data_3OUY
# 
_entry.id   3OUY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OUY         
NDB   NA0758       
RCSB  RCSB061605   
WWPDB D_1000061605 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OV7 . unspecified 
PDB 3OVA . unspecified 
PDB 3OVB . unspecified 
PDB 3OVS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OUY 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, B.C.'    1 
'Xiong, Y.'    2 
'Steitz, T.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            330 
_citation.page_first                937 
_citation.page_last                 940 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21071662 
_citation.pdbx_database_id_DOI      10.1126/science.1194985 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, B.'      1 
primary 'Xiong, Y.'    2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           3OUY 
_cell.length_a           111.217 
_cell.length_b           228.075 
_cell.length_c           58.459 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OUY 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CCA-Adding Enzyme' 51909.758 1   '2.7.7.25, 2.7.7.21' ? ? ? 
2 polymer     nat 'CCA-Adding Enzyme' 51469.137 1   '2.7.7.25, 2.7.7.21' ? ? ? 
3 polymer     syn 'RNA (35-MER)'      11166.653 2   ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'       96.063    3   ?                    ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL      62.068    1   ?                    ? ? ? 
6 non-polymer syn 'PYROPHOSPHATE 2-'  175.959   2   ?                    ? ? ? 
7 water       nat water               18.015    137 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
2 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCM
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCM
;
A   ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
B   ? 
3 polyribonucleotide no no GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 CYS n 
1 439 CYS n 
1 440 CYS n 
1 441 MET n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
3 1   G   n 
3 2   G   n 
3 3   A   n 
3 4   A   n 
3 5   G   n 
3 6   U   n 
3 7   A   n 
3 8   G   n 
3 9   A   n 
3 10  U   n 
3 11  G   n 
3 12  G   n 
3 13  U   n 
3 14  U   n 
3 15  C   n 
3 16  A   n 
3 17  A   n 
3 18  G   n 
3 19  U   n 
3 20  C   n 
3 21  C   n 
3 22  A   n 
3 23  U   n 
3 24  U   n 
3 25  U   n 
3 26  A   n 
3 27  C   n 
3 28  U   n 
3 29  U   n 
3 30  C   n 
3 31  C   n 
3 32  A   n 
3 33  C   n 
3 34  C   n 
3 35  A   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Archaeoglobus fulgidus' 2234 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Archaeoglobus fulgidus' 2234 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemical synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 O28126 ? 
2 UNP CCA_ARCFU 2 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 O28126 ? 
3 PDB 3OUY      3 ? ? 3OUY   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OUY A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 3OUY B 1 ? 437 ? O28126 1 ? 437 ? 1 437 
3 3 3OUY C 1 ? 35  ? 3OUY   1 ? 35  ? 1 35  
4 3 3OUY D 1 ? 35  ? 3OUY   1 ? 35  ? 1 35  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OUY CYS A 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 1 
1 3OUY CYS A 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 2 
1 3OUY CYS A 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 3 
1 3OUY MET A 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ?                 'C3 H7 N O2 S'    121.158 
EDO non-polymer         . 1,2-ETHANEDIOL               'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                 'C9 H11 N O2'     165.189 
POP non-polymer         . 'PYROPHOSPHATE 2-'           ?                 'H2 O7 P2 -2'     175.959 
PRO 'L-peptide linking' y PROLINE                      ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ?                 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ?                 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3OUY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 0.2 M tri-lithium citrate, 80 mM ammonium sulfate, 50 mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-10-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3OUY 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.69 
_reflns.number_obs                   47752 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.163 
_reflns.pdbx_netI_over_sigmaI        13.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.69 2.82 86.5 ? 0.891 ? ? ? ? ? ? ? ? ? 1 
2.82 2.96 86.4 ? 0.703 ? ? ? ? ? ? ? ? ? 2 
2.96 3.15 87.1 ? 0.466 ? ? ? ? ? ? ? ? ? 3 
3.15 3.39 90.3 ? 0.301 ? ? ? ? ? ? ? ? ? 4 
3.39 3.73 95.0 ? 0.218 ? ? ? ? ? ? ? ? ? 5 
3.73 4.27 98.4 ? 0.174 ? ? ? ? ? ? ? ? ? 6 
# 
_refine.entry_id                                 3OUY 
_refine.ls_number_reflns_obs                     37297 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.69 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.20935 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20651 
_refine.ls_R_factor_R_free                       0.26374 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1968 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.878 
_refine.B_iso_mean                               57.430 
_refine.aniso_B[1][1]                            -0.18 
_refine.aniso_B[2][2]                            0.17 
_refine.aniso_B[3][3]                            0.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.353 
_refine.overall_SU_ML                            0.287 
_refine.overall_SU_B                             29.283 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7284 
_refine_hist.pdbx_number_atoms_nucleic_acid   1484 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             137 
_refine_hist.number_atoms_total               8942 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 9129  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.431  2.180  ? 12616 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.843  5.000  ? 876   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.247 22.784 ? 388   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.489 15.000 ? 1396  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.516 15.000 ? 80    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.092  0.200  ? 1388  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 6400  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.217  0.200  ? 4170  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.311  0.200  ? 6129  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.148  0.200  ? 302   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.177  0.200  ? 42    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.227  0.200  ? 6     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.454  1.500  ? 4474  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.820  2.000  ? 7068  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.156  3.000  ? 5637  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.958  4.500  ? 5548  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.690 
_refine_ls_shell.d_res_low                        2.760 
_refine_ls_shell.number_reflns_R_work             2500 
_refine_ls_shell.R_factor_R_work                  0.321 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             143 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OUY 
_struct.title                     'How the CCA-adding Enzyme Selects Adenine Over Cytosine at Position 76 of tRNA' 
_struct.pdbx_descriptor           'CCA-Adding Enzyme (E.C.2.7.7.25, 2.7.7.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OUY 
_struct_keywords.pdbx_keywords   Transferase/RNA 
_struct_keywords.text            'Protein-RNA complex, Rossmann Fold, CCA-Adding, tRNA, Phospholation, Transferase-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 4 ? 
I N N 6 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 2   ? LEU A 13  ? LYS A 2   LEU A 13  1 ? 12 
HELX_P HELX_P2  2  ASP A 17  ? LEU A 38  ? ASP A 17  LEU A 38  1 ? 22 
HELX_P HELX_P3  3  SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P4  4  ARG A 129 ? GLU A 138 ? ARG A 129 GLU A 138 1 ? 10 
HELX_P HELX_P5  5  LYS A 144 ? ALA A 157 ? LYS A 144 ALA A 157 1 ? 14 
HELX_P HELX_P6  6  SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P7  7  SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P8  8  SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P9  9  SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P10 10 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P11 11 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P12 12 ASP A 351 ? LEU A 359 ? ASP A 351 LEU A 359 1 ? 9  
HELX_P HELX_P13 13 THR A 384 ? TRP A 397 ? THR A 384 TRP A 397 1 ? 14 
HELX_P HELX_P14 14 HIS A 398 ? LEU A 400 ? HIS A 398 LEU A 400 5 ? 3  
HELX_P HELX_P15 15 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P16 16 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P17 17 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P18 18 LYS B 2   ? ILE B 15  ? LYS B 2   ILE B 15  1 ? 14 
HELX_P HELX_P19 19 ASP B 17  ? GLU B 37  ? ASP B 17  GLU B 37  1 ? 21 
HELX_P HELX_P20 20 SER B 47  ? ASN B 51  ? SER B 47  ASN B 51  5 ? 5  
HELX_P HELX_P21 21 SER B 71  ? LEU B 87  ? SER B 71  LEU B 87  1 ? 17 
HELX_P HELX_P22 22 ARG B 129 ? GLU B 138 ? ARG B 129 GLU B 138 1 ? 10 
HELX_P HELX_P23 23 LYS B 144 ? ASN B 158 ? LYS B 144 ASN B 158 1 ? 15 
HELX_P HELX_P24 24 TYR B 173 ? GLY B 183 ? TYR B 173 GLY B 183 1 ? 11 
HELX_P HELX_P25 25 SER B 184 ? ARG B 193 ? SER B 184 ARG B 193 1 ? 10 
HELX_P HELX_P26 26 SER B 231 ? ALA B 248 ? SER B 231 ALA B 248 1 ? 18 
HELX_P HELX_P27 27 SER B 250 ? PHE B 254 ? SER B 250 PHE B 254 5 ? 5  
HELX_P HELX_P28 28 GLU B 263 ? GLY B 275 ? GLU B 263 GLY B 275 1 ? 13 
HELX_P HELX_P29 29 VAL B 289 ? GLU B 311 ? VAL B 289 GLU B 311 1 ? 23 
HELX_P HELX_P30 30 ASP B 351 ? SER B 360 ? ASP B 351 SER B 360 1 ? 10 
HELX_P HELX_P31 31 THR B 384 ? TRP B 397 ? THR B 384 TRP B 397 1 ? 14 
HELX_P HELX_P32 32 HIS B 398 ? LEU B 400 ? HIS B 398 LEU B 400 5 ? 3  
HELX_P HELX_P33 33 GLY B 401 ? TYR B 411 ? GLY B 401 TYR B 411 1 ? 11 
HELX_P HELX_P34 34 GLY B 417 ? LYS B 422 ? GLY B 417 LYS B 422 1 ? 6  
HELX_P HELX_P35 35 VAL B 425 ? GLY B 434 ? VAL B 425 GLY B 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C G 1  N1 ? ? ? 1_555 C C 31 N3 ? ? C G 1  C C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C G 1  N2 ? ? ? 1_555 C C 31 O2 ? ? C G 1  C C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C G 1  O6 ? ? ? 1_555 C C 31 N4 ? ? C G 1  C C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C G 2  N1 ? ? ? 1_555 C C 30 N3 ? ? C G 2  C C 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C G 2  N2 ? ? ? 1_555 C C 30 O2 ? ? C G 2  C C 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C G 2  O6 ? ? ? 1_555 C C 30 N4 ? ? C G 2  C C 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C A 3  N1 ? ? ? 1_555 C U 29 N3 ? ? C A 3  C U 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C A 3  N6 ? ? ? 1_555 C U 29 O4 ? ? C A 3  C U 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C A 4  N1 ? ? ? 1_555 C U 28 N3 ? ? C A 4  C U 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C A 4  N6 ? ? ? 1_555 C U 28 O4 ? ? C A 4  C U 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C G 5  N1 ? ? ? 1_555 C C 27 N3 ? ? C G 5  C C 27 1_555 ? ? ? ? ? ? 'G-C PAIR'   ? ? 
hydrog12 hydrog ? ? C U 6  N3 ? ? ? 1_555 C A 26 N1 ? ? C U 6  C A 26 1_555 ? ? ? ? ? ? 'U-A PAIR'   ? ? 
hydrog13 hydrog ? ? C A 7  N1 ? ? ? 1_555 C U 25 N3 ? ? C A 7  C U 25 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog14 hydrog ? ? C G 8  N1 ? ? ? 1_555 C U 24 O2 ? ? C G 8  C U 24 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15 hydrog ? ? C G 8  O6 ? ? ? 1_555 C U 24 N3 ? ? C G 8  C U 24 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog16 hydrog ? ? C A 9  N1 ? ? ? 1_555 C U 23 N3 ? ? C A 9  C U 23 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog17 hydrog ? ? C U 10 N3 ? ? ? 1_555 C A 22 N1 ? ? C U 10 C A 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C U 10 O4 ? ? ? 1_555 C A 22 N6 ? ? C U 10 C A 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C G 11 N1 ? ? ? 1_555 C C 21 N3 ? ? C G 11 C C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C G 11 N2 ? ? ? 1_555 C C 21 O2 ? ? C G 11 C C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C G 11 O6 ? ? ? 1_555 C C 21 N4 ? ? C G 11 C C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C G 12 N1 ? ? ? 1_555 C C 20 N3 ? ? C G 12 C C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C G 12 N2 ? ? ? 1_555 C C 20 O2 ? ? C G 12 C C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C G 12 O6 ? ? ? 1_555 C C 20 N4 ? ? C G 12 C C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? D G 1  N1 ? ? ? 1_555 D C 31 N3 ? ? D G 1  D C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? D G 1  N2 ? ? ? 1_555 D C 31 O2 ? ? D G 1  D C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? D G 1  O6 ? ? ? 1_555 D C 31 N4 ? ? D G 1  D C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? D G 2  N1 ? ? ? 1_555 D C 30 N3 ? ? D G 2  D C 30 1_555 ? ? ? ? ? ? 'G-C PAIR'   ? ? 
hydrog29 hydrog ? ? D A 3  N1 ? ? ? 1_555 D U 29 N3 ? ? D A 3  D U 29 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog30 hydrog ? ? D A 4  N1 ? ? ? 1_555 D U 28 N3 ? ? D A 4  D U 28 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog31 hydrog ? ? D G 5  N2 ? ? ? 1_555 D C 27 O2 ? ? D G 5  D C 27 1_555 ? ? ? ? ? ? 'G-C PAIR'   ? ? 
hydrog32 hydrog ? ? D U 6  N3 ? ? ? 1_555 D A 26 N1 ? ? D U 6  D A 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? D U 6  O4 ? ? ? 1_555 D A 26 N6 ? ? D U 6  D A 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? D A 7  N1 ? ? ? 1_555 D U 25 N3 ? ? D A 7  D U 25 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog35 hydrog ? ? D G 8  N1 ? ? ? 1_555 D U 24 O2 ? ? D G 8  D U 24 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog36 hydrog ? ? D G 8  O6 ? ? ? 1_555 D U 24 N3 ? ? D G 8  D U 24 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog37 hydrog ? ? D A 9  N1 ? ? ? 1_555 D U 23 N3 ? ? D A 9  D U 23 1_555 ? ? ? ? ? ? 'A-U PAIR'   ? ? 
hydrog38 hydrog ? ? D U 10 N3 ? ? ? 1_555 D A 22 N1 ? ? D U 10 D A 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? D U 10 O4 ? ? ? 1_555 D A 22 N6 ? ? D U 10 D A 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? D G 11 N1 ? ? ? 1_555 D C 21 N3 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? D G 11 N2 ? ? ? 1_555 D C 21 O2 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? D G 11 O6 ? ? ? 1_555 D C 21 N4 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? D G 12 N1 ? ? ? 1_555 D C 20 N3 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? D G 12 N2 ? ? ? 1_555 D C 20 O2 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? D G 12 O6 ? ? ? 1_555 D C 20 N4 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
F ? 5 ? 
G ? 3 ? 
H ? 4 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
A 2 GLU A 59  ? PHE A 66  ? GLU A 59  PHE A 66  
A 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
A 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 
A 5 SER A 89  ? GLU A 91  ? SER A 89  GLU A 91  
B 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
B 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
B 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
B 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
C 1 HIS A 258 ? PRO A 259 ? HIS A 258 PRO A 259 
C 2 CYS A 439 ? CYS A 440 ? CYS A 439 CYS A 440 
D 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
D 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
D 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
D 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
E 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
E 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
E 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
F 1 TYR B 42  ? VAL B 45  ? TYR B 42  VAL B 45  
F 2 GLU B 59  ? PHE B 66  ? GLU B 59  PHE B 66  
F 3 VAL B 107 ? TYR B 115 ? VAL B 107 TYR B 115 
F 4 VAL B 100 ? VAL B 104 ? VAL B 100 VAL B 104 
F 5 SER B 89  ? GLU B 91  ? SER B 89  GLU B 91  
G 1 GLU B 207 ? LYS B 210 ? GLU B 207 LYS B 210 
G 2 THR B 199 ? ASP B 202 ? THR B 199 ASP B 202 
G 3 PHE B 215 ? VAL B 217 ? PHE B 215 VAL B 217 
H 1 PRO B 315 ? ALA B 322 ? PRO B 315 ALA B 322 
H 2 PHE B 326 ? CYS B 333 ? PHE B 326 CYS B 333 
H 3 ALA B 277 ? ARG B 284 ? ALA B 277 ARG B 284 
H 4 GLU B 413 ? SER B 416 ? GLU B 413 SER B 416 
I 1 VAL B 341 ? GLN B 348 ? VAL B 341 GLN B 348 
I 2 ARG B 373 ? MET B 379 ? ARG B 373 MET B 379 
I 3 PHE B 368 ? GLU B 370 ? PHE B 368 GLU B 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
A 2 3 N ILE A 60  ? N ILE A 60  O GLU A 108 ? O GLU A 108 
A 3 4 O VAL A 107 ? O VAL A 107 N VAL A 104 ? N VAL A 104 
A 4 5 O HIS A 101 ? O HIS A 101 N GLU A 91  ? N GLU A 91  
B 1 2 O GLU A 207 ? O GLU A 207 N ASP A 202 ? N ASP A 202 
B 2 3 N ILE A 201 ? N ILE A 201 O PHE A 215 ? O PHE A 215 
B 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
C 1 2 N HIS A 258 ? N HIS A 258 O CYS A 440 ? O CYS A 440 
D 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
D 2 3 O CYS A 333 ? O CYS A 333 N ALA A 277 ? N ALA A 277 
D 3 4 N LYS A 282 ? N LYS A 282 O GLU A 413 ? O GLU A 413 
E 1 2 N PHE A 342 ? N PHE A 342 O GLU A 378 ? O GLU A 378 
E 2 3 O ARG A 373 ? O ARG A 373 N GLU A 370 ? N GLU A 370 
F 1 2 N VAL B 43  ? N VAL B 43  O PHE B 63  ? O PHE B 63  
F 2 3 N VAL B 62  ? N VAL B 62  O ASP B 110 ? O ASP B 110 
F 3 4 O VAL B 109 ? O VAL B 109 N GLY B 102 ? N GLY B 102 
F 4 5 O HIS B 101 ? O HIS B 101 N GLU B 91  ? N GLU B 91  
G 1 2 O ARG B 209 ? O ARG B 209 N VAL B 200 ? N VAL B 200 
G 2 3 N ILE B 201 ? N ILE B 201 O VAL B 217 ? O VAL B 217 
H 1 2 N LEU B 316 ? N LEU B 316 O GLU B 332 ? O GLU B 332 
H 2 3 O PHE B 331 ? O PHE B 331 N PHE B 279 ? N PHE B 279 
H 3 4 N ALA B 280 ? N ALA B 280 O ILE B 415 ? O ILE B 415 
I 1 2 N GLY B 346 ? N GLY B 346 O TRP B 374 ? O TRP B 374 
I 2 3 O ARG B 373 ? O ARG B 373 N GLU B 370 ? N GLU B 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 601' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 602' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 801' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 603' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE POP B 702' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE POP C 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG A 299 ? ARG A 299 . ? 1_555 ? 
