 0.4809 -0.0076 -0.0955 0.0425  401 LYS A O   
742  C CB  . LYS A 106 ? 0.6801 0.4120 0.4945 0.0044  -0.1151 0.0254  401 LYS A CB  
743  C CG  . LYS A 106 ? 0.7500 0.4528 0.5553 0.0144  -0.1296 0.0171  401 LYS A CG  
744  C CD  . LYS A 106 ? 0.8358 0.5118 0.6151 0.0141  -0.1272 0.0176  401 LYS A CD  
745  C CE  . LYS A 106 ? 1.0118 0.6535 0.7766 0.0252  -0.1419 0.0110  401 LYS A CE  
746  N NZ  . LYS A 106 ? 1.1509 0.7657 0.8893 0.0250  -0.1393 0.0118  401 LYS A NZ  
747  N N   . LEU A 107 ? 0.5910 0.4066 0.4595 -0.0146 -0.0943 0.0303  402 LEU A N   
748  C CA  . LEU A 107 ? 0.5217 0.3678 0.4009 -0.0256 -0.0794 0.0366  402 LEU A CA  
749  C C   . LEU A 107 ? 0.5937 0.4397 0.4644 -0.0332 -0.0697 0.0370  402 LEU A C   
750  O O   . LEU A 107 ? 0.5169 0.3655 0.3965 -0.0340 -0.0725 0.0293  402 LEU A O   
751  C CB  . LEU A 107 ? 0.4296 0.3126 0.3437 -0.0292 -0.0790 0.0325  402 LEU A CB  
752  C CG  . LEU A 107 ? 0.5034 0.3922 0.4283 -0.0233 -0.0861 0.0335  402 LEU A CG  
753  C CD1 . LEU A 107 ? 0.3684 0.2938 0.3282 -0.0272 -0.0853 0.0291  402 LEU A CD1 
754  C CD2 . LEU A 107 ? 0.5127 0.3993 0.4229 -0.0252 -0.0785 0.0444  402 LEU A CD2 
755  N N   . LEU A 108 ? 0.5044 0.3472 0.3576 -0.0387 -0.0583 0.0459  403 LEU A N   
756  C CA  . LEU A 108 ? 0.5110 0.3520 0.3536 -0.0459 -0.0483 0.0474  403 LEU A CA  
757  C C   . LEU A 108 ? 0.4754 0.3552 0.3408 -0.0571 -0.0358 0.0488  403 LEU A C   
758  O O   . LEU A 108 ? 0.5140 0.4053 0.3751 -0.0638 -0.0240 0.0570  403 LEU A O   
759  C CB  . LEU A 108 ? 0.5143 0.3302 0.3253 -0.0458 -0.0425 0.0563  403 LEU A CB  
760  C CG  . LEU A 108 ? 0.6657 0.4652 0.4565 -0.0496 -0.0358 0.0574  403 LEU A CG  
761  C CD1 . LEU A 108 ? 0.7827 0.5484 0.5404 -0.0450 -0.0359 0.0643  403 LEU A CD1 
762  C CD2 . LEU A 108 ? 0.7250 0.5529 0.5261 -0.0617 -0.0205 0.0611  403 LEU A CD2 
763  N N   . PHE A 109 ? 0.4173 0.3175 0.3075 -0.0589 -0.0385 0.0407  404 PHE A N   
764  C CA  . PHE A 109 ? 0.4656 0.4033 0.3791 -0.0692 -0.0273 0.0412  404 PHE A CA  
765  C C   . PHE A 109 ? 0.4897 0.4262 0.3898 -0.0773 -0.0150 0.0451  404 PHE A C   
766  O O   . PHE A 109 ? 0.5118 0.4724 0.4195 -0.0862 -0.0024 0.0503  404 PHE A O   
767  C CB  . PHE A 109 ? 0.3736 0.3299 0.3144 -0.0688 -0.0337 0.0311  404 PHE A CB  
768  C CG  . PHE A 109 ? 0.4663 0.4289 0.4242 -0.0619 -0.0446 0.0273  404 PHE A CG  
769  C CD1 . PHE A 109 ? 0.4426 0.4376 0.4245 -0.0660 -0.0402 0.0291  404 PHE A CD1 
770  C CD2 . PHE A 109 ? 0.4792 0.4151 0.4290 -0.0514 -0.0592 0.0218  404 PHE A CD2 
771  C CE1 . PHE A 109 ? 0.4348 0.4356 0.4327 -0.0596 -0.0502 0.0256  404 PHE A CE1 
772  C CE2 . PHE A 109 ? 0.5643 0.5058 0.5301 -0.0449 -0.0693 0.0182  404 PHE A CE2 
773  C CZ  . PHE A 109 ? 0.4396 0.4138 0.4296 -0.0491 -0.0647 0.0201  404 PHE A CZ  
774  N N   . ALA A 110 ? 0.4321 0.3398 0.3118 -0.0738 -0.0190 0.0425  405 ALA A N   
775  C CA  . ALA A 110 ? 0.4840 0.3841 0.3469 -0.0801 -0.0086 0.0459  405 ALA A CA  
776  C C   . ALA A 110 ? 0.5488 0.4076 0.3825 -0.0725 -0.0161 0.0452  405 ALA A C   
777  O O   . ALA A 110 ? 0.5792 0.4198 0.4107 -0.0633 -0.0294 0.0398  405 ALA A O   
778  C CB  . ALA A 110 ? 0.4837 0.4057 0.3652 -0.0869 -0.0040 0.0400  405 ALA A CB  
779  N N   . PRO A 111 ? 0.5871 0.4306 0.3979 -0.0762 -0.0076 0.0506  406 PRO A N   
780  C CA  . PRO A 111 ? 0.6099 0.4133 0.3921 -0.0688 -0.0145 0.0503  406 PRO A CA  
781  C C   . PRO A 111 ? 0.6425 0.4338 0.4285 -0.0637 -0.0252 0.0400  406 PRO A C   
782  O O   . PRO A 111 ? 0.6882 0.4475 0.4558 -0.0551 -0.0353 0.0376  406 PRO A O   
783  C CB  . PRO A 111 ? 0.6250 0.4214 0.3877 -0.0757 -0.0016 0.0570  406 PRO A CB  
784  C CG  . PRO A 111 ? 0.5602 0.3874 0.3356 -0.0844 0.0108  0.0640  406 PRO A CG  
785  C CD  . PRO A 111 ? 0.4993 0.3594 0.3078 -0.0865 0.0083  0.0581  406 PRO A CD  
786  N N   . ASN A 112 ? 0.5839 0.4006 0.3934 -0.0691 -0.0231 0.0339  407 ASN A N   
787  C CA  . ASN A 112 ? 0.6041 0.4127 0.4199 -0.0651 -0.0327 0.0238  407 ASN A CA  
788  C C   . ASN A 112 ? 0.6410 0.4669 0.4834 -0.0611 -0.0426 0.0168  407 ASN A C   
789  O O   . ASN A 112 ? 0.6462 0.4747 0.5012 -0.0594 -0.0495 0.0080  407 ASN A O   
790  C CB  . ASN A 112 ? 0.5870 0.4096 0.4095 -0.0735 -0.0240 0.0213  407 ASN A CB  
791  C CG  . ASN A 112 ? 0.6040 0.4682 0.4543 -0.0828 -0.0144 0.0219  407 ASN A CG  
792  O OD1 . ASN A 112 ? 0.5422 0.4237 0.4000 -0.0855 -0.0092 0.0278  407 ASN A OD1 
793  N ND2 . ASN A 112 ? 0.5423 0.4229 0.4084 -0.0877 -0.0122 0.0158  407 ASN A ND2 
794  N N   . LEU A 113 ? 0.5528 0.3909 0.4040 -0.0598 -0.0432 0.0207  408 LEU A N   
795  C CA  . LEU A 113 ? 0.5084 0.3615 0.3839 -0.0555 -0.0529 0.0144  408 LEU A CA  
796  C C   . LEU A 113 ? 0.6153 0.4560 0.4837 -0.0479 -0.0599 0.0182  408 LEU A C   
797  O O   . LEU A 113 ? 0.5952 0.4569 0.4760 -0.0505 -0.0556 0.0228  408 LEU A O   
798  C CB  . LEU A 113 ? 0.4820 0.3771 0.3880 -0.0641 -0.0447 0.0138  408 LEU A CB  
799  C CG  . LEU A 113 ? 0.5467 0.4588 0.4804 -0.0606 -0.0544 0.0051  408 LEU A CG  
800  C CD1 . LEU A 113 ? 0.6211 0.5205 0.5559 -0.0572 -0.0628 -0.0044 408 LEU A CD1 
801  C CD2 . LEU A 113 ? 0.5241 0.4777 0.4868 -0.0691 -0.0456 0.0055  408 LEU A CD2 
802  N N   . LEU A 114 ? 0.6152 0.4212 0.4632 -0.0384 -0.0707 0.0162  409 LEU A N   
803  C CA  . LEU A 114 ? 0.6684 0.4579 0.5071 -0.0300 -0.0789 0.0190  409 LEU A CA  
804  C C   . LEU A 114 ? 0.7147 0.5028 0.5696 -0.0219 -0.0937 0.0097  409 LEU A C   
805  O O   . LEU A 114 ? 0.7167 0.4844 0.5650 -0.0164 -0.1028 0.0027  409 LEU A O   
806  C CB  . LEU A 114 ? 0.6917 0.4420 0.4955 -0.0246 -0.0810 0.0231  409 LEU A CB  
807  C CG  . LEU A 114 ? 0.7554 0.4829 0.5438 -0.0155 -0.0892 0.0268  409 LEU A CG  
808  C CD1 . LEU A 114 ? 0.7086 0.4559 0.5029 -0.0196 -0.0811 0.0353  409 LEU A CD1 
809  C CD2 . LEU A 114 ? 0.7755 0.4639 0.5292 -0.0107 -0.0908 0.0300  409 LEU A CD2 
810  N N   . LEU A 115 ? 0.6829 0.4925 0.5589 -0.0211 -0.0960 0.0096  410 LEU A N   
811  C CA  . LEU A 115 ? 0.6422 0.4560 0.5380 -0.0146 -0.1089 0.0006  410 LEU A CA  
812  C C   . LEU A 115 ? 0.6386 0.4382 0.5301 -0.0051 -0.1193 0.0017  410 LEU A C   
813  O O   . LEU A 115 ? 0.5770 0.3839 0.4667 -0.0064 -0.1143 0.0093  410 LEU A O   
814  C CB  . LEU A 115 ? 0.5796 0.4341 0.5093 -0.0216 -0.1041 -0.0025 410 LEU A CB  
815  C CG  . LEU A 115 ? 0.5863 0.4601 0.5251 -0.0313 -0.0938 -0.0041 410 LEU A CG  
816  C CD1 . LEU A 115 ? 0.5849 0.4990 0.5574 -0.0375 -0.0895 -0.0067 410 LEU A CD1 
817  C CD2 . LEU A 115 ? 0.5565 0.4109 0.4885 -0.0280 -0.1010 -0.0123 410 LEU A CD2 
818  N N   . ASP A 116 ? 0.8255 0.4254 0.5916 0.0396  -0.1950 -0.0332 411 ASP A N   
819  C CA  . ASP A 116 ? 0.8264 0.4693 0.5906 0.0304  -0.2017 -0.0115 411 ASP A CA  
820  C C   . ASP A 116 ? 0.8155 0.4495 0.5776 0.0408  -0.1686 -0.0372 411 ASP A C   
821  O O   . ASP A 116 ? 0.8619 0.4590 0.6351 0.0553  -0.1425 -0.0676 411 ASP A O   
822  C CB  . ASP A 116 ? 0.8249 0.5086 0.6724 0.0260  -0.2260 0.0352  411 ASP A CB  
823  C CG  . ASP A 116 ? 0.9119 0.5882 0.8557 0.0415  -0.2121 0.0391  411 ASP A CG  
824  O OD1 . ASP A 116 ? 0.9110 0.5739 0.8673 0.0530  -0.1832 0.0167  411 ASP A OD1 
825  O OD2 . ASP A 116 ? 0.9222 0.6067 0.9300 0.0420  -0.2305 0.0654  411 ASP A OD2 
826  N N   . ARG A 117 ? 0.8014 0.4690 0.5494 0.0334  -0.1696 -0.0252 412 ARG A N   
827  C CA  . ARG A 117 ? 0.9228 0.5819 0.6509 0.0411  -0.1387 -0.0523 412 ARG A CA  
828  C C   . ARG A 117 ? 0.9730 0.6239 0.7843 0.0576  -0.1162 -0.0565 412 ARG A C   
829  O O   . ARG A 117 ? 1.0669 0.7063 0.8672 0.0661  -0.0883 -0.0812 412 ARG A O   
830  C CB  . ARG A 117 ? 0.8925 0.5900 0.5807 0.0283  -0.1461 -0.0384 412 ARG A CB  
831  C CG  . ARG A 117 ? 0.8764 0.6073 0.6316 0.0311  -0.1415 -0.0168 412 ARG A CG  
832  C CD  . ARG A 117 ? 0.8878 0.6529 0.5930 0.0182  -0.1473 -0.0074 412 ARG A CD  
833  N NE  . ARG A 117 ? 1.0091 0.7659 0.6966 0.0260  -0.1162 -0.0341 412 ARG A NE  
834  C CZ  . ARG A 117 ? 1.1852 0.9755 0.8926 0.0231  -0.1134 -0.0192 412 ARG A CZ  
835  N NH1 . ARG A 117 ? 1.2756 1.1100 1.0204 0.0123  -0.1401 0.0222  412 ARG A NH1 
836  N NH2 . ARG A 117 ? 1.2295 1.0092 0.9190 0.0308  -0.0841 -0.0456 412 ARG A NH2 
837  N N   . ASN A 118 ? 0.9221 0.5780 0.8156 0.0625  -0.1280 -0.0330 413 ASN A N   
838  C CA  . ASN A 118 ? 1.0610 0.7093 1.0375 0.0782  -0.1082 -0.0351 413 ASN A CA  
839  C C   . ASN A 118 ? 1.2021 0.8053 1.2048 0.0925  -0.0939 -0.0581 413 ASN A C   
840  O O   . ASN A 118 ? 1.2889 0.8704 1.3265 0.1074  -0.0667 -0.0786 413 ASN A O   
841  C CB  . ASN A 118 ? 1.0806 0.7711 1.1428 0.0749  -0.1285 0.0098  413 ASN A CB  
842  C CG  . ASN A 118 ? 1.1376 0.8678 1.1996 0.0682  -0.1285 0.0256  413 ASN A CG  
843  O OD1 . ASN A 118 ? 1.1594 0.8841 1.2254 0.0767  -0.1022 0.0067  413 ASN A OD1 
844  N ND2 . ASN A 118 ? 1.1508 0.9215 1.2086 0.0529  -0.1582 0.0605  413 ASN A ND2 
845  N N   . GLN A 119 ? 1.2587 0.8481 1.2444 0.0878  -0.1124 -0.0545 414 GLN A N   
846  C CA  . GLN A 119 ? 1.3136 0.8634 1.3305 0.1001  -0.1037 -0.0709 414 GLN A CA  
847  C C   . GLN A 119 ? 1.4150 0.9201 1.4042 0.1145  -0.0677 -0.1172 414 GLN A C   
848  O O   . GLN A 119 ? 1.4650 0.9562 1.5144 0.1291  -0.0471 -0.1258 414 GLN A O   
849  C CB  . GLN A 119 ? 1.2721 0.8112 1.2516 0.0912  -0.1273 -0.0663 414 GLN A CB  
850  C CG  . GLN A 119 ? 1.2683 0.8464 1.2851 0.0788  -0.1632 -0.0205 414 GLN A CG  
851  C CD  . GLN A 119 ? 1.3192 0.8833 1.3044 0.0716  -0.1849 -0.0173 414 GLN A CD  
852  O OE1 . GLN A 119 ? 1.3902 0.9147 1.3715 0.0804  -0.1745 -0.0410 414 GLN A OE1 
853  N NE2 . GLN A 119 ? 1.3091 0.9059 1.2718 0.0555  -0.2153 0.0122  414 GLN A NE2 
854  N N   . GLY A 120 ? 1.4328 0.9151 1.3311 0.1106  -0.0602 -0.1470 415 GLY A N   
855  C CA  . GLY A 120 ? 1.4768 0.9165 1.3408 0.1236  -0.0265 -0.1921 415 GLY A CA  
856  C C   . GLY A 120 ? 1.4859 0.9336 1.3739 0.1320  -0.0011 -0.2011 415 GLY A C   
857  O O   . GLY A 120 ? 1.5027 0.9875 1.3884 0.1236  -0.0080 -0.1818 415 GLY A O   
858  N N   . LYS A 121 ? 1.5433 0.9563 1.4548 0.1487  0.0285  -0.2302 416 LYS A N   
859  C CA  . LYS A 121 ? 1.5882 1.0042 1.5180 0.1578  0.0553  -0.2430 416 LYS A CA  
860  C C   . LYS A 121 ? 1.6000 1.0004 1.4358 0.1558  0.0741  -0.2775 416 LYS A C   
861  O O   . LYS A 121 ? 1.6162 0.9772 1.3993 0.1607  0.0874  -0.3112 416 LYS A O   
862  C CB  . LYS A 121 ? 1.6307 1.0164 1.6274 0.1769  0.0793  -0.2591 416 LYS A CB  
863  N N   . CME A 122 ? 1.5694 1.0009 1.3841 0.1486  0.0751  -0.2690 417 CME A N   
864  C CA  . CME A 122 ? 1.5664 0.9883 1.2890 0.1445  0.0892  -0.2976 417 CME A CA  
865  C CB  . CME A 122 ? 1.5656 1.0145 1.2274 0.1256  0.0617  -0.2791 417 CME A CB  
866  S SG  . CME A 122 ? 1.6434 1.0787 1.2630 0.1158  0.0348  -0.2747 417 CME A SG  
867  S SD  . CME A 122 ? 1.5826 1.0768 1.1736 0.0909  -0.0071 -0.2282 417 CME A SD  
868  C CE  . CME A 122 ? 1.1131 0.6412 0.8067 0.0880  -0.0362 -0.1784 417 CME A CE  
869  C CZ  . CME A 122 ? 1.1146 0.6263 0.8258 0.0876  -0.0542 -0.1706 417 CME A CZ  
870  O OH  . CME A 122 ? 1.0953 0.6334 0.8822 0.0846  -0.0776 -0.1318 417 CME A OH  
871  C C   . CME A 122 ? 1.5782 1.0158 1.3047 0.1479  0.1095  -0.3033 417 CME A C   
872  O O   . CME A 122 ? 1.5858 1.0578 1.3732 0.1466  0.1027  -0.2746 417 CME A O   
873  N N   . VAL A 123 ? 1.0560 1.3159 1.4594 0.1431  0.0723  -0.0053 418 VAL A N   
874  C CA  . VAL A 123 ? 1.0171 1.2970 1.4714 0.1455  0.0736  0.0322  418 VAL A CA  
875  C C   . VAL A 123 ? 0.9631 1.2218 1.4114 0.1062  0.0400  0.0390  418 VAL A C   
876  O O   . VAL A 123 ? 0.9511 1.1838 1.3438 0.0846  0.0242  0.0079  418 VAL A O   
877  C CB  . VAL A 123 ? 0.9579 1.2610 1.3981 0.1768  0.1052  0.0243  418 VAL A CB  
878  C CG1 . VAL A 123 ? 0.9624 1.2913 1.4644 0.1864  0.1119  0.0668  418 VAL A CG1 
879  C CG2 . VAL A 123 ? 0.8777 1.1946 1.2999 0.2131  0.1376  0.0032  418 VAL A CG2 
880  N N   . GLU A 124 ? 0.9434 1.2127 1.4483 0.0967  0.0290  0.0794  419 GLU A N   
881  C CA  . GLU A 124 ? 0.8966 1.1465 1.4000 0.0591  -0.0032 0.0885  419 GLU A CA  
882  C C   . GLU A 124 ? 0.8070 1.0519 1.2622 0.0558  0.0000  0.0661  419 GLU A C   
883  O O   . GLU A 124 ? 0.7354 0.9572 1.1655 0.0237  -0.0263 0.0583  419 GLU A O   
884  C CB  . GLU A 124 ? 0.9226 1.1860 1.4994 0.0505  -0.0151 0.1378  419 GLU A CB  
885  C CG  . GLU A 124 ? 0.9775 1.2723 1.5909 0.0764  0.0084  0.1626  419 GLU A CG  
886  C CD  . GLU A 124 ? 1.0539 1.3638 1.7440 0.0718  -0.0008 0.2119  419 GLU A CD  
887  O OE1 . GLU A 124 ? 1.1149 1.4425 1.8351 0.0779  0.0054  0.2360  419 GLU A OE1 
888  O OE2 . GLU A 124 ? 1.0210 1.3249 1.7414 0.0618  -0.0143 0.2265  419 GLU A OE2 
889  N N   . GLY A 125 ? 0.7467 1.0130 1.1884 0.0890  0.0322  0.0554  420 GLY A N   
890  C CA  . GLY A 125 ? 0.6948 0.9562 1.0846 0.0889  0.0382  0.0292  420 GLY A CA  
891  C C   . GLY A 125 ? 0.6682 0.9019 0.9863 0.0765  0.0304  -0.0167 420 GLY A C   
892  O O   . GLY A 125 ? 0.4667 0.6829 0.7381 0.0583  0.0189  -0.0388 420 GLY A O   
893  N N   . MET A 126 ? 0.6205 0.8503 0.9302 0.0862  0.0367  -0.0309 421 MET A N   
894  C CA  . MET A 126 ? 0.6484 0.8526 0.8929 0.0760  0.0301  -0.0740 421 MET A CA  
895  C C   . MET A 126 ? 0.6627 0.8348 0.8945 0.0326  -0.0089 -0.0763 421 MET A C   
896  O O   . MET A 126 ? 0.6711 0.8195 0.8443 0.0146  -0.0209 -0.1090 421 MET A O   
897  C CB  . MET A 126 ? 0.7053 0.9152 0.9498 0.0987  0.0475  -0.0853 421 MET A CB  
898  C CG  . MET A 126 ? 0.7332 0.9726 0.9813 0.1421  0.0870  -0.0890 421 MET A CG  
899  S SD  . MET A 126 ? 1.0927 1.3239 1.2559 0.1566  0.1064  -0.1428 421 MET A SD  
900  C CE  . MET A 126 ? 1.0259 1.2361 1.1575 0.1520  0.1003  -0.1716 421 MET A CE  
901  N N   . VAL A 127 ? 0.4240 0.5954 0.7105 0.0157  -0.0287 -0.0417 422 VAL A N   
902  C CA  . VAL A 127 ? 0.4743 0.6154 0.7518 -0.0256 -0.0662 -0.0423 422 VAL A CA  
903  C C   . VAL A 127 ? 0.5055 0.6338 0.7618 -0.0508 -0.0845 -0.0441 422 VAL A C   
904  O O   . VAL A 127 ? 0.5420 0.6413 0.7610 -0.0820 -0.1105 -0.0627 422 VAL A O   
905  C CB  . VAL A 127 ? 0.5510 0.6924 0.8907 -0.0393 -0.0848 -0.0060 422 VAL A CB  
906  C CG1 . VAL A 127 ? 0.6360 0.8089 1.0332 -0.0063 -0.0597 0.0224  422 VAL A CG1 
907  C CG2 . VAL A 127 ? 0.4390 0.5657 0.8022 -0.0767 -0.1188 0.0181  422 VAL A CG2 
908  N N   . GLU A 128 ? 0.4470 0.5968 0.7250 -0.0364 -0.0701 -0.0260 423 GLU A N   
909  C CA  . GLU A 128 ? 0.5400 0.6800 0.7949 -0.0562 -0.0832 -0.0298 423 GLU A CA  
910  C C   . GLU A 128 ? 0.4968 0.6189 0.6733 -0.0579 -0.0791 -0.0772 423 GLU A C   
911  O O   . GLU A 128 ? 0.5117 0.6078 0.6519 -0.0886 -0.1035 -0.0928 423 GLU A O   
912  C CB  . GLU A 128 ? 0.6267 0.7956 0.9176 -0.0355 -0.0640 -0.0037 423 GLU A CB  
913  C CG  . GLU A 128 ? 0.7894 0.9785 1.1590 -0.0310 -0.0655 0.0441  423 GLU A CG  
914  C CD  . GLU A 128 ? 0.9579 1.1756 1.3610 -0.0100 -0.0458 0.0685  423 GLU A CD  
915  O OE1 . GLU A 128 ? 1.0301 1.2687 1.4975 0.0001  -0.0411 0.1067  423 GLU A OE1 
916  O OE2 . GLU A 128 ? 1.0121 1.2315 1.3773 -0.0036 -0.0349 0.0495  423 GLU A OE2 
917  N N   . ILE A 129 ? 0.3697 0.4669 0.6822 -0.0284 -0.1388 -0.0353 424 ILE A N   
918  C CA  . ILE A 129 ? 0.3947 0.4708 0.6829 -0.0303 -0.1204 -0.0229 424 ILE A CA  
919  C C   . ILE A 129 ? 0.4031 0.4624 0.6554 -0.0139 -0.1225 -0.0088 424 ILE A C   
920  O O   . ILE A 129 ? 0.4791 0.5202 0.6978 -0.0114 -0.1170 -0.0029 424 ILE A O   
921  C CB  . ILE A 129 ? 0.4296 0.5069 0.7423 -0.0392 -0.1020 -0.0162 424 ILE A CB  
922  C CG1 . ILE A 129 ? 0.4531 0.5462 0.8012 -0.0559 -0.0988 -0.0298 424 ILE A CG1 
923  C CG2 . ILE A 129 ? 0.4639 0.5186 0.7502 -0.0402 -0.0835 -0.0029 424 ILE A CG2 
924  C CD1 . ILE A 129 ? 0.4474 0.5471 0.8270 -0.0638 -0.0845 -0.0253 424 ILE A CD1 
925  N N   . PHE A 130 ? 0.3607 0.4266 0.6207 -0.0028 -0.1305 -0.0034 425 PHE A N   
926  C CA  . PHE A 130 ? 0.4068 0.4584 0.6347 0.0135  -0.1340 0.0096  425 PHE A CA  
927  C C   . PHE A 130 ? 0.3552 0.3995 0.5508 0.0205  -0.1473 0.0045  425 PHE A C   
928  O O   . PHE A 130 ? 0.4322 0.4572 0.5920 0.0268  -0.1425 0.0138  425 PHE A O   
929  C CB  . PHE A 130 ? 0.4540 0.5174 0.6988 0.0240  -0.1443 0.0127  425 PHE A CB  
930  C CG  . PHE A 130 ? 0.4855 0.5339 0.7027 0.0395  -0.1432 0.0289  425 PHE A CG  
931  C CD1 . PHE A 130 ? 0.5292 0.5695 0.7143 0.0530  -0.1567 0.0305  425 PHE A CD1 
932  C CD2 . PHE A 130 ? 0.4354 0.4779 0.6591 0.0406  -0.1288 0.0423  425 PHE A CD2 
933  C CE1 . PHE A 130 ? 0.4983 0.5245 0.6578 0.0673  -0.1556 0.0454  425 PHE A CE1 
934  C CE2 . PHE A 130 ? 0.4134 0.4420 0.6120 0.0548  -0.1277 0.0572  425 PHE A CE2 
935  C CZ  . PHE A 130 ? 0.4378 0.4582 0.6042 0.0681  -0.1411 0.0588  425 PHE A CZ  
936  N N   . ASP A 131 ? 0.3075 0.3677 0.5166 0.0192  -0.1640 -0.0104 426 ASP A N   
937  C CA  . ASP A 131 ? 0.3458 0.4014 0.5277 0.0251  -0.1779 -0.0171 426 ASP A CA  
938  C C   . ASP A 131 ? 0.4179 0.4583 0.5764 0.0171  -0.1672 -0.0173 426 ASP A C   
939  O O   . ASP A 131 ? 0.4789 0.5052 0.6016 0.0250  -0.1715 -0.0142 426 ASP A O   
940  C CB  . ASP A 131 ? 0.3163 0.3932 0.5223 0.0222  -0.1959 -0.0346 426 ASP A CB  
941  C CG  . ASP A 131 ? 0.5498 0.6392 0.7682 0.0342  -0.2113 -0.0348 426 ASP A CG  
942  O OD1 . ASP A 131 ? 0.5382 0.6178 0.7393 0.0469  -0.2107 -0.0214 426 ASP A OD1 
943  O OD2 . ASP A 131 ? 0.5484 0.6574 0.7940 0.0308  -0.2241 -0.0483 426 ASP A OD2 
944  N N   . MET A 132 ? 0.4411 0.4840 0.6195 0.0015  -0.1531 -0.0211 427 MET A N   
945  C CA  . MET A 132 ? 0.4948 0.5237 0.6533 -0.0072 -0.1419 -0.0215 427 MET A CA  
946  C C   . MET A 132 ? 0.4386 0.4444 0.5659 -0.0015 -0.1271 -0.0045 427 MET A C   
947  O O   . MET A 132 ? 0.4454 0.4357 0.5409 -0.0003 -0.1244 -0.0023 427 MET A O   
948  C CB  . MET A 132 ? 0.4964 0.5345 0.6857 -0.0255 -0.1308 -0.0301 427 MET A CB  
949  C CG  . MET A 132 ? 0.5211 0.5787 0.7346 -0.0331 -0.1444 -0.0486 427 MET A CG  
950  S SD  . MET A 132 ? 0.5905 0.6563 0.8357 -0.0549 -0.1303 -0.0583 427 MET A SD  
951  C CE  . MET A 132 ? 0.4446 0.5200 0.7253 -0.0577 -0.1195 -0.0510 427 MET A CE  
952  N N   . LEU A 133 ? 0.3057 0.3096 0.4425 0.0019  -0.1176 0.0074  428 LEU A N   
953  C CA  . LEU A 133 ? 0.3371 0.3197 0.4463 0.0077  -0.1032 0.0242  428 LEU A CA  
954  C C   . LEU A 133 ? 0.4075 0.3776 0.4785 0.0241  -0.1140 0.0308  428 LEU A C   
955  O O   . LEU A 133 ? 0.4250 0.3760 0.4625 0.0270  -0.1068 0.0382  428 LEU A O   
956  C CB  . LEU A 133 ? 0.3209 0.3059 0.4510 0.0086  -0.0923 0.0349  428 LEU A CB  
957  C CG  . LEU A 133 ? 0.2722 0.2650 0.4351 -0.0078 -0.0777 0.0310  428 LEU A CG  
958  C CD1 . LEU A 133 ? 0.3096 0.3113 0.5006 -0.0065 -0.0724 0.0377  428 LEU A CD1 
959  C CD2 . LEU A 133 ? 0.2491 0.2238 0.3939 -0.0158 -0.0591 0.0369  428 LEU A CD2 
960  N N   . LEU A 134 ? 0.4175 0.3987 0.4938 0.0349  -0.1313 0.0280  429 LEU A N   
961  C CA  . LEU A 134 ? 0.4681 0.4398 0.5102 0.0509  -0.1441 0.0325  429 LEU A CA  
962  C C   . LEU A 134 ? 0.4715 0.4352 0.4864 0.0496  -0.1498 0.0251  429 LEU A C   
963  O O   . LEU A 134 ? 0.5175 0.4631 0.4951 0.0581  -0.1483 0.0336  429 LEU A O   
964  C CB  . LEU A 134 ? 0.5040 0.4922 0.5612 0.0605  -0.1637 0.0269  429 LEU A CB  
965  C CG  . LEU A 134 ? 0.5103 0.5022 0.5816 0.0685  -0.1618 0.0375  429 LEU A CG  
966  C CD1 . LEU A 134 ? 0.4983 0.5086 0.5880 0.0759  -0.1819 0.0292  429 LEU A CD1 
967  C CD2 . LEU A 134 ? 0.5475 0.5182 0.5834 0.0814  -0.1553 0.0549  429 LEU A CD2 
968  N N   . ALA A 135 ? 0.4073 0.3845 0.4411 0.0387  -0.1562 0.0092  430 ALA A N   
969  C CA  . ALA A 135 ? 0.4296 0.4012 0.4409 0.0366  -0.1625 0.0007  430 ALA A CA  
970  C C   . ALA A 135 ? 0.4643 0.4153 0.4500 0.0313  -0.1449 0.0087  430 ALA A C   
971  O O   . ALA A 135 ? 0.5103 0.4464 0.4599 0.0382  -0.1473 0.0122  430 ALA A O   
972  C CB  . ALA A 135 ? 0.3831 0.3733 0.4232 0.0243  -0.1701 -0.0175 430 ALA A CB  
973  N N   . THR A 136 ? 0.4694 0.4198 0.4741 0.0191  -0.1273 0.0115  431 THR A N   
974  C CA  . THR A 136 ? 0.4897 0.4214 0.4737 0.0129  -0.1094 0.0190  431 THR A CA  
975  C C   . THR A 136 ? 0.4837 0.3951 0.4317 0.0265  -0.1045 0.0354  431 THR A C   
976  O O   . THR A 136 ? 0.4792 0.3736 0.3946 0.0281  -0.0999 0.0393  431 THR A O   
977  C CB  . THR A 136 ? 0.4564 0.3910 0.4688 -0.0005 -0.0912 0.0212  431 THR A CB  
978  O OG1 . THR A 136 ? 0.4222 0.3777 0.4717 -0.0117 -0.0969 0.0065  431 THR A OG1 
979  C CG2 . THR A 136 ? 0.3763 0.2936 0.3700 -0.0092 -0.0740 0.0253  431 THR A CG2 
980  N N   . SER A 137 ? 0.4778 0.3911 0.4319 0.0364  -0.1057 0.0450  432 SER A N   
981  C CA  . SER A 137 ? 0.4616 0.3565 0.3837 0.0497  -0.1012 0.0611  432 SER A CA  
982  C C   . SER A 137 ? 0.5474 0.4342 0.4339 0.0621  -0.1158 0.0601  432 SER A C   
983  O O   . SER A 137 ? 0.6194 0.4867 0.4708 0.0683  -0.1096 0.0699  432 SER A O   
984  C CB  . SER A 137 ? 0.5264 0.4272 0.4647 0.0581  -0.1017 0.0702  432 SER A CB  
985  O OG  . SER A 137 ? 0.5617 0.4437 0.4707 0.0694  -0.0943 0.0866  432 SER A OG  
986  N N   . SER A 138 ? 0.5553 0.4572 0.4509 0.0658  -0.1353 0.0483  433 SER A N   
987  C CA  . SER A 138 ? 0.5952 0.4913 0.4592 0.0769  -0.1506 0.0456  433 SER A CA  
988  C C   . SER A 138 ? 0.6156 0.5005 0.4570 0.0698  -0.1460 0.0408  433 SER A C   
989  O O   . SER A 138 ? 0.6916 0.5605 0.4956 0.0785  -0.1477 0.0465  433 SER A O   
990  C CB  . SER A 138 ? 0.6511 0.5673 0.5337 0.0802  -0.1720 0.0320  433 SER A CB  
991  O OG  . SER A 138 ? 0.7706 0.6970 0.6736 0.0871  -0.1768 0.0363  433 SER A OG  
992  N N   . ARG A 139 ? 0.5033 0.5561 0.3790 0.1415  -0.0449 0.0363  434 ARG A N   
993  C CA  . ARG A 139 ? 0.5644 0.6289 0.4581 0.1016  -0.0515 0.0214  434 ARG A CA  
994  C C   . ARG A 139 ? 0.5833 0.5781 0.5130 0.0797  -0.0415 -0.0128 434 ARG A C   
995  O O   . ARG A 139 ? 0.6424 0.6231 0.5819 0.0443  -0.0327 -0.0147 434 ARG A O   
996  C CB  . ARG A 139 ? 0.6023 0.7165 0.4995 0.1052  -0.0758 0.0095  434 ARG A CB  
997  C CG  . ARG A 139 ? 0.6870 0.8171 0.6025 0.0651  -0.0841 -0.0062 434 ARG A CG  
998  C CD  . ARG A 139 ? 0.7656 0.9613 0.6551 0.0484  -0.0887 0.0253  434 ARG A CD  
999  N NE  . ARG A 139 ? 0.8242 1.0341 0.7319 0.0098  -0.0965 0.0096  434 ARG A NE  
1000 C CZ  . ARG A 139 ? 0.8011 0.9935 0.7161 -0.0262 -0.0845 0.0115  434 ARG A CZ  
1001 N NH1 . ARG A 139 ? 0.8522 1.0128 0.7578 -0.0284 -0.0641 0.0288  434 ARG A NH1 
1002 N NH2 . ARG A 139 ? 0.6863 0.8932 0.6180 -0.0598 -0.0929 -0.0037 434 ARG A NH2 
1003 N N   . PHE A 140 ? 0.5902 0.5413 0.5396 0.1008  -0.0427 -0.0397 435 PHE A N   
1004 C CA  . PHE A 140 ? 0.5675 0.4499 0.5518 0.0829  -0.0333 -0.0736 435 PHE A CA  
1005 C C   . PHE A 140 ? 0.5371 0.3737 0.5181 0.0722  -0.0090 -0.0611 435 PHE A C   
1006 O O   . PHE A 140 ? 0.5530 0.3514 0.5556 0.0409  0.0006  -0.0770 435 PHE A O   
1007 C CB  . PHE A 140 ? 0.5772 0.4227 0.5802 0.1117  -0.0386 -0.1021 435 PHE A CB  
1008 C CG  . PHE A 140 ? 0.5495 0.4196 0.5694 0.1114  -0.0608 -0.1278 435 PHE A CG  
1009 C CD1 . PHE A 140 ? 0.5803 0.4806 0.6101 0.0783  -0.0712 -0.1356 435 PHE A CD1 
1010 C CD2 . PHE A 140 ? 0.5882 0.4501 0.6149 0.1440  -0.0709 -0.1448 435 PHE A CD2 
1011 C CE1 . PHE A 140 ? 0.5511 0.4735 0.5967 0.0780  -0.0915 -0.1595 435 PHE A CE1 
1012 C CE2 . PHE A 140 ? 0.5272 0.4114 0.5696 0.1439  -0.0913 -0.1687 435 PHE A CE2 
1013 C CZ  . PHE A 140 ? 0.5220 0.4364 0.5737 0.1110  -0.1016 -0.1760 435 PHE A CZ  
1014 N N   . ARG A 141 ? 0.5728 0.4138 0.5267 0.0986  0.0009  -0.0324 436 ARG A N   
1015 C CA  . ARG A 141 ? 0.6309 0.4345 0.5771 0.0910  0.0239  -0.0159 436 ARG A CA  
1016 C C   . ARG A 141 ? 0.6603 0.4870 0.6008 0.0518  0.0286  -0.0005 436 ARG A C   
1017 O O   . ARG A 141 ? 0.6668 0.4498 0.6232 0.0249  0.0431  -0.0096 436 ARG A O   
1018 C CB  . ARG A 141 ? 0.6523 0.4713 0.5653 0.1262  0.0308  0.0170  436 ARG A CB  
1019 C CG  . ARG A 141 ? 0.6777 0.4465 0.5853 0.1271  0.0553  0.0296  436 ARG A CG  
1020 C CD  . ARG A 141 ? 0.7055 0.4992 0.5772 0.1599  0.0609  0.0658  436 ARG A CD  
1021 N NE  . ARG A 141 ? 0.8807 0.6864 0.7476 0.1992  0.0487  0.0605  436 ARG A NE  
1022 C CZ  . ARG A 141 ? 0.8817 0.7478 0.7219 0.2220  0.0359  0.0835  436 ARG A CZ  
1023 N NH1 . ARG A 141 ? 0.8546 0.7762 0.6695 0.2099  0.0334  0.1142  436 ARG A NH1 
1024 N NH2 . ARG A 141 ? 0.8648 0.7355 0.7034 0.2572  0.0257  0.0758  436 ARG A NH2 
1025 N N   . MET A 142 ? 0.5468 0.4427 0.4650 0.0485  0.0160  0.0223  437 MET A N   
1026 C CA  . MET A 142 ? 0.6358 0.5610 0.5450 0.0134  0.0195  0.0403  437 MET A CA  
1027 C C   . MET A 142 ? 0.6901 0.5917 0.6319 -0.0254 0.0174  0.0100  437 MET A C   
1028 O O   . MET A 142 ? 0.6621 0.5465 0.6080 -0.0566 0.0299  0.0147  437 MET A O   
1029 C CB  . MET A 142 ? 0.7127 0.7187 0.5945 0.0185  0.0037  0.0664  437 MET A CB  
1030 C CG  . MET A 142 ? 0.8220 0.8578 0.6689 0.0547  0.0056  0.0999  437 MET A CG  
1031 S SD  . MET A 142 ? 1.9650 1.9699 1.7918 0.0541  0.0323  0.1302  437 MET A SD  
1032 C CE  . MET A 142 ? 1.3947 1.4292 1.2171 0.0067  0.0359  0.1453  437 MET A CE  
1033 N N   . MET A 143 ? 0.6185 0.4967 0.5013 0.0061  0.0778  -0.0574 438 MET A N   
1034 C CA  . MET A 143 ? 0.6544 0.5415 0.5460 0.0108  0.0842  -0.0471 438 MET A CA  
1035 C C   . MET A 143 ? 0.5439 0.4434 0.4447 0.0106  0.0890  -0.0365 438 MET A C   
1036 O O   . MET A 143 ? 0.5757 0.4845 0.4846 0.0154  0.0947  -0.0291 438 MET A O   
1037 C CB  . MET A 143 ? 0.6185 0.5140 0.5201 0.0047  0.0802  -0.0451 438 MET A CB  
1038 C CG  . MET A 143 ? 0.6086 0.4936 0.5021 0.0036  0.0764  -0.0533 438 MET A CG  
1039 S SD  . MET A 143 ? 0.6771 0.5705 0.5798 -0.0035 0.0725  -0.0479 438 MET A SD  
1040 C CE  . MET A 143 ? 0.5541 0.4472 0.4607 0.0080  0.0775  -0.0390 438 MET A CE  
1041 N N   . ASN A 144 ? 0.5250 0.4251 0.4253 0.0046  0.0859  -0.0364 439 ASN A N   
1042 C CA  . ASN A 144 ? 0.5439 0.4558 0.4537 0.0021  0.0898  -0.0258 439 ASN A CA  
1043 C C   . ASN A 144 ? 0.5245 0.4546 0.4546 -0.0018 0.0894  -0.0183 439 ASN A C   
1044 O O   . ASN A 144 ? 0.4860 0.4281 0.4261 0.0008  0.0963  -0.0098 439 ASN A O   
1045 C CB  . ASN A 144 ? 0.6300 0.5403 0.5325 0.0111  0.1004  -0.0211 439 ASN A CB  
1046 C CG  . ASN A 144 ? 0.7395 0.6618 0.6497 0.0069  0.1054  -0.0104 439 ASN A CG  
1047 O OD1 . ASN A 144 ? 0.7943 0.7158 0.7063 -0.0018 0.0994  -0.0086 439 ASN A OD1 
1048 N ND2 . ASN A 144 ? 0.7176 0.6517 0.6330 0.0130  0.1157  -0.0038 439 ASN A ND2 
1049 N N   . LEU A 145 ? 0.4936 0.4262 0.4293 -0.0077 0.0812  -0.0223 440 LEU A N   
1050 C CA  . LEU A 145 ? 0.4263 0.3736 0.3793 -0.0110 0.0793  -0.0164 440 LEU A CA  
1051 C C   . LEU A 145 ? 0.5032 0.4641 0.4713 -0.0140 0.0810  -0.0072 440 LEU A C   
1052 O O   . LEU A 145 ? 0.4980 0.4577 0.4652 -0.0189 0.0774  -0.0067 440 LEU A O   
1053 C CB  . LEU A 145 ? 0.4337 0.3826 0.3889 -0.0185 0.0693  -0.0224 440 LEU A CB  
1054 C CG  . LEU A 145 ? 0.4615 0.4238 0.4328 -0.0217 0.0659  -0.0170 440 LEU A CG  
1055 C CD1 . LEU A 145 ? 0.5317 0.4918 0.5024 -0.0161 0.0701  -0.0143 440 LEU A CD1 
1056 C CD2 . LEU A 145 ? 0.4609 0.4270 0.4333 -0.0294 0.0559  -0.0233 440 LEU A CD2 
1057 N N   . GLN A 146 ? 0.5133 0.4865 0.4956 -0.0110 0.0854  -0.0004 441 GLN A N   
1058 C CA  . GLN A 146 ? 0.4194 0.4078 0.4192 -0.0140 0.0876  0.0082  441 GLN A CA  
1059 C C   . GLN A 146 ? 0.4325 0.4316 0.4500 -0.0194 0.0790  0.0101  441 GLN A C   
1060 O O   . GLN A 146 ? 0.4373 0.4353 0.4555 -0.0187 0.0744  0.0067  441 GLN A O   
1061 C CB  . GLN A 146 ? 0.4937 0.4916 0.4998 -0.0065 0.0982  0.0130  441 GLN A CB  
1062 C CG  . GLN A 146 ? 0.5704 0.5604 0.5600 -0.0001 0.1069  0.0115  441 GLN A CG  
1063 C CD  . GLN A 146 ? 0.6672 0.6545 0.6502 -0.0054 0.1093  0.0152  441 GLN A CD  
1064 O OE1 . GLN A 146 ? 0.7780 0.7784 0.7733 -0.0100 0.1129  0.0230  441 GLN A OE1 
1065 N NE2 . GLN A 146 ? 0.5558 0.5252 0.5190 -0.0051 0.1066  0.0093  441 GLN A NE2 
1066 N N   . GLY A 147 ? 0.4742 0.4831 0.5056 -0.0249 0.0765  0.0158  442 GLY A N   
1067 C CA  . GLY A 147 ? 0.3887 0.4083 0.4386 -0.0289 0.0676  0.0176  442 GLY A CA  
1068 C C   . GLY A 147 ? 0.4226 0.4501 0.4842 -0.0238 0.0694  0.0189  442 GLY A C   
1069 O O   . GLY A 147 ? 0.5001 0.5288 0.5662 -0.0248 0.0613  0.0164  442 GLY A O   
1070 N N   . GLU A 148 ? 0.3629 0.3958 0.4284 -0.0179 0.0793  0.0223  443 GLU A N   
1071 C CA  . GLU A 148 ? 0.3307 0.3697 0.4066 -0.0118 0.0800  0.0222  443 GLU A CA  
1072 C C   . GLU A 148 ? 0.3817 0.4071 0.4424 -0.0087 0.0756  0.0163  443 GLU A C   
1073 O O   . GLU A 148 ? 0.4710 0.4973 0.5380 -0.0065 0.0705  0.0157  443 GLU A O   
1074 C CB  . GLU A 148 ? 0.3479 0.3962 0.4294 -0.0051 0.0910  0.0244  443 GLU A CB  
1075 C CG  . GLU A 148 ? 0.5222 0.5877 0.6226 -0.0089 0.0961  0.0310  443 GLU A CG  
1076 C CD  . GLU A 148 ? 0.6441 0.7066 0.7336 -0.0141 0.1019  0.0346  443 GLU A CD  
1077 O OE1 . GLU A 148 ? 0.6180 0.6649 0.6856 -0.0132 0.1020  0.0308  443 GLU A OE1 
1078 O OE2 . GLU A 148 ? 0.7577 0.8327 0.8603 -0.0192 0.1061  0.0412  443 GLU A OE2 
1079 N N   . GLU A 149 ? 0.4492 0.4611 0.4896 -0.0086 0.0774  0.0121  444 GLU A N   
1080 C CA  . GLU A 149 ? 0.4511 0.4494 0.4763 -0.0074 0.0734  0.0069  444 GLU A CA  
1081 C C   . GLU A 149 ? 0.4670 0.4636 0.4903 -0.0154 0.0639  0.0040  444 GLU A C   
1082 O O   . GLU A 149 ? 0.3797 0.3713 0.3985 -0.0163 0.0588  0.0023  444 GLU A O   
1083 C CB  . GLU A 149 ? 0.4495 0.4348 0.4554 -0.0044 0.0782  0.0025  444 GLU A CB  
1084 C CG  . GLU A 149 ? 0.4923 0.4791 0.4972 0.0049  0.0872  0.0039  444 GLU A CG  
1085 C CD  . GLU A 149 ? 0.4931 0.4664 0.4788 0.0088  0.0911  -0.0009 444 GLU A CD  
1086 O OE1 . GLU A 149 ? 0.4947 0.4614 0.4715 0.0036  0.0898  -0.0036 444 GLU A OE1 
1087 O OE2 . GLU A 149 ? 0.4510 0.4197 0.4308 0.0179  0.0943  -0.0028 444 GLU A OE2 
1088 N N   . PHE A 150 ? 0.4178 0.4186 0.4436 -0.0212 0.0610  0.0032  445 PHE A N   
1089 C CA  . PHE A 150 ? 0.3883 0.3913 0.4141 -0.0281 0.0511  -0.0010 445 PHE A CA  
1090 C C   . PHE A 150 ? 0.3637 0.3761 0.4039 -0.0287 0.0448  0.0019  445 PHE A C   
1091 O O   . PHE A 150 ? 0.3659 0.3764 0.3998 -0.0317 0.0390  -0.0015 445 PHE A O   
1092 C CB  . PHE A 150 ? 0.3254 0.3319 0.3541 -0.0326 0.0472  -0.0026 445 PHE A CB  
1093 C CG  . PHE A 150 ? 0.3410 0.3558 0.3772 -0.0382 0.0352  -0.0064 445 PHE A CG  
1094 C CD1 . PHE A 150 ? 0.4389 0.4508 0.4631 -0.0422 0.0293  -0.0158 445 PHE A CD1 
1095 C CD2 . PHE A 150 ? 0.4150 0.4421 0.4711 -0.0391 0.0296  -0.0014 445 PHE A CD2 
1096 C CE1 . PHE A 150 ? 0.3179 0.3402 0.3492 -0.0465 0.0179  -0.0206 445 PHE A CE1 