2  AC1 4 ARG A 302 ? ARG A 302 . ? 1_555 ? 
3  AC1 4 LYS A 303 ? LYS A 303 . ? 1_555 ? 
4  AC1 4 HOH K .   ? HOH A 475 . ? 1_555 ? 
5  AC2 3 VAL A 289 ? VAL A 289 . ? 1_555 ? 
6  AC2 3 ASP A 290 ? ASP A 290 . ? 1_555 ? 
7  AC2 3 HOH K .   ? HOH A 456 . ? 1_555 ? 
8  AC3 3 VAL A 40  ? VAL A 40  . ? 1_555 ? 
9  AC3 3 GLU A 41  ? GLU A 41  . ? 1_555 ? 
10 AC3 3 LEU A 65  ? LEU A 65  . ? 1_555 ? 
11 AC4 3 ARG B 299 ? ARG B 299 . ? 1_555 ? 
12 AC4 3 ARG B 302 ? ARG B 302 . ? 1_555 ? 
13 AC4 3 LYS B 303 ? LYS B 303 . ? 1_555 ? 
14 AC5 6 GLY B 46  ? GLY B 46  . ? 1_555 ? 
15 AC5 6 SER B 47  ? SER B 47  . ? 1_555 ? 
16 AC5 6 ASP B 61  ? ASP B 61  . ? 1_555 ? 
17 AC5 6 LYS B 152 ? LYS B 152 . ? 1_555 ? 
18 AC5 6 TYR B 161 ? TYR B 161 . ? 1_555 ? 
19 AC5 6 A   D 35  ? A   D 35  . ? 1_555 ? 
20 AC6 7 GLY A 46  ? GLY A 46  . ? 1_555 ? 
21 AC6 7 SER A 47  ? SER A 47  . ? 1_555 ? 
22 AC6 7 ASP A 61  ? ASP A 61  . ? 1_555 ? 
23 AC6 7 LYS A 152 ? LYS A 152 . ? 1_555 ? 
24 AC6 7 TYR A 161 ? TYR A 161 . ? 1_555 ? 
25 AC6 7 HOH K .   ? HOH A 543 . ? 1_555 ? 
26 AC6 7 A   C 35  ? A   C 35  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OUY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OUY 
_atom_sites.fract_transf_matrix[1][1]   0.008991 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004385 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017106 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? 13.029 55.650  -15.387 1.00 84.19  ? 1   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? 14.422 56.069  -15.742 1.00 81.40  ? 1   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? 15.219 54.953  -16.427 1.00 78.88  ? 1   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? 15.564 53.936  -15.805 1.00 76.73  ? 1   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? 15.168 56.577  -14.498 1.00 79.07  ? 1   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? 14.817 58.015  -14.095 1.00 81.34  ? 1   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? 16.015 58.792  -12.976 1.00 78.66  ? 1   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? 17.414 59.029  -14.071 1.00 76.51  ? 1   MET A CE    1 
ATOM   9    N N     . LYS A 1 2   ? 15.506 55.144  -17.713 1.00 79.14  ? 2   LYS A N     1 
ATOM   10   C CA    . LYS A 1 2   ? 16.330 54.190  -18.445 1.00 76.79  ? 2   LYS A CA    1 
ATOM   11   C C     . LYS A 1 2   ? 17.745 54.186  -17.876 1.00 72.58  ? 2   LYS A C     1 
ATOM   12   O O     . LYS A 1 2   ? 18.213 55.197  -17.343 1.00 71.73  ? 2   LYS A O     1 
ATOM   13   C CB    . LYS A 1 2   ? 16.353 54.504  -19.945 1.00 78.84  ? 2   LYS A CB    1 
ATOM   14   C CG    . LYS A 1 2   ? 15.231 53.845  -20.742 1.00 81.98  ? 2   LYS A CG    1 
ATOM   15   C CD    . LYS A 1 2   ? 14.174 54.853  -21.167 1.00 85.88  ? 2   LYS A CD    1 
ATOM   16   C CE    . LYS A 1 2   ? 14.540 55.526  -22.489 1.00 86.02  ? 2   LYS A CE    1 
ATOM   17   N NZ    . LYS A 1 2   ? 13.636 56.667  -22.781 1.00 88.79  ? 2   LYS A NZ    1 
ATOM   18   N N     . VAL A 1 3   ? 18.422 53.049  -17.994 1.00 69.86  ? 3   VAL A N     1 
ATOM   19   C CA    . VAL A 1 3   ? 19.773 52.904  -17.451 1.00 65.99  ? 3   VAL A CA    1 
ATOM   20   C C     . VAL A 1 3   ? 20.757 53.958  -17.994 1.00 65.08  ? 3   VAL A C     1 
ATOM   21   O O     . VAL A 1 3   ? 21.663 54.392  -17.299 1.00 63.44  ? 3   VAL A O     1 
ATOM   22   C CB    . VAL A 1 3   ? 20.297 51.435  -17.591 1.00 64.26  ? 3   VAL A CB    1 
ATOM   23   C CG1   . VAL A 1 3   ? 20.581 51.062  -19.037 1.00 65.21  ? 3   VAL A CG1   1 
ATOM   24   C CG2   . VAL A 1 3   ? 21.507 51.204  -16.724 1.00 61.04  ? 3   VAL A CG2   1 
ATOM   25   N N     . GLU A 1 4   ? 20.539 54.406  -19.219 1.00 66.79  ? 4   GLU A N     1 
ATOM   26   C CA    . GLU A 1 4   ? 21.435 55.359  -19.874 1.00 66.19  ? 4   GLU A CA    1 
ATOM   27   C C     . GLU A 1 4   ? 21.178 56.783  -19.381 1.00 66.54  ? 4   GLU A C     1 
ATOM   28   O O     . GLU A 1 4   ? 21.984 57.685  -19.601 1.00 66.10  ? 4   GLU A O     1 
ATOM   29   C CB    . GLU A 1 4   ? 21.268 55.274  -21.405 1.00 68.63  ? 4   GLU A CB    1 
ATOM   30   C CG    . GLU A 1 4   ? 21.333 53.832  -22.006 1.00 69.44  ? 4   GLU A CG    1 
ATOM   31   C CD    . GLU A 1 4   ? 19.953 53.114  -22.144 1.00 73.18  ? 4   GLU A CD    1 
ATOM   32   O OE1   . GLU A 1 4   ? 19.672 52.577  -23.243 1.00 75.75  ? 4   GLU A OE1   1 
ATOM   33   O OE2   . GLU A 1 4   ? 19.157 53.068  -21.172 1.00 73.04  ? 4   GLU A OE2   1 
ATOM   34   N N     . GLU A 1 5   ? 20.048 56.968  -18.708 1.00 67.12  ? 5   GLU A N     1 
ATOM   35   C CA    . GLU A 1 5   ? 19.612 58.273  -18.241 1.00 68.07  ? 5   GLU A CA    1 
ATOM   36   C C     . GLU A 1 5   ? 20.148 58.519  -16.830 1.00 64.53  ? 5   GLU A C     1 
ATOM   37   O O     . GLU A 1 5   ? 20.586 59.620  -16.504 1.00 64.92  ? 5   GLU A O     1 
ATOM   38   C CB    . GLU A 1 5   ? 18.081 58.327  -18.270 1.00 71.46  ? 5   GLU A CB    1 
ATOM   39   C CG    . GLU A 1 5   ? 17.437 59.661  -17.867 1.00 74.94  ? 5   GLU A CG    1 
ATOM   40   C CD    . GLU A 1 5   ? 15.995 59.485  -17.357 1.00 77.51  ? 5   GLU A CD    1 
ATOM   41   O OE1   . GLU A 1 5   ? 15.213 58.730  -17.988 1.00 80.56  ? 5   GLU A OE1   1 
ATOM   42   O OE2   . GLU A 1 5   ? 15.645 60.097  -16.319 1.00 79.17  ? 5   GLU A OE2   1 
ATOM   43   N N     . ILE A 1 6   ? 20.103 57.485  -16.001 1.00 61.01  ? 6   ILE A N     1 
ATOM   44   C CA    . ILE A 1 6   ? 20.696 57.502  -14.666 1.00 57.38  ? 6   ILE A CA    1 
ATOM   45   C C     . ILE A 1 6   ? 22.195 57.853  -14.739 1.00 54.63  ? 6   ILE A C     1 
ATOM   46   O O     . ILE A 1 6   ? 22.718 58.636  -13.936 1.00 53.60  ? 6   ILE A O     1 
ATOM   47   C CB    . ILE A 1 6   ? 20.476 56.124  -13.974 1.00 55.62  ? 6   ILE A CB    1 
ATOM   48   C CG1   . ILE A 1 6   ? 18.986 55.897  -13.733 1.00 57.50  ? 6   ILE A CG1   1 
ATOM   49   C CG2   . ILE A 1 6   ? 21.210 56.041  -12.667 1.00 52.81  ? 6   ILE A CG2   1 
ATOM   50   C CD1   . ILE A 1 6   ? 18.526 54.519  -14.000 1.00 56.32  ? 6   ILE A CD1   1 
ATOM   51   N N     . LEU A 1 7   ? 22.870 57.271  -15.723 1.00 52.83  ? 7   LEU A N     1 
ATOM   52   C CA    . LEU A 1 7   ? 24.282 57.497  -15.925 1.00 50.04  ? 7   LEU A CA    1 
ATOM   53   C C     . LEU A 1 7   ? 24.597 58.933  -16.322 1.00 51.31  ? 7   LEU A C     1 
ATOM   54   O O     . LEU A 1 7   ? 25.529 59.522  -15.800 1.00 50.11  ? 7   LEU A O     1 
ATOM   55   C CB    . LEU A 1 7   ? 24.825 56.512  -16.949 1.00 48.79  ? 7   LEU A CB    1 
ATOM   56   C CG    . LEU A 1 7   ? 24.762 55.056  -16.517 1.00 46.15  ? 7   LEU A CG    1 
ATOM   57   C CD1   . LEU A 1 7   ? 25.440 54.212  -17.559 1.00 43.66  ? 7   LEU A CD1   1 
ATOM   58   C CD2   . LEU A 1 7   ? 25.405 54.852  -15.152 1.00 42.94  ? 7   LEU A CD2   1 
ATOM   59   N N     . GLU A 1 8   ? 23.821 59.508  -17.226 1.00 53.95  ? 8   GLU A N     1 
ATOM   60   C CA    . GLU A 1 8   ? 24.009 60.917  -17.532 1.00 56.20  ? 8   GLU A CA    1 
ATOM   61   C C     . GLU A 1 8   ? 23.902 61.835  -16.309 1.00 56.02  ? 8   GLU A C     1 
ATOM   62   O O     . GLU A 1 8   ? 24.701 62.764  -16.170 1.00 56.02  ? 8   GLU A O     1 
ATOM   63   C CB    . GLU A 1 8   ? 23.098 61.385  -18.666 1.00 59.85  ? 8   GLU A CB    1 
ATOM   64   C CG    . GLU A 1 8   ? 23.779 61.341  -20.052 1.00 63.01  ? 8   GLU A CG    1 
ATOM   65   C CD    . GLU A 1 8   ? 24.850 62.435  -20.269 1.00 66.39  ? 8   GLU A CD    1 
ATOM   66   O OE1   . GLU A 1 8   ? 25.178 63.185  -19.316 1.00 67.46  ? 8   GLU A OE1   1 
ATOM   67   O OE2   . GLU A 1 8   ? 25.361 62.548  -21.412 1.00 68.27  ? 8   GLU A OE2   1 
ATOM   68   N N     . LYS A 1 9   ? 22.936 61.573  -15.427 1.00 56.03  ? 9   LYS A N     1 
ATOM   69   C CA    . LYS A 1 9   ? 22.869 62.270  -14.133 1.00 55.72  ? 9   LYS A CA    1 
ATOM   70   C C     . LYS A 1 9   ? 24.042 61.882  -13.214 1.00 52.34  ? 9   LYS A C     1 
ATOM   71   O O     . LYS A 1 9   ? 24.535 62.714  -12.450 1.00 52.39  ? 9   LYS A O     1 
ATOM   72   C CB    . LYS A 1 9   ? 21.549 61.998  -13.394 1.00 57.02  ? 9   LYS A CB    1 
ATOM   73   C CG    . LYS A 1 9   ? 20.277 62.427  -14.090 1.00 60.73  ? 9   LYS A CG    1 
ATOM   74   C CD    . LYS A 1 9   ? 19.227 62.785  -13.047 1.00 63.83  ? 9   LYS A CD    1 
ATOM   75   C CE    . LYS A 1 9   ? 17.808 62.420  -13.474 1.00 67.02  ? 9   LYS A CE    1 
ATOM   76   N NZ    . LYS A 1 9   ? 17.362 63.066  -14.743 1.00 70.53  ? 9   LYS A NZ    1 
ATOM   77   N N     . ALA A 1 10  ? 24.475 60.626  -13.278 1.00 49.52  ? 10  ALA A N     1 
ATOM   78   C CA    . ALA A 1 10  ? 25.570 60.162  -12.428 1.00 46.90  ? 10  ALA A CA    1 
ATOM   79   C C     . ALA A 1 10  ? 26.915 60.801  -12.787 1.00 46.26  ? 10  ALA A C     1 
ATOM   80   O O     . ALA A 1 10  ? 27.825 60.851  -11.964 1.00 44.92  ? 10  ALA A O     1 
ATOM   81   C CB    . ALA A 1 10  ? 25.669 58.649  -12.456 1.00 44.78  ? 10  ALA A CB    1 
ATOM   82   N N     . LEU A 1 11  ? 27.032 61.298  -14.014 1.00 47.50  ? 11  LEU A N     1 
ATOM   83   C CA    . LEU A 1 11  ? 28.243 61.970  -14.447 1.00 47.30  ? 11  LEU A CA    1 
ATOM   84   C C     . LEU A 1 11  ? 28.431 63.272  -13.697 1.00 48.75  ? 11  LEU A C     1 
ATOM   85   O O     . LEU A 1 11  ? 29.551 63.648  -13.417 1.00 48.18  ? 11  LEU A O     1 
ATOM   86   C CB    . LEU A 1 11  ? 28.231 62.222  -15.955 1.00 48.59  ? 11  LEU A CB    1 
ATOM   87   C CG    . LEU A 1 11  ? 28.250 61.010  -16.898 1.00 47.43  ? 11  LEU A CG    1 
ATOM   88   C CD1   . LEU A 1 11  ? 27.831 61.388  -18.314 1.00 48.66  ? 11  LEU A CD1   1 
ATOM   89   C CD2   . LEU A 1 11  ? 29.600 60.329  -16.910 1.00 45.04  ? 11  LEU A CD2   1 
ATOM   90   N N     . GLU A 1 12  ? 27.338 63.953  -13.363 1.00 51.50  ? 12  GLU A N     1 
ATOM   91   C CA    . GLU A 1 12  ? 27.407 65.189  -12.566 1.00 53.45  ? 12  GLU A CA    1 
ATOM   92   C C     . GLU A 1 12  ? 27.980 64.965  -11.164 1.00 51.32  ? 12  GLU A C     1 
ATOM   93   O O     . GLU A 1 12  ? 28.564 65.886  -10.576 1.00 52.30  ? 12  GLU A O     1 
ATOM   94   C CB    . GLU A 1 12  ? 26.042 65.854  -12.445 1.00 56.46  ? 12  GLU A CB    1 
ATOM   95   C CG    . GLU A 1 12  ? 25.761 66.876  -13.510 1.00 63.01  ? 12  GLU A CG    1 
ATOM   96   C CD    . GLU A 1 12  ? 25.051 66.276  -14.713 1.00 68.51  ? 12  GLU A CD    1 
ATOM   97   O OE1   . GLU A 1 12  ? 23.879 65.851  -14.540 1.00 71.19  ? 12  GLU A OE1   1 
ATOM   98   O OE2   . GLU A 1 12  ? 25.655 66.240  -15.824 1.00 69.49  ? 12  GLU A OE2   1 
ATOM   99   N N     . LEU A 1 13  ? 27.796 63.761  -10.627 1.00 48.50  ? 13  LEU A N     1 
ATOM   100  C CA    . LEU A 1 13  ? 28.402 63.407  -9.348  1.00 46.38  ? 13  LEU A CA    1 
ATOM   101  C C     . LEU A 1 13  ? 29.902 63.095  -9.463  1.00 44.40  ? 13  LEU A C     1 
ATOM   102  O O     . LEU A 1 13  ? 30.589 63.031  -8.443  1.00 43.94  ? 13  LEU A O     1 
ATOM   103  C CB    . LEU A 1 13  ? 27.698 62.202  -8.702  1.00 45.29  ? 13  LEU A CB    1 
ATOM   104  C CG    . LEU A 1 13  ? 26.356 62.261  -7.966  1.00 45.79  ? 13  LEU A CG    1 
ATOM   105  C CD1   . LEU A 1 13  ? 25.990 63.690  -7.589  1.00 48.57  ? 13  LEU A CD1   1 
ATOM   106  C CD2   . LEU A 1 13  ? 25.266 61.641  -8.801  1.00 45.85  ? 13  LEU A CD2   1 
ATOM   107  N N     . VAL A 1 14  ? 30.412 62.883  -10.680 1.00 43.20  ? 14  VAL A N     1 
ATOM   108  C CA    . VAL A 1 14  ? 31.808 62.440  -10.840 1.00 40.55  ? 14  VAL A CA    1 
ATOM   109  C C     . VAL A 1 14  ? 32.710 63.309  -11.737 1.00 41.27  ? 14  VAL A C     1 
ATOM   110  O O     . VAL A 1 14  ? 33.885 63.451  -11.438 1.00 40.72  ? 14  VAL A O     1 
ATOM   111  C CB    . VAL A 1 14  ? 31.933 60.922  -11.184 1.00 38.21  ? 14  VAL A CB    1 
ATOM   112  C CG1   . VAL A 1 14  ? 31.182 60.111  -10.186 1.00 37.09  ? 14  VAL A CG1   1 
ATOM   113  C CG2   . VAL A 1 14  ? 31.393 60.609  -12.558 1.00 38.73  ? 14  VAL A CG2   1 
ATOM   114  N N     . ILE A 1 15  ? 32.189 63.893  -12.814 1.00 42.78  ? 15  ILE A N     1 
ATOM   115  C CA    . ILE A 1 15  ? 33.013 64.799  -13.643 1.00 43.99  ? 15  ILE A CA    1 
ATOM   116  C C     . ILE A 1 15  ? 33.376 66.038  -12.831 1.00 45.20  ? 15  ILE A C     1 
ATOM   117  O O     . ILE A 1 15  ? 32.496 66.720  -12.311 1.00 46.42  ? 15  ILE A O     1 
ATOM   118  C CB    . ILE A 1 15  ? 32.352 65.204  -15.010 1.00 45.82  ? 15  ILE A CB    1 
ATOM   119  C CG1   . ILE A 1 15  ? 32.499 64.115  -16.074 1.00 45.40  ? 15  ILE A CG1   1 
ATOM   120  C CG2   . ILE A 1 15  ? 33.039 66.395  -15.613 1.00 47.98  ? 15  ILE A CG2   1 
ATOM   121  C CD1   . ILE A 1 15  ? 31.870 62.802  -15.708 1.00 45.52  ? 15  ILE A CD1   1 
ATOM   122  N N     . PRO A 1 16  ? 34.681 66.307  -12.681 1.00 42.59  ? 16  PRO A N     1 
ATOM   123  C CA    . PRO A 1 16  ? 35.047 67.560  -12.045 1.00 43.47  ? 16  PRO A CA    1 
ATOM   124  C C     . PRO A 1 16  ? 34.615 68.709  -12.936 1.00 46.05  ? 16  PRO A C     1 
ATOM   125  O O     . PRO A 1 16  ? 34.741 68.630  -14.160 1.00 45.96  ? 16  PRO A O     1 
ATOM   126  C CB    . PRO A 1 16  ? 36.569 67.487  -11.964 1.00 41.31  ? 16  PRO A CB    1 
ATOM   127  C CG    . PRO A 1 16  ? 36.917 66.063  -12.228 1.00 39.56  ? 16  PRO A CG    1 
ATOM   128  C CD    . PRO A 1 16  ? 35.857 65.508  -13.069 1.00 40.27  ? 16  PRO A CD    1 
ATOM   129  N N     . ASP A 1 17  ? 34.076 69.755  -12.326 1.00 48.97  ? 17  ASP A N     1 
ATOM   130  C CA    . ASP A 1 17  ? 33.698 70.960  -13.057 1.00 52.31  ? 17  ASP A CA    1 
ATOM   131  C C     . ASP A 1 17  ? 34.929 71.867  -13.220 1.00 52.20  ? 17  ASP A C     1 
ATOM   132  O O     . ASP A 1 17  ? 35.976 71.596  -12.641 1.00 50.53  ? 17  ASP A O     1 
ATOM   133  C CB    . ASP A 1 17  ? 32.591 71.695  -12.304 1.00 55.14  ? 17  ASP A CB    1 
ATOM   134  C CG    . ASP A 1 17  ? 33.023 72.096  -10.902 1.00 56.69  ? 17  ASP A CG    1 
ATOM   135  O OD1   . ASP A 1 17  ? 33.852 71.346  -10.322 1.00 56.61  ? 17  ASP A OD1   1 
ATOM   136  O OD2   . ASP A 1 17  ? 32.551 73.143  -10.392 1.00 59.23  ? 17  ASP A OD2   1 
ATOM   137  N N     . GLU A 1 18  ? 34.779 72.952  -13.979 1.00 54.67  ? 18  GLU A N     1 
ATOM   138  C CA    . GLU A 1 18  ? 35.905 73.792  -14.433 1.00 55.08  ? 18  GLU A CA    1 
ATOM   139  C C     . GLU A 1 18  ? 36.843 74.352  -13.343 1.00 53.97  ? 18  GLU A C     1 
ATOM   140  O O     . GLU A 1 18  ? 38.055 74.217  -13.443 1.00 52.13  ? 18  GLU A O     1 
ATOM   141  C CB    . GLU A 1 18  ? 35.399 74.893  -15.397 1.00 58.15  ? 18  GLU A CB    1 
ATOM   142  C CG    . GLU A 1 18  ? 34.910 74.363  -16.777 1.00 61.39  ? 18  GLU A CG    1 
ATOM   143  C CD    . GLU A 1 18  ? 35.898 73.360  -17.440 1.00 63.49  ? 18  GLU A CD    1 
ATOM   144  O OE1   . GLU A 1 18  ? 37.091 73.720  -17.631 1.00 64.40  ? 18  GLU A OE1   1 
ATOM   145  O OE2   . GLU A 1 18  ? 35.485 72.212  -17.761 1.00 62.84  ? 18  GLU A OE2   1 
ATOM   146  N N     . GLU A 1 19  ? 36.272 74.964  -12.313 1.00 55.52  ? 19  GLU A N     1 
ATOM   147  C CA    . GLU A 1 19  ? 37.023 75.594  -11.228 1.00 55.85  ? 19  GLU A CA    1 
ATOM   148  C C     . GLU A 1 19  ? 38.089 74.675  -10.652 1.00 52.98  ? 19  GLU A C     1 
ATOM   149  O O     . GLU A 1 19  ? 39.169 75.123  -10.296 1.00 52.59  ? 19  GLU A O     1 
ATOM   150  C CB    . GLU A 1 19  ? 36.050 76.059  -10.135 1.00 58.02  ? 19  GLU A CB    1 
ATOM   151  C CG    . GLU A 1 19  ? 36.632 76.213  -8.726  1.00 59.56  ? 19  GLU A CG    1 
ATOM   152  C CD    . GLU A 1 19  ? 37.301 77.570  -8.459  1.00 63.16  ? 19  GLU A CD    1 
ATOM   153  O OE1   . GLU A 1 19  ? 38.419 77.582  -7.878  1.00 62.98  ? 19  GLU A OE1   1 
ATOM   154  O OE2   . GLU A 1 19  ? 36.713 78.616  -8.815  1.00 64.45  ? 19  GLU A OE2   1 
ATOM   155  N N     . GLU A 1 20  ? 37.774 73.387  -10.582 1.00 51.53  ? 20  GLU A N     1 
ATOM   156  C CA    . GLU A 1 20  ? 38.654 72.373  -9.999  1.00 49.26  ? 20  GLU A CA    1 
ATOM   157  C C     . GLU A 1 20  ? 39.709 71.883  -11.001 1.00 47.17  ? 20  GLU A C     1 
ATOM   158  O O     . GLU A 1 20  ? 40.797 71.440  -10.615 1.00 45.61  ? 20  GLU A O     1 
ATOM   159  C CB    . GLU A 1 20  ? 37.804 71.205  -9.493  1.00 48.66  ? 20  GLU A CB    1 
ATOM   160  C CG    . GLU A 1 20  ? 38.568 70.078  -8.810  1.00 47.28  ? 20  GLU A CG    1 
ATOM   161  C CD    . GLU A 1 20  ? 37.657 69.103  -8.074  1.00 47.60  ? 20  GLU A CD    1 
ATOM   162  O OE1   . GLU A 1 20  ? 36.501 69.468  -7.780  1.00 51.37  ? 20  GLU A OE1   1 
ATOM   163  O OE2   . GLU A 1 20  ? 38.093 67.972  -7.782  1.00 47.73  ? 20  GLU A OE2   1 
ATOM   164  N N     . VAL A 1 21  ? 39.379 71.949  -12.287 1.00 47.14  ? 21  VAL A N     1 
ATOM   165  C CA    . VAL A 1 21  ? 40.323 71.588  -13.331 1.00 45.41  ? 21  VAL A CA    1 
ATOM   166  C C     . VAL A 1 21  ? 41.343 72.716  -13.434 1.00 46.02  ? 21  VAL A C     1 
ATOM   167  O O     . VAL A 1 21  ? 42.541 72.469  -13.560 1.00 44.42  ? 21  VAL A O     1 
ATOM   168  C CB    . VAL A 1 21  ? 39.614 71.317  -14.693 1.00 46.14  ? 21  VAL A CB    1 
ATOM   169  C CG1   . VAL A 1 21  ? 40.623 71.105  -15.821 1.00 45.25  ? 21  VAL A CG1   1 
ATOM   170  C CG2   . VAL A 1 21  ? 38.699 70.110  -14.588 1.00 44.74  ? 21  VAL A CG2   1 
ATOM   171  N N     . ARG A 1 22  ? 40.871 73.955  -13.344 1.00 48.34  ? 22  ARG A N     1 
ATOM   172  C CA    . ARG A 1 22  ? 41.775 75.091  -13.422 1.00 49.68  ? 22  ARG A CA    1 
ATOM   173  C C     . ARG A 1 22  ? 42.713 75.097  -12.237 1.00 48.20  ? 22  ARG A C     1 
ATOM   174  O O     . ARG A 1 22  ? 43.921 75.258  -12.402 1.00 47.24  ? 22  ARG A O     1 
ATOM   175  C CB    . ARG A 1 22  ? 41.022 76.405  -13.507 1.00 52.64  ? 22  ARG A CB    1 
ATOM   176  C CG    . ARG A 1 22  ? 40.968 77.021  -14.896 1.00 57.15  ? 22  ARG A CG    1 
ATOM   177  C CD    . ARG A 1 22  ? 40.730 78.545  -14.829 1.00 64.43  ? 22  ARG A CD    1 
ATOM   178  N NE    . ARG A 1 22  ? 39.623 78.914  -13.930 1.00 69.23  ? 22  ARG A NE    1 
ATOM   179  C CZ    . ARG A 1 22  ? 39.749 79.175  -12.622 1.00 70.52  ? 22  ARG A CZ    1 
ATOM   180  N NH1   . ARG A 1 22  ? 40.939 79.111  -12.027 1.00 69.38  ? 22  ARG A NH1   1 
ATOM   181  N NH2   . ARG A 1 22  ? 38.677 79.492  -11.902 1.00 72.26  ? 22  ARG A NH2   1 
ATOM   182  N N     . LYS A 1 23  ? 42.158 74.895  -11.046 1.00 48.16  ? 23  LYS A N     1 
ATOM   183  C CA    . LYS A 1 23  ? 42.974 74.895  -9.849  1.00 47.77  ? 23  LYS A CA    1 
ATOM   184  C C     . LYS A 1 23  ? 44.096 73.908  -10.048 1.00 45.28  ? 23  LYS A C     1 
ATOM   185  O O     . LYS A 1 23  ? 45.263 74.240  -9.840  1.00 44.91  ? 23  LYS A O     1 
ATOM   186  C CB    . LYS A 1 23  ? 42.153 74.570  -8.608  1.00 48.24  ? 23  LYS A CB    1 
ATOM   187  C CG    . LYS A 1 23  ? 41.666 75.812  -7.853  1.00 51.91  ? 23  LYS A CG    1 
ATOM   188  C CD    . LYS A 1 23  ? 40.963 75.421  -6.550  1.00 55.55  ? 23  LYS A CD    1 
ATOM   189  C CE    . LYS A 1 23  ? 41.948 74.841  -5.507  1.00 56.47  ? 23  LYS A CE    1 
ATOM   190  N NZ    . LYS A 1 23  ? 41.345 73.803  -4.595  1.00 56.79  ? 23  LYS A NZ    1 
ATOM   191  N N     . GLY A 1 24  ? 43.729 72.710  -10.498 1.00 44.13  ? 24  GLY A N     1 
ATOM   192  C CA    . GLY A 1 24  ? 44.682 71.682  -10.895 1.00 42.12  ? 24  GLY A CA    1 
ATOM   193  C C     . GLY A 1 24  ? 45.675 72.130  -11.958 1.00 42.54  ? 24  GLY A C     1 
ATOM   194  O O     . GLY A 1 24  ? 46.871 71.879  -11.818 1.00 41.80  ? 24  GLY A O     1 
ATOM   195  N N     . ARG A 1 25  ? 45.197 72.790  -13.016 1.00 43.95  ? 25  ARG A N     1 
ATOM   196  C CA    . ARG A 1 25  ? 46.082 73.185  -14.113 1.00 44.53  ? 25  ARG A CA    1 
ATOM   197  C C     . ARG A 1 25  ? 47.165 74.132  -13.619 1.00 44.52  ? 25  ARG A C     1 
ATOM   198  O O     . ARG A 1 25  ? 48.313 74.026  -14.034 1.00 44.46  ? 25  ARG A O     1 
ATOM   199  C CB    . ARG A 1 25  ? 45.321 73.808  -15.300 1.00 47.24  ? 25  ARG A CB    1 
ATOM   200  C CG    . ARG A 1 25  ? 44.408 72.853  -16.108 1.00 48.19  ? 25  ARG A CG    1 
ATOM   201  C CD    . ARG A 1 25  ? 45.160 71.958  -17.131 1.00 50.26  ? 25  ARG A CD    1 
ATOM   202  N NE    . ARG A 1 25  ? 44.392 70.781  -17.581 1.00 50.30  ? 25  ARG A NE    1 
ATOM   203  C CZ    . ARG A 1 25  ? 44.241 69.646  -16.876 1.00 51.03  ? 25  ARG A CZ    1 
ATOM   204  N NH1   . ARG A 1 25  ? 44.780 69.519  -15.668 1.00 50.29  ? 25  ARG A NH1   1 
ATOM   205  N NH2   . ARG A 1 25  ? 43.535 68.630  -17.365 1.00 50.03  ? 25  ARG A NH2   1 
ATOM   206  N N     . GLU A 1 26  ? 46.819 75.042  -12.718 1.00 44.97  ? 26  GLU A N     1 
ATOM   207  C CA    . GLU A 1 26  ? 47.808 76.014  -12.258 1.00 45.33  ? 26  GLU A CA    1 
ATOM   208  C C     . GLU A 1 26  ? 48.617 75.546  -11.084 1.00 42.93  ? 26  GLU A C     1 
ATOM   209  O O     . GLU A 1 26  ? 49.627 76.143  -10.747 1.00 42.94  ? 26  GLU A O     1 
ATOM   210  C CB    . GLU A 1 26  ? 47.194 77.377  -11.971 1.00 48.28  ? 26  GLU A CB    1 
ATOM   211  C CG    . GLU A 1 26  ? 45.862 77.366  -11.281 1.00 50.89  ? 26  GLU A CG    1 
ATOM   212  C CD    . GLU A 1 26  ? 45.063 78.620  -11.598 1.00 56.75  ? 26  GLU A CD    1 
ATOM   213  O OE1   . GLU A 1 26  ? 43.911 78.498  -12.097 1.00 58.49  ? 26  GLU A OE1   1 
ATOM   214  O OE2   . GLU A 1 26  ? 45.605 79.731  -11.368 1.00 59.58  ? 26  GLU A OE2   1 
ATOM   215  N N     . ALA A 1 27  ? 48.171 74.466  -10.465 1.00 40.96  ? 27  ALA A N     1 
ATOM   216  C CA    . ALA A 1 27  ? 48.989 73.776  -9.487  1.00 39.12  ? 27  ALA A CA    1 
ATOM   217  C C     . ALA A 1 27  ? 50.094 73.028  -10.230 1.00 37.53  ? 27  ALA A C     1 
ATOM   218  O O     . ALA A 1 27  ? 51.265 73.060  -9.836  1.00 36.76  ? 27  ALA A O     1 
ATOM   219  C CB    . ALA A 1 27  ? 48.147 72.825  -8.682  1.00 38.11  ? 27  ALA A CB    1 
ATOM   220  N N     . GLU A 1 28  ? 49.704 72.381  -11.325 1.00 36.93  ? 28  GLU A N     1 
ATOM   221  C CA    . GLU A 1 28  ? 50.607 71.605  -12.161 1.00 36.03  ? 28  GLU A CA    1 
ATOM   222  C C     . GLU A 1 28  ? 51.732 72.449  -12.717 1.00 37.02  ? 28  GLU A C     1 
ATOM   223  O O     . GLU A 1 28  ? 52.896 72.063  -12.617 1.00 36.15  ? 28  GLU A O     1 
ATOM   224  C CB    . GLU A 1 28  ? 49.831 70.985  -13.300 1.00 35.97  ? 28  GLU A CB    1 
ATOM   225  C CG    . GLU A 1 28  ? 50.651 70.170  -14.248 1.00 35.95  ? 28  GLU A CG    1 
ATOM   226  C CD    . GLU A 1 28  ? 49.849 69.777  -15.489 1.00 39.55  ? 28  GLU A CD    1 
ATOM   227  O OE1   . GLU A 1 28  ? 48.591 69.847  -15.424 1.00 40.72  ? 28  GLU A OE1   1 
ATOM   228  O OE2   . GLU A 1 28  ? 50.469 69.408  -16.528 1.00 40.21  ? 28  GLU A OE2   1 
ATOM   229  N N     . GLU A 1 29  ? 51.384 73.592  -13.307 1.00 39.13  ? 29  GLU A N     1 
ATOM   230  C CA    . GLU A 1 29  ? 52.389 74.522  -13.822 1.00 41.01  ? 29  GLU A CA    1 
ATOM   231  C C     . GLU A 1 29  ? 53.373 74.960  -12.738 1.00 40.43  ? 29  GLU A C     1 
ATOM   232  O O     . GLU A 1 29  ? 54.588 74.908  -12.944 1.00 40.47  ? 29  GLU A O     1 
ATOM   233  C CB    . GLU A 1 29  ? 51.742 75.731  -14.495 1.00 43.65  ? 29  GLU A CB    1 
ATOM   234  C CG    . GLU A 1 29  ? 51.236 75.437  -15.903 1.00 48.01  ? 29  GLU A CG    1 
ATOM   235  C CD    . GLU A 1 29  ? 52.366 75.082  -16.892 1.00 53.44  ? 29  GLU A CD    1 
ATOM   236  O OE1   . GLU A 1 29  ? 52.987 76.015  -17.470 1.00 54.10  ? 29  GLU A OE1   1 
ATOM   237  O OE2   . GLU A 1 29  ? 52.618 73.858  -17.093 1.00 55.09  ? 29  GLU A OE2   1 
ATOM   238  N N     . GLU A 1 30  ? 52.857 75.369  -11.581 1.00 39.92  ? 30  GLU A N     1 
ATOM   239  C CA    . GLU A 1 30  ? 53.721 75.786  -10.496 1.00 39.43  ? 30  GLU A CA    1 
ATOM   240  C C     . GLU A 1 30  ? 54.697 74.669  -10.135 1.00 36.99  ? 30  GLU A C     1 
ATOM   241  O O     . GLU A 1 30  ? 55.888 74.900  -9.983  1.00 36.77  ? 30  GLU A O     1 
ATOM   242  C CB    . GLU A 1 30  ? 52.899 76.229  -9.288  1.00 40.43  ? 30  GLU A CB    1 
ATOM   243  C CG    . GLU A 1 30  ? 53.717 76.877  -8.171  1.00 42.25  ? 30  GLU A CG    1 
ATOM   244  C CD    . GLU A 1 30  ? 54.675 77.939  -8.700  1.00 46.34  ? 30  GLU A CD    1 
ATOM   245  O OE1   . GLU A 1 30  ? 54.238 78.783  -9.524  1.00 49.65  ? 30  GLU A OE1   1 
ATOM   246  O OE2   . GLU A 1 30  ? 55.863 77.920  -8.301  1.00 46.29  ? 30  GLU A OE2   1 
ATOM   247  N N     . LEU A 1 31  ? 54.180 73.454  -10.028 1.00 35.43  ? 31  LEU A N     1 
ATOM   248  C CA    . LEU A 1 31  ? 55.005 72.260  -9.838  1.00 33.92  ? 31  LEU A CA    1 
ATOM   249  C C     . LEU A 1 31  ? 56.112 72.138  -10.904 1.00 34.18  ? 31  LEU A C     1 
ATOM   250  O O     . LEU A 1 31  ? 57.301 72.037  -10.575 1.00 33.57  ? 31  LEU A O     1 
ATOM   251  C CB    . LEU A 1 31  ? 54.111 71.018  -9.833  1.00 32.62  ? 31  LEU A CB    1 
ATOM   252  C CG    . LEU A 1 31  ? 54.245 70.071  -8.637  1.00 31.45  ? 31  LEU A CG    1 
ATOM   253  C CD1   . LEU A 1 31  ? 54.323 70.831  -7.347  1.00 30.42  ? 31  LEU A CD1   1 
ATOM   254  C CD2   . LEU A 1 31  ? 53.069 69.171  -8.602  1.00 30.36  ? 31  LEU A CD2   1 
ATOM   255  N N     . ARG A 1 32  ? 55.717 72.192  -12.175 1.00 35.09  ? 32  ARG A N     1 
ATOM   256  C CA    . ARG A 1 32  ? 56.678 72.184  -13.267 1.00 36.50  ? 32  ARG A CA    1 
ATOM   257  C C     . ARG A 1 32  ? 57.794 73.211  -13.042 1.00 37.61  ? 32  ARG A C     1 
ATOM   258  O O     . ARG A 1 32  ? 58.954 72.812  -12.963 1.00 37.87  ? 32  ARG A O     1 
ATOM   259  C CB    . ARG A 1 32  ? 55.983 72.304  -14.636 1.00 37.33  ? 32  ARG A CB    1 
ATOM   260  C CG    . ARG A 1 32  ? 55.249 71.006  -15.028 1.00 37.89  ? 32  ARG A CG    1 
ATOM   261  C CD    . ARG A 1 32  ? 54.305 71.123  -16.265 1.00 38.97  ? 32  ARG A CD    1 
ATOM   262  N NE    . ARG A 1 32  ? 54.451 69.960  -17.156 1.00 40.73  ? 32  ARG A NE    1 
ATOM   263  C CZ    . ARG A 1 32  ? 54.034 68.721  -16.880 1.00 40.82  ? 32  ARG A CZ    1 
ATOM   264  N NH1   . ARG A 1 32  ? 53.419 68.463  -15.743 1.00 41.81  ? 32  ARG A NH1   1 
ATOM   265  N NH2   . ARG A 1 32  ? 54.225 67.723  -17.738 1.00 41.42  ? 32  ARG A NH2   1 
ATOM   266  N N     . ARG A 1 33  ? 57.452 74.497  -12.870 1.00 38.98  ? 33  ARG A N     1 
ATOM   267  C CA    . ARG A 1 33  ? 58.451 75.572  -12.645 1.00 40.31  ? 33  ARG A CA    1 
ATOM   268  C C     . ARG A 1 33  ? 59.428 75.242  -11.549 1.00 38.98  ? 33  ARG A C     1 
ATOM   269  O O     . ARG A 1 33  ? 60.626 75.417  -11.719 1.00 39.70  ? 33  ARG A O     1 
ATOM   270  C CB    . ARG A 1 33  ? 57.794 76.903  -12.308 1.00 42.03  ? 33  ARG A CB    1 
ATOM   271  C CG    . ARG A 1 33  ? 57.203 77.590  -13.494 1.00 46.71  ? 33  ARG A CG    1 
ATOM   272  C CD    . ARG A 1 33  ? 56.088 78.483  -13.050 1.00 52.90  ? 33  ARG A CD    1 
ATOM   273  N NE    . ARG A 1 33  ? 55.205 78.850  -14.155 1.00 57.66  ? 33  ARG A NE    1 
ATOM   274  C CZ    . ARG A 1 33  ? 53.875 78.900  -14.063 1.00 60.29  ? 33  ARG A CZ    1 
ATOM   275  N NH1   . ARG A 1 33  ? 53.263 78.588  -12.914 1.00 60.04  ? 33  ARG A NH1   1 
ATOM   276  N NH2   . ARG A 1 33  ? 53.146 79.240  -15.126 1.00 62.30  ? 33  ARG A NH2   1 
ATOM   277  N N     . ARG A 1 34  ? 58.907 74.760  -10.425 1.00 37.45  ? 34  ARG A N     1 
ATOM   278  C CA    . ARG A 1 34  ? 59.738 74.392  -9.296  1.00 36.74  ? 34  ARG A CA    1 
ATOM   279  C C     . ARG A 1 34  ? 60.640 73.199  -9.604  1.00 35.81  ? 34  ARG A C     1 
ATOM   280  O O     . ARG A 1 34  ? 61.838 73.244  -9.329  1.00 37.11  ? 34  ARG A O     1 
ATOM   281  C CB    . ARG A 1 34  ? 58.895 74.120  -8.057  1.00 35.88  ? 34  ARG A CB    1 
ATOM   282  C CG    . ARG A 1 34  ? 58.129 75.336  -7.599  1.00 37.08  ? 34  ARG A CG    1 
ATOM   283  C CD    . ARG A 1 34  ? 57.313 75.029  -6.371  1.00 34.99  ? 34  ARG A CD    1 
ATOM   284  N NE    . ARG A 1 34  ? 56.470 76.169  -6.032  1.00 35.95  ? 34  ARG A NE    1 
ATOM   285  C CZ    . ARG A 1 34  ? 55.578 76.187  -5.047  1.00 36.65  ? 34  ARG A CZ    1 
ATOM   286  N NH1   . ARG A 1 34  ? 55.380 75.124  -4.276  1.00 36.53  ? 34  ARG A NH1   1 
ATOM   287  N NH2   . ARG A 1 34  ? 54.867 77.274  -4.830  1.00 38.55  ? 34  ARG A NH2   1 
ATOM   288  N N     . LEU A 1 35  ? 60.095 72.142  -10.184 1.00 33.75  ? 35  LEU A N     1 
ATOM   289  C CA    . LEU A 1 35  ? 60.925 70.986  -10.478 1.00 32.10  ? 35  LEU A CA    1 
ATOM   290  C C     . LEU A 1 35  ? 61.907 71.209  -11.620 1.00 33.51  ? 35  LEU A C     1 
ATOM   291  O O     . LEU A 1 35  ? 62.922 70.512  -11.715 1.00 33.22  ? 35  LEU A O     1 
ATOM   292  C CB    . LEU A 1 35  ? 60.046 69.796  -10.787 1.00 30.73  ? 35  LEU A CB    1 
ATOM   293  C CG    . LEU A 1 35  ? 59.209 69.377  -9.600  1.00 27.46  ? 35  LEU A CG    1 
ATOM   294  C CD1   . LEU A 1 35  ? 57.934 68.814  -10.123 1.00 25.33  ? 35  LEU A CD1   1 
ATOM   295  C CD2   . LEU A 1 35  ? 59.977 68.364  -8.824  1.00 25.93  ? 35  LEU A CD2   1 
ATOM   296  N N     . ASP A 1 36  ? 61.602 72.164  -12.497 1.00 35.04  ? 36  ASP A N     1 
ATOM   297  C CA    . ASP A 1 36  ? 62.542 72.557  -13.555 1.00 36.43  ? 36  ASP A CA    1 
ATOM   298  C C     . ASP A 1 36  ? 63.717 73.313  -12.947 1.00 36.80  ? 36  ASP A C     1 
ATOM   299  O O     . ASP A 1 36  ? 64.875 73.005  -13.213 1.00 37.04  ? 36  ASP A O     1 
ATOM   300  C CB    . ASP A 1 36  ? 61.858 73.415  -14.629 1.00 38.26  ? 36  ASP A CB    1 
ATOM   301  C CG    . ASP A 1 36  ? 60.774 72.653  -15.407 1.00 38.77  ? 36  ASP A CG    1 
ATOM   302  O OD1   . ASP A 1 36  ? 60.787 71.393  -15.447 1.00 35.87  ? 36  ASP A OD1   1 
ATOM   303  O OD2   . ASP A 1 36  ? 59.899 73.342  -15.987 1.00 42.56  ? 36  ASP A OD2   1 
ATOM   304  N N     . GLU A 1 37  ? 63.398 74.289  -12.113 1.00 36.78  ? 37  GLU A N     1 
ATOM   305  C CA    . GLU A 1 37  ? 64.391 75.074  -11.435 1.00 37.73  ? 37  GLU A CA    1 
ATOM   306  C C     . GLU A 1 37  ? 65.433 74.211  -10.742 1.00 37.02  ? 37  GLU A C     1 
ATOM   307  O O     . GLU A 1 37  ? 66.586 74.620  -10.628 1.00 38.71  ? 37  GLU A O     1 
ATOM   308  C CB    . GLU A 1 37  ? 63.717 75.971  -10.411 1.00 37.99  ? 37  GLU A CB    1 
ATOM   309  C CG    . GLU A 1 37  ? 64.549 77.182  -10.033 1.00 40.29  ? 37  GLU A CG    1 
ATOM   310  C CD    . GLU A 1 37  ? 63.863 78.074  -9.022  1.00 41.72  ? 37  GLU A CD    1 
ATOM   311  O OE1   . GLU A 1 37  ? 62.886 77.633  -8.365  1.00 40.14  ? 37  GLU A OE1   1 
ATOM   312  O OE2   . GLU A 1 37  ? 64.306 79.230  -8.874  1.00 44.35  ? 37  GLU A OE2   1 
ATOM   313  N N     . LEU A 1 38  ? 65.034 73.030  -10.273 1.00 35.16  ? 38  LEU A N     1 
ATOM   314  C CA    . LEU A 1 38  ? 65.941 72.132  -9.553  1.00 34.31  ? 38  LEU A CA    1 
ATOM   315  C C     . LEU A 1 38  ? 66.666 71.152  -10.448 1.00 34.78  ? 38  LEU A C     1 
ATOM   316  O O     . LEU A 1 38  ? 67.585 70.468  -9.989  1.00 35.18  ? 38  LEU A O     1 
ATOM   317  C CB    . LEU A 1 38  ? 65.197 71.330  -8.499  1.00 32.68  ? 38  LEU A CB    1 
ATOM   318  C CG    . LEU A 1 38  ? 64.807 72.004  -7.191  1.00 31.78  ? 38  LEU A CG    1 
ATOM   319  C CD1   . LEU A 1 38  ? 63.856 71.058  -6.521  1.00 29.62  ? 38  LEU A CD1   1 
ATOM   320  C CD2   . LEU A 1 38  ? 66.025 72.277  -6.332  1.00 32.01  ? 38  LEU A CD2   1 
ATOM   321  N N     . GLY A 1 39  ? 66.236 71.063  -11.707 1.00 35.23  ? 39  GLY A N     1 
ATOM   322  C CA    . GLY A 1 39  ? 66.932 70.285  -12.725 1.00 35.39  ? 39  GLY A CA    1 
ATOM   323  C C     . GLY A 1 39  ? 66.919 68.817  -12.401 1.00 33.97  ? 39  GLY A C     1 
ATOM   324  O O     . GLY A 1 39  ? 67.940 68.148  -12.506 1.00 34.86  ? 39  GLY A O     1 
ATOM   325  N N     . VAL A 1 40  ? 65.758 68.313  -12.007 1.00 32.50  ? 40  VAL A N     1 
ATOM   326  C CA    . VAL A 1 40  ? 65.608 66.902  -11.612 1.00 30.85  ? 40  VAL A CA    1 
ATOM   327  C C     . VAL A 1 40  ? 64.686 66.163  -12.577 1.00 30.59  ? 40  VAL A C     1 
ATOM   328  O O     . VAL A 1 40  ? 63.823 66.781  -13.198 1.00 31.12  ? 40  VAL A O     1 
ATOM   329  C CB    . VAL A 1 40  ? 65.112 66.759  -10.134 1.00 29.55  ? 40  VAL A CB    1 
ATOM   330  C CG1   . VAL A 1 40  ? 66.270 66.973  -9.158  1.00 29.98  ? 40  VAL A CG1   1 
ATOM   331  C CG2   . VAL A 1 40  ? 63.971 67.732  -9.821  1.00 28.05  ? 40  VAL A CG2   1 
ATOM   332  N N     . GLU A 1 41  ? 64.881 64.852  -12.724 1.00 30.36  ? 41  GLU A N     1 
ATOM   333  C CA    . GLU A 1 41  ? 63.957 64.022  -13.512 1.00 30.34  ? 41  GLU A CA    1 
ATOM   334  C C     . GLU A 1 41  ? 62.648 63.776  -12.776 1.00 28.49  ? 41  GLU A C     1 
ATOM   335  O O     . GLU A 1 41  ? 62.634 63.213  -11.673 1.00 27.94  ? 41  GLU A O     1 
ATOM   336  C CB    . GLU A 1 41  ? 64.581 62.680  -13.857 1.00 30.78  ? 41  GLU A CB    1 
ATOM   337  C CG    . GLU A 1 41  ? 65.215 62.645  -15.202 1.00 36.10  ? 41  GLU A CG    1 
ATOM   338  C CD    . GLU A 1 41  ? 65.824 61.291  -15.512 1.00 42.16  ? 41  GLU A CD    1 
ATOM   339  O OE1   . GLU A 1 41  ? 67.080 61.185  -15.613 1.00 45.89  ? 41  GLU A OE1   1 
ATOM   340  O OE2   . GLU A 1 41  ? 65.037 60.335  -15.652 1.00 43.45  ? 41  GLU A OE2   1 
ATOM   341  N N     . TYR A 1 42  ? 61.546 64.190  -13.381 1.00 27.90  ? 42  TYR A N     1 
ATOM   342  C CA    . TYR A 1 42  ? 60.241 63.913  -12.800 1.00 26.39  ? 42  TYR A CA    1 
ATOM   343  C C     . TYR A 1 42  ? 59.264 63.625  -13.907 1.00 26.46  ? 42  TYR A C     1 
ATOM   344  O O     . TYR A 1 42  ? 59.539 63.889  -15.068 1.00 27.34  ? 42  TYR A O     1 
ATOM   345  C CB    . TYR A 1 42  ? 59.735 65.107  -11.997 1.00 26.19  ? 42  TYR A CB    1 
ATOM   346  C CG    . TYR A 1 42  ? 59.479 66.315  -12.864 1.00 27.26  ? 42  TYR A CG    1 
ATOM   347  C CD1   . TYR A 1 42  ? 58.222 66.526  -13.441 1.00 26.87  ? 42  TYR A CD1   1 
ATOM   348  C CD2   . TYR A 1 42  ? 60.507 67.223  -13.151 1.00 27.16  ? 42  TYR A CD2   1 
ATOM   349  C CE1   . TYR A 1 42  ? 57.986 67.629  -14.260 1.00 28.29  ? 42  TYR A CE1   1 
ATOM   350  C CE2   . TYR A 1 42  ? 60.284 68.316  -13.971 1.00 29.26  ? 42  TYR A CE2   1 
ATOM   351  C CZ    . TYR A 1 42  ? 59.018 68.521  -14.520 1.00 29.56  ? 42  TYR A CZ    1 
ATOM   352  O OH    . TYR A 1 42  ? 58.779 69.620  -15.316 1.00 30.99  ? 42  TYR A OH    1 
ATOM   353  N N     . VAL A 1 43  ? 58.105 63.117  -13.523 1.00 25.51  ? 43  VAL A N     1 
ATOM   354  C CA    . VAL A 1 43  ? 57.047 62.796  -14.458 1.00 25.40  ? 43  VAL A CA    1 
ATOM   355  C C     . VAL A 1 43  ? 55.752 62.827  -13.664 1.00 24.53  ? 43  VAL A C     1 
ATOM   356  O O     . VAL A 1 43  ? 55.751 62.529  -12.477 1.00 23.12  ? 43  VAL A O     1 
ATOM   357  C CB    . VAL A 1 43  ? 57.267 61.383  -15.146 1.00 25.72  ? 43  VAL A CB    1 
ATOM   358  C CG1   . VAL A 1 43  ? 56.996 60.199  -14.173 1.00 22.69  ? 43  VAL A CG1   1 
ATOM   359  C CG2   . VAL A 1 43  ? 56.398 61.252  -16.362 1.00 26.29  ? 43  VAL A CG2   1 
ATOM   360  N N     . PHE A 1 44  ? 54.664 63.207  -14.318 1.00 25.42  ? 44  PHE A N     1 
ATOM   361  C CA    . PHE A 1 44  ? 53.354 63.182  -13.698 1.00 25.58  ? 44  PHE A CA    1 
ATOM   362  C C     . PHE A 1 44  ? 52.639 61.926  -14.109 1.00 25.33  ? 44  PHE A C     1 
ATOM   363  O O     . PHE A 1 44  ? 52.528 61.632  -15.299 1.00 26.66  ? 44  PHE A O     1 
ATOM   364  C CB    . PHE A 1 44  ? 52.546 64.365  -14.160 1.00 26.96  ? 44  PHE A CB    1 
ATOM   365  C CG    . PHE A 1 44  ? 53.021 65.641  -13.623 1.00 28.29  ? 44  PHE A CG    1 
ATOM   366  C CD1   . PHE A 1 44  ? 54.295 66.076  -13.877 1.00 31.10  ? 44  PHE A CD1   1 
ATOM   367  C CD2   . PHE A 1 44  ? 52.186 66.419  -12.846 1.00 31.31  ? 44  PHE A CD2   1 
ATOM   368  C CE1   . PHE A 1 44  ? 54.742 67.289  -13.355 1.00 34.31  ? 44  PHE A CE1   1 
ATOM   369  C CE2   . PHE A 1 44  ? 52.604 67.630  -12.326 1.00 32.67  ? 44  PHE A CE2   1 
ATOM   370  C CZ    . PHE A 1 44  ? 53.887 68.075  -12.582 1.00 33.16  ? 44  PHE A CZ    1 
ATOM   371  N N     . VAL A 1 45  ? 52.138 61.193  -13.124 1.00 24.29  ? 45  VAL A N     1 
ATOM   372  C CA    . VAL A 1 45  ? 51.467 59.935  -13.381 1.00 23.91  ? 45  VAL A CA    1 
ATOM   373  C C     . VAL A 1 45  ? 50.152 59.972  -12.621 1.00 24.03  ? 45  VAL A C     1 
ATOM   374  O O     . VAL A 1 45  ? 49.733 61.052  -12.216 1.00 24.85  ? 45  VAL A O     1 
ATOM   375  C CB    . VAL A 1 45  ? 52.352 58.751  -12.961 1.00 23.63  ? 45  VAL A CB    1 
ATOM   376  C CG1   . VAL A 1 45  ? 53.524 58.639  -13.894 1.00 24.07  ? 45  VAL A CG1   1 
ATOM   377  C CG2   . VAL A 1 45  ? 52.847 58.904  -11.494 1.00 22.36  ? 45  VAL A CG2   1 
ATOM   378  N N     . GLY A 1 46  ? 49.509 58.818  -12.414 1.00 23.82  ? 46  GLY A N     1 
ATOM   379  C CA    . GLY A 1 46  ? 48.238 58.763  -11.695 1.00 23.42  ? 46  GLY A CA    1 
ATOM   380  C C     . GLY A 1 46  ? 47.027 59.380  -12.379 1.00 24.22  ? 46  GLY A C     1 
ATOM   381  O O     . GLY A 1 46  ? 47.042 59.727  -13.573 1.00 25.74  ? 46  GLY A O     1 
ATOM   382  N N     . SER A 1 47  ? 45.966 59.545  -11.618 1.00 23.94  ? 47  SER A N     1 
ATOM   383  C CA    . SER A 1 47  ? 44.684 59.891  -12.197 1.00 25.17  ? 47  SER A CA    1 
ATOM   384  C C     . SER A 1 47  ? 44.627 61.332  -12.721 1.00 25.63  ? 47  SER A C     1 
ATOM   385  O O     . SER A 1 47  ? 43.890 61.621  -13.661 1.00 26.56  ? 47  SER A O     1 
ATOM   386  C CB    . SER A 1 47  ? 43.555 59.618  -11.196 1.00 25.42  ? 47  SER A CB    1 
ATOM   387  O OG    . SER A 1 47  ? 43.731 60.435  -10.043 1.00 26.92  ? 47  SER A OG    1 
ATOM   388  N N     . TYR A 1 48  ? 45.401 62.228  -12.125 1.00 25.53  ? 48  TYR A N     1 
ATOM   389  C CA    . TYR A 1 48  ? 45.396 63.609  -12.571 1.00 26.36  ? 48  TYR A CA    1 
ATOM   390  C C     . TYR A 1 48  ? 45.965 63.697  -13.964 1.00 27.33  ? 48  TYR A C     1 
ATOM   391  O O     . TYR A 1 48  ? 45.407 64.399  -14.841 1.00 28.83  ? 48  TYR A O     1 
ATOM   392  C CB    . TYR A 1 48  ? 46.188 64.534  -11.647 1.00 25.96  ? 48  TYR A CB    1 
ATOM   393  C CG    . TYR A 1 48  ? 46.294 65.926  -12.209 1.00 26.36  ? 48  TYR A CG    1 
ATOM   394  C CD1   . TYR A 1 48  ? 45.218 66.802  -12.146 1.00 28.10  ? 48  TYR A CD1   1 
ATOM   395  C CD2   . TYR A 1 48  ? 47.450 66.352  -12.839 1.00 27.40  ? 48  TYR A CD2   1 
ATOM   396  C CE1   . TYR A 1 48  ? 45.284 68.084  -12.672 1.00 29.40  ? 48  TYR A CE1   1 
ATOM   397  C CE2   . TYR A 1 48  ? 47.537 67.634  -13.388 1.00 30.09  ? 48  TYR A CE2   1 
ATOM   398  C CZ    . TYR A 1 48  ? 46.442 68.504  -13.295 1.00 30.39  ? 48  TYR A CZ    1 
ATOM   399  O OH    . TYR A 1 48  ? 46.512 69.784  -13.822 1.00 30.40  ? 48  TYR A OH    1 
ATOM   400  N N     . ALA A 1 49  ? 47.076 63.001  -14.178 1.00 26.59  ? 49  ALA A N     1 
ATOM   401  C CA    . ALA A 1 49  ? 47.759 63.107  -15.467 1.00 27.60  ? 49  ALA A CA    1 
ATOM   402  C C     . ALA A 1 49  ? 47.126 62.261  -16.574 1.00 28.42  ? 49  ALA A C     1 
ATOM   403  O O     . ALA A 1 49  ? 47.663 62.220  -17.676 1.00 29.13  ? 49  ALA A O     1 