1097 C CE2 . PHE A 150 ? 0.4141 0.4497 0.4777 -0.0428 0.0172  -0.0056 445 PHE A CE2 
1098 C CZ  . PHE A 150 ? 0.3267 0.3607 0.3776 -0.0462 0.0113  -0.0155 445 PHE A CZ  
1099 N N   . VAL A 151 ? 0.3984 0.4212 0.4574 -0.0259 0.0459  0.0080  446 VAL A N   
1100 C CA  . VAL A 151 ? 0.3098 0.3409 0.3838 -0.0250 0.0392  0.0102  446 VAL A CA  
1101 C C   . VAL A 151 ? 0.3740 0.3966 0.4398 -0.0211 0.0393  0.0097  446 VAL A C   
1102 O O   . VAL A 151 ? 0.4012 0.4238 0.4674 -0.0225 0.0319  0.0089  446 VAL A O   
1103 C CB  . VAL A 151 ? 0.3811 0.4254 0.4792 -0.0226 0.0403  0.0162  446 VAL A CB  
1104 C CG1 . VAL A 151 ? 0.3558 0.4069 0.4620 -0.0282 0.0362  0.0173  446 VAL A CG1 
1105 C CG2 . VAL A 151 ? 0.3332 0.3782 0.4336 -0.0169 0.0515  0.0193  446 VAL A CG2 
1106 N N   . CYS A 152 ? 0.3415 0.3559 0.3987 -0.0161 0.0467  0.0100  447 CYS A N   
1107 C CA  . CYS A 152 ? 0.3716 0.3744 0.4181 -0.0126 0.0449  0.0090  447 CYS A CA  
1108 C C   . CYS A 152 ? 0.3844 0.3765 0.4118 -0.0194 0.0402  0.0054  447 CYS A C   
1109 O O   . CYS A 152 ? 0.3798 0.3665 0.4021 -0.0210 0.0340  0.0057  447 CYS A O   
1110 C CB  . CYS A 152 ? 0.4192 0.4155 0.4597 -0.0052 0.0523  0.0086  447 CYS A CB  
1111 S SG  . CYS A 152 ? 0.4632 0.4743 0.5263 0.0036  0.0575  0.0115  447 CYS A SG  
1112 N N   . LEU A 153 ? 0.3199 0.3091 0.3364 -0.0237 0.0430  0.0015  448 LEU A N   
1113 C CA  . LEU A 153 ? 0.3447 0.3259 0.3438 -0.0308 0.0397  -0.0033 448 LEU A CA  
1114 C C   . LEU A 153 ? 0.3652 0.3563 0.3685 -0.0376 0.0317  -0.0048 448 LEU A C   
1115 O O   . LEU A 153 ? 0.3612 0.3476 0.3532 -0.0428 0.0278  -0.0060 448 LEU A O   
1116 C CB  . LEU A 153 ? 0.4159 0.3933 0.4049 -0.0331 0.0437  -0.0090 448 LEU A CB  
1117 C CG  . LEU A 153 ? 0.4852 0.4502 0.4644 -0.0267 0.0508  -0.0094 448 LEU A CG  
1118 C CD1 . LEU A 153 ? 0.4875 0.4493 0.4584 -0.0282 0.0537  -0.0156 448 LEU A CD1 
1119 C CD2 . LEU A 153 ? 0.4524 0.4031 0.4177 -0.0269 0.0490  -0.0096 448 LEU A CD2 
1120 N N   . LYS A 154 ? 0.2978 0.3027 0.3170 -0.0376 0.0288  -0.0046 449 LYS A N   
1121 C CA  . LYS A 154 ? 0.3266 0.3429 0.3519 -0.0422 0.0199  -0.0068 449 LYS A CA  
1122 C C   . LYS A 154 ? 0.3017 0.3173 0.3307 -0.0400 0.0155  -0.0023 449 LYS A C   
1123 O O   . LYS A 154 ? 0.3449 0.3632 0.3675 -0.0448 0.0095  -0.0044 449 LYS A O   
1124 C CB  . LYS A 154 ? 0.3118 0.3415 0.3551 -0.0414 0.0159  -0.0071 449 LYS A CB  
1125 C CG  . LYS A 154 ? 0.3622 0.4051 0.4113 -0.0455 0.0051  -0.0120 449 LYS A CG  
1126 C CD  . LYS A 154 ? 0.3583 0.4112 0.4212 -0.0457 -0.0008 -0.0142 449 LYS A CD  
1127 C CE  . LYS A 154 ? 0.3867 0.4426 0.4692 -0.0407 0.0012  -0.0057 449 LYS A CE  
1128 N NZ  . LYS A 154 ? 0.4324 0.4996 0.5316 -0.0416 -0.0088 -0.0066 449 LYS A NZ  
1129 N N   . SER A 155 ? 0.3376 0.3500 0.3766 -0.0326 0.0181  0.0031  450 SER A N   
1130 C CA  . SER A 155 ? 0.4003 0.4090 0.4423 -0.0290 0.0130  0.0063  450 SER A CA  
1131 C C   . SER A 155 ? 0.3883 0.3800 0.4076 -0.0320 0.0122  0.0064  450 SER A C   
1132 O O   . SER A 155 ? 0.4023 0.3899 0.4154 -0.0339 0.0056  0.0076  450 SER A O   
1133 C CB  . SER A 155 ? 0.4181 0.4283 0.4769 -0.0198 0.0158  0.0100  450 SER A CB  
1134 O OG  . SER A 155 ? 0.5351 0.5612 0.6163 -0.0184 0.0149  0.0111  450 SER A OG  
1135 N N   . ILE A 156 ? 0.3082 0.2891 0.3147 -0.0324 0.0184  0.0054  451 ILE A N   
1136 C CA  . ILE A 156 ? 0.3602 0.3238 0.3447 -0.0365 0.0170  0.0057  451 ILE A CA  
1137 C C   . ILE A 156 ? 0.3873 0.3540 0.3591 -0.0477 0.0136  0.0030  451 ILE A C   
1138 O O   . ILE A 156 ? 0.3229 0.2801 0.2809 -0.0525 0.0088  0.0052  451 ILE A O   
1139 C CB  . ILE A 156 ? 0.3519 0.3048 0.3268 -0.0343 0.0236  0.0041  451 ILE A CB  
1140 C CG1 . ILE A 156 ? 0.3332 0.2814 0.3166 -0.0229 0.0254  0.0064  451 ILE A CG1 
1141 C CG2 . ILE A 156 ? 0.3429 0.2799 0.2950 -0.0417 0.0218  0.0033  451 ILE A CG2 
1142 C CD1 . ILE A 156 ? 0.3545 0.2946 0.3307 -0.0183 0.0317  0.0044  451 ILE A CD1 
1143 N N   . ILE A 157 ? 0.3389 0.3193 0.3148 -0.0521 0.0154  -0.0024 452 ILE A N   
1144 C CA  . ILE A 157 ? 0.2906 0.2789 0.2567 -0.0623 0.0122  -0.0072 452 ILE A CA  
1145 C C   . ILE A 157 ? 0.3374 0.3332 0.3068 -0.0637 0.0045  -0.0049 452 ILE A C   
1146 O O   . ILE A 157 ? 0.3284 0.3228 0.2829 -0.0718 0.0018  -0.0052 452 ILE A O   
1147 C CB  . ILE A 157 ? 0.3636 0.3676 0.3376 -0.0645 0.0127  -0.0151 452 ILE A CB  
1148 C CG1 . ILE A 157 ? 0.3497 0.3447 0.3154 -0.0647 0.0197  -0.0192 452 ILE A CG1 
1149 C CG2 . ILE A 157 ? 0.2977 0.3159 0.2666 -0.0733 0.0074  -0.0216 452 ILE A CG2 
1150 C CD1 . ILE A 157 ? 0.3838 0.3904 0.3552 -0.0660 0.0189  -0.0278 452 ILE A CD1 
1151 N N   . LEU A 158 ? 0.3156 0.3198 0.3048 -0.0557 0.0011  -0.0025 453 LEU A N   
1152 C CA  . LEU A 158 ? 0.3492 0.3611 0.3449 -0.0544 -0.0070 -0.0009 453 LEU A CA  
1153 C C   . LEU A 158 ? 0.3955 0.3897 0.3765 -0.0545 -0.0100 0.0046  453 LEU A C   
1154 O O   . LEU A 158 ? 0.3329 0.3282 0.3032 -0.0598 -0.0153 0.0050  453 LEU A O   
1155 C CB  . LEU A 158 ? 0.3622 0.3839 0.3840 -0.0447 -0.0098 0.0008  453 LEU A CB  
1156 C CG  . LEU A 158 ? 0.3964 0.4236 0.4280 -0.0403 -0.0189 0.0026  453 LEU A CG  
1157 C CD1 . LEU A 158 ? 0.3549 0.3988 0.3852 -0.0456 -0.0254 -0.0028 453 LEU A CD1 
1158 C CD2 . LEU A 158 ? 0.3485 0.3824 0.4069 -0.0304 -0.0205 0.0048  453 LEU A CD2 
1159 N N   . LEU A 159 ? 0.3858 0.3636 0.3656 -0.0485 -0.0074 0.0085  454 LEU A N   
1160 C CA  . LEU A 159 ? 0.3494 0.3074 0.3156 -0.0472 -0.0126 0.0132  454 LEU A CA  
1161 C C   . LEU A 159 ? 0.4342 0.3765 0.3729 -0.0578 -0.0117 0.0146  454 LEU A C   
1162 O O   . LEU A 159 ? 0.4858 0.4149 0.4079 -0.0622 -0.0178 0.0183  454 LEU A O   
1163 C CB  . LEU A 159 ? 0.3600 0.3078 0.3366 -0.0357 -0.0120 0.0151  454 LEU A CB  
1164 C CG  . LEU A 159 ? 0.4773 0.4407 0.4823 -0.0260 -0.0128 0.0142  454 LEU A CG  
1165 C CD1 . LEU A 159 ? 0.5078 0.4669 0.5244 -0.0160 -0.0091 0.0142  454 LEU A CD1 
1166 C CD2 . LEU A 159 ? 0.4487 0.4126 0.4582 -0.0230 -0.0225 0.0152  454 LEU A CD2 
1167 N N   . ASN A 160 ? 0.4378 0.3809 0.3713 -0.0625 -0.0046 0.0116  455 ASN A N   
1168 C CA  . ASN A 160 ? 0.5015 0.4284 0.4111 -0.0721 -0.0035 0.0129  455 ASN A CA  
1169 C C   . ASN A 160 ? 0.5243 0.4601 0.4196 -0.0864 -0.0034 0.0107  455 ASN A C   
1170 O O   . ASN A 160 ? 0.5756 0.4971 0.4497 -0.0958 -0.0059 0.0145  455 ASN A O   
1171 C CB  . ASN A 160 ? 0.4666 0.3886 0.3763 -0.0699 0.0036  0.0099  455 ASN A CB  
1172 C CG  . ASN A 160 ? 0.5003 0.4053 0.3874 -0.0795 0.0040  0.0109  455 ASN A CG  
1173 O OD1 . ASN A 160 ? 0.5576 0.4679 0.4403 -0.0861 0.0094  0.0059  455 ASN A OD1 
1174 N ND2 . ASN A 160 ? 0.4694 0.3528 0.3420 -0.0805 -0.0028 0.0171  455 ASN A ND2 
1175 N N   . SER A 161 ? 0.5141 0.4736 0.4207 -0.0885 -0.0012 0.0041  456 SER A N   
1176 C CA  . SER A 161 ? 0.5846 0.5568 0.4797 -0.1017 0.0003  -0.0012 456 SER A CA  
1177 C C   . SER A 161 ? 0.5485 0.5200 0.4271 -0.1111 -0.0046 0.0027  456 SER A C   
1178 O O   . SER A 161 ? 0.6338 0.6049 0.4943 -0.1245 -0.0023 0.0018  456 SER A O   
1179 C CB  . SER A 161 ? 0.5784 0.5767 0.4900 -0.1005 0.0013  -0.0109 456 SER A CB  
1180 O OG  . SER A 161 ? 0.5912 0.5872 0.5095 -0.0965 0.0069  -0.0152 456 SER A OG  
1181 N N   . GLY A 162 ? 0.4567 0.4280 0.3410 -0.1043 -0.0113 0.0070  457 GLY A N   
1182 C CA  . GLY A 162 ? 0.5510 0.5215 0.4189 -0.1121 -0.0165 0.0108  457 GLY A CA  
1183 C C   . GLY A 162 ? 0.6249 0.5657 0.4767 -0.1107 -0.0225 0.0207  457 GLY A C   
1184 O O   . GLY A 162 ? 0.6682 0.6046 0.5048 -0.1159 -0.0280 0.0249  457 GLY A O   
1185 N N   . VAL A 163 ? 0.6129 0.5330 0.4667 -0.1034 -0.0223 0.0238  458 VAL A N   
1186 C CA  . VAL A 163 ? 0.7614 0.6525 0.6022 -0.0995 -0.0304 0.0313  458 VAL A CA  
1187 C C   . VAL A 163 ? 0.8716 0.7409 0.6804 -0.1143 -0.0333 0.0378  458 VAL A C   
1188 O O   . VAL A 163 ? 0.9369 0.7873 0.7294 -0.1155 -0.0422 0.0440  458 VAL A O   
1189 C CB  . VAL A 163 ? 0.7129 0.5898 0.5660 -0.0863 -0.0307 0.0313  458 VAL A CB  
1190 C CG1 . VAL A 163 ? 0.6341 0.5043 0.4808 -0.0911 -0.0242 0.0300  458 VAL A CG1 
1191 C CG2 . VAL A 163 ? 0.7455 0.5947 0.5878 -0.0801 -0.0418 0.0366  458 VAL A CG2 
1192 N N   . TYR A 164 ? 0.9061 0.7772 0.7056 -0.1258 -0.0265 0.0364  459 TYR A N   
1193 C CA  . TYR A 164 ? 1.0117 0.8615 0.7819 -0.1411 -0.0289 0.0431  459 TYR A CA  
1194 C C   . TYR A 164 ? 1.0611 0.9205 0.8136 -0.1555 -0.0298 0.0458  459 TYR A C   
1195 O O   . TYR A 164 ? 1.2034 1.0457 0.9294 -0.1702 -0.0323 0.0528  459 TYR A O   
1196 C CB  . TYR A 164 ? 1.0090 0.8593 0.7767 -0.1490 -0.0213 0.0398  459 TYR A CB  
1197 C CG  . TYR A 164 ? 1.0376 0.8813 0.8223 -0.1345 -0.0196 0.0364  459 TYR A CG  
1198 C CD1 . TYR A 164 ? 1.0867 0.9538 0.8936 -0.1278 -0.0111 0.0276  459 TYR A CD1 
1199 C CD2 . TYR A 164 ? 0.9958 0.8102 0.7739 -0.1271 -0.0273 0.0414  459 TYR A CD2 
1200 C CE1 . TYR A 164 ? 1.0889 0.9507 0.9096 -0.1148 -0.0089 0.0249  459 TYR A CE1 
1201 C CE2 . TYR A 164 ? 0.9928 0.8041 0.7864 -0.1133 -0.0255 0.0375  459 TYR A CE2 
1202 C CZ  . TYR A 164 ? 1.0333 0.8686 0.8478 -0.1075 -0.0155 0.0297  459 TYR A CZ  
1203 O OH  . TYR A 164 ? 0.9683 0.8012 0.7966 -0.0942 -0.0131 0.0263  459 TYR A OH  
1204 N N   . THR A 165 ? 1.5936 1.4936 1.3434 -0.3614 0.0242  0.2464  460 THR A N   
1205 C CA  . THR A 165 ? 1.5628 1.3953 1.2649 -0.3482 0.0456  0.2799  460 THR A CA  
1206 C C   . THR A 165 ? 1.6416 1.3943 1.2905 -0.3103 0.0319  0.2760  460 THR A C   
1207 O O   . THR A 165 ? 1.6955 1.4250 1.3164 -0.2918 0.0477  0.3037  460 THR A O   
1208 C CB  . THR A 165 ? 1.4937 1.3903 1.2175 -0.3564 0.0762  0.3172  460 THR A CB  
1209 O OG1 . THR A 165 ? 1.3394 1.2949 1.0833 -0.3405 0.0711  0.3158  460 THR A OG1 
1210 C CG2 . THR A 165 ? 1.2802 1.2517 1.0548 -0.3944 0.0906  0.3222  460 THR A CG2 
1211 N N   . PHE A 166 ? 1.6866 1.3978 1.3218 -0.2989 0.0026  0.2414  461 PHE A N   
1212 C CA  . PHE A 166 ? 1.7347 1.3610 1.3165 -0.2640 -0.0121 0.2352  461 PHE A CA  
1213 C C   . PHE A 166 ? 1.8565 1.3821 1.3865 -0.2606 -0.0039 0.2479  461 PHE A C   
1214 O O   . PHE A 166 ? 1.9396 1.4022 1.4233 -0.2374 0.0052  0.2688  461 PHE A O   
1215 C CB  . PHE A 166 ? 1.6762 1.2936 1.2625 -0.2541 -0.0469 0.1928  461 PHE A CB  
1216 C CG  . PHE A 166 ? 1.5708 1.2619 1.1897 -0.2436 -0.0587 0.1806  461 PHE A CG  
1217 C CD1 . PHE A 166 ? 1.5486 1.2473 1.1535 -0.2202 -0.0495 0.2014  461 PHE A CD1 
1218 C CD2 . PHE A 166 ? 1.4948 1.2467 1.1579 -0.2567 -0.0793 0.1482  461 PHE A CD2 
1219 C CE1 . PHE A 166 ? 1.4496 1.2159 1.0844 -0.2103 -0.0603 0.1904  461 PHE A CE1 
1220 C CE2 . PHE A 166 ? 1.3975 1.2170 1.0905 -0.2468 -0.0903 0.1371  461 PHE A CE2 
1221 C CZ  . PHE A 166 ? 1.3790 1.2057 1.0579 -0.2236 -0.0808 0.1582  461 PHE A CZ  
1222 N N   . LEU A 167 ? 1.9152 1.4302 1.4563 -0.2848 -0.0080 0.2338  462 LEU A N   
1223 C CA  . LEU A 167 ? 2.0375 1.4677 1.5403 -0.2904 -0.0015 0.2408  462 LEU A CA  
1224 C C   . LEU A 167 ? 2.1608 1.4897 1.5983 -0.2618 0.0031  0.2579  462 LEU A C   
1225 O O   . LEU A 167 ? 2.1874 1.5093 1.6083 -0.2563 0.0276  0.2925  462 LEU A O   
1227 N N   . SER A 168 ? 2.1696 1.4193 1.5699 -0.2440 -0.0203 0.2339  463 SER A N   
1228 C CA  . SER A 168 ? 2.0989 1.3542 1.5173 -0.2492 -0.0501 0.1925  463 SER A CA  
1229 C C   . SER A 168 ? 2.1407 1.2898 1.5044 -0.2248 -0.0704 0.1751  463 SER A C   
1230 O O   . SER A 168 ? 2.1532 1.2660 1.4859 -0.1944 -0.0793 0.1745  463 SER A O   
1231 C CB  . SER A 168 ? 2.0439 1.3308 1.4969 -0.2851 -0.0474 0.1828  463 SER A CB  
1232 N N   . SER A 169 ? 2.1334 1.2332 1.4857 -0.2387 -0.0774 0.1610  464 SER A N   
1233 C CA  . SER A 169 ? 2.1586 1.1528 1.4582 -0.2191 -0.0948 0.1457  464 SER A CA  
1234 C C   . SER A 169 ? 2.1350 1.1135 1.4241 -0.1927 -0.1245 0.1160  464 SER A C   
1235 O O   . SER A 169 ? 2.1086 1.1298 1.4310 -0.2012 -0.1457 0.0846  464 SER A O   
1236 C CB  . SER A 169 ? 2.2031 1.1176 1.4485 -0.2030 -0.0752 0.1781  464 SER A CB  
1237 O OG  . SER A 169 ? 2.1853 1.1182 1.4219 -0.1819 -0.0640 0.2006  464 SER A OG  
1238 N N   . THR A 170 ? 2.1202 1.0367 1.3624 -0.1608 -0.1258 0.1264  465 THR A N   
1239 C CA  . THR A 170 ? 2.0928 0.9816 1.3165 -0.1321 -0.1528 0.1013  465 THR A CA  
1240 C C   . THR A 170 ? 2.0358 0.9893 1.3039 -0.1393 -0.1781 0.0648  465 THR A C   
1241 O O   . THR A 170 ? 1.9987 1.0479 1.3190 -0.1575 -0.1723 0.0652  465 THR A O   
1242 C CB  . THR A 170 ? 2.0880 0.9766 1.2911 -0.1038 -0.1442 0.1231  465 THR A CB  
1243 O OG1 . THR A 170 ? 2.0871 0.9825 1.2911 -0.0817 -0.1705 0.0965  465 THR A OG1 
1244 C CG2 . THR A 170 ? 2.0150 0.9954 1.2585 -0.1183 -0.1193 0.1502  465 THR A CG2 
1245 N N   . LEU A 171 ? 2.0370 0.9363 1.2831 -0.1243 -0.2062 0.0335  466 LEU A N   
1246 C CA  . LEU A 171 ? 1.9918 0.9396 1.2725 -0.1264 -0.2332 -0.0033 466 LEU A CA  
1247 C C   . LEU A 171 ? 1.9238 0.9558 1.2380 -0.1180 -0.2331 -0.0005 466 LEU A C   
1248 O O   . LEU A 171 ? 1.8341 0.9476 1.1988 -0.1339 -0.2422 -0.0188 466 LEU A O   
1249 C CB  . LEU A 171 ? 2.0248 0.8893 1.2653 -0.1028 -0.2617 -0.0319 466 LEU A CB  
1250 C CG  . LEU A 171 ? 1.9783 0.8763 1.2396 -0.0914 -0.2915 -0.0671 466 LEU A CG  
1251 C CD1 . LEU A 171 ? 1.9367 0.9111 1.2547 -0.1210 -0.3013 -0.0916 466 LEU A CD1 
1252 C CD2 . LEU A 171 ? 1.9905 0.7936 1.2038 -0.0665 -0.3162 -0.0901 466 LEU A CD2 
1253 N N   . LYS A 172 ? 0.7747 0.9796 0.8930 0.1449  0.1062  -0.1077 467 LYS A N   
1254 C CA  . LYS A 172 ? 0.8034 0.9720 0.8682 0.1177  0.1144  -0.1125 467 LYS A CA  
1255 C C   . LYS A 172 ? 0.8234 0.9094 0.8879 0.1227  0.0870  -0.1048 467 LYS A C   
1256 O O   . LYS A 172 ? 0.8142 0.8625 0.8269 0.1110  0.0795  -0.1096 467 LYS A O   
1257 C CB  . LYS A 172 ? 0.7725 0.9641 0.8418 0.0947  0.1447  -0.1131 467 LYS A CB  
1258 C CG  . LYS A 172 ? 0.8876 1.0528 0.8973 0.0643  0.1576  -0.1197 467 LYS A CG  
1259 C CD  . LYS A 172 ? 1.0062 1.1990 1.0220 0.0422  0.1886  -0.1206 467 LYS A CD  
1260 C CE  . LYS A 172 ? 1.0984 1.2769 1.0503 0.0110  0.2047  -0.1292 467 LYS A CE  
1261 N NZ  . LYS A 172 ? 1.0819 1.2916 1.0381 -0.0109 0.2360  -0.1310 467 LYS A NZ  
1262 N N   . SER A 173 ? 0.8017 0.8600 0.9242 0.1402  0.0722  -0.0927 468 SER A N   
1263 C CA  . SER A 173 ? 0.8370 0.8174 0.9654 0.1473  0.0451  -0.0846 468 SER A CA  
1264 C C   . SER A 173 ? 0.8166 0.7713 0.9195 0.1624  0.0183  -0.0872 468 SER A C   
1265 O O   . SER A 173 ? 0.8652 0.7614 0.9352 0.1569  0.0024  -0.0871 468 SER A O   
1266 C CB  . SER A 173 ? 0.9183 0.8810 1.1180 0.1668  0.0332  -0.0713 468 SER A CB  
1267 O OG  . SER A 173 ? 1.0558 0.9424 1.2610 0.1728  0.0077  -0.0633 468 SER A OG  
1268 N N   . LEU A 174 ? 0.7027 0.7017 0.8208 0.1817  0.0133  -0.0897 469 LEU A N   
1269 C CA  . LEU A 174 ? 0.8117 0.7942 0.9061 0.1969  -0.0108 -0.0929 469 LEU A CA  
1270 C C   . LEU A 174 ? 0.9004 0.8840 0.9202 0.1758  -0.0023 -0.1050 469 LEU A C   
1271 O O   . LEU A 174 ? 0.9737 0.9097 0.9606 0.1778  -0.0228 -0.1063 469 LEU A O   
1272 C CB  . LEU A 174 ? 0.8286 0.8644 0.9565 0.2210  -0.0151 -0.0933 469 LEU A CB  
1273 C CG  . LEU A 174 ? 0.8181 0.8441 1.0188 0.2478  -0.0321 -0.0809 469 LEU A CG  
1274 C CD1 . LEU A 174 ? 0.8267 0.9162 1.0589 0.2678  -0.0297 -0.0823 469 LEU A CD1 
1275 C CD2 . LEU A 174 ? 0.8581 0.8124 1.0659 0.2643  -0.0668 -0.0738 469 LEU A CD2 
1276 N N   . GLU A 175 ? 0.8860 0.9240 0.8793 0.1556  0.0280  -0.1138 470 GLU A N   
1277 C CA  . GLU A 175 ? 0.8812 0.9241 0.8035 0.1334  0.0393  -0.1255 470 GLU A CA  
1278 C C   . GLU A 175 ? 0.8550 0.8293 0.7434 0.1161  0.0326  -0.1240 470 GLU A C   
1279 O O   . GLU A 175 ? 0.8772 0.8185 0.7193 0.1129  0.0189  -0.1286 470 GLU A O   
1280 C CB  . GLU A 175 ? 0.9320 1.0411 0.8368 0.1126  0.0750  -0.1340 470 GLU A CB  
1281 C CG  . GLU A 175 ? 1.0426 1.2238 0.9644 0.1260  0.0837  -0.1386 470 GLU A CG  
1282 C CD  . GLU A 175 ? 1.1356 1.3801 1.0338 0.1039  0.1190  -0.1479 470 GLU A CD  
1283 O OE1 . GLU A 175 ? 1.1604 1.3919 1.0287 0.0780  0.1364  -0.1508 470 GLU A OE1 
1284 O OE2 . GLU A 175 ? 1.1540 1.4613 1.0633 0.1122  0.1295  -0.1523 470 GLU A OE2 
1285 N N   . GLU A 176 ? 0.7768 0.7301 0.6889 0.1052  0.0421  -0.1175 471 GLU A N   
1286 C CA  . GLU A 176 ? 0.7604 0.6479 0.6455 0.0888  0.0365  -0.1152 471 GLU A CA  
1287 C C   . GLU A 176 ? 0.8145 0.6366 0.6975 0.1060  0.0014  -0.1100 471 GLU A C   
1288 O O   . GLU A 176 ? 0.7707 0.5519 0.6035 0.0943  -0.0063 -0.1141 471 GLU A O   
1289 C CB  . GLU A 176 ? 0.6816 0.5545 0.6066 0.0811  0.0474  -0.1067 471 GLU A CB  
1290 C CG  . GLU A 176 ? 0.7778 0.7095 0.7020 0.0613  0.0829  -0.1117 471 GLU A CG  
1291 C CD  . GLU A 176 ? 0.8574 0.7823 0.7201 0.0292  0.1027  -0.1203 471 GLU A CD  
1292 O OE1 . GLU A 176 ? 0.7953 0.6730 0.6532 0.0151  0.1034  -0.1160 471 GLU A OE1 
1293 O OE2 . GLU A 176 ? 0.8745 0.8417 0.6937 0.0180  0.1176  -0.1314 471 GLU A OE2 
1294 N N   . LYS A 177 ? 0.7896 0.6021 0.7271 0.1338  -0.0197 -0.1010 472 LYS A N   
1295 C CA  . LYS A 177 ? 0.7889 0.5417 0.7299 0.1525  -0.0539 -0.0956 472 LYS A CA  
1296 C C   . LYS A 177 ? 0.8177 0.5778 0.7111 0.1567  -0.0645 -0.1047 472 LYS A C   
1297 O O   . LYS A 177 ? 0.7910 0.4980 0.6516 0.1563  -0.0837 -0.1053 472 LYS A O   
1298 C CB  . LYS A 177 ? 0.8548 0.6033 0.8656 0.1823  -0.0730 -0.0846 472 LYS A CB  
1299 C CG  . LYS A 177 ? 0.9323 0.6596 0.9923 0.1812  -0.0688 -0.0741 472 LYS A CG  
1300 C CD  . LYS A 177 ? 1.0177 0.7035 1.1314 0.2092  -0.0988 -0.0623 472 LYS A CD  
1301 C CE  . LYS A 177 ? 1.0367 0.7621 1.2183 0.2251  -0.0926 -0.0549 472 LYS A CE  
1302 N NZ  . LYS A 177 ? 1.0562 0.8491 1.2465 0.2381  -0.0864 -0.0604 472 LYS A NZ  
1303 N N   . ASP A 178 ? 0.5921 0.4944 0.5036 -0.0010 -0.0920 0.0728  473 ASP A N   
1304 C CA  . ASP A 178 ? 0.5748 0.4900 0.5048 0.0140  -0.0949 0.0648  473 ASP A CA  
1305 C C   . ASP A 178 ? 0.6103 0.5725 0.5763 0.0158  -0.0913 0.0575  473 ASP A C   
1306 O O   . ASP A 178 ? 0.6509 0.6291 0.6345 0.0174  -0.0845 0.0506  473 ASP A O   
1307 C CB  . ASP A 178 ? 0.6825 0.5765 0.6006 0.0332  -0.1106 0.0645  473 ASP A CB  
1308 C CG  . ASP A 178 ? 0.9122 0.7902 0.8281 0.0436  -0.1113 0.0599  473 ASP A CG  
1309 O OD1 . ASP A 178 ? 1.1045 0.9413 0.9904 0.0481  -0.1160 0.0642  473 ASP A OD1 
1310 O OD2 . ASP A 178 ? 0.9124 0.8174 0.8554 0.0465  -0.1061 0.0518  473 ASP A OD2 
1311 N N   . HIS A 179 ? 0.5856 0.5686 0.5615 0.0150  -0.0948 0.0586  474 HIS A N   
1312 C CA  . HIS A 179 ? 0.5253 0.5512 0.5333 0.0156  -0.0896 0.0511  474 HIS A CA  
1313 C C   . HIS A 179 ? 0.5089 0.5503 0.5250 0.0001  -0.0739 0.0509  474 HIS A C   
1314 O O   . HIS A 179 ? 0.4850 0.5504 0.5221 0.0018  -0.0667 0.0429  474 HIS A O   
1315 C CB  . HIS A 179 ? 0.4672 0.5105 0.4819 0.0160  -0.0952 0.0527  474 HIS A CB  
1316 C CG  . HIS A 179 ? 0.5032 0.5895 0.5494 0.0151  -0.0876 0.0444  474 HIS A CG  
1317 N ND1 . HIS A 179 ? 0.4575 0.5654 0.5280 0.0286  -0.0899 0.0317  474 HIS A ND1 
1318 C CD2 . HIS A 179 ? 0.4902 0.6005 0.5470 0.0019  -0.0768 0.0460  474 HIS A CD2 
1319 C CE1 . HIS A 179 ? 0.4395 0.5817 0.5329 0.0233  -0.0797 0.0255  474 HIS A CE1 
1320 N NE2 . HIS A 179 ? 0.4381 0.5822 0.5232 0.0075  -0.0719 0.0346  474 HIS A NE2 
1321 N N   . ILE A 180 ? 0.5425 0.5687 0.5410 -0.0150 -0.0687 0.0587  475 ILE A N   
1322 C CA  . ILE A 180 ? 0.4513 0.4889 0.4548 -0.0289 -0.0556 0.0581  475 ILE A CA  
1323 C C   . ILE A 180 ? 0.4611 0.4936 0.4668 -0.0256 -0.0504 0.0522  475 ILE A C   
1324 O O   . ILE A 180 ? 0.4220 0.4757 0.4427 -0.0280 -0.0418 0.0470  475 ILE A O   
1325 C CB  . ILE A 180 ? 0.5190 0.5367 0.5025 -0.0450 -0.0523 0.0654  475 ILE A CB  
1326 C CG1 . ILE A 180 ? 0.5466 0.5767 0.5325 -0.0518 -0.0544 0.0708  475 ILE A CG1 
1327 C CG2 . ILE A 180 ? 0.4951 0.5190 0.4816 -0.0568 -0.0407 0.0627  475 ILE A CG2 
1328 C CD1 . ILE A 180 ? 0.5153 0.5264 0.4831 -0.0689 -0.0509 0.0771  475 ILE A CD1 
1329 N N   . HIS A 181 ? 0.4953 0.4982 0.4847 -0.0198 -0.0551 0.0530  476 HIS A N   
1330 C CA  . HIS A 181 ? 0.5205 0.5170 0.5112 -0.0171 -0.0500 0.0476  476 HIS A CA  
1331 C C   . HIS A 181 ? 0.5282 0.5474 0.5423 -0.0049 -0.0505 0.0392  476 HIS A C   
1332 O O   . HIS A 181 ? 0.5521 0.5814 0.5757 -0.0063 -0.0425 0.0335  476 HIS A O   
1333 C CB  . HIS A 181 ? 0.6737 0.6321 0.6408 -0.0140 -0.0538 0.0502  476 HIS A CB  
1334 C CG  . HIS A 181 ? 0.8237 0.7582 0.7683 -0.0287 -0.0487 0.0549  476 HIS A CG  
1335 N ND1 . HIS A 181 ? 0.7038 0.6439 0.6503 -0.0415 -0.0380 0.0518  476 HIS A ND1 
1336 C CD2 . HIS A 181 ? 0.8748 0.7786 0.7944 -0.0329 -0.0527 0.0610  476 HIS A CD2 
1337 C CE1 . HIS A 181 ? 0.7436 0.6594 0.6698 -0.0535 -0.0352 0.0547  476 HIS A CE1 
1338 N NE2 . HIS A 181 ? 0.8771 0.7695 0.7857 -0.0492 -0.0432 0.0606  476 HIS A NE2 
1339 N N   . ARG A 182 ? 0.4288 0.4562 0.4523 0.0068  -0.0600 0.0372  477 ARG A N   
1340 C CA  . ARG A 182 ? 0.5203 0.5707 0.5685 0.0176  -0.0601 0.0267  477 ARG A CA  
1341 C C   . ARG A 182 ? 0.4816 0.5637 0.5484 0.0101  -0.0488 0.0218  477 ARG A C   
1342 O O   . ARG A 182 ? 0.4238 0.5178 0.5037 0.0114  -0.0414 0.0137  477 ARG A O   
1343 C CB  . ARG A 182 ? 0.5345 0.5865 0.5894 0.0327  -0.0738 0.0233  477 ARG A CB  
1344 C CG  . ARG A 182 ? 0.6132 0.6355 0.6546 0.0447  -0.0840 0.0238  477 ARG A CG  
1345 C CD  . ARG A 182 ? 0.7795 0.8003 0.8239 0.0609  -0.1000 0.0208  477 ARG A CD  
1346 N NE  . ARG A 182 ? 0.9043 0.9016 0.9227 0.0595  -0.1084 0.0314  477 ARG A NE  
1347 N N   . VAL A 183 ? 0.4214 0.5152 0.4876 0.0018  -0.0468 0.0266  478 VAL A N   
1348 C CA  . VAL A 183 ? 0.4576 0.5773 0.5368 -0.0066 -0.0349 0.0232  478 VAL A CA  
1349 C C   . VAL A 183 ? 0.4471 0.5605 0.5179 -0.0160 -0.0248 0.0241  478 VAL A C   
1350 O O   . VAL A 183 ? 0.3138 0.4423 0.3944 -0.0176 -0.0153 0.0176  478 VAL A O   
1351 C CB  . VAL A 183 ? 0.4301 0.5618 0.5088 -0.0149 -0.0342 0.0293  478 VAL A CB  
1352 C CG1 . VAL A 183 ? 0.4306 0.5876 0.5217 -0.0226 -0.0210 0.0252  478 VAL A CG1 
1353 C CG2 . VAL A 183 ? 0.3471 0.4857 0.4338 -0.0050 -0.0448 0.0277  478 VAL A CG2 
1354 N N   . LEU A 184 ? 0.2770 0.3672 0.3287 -0.0223 -0.0266 0.0309  479 LEU A N   
1355 C CA  . LEU A 184 ? 0.2735 0.3569 0.3178 -0.0295 -0.0187 0.0298  479 LEU A CA  
1356 C C   . LEU A 184 ? 0.3589 0.4428 0.4109 -0.0213 -0.0159 0.0217  479 LEU A C   
1357 O O   . LEU A 184 ? 0.3334 0.4262 0.3888 -0.0245 -0.0073 0.0171  479 LEU A O   
1358 C CB  . LEU A 184 ? 0.3415 0.3983 0.3654 -0.0366 -0.0211 0.0356  479 LEU A CB  
1359 C CG  . LEU A 184 ? 0.3372 0.3939 0.3529 -0.0498 -0.0195 0.0417  479 LEU A CG  
1360 C CD1 . LEU A 184 ? 0.3072 0.3347 0.3029 -0.0571 -0.0210 0.0449  479 LEU A CD1 
1361 C CD2 . LEU A 184 ? 0.3091 0.3842 0.3312 -0.0576 -0.0106 0.0389  479 LEU A CD2 
1362 N N   . ASP A 185 ? 0.3283 0.4015 0.3822 -0.0106 -0.0234 0.0198  480 ASP A N   
1363 C CA  . ASP A 185 ? 0.3407 0.4141 0.4041 -0.0027 -0.0215 0.0117  480 ASP A CA  
1364 C C   . ASP A 185 ? 0.4280 0.5269 0.5109 -0.0008 -0.0145 0.0027  480 ASP A C   
1365 O O   . ASP A 185 ? 0.3451 0.4471 0.4321 -0.0015 -0.0068 -0.0035 480 ASP A O   
1366 C CB  . ASP A 185 ? 0.4017 0.4610 0.4655 0.0096  -0.0322 0.0110  480 ASP A CB  
1367 C CG  . ASP A 185 ? 0.5181 0.5467 0.5607 0.0084  -0.0353 0.0169  480 ASP A CG  
1368 O OD1 . ASP A 185 ? 0.5496 0.5704 0.5819 -0.0009 -0.0278 0.0184  480 ASP A OD1 
1369 O OD2 . ASP A 185 ? 0.6192 0.6304 0.6546 0.0172  -0.0449 0.0192  480 ASP A OD2 
1370 N N   . LYS A 186 ? 0.3830 0.4989 0.4770 0.0013  -0.0164 0.0011  481 LYS A N   
1371 C CA  . LYS A 186 ? 0.3727 0.5117 0.4848 0.0022  -0.0080 -0.0091 481 LYS A CA  
1372 C C   . LYS A 186 ? 0.3376 0.4826 0.4429 -0.0086 0.0047  -0.0085 481 LYS A C   
1373 O O   . LYS A 186 ? 0.3553 0.5077 0.4670 -0.0090 0.0142  -0.0170 481 LYS A O   
1374 C CB  . LYS A 186 ? 0.4414 0.5983 0.5672 0.0062  -0.0120 -0.0120 481 LYS A CB  
1375 C CG  . LYS A 186 ? 0.4597 0.6409 0.6033 0.0049  -0.0006 -0.0237 481 LYS A CG  
1376 C CD  . LYS A 186 ? 0.4578 0.6428 0.6177 0.0126  0.0017  -0.0379 481 LYS A CD  
1377 C CE  . LYS A 186 ? 0.5210 0.7060 0.6938 0.0259  -0.0124 -0.0430 481 LYS A CE  
1378 N NZ  . LYS A 186 ? 0.4867 0.6804 0.6808 0.0329  -0.0096 -0.0597 481 LYS A NZ  
1379 N N   . ILE A 187 ? 0.3350 0.4748 0.4259 -0.0174 0.0047  0.0011  482 ILE A N   
1380 C CA  . ILE A 187 ? 0.3044 0.4478 0.3870 -0.0264 0.0149  0.0018  482 ILE A CA  
1381 C C   . ILE A 187 ? 0.3534 0.4832 0.4266 -0.0267 0.0181  -0.0008 482 ILE A C   
1382 O O   . ILE A 187 ? 0.3678 0.5014 0.4382 -0.0292 0.0272  -0.0055 482 ILE A O   
1383 C CB  . ILE A 187 ? 0.3449 0.4874 0.4168 -0.0359 0.0136  0.0112  482 ILE A CB  
1384 C CG1 . ILE A 187 ? 0.3942 0.5526 0.4763 -0.0361 0.0118  0.0132  482 ILE A CG1 
1385 C CG2 . ILE A 187 ? 0.2974 0.4421 0.3600 -0.0435 0.0227  0.0109  482 ILE A CG2 
1386 C CD1 . ILE A 187 ? 0.4381 0.5975 0.5118 -0.0466 0.0114  0.0222  482 ILE A CD1 
1387 N N   . THR A 188 ? 0.3454 0.4585 0.4128 -0.0239 0.0112  0.0018  483 THR A N   
1388 C CA  . THR A 188 ? 0.3611 0.4630 0.4228 -0.0230 0.0142  -0.0020 483 THR A CA  
1389 C C   . THR A 188 ? 0.4136 0.5230 0.4876 -0.0172 0.0198  -0.0117 483 THR A C   
1390 O O   . THR A 188 ? 0.3532 0.4623 0.4227 -0.0195 0.0276  -0.0164 483 THR A O   
1391 C CB  . THR A 188 ? 0.4107 0.4933 0.4662 -0.0201 0.0070  0.0010  483 THR A CB  
1392 O OG1 . THR A 188 ? 0.4949 0.5674 0.5372 -0.0273 0.0037  0.0083  483 THR A OG1 
1393 C CG2 . THR A 188 ? 0.3779 0.4519 0.4303 -0.0189 0.0114  -0.0042 483 THR A CG2 
1394 N N   . ASP A 189 ? 0.3530 0.4681 0.4421 -0.0096 0.0154  -0.0157 484 ASP A N   
1395 C CA  . ASP A 189 ? 0.4096 0.5338 0.5141 -0.0048 0.0209  -0.0271 484 ASP A CA  
1396 C C   . ASP A 189 ? 0.3925 0.5278 0.4958 -0.0108 0.0333  -0.0323 484 ASP A C   
1397 O O   . ASP A 189 ? 0.3857 0.5192 0.4886 -0.0117 0.0418  -0.0397 484 ASP A O   
1398 C CB  . ASP A 189 ? 0.3928 0.5266 0.5158 0.0037  0.0139  -0.0322 484 ASP A CB  
1399 C CG  . ASP A 189 ? 0.4697 0.5893 0.5926 0.0119  0.0015  -0.0287 484 ASP A CG  
1400 O OD1 . ASP A 189 ? 0.3861 0.4887 0.4961 0.0104  0.0003  -0.0235 484 ASP A OD1 
1401 O OD2 . ASP A 189 ? 0.6044 0.7293 0.7395 0.0204  -0.0070 -0.0320 484 ASP A OD2 
1402 N N   . THR A 190 ? 0.3862 0.5314 0.4877 -0.0150 0.0349  -0.0284 485 THR A N   
1403 C CA  . THR A 190 ? 0.3351 0.4893 0.4333 -0.0207 0.0473  -0.0327 485 THR A CA  
1404 C C   . THR A 190 ? 0.3494 0.4918 0.4275 -0.0260 0.0536  -0.0307 485 THR A C   
1405 O O   . THR A 190 ? 0.4039 0.5450 0.4777 -0.0275 0.0643  -0.0382 485 THR A O   
1406 C CB  . THR A 190 ? 0.4123 0.5788 0.5117 -0.0245 0.0470  -0.0274 485 THR A CB  
1407 O OG1 . THR A 190 ? 0.3562 0.5340 0.4743 -0.0182 0.0405  -0.0309 485 THR A OG1 
1408 C CG2 . THR A 190 ? 0.4153 0.5898 0.5102 -0.0303 0.0613  -0.0322 485 THR A CG2 
1409 N N   . LEU A 191 ? 0.3371 0.4700 0.4024 -0.0287 0.0470  -0.0217 486 LEU A N   
1410 C CA  . LEU A 191 ? 0.3115 0.4334 0.3588 -0.0321 0.0506  -0.0211 486 LEU A CA  
1411 C C   . LEU A 191 ? 0.3992 0.5131 0.4464 -0.0285 0.0546  -0.0290 486 LEU A C   
1412 O O   . LEU A 191 ? 0.4308 0.5402 0.4667 -0.0302 0.0630  -0.0337 486 LEU A O   
1413 C CB  . LEU A 191 ? 0.3306 0.4437 0.3686 -0.0350 0.0420  -0.0134 486 LEU A CB  
1414 C CG  . LEU A 191 ? 0.3784 0.4962 0.4098 -0.0416 0.0404  -0.0064 486 LEU A CG  
1415 C CD1 . LEU A 191 ? 0.3674 0.4756 0.3932 -0.0450 0.0321  -0.0011 486 LEU A CD1 
1416 C CD2 . LEU A 191 ? 0.3217 0.4398 0.3393 -0.0450 0.0479  -0.0084 486 LEU A CD2 
1417 N N   . ILE A 192 ? 0.4294 0.5401 0.4878 -0.0236 0.0488  -0.0303 487 ILE A N   
1418 C CA  . ILE A 192 ? 0.3615 0.4656 0.4226 -0.0205 0.0524  -0.0378 487 ILE A CA  
1419 C C   . ILE A 192 ? 0.4349 0.5453 0.5032 -0.0205 0.0629  -0.0479 487 ILE A C   
1420 O O   . ILE A 192 ? 0.4429 0.5463 0.5027 -0.0221 0.0709  -0.0539 487 ILE A O   
1421 C CB  . ILE A 192 ? 0.4418 0.5420 0.5155 -0.0148 0.0444  -0.0375 487 ILE A CB  
1422 C CG1 . ILE A 192 ? 0.4152 0.5048 0.4784 -0.0161 0.0368  -0.0293 487 ILE A CG1 
1423 C CG2 . ILE A 192 ? 0.4039 0.4999 0.4839 -0.0122 0.0492  -0.0461 487 ILE A CG2 
1424 C CD1 . ILE A 192 ? 0.3430 0.4243 0.3913 -0.0196 0.0403  -0.0302 487 ILE A CD1 
1425 N N   . HIS A 193 ? 0.4492 0.5721 0.5327 -0.0191 0.0634  -0.0511 488 HIS A N   
1426 C CA  . HIS A 193 ? 0.4779 0.6074 0.5700 -0.0201 0.0749  -0.0632 488 HIS A CA  
1427 C C   . HIS A 193 ? 0.4388 0.5621 0.5101 -0.0265 0.0872  -0.0647 488 HIS A C   
1428 O O   . HIS A 193 ? 0.4136 0.5303 0.4805 -0.0285 0.0979  -0.0741 488 HIS A O   
1429 C CB  . HIS A 193 ? 0.5043 0.6503 0.6158 -0.0178 0.0735  -0.0674 488 HIS A CB  
1430 C CG  . HIS A 193 ? 0.5913 0.7449 0.7131 -0.0198 0.0870  -0.0824 488 HIS A CG  
1431 N ND1 . HIS A 193 ? 0.6282 0.7873 0.7432 -0.0254 0.0985  -0.0853 488 HIS A ND1 
1432 C CD2 . HIS A 193 ? 0.6234 0.7787 0.7615 -0.0180 0.0921  -0.0967 488 HIS A CD2 
1433 C CE1 . HIS A 193 ? 0.6007 0.7639 0.7267 -0.0270 0.1109  -0.1012 488 HIS A CE1 
1434 N NE2 . HIS A 193 ? 0.6238 0.7853 0.7647 -0.0229 0.1070  -0.1088 488 HIS A NE2 
1435 N N   . LEU A 194 ? 0.4135 0.5371 0.4705 -0.0297 0.0856  -0.0555 489 LEU A N   
1436 C CA  . LEU A 194 ? 0.4133 0.5282 0.4470 -0.0345 0.0956  -0.0557 489 LEU A CA  
1437 C C   . LEU A 194 ? 0.4916 0.5893 0.5073 -0.0340 0.0970  -0.0572 489 LEU A C   
1438 O O   . LEU A 194 ? 0.4706 0.5577 0.4714 -0.0362 0.1082  -0.0640 489 LEU A O   
1439 C CB  . LEU A 194 ? 0.3567 0.4747 0.3796 -0.0375 0.0912  -0.0451 489 LEU A CB  
1440 C CG  . LEU A 194 ? 0.3326 0.4672 0.3681 -0.0395 0.0919  -0.0428 489 LEU A CG  
1441 C CD1 . LEU A 194 ? 0.3577 0.4935 0.3830 -0.0430 0.0854  -0.0313 489 LEU A CD1 
1442 C CD2 . LEU A 194 ? 0.4012 0.5395 0.4355 -0.0426 0.1079  -0.0521 489 LEU A CD2 
1443 N N   . MET A 195 ? 0.4816 0.5757 0.4977 -0.0314 0.0860  -0.0516 490 MET A N   
1444 C CA  . MET A 195 ? 0.4138 0.4939 0.4147 -0.0303 0.0859  -0.0532 490 MET A CA  
1445 C C   . MET A 195 ? 0.4990 0.5738 0.5057 -0.0294 0.0934  -0.0633 490 MET A C   
1446 O O   . MET A 195 ? 0.5955 0.6573 0.5839 -0.0305 0.1003  -0.0679 490 MET A O   
1447 C CB  . MET A 195 ? 0.4508 0.5300 0.4547 -0.0282 0.0739  -0.0470 490 MET A CB  
1448 C CG  . MET A 195 ? 0.4837 0.5660 0.4806 -0.0305 0.0670  -0.0386 490 MET A CG  
1449 S SD  . MET A 195 ? 0.4589 0.5384 0.4599 -0.0298 0.0553  -0.0338 490 MET A SD  
1450 C CE  . MET A 195 ? 0.3849 0.4700 0.3811 -0.0349 0.0503  -0.0256 490 MET A CE  
1451 N N   . ALA A 196 ? 0.3559 0.4397 0.3871 -0.0273 0.0916  -0.0672 491 ALA A N   
1452 C CA  . ALA A 196 ? 0.4845 0.5652 0.5255 -0.0272 0.0988  -0.0781 491 ALA A CA  
1453 C C   . ALA A 196 ? 0.5741 0.6509 0.6073 -0.0319 0.1138  -0.0877 491 ALA A C   