ATOM   404  C CB    . ALA A 1 49  ? 49.271 62.807  -15.324 1.00 26.52  ? 49  ALA A CB    1 
ATOM   405  N N     . ARG A 1 50  ? 46.022 61.569  -16.259 1.00 28.76  ? 50  ARG A N     1 
ATOM   406  C CA    . ARG A 1 50  ? 45.266 60.746  -17.225 1.00 29.64  ? 50  ARG A CA    1 
ATOM   407  C C     . ARG A 1 50  ? 43.819 61.216  -17.302 1.00 31.09  ? 50  ARG A C     1 
ATOM   408  O O     . ARG A 1 50  ? 43.029 60.711  -18.088 1.00 32.15  ? 50  ARG A O     1 
ATOM   409  C CB    . ARG A 1 50  ? 45.299 59.257  -16.854 1.00 29.04  ? 50  ARG A CB    1 
ATOM   410  C CG    . ARG A 1 50  ? 46.644 58.580  -17.038 1.00 27.96  ? 50  ARG A CG    1 
ATOM   411  C CD    . ARG A 1 50  ? 46.543 57.040  -16.988 1.00 28.08  ? 50  ARG A CD    1 
ATOM   412  N NE    . ARG A 1 50  ? 46.189 56.475  -15.677 1.00 28.66  ? 50  ARG A NE    1 
ATOM   413  C CZ    . ARG A 1 50  ? 47.013 56.389  -14.618 1.00 28.11  ? 50  ARG A CZ    1 
ATOM   414  N NH1   . ARG A 1 50  ? 48.256 56.853  -14.685 1.00 27.44  ? 50  ARG A NH1   1 
ATOM   415  N NH2   . ARG A 1 50  ? 46.599 55.845  -13.478 1.00 25.28  ? 50  ARG A NH2   1 
ATOM   416  N N     . ASN A 1 51  ? 43.487 62.194  -16.467 1.00 31.94  ? 51  ASN A N     1 
ATOM   417  C CA    . ASN A 1 51  ? 42.152 62.785  -16.411 1.00 33.59  ? 51  ASN A CA    1 
ATOM   418  C C     . ASN A 1 51  ? 41.067 61.848  -15.957 1.00 33.39  ? 51  ASN A C     1 
ATOM   419  O O     . ASN A 1 51  ? 39.979 61.865  -16.527 1.00 34.72  ? 51  ASN A O     1 
ATOM   420  C CB    . ASN A 1 51  ? 41.752 63.366  -17.759 1.00 35.47  ? 51  ASN A CB    1 
ATOM   421  C CG    . ASN A 1 51  ? 41.487 64.850  -17.687 1.00 39.12  ? 51  ASN A CG    1 
ATOM   422  O OD1   . ASN A 1 51  ? 40.755 65.341  -16.796 1.00 40.97  ? 51  ASN A OD1   1 
ATOM   423  N ND2   . ASN A 1 51  ? 42.071 65.588  -18.635 1.00 41.16  ? 51  ASN A ND2   1 
ATOM   424  N N     . THR A 1 52  ? 41.351 61.056  -14.924 1.00 31.97  ? 52  THR A N     1 
ATOM   425  C CA    . THR A 1 52  ? 40.407 60.057  -14.431 1.00 31.89  ? 52  THR A CA    1 
ATOM   426  C C     . THR A 1 52  ? 40.105 60.199  -12.940 1.00 31.48  ? 52  THR A C     1 
ATOM   427  O O     . THR A 1 52  ? 39.546 59.297  -12.302 1.00 31.94  ? 52  THR A O     1 
ATOM   428  C CB    . THR A 1 52  ? 40.919 58.649  -14.733 1.00 31.46  ? 52  THR A CB    1 
ATOM   429  O OG1   . THR A 1 52  ? 42.309 58.595  -14.415 1.00 30.99  ? 52  THR A OG1   1 
ATOM   430  C CG2   . THR A 1 52  ? 40.751 58.349  -16.212 1.00 31.52  ? 52  THR A CG2   1 
ATOM   431  N N     . TRP A 1 53  ? 40.466 61.347  -12.388 1.00 31.20  ? 53  TRP A N     1 
ATOM   432  C CA    . TRP A 1 53  ? 40.237 61.619  -10.997 1.00 30.62  ? 53  TRP A CA    1 
ATOM   433  C C     . TRP A 1 53  ? 38.813 62.088  -10.846 1.00 31.94  ? 53  TRP A C     1 
ATOM   434  O O     . TRP A 1 53  ? 38.228 62.591  -11.804 1.00 33.01  ? 53  TRP A O     1 
ATOM   435  C CB    . TRP A 1 53  ? 41.227 62.651  -10.493 1.00 30.64  ? 53  TRP A CB    1 
ATOM   436  C CG    . TRP A 1 53  ? 40.820 64.065  -10.680 1.00 32.37  ? 53  TRP A CG    1 
ATOM   437  C CD1   . TRP A 1 53  ? 40.083 64.840  -9.815  1.00 34.70  ? 53  TRP A CD1   1 
ATOM   438  C CD2   . TRP A 1 53  ? 41.154 64.902  -11.778 1.00 32.31  ? 53  TRP A CD2   1 
ATOM   439  N NE1   . TRP A 1 53  ? 39.927 66.109  -10.327 1.00 35.84  ? 53  TRP A NE1   1 
ATOM   440  C CE2   . TRP A 1 53  ? 40.578 66.172  -11.531 1.00 34.38  ? 53  TRP A CE2   1 
ATOM   441  C CE3   . TRP A 1 53  ? 41.879 64.703  -12.951 1.00 32.54  ? 53  TRP A CE3   1 
ATOM   442  C CZ2   . TRP A 1 53  ? 40.704 67.230  -12.417 1.00 35.30  ? 53  TRP A CZ2   1 
ATOM   443  C CZ3   . TRP A 1 53  ? 42.003 65.754  -13.835 1.00 34.70  ? 53  TRP A CZ3   1 
ATOM   444  C CH2   . TRP A 1 53  ? 41.416 67.008  -13.563 1.00 35.36  ? 53  TRP A CH2   1 
ATOM   445  N N     . LEU A 1 54  ? 38.279 61.919  -9.637  1.00 32.24  ? 54  LEU A N     1 
ATOM   446  C CA    . LEU A 1 54  ? 36.874 62.124  -9.306  1.00 33.41  ? 54  LEU A CA    1 
ATOM   447  C C     . LEU A 1 54  ? 36.589 63.576  -8.896  1.00 34.52  ? 54  LEU A C     1 
ATOM   448  O O     . LEU A 1 54  ? 37.425 64.220  -8.252  1.00 34.15  ? 54  LEU A O     1 
ATOM   449  C CB    . LEU A 1 54  ? 36.529 61.203  -8.140  1.00 33.48  ? 54  LEU A CB    1 
ATOM   450  C CG    . LEU A 1 54  ? 35.264 60.369  -8.211  1.00 34.96  ? 54  LEU A CG    1 
ATOM   451  C CD1   . LEU A 1 54  ? 35.353 59.400  -9.362  1.00 35.41  ? 54  LEU A CD1   1 
ATOM   452  C CD2   . LEU A 1 54  ? 35.117 59.606  -6.937  1.00 35.66  ? 54  LEU A CD2   1 
ATOM   453  N N     . LYS A 1 55  ? 35.411 64.084  -9.268  1.00 35.78  ? 55  LYS A N     1 
ATOM   454  C CA    . LYS A 1 55  ? 34.930 65.374  -8.781  1.00 37.39  ? 55  LYS A CA    1 
ATOM   455  C C     . LYS A 1 55  ? 35.097 65.401  -7.273  1.00 37.99  ? 55  LYS A C     1 
ATOM   456  O O     . LYS A 1 55  ? 34.585 64.533  -6.568  1.00 38.33  ? 55  LYS A O     1 
ATOM   457  C CB    . LYS A 1 55  ? 33.460 65.563  -9.133  1.00 38.97  ? 55  LYS A CB    1 
ATOM   458  C CG    . LYS A 1 55  ? 32.848 66.875  -8.696  1.00 40.87  ? 55  LYS A CG    1 
ATOM   459  C CD    . LYS A 1 55  ? 31.318 66.799  -8.781  1.00 43.48  ? 55  LYS A CD    1 
ATOM   460  C CE    . LYS A 1 55  ? 30.687 68.157  -9.097  1.00 45.55  ? 55  LYS A CE    1 
ATOM   461  N NZ    . LYS A 1 55  ? 30.664 69.054  -7.904  1.00 48.26  ? 55  LYS A NZ    1 
ATOM   462  N N     . GLY A 1 56  ? 35.855 66.370  -6.786  1.00 38.18  ? 56  GLY A N     1 
ATOM   463  C CA    . GLY A 1 56  ? 35.938 66.591  -5.364  1.00 39.47  ? 56  GLY A CA    1 
ATOM   464  C C     . GLY A 1 56  ? 37.191 66.069  -4.725  1.00 38.49  ? 56  GLY A C     1 
ATOM   465  O O     . GLY A 1 56  ? 37.513 66.453  -3.615  1.00 39.51  ? 56  GLY A O     1 
ATOM   466  N N     . SER A 1 57  ? 37.905 65.185  -5.404  1.00 37.35  ? 57  SER A N     1 
ATOM   467  C CA    . SER A 1 57  ? 39.129 64.626  -4.818  1.00 36.78  ? 57  SER A CA    1 
ATOM   468  C C     . SER A 1 57  ? 40.322 64.681  -5.779  1.00 35.40  ? 57  SER A C     1 
ATOM   469  O O     . SER A 1 57  ? 40.821 63.660  -6.243  1.00 34.33  ? 57  SER A O     1 
ATOM   470  C CB    . SER A 1 57  ? 38.877 63.212  -4.279  1.00 36.33  ? 57  SER A CB    1 
ATOM   471  O OG    . SER A 1 57  ? 38.929 62.270  -5.318  1.00 35.40  ? 57  SER A OG    1 
ATOM   472  N N     . LEU A 1 58  ? 40.747 65.904  -6.075  1.00 36.33  ? 58  LEU A N     1 
ATOM   473  C CA    . LEU A 1 58  ? 41.879 66.178  -6.941  1.00 35.75  ? 58  LEU A CA    1 
ATOM   474  C C     . LEU A 1 58  ? 43.155 66.066  -6.151  1.00 35.52  ? 58  LEU A C     1 
ATOM   475  O O     . LEU A 1 58  ? 43.357 66.788  -5.166  1.00 36.24  ? 58  LEU A O     1 
ATOM   476  C CB    . LEU A 1 58  ? 41.786 67.602  -7.509  1.00 36.81  ? 58  LEU A CB    1 
ATOM   477  C CG    . LEU A 1 58  ? 43.091 68.295  -7.958  1.00 35.69  ? 58  LEU A CG    1 
ATOM   478  C CD1   . LEU A 1 58  ? 43.468 67.942  -9.396  1.00 32.27  ? 58  LEU A CD1   1 
ATOM   479  C CD2   . LEU A 1 58  ? 42.998 69.813  -7.773  1.00 34.93  ? 58  LEU A CD2   1 
ATOM   480  N N     . GLU A 1 59  ? 44.021 65.174  -6.614  1.00 35.03  ? 59  GLU A N     1 
ATOM   481  C CA    . GLU A 1 59  ? 45.351 64.985  -6.052  1.00 35.05  ? 59  GLU A CA    1 
ATOM   482  C C     . GLU A 1 59  ? 46.353 64.718  -7.189  1.00 33.80  ? 59  GLU A C     1 
ATOM   483  O O     . GLU A 1 59  ? 46.108 63.868  -8.051  1.00 34.18  ? 59  GLU A O     1 
ATOM   484  C CB    . GLU A 1 59  ? 45.308 63.823  -5.082  1.00 35.00  ? 59  GLU A CB    1 
ATOM   485  C CG    . GLU A 1 59  ? 46.508 63.721  -4.157  1.00 37.88  ? 59  GLU A CG    1 
ATOM   486  C CD    . GLU A 1 59  ? 46.687 62.314  -3.590  1.00 40.08  ? 59  GLU A CD    1 
ATOM   487  O OE1   . GLU A 1 59  ? 47.120 61.404  -4.362  1.00 39.93  ? 59  GLU A OE1   1 
ATOM   488  O OE2   . GLU A 1 59  ? 46.398 62.135  -2.378  1.00 40.33  ? 59  GLU A OE2   1 
ATOM   489  N N     . ILE A 1 60  ? 47.462 65.451  -7.217  1.00 33.25  ? 60  ILE A N     1 
ATOM   490  C CA    . ILE A 1 60  ? 48.450 65.297  -8.291  1.00 31.89  ? 60  ILE A CA    1 
ATOM   491  C C     . ILE A 1 60  ? 49.582 64.433  -7.803  1.00 30.89  ? 60  ILE A C     1 
ATOM   492  O O     . ILE A 1 60  ? 50.092 64.656  -6.712  1.00 31.56  ? 60  ILE A O     1 
ATOM   493  C CB    . ILE A 1 60  ? 49.052 66.654  -8.709  1.00 32.80  ? 60  ILE A CB    1 
ATOM   494  C CG1   . ILE A 1 60  ? 47.955 67.625  -9.176  1.00 33.43  ? 60  ILE A CG1   1 
ATOM   495  C CG2   . ILE A 1 60  ? 50.111 66.457  -9.780  1.00 32.36  ? 60  ILE A CG2   1 
ATOM   496  C CD1   . ILE A 1 60  ? 48.431 69.004  -9.411  1.00 33.71  ? 60  ILE A CD1   1 
ATOM   497  N N     . ASP A 1 61  ? 49.963 63.433  -8.589  1.00 30.16  ? 61  ASP A N     1 
ATOM   498  C CA    . ASP A 1 61  ? 51.149 62.621  -8.297  1.00 29.43  ? 61  ASP A CA    1 
ATOM   499  C C     . ASP A 1 61  ? 52.306 63.042  -9.199  1.00 29.25  ? 61  ASP A C     1 
ATOM   500  O O     . ASP A 1 61  ? 52.186 63.029  -10.422 1.00 30.82  ? 61  ASP A O     1 
ATOM   501  C CB    . ASP A 1 61  ? 50.869 61.134  -8.476  1.00 28.45  ? 61  ASP A CB    1 
ATOM   502  C CG    . ASP A 1 61  ? 49.720 60.634  -7.605  1.00 30.79  ? 61  ASP A CG    1 
ATOM   503  O OD1   . ASP A 1 61  ? 48.655 60.326  -8.196  1.00 32.04  ? 61  ASP A OD1   1 
ATOM   504  O OD2   . ASP A 1 61  ? 49.870 60.524  -6.347  1.00 31.63  ? 61  ASP A OD2   1 
ATOM   505  N N     . VAL A 1 62  ? 53.416 63.431  -8.590  1.00 28.91  ? 62  VAL A N     1 
ATOM   506  C CA    . VAL A 1 62  ? 54.658 63.717  -9.302  1.00 28.60  ? 62  VAL A CA    1 
ATOM   507  C C     . VAL A 1 62  ? 55.631 62.655  -8.883  1.00 27.54  ? 62  VAL A C     1 
ATOM   508  O O     . VAL A 1 62  ? 55.788 62.402  -7.700  1.00 27.74  ? 62  VAL A O     1 
ATOM   509  C CB    . VAL A 1 62  ? 55.251 65.086  -8.900  1.00 29.18  ? 62  VAL A CB    1 
ATOM   510  C CG1   . VAL A 1 62  ? 56.435 65.435  -9.758  1.00 29.71  ? 62  VAL A CG1   1 
ATOM   511  C CG2   . VAL A 1 62  ? 54.233 66.132  -9.082  1.00 30.42  ? 62  VAL A CG2   1 
ATOM   512  N N     . PHE A 1 63  ? 56.277 62.026  -9.847  1.00 27.12  ? 63  PHE A N     1 
ATOM   513  C CA    . PHE A 1 63  ? 57.211 60.946  -9.553  1.00 26.33  ? 63  PHE A CA    1 
ATOM   514  C C     . PHE A 1 63  ? 58.628 61.338  -9.896  1.00 27.00  ? 63  PHE A C     1 
ATOM   515  O O     . PHE A 1 63  ? 58.865 61.948  -10.952 1.00 28.27  ? 63  PHE A O     1 
ATOM   516  C CB    . PHE A 1 63  ? 56.816 59.700  -10.299 1.00 25.41  ? 63  PHE A CB    1 
ATOM   517  C CG    . PHE A 1 63  ? 56.084 58.719  -9.458  1.00 25.31  ? 63  PHE A CG    1 
ATOM   518  C CD1   . PHE A 1 63  ? 54.942 59.098  -8.760  1.00 25.09  ? 63  PHE A CD1   1 
ATOM   519  C CD2   . PHE A 1 63  ? 56.538 57.406  -9.344  1.00 22.82  ? 63  PHE A CD2   1 
ATOM   520  C CE1   . PHE A 1 63  ? 54.277 58.175  -7.971  1.00 24.21  ? 63  PHE A CE1   1 
ATOM   521  C CE2   . PHE A 1 63  ? 55.875 56.489  -8.561  1.00 20.54  ? 63  PHE A CE2   1 
ATOM   522  C CZ    . PHE A 1 63  ? 54.753 56.859  -7.885  1.00 22.50  ? 63  PHE A CZ    1 
ATOM   523  N N     . LEU A 1 64  ? 59.552 61.025  -8.984  1.00 26.40  ? 64  LEU A N     1 
ATOM   524  C CA    . LEU A 1 64  ? 60.967 61.315  -9.175  1.00 26.19  ? 64  LEU A CA    1 
ATOM   525  C C     . LEU A 1 64  ? 61.688 60.061  -9.601  1.00 26.41  ? 64  LEU A C     1 
ATOM   526  O O     . LEU A 1 64  ? 61.597 59.006  -8.946  1.00 26.03  ? 64  LEU A O     1 
ATOM   527  C CB    . LEU A 1 64  ? 61.605 61.865  -7.916  1.00 26.05  ? 64  LEU A CB    1 
ATOM   528  C CG    . LEU A 1 64  ? 60.851 62.960  -7.167  1.00 26.58  ? 64  LEU A CG    1 
ATOM   529  C CD1   . LEU A 1 64  ? 61.325 62.971  -5.736  1.00 26.60  ? 64  LEU A CD1   1 
ATOM   530  C CD2   . LEU A 1 64  ? 61.000 64.352  -7.791  1.00 26.37  ? 64  LEU A CD2   1 
ATOM   531  N N     . LEU A 1 65  ? 62.414 60.199  -10.704 1.00 26.96  ? 65  LEU A N     1 
ATOM   532  C CA    . LEU A 1 65  ? 63.114 59.099  -11.327 1.00 27.43  ? 65  LEU A CA    1 
ATOM   533  C C     . LEU A 1 65  ? 64.611 59.119  -10.977 1.00 28.26  ? 65  LEU A C     1 
ATOM   534  O O     . LEU A 1 65  ? 65.347 59.972  -11.471 1.00 29.55  ? 65  LEU A O     1 
ATOM   535  C CB    . LEU A 1 65  ? 62.883 59.171  -12.832 1.00 28.02  ? 65  LEU A CB    1 
ATOM   536  C CG    . LEU A 1 65  ? 61.401 59.255  -13.238 1.00 27.43  ? 65  LEU A CG    1 
ATOM   537  C CD1   . LEU A 1 65  ? 61.268 59.438  -14.737 1.00 26.32  ? 65  LEU A CD1   1 
ATOM   538  C CD2   . LEU A 1 65  ? 60.570 58.032  -12.768 1.00 26.27  ? 65  LEU A CD2   1 
ATOM   539  N N     . PHE A 1 66  ? 65.040 58.183  -10.120 1.00 27.72  ? 66  PHE A N     1 
ATOM   540  C CA    . PHE A 1 66  ? 66.423 58.096  -9.631  1.00 27.63  ? 66  PHE A CA    1 
ATOM   541  C C     . PHE A 1 66  ? 67.213 56.938  -10.252 1.00 28.39  ? 66  PHE A C     1 
ATOM   542  O O     . PHE A 1 66  ? 66.623 55.957  -10.717 1.00 28.28  ? 66  PHE A O     1 
ATOM   543  C CB    . PHE A 1 66  ? 66.419 57.957  -8.106  1.00 27.43  ? 66  PHE A CB    1 
ATOM   544  C CG    . PHE A 1 66  ? 66.105 59.239  -7.373  1.00 27.61  ? 66  PHE A CG    1 
ATOM   545  C CD1   . PHE A 1 66  ? 67.089 60.212  -7.184  1.00 29.34  ? 66  PHE A CD1   1 
ATOM   546  C CD2   . PHE A 1 66  ? 64.828 59.478  -6.866  1.00 28.60  ? 66  PHE A CD2   1 
ATOM   547  C CE1   . PHE A 1 66  ? 66.808 61.408  -6.513  1.00 29.14  ? 66  PHE A CE1   1 
ATOM   548  C CE2   . PHE A 1 66  ? 64.531 60.671  -6.181  1.00 28.42  ? 66  PHE A CE2   1 
ATOM   549  C CZ    . PHE A 1 66  ? 65.527 61.635  -6.011  1.00 28.92  ? 66  PHE A CZ    1 
ATOM   550  N N     . PRO A 1 67  ? 68.553 57.040  -10.267 1.00 29.23  ? 67  PRO A N     1 
ATOM   551  C CA    . PRO A 1 67  ? 69.379 55.953  -10.773 1.00 30.85  ? 67  PRO A CA    1 
ATOM   552  C C     . PRO A 1 67  ? 69.162 54.655  -10.019 1.00 31.48  ? 67  PRO A C     1 
ATOM   553  O O     . PRO A 1 67  ? 69.138 54.627  -8.793  1.00 30.80  ? 67  PRO A O     1 
ATOM   554  C CB    . PRO A 1 67  ? 70.804 56.452  -10.543 1.00 31.86  ? 67  PRO A CB    1 
ATOM   555  C CG    . PRO A 1 67  ? 70.691 57.934  -10.499 1.00 31.15  ? 67  PRO A CG    1 
ATOM   556  C CD    . PRO A 1 67  ? 69.370 58.192  -9.852  1.00 29.87  ? 67  PRO A CD    1 
ATOM   557  N N     . GLU A 1 68  ? 69.023 53.572  -10.762 1.00 33.27  ? 68  GLU A N     1 
ATOM   558  C CA    . GLU A 1 68  ? 68.757 52.270  -10.163 1.00 34.43  ? 68  GLU A CA    1 
ATOM   559  C C     . GLU A 1 68  ? 69.715 51.904  -9.037  1.00 34.55  ? 68  GLU A C     1 
ATOM   560  O O     . GLU A 1 68  ? 69.331 51.217  -8.089  1.00 34.00  ? 68  GLU A O     1 
ATOM   561  C CB    . GLU A 1 68  ? 68.802 51.180  -11.222 1.00 36.46  ? 68  GLU A CB    1 
ATOM   562  C CG    . GLU A 1 68  ? 67.657 50.220  -11.075 1.00 40.32  ? 68  GLU A CG    1 
ATOM   563  C CD    . GLU A 1 68  ? 68.095 48.771  -11.058 1.00 47.19  ? 68  GLU A CD    1 
ATOM   564  O OE1   . GLU A 1 68  ? 68.654 48.310  -10.021 1.00 48.77  ? 68  GLU A OE1   1 
ATOM   565  O OE2   . GLU A 1 68  ? 67.871 48.095  -12.093 1.00 51.83  ? 68  GLU A OE2   1 
ATOM   566  N N     . GLU A 1 69  ? 70.953 52.374  -9.150  1.00 35.27  ? 69  GLU A N     1 
ATOM   567  C CA    . GLU A 1 69  ? 72.021 51.983  -8.233  1.00 36.31  ? 69  GLU A CA    1 
ATOM   568  C C     . GLU A 1 69  ? 71.955 52.627  -6.844  1.00 34.56  ? 69  GLU A C     1 
ATOM   569  O O     . GLU A 1 69  ? 72.600 52.134  -5.918  1.00 36.29  ? 69  GLU A O     1 
ATOM   570  C CB    . GLU A 1 69  ? 73.397 52.227  -8.854  1.00 38.13  ? 69  GLU A CB    1 
ATOM   571  C CG    . GLU A 1 69  ? 73.580 51.631  -10.238 1.00 40.93  ? 69  GLU A CG    1 
ATOM   572  C CD    . GLU A 1 69  ? 73.270 52.627  -11.351 1.00 41.31  ? 69  GLU A CD    1 
ATOM   573  O OE1   . GLU A 1 69  ? 74.221 52.977  -12.092 1.00 42.26  ? 69  GLU A OE1   1 
ATOM   574  O OE2   . GLU A 1 69  ? 72.093 53.051  -11.479 1.00 39.08  ? 69  GLU A OE2   1 
ATOM   575  N N     . PHE A 1 70  ? 71.193 53.711  -6.707  1.00 31.60  ? 70  PHE A N     1 
ATOM   576  C CA    . PHE A 1 70  ? 70.976 54.375  -5.417  1.00 30.07  ? 70  PHE A CA    1 
ATOM   577  C C     . PHE A 1 70  ? 70.510 53.402  -4.335  1.00 30.83  ? 70  PHE A C     1 
ATOM   578  O O     . PHE A 1 70  ? 69.702 52.495  -4.592  1.00 30.61  ? 70  PHE A O     1 
ATOM   579  C CB    . PHE A 1 70  ? 69.927 55.482  -5.544  1.00 27.16  ? 70  PHE A CB    1 
ATOM   580  C CG    . PHE A 1 70  ? 70.476 56.821  -5.887  1.00 25.25  ? 70  PHE A CG    1 
ATOM   581  C CD1   . PHE A 1 70  ? 71.636 56.954  -6.640  1.00 25.36  ? 70  PHE A CD1   1 
ATOM   582  C CD2   . PHE A 1 70  ? 69.792 57.986  -5.488  1.00 22.91  ? 70  PHE A CD2   1 
ATOM   583  C CE1   . PHE A 1 70  ? 72.130 58.235  -6.966  1.00 25.36  ? 70  PHE A CE1   1 
ATOM   584  C CE2   . PHE A 1 70  ? 70.270 59.259  -5.814  1.00 20.73  ? 70  PHE A CE2   1 
ATOM   585  C CZ    . PHE A 1 70  ? 71.437 59.388  -6.556  1.00 22.85  ? 70  PHE A CZ    1 
ATOM   586  N N     . SER A 1 71  ? 71.023 53.603  -3.126  1.00 31.95  ? 71  SER A N     1 
ATOM   587  C CA    . SER A 1 71  ? 70.572 52.846  -1.974  1.00 33.02  ? 71  SER A CA    1 
ATOM   588  C C     . SER A 1 71  ? 69.189 53.307  -1.575  1.00 32.30  ? 71  SER A C     1 
ATOM   589  O O     . SER A 1 71  ? 68.793 54.451  -1.842  1.00 31.26  ? 71  SER A O     1 
ATOM   590  C CB    . SER A 1 71  ? 71.541 52.984  -0.794  1.00 34.15  ? 71  SER A CB    1 
ATOM   591  O OG    . SER A 1 71  ? 71.537 54.293  -0.236  1.00 33.43  ? 71  SER A OG    1 
ATOM   592  N N     . LYS A 1 72  ? 68.466 52.400  -0.929  1.00 33.76  ? 72  LYS A N     1 
ATOM   593  C CA    . LYS A 1 72  ? 67.159 52.683  -0.387  1.00 34.03  ? 72  LYS A CA    1 
ATOM   594  C C     . LYS A 1 72  ? 67.225 53.923  0.496   1.00 34.01  ? 72  LYS A C     1 
ATOM   595  O O     . LYS A 1 72  ? 66.270 54.698  0.551   1.00 32.76  ? 72  LYS A O     1 
ATOM   596  C CB    . LYS A 1 72  ? 66.673 51.484  0.407   1.00 35.16  ? 72  LYS A CB    1 
ATOM   597  C CG    . LYS A 1 72  ? 65.362 50.935  -0.123  1.00 38.69  ? 72  LYS A CG    1 
ATOM   598  C CD    . LYS A 1 72  ? 64.162 51.404  0.720   1.00 43.45  ? 72  LYS A CD    1 
ATOM   599  C CE    . LYS A 1 72  ? 62.965 51.784  -0.171  1.00 43.48  ? 72  LYS A CE    1 
ATOM   600  N NZ    . LYS A 1 72  ? 63.066 53.237  -0.506  1.00 42.44  ? 72  LYS A NZ    1 
ATOM   601  N N     . GLU A 1 73  ? 68.363 54.112  1.165   1.00 35.62  ? 73  GLU A N     1 
ATOM   602  C CA    . GLU A 1 73  ? 68.538 55.227  2.079   1.00 36.81  ? 73  GLU A CA    1 
ATOM   603  C C     . GLU A 1 73  ? 68.748 56.515  1.312   1.00 35.71  ? 73  GLU A C     1 
ATOM   604  O O     . GLU A 1 73  ? 68.359 57.599  1.769   1.00 34.78  ? 73  GLU A O     1 
ATOM   605  C CB    . GLU A 1 73  ? 69.723 54.994  3.011   1.00 38.76  ? 73  GLU A CB    1 
ATOM   606  C CG    . GLU A 1 73  ? 69.424 55.346  4.479   1.00 43.49  ? 73  GLU A CG    1 
ATOM   607  C CD    . GLU A 1 73  ? 68.879 56.781  4.691   1.00 46.84  ? 73  GLU A CD    1 
ATOM   608  O OE1   . GLU A 1 73  ? 67.665 56.939  5.012   1.00 47.81  ? 73  GLU A OE1   1 
ATOM   609  O OE2   . GLU A 1 73  ? 69.664 57.747  4.531   1.00 48.52  ? 73  GLU A OE2   1 
ATOM   610  N N     . GLU A 1 74  ? 69.377 56.383  0.144   1.00 35.93  ? 74  GLU A N     1 
ATOM   611  C CA    . GLU A 1 74  ? 69.643 57.530  -0.729  1.00 35.10  ? 74  GLU A CA    1 
ATOM   612  C C     . GLU A 1 74  ? 68.375 57.972  -1.404  1.00 33.77  ? 74  GLU A C     1 
ATOM   613  O O     . GLU A 1 74  ? 68.114 59.189  -1.517  1.00 32.90  ? 74  GLU A O     1 
ATOM   614  C CB    . GLU A 1 74  ? 70.692 57.190  -1.769  1.00 35.24  ? 74  GLU A CB    1 
ATOM   615  C CG    . GLU A 1 74  ? 72.011 57.834  -1.462  1.00 37.02  ? 74  GLU A CG    1 
ATOM   616  C CD    . GLU A 1 74  ? 73.170 57.163  -2.151  1.00 38.64  ? 74  GLU A CD    1 
ATOM   617  O OE1   . GLU A 1 74  ? 73.039 55.966  -2.505  1.00 37.15  ? 74  GLU A OE1   1 
ATOM   618  O OE2   . GLU A 1 74  ? 74.214 57.842  -2.316  1.00 39.90  ? 74  GLU A OE2   1 
ATOM   619  N N     . LEU A 1 75  ? 67.593 56.962  -1.819  1.00 33.07  ? 75  LEU A N     1 
ATOM   620  C CA    . LEU A 1 75  ? 66.311 57.163  -2.476  1.00 31.85  ? 75  LEU A CA    1 
ATOM   621  C C     . LEU A 1 75  ? 65.469 58.000  -1.572  1.00 31.70  ? 75  LEU A C     1 
ATOM   622  O O     . LEU A 1 75  ? 64.760 58.881  -2.021  1.00 31.93  ? 75  LEU A O     1 
ATOM   623  C CB    . LEU A 1 75  ? 65.627 55.830  -2.724  1.00 31.45  ? 75  LEU A CB    1 
ATOM   624  C CG    . LEU A 1 75  ? 64.651 55.599  -3.883  1.00 30.49  ? 75  LEU A CG    1 
ATOM   625  C CD1   . LEU A 1 75  ? 63.238 55.879  -3.487  1.00 29.44  ? 75  LEU A CD1   1 
ATOM   626  C CD2   . LEU A 1 75  ? 65.013 56.394  -5.116  1.00 28.75  ? 75  LEU A CD2   1 
ATOM   627  N N     . ARG A 1 76  ? 65.615 57.745  -0.280  1.00 32.82  ? 76  ARG A N     1 
ATOM   628  C CA    . ARG A 1 76  ? 64.846 58.377  0.774   1.00 33.09  ? 76  ARG A CA    1 
ATOM   629  C C     . ARG A 1 76  ? 65.234 59.840  1.054   1.00 33.66  ? 76  ARG A C     1 
ATOM   630  O O     . ARG A 1 76  ? 64.377 60.718  1.011   1.00 33.31  ? 76  ARG A O     1 
ATOM   631  C CB    . ARG A 1 76  ? 65.053 57.552  2.021   1.00 34.38  ? 76  ARG A CB    1 
ATOM   632  C CG    . ARG A 1 76  ? 64.149 57.875  3.150   1.00 35.43  ? 76  ARG A CG    1 
ATOM   633  C CD    . ARG A 1 76  ? 64.646 57.144  4.360   1.00 38.15  ? 76  ARG A CD    1 
ATOM   634  N NE    . ARG A 1 76  ? 64.248 57.891  5.526   1.00 41.12  ? 76  ARG A NE    1 
ATOM   635  C CZ    . ARG A 1 76  ? 64.749 59.070  5.873   1.00 42.60  ? 76  ARG A CZ    1 
ATOM   636  N NH1   . ARG A 1 76  ? 65.708 59.654  5.152   1.00 42.73  ? 76  ARG A NH1   1 
ATOM   637  N NH2   . ARG A 1 76  ? 64.286 59.661  6.965   1.00 44.69  ? 76  ARG A NH2   1 
ATOM   638  N N     . GLU A 1 77  ? 66.506 60.084  1.369   1.00 34.37  ? 77  GLU A N     1 
ATOM   639  C CA    . GLU A 1 77  ? 66.985 61.419  1.653   1.00 35.80  ? 77  GLU A CA    1 
ATOM   640  C C     . GLU A 1 77  ? 66.701 62.391  0.509   1.00 34.46  ? 77  GLU A C     1 
ATOM   641  O O     . GLU A 1 77  ? 66.235 63.509  0.735   1.00 33.85  ? 77  GLU A O     1 
ATOM   642  C CB    . GLU A 1 77  ? 68.479 61.402  1.913   1.00 36.70  ? 77  GLU A CB    1 
ATOM   643  C CG    . GLU A 1 77  ? 68.895 60.877  3.274   1.00 40.59  ? 77  GLU A CG    1 
ATOM   644  C CD    . GLU A 1 77  ? 70.403 61.023  3.500   1.00 42.05  ? 77  GLU A CD    1 
ATOM   645  O OE1   . GLU A 1 77  ? 70.878 60.690  4.612   1.00 46.75  ? 77  GLU A OE1   1 
ATOM   646  O OE2   . GLU A 1 77  ? 71.115 61.466  2.559   1.00 45.18  ? 77  GLU A OE2   1 
ATOM   647  N N     . ARG A 1 78  ? 66.980 61.954  -0.716  1.00 33.70  ? 78  ARG A N     1 
ATOM   648  C CA    . ARG A 1 78  ? 66.846 62.831  -1.873  1.00 33.33  ? 78  ARG A CA    1 
ATOM   649  C C     . ARG A 1 78  ? 65.367 63.091  -2.201  1.00 32.52  ? 78  ARG A C     1 
ATOM   650  O O     . ARG A 1 78  ? 64.948 64.254  -2.415  1.00 32.25  ? 78  ARG A O     1 
ATOM   651  C CB    . ARG A 1 78  ? 67.616 62.273  -3.077  1.00 33.14  ? 78  ARG A CB    1 
ATOM   652  C CG    . ARG A 1 78  ? 69.123 62.188  -2.848  1.00 33.53  ? 78  ARG A CG    1 
ATOM   653  C CD    . ARG A 1 78  ? 69.901 63.354  -3.452  1.00 33.96  ? 78  ARG A CD    1 
ATOM   654  N NE    . ARG A 1 78  ? 69.314 64.680  -3.230  1.00 32.56  ? 78  ARG A NE    1 
ATOM   655  C CZ    . ARG A 1 78  ? 68.837 65.466  -4.196  1.00 32.65  ? 78  ARG A CZ    1 
ATOM   656  N NH1   . ARG A 1 78  ? 68.864 65.078  -5.463  1.00 30.85  ? 78  ARG A NH1   1 
ATOM   657  N NH2   . ARG A 1 78  ? 68.331 66.658  -3.899  1.00 33.81  ? 78  ARG A NH2   1 
ATOM   658  N N     . GLY A 1 79  ? 64.584 62.011  -2.212  1.00 31.48  ? 79  GLY A N     1 
ATOM   659  C CA    . GLY A 1 79  ? 63.144 62.125  -2.402  1.00 30.97  ? 79  GLY A CA    1 
ATOM   660  C C     . GLY A 1 79  ? 62.515 63.178  -1.495  1.00 31.35  ? 79  GLY A C     1 
ATOM   661  O O     . GLY A 1 79  ? 61.746 64.037  -1.948  1.00 31.05  ? 79  GLY A O     1 
ATOM   662  N N     . LEU A 1 80  ? 62.852 63.102  -0.215  1.00 31.80  ? 80  LEU A N     1 
ATOM   663  C CA    . LEU A 1 80  ? 62.263 63.961  0.779   1.00 32.96  ? 80  LEU A CA    1 
ATOM   664  C C     . LEU A 1 80  ? 62.816 65.350  0.597   1.00 33.53  ? 80  LEU A C     1 
ATOM   665  O O     . LEU A 1 80  ? 62.083 66.325  0.663   1.00 33.70  ? 80  LEU A O     1 
ATOM   666  C CB    . LEU A 1 80  ? 62.549 63.433  2.192   1.00 34.18  ? 80  LEU A CB    1 
ATOM   667  C CG    . LEU A 1 80  ? 61.539 62.393  2.719   1.00 35.30  ? 80  LEU A CG    1 
ATOM   668  C CD1   . LEU A 1 80  ? 61.042 61.401  1.626   1.00 35.00  ? 80  LEU A CD1   1 
ATOM   669  C CD2   . LEU A 1 80  ? 62.048 61.640  3.956   1.00 35.16  ? 80  LEU A CD2   1 
ATOM   670  N N     . GLU A 1 81  ? 64.112 65.426  0.332   1.00 33.78  ? 81  GLU A N     1 
ATOM   671  C CA    . GLU A 1 81  ? 64.770 66.694  0.141   1.00 34.86  ? 81  GLU A CA    1 
ATOM   672  C C     . GLU A 1 81  ? 63.991 67.477  -0.923  1.00 33.64  ? 81  GLU A C     1 
ATOM   673  O O     . GLU A 1 81  ? 63.602 68.630  -0.687  1.00 33.99  ? 81  GLU A O     1 
ATOM   674  C CB    . GLU A 1 81  ? 66.208 66.459  -0.305  1.00 34.66  ? 81  GLU A CB    1 
ATOM   675  C CG    . GLU A 1 81  ? 67.265 67.162  0.515   1.00 37.90  ? 81  GLU A CG    1 
ATOM   676  C CD    . GLU A 1 81  ? 68.654 67.122  -0.153  1.00 40.12  ? 81  GLU A CD    1 
ATOM   677  O OE1   . GLU A 1 81  ? 69.147 66.001  -0.488  1.00 42.43  ? 81  GLU A OE1   1 
ATOM   678  O OE2   . GLU A 1 81  ? 69.254 68.223  -0.338  1.00 44.10  ? 81  GLU A OE2   1 
ATOM   679  N N     . ILE A 1 82  ? 63.740 66.832  -2.067  1.00 31.87  ? 82  ILE A N     1 
ATOM   680  C CA    . ILE A 1 82  ? 63.122 67.495  -3.219  1.00 31.29  ? 82  ILE A CA    1 
ATOM   681  C C     . ILE A 1 82  ? 61.639 67.818  -2.986  1.00 30.94  ? 82  ILE A C     1 
ATOM   682  O O     . ILE A 1 82  ? 61.150 68.900  -3.365  1.00 30.74  ? 82  ILE A O     1 
ATOM   683  C CB    . ILE A 1 82  ? 63.271 66.665  -4.508  1.00 30.25  ? 82  ILE A CB    1 
ATOM   684  C CG1   . ILE A 1 82  ? 64.728 66.517  -4.902  1.00 31.16  ? 82  ILE A CG1   1 
ATOM   685  C CG2   . ILE A 1 82  ? 62.605 67.352  -5.662  1.00 30.47  ? 82  ILE A CG2   1 
ATOM   686  C CD1   . ILE A 1 82  ? 64.988 65.252  -5.733  1.00 32.60  ? 82  ILE A CD1   1 
ATOM   687  N N     . GLY A 1 83  ? 60.945 66.862  -2.362  1.00 30.24  ? 83  GLY A N     1 
ATOM   688  C CA    . GLY A 1 83  ? 59.520 66.965  -2.089  1.00 29.70  ? 83  GLY A CA    1 
ATOM   689  C C     . GLY A 1 83  ? 59.283 68.135  -1.176  1.00 30.93  ? 83  GLY A C     1 
ATOM   690  O O     . GLY A 1 83  ? 58.503 69.026  -1.500  1.00 31.74  ? 83  GLY A O     1 
ATOM   691  N N     . LYS A 1 84  ? 59.977 68.136  -0.039  1.00 31.36  ? 84  LYS A N     1 
ATOM   692  C CA    . LYS A 1 84  ? 60.035 69.300  0.831   1.00 32.85  ? 84  LYS A CA    1 
ATOM   693  C C     . LYS A 1 84  ? 60.418 70.605  0.114   1.00 33.23  ? 84  LYS A C     1 
ATOM   694  O O     . LYS A 1 84  ? 59.944 71.674  0.512   1.00 34.95  ? 84  LYS A O     1 
ATOM   695  C CB    . LYS A 1 84  ? 61.009 69.064  1.979   1.00 33.43  ? 84  LYS A CB    1 
ATOM   696  C CG    . LYS A 1 84  ? 60.495 68.167  3.092   1.00 35.15  ? 84  LYS A CG    1 
ATOM   697  C CD    . LYS A 1 84  ? 61.501 68.077  4.259   1.00 36.63  ? 84  LYS A CD    1 
ATOM   698  C CE    . LYS A 1 84  ? 62.552 66.993  3.984   1.00 40.03  ? 84  LYS A CE    1 
ATOM   699  N NZ    . LYS A 1 84  ? 63.957 67.332  4.402   1.00 41.11  ? 84  LYS A NZ    1 
ATOM   700  N N     . ALA A 1 85  ? 61.264 70.545  -0.919  1.00 32.16  ? 85  ALA A N     1 
ATOM   701  C CA    . ALA A 1 85  ? 61.763 71.788  -1.546  1.00 33.13  ? 85  ALA A CA    1 
ATOM   702  C C     . ALA A 1 85  ? 60.741 72.410  -2.481  1.00 33.37  ? 85  ALA A C     1 
ATOM   703  O O     . ALA A 1 85  ? 60.831 73.589  -2.842  1.00 34.24  ? 85  ALA A O     1 
ATOM   704  C CB    . ALA A 1 85  ? 63.055 71.553  -2.284  1.00 32.44  ? 85  ALA A CB    1 
ATOM   705  N N     . VAL A 1 86  ? 59.759 71.599  -2.847  1.00 32.38  ? 86  VAL A N     1 
ATOM   706  C CA    . VAL A 1 86  ? 58.843 71.921  -3.923  1.00 32.61  ? 86  VAL A CA    1 
ATOM   707  C C     . VAL A 1 86  ? 57.410 72.236  -3.454  1.00 33.56  ? 86  VAL A C     1 
ATOM   708  O O     . VAL A 1 86  ? 56.695 73.031  -4.080  1.00 34.89  ? 86  VAL A O     1 
ATOM   709  C CB    . VAL A 1 86  ? 58.836 70.772  -4.913  1.00 30.73  ? 86  VAL A CB    1 
ATOM   710  C CG1   . VAL A 1 86  ? 57.448 70.498  -5.399  1.00 30.45  ? 86  VAL A CG1   1 
ATOM   711  C CG2   . VAL A 1 86  ? 59.807 71.064  -6.049  1.00 31.19  ? 86  VAL A CG2   1 
ATOM   712  N N     . LEU A 1 87  ? 57.004 71.617  -2.352  1.00 33.09  ? 87  LEU A N     1 
ATOM   713  C CA    . LEU A 1 87  ? 55.688 71.828  -1.791  1.00 33.14  ? 87  LEU A CA    1 
ATOM   714  C C     . LEU A 1 87  ? 55.622 73.091  -0.922  1.00 35.49  ? 87  LEU A C     1 
ATOM   715  O O     . LEU A 1 87  ? 56.617 73.490  -0.300  1.00 35.91  ? 87  LEU A O     1 
ATOM   716  C CB    . LEU A 1 87  ? 55.280 70.582  -1.011  1.00 31.97  ? 87  LEU A CB    1 
ATOM   717  C CG    . LEU A 1 87  ? 55.303 69.337  -1.874  1.00 28.74  ? 87  LEU A CG    1 
ATOM   718  C CD1   . LEU A 1 87  ? 54.972 68.130  -1.080  1.00 27.75  ? 87  LEU A CD1   1 
ATOM   719  C CD2   . LEU A 1 87  ? 54.328 69.502  -3.012  1.00 27.85  ? 87  LEU A CD2   1 
ATOM   720  N N     . ASP A 1 88  ? 54.445 73.718  -0.904  1.00 36.98  ? 88  ASP A N     1 
ATOM   721  C CA    . ASP A 1 88  ? 54.201 74.916  -0.107  1.00 39.65  ? 88  ASP A CA    1 
ATOM   722  C C     . ASP A 1 88  ? 54.163 74.572  1.374   1.00 40.89  ? 88  ASP A C     1 
ATOM   723  O O     . ASP A 1 88  ? 54.508 75.393  2.239   1.00 42.41  ? 88  ASP A O     1 
ATOM   724  C CB    . ASP A 1 88  ? 52.868 75.546  -0.494  1.00 40.83  ? 88  ASP A CB    1 
ATOM   725  C CG    . ASP A 1 88  ? 52.962 76.411  -1.734  1.00 42.21  ? 88  ASP A CG    1 
ATOM   726  O OD1   . ASP A 1 88  ? 54.079 76.890  -2.036  1.00 43.39  ? 88  ASP A OD1   1 
ATOM   727  O OD2   . ASP A 1 88  ? 51.910 76.626  -2.392  1.00 42.76  ? 88  ASP A OD2   1 
ATOM   728  N N     . SER A 1 89  ? 53.706 73.359  1.655   1.00 39.92  ? 89  SER A N     1 
ATOM   729  C CA    . SER A 1 89  ? 53.612 72.851  3.013   1.00 41.57  ? 89  SER A CA    1 
ATOM   730  C C     . SER A 1 89  ? 53.489 71.350  2.889   1.00 40.32  ? 89  SER A C     1 
ATOM   731  O O     . SER A 1 89  ? 52.989 70.837  1.869   1.00 39.47  ? 89  SER A O     1 
ATOM   732  C CB    . SER A 1 89  ? 52.407 73.428  3.749   1.00 43.32  ? 89  SER A CB    1 
ATOM   733  O OG    . SER A 1 89  ? 51.229 73.135  3.041   1.00 42.46  ? 89  SER A OG    1 
ATOM   734  N N     . TYR A 1 90  ? 53.963 70.635  3.899   1.00 40.48  ? 90  TYR A N     1 
ATOM   735  C CA    . TYR A 1 90  ? 54.119 69.208  3.735   1.00 38.92  ? 90  TYR A CA    1 
ATOM   736  C C     . TYR A 1 90  ? 53.870 68.453  5.008   1.00 39.87  ? 90  TYR A C     1 
ATOM   737  O O     . TYR A 1 90  ? 53.479 69.020  6.012   1.00 42.53  ? 90  TYR A O     1 
ATOM   738  C CB    . TYR A 1 90  ? 55.489 68.869  3.132   1.00 37.74  ? 90  TYR A CB    1 
ATOM   739  C CG    . TYR A 1 90  ? 56.661 69.350  3.940   1.00 39.38  ? 90  TYR A CG    1 
ATOM   740  C CD1   . TYR A 1 90  ? 57.140 68.606  5.024   1.00 40.05  ? 90  TYR A CD1   1 
ATOM   741  C CD2   . TYR A 1 90  ? 57.299 70.564  3.631   1.00 40.98  ? 90  TYR A CD2   1 
ATOM   742  C CE1   . TYR A 1 90  ? 58.234 69.061  5.794   1.00 40.47  ? 90  TYR A CE1   1 
ATOM   743  C CE2   . TYR A 1 90  ? 58.390 71.026  4.399   1.00 41.91  ? 90  TYR A CE2   1 
ATOM   744  C CZ    . TYR A 1 90  ? 58.845 70.260  5.472   1.00 41.38  ? 90  TYR A CZ    1 
ATOM   745  O OH    . TYR A 1 90  ? 59.910 70.693  6.218   1.00 43.61  ? 90  TYR A OH    1 
ATOM   746  N N     . GLU A 1 91  ? 54.099 67.155  4.944   1.00 38.78  ? 91  GLU A N     1 
ATOM   747  C CA    . GLU A 1 91  ? 53.710 66.225  5.981   1.00 39.76  ? 91  GLU A CA    1 
ATOM   748  C C     . GLU A 1 91  ? 54.219 64.906  5.505   1.00 37.25  ? 91  GLU A C     1 
ATOM   749  O O     . GLU A 1 91  ? 53.989 64.537  4.352   1.00 35.92  ? 91  GLU A O     1 
ATOM   750  C CB    . GLU A 1 91  ? 52.206 66.142  6.082   1.00 40.79  ? 91  GLU A CB    1 
ATOM   751  C CG    . GLU A 1 91  ? 51.728 65.395  7.299   1.00 45.97  ? 91  GLU A CG    1 
ATOM   752  C CD    . GLU A 1 91  ? 50.218 65.177  7.261   1.00 51.51  ? 91  GLU A CD    1 
ATOM   753  O OE1   . GLU A 1 91  ? 49.684 64.912  6.130   1.00 48.30  ? 91  GLU A OE1   1 
ATOM   754  O OE2   . GLU A 1 91  ? 49.594 65.287  8.362   1.00 53.98  ? 91  GLU A OE2   1 
ATOM   755  N N     . ILE A 1 92  ? 54.945 64.215  6.372   1.00 37.28  ? 92  ILE A N     1 
ATOM   756  C CA    . ILE A 1 92  ? 55.598 62.980  5.994   1.00 35.40  ? 92  ILE A CA    1 
ATOM   757  C C     . ILE A 1 92  ? 55.081 61.902  6.911   1.00 36.85  ? 92  ILE A C     1 
ATOM   758  O O     . ILE A 1 92  ? 55.448 61.828  8.077   1.00 38.83  ? 92  ILE A O     1 
ATOM   759  C CB    . ILE A 1 92  ? 57.133 63.109  6.023   1.00 34.59  ? 92  ILE A CB    1 
ATOM   760  C CG1   . ILE A 1 92  ? 57.591 64.009  4.880   1.00 32.58  ? 92  ILE A CG1   1 
ATOM   761  C CG2   . ILE A 1 92  ? 57.770 61.768  5.852   1.00 33.82  ? 92  ILE A CG2   1 
ATOM   762  C CD1   . ILE A 1 92  ? 59.007 64.495  4.971   1.00 31.72  ? 92  ILE A CD1   1 
ATOM   763  N N     . ARG A 1 93  ? 54.162 61.107  6.385   1.00 36.45  ? 93  ARG A N     1 
ATOM   764  C CA    . ARG A 1 93  ? 53.649 59.958  7.103   1.00 37.90  ? 93  ARG A CA    1 
ATOM   765  C C     . ARG A 1 93  ? 53.579 58.838  6.093   1.00 35.70  ? 93  ARG A C     1 
ATOM   766  O O     . ARG A 1 93  ? 52.827 58.915  5.131   1.00 35.15  ? 93  ARG A O     1 
ATOM   767  C CB    . ARG A 1 93  ? 52.260 60.239  7.706   1.00 39.96  ? 93  ARG A CB    1 
ATOM   768  C CG    . ARG A 1 93  ? 52.262 61.128  8.961   1.00 44.61  ? 93  ARG A CG    1 
ATOM   769  C CD    . ARG A 1 93  ? 52.629 60.360  10.265  1.00 50.85  ? 93  ARG A CD    1 
ATOM   770  N NE    . ARG A 1 93  ? 51.476 60.036  11.131  1.00 55.67  ? 93  ARG A NE    1 
ATOM   771  C CZ    . ARG A 1 93  ? 51.555 59.395  12.305  1.00 60.01  ? 93  ARG A CZ    1 
ATOM   772  N NH1   . ARG A 1 93  ? 52.731 58.991  12.793  1.00 61.08  ? 93  ARG A NH1   1 
ATOM   773  N NH2   . ARG A 1 93  ? 50.455 59.155  13.009  1.00 62.51  ? 93  ARG A NH2   1 
ATOM   774  N N     . TYR A 1 94  ? 54.387 57.807  6.281   1.00 35.09  ? 94  TYR A N     1 
ATOM   775  C CA    . TYR A 1 94  ? 54.307 56.650  5.400   1.00 32.99  ? 94  TYR A CA    1 
ATOM   776  C C     . TYR A 1 94  ? 54.546 55.341  6.169   1.00 34.29  ? 94  TYR A C     1 
ATOM   777  O O     . TYR A 1 94  ? 54.960 55.366  7.313   1.00 35.78  ? 94  TYR A O     1 
ATOM   778  C CB    . TYR A 1 94  ? 55.259 56.828  4.226   1.00 30.10  ? 94  TYR A CB    1 
ATOM   779  C CG    . TYR A 1 94  ? 56.698 57.007  4.617   1.00 29.34  ? 94  TYR A CG    1 
ATOM   780  C CD1   . TYR A 1 94  ? 57.521 55.894  4.806   1.00 27.47  ? 94  TYR A CD1   1 
ATOM   781  C CD2   . TYR A 1 94  ? 57.258 58.294  4.755   1.00 27.44  ? 94  TYR A CD2   1 
ATOM   782  C CE1   . TYR A 1 94  ? 58.847 56.040  5.143   1.00 27.69  ? 94  TYR A CE1   1 
ATOM   783  C CE2   . TYR A 1 94  ? 58.598 58.458  5.096   1.00 25.51  ? 94  TYR A CE2   1 
ATOM   784  C CZ    . TYR A 1 94  ? 59.385 57.321  5.299   1.00 28.38  ? 94  TYR A CZ    1 
ATOM   785  O OH    . TYR A 1 94  ? 60.713 57.434  5.644   1.00 29.46  ? 94  TYR A OH    1 
ATOM   786  N N     . ALA A 1 95  ? 54.260 54.202  5.553   1.00 34.03  ? 95  ALA A N     1 
ATOM   787  C CA    . ALA A 1 95  ? 54.408 52.929  6.251   1.00 35.80  ? 95  ALA A CA    1 
ATOM   788  C C     . ALA A 1 95  ? 55.693 52.215  5.894   1.00 35.82  ? 95  ALA A C     1 
ATOM   789  O O     . ALA A 1 95  ? 56.288 51.562  6.743   1.00 37.73  ? 95  ALA A O     1 
ATOM   790  C CB    . ALA A 1 95  ? 53.217 52.025  5.992   1.00 36.16  ? 95  ALA A CB    1 
ATOM   791  N N     . GLU A 1 96  ? 56.108 52.313  4.634   1.00 34.71  ? 96  GLU A N     1 
ATOM   792  C CA    . GLU A 1 96  ? 57.361 51.697  4.208   1.00 35.06  ? 96  GLU A CA    1 
ATOM   793  C C     . GLU A 1 96  ? 58.054 52.523  3.153   1.00 33.60  ? 96  GLU A C     1 
ATOM   794  O O     . GLU A 1 96  ? 59.195 52.897  3.331   1.00 34.72  ? 96  GLU A O     1 
ATOM   795  C CB    . GLU A 1 96  ? 57.163 50.239  3.750   1.00 35.75  ? 96  GLU A CB    1 
ATOM   796  C CG    . GLU A 1 96  ? 58.442 49.536  3.301   1.00 35.48  ? 96  GLU A CG    1 
ATOM   797  C CD    . GLU A 1 96  ? 58.872 49.931  1.894   1.00 34.68  ? 96  GLU A CD    1 
ATOM   798  O OE1   . GLU A 1 96  ? 58.009 50.037  1.002   1.00 32.44  ? 96  GLU A OE1   1 
ATOM   799  O OE2   . GLU A 1 96  ? 60.082 50.148  1.675   1.00 36.78  ? 96  GLU A OE2   1 
ATOM   800  N N     . HIS A 1 97  ? 57.388 52.806  2.052   1.00 32.40  ? 97  HIS A N     1 
ATOM   801  C CA    . HIS A 1 97  ? 58.026 53.593  1.020   1.00 31.40  ? 97  HIS A CA    1 
ATOM   802  C C     . HIS A 1 97  ? 57.964 55.092  1.335   1.00 31.31  ? 97  HIS A C     1 
ATOM   803  O O     . HIS A 1 97  ? 56.885 55.650  1.499   1.00 31.53  ? 97  HIS A O     1 
ATOM   804  C CB    . HIS A 1 97  ? 57.393 53.303  -0.332  1.00 30.65  ? 97  HIS A CB    1 
ATOM   805  C CG    . HIS A 1 97  ? 58.173 53.857  -1.474  1.00 29.96  ? 97  HIS A CG    1 
ATOM   806  N ND1   . HIS A 1 97  ? 57.960 55.122  -1.971  1.00 30.78  ? 97  HIS A ND1   1 
ATOM   807  C CD2   . HIS A 1 97  ? 59.202 53.339  -2.182  1.00 30.42  ? 97  HIS A CD2   1 
ATOM   808  C CE1   . HIS A 1 97  ? 58.817 55.355  -2.949  1.00 30.52  ? 97  HIS A CE1   1 
ATOM   809  N NE2   . HIS A 1 97  ? 59.583 54.288  -3.097  1.00 29.93  ? 97  HIS A NE2   1 
ATOM   810  N N     . PRO A 1 98  ? 59.124 55.758  1.401   1.00 31.52  ? 98  PRO A N     1 
ATOM   811  C CA    . PRO A 1 98  ? 59.174 57.174  1.762   1.00 31.34  ? 98  PRO A CA    1 
ATOM   812  C C     . PRO A 1 98  ? 58.664 58.036  0.627   1.00 30.19  ? 98  PRO A C     1 
ATOM   813  O O     . PRO A 1 98  ? 58.934 57.742  -0.540  1.00 29.45  ? 98  PRO A O     1 
ATOM   814  C CB    . PRO A 1 98  ? 60.668 57.429  1.919   1.00 31.89  ? 98  PRO A CB    1 
ATOM   815  C CG    . PRO A 1 98  ? 61.304 56.469  0.895   1.00 31.45  ? 98  PRO A CG    1 
ATOM   816  C CD    . PRO A 1 98  ? 60.463 55.226  1.074   1.00 32.24  ? 98  PRO A CD    1 
ATOM   817  N N     . TYR A 1 99  ? 57.928 59.086  0.974   1.00 30.30  ? 99  TYR A N     1 
ATOM   818  C CA    . TYR A 1 99  ? 57.431 60.081  0.028   1.00 29.13  ? 99  TYR A CA    1 
ATOM   819  C C     . TYR A 1 99  ? 56.907 61.207  0.859   1.00 29.57  ? 99  TYR A C     1 
ATOM   820  O O     . TYR A 1 99  ? 56.708 61.033  2.055   1.00 30.66  ? 99  TYR A O     1 
ATOM   821  C CB    . TYR A 1 99  ? 56.291 59.537  -0.836  1.00 28.95  ? 99  TYR A CB    1 
ATOM   822  C CG    . TYR A 1 99  ? 54.996 59.183  -0.095  1.00 30.83  ? 99  TYR A CG    1 