1454 O O   . ALA A 196 ? 0.6331 0.6969 0.6540 -0.0346 0.1230  -0.0949 491 ALA A O   
1455 C CB  . ALA A 196 ? 0.4226 0.5148 0.4927 -0.0231 0.0927  -0.0811 491 ALA A CB  
1456 N N   . LYS A 197 ? 0.6116 0.6988 0.6514 -0.0333 0.1169  -0.0885 492 LYS A N   
1457 C CA  . LYS A 197 ? 0.6410 0.7247 0.6726 -0.0386 0.1327  -0.0980 492 LYS A CA  
1458 C C   . LYS A 197 ? 0.6131 0.6757 0.6092 -0.0418 0.1405  -0.0962 492 LYS A C   
1459 O O   . LYS A 197 ? 0.6183 0.6678 0.6015 -0.0462 0.1551  -0.1063 492 LYS A O   
1460 C CB  . LYS A 197 ? 0.7167 0.8153 0.7563 -0.0393 0.1328  -0.0952 492 LYS A CB  
1461 C CG  . LYS A 197 ? 0.8133 0.9137 0.8538 -0.0444 0.1499  -0.1078 492 LYS A CG  
1462 C CD  . LYS A 197 ? 0.8989 1.0156 0.9467 -0.0448 0.1486  -0.1031 492 LYS A CD  
1463 C CE  . LYS A 197 ? 1.0151 1.1367 1.0675 -0.0500 0.1665  -0.1172 492 LYS A CE  
1464 N NZ  . LYS A 197 ? 1.0807 1.2188 1.1391 -0.0506 0.1658  -0.1120 492 LYS A NZ  
1465 N N   . ALA A 198 ? 0.5652 0.6234 0.5448 -0.0394 0.1306  -0.0844 493 ALA A N   
1466 C CA  . ALA A 198 ? 0.5500 0.5884 0.4949 -0.0403 0.1348  -0.0824 493 ALA A CA  
1467 C C   . ALA A 198 ? 0.6349 0.6579 0.5690 -0.0392 0.1361  -0.0874 493 ALA A C   
1468 O O   . ALA A 198 ? 0.7710 0.7739 0.6748 -0.0398 0.1420  -0.0892 493 ALA A O   
1469 C CB  . ALA A 198 ? 0.5382 0.5787 0.4721 -0.0378 0.1230  -0.0705 493 ALA A CB  
1470 N N   . GLY A 199 ? 0.5660 0.5976 0.5239 -0.0373 0.1304  -0.0895 494 GLY A N   
1471 C CA  . GLY A 199 ? 0.6755 0.6956 0.6285 -0.0370 0.1326  -0.0951 494 GLY A CA  
1472 C C   . GLY A 199 ? 0.7058 0.7255 0.6562 -0.0324 0.1203  -0.0888 494 GLY A C   
1473 O O   . GLY A 199 ? 0.7449 0.7532 0.6844 -0.0319 0.1222  -0.0928 494 GLY A O   
1474 N N   . LEU A 200 ? 0.6261 0.6577 0.5859 -0.0295 0.1085  -0.0799 495 LEU A N   
1475 C CA  . LEU A 200 ? 0.5687 0.6011 0.5293 -0.0259 0.0980  -0.0758 495 LEU A CA  
1476 C C   . LEU A 200 ? 0.5362 0.5753 0.5218 -0.0247 0.0961  -0.0787 495 LEU A C   
1477 O O   . LEU A 200 ? 0.4689 0.5173 0.4762 -0.0251 0.0971  -0.0803 495 LEU A O   
1478 C CB  . LEU A 200 ? 0.4768 0.5176 0.4391 -0.0247 0.0876  -0.0667 495 LEU A CB  
1479 C CG  . LEU A 200 ? 0.5144 0.5505 0.4544 -0.0256 0.0875  -0.0629 495 LEU A CG  
1480 C CD1 . LEU A 200 ? 0.4737 0.5192 0.4199 -0.0256 0.0769  -0.0551 495 LEU A CD1 
1481 C CD2 . LEU A 200 ? 0.4837 0.5037 0.3959 -0.0233 0.0888  -0.0668 495 LEU A CD2 
1482 N N   . THR A 201 ? 0.5217 0.5564 0.5047 -0.0228 0.0932  -0.0803 496 THR A N   
1483 C CA  . THR A 201 ? 0.5720 0.6124 0.5778 -0.0215 0.0914  -0.0823 496 THR A CA  
1484 C C   . THR A 201 ? 0.5781 0.6280 0.5995 -0.0193 0.0819  -0.0750 496 THR A C   
1485 O O   . THR A 201 ? 0.5969 0.6489 0.6106 -0.0194 0.0767  -0.0687 496 THR A O   
1486 C CB  . THR A 201 ? 0.5999 0.6344 0.5991 -0.0201 0.0909  -0.0857 496 THR A CB  
1487 O OG1 . THR A 201 ? 0.5948 0.6296 0.5838 -0.0179 0.0829  -0.0812 496 THR A OG1 
1488 C CG2 . THR A 201 ? 0.6538 0.6758 0.6328 -0.0219 0.0995  -0.0924 496 THR A CG2 
1489 N N   . LEU A 202 ? 0.5099 0.5638 0.5518 -0.0173 0.0798  -0.0761 497 LEU A N   
1490 C CA  . LEU A 202 ? 0.5265 0.5845 0.5795 -0.0147 0.0711  -0.0693 497 LEU A CA  
1491 C C   . LEU A 202 ? 0.5118 0.5657 0.5521 -0.0150 0.0658  -0.0647 497 LEU A C   
1492 O O   . LEU A 202 ? 0.4779 0.5330 0.5166 -0.0153 0.0596  -0.0582 497 LEU A O   
1493 C CB  . LEU A 202 ? 0.5751 0.6341 0.6485 -0.0117 0.0701  -0.0720 497 LEU A CB  
1494 C CG  . LEU A 202 ? 0.6820 0.7481 0.7747 -0.0096 0.0697  -0.0751 497 LEU A CG  
1495 C CD1 . LEU A 202 ? 0.7144 0.7803 0.8265 -0.0061 0.0689  -0.0794 497 LEU A CD1 
1496 C CD2 . LEU A 202 ? 0.7224 0.7927 0.8163 -0.0074 0.0617  -0.0678 497 LEU A CD2 
1497 N N   . GLN A 203 ? 0.5041 0.5534 0.5360 -0.0152 0.0685  -0.0693 498 GLN A N   
1498 C CA  . GLN A 203 ? 0.4566 0.5030 0.4785 -0.0154 0.0644  -0.0686 498 GLN A CA  
1499 C C   . GLN A 203 ? 0.4156 0.4622 0.4213 -0.0170 0.0610  -0.0656 498 GLN A C   
1500 O O   . GLN A 203 ? 0.5120 0.5589 0.5155 -0.0185 0.0555  -0.0621 498 GLN A O   
1501 C CB  . GLN A 203 ? 0.4759 0.5192 0.4931 -0.0146 0.0683  -0.0764 498 GLN A CB  
1502 C CG  . GLN A 203 ? 0.5493 0.5913 0.5606 -0.0147 0.0649  -0.0789 498 GLN A CG  
1503 C CD  . GLN A 203 ? 0.6239 0.6648 0.6305 -0.0132 0.0687  -0.0881 498 GLN A CD  
1504 O OE1 . GLN A 203 ? 0.6489 0.6880 0.6504 -0.0125 0.0731  -0.0915 498 GLN A OE1 
1505 N NE2 . GLN A 203 ? 0.6249 0.6663 0.6328 -0.0131 0.0677  -0.0931 498 GLN A NE2 
1506 N N   . GLN A 204 ? 0.3873 0.4322 0.3808 -0.0173 0.0650  -0.0675 499 GLN A N   
1507 C CA  . GLN A 204 ? 0.4043 0.4483 0.3811 -0.0184 0.0624  -0.0648 499 GLN A CA  
1508 C C   . GLN A 204 ? 0.4194 0.4699 0.4041 -0.0206 0.0594  -0.0571 499 GLN A C   
1509 O O   . GLN A 204 ? 0.5119 0.5639 0.4895 -0.0224 0.0546  -0.0533 499 GLN A O   
1510 C CB  . GLN A 204 ? 0.4126 0.4496 0.3723 -0.0180 0.0690  -0.0684 499 GLN A CB  
1511 C CG  . GLN A 204 ? 0.4924 0.5213 0.4416 -0.0156 0.0720  -0.0761 499 GLN A CG  
1512 C CD  . GLN A 204 ? 0.6362 0.6534 0.5647 -0.0158 0.0795  -0.0797 499 GLN A CD  
1513 O OE1 . GLN A 204 ? 0.6511 0.6675 0.5824 -0.0187 0.0866  -0.0792 499 GLN A OE1 
1514 N NE2 . GLN A 204 ? 0.6940 0.7010 0.6004 -0.0125 0.0782  -0.0844 499 GLN A NE2 
1515 N N   . GLN A 205 ? 0.4486 0.5035 0.4486 -0.0204 0.0620  -0.0558 500 GLN A N   
1516 C CA  . GLN A 205 ? 0.4112 0.4733 0.4205 -0.0216 0.0587  -0.0494 500 GLN A CA  
1517 C C   . GLN A 205 ? 0.4454 0.5070 0.4582 -0.0224 0.0507  -0.0440 500 GLN A C   
1518 O O   . GLN A 205 ? 0.3956 0.4598 0.4041 -0.0252 0.0468  -0.0386 500 GLN A O   
1519 C CB  . GLN A 205 ? 0.4434 0.5105 0.4713 -0.0197 0.0613  -0.0516 500 GLN A CB  
1520 C CG  . GLN A 205 ? 0.4151 0.4831 0.4419 -0.0207 0.0709  -0.0582 500 GLN A CG  
1521 C CD  . GLN A 205 ? 0.4541 0.5285 0.5032 -0.0187 0.0728  -0.0632 500 GLN A CD  
1522 O OE1 . GLN A 205 ? 0.3678 0.4485 0.4312 -0.0160 0.0659  -0.0596 500 GLN A OE1 
1523 N NE2 . GLN A 205 ? 0.4080 0.4798 0.4596 -0.0199 0.0818  -0.0724 500 GLN A NE2 
1524 N N   . HIS A 206 ? 0.4473 0.5043 0.4671 -0.0205 0.0492  -0.0458 501 HIS A N   
1525 C CA  A HIS A 206 ? 0.4417 0.4941 0.4630 -0.0219 0.0434  -0.0418 501 HIS A CA  
1526 C CA  B HIS A 206 ? 0.4487 0.5010 0.4700 -0.0218 0.0434  -0.0418 501 HIS A CA  
1527 C C   . HIS A 206 ? 0.4359 0.4855 0.4444 -0.0257 0.0415  -0.0432 501 HIS A C   
1528 O O   . HIS A 206 ? 0.4256 0.4728 0.4322 -0.0294 0.0373  -0.0393 501 HIS A O   
1529 C CB  A HIS A 206 ? 0.4644 0.5104 0.4951 -0.0188 0.0439  -0.0440 501 HIS A CB  
1530 C CB  B HIS A 206 ? 0.4779 0.5237 0.5084 -0.0188 0.0440  -0.0441 501 HIS A CB  
1531 C CG  A HIS A 206 ? 0.4650 0.5132 0.5101 -0.0145 0.0429  -0.0423 501 HIS A CG  
1532 C CG  B HIS A 206 ? 0.5422 0.5839 0.5682 -0.0191 0.0476  -0.0513 501 HIS A CG  
1533 N ND1 A HIS A 206 ? 0.5468 0.6009 0.5966 -0.0138 0.0393  -0.0376 501 HIS A ND1 
1534 N ND1 B HIS A 206 ? 0.5466 0.5866 0.5809 -0.0162 0.0519  -0.0562 501 HIS A ND1 
1535 C CD2 A HIS A 206 ? 0.3923 0.4386 0.4493 -0.0105 0.0447  -0.0459 501 HIS A CD2 
1536 C CD2 B HIS A 206 ? 0.5398 0.5798 0.5552 -0.0217 0.0475  -0.0556 501 HIS A CD2 
1537 C CE1 A HIS A 206 ? 0.5557 0.6116 0.6202 -0.0087 0.0382  -0.0394 501 HIS A CE1 
1538 C CE1 B HIS A 206 ? 0.4936 0.5315 0.5222 -0.0171 0.0548  -0.0627 501 HIS A CE1 
1539 N NE2 A HIS A 206 ? 0.5236 0.5744 0.5925 -0.0067 0.0412  -0.0441 501 HIS A NE2 
1540 N NE2 B HIS A 206 ? 0.4661 0.5041 0.4834 -0.0200 0.0519  -0.0631 501 HIS A NE2 
1541 N N   . GLN A 207 ? 0.3590 0.3096 0.3788 0.0064  -0.0088 -0.0527 502 GLN A N   
1542 C CA  . GLN A 207 ? 0.3707 0.3274 0.3887 0.0083  -0.0121 -0.0555 502 GLN A CA  
1543 C C   . GLN A 207 ? 0.3596 0.3182 0.3740 0.0106  -0.0116 -0.0545 502 GLN A C   
1544 O O   . GLN A 207 ? 0.3593 0.3256 0.3760 0.0100  -0.0138 -0.0547 502 GLN A O   
1545 C CB  . GLN A 207 ? 0.3869 0.3402 0.3984 0.0119  -0.0136 -0.0591 502 GLN A CB  
1546 C CG  . GLN A 207 ? 0.4180 0.3713 0.4335 0.0095  -0.0147 -0.0608 502 GLN A CG  
1547 C CD  . GLN A 207 ? 0.4654 0.4157 0.4747 0.0132  -0.0159 -0.0645 502 GLN A CD  
1548 O OE1 . GLN A 207 ? 0.4682 0.4158 0.4699 0.0180  -0.0155 -0.0655 502 GLN A OE1 
1549 N NE2 . GLN A 207 ? 0.4659 0.4169 0.4787 0.0111  -0.0170 -0.0666 502 GLN A NE2 
1550 N N   . ARG A 208 ? 0.3739 0.3255 0.3826 0.0132  -0.0085 -0.0532 503 ARG A N   
1551 C CA  . ARG A 208 ? 0.3271 0.2799 0.3322 0.0155  -0.0073 -0.0525 503 ARG A CA  
1552 C C   . ARG A 208 ? 0.3182 0.2774 0.3306 0.0117  -0.0068 -0.0498 503 ARG A C   
1553 O O   . ARG A 208 ? 0.4031 0.3682 0.4158 0.0120  -0.0081 -0.0497 503 ARG A O   
1554 C CB  . ARG A 208 ? 0.3420 0.2855 0.3402 0.0192  -0.0037 -0.0517 503 ARG A CB  
1555 C CG  . ARG A 208 ? 0.3691 0.3134 0.3631 0.0220  -0.0020 -0.0513 503 ARG A CG  
1556 C CD  . ARG A 208 ? 0.3921 0.3272 0.3790 0.0264  0.0015  -0.0511 503 ARG A CD  
1557 N NE  . ARG A 208 ? 0.4326 0.3681 0.4158 0.0290  0.0039  -0.0507 503 ARG A NE  
1558 C CZ  . ARG A 208 ? 0.5035 0.4407 0.4812 0.0333  0.0038  -0.0525 503 ARG A CZ  
1559 N NH1 . ARG A 208 ? 0.4152 0.3543 0.3903 0.0354  0.0011  -0.0550 503 ARG A NH1 
1560 N NH2 . ARG A 208 ? 0.4599 0.3972 0.4346 0.0354  0.0066  -0.0518 503 ARG A NH2 
1561 N N   . LEU A 209 ? 0.3886 0.3467 0.4067 0.0082  -0.0049 -0.0474 504 LEU A N   
1562 C CA  . LEU A 209 ? 0.3913 0.3567 0.4176 0.0045  -0.0042 -0.0448 504 LEU A CA  
1563 C C   . LEU A 209 ? 0.4011 0.3764 0.4332 0.0028  -0.0081 -0.0456 504 LEU A C   
1564 O O   . LEU A 209 ? 0.4076 0.3893 0.4421 0.0025  -0.0088 -0.0447 504 LEU A O   
1565 C CB  . LEU A 209 ? 0.3585 0.3226 0.3907 0.0008  -0.0016 -0.0424 504 LEU A CB  
1566 C CG  . LEU A 209 ? 0.4102 0.3833 0.4522 -0.0030 -0.0007 -0.0397 504 LEU A CG  
1567 C CD1 . LEU A 209 ? 0.3748 0.3491 0.4153 -0.0022 0.0017  -0.0383 504 LEU A CD1 
1568 C CD2 . LEU A 209 ? 0.4103 0.3828 0.4580 -0.0064 0.0021  -0.0373 504 LEU A CD2 
1569 N N   . ALA A 210 ? 0.3509 0.3276 0.3852 0.0019  -0.0107 -0.0474 505 ALA A N   
1570 C CA  . ALA A 210 ? 0.2859 0.2718 0.3258 0.0005  -0.0146 -0.0483 505 ALA A CA  
1571 C C   . ALA A 210 ? 0.3199 0.3083 0.3536 0.0036  -0.0172 -0.0499 505 ALA A C   
1572 O O   . ALA A 210 ? 0.3432 0.3393 0.3808 0.0026  -0.0194 -0.0490 505 ALA A O   
1573 C CB  . ALA A 210 ? 0.3269 0.3127 0.3694 -0.0008 -0.0165 -0.0505 505 ALA A CB  
1574 N N   . GLN A 211 ? 0.2495 0.2317 0.2736 0.0074  -0.0168 -0.0520 506 GLN A N   
1575 C CA  . GLN A 211 ? 0.3542 0.3385 0.3714 0.0108  -0.0185 -0.0534 506 GLN A CA  
1576 C C   . GLN A 211 ? 0.4021 0.3892 0.4197 0.0108  -0.0171 -0.0509 506 GLN A C   
1577 O O   . GLN A 211 ? 0.3667 0.3600 0.3838 0.0111  -0.0196 -0.0508 506 GLN A O   
1578 C CB  . GLN A 211 ? 0.4626 0.4396 0.4696 0.0154  -0.0170 -0.0557 506 GLN A CB  
1579 C CG  . GLN A 211 ? 0.5686 0.5440 0.5747 0.0159  -0.0187 -0.0586 506 GLN A CG  
1580 C CD  . GLN A 211 ? 0.5875 0.5549 0.5852 0.0204  -0.0165 -0.0603 506 GLN A CD  
1581 O OE1 . GLN A 211 ? 0.5737 0.5367 0.5662 0.0234  -0.0136 -0.0593 506 GLN A OE1 
1582 N NE2 . GLN A 211 ? 0.5355 0.5015 0.5324 0.0209  -0.0178 -0.0630 506 GLN A NE2 
1583 N N   . LEU A 212 ? 0.3638 0.3465 0.3821 0.0103  -0.0132 -0.0490 507 LEU A N   
1584 C CA  . LEU A 212 ? 0.4026 0.3876 0.4213 0.0102  -0.0112 -0.0470 507 LEU A CA  
1585 C C   . LEU A 212 ? 0.3754 0.3702 0.4040 0.0064  -0.0134 -0.0450 507 LEU A C   
1586 O O   . LEU A 212 ? 0.3927 0.3928 0.4214 0.0068  -0.0145 -0.0441 507 LEU A O   
1587 C CB  . LEU A 212 ? 0.4240 0.4020 0.4415 0.0104  -0.0064 -0.0456 507 LEU A CB  
1588 C CG  . LEU A 212 ? 0.4172 0.3854 0.4250 0.0148  -0.0036 -0.0469 507 LEU A CG  
1589 C CD1 . LEU A 212 ? 0.3906 0.3525 0.3983 0.0143  0.0009  -0.0452 507 LEU A CD1 
1590 C CD2 . LEU A 212 ? 0.4065 0.3754 0.4072 0.0186  -0.0034 -0.0479 507 LEU A CD2 
1591 N N   . LEU A 213 ? 0.3070 0.3044 0.3442 0.0030  -0.0137 -0.0440 508 LEU A N   
1592 C CA  . LEU A 213 ? 0.3117 0.3190 0.3596 -0.0003 -0.0152 -0.0419 508 LEU A CA  
1593 C C   . LEU A 213 ? 0.3358 0.3504 0.3856 -0.0002 -0.0204 -0.0428 508 LEU A C   
1594 O O   . LEU A 213 ? 0.3748 0.3976 0.4305 -0.0014 -0.0222 -0.0410 508 LEU A O   
1595 C CB  . LEU A 213 ? 0.2871 0.2956 0.3437 -0.0036 -0.0136 -0.0406 508 LEU A CB  
1596 C CG  . LEU A 213 ? 0.3493 0.3512 0.4044 -0.0041 -0.0085 -0.0392 508 LEU A CG  
1597 C CD1 . LEU A 213 ? 0.4041 0.4088 0.4684 -0.0076 -0.0068 -0.0374 508 LEU A CD1 
1598 C CD2 . LEU A 213 ? 0.2755 0.2795 0.3304 -0.0039 -0.0059 -0.0375 508 LEU A CD2 
1599 N N   . LEU A 214 ? 0.4110 0.4230 0.4559 0.0013  -0.0228 -0.0454 509 LEU A N   
1600 C CA  . LEU A 214 ? 0.3230 0.3414 0.3684 0.0016  -0.0278 -0.0464 509 LEU A CA  
1601 C C   . LEU A 214 ? 0.3784 0.3988 0.4174 0.0040  -0.0289 -0.0458 509 LEU A C   
1602 O O   . LEU A 214 ? 0.3835 0.4112 0.4254 0.0035  -0.0326 -0.0449 509 LEU A O   
1603 C CB  . LEU A 214 ? 0.3333 0.3482 0.3737 0.0030  -0.0295 -0.0497 509 LEU A CB  
1604 C CG  . LEU A 214 ? 0.4367 0.4515 0.4845 0.0002  -0.0295 -0.0504 509 LEU A CG  
1605 C CD1 . LEU A 214 ? 0.4474 0.4600 0.4902 0.0016  -0.0316 -0.0540 509 LEU A CD1 
1606 C CD2 . LEU A 214 ? 0.3979 0.4221 0.4578 -0.0029 -0.0317 -0.0485 509 LEU A CD2 
1607 N N   . ILE A 215 ? 0.3414 0.3551 0.3718 0.0067  -0.0255 -0.0462 510 ILE A N   
1608 C CA  . ILE A 215 ? 0.3165 0.3315 0.3405 0.0090  -0.0255 -0.0455 510 ILE A CA  
1609 C C   . ILE A 215 ? 0.2969 0.3188 0.3285 0.0067  -0.0256 -0.0425 510 ILE A C   
1610 O O   . ILE A 215 ? 0.3075 0.3339 0.3372 0.0075  -0.0276 -0.0414 510 ILE A O   
1611 C CB  . ILE A 215 ? 0.2986 0.3051 0.3130 0.0125  -0.0210 -0.0464 510 ILE A CB  
1612 C CG1 . ILE A 215 ? 0.4009 0.4024 0.4074 0.0155  -0.0214 -0.0493 510 ILE A CG1 
1613 C CG2 . ILE A 215 ? 0.3944 0.4025 0.4034 0.0145  -0.0200 -0.0452 510 ILE A CG2 
1614 C CD1 . ILE A 215 ? 0.4554 0.4484 0.4535 0.0193  -0.0169 -0.0503 510 ILE A CD1 
1615 N N   . LEU A 216 ? 0.3379 0.3609 0.3782 0.0039  -0.0235 -0.0411 511 LEU A N   
1616 C CA  . LEU A 216 ? 0.2996 0.3302 0.3482 0.0017  -0.0234 -0.0384 511 LEU A CA  
1617 C C   . LEU A 216 ? 0.3347 0.3750 0.3899 0.0005  -0.0288 -0.0373 511 LEU A C   
1618 O O   . LEU A 216 ? 0.3583 0.4051 0.4168 0.0001  -0.0301 -0.0353 511 LEU A O   
1619 C CB  . LEU A 216 ? 0.2814 0.3125 0.3384 -0.0010 -0.0199 -0.0371 511 LEU A CB  
1620 C CG  . LEU A 216 ? 0.3631 0.3849 0.4139 0.0001  -0.0144 -0.0376 511 LEU A CG  
1621 C CD1 . LEU A 216 ? 0.2880 0.3115 0.3469 -0.0028 -0.0108 -0.0357 511 LEU A CD1 
1622 C CD2 . LEU A 216 ? 0.3610 0.3803 0.4041 0.0025  -0.0125 -0.0376 511 LEU A CD2 
1623 N N   . SER A 217 ? 0.3501 0.3916 0.4074 0.0001  -0.0321 -0.0386 512 SER A N   
1624 C CA  . SER A 217 ? 0.3542 0.4048 0.4181 -0.0008 -0.0374 -0.0376 512 SER A CA  
1625 C C   . SER A 217 ? 0.2947 0.3465 0.3501 0.0015  -0.0406 -0.0375 512 SER A C   
1626 O O   . SER A 217 ? 0.3185 0.3780 0.3784 0.0010  -0.0441 -0.0355 512 SER A O   
1627 C CB  . SER A 217 ? 0.3943 0.4456 0.4623 -0.0019 -0.0398 -0.0393 512 SER A CB  
1628 O OG  . SER A 217 ? 0.5615 0.6063 0.6191 0.0002  -0.0404 -0.0423 512 SER A OG  
1629 N N   . HIS A 218 ? 0.2946 0.3390 0.3378 0.0042  -0.0392 -0.0396 513 HIS A N   
1630 C CA  . HIS A 218 ? 0.2740 0.3189 0.3077 0.0068  -0.0410 -0.0393 513 HIS A CA  
1631 C C   . HIS A 218 ? 0.3283 0.3749 0.3619 0.0069  -0.0388 -0.0368 513 HIS A C   
1632 O O   . HIS A 218 ? 0.4310 0.4825 0.4631 0.0074  -0.0417 -0.0350 513 HIS A O   
1633 C CB  . HIS A 218 ? 0.3834 0.4204 0.4047 0.0100  -0.0388 -0.0420 513 HIS A CB  
1634 C CG  . HIS A 218 ? 0.6443 0.6798 0.6653 0.0099  -0.0407 -0.0448 513 HIS A CG  
1635 N ND1 . HIS A 218 ? 0.7582 0.7987 0.7790 0.0098  -0.0457 -0.0455 513 HIS A ND1 
1636 C CD2 . HIS A 218 ? 0.7436 0.7732 0.7645 0.0099  -0.0383 -0.0471 513 HIS A CD2 
1637 C CE1 . HIS A 218 ? 0.7226 0.7607 0.7436 0.0096  -0.0461 -0.0483 513 HIS A CE1 
1638 N NE2 . HIS A 218 ? 0.7209 0.7524 0.7421 0.0096  -0.0417 -0.0493 513 HIS A NE2 
1639 N N   . ILE A 219 ? 0.3031 0.3455 0.3382 0.0064  -0.0337 -0.0367 514 ILE A N   
1640 C CA  . ILE A 219 ? 0.3497 0.3938 0.3853 0.0062  -0.0310 -0.0348 514 ILE A CA  
1641 C C   . ILE A 219 ? 0.3550 0.4096 0.4021 0.0036  -0.0344 -0.0321 514 ILE A C   
1642 O O   . ILE A 219 ? 0.3710 0.4297 0.4174 0.0039  -0.0353 -0.0302 514 ILE A O   
1643 C CB  . ILE A 219 ? 0.3308 0.3686 0.3662 0.0060  -0.0247 -0.0353 514 ILE A CB  
1644 C CG1 . ILE A 219 ? 0.3792 0.4072 0.4024 0.0095  -0.0215 -0.0376 514 ILE A CG1 
1645 C CG2 . ILE A 219 ? 0.2972 0.3386 0.3358 0.0051  -0.0221 -0.0333 514 ILE A CG2 
1646 C CD1 . ILE A 219 ? 0.4166 0.4373 0.4385 0.0098  -0.0155 -0.0382 514 ILE A CD1 
1647 N N   . ARG A 220 ? 0.3170 0.3761 0.3747 0.0013  -0.0362 -0.0319 515 ARG A N   
1648 C CA  . ARG A 220 ? 0.2734 0.3433 0.3432 -0.0006 -0.0395 -0.0293 515 ARG A CA  
1649 C C   . ARG A 220 ? 0.3331 0.4077 0.4002 0.0006  -0.0456 -0.0283 515 ARG A C   
1650 O O   . ARG A 220 ? 0.2735 0.3555 0.3453 0.0002  -0.0481 -0.0258 515 ARG A O   
1651 C CB  . ARG A 220 ? 0.3350 0.4086 0.4162 -0.0029 -0.0400 -0.0294 515 ARG A CB  
1652 C CG  . ARG A 220 ? 0.3698 0.4556 0.4646 -0.0044 -0.0435 -0.0268 515 ARG A CG  
1653 C CD  . ARG A 220 ? 0.3530 0.4444 0.4561 -0.0059 -0.0399 -0.0248 515 ARG A CD  
1654 N NE  . ARG A 220 ? 0.5075 0.5968 0.6156 -0.0076 -0.0350 -0.0254 515 ARG A NE  
1655 C CZ  . ARG A 220 ? 0.5274 0.6252 0.6487 -0.0095 -0.0337 -0.0236 515 ARG A CZ  
1656 N NH1 . ARG A 220 ? 0.4992 0.6087 0.6310 -0.0097 -0.0370 -0.0214 515 ARG A NH1 
1657 N NH2 . ARG A 220 ? 0.5722 0.6671 0.6963 -0.0109 -0.0289 -0.0240 515 ARG A NH2 
1658 N N   . HIS A 221 ? 0.3130 0.3836 0.3725 0.0020  -0.0480 -0.0302 516 HIS A N   
1659 C CA  . HIS A 221 ? 0.3413 0.4157 0.3968 0.0033  -0.0536 -0.0293 516 HIS A CA  
1660 C C   . HIS A 221 ? 0.3689 0.4426 0.4155 0.0050  -0.0531 -0.0277 516 HIS A C   
1661 O O   . HIS A 221 ? 0.3225 0.4029 0.3716 0.0049  -0.0570 -0.0250 516 HIS A O   
1662 C CB  . HIS A 221 ? 0.3691 0.4390 0.4169 0.0046  -0.0554 -0.0321 516 HIS A CB  
1663 C CG  . HIS A 221 ? 0.4755 0.5495 0.5189 0.0058  -0.0612 -0.0313 516 HIS A CG  
1664 N ND1 . HIS A 221 ? 0.4900 0.5723 0.5429 0.0046  -0.0666 -0.0295 516 HIS A ND1 
1665 C CD2 . HIS A 221 ? 0.4657 0.5369 0.4961 0.0083  -0.0623 -0.0317 516 HIS A CD2 
1666 C CE1 . HIS A 221 ? 0.4164 0.5003 0.4620 0.0061  -0.0711 -0.0290 516 HIS A CE1 
1667 N NE2 . HIS A 221 ? 0.3608 0.4382 0.3924 0.0083  -0.0685 -0.0303 516 HIS A NE2 
1668 N N   . MET A 222 ? 0.3225 0.3883 0.3590 0.0067  -0.0481 -0.0291 517 MET A N   
1669 C CA  . MET A 222 ? 0.3015 0.3660 0.3291 0.0085  -0.0464 -0.0277 517 MET A CA  
1670 C C   . MET A 222 ? 0.2739 0.3445 0.3097 0.0068  -0.0459 -0.0249 517 MET A C   
1671 O O   . MET A 222 ? 0.2826 0.3572 0.3160 0.0073  -0.0483 -0.0225 517 MET A O   
1672 C CB  . MET A 222 ? 0.2971 0.3520 0.3143 0.0108  -0.0401 -0.0298 517 MET A CB  
1673 C CG  . MET A 222 ? 0.3525 0.4023 0.3600 0.0133  -0.0406 -0.0324 517 MET A CG  
1674 S SD  . MET A 222 ? 0.4233 0.4628 0.4193 0.0167  -0.0333 -0.0348 517 MET A SD  
1675 C CE  . MET A 222 ? 0.3212 0.3567 0.3262 0.0145  -0.0292 -0.0359 517 MET A CE  
1676 N N   . SER A 223 ? 0.3762 0.2838 0.3163 0.0294  -0.0149 0.0210  518 SER A N   
1677 C CA  . SER A 223 ? 0.4603 0.3339 0.3856 0.0454  -0.0241 0.0213  518 SER A CA  
1678 C C   . SER A 223 ? 0.4712 0.3089 0.3468 0.0270  -0.0115 0.0173  518 SER A C   
1679 O O   . SER A 223 ? 0.4330 0.2783 0.3153 0.0294  -0.0102 0.0182  518 SER A O   
1680 C CB  . SER A 223 ? 0.5279 0.3490 0.4314 0.0674  -0.0413 0.0213  518 SER A CB  
1681 O OG  . SER A 223 ? 0.5913 0.3676 0.4659 0.0786  -0.0479 0.0204  518 SER A OG  
1682 N N   . ASN A 224 ? 0.4677 0.2660 0.2933 0.0084  -0.0021 0.0130  519 ASN A N   
1683 C CA  . ASN A 224 ? 0.4311 0.1943 0.2074 -0.0107 0.0108  0.0089  519 ASN A CA  
1684 C C   . ASN A 224 ? 0.5402 0.3552 0.3433 -0.0266 0.0247  0.0096  519 ASN A C   
1685 O O   . ASN A 224 ? 0.5459 0.3467 0.3320 -0.0298 0.0289  0.0088  519 ASN A O   
1686 C CB  . ASN A 224 ? 0.5259 0.2502 0.2520 -0.0307 0.0208  0.0042  519 ASN A CB  
1687 C CG  . ASN A 224 ? 0.6737 0.3341 0.3607 -0.0166 0.0083  0.0028  519 ASN A CG  
1688 O OD1 . ASN A 224 ? 0.7245 0.3562 0.4070 0.0052  -0.0057 0.0042  519 ASN A OD1 
1689 N ND2 . ASN A 224 ? 0.5953 0.2339 0.2542 -0.0290 0.0135  0.0000  519 ASN A ND2 
1690 N N   . LYS A 225 ? 0.4154 0.2907 0.2608 -0.0362 0.0317  0.0113  520 LYS A N   
1691 C CA  . LYS A 225 ? 0.4136 0.3427 0.2878 -0.0516 0.0451  0.0122  520 LYS A CA  
1692 C C   . LYS A 225 ? 0.4814 0.4414 0.3972 -0.0333 0.0368  0.0165  520 LYS A C   
1693 O O   . LYS A 225 ? 0.4821 0.4525 0.3966 -0.0418 0.0451  0.0163  520 LYS A O   
1694 C CB  . LYS A 225 ? 0.3833 0.3705 0.2949 -0.0644 0.0535  0.0132  520 LYS A CB  
1695 C CG  . LYS A 225 ? 0.4471 0.4118 0.3189 -0.0879 0.0658  0.0085  520 LYS A CG  
1696 C CD  . LYS A 225 ? 0.6031 0.5138 0.4137 -0.1041 0.0760  0.0037  520 LYS A CD  
1697 C CE  . LYS A 225 ? 0.8308 0.7361 0.6108 -0.1328 0.0930  -0.0009 520 LYS A CE  
1698 N NZ  . LYS A 225 ? 0.8761 0.8328 0.6778 -0.1537 0.1094  -0.0012 520 LYS A NZ  
1699 N N   . GLY A 226 ? 0.4039 0.3784 0.3565 -0.0082 0.0206  0.0204  521 GLY A N   
1700 C CA  . GLY A 226 ? 0.4082 0.4107 0.4017 0.0114  0.0112  0.0245  521 GLY A CA  
1701 C C   . GLY A 226 ? 0.4791 0.4303 0.4363 0.0200  0.0061  0.0231  521 GLY A C   
1702 O O   . GLY A 226 ? 0.5391 0.5093 0.5117 0.0213  0.0084  0.0246  521 GLY A O   
1703 N N   . MET A 227 ? 0.5146 0.4001 0.4231 0.0260  -0.0011 0.0203  522 MET A N   
1704 C CA  . MET A 227 ? 0.6218 0.4526 0.4900 0.0338  -0.0060 0.0185  522 MET A CA  
1705 C C   . MET A 227 ? 0.6675 0.4934 0.5078 0.0108  0.0108  0.0158  522 MET A C   
1706 O O   . MET A 227 ? 0.6350 0.4491 0.4681 0.0159  0.0096  0.0161  522 MET A O   
1707 C CB  . MET A 227 ? 0.6752 0.4364 0.4910 0.0393  -0.0134 0.0154  522 MET A CB  
1708 C CG  . MET A 227 ? 0.8343 0.5457 0.6265 0.0602  -0.0270 0.0152  522 MET A CG  
1709 S SD  . MET A 227 ? 0.7152 0.4620 0.5691 0.0931  -0.0469 0.0206  522 MET A SD  
1710 C CE  . MET A 227 ? 0.9620 0.7299 0.8398 0.0960  -0.0517 0.0220  522 MET A CE  
1711 N N   . GLU A 228 ? 0.6843 0.5197 0.5092 -0.0147 0.0264  0.0132  523 GLU A N   
1712 C CA  . GLU A 228 ? 0.7585 0.5914 0.5566 -0.0392 0.0438  0.0103  523 GLU A CA  
1713 C C   . GLU A 228 ? 0.7212 0.6096 0.5635 -0.0398 0.0483  0.0135  523 GLU A C   
1714 O O   . GLU A 228 ? 0.7704 0.6443 0.5940 -0.0448 0.0536  0.0126  523 GLU A O   
1715 C CB  . GLU A 228 ? 0.8868 0.7317 0.6720 -0.0649 0.0589  0.0074  523 GLU A CB  
1716 C CG  . GLU A 228 ? 1.0200 0.8214 0.7461 -0.0884 0.0736  0.0023  523 GLU A CG  
1717 C CD  . GLU A 228 ? 1.0531 0.8677 0.7688 -0.1129 0.0879  -0.0007 523 GLU A CD  
1718 O OE1 . GLU A 228 ? 1.1360 0.9051 0.7980 -0.1298 0.0975  -0.0053 523 GLU A OE1 
1719 O OE2 . GLU A 228 ? 1.0080 0.8788 0.7696 -0.1150 0.0895  0.0016  523 GLU A OE2 
1720 N N   . HIS A 229 ? 0.6747 0.6269 0.5760 -0.0348 0.0465  0.0174  524 HIS A N   
1721 C CA  . HIS A 229 ? 0.6753 0.6861 0.6245 -0.0344 0.0504  0.0209  524 HIS A CA  
1722 C C   . HIS A 229 ? 0.6841 0.6827 0.6440 -0.0111 0.0373  0.0234  524 HIS A C   
1723 O O   . HIS A 229 ? 0.6977 0.7093 0.6629 -0.0150 0.0428  0.0242  524 HIS A O   
1724 C CB  . HIS A 229 ? 0.6892 0.7682 0.6994 -0.0313 0.0495  0.0246  524 HIS A CB  
1725 C CG  . HIS A 229 ? 0.8019 0.9454 0.8600 -0.0358 0.0569  0.0279  524 HIS A CG  
1726 N ND1 . HIS A 229 ? 0.8205 0.9968 0.9256 -0.0146 0.0463  0.0325  524 HIS A ND1 
1727 C CD2 . HIS A 229 ? 0.8234 1.0048 0.8898 -0.0592 0.0741  0.0272  524 HIS A CD2 
1728 C CE1 . HIS A 229 ? 0.7906 1.0222 0.9308 -0.0246 0.0566  0.0346  524 HIS A CE1 
1729 N NE2 . HIS A 229 ? 0.8297 1.0656 0.9472 -0.0517 0.0734  0.0315  524 HIS A NE2 
1730 N N   . LEU A 230 ? 0.6405 0.6140 0.6034 0.0132  0.0199  0.0247  525 LEU A N   
1731 C CA  . LEU A 230 ? 0.6151 0.5725 0.5862 0.0371  0.0059  0.0268  525 LEU A CA  
1732 C C   . LEU A 230 ? 0.7475 0.6552 0.6692 0.0313  0.0100  0.0238  525 LEU A C   
1733 O O   . LEU A 230 ? 0.7713 0.6872 0.7074 0.0408  0.0067  0.0256  525 LEU A O   
1734 C CB  . LEU A 230 ? 0.5403 0.4668 0.5103 0.0615  -0.0126 0.0275  525 LEU A CB  
1735 C CG  . LEU A 230 ? 0.4863 0.4639 0.5163 0.0775  -0.0223 0.0317  525 LEU A CG  
1736 C CD1 . LEU A 230 ? 0.4354 0.3747 0.4575 0.1013  -0.0405 0.0320  525 LEU A CD1 
1737 C CD2 . LEU A 230 ? 0.5254 0.5578 0.6102 0.0878  -0.0244 0.0360  525 LEU A CD2 
1738 N N   . TYR A 231 ? 0.8038 0.6597 0.6674 0.0159  0.0174  0.0192  526 TYR A N   
1739 C CA  . TYR A 231 ? 0.8945 0.6986 0.7068 0.0098  0.0217  0.0161  526 TYR A CA  
1740 C C   . TYR A 231 ? 0.8981 0.7304 0.7121 -0.0118 0.0387  0.0157  526 TYR A C   
1741 O O   . TYR A 231 ? 1.0178 0.8206 0.8029 -0.0141 0.0415  0.0143  526 TYR A O   
1742 C CB  . TYR A 231 ? 0.9626 0.7005 0.7112 0.0009  0.0241  0.0114  526 TYR A CB  
1743 C CG  . TYR A 231 ? 1.0682 0.7555 0.7968 0.0245  0.0063  0.0111  526 TYR A CG  
1744 C CD1 . TYR A 231 ? 1.1059 0.7636 0.8257 0.0438  -0.0051 0.0117  526 TYR A CD1 
1745 C CD2 . TYR A 231 ? 1.1421 0.8106 0.8595 0.0272  0.0012  0.0100  526 TYR A CD2 
1746 C CE1 . TYR A 231 ? 1.1468 0.7583 0.8481 0.0654  -0.0212 0.0113  526 TYR A CE1 
1747 C CE2 . TYR A 231 ? 1.1854 0.8075 0.8841 0.0486  -0.0149 0.0098  526 TYR A CE2 
1748 C CZ  . TYR A 231 ? 1.1995 0.7933 0.8902 0.0677  -0.0260 0.0104  526 TYR A CZ  
1749 O OH  . TYR A 231 ? 1.2498 0.7975 0.9218 0.0892  -0.0421 0.0101  526 TYR A OH  
1750 N N   . SER A 232 ? 1.4397 0.6914 1.1894 0.2166  -0.1530 -0.0143 527 SER A N   
1751 C CA  . SER A 232 ? 1.4068 0.6965 1.1324 0.2143  -0.1294 -0.0059 527 SER A CA  
1752 C C   . SER A 232 ? 1.4361 0.7343 1.1725 0.2341  -0.0986 -0.0004 527 SER A C   
1753 O O   . SER A 232 ? 1.4713 0.8036 1.1929 0.2364  -0.0749 0.0073  527 SER A O   
1754 C CB  . SER A 232 ? 1.2412 0.5933 0.9768 0.2203  -0.1183 0.0012  527 SER A CB  
1755 O OG  . SER A 232 ? 1.2053 0.5938 0.9855 0.2494  -0.0972 0.0062  527 SER A OG  
1756 N N   . MET A 233 ? 1.4489 0.7163 1.2116 0.2485  -0.0989 -0.0043 528 MET A N   
1757 C CA  . MET A 233 ? 1.4032 0.6725 1.1774 0.2671  -0.0717 -0.0001 528 MET A CA  
1758 C C   . MET A 233 ? 1.5044 0.7196 1.2468 0.2512  -0.0808 -0.0052 528 MET A C   
1759 O O   . MET A 233 ? 1.4950 0.6573 1.2338 0.2403  -0.1065 -0.0142 528 MET A O   
1760 C CB  . MET A 233 ? 1.3323 0.6002 1.1544 0.2932  -0.0652 -0.0012 528 MET A CB  
1761 C CG  . MET A 233 ? 1.3081 0.6329 1.1653 0.3132  -0.0508 0.0049  528 MET A CG  
1762 S SD  . MET A 233 ? 1.2677 0.5824 1.1797 0.3395  -0.0513 0.0015  528 MET A SD  
1763 C CE  . MET A 233 ? 1.6781 0.9199 1.5795 0.3328  -0.0643 -0.0071 528 MET A CE  
1764 N N   . LYS A 234 ? 1.6523 0.8809 1.3718 0.2499  -0.0595 0.0006  529 LYS A N   
1765 C CA  . LYS A 234 ? 1.7755 0.9564 1.4632 0.2349  -0.0655 -0.0034 529 LYS A CA  
1766 C C   . LYS A 234 ? 1.8885 1.0345 1.5995 0.2509  -0.0601 -0.0067 529 LYS A C   
1767 O O   . LYS A 234 ? 1.9530 1.0763 1.6469 0.2488  -0.0506 -0.0064 529 LYS A O   
1768 C CB  . LYS A 234 ? 1.7907 0.9992 1.4485 0.2300  -0.0427 0.0042  529 LYS A CB  
1769 N N   . CYS A 235 ? 1.9229 1.0647 1.6729 0.2668  -0.0660 -0.0098 530 CYS A N   
1770 C CA  . CYS A 235 ? 1.9606 1.0690 1.7357 0.2825  -0.0625 -0.0135 530 CYS A CA  
1771 C C   . CYS A 235 ? 2.0410 1.0842 1.8067 0.2658  -0.0963 -0.0248 530 CYS A C   
1772 O O   . CYS A 235 ? 2.0773 1.0865 1.8633 0.2765  -0.0987 -0.0294 530 CYS A O   
1773 C CB  . CYS A 235 ? 1.9048 1.0465 1.7298 0.3117  -0.0470 -0.0100 530 CYS A CB  
1774 S SG  . CYS A 235 ? 1.6882 0.8842 1.5322 0.3396  -0.0013 0.0019  530 CYS A SG  
1775 N N   . LYS A 236 ? 2.0555 1.0817 1.7903 0.2397  -0.1222 -0.0293 531 LYS A N   
1776 C CA  . LYS A 236 ? 2.0602 1.0243 1.7800 0.2204  -0.1556 -0.0401 531 LYS A CA  
1777 C C   . LYS A 236 ? 2.0171 0.9579 1.7751 0.2333  -0.1694 -0.0464 531 LYS A C   
1778 O O   . LYS A 236 ? 2.0128 0.9003 1.7633 0.2202  -0.1964 -0.0556 531 LYS A O   
1779 C CB  . LYS A 236 ? 2.0918 1.0122 1.7836 0.2103  -0.1549 -0.0428 531 LYS A CB  
1780 N N   . ASN A 237 ? 2.0530 1.0331 1.8519 0.2591  -0.1510 -0.0415 532 ASN A N   
1781 C CA  . ASN A 237 ? 2.0044 0.9651 1.8414 0.2728  -0.1623 -0.0471 532 ASN A CA  
1782 C C   . ASN A 237 ? 1.9230 0.9314 1.8059 0.3018  -0.1409 -0.0412 532 ASN A C   
1783 O O   . ASN A 237 ? 1.9182 0.9573 1.8156 0.3215  -0.1105 -0.0339 532 ASN A O   
1784 C CB  . ASN A 237 ? 2.0309 0.9363 1.8704 0.2751  -0.1674 -0.0534 532 ASN A CB  
1785 C CG  . ASN A 237 ? 2.0660 0.9425 1.9393 0.2842  -0.1854 -0.0610 532 ASN A CG  
1786 O OD1 . ASN A 237 ? 2.0207 0.9058 1.9065 0.2812  -0.2026 -0.0637 532 ASN A OD1 
1787 N ND2 . ASN A 237 ? 2.0778 0.9196 1.9659 0.2952  -0.1818 -0.0645 532 ASN A ND2 
1788 N N   . VAL A 238 ? 1.8436 0.8574 1.7480 0.3032  -0.1581 -0.0447 533 VAL A N   
1789 C CA  . VAL A 238 ? 1.7361 0.7620 1.6884 0.3277  -0.1523 -0.0449 533 VAL A CA  
1790 C C   . VAL A 238 ? 1.6395 0.6362 1.5950 0.3141  -0.1871 -0.0538 533 VAL A C   
1791 O O   . VAL A 238 ? 1.6172 0.6042 1.6072 0.3272  -0.1946 -0.0578 533 VAL A O   
1792 C CB  . VAL A 238 ? 1.7850 0.8796 1.7634 0.3487  -0.1254 -0.0351 533 VAL A CB  
1793 C CG1 . VAL A 238 ? 1.7439 0.8774 1.6947 0.3440  -0.1034 -0.0263 533 VAL A CG1 
1794 C CG2 . VAL A 238 ? 1.7485 0.8635 1.7437 0.3469  -0.1422 -0.0368 533 VAL A CG2 
1795 N N   . VAL A 239 ? 0.8164 0.7354 0.7984 0.0232  0.0209  -0.0332 534 VAL A N   
1796 C CA  . VAL A 239 ? 0.7472 0.6636 0.6997 0.0179  0.0352  -0.0070 534 VAL A CA  
1797 C C   . VAL A 239 ? 0.6494 0.5832 0.6010 0.0343  0.0191  -0.0259 534 VAL A C   
1798 O O   . VAL A 239 ? 0.6122 0.5817 0.5482 0.0558  0.0122  -0.0481 534 VAL A O   
1799 C CB  . VAL A 239 ? 0.7429 0.6836 0.6464 0.0223  0.0587  0.0114  534 VAL A CB  
1800 C CG1 . VAL A 239 ? 0.7788 0.7087 0.6544 0.0113  0.0767  0.0444  534 VAL A CG1 
1801 C CG2 . VAL A 239 ? 0.7108 0.6448 0.6141 0.0124  0.0716  0.0210  534 VAL A CG2 
1802 N N   . PRO A 240 ? 0.6623 0.5714 0.6308 0.0242  0.0131  -0.0172 535 PRO A N   
1803 C CA  . PRO A 240 ? 0.6643 0.5874 0.6347 0.0385  -0.0029 -0.0347 535 PRO A CA  
1804 C C   . PRO A 240 ? 0.6534 0.6059 0.5764 0.0503  0.0106  -0.0243 535 PRO A C   
1805 O O   . PRO A 240 ? 0.6797 0.6243 0.5746 0.0388  0.0327  0.0074  535 PRO A O   
1806 C CB  . PRO A 240 ? 0.5333 0.4182 0.5285 0.0202  -0.0066 -0.0191 535 PRO A CB  
1807 C CG  . PRO A 240 ? 0.5714 0.4301 0.5561 -0.0022 0.0163  0.0167  535 PRO A CG  
1808 C CD  . PRO A 240 ? 0.6614 0.5286 0.6452 -0.0013 0.0223  0.0113  535 PRO A CD  