ATOM   823  C CD1   . TYR A 1 99  ? 53.918 60.077  -0.060  1.00 30.24  ? 99  TYR A CD1   1 
ATOM   824  C CD2   . TYR A 1 99  ? 54.835 57.926  0.534   1.00 31.95  ? 99  TYR A CD2   1 
ATOM   825  C CE1   . TYR A 1 99  ? 52.725 59.743  0.585   1.00 31.56  ? 99  TYR A CE1   1 
ATOM   826  C CE2   . TYR A 1 99  ? 53.645 57.587  1.182   1.00 32.57  ? 99  TYR A CE2   1 
ATOM   827  C CZ    . TYR A 1 99  ? 52.595 58.501  1.207   1.00 32.82  ? 99  TYR A CZ    1 
ATOM   828  O OH    . TYR A 1 99  ? 51.418 58.177  1.853   1.00 33.36  ? 99  TYR A OH    1 
ATOM   829  N N     . VAL A 1 100 ? 56.652 62.350  0.231   1.00 28.85  ? 100 VAL A N     1 
ATOM   830  C CA    . VAL A 1 100 ? 56.127 63.484  0.958   1.00 29.35  ? 100 VAL A CA    1 
ATOM   831  C C     . VAL A 1 100 ? 54.814 63.940  0.368   1.00 29.29  ? 100 VAL A C     1 
ATOM   832  O O     . VAL A 1 100 ? 54.686 64.064  -0.836  1.00 29.01  ? 100 VAL A O     1 
ATOM   833  C CB    . VAL A 1 100 ? 57.168 64.616  1.080   1.00 29.70  ? 100 VAL A CB    1 
ATOM   834  C CG1   . VAL A 1 100 ? 58.254 64.413  0.102   1.00 28.48  ? 100 VAL A CG1   1 
ATOM   835  C CG2   . VAL A 1 100 ? 56.534 65.996  0.915   1.00 29.47  ? 100 VAL A CG2   1 
ATOM   836  N N     . HIS A 1 101 ? 53.830 64.143  1.237   1.00 30.31  ? 101 HIS A N     1 
ATOM   837  C CA    . HIS A 1 101 ? 52.525 64.685  0.855   1.00 30.09  ? 101 HIS A CA    1 
ATOM   838  C C     . HIS A 1 101 ? 52.526 66.175  1.098   1.00 30.98  ? 101 HIS A C     1 
ATOM   839  O O     . HIS A 1 101 ? 53.189 66.654  2.012   1.00 31.95  ? 101 HIS A O     1 
ATOM   840  C CB    . HIS A 1 101 ? 51.430 64.074  1.721   1.00 30.82  ? 101 HIS A CB    1 
ATOM   841  C CG    . HIS A 1 101 ? 50.044 64.420  1.280   1.00 30.78  ? 101 HIS A CG    1 
ATOM   842  N ND1   . HIS A 1 101 ? 49.617 64.267  -0.024  1.00 29.53  ? 101 HIS A ND1   1 
ATOM   843  C CD2   . HIS A 1 101 ? 48.973 64.872  1.974   1.00 31.91  ? 101 HIS A CD2   1 
ATOM   844  C CE1   . HIS A 1 101 ? 48.347 64.614  -0.115  1.00 29.60  ? 101 HIS A CE1   1 
ATOM   845  N NE2   . HIS A 1 101 ? 47.932 64.983  1.083   1.00 31.58  ? 101 HIS A NE2   1 
ATOM   846  N N     . GLY A 1 102 ? 51.771 66.915  0.308   1.00 30.60  ? 102 GLY A N     1 
ATOM   847  C CA    . GLY A 1 102 ? 51.702 68.325  0.544   1.00 31.76  ? 102 GLY A CA    1 
ATOM   848  C C     . GLY A 1 102 ? 50.663 69.035  -0.267  1.00 32.12  ? 102 GLY A C     1 
ATOM   849  O O     . GLY A 1 102 ? 49.729 68.424  -0.778  1.00 31.75  ? 102 GLY A O     1 
ATOM   850  N N     . VAL A 1 103 ? 50.861 70.343  -0.376  1.00 32.82  ? 103 VAL A N     1 
ATOM   851  C CA    . VAL A 1 103 ? 49.946 71.244  -1.026  1.00 33.28  ? 103 VAL A CA    1 
ATOM   852  C C     . VAL A 1 103 ? 50.736 72.247  -1.871  1.00 33.39  ? 103 VAL A C     1 
ATOM   853  O O     . VAL A 1 103 ? 51.756 72.804  -1.452  1.00 33.76  ? 103 VAL A O     1 
ATOM   854  C CB    . VAL A 1 103 ? 49.113 71.986  0.029   1.00 35.88  ? 103 VAL A CB    1 
ATOM   855  C CG1   . VAL A 1 103 ? 48.362 73.185  -0.572  1.00 37.41  ? 103 VAL A CG1   1 
ATOM   856  C CG2   . VAL A 1 103 ? 48.167 71.026  0.739   1.00 35.80  ? 103 VAL A CG2   1 
ATOM   857  N N     . VAL A 1 104 ? 50.254 72.450  -3.084  1.00 32.92  ? 104 VAL A N     1 
ATOM   858  C CA    . VAL A 1 104 ? 50.758 73.482  -3.953  1.00 33.13  ? 104 VAL A CA    1 
ATOM   859  C C     . VAL A 1 104 ? 49.539 74.243  -4.487  1.00 34.72  ? 104 VAL A C     1 
ATOM   860  O O     . VAL A 1 104 ? 48.622 73.647  -5.070  1.00 33.78  ? 104 VAL A O     1 
ATOM   861  C CB    . VAL A 1 104 ? 51.646 72.889  -5.064  1.00 31.22  ? 104 VAL A CB    1 
ATOM   862  C CG1   . VAL A 1 104 ? 51.729 73.814  -6.261  1.00 32.37  ? 104 VAL A CG1   1 
ATOM   863  C CG2   . VAL A 1 104 ? 53.015 72.643  -4.528  1.00 30.28  ? 104 VAL A CG2   1 
ATOM   864  N N     . LYS A 1 105 ? 49.514 75.553  -4.225  1.00 36.88  ? 105 LYS A N     1 
ATOM   865  C CA    . LYS A 1 105 ? 48.410 76.404  -4.657  1.00 38.89  ? 105 LYS A CA    1 
ATOM   866  C C     . LYS A 1 105 ? 47.043 75.760  -4.355  1.00 39.15  ? 105 LYS A C     1 
ATOM   867  O O     . LYS A 1 105 ? 46.179 75.607  -5.231  1.00 38.85  ? 105 LYS A O     1 
ATOM   868  C CB    . LYS A 1 105 ? 48.559 76.752  -6.144  1.00 38.84  ? 105 LYS A CB    1 
ATOM   869  C CG    . LYS A 1 105 ? 49.466 77.914  -6.426  1.00 39.07  ? 105 LYS A CG    1 
ATOM   870  C CD    . LYS A 1 105 ? 49.910 77.919  -7.883  1.00 39.14  ? 105 LYS A CD    1 
ATOM   871  C CE    . LYS A 1 105 ? 49.587 79.245  -8.627  1.00 42.18  ? 105 LYS A CE    1 
ATOM   872  N NZ    . LYS A 1 105 ? 49.891 80.506  -7.887  1.00 43.70  ? 105 LYS A NZ    1 
ATOM   873  N N     . GLY A 1 106 ? 46.873 75.369  -3.101  1.00 39.81  ? 106 GLY A N     1 
ATOM   874  C CA    . GLY A 1 106 ? 45.619 74.817  -2.635  1.00 41.14  ? 106 GLY A CA    1 
ATOM   875  C C     . GLY A 1 106 ? 45.309 73.399  -3.074  1.00 39.85  ? 106 GLY A C     1 
ATOM   876  O O     . GLY A 1 106 ? 44.205 72.909  -2.812  1.00 40.43  ? 106 GLY A O     1 
ATOM   877  N N     . VAL A 1 107 ? 46.251 72.721  -3.732  1.00 38.44  ? 107 VAL A N     1 
ATOM   878  C CA    . VAL A 1 107 ? 45.955 71.363  -4.198  1.00 37.63  ? 107 VAL A CA    1 
ATOM   879  C C     . VAL A 1 107 ? 46.961 70.298  -3.728  1.00 36.57  ? 107 VAL A C     1 
ATOM   880  O O     . VAL A 1 107 ? 48.146 70.567  -3.591  1.00 36.44  ? 107 VAL A O     1 
ATOM   881  C CB    . VAL A 1 107 ? 45.679 71.294  -5.737  1.00 36.93  ? 107 VAL A CB    1 
ATOM   882  C CG1   . VAL A 1 107 ? 45.472 72.679  -6.330  1.00 37.57  ? 107 VAL A CG1   1 
ATOM   883  C CG2   . VAL A 1 107 ? 46.767 70.554  -6.462  1.00 35.78  ? 107 VAL A CG2   1 
ATOM   884  N N     . GLU A 1 108 ? 46.454 69.094  -3.489  1.00 36.50  ? 108 GLU A N     1 
ATOM   885  C CA    . GLU A 1 108 ? 47.218 67.995  -2.907  1.00 36.04  ? 108 GLU A CA    1 
ATOM   886  C C     . GLU A 1 108 ? 48.171 67.281  -3.863  1.00 34.48  ? 108 GLU A C     1 
ATOM   887  O O     . GLU A 1 108 ? 47.841 66.938  -5.019  1.00 33.91  ? 108 GLU A O     1 
ATOM   888  C CB    . GLU A 1 108 ? 46.270 66.960  -2.320  1.00 36.83  ? 108 GLU A CB    1 
ATOM   889  C CG    . GLU A 1 108 ? 45.121 67.534  -1.520  1.00 40.80  ? 108 GLU A CG    1 
ATOM   890  C CD    . GLU A 1 108 ? 45.414 67.598  -0.050  1.00 45.78  ? 108 GLU A CD    1 
ATOM   891  O OE1   . GLU A 1 108 ? 44.476 67.343  0.730   1.00 49.97  ? 108 GLU A OE1   1 
ATOM   892  O OE2   . GLU A 1 108 ? 46.568 67.900  0.342   1.00 47.30  ? 108 GLU A OE2   1 
ATOM   893  N N     . VAL A 1 109 ? 49.364 67.026  -3.351  1.00 33.69  ? 109 VAL A N     1 
ATOM   894  C CA    . VAL A 1 109 ? 50.396 66.445  -4.161  1.00 32.04  ? 109 VAL A CA    1 
ATOM   895  C C     . VAL A 1 109 ? 51.069 65.319  -3.402  1.00 31.38  ? 109 VAL A C     1 
ATOM   896  O O     . VAL A 1 109 ? 51.359 65.433  -2.218  1.00 32.28  ? 109 VAL A O     1 
ATOM   897  C CB    . VAL A 1 109 ? 51.448 67.493  -4.543  1.00 32.27  ? 109 VAL A CB    1 
ATOM   898  C CG1   . VAL A 1 109 ? 52.257 67.008  -5.709  1.00 30.99  ? 109 VAL A CG1   1 
ATOM   899  C CG2   . VAL A 1 109 ? 50.794 68.859  -4.878  1.00 33.19  ? 109 VAL A CG2   1 
ATOM   900  N N     . ASP A 1 110 ? 51.278 64.207  -4.077  1.00 30.07  ? 110 ASP A N     1 
ATOM   901  C CA    . ASP A 1 110 ? 52.249 63.268  -3.595  1.00 29.33  ? 110 ASP A CA    1 
ATOM   902  C C     . ASP A 1 110 ? 53.454 63.522  -4.470  1.00 28.41  ? 110 ASP A C     1 
ATOM   903  O O     . ASP A 1 110 ? 53.349 63.593  -5.711  1.00 27.61  ? 110 ASP A O     1 
ATOM   904  C CB    . ASP A 1 110 ? 51.790 61.822  -3.782  1.00 29.08  ? 110 ASP A CB    1 
ATOM   905  C CG    . ASP A 1 110 ? 50.625 61.438  -2.879  1.00 31.22  ? 110 ASP A CG    1 
ATOM   906  O OD1   . ASP A 1 110 ? 49.853 60.537  -3.285  1.00 35.04  ? 110 ASP A OD1   1 
ATOM   907  O OD2   . ASP A 1 110 ? 50.474 61.999  -1.772  1.00 32.61  ? 110 ASP A OD2   1 
ATOM   908  N N     . VAL A 1 111 ? 54.603 63.676  -3.833  1.00 27.47  ? 111 VAL A N     1 
ATOM   909  C CA    . VAL A 1 111 ? 55.848 63.573  -4.573  1.00 25.89  ? 111 VAL A CA    1 
ATOM   910  C C     . VAL A 1 111 ? 56.629 62.328  -4.089  1.00 24.96  ? 111 VAL A C     1 
ATOM   911  O O     . VAL A 1 111 ? 57.047 62.221  -2.942  1.00 25.11  ? 111 VAL A O     1 
ATOM   912  C CB    . VAL A 1 111 ? 56.574 64.962  -4.725  1.00 25.82  ? 111 VAL A CB    1 
ATOM   913  C CG1   . VAL A 1 111 ? 56.172 65.901  -3.621  1.00 27.02  ? 111 VAL A CG1   1 
ATOM   914  C CG2   . VAL A 1 111 ? 58.087 64.827  -4.829  1.00 24.96  ? 111 VAL A CG2   1 
ATOM   915  N N     . VAL A 1 112 ? 56.740 61.366  -4.988  1.00 24.33  ? 112 VAL A N     1 
ATOM   916  C CA    . VAL A 1 112 ? 57.158 60.013  -4.641  1.00 24.79  ? 112 VAL A CA    1 
ATOM   917  C C     . VAL A 1 112 ? 58.432 59.682  -5.411  1.00 25.36  ? 112 VAL A C     1 
ATOM   918  O O     . VAL A 1 112 ? 58.427 59.699  -6.653  1.00 25.51  ? 112 VAL A O     1 
ATOM   919  C CB    . VAL A 1 112 ? 56.084 58.967  -5.074  1.00 24.41  ? 112 VAL A CB    1 
ATOM   920  C CG1   . VAL A 1 112 ? 56.536 57.546  -4.755  1.00 24.84  ? 112 VAL A CG1   1 
ATOM   921  C CG2   . VAL A 1 112 ? 54.716 59.256  -4.461  1.00 24.42  ? 112 VAL A CG2   1 
ATOM   922  N N     . PRO A 1 113 ? 59.533 59.394  -4.692  1.00 25.65  ? 113 PRO A N     1 
ATOM   923  C CA    . PRO A 1 113 ? 60.742 58.941  -5.363  1.00 25.77  ? 113 PRO A CA    1 
ATOM   924  C C     . PRO A 1 113 ? 60.626 57.487  -5.762  1.00 26.61  ? 113 PRO A C     1 
ATOM   925  O O     . PRO A 1 113 ? 60.134 56.672  -4.973  1.00 26.43  ? 113 PRO A O     1 
ATOM   926  C CB    . PRO A 1 113 ? 61.812 59.091  -4.285  1.00 26.34  ? 113 PRO A CB    1 
ATOM   927  C CG    . PRO A 1 113 ? 61.099 58.943  -3.008  1.00 25.87  ? 113 PRO A CG    1 
ATOM   928  C CD    . PRO A 1 113 ? 59.720 59.515  -3.237  1.00 26.15  ? 113 PRO A CD    1 
ATOM   929  N N     . CYS A 1 114 ? 61.082 57.165  -6.975  1.00 27.50  ? 114 CYS A N     1 
ATOM   930  C CA    . CYS A 1 114 ? 61.239 55.767  -7.392  1.00 28.39  ? 114 CYS A CA    1 
ATOM   931  C C     . CYS A 1 114 ? 62.517 55.577  -8.206  1.00 29.08  ? 114 CYS A C     1 
ATOM   932  O O     . CYS A 1 114 ? 63.249 56.543  -8.465  1.00 29.36  ? 114 CYS A O     1 
ATOM   933  C CB    . CYS A 1 114 ? 60.036 55.331  -8.213  1.00 28.24  ? 114 CYS A CB    1 
ATOM   934  S SG    . CYS A 1 114 ? 60.129 55.936  -9.893  1.00 31.36  ? 114 CYS A SG    1 
ATOM   935  N N     . TYR A 1 115 ? 62.764 54.340  -8.631  1.00 29.78  ? 115 TYR A N     1 
ATOM   936  C CA    . TYR A 1 115 ? 63.923 54.018  -9.450  1.00 30.99  ? 115 TYR A CA    1 
ATOM   937  C C     . TYR A 1 115 ? 63.604 53.991  -10.937 1.00 31.72  ? 115 TYR A C     1 
ATOM   938  O O     . TYR A 1 115 ? 62.688 53.292  -11.362 1.00 32.43  ? 115 TYR A O     1 
ATOM   939  C CB    . TYR A 1 115 ? 64.481 52.664  -9.045  1.00 31.74  ? 115 TYR A CB    1 
ATOM   940  C CG    . TYR A 1 115 ? 65.097 52.637  -7.668  1.00 32.73  ? 115 TYR A CG    1 
ATOM   941  C CD1   . TYR A 1 115 ? 64.505 51.901  -6.619  1.00 32.51  ? 115 TYR A CD1   1 
ATOM   942  C CD2   . TYR A 1 115 ? 66.278 53.331  -7.401  1.00 32.22  ? 115 TYR A CD2   1 
ATOM   943  C CE1   . TYR A 1 115 ? 65.079 51.871  -5.361  1.00 30.55  ? 115 TYR A CE1   1 
ATOM   944  C CE2   . TYR A 1 115 ? 66.852 53.294  -6.135  1.00 31.32  ? 115 TYR A CE2   1 
ATOM   945  C CZ    . TYR A 1 115 ? 66.248 52.574  -5.142  1.00 30.92  ? 115 TYR A CZ    1 
ATOM   946  O OH    . TYR A 1 115 ? 66.831 52.570  -3.923  1.00 33.80  ? 115 TYR A OH    1 
ATOM   947  N N     . LYS A 1 116 ? 64.373 54.721  -11.741 1.00 32.44  ? 116 LYS A N     1 
ATOM   948  C CA    . LYS A 1 116 ? 64.184 54.689  -13.181 1.00 33.40  ? 116 LYS A CA    1 
ATOM   949  C C     . LYS A 1 116 ? 64.640 53.344  -13.766 1.00 35.61  ? 116 LYS A C     1 
ATOM   950  O O     . LYS A 1 116 ? 65.833 53.061  -13.842 1.00 37.47  ? 116 LYS A O     1 
ATOM   951  C CB    . LYS A 1 116 ? 64.930 55.857  -13.820 1.00 33.82  ? 116 LYS A CB    1 
ATOM   952  C CG    . LYS A 1 116 ? 64.791 55.933  -15.332 1.00 33.59  ? 116 LYS A CG    1 
ATOM   953  C CD    . LYS A 1 116 ? 65.165 57.299  -15.824 1.00 32.12  ? 116 LYS A CD    1 
ATOM   954  C CE    . LYS A 1 116 ? 64.761 57.510  -17.262 1.00 33.94  ? 116 LYS A CE    1 
ATOM   955  N NZ    . LYS A 1 116 ? 65.300 58.798  -17.788 1.00 34.38  ? 116 LYS A NZ    1 
ATOM   956  N N     . LEU A 1 117 ? 63.700 52.504  -14.171 1.00 36.32  ? 117 LEU A N     1 
ATOM   957  C CA    . LEU A 1 117 ? 64.071 51.186  -14.698 1.00 38.50  ? 117 LEU A CA    1 
ATOM   958  C C     . LEU A 1 117 ? 63.847 51.130  -16.188 1.00 40.85  ? 117 LEU A C     1 
ATOM   959  O O     . LEU A 1 117 ? 63.067 51.910  -16.736 1.00 40.16  ? 117 LEU A O     1 
ATOM   960  C CB    . LEU A 1 117 ? 63.245 50.084  -14.049 1.00 37.60  ? 117 LEU A CB    1 
ATOM   961  C CG    . LEU A 1 117 ? 63.000 50.164  -12.552 1.00 35.95  ? 117 LEU A CG    1 
ATOM   962  C CD1   . LEU A 1 117 ? 62.108 49.028  -12.100 1.00 35.75  ? 117 LEU A CD1   1 
ATOM   963  C CD2   . LEU A 1 117 ? 64.312 50.144  -11.826 1.00 37.19  ? 117 LEU A CD2   1 
ATOM   964  N N     . LYS A 1 118 ? 64.516 50.198  -16.854 1.00 44.39  ? 118 LYS A N     1 
ATOM   965  C CA    . LYS A 1 118 ? 64.195 49.947  -18.256 1.00 47.65  ? 118 LYS A CA    1 
ATOM   966  C C     . LYS A 1 118 ? 62.976 49.051  -18.384 1.00 48.20  ? 118 LYS A C     1 
ATOM   967  O O     . LYS A 1 118 ? 62.207 49.191  -19.325 1.00 49.06  ? 118 LYS A O     1 
ATOM   968  C CB    . LYS A 1 118 ? 65.392 49.399  -19.048 1.00 50.49  ? 118 LYS A CB    1 
ATOM   969  C CG    . LYS A 1 118 ? 66.588 48.947  -18.207 1.00 53.55  ? 118 LYS A CG    1 
ATOM   970  C CD    . LYS A 1 118 ? 66.419 47.521  -17.641 1.00 57.34  ? 118 LYS A CD    1 
ATOM   971  C CE    . LYS A 1 118 ? 66.564 46.448  -18.726 1.00 59.12  ? 118 LYS A CE    1 
ATOM   972  N NZ    . LYS A 1 118 ? 66.404 45.104  -18.111 1.00 61.15  ? 118 LYS A NZ    1 
ATOM   973  N N     . GLU A 1 119 ? 62.806 48.143  -17.425 1.00 48.71  ? 119 GLU A N     1 
ATOM   974  C CA    . GLU A 1 119 ? 61.675 47.220  -17.382 1.00 49.79  ? 119 GLU A CA    1 
ATOM   975  C C     . GLU A 1 119 ? 61.159 47.135  -15.959 1.00 48.19  ? 119 GLU A C     1 
ATOM   976  O O     . GLU A 1 119 ? 61.934 47.293  -15.027 1.00 48.00  ? 119 GLU A O     1 
ATOM   977  C CB    . GLU A 1 119 ? 62.118 45.819  -17.789 1.00 52.68  ? 119 GLU A CB    1 
ATOM   978  C CG    . GLU A 1 119 ? 62.187 45.563  -19.264 1.00 56.81  ? 119 GLU A CG    1 
ATOM   979  C CD    . GLU A 1 119 ? 61.730 44.154  -19.586 1.00 62.90  ? 119 GLU A CD    1 
ATOM   980  O OE1   . GLU A 1 119 ? 62.548 43.361  -20.106 1.00 66.73  ? 119 GLU A OE1   1 
ATOM   981  O OE2   . GLU A 1 119 ? 60.552 43.826  -19.292 1.00 63.91  ? 119 GLU A OE2   1 
ATOM   982  N N     . PRO A 1 120 ? 59.854 46.875  -15.775 1.00 47.67  ? 120 PRO A N     1 
ATOM   983  C CA    . PRO A 1 120 ? 59.375 46.637  -14.419 1.00 46.77  ? 120 PRO A CA    1 
ATOM   984  C C     . PRO A 1 120 ? 59.370 45.157  -13.993 1.00 48.89  ? 120 PRO A C     1 
ATOM   985  O O     . PRO A 1 120 ? 58.469 44.736  -13.266 1.00 48.81  ? 120 PRO A O     1 
ATOM   986  C CB    . PRO A 1 120 ? 57.955 47.216  -14.448 1.00 44.90  ? 120 PRO A CB    1 
ATOM   987  C CG    . PRO A 1 120 ? 57.568 47.235  -15.894 1.00 46.02  ? 120 PRO A CG    1 
ATOM   988  C CD    . PRO A 1 120 ? 58.748 46.839  -16.741 1.00 47.85  ? 120 PRO A CD    1 
ATOM   989  N N     . LYS A 1 121 ? 60.348 44.370  -14.450 1.00 51.41  ? 121 LYS A N     1 
ATOM   990  C CA    . LYS A 1 121 ? 60.680 43.098  -13.787 1.00 53.44  ? 121 LYS A CA    1 
ATOM   991  C C     . LYS A 1 121 ? 61.564 43.487  -12.615 1.00 52.69  ? 121 LYS A C     1 
ATOM   992  O O     . LYS A 1 121 ? 62.085 44.619  -12.578 1.00 51.76  ? 121 LYS A O     1 
ATOM   993  C CB    . LYS A 1 121 ? 61.459 42.151  -14.711 1.00 56.39  ? 121 LYS A CB    1 
ATOM   994  C CG    . LYS A 1 121 ? 60.765 41.758  -16.020 1.00 59.50  ? 121 LYS A CG    1 
ATOM   995  C CD    . LYS A 1 121 ? 59.298 41.276  -15.838 1.00 61.38  ? 121 LYS A CD    1 
ATOM   996  C CE    . LYS A 1 121 ? 58.246 42.367  -16.204 1.00 59.57  ? 121 LYS A CE    1 
ATOM   997  N NZ    . LYS A 1 121 ? 56.860 41.803  -16.392 1.00 59.16  ? 121 LYS A NZ    1 
ATOM   998  N N     . ASN A 1 122 ? 61.733 42.580  -11.654 1.00 53.28  ? 122 ASN A N     1 
ATOM   999  C CA    . ASN A 1 122 ? 62.658 42.811  -10.522 1.00 52.47  ? 122 ASN A CA    1 
ATOM   1000 C C     . ASN A 1 122 ? 62.714 44.278  -10.060 1.00 49.09  ? 122 ASN A C     1 
ATOM   1001 O O     . ASN A 1 122 ? 63.762 44.961  -10.093 1.00 48.98  ? 122 ASN A O     1 
ATOM   1002 C CB    . ASN A 1 122 ? 64.043 42.266  -10.860 1.00 54.89  ? 122 ASN A CB    1 
ATOM   1003 C CG    . ASN A 1 122 ? 63.971 40.899  -11.482 1.00 59.36  ? 122 ASN A CG    1 
ATOM   1004 O OD1   . ASN A 1 122 ? 63.548 39.939  -10.833 1.00 62.18  ? 122 ASN A OD1   1 
ATOM   1005 N ND2   . ASN A 1 122 ? 64.356 40.800  -12.757 1.00 62.05  ? 122 ASN A ND2   1 
ATOM   1006 N N     . ILE A 1 123 ? 61.527 44.740  -9.680  1.00 46.11  ? 123 ILE A N     1 
ATOM   1007 C CA    . ILE A 1 123 ? 61.255 46.027  -9.052  1.00 42.47  ? 123 ILE A CA    1 
ATOM   1008 C C     . ILE A 1 123 ? 62.217 46.192  -7.866  1.00 40.88  ? 123 ILE A C     1 
ATOM   1009 O O     . ILE A 1 123 ? 62.473 45.229  -7.140  1.00 42.33  ? 123 ILE A O     1 
ATOM   1010 C CB    . ILE A 1 123 ? 59.746 46.018  -8.634  1.00 41.62  ? 123 ILE A CB    1 
ATOM   1011 C CG1   . ILE A 1 123 ? 58.865 46.398  -9.808  1.00 42.60  ? 123 ILE A CG1   1 
ATOM   1012 C CG2   . ILE A 1 123 ? 59.426 46.904  -7.507  1.00 41.92  ? 123 ILE A CG2   1 
ATOM   1013 C CD1   . ILE A 1 123 ? 58.251 45.165  -10.484 1.00 48.46  ? 123 ILE A CD1   1 
ATOM   1014 N N     . LYS A 1 124 ? 62.788 47.378  -7.690  1.00 37.47  ? 124 LYS A N     1 
ATOM   1015 C CA    . LYS A 1 124 ? 63.664 47.574  -6.556  1.00 35.86  ? 124 LYS A CA    1 
ATOM   1016 C C     . LYS A 1 124 ? 62.908 48.170  -5.384  1.00 33.99  ? 124 LYS A C     1 
ATOM   1017 O O     . LYS A 1 124 ? 63.108 47.745  -4.253  1.00 34.59  ? 124 LYS A O     1 
ATOM   1018 C CB    . LYS A 1 124 ? 64.876 48.429  -6.915  1.00 35.77  ? 124 LYS A CB    1 
ATOM   1019 C CG    . LYS A 1 124 ? 66.126 48.117  -6.092  1.00 36.03  ? 124 LYS A CG    1 
ATOM   1020 C CD    . LYS A 1 124 ? 67.191 49.196  -6.217  1.00 35.21  ? 124 LYS A CD    1 
ATOM   1021 C CE    . LYS A 1 124 ? 68.518 48.749  -5.617  1.00 36.77  ? 124 LYS A CE    1 
ATOM   1022 N NZ    . LYS A 1 124 ? 69.312 49.893  -5.044  1.00 37.07  ? 124 LYS A NZ    1 
ATOM   1023 N N     . SER A 1 125 ? 62.071 49.174  -5.659  1.00 31.52  ? 125 SER A N     1 
ATOM   1024 C CA    . SER A 1 125 ? 61.183 49.797  -4.661  1.00 29.28  ? 125 SER A CA    1 
ATOM   1025 C C     . SER A 1 125 ? 59.761 49.372  -4.990  1.00 28.90  ? 125 SER A C     1 
ATOM   1026 O O     . SER A 1 125 ? 59.481 48.917  -6.103  1.00 28.43  ? 125 SER A O     1 
ATOM   1027 C CB    . SER A 1 125 ? 61.299 51.332  -4.659  1.00 27.75  ? 125 SER A CB    1 
ATOM   1028 O OG    . SER A 1 125 ? 60.369 51.975  -5.523  1.00 24.82  ? 125 SER A OG    1 
ATOM   1029 N N     . ALA A 1 126 ? 58.849 49.537  -4.042  1.00 28.29  ? 126 ALA A N     1 
ATOM   1030 C CA    . ALA A 1 126 ? 57.506 49.001  -4.242  1.00 27.42  ? 126 ALA A CA    1 
ATOM   1031 C C     . ALA A 1 126 ? 56.632 49.920  -5.106  1.00 25.41  ? 126 ALA A C     1 