1809 N N   . SER A 241 ? 0.6040 0.5898 0.5181 0.0731  -0.0024 -0.0504 536 SER A N   
1810 C CA  . SER A 241 ? 0.5489 0.5652 0.4182 0.0863  0.0091  -0.0432 536 SER A CA  
1811 C C   . SER A 241 ? 0.5967 0.6014 0.4595 0.0813  0.0101  -0.0279 536 SER A C   
1812 O O   . SER A 241 ? 0.6394 0.6165 0.5347 0.0709  -0.0019 -0.0288 536 SER A O   
1813 C CB  . SER A 241 ? 0.5850 0.6417 0.4479 0.1129  -0.0057 -0.0777 536 SER A CB  
1814 O OG  . SER A 241 ? 0.5977 0.6526 0.4919 0.1210  -0.0306 -0.1038 536 SER A OG  
1815 N N   . TYR A 242 ? 0.6442 0.6704 0.4648 0.0887  0.0246  -0.0138 537 TYR A N   
1816 C CA  . TYR A 242 ? 0.6420 0.6629 0.4517 0.0870  0.0259  -0.0008 537 TYR A CA  
1817 C C   . TYR A 242 ? 0.5974 0.6268 0.4327 0.1010  -0.0005 -0.0316 537 TYR A C   
1818 O O   . TYR A 242 ? 0.5867 0.5934 0.4422 0.0923  -0.0089 -0.0273 537 TYR A O   
1819 C CB  . TYR A 242 ? 0.6570 0.7056 0.4153 0.0964  0.0449  0.0151  537 TYR A CB  
1820 C CG  . TYR A 242 ? 0.6855 0.7336 0.4282 0.0972  0.0468  0.0275  537 TYR A CG  
1821 C CD1 . TYR A 242 ? 0.7216 0.7950 0.4623 0.1169  0.0307  0.0037  537 TYR A CD1 
1822 C CD2 . TYR A 242 ? 0.6819 0.7047 0.4107 0.0784  0.0651  0.0632  537 TYR A CD2 
1823 C CE1 . TYR A 242 ? 0.7343 0.8078 0.4604 0.1179  0.0326  0.0150  537 TYR A CE1 
1824 C CE2 . TYR A 242 ? 0.6957 0.7182 0.4099 0.0792  0.0671  0.0748  537 TYR A CE2 
1825 C CZ  . TYR A 242 ? 0.7258 0.7738 0.4387 0.0991  0.0508  0.0505  537 TYR A CZ  
1826 O OH  . TYR A 242 ? 0.7865 0.8347 0.4847 0.1002  0.0527  0.0618  537 TYR A OH  
1827 N N   . ASP A 243 ? 0.6035 0.6654 0.4382 0.1224  -0.0137 -0.0629 538 ASP A N   
1828 C CA  . ASP A 243 ? 0.7245 0.7989 0.5810 0.1378  -0.0388 -0.0943 538 ASP A CA  
1829 C C   . ASP A 243 ? 0.6718 0.7148 0.5796 0.1269  -0.0577 -0.1072 538 ASP A C   
1830 O O   . ASP A 243 ? 0.6724 0.7059 0.6013 0.1276  -0.0732 -0.1167 538 ASP A O   
1831 C CB  . ASP A 243 ? 0.8088 0.9242 0.6539 0.1623  -0.0478 -0.1247 538 ASP A CB  
1832 C CG  . ASP A 243 ? 0.9351 1.0812 0.7297 0.1726  -0.0280 -0.1118 538 ASP A CG  
1833 O OD1 . ASP A 243 ? 1.0571 1.2151 0.8376 0.1746  -0.0175 -0.1105 538 ASP A OD1 
1834 O OD2 . ASP A 243 ? 0.9512 1.1095 0.7202 0.1785  -0.0228 -0.1026 538 ASP A OD2 
1835 N N   . LEU A 244 ? 0.6896 0.7164 0.6171 0.1166  -0.0560 -0.1072 539 LEU A N   
1836 C CA  . LEU A 244 ? 0.6543 0.6500 0.6303 0.1051  -0.0724 -0.1178 539 LEU A CA  
1837 C C   . LEU A 244 ? 0.6740 0.6330 0.6626 0.0849  -0.0685 -0.0929 539 LEU A C   
1838 O O   . LEU A 244 ? 0.6651 0.6087 0.6854 0.0831  -0.0866 -0.1054 539 LEU A O   
1839 C CB  . LEU A 244 ? 0.6468 0.6307 0.6375 0.0960  -0.0675 -0.1172 539 LEU A CB  
1840 C CG  . LEU A 244 ? 0.7034 0.6509 0.7433 0.0810  -0.0815 -0.1232 539 LEU A CG  
1841 C CD1 . LEU A 244 ? 0.7224 0.6793 0.7944 0.0956  -0.1097 -0.1608 539 LEU A CD1 
1842 C CD2 . LEU A 244 ? 0.7016 0.6352 0.7526 0.0697  -0.0734 -0.1174 539 LEU A CD2 
1843 N N   . LEU A 245 ? 0.5180 0.4632 0.4813 0.0698  -0.0447 -0.0575 540 LEU A N   
1844 C CA  . LEU A 245 ? 0.4747 0.3843 0.4472 0.0494  -0.0385 -0.0307 540 LEU A CA  
1845 C C   . LEU A 245 ? 0.5465 0.4627 0.5132 0.0570  -0.0468 -0.0335 540 LEU A C   
1846 O O   . LEU A 245 ? 0.5197 0.4090 0.5129 0.0464  -0.0563 -0.0302 540 LEU A O   
1847 C CB  . LEU A 245 ? 0.3955 0.2930 0.3375 0.0334  -0.0102 0.0075  540 LEU A CB  
1848 C CG  . LEU A 245 ? 0.4367 0.3152 0.3920 0.0191  -0.0016 0.0163  540 LEU A CG  
1849 C CD1 . LEU A 245 ? 0.4534 0.3306 0.3711 0.0085  0.0270  0.0502  540 LEU A CD1 
1850 C CD2 . LEU A 245 ? 0.4990 0.3356 0.4984 -0.0001 -0.0111 0.0203  540 LEU A CD2 
1851 N N   . LEU A 246 ? 0.6712 0.6566 0.4135 0.0058  -0.1065 0.1094  541 LEU A N   
1852 C CA  . LEU A 246 ? 0.5551 0.5844 0.3387 -0.0067 -0.1167 0.0504  541 LEU A CA  
1853 C C   . LEU A 246 ? 0.6139 0.6241 0.4242 -0.0097 -0.0627 -0.0209 541 LEU A C   
1854 O O   . LEU A 246 ? 0.6019 0.5821 0.4369 -0.0262 -0.0454 -0.0745 541 LEU A O   
1855 C CB  . LEU A 246 ? 0.5539 0.6902 0.3509 0.0021  -0.1650 0.0646  541 LEU A CB  
1856 C CG  . LEU A 246 ? 0.6246 0.8196 0.4638 -0.0095 -0.1844 0.0105  541 LEU A CG  
1857 C CD1 . LEU A 246 ? 0.6718 0.8299 0.5177 -0.0296 -0.2034 0.0023  541 LEU A CD1 
1858 C CD2 . LEU A 246 ? 0.6803 0.9791 0.5265 0.0019  -0.2322 0.0344  541 LEU A CD2 
1859 N N   . GLU A 247 ? 0.6939 0.7215 0.4993 0.0064  -0.0362 -0.0213 542 GLU A N   
1860 C CA  . GLU A 247 ? 0.7517 0.7583 0.5792 0.0052  0.0174  -0.0851 542 GLU A CA  
1861 C C   . GLU A 247 ? 0.7610 0.6661 0.5848 -0.0096 0.0581  -0.1113 542 GLU A C   
1862 O O   . GLU A 247 ? 0.7840 0.6724 0.6377 -0.0234 0.0805  -0.1737 542 GLU A O   
1863 C CB  . GLU A 247 ? 0.8259 0.8460 0.6381 0.0254  0.0431  -0.0682 542 GLU A CB  
1864 C CG  . GLU A 247 ? 1.1033 1.1494 0.9463 0.0283  0.0808  -0.1330 542 GLU A CG  
1865 C CD  . GLU A 247 ? 1.3265 1.3934 1.1546 0.0491  0.1019  -0.1134 542 GLU A CD  
1866 O OE1 . GLU A 247 ? 1.3383 1.4845 1.1847 0.0587  0.0909  -0.1284 542 GLU A OE1 
1867 O OE2 . GLU A 247 ? 1.4585 1.4624 1.2568 0.0557  0.1294  -0.0832 542 GLU A OE2 
1868 N N   . MET A 248 ? 0.7376 0.5756 0.5245 -0.0069 0.0664  -0.0624 543 MET A N   
1869 C CA  . MET A 248 ? 0.7511 0.4883 0.5296 -0.0194 0.1059  -0.0803 543 MET A CA  
1870 C C   . MET A 248 ? 0.7919 0.5050 0.5889 -0.0410 0.0919  -0.1096 543 MET A C   
1871 O O   . MET A 248 ? 0.8458 0.4906 0.6519 -0.0540 0.1298  -0.1515 543 MET A O   
1872 C CB  . MET A 248 ? 0.8104 0.4862 0.5437 -0.0121 0.1096  -0.0150 543 MET A CB  
1873 C CG  . MET A 248 ? 0.9129 0.5382 0.6310 -0.0016 0.1635  -0.0195 543 MET A CG  
1874 S SD  . MET A 248 ? 1.2906 0.8465 0.9557 0.0070  0.1652  0.0591  543 MET A SD  
1875 C CE  . MET A 248 ? 0.8954 0.5439 0.5445 0.0244  0.1059  0.1263  543 MET A CE  
1876 N N   . LEU A 249 ? 0.7059 0.4749 0.5087 -0.0447 0.0376  -0.0876 544 LEU A N   
1877 C CA  . LEU A 249 ? 0.7444 0.4952 0.5638 -0.0648 0.0191  -0.1103 544 LEU A CA  
1878 C C   . LEU A 249 ? 0.7871 0.5596 0.6513 -0.0766 0.0368  -0.1895 544 LEU A C   
1879 O O   . LEU A 249 ? 0.7646 0.4870 0.6427 -0.0942 0.0509  -0.2259 544 LEU A O   
1880 C CB  . LEU A 249 ? 0.7965 0.6020 0.6085 -0.0649 -0.0451 -0.0619 544 LEU A CB  
1881 C CG  . LEU A 249 ? 0.8352 0.5880 0.6064 -0.0643 -0.0630 0.0060  544 LEU A CG  
1882 C CD1 . LEU A 249 ? 0.9504 0.7694 0.7119 -0.0594 -0.1258 0.0594  544 LEU A CD1 
1883 C CD2 . LEU A 249 ? 0.8076 0.4756 0.5781 -0.0838 -0.0466 -0.0130 544 LEU A CD2 
1884 N N   . ASP A 250 ? 0.8042 0.6517 0.6911 -0.0671 0.0357  -0.2158 545 ASP A N   
1885 C CA  . ASP A 250 ? 0.9904 0.8608 0.9198 -0.0769 0.0549  -0.2916 545 ASP A CA  
1886 C C   . ASP A 250 ? 1.1067 0.8949 1.0400 -0.0833 0.1174  -0.3370 545 ASP A C   
1887 O O   . ASP A 250 ? 1.0872 0.8645 1.0137 -0.0713 0.1543  -0.3435 545 ASP A O   
1888 C CB  . ASP A 250 ? 1.0578 1.0211 1.0072 -0.0635 0.0451  -0.3076 545 ASP A CB  
1889 C CG  . ASP A 250 ? 1.0986 1.1467 1.0470 -0.0579 -0.0173 -0.2668 545 ASP A CG  
1890 O OD1 . ASP A 250 ? 1.0575 1.1015 1.0031 -0.0688 -0.0539 -0.2461 545 ASP A OD1 
1891 O OD2 . ASP A 250 ? 1.1392 1.2583 1.0897 -0.0425 -0.0299 -0.2552 545 ASP A OD2 
1892 N N   . ALA A 251 ? 1.2667 0.9970 1.2104 -0.1022 0.1284  -0.3673 546 ALA A N   
1893 C CA  . ALA A 251 ? 1.3180 0.9604 1.2630 -0.1108 0.1852  -0.4065 546 ALA A CA  
1894 C C   . ALA A 251 ? 1.3748 1.0012 1.3106 -0.0961 0.2315  -0.4139 546 ALA A C   
1895 O O   . ALA A 251 ? 1.4264 1.0798 1.3897 -0.0944 0.2582  -0.4675 546 ALA A O   
1896 C CB  . ALA A 251 ? 1.3413 0.9808 1.3270 -0.1286 0.1992  -0.4800 546 ALA A CB  
1897 N N   . LEU B 11  ? 0.9054 0.9683 1.1973 -0.0557 0.1769  0.0202  306 LEU B N   
1898 C CA  . LEU B 11  ? 0.8783 0.9216 1.1190 -0.0541 0.1883  0.0197  306 LEU B CA  
1899 C C   . LEU B 11  ? 0.7856 0.8239 0.9828 -0.0484 0.1670  0.0147  306 LEU B C   
1900 O O   . LEU B 11  ? 0.6786 0.7269 0.8870 -0.0480 0.1430  0.0093  306 LEU B O   
1901 C CB  . LEU B 11  ? 0.8899 0.9201 1.1339 -0.0638 0.2018  0.0150  306 LEU B CB  
1902 N N   . ALA B 12  ? 0.7702 0.7932 0.9180 -0.0440 0.1761  0.0166  307 ALA B N   
1903 C CA  . ALA B 12  ? 0.7389 0.7563 0.8414 -0.0375 0.1582  0.0131  307 ALA B CA  
1904 C C   . ALA B 12  ? 0.7250 0.7393 0.8230 -0.0422 0.1375  0.0023  307 ALA B C   
1905 O O   . ALA B 12  ? 0.7143 0.7329 0.7957 -0.0373 0.1150  -0.0014 307 ALA B O   
1906 C CB  . ALA B 12  ? 0.7455 0.7449 0.7972 -0.0335 0.1744  0.0169  307 ALA B CB  
1907 N N   . LEU B 13  ? 0.6402 0.6472 0.7533 -0.0518 0.1453  -0.0028 308 LEU B N   
1908 C CA  . LEU B 13  ? 0.6323 0.6341 0.7389 -0.0570 0.1280  -0.0133 308 LEU B CA  
1909 C C   . LEU B 13  ? 0.6378 0.6569 0.7811 -0.0586 0.1037  -0.0184 308 LEU B C   
1910 O O   . LEU B 13  ? 0.6675 0.6841 0.8045 -0.0618 0.0857  -0.0272 308 LEU B O   
1911 C CB  . LEU B 13  ? 0.6409 0.6305 0.7552 -0.0669 0.1440  -0.0171 308 LEU B CB  
1912 C CG  . LEU B 13  ? 0.6521 0.6220 0.7240 -0.0667 0.1648  -0.0145 308 LEU B CG  
1913 C CD1 . LEU B 13  ? 0.6163 0.5759 0.6996 -0.0771 0.1773  -0.0192 308 LEU B CD1 
1914 C CD2 . LEU B 13  ? 0.6776 0.6367 0.6948 -0.0602 0.1522  -0.0171 308 LEU B CD2 
1915 N N   . SER B 14  ? 0.6018 0.6382 0.7830 -0.0566 0.1031  -0.0128 309 SER B N   
1916 C CA  . SER B 14  ? 0.6251 0.6791 0.8440 -0.0581 0.0809  -0.0166 309 SER B CA  
1917 C C   . SER B 14  ? 0.5885 0.6531 0.7926 -0.0489 0.0598  -0.0153 309 SER B C   
1918 O O   . SER B 14  ? 0.5704 0.6488 0.7985 -0.0495 0.0383  -0.0192 309 SER B O   
1919 C CB  . SER B 14  ? 0.6067 0.6745 0.8816 -0.0624 0.0913  -0.0117 309 SER B CB  
1920 O OG  . SER B 14  ? 0.6783 0.7413 0.9784 -0.0727 0.0990  -0.0165 309 SER B OG  
1921 N N   . LEU B 15  ? 0.4897 0.5481 0.6544 -0.0403 0.0660  -0.0097 310 LEU B N   
1922 C CA  . LEU B 15  ? 0.5439 0.6118 0.6914 -0.0308 0.0474  -0.0079 310 LEU B CA  
1923 C C   . LEU B 15  ? 0.5382 0.6044 0.6644 -0.0304 0.0212  -0.0173 310 LEU B C   
1924 O O   . LEU B 15  ? 0.4777 0.5284 0.5772 -0.0343 0.0211  -0.0238 310 LEU B O   
1925 C CB  . LEU B 15  ? 0.5731 0.6319 0.6775 -0.0219 0.0602  -0.0006 310 LEU B CB  
1926 C CG  . LEU B 15  ? 0.5399 0.6013 0.6594 -0.0199 0.0845  0.0097  310 LEU B CG  
1927 C CD1 . LEU B 15  ? 0.6150 0.6708 0.6914 -0.0096 0.0901  0.0163  310 LEU B CD1 
1928 C CD2 . LEU B 15  ? 0.4759 0.5586 0.6483 -0.0203 0.0800  0.0135  310 LEU B CD2 
1929 N N   . THR B 16  ? 0.4707 0.5529 0.6087 -0.0258 -0.0008 -0.0177 311 THR B N   
1930 C CA  . THR B 16  ? 0.4711 0.5524 0.5842 -0.0237 -0.0264 -0.0256 311 THR B CA  
1931 C C   . THR B 16  ? 0.5090 0.5800 0.5670 -0.0141 -0.0264 -0.0228 311 THR B C   
1932 O O   . THR B 16  ? 0.4917 0.5591 0.5359 -0.0090 -0.0085 -0.0144 311 THR B O   
1933 C CB  . THR B 16  ? 0.5151 0.6180 0.6596 -0.0217 -0.0503 -0.0267 311 THR B CB  
1934 O OG1 . THR B 16  ? 0.4472 0.5609 0.5879 -0.0121 -0.0502 -0.0180 311 THR B OG1 
1935 C CG2 . THR B 16  ? 0.5392 0.6542 0.7418 -0.0304 -0.0486 -0.0275 311 THR B CG2 
1936 N N   . ALA B 17  ? 0.5277 0.5939 0.5541 -0.0117 -0.0465 -0.0296 312 ALA B N   
1937 C CA  . ALA B 17  ? 0.5047 0.5621 0.4786 -0.0021 -0.0491 -0.0271 312 ALA B CA  
1938 C C   . ALA B 17  ? 0.5395 0.6119 0.5186 0.0074  -0.0520 -0.0185 312 ALA B C   
1939 O O   . ALA B 17  ? 0.5597 0.6259 0.5103 0.0144  -0.0392 -0.0114 312 ALA B O   
1940 C CB  . ALA B 17  ? 0.3910 0.4431 0.3353 -0.0012 -0.0725 -0.0361 312 ALA B CB  
1941 N N   . ASP B 18  ? 0.4828 0.5752 0.4990 0.0075  -0.0689 -0.0190 313 ASP B N   
1942 C CA  . ASP B 18  ? 0.5538 0.6625 0.5795 0.0162  -0.0734 -0.0110 313 ASP B CA  
1943 C C   . ASP B 18  ? 0.4622 0.5723 0.5045 0.0173  -0.0476 -0.0010 313 ASP B C   
1944 O O   . ASP B 18  ? 0.3987 0.5129 0.4272 0.0260  -0.0430 0.0068  313 ASP B O   
1945 C CB  . ASP B 18  ? 0.6367 0.7670 0.7045 0.0146  -0.0950 -0.0135 313 ASP B CB  
1946 C CG  . ASP B 18  ? 0.7560 0.8879 0.8037 0.0162  -0.1229 -0.0219 313 ASP B CG  
1947 O OD1 . ASP B 18  ? 0.7680 0.8883 0.7671 0.0223  -0.1275 -0.0233 313 ASP B OD1 
1948 O OD2 . ASP B 18  ? 0.8469 0.9915 0.9273 0.0115  -0.1403 -0.0271 313 ASP B OD2 
1949 N N   . GLN B 19  ? 0.4312 0.5378 0.5032 0.0085  -0.0307 -0.0013 314 GLN B N   
1950 C CA  . GLN B 19  ? 0.4259 0.5336 0.5166 0.0085  -0.0055 0.0078  314 GLN B CA  
1951 C C   . GLN B 19  ? 0.4115 0.5002 0.4576 0.0120  0.0148  0.0117  314 GLN B C   
1952 O O   . GLN B 19  ? 0.3982 0.4880 0.4422 0.0169  0.0312  0.0206  314 GLN B O   
1953 C CB  . GLN B 19  ? 0.4190 0.5292 0.5562 -0.0021 0.0059  0.0062  314 GLN B CB  
1954 C CG  . GLN B 19  ? 0.4727 0.6042 0.6621 -0.0050 -0.0090 0.0055  314 GLN B CG  
1955 C CD  . GLN B 19  ? 0.5370 0.6693 0.7691 -0.0161 -0.0002 0.0025  314 GLN B CD  
1956 O OE1 . GLN B 19  ? 0.5512 0.6683 0.7718 -0.0226 0.0083  -0.0027 314 GLN B OE1 
1957 N NE2 . GLN B 19  ? 0.5739 0.7240 0.8558 -0.0182 -0.0021 0.0060  314 GLN B NE2 
1958 N N   . MET B 20  ? 0.5120 0.5832 0.5228 0.0092  0.0138  0.0052  315 MET B N   
1959 C CA  . MET B 20  ? 0.5086 0.5604 0.4741 0.0120  0.0318  0.0084  315 MET B CA  
1960 C C   . MET B 20  ? 0.4298 0.4821 0.3570 0.0238  0.0256  0.0135  315 MET B C   
1961 O O   . MET B 20  ? 0.4989 0.5455 0.4078 0.0286  0.0435  0.0214  315 MET B O   
1962 C CB  . MET B 20  ? 0.5299 0.5638 0.4675 0.0062  0.0298  -0.0002 315 MET B CB  
1963 C CG  . MET B 20  ? 0.5697 0.5832 0.4565 0.0094  0.0461  0.0026  315 MET B CG  
1964 S SD  . MET B 20  ? 0.6703 0.6746 0.5684 0.0046  0.0816  0.0099  315 MET B SD  
1965 C CE  . MET B 20  ? 0.5432 0.5448 0.4774 -0.0091 0.0843  0.0016  315 MET B CE  
1966 N N   . VAL B 21  ? 0.4310 0.4902 0.3460 0.0284  0.0000  0.0091  316 VAL B N   
1967 C CA  . VAL B 21  ? 0.4961 0.5575 0.3766 0.0398  -0.0089 0.0135  316 VAL B CA  
1968 C C   . VAL B 21  ? 0.5114 0.5869 0.4131 0.0459  -0.0001 0.0236  316 VAL B C   
1969 O O   . VAL B 21  ? 0.4533 0.5235 0.3252 0.0536  0.0099  0.0305  316 VAL B O   
1970 C CB  . VAL B 21  ? 0.5440 0.6146 0.4183 0.0431  -0.0395 0.0070  316 VAL B CB  
1971 C CG1 . VAL B 21  ? 0.5690 0.6429 0.4095 0.0553  -0.0484 0.0121  316 VAL B CG1 
1972 C CG2 . VAL B 21  ? 0.5728 0.6290 0.4234 0.0377  -0.0490 -0.0031 316 VAL B CG2 
1973 N N   . SER B 22  ? 0.4654 0.5182 0.5789 0.0308  -0.1014 0.1210  317 SER B N   
1974 C CA  . SER B 22  ? 0.4775 0.5232 0.6395 0.0422  -0.1109 0.1097  317 SER B CA  
1975 C C   . SER B 22  ? 0.4238 0.5024 0.6110 0.0512  -0.0880 0.0830  317 SER B C   
1976 O O   . SER B 22  ? 0.4490 0.5135 0.6506 0.0548  -0.0884 0.0729  317 SER B O   
1977 C CB  . SER B 22  ? 0.5489 0.6030 0.7562 0.0522  -0.1280 0.1137  317 SER B CB  
1978 O OG  . SER B 22  ? 0.6728 0.6991 0.8572 0.0441  -0.1485 0.1386  317 SER B OG  
1979 N N   . ALA B 23  ? 0.3708 0.4931 0.5632 0.0547  -0.0682 0.0717  318 ALA B N   
1980 C CA  . ALA B 23  ? 0.3617 0.5186 0.5772 0.0628  -0.0449 0.0462  318 ALA B CA  
1981 C C   . ALA B 23  ? 0.4183 0.5611 0.5973 0.0549  -0.0309 0.0406  318 ALA B C   
1982 O O   . ALA B 23  ? 0.4042 0.5510 0.6047 0.0612  -0.0223 0.0236  318 ALA B O   
1983 C CB  . ALA B 23  ? 0.3375 0.5413 0.5571 0.0656  -0.0267 0.0376  318 ALA B CB  
1984 N N   . LEU B 24  ? 0.4005 0.5269 0.5244 0.0410  -0.0286 0.0550  319 LEU B N   
1985 C CA  . LEU B 24  ? 0.4355 0.5485 0.5206 0.0324  -0.0151 0.0509  319 LEU B CA  
1986 C C   . LEU B 24  ? 0.4507 0.5211 0.5356 0.0306  -0.0301 0.0550  319 LEU B C   
1987 O O   . LEU B 24  ? 0.5307 0.5991 0.6155 0.0317  -0.0186 0.0413  319 LEU B O   
1988 C CB  . LEU B 24  ? 0.4507 0.5563 0.4769 0.0178  -0.0102 0.0661  319 LEU B CB  
1989 C CG  . LEU B 24  ? 0.3614 0.5095 0.3797 0.0180  0.0084  0.0603  319 LEU B CG  
1990 C CD1 . LEU B 24  ? 0.3717 0.5085 0.3292 0.0031  0.0132  0.0748  319 LEU B CD1 
1991 C CD2 . LEU B 24  ? 0.2726 0.4577 0.3123 0.0259  0.0336  0.0342  319 LEU B CD2 
1992 N N   . LEU B 25  ? 0.4630 0.4988 0.5476 0.0277  -0.0559 0.0738  320 LEU B N   
1993 C CA  . LEU B 25  ? 0.4474 0.4409 0.5324 0.0258  -0.0722 0.0786  320 LEU B CA  
1994 C C   . LEU B 25  ? 0.4855 0.4894 0.6234 0.0399  -0.0712 0.0590  320 LEU B C   
1995 O O   . LEU B 25  ? 0.5322 0.5192 0.6670 0.0394  -0.0683 0.0510  320 LEU B O   
1996 C CB  . LEU B 25  ? 0.5349 0.4920 0.6145 0.0210  -0.1009 0.1021  320 LEU B CB  
1997 C CG  . LEU B 25  ? 0.5617 0.4946 0.5842 0.0051  -0.1066 0.1244  320 LEU B CG  
1998 C CD1 . LEU B 25  ? 0.5992 0.5036 0.6262 0.0029  -0.1343 0.1459  320 LEU B CD1 
1999 C CD2 . LEU B 25  ? 0.5413 0.4431 0.5209 -0.0063 -0.1030 0.1270  320 LEU B CD2 
2000 N N   . ASP B 26  ? 0.4925 0.5242 0.6787 0.0523  -0.0736 0.0512  321 ASP B N   
2001 C CA  . ASP B 26  ? 0.5691 0.6135 0.8091 0.0665  -0.0730 0.0324  321 ASP B CA  
2002 C C   . ASP B 26  ? 0.4941 0.5656 0.7366 0.0700  -0.0462 0.0098  321 ASP B C   
2003 O O   . ASP B 26  ? 0.5311 0.6010 0.8028 0.0780  -0.0446 -0.0046 321 ASP B O   
2004 C CB  . ASP B 26  ? 0.6102 0.6836 0.8996 0.0787  -0.0787 0.0281  321 ASP B CB  
2005 C CG  . ASP B 26  ? 0.7358 0.7812 1.0325 0.0776  -0.1072 0.0484  321 ASP B CG  
2006 O OD1 . ASP B 26  ? 0.7254 0.7268 0.9952 0.0689  -0.1240 0.0641  321 ASP B OD1 
2007 O OD2 . ASP B 26  ? 0.7584 0.8256 1.0876 0.0854  -0.1129 0.0487  321 ASP B OD2 
2008 N N   . ALA B 27  ? 0.3941 0.4899 0.6053 0.0639  -0.0253 0.0068  322 ALA B N   
2009 C CA  . ALA B 27  ? 0.4021 0.5275 0.6154 0.0671  0.0016  -0.0148 322 ALA B CA  
2010 C C   . ALA B 27  ? 0.3664 0.4655 0.5437 0.0587  0.0082  -0.0161 322 ALA B C   
2011 O O   . ALA B 27  ? 0.2964 0.4148 0.4757 0.0613  0.0291  -0.0340 322 ALA B O   
2012 C CB  . ALA B 27  ? 0.2774 0.4405 0.4728 0.0642  0.0214  -0.0183 322 ALA B CB  
2013 N N   . GLU B 28  ? 0.3255 0.3810 0.4698 0.0483  -0.0094 0.0029  323 GLU B N   
2014 C CA  . GLU B 28  ? 0.3892 0.4178 0.4929 0.0383  -0.0040 0.0042  323 GLU B CA  
2015 C C   . GLU B 28  ? 0.4135 0.4438 0.5435 0.0464  0.0043  -0.0152 323 GLU B C   
2016 O O   . GLU B 28  ? 0.3564 0.3823 0.5305 0.0569  -0.0079 -0.0209 323 GLU B O   
2017 C CB  . GLU B 28  ? 0.4345 0.4133 0.5071 0.0275  -0.0281 0.0273  323 GLU B CB  
2018 C CG  . GLU B 28  ? 0.4493 0.4199 0.4707 0.0137  -0.0284 0.0458  323 GLU B CG  
2019 C CD  . GLU B 28  ? 0.4963 0.4782 0.4746 0.0049  -0.0044 0.0393  323 GLU B CD  
2020 O OE1 . GLU B 28  ? 0.5668 0.5177 0.5080 -0.0053 -0.0059 0.0453  323 GLU B OE1 
2021 O OE2 . GLU B 28  ? 0.4852 0.5070 0.4669 0.0082  0.0158  0.0280  323 GLU B OE2 
2022 N N   . PRO B 29  ? 0.3848 0.4217 0.4875 0.0415  0.0252  -0.0255 324 PRO B N   
2023 C CA  . PRO B 29  ? 0.3966 0.4345 0.5186 0.0478  0.0350  -0.0437 324 PRO B CA  
2024 C C   . PRO B 29  ? 0.4341 0.4239 0.5424 0.0426  0.0167  -0.0342 324 PRO B C   
2025 O O   . PRO B 29  ? 0.4251 0.3823 0.5000 0.0319  0.0007  -0.0141 324 PRO B O   
2026 C CB  . PRO B 29  ? 0.3948 0.4520 0.4818 0.0414  0.0621  -0.0535 324 PRO B CB  
2027 C CG  . PRO B 29  ? 0.4026 0.4448 0.4373 0.0271  0.0587  -0.0343 324 PRO B CG  
2028 C CD  . PRO B 29  ? 0.3415 0.3838 0.3916 0.0291  0.0404  -0.0199 324 PRO B CD  
2029 N N   . PRO B 30  ? 0.4279 0.4129 0.5610 0.0499  0.0189  -0.0484 325 PRO B N   
2030 C CA  . PRO B 30  ? 0.4532 0.3924 0.5733 0.0450  0.0018  -0.0403 325 PRO B CA  
2031 C C   . PRO B 30  ? 0.5159 0.4371 0.5822 0.0319  0.0133  -0.0379 325 PRO B C   
2032 O O   . PRO B 30  ? 0.4625 0.4101 0.5101 0.0293  0.0370  -0.0473 325 PRO B O   
2033 C CB  . PRO B 30  ? 0.4862 0.4335 0.6550 0.0587  0.0031  -0.0589 325 PRO B CB  
2034 C CG  . PRO B 30  ? 0.4794 0.4739 0.6644 0.0658  0.0307  -0.0791 325 PRO B CG  
2035 C CD  . PRO B 30  ? 0.3955 0.4163 0.5692 0.0628  0.0371  -0.0725 325 PRO B CD  
2036 N N   . ILE B 31  ? 0.5893 0.4656 0.6306 0.0234  -0.0036 -0.0253 326 ILE B N   
2037 C CA  . ILE B 31  ? 0.6742 0.5309 0.6688 0.0119  0.0063  -0.0247 326 ILE B CA  
2038 C C   . ILE B 31  ? 0.5897 0.4458 0.6061 0.0193  0.0139  -0.0426 326 ILE B C   
2039 O O   . ILE B 31  ? 0.5545 0.3936 0.6034 0.0268  -0.0024 -0.0443 326 ILE B O   
2040 C CB  . ILE B 31  ? 0.7300 0.5377 0.6851 -0.0017 -0.0152 -0.0027 326 ILE B CB  
2041 C CG1 . ILE B 31  ? 0.7105 0.5186 0.6426 -0.0094 -0.0225 0.0155  326 ILE B CG1 
2042 C CG2 . ILE B 31  ? 0.6760 0.4631 0.5842 -0.0134 -0.0051 -0.0032 326 ILE B CG2 
2043 C CD1 . ILE B 31  ? 0.7864 0.5469 0.6851 -0.0218 -0.0458 0.0380  326 ILE B CD1 
2044 N N   . LEU B 32  ? 0.4935 0.3686 0.4923 0.0175  0.0387  -0.0561 327 LEU B N   
2045 C CA  . LEU B 32  ? 0.5107 0.3874 0.5276 0.0242  0.0484  -0.0737 327 LEU B CA  
2046 C C   . LEU B 32  ? 0.5388 0.3785 0.5118 0.0123  0.0467  -0.0682 327 LEU B C   
2047 O O   . LEU B 32  ? 0.5316 0.3519 0.4566 -0.0015 0.0444  -0.0536 327 LEU B O   
2048 C CB  . LEU B 32  ? 0.4785 0.4016 0.5095 0.0312  0.0775  -0.0943 327 LEU B CB  
2049 C CG  . LEU B 32  ? 0.4714 0.4353 0.5451 0.0427  0.0824  -0.1019 327 LEU B CG  
2050 C CD1 . LEU B 32  ? 0.4073 0.4137 0.4920 0.0487  0.1116  -0.1229 327 LEU B CD1 
2051 C CD2 . LEU B 32  ? 0.4254 0.3844 0.5529 0.0555  0.0633  -0.1042 327 LEU B CD2 
2052 N N   . TYR B 33  ? 0.4482 0.2779 0.4380 0.0178  0.0476  -0.0800 328 TYR B N   
2053 C CA  . TYR B 33  ? 0.5540 0.3504 0.5048 0.0075  0.0472  -0.0770 328 TYR B CA  
2054 C C   . TYR B 33  ? 0.5244 0.3452 0.4604 0.0070  0.0762  -0.0935 328 TYR B C   
2055 O O   . TYR B 33  ? 0.4936 0.3535 0.4609 0.0176  0.0938  -0.1102 328 TYR B O   
2056 C CB  . TYR B 33  ? 0.6197 0.3854 0.5944 0.0127  0.0284  -0.0782 328 TYR B CB  
2057 C CG  . TYR B 33  ? 0.6860 0.4191 0.6663 0.0104  -0.0019 -0.0599 328 TYR B CG  
2058 C CD1 . TYR B 33  ? 0.7924 0.5409 0.8163 0.0209  -0.0134 -0.0587 328 TYR B CD1 
2059 C CD2 . TYR B 33  ? 0.7156 0.4025 0.6574 -0.0025 -0.0191 -0.0438 328 TYR B CD2 
2060 C CE1 . TYR B 33  ? 0.8682 0.5868 0.8974 0.0188  -0.0412 -0.0418 328 TYR B CE1 
2061 C CE2 . TYR B 33  ? 0.7670 0.4234 0.7135 -0.0050 -0.0469 -0.0268 328 TYR B CE2 
2062 C CZ  . TYR B 33  ? 0.8565 0.5288 0.8469 0.0059  -0.0580 -0.0259 328 TYR B CZ  
2063 O OH  . TYR B 33  ? 0.8866 0.5286 0.8825 0.0036  -0.0858 -0.0091 328 TYR B OH  
2064 N N   . SER B 34  ? 0.3674 0.5524 0.5561 -0.0063 -0.1837 0.0180  329 SER B N   
2065 C CA  . SER B 34  ? 0.3278 0.5726 0.5584 -0.0039 -0.1531 0.0068  329 SER B CA  
2066 C C   . SER B 34  ? 0.4071 0.6956 0.7368 -0.0016 -0.1634 -0.0178 329 SER B C   
2067 O O   . SER B 34  ? 0.3643 0.6183 0.7151 -0.0014 -0.1886 -0.0177 329 SER B O   
2068 C CB  . SER B 34  ? 0.2959 0.4872 0.4639 -0.0017 -0.1194 0.0389  329 SER B CB  
2069 O OG  . SER B 34  ? 0.3969 0.6465 0.6064 0.0008  -0.0895 0.0279  329 SER B OG  
2070 N N   . GLU B 35  ? 0.3758 0.7404 0.7662 0.0001  -0.1441 -0.0392 330 GLU B N   
2071 C CA  . GLU B 35  ? 0.4024 0.8116 0.8874 0.0024  -0.1499 -0.0623 330 GLU B CA  
2072 C C   . GLU B 35  ? 0.3799 0.7174 0.8538 0.0047  -0.1508 -0.0407 330 GLU B C   
2073 O O   . GLU B 35  ? 0.3730 0.6611 0.7921 0.0063  -0.1257 -0.0135 330 GLU B O   
2074 C CB  . GLU B 35  ? 0.3829 0.8667 0.9157 0.0046  -0.1198 -0.0787 330 GLU B CB  
2075 C CG  . GLU B 35  ? 0.5860 1.1204 1.1115 0.0035  -0.1122 -0.1018 330 GLU B CG  
2076 C CD  . GLU B 35  ? 0.6869 1.2517 1.2262 0.0068  -0.0809 -0.1229 330 GLU B CD  
2077 O OE1 . GLU B 35  ? 0.6731 1.2377 1.2415 0.0090  -0.0659 -0.1170 330 GLU B OE1 
2078 O OE2 . GLU B 35  ? 0.7456 1.3317 1.2638 0.0070  -0.0731 -0.1456 330 GLU B OE2 
2079 N N   . TYR B 36  ? 0.3934 0.7240 0.9178 0.0049  -0.1801 -0.0525 331 TYR B N   
2080 C CA  . TYR B 36  ? 0.5224 0.7797 1.0328 0.0069  -0.1850 -0.0316 331 TYR B CA  
2081 C C   . TYR B 36  ? 0.5271 0.7935 1.0700 0.0105  -0.1563 -0.0283 331 TYR B C   
2082 O O   . TYR B 36  ? 0.5418 0.8836 1.1579 0.0118  -0.1463 -0.0536 331 TYR B O   
2083 C CB  . TYR B 36  ? 0.6597 0.9122 1.2214 0.0063  -0.2237 -0.0472 331 TYR B CB  
2084 C CG  . TYR B 36  ? 0.9388 1.1089 1.4786 0.0081  -0.2327 -0.0244 331 TYR B CG  
2085 C CD1 . TYR B 36  ? 1.0980 1.2174 1.5979 0.0106  -0.2053 0.0023  331 TYR B CD1 
2086 C CD2 . TYR B 36  ? 1.1178 1.2606 1.6767 0.0074  -0.2686 -0.0296 331 TYR B CD2 
2087 C CE1 . TYR B 36  ? 1.2278 1.2723 1.7075 0.0123  -0.2129 0.0230  331 TYR B CE1 
2088 C CE2 . TYR B 36  ? 1.2460 1.3134 1.7844 0.0093  -0.2766 -0.0088 331 TYR B CE2 
2089 C CZ  . TYR B 36  ? 1.2607 1.2790 1.7594 0.0117  -0.2485 0.0175  331 TYR B CZ  
2090 O OH  . TYR B 36  ? 1.3168 1.2592 1.7942 0.0136  -0.2557 0.0386  331 TYR B OH  
2091 N N   . ASP B 37  ? 0.5890 0.7771 1.0753 0.0121  -0.1432 0.0033  332 ASP B N   
2092 C CA  . ASP B 37  ? 0.6341 0.8145 1.1478 0.0156  -0.1204 0.0097  332 ASP B CA  
2093 C C   . ASP B 37  ? 0.5638 0.8147 1.1103 0.0171  -0.0882 -0.0035 332 ASP B C   
2094 O O   . ASP B 37  ? 0.5607 0.8730 1.1912 0.0188  -0.0860 -0.0284 332 ASP B O   
2095 C CB  . ASP B 37  ? 0.7356 0.9250 1.3281 0.0171  -0.1429 -0.0074 332 ASP B CB  
2096 C CG  . ASP B 37  ? 0.8262 0.9863 1.4334 0.0206  -0.1228 0.0052  332 ASP B CG  
2097 O OD1 . ASP B 37  ? 0.9094 1.0465 1.4692 0.0218  -0.0906 0.0258  332 ASP B OD1 
2098 O OD2 . ASP B 37  ? 0.8348 0.9947 1.5010 0.0220  -0.1390 -0.0057 332 ASP B OD2 
2099 N N   . PRO B 38  ? 0.5775 0.8200 1.0576 0.0165  -0.0631 0.0130  333 PRO B N   
2100 C CA  . PRO B 38  ? 0.5256 0.8276 1.0298 0.0183  -0.0296 0.0040  333 PRO B CA  
2101 C C   . PRO B 38  ? 0.5200 0.7798 1.0099 0.0215  -0.0027 0.0251  333 PRO B C   
2102 O O   . PRO B 38  ? 0.4825 0.6603 0.9239 0.0217  -0.0074 0.0514  333 PRO B O   
2103 C CB  . PRO B 38  ? 0.5277 0.8268 0.9574 0.0162  -0.0162 0.0162  333 PRO B CB  
2104 C CG  . PRO B 38  ? 0.5831 0.7885 0.9269 0.0144  -0.0293 0.0470  333 PRO B CG  
2105 C CD  . PRO B 38  ? 0.6356 0.8131 1.0156 0.0142  -0.0637 0.0409  333 PRO B CD  
2106 N N   . THR B 39  ? 0.5165 0.8315 1.0486 0.0239  0.0249  0.0136  334 THR B N   
2107 C CA  . THR B 39  ? 0.5485 0.8276 1.0644 0.0268  0.0538  0.0335  334 THR B CA  
2108 C C   . THR B 39  ? 0.5557 0.7572 0.9643 0.0260  0.0703  0.0708  334 THR B C   
2109 O O   . THR B 39  ? 0.5003 0.7123 0.8595 0.0244  0.0800  0.0759  334 THR B O   
2110 C CB  . THR B 39  ? 0.5580 0.9125 1.1245 0.0293  0.0840  0.0162  334 THR B CB  
2111 O OG1 . THR B 39  ? 0.5529 0.9822 1.2208 0.0300  0.0691  -0.0192 334 THR B OG1 
2112 C CG2 . THR B 39  ? 0.4831 0.7984 1.0325 0.0323  0.1139  0.0371  334 THR B CG2 
2113 N N   . ARG B 40  ? 0.6110 0.7339 0.9833 0.0271  0.0729  0.0968  335 ARG B N   
2114 C CA  . ARG B 40  ? 0.6257 0.6738 0.9001 0.0269  0.0931  0.1334  335 ARG B CA  
2115 C C   . ARG B 40  ? 0.5843 0.6101 0.8649 0.0301  0.1215  0.1467  335 ARG B C   
2116 O O   . ARG B 40  ? 0.5746 0.5992 0.9118 0.0319  0.1138  0.1385  335 ARG B O   
2117 C CB  . ARG B 40  ? 0.7144 0.6772 0.9265 0.0249  0.0679  0.1560  335 ARG B CB  
2118 C CG  . ARG B 40  ? 0.8363 0.8092 1.0240 0.0214  0.0425  0.1486  335 ARG B CG  
2119 C CD  . ARG B 40  ? 0.9870 0.8852 1.0659 0.0195  0.0483  0.1822  335 ARG B CD  
2120 N NE  . ARG B 40  ? 1.0749 0.9509 1.1264 0.0164  0.0155  0.1815  335 ARG B NE  
2121 C CZ  . ARG B 40  ? 1.1267 0.9407 1.0885 0.0142  0.0133  0.2072  335 ARG B CZ  
2122 N NH1 . ARG B 40  ? 1.1300 0.8978 1.0200 0.0147  0.0421  0.2359  335 ARG B NH1 
2123 N NH2 . ARG B 40  ? 1.1631 0.9619 1.1074 0.0115  -0.0178 0.2039  335 ARG B NH2 
2124 N N   . PRO B 41  ? 0.5482 0.5564 0.7712 0.0308  0.1547  0.1671  336 PRO B N   
2125 C CA  . PRO B 41  ? 0.5481 0.5505 0.6973 0.0288  0.1665  0.1801  336 PRO B CA  
2126 C C   . PRO B 41  ? 0.5557 0.6511 0.7467 0.0281  0.1678  0.1508  336 PRO B C   
2127 O O   . PRO B 41  ? 0.5228 0.6905 0.7994 0.0297  0.1677  0.1219  336 PRO B O   
2128 C CB  . PRO B 41  ? 0.5649 0.5352 0.6650 0.0308  0.2054  0.2050  336 PRO B CB  
2129 C CG  . PRO B 41  ? 0.6344 0.5742 0.7685 0.0334  0.2096  0.2104  336 PRO B CG  
2130 C CD  . PRO B 41  ? 0.5989 0.5940 0.8299 0.0339  0.1849  0.1779  336 PRO B CD  
2131 N N   . PHE B 42  ? 0.4949 0.5873 0.6249 0.0258  0.1695  0.1587  337 PHE B N   
2132 C CA  . PHE B 42  ? 0.5185 0.6943 0.6777 0.0250  0.1726  0.1337  337 PHE B CA  
2133 C C   . PHE B 42  ? 0.5753 0.7890 0.7312 0.0274  0.2116  0.1348  337 PHE B C   
2134 O O   . PHE B 42  ? 0.6346 0.7984 0.7404 0.0288  0.2366  0.1609  337 PHE B O   
2135 C CB  . PHE B 42  ? 0.4949 0.6508 0.5864 0.0215  0.1600  0.1425  337 PHE B CB  
2136 C CG  . PHE B 42  ? 0.4974 0.6148 0.5829 0.0189  0.1215  0.1425  337 PHE B CG  
2137 C CD1 . PHE B 42  ? 0.4842 0.6551 0.6474 0.0181  0.0930  0.1113  337 PHE B CD1 
2138 C CD2 . PHE B 42  ? 0.5976 0.6262 0.5985 0.0171  0.1139  0.1736  337 PHE B CD2 
2139 C CE1 . PHE B 42  ? 0.5775 0.7134 0.7347 0.0158  0.0576  0.1111  337 PHE B CE1 
2140 C CE2 . PHE B 42  ? 0.6917 0.6851 0.6860 0.0148  0.0784  0.1735  337 PHE B CE2 
2141 C CZ  . PHE B 42  ? 0.6474 0.6944 0.7199 0.0142  0.0502  0.1422  337 PHE B CZ  
2142 N N   . SER B 43  ? 0.6436 0.7508 0.8652 0.0187  -0.0489 0.2438  338 SER B N   
2143 C CA  . SER B 43  ? 0.6230 0.7364 0.8744 0.0160  -0.0445 0.2740  338 SER B CA  
2144 C C   . SER B 43  ? 0.6653 0.7736 0.9188 0.0177  -0.0255 0.2614  338 SER B C   
2145 O O   . SER B 43  ? 0.6710 0.7715 0.9016 0.0196  -0.0191 0.2310  338 SER B O   
2146 C CB  . SER B 43  ? 0.6029 0.7188 0.8505 0.0031  -0.0700 0.2944  338 SER B CB  
2147 O OG  . SER B 43  ? 0.6179 0.7259 0.8360 -0.0051 -0.0812 0.2749  338 SER B OG  
2148 N N   . GLU B 44  ? 0.7144 0.8274 0.9955 0.0168  -0.0166 0.2850  339 GLU B N   
2149 C CA  . GLU B 44  ? 0.7814 0.8903 1.0674 0.0180  0.0014  0.2760  339 GLU B CA  
2150 C C   . GLU B 44  ? 0.6598 0.7619 0.9170 0.0089  -0.0100 0.2564  339 GLU B C   
2151 O O   . GLU B 44  ? 0.6181 0.7135 0.8626 0.0115  0.0027  0.2318  339 GLU B O   
2152 C CB  . GLU B 44  ? 0.8710 0.9869 1.1913 0.0169  0.0088  0.3080  339 GLU B CB  
2153 C CG  . GLU B 44  ? 1.0598 1.1821 1.3859 0.0054  -0.0143 0.3356  339 GLU B CG  
2154 C CD  . GLU B 44  ? 1.2351 1.3621 1.5873 0.0013  -0.0082 0.3601  339 GLU B CD  
2155 O OE1 . GLU B 44  ? 1.2675 1.4013 1.6329 -0.0063 -0.0233 0.3886  339 GLU B OE1 
2156 O OE2 . GLU B 44  ? 1.2792 1.4029 1.6385 0.0055  0.0115  0.3510  339 GLU B OE2 
2157 N N   . ALA B 45  ? 0.6153 0.7190 0.8621 -0.0020 -0.0342 0.2679  340 ALA B N   
2158 C CA  . ALA B 45  ? 0.5787 0.6764 0.7975 -0.0111 -0.0474 0.2520  340 ALA B CA  
2159 C C   . ALA B 45  ? 0.5285 0.6185 0.7125 -0.0090 -0.0517 0.2180  340 ALA B C   
2160 O O   . ALA B 45  ? 0.5734 0.6572 0.7379 -0.0103 -0.0475 0.1948  340 ALA B O   
2161 C CB  . ALA B 45  ? 0.5669 0.6677 0.7835 -0.0229 -0.0727 0.2746  340 ALA B CB  
2162 N N   . SER B 46  ? 0.4855 0.5764 0.6622 -0.0058 -0.0600 0.2155  341 SER B N   
2163 C CA  . SER B 46  ? 0.4658 0.5499 0.6094 -0.0042 -0.0658 0.1847  341 SER B CA  
2164 C C   . SER B 46  ? 0.4425 0.5217 0.5810 0.0046  -0.0427 0.1573  341 SER B C   
2165 O O   . SER B 46  ? 0.5100 0.5824 0.6212 0.0031  -0.0441 0.1307  341 SER B O   
2166 C CB  . SER B 46  ? 0.4660 0.5528 0.6062 -0.0017 -0.0776 0.1887  341 SER B CB  
2167 O OG  . SER B 46  ? 0.5126 0.6025 0.6712 0.0096  -0.0587 0.1879  341 SER B OG  
2168 N N   . MET B 47  ? 0.4206 0.5026 0.5848 0.0138  -0.0215 0.1640  342 MET B N   
2169 C CA  . MET B 47  ? 0.4977 0.5740 0.6577 0.0222  0.0009  0.1392  342 MET B CA  
2170 C C   . MET B 47  ? 0.4909 0.5629 0.6451 0.0179  0.0076  0.1294  342 MET B C   
2171 O O   . MET B 47  ? 0.4796 0.5450 0.6114 0.0189  0.0127  0.1014  342 MET B O   
2172 C CB  . MET B 47  ? 0.5328 0.6122 0.7224 0.0329  0.0225  0.1505  342 MET B CB  
2173 C CG  . MET B 47  ? 0.5438 0.6164 0.7246 0.0425  0.0424  0.1228  342 MET B CG  
2174 S SD  . MET B 47  ? 0.8685 0.9423 1.0837 0.0548  0.0711  0.1353  342 MET B SD  
2175 C CE  . MET B 47  ? 0.6650 0.7386 0.8964 0.0498  0.0796  0.1480  342 MET B CE  
2176 N N   . MET B 48  ? 0.4891 0.5654 0.6638 0.0130  0.0075  0.1530  343 MET B N   
2177 C CA  . MET B 48  ? 0.4536 0.5269 0.6247 0.0081  0.0123  0.1469  343 MET B CA  
2178 C C   . MET B 48  ? 0.4473 0.5158 0.5836 0.0003  -0.0046 0.1269  343 MET B C   
2179 O O   . MET B 48  ? 0.4882 0.5518 0.6102 -0.0001 0.0028  0.1061  343 MET B O   
2180 C CB  . MET B 48  ? 0.5525 0.6322 0.7501 0.0025  0.0102  0.1783  343 MET B CB  
2181 C CG  . MET B 48  ? 0.6059 0.6891 0.8382 0.0105  0.0322  0.1953  343 MET B CG  
2182 S SD  . MET B 48  ? 0.9187 0.9940 1.1492 0.0197  0.0602  0.1685  343 MET B SD  
2183 C CE  . MET B 48  ? 0.3596 0.4306 0.5662 0.0100  0.0526  0.1509  343 MET B CE  
2184 N N   . GLY B 49  ? 0.4455 0.5155 0.5683 -0.0058 -0.0276 0.1337  344 GLY B N   
2185 C CA  . GLY B 49  ? 0.4775 0.5424 0.5658 -0.0126 -0.0451 0.1154  344 GLY B CA  
2186 C C   . GLY B 49  ? 0.4351 0.4938 0.4990 -0.0067 -0.0374 0.0817  344 GLY B C   
2187 O O   . GLY B 49  ? 0.4489 0.5027 0.4890 -0.0097 -0.0397 0.0610  344 GLY B O   
2188 N N   . LEU B 50  ? 0.4093 0.4684 0.4796 0.0019  -0.0281 0.0766  345 LEU B N   
2189 C CA  . LEU B 50  ? 0.4328 0.4863 0.4823 0.0081  -0.0196 0.0456  345 LEU B CA  
2190 C C   . LEU B 50  ? 0.3880 0.4376 0.4410 0.0123  0.0025  0.0298  345 LEU B C   
2191 O O   . LEU B 50  ? 0.4117 0.4560 0.4406 0.0120  0.0042  0.0040  345 LEU B O   
2192 C CB  . LEU B 50  ? 0.4205 0.4758 0.4777 0.0162  -0.0151 0.0459  345 LEU B CB  
2193 C CG  . LEU B 50  ? 0.5571 0.6142 0.6008 0.0128  -0.0376 0.0507  345 LEU B CG  
2194 C CD1 . LEU B 50  ? 0.4769 0.5368 0.5315 0.0215  -0.0310 0.0521  345 LEU B CD1 
2195 C CD2 . LEU B 50  ? 0.5838 0.6349 0.5898 0.0085  -0.0514 0.0251  345 LEU B CD2 
2196 N N   . LEU B 51  ? 0.3429 0.3951 0.4257 0.0163  0.0194  0.0458  346 LEU B N   
2197 C CA  . LEU B 51  ? 0.4180 0.4660 0.5063 0.0207  0.0411  0.0326  346 LEU B CA  
2198 C C   . LEU B 51  ? 0.3762 0.4224 0.4519 0.0129  0.0365  0.0260  346 LEU B C   
2199 O O   . LEU B 51  ? 0.4700 0.5111 0.5306 0.0141  0.0454  0.0026  346 LEU B O   
2200 C CB  . LEU B 51  ? 0.4260 0.4771 0.5498 0.0263  0.0588  0.0541  346 LEU B CB  
2201 C CG  . LEU B 51  ? 0.4084 0.4611 0.5476 0.0355  0.0674  0.0612  346 LEU B CG  
2202 C CD1 . LEU B 51  ? 0.4525 0.5083 0.6267 0.0406  0.0845  0.0839  346 LEU B CD1 
2203 C CD2 . LEU B 51  ? 0.3946 0.4405 0.5169 0.0431  0.0787  0.0321  346 LEU B CD2 
2204 N N   . THR B 52  ? 0.4077 0.4585 0.4900 0.0047  0.0223  0.0474  347 THR B N   
2205 C CA  . THR B 52  ? 0.4226 0.4728 0.4944 -0.0033 0.0161  0.0445  347 THR B CA  
2206 C C   . THR B 52  ? 0.4443 0.4897 0.4789 -0.0069 0.0036  0.0188  347 THR B C   
2207 O O   . THR B 52  ? 0.3920 0.4344 0.4136 -0.0083 0.0091  0.0017  347 THR B O   
2208 C CB  . THR B 52  ? 0.5173 0.5732 0.6021 -0.0117 0.0008  0.0737  347 THR B CB  
2209 O OG1 . THR B 52  ? 0.6398 0.6999 0.7589 -0.0095 0.0152  0.0958  347 THR B OG1 
2210 C CG2 . THR B 52  ? 0.6089 0.6635 0.6742 -0.0208 -0.0116 0.0679  347 THR B CG2 
2211 N N   . ASN B 53  ? 0.3930 0.4382 0.4108 -0.0083 -0.0136 0.0168  348 ASN B N   
2212 C CA  . ASN B 53  ? 0.3703 0.4108 0.3522 -0.0109 -0.0259 -0.0074 348 ASN B CA  
2213 C C   . ASN B 53  ? 0.3521 0.3880 0.3218 -0.0041 -0.0096 -0.0364 348 ASN B C   
2214 O O   . ASN B 53  ? 0.4354 0.4679 0.3832 -0.0064 -0.0103 -0.0560 348 ASN B O   
2215 C CB  . ASN B 53  ? 0.3940 0.4345 0.3620 -0.0121 -0.0449 -0.0051 348 ASN B CB  
2216 C CG  . ASN B 53  ? 0.5310 0.5661 0.4619 -0.0132 -0.0553 -0.0319 348 ASN B CG  
2217 O OD1 . ASN B 53  ? 0.5333 0.5659 0.4535 -0.0071 -0.0488 -0.0517 348 ASN B OD1 
2218 N ND2 . ASN B 53  ? 0.5199 0.5534 0.4310 -0.0210 -0.0715 -0.0327 348 ASN B ND2 
2219 N N   . LEU B 54  ? 0.3479 0.3834 0.3318 0.0042  0.0051  -0.0384 349 LEU B N   
2220 C CA  . LEU B 54  ? 0.3177 0.3482 0.2921 0.0110  0.0215  -0.0645 349 LEU B CA  
2221 C C   . LEU B 54  ? 0.3936 0.4221 0.3726 0.0105  0.0365  -0.0718 349 LEU B C   
2222 O O   . LEU B 54  ? 0.4300 0.4545 0.3874 0.0102  0.0392  -0.0955 349 LEU B O   
2223 C CB  . LEU B 54  ? 0.2953 0.3259 0.2880 0.0201  0.0354  -0.0612 349 LEU B CB  
2224 C CG  . LEU B 54  ? 0.3976 0.4223 0.3831 0.0277  0.0539  -0.0866 349 LEU B CG  
2225 C CD1 . LEU B 54  ? 0.4061 0.4274 0.3575 0.0265  0.0443  -0.1135 349 LEU B CD1 
2226 C CD2 . LEU B 54  ? 0.3543 0.3793 0.3601 0.0367  0.0669  -0.0796 349 LEU B CD2 
2227 N N   . ALA B 55  ? 0.4071 0.4384 0.4141 0.0103  0.0458  -0.0510 350 ALA B N   
2228 C CA  . ALA B 55  ? 0.3893 0.4190 0.4034 0.0097  0.0601  -0.0555 350 ALA B CA  
2229 C C   . ALA B 55  ? 0.3902 0.4200 0.3825 0.0016  0.0479  -0.0643 350 ALA B C   
2230 O O   . ALA B 55  ? 0.4519 0.4785 0.4333 0.0018  0.0567  -0.0828 350 ALA B O   
2231 C CB  . ALA B 55  ? 0.3729 0.4064 0.4214 0.0100  0.0695  -0.0286 350 ALA B CB  
2232 N N   . ASP B 56  ? 0.4727 0.3270 0.4584 0.0118  -0.0402 -0.0094 351 ASP B N   
2233 C CA  . ASP B 56  ? 0.6239 0.4816 0.5960 0.0110  -0.0365 -0.0158 351 ASP B CA  
2234 C C   . ASP B 56  ? 0.5773 0.4435 0.5506 0.0207  -0.0280 -0.0194 351 ASP B C   
2235 O O   . ASP B 56  ? 0.5044 0.3824 0.4711 0.0205  -0.0243 -0.0215 351 ASP B O   
2236 C CB  . ASP B 56  ? 0.7465 0.5884 0.7085 0.0081  -0.0383 -0.0220 351 ASP B CB  
2237 C CG  . ASP B 56  ? 0.9867 0.8237 0.9437 -0.0028 -0.0463 -0.0194 351 ASP B CG  
2238 O OD1 . ASP B 56  ? 1.0662 0.9127 1.0259 -0.0082 -0.0499 -0.0134 351 ASP B OD1 
2239 O OD2 . ASP B 56  ? 1.0968 0.9204 1.0469 -0.0062 -0.0489 -0.0231 351 ASP B OD2 
2240 N N   . ARG B 57  ? 0.4846 0.3451 0.4663 0.0291  -0.0250 -0.0198 352 ARG B N   
2241 C CA  . ARG B 57  ? 0.4514 0.3197 0.4354 0.0390  -0.0170 -0.0226 352 ARG B CA  
2242 C C   . ARG B 57  ? 0.4295 0.3164 0.4216 0.0409  -0.0149 -0.0169 352 ARG B C   
2243 O O   . ARG B 57  ? 0.5112 0.4101 0.5016 0.0459  -0.0087 -0.0190 352 ARG B O   
2244 C CB  . ARG B 57  ? 0.4586 0.3147 0.4489 0.0474  -0.0145 -0.0246 352 ARG B CB  
2245 C CG  . ARG B 57  ? 0.4656 0.3054 0.4453 0.0476  -0.0133 -0.0323 352 ARG B CG  
2246 C CD  . ARG B 57  ? 0.3613 0.1891 0.3468 0.0566  -0.0100 -0.0344 352 ARG B CD  
2247 N NE  . ARG B 57  ? 0.5120 0.3287 0.5051 0.0541  -0.0160 -0.0304 352 ARG B NE  
2248 C CZ  . ARG B 57  ? 0.5222 0.3397 0.5283 0.0595  -0.0160 -0.0258 352 ARG B CZ  
2249 N NH1 . ARG B 57  ? 0.4188 0.2483 0.4319 0.0677  -0.0103 -0.0241 352 ARG B NH1 
2250 N NH2 . ARG B 57  ? 0.4853 0.2921 0.4976 0.0565  -0.0216 -0.0226 352 ARG B NH2 
2251 N N   . GLU B 58  ? 0.4321 0.3216 0.4328 0.0364  -0.0198 -0.0097 353 GLU B N   
2252 C CA  . GLU B 58  ? 0.4490 0.3558 0.4569 0.0371  -0.0177 -0.0041 353 GLU B CA  
2253 C C   . GLU B 58  ? 0.4801 0.3996 0.4790 0.0307  -0.0176 -0.0041 353 GLU B C   
2254 O O   . GLU B 58  ? 0.4264 0.3620 0.4274 0.0323  -0.0137 -0.0018 353 GLU B O   
2255 C CB  . GLU B 58  ? 0.4408 0.3461 0.4605 0.0339  -0.0225 0.0035  353 GLU B CB  
2256 C CG  . GLU B 58  ? 0.5112 0.4065 0.5413 0.0405  -0.0222 0.0043  353 GLU B CG  
2257 C CD  . GLU B 58  ? 0.5384 0.4336 0.5805 0.0371  -0.0264 0.0118  353 GLU B CD  
2258 O OE1 . GLU B 58  ? 0.4910 0.3740 0.5339 0.0315  -0.0325 0.0133  353 GLU B OE1 
2259 O OE2 . GLU B 58  ? 0.5622 0.4695 0.6127 0.0397  -0.0234 0.0163  353 GLU B OE2 
2260 N N   . LEU B 59  ? 0.4868 0.3991 0.4753 0.0231  -0.0219 -0.0064 354 LEU B N   
2261 C CA  . LEU B 59  ? 0.4812 0.4043 0.4609 0.0160  -0.0226 -0.0060 354 LEU B CA  
2262 C C   . LEU B 59  ? 0.4640 0.3994 0.4373 0.0209  -0.0154 -0.0109 354 LEU B C   
2263 O O   . LEU B 59  ? 0.4443 0.3950 0.4163 0.0190  -0.0132 -0.0087 354 LEU B O   
2264 C CB  . LEU B 59  ? 0.6062 0.5187 0.5753 0.0074  -0.0283 -0.0083 354 LEU B CB  
2265 C CG  . LEU B 59  ? 0.7153 0.6366 0.6783 -0.0019 -0.0318 -0.0049 354 LEU B CG  
2266 C CD1 . LEU B 59  ? 0.6989 0.6263 0.6728 -0.0043 -0.0343 0.0037  354 LEU B CD1 
2267 C CD2 . LEU B 59  ? 0.7973 0.7074 0.7509 -0.0103 -0.0379 -0.0066 354 LEU B CD2 
2268 N N   . VAL B 60  ? 0.4110 0.3395 0.3802 0.0271  -0.0113 -0.0177 355 VAL B N   
2269 C CA  . VAL B 60  ? 0.4193 0.3583 0.3830 0.0325  -0.0040 -0.0228 355 VAL B CA  
2270 C C   . VAL B 60  ? 0.3988 0.3544 0.3723 0.0384  0.0006  -0.0185 355 VAL B C   
2271 O O   . VAL B 60  ? 0.3992 0.3703 0.3686 0.0376  0.0039  -0.0187 355 VAL B O   
2272 C CB  . VAL B 60  ? 0.4940 0.4213 0.4549 0.0400  0.0003  -0.0298 355 VAL B CB  
2273 C CG1 . VAL B 60  ? 0.5470 0.4841 0.5002 0.0443  0.0076  -0.0358 355 VAL B CG1 
2274 C CG2 . VAL B 60  ? 0.5668 0.4760 0.5198 0.0339  -0.0047 -0.0332 355 VAL B CG2 
2275 N N   . HIS B 61  ? 0.3547 0.3073 0.3408 0.0440  0.0006  -0.0145 356 HIS B N   
2276 C CA  . HIS B 61  ? 0.3178 0.2858 0.3139 0.0493  0.0046  -0.0098 356 HIS B CA  
2277 C C   . HIS B 61  ? 0.4119 0.3922 0.4098 0.0418  0.0020  -0.0034 356 HIS B C   
2278 O O   . HIS B 61  ? 0.4312 0.4281 0.4331 0.0441  0.0061  -0.0006 356 HIS B O   
2279 C CB  . HIS B 61  ? 0.3822 0.3429 0.3910 0.0562  0.0048  -0.0070 356 HIS B CB  
2280 C CG  . HIS B 61  ? 0.4038 0.3532 0.4112 0.0647  0.0085  -0.0130 356 HIS B CG  
2281 N ND1 . HIS B 61  ? 0.4246 0.3828 0.4332 0.0740  0.0159  -0.0158 356 HIS B ND1 
2282 C CD2 . HIS B 61  ? 0.4236 0.3539 0.4281 0.0649  0.0060  -0.0168 356 HIS B CD2 
2283 C CE1 . HIS B 61  ? 0.5127 0.4568 0.5194 0.0801  0.0181  -0.0211 356 HIS B CE1 
2284 N NE2 . HIS B 61  ? 0.5191 0.4461 0.5229 0.0744  0.0122  -0.0219 356 HIS B NE2 
2285 N N   . MET B 62  ? 0.4166 0.3890 0.4118 0.0327  -0.0047 -0.0008 357 MET B N   
2286 C CA  . MET B 62  ? 0.3266 0.3089 0.3234 0.0252  -0.0072 0.0055  357 MET B CA  
2287 C C   . MET B 62  ? 0.3663 0.3623 0.3521 0.0214  -0.0044 0.0031  357 MET B C   
2288 O O   . MET B 62  ? 0.3549 0.3655 0.3423 0.0191  -0.0025 0.0071  357 MET B O   
2289 C CB  . MET B 62  ? 0.3173 0.2868 0.3143 0.0168  -0.0150 0.0089  357 MET B CB  
2290 C CG  . MET B 62  ? 0.4030 0.3808 0.4038 0.0097  -0.0174 0.0163  357 MET B CG  
2291 S SD  . MET B 62  ? 0.4390 0.4035 0.4379 -0.0006 -0.0264 0.0200  357 MET B SD  
2292 C CE  . MET B 62  ? 0.4462 0.3932 0.4559 0.0037  -0.0297 0.0207  357 MET B CE  
2293 N N   . ILE B 63  ? 0.3649 0.3559 0.3389 0.0204  -0.0041 -0.0037 358 ILE B N   
2294 C CA  . ILE B 63  ? 0.4457 0.4489 0.4083 0.0173  -0.0011 -0.0071 358 ILE B CA  
2295 C C   . ILE B 63  ? 0.4859 0.5058 0.4520 0.0248  0.0064  -0.0078 358 ILE B C   
2296 O O   . ILE B 63  ? 0.4524 0.4878 0.4160 0.0217  0.0086  -0.0057 358 ILE B O   
2297 C CB  . ILE B 63  ? 0.5320 0.5263 0.4820 0.0162  -0.0011 -0.0151 358 ILE B CB  
2298 C CG1 . ILE B 63  ? 0.5983 0.5759 0.5447 0.0089  -0.0086 -0.0146 358 ILE B CG1 
2299 C CG2 . ILE B 63  ? 0.5199 0.5269 0.4581 0.0123  0.0018  -0.0185 358 ILE B CG2 
2300 C CD1 . ILE B 63  ? 0.5156 0.4957 0.4613 -0.0007 -0.0142 -0.0084 358 ILE B CD1 
2301 N N   . ASN B 64  ? 0.4493 0.4661 0.4211 0.0346  0.0105  -0.0105 359 ASN B N   
2302 C CA  . ASN B 64  ? 0.4011 0.4336 0.3775 0.0428  0.0177  -0.0109 359 ASN B CA  
2303 C C   . ASN B 64  ? 0.3917 0.4376 0.3772 0.0412  0.0179  -0.0031 359 ASN B C   
2304 O O   . ASN B 64  ? 0.4375 0.5012 0.4214 0.0416  0.0223  -0.0024 359 ASN B O   
2305 C CB  . ASN B 64  ? 0.4203 0.4452 0.4039 0.0537  0.0212  -0.0135 359 ASN B CB  
2306 C CG  . ASN B 64  ? 0.4835 0.4980 0.4574 0.0564  0.0234  -0.0219 359 ASN B CG  
2307 O OD1 . ASN B 64  ? 0.4976 0.5144 0.4594 0.0512  0.0236  -0.0263 359 ASN B OD1 
2308 N ND2 . ASN B 64  ? 0.4200 0.4225 0.3988 0.0643  0.0251  -0.0243 359 ASN B ND2 
2309 N N   . TRP B 65  ? 0.4136 0.4509 0.4082 0.0391  0.0134  0.0024  360 TRP B N   
2310 C CA  . TRP B 65  ? 0.4128 0.4609 0.4164 0.0368  0.0134  0.0100  360 TRP B CA  
2311 C C   . TRP B 65  ? 0.4182 0.4766 0.4140 0.0274  0.0123  0.0122  360 TRP B C   
2312 O O   . TRP B 65  ? 0.3858 0.4614 0.3823 0.0271  0.0164  0.0147  360 TRP B O   
2313 C CB  . TRP B 65  ? 0.3744 0.4090 0.3882 0.0354  0.0083  0.0150  360 TRP B CB  
2314 C CG  . TRP B 65  ? 0.4096 0.4524 0.4302 0.0296  0.0070  0.0227  360 TRP B CG  
2315 C CD1 . TRP B 65  ? 0.3401 0.3963 0.3696 0.0325  0.0110  0.0273  360 TRP B CD1 
2316 C CD2 . TRP B 65  ? 0.3956 0.4333 0.4142 0.0197  0.0017  0.0268  360 TRP B CD2 
2317 N NE1 . TRP B 65  ? 0.3573 0.4167 0.3902 0.0247  0.0087  0.0337  360 TRP B NE1 
2318 C CE2 . TRP B 65  ? 0.3170 0.3649 0.3436 0.0171  0.0031  0.0336  360 TRP B CE2 
2319 C CE3 . TRP B 65  ? 0.4149 0.4406 0.4260 0.0128  -0.0040 0.0256  360 TRP B CE3 
2320 C CZ2 . TRP B 65  ? 0.3205 0.3665 0.3476 0.0080  -0.0006 0.0389  360 TRP B CZ2 
2321 C CZ3 . TRP B 65  ? 0.3622 0.3864 0.3743 0.0041  -0.0081 0.0313  360 TRP B CZ3 
2322 C CH2 . TRP B 65  ? 0.3658 0.3998 0.3859 0.0020  -0.0062 0.0378  360 TRP B CH2 
2323 N N   . ALA B 66  ? 0.3868 0.4345 0.3749 0.0195  0.0069  0.0114  361 ALA B N   
2324 C CA  . ALA B 66  ? 0.4035 0.4584 0.3836 0.0101  0.0052  0.0136  361 ALA B CA  
2325 C C   . ALA B 66  ? 0.4534 0.5260 0.4248 0.0104  0.0109  0.0103  361 ALA B C   
2326 O O   . ALA B 66  ? 0.4913 0.5773 0.4619 0.0060  0.0127  0.0142  361 ALA B O   
2327 C CB  . ALA B 66  ? 0.3787 0.4192 0.3500 0.0030  -0.0011 0.0117  361 ALA B CB  
2328 N N   . LYS B 67  ? 0.4271 0.4995 0.3919 0.0154  0.0139  0.0032  362 LYS B N   
2329 C CA  . LYS B 67  ? 0.3751 0.4637 0.3314 0.0163  0.0195  -0.0009 362 LYS B CA  
2330 C C   . LYS B 67  ? 0.4000 0.5071 0.3639 0.0212  0.0254  0.0025  362 LYS B C   
2331 O O   . LYS B 67  ? 0.4551 0.5783 0.4127 0.0197  0.0295  0.0012  362 LYS B O   
2332 C CB  . LYS B 67  ? 0.4487 0.5321 0.3987 0.0222  0.0223  -0.0092 362 LYS B CB  
2333 C CG  . LYS B 67  ? 0.5074 0.5758 0.4468 0.0163  0.0175  -0.0137 362 LYS B CG  
2334 C CD  . LYS B 67  ? 0.7262 0.7855 0.6628 0.0234  0.0203  -0.0211 362 LYS B CD  
2335 C CE  . LYS B 67  ? 0.8941 0.9480 0.8158 0.0174  0.0189  -0.0276 362 LYS B CE  
2336 N NZ  . LYS B 67  ? 0.9438 1.0144 0.8562 0.0136  0.0223  -0.0295 362 LYS B NZ  
2337 N N   . ARG B 68  ? 0.3518 0.4567 0.3290 0.0268  0.0257  0.0068  363 ARG B N   
2338 C CA  . ARG B 68  ? 0.3848 0.5071 0.3703 0.0312  0.0309  0.0107  363 ARG B CA  
2339 C C   . ARG B 68  ? 0.4482 0.5765 0.4390 0.0242  0.0293  0.0185  363 ARG B C   
2340 O O   . ARG B 68  ? 0.4794 0.6231 0.4761 0.0262  0.0335  0.0224  363 ARG B O   
2341 C CB  . ARG B 68  ? 0.4240 0.5426 0.4210 0.0421  0.0333  0.0107  363 ARG B CB  
2342 C CG  . ARG B 68  ? 0.5229 0.6383 0.5152 0.0500  0.0367  0.0030  363 ARG B CG  
2343 C CD  . ARG B 68  ? 0.6416 0.7543 0.6453 0.0610  0.0395  0.0035  363 ARG B CD  
2344 N NE  . ARG B 68  ? 0.7501 0.8809 0.7631 0.0646  0.0437  0.0088  363 ARG B NE  
2345 C CZ  . ARG B 68  ? 0.8046 0.9383 0.8280 0.0744  0.0472  0.0102  363 ARG B CZ  
2346 N NH1 . ARG B 68  ? 0.8330 0.9521 0.8588 0.0818  0.0472  0.0065  363 ARG B NH1 
2347 N NH2 . ARG B 68  ? 0.7895 0.9409 0.8208 0.0765  0.0507  0.0155  363 ARG B NH2 
2348 N N   . VAL B 69  ? 0.3627 0.4790 0.3511 0.0160  0.0234  0.0211  364 VAL B N   
2349 C CA  . VAL B 69  ? 0.3030 0.4241 0.2948 0.0085  0.0222  0.0282  364 VAL B CA  
2350 C C   . VAL B 69  ? 0.3895 0.5272 0.3709 0.0029  0.0257  0.0276  364 VAL B C   
2351 O O   . VAL B 69  ? 0.4144 0.5499 0.3837 -0.0017 0.0241  0.0237  364 VAL B O   
2352 C CB  . VAL B 69  ? 0.3824 0.4861 0.3741 0.0012  0.0150  0.0310  364 VAL B CB  
2353 C CG1 . VAL B 69  ? 0.3182 0.4270 0.3127 -0.0068 0.0145  0.0382  364 VAL B CG1 
2354 C CG2 . VAL B 69  ? 0.3004 0.3875 0.3020 0.0063  0.0115  0.0313  364 VAL B CG2 
2355 N N   . PRO B 70  ? 0.4291 0.5838 0.4146 0.0030  0.0305  0.0315  365 PRO B N   
2356 C CA  . PRO B 70  ? 0.4368 0.6084 0.4120 -0.0022 0.0344  0.0307  365 PRO B CA  
2357 C C   . PRO B 70  ? 0.4248 0.5899 0.3894 -0.0127 0.0304  0.0313  365 PRO B C   
2358 O O   . PRO B 70  ? 0.4343 0.5907 0.4029 -0.0184 0.0268  0.0366  365 PRO B O   
2359 C CB  . PRO B 70  ? 0.4499 0.6360 0.4333 -0.0029 0.0385  0.0370  365 PRO B CB  
2360 C CG  . PRO B 70  ? 0.4353 0.6177 0.4324 0.0062  0.0390  0.0383  365 PRO B CG  
2361 C CD  . PRO B 70  ? 0.4337 0.5932 0.4330 0.0074  0.0327  0.0367  365 PRO B CD  
2362 N N   . GLY B 71  ? 0.3891 0.5581 0.3405 -0.0151 0.0311  0.0258  366 GLY B N   
2363 C CA  . GLY B 71  ? 0.4430 0.6074 0.3834 -0.0250 0.0277  0.0263  366 GLY B CA  
2364 C C   . GLY B 71  ? 0.4826 0.6289 0.4178 -0.0266 0.0215  0.0228  366 GLY B C   
2365 O O   . GLY B 71  ? 0.5317 0.6754 0.4554 -0.0338 0.0190  0.0213  366 GLY B O   
2366 N N   . PHE B 72  ? 0.4660 0.5261 0.4333 -0.0168 0.0056  0.0449  367 PHE B N   
2367 C CA  . PHE B 72  ? 0.4845 0.5353 0.4587 -0.0125 0.0108  0.0348  367 PHE B CA  
2368 C C   . PHE B 72  ? 0.5021 0.5491 0.4875 -0.0094 0.0131  0.0301  367 PHE B C   
2369 O O   . PHE B 72  ? 0.4517 0.4902 0.4333 -0.0090 0.0143  0.0189  367 PHE B O   
2370 C CB  . PHE B 72  ? 0.4325 0.4828 0.4186 -0.0099 0.0155  0.0390  367 PHE B CB  
2371 C CG  . PHE B 72  ? 0.4005 0.4412 0.3895 -0.0067 0.0206  0.0292  367 PHE B CG  
2372 C CD1 . PHE B 72  ? 0.3953 0.4294 0.3711 -0.0084 0.0200  0.0210  367 PHE B CD1 
2373 C CD2 . PHE B 72  ? 0.3850 0.4228 0.3898 -0.0029 0.0267  0.0291  367 PHE B CD2 
2374 C CE1 . PHE B 72  ? 0.3704 0.3962 0.3493 -0.0061 0.0242  0.0134  367 PHE B CE1 
2375 C CE2 . PHE B 72  ? 0.4027 0.4316 0.4084 -0.0013 0.0315  0.0210  367 PHE B CE2 
2376 C CZ  . PHE B 72  ? 0.4178 0.4412 0.4108 -0.0029 0.0296  0.0135  367 PHE B CZ  
2377 N N   . VAL B 73  ? 0.4730 0.5254 0.4727 -0.0080 0.0139  0.0392  368 VAL B N   
2378 C CA  . VAL B 73  ? 0.5498 0.5962 0.5612 -0.0060 0.0175  0.0354  368 VAL B CA  
2379 C C   . VAL B 73  ? 0.5566 0.6005 0.5564 -0.0080 0.0123  0.0282  368 VAL B C   
2380 O O   . VAL B 73  ? 0.5736 0.6096 0.5799 -0.0075 0.0147  0.0222  368 VAL B O   
2381 C CB  . VAL B 73  ? 0.6007 0.6523 0.6339 -0.0039 0.0219  0.0481  368 VAL B CB  
2382 C CG1 . VAL B 73  ? 0.6035 0.6565 0.6490 -0.0014 0.0284  0.0535  368 VAL B CG1 
2383 C CG2 . VAL B 73  ? 0.4902 0.5536 0.5221 -0.0059 0.0156  0.0602  368 VAL B CG2 
2384 N N   . ASP B 74  ? 0.5078 0.5573 0.4894 -0.0108 0.0058  0.0283  369 ASP B N   
2385 C CA  . ASP B 74  ? 0.5619 0.6094 0.5293 -0.0124 0.0010  0.0202  369 ASP B CA  
2386 C C   . ASP B 74  ? 0.5632 0.6002 0.5227 -0.0127 0.0019  0.0047  369 ASP B C   
2387 O O   . ASP B 74  ? 0.5429 0.5755 0.4944 -0.0135 -0.0009 -0.0047 369 ASP B O   
2388 C CB  . ASP B 74  ? 0.5770 0.6331 0.5246 -0.0162 -0.0048 0.0248  369 ASP B CB  
2389 C CG  . ASP B 74  ? 0.6043 0.6713 0.5586 -0.0176 -0.0071 0.0410  369 ASP B CG  
2390 O OD1 . ASP B 74  ? 0.6670 0.7348 0.6399 -0.0149 -0.0054 0.0469  369 ASP B OD1 
2391 O OD2 . ASP B 74  ? 0.6334 0.7074 0.5745 -0.0224 -0.0103 0.0484  369 ASP B OD2 
2392 N N   . LEU B 75  ? 0.5667 0.5999 0.5290 -0.0123 0.0057  0.0023  370 LEU B N   
2393 C CA  . LEU B 75  ? 0.4261 0.4504 0.3825 -0.0133 0.0065  -0.0103 370 LEU B CA  
2394 C C   . LEU B 75  ? 0.4944 0.5086 0.4643 -0.0131 0.0108  -0.0156 370 LEU B C   
2395 O O   . LEU B 75  ? 0.5205 0.5342 0.5059 -0.0116 0.0153  -0.0089 370 LEU B O   
2396 C CB  . LEU B 75  ? 0.4630 0.4868 0.4164 -0.0134 0.0088  -0.0097 370 LEU B CB  
2397 C CG  . LEU B 75  ? 0.5090 0.5393 0.4483 -0.0155 0.0064  -0.0047 370 LEU B CG  
2398 C CD1 . LEU B 75  ? 0.5051 0.5332 0.4465 -0.0151 0.0100  -0.0024 370 LEU B CD1 
2399 C CD2 . LEU B 75  ? 0.4975 0.5272 0.4180 -0.0184 0.0030  -0.0127 370 LEU B CD2 
2400 N N   . THR B 76  ? 0.4091 0.4149 0.3734 -0.0157 0.0100  -0.0272 371 THR B N   
2401 C CA  . THR B 76  ? 0.4968 0.4912 0.4721 -0.0180 0.0146  -0.0322 371 THR B CA  
2402 C C   . THR B 76  ? 0.5158 0.5084 0.5015 -0.0170 0.0214  -0.0270 371 THR B C   
2403 O O   . THR B 76  ? 0.4909 0.4892 0.4729 -0.0148 0.0212  -0.0230 371 THR B O   
2404 C CB  . THR B 76  ? 0.5194 0.5054 0.4860 -0.0225 0.0115  -0.0452 371 THR B CB  
2405 O OG1 . THR B 76  ? 0.5850 0.5723 0.5457 -0.0230 0.0111  -0.0470 371 THR B OG1 
2406 C CG2 . THR B 76  ? 0.5124 0.5009 0.4662 -0.0229 0.0047  -0.0515 371 THR B CG2 
2407 N N   . ARG B 77  ? 0.5269 0.5105 0.5244 -0.0190 0.0281  -0.0272 372 ARG B N   
2408 C CA  . ARG B 77  ? 0.5398 0.5209 0.5457 -0.0184 0.0356  -0.0228 372 ARG B CA  
2409 C C   . ARG B 77  ? 0.5188 0.4979 0.5160 -0.0200 0.0337  -0.0280 372 ARG B C   
2410 O O   . ARG B 77  ? 0.5148 0.4975 0.5131 -0.0171 0.0362  -0.0234 372 ARG B O   
2411 N N   . HIS B 78  ? 0.4779 0.4513 0.4672 -0.0247 0.0293  -0.0374 373 HIS B N   
2412 C CA  . HIS B 78  ? 0.5352 0.5066 0.5182 -0.0269 0.0275  -0.0416 373 HIS B CA  
2413 C C   . HIS B 78  ? 0.4745 0.4552 0.4509 -0.0221 0.0247  -0.0379 373 HIS B C   
2414 O O   . HIS B 78  ? 0.4496 0.4300 0.4267 -0.0210 0.0271  -0.0356 373 HIS B O   
2415 C CB  . HIS B 78  ? 0.5017 0.4673 0.4777 -0.0327 0.0222  -0.0517 373 HIS B CB  
2416 C CG  . HIS B 78  ? 0.4832 0.4476 0.4550 -0.0354 0.0203  -0.0548 373 HIS B CG  
2417 N ND1 . HIS B 78  ? 0.4950 0.4646 0.4576 -0.0347 0.0149  -0.0585 373 HIS B ND1 
2418 C CD2 . HIS B 78  ? 0.4668 0.4253 0.4426 -0.0391 0.0238  -0.0539 373 HIS B CD2 
2419 C CE1 . HIS B 78  ? 0.4595 0.4264 0.4227 -0.0376 0.0151  -0.0594 373 HIS B CE1 
2420 N NE2 . HIS B 78  ? 0.4724 0.4329 0.4433 -0.0403 0.0199  -0.0565 373 HIS B NE2 
2421 N N   . ASP B 79  ? 0.4316 0.4197 0.4007 -0.0201 0.0199  -0.0372 374 ASP B N   
2422 C CA  . ASP B 79  ? 0.4424 0.4375 0.4031 -0.0176 0.0180  -0.0336 374 ASP B CA  
2423 C C   . ASP B 79  ? 0.4469 0.4462 0.4141 -0.0138 0.0217  -0.0242 374 ASP B C   
2424 O O   . ASP B 79  ? 0.4264 0.4267 0.3901 -0.0127 0.0226  -0.0218 374 ASP B O   
2425 C CB  . ASP B 79  ? 0.5016 0.5030 0.4508 -0.0179 0.0128  -0.0347 374 ASP B CB  
2426 C CG  . ASP B 79  ? 0.6110 0.6092 0.5509 -0.0212 0.0091  -0.0448 374 ASP B CG  
2427 O OD1 . ASP B 79  ? 0.6073 0.6001 0.5488 -0.0235 0.0101  -0.0492 374 ASP B OD1 
2428 O OD2 . ASP B 79  ? 0.5869 0.5882 0.5179 -0.0218 0.0051  -0.0480 374 ASP B OD2 
2429 N N   . GLN B 80  ? 0.4489 0.4499 0.4264 -0.0121 0.0244  -0.0188 375 GLN B N   
2430 C CA  . GLN B 80  ? 0.4062 0.4116 0.3916 -0.0085 0.0284  -0.0099 375 GLN B CA  
2431 C C   . GLN B 80  ? 0.4013 0.4009 0.3901 -0.0077 0.0335  -0.0112 375 GLN B C   
2432 O O   . GLN B 80  ? 0.3589 0.3609 0.3469 -0.0053 0.0346  -0.0072 375 GLN B O   
2433 C CB  . GLN B 80  ? 0.3041 0.3119 0.3023 -0.0070 0.0317  -0.0035 375 GLN B CB  
2434 C CG  . GLN B 80  ? 0.3921 0.4069 0.3876 -0.0074 0.0265  0.0000  375 GLN B CG  
2435 C CD  . GLN B 80  ? 0.4904 0.5073 0.5011 -0.0059 0.0304  0.0077  375 GLN B CD  
2436 O OE1 . GLN B 80  ? 0.4952 0.5124 0.5184 -0.0036 0.0370  0.0136  375 GLN B OE1 
2437 N NE2 . GLN B 80  ? 0.4832 0.5016 0.4934 -0.0069 0.0268  0.0078  375 GLN B NE2 
2438 N N   . VAL B 81  ? 0.3934 0.3847 0.3851 -0.0105 0.0363  -0.0168 376 VAL B N   
2439 C CA  . VAL B 81  ? 0.3922 0.3777 0.3859 -0.0107 0.0412  -0.0177 376 VAL B CA  
2440 C C   . VAL B 81  ? 0.3728 0.3576 0.3579 -0.0108 0.0377  -0.0206 376 VAL B C   
2441 O O   . VAL B 81  ? 0.4266 0.4106 0.4118 -0.0083 0.0404  -0.0182 376 VAL B O   
2442 C CB  . VAL B 81  ? 0.4593 0.4352 0.4565 -0.0161 0.0449  -0.0223 376 VAL B CB  
2443 C CG1 . VAL B 81  ? 0.4360 0.4063 0.4329 -0.0172 0.0492  -0.0226 376 VAL B CG1 
2444 C CG2 . VAL B 81  ? 0.4369 0.4107 0.4438 -0.0166 0.0511  -0.0188 376 VAL B CG2 
2445 N N   . HIS B 82  ? 0.5007 0.4853 0.4784 -0.0139 0.0324  -0.0258 377 HIS B N   
2446 C CA  . HIS B 82  ? 0.4538 0.4370 0.4245 -0.0147 0.0302  -0.0283 377 HIS B CA  
2447 C C   . HIS B 82  ? 0.4406 0.4276 0.4070 -0.0114 0.0305  -0.0234 377 HIS B C   
2448 O O   . HIS B 82  ? 0.4429 0.4261 0.4080 -0.0108 0.0324  -0.0231 377 HIS B O   
2449 C CB  . HIS B 82  ? 0.4171 0.4007 0.3805 -0.0183 0.0252  -0.0343 377 HIS B CB  
2450 C CG  . HIS B 82  ? 0.4072 0.3895 0.3644 -0.0195 0.0244  -0.0361 377 HIS B CG  
2451 N ND1 . HIS B 82  ? 0.4084 0.3851 0.3697 -0.0214 0.0260  -0.0373 377 HIS B ND1 
2452 C CD2 . HIS B 82  ? 0.4342 0.4195 0.3819 -0.0198 0.0230  -0.0360 377 HIS B CD2 
2453 C CE1 . HIS B 82  ? 0.4197 0.3960 0.3759 -0.0221 0.0259  -0.0379 377 HIS B CE1 
2454 N NE2 . HIS B 82  ? 0.4380 0.4189 0.3853 -0.0214 0.0246  -0.0374 377 HIS B NE2 
2455 N N   . LEU B 83  ? 0.4004 0.3940 0.3645 -0.0102 0.0288  -0.0192 378 LEU B N   
2456 C CA  . LEU B 83  ? 0.3684 0.3647 0.3278 -0.0091 0.0288  -0.0140 378 LEU B CA  
2457 C C   . LEU B 83  ? 0.3998 0.3942 0.3665 -0.0055 0.0331  -0.0103 378 LEU B C   
2458 O O   . LEU B 83  ? 0.3392 0.3303 0.3021 -0.0052 0.0343  -0.0094 378 LEU B O   
2459 C CB  . LEU B 83  ? 0.4371 0.4415 0.3930 -0.0099 0.0256  -0.0088 378 LEU B CB  
2460 C CG  . LEU B 83  ? 0.4530 0.4599 0.3978 -0.0134 0.0214  -0.0119 378 LEU B CG  
2461 C CD1 . LEU B 83  ? 0.3775 0.3928 0.3193 -0.0144 0.0183  -0.0050 378 LEU B CD1 
2462 C CD2 . LEU B 83  ? 0.4306 0.4334 0.3634 -0.0167 0.0218  -0.0152 378 LEU B CD2 
2463 N N   . LEU B 84  ? 0.3748 0.3704 0.3517 -0.0032 0.0362  -0.0084 379 LEU B N   
2464 C CA  . LEU B 84  ? 0.4118 0.4063 0.3950 0.0006  0.0412  -0.0052 379 LEU B CA  
2465 C C   . LEU B 84  ? 0.4028 0.3891 0.3845 0.0009  0.0441  -0.0096 379 LEU B C   
2466 O O   . LEU B 84  ? 0.4301 0.4138 0.4107 0.0035  0.0462  -0.0086 379 LEU B O   
2467 C CB  . LEU B 84  ? 0.4571 0.4546 0.4515 0.0025  0.0457  -0.0016 379 LEU B CB  
2468 C CG  . LEU B 84  ? 0.3926 0.3992 0.3921 0.0034  0.0440  0.0057  379 LEU B CG  
2469 C CD1 . LEU B 84  ? 0.4474 0.4548 0.4588 0.0040  0.0491  0.0083  379 LEU B CD1 
2470 C CD2 . LEU B 84  ? 0.3167 0.3276 0.3173 0.0060  0.0445  0.0117  379 LEU B CD2 
2471 N N   . GLU B 85  ? 0.3678 0.3497 0.3496 -0.0022 0.0440  -0.0142 380 GLU B N   
2472 C CA  . GLU B 85  ? 0.4489 0.4235 0.4295 -0.0033 0.0457  -0.0174 380 GLU B CA  
2473 C C   . GLU B 85  ? 0.4025 0.3743 0.3771 -0.0025 0.0442  -0.0177 380 GLU B C   
2474 O O   . GLU B 85  ? 0.4286 0.3956 0.4034 -0.0001 0.0471  -0.0173 380 GLU B O   
2475 C CB  . GLU B 85  ? 0.5068 0.4782 0.4869 -0.0088 0.0433  -0.0219 380 GLU B CB  
2476 C CG  . GLU B 85  ? 0.6601 0.6270 0.6450 -0.0121 0.0472  -0.0226 380 GLU B CG  
2477 C CD  . GLU B 85  ? 0.7142 0.6762 0.6980 -0.0188 0.0443  -0.0267 380 GLU B CD  
2478 O OE1 . GLU B 85  ? 0.7682 0.7324 0.7494 -0.0212 0.0391  -0.0302 380 GLU B OE1 
2479 O OE2 . GLU B 85  ? 0.7769 0.7332 0.7621 -0.0221 0.0470  -0.0263 380 GLU B OE2 
2480 N N   . CYS B 86  ? 0.3925 0.3663 0.3612 -0.0049 0.0402  -0.0187 381 CYS B N   
2481 C CA  . CYS B 86  ? 0.3898 0.3589 0.3522 -0.0059 0.0401  -0.0192 381 CYS B CA  
2482 C C   . CYS B 86  ? 0.3878 0.3559 0.3473 -0.0038 0.0415  -0.0158 381 CYS B C   
2483 O O   . CYS B 86  ? 0.4662 0.4269 0.4222 -0.0043 0.0433  -0.0164 381 CYS B O   
2484 C CB  . CYS B 86  ? 0.4136 0.3848 0.3687 -0.0101 0.0370  -0.0209 381 CYS B CB  
2485 S SG  . CYS B 86  ? 0.4793 0.4511 0.4369 -0.0134 0.0345  -0.0260 381 CYS B SG  
2486 N N   . ALA B 87  ? 0.4098 0.3848 0.3713 -0.0021 0.0408  -0.0120 382 ALA B N   
2487 C CA  . ALA B 87  ? 0.3829 0.3584 0.3406 -0.0022 0.0405  -0.0081 382 ALA B CA  
2488 C C   . ALA B 87  ? 0.3656 0.3419 0.3295 0.0025  0.0433  -0.0057 382 ALA B C   
2489 O O   . ALA B 87  ? 0.3367 0.3112 0.2973 0.0020  0.0431  -0.0035 382 ALA B O   
2490 C CB  . ALA B 87  ? 0.3201 0.3038 0.2738 -0.0056 0.0366  -0.0039 382 ALA B CB  
2491 N N   . TRP B 88  ? 0.3206 0.2988 0.2926 0.0063  0.0464  -0.0063 383 TRP B N   
2492 C CA  . TRP B 88  ? 0.3743 0.3548 0.3520 0.0110  0.0500  -0.0035 383 TRP B CA  
2493 C C   . TRP B 88  ? 0.4079 0.3814 0.3811 0.0128  0.0513  -0.0050 383 TRP B C   
2494 O O   . TRP B 88  ? 0.3926 0.3692 0.3668 0.0141  0.0511  -0.0018 383 TRP B O   
2495 C CB  . TRP B 88  ? 0.4034 0.3846 0.3883 0.0137  0.0554  -0.0042 383 TRP B CB  
2496 C CG  . TRP B 88  ? 0.4647 0.4373 0.4469 0.0139  0.0582  -0.0088 383 TRP B CG  
2497 C CD1 . TRP B 88  ? 0.5067 0.4753 0.4875 0.0102  0.0569  -0.0119 383 TRP B CD1 
2498 C CD2 . TRP B 88  ? 0.5580 0.5253 0.5387 0.0178  0.0626  -0.0102 383 TRP B CD2 
2499 N NE1 . TRP B 88  ? 0.5959 0.5574 0.5752 0.0109  0.0600  -0.0140 383 TRP B NE1 
2500 C CE2 . TRP B 88  ? 0.5718 0.5320 0.5502 0.0159  0.0637  -0.0133 383 TRP B CE2 
2501 C CE3 . TRP B 88  ? 0.5859 0.5537 0.5665 0.0226  0.0655  -0.0092 383 TRP B CE3 
2502 C CZ2 . TRP B 88  ? 0.5711 0.5249 0.5468 0.0186  0.0677  -0.0150 383 TRP B CZ2 
2503 C CZ3 . TRP B 88  ? 0.5644 0.5253 0.5415 0.0259  0.0697  -0.0122 383 TRP B CZ3 
2504 C CH2 . TRP B 88  ? 0.5552 0.5092 0.5296 0.0240  0.0707  -0.0148 383 TRP B CH2 
2505 N N   . LEU B 89  ? 0.3792 0.3430 0.3479 0.0126  0.0524  -0.0097 384 LEU B N   
2506 C CA  . LEU B 89  ? 0.3372 0.2922 0.3017 0.0146  0.0541  -0.0120 384 LEU B CA  
2507 C C   . LEU B 89  ? 0.4006 0.3518 0.3582 0.0099  0.0510  -0.0109 384 LEU B C   
2508 O O   . LEU B 89  ? 0.3753 0.3236 0.3309 0.0108  0.0513  -0.0106 384 LEU B O   
2509 C CB  . LEU B 89  ? 0.3648 0.3098 0.3277 0.0153  0.0564  -0.0163 384 LEU B CB  
2510 C CG  . LEU B 89  ? 0.4166 0.3513 0.3757 0.0185  0.0589  -0.0193 384 LEU B CG  
2511 C CD1 . LEU B 89  ? 0.4291 0.3687 0.3903 0.0241  0.0616  -0.0187 384 LEU B CD1 
2512 C CD2 . LEU B 89  ? 0.3803 0.3059 0.3393 0.0193  0.0612  -0.0221 384 LEU B CD2 
2513 N N   . GLU B 90  ? 0.3687 0.3192 0.3216 0.0041  0.0485  -0.0103 385 GLU B N   
2514 C CA  . GLU B 90  ? 0.3656 0.3128 0.3100 -0.0026 0.0464  -0.0081 385 GLU B CA  
2515 C C   . GLU B 90  ? 0.3694 0.3258 0.3158 -0.0031 0.0437  -0.0024 385 GLU B C   
2516 O O   . GLU B 90  ? 0.3759 0.3277 0.3174 -0.0068 0.0429  -0.0009 385 GLU B O   
2517 C CB  . GLU B 90  ? 0.3839 0.3325 0.3226 -0.0085 0.0448  -0.0073 385 GLU B CB  
2518 C CG  . GLU B 90  ? 0.4729 0.4106 0.4079 -0.0109 0.0478  -0.0115 385 GLU B CG  
2519 C CD  . GLU B 90  ? 0.5148 0.4553 0.4434 -0.0167 0.0468  -0.0107 385 GLU B CD  
2520 O OE1 . GLU B 90  ? 0.4842 0.4188 0.4023 -0.0240 0.0481  -0.0091 385 GLU B OE1 