ATOM   1032 O O     . ALA A 1 126 ? 55.492 49.576  -5.411  1.00 25.48  ? 126 ALA A O     1 
ATOM   1033 C CB    . ALA A 1 126 ? 56.852 48.694  -2.894  1.00 27.88  ? 126 ALA A CB    1 
ATOM   1034 N N     . VAL A 1 127 ? 57.149 51.075  -5.513  1.00 23.39  ? 127 VAL A N     1 
ATOM   1035 C CA    . VAL A 1 127 ? 56.351 51.955  -6.363  1.00 22.40  ? 127 VAL A CA    1 
ATOM   1036 C C     . VAL A 1 127 ? 56.785 51.936  -7.835  1.00 22.52  ? 127 VAL A C     1 
ATOM   1037 O O     . VAL A 1 127 ? 56.240 52.655  -8.676  1.00 22.31  ? 127 VAL A O     1 
ATOM   1038 C CB    . VAL A 1 127 ? 56.313 53.398  -5.837  1.00 21.56  ? 127 VAL A CB    1 
ATOM   1039 C CG1   . VAL A 1 127 ? 55.715 53.433  -4.423  1.00 22.74  ? 127 VAL A CG1   1 
ATOM   1040 C CG2   . VAL A 1 127 ? 57.703 54.030  -5.865  1.00 20.40  ? 127 VAL A CG2   1 
ATOM   1041 N N     . ASP A 1 128 ? 57.759 51.101  -8.138  1.00 23.15  ? 128 ASP A N     1 
ATOM   1042 C CA    . ASP A 1 128 ? 58.433 51.137  -9.416  1.00 23.59  ? 128 ASP A CA    1 
ATOM   1043 C C     . ASP A 1 128 ? 57.533 50.944  -10.672 1.00 23.83  ? 128 ASP A C     1 
ATOM   1044 O O     . ASP A 1 128 ? 57.891 51.408  -11.763 1.00 24.04  ? 128 ASP A O     1 
ATOM   1045 C CB    . ASP A 1 128 ? 59.611 50.144  -9.380  1.00 24.97  ? 128 ASP A CB    1 
ATOM   1046 C CG    . ASP A 1 128 ? 60.809 50.661  -8.544  1.00 25.04  ? 128 ASP A CG    1 
ATOM   1047 O OD1   . ASP A 1 128 ? 60.862 51.893  -8.224  1.00 19.91  ? 128 ASP A OD1   1 
ATOM   1048 O OD2   . ASP A 1 128 ? 61.705 49.818  -8.232  1.00 24.44  ? 128 ASP A OD2   1 
ATOM   1049 N N     . ARG A 1 129 ? 56.378 50.283  -10.525 1.00 23.84  ? 129 ARG A N     1 
ATOM   1050 C CA    . ARG A 1 129 ? 55.516 49.958  -11.680 1.00 23.40  ? 129 ARG A CA    1 
ATOM   1051 C C     . ARG A 1 129 ? 54.764 51.185  -12.131 1.00 23.38  ? 129 ARG A C     1 
ATOM   1052 O O     . ARG A 1 129 ? 54.381 51.295  -13.292 1.00 24.12  ? 129 ARG A O     1 
ATOM   1053 C CB    . ARG A 1 129 ? 54.489 48.862  -11.357 1.00 23.62  ? 129 ARG A CB    1 
ATOM   1054 C CG    . ARG A 1 129 ? 55.054 47.554  -10.814 1.00 23.61  ? 129 ARG A CG    1 
ATOM   1055 C CD    . ARG A 1 129 ? 53.978 46.444  -10.747 1.00 24.40  ? 129 ARG A CD    1 
ATOM   1056 N NE    . ARG A 1 129 ? 54.486 45.237  -10.095 1.00 22.32  ? 129 ARG A NE    1 
ATOM   1057 C CZ    . ARG A 1 129 ? 54.580 45.066  -8.767  1.00 22.01  ? 129 ARG A CZ    1 
ATOM   1058 N NH1   . ARG A 1 129 ? 54.181 46.028  -7.925  1.00 17.79  ? 129 ARG A NH1   1 
ATOM   1059 N NH2   . ARG A 1 129 ? 55.081 43.929  -8.277  1.00 19.42  ? 129 ARG A NH2   1 
ATOM   1060 N N     . THR A 1 130 ? 54.551 52.111  -11.206 1.00 23.10  ? 130 THR A N     1 
ATOM   1061 C CA    . THR A 1 130 ? 53.702 53.293  -11.455 1.00 23.20  ? 130 THR A CA    1 
ATOM   1062 C C     . THR A 1 130 ? 53.946 54.101  -12.748 1.00 23.52  ? 130 THR A C     1 
ATOM   1063 O O     . THR A 1 130 ? 52.992 54.379  -13.470 1.00 24.51  ? 130 THR A O     1 
ATOM   1064 C CB    . THR A 1 130 ? 53.623 54.206  -10.211 1.00 22.49  ? 130 THR A CB    1 
ATOM   1065 O OG1   . THR A 1 130 ? 53.284 53.396  -9.074  1.00 23.13  ? 130 THR A OG1   1 
ATOM   1066 C CG2   . THR A 1 130 ? 52.570 55.288  -10.395 1.00 21.11  ? 130 THR A CG2   1 
ATOM   1067 N N     . PRO A 1 131 ? 55.201 54.492  -13.047 1.00 23.65  ? 131 PRO A N     1 
ATOM   1068 C CA    . PRO A 1 131 ? 55.423 55.195  -14.329 1.00 23.28  ? 131 PRO A CA    1 
ATOM   1069 C C     . PRO A 1 131 ? 55.046 54.354  -15.548 1.00 24.05  ? 131 PRO A C     1 
ATOM   1070 O O     . PRO A 1 131 ? 54.597 54.896  -16.570 1.00 24.63  ? 131 PRO A O     1 
ATOM   1071 C CB    . PRO A 1 131 ? 56.926 55.443  -14.343 1.00 23.19  ? 131 PRO A CB    1 
ATOM   1072 C CG    . PRO A 1 131 ? 57.321 55.415  -12.943 1.00 23.99  ? 131 PRO A CG    1 
ATOM   1073 C CD    . PRO A 1 131 ? 56.450 54.368  -12.277 1.00 23.37  ? 131 PRO A CD    1 
ATOM   1074 N N     . PHE A 1 132 ? 55.250 53.044  -15.450 1.00 24.39  ? 132 PHE A N     1 
ATOM   1075 C CA    . PHE A 1 132 ? 54.862 52.117  -16.517 1.00 25.33  ? 132 PHE A CA    1 
ATOM   1076 C C     . PHE A 1 132 ? 53.343 51.960  -16.605 1.00 25.16  ? 132 PHE A C     1 
ATOM   1077 O O     . PHE A 1 132 ? 52.800 51.780  -17.686 1.00 25.59  ? 132 PHE A O     1 
ATOM   1078 C CB    . PHE A 1 132 ? 55.481 50.751  -16.281 1.00 25.78  ? 132 PHE A CB    1 
ATOM   1079 C CG    . PHE A 1 132 ? 56.952 50.724  -16.427 1.00 26.77  ? 132 PHE A CG    1 
ATOM   1080 C CD1   . PHE A 1 132 ? 57.772 50.771  -15.307 1.00 27.48  ? 132 PHE A CD1   1 
ATOM   1081 C CD2   . PHE A 1 132 ? 57.537 50.613  -17.682 1.00 28.25  ? 132 PHE A CD2   1 
ATOM   1082 C CE1   . PHE A 1 132 ? 59.170 50.718  -15.436 1.00 28.15  ? 132 PHE A CE1   1 
ATOM   1083 C CE2   . PHE A 1 132 ? 58.928 50.558  -17.833 1.00 28.49  ? 132 PHE A CE2   1 
ATOM   1084 C CZ    . PHE A 1 132 ? 59.747 50.609  -16.713 1.00 29.43  ? 132 PHE A CZ    1 
ATOM   1085 N N     . HIS A 1 133 ? 52.668 51.994  -15.453 1.00 24.41  ? 133 HIS A N     1 
ATOM   1086 C CA    . HIS A 1 133 ? 51.224 51.921  -15.437 1.00 24.22  ? 133 HIS A CA    1 
ATOM   1087 C C     . HIS A 1 133 ? 50.788 53.085  -16.280 1.00 24.43  ? 133 HIS A C     1 
ATOM   1088 O O     . HIS A 1 133 ? 49.986 52.932  -17.189 1.00 25.52  ? 133 HIS A O     1 
ATOM   1089 C CB    . HIS A 1 133 ? 50.660 52.098  -14.033 1.00 23.16  ? 133 HIS A CB    1 
ATOM   1090 C CG    . HIS A 1 133 ? 50.789 50.900  -13.152 1.00 23.76  ? 133 HIS A CG    1 
ATOM   1091 N ND1   . HIS A 1 133 ? 50.718 50.990  -11.780 1.00 22.15  ? 133 HIS A ND1   1 
ATOM   1092 C CD2   . HIS A 1 133 ? 50.969 49.583  -13.437 1.00 26.71  ? 133 HIS A CD2   1 
ATOM   1093 C CE1   . HIS A 1 133 ? 50.850 49.780  -11.257 1.00 23.84  ? 133 HIS A CE1   1 
ATOM   1094 N NE2   . HIS A 1 133 ? 50.998 48.908  -12.240 1.00 24.87  ? 133 HIS A NE2   1 
ATOM   1095 N N     . HIS A 1 134 ? 51.341 54.257  -16.001 1.00 23.89  ? 134 HIS A N     1 
ATOM   1096 C CA    . HIS A 1 134 ? 50.968 55.418  -16.773 1.00 24.53  ? 134 HIS A CA    1 
ATOM   1097 C C     . HIS A 1 134 ? 51.230 55.223  -18.245 1.00 26.26  ? 134 HIS A C     1 
ATOM   1098 O O     . HIS A 1 134 ? 50.399 55.581  -19.084 1.00 27.67  ? 134 HIS A O     1 
ATOM   1099 C CB    . HIS A 1 134 ? 51.717 56.642  -16.350 1.00 23.60  ? 134 HIS A CB    1 
ATOM   1100 C CG    . HIS A 1 134 ? 51.216 57.872  -17.019 1.00 24.88  ? 134 HIS A CG    1 
ATOM   1101 N ND1   . HIS A 1 134 ? 50.089 58.533  -16.594 1.00 25.42  ? 134 HIS A ND1   1 
ATOM   1102 C CD2   . HIS A 1 134 ? 51.645 58.527  -18.117 1.00 26.87  ? 134 HIS A CD2   1 
ATOM   1103 C CE1   . HIS A 1 134 ? 49.866 59.571  -17.377 1.00 25.10  ? 134 HIS A CE1   1 
ATOM   1104 N NE2   . HIS A 1 134 ? 50.793 59.584  -18.314 1.00 27.62  ? 134 HIS A NE2   1 
ATOM   1105 N N     . LYS A 1 135 ? 52.390 54.671  -18.572 1.00 26.89  ? 135 LYS A N     1 
ATOM   1106 C CA    . LYS A 1 135 ? 52.763 54.569  -19.962 1.00 28.40  ? 135 LYS A CA    1 
ATOM   1107 C C     . LYS A 1 135 ? 51.782 53.680  -20.709 1.00 28.62  ? 135 LYS A C     1 
ATOM   1108 O O     . LYS A 1 135 ? 51.303 54.046  -21.768 1.00 30.00  ? 135 LYS A O     1 
ATOM   1109 C CB    . LYS A 1 135 ? 54.186 54.083  -20.090 1.00 29.50  ? 135 LYS A CB    1 
ATOM   1110 C CG    . LYS A 1 135 ? 54.944 54.777  -21.180 1.00 33.40  ? 135 LYS A CG    1 
ATOM   1111 C CD    . LYS A 1 135 ? 55.790 53.739  -21.910 1.00 38.38  ? 135 LYS A CD    1 
ATOM   1112 C CE    . LYS A 1 135 ? 56.115 54.147  -23.323 1.00 40.19  ? 135 LYS A CE    1 
ATOM   1113 N NZ    . LYS A 1 135 ? 56.915 53.028  -23.866 1.00 45.04  ? 135 LYS A NZ    1 
ATOM   1114 N N     . TRP A 1 136 ? 51.433 52.551  -20.103 1.00 28.17  ? 136 TRP A N     1 
ATOM   1115 C CA    . TRP A 1 136 ? 50.509 51.577  -20.681 1.00 28.77  ? 136 TRP A CA    1 
ATOM   1116 C C     . TRP A 1 136 ? 49.090 52.121  -20.899 1.00 29.38  ? 136 TRP A C     1 
ATOM   1117 O O     . TRP A 1 136 ? 48.482 51.882  -21.927 1.00 31.36  ? 136 TRP A O     1 
ATOM   1118 C CB    . TRP A 1 136 ? 50.490 50.323  -19.823 1.00 27.41  ? 136 TRP A CB    1 
ATOM   1119 C CG    . TRP A 1 136 ? 49.927 49.147  -20.511 1.00 27.77  ? 136 TRP A CG    1 
ATOM   1120 C CD1   . TRP A 1 136 ? 50.602 48.236  -21.261 1.00 28.92  ? 136 TRP A CD1   1 
ATOM   1121 C CD2   . TRP A 1 136 ? 48.556 48.751  -20.527 1.00 27.64  ? 136 TRP A CD2   1 
ATOM   1122 N NE1   . TRP A 1 136 ? 49.730 47.285  -21.761 1.00 30.27  ? 136 TRP A NE1   1 
ATOM   1123 C CE2   . TRP A 1 136 ? 48.467 47.580  -21.326 1.00 29.21  ? 136 TRP A CE2   1 
ATOM   1124 C CE3   . TRP A 1 136 ? 47.385 49.279  -19.955 1.00 26.01  ? 136 TRP A CE3   1 
ATOM   1125 C CZ2   . TRP A 1 136 ? 47.260 46.920  -21.557 1.00 29.96  ? 136 TRP A CZ2   1 
ATOM   1126 C CZ3   . TRP A 1 136 ? 46.182 48.624  -20.185 1.00 27.68  ? 136 TRP A CZ3   1 
ATOM   1127 C CH2   . TRP A 1 136 ? 46.129 47.451  -20.982 1.00 29.40  ? 136 TRP A CH2   1 
ATOM   1128 N N     . LEU A 1 137 ? 48.587 52.870  -19.938 1.00 29.02  ? 137 LEU A N     1 
ATOM   1129 C CA    . LEU A 1 137 ? 47.247 53.453  -19.977 1.00 29.96  ? 137 LEU A CA    1 
ATOM   1130 C C     . LEU A 1 137 ? 47.117 54.706  -20.843 1.00 31.62  ? 137 LEU A C     1 
ATOM   1131 O O     . LEU A 1 137 ? 46.096 54.904  -21.491 1.00 32.57  ? 137 LEU A O     1 
ATOM   1132 C CB    . LEU A 1 137 ? 46.805 53.786  -18.549 1.00 28.32  ? 137 LEU A CB    1 
ATOM   1133 C CG    . LEU A 1 137 ? 45.682 53.036  -17.821 1.00 28.80  ? 137 LEU A CG    1 
ATOM   1134 C CD1   . LEU A 1 137 ? 45.399 51.631  -18.367 1.00 30.68  ? 137 LEU A CD1   1 
ATOM   1135 C CD2   . LEU A 1 137 ? 45.931 53.008  -16.322 1.00 26.70  ? 137 LEU A CD2   1 
ATOM   1136 N N     . GLU A 1 138 ? 48.136 55.559  -20.827 1.00 32.64  ? 138 GLU A N     1 
ATOM   1137 C CA    . GLU A 1 138 ? 48.134 56.816  -21.570 1.00 34.94  ? 138 GLU A CA    1 
ATOM   1138 C C     . GLU A 1 138 ? 47.214 56.874  -22.788 1.00 36.94  ? 138 GLU A C     1 
ATOM   1139 O O     . GLU A 1 138 ? 46.333 57.755  -22.862 1.00 38.24  ? 138 GLU A O     1 
ATOM   1140 C CB    . GLU A 1 138 ? 49.539 57.125  -22.049 1.00 36.15  ? 138 GLU A CB    1 
ATOM   1141 C CG    . GLU A 1 138 ? 50.106 58.401  -21.492 1.00 39.10  ? 138 GLU A CG    1 
ATOM   1142 C CD    . GLU A 1 138 ? 51.498 58.695  -22.043 1.00 44.53  ? 138 GLU A CD    1 
ATOM   1143 O OE1   . GLU A 1 138 ? 52.176 59.577  -21.463 1.00 46.04  ? 138 GLU A OE1   1 
ATOM   1144 O OE2   . GLU A 1 138 ? 51.916 58.041  -23.037 1.00 46.56  ? 138 GLU A OE2   1 
ATOM   1145 N N     . GLY A 1 139 ? 47.436 55.962  -23.743 1.00 37.77  ? 139 GLY A N     1 
ATOM   1146 C CA    . GLY A 1 139 ? 46.705 55.965  -25.007 1.00 39.01  ? 139 GLY A CA    1 
ATOM   1147 C C     . GLY A 1 139 ? 45.692 54.841  -25.179 1.00 39.69  ? 139 GLY A C     1 
ATOM   1148 O O     . GLY A 1 139 ? 45.280 54.535  -26.295 1.00 42.18  ? 139 GLY A O     1 
ATOM   1149 N N     . ARG A 1 140 ? 45.277 54.203  -24.094 1.00 37.68  ? 140 ARG A N     1 
ATOM   1150 C CA    . ARG A 1 140 ? 44.182 53.252  -24.203 1.00 37.39  ? 140 ARG A CA    1 
ATOM   1151 C C     . ARG A 1 140 ? 42.960 53.812  -23.494 1.00 36.40  ? 140 ARG A C     1 
ATOM   1152 O O     . ARG A 1 140 ? 41.827 53.450  -23.812 1.00 37.64  ? 140 ARG A O     1 
ATOM   1153 C CB    . ARG A 1 140 ? 44.584 51.885  -23.652 1.00 36.94  ? 140 ARG A CB    1 
ATOM   1154 C CG    . ARG A 1 140 ? 45.994 51.535  -24.003 1.00 35.60  ? 140 ARG A CG    1 
ATOM   1155 C CD    . ARG A 1 140 ? 46.238 50.076  -24.205 1.00 33.21  ? 140 ARG A CD    1 
ATOM   1156 N NE    . ARG A 1 140 ? 47.672 49.895  -24.151 1.00 33.79  ? 140 ARG A NE    1 
ATOM   1157 C CZ    . ARG A 1 140 ? 48.341 48.903  -24.715 1.00 36.83  ? 140 ARG A CZ    1 
ATOM   1158 N NH1   . ARG A 1 140 ? 47.710 47.962  -25.398 1.00 38.78  ? 140 ARG A NH1   1 
ATOM   1159 N NH2   . ARG A 1 140 ? 49.661 48.865  -24.599 1.00 38.45  ? 140 ARG A NH2   1 
ATOM   1160 N N     . ILE A 1 141 ? 43.205 54.724  -22.566 1.00 34.14  ? 141 ILE A N     1 
ATOM   1161 C CA    . ILE A 1 141 ? 42.163 55.335  -21.779 1.00 33.53  ? 141 ILE A CA    1 
ATOM   1162 C C     . ILE A 1 141 ? 41.564 56.633  -22.396 1.00 34.49  ? 141 ILE A C     1 
ATOM   1163 O O     . ILE A 1 141 ? 40.506 57.100  -21.956 1.00 33.98  ? 141 ILE A O     1 
ATOM   1164 C CB    . ILE A 1 141 ? 42.676 55.547  -20.305 1.00 32.07  ? 141 ILE A CB    1 
ATOM   1165 C CG1   . ILE A 1 141 ? 41.583 55.248  -19.272 1.00 31.40  ? 141 ILE A CG1   1 
ATOM   1166 C CG2   . ILE A 1 141 ? 43.333 56.937  -20.106 1.00 31.12  ? 141 ILE A CG2   1 
ATOM   1167 C CD1   . ILE A 1 141 ? 41.086 53.805  -19.295 1.00 32.16  ? 141 ILE A CD1   1 
ATOM   1168 N N     . LYS A 1 142 ? 42.204 57.217  -23.411 1.00 35.97  ? 142 LYS A N     1 
ATOM   1169 C CA    . LYS A 1 142 ? 41.614 58.417  -24.024 1.00 37.93  ? 142 LYS A CA    1 
ATOM   1170 C C     . LYS A 1 142 ? 40.201 58.075  -24.454 1.00 39.31  ? 142 LYS A C     1 
ATOM   1171 O O     . LYS A 1 142 ? 39.959 57.007  -25.056 1.00 40.23  ? 142 LYS A O     1 
ATOM   1172 C CB    . LYS A 1 142 ? 42.355 58.914  -25.278 1.00 40.13  ? 142 LYS A CB    1 
ATOM   1173 C CG    . LYS A 1 142 ? 43.836 59.198  -25.165 1.00 41.79  ? 142 LYS A CG    1 
ATOM   1174 C CD    . LYS A 1 142 ? 44.184 60.370  -24.247 1.00 42.95  ? 142 LYS A CD    1 
ATOM   1175 C CE    . LYS A 1 142 ? 45.695 60.622  -24.285 1.00 43.81  ? 142 LYS A CE    1 
ATOM   1176 N NZ    . LYS A 1 142 ? 46.177 60.677  -25.726 1.00 46.92  ? 142 LYS A NZ    1 
ATOM   1177 N N     . GLY A 1 143 ? 39.281 58.991  -24.162 1.00 39.25  ? 143 GLY A N     1 
ATOM   1178 C CA    . GLY A 1 143 ? 37.895 58.864  -24.574 1.00 40.16  ? 143 GLY A CA    1 
ATOM   1179 C C     . GLY A 1 143 ? 37.122 57.969  -23.636 1.00 39.46  ? 143 GLY A C     1 
ATOM   1180 O O     . GLY A 1 143 ? 35.933 57.756  -23.830 1.00 40.69  ? 143 GLY A O     1 
ATOM   1181 N N     . LYS A 1 144 ? 37.789 57.437  -22.618 1.00 35.06  ? 144 LYS A N     1 
ATOM   1182 C CA    . LYS A 1 144 ? 37.119 56.550  -21.668 1.00 34.11  ? 144 LYS A CA    1 
ATOM   1183 C C     . LYS A 1 144 ? 37.182 57.077  -20.248 1.00 32.96  ? 144 LYS A C     1 
ATOM   1184 O O     . LYS A 1 144 ? 36.580 56.519  -19.337 1.00 31.59  ? 144 LYS A O     1 
ATOM   1185 C CB    . LYS A 1 144 ? 37.698 55.141  -21.728 1.00 32.68  ? 144 LYS A CB    1 
ATOM   1186 C CG    . LYS A 1 144 ? 37.415 54.469  -23.027 1.00 35.46  ? 144 LYS A CG    1 
ATOM   1187 C CD    . LYS A 1 144 ? 37.800 52.999  -22.988 1.00 39.25  ? 144 LYS A CD    1 
ATOM   1188 C CE    . LYS A 1 144 ? 37.188 52.245  -24.174 1.00 42.64  ? 144 LYS A CE    1 
ATOM   1189 N NZ    . LYS A 1 144 ? 37.310 53.013  -25.476 1.00 44.77  ? 144 LYS A NZ    1 
ATOM   1190 N N     . GLU A 1 145 ? 37.911 58.165  -20.071 1.00 33.73  ? 145 GLU A N     1 
ATOM   1191 C CA    . GLU A 1 145 ? 38.108 58.722  -18.751 1.00 33.71  ? 145 GLU A CA    1 
ATOM   1192 C C     . GLU A 1 145 ? 36.807 58.906  -17.950 1.00 33.75  ? 145 GLU A C     1 
ATOM   1193 O O     . GLU A 1 145 ? 36.790 58.753  -16.734 1.00 33.35  ? 145 GLU A O     1 
ATOM   1194 C CB    . GLU A 1 145 ? 38.968 59.992  -18.804 1.00 35.10  ? 145 GLU A CB    1 
ATOM   1195 C CG    . GLU A 1 145 ? 38.656 60.969  -19.906 1.00 38.38  ? 145 GLU A CG    1 
ATOM   1196 C CD    . GLU A 1 145 ? 39.228 60.556  -21.258 1.00 40.98  ? 145 GLU A CD    1 
ATOM   1197 O OE1   . GLU A 1 145 ? 40.479 60.508  -21.435 1.00 40.65  ? 145 GLU A OE1   1 
ATOM   1198 O OE2   . GLU A 1 145 ? 38.396 60.299  -22.151 1.00 42.94  ? 145 GLU A OE2   1 
ATOM   1199 N N     . ASN A 1 146 ? 35.709 59.188  -18.622 1.00 35.17  ? 146 ASN A N     1 
ATOM   1200 C CA    . ASN A 1 146 ? 34.456 59.254  -17.905 1.00 35.39  ? 146 ASN A CA    1 
ATOM   1201 C C     . ASN A 1 146 ? 33.893 57.894  -17.525 1.00 33.74  ? 146 ASN A C     1 
ATOM   1202 O O     . ASN A 1 146 ? 33.297 57.757  -16.463 1.00 33.71  ? 146 ASN A O     1 
ATOM   1203 C CB    . ASN A 1 146 ? 33.435 60.122  -18.625 1.00 37.62  ? 146 ASN A CB    1 
ATOM   1204 C CG    . ASN A 1 146 ? 33.727 61.570  -18.454 1.00 39.88  ? 146 ASN A CG    1 
ATOM   1205 O OD1   . ASN A 1 146 ? 34.543 61.953  -17.623 1.00 41.12  ? 146 ASN A OD1   1 
ATOM   1206 N ND2   . ASN A 1 146 ? 33.075 62.394  -19.235 1.00 43.93  ? 146 ASN A ND2   1 
ATOM   1207 N N     . GLU A 1 147 ? 34.096 56.878  -18.351 1.00 32.94  ? 147 GLU A N     1 
ATOM   1208 C CA    . GLU A 1 147 ? 33.726 55.510  -17.919 1.00 31.43  ? 147 GLU A CA    1 
ATOM   1209 C C     . GLU A 1 147 ? 34.477 55.098  -16.630 1.00 29.38  ? 147 GLU A C     1 
ATOM   1210 O O     . GLU A 1 147 ? 33.899 54.470  -15.736 1.00 28.76  ? 147 GLU A O     1 
ATOM   1211 C CB    . GLU A 1 147 ? 33.932 54.482  -19.030 1.00 31.41  ? 147 GLU A CB    1 
ATOM   1212 C CG    . GLU A 1 147 ? 33.128 54.734  -20.317 1.00 33.41  ? 147 GLU A CG    1 
ATOM   1213 C CD    . GLU A 1 147 ? 31.629 54.534  -20.163 1.00 34.78  ? 147 GLU A CD    1 
ATOM   1214 O OE1   . GLU A 1 147 ? 31.184 53.858  -19.211 1.00 35.81  ? 147 GLU A OE1   1 
ATOM   1215 O OE2   . GLU A 1 147 ? 30.883 55.048  -21.020 1.00 37.97  ? 147 GLU A OE2   1 
ATOM   1216 N N     . VAL A 1 148 ? 35.745 55.495  -16.525 1.00 28.21  ? 148 VAL A N     1 
ATOM   1217 C CA    . VAL A 1 148 ? 36.519 55.284  -15.307 1.00 26.23  ? 148 VAL A CA    1 
ATOM   1218 C C     . VAL A 1 148 ? 35.838 55.927  -14.091 1.00 25.95  ? 148 VAL A C     1 
ATOM   1219 O O     . VAL A 1 148 ? 35.601 55.263  -13.084 1.00 24.48  ? 148 VAL A O     1 
ATOM   1220 C CB    . VAL A 1 148 ? 37.946 55.844  -15.436 1.00 26.09  ? 148 VAL A CB    1 
ATOM   1221 C CG1   . VAL A 1 148 ? 38.697 55.622  -14.163 1.00 25.27  ? 148 VAL A CG1   1 
ATOM   1222 C CG2   . VAL A 1 148 ? 38.683 55.196  -16.584 1.00 25.96  ? 148 VAL A CG2   1 
ATOM   1223 N N     . ARG A 1 149 ? 35.526 57.218  -14.195 1.00 26.93  ? 149 ARG A N     1 
ATOM   1224 C CA    . ARG A 1 149 ? 34.929 57.958  -13.073 1.00 27.19  ? 149 ARG A CA    1 
ATOM   1225 C C     . ARG A 1 149 ? 33.616 57.359  -12.561 1.00 27.34  ? 149 ARG A C     1 
ATOM   1226 O O     . ARG A 1 149 ? 33.447 57.156  -11.356 1.00 26.87  ? 149 ARG A O     1 
ATOM   1227 C CB    . ARG A 1 149 ? 34.758 59.426  -13.430 1.00 28.48  ? 149 ARG A CB    1 
ATOM   1228 C CG    . ARG A 1 149 ? 36.074 60.118  -13.577 1.00 27.37  ? 149 ARG A CG    1 
ATOM   1229 C CD    . ARG A 1 149 ? 35.929 61.351  -14.380 1.00 29.30  ? 149 ARG A CD    1 
ATOM   1230 N NE    . ARG A 1 149 ? 36.981 62.308  -14.088 1.00 30.46  ? 149 ARG A NE    1 
ATOM   1231 C CZ    . ARG A 1 149 ? 37.480 63.133  -14.992 1.00 33.85  ? 149 ARG A CZ    1 
ATOM   1232 N NH1   . ARG A 1 149 ? 37.017 63.085  -16.236 1.00 33.76  ? 149 ARG A NH1   1 
ATOM   1233 N NH2   . ARG A 1 149 ? 38.439 63.996  -14.661 1.00 35.88  ? 149 ARG A NH2   1 
ATOM   1234 N N     . LEU A 1 150 ? 32.703 57.048  -13.482 1.00 28.08  ? 150 LEU A N     1 
ATOM   1235 C CA    . LEU A 1 150 ? 31.517 56.257  -13.150 1.00 27.61  ? 150 LEU A CA    1 
ATOM   1236 C C     . LEU A 1 150 ? 31.856 55.058  -12.273 1.00 25.50  ? 150 LEU A C     1 
ATOM   1237 O O     . LEU A 1 150 ? 31.241 54.874  -11.225 1.00 25.40  ? 150 LEU A O     1 
ATOM   1238 C CB    . LEU A 1 150 ? 30.764 55.814  -14.405 1.00 28.68  ? 150 LEU A CB    1 
ATOM   1239 C CG    . LEU A 1 150 ? 29.934 56.902  -15.102 1.00 31.42  ? 150 LEU A CG    1 
ATOM   1240 C CD1   . LEU A 1 150 ? 29.286 56.339  -16.359 1.00 32.98  ? 150 LEU A CD1   1 
ATOM   1241 C CD2   . LEU A 1 150 ? 28.871 57.503  -14.184 1.00 31.96  ? 150 LEU A CD2   1 