2521 O OE2 . GLU B 90  ? 0.4934 0.4413 0.4263 -0.0147 0.0451  -0.0118 385 GLU B OE2 
2522 N N   . ILE B 91  ? 0.3513 0.3203 0.3055 -0.0003 0.0425  0.0012  386 ILE B N   
2523 C CA  . ILE B 91  ? 0.3899 0.3696 0.3494 -0.0005 0.0402  0.0083  386 ILE B CA  
2524 C C   . ILE B 91  ? 0.4155 0.3939 0.3797 0.0041  0.0427  0.0081  386 ILE B C   
2525 O O   . ILE B 91  ? 0.4061 0.3862 0.3693 0.0008  0.0403  0.0124  386 ILE B O   
2526 C CB  . ILE B 91  ? 0.3341 0.3257 0.3031 0.0021  0.0399  0.0120  386 ILE B CB  
2527 C CG1 . ILE B 91  ? 0.3994 0.3930 0.3618 -0.0032 0.0364  0.0124  386 ILE B CG1 
2528 C CG2 . ILE B 91  ? 0.2935 0.2961 0.2716 0.0030  0.0390  0.0203  386 ILE B CG2 
2529 C CD1 . ILE B 91  ? 0.4639 0.4656 0.4343 -0.0008 0.0363  0.0135  386 ILE B CD1 
2530 N N   . LEU B 92  ? 0.3369 0.3121 0.3052 0.0110  0.0474  0.0033  387 LEU B N   
2531 C CA  . LEU B 92  ? 0.3475 0.3210 0.3184 0.0160  0.0504  0.0019  387 LEU B CA  
2532 C C   . LEU B 92  ? 0.4170 0.3781 0.3781 0.0123  0.0487  -0.0017 387 LEU B C   
2533 O O   . LEU B 92  ? 0.3207 0.2822 0.2821 0.0121  0.0478  -0.0002 387 LEU B O   
2534 C CB  . LEU B 92  ? 0.3581 0.3290 0.3321 0.0231  0.0565  -0.0028 387 LEU B CB  
2535 C CG  . LEU B 92  ? 0.4194 0.3999 0.4031 0.0265  0.0608  0.0004  387 LEU B CG  
2536 C CD1 . LEU B 92  ? 0.3741 0.3490 0.3568 0.0310  0.0671  -0.0045 387 LEU B CD1 
2537 C CD2 . LEU B 92  ? 0.2780 0.2696 0.2713 0.0289  0.0626  0.0070  387 LEU B CD2 
2538 N N   . MET B 93  ? 0.3450 0.2946 0.2981 0.0087  0.0486  -0.0062 388 MET B N   
2539 C CA  . MET B 93  ? 0.2879 0.2222 0.2316 0.0045  0.0485  -0.0102 388 MET B CA  
2540 C C   . MET B 93  ? 0.3846 0.3180 0.3221 -0.0050 0.0446  -0.0056 388 MET B C   
2541 O O   . MET B 93  ? 0.4082 0.3329 0.3412 -0.0076 0.0442  -0.0074 388 MET B O   
2542 C CB  . MET B 93  ? 0.2934 0.2153 0.2319 0.0024  0.0508  -0.0149 388 MET B CB  
2543 C CG  . MET B 93  ? 0.3456 0.2633 0.2880 0.0103  0.0547  -0.0199 388 MET B CG  
2544 S SD  . MET B 93  ? 0.4104 0.3161 0.3505 0.0073  0.0570  -0.0230 388 MET B SD  
2545 C CE  . MET B 93  ? 0.4054 0.3050 0.3489 0.0159  0.0609  -0.0276 388 MET B CE  
2546 N N   . ILE B 94  ? 0.3705 0.3120 0.3067 -0.0110 0.0416  0.0004  389 ILE B N   
2547 C CA  . ILE B 94  ? 0.3687 0.3097 0.2977 -0.0217 0.0378  0.0063  389 ILE B CA  
2548 C C   . ILE B 94  ? 0.3622 0.3136 0.2991 -0.0199 0.0350  0.0117  389 ILE B C   
2549 O O   . ILE B 94  ? 0.4173 0.3634 0.3489 -0.0273 0.0326  0.0138  389 ILE B O   
2550 C CB  . ILE B 94  ? 0.4613 0.4092 0.3853 -0.0289 0.0353  0.0121  389 ILE B CB  
2551 C CG1 . ILE B 94  ? 0.4093 0.3515 0.3209 -0.0427 0.0328  0.0175  389 ILE B CG1 
2552 C CG2 . ILE B 94  ? 0.3710 0.3377 0.3066 -0.0234 0.0329  0.0180  389 ILE B CG2 
2553 C CD1 . ILE B 94  ? 0.3320 0.2799 0.2349 -0.0513 0.0309  0.0234  389 ILE B CD1 
2554 N N   . GLY B 95  ? 0.3494 0.3147 0.2993 -0.0108 0.0360  0.0140  390 GLY B N   
2555 C CA  . GLY B 95  ? 0.4175 0.3929 0.3775 -0.0074 0.0353  0.0189  390 GLY B CA  
2556 C C   . GLY B 95  ? 0.4623 0.4267 0.4187 -0.0052 0.0369  0.0124  390 GLY B C   
2557 O O   . GLY B 95  ? 0.3946 0.3604 0.3516 -0.0095 0.0340  0.0160  390 GLY B O   
2558 N N   . LEU B 96  ? 0.4388 0.3920 0.3913 0.0008  0.0413  0.0029  391 LEU B N   
2559 C CA  . LEU B 96  ? 0.4470 0.3879 0.3948 0.0039  0.0433  -0.0049 391 LEU B CA  
2560 C C   . LEU B 96  ? 0.4764 0.4021 0.4124 -0.0073 0.0401  -0.0066 391 LEU B C   
2561 O O   . LEU B 96  ? 0.4363 0.3566 0.3701 -0.0087 0.0388  -0.0088 391 LEU B O   
2562 C CB  . LEU B 96  ? 0.3779 0.3090 0.3230 0.0112  0.0484  -0.0135 391 LEU B CB  
2563 C CG  . LEU B 96  ? 0.4239 0.3395 0.3622 0.0144  0.0507  -0.0226 391 LEU B CG  
2564 C CD1 . LEU B 96  ? 0.4361 0.3601 0.3798 0.0220  0.0524  -0.0232 391 LEU B CD1 
2565 C CD2 . LEU B 96  ? 0.4063 0.3119 0.3418 0.0196  0.0550  -0.0291 391 LEU B CD2 
2566 N N   . VAL B 97  ? 0.4136 0.3313 0.3414 -0.0158 0.0394  -0.0058 392 VAL B N   
2567 C CA  . VAL B 97  ? 0.4933 0.3938 0.4083 -0.0283 0.0382  -0.0072 392 VAL B CA  
2568 C C   . VAL B 97  ? 0.5035 0.4109 0.4174 -0.0386 0.0325  0.0014  392 VAL B C   
2569 O O   . VAL B 97  ? 0.5692 0.4639 0.4754 -0.0472 0.0310  -0.0003 392 VAL B O   
2570 C CB  . VAL B 97  ? 0.5416 0.4321 0.4481 -0.0350 0.0408  -0.0080 392 VAL B CB  
2571 C CG1 . VAL B 97  ? 0.6656 0.5417 0.5584 -0.0513 0.0401  -0.0058 392 VAL B CG1 
2572 C CG2 . VAL B 97  ? 0.4444 0.3220 0.3510 -0.0275 0.0463  -0.0171 392 VAL B CG2 
2573 N N   . TRP B 98  ? 0.5499 0.4769 0.4720 -0.0383 0.0294  0.0112  393 TRP B N   
2574 C CA  . TRP B 98  ? 0.5035 0.4407 0.4280 -0.0471 0.0236  0.0216  393 TRP B CA  
2575 C C   . TRP B 98  ? 0.5245 0.4648 0.4568 -0.0425 0.0224  0.0206  393 TRP B C   
2576 O O   . TRP B 98  ? 0.5193 0.4532 0.4462 -0.0529 0.0185  0.0228  393 TRP B O   
2577 C CB  . TRP B 98  ? 0.3461 0.3043 0.2805 -0.0452 0.0212  0.0322  393 TRP B CB  
2578 C CG  . TRP B 98  ? 0.5222 0.4940 0.4632 -0.0525 0.0153  0.0449  393 TRP B CG  
2579 C CD1 . TRP B 98  ? 0.5674 0.5568 0.5260 -0.0450 0.0144  0.0516  393 TRP B CD1 
2580 C CD2 . TRP B 98  ? 0.6128 0.5817 0.5432 -0.0696 0.0100  0.0535  393 TRP B CD2 
2581 N NE1 . TRP B 98  ? 0.5794 0.5781 0.5409 -0.0558 0.0082  0.0644  393 TRP B NE1 
2582 C CE2 . TRP B 98  ? 0.6226 0.6089 0.5661 -0.0715 0.0050  0.0658  393 TRP B CE2 
2583 C CE3 . TRP B 98  ? 0.6648 0.6175 0.5757 -0.0845 0.0099  0.0526  393 TRP B CE3 
2584 C CZ2 . TRP B 98  ? 0.5959 0.5846 0.5335 -0.0881 -0.0013 0.0777  393 TRP B CZ2 
2585 C CZ3 . TRP B 98  ? 0.6886 0.6426 0.5918 -0.1014 0.0045  0.0638  393 TRP B CZ3 
2586 C CH2 . TRP B 98  ? 0.5795 0.5517 0.4959 -0.1033 -0.0017 0.0764  393 TRP B CH2 
2587 N N   . ARG B 99  ? 0.4936 0.4430 0.4378 -0.0277 0.0261  0.0171  394 ARG B N   
2588 C CA  . ARG B 99  ? 0.5252 0.4789 0.4770 -0.0215 0.0265  0.0155  394 ARG B CA  
2589 C C   . ARG B 99  ? 0.5881 0.5210 0.5279 -0.0251 0.0264  0.0051  394 ARG B C   
2590 O O   . ARG B 99  ? 0.5437 0.4769 0.4851 -0.0274 0.0237  0.0054  394 ARG B O   
2591 C CB  . ARG B 99  ? 0.4314 0.3948 0.3943 -0.0055 0.0329  0.0120  394 ARG B CB  
2592 C CG  . ARG B 99  ? 0.4714 0.4538 0.4476 -0.0016 0.0341  0.0215  394 ARG B CG  
2593 C CD  . ARG B 99  ? 0.5012 0.4938 0.4896 0.0118  0.0413  0.0203  394 ARG B CD  
2594 N NE  . ARG B 99  ? 0.4486 0.4319 0.4313 0.0202  0.0475  0.0098  394 ARG B NE  
2595 C CZ  . ARG B 99  ? 0.4516 0.4355 0.4345 0.0224  0.0500  0.0092  394 ARG B CZ  
2596 N NH1 . ARG B 99  ? 0.5019 0.4945 0.4896 0.0176  0.0470  0.0171  394 ARG B NH1 
2597 N NH2 . ARG B 99  ? 0.4036 0.3794 0.3817 0.0290  0.0552  0.0008  394 ARG B NH2 
2598 N N   . SER B 100 ? 0.5174 0.4319 0.4457 -0.0257 0.0296  -0.0041 395 SER B N   
2599 C CA  . SER B 100 ? 0.5806 0.4735 0.4986 -0.0264 0.0312  -0.0156 395 SER B CA  
2600 C C   . SER B 100 ? 0.5996 0.4748 0.5046 -0.0439 0.0275  -0.0154 395 SER B C   
2601 O O   . SER B 100 ? 0.6188 0.4738 0.5148 -0.0467 0.0285  -0.0249 395 SER B O   
2602 C CB  . SER B 100 ? 0.5609 0.4413 0.4745 -0.0188 0.0371  -0.0250 395 SER B CB  
2603 O OG  . SER B 100 ? 0.4907 0.3856 0.4144 -0.0045 0.0408  -0.0253 395 SER B OG  
2604 N N   . MET B 101 ? 0.5540 0.4357 0.4571 -0.0564 0.0237  -0.0045 396 MET B N   
2605 C CA  . MET B 101 ? 0.6258 0.4894 0.5141 -0.0758 0.0215  -0.0029 396 MET B CA  
2606 C C   . MET B 101 ? 0.6711 0.5215 0.5539 -0.0835 0.0183  -0.0073 396 MET B C   
2607 O O   . MET B 101 ? 0.6971 0.5219 0.5660 -0.0941 0.0203  -0.0145 396 MET B O   
2608 C CB  . MET B 101 ? 0.5881 0.4647 0.4754 -0.0880 0.0172  0.0114  396 MET B CB  
2609 C CG  . MET B 101 ? 0.5522 0.4283 0.4341 -0.0894 0.0210  0.0132  396 MET B CG  
2610 S SD  . MET B 101 ? 0.6682 0.5601 0.5473 -0.1034 0.0158  0.0299  396 MET B SD  
2611 C CE  . MET B 101 ? 0.6446 0.5156 0.5055 -0.1280 0.0131  0.0328  396 MET B CE  
2612 N N   . GLU B 102 ? 0.8187 0.5735 0.5994 -0.0101 -0.0211 0.0900  397 GLU B N   
2613 C CA  . GLU B 102 ? 0.9208 0.6474 0.6807 -0.0204 -0.0205 0.0945  397 GLU B CA  
2614 C C   . GLU B 102 ? 0.9201 0.6456 0.6833 -0.0279 -0.0143 0.0896  397 GLU B C   
2615 O O   . GLU B 102 ? 0.9010 0.6039 0.6526 -0.0344 -0.0168 0.0922  397 GLU B O   
2616 C CB  . GLU B 102 ? 1.0772 0.7796 0.8262 -0.0189 -0.0327 0.1010  397 GLU B CB  
2617 C CG  . GLU B 102 ? 1.2305 0.9403 0.9962 -0.0091 -0.0427 0.0991  397 GLU B CG  
2618 C CD  . GLU B 102 ? 1.3815 1.0701 1.1365 -0.0062 -0.0547 0.1067  397 GLU B CD  
2619 O OE1 . GLU B 102 ? 1.3766 1.0669 1.1434 0.0009  -0.0635 0.1060  397 GLU B OE1 
2620 O OE2 . GLU B 102 ? 1.4557 1.1259 1.1904 -0.0113 -0.0552 0.1134  397 GLU B OE2 
2621 N N   . HIS B 103 ? 0.9021 0.6524 0.6814 -0.0269 -0.0061 0.0828  398 HIS B N   
2622 C CA  . HIS B 103 ? 0.8132 0.5650 0.5954 -0.0345 0.0016  0.0780  398 HIS B CA  
2623 C C   . HIS B 103 ? 0.7640 0.5335 0.5493 -0.0379 0.0140  0.0750  398 HIS B C   
2624 O O   . HIS B 103 ? 0.7353 0.5300 0.5392 -0.0348 0.0187  0.0689  398 HIS B O   
2625 C CB  . HIS B 103 ? 0.7721 0.5378 0.5745 -0.0299 -0.0017 0.0716  398 HIS B CB  
2626 C CG  . HIS B 103 ? 0.8137 0.5645 0.6160 -0.0256 -0.0137 0.0741  398 HIS B CG  
2627 N ND1 . HIS B 103 ? 0.7583 0.4866 0.5520 -0.0316 -0.0169 0.0756  398 HIS B ND1 
2628 C CD2 . HIS B 103 ? 0.7726 0.5277 0.5829 -0.0159 -0.0232 0.0754  398 HIS B CD2 
2629 C CE1 . HIS B 103 ? 0.7828 0.5022 0.5795 -0.0258 -0.0278 0.0779  398 HIS B CE1 
2630 N NE2 . HIS B 103 ? 0.8082 0.5435 0.6148 -0.0162 -0.0318 0.0778  398 HIS B NE2 
2631 N N   . PRO B 104 ? 0.8141 0.5704 0.5813 -0.0443 0.0193  0.0796  399 PRO B N   
2632 C CA  . PRO B 104 ? 0.7777 0.5483 0.5462 -0.0481 0.0315  0.0776  399 PRO B CA  
2633 C C   . PRO B 104 ? 0.7917 0.5741 0.5709 -0.0533 0.0400  0.0712  399 PRO B C   
2634 O O   . PRO B 104 ? 0.7725 0.5393 0.5451 -0.0598 0.0397  0.0706  399 PRO B O   
2635 C CB  . PRO B 104 ? 0.8594 0.6049 0.6028 -0.0567 0.0346  0.0838  399 PRO B CB  
2636 C CG  . PRO B 104 ? 0.9005 0.6257 0.6322 -0.0536 0.0226  0.0899  399 PRO B CG  
2637 C CD  . PRO B 104 ? 0.8940 0.6206 0.6381 -0.0486 0.0139  0.0872  399 PRO B CD  
2638 N N   . GLY B 105 ? 0.7700 0.5801 0.5658 -0.0503 0.0473  0.0667  400 GLY B N   
2639 C CA  . GLY B 105 ? 0.7390 0.5626 0.5458 -0.0551 0.0558  0.0607  400 GLY B CA  
2640 C C   . GLY B 105 ? 0.6887 0.5253 0.5136 -0.0506 0.0507  0.0551  400 GLY B C   
2641 O O   . GLY B 105 ? 0.6898 0.5389 0.5252 -0.0542 0.0570  0.0498  400 GLY B O   
2642 N N   . LYS B 106 ? 0.6053 0.4391 0.4341 -0.0429 0.0396  0.0562  401 LYS B N   
2643 C CA  . LYS B 106 ? 0.6205 0.4650 0.4659 -0.0385 0.0343  0.0509  401 LYS B CA  
2644 C C   . LYS B 106 ? 0.6201 0.4812 0.4800 -0.0268 0.0265  0.0501  401 LYS B C   
2645 O O   . LYS B 106 ? 0.6094 0.4669 0.4633 -0.0218 0.0223  0.0548  401 LYS B O   
2646 C CB  . LYS B 106 ? 0.6300 0.4485 0.4652 -0.0426 0.0279  0.0523  401 LYS B CB  
2647 C CG  . LYS B 106 ? 0.6937 0.4961 0.5161 -0.0541 0.0351  0.0524  401 LYS B CG  
2648 C CD  . LYS B 106 ? 0.7936 0.5692 0.6052 -0.0575 0.0279  0.0548  401 LYS B CD  
2649 C CE  . LYS B 106 ? 0.9618 0.7175 0.7567 -0.0691 0.0345  0.0563  401 LYS B CE  
2650 N NZ  . LYS B 106 ? 1.0999 0.8286 0.8838 -0.0724 0.0272  0.0593  401 LYS B NZ  
2651 N N   . LEU B 107 ? 0.5281 0.4072 0.4070 -0.0228 0.0247  0.0441  402 LEU B N   
2652 C CA  . LEU B 107 ? 0.5192 0.4142 0.4130 -0.0120 0.0171  0.0425  402 LEU B CA  
2653 C C   . LEU B 107 ? 0.5717 0.4569 0.4700 -0.0098 0.0082  0.0406  402 LEU B C   
2654 O O   . LEU B 107 ? 0.4914 0.3786 0.3963 -0.0141 0.0105  0.0357  402 LEU B O   
2655 C CB  . LEU B 107 ? 0.4497 0.3787 0.3644 -0.0084 0.0230  0.0368  402 LEU B CB  
2656 C CG  . LEU B 107 ? 0.5167 0.4590 0.4305 -0.0083 0.0309  0.0389  402 LEU B CG  
2657 C CD1 . LEU B 107 ? 0.3427 0.3187 0.2783 -0.0051 0.0365  0.0332  402 LEU B CD1 
2658 C CD2 . LEU B 107 ? 0.4904 0.4267 0.3968 -0.0015 0.0251  0.0446  402 LEU B CD2 
2659 N N   . LEU B 108 ? 0.4580 0.3319 0.3524 -0.0033 -0.0018 0.0446  403 LEU B N   
2660 C CA  . LEU B 108 ? 0.4568 0.3192 0.3548 -0.0008 -0.0108 0.0437  403 LEU B CA  
2661 C C   . LEU B 108 ? 0.4429 0.3295 0.3629 0.0083  -0.0148 0.0382  403 LEU B C   
2662 O O   . LEU B 108 ? 0.4844 0.3726 0.4078 0.0168  -0.0225 0.0404  403 LEU B O   
2663 C CB  . LEU B 108 ? 0.4973 0.3336 0.3794 0.0010  -0.0198 0.0514  403 LEU B CB  
2664 C CG  . LEU B 108 ? 0.6242 0.4386 0.5029 0.0005  -0.0283 0.0528  403 LEU B CG  
2665 C CD1 . LEU B 108 ? 0.7276 0.5137 0.5855 -0.0016 -0.0340 0.0616  403 LEU B CD1 
2666 C CD2 . LEU B 108 ? 0.6891 0.5154 0.5855 0.0100  -0.0362 0.0495  403 LEU B CD2 
2667 N N   . PHE B 109 ? 0.4371 0.3428 0.3718 0.0063  -0.0093 0.0311  404 PHE B N   
2668 C CA  . PHE B 109 ? 0.4724 0.4022 0.4284 0.0140  -0.0123 0.0253  404 PHE B CA  
2669 C C   . PHE B 109 ? 0.4846 0.4011 0.4434 0.0183  -0.0225 0.0252  404 PHE B C   
2670 O O   . PHE B 109 ? 0.4675 0.3953 0.4382 0.0270  -0.0287 0.0238  404 PHE B O   
2671 C CB  . PHE B 109 ? 0.4000 0.3511 0.3697 0.0096  -0.0041 0.0178  404 PHE B CB  
2672 C CG  . PHE B 109 ? 0.4567 0.4247 0.4271 0.0064  0.0058  0.0177  404 PHE B CG  
2673 C CD1 . PHE B 109 ? 0.4059 0.4018 0.3907 0.0127  0.0076  0.0156  404 PHE B CD1 
2674 C CD2 . PHE B 109 ? 0.4533 0.4091 0.4102 -0.0030 0.0135  0.0197  404 PHE B CD2 
2675 C CE1 . PHE B 109 ? 0.4353 0.4467 0.4216 0.0098  0.0169  0.0158  404 PHE B CE1 
2676 C CE2 . PHE B 109 ? 0.5294 0.5004 0.4875 -0.0060 0.0229  0.0196  404 PHE B CE2 
2677 C CZ  . PHE B 109 ? 0.4195 0.4185 0.3927 0.0004  0.0247  0.0177  404 PHE B CZ  
2678 N N   . ALA B 110 ? 0.4351 0.3271 0.3830 0.0119  -0.0239 0.0268  405 ALA B N   
2679 C CA  . ALA B 110 ? 0.4831 0.3577 0.4314 0.0146  -0.0332 0.0278  405 ALA B CA  
2680 C C   . ALA B 110 ? 0.5166 0.3599 0.4453 0.0069  -0.0340 0.0333  405 ALA B C   
2681 O O   . ALA B 110 ? 0.5277 0.3661 0.4460 -0.0013 -0.0263 0.0341  405 ALA B O   
2682 C CB  . ALA B 110 ? 0.5169 0.4041 0.4828 0.0150  -0.0329 0.0198  405 ALA B CB  
2683 N N   . PRO B 111 ? 0.5458 0.3679 0.4695 0.0092  -0.0432 0.0374  406 PRO B N   
2684 C CA  . PRO B 111 ? 0.5796 0.3717 0.4843 0.0017  -0.0443 0.0433  406 PRO B CA  
2685 C C   . PRO B 111 ? 0.6063 0.3936 0.5101 -0.0077 -0.0373 0.0391  406 PRO B C   
2686 O O   . PRO B 111 ? 0.6613 0.4285 0.5485 -0.0157 -0.0347 0.0431  406 PRO B O   
2687 C CB  . PRO B 111 ? 0.5877 0.3626 0.4929 0.0069  -0.0556 0.0470  406 PRO B CB  
2688 C CG  . PRO B 111 ? 0.5347 0.3280 0.4527 0.0177  -0.0607 0.0459  406 PRO B CG  
2689 C CD  . PRO B 111 ? 0.4379 0.2616 0.3717 0.0188  -0.0530 0.0378  406 PRO B CD  
2690 N N   . ASN B 112 ? 0.5366 0.3422 0.4579 -0.0069 -0.0344 0.0309  407 ASN B N   
2691 C CA  . ASN B 112 ? 0.5794 0.3832 0.5017 -0.0155 -0.0275 0.0261  407 ASN B CA  
2692 C C   . ASN B 112 ? 0.6128 0.4406 0.5412 -0.0188 -0.0170 0.0210  407 ASN B C   
2693 O O   . ASN B 112 ? 0.5910 0.4245 0.5247 -0.0248 -0.0108 0.0154  407 ASN B O   
2694 C CB  . ASN B 112 ? 0.5541 0.3598 0.4914 -0.0137 -0.0310 0.0204  407 ASN B CB  
2695 C CG  . ASN B 112 ? 0.5715 0.4059 0.5295 -0.0059 -0.0317 0.0139  407 ASN B CG  
2696 O OD1 . ASN B 112 ? 0.4773 0.3247 0.4383 0.0009  -0.0339 0.0157  407 ASN B OD1 
2697 N ND2 . ASN B 112 ? 0.5145 0.3588 0.4867 -0.0072 -0.0298 0.0064  407 ASN B ND2 
2698 N N   . LEU B 113 ? 0.4826 0.3247 0.4107 -0.0149 -0.0151 0.0229  408 LEU B N   
2699 C CA  . LEU B 113 ? 0.4760 0.3404 0.4095 -0.0180 -0.0051 0.0190  408 LEU B CA  
2700 C C   . LEU B 113 ? 0.6073 0.4693 0.5277 -0.0189 -0.0017 0.0248  408 LEU B C   
2701 O O   . LEU B 113 ? 0.5776 0.4573 0.5043 -0.0126 -0.0016 0.0252  408 LEU B O   
2702 C CB  . LEU B 113 ? 0.4623 0.3577 0.4176 -0.0113 -0.0047 0.0125  408 LEU B CB  
2703 C CG  . LEU B 113 ? 0.5183 0.4374 0.4826 -0.0159 0.0057  0.0070  408 LEU B CG  
2704 C CD1 . LEU B 113 ? 0.5971 0.5088 0.5608 -0.0247 0.0104  0.0027  408 LEU B CD1 
2705 C CD2 . LEU B 113 ? 0.4842 0.4341 0.4694 -0.0088 0.0052  0.0015  408 LEU B CD2 
2706 N N   . LEU B 114 ? 0.5893 0.4290 0.4912 -0.0269 0.0013  0.0293  409 LEU B N   
2707 C CA  . LEU B 114 ? 0.6001 0.4342 0.4873 -0.0293 0.0053  0.0349  409 LEU B CA  
2708 C C   . LEU B 114 ? 0.6712 0.5157 0.5583 -0.0371 0.0173  0.0316  409 LEU B C   
2709 O O   . LEU B 114 ? 0.7034 0.5354 0.5838 -0.0454 0.0213  0.0304  409 LEU B O   
2710 C CB  . LEU B 114 ? 0.6407 0.4418 0.5065 -0.0334 0.0005  0.0423  409 LEU B CB  
2711 C CG  . LEU B 114 ? 0.6981 0.4877 0.5453 -0.0369 0.0038  0.0489  409 LEU B CG  
2712 C CD1 . LEU B 114 ? 0.6492 0.4521 0.5004 -0.0281 0.0006  0.0513  409 LEU B CD1 
2713 C CD2 . LEU B 114 ? 0.7151 0.4716 0.5420 -0.0419 -0.0014 0.0556  409 LEU B CD2 
2714 N N   . LEU B 115 ? 0.6371 0.5047 0.5321 -0.0344 0.0230  0.0303  410 LEU B N   
2715 C CA  . LEU B 115 ? 0.5855 0.4673 0.4843 -0.0409 0.0343  0.0266  410 LEU B CA  
2716 C C   . LEU B 115 ? 0.6354 0.5146 0.5219 -0.0443 0.0412  0.0312  410 LEU B C   
2717 O O   . LEU B 115 ? 0.5247 0.4084 0.4098 -0.0384 0.0388  0.0349  410 LEU B O   
2718 C CB  . LEU B 115 ? 0.5406 0.4557 0.4625 -0.0358 0.0367  0.0201  410 LEU B CB  
2719 C CG  . LEU B 115 ? 0.5584 0.4806 0.4949 -0.0325 0.0311  0.0145  410 LEU B CG  
2720 C CD1 . LEU B 115 ? 0.5769 0.5331 0.5352 -0.0278 0.0339  0.0086  410 LEU B CD1 
2721 C CD2 . LEU B 115 ? 0.5222 0.4301 0.4543 -0.0411 0.0337  0.0116  410 LEU B CD2 
2722 N N   . ASP B 116 ? 0.7168 0.4826 0.5427 -0.0411 0.1732  -0.0894 411 ASP B N   
2723 C CA  . ASP B 116 ? 0.7424 0.5109 0.6205 -0.0304 0.1819  -0.0739 411 ASP B CA  
2724 C C   . ASP B 116 ? 0.7211 0.4870 0.6381 -0.0488 0.1517  -0.0532 411 ASP B C   
2725 O O   . ASP B 116 ? 0.7573 0.5192 0.6639 -0.0680 0.1262  -0.0509 411 ASP B O   
2726 C CB  . ASP B 116 ? 0.7546 0.5235 0.6756 -0.0086 0.2080  -0.0702 411 ASP B CB  
2727 C CG  . ASP B 116 ? 0.8788 0.6427 0.8350 -0.0142 0.1971  -0.0604 411 ASP B CG  
2728 O OD1 . ASP B 116 ? 0.8513 0.6120 0.8364 -0.0309 0.1705  -0.0446 411 ASP B OD1 
2729 O OD2 . ASP B 116 ? 0.9010 0.6641 0.8563 -0.0017 0.2154  -0.0685 411 ASP B OD2 
2730 N N   . ARG B 117 ? 0.7073 0.4756 0.6686 -0.0428 0.1544  -0.0382 412 ARG B N   
2731 C CA  . ARG B 117 ? 0.8114 0.5781 0.8035 -0.0606 0.1258  -0.0197 412 ARG B CA  
2732 C C   . ARG B 117 ? 0.8610 0.6226 0.8976 -0.0710 0.1071  -0.0040 412 ARG B C   
2733 O O   . ARG B 117 ? 0.9558 0.7155 1.0171 -0.0873 0.0814  0.0113  412 ARG B O   
2734 C CB  . ARG B 117 ? 0.7751 0.5457 0.8017 -0.0512 0.1340  -0.0081 412 ARG B CB  
2735 C CG  . ARG B 117 ? 0.7473 0.5168 0.8469 -0.0455 0.1338  0.0133  412 ARG B CG  
2736 C CD  . ARG B 117 ? 0.7530 0.5264 0.8803 -0.0379 0.1398  0.0237  412 ARG B CD  
2737 N NE  . ARG B 117 ? 0.8527 0.6244 1.0123 -0.0555 0.1115  0.0426  412 ARG B NE  
2738 C CZ  . ARG B 117 ? 1.0262 0.7987 1.2438 -0.0501 0.1117  0.0612  412 ARG B CZ  
2739 N NH1 . ARG B 117 ? 1.1377 0.9127 1.3870 -0.0275 0.1390  0.0633  412 ARG B NH1 
2740 N NH2 . ARG B 117 ? 1.0509 0.8218 1.2946 -0.0671 0.0849  0.0777  412 ARG B NH2 
2741 N N   . ASN B 118 ? 0.8394 0.5986 0.8855 -0.0619 0.1195  -0.0079 413 ASN B N   
2742 C CA  . ASN B 118 ? 0.9948 0.7490 1.0823 -0.0709 0.1031  0.0061  413 ASN B CA  
2743 C C   . ASN B 118 ? 1.1333 0.8828 1.1842 -0.0850 0.0879  -0.0039 413 ASN B C   
2744 O O   . ASN B 118 ? 1.2071 0.9520 1.2781 -0.1016 0.0629  0.0075  413 ASN B O   
2745 C CB  . ASN B 118 ? 1.0272 0.7819 1.1659 -0.0507 0.1258  0.0137  413 ASN B CB  
2746 C CG  . ASN B 118 ? 1.0826 0.8398 1.2791 -0.0438 0.1285  0.0329  413 ASN B CG  
2747 O OD1 . ASN B 118 ? 1.0949 0.8500 1.3255 -0.0580 0.1048  0.0504  413 ASN B OD1 
2748 N ND2 . ASN B 118 ? 1.1023 0.8640 1.3102 -0.0217 0.1574  0.0297  413 ASN B ND2 
2749 N N   . GLN B 119 ? 1.2003 0.9508 1.1973 -0.0785 0.1031  -0.0251 414 GLN B N   
2750 C CA  . GLN B 119 ? 1.2645 1.0106 1.2256 -0.0885 0.0934  -0.0366 414 GLN B CA  
2751 C C   . GLN B 119 ? 1.3498 1.0921 1.2955 -0.1151 0.0576  -0.0315 414 GLN B C   
2752 O O   . GLN B 119 ? 1.4156 1.1529 1.3890 -0.1262 0.0394  -0.0206 414 GLN B O   
2753 C CB  . GLN B 119 ? 1.2284 0.9770 1.1267 -0.0793 0.1130  -0.0610 414 GLN B CB  
2754 C CG  . GLN B 119 ? 1.2431 0.9947 1.1513 -0.0534 0.1486  -0.0683 414 GLN B CG  
2755 C CD  . GLN B 119 ? 1.2974 1.0511 1.1428 -0.0455 0.1666  -0.0925 414 GLN B CD  
2756 O OE1 . GLN B 119 ? 1.3664 1.1171 1.1689 -0.0574 0.1546  -0.1039 414 GLN B OE1 
2757 N NE2 . GLN B 119 ? 1.2959 1.0546 1.1352 -0.0254 0.1955  -0.1005 414 GLN B NE2 
2758 N N   . GLY B 120 ? 1.3402 1.0849 1.2408 -0.1252 0.0479  -0.0398 415 GLY B N   
2759 C CA  . GLY B 120 ? 1.3662 1.1080 1.2485 -0.1503 0.0144  -0.0359 415 GLY B CA  
2760 C C   . GLY B 120 ? 1.3583 1.0977 1.2990 -0.1614 -0.0072 -0.0120 415 GLY B C   
2761 O O   . GLY B 120 ? 1.3866 1.1287 1.3707 -0.1526 0.0004  0.0010  415 GLY B O   
2762 N N   . LYS B 121 ? 1.2990 1.0332 1.2413 -0.1806 -0.0342 -0.0063 416 LYS B N   
2763 C CA  . LYS B 121 ? 1.2502 0.9818 1.2434 -0.1940 -0.0582 0.0160  416 LYS B CA  
2764 C C   . LYS B 121 ? 1.2739 1.0079 1.2479 -0.2103 -0.0793 0.0193  416 LYS B C   
2765 O O   . LYS B 121 ? 1.3344 1.0670 1.2634 -0.2270 -0.0982 0.0109  416 LYS B O   
2766 C CB  . LYS B 121 ? 1.1692 0.8942 1.1715 -0.2079 -0.0784 0.0205  416 LYS B CB  
2767 N N   . CME B 122 ? 1.2374 0.9750 1.2447 -0.2051 -0.0757 0.0315  417 CME B N   
2768 C CA  . CME B 122 ? 1.2159 0.9563 1.2057 -0.2187 -0.0932 0.0346  417 CME B CA  
2769 C CB  . CME B 122 ? 1.1535 0.8994 1.1016 -0.2067 -0.0726 0.0191  417 CME B CB  
2770 S SG  . CME B 122 ? 1.8108 1.5616 1.7993 -0.1819 -0.0426 0.0254  417 CME B SG  
2771 S SD  . CME B 122 ? 1.2494 1.0052 1.1806 -0.1580 -0.0033 -0.0019 417 CME B SD  
2772 C CE  . CME B 122 ? 0.9517 0.7039 0.8703 -0.1483 0.0122  -0.0146 417 CME B CE  
2773 C CZ  . CME B 122 ? 0.9500 0.7043 0.8891 -0.1230 0.0456  -0.0184 417 CME B CZ  
2774 O OH  . CME B 122 ? 1.0305 0.7852 0.9271 -0.1125 0.0651  -0.0383 417 CME B OH  
2775 C C   . CME B 122 ? 1.1942 0.9350 1.2428 -0.2222 -0.1043 0.0572  417 CME B C   
2776 O O   . CME B 122 ? 1.1408 0.8815 1.2411 -0.2087 -0.0908 0.0686  417 CME B O   
2777 N N   . VAL B 123 ? 1.1583 0.8998 1.1984 -0.2405 -0.1291 0.0638  418 VAL B N   
2778 C CA  . VAL B 123 ? 1.1117 0.8535 1.2043 -0.2469 -0.1436 0.0856  418 VAL B CA  
2779 C C   . VAL B 123 ? 1.1988 0.9459 1.3114 -0.2303 -0.1233 0.0893  418 VAL B C   
2780 O O   . VAL B 123 ? 1.2227 0.9737 1.2970 -0.2193 -0.1045 0.0742  418 VAL B O   
2781 C CB  . VAL B 123 ? 1.0163 0.7572 1.0906 -0.2727 -0.1776 0.0908  418 VAL B CB  
2782 C CG1 . VAL B 123 ? 0.8992 0.6443 0.9906 -0.2750 -0.1832 0.1016  418 VAL B CG1 
2783 C CG2 . VAL B 123 ? 0.9650 0.7001 1.0710 -0.2888 -0.2027 0.1047  418 VAL B CG2 
2784 N N   . GLU B 124 ? 1.2139 0.9609 1.3870 -0.2284 -0.1272 0.1096  419 GLU B N   
2785 C CA  . GLU B 124 ? 1.1928 0.9443 1.3926 -0.2135 -0.1101 0.1160  419 GLU B CA  
2786 C C   . GLU B 124 ? 1.1161 0.8723 1.2703 -0.2142 -0.1071 0.1048  419 GLU B C   
2787 O O   . GLU B 124 ? 1.0691 0.8292 1.2153 -0.1958 -0.0814 0.0968  419 GLU B O   
2788 C CB  . GLU B 124 ? 1.2841 1.0344 1.5472 -0.2202 -0.1262 0.1406  419 GLU B CB  
2789 C CG  . GLU B 124 ? 1.3522 1.1070 1.6402 -0.2100 -0.1159 0.1488  419 GLU B CG  
2790 C CD  . GLU B 124 ? 1.3953 1.1489 1.7430 -0.2189 -0.1347 0.1731  419 GLU B CD  
2791 O OE1 . GLU B 124 ? 1.3611 1.1178 1.7236 -0.2175 -0.1354 0.1809  419 GLU B OE1 
2792 O OE2 . GLU B 124 ? 1.3971 1.1465 1.7767 -0.2274 -0.1489 0.1844  419 GLU B OE2 
2793 N N   . GLY B 125 ? 1.0263 0.7822 1.1513 -0.2355 -0.1336 0.1045  420 GLY B N   
2794 C CA  . GLY B 125 ? 0.9719 0.7321 1.0525 -0.2385 -0.1338 0.0945  420 GLY B CA  
2795 C C   . GLY B 125 ? 0.9349 0.6972 0.9573 -0.2277 -0.1126 0.0707  420 GLY B C   
2796 O O   . GLY B 125 ? 0.7339 0.5006 0.7270 -0.2198 -0.0994 0.0610  420 GLY B O   
2797 N N   . MET B 126 ? 0.8557 0.6147 0.8613 -0.2273 -0.1096 0.0614  421 MET B N   
2798 C CA  . MET B 126 ? 0.8821 0.6425 0.8331 -0.2172 -0.0898 0.0386  421 MET B CA  
2799 C C   . MET B 126 ? 0.8994 0.6626 0.8647 -0.1905 -0.0544 0.0335  421 MET B C   
2800 O O   . MET B 126 ? 0.8888 0.6556 0.8127 -0.1799 -0.0355 0.0173  421 MET B O   
2801 C CB  . MET B 126 ? 0.9534 0.7090 0.8876 -0.2243 -0.0971 0.0316  421 MET B CB  
2802 C CG  . MET B 126 ? 1.0106 0.7635 0.9217 -0.2505 -0.1310 0.0336  421 MET B CG  
2803 S SD  . MET B 126 ? 1.3621 1.1180 1.1878 -0.2588 -0.1340 0.0102  421 MET B SD  
2804 C CE  . MET B 126 ? 1.2848 1.0378 1.0810 -0.2476 -0.1150 -0.0080 421 MET B CE  
2805 N N   . VAL B 127 ? 0.4434 0.5203 0.5583 0.0026  0.1184  0.0119  422 VAL B N   
2806 C CA  . VAL B 127 ? 0.5593 0.6366 0.6525 -0.0047 0.1219  0.0052  422 VAL B CA  
2807 C C   . VAL B 127 ? 0.5875 0.6582 0.6820 0.0017  0.1206  -0.0053 422 VAL B C   
2808 O O   . VAL B 127 ? 0.6042 0.6663 0.6802 -0.0036 0.1181  -0.0078 422 VAL B O   
2809 C CB  . VAL B 127 ? 0.6235 0.7210 0.7148 -0.0081 0.1339  -0.0019 422 VAL B CB  
2810 C CG1 . VAL B 127 ? 0.5697 0.6690 0.6399 -0.0149 0.1386  -0.0103 422 VAL B CG1 
2811 C CG2 . VAL B 127 ? 0.7496 0.8569 0.8430 -0.0134 0.1369  0.0067  422 VAL B CG2 
2812 N N   . GLU B 128 ? 0.4966 0.5719 0.6131 0.0130  0.1229  -0.0116 423 GLU B N   
2813 C CA  . GLU B 128 ? 0.5955 0.6645 0.7161 0.0201  0.1221  -0.0216 423 GLU B CA  
2814 C C   . GLU B 128 ? 0.5297 0.5777 0.6449 0.0207  0.1103  -0.0159 423 GLU B C   
2815 O O   . GLU B 128 ? 0.5522 0.5916 0.6541 0.0185  0.1082  -0.0213 423 GLU B O   
2816 C CB  . GLU B 128 ? 0.6806 0.7584 0.8281 0.0327  0.1265  -0.0277 423 GLU B CB  
2817 N N   . ILE B 129 ? 0.4134 0.4533 0.5389 0.0236  0.1027  -0.0049 424 ILE B N   
2818 C CA  . ILE B 129 ? 0.4523 0.4720 0.5737 0.0242  0.0912  0.0022  424 ILE B CA  
2819 C C   . ILE B 129 ? 0.4655 0.4767 0.5601 0.0121  0.0873  0.0074  424 ILE B C   
2820 O O   . ILE B 129 ? 0.5064 0.5042 0.5909 0.0111  0.0810  0.0066  424 ILE B O   
2821 C CB  . ILE B 129 ? 0.5215 0.5348 0.6577 0.0281  0.0846  0.0142  424 ILE B CB  
2822 C CG1 . ILE B 129 ? 0.5221 0.5439 0.6854 0.0402  0.0879  0.0099  424 ILE B CG1 
2823 C CG2 . ILE B 129 ? 0.5377 0.5295 0.6690 0.0283  0.0727  0.0218  424 ILE B CG2 
2824 C CD1 . ILE B 129 ? 0.5354 0.5561 0.7135 0.0428  0.0840  0.0211  424 ILE B CD1 
2825 N N   . PHE B 130 ? 0.3784 0.3980 0.4620 0.0030  0.0913  0.0129  425 PHE B N   
2826 C CA  . PHE B 130 ? 0.4539 0.4676 0.5121 -0.0088 0.0888  0.0180  425 PHE B CA  
2827 C C   . PHE B 130 ? 0.4119 0.4266 0.4556 -0.0113 0.0920  0.0064  425 PHE B C   
2828 O O   . PHE B 130 ? 0.4798 0.4823 0.5082 -0.0157 0.0856  0.0082  425 PHE B O   
2829 C CB  . PHE B 130 ? 0.5371 0.5630 0.5873 -0.0175 0.0951  0.0233  425 PHE B CB  
2830 C CG  . PHE B 130 ? 0.5449 0.5632 0.5720 -0.0292 0.0913  0.0325  425 PHE B CG  
2831 C CD1 . PHE B 130 ? 0.5763 0.5964 0.5820 -0.0369 0.0940  0.0272  425 PHE B CD1 
2832 C CD2 . PHE B 130 ? 0.5063 0.5158 0.5332 -0.0326 0.0854  0.0467  425 PHE B CD2 
2833 C CE1 . PHE B 130 ? 0.5434 0.5572 0.5283 -0.0475 0.0906  0.0360  425 PHE B CE1 
2834 C CE2 . PHE B 130 ? 0.4949 0.4977 0.5012 -0.0432 0.0824  0.0556  425 PHE B CE2 
2835 C CZ  . PHE B 130 ? 0.4728 0.4780 0.4582 -0.0505 0.0849  0.0504  425 PHE B CZ  
2836 N N   . ASP B 131 ? 0.3048 0.3343 0.3536 -0.0087 0.1020  -0.0054 426 ASP B N   
2837 C CA  . ASP B 131 ? 0.3705 0.4021 0.4071 -0.0107 0.1064  -0.0176 426 ASP B CA  
2838 C C   . ASP B 131 ? 0.4608 0.4784 0.5010 -0.0043 0.0997  -0.0222 426 ASP B C   
2839 O O   . ASP B 131 ? 0.5069 0.5185 0.5301 -0.0092 0.0981  -0.0270 426 ASP B O   
2840 C CB  . ASP B 131 ? 0.3682 0.4177 0.4143 -0.0070 0.1186  -0.0293 426 ASP B CB  
2841 C CG  . ASP B 131 ? 0.5936 0.6574 0.6296 -0.0155 0.1264  -0.0274 426 ASP B CG  
2842 O OD1 . ASP B 131 ? 0.5881 0.6478 0.6056 -0.0255 0.1232  -0.0192 426 ASP B OD1 
2843 O OD2 . ASP B 131 ? 0.6312 0.7105 0.6781 -0.0122 0.1359  -0.0342 426 ASP B OD2 
2844 N N   . MET B 132 ? 0.4823 0.4948 0.5444 0.0064  0.0957  -0.0207 427 MET B N   
2845 C CA  . MET B 132 ? 0.5256 0.5243 0.5930 0.0132  0.0893  -0.0247 427 MET B CA  
2846 C C   . MET B 132 ? 0.4745 0.4556 0.5281 0.0079  0.0776  -0.0146 427 MET B C   
2847 O O   . MET B 132 ? 0.4430 0.4140 0.4881 0.0076  0.0732  -0.0190 427 MET B O   
2848 C CB  . MET B 132 ? 0.5284 0.5267 0.6238 0.0264  0.0883  -0.0253 427 MET B CB  
2849 C CG  . MET B 132 ? 0.5672 0.5808 0.6778 0.0337  0.0994  -0.0376 427 MET B CG  
2850 S SD  . MET B 132 ? 0.5962 0.6081 0.7395 0.0497  0.0976  -0.0384 427 MET B SD  
2851 C CE  . MET B 132 ? 0.4921 0.5081 0.6458 0.0491  0.0945  -0.0238 427 MET B CE  
2852 N N   . LEU B 133 ? 0.3237 0.3012 0.3754 0.0037  0.0728  -0.0010 428 LEU B N   
2853 C CA  . LEU B 133 ? 0.3675 0.3289 0.4063 -0.0019 0.0621  0.0101  428 LEU B CA  
2854 C C   . LEU B 133 ? 0.4095 0.3705 0.4213 -0.0131 0.0626  0.0081  428 LEU B C   
2855 O O   . LEU B 133 ? 0.4130 0.3614 0.4140 -0.0154 0.0552  0.0092  428 LEU B O   
2856 C CB  . LEU B 133 ? 0.3540 0.3130 0.3964 -0.0046 0.0585  0.0249  428 LEU B CB  
2857 C CG  . LEU B 133 ? 0.3237 0.2790 0.3917 0.0063  0.0553  0.0288  428 LEU B CG  
2858 C CD1 . LEU B 133 ? 0.3411 0.2995 0.4136 0.0031  0.0555  0.0408  428 LEU B CD1 
2859 C CD2 . LEU B 133 ? 0.2673 0.2038 0.3399 0.0117  0.0445  0.0324  428 LEU B CD2 
2860 N N   . LEU B 134 ? 0.4221 0.3972 0.4233 -0.0203 0.0713  0.0052  429 LEU B N   
2861 C CA  . LEU B 134 ? 0.4631 0.4402 0.4389 -0.0310 0.0733  0.0021  429 LEU B CA  
2862 C C   . LEU B 134 ? 0.4967 0.4709 0.4675 -0.0289 0.0739  -0.0109 429 LEU B C   
2863 O O   . LEU B 134 ? 0.5334 0.4994 0.4859 -0.0354 0.0688  -0.0101 429 LEU B O   
2864 C CB  . LEU B 134 ? 0.5257 0.5200 0.4945 -0.0371 0.0840  -0.0011 429 LEU B CB  
2865 C CG  . LEU B 134 ? 0.5342 0.5315 0.4980 -0.0440 0.0840  0.0119  429 LEU B CG  
2866 C CD1 . LEU B 134 ? 0.5088 0.5242 0.4690 -0.0483 0.0956  0.0066  429 LEU B CD1 
2867 C CD2 . LEU B 134 ? 0.5710 0.5574 0.5133 -0.0539 0.0765  0.0222  429 LEU B CD2 
2868 N N   . ALA B 135 ? 0.3882 0.3694 0.3753 -0.0200 0.0804  -0.0226 430 ALA B N   
2869 C CA  . ALA B 135 ? 0.4200 0.3989 0.4040 -0.0175 0.0824  -0.0360 430 ALA B CA  
2870 C C   . ALA B 135 ? 0.4373 0.3984 0.4212 -0.0146 0.0712  -0.0328 430 ALA B C   
2871 O O   . ALA B 135 ? 0.5133 0.4685 0.4807 -0.0199 0.0685  -0.0371 430 ALA B O   
2872 C CB  . ALA B 135 ? 0.3505 0.3395 0.3552 -0.0073 0.0914  -0.0477 430 ALA B CB  
2873 N N   . THR B 136 ? 0.4206 0.3734 0.4228 -0.0064 0.0646  -0.0252 431 THR B N   
2874 C CA  . THR B 136 ? 0.4623 0.3977 0.4661 -0.0031 0.0536  -0.0209 431 THR B CA  
2875 C C   . THR B 136 ? 0.4470 0.3733 0.4273 -0.0142 0.0457  -0.0116 431 THR B C   
2876 O O   . THR B 136 ? 0.4139 0.3302 0.3846 -0.0159 0.0399  -0.0140 431 THR B O   
2877 C CB  . THR B 136 ? 0.4313 0.3596 0.4573 0.0061  0.0478  -0.0118 431 THR B CB  
2878 O OG1 . THR B 136 ? 0.4325 0.3721 0.4798 0.0153  0.0558  -0.0187 431 THR B OG1 
2879 C CG2 . THR B 136 ? 0.3501 0.2613 0.3819 0.0120  0.0378  -0.0105 431 THR B CG2 
2880 N N   . SER B 137 ? 0.4300 0.3603 0.4011 -0.0219 0.0458  -0.0009 432 SER B N   
2881 C CA  . SER B 137 ? 0.4381 0.3609 0.3875 -0.0326 0.0389  0.0093  432 SER B CA  
2882 C C   . SER B 137 ? 0.5037 0.4303 0.4307 -0.0411 0.0419  0.0004  432 SER B C   
2883 O O   . SER B 137 ? 0.5581 0.4749 0.4705 -0.0464 0.0344  0.0038  432 SER B O   
2884 C CB  . SER B 137 ? 0.5095 0.4375 0.4541 -0.0391 0.0405  0.0214  432 SER B CB  
2885 O OG  . SER B 137 ? 0.5514 0.4705 0.4778 -0.0483 0.0330  0.0330  432 SER B OG  
2886 N N   . SER B 138 ? 0.4791 0.4202 0.4036 -0.0424 0.0530  -0.0110 433 SER B N   
2887 C CA  . SER B 138 ? 0.5389 0.4845 0.4433 -0.0500 0.0571  -0.0210 433 SER B CA  
2888 C C   . SER B 138 ? 0.5277 0.4641 0.4336 -0.0455 0.0533  -0.0304 433 SER B C   
2889 O O   . SER B 138 ? 0.5989 0.5306 0.4860 -0.0528 0.0498  -0.0323 433 SER B O   
2890 C CB  . SER B 138 ? 0.6194 0.5820 0.5243 -0.0507 0.0703  -0.0321 433 SER B CB  
2891 O OG  . SER B 138 ? 0.7511 0.7224 0.6540 -0.0552 0.0740  -0.0237 433 SER B OG  
2892 N N   . ARG B 139 ? 0.3867 0.4334 0.4170 -0.0511 0.0309  0.1086  434 ARG B N   
2893 C CA  . ARG B 139 ? 0.5262 0.5625 0.5688 -0.0516 0.0473  0.1013  434 ARG B CA  
2894 C C   . ARG B 139 ? 0.5239 0.5560 0.5678 -0.0537 0.0283  0.0666  434 ARG B C   
2895 O O   . ARG B 139 ? 0.6059 0.6061 0.6405 -0.0520 0.0303  0.0507  434 ARG B O   
2896 C CB  . ARG B 139 ? 0.5602 0.6325 0.6344 -0.0548 0.0697  0.1221  434 ARG B CB  
2897 C CG  . ARG B 139 ? 0.6603 0.7248 0.7496 -0.0556 0.0875  0.1164  434 ARG B CG  
2898 C CD  . ARG B 139 ? 0.7357 0.7744 0.8191 -0.0519 0.1136  0.1379  434 ARG B CD  
2899 N NE  . ARG B 139 ? 0.8095 0.8409 0.9079 -0.0527 0.1300  0.1318  434 ARG B NE  
2900 C CZ  . ARG B 139 ? 0.8140 0.8073 0.8983 -0.0501 0.1296  0.1141  434 ARG B CZ  
2901 N NH1 . ARG B 139 ? 0.8681 0.8270 0.9226 -0.0464 0.1141  0.1010  434 ARG B NH1 
2902 N NH2 . ARG B 139 ? 0.7055 0.6951 0.8056 -0.0511 0.1448  0.1097  434 ARG B NH2 
2903 N N   . PHE B 140 ? 0.5056 0.5700 0.5608 -0.0574 0.0095  0.0549  435 PHE B N   
2904 C CA  . PHE B 140 ? 0.4638 0.5269 0.5200 -0.0596 -0.0108 0.0217  435 PHE B CA  
2905 C C   . PHE B 140 ? 0.4361 0.4577 0.4606 -0.0562 -0.0299 0.0009  435 PHE B C   
2906 O O   . PHE B 140 ? 0.4214 0.4215 0.4406 -0.0561 -0.0372 -0.0241 435 PHE B O   
2907 C CB  . PHE B 140 ? 0.4354 0.5415 0.5076 -0.0637 -0.0284 0.0149  435 PHE B CB  
2908 C CG  . PHE B 140 ? 0.4373 0.5836 0.5431 -0.0678 -0.0137 0.0240  435 PHE B CG  
2909 C CD1 . PHE B 140 ? 0.4651 0.6052 0.5853 -0.0684 0.0078  0.0265  435 PHE B CD1 
2910 C CD2 . PHE B 140 ? 0.4450 0.6354 0.5684 -0.0712 -0.0219 0.0294  435 PHE B CD2 
2911 C CE1 . PHE B 140 ? 0.4210 0.5984 0.5725 -0.0724 0.0212  0.0349  435 PHE B CE1 
2912 C CE2 . PHE B 140 ? 0.3650 0.5930 0.5195 -0.0751 -0.0085 0.0378  435 PHE B CE2 
2913 C CZ  . PHE B 140 ? 0.4007 0.6223 0.5693 -0.0757 0.0131  0.0406  435 PHE B CZ  
2914 N N   . ARG B 141 ? 0.5069 0.5176 0.5105 -0.0535 -0.0383 0.0113  436 ARG B N   
2915 C CA  . ARG B 141 ? 0.5721 0.5427 0.5444 -0.0501 -0.0555 -0.0054 436 ARG B CA  
2916 C C   . ARG B 141 ? 0.6051 0.5349 0.5660 -0.0467 -0.0393 -0.0074 436 ARG B C   
2917 O O   . ARG B 141 ? 0.6172 0.5188 0.5649 -0.0457 -0.0505 -0.0326 436 ARG B O   
2918 C CB  . ARG B 141 ? 0.5858 0.5526 0.5394 -0.0476 -0.0623 0.0120  436 ARG B CB  
2919 C CG  . ARG B 141 ? 0.5912 0.5244 0.5138 -0.0449 -0.0858 -0.0068 436 ARG B CG  
2920 C CD  . ARG B 141 ? 0.5767 0.5042 0.4810 -0.0422 -0.0889 0.0139  436 ARG B CD  
2921 N NE  . ARG B 141 ? 0.7908 0.7609 0.7115 -0.0449 -0.0920 0.0300  436 ARG B NE  
2922 C CZ  . ARG B 141 ? 0.7992 0.7841 0.7261 -0.0441 -0.0749 0.0613  436 ARG B CZ  
2923 N NH1 . ARG B 141 ? 0.7902 0.7509 0.7080 -0.0406 -0.0533 0.0806  436 ARG B NH1 
2924 N NH2 . ARG B 141 ? 0.7701 0.7943 0.7122 -0.0468 -0.0798 0.0732  436 ARG B NH2 
2925 N N   . MET B 142 ? 0.4823 0.4096 0.4488 -0.0449 -0.0127 0.0195  437 MET B N   
2926 C CA  . MET B 142 ? 0.6029 0.4923 0.5588 -0.0412 0.0048  0.0213  437 MET B CA  
2927 C C   . MET B 142 ? 0.6757 0.5600 0.6449 -0.0430 0.0081  -0.0002 437 MET B C   
2928 O O   . MET B 142 ? 0.6622 0.5092 0.6156 -0.0403 0.0071  -0.0159 437 MET B O   
2929 C CB  . MET B 142 ? 0.7096 0.6039 0.6739 -0.0395 0.0337  0.0550  437 MET B CB  
2930 C CG  . MET B 142 ? 0.8244 0.7202 0.7745 -0.0372 0.0333  0.0785  437 MET B CG  
2931 S SD  . MET B 142 ? 1.9915 1.8404 1.9010 -0.0322 0.0156  0.0673  437 MET B SD  
2932 C CE  . MET B 142 ? 1.4415 1.2461 1.3408 -0.0279 0.0360  0.0647  437 MET B CE  
2933 N N   . MET B 143 ? 0.5762 0.4983 0.5745 -0.0476 0.0118  -0.0007 438 MET B N   
2934 C CA  . MET B 143 ? 0.5813 0.5029 0.5952 -0.0498 0.0157  -0.0195 438 MET B CA  
2935 C C   . MET B 143 ? 0.5400 0.4544 0.5458 -0.0513 -0.0115 -0.0541 438 MET B C   
2936 O O   . MET B 143 ? 0.5486 0.4585 0.5641 -0.0529 -0.0116 -0.0734 438 MET B O   
2937 C CB  . MET B 143 ? 0.5333 0.4994 0.5818 -0.0544 0.0289  -0.0079 438 MET B CB  
2938 C CG  . MET B 143 ? 0.5183 0.4939 0.5793 -0.0536 0.0575  0.0250  438 MET B CG  
2939 S SD  . MET B 143 ? 0.5458 0.5716 0.6479 -0.0594 0.0710  0.0331  438 MET B SD  
2940 C CE  . MET B 143 ? 0.4330 0.4374 0.5427 -0.0599 0.0768  0.0097  438 MET B CE  
2941 N N   . ASN B 144 ? 0.5644 0.2701 0.4707 0.1151  0.0290  0.0177  439 ASN B N   
2942 C CA  . ASN B 144 ? 0.6229 0.3486 0.5322 0.1095  0.0318  0.0289  439 ASN B CA  
2943 C C   . ASN B 144 ? 0.6042 0.3539 0.5074 0.1016  0.0158  0.0319  439 ASN B C   
2944 O O   . ASN B 144 ? 0.6045 0.3594 0.4829 0.0914  0.0091  0.0453  439 ASN B O   
2945 C CB  . ASN B 144 ? 0.7023 0.4077 0.5762 0.1024  0.0349  0.0443  439 ASN B CB  
2946 C CG  . ASN B 144 ? 0.7967 0.5210 0.6760 0.0979  0.0404  0.0555  439 ASN B CG  
2947 O OD1 . ASN B 144 ? 0.8739 0.6189 0.7908 0.1042  0.0510  0.0508  439 ASN B OD1 
2948 N ND2 . ASN B 144 ? 0.7974 0.5145 0.6389 0.0870  0.0332  0.0705  439 ASN B ND2 
2949 N N   . LEU B 145 ? 0.5688 0.3333 0.4947 0.1062  0.0096  0.0192  440 LEU B N   
2950 C CA  . LEU B 145 ? 0.4912 0.2786 0.4134 0.0995  -0.0058 0.0205  440 LEU B CA  
2951 C C   . LEU B 145 ? 0.5513 0.3639 0.4830 0.0946  -0.0030 0.0300  440 LEU B C   
2952 O O   . LEU B 145 ? 0.5595 0.3841 0.5232 0.1009  0.0115  0.0278  440 LEU B O   
2953 C CB  . LEU B 145 ? 0.4870 0.2903 0.4423 0.1075  -0.0089 0.0041  440 LEU B CB  
2954 C CG  . LEU B 145 ? 0.5360 0.3645 0.4909 0.1014  -0.0246 0.0039  440 LEU B CG  
2955 C CD1 . LEU B 145 ? 0.6074 0.4200 0.5169 0.0916  -0.0422 0.0104  440 LEU B CD1 
2956 C CD2 . LEU B 145 ? 0.4989 0.3456 0.4924 0.1106  -0.0247 -0.0125 440 LEU B CD2 
2957 N N   . GLN B 146 ? 0.5800 0.4004 0.4838 0.0832  -0.0170 0.0406  441 GLN B N   
2958 C CA  . GLN B 146 ? 0.5133 0.3580 0.4232 0.0774  -0.0162 0.0501  441 GLN B CA  
2959 C C   . GLN B 146 ? 0.4824 0.3595 0.4162 0.0770  -0.0248 0.0440  441 GLN B C   
2960 O O   . GLN B 146 ? 0.4579 0.3369 0.3882 0.0767  -0.0370 0.0365  441 GLN B O   
2961 C CB  . GLN B 146 ? 0.6006 0.4344 0.4645 0.0647  -0.0253 0.0667  441 GLN B CB  
2962 C CG  . GLN B 146 ? 0.6884 0.4918 0.5279 0.0644  -0.0168 0.0741  441 GLN B CG  
2963 C CD  . GLN B 146 ? 0.7721 0.5790 0.6363 0.0704  0.0021  0.0761  441 GLN B CD  
2964 O OE1 . GLN B 146 ? 0.8910 0.7154 0.7598 0.0663  0.0049  0.0848  441 GLN B OE1 
2965 N NE2 . GLN B 146 ? 0.6319 0.4220 0.5120 0.0803  0.0151  0.0681  441 GLN B NE2 
2966 N N   . GLY B 147 ? 0.5066 0.4090 0.4642 0.0770  -0.0184 0.0473  442 GLY B N   
2967 C CA  . GLY B 147 ? 0.4443 0.3790 0.4263 0.0765  -0.0252 0.0422  442 GLY B CA  
2968 C C   . GLY B 147 ? 0.4718 0.4106 0.4230 0.0659  -0.0452 0.0472  442 GLY B C   
2969 O O   . GLY B 147 ? 0.5230 0.4766 0.4868 0.0671  -0.0547 0.0383  442 GLY B O   
2970 N N   . GLU B 148 ? 0.4178 0.3434 0.3283 0.0554  -0.0517 0.0614  443 GLU B N   
2971 C CA  . GLU B 148 ? 0.4127 0.3403 0.2905 0.0446  -0.0706 0.0673  443 GLU B CA  
2972 C C   . GLU B 148 ? 0.4720 0.3831 0.3358 0.0461  -0.0810 0.0587  443 GLU B C   
2973 O O   . GLU B 148 ? 0.5482 0.4689 0.4013 0.0408  -0.0961 0.0574  443 GLU B O   
2974 C CB  . GLU B 148 ? 0.4496 0.3634 0.2855 0.0335  -0.0744 0.0841  443 GLU B CB  
2975 C CG  . GLU B 148 ? 0.6339 0.5670 0.4779 0.0294  -0.0682 0.0943  443 GLU B CG  
2976 C CD  . GLU B 148 ? 0.7542 0.6784 0.6135 0.0361  -0.0493 0.0963  443 GLU B CD  
2977 O OE1 . GLU B 148 ? 0.6977 0.5999 0.5600 0.0436  -0.0411 0.0899  443 GLU B OE1 
2978 O OE2 . GLU B 148 ? 0.8731 0.8121 0.7410 0.0338  -0.0427 0.1042  443 GLU B OE2 
2979 N N   . GLU B 149 ? 0.5238 0.4096 0.3867 0.0532  -0.0731 0.0530  444 GLU B N   
2980 C CA  . GLU B 149 ? 0.5527 0.4209 0.4037 0.0558  -0.0816 0.0440  444 GLU B CA  
2981 C C   . GLU B 149 ? 0.5262 0.4127 0.4169 0.0653  -0.0812 0.0277  444 GLU B C   
2982 O O   . GLU B 149 ? 0.4617 0.3492 0.3461 0.0645  -0.0939 0.0212  444 GLU B O   
2983 C CB  . GLU B 149 ? 0.5259 0.3611 0.3640 0.0605  -0.0726 0.0431  444 GLU B CB  
2984 C CG  . GLU B 149 ? 0.6176 0.4314 0.4143 0.0516  -0.0734 0.0584  444 GLU B CG  
2985 C CD  . GLU B 149 ? 0.6175 0.3996 0.4043 0.0569  -0.0634 0.0570  444 GLU B CD  
2986 O OE1 . GLU B 149 ? 0.5917 0.3731 0.4108 0.0676  -0.0487 0.0482  444 GLU B OE1 
2987 O OE2 . GLU B 149 ? 0.5312 0.2890 0.2779 0.0502  -0.0699 0.0649  444 GLU B OE2 
2988 N N   . PHE B 150 ? 0.5078 0.4085 0.4395 0.0743  -0.0662 0.0212  445 PHE B N   
2989 C CA  . PHE B 150 ? 0.4212 0.3418 0.3949 0.0839  -0.0638 0.0059  445 PHE B CA  
2990 C C   . PHE B 150 ? 0.3886 0.3364 0.3672 0.0788  -0.0780 0.0044  445 PHE B C   
2991 O O   . PHE B 150 ? 0.3646 0.3171 0.3530 0.0826  -0.0858 -0.0068 445 PHE B O   
2992 C CB  . PHE B 150 ? 0.3539 0.2878 0.3687 0.0927  -0.0453 0.0018  445 PHE B CB  
2993 C CG  . PHE B 150 ? 0.3747 0.3372 0.4346 0.1004  -0.0431 -0.0114 445 PHE B CG  
2994 C CD1 . PHE B 150 ? 0.4608 0.4192 0.5442 0.1109  -0.0402 -0.0270 445 PHE B CD1 
2995 C CD2 . PHE B 150 ? 0.3998 0.3932 0.4792 0.0976  -0.0435 -0.0082 445 PHE B CD2 
2996 C CE1 . PHE B 150 ? 0.3213 0.3062 0.4466 0.1182  -0.0380 -0.0394 445 PHE B CE1 
2997 C CE2 . PHE B 150 ? 0.4056 0.4254 0.5268 0.1048  -0.0413 -0.0203 445 PHE B CE2 
2998 C CZ  . PHE B 150 ? 0.3203 0.3358 0.4645 0.1151  -0.0386 -0.0360 445 PHE B CZ  
2999 N N   . VAL B 151 ? 0.4045 0.3706 0.3768 0.0704  -0.0814 0.0154  446 VAL B N   
3000 C CA  . VAL B 151 ? 0.3560 0.3487 0.3330 0.0652  -0.0946 0.0146  446 VAL B CA  
3001 C C   . VAL B 151 ? 0.4291 0.4098 0.3703 0.0581  -0.1129 0.0157  446 VAL B C   
3002 O O   . VAL B 151 ? 0.4211 0.4171 0.3718 0.0585  -0.1234 0.0081  446 VAL B O   
3003 C CB  . VAL B 151 ? 0.4314 0.4461 0.4081 0.0573  -0.0945 0.0266  446 VAL B CB  
3004 C CG1 . VAL B 151 ? 0.3602 0.3928 0.3798 0.0654  -0.0775 0.0228  446 VAL B CG1 
3005 C CG2 . VAL B 151 ? 0.3804 0.3759 0.3142 0.0471  -0.0969 0.0429  446 VAL B CG2 
3006 N N   . CYS B 152 ? 0.3024 0.3502 0.4474 -0.0269 -0.0195 -0.0225 447 CYS B N   
3007 C CA  . CYS B 152 ? 0.3411 0.3777 0.4627 -0.0303 -0.0140 -0.0192 447 CYS B CA  
3008 C C   . CYS B 152 ? 0.3257 0.3545 0.4361 -0.0217 -0.0104 -0.0195 447 CYS B C   
3009 O O   . CYS B 152 ? 0.3400 0.3711 0.4411 -0.0196 -0.0064 -0.0208 447 CYS B O   
3010 C CB  . CYS B 152 ? 0.3794 0.3979 0.4834 -0.0397 -0.0127 -0.0123 447 CYS B CB  
3011 S SG  . CYS B 152 ? 0.3986 0.4272 0.5101 -0.0512 -0.0155 -0.0119 447 CYS B SG  
3012 N N   . LEU B 153 ? 0.2620 0.2817 0.3733 -0.0167 -0.0118 -0.0185 448 LEU B N   
3013 C CA  . LEU B 153 ? 0.2931 0.3054 0.3939 -0.0083 -0.0087 -0.0187 448 LEU B CA  
3014 C C   . LEU B 153 ? 0.3440 0.3749 0.4576 0.0002  -0.0087 -0.0257 448 LEU B C   
3015 O O   . LEU B 153 ? 0.3217 0.3510 0.4235 0.0053  -0.0051 -0.0261 448 LEU B O   
3016 C CB  . LEU B 153 ? 0.3318 0.3322 0.4334 -0.0050 -0.0104 -0.0172 448 LEU B CB  
3017 C CG  . LEU B 153 ? 0.4331 0.4108 0.5173 -0.0119 -0.0092 -0.0098 448 LEU B CG  
3018 C CD1 . LEU B 153 ? 0.4126 0.3814 0.5025 -0.0084 -0.0117 -0.0097 448 LEU B CD1 
3019 C CD2 . LEU B 153 ? 0.4302 0.3923 0.4880 -0.0126 -0.0031 -0.0049 448 LEU B CD2 
3020 N N   . LYS B 154 ? 0.2430 0.2913 0.3805 0.0017  -0.0127 -0.0310 449 LYS B N   
3021 C CA  . LYS B 154 ? 0.2445 0.3114 0.3958 0.0089  -0.0127 -0.0380 449 LYS B CA  
3022 C C   . LYS B 154 ? 0.2655 0.3402 0.4104 0.0068  -0.0097 -0.0389 449 LYS B C   
3023 O O   . LYS B 154 ? 0.2638 0.3452 0.4065 0.0131  -0.0074 -0.0422 449 LYS B O   
3024 C CB  . LYS B 154 ? 0.2597 0.3426 0.4375 0.0101  -0.0169 -0.0432 449 LYS B CB  
3025 C CG  . LYS B 154 ? 0.2465 0.3473 0.4396 0.0181  -0.0166 -0.0507 449 LYS B CG  
3026 C CD  . LYS B 154 ? 0.3055 0.4179 0.5227 0.0201  -0.0198 -0.0555 449 LYS B CD  
3027 C CE  . LYS B 154 ? 0.3224 0.4420 0.5512 0.0131  -0.0225 -0.0546 449 LYS B CE  
3028 N NZ  . LYS B 154 ? 0.3402 0.4756 0.5937 0.0163  -0.0246 -0.0605 449 LYS B NZ  
3029 N N   . SER B 155 ? 0.2904 0.3640 0.4320 -0.0022 -0.0096 -0.0363 450 SER B N   
3030 C CA  . SER B 155 ? 0.3332 0.4122 0.4672 -0.0054 -0.0063 -0.0373 450 SER B CA  
3031 C C   . SER B 155 ? 0.3296 0.3925 0.4365 -0.0042 -0.0008 -0.0333 450 SER B C   
3032 O O   . SER B 155 ? 0.2876 0.3552 0.3879 -0.0015 0.0026  -0.0356 450 SER B O   
3033 C CB  . SER B 155 ? 0.3668 0.4482 0.5035 -0.0159 -0.0073 -0.0357 450 SER B CB  
3034 O OG  . SER B 155 ? 0.4958 0.5949 0.6582 -0.0161 -0.0120 -0.0399 450 SER B OG  
3035 N N   . ILE B 156 ? 0.2329 0.2761 0.3236 -0.0063 0.0005  -0.0273 451 ILE B N   
3036 C CA  . ILE B 156 ? 0.3000 0.3259 0.3643 -0.0042 0.0060  -0.0230 451 ILE B CA  
3037 C C   . ILE B 156 ? 0.3370 0.3677 0.4014 0.0075  0.0069  -0.0262 451 ILE B C   
3038 O O   . ILE B 156 ? 0.3006 0.3278 0.3492 0.0109  0.0113  -0.0258 451 ILE B O   
3039 C CB  . ILE B 156 ? 0.3087 0.3129 0.3580 -0.0080 0.0070  -0.0161 451 ILE B CB  
3040 C CG1 . ILE B 156 ? 0.2702 0.2672 0.3116 -0.0203 0.0082  -0.0122 451 ILE B CG1 
3041 C CG2 . ILE B 156 ? 0.2906 0.2780 0.3160 -0.0025 0.0122  -0.0122 451 ILE B CG2 
3042 C CD1 . ILE B 156 ? 0.2917 0.2681 0.3199 -0.0256 0.0089  -0.0055 451 ILE B CD1 
3043 N N   . ILE B 157 ? 0.3033 0.3424 0.3852 0.0136  0.0028  -0.0297 452 ILE B N   
3044 C CA  . ILE B 157 ? 0.2491 0.2949 0.3331 0.0246  0.0032  -0.0336 452 ILE B CA  
3045 C C   . ILE B 157 ? 0.3336 0.3963 0.4232 0.0275  0.0044  -0.0388 452 ILE B C   
3046 O O   . ILE B 157 ? 0.2897 0.3523 0.3680 0.0344  0.0073  -0.0396 452 ILE B O   
3047 C CB  . ILE B 157 ? 0.2710 0.3259 0.3762 0.0295  -0.0012 -0.0379 452 ILE B CB  
3048 C CG1 . ILE B 157 ? 0.2786 0.3152 0.3761 0.0285  -0.0018 -0.0331 452 ILE B CG1 
3049 C CG2 . ILE B 157 ? 0.2550 0.3231 0.3667 0.0399  -0.0009 -0.0439 452 ILE B CG2 
3050 C CD1 . ILE B 157 ? 0.3049 0.3482 0.4218 0.0327  -0.0055 -0.0375 452 ILE B CD1 
3051 N N   . LEU B 158 ? 0.2519 0.3292 0.3591 0.0224  0.0021  -0.0424 453 LEU B N   
3052 C CA  . LEU B 158 ? 0.2851 0.3794 0.4007 0.0240  0.0028  -0.0479 453 LEU B CA  
3053 C C   . LEU B 158 ? 0.3625 0.4484 0.4556 0.0220  0.0080  -0.0454 453 LEU B C   
3054 O O   . LEU B 158 ? 0.3086 0.4006 0.3972 0.0279  0.0102  -0.0483 453 LEU B O   
3055 C CB  . LEU B 158 ? 0.2826 0.3914 0.4197 0.0174  -0.0003 -0.0512 453 LEU B CB  
3056 C CG  . LEU B 158 ? 0.3264 0.4519 0.4722 0.0169  0.0009  -0.0565 453 LEU B CG  
3057 C CD1 . LEU B 158 ? 0.3093 0.4496 0.4672 0.0262  0.0003  -0.0626 453 LEU B CD1 
3058 C CD2 . LEU B 158 ? 0.2582 0.3952 0.4225 0.0093  -0.0018 -0.0584 453 LEU B CD2 
3059 N N   . LEU B 159 ? 0.3468 0.4182 0.4252 0.0134  0.0103  -0.0400 454 LEU B N   
3060 C CA  . LEU B 159 ? 0.3102 0.3720 0.3663 0.0100  0.0160  -0.0377 454 LEU B CA  
3061 C C   . LEU B 159 ? 0.3576 0.4013 0.3878 0.0160  0.0205  -0.0330 454 LEU B C   
3062 O O   . LEU B 159 ? 0.4131 0.4530 0.4270 0.0186  0.0252  -0.0330 454 LEU B O   
3063 C CB  . LEU B 159 ? 0.3080 0.3622 0.3585 -0.0022 0.0172  -0.0345 454 LEU B CB  
3064 C CG  . LEU B 159 ? 0.3930 0.4656 0.4682 -0.0083 0.0130  -0.0389 454 LEU B CG  
3065 C CD1 . LEU B 159 ? 0.4674 0.5322 0.5385 -0.0197 0.0130  -0.0352 454 LEU B CD1 
3066 C CD2 . LEU B 159 ? 0.3269 0.4139 0.4079 -0.0078 0.0148  -0.0446 454 LEU B CD2 
3067 N N   . ASN B 160 ? 0.3552 0.3875 0.3815 0.0186  0.0193  -0.0291 455 ASN B N   
3068 C CA  . ASN B 160 ? 0.4402 0.4536 0.4412 0.0237  0.0238  -0.0238 455 ASN B CA  
3069 C C   . ASN B 160 ? 0.4884 0.5078 0.4886 0.0365  0.0237  -0.0266 455 ASN B C   
3070 O O   . ASN B 160 ? 0.4944 0.5033 0.4728 0.0415  0.0285  -0.0238 455 ASN B O   
3071 C CB  . ASN B 160 ? 0.4068 0.4034 0.4017 0.0207  0.0232  -0.0181 455 ASN B CB  
3072 C CG  . ASN B 160 ? 0.4315 0.4077 0.4002 0.0258  0.0283  -0.0123 455 ASN B CG  
3073 O OD1 . ASN B 160 ? 0.5030 0.4742 0.4724 0.0319  0.0267  -0.0110 455 ASN B OD1 
3074 N ND2 . ASN B 160 ? 0.3898 0.3539 0.3349 0.0235  0.0348  -0.0090 455 ASN B ND2 
3075 N N   . SER B 161 ? 0.4408 0.4773 0.4644 0.0419  0.0186  -0.0321 456 SER B N   
3076 C CA  . SER B 161 ? 0.5087 0.5502 0.5323 0.0537  0.0180  -0.0345 456 SER B CA  
3077 C C   . SER B 161 ? 0.4592 0.5066 0.4722 0.0607  0.0211  -0.0367 456 SER B C   
3078 O O   . SER B 161 ? 0.5717 0.6132 0.5708 0.0697  0.0230  -0.0352 456 SER B O   
3079 C CB  . SER B 161 ? 0.5134 0.5724 0.5647 0.0572  0.0124  -0.0407 456 SER B CB  
3080 O OG  . SER B 161 ? 0.5332 0.5820 0.5885 0.0537  0.0102  -0.0377 456 SER B OG  
3081 N N   . GLY B 162 ? 0.3769 0.4356 0.3960 0.0569  0.0216  -0.0404 457 GLY B N   
3082 C CA  . GLY B 162 ? 0.4497 0.5146 0.4598 0.0631  0.0244  -0.0430 457 GLY B CA  
3083 C C   . GLY B 162 ? 0.5535 0.6041 0.5394 0.0584  0.0304  -0.0391 457 GLY B C   
3084 O O   . GLY B 162 ? 0.5861 0.6408 0.5635 0.0626  0.0331  -0.0414 457 GLY B O   
3085 N N   . VAL B 163 ? 0.5197 0.5531 0.4936 0.0495  0.0330  -0.0335 458 VAL B N   
3086 C CA  . VAL B 163 ? 0.6733 0.6933 0.6251 0.0432  0.0394  -0.0306 458 VAL B CA  
3087 C C   . VAL B 163 ? 0.7863 0.7894 0.7079 0.0506  0.0456  -0.0262 458 VAL B C   
3088 O O   . VAL B 163 ? 0.8523 0.8514 0.7588 0.0501  0.0505  -0.0267 458 VAL B O   
3089 C CB  . VAL B 163 ? 0.6359 0.6429 0.5830 0.0308  0.0408  -0.0262 458 VAL B CB  
3090 C CG1 . VAL B 163 ? 0.5576 0.5457 0.4913 0.0318  0.0419  -0.0194 458 VAL B CG1 
3091 C CG2 . VAL B 163 ? 0.6594 0.6558 0.5866 0.0234  0.0476  -0.0249 458 VAL B CG2 
3092 N N   . TYR B 164 ? 0.8396 0.8323 0.7521 0.0576  0.0456  -0.0220 459 TYR B N   
3093 C CA  . TYR B 164 ? 0.9266 0.9017 0.8095 0.0650  0.0517  -0.0170 459 TYR B CA  
3094 C C   . TYR B 164 ? 0.9967 0.9838 0.8782 0.0766  0.0514  -0.0211 459 TYR B C   
3095 O O   . TYR B 164 ? 1.1175 1.0922 0.9746 0.0839  0.0564  -0.0176 459 TYR B O   
3096 C CB  . TYR B 164 ? 0.9324 0.8936 0.8073 0.0694  0.0516  -0.0113 459 TYR B CB  
3097 C CG  . TYR B 164 ? 0.9649 0.9147 0.8421 0.0582  0.0514  -0.0074 459 TYR B CG  
3098 C CD1 . TYR B 164 ? 1.0167 0.9764 0.9180 0.0564  0.0447  -0.0095 459 TYR B CD1 
3099 C CD2 . TYR B 164 ? 0.9293 0.8585 0.7842 0.0493  0.0580  -0.0018 459 TYR B CD2 
3100 C CE1 . TYR B 164 ? 1.0285 0.9779 0.9317 0.0463  0.0442  -0.0058 459 TYR B CE1 
3101 C CE2 . TYR B 164 ? 0.9372 0.8567 0.7942 0.0387  0.0577  0.0017  459 TYR B CE2 
3102 C CZ  . TYR B 164 ? 0.9707 0.9004 0.8519 0.0375  0.0505  -0.0002 459 TYR B CZ  
3103 O OH  . TYR B 164 ? 0.9105 0.8306 0.7933 0.0271  0.0500  0.0034  459 TYR B OH  
3104 N N   . THR B 165 ? 1.6667 1.4971 1.1826 0.3176  0.1431  0.2060  460 THR B N   
3105 C CA  . THR B 165 ? 1.6315 1.4320 1.1161 0.3263  0.1328  0.2148  460 THR B CA  
3106 C C   . THR B 165 ? 1.6981 1.4547 1.1609 0.3243  0.1397  0.2068  460 THR B C   
3107 O O   . THR B 165 ? 1.7444 1.4867 1.1921 0.3240  0.1231  0.2134  460 THR B O   
3108 C CB  . THR B 165 ? 1.5858 1.4152 1.0779 0.3237  0.1020  0.2300  460 THR B CB  
3109 O OG1 . THR B 165 ? 1.4422 1.2894 0.9540 0.3094  0.0878  0.2281  460 THR B OG1 
3110 C CG2 . THR B 165 ? 1.3676 1.2390 0.8794 0.3266  0.0956  0.2383  460 THR B CG2 
3111 N N   . PHE B 166 ? 1.7373 1.4727 1.1986 0.3231  0.1643  0.1925  461 PHE B N   
3112 C CA  . PHE B 166 ? 1.7637 1.4538 1.2020 0.3229  0.1746  0.1839  461 PHE B CA  
3113 C C   . PHE B 166 ? 1.8630 1.5098 1.2637 0.3374  0.1828  0.1869  461 PHE B C   
3114 O O   . PHE B 166 ? 1.9294 1.5487 1.3088 0.3385  0.1741  0.1897  461 PHE B O   
3115 C CB  . PHE B 166 ? 1.7016 1.3837 1.1514 0.3160  0.1975  0.1675  461 PHE B CB  
3116 C CG  . PHE B 166 ? 1.6131 1.3206 1.0903 0.3002  0.1879  0.1630  461 PHE B CG  
3117 C CD1 . PHE B 166 ? 1.5900 1.2934 1.0638 0.2932  0.1682  0.1671  461 PHE B CD1 
3118 C CD2 . PHE B 166 ? 1.5513 1.2862 1.0575 0.2925  0.1988  0.1544  461 PHE B CD2 
3119 C CE1 . PHE B 166 ? 1.5107 1.2372 1.0095 0.2787  0.1595  0.1628  461 PHE B CE1 
3120 C CE2 . PHE B 166 ? 1.4707 1.2286 1.0018 0.2781  0.1902  0.1501  461 PHE B CE2 
3121 C CZ  . PHE B 166 ? 1.4513 1.2050 0.9788 0.2712  0.1706  0.1543  461 PHE B CZ  
3122 N N   . LEU B 167 ? 1.9228 1.5615 1.3139 0.3486  0.1993  0.1863  462 LEU B N   
3123 C CA  . LEU B 167 ? 1.9434 1.6069 1.3551 0.3491  0.2140  0.1815  462 LEU B CA  
3124 C C   . LEU B 167 ? 2.0286 1.6561 1.4134 0.3630  0.2363  0.1779  462 LEU B C   
3125 O O   . LEU B 167 ? 1.9878 1.6257 1.3704 0.3724  0.2388  0.1841  462 LEU B O   
3126 C CB  . LEU B 167 ? 1.9286 1.6373 1.3596 0.3499  0.1962  0.1940  462 LEU B CB  
3127 N N   . SER B 168 ? 2.0019 1.5865 1.3658 0.3644  0.2519  0.1682  463 SER B N   
3128 C CA  . SER B 168 ? 1.9772 1.5230 1.3124 0.3776  0.2722  0.1650  463 SER B CA  
3129 C C   . SER B 168 ? 1.9434 1.4431 1.2577 0.3772  0.2882  0.1535  463 SER B C   
3130 O O   . SER B 168 ? 1.9268 1.4203 1.2437 0.3677  0.2802  0.1502  463 SER B O   
3131 C CB  . SER B 168 ? 1.9604 1.4967 1.2723 0.3894  0.2586  0.1789  463 SER B CB  
3132 N N   . SER B 169 ? 1.9608 1.4286 1.2547 0.3876  0.3110  0.1476  464 SER B N   
3133 C CA  . SER B 169 ? 1.9816 1.4001 1.2487 0.3907  0.3263  0.1388  464 SER B CA  
3134 C C   . SER B 169 ? 1.9726 1.3827 1.2509 0.3793  0.3379  0.1246  464 SER B C   
3135 O O   . SER B 169 ? 1.9593 1.3947 1.2640 0.3717  0.3464  0.1172  464 SER B O   
3136 C CB  . SER B 169 ? 2.0168 1.4109 1.2581 0.3946  0.3089  0.1479  464 SER B CB  
3137 O OG  . SER B 169 ? 2.0632 1.4558 1.2882 0.4070  0.3020  0.1597  464 SER B OG  
3138 N N   . THR B 170 ? 1.9597 1.3333 1.2167 0.3785  0.3381  0.1213  465 THR B N   
3139 C CA  . THR B 170 ? 1.9255 1.2805 1.1850 0.3694  0.3496  0.1079  465 THR B CA  
3140 C C   . THR B 170 ? 1.8840 1.2658 1.1751 0.3585  0.3606  0.0972  465 THR B C   
3141 O O   . THR B 170 ? 1.8723 1.2973 1.1919 0.3510  0.3477  0.1013  465 THR B O   
3142 C CB  . THR B 170 ? 1.9213 1.2682 1.1752 0.3619  0.3296  0.1115  465 THR B CB  
3143 O OG1 . THR B 170 ? 1.9239 1.2659 1.1896 0.3503  0.3376  0.0991  465 THR B OG1 
3144 C CG2 . THR B 170 ? 1.8703 1.2585 1.1431 0.3566  0.3011  0.1243  465 THR B CG2 
3145 N N   . LEU B 171 ? 1.8727 1.2275 1.1579 0.3577  0.3844  0.0834  466 LEU B N   
3146 C CA  . LEU B 171 ? 1.8375 1.2108 1.1494 0.3473  0.3972  0.0714  466 LEU B CA  
3147 C C   . LEU B 171 ? 1.7723 1.1761 1.1097 0.3324  0.3781  0.0723  466 LEU B C   
3148 O O   . LEU B 171 ? 1.7182 1.1586 1.0860 0.3241  0.3779  0.0693  466 LEU B O   
3149 C CB  . LEU B 171 ? 1.8511 1.1834 1.1475 0.3480  0.4225  0.0569  466 LEU B CB  
3150 C CG  . LEU B 171 ? 1.8126 1.1534 1.1312 0.3353  0.4337  0.0434  466 LEU B CG  
3151 C CD1 . LEU B 171 ? 1.7887 1.1680 1.1374 0.3319  0.4417  0.0401  466 LEU B CD1 
3152 C CD2 . LEU B 171 ? 1.7961 1.0912 1.0939 0.3379  0.4575  0.0306  466 LEU B CD2 
3153 N N   . LYS B 172 ? 1.0126 0.7786 0.9237 -0.1512 0.0176  0.1461  467 LYS B N   
3154 C CA  . LYS B 172 ? 0.9627 0.7824 0.8799 -0.1265 0.0262  0.1483  467 LYS B CA  
3155 C C   . LYS B 172 ? 0.9627 0.7573 0.8946 -0.1042 0.0294  0.1311  467 LYS B C   
3156 O O   . LYS B 172 ? 0.8993 0.7350 0.8362 -0.0978 0.0368  0.1228  467 LYS B O   
3157 C CB  . LYS B 172 ? 0.9336 0.7713 0.8488 -0.1036 0.0264  0.1684  467 LYS B CB  
3158 N N   . SER B 173 ? 0.9802 0.7076 0.9192 -0.0926 0.0239  0.1257  468 SER B N   
3159 C CA  . SER B 173 ? 0.9935 0.6909 0.9466 -0.0722 0.0261  0.1094  468 SER B CA  
3160 C C   . SER B 173 ? 0.9479 0.6487 0.9024 -0.0923 0.0286  0.0901  468 SER B C   
3161 O O   . SER B 173 ? 0.9587 0.6758 0.9228 -0.0783 0.0346  0.0782  468 SER B O   
3162 C CB  . SER B 173 ? 1.1216 0.7425 1.0805 -0.0610 0.0188  0.1071  468 SER B CB  
3163 O OG  . SER B 173 ? 1.2327 0.8256 1.2055 -0.0399 0.0210  0.0921  468 SER B OG  
3164 N N   . LEU B 174 ? 0.8589 0.5443 0.8037 -0.1253 0.0239  0.0873  469 LEU B N   
3165 C CA  . LEU B 174 ? 0.9450 0.6344 0.8891 -0.1478 0.0258  0.0700  469 LEU B CA  
3166 C C   . LEU B 174 ? 0.9878 0.7536 0.9294 -0.1525 0.0342  0.0703  469 LEU B C   
3167 O O   . LEU B 174 ? 1.0288 0.8077 0.9768 -0.1514 0.0392  0.0550  469 LEU B O   
3168 C CB  . LEU B 174 ? 1.0157 0.6732 0.9483 -0.1829 0.0184  0.0688  469 LEU B CB  
3169 C CG  . LEU B 174 ? 1.0461 0.6225 0.9815 -0.1828 0.0103  0.0630  469 LEU B CG  
3170 C CD1 . LEU B 174 ? 1.1152 0.6672 1.0376 -0.2171 0.0029  0.0658  469 LEU B CD1 
3171 C CD2 . LEU B 174 ? 1.0844 0.6247 1.0309 -0.1744 0.0117  0.0419  469 LEU B CD2 
3172 N N   . GLU B 175 ? 0.9691 0.7852 0.9014 -0.1577 0.0358  0.0877  470 GLU B N   
3173 C CA  . GLU B 175 ? 0.9260 0.8177 0.8555 -0.1608 0.0439  0.0902  470 GLU B CA  
3174 C C   . GLU B 175 ? 0.8569 0.7714 0.7994 -0.1289 0.0515  0.0839  470 GLU B C   
3175 O O   . GLU B 175 ? 0.8348 0.7811 0.7811 -0.1319 0.0576  0.0720  470 GLU B O   
3176 C CB  . GLU B 175 ? 0.9764 0.9150 0.8949 -0.1653 0.0443  0.1120  470 GLU B CB  
3177 C CG  . GLU B 175 ? 1.1375 1.0708 1.0419 -0.2004 0.0382  0.1187  470 GLU B CG  
3178 C CD  . GLU B 175 ? 1.2203 1.2067 1.1140 -0.2045 0.0394  0.1401  470 GLU B CD  
3179 O OE1 . GLU B 175 ? 1.2143 1.2411 1.1113 -0.1798 0.0451  0.1495  470 GLU B OE1 
3180 O OE2 . GLU B 175 ? 1.2700 1.2578 1.1518 -0.2324 0.0347  0.1477  470 GLU B OE2 
3181 N N   . GLU B 176 ? 0.7875 0.6853 0.7367 -0.0985 0.0509  0.0920  471 GLU B N   
3182 C CA  . GLU B 176 ? 0.7214 0.6364 0.6832 -0.0662 0.0574  0.0870  471 GLU B CA  
3183 C C   . GLU B 176 ? 0.7456 0.6335 0.7181 -0.0649 0.0592  0.0646  471 GLU B C   
3184 O O   . GLU B 176 ? 0.6210 0.5485 0.5996 -0.0565 0.0666  0.0562  471 GLU B O   
3185 C CB  . GLU B 176 ? 0.6417 0.5254 0.6091 -0.0357 0.0544  0.0974  471 GLU B CB  
3186 C CG  . GLU B 176 ? 0.7589 0.6722 0.7166 -0.0322 0.0534  0.1200  471 GLU B CG  
3187 C CD  . GLU B 176 ? 0.7984 0.7834 0.7561 -0.0152 0.0619  0.1285  471 GLU B CD  
3188 O OE1 . GLU B 176 ? 0.7116 0.6980 0.6787 0.0165  0.0649  0.1291  471 GLU B OE1 
3189 O OE2 . GLU B 176 ? 0.8101 0.8499 0.7582 -0.0335 0.0653  0.1349  471 GLU B OE2 
3190 N N   . LYS B 177 ? 0.7710 0.5916 0.7456 -0.0733 0.0524  0.0550  472 LYS B N   
3191 C CA  . LYS B 177 ? 0.7497 0.5392 0.7336 -0.0734 0.0533  0.0337  472 LYS B CA  
3192 C C   . LYS B 177 ? 0.7307 0.5577 0.7096 -0.0997 0.0574  0.0230  472 LYS B C   
3193 O O   . LYS B 177 ? 0.6625 0.5033 0.6498 -0.0929 0.0629  0.0086  472 LYS B O   
3194 C CB  . LYS B 177 ? 0.8762 0.5862 0.8612 -0.0802 0.0448  0.0266  472 LYS B CB  
3195 C CG  . LYS B 177 ? 0.9765 0.6424 0.9691 -0.0519 0.0410  0.0335  472 LYS B CG  
3196 C CD  . LYS B 177 ? 1.0834 0.6757 1.0836 -0.0495 0.0359  0.0188  472 LYS B CD  
3197 C CE  . LYS B 177 ? 1.1596 0.6952 1.1544 -0.0559 0.0269  0.0274  472 LYS B CE  
3198 N NZ  . LYS B 177 ? 1.2134 0.7486 1.1939 -0.0921 0.0224  0.0306  472 LYS B NZ  
3199 N N   . ASP B 178 ? 0.5929 0.4369 0.5580 -0.1298 0.0547  0.0304  473 ASP B N   
3200 C CA  . ASP B 178 ? 0.5704 0.4499 0.5292 -0.1574 0.0579  0.0217  473 ASP B CA  
3201 C C   . ASP B 178 ? 0.6151 0.5695 0.5765 -0.1472 0.0676  0.0235  473 ASP B C   
3202 O O   . ASP B 178 ? 0.6332 0.6091 0.5981 -0.1536 0.0726  0.0094  473 ASP B O   
3203 C CB  . ASP B 178 ? 0.6807 0.5645 0.6238 -0.1907 0.0526  0.0315  473 ASP B CB  
3204 C CG  . ASP B 178 ? 0.9203 0.7877 0.8578 -0.2226 0.0503  0.0167  473 ASP B CG  
3205 O OD1 . ASP B 178 ? 1.0877 0.9041 1.0190 -0.2410 0.0424  0.0156  473 ASP B OD1 
3206 O OD2 . ASP B 178 ? 0.9285 0.8331 0.8677 -0.2291 0.0564  0.0061  473 ASP B OD2 
3207 N N   . HIS B 179 ? 0.5918 0.5853 0.5513 -0.1310 0.0703  0.0408  474 HIS B N   
3208 C CA  . HIS B 179 ? 0.5261 0.5909 0.4878 -0.1188 0.0794  0.0443  474 HIS B CA  
3209 C C   . HIS B 179 ? 0.5169 0.5796 0.4940 -0.0920 0.0850  0.0302  474 HIS B C   
3210 O O   . HIS B 179 ? 0.4860 0.5931 0.4663 -0.0930 0.0921  0.0217  474 HIS B O   
3211 C CB  . HIS B 179 ? 0.4705 0.5696 0.4275 -0.1035 0.0805  0.0660  474 HIS B CB  
3212 C CG  . HIS B 179 ? 0.4975 0.6691 0.4563 -0.0894 0.0899  0.0706  474 HIS B CG  
3213 N ND1 . HIS B 179 ? 0.4672 0.6986 0.4182 -0.1103 0.0949  0.0718  474 HIS B ND1 
3214 C CD2 . HIS B 179 ? 0.4946 0.6885 0.4621 -0.0564 0.0951  0.0743  474 HIS B CD2 
3215 C CE1 . HIS B 179 ? 0.4507 0.7382 0.4055 -0.0907 0.1029  0.0761  474 HIS B CE1 
3216 N NE2 . HIS B 179 ? 0.4569 0.7231 0.4215 -0.0579 0.1032  0.0776  474 HIS B NE2 
3217 N N   . ILE B 180 ? 0.5519 0.5624 0.5386 -0.0682 0.0816  0.0277  475 ILE B N   
3218 C CA  . ILE B 180 ? 0.4606 0.4624 0.4624 -0.0418 0.0859  0.0145  475 ILE B CA  
3219 C C   . ILE B 180 ? 0.4806 0.4705 0.4864 -0.0574 0.0875  -0.0066 475 ILE B C   
3220 O O   . ILE B 180 ? 0.4151 0.4360 0.4291 -0.0466 0.0945  -0.0168 475 ILE B O   
3221 C CB  . ILE B 180 ? 0.5196 0.4585 0.5300 -0.0178 0.0806  0.0149  475 ILE B CB  
3222 C CG1 . ILE B 180 ? 0.5447 0.5017 0.5539 0.0054  0.0807  0.0344  475 ILE B CG1 
3223 C CG2 . ILE B 180 ? 0.5442 0.4630 0.5700 0.0036  0.0838  -0.0021 475 ILE B CG2 
3224 C CD1 . ILE B 180 ? 0.5146 0.4106 0.5312 0.0283  0.0750  0.0367  475 ILE B CD1 
3225 N N   . HIS B 181 ? 0.4842 0.4287 0.4839 -0.0830 0.0810  -0.0132 476 HIS B N   
3226 C CA  . HIS B 181 ? 0.5239 0.4512 0.5264 -0.0988 0.0816  -0.0334 476 HIS B CA  
3227 C C   . HIS B 181 ? 0.5475 0.5390 0.5441 -0.1185 0.0881  -0.0366 476 HIS B C   
3228 O O   . HIS B 181 ? 0.5545 0.5579 0.5578 -0.1181 0.0929  -0.0522 476 HIS B O   
3229 C CB  . HIS B 181 ? 0.7026 0.5646 0.6990 -0.1215 0.0728  -0.0391 476 HIS B CB  
3230 C CG  . HIS B 181 ? 0.8469 0.6405 0.8517 -0.1015 0.0672  -0.0414 476 HIS B CG  
3231 N ND1 . HIS B 181 ? 0.7490 0.5170 0.7681 -0.0780 0.0694  -0.0549 476 HIS B ND1 
3232 C CD2 . HIS B 181 ? 0.9004 0.6462 0.9014 -0.1016 0.0595  -0.0320 476 HIS B CD2 
3233 C CE1 . HIS B 181 ? 0.7977 0.5054 0.8213 -0.0644 0.0634  -0.0533 476 HIS B CE1 
3234 N NE2 . HIS B 181 ? 0.9219 0.6147 0.9347 -0.0783 0.0573  -0.0397 476 HIS B NE2 
3235 N N   . ARG B 182 ? 0.4783 0.5123 0.4627 -0.1352 0.0883  -0.0216 477 ARG B N   
3236 C CA  . ARG B 182 ? 0.5282 0.6270 0.5064 -0.1535 0.0945  -0.0226 477 ARG B CA  
3237 C C   . ARG B 182 ? 0.5125 0.6666 0.5002 -0.1286 0.1041  -0.0238 477 ARG B C   
3238 O O   . ARG B 182 ? 0.4239 0.6093 0.4146 -0.1350 0.1099  -0.0359 477 ARG B O   
3239 C CB  . ARG B 182 ? 0.5351 0.6655 0.4977 -0.1770 0.0921  -0.0054 477 ARG B CB  
3240 C CG  . ARG B 182 ? 0.6382 0.7304 0.5899 -0.2118 0.0845  -0.0092 477 ARG B CG  
3241 C CD  . ARG B 182 ? 0.7813 0.8994 0.7181 -0.2330 0.0812  0.0093  477 ARG B CD  
3242 N NE  . ARG B 182 ? 0.9108 0.9887 0.8456 -0.2236 0.0745  0.0225  477 ARG B NE  
3243 C CZ  . ARG B 182 ? 1.0819 1.1759 1.0052 -0.2356 0.0711  0.0405  477 ARG B CZ  
3244 N NH1 . ARG B 182 ? 1.1378 1.2882 1.0506 -0.2575 0.0739  0.0480  477 ARG B NH1 
3245 N NH2 . ARG B 182 ? 1.0914 1.1455 1.0140 -0.2255 0.0650  0.0514  477 ARG B NH2 
3246 N N   . VAL B 183 ? 0.3868 0.5466 0.5196 -0.0238 0.0074  -0.0094 478 VAL B N   
3247 C CA  . VAL B 183 ? 0.4325 0.5936 0.5704 -0.0106 -0.0033 -0.0093 478 VAL B CA  
3248 C C   . VAL B 183 ? 0.3982 0.5277 0.5255 -0.0070 -0.0006 -0.0005 478 VAL B C   
3249 O O   . VAL B 183 ? 0.3314 0.4589 0.4548 -0.0030 -0.0066 -0.0016 478 VAL B O   
3250 C CB  . VAL B 183 ? 0.3869 0.5598 0.5412 0.0024  -0.0102 -0.0093 478 VAL B CB  
3251 C CG1 . VAL B 183 ? 0.4230 0.5981 0.5820 0.0156  -0.0215 -0.0097 478 VAL B CG1 
3252 C CG2 . VAL B 183 ? 0.2989 0.5034 0.4637 -0.0004 -0.0129 -0.0177 478 VAL B CG2 
3253 N N   . LEU B 184 ? 0.2356 0.3406 0.3584 -0.0083 0.0085  0.0084  479 LEU B N   
3254 C CA  . LEU B 184 ? 0.2469 0.3205 0.3577 -0.0067 0.0127  0.0175  479 LEU B CA  
3255 C C   . LEU B 184 ? 0.3223 0.3900 0.4180 -0.0158 0.0148  0.0152  479 LEU B C   
3256 O O   . LEU B 184 ? 0.3328 0.3883 0.4228 -0.0105 0.0110  0.0180  479 LEU B O   
3257 C CB  . LEU B 184 ? 0.2766 0.3262 0.3827 -0.0100 0.0241  0.0269  479 LEU B CB  
3258 C CG  . LEU B 184 ? 0.2868 0.3309 0.4050 0.0019  0.0219  0.0330  479 LEU B CG  
3259 C CD1 . LEU B 184 ? 0.2470 0.2690 0.3602 -0.0026 0.0339  0.0418  479 LEU B CD1 
3260 C CD2 . LEU B 184 ? 0.2790 0.3115 0.3986 0.0149  0.0139  0.0381  479 LEU B CD2 
3261 N N   . ASP B 185 ? 0.2620 0.3384 0.3515 -0.0294 0.0206  0.0102  480 ASP B N   
3262 C CA  . ASP B 185 ? 0.3195 0.3919 0.3944 -0.0393 0.0226  0.0073  480 ASP B CA  
3263 C C   . ASP B 185 ? 0.4178 0.5072 0.4958 -0.0340 0.0114  0.0004  480 ASP B C   
3264 O O   . ASP B 185 ? 0.3300 0.4069 0.3974 -0.0346 0.0105  0.0017  480 ASP B O   
3265 C CB  . ASP B 185 ? 0.3913 0.4757 0.4618 -0.0543 0.0291  0.0018  480 ASP B CB  
3266 C CG  . ASP B 185 ? 0.4897 0.5508 0.5501 -0.0627 0.0421  0.0090  480 ASP B CG  
3267 O OD1 . ASP B 185 ? 0.5164 0.5492 0.5686 -0.0591 0.0467  0.0181  480 ASP B OD1 
3268 O OD2 . ASP B 185 ? 0.5939 0.6653 0.6545 -0.0731 0.0477  0.0056  480 ASP B OD2 
3269 N N   . LYS B 186 ? 0.3721 0.4903 0.4646 -0.0290 0.0029  -0.0069 481 LYS B N   
3270 C CA  . LYS B 186 ? 0.3691 0.5053 0.4655 -0.0235 -0.0079 -0.0136 481 LYS B CA  
3271 C C   . LYS B 186 ? 0.3367 0.4571 0.4338 -0.0104 -0.0134 -0.0081 481 LYS B C   
3272 O O   . LYS B 186 ? 0.3764 0.4975 0.4690 -0.0085 -0.0186 -0.0105 481 LYS B O   
3273 C CB  . LYS B 186 ? 0.4394 0.6092 0.5513 -0.0197 -0.0157 -0.0217 481 LYS B CB  
3274 C CG  . LYS B 186 ? 0.4729 0.6622 0.5902 -0.0123 -0.0275 -0.0283 481 LYS B CG  
3275 C CD  . LYS B 186 ? 0.4667 0.6639 0.5737 -0.0225 -0.0278 -0.0343 481 LYS B CD  
3276 C CE  . LYS B 186 ? 0.5236 0.7406 0.6307 -0.0350 -0.0241 -0.0402 481 LYS B CE  
3277 N NZ  . LYS B 186 ? 0.5119 0.7411 0.6109 -0.0441 -0.0263 -0.0467 481 LYS B NZ  
3278 N N   . ILE B 187 ? 0.3149 0.4211 0.4180 -0.0014 -0.0125 -0.0006 482 ILE B N   
3279 C CA  . ILE B 187 ? 0.2954 0.3857 0.3995 0.0111  -0.0176 0.0055  482 ILE B CA  
3280 C C   . ILE B 187 ? 0.3543 0.4156 0.4420 0.0071  -0.0111 0.0125  482 ILE B C   
3281 O O   . ILE B 187 ? 0.3290 0.3829 0.4139 0.0138  -0.0162 0.0141  482 ILE B O   
3282 C CB  . ILE B 187 ? 0.3352 0.4177 0.4501 0.0220  -0.0186 0.0123  482 ILE B CB  
3283 C CG1 . ILE B 187 ? 0.3723 0.4840 0.5034 0.0276  -0.0266 0.0051  482 ILE B CG1 
3284 C CG2 . ILE B 187 ? 0.2871 0.3515 0.4020 0.0342  -0.0235 0.0195  482 ILE B CG2 
3285 C CD1 . ILE B 187 ? 0.4392 0.5453 0.5816 0.0388  -0.0288 0.0110  482 ILE B CD1 
3286 N N   . THR B 188 ? 0.3572 0.4021 0.4339 -0.0035 0.0001  0.0168  483 THR B N   
3287 C CA  . THR B 188 ? 0.3831 0.4020 0.4424 -0.0089 0.0067  0.0225  483 THR B CA  
3288 C C   . THR B 188 ? 0.4257 0.4544 0.4776 -0.0141 0.0026  0.0152  483 THR B C   
3289 O O   . THR B 188 ? 0.3571 0.3716 0.4016 -0.0100 0.0006  0.0183  483 THR B O   
3290 C CB  . THR B 188 ? 0.4585 0.4624 0.5068 -0.0213 0.0194  0.0264  483 THR B CB  
3291 O OG1 . THR B 188 ? 0.5490 0.5404 0.6027 -0.0164 0.0240  0.0344  483 THR B OG1 
3292 C CG2 . THR B 188 ? 0.4157 0.3937 0.4448 -0.0271 0.0257  0.0317  483 THR B CG2 
3293 N N   . ASP B 189 ? 0.3574 0.4106 0.4115 -0.0231 0.0014  0.0056  484 ASP B N   
3294 C CA  . ASP B 189 ? 0.4360 0.5032 0.4851 -0.0281 -0.0034 -0.0024 484 ASP B CA  
3295 C C   . ASP B 189 ? 0.4400 0.5134 0.4959 -0.0154 -0.0141 -0.0040 484 ASP B C   
3296 O O   . ASP B 189 ? 0.3853 0.4517 0.4326 -0.0155 -0.0162 -0.0045 484 ASP B O   
3297 C CB  . ASP B 189 ? 0.4246 0.5231 0.4804 -0.0361 -0.0058 -0.0125 484 ASP B CB  
3298 C CG  . ASP B 189 ? 0.5107 0.6058 0.5591 -0.0502 0.0043  -0.0122 484 ASP B CG  
3299 O OD1 . ASP B 189 ? 0.3702 0.4382 0.4064 -0.0549 0.0134  -0.0048 484 ASP B OD1 
3300 O OD2 . ASP B 189 ? 0.6134 0.7333 0.6680 -0.0567 0.0031  -0.0195 484 ASP B OD2 
3301 N N   . THR B 190 ? 0.3968 0.4838 0.4684 -0.0043 -0.0210 -0.0048 485 THR B N   
3302 C CA  . THR B 190 ? 0.3516 0.4469 0.4314 0.0083  -0.0317 -0.0068 485 THR B CA  
3303 C C   . THR B 190 ? 0.3601 0.4276 0.4331 0.0159  -0.0311 0.0021  485 THR B C   
3304 O O   . THR B 190 ? 0.4050 0.4729 0.4750 0.0194  -0.0363 0.0000  485 THR B O   
3305 C CB  . THR B 190 ? 0.4248 0.5375 0.5220 0.0186  -0.0385 -0.0084 485 THR B CB  
3306 O OG1 . THR B 190 ? 0.3541 0.4935 0.4572 0.0116  -0.0392 -0.0167 485 THR B OG1 
3307 C CG2 . THR B 190 ? 0.4320 0.5544 0.5378 0.0316  -0.0499 -0.0108 485 THR B CG2 
3308 N N   . LEU B 191 ? 0.3580 0.4016 0.4286 0.0185  -0.0248 0.0122  486 LEU B N   
3309 C CA  . LEU B 191 ? 0.3157 0.3309 0.3786 0.0249  -0.0230 0.0219  486 LEU B CA  
3310 C C   . LEU B 191 ? 0.4232 0.4264 0.4697 0.0172  -0.0193 0.0214  486 LEU B C   
3311 O O   . LEU B 191 ? 0.4177 0.4138 0.4617 0.0240  -0.0239 0.0230  486 LEU B O   
3312 C CB  . LEU B 191 ? 0.3652 0.3560 0.4250 0.0255  -0.0144 0.0329  486 LEU B CB  
3313 C CG  . LEU B 191 ? 0.3750 0.3666 0.4494 0.0377  -0.0188 0.0377  486 LEU B CG  
3314 C CD1 . LEU B 191 ? 0.3881 0.3580 0.4588 0.0355  -0.0091 0.0476  486 LEU B CD1 
3315 C CD2 . LEU B 191 ? 0.3092 0.2936 0.3882 0.0516  -0.0271 0.0420  486 LEU B CD2 
3316 N N   . ILE B 192 ? 0.4249 0.4256 0.4603 0.0031  -0.0111 0.0194  487 ILE B N   
3317 C CA  . ILE B 192 ? 0.3810 0.3699 0.3997 -0.0052 -0.0074 0.0188  487 ILE B CA  
3318 C C   . ILE B 192 ? 0.4347 0.4443 0.4561 -0.0042 -0.0163 0.0094  487 ILE B C   
3319 O O   . ILE B 192 ? 0.4316 0.4300 0.4449 -0.0019 -0.0180 0.0108  487 ILE B O   
3320 C CB  . ILE B 192 ? 0.4792 0.4652 0.4865 -0.0212 0.0023  0.0171  487 ILE B CB  
3321 C CG1 . ILE B 192 ? 0.4718 0.4339 0.4739 -0.0227 0.0122  0.0272  487 ILE B CG1 
3322 C CG2 . ILE B 192 ? 0.4600 0.4360 0.4503 -0.0297 0.0048  0.0154  487 ILE B CG2 
3323 C CD1 . ILE B 192 ? 0.4218 0.3517 0.4128 -0.0168 0.0159  0.0383  487 ILE B CD1 
3324 N N   . HIS B 193 ? 0.4672 0.5072 0.5003 -0.0056 -0.0221 0.0000  488 HIS B N   
3325 C CA  . HIS B 193 ? 0.5037 0.5656 0.5402 -0.0045 -0.0308 -0.0092 488 HIS B CA  
3326 C C   . HIS B 193 ? 0.4594 0.5165 0.5012 0.0097  -0.0385 -0.0067 488 HIS B C   
3327 O O   . HIS B 193 ? 0.4441 0.5009 0.4800 0.0098  -0.0416 -0.0094 488 HIS B O   
3328 C CB  . HIS B 193 ? 0.5304 0.6260 0.5802 -0.0059 -0.0363 -0.0185 488 HIS B CB  
3329 C CG  . HIS B 193 ? 0.6108 0.7299 0.6645 -0.0043 -0.0453 -0.0277 488 HIS B CG  
3330 N ND1 . HIS B 193 ? 0.6544 0.7892 0.7216 0.0084  -0.0552 -0.0306 488 HIS B ND1 
3331 C CD2 . HIS B 193 ? 0.6548 0.7841 0.7005 -0.0138 -0.0459 -0.0344 488 HIS B CD2 
3332 C CE1 . HIS B 193 ? 0.6374 0.7915 0.7048 0.0066  -0.0612 -0.0388 488 HIS B CE1 
3333 N NE2 . HIS B 193 ? 0.6473 0.7985 0.7019 -0.0068 -0.0557 -0.0412 488 HIS B NE2 
3334 N N   . LEU B 194 ? 0.4426 0.4958 0.4956 0.0216  -0.0415 -0.0012 489 LEU B N   
3335 C CA  . LEU B 194 ? 0.4013 0.4484 0.4598 0.0356  -0.0486 0.0022  489 LEU B CA  
3336 C C   . LEU B 194 ? 0.4916 0.5102 0.5359 0.0359  -0.0443 0.0097  489 LEU B C   
3337 O O   . LEU B 194 ? 0.4240 0.4432 0.4675 0.0415  -0.0497 0.0080  489 LEU B O   
3338 C CB  . LEU B 194 ? 0.3501 0.3930 0.4210 0.0473  -0.0513 0.0086  489 LEU B CB  
3339 C CG  . LEU B 194 ? 0.3331 0.4027 0.4202 0.0516  -0.0578 0.0025  489 LEU B CG  
3340 C CD1 . LEU B 194 ? 0.3402 0.3988 0.4364 0.0615  -0.0581 0.0108  489 LEU B CD1 
3341 C CD2 . LEU B 194 ? 0.3699 0.4636 0.4660 0.0586  -0.0690 -0.0060 489 LEU B CD2 
3342 N N   . MET B 195 ? 0.4744 0.4685 0.5076 0.0302  -0.0343 0.0179  490 MET B N   
3343 C CA  . MET B 195 ? 0.4363 0.4012 0.4550 0.0306  -0.0292 0.0262  490 MET B CA  
3344 C C   . MET B 195 ? 0.5014 0.4675 0.5074 0.0221  -0.0286 0.0204  490 MET B C   
3345 O O   . MET B 195 ? 0.5893 0.5438 0.5897 0.0274  -0.0308 0.0230  490 MET B O   
3346 C CB  . MET B 195 ? 0.4866 0.4265 0.4954 0.0252  -0.0182 0.0358  490 MET B CB  
3347 C CG  . MET B 195 ? 0.5302 0.4648 0.5502 0.0341  -0.0183 0.0431  490 MET B CG  
3348 S SD  . MET B 195 ? 0.4853 0.3929 0.4942 0.0270  -0.0049 0.0538  490 MET B SD  
3349 C CE  . MET B 195 ? 0.4422 0.3547 0.4694 0.0382  -0.0085 0.0586  490 MET B CE  
3350 N N   . ALA B 196 ? 0.3659 0.3459 0.3674 0.0089  -0.0257 0.0128  491 ALA B N   
3351 C CA  . ALA B 196 ? 0.5208 0.5040 0.5106 -0.0001 -0.0254 0.0066  491 ALA B CA  
3352 C C   . ALA B 196 ? 0.6025 0.6058 0.6010 0.0070  -0.0359 -0.0008 491 ALA B C   
3353 O O   . ALA B 196 ? 0.6335 0.6284 0.6241 0.0084  -0.0375 -0.0008 491 ALA B O   
3354 C CB  . ALA B 196 ? 0.4533 0.4508 0.4392 -0.0150 -0.0213 -0.0002 491 ALA B CB  
3355 N N   . LYS B 197 ? 0.6808 0.6291 0.6050 0.0407  -0.0067 0.0631  492 LYS B N   
3356 C CA  . LYS B 197 ? 0.7200 0.6609 0.6422 0.0417  0.0017  0.0652  492 LYS B CA  
3357 C C   . LYS B 197 ? 0.6766 0.6140 0.5876 0.0410  0.0029  0.0555  492 LYS B C   
3358 O O   . LYS B 197 ? 0.6448 0.5768 0.5585 0.0431  0.0032  0.0565  492 LYS B O   
3359 C CB  . LYS B 197 ? 0.8090 0.7481 0.7234 0.0393  0.0154  0.0682  492 LYS B CB  
3360 C CG  . LYS B 197 ? 0.9092 0.8409 0.8244 0.0410  0.0246  0.0731  492 LYS B CG  
3361 C CD  . LYS B 197 ? 1.0142 0.9444 0.9197 0.0383  0.0382  0.0744  492 LYS B CD  
3362 C CE  . LYS B 197 ? 1.1349 1.0580 1.0420 0.0405  0.0478  0.0800  492 LYS B CE  
3363 N NZ  . LYS B 197 ? 1.2088 1.1299 1.1049 0.0378  0.0615  0.0800  492 LYS B NZ  
3364 N N   . ALA B 198 ? 0.6259 0.5668 0.5243 0.0379  0.0034  0.0464  493 ALA B N   
3365 C CA  . ALA B 198 ? 0.6096 0.5482 0.4959 0.0365  0.0050  0.0367  493 ALA B CA  
3366 C C   . ALA B 198 ? 0.6517 0.5919 0.5453 0.0392  -0.0074 0.0333  493 ALA B C   
3367 O O   . ALA B 198 ? 0.7557 0.6932 0.6424 0.0388  -0.0073 0.0269  493 ALA B O   
3368 C CB  . ALA B 198 ? 0.5847 0.5273 0.4552 0.0320  0.0099  0.0284  493 ALA B CB  
3369 N N   . GLY B 199 ? 0.6020 0.5463 0.5091 0.0417  -0.0181 0.0377  494 GLY B N   
3370 C CA  . GLY B 199 ? 0.6806 0.6259 0.5961 0.0445  -0.0303 0.0353  494 GLY B CA  
3371 C C   . GLY B 199 ? 0.7138 0.6660 0.6272 0.0442  -0.0392 0.0278  494 GLY B C   
3372 O O   . GLY B 199 ? 0.7353 0.6882 0.6520 0.0461  -0.0481 0.0234  494 GLY B O   
3373 N N   . LEU B 200 ? 0.6482 0.6056 0.5559 0.0417  -0.0366 0.0264  495 LEU B N   
3374 C CA  . LEU B 200 ? 0.5849 0.5495 0.4918 0.0416  -0.0451 0.0201  495 LEU B CA  
3375 C C   . LEU B 200 ? 0.5705 0.5373 0.4938 0.0450  -0.0572 0.0261  495 LEU B C   
3376 O O   . LEU B 200 ? 0.4427 0.4078 0.3756 0.0459  -0.0568 0.0358  495 LEU B O   
3377 C CB  . LEU B 200 ? 0.4966 0.4663 0.3924 0.0376  -0.0385 0.0172  495 LEU B CB  
3378 C CG  . LEU B 200 ? 0.5511 0.5192 0.4292 0.0335  -0.0266 0.0107  495 LEU B CG  
3379 C CD1 . LEU B 200 ? 0.5075 0.4816 0.3759 0.0295  -0.0218 0.0083  495 LEU B CD1 
3380 C CD2 . LEU B 200 ? 0.4615 0.4297 0.3324 0.0336  -0.0295 0.0011  495 LEU B CD2 
3381 N N   . THR B 201 ? 0.5777 0.5481 0.5040 0.0470  -0.0680 0.0205  496 THR B N   
3382 C CA  . THR B 201 ? 0.6040 0.5764 0.5448 0.0500  -0.0799 0.0253  496 THR B CA  
3383 C C   . THR B 201 ? 0.6275 0.6050 0.5694 0.0482  -0.0790 0.0295  496 THR B C   
3384 O O   . THR B 201 ? 0.6154 0.5957 0.5458 0.0447  -0.0699 0.0269  496 THR B O   
3385 C CB  . THR B 201 ? 0.6240 0.5994 0.5664 0.0525  -0.0912 0.0173  496 THR B CB  
3386 O OG1 . THR B 201 ? 0.6122 0.5944 0.5437 0.0504  -0.0896 0.0089  496 THR B OG1 
3387 C CG2 . THR B 201 ? 0.6566 0.6276 0.5968 0.0537  -0.0918 0.0126  496 THR B CG2 
3388 N N   . LEU B 202 ? 0.5705 0.5491 0.5258 0.0504  -0.0883 0.0360  497 LEU B N   
3389 C CA  . LEU B 202 ? 0.5793 0.5631 0.5367 0.0488  -0.0890 0.0402  497 LEU B CA  
3390 C C   . LEU B 202 ? 0.5542 0.5450 0.5017 0.0471  -0.0898 0.0313  497 LEU B C   
3391 O O   . LEU B 202 ? 0.5017 0.4968 0.4425 0.0438  -0.0836 0.0320  497 LEU B O   
3392 C CB  . LEU B 202 ? 0.6264 0.6100 0.6001 0.0517  -0.1008 0.0479  497 LEU B CB  
3393 C CG  . LEU B 202 ? 0.7506 0.7305 0.7343 0.0517  -0.0983 0.0599  497 LEU B CG  
3394 C CD1 . LEU B 202 ? 0.7856 0.7646 0.7853 0.0546  -0.1113 0.0666  497 LEU B CD1 
3395 C CD2 . LEU B 202 ? 0.7904 0.7734 0.7689 0.0480  -0.0885 0.0646  497 LEU B CD2 
3396 N N   . GLN B 203 ? 0.5074 0.4996 0.4540 0.0494  -0.0973 0.0230  498 GLN B N   
3397 C CA  . GLN B 203 ? 0.5067 0.5062 0.4449 0.0484  -0.0991 0.0143  498 GLN B CA  
3398 C C   . GLN B 203 ? 0.4656 0.4671 0.3870 0.0440  -0.0867 0.0084  498 GLN B C   
3399 O O   . GLN B 203 ? 0.5451 0.5527 0.4590 0.0411  -0.0834 0.0060  498 GLN B O   
3400 C CB  . GLN B 203 ? 0.5139 0.5143 0.4548 0.0521  -0.1093 0.0065  498 GLN B CB  
3401 C CG  . GLN B 203 ? 0.5971 0.6057 0.5313 0.0518  -0.1126 -0.0021 498 GLN B CG  
3402 C CD  . GLN B 203 ? 0.6694 0.6789 0.6056 0.0555  -0.1218 -0.0103 498 GLN B CD  
3403 O OE1 . GLN B 203 ? 0.6753 0.6793 0.6136 0.0573  -0.1231 -0.0114 498 GLN B OE1 
3404 N NE2 . GLN B 203 ? 0.6755 0.6921 0.6108 0.0568  -0.1280 -0.0162 498 GLN B NE2 
3405 N N   . GLN B 204 ? 0.3903 0.3863 0.3056 0.0434  -0.0800 0.0062  499 GLN B N   
3406 C CA  . GLN B 204 ? 0.4526 0.4490 0.3516 0.0391  -0.0679 0.0009  499 GLN B CA  
3407 C C   . GLN B 204 ? 0.4552 0.4511 0.3506 0.0356  -0.0580 0.0075  499 GLN B C   
3408 O O   . GLN B 204 ? 0.5436 0.5429 0.4263 0.0314  -0.0503 0.0036  499 GLN B O   
3409 C CB  . GLN B 204 ? 0.4338 0.4234 0.3286 0.0395  -0.0633 -0.0016 499 GLN B CB  
3410 C CG  . GLN B 204 ? 0.5069 0.4968 0.4047 0.0428  -0.0726 -0.0083 499 GLN B CG  
3411 C CD  . GLN B 204 ? 0.6584 0.6415 0.5531 0.0430  -0.0685 -0.0097 499 GLN B CD  
3412 O OE1 . GLN B 204 ? 0.6593 0.6358 0.5580 0.0432  -0.0636 -0.0024 499 GLN B OE1 
3413 N NE2 . GLN B 204 ? 0.7291 0.7140 0.6166 0.0430  -0.0704 -0.0191 499 GLN B NE2 
3414 N N   . GLN B 205 ? 0.4789 0.4705 0.3853 0.0370  -0.0583 0.0176  500 GLN B N   
3415 C CA  . GLN B 205 ? 0.4656 0.4570 0.3700 0.0340  -0.0494 0.0245  500 GLN B CA  
3416 C C   . GLN B 205 ? 0.5082 0.5076 0.4100 0.0314  -0.0510 0.0240  500 GLN B C   
3417 O O   . GLN B 205 ? 0.4655 0.4672 0.3557 0.0271  -0.0416 0.0225  500 GLN B O   
3418 C CB  . GLN B 205 ? 0.4920 0.4791 0.4109 0.0364  -0.0517 0.0357  500 GLN B CB  
3419 C CG  . GLN B 205 ? 0.4598 0.4389 0.3816 0.0384  -0.0481 0.0384  500 GLN B CG  
3420 C CD  . GLN B 205 ? 0.5145 0.4907 0.4516 0.0409  -0.0515 0.0498  500 GLN B CD  
3421 O OE1 . GLN B 205 ? 0.4400 0.4190 0.3818 0.0397  -0.0505 0.0567  500 GLN B OE1 
3422 N NE2 . GLN B 205 ? 0.4754 0.4465 0.4206 0.0441  -0.0557 0.0519  500 GLN B NE2 
3423 N N   . HIS B 206 ? 0.4863 0.4898 0.3986 0.0341  -0.0630 0.0252  501 HIS B N   
3424 C CA  A HIS B 206 ? 0.4915 0.5027 0.4032 0.0321  -0.0658 0.0258  501 HIS B CA  
3425 C CA  B HIS B 206 ? 0.4993 0.5106 0.4112 0.0322  -0.0660 0.0257  501 HIS B CA  
3426 C C   . HIS B 206 ? 0.4658 0.4832 0.3635 0.0294  -0.0634 0.0155  501 HIS B C   
3427 O O   . HIS B 206 ? 0.4453 0.4685 0.3363 0.0256  -0.0594 0.0154  501 HIS B O   
3428 C CB  A HIS B 206 ? 0.5198 0.5331 0.4471 0.0359  -0.0797 0.0302  501 HIS B CB  
3429 C CB  B HIS B 206 ? 0.5339 0.5472 0.4612 0.0360  -0.0800 0.0299  501 HIS B CB  
3430 C CG  A HIS B 206 ? 0.5190 0.5279 0.4593 0.0373  -0.0815 0.0415  501 HIS B CG  
3431 C CG  B HIS B 206 ? 0.5871 0.6032 0.5159 0.0393  -0.0902 0.0217  501 HIS B CG  
3432 N ND1 A HIS B 206 ? 0.5962 0.6031 0.5344 0.0344  -0.0714 0.0484  501 HIS B ND1 
3433 N ND1 B HIS B 206 ? 0.5856 0.5990 0.5277 0.0441  -0.1021 0.0234  501 HIS B ND1 
3434 C CD2 A HIS B 206 ? 0.4506 0.4570 0.4062 0.0412  -0.0923 0.0473  501 HIS B CD2 
3435 C CD2 B HIS B 206 ? 0.5803 0.6019 0.4990 0.0384  -0.0902 0.0117  501 HIS B CD2 
3436 C CE1 A HIS B 206 ? 0.6040 0.6080 0.5558 0.0365  -0.0757 0.0580  501 HIS B CE1 
3437 C CE1 B HIS B 206 ? 0.5302 0.5471 0.4702 0.0463  -0.1088 0.0147  501 HIS B CE1 
3438 N NE2 A HIS B 206 ? 0.5593 0.5628 0.5217 0.0404  -0.0885 0.0576  501 HIS B NE2 
3439 N NE2 B HIS B 206 ? 0.5016 0.5238 0.4277 0.0430  -0.1018 0.0075  501 HIS B NE2 
3440 N N   . GLN B 207 ? 0.3516 0.3682 0.2447 0.0310  -0.0653 0.0071  502 GLN B N   
3441 C CA  . GLN B 207 ? 0.4059 0.4286 0.2855 0.0284  -0.0628 -0.0029 502 GLN B CA  
3442 C C   . GLN B 207 ? 0.3697 0.3909 0.2333 0.0229  -0.0485 -0.0049 502 GLN B C   
3443 O O   . GLN B 207 ? 0.3602 0.3876 0.2131 0.0188  -0.0442 -0.0087 502 GLN B O   
3444 C CB  . GLN B 207 ? 0.3965 0.4190 0.2758 0.0316  -0.0688 -0.0112 502 GLN B CB  
3445 C CG  . GLN B 207 ? 0.4709 0.4963 0.3634 0.0367  -0.0831 -0.0115 502 GLN B CG  
3446 C CD  . GLN B 207 ? 0.4977 0.5223 0.3900 0.0399  -0.0888 -0.0196 502 GLN B CD  
3447 O OE1 . GLN B 207 ? 0.4864 0.5081 0.3696 0.0384  -0.0823 -0.0244 502 GLN B OE1 
3448 N NE2 . GLN B 207 ? 0.4721 0.4993 0.3745 0.0444  -0.1012 -0.0212 502 GLN B NE2 
3449 N N   . ARG B 208 ? 0.3492 0.3620 0.2113 0.0228  -0.0413 -0.0023 503 ARG B N   
3450 C CA  . ARG B 208 ? 0.3701 0.3799 0.2172 0.0180  -0.0277 -0.0042 503 ARG B CA  
3451 C C   . ARG B 208 ? 0.3389 0.3508 0.1828 0.0141  -0.0209 0.0015  503 ARG B C   
3452 O O   . ARG B 208 ? 0.4493 0.4640 0.2790 0.0091  -0.0129 -0.0025 503 ARG B O   
3453 C CB  . ARG B 208 ? 0.3536 0.3534 0.2012 0.0194  -0.0219 -0.0018 503 ARG B CB  
3454 C CG  . ARG B 208 ? 0.3748 0.3703 0.2063 0.0146  -0.0079 -0.0043 503 ARG B CG  
3455 C CD  . ARG B 208 ? 0.4114 0.3973 0.2436 0.0165  -0.0032 -0.0028 503 ARG B CD  
3456 N NE  . ARG B 208 ? 0.4681 0.4490 0.2850 0.0122  0.0101  -0.0052 503 ARG B NE  
3457 C CZ  . ARG B 208 ? 0.5200 0.5005 0.3227 0.0092  0.0144  -0.0139 503 ARG B CZ  
3458 N NH1 . ARG B 208 ? 0.4422 0.4279 0.2440 0.0102  0.0065  -0.0212 503 ARG B NH1 
3459 N NH2 . ARG B 208 ? 0.5239 0.4987 0.3129 0.0052  0.0266  -0.0153 503 ARG B NH2 
3460 N N   . LEU B 209 ? 0.4340 0.3080 0.3569 0.0254  0.0033  -0.0135 504 LEU B N   
3461 C CA  . LEU B 209 ? 0.4731 0.3696 0.4112 0.0296  -0.0074 -0.0014 504 LEU B CA  
3462 C C   . LEU B 209 ? 0.4555 0.3744 0.4282 0.0234  -0.0066 -0.0048 504 LEU B C   
3463 O O   . LEU B 209 ? 0.4050 0.3317 0.3750 0.0208  -0.0069 -0.0027 504 LEU B O   
3464 C CB  . LEU B 209 ? 0.3443 0.2547 0.3013 0.0400  -0.0212 0.0115  504 LEU B CB  
3465 C CG  . LEU B 209 ? 0.4429 0.3794 0.4205 0.0450  -0.0329 0.0246  504 LEU B CG  
3466 C CD1 . LEU B 209 ? 0.4250 0.3533 0.3687 0.0466  -0.0330 0.0300  504 LEU B CD1 
3467 C CD2 . LEU B 209 ? 0.4367 0.3878 0.4371 0.0547  -0.0460 0.0368  504 LEU B CD2 
3468 N N   . ALA B 210 ? 0.3730 0.3018 0.3782 0.0209  -0.0056 -0.0103 505 ALA B N   
3469 C CA  . ALA B 210 ? 0.3181 0.2686 0.3589 0.0150  -0.0050 -0.0138 505 ALA B CA  
3470 C C   . ALA B 210 ? 0.3458 0.2858 0.3702 0.0050  0.0074  -0.0246 505 ALA B C   
3471 O O   . ALA B 210 ? 0.3691 0.3238 0.4060 0.0013  0.0064  -0.0233 505 ALA B O   
3472 C CB  . ALA B 210 ? 0.3104 0.2701 0.3857 0.0141  -0.0050 -0.0188 505 ALA B CB  
3473 N N   . GLN B 211 ? 0.3031 0.2176 0.2998 0.0006  0.0191  -0.0351 506 GLN B N   
3474 C CA  . GLN B 211 ? 0.3743 0.2770 0.3543 -0.0090 0.0314  -0.0455 506 GLN B CA  
3475 C C   . GLN B 211 ? 0.4564 0.3583 0.4142 -0.0090 0.0293  -0.0398 506 GLN B C   
3476 O O   . GLN B 211 ? 0.4284 0.3365 0.3916 -0.0158 0.0333  -0.0437 506 GLN B O   
3477 C CB  . GLN B 211 ? 0.5017 0.3753 0.4504 -0.0122 0.0434  -0.0561 506 GLN B CB  
3478 C CG  . GLN B 211 ? 0.6093 0.4820 0.5784 -0.0134 0.0474  -0.0638 506 GLN B CG  
3479 C CD  . GLN B 211 ? 0.6684 0.5120 0.6043 -0.0136 0.0565  -0.0714 506 GLN B CD  
3480 O OE1 . GLN B 211 ? 0.6340 0.4578 0.5313 -0.0132 0.0601  -0.0710 506 GLN B OE1 
3481 N NE2 . GLN B 211 ? 0.5648 0.4058 0.5156 -0.0139 0.0600  -0.0783 506 GLN B NE2 
3482 N N   . LEU B 212 ? 0.4293 0.3236 0.3625 -0.0012 0.0226  -0.0305 507 LEU B N   
3483 C CA  . LEU B 212 ? 0.4674 0.3590 0.3760 -0.0001 0.0202  -0.0247 507 LEU B CA  
3484 C C   . LEU B 212 ? 0.4427 0.3623 0.3803 0.0014  0.0106  -0.0164 507 LEU B C   
3485 O O   . LEU B 212 ? 0.4389 0.3608 0.3698 -0.0030 0.0127  -0.0177 507 LEU B O   
3486 C CB  . LEU B 212 ? 0.5034 0.3815 0.3811 0.0087  0.0147  -0.0159 507 LEU B CB  
3487 C CG  . LEU B 212 ? 0.4941 0.3411 0.3328 0.0076  0.0240  -0.0229 507 LEU B CG  
3488 C CD1 . LEU B 212 ? 0.4569 0.2942 0.2695 0.0171  0.0166  -0.0124 507 LEU B CD1 
3489 C CD2 . LEU B 212 ? 0.5255 0.3558 0.3374 -0.0011 0.0357  -0.0324 507 LEU B CD2 
3490 N N   . LEU B 213 ? 0.3170 0.2575 0.2864 0.0079  0.0000  -0.0079 508 LEU B N   
3491 C CA  . LEU B 213 ? 0.3425 0.3108 0.3406 0.0105  -0.0102 0.0012  508 LEU B CA  
3492 C C   . LEU B 213 ? 0.3327 0.3154 0.3596 0.0016  -0.0056 -0.0065 508 LEU B C   
3493 O O   . LEU B 213 ? 0.3808 0.3790 0.4183 0.0006  -0.0098 -0.0024 508 LEU B O   
3494 C CB  . LEU B 213 ? 0.2851 0.2720 0.3115 0.0196  -0.0225 0.0121  508 LEU B CB  
3495 C CG  . LEU B 213 ? 0.3894 0.3651 0.3910 0.0292  -0.0287 0.0215  508 LEU B CG  
3496 C CD1 . LEU B 213 ? 0.3888 0.3860 0.4222 0.0380  -0.0417 0.0333  508 LEU B CD1 
3497 C CD2 . LEU B 213 ? 0.3227 0.2917 0.2923 0.0318  -0.0305 0.0277  508 LEU B CD2 
3498 N N   . LEU B 214 ? 0.3776 0.3555 0.4178 -0.0046 0.0029  -0.0174 509 LEU B N   
3499 C CA  . LEU B 214 ? 0.3171 0.3071 0.3841 -0.0135 0.0083  -0.0255 509 LEU B CA  
3500 C C   . LEU B 214 ? 0.3655 0.3443 0.4086 -0.0210 0.0164  -0.0315 509 LEU B C   
3501 O O   . LEU B 214 ? 0.3851 0.3782 0.4476 -0.0265 0.0168  -0.0334 509 LEU B O   
3502 C CB  . LEU B 214 ? 0.3135 0.2974 0.3947 -0.0183 0.0168  -0.0363 509 LEU B CB  
3503 C CG  . LEU B 214 ? 0.4275 0.4275 0.5434 -0.0129 0.0091  -0.0321 509 LEU B CG  
3504 C CD1 . LEU B 214 ? 0.4269 0.4208 0.5565 -0.0188 0.0187  -0.0443 509 LEU B CD1 
3505 C CD2 . LEU B 214 ? 0.3986 0.4299 0.5532 -0.0108 -0.0017 -0.0236 509 LEU B CD2 
3506 N N   . ILE B 215 ? 0.3568 0.3096 0.3576 -0.0212 0.0227  -0.0345 510 ILE B N   
3507 C CA  . ILE B 215 ? 0.3678 0.3081 0.3427 -0.0278 0.0300  -0.0397 510 ILE B CA  
3508 C C   . ILE B 215 ? 0.3051 0.2600 0.2807 -0.0243 0.0204  -0.0299 510 ILE B C   
3509 O O   . ILE B 215 ? 0.3761 0.3319 0.3478 -0.0304 0.0236  -0.0334 510 ILE B O   
3510 C CB  . ILE B 215 ? 0.3405 0.2499 0.2692 -0.0279 0.0379  -0.0440 510 ILE B CB  
3511 C CG1 . ILE B 215 ? 0.4617 0.3562 0.3895 -0.0330 0.0491  -0.0555 510 ILE B CG1 
3512 C CG2 . ILE B 215 ? 0.4638 0.3614 0.3649 -0.0334 0.0433  -0.0473 510 ILE B CG2 
3513 C CD1 . ILE B 215 ? 0.5401 0.4050 0.4251 -0.0322 0.0563  -0.0592 510 ILE B CD1 
3514 N N   . LEU B 216 ? 0.3778 0.3446 0.3590 -0.0144 0.0084  -0.0176 511 LEU B N   
3515 C CA  . LEU B 216 ? 0.3488 0.3305 0.3315 -0.0101 -0.0013 -0.0075 511 LEU B CA  
3516 C C   . LEU B 216 ? 0.3613 0.3676 0.3816 -0.0149 -0.0039 -0.0084 511 LEU B C   
3517 O O   . LEU B 216 ? 0.3530 0.3667 0.3703 -0.0158 -0.0071 -0.0054 511 LEU B O   
3518 C CB  . LEU B 216 ? 0.3080 0.2996 0.2931 0.0019  -0.0137 0.0064  511 LEU B CB  
3519 C CG  . LEU B 216 ? 0.4115 0.3792 0.3573 0.0075  -0.0124 0.0089  511 LEU B CG  
3520 C CD1 . LEU B 216 ? 0.3480 0.3269 0.2959 0.0193  -0.0253 0.0239  511 LEU B CD1 
3521 C CD2 . LEU B 216 ? 0.4375 0.3837 0.3424 0.0035  -0.0054 0.0043  511 LEU B CD2 
3522 N N   . SER B 217 ? 0.3579 0.3771 0.4139 -0.0179 -0.0026 -0.0125 512 SER B N   
3523 C CA  . SER B 217 ? 0.3577 0.4007 0.4509 -0.0227 -0.0050 -0.0134 512 SER B CA  
3524 C C   . SER B 217 ? 0.3264 0.3600 0.4096 -0.0333 0.0051  -0.0239 512 SER B C   
3525 O O   . SER B 217 ? 0.3400 0.3882 0.4376 -0.0364 0.0020  -0.0226 512 SER B O   
3526 C CB  . SER B 217 ? 0.3947 0.4536 0.5288 -0.0234 -0.0060 -0.0154 512 SER B CB  
3527 O OG  . SER B 217 ? 0.5597 0.6018 0.6885 -0.0299 0.0059  -0.0275 512 SER B OG  
3528 N N   . HIS B 218 ? 0.2895 0.2986 0.3481 -0.0389 0.0171  -0.0342 513 HIS B N   
3529 C CA  . HIS B 218 ? 0.3369 0.3339 0.3812 -0.0488 0.0272  -0.0440 513 HIS B CA  
3530 C C   . HIS B 218 ? 0.3524 0.3421 0.3664 -0.0472 0.0241  -0.0394 513 HIS B C   
3531 O O   . HIS B 218 ? 0.4333 0.4268 0.4495 -0.0532 0.0257  -0.0424 513 HIS B O   
3532 C CB  . HIS B 218 ? 0.4125 0.3842 0.4350 -0.0541 0.0405  -0.0550 513 HIS B CB  
3533 C CG  . HIS B 218 ? 0.6548 0.6320 0.7048 -0.0556 0.0442  -0.0602 513 HIS B CG  
3534 N ND1 . HIS B 218 ? 0.7641 0.7557 0.8484 -0.0627 0.0479  -0.0663 513 HIS B ND1 
3535 C CD2 . HIS B 218 ? 0.7436 0.7138 0.7920 -0.0506 0.0443  -0.0600 513 HIS B CD2 
3536 C CE1 . HIS B 218 ? 0.7196 0.7129 0.8221 -0.0620 0.0504  -0.0699 513 HIS B CE1 
3537 N NE2 . HIS B 218 ? 0.7202 0.7007 0.8016 -0.0547 0.0481  -0.0662 513 HIS B NE2 
3538 N N   . ILE B 219 ? 0.3527 0.3319 0.3384 -0.0388 0.0192  -0.0320 514 ILE B N   
3539 C CA  . ILE B 219 ? 0.3888 0.3604 0.3441 -0.0363 0.0158  -0.0272 514 ILE B CA  
3540 C C   . ILE B 219 ? 0.3859 0.3829 0.3645 -0.0334 0.0049  -0.0189 514 ILE B C   
3541 O O   . ILE B 219 ? 0.3999 0.3954 0.3661 -0.0361 0.0044  -0.0193 514 ILE B O   
3542 C CB  . ILE B 219 ? 0.3710 0.3270 0.2921 -0.0273 0.0124  -0.0203 514 ILE B CB  
3543 C CG1 . ILE B 219 ? 0.4368 0.3641 0.3278 -0.0314 0.0244  -0.0297 514 ILE B CG1 
3544 C CG2 . ILE B 219 ? 0.3426 0.2959 0.2379 -0.0232 0.0066  -0.0134 514 ILE B CG2 
3545 C CD1 . ILE B 219 ? 0.5146 0.4248 0.3722 -0.0233 0.0222  -0.0239 514 ILE B CD1 
3546 N N   . ARG B 220 ? 0.2931 0.3132 0.3059 -0.0279 -0.0039 -0.0115 515 ARG B N   
3547 C CA  . ARG B 220 ? 0.3089 0.3553 0.3486 -0.0252 -0.0142 -0.0037 515 ARG B CA  
3548 C C   . ARG B 220 ? 0.3133 0.3676 0.3736 -0.0357 -0.0090 -0.0122 515 ARG B C   
3549 O O   . ARG B 220 ? 0.3200 0.3844 0.3833 -0.0365 -0.0137 -0.0094 515 ARG B O   
3550 C CB  . ARG B 220 ? 0.3267 0.3962 0.4019 -0.0181 -0.0236 0.0049  515 ARG B CB  
3551 C CG  . ARG B 220 ? 0.3694 0.4679 0.4764 -0.0157 -0.0340 0.0128  515 ARG B CG  
3552 C CD  . ARG B 220 ? 0.3863 0.4892 0.4751 -0.0058 -0.0444 0.0253  515 ARG B CD  
3553 N NE  . ARG B 220 ? 0.4853 0.5914 0.5746 0.0044  -0.0514 0.0351  515 ARG B NE  
3554 C CZ  . ARG B 220 ? 0.5307 0.6587 0.6391 0.0133  -0.0635 0.0478  515 ARG B CZ  
3555 N NH1 . ARG B 220 ? 0.4782 0.6269 0.6058 0.0137  -0.0701 0.0524  515 ARG B NH1 
3556 N NH2 . ARG B 220 ? 0.5633 0.6922 0.6712 0.0221  -0.0690 0.0562  515 ARG B NH2 
3557 N N   . HIS B 221 ? 0.3622 0.2574 0.3276 0.0221  0.0035  -0.0082 516 HIS B N   
3558 C CA  . HIS B 221 ? 0.4089 0.3097 0.3945 0.0245  0.0009  0.0004  516 HIS B CA  
3559 C C   . HIS B 221 ? 0.4516 0.3602 0.4546 0.0215  -0.0026 0.0031  516 HIS B C   
3560 O O   . HIS B 221 ? 0.3937 0.3044 0.4067 0.0172  -0.0101 0.0057  516 HIS B O   
3561 C CB  . HIS B 221 ? 0.4038 0.3072 0.3961 0.0332  0.0096  0.0069  516 HIS B CB  
3562 C CG  . HIS B 221 ? 0.5350 0.4445 0.5485 0.0364  0.0075  0.0167  516 HIS B CG  
3563 N ND1 . HIS B 221 ? 0.5621 0.4696 0.5781 0.0353  0.0019  0.0202  516 HIS B ND1 
3564 C CD2 . HIS B 221 ? 0.4995 0.4178 0.5330 0.0406  0.0103  0.0241  516 HIS B CD2 
3565 C CE1 . HIS B 221 ? 0.4724 0.3877 0.5091 0.0386  0.0013  0.0297  516 HIS B CE1 
3566 N NE2 . HIS B 221 ? 0.3937 0.3152 0.4413 0.0419  0.0063  0.0320  516 HIS B NE2 
3567 N N   . MET B 222 ? 0.3885 0.3014 0.3946 0.0235  0.0033  0.0025  517 MET B N   
3568 C CA  . MET B 222 ? 0.3485 0.2680 0.3704 0.0209  0.0017  0.0045  517 MET B CA  
3569 C C   . MET B 222 ? 0.3375 0.2529 0.3552 0.0115  -0.0065 -0.0008 517 MET B C   
3570 O O   . MET B 222 ? 0.3409 0.2599 0.3725 0.0074  -0.0117 0.0020  517 MET B O   
3571 C CB  . MET B 222 ? 0.3276 0.2516 0.3502 0.0244  0.0100  0.0040  517 MET B CB  
3572 C CG  . MET B 222 ? 0.3901 0.3199 0.4210 0.0331  0.0182  0.0103  517 MET B CG  
3573 S SD  . MET B 222 ? 0.4056 0.3431 0.4395 0.0371  0.0276  0.0110  517 MET B SD  
3574 C CE  . MET B 222 ? 0.3576 0.2888 0.3644 0.0340  0.0296  0.0021  517 MET B CE  
3575 N N   . SER B 223 ? 0.3988 0.3065 0.3970 0.0077  -0.0076 -0.0087 518 SER B N   
3576 C CA  . SER B 223 ? 0.4317 0.3340 0.4236 -0.0015 -0.0151 -0.0145 518 SER B CA  
3577 C C   . SER B 223 ? 0.4013 0.3027 0.3976 -0.0057 -0.0240 -0.0122 518 SER B C   
3578 O O   . SER B 223 ? 0.3523 0.2551 0.3569 -0.0125 -0.0298 -0.0121 518 SER B O   
3579 C CB  . SER B 223 ? 0.4876 0.3815 0.4568 -0.0040 -0.0146 -0.0228 518 SER B CB  
3580 O OG  . SER B 223 ? 0.4991 0.3863 0.4607 -0.0127 -0.0224 -0.0283 518 SER B OG  
3581 N N   . ASN B 224 ? 0.3875 0.2868 0.3783 -0.0020 -0.0247 -0.0101 519 ASN B N   
3582 C CA  . ASN B 224 ? 0.3226 0.2228 0.3187 -0.0051 -0.0326 -0.0064 519 ASN B CA  
3583 C C   . ASN B 224 ? 0.4467 0.3567 0.4658 -0.0058 -0.0352 0.0016  519 ASN B C   
3584 O O   . ASN B 224 ? 0.4220 0.3340 0.4464 -0.0132 -0.0433 0.0023  519 ASN B O   
3585 C CB  . ASN B 224 ? 0.3798 0.2775 0.3702 0.0012  -0.0303 -0.0032 519 ASN B CB  
3586 C CG  . ASN B 224 ? 0.4996 0.3868 0.4661 0.0002  -0.0295 -0.0114 519 ASN B CG  
3587 O OD1 . ASN B 224 ? 0.5665 0.4484 0.5213 -0.0067