ATOM   1242 N N     . LEU A 1 151 ? 32.845 54.271  -12.664 1.00 23.82  ? 151 LEU A N     1 
ATOM   1243 C CA    . LEU A 1 151 ? 33.212 53.114  -11.856 1.00 23.01  ? 151 LEU A CA    1 
ATOM   1244 C C     . LEU A 1 151 ? 33.780 53.475  -10.473 1.00 23.37  ? 151 LEU A C     1 
ATOM   1245 O O     . LEU A 1 151 ? 33.535 52.766  -9.469  1.00 22.90  ? 151 LEU A O     1 
ATOM   1246 C CB    . LEU A 1 151 ? 34.191 52.225  -12.615 1.00 22.49  ? 151 LEU A CB    1 
ATOM   1247 C CG    . LEU A 1 151 ? 34.494 50.847  -12.051 1.00 20.70  ? 151 LEU A CG    1 
ATOM   1248 C CD1   . LEU A 1 151 ? 33.188 50.112  -11.797 1.00 20.95  ? 151 LEU A CD1   1 
ATOM   1249 C CD2   . LEU A 1 151 ? 35.378 50.101  -13.015 1.00 17.80  ? 151 LEU A CD2   1 
ATOM   1250 N N     . LYS A 1 152 ? 34.519 54.584  -10.411 1.00 23.81  ? 152 LYS A N     1 
ATOM   1251 C CA    . LYS A 1 152 ? 35.144 54.964  -9.173  1.00 23.90  ? 152 LYS A CA    1 
ATOM   1252 C C     . LYS A 1 152 ? 34.105 55.516  -8.230  1.00 25.16  ? 152 LYS A C     1 
ATOM   1253 O O     . LYS A 1 152 ? 34.146 55.270  -7.040  1.00 25.33  ? 152 LYS A O     1 
ATOM   1254 C CB    . LYS A 1 152 ? 36.231 55.989  -9.421  1.00 25.03  ? 152 LYS A CB    1 
ATOM   1255 C CG    . LYS A 1 152 ? 37.459 55.462  -10.122 1.00 25.07  ? 152 LYS A CG    1 
ATOM   1256 C CD    . LYS A 1 152 ? 38.514 56.543  -10.268 1.00 27.97  ? 152 LYS A CD    1 
ATOM   1257 C CE    . LYS A 1 152 ? 39.806 55.918  -10.765 1.00 28.14  ? 152 LYS A CE    1 
ATOM   1258 N NZ    . LYS A 1 152 ? 40.920 56.874  -10.900 1.00 28.02  ? 152 LYS A NZ    1 
ATOM   1259 N N     . GLY A 1 153 ? 33.156 56.267  -8.762  1.00 27.19  ? 153 GLY A N     1 
ATOM   1260 C CA    . GLY A 1 153 ? 32.128 56.885  -7.925  1.00 29.27  ? 153 GLY A CA    1 
ATOM   1261 C C     . GLY A 1 153 ? 31.153 55.841  -7.436  1.00 29.53  ? 153 GLY A C     1 
ATOM   1262 O O     . GLY A 1 153 ? 30.574 55.956  -6.347  1.00 29.98  ? 153 GLY A O     1 
ATOM   1263 N N     . PHE A 1 154 ? 30.987 54.816  -8.263  1.00 29.68  ? 154 PHE A N     1 
ATOM   1264 C CA    . PHE A 1 154 ? 30.094 53.729  -7.978  1.00 30.23  ? 154 PHE A CA    1 
ATOM   1265 C C     . PHE A 1 154 ? 30.681 52.955  -6.817  1.00 29.82  ? 154 PHE A C     1 
ATOM   1266 O O     . PHE A 1 154 ? 29.967 52.596  -5.879  1.00 30.71  ? 154 PHE A O     1 
ATOM   1267 C CB    . PHE A 1 154 ? 29.981 52.852  -9.211  1.00 30.03  ? 154 PHE A CB    1 
ATOM   1268 C CG    . PHE A 1 154 ? 29.045 51.690  -9.057  1.00 30.79  ? 154 PHE A CG    1 
ATOM   1269 C CD1   . PHE A 1 154 ? 27.660 51.891  -9.004  1.00 32.51  ? 154 PHE A CD1   1 
ATOM   1270 C CD2   . PHE A 1 154 ? 29.542 50.390  -8.993  1.00 28.99  ? 154 PHE A CD2   1 
ATOM   1271 C CE1   . PHE A 1 154 ? 26.782 50.815  -8.873  1.00 31.70  ? 154 PHE A CE1   1 
ATOM   1272 C CE2   . PHE A 1 154 ? 28.679 49.314  -8.864  1.00 29.73  ? 154 PHE A CE2   1 
ATOM   1273 C CZ    . PHE A 1 154 ? 27.292 49.524  -8.807  1.00 31.07  ? 154 PHE A CZ    1 
ATOM   1274 N N     . LEU A 1 155 ? 31.988 52.716  -6.864  1.00 29.08  ? 155 LEU A N     1 
ATOM   1275 C CA    . LEU A 1 155 ? 32.639 51.935  -5.811  1.00 28.41  ? 155 LEU A CA    1 
ATOM   1276 C C     . LEU A 1 155 ? 32.800 52.746  -4.531  1.00 29.43  ? 155 LEU A C     1 
ATOM   1277 O O     . LEU A 1 155 ? 32.600 52.225  -3.419  1.00 30.08  ? 155 LEU A O     1 
ATOM   1278 C CB    . LEU A 1 155 ? 33.993 51.435  -6.286  1.00 27.21  ? 155 LEU A CB    1 
ATOM   1279 C CG    . LEU A 1 155 ? 33.937 50.351  -7.348  1.00 25.81  ? 155 LEU A CG    1 
ATOM   1280 C CD1   . LEU A 1 155 ? 35.239 50.339  -8.041  1.00 27.23  ? 155 LEU A CD1   1 
ATOM   1281 C CD2   . LEU A 1 155 ? 33.661 48.999  -6.756  1.00 24.33  ? 155 LEU A CD2   1 
ATOM   1282 N N     . LYS A 1 156 ? 33.147 54.022  -4.704  1.00 29.69  ? 156 LYS A N     1 
ATOM   1283 C CA    . LYS A 1 156 ? 33.309 54.953  -3.604  1.00 30.59  ? 156 LYS A CA    1 
ATOM   1284 C C     . LYS A 1 156 ? 32.061 55.041  -2.748  1.00 31.37  ? 156 LYS A C     1 
ATOM   1285 O O     . LYS A 1 156 ? 32.140 55.092  -1.528  1.00 32.43  ? 156 LYS A O     1 
ATOM   1286 C CB    . LYS A 1 156 ? 33.640 56.342  -4.133  1.00 31.46  ? 156 LYS A CB    1 
ATOM   1287 C CG    . LYS A 1 156 ? 33.643 57.406  -3.046  1.00 33.61  ? 156 LYS A CG    1 
ATOM   1288 C CD    . LYS A 1 156 ? 35.054 57.757  -2.617  1.00 35.39  ? 156 LYS A CD    1 
ATOM   1289 C CE    . LYS A 1 156 ? 35.581 59.019  -3.339  1.00 35.16  ? 156 LYS A CE    1 
ATOM   1290 N NZ    . LYS A 1 156 ? 35.671 60.156  -2.396  1.00 36.70  ? 156 LYS A NZ    1 
ATOM   1291 N N     . ALA A 1 157 ? 30.909 55.072  -3.401  1.00 31.76  ? 157 ALA A N     1 
ATOM   1292 C CA    . ALA A 1 157 ? 29.643 55.274  -2.720  1.00 32.69  ? 157 ALA A CA    1 
ATOM   1293 C C     . ALA A 1 157 ? 29.193 54.014  -1.984  1.00 32.32  ? 157 ALA A C     1 
ATOM   1294 O O     . ALA A 1 157 ? 28.273 54.062  -1.163  1.00 33.81  ? 157 ALA A O     1 
ATOM   1295 C CB    . ALA A 1 157 ? 28.580 55.725  -3.713  1.00 33.29  ? 157 ALA A CB    1 
ATOM   1296 N N     . ASN A 1 158 ? 29.828 52.890  -2.281  1.00 30.43  ? 158 ASN A N     1 
ATOM   1297 C CA    . ASN A 1 158 ? 29.453 51.662  -1.630  1.00 30.07  ? 158 ASN A CA    1 
ATOM   1298 C C     . ASN A 1 158 ? 30.609 51.189  -0.791  1.00 29.32  ? 158 ASN A C     1 
ATOM   1299 O O     . ASN A 1 158 ? 30.689 50.008  -0.387  1.00 28.66  ? 158 ASN A O     1 
ATOM   1300 C CB    . ASN A 1 158 ? 29.027 50.627  -2.653  1.00 29.95  ? 158 ASN A CB    1 
ATOM   1301 C CG    . ASN A 1 158 ? 27.747 51.011  -3.338  1.00 31.25  ? 158 ASN A CG    1 
ATOM   1302 O OD1   . ASN A 1 158 ? 26.695 50.426  -3.074  1.00 31.27  ? 158 ASN A OD1   1 
ATOM   1303 N ND2   . ASN A 1 158 ? 27.817 52.025  -4.206  1.00 30.53  ? 158 ASN A ND2   1 
ATOM   1304 N N     . GLY A 1 159 ? 31.498 52.148  -0.540  1.00 28.73  ? 159 GLY A N     1 
ATOM   1305 C CA    . GLY A 1 159 ? 32.561 52.007  0.436   1.00 28.65  ? 159 GLY A CA    1 
ATOM   1306 C C     . GLY A 1 159 ? 33.582 50.925  0.138   1.00 27.53  ? 159 GLY A C     1 
ATOM   1307 O O     . GLY A 1 159 ? 34.169 50.384  1.076   1.00 27.92  ? 159 GLY A O     1 
ATOM   1308 N N     . ILE A 1 160 ? 33.793 50.621  -1.150  1.00 26.17  ? 160 ILE A N     1 
ATOM   1309 C CA    . ILE A 1 160 ? 34.813 49.658  -1.582  1.00 24.69  ? 160 ILE A CA    1 
ATOM   1310 C C     . ILE A 1 160 ? 35.830 50.202  -2.605  1.00 24.42  ? 160 ILE A C     1 
ATOM   1311 O O     . ILE A 1 160 ? 36.489 49.442  -3.310  1.00 23.01  ? 160 ILE A O     1 
ATOM   1312 C CB    . ILE A 1 160 ? 34.190 48.338  -2.077  1.00 24.53  ? 160 ILE A CB    1 
ATOM   1313 C CG1   . ILE A 1 160 ? 33.190 48.580  -3.200  1.00 23.60  ? 160 ILE A CG1   1 
ATOM   1314 C CG2   . ILE A 1 160 ? 33.542 47.583  -0.922  1.00 24.76  ? 160 ILE A CG2   1 
ATOM   1315 C CD1   . ILE A 1 160 ? 32.646 47.289  -3.802  1.00 23.75  ? 160 ILE A CD1   1 
ATOM   1316 N N     . TYR A 1 161 ? 35.965 51.522  -2.667  1.00 25.48  ? 161 TYR A N     1 
ATOM   1317 C CA    . TYR A 1 161 ? 37.036 52.144  -3.429  1.00 25.76  ? 161 TYR A CA    1 
ATOM   1318 C C     . TYR A 1 161 ? 38.293 52.428  -2.602  1.00 26.62  ? 161 TYR A C     1 
ATOM   1319 O O     . TYR A 1 161 ? 38.230 53.147  -1.600  1.00 27.84  ? 161 TYR A O     1 
ATOM   1320 C CB    . TYR A 1 161 ? 36.561 53.452  -3.985  1.00 26.81  ? 161 TYR A CB    1 
ATOM   1321 C CG    . TYR A 1 161 ? 37.549 54.058  -4.953  1.00 27.33  ? 161 TYR A CG    1 
ATOM   1322 C CD1   . TYR A 1 161 ? 37.876 53.393  -6.138  1.00 24.90  ? 161 TYR A CD1   1 
ATOM   1323 C CD2   . TYR A 1 161 ? 38.139 55.296  -4.691  1.00 27.72  ? 161 TYR A CD2   1 
ATOM   1324 C CE1   . TYR A 1 161 ? 38.760 53.925  -7.023  1.00 27.09  ? 161 TYR A CE1   1 
ATOM   1325 C CE2   . TYR A 1 161 ? 39.037 55.854  -5.581  1.00 29.10  ? 161 TYR A CE2   1 
ATOM   1326 C CZ    . TYR A 1 161 ? 39.342 55.158  -6.756  1.00 29.01  ? 161 TYR A CZ    1 
ATOM   1327 O OH    . TYR A 1 161 ? 40.222 55.692  -7.676  1.00 29.04  ? 161 TYR A OH    1 
ATOM   1328 N N     . GLY A 1 162 ? 39.430 51.892  -3.050  1.00 26.20  ? 162 GLY A N     1 
ATOM   1329 C CA    . GLY A 1 162 ? 40.699 51.937  -2.319  1.00 26.59  ? 162 GLY A CA    1 
ATOM   1330 C C     . GLY A 1 162 ? 41.264 50.539  -2.064  1.00 26.54  ? 162 GLY A C     1 
ATOM   1331 O O     . GLY A 1 162 ? 40.546 49.644  -1.625  1.00 27.16  ? 162 GLY A O     1 
ATOM   1332 N N     . ALA A 1 163 ? 42.547 50.333  -2.345  1.00 25.96  ? 163 ALA A N     1 
ATOM   1333 C CA    . ALA A 1 163 ? 43.190 49.069  -2.037  1.00 25.29  ? 163 ALA A CA    1 
ATOM   1334 C C     . ALA A 1 163 ? 43.842 49.046  -0.652  1.00 26.34  ? 163 ALA A C     1 
ATOM   1335 O O     . ALA A 1 163 ? 44.320 47.990  -0.225  1.00 27.12  ? 163 ALA A O     1 
ATOM   1336 C CB    . ALA A 1 163 ? 44.213 48.727  -3.097  1.00 25.03  ? 163 ALA A CB    1 
ATOM   1337 N N     . GLU A 1 164 ? 43.876 50.196  0.034   1.00 26.46  ? 164 GLU A N     1 
ATOM   1338 C CA    . GLU A 1 164 ? 44.456 50.319  1.386   1.00 27.40  ? 164 GLU A CA    1 
ATOM   1339 C C     . GLU A 1 164 ? 43.781 49.404  2.418   1.00 28.01  ? 164 GLU A C     1 
ATOM   1340 O O     . GLU A 1 164 ? 42.688 48.883  2.184   1.00 27.26  ? 164 GLU A O     1 
ATOM   1341 C CB    . GLU A 1 164 ? 44.472 51.780  1.865   1.00 27.56  ? 164 GLU A CB    1 
ATOM   1342 C CG    . GLU A 1 164 ? 43.131 52.439  2.083   1.00 26.95  ? 164 GLU A CG    1 
ATOM   1343 C CD    . GLU A 1 164 ? 42.590 53.124  0.826   1.00 29.32  ? 164 GLU A CD    1 
ATOM   1344 O OE1   . GLU A 1 164 ? 41.711 54.009  0.954   1.00 28.86  ? 164 GLU A OE1   1 
ATOM   1345 O OE2   . GLU A 1 164 ? 43.028 52.783  -0.309  1.00 30.23  ? 164 GLU A OE2   1 
ATOM   1346 N N     . TYR A 1 165 ? 44.425 49.186  3.559   1.00 30.08  ? 165 TYR A N     1 
ATOM   1347 C CA    . TYR A 1 165 ? 43.876 48.205  4.486   1.00 30.96  ? 165 TYR A CA    1 
ATOM   1348 C C     . TYR A 1 165 ? 42.567 48.632  5.112   1.00 30.64  ? 165 TYR A C     1 
ATOM   1349 O O     . TYR A 1 165 ? 41.724 47.802  5.383   1.00 30.17  ? 165 TYR A O     1 
ATOM   1350 C CB    . TYR A 1 165 ? 44.889 47.759  5.532   1.00 33.50  ? 165 TYR A CB    1 
ATOM   1351 C CG    . TYR A 1 165 ? 45.772 46.655  5.023   1.00 34.17  ? 165 TYR A CG    1 
ATOM   1352 C CD1   . TYR A 1 165 ? 47.156 46.820  4.960   1.00 35.68  ? 165 TYR A CD1   1 
ATOM   1353 C CD2   . TYR A 1 165 ? 45.226 45.449  4.585   1.00 33.86  ? 165 TYR A CD2   1 
ATOM   1354 C CE1   . TYR A 1 165 ? 47.984 45.802  4.481   1.00 36.53  ? 165 TYR A CE1   1 
ATOM   1355 C CE2   . TYR A 1 165 ? 46.039 44.425  4.101   1.00 35.47  ? 165 TYR A CE2   1 
ATOM   1356 C CZ    . TYR A 1 165 ? 47.422 44.613  4.053   1.00 36.69  ? 165 TYR A CZ    1 
ATOM   1357 O OH    . TYR A 1 165 ? 48.243 43.615  3.564   1.00 37.84  ? 165 TYR A OH    1 
ATOM   1358 N N     . LYS A 1 166 ? 42.379 49.932  5.289   1.00 30.94  ? 166 LYS A N     1 
ATOM   1359 C CA    . LYS A 1 166 ? 41.113 50.451  5.802   1.00 31.28  ? 166 LYS A CA    1 
ATOM   1360 C C     . LYS A 1 166 ? 39.932 50.038  4.947   1.00 29.66  ? 166 LYS A C     1 
ATOM   1361 O O     . LYS A 1 166 ? 38.795 50.159  5.369   1.00 29.68  ? 166 LYS A O     1 
ATOM   1362 C CB    . LYS A 1 166 ? 41.158 51.969  5.878   1.00 31.86  ? 166 LYS A CB    1 
ATOM   1363 C CG    . LYS A 1 166 ? 40.204 52.569  6.860   1.00 33.86  ? 166 LYS A CG    1 
ATOM   1364 C CD    . LYS A 1 166 ? 40.226 54.084  6.725   1.00 36.42  ? 166 LYS A CD    1 
ATOM   1365 C CE    . LYS A 1 166 ? 39.436 54.768  7.825   1.00 37.29  ? 166 LYS A CE    1 
ATOM   1366 N NZ    . LYS A 1 166 ? 39.839 56.196  7.834   1.00 42.37  ? 166 LYS A NZ    1 
ATOM   1367 N N     . VAL A 1 167 ? 40.199 49.561  3.736   1.00 29.14  ? 167 VAL A N     1 
ATOM   1368 C CA    . VAL A 1 167 ? 39.127 49.321  2.763   1.00 28.17  ? 167 VAL A CA    1 
ATOM   1369 C C     . VAL A 1 167 ? 39.163 47.927  2.129   1.00 27.78  ? 167 VAL A C     1 
ATOM   1370 O O     . VAL A 1 167 ? 38.126 47.261  2.005   1.00 27.63  ? 167 VAL A O     1 
ATOM   1371 C CB    . VAL A 1 167 ? 39.139 50.371  1.640   1.00 27.31  ? 167 VAL A CB    1 
ATOM   1372 C CG1   . VAL A 1 167 ? 37.845 50.308  0.838   1.00 26.02  ? 167 VAL A CG1   1 
ATOM   1373 C CG2   . VAL A 1 167 ? 39.359 51.775  2.199   1.00 28.06  ? 167 VAL A CG2   1 
ATOM   1374 N N     . ARG A 1 168 ? 40.353 47.503  1.719   1.00 27.90  ? 168 ARG A N     1 
ATOM   1375 C CA    . ARG A 1 168 ? 40.514 46.253  0.975   1.00 27.65  ? 168 ARG A CA    1 
ATOM   1376 C C     . ARG A 1 168 ? 39.563 46.173  -0.234  1.00 26.48  ? 168 ARG A C     1 
ATOM   1377 O O     . ARG A 1 168 ? 38.851 45.192  -0.409  1.00 26.18  ? 168 ARG A O     1 
ATOM   1378 C CB    . ARG A 1 168 ? 40.356 45.051  1.906   1.00 28.67  ? 168 ARG A CB    1 
ATOM   1379 C CG    . ARG A 1 168 ? 41.389 44.988  3.030   1.00 29.63  ? 168 ARG A CG    1 
ATOM   1380 C CD    . ARG A 1 168 ? 41.126 43.783  3.855   1.00 31.84  ? 168 ARG A CD    1 
ATOM   1381 N NE    . ARG A 1 168 ? 42.069 43.600  4.954   1.00 36.60  ? 168 ARG A NE    1 
ATOM   1382 C CZ    . ARG A 1 168 ? 43.016 42.660  4.995   1.00 37.14  ? 168 ARG A CZ    1 
ATOM   1383 N NH1   . ARG A 1 168 ? 43.147 41.812  3.976   1.00 34.09  ? 168 ARG A NH1   1 
ATOM   1384 N NH2   . ARG A 1 168 ? 43.825 42.572  6.062   1.00 36.68  ? 168 ARG A NH2   1 
ATOM   1385 N N     . GLY A 1 169 ? 39.587 47.223  -1.056  1.00 25.68  ? 169 GLY A N     1 
ATOM   1386 C CA    . GLY A 1 169 ? 38.667 47.388  -2.167  1.00 25.28  ? 169 GLY A CA    1 
ATOM   1387 C C     . GLY A 1 169 ? 39.383 47.445  -3.500  1.00 25.42  ? 169 GLY A C     1 
ATOM   1388 O O     . GLY A 1 169 ? 40.248 46.608  -3.766  1.00 26.41  ? 169 GLY A O     1 
ATOM   1389 N N     . PHE A 1 170 ? 39.032 48.423  -4.336  1.00 24.66  ? 170 PHE A N     1 
ATOM   1390 C CA    . PHE A 1 170 ? 39.521 48.485  -5.706  1.00 24.14  ? 170 PHE A CA    1 
ATOM   1391 C C     . PHE A 1 170 ? 40.334 49.737  -5.880  1.00 24.82  ? 170 PHE A C     1 
ATOM   1392 O O     . PHE A 1 170 ? 39.848 50.828  -5.593  1.00 25.57  ? 170 PHE A O     1 
ATOM   1393 C CB    . PHE A 1 170 ? 38.346 48.599  -6.677  1.00 23.93  ? 170 PHE A CB    1 
ATOM   1394 C CG    . PHE A 1 170 ? 37.494 47.372  -6.772  1.00 23.99  ? 170 PHE A CG    1 
ATOM   1395 C CD1   . PHE A 1 170 ? 36.631 47.021  -5.741  1.00 24.54  ? 170 PHE A CD1   1 
ATOM   1396 C CD2   . PHE A 1 170 ? 37.528 46.575  -7.925  1.00 23.91  ? 170 PHE A CD2   1 
ATOM   1397 C CE1   . PHE A 1 170 ? 35.823 45.881  -5.848  1.00 25.89  ? 170 PHE A CE1   1 
ATOM   1398 C CE2   . PHE A 1 170 ? 36.741 45.422  -8.042  1.00 23.99  ? 170 PHE A CE2   1 
ATOM   1399 C CZ    . PHE A 1 170 ? 35.882 45.073  -7.008  1.00 24.87  ? 170 PHE A CZ    1 
ATOM   1400 N N     . SER A 1 171 ? 41.550 49.627  -6.391  1.00 25.08  ? 171 SER A N     1 
ATOM   1401 C CA    . SER A 1 171 ? 42.310 50.857  -6.667  1.00 25.57  ? 171 SER A CA    1 
ATOM   1402 C C     . SER A 1 171 ? 41.765 51.589  -7.888  1.00 25.33  ? 171 SER A C     1 
ATOM   1403 O O     . SER A 1 171 ? 40.943 51.048  -8.641  1.00 25.05  ? 171 SER A O     1 
ATOM   1404 C CB    . SER A 1 171 ? 43.783 50.555  -6.877  1.00 26.20  ? 171 SER A CB    1 
ATOM   1405 O OG    . SER A 1 171 ? 43.950 49.274  -7.451  1.00 27.06  ? 171 SER A OG    1 
ATOM   1406 N N     . GLY A 1 172 ? 42.221 52.818  -8.090  1.00 25.52  ? 172 GLY A N     1 
ATOM   1407 C CA    . GLY A 1 172 ? 41.792 53.583  -9.251  1.00 24.94  ? 172 GLY A CA    1 
ATOM   1408 C C     . GLY A 1 172 ? 42.356 52.937  -10.479 1.00 24.50  ? 172 GLY A C     1 
ATOM   1409 O O     . GLY A 1 172 ? 41.682 52.817  -11.516 1.00 24.68  ? 172 GLY A O     1 
ATOM   1410 N N     . TYR A 1 173 ? 43.602 52.504  -10.343 1.00 24.58  ? 173 TYR A N     1 
ATOM   1411 C CA    . TYR A 1 173 ? 44.302 51.774  -11.392 1.00 24.51  ? 173 TYR A CA    1 
ATOM   1412 C C     . TYR A 1 173 ? 43.534 50.531  -11.789 1.00 23.45  ? 173 TYR A C     1 
ATOM   1413 O O     . TYR A 1 173 ? 43.331 50.269  -12.970 1.00 23.61  ? 173 TYR A O     1 
ATOM   1414 C CB    . TYR A 1 173 ? 45.695 51.367  -10.932 1.00 24.96  ? 173 TYR A CB    1 
ATOM   1415 C CG    . TYR A 1 173 ? 46.464 50.614  -11.985 1.00 25.14  ? 173 TYR A CG    1 
ATOM   1416 C CD1   . TYR A 1 173 ? 46.691 51.180  -13.247 1.00 25.13  ? 173 TYR A CD1   1 
ATOM   1417 C CD2   . TYR A 1 173 ? 46.980 49.337  -11.724 1.00 25.04  ? 173 TYR A CD2   1 
ATOM   1418 C CE1   . TYR A 1 173 ? 47.406 50.489  -14.231 1.00 26.63  ? 173 TYR A CE1   1 
ATOM   1419 C CE2   . TYR A 1 173 ? 47.703 48.624  -12.717 1.00 25.48  ? 173 TYR A CE2   1 
ATOM   1420 C CZ    . TYR A 1 173 ? 47.902 49.207  -13.962 1.00 25.98  ? 173 TYR A CZ    1 
ATOM   1421 O OH    . TYR A 1 173 ? 48.621 48.550  -14.929 1.00 25.31  ? 173 TYR A OH    1 
ATOM   1422 N N     . LEU A 1 174 ? 43.098 49.772  -10.796 1.00 22.86  ? 174 LEU A N     1 
ATOM   1423 C CA    . LEU A 1 174 ? 42.301 48.580  -11.071 1.00 22.26  ? 174 LEU A CA    1 
ATOM   1424 C C     . LEU A 1 174 ? 41.092 48.971  -11.903 1.00 21.86  ? 174 LEU A C     1 
ATOM   1425 O O     . LEU A 1 174 ? 40.711 48.228  -12.831 1.00 21.73  ? 174 LEU A O     1 
ATOM   1426 C CB    . LEU A 1 174 ? 41.832 47.932  -9.775  1.00 21.68  ? 174 LEU A CB    1 
ATOM   1427 C CG    . LEU A 1 174 ? 41.572 46.438  -9.835  1.00 22.15  ? 174 LEU A CG    1 
ATOM   1428 C CD1   . LEU A 1 174 ? 40.848 45.920  -8.579  1.00 21.79  ? 174 LEU A CD1   1 
ATOM   1429 C CD2   . LEU A 1 174 ? 40.816 46.070  -11.052 1.00 22.48  ? 174 LEU A CD2   1 
ATOM   1430 N N     . CYS A 1 175 ? 40.504 50.125  -11.563 1.00 21.09  ? 175 CYS A N     1 
ATOM   1431 C CA    . CYS A 1 175 ? 39.341 50.644  -12.267 1.00 21.59  ? 175 CYS A CA    1 
ATOM   1432 C C     . CYS A 1 175 ? 39.695 50.963  -13.700 1.00 21.52  ? 175 CYS A C     1 
ATOM   1433 O O     . CYS A 1 175 ? 38.923 50.719  -14.619 1.00 20.90  ? 175 CYS A O     1 
ATOM   1434 C CB    . CYS A 1 175 ? 38.798 51.903  -11.602 1.00 22.15  ? 175 CYS A CB    1 
ATOM   1435 S SG    . CYS A 1 175 ? 37.917 51.628  -10.036 1.00 25.14  ? 175 CYS A SG    1 
ATOM   1436 N N     . GLU A 1 176 ? 40.875 51.520  -13.895 1.00 22.09  ? 176 GLU A N     1 
ATOM   1437 C CA    . GLU A 1 176 ? 41.260 51.900  -15.235 1.00 22.80  ? 176 GLU A CA    1 
ATOM   1438 C C     . GLU A 1 176 ? 41.404 50.622  -16.050 1.00 21.81  ? 176 GLU A C     1 
ATOM   1439 O O     . GLU A 1 176 ? 40.792 50.468  -17.117 1.00 22.79  ? 176 GLU A O     1 
ATOM   1440 C CB    . GLU A 1 176 ? 42.514 52.783  -15.210 1.00 23.71  ? 176 GLU A CB    1 
ATOM   1441 C CG    . GLU A 1 176 ? 42.205 54.175  -14.711 1.00 26.70  ? 176 GLU A CG    1 
ATOM   1442 C CD    . GLU A 1 176 ? 43.433 55.030  -14.411 1.00 32.30  ? 176 GLU A CD    1 
ATOM   1443 O OE1   . GLU A 1 176 ? 43.568 56.128  -15.005 1.00 34.30  ? 176 GLU A OE1   1 
ATOM   1444 O OE2   . GLU A 1 176 ? 44.258 54.624  -13.559 1.00 35.03  ? 176 GLU A OE2   1 
ATOM   1445 N N     . LEU A 1 177 ? 42.162 49.674  -15.529 1.00 20.34  ? 177 LEU A N     1 
ATOM   1446 C CA    . LEU A 1 177 ? 42.312 48.392  -16.223 1.00 19.82  ? 177 LEU A CA    1 
ATOM   1447 C C     . LEU A 1 177 ? 40.974 47.767  -16.614 1.00 19.55  ? 177 LEU A C     1 
ATOM   1448 O O     . LEU A 1 177 ? 40.867 47.169  -17.667 1.00 20.04  ? 177 LEU A O     1 
ATOM   1449 C CB    . LEU A 1 177 ? 43.137 47.411  -15.393 1.00 19.09  ? 177 LEU A CB    1 
ATOM   1450 C CG    . LEU A 1 177 ? 44.598 47.776  -15.169 1.00 18.86  ? 177 LEU A CG    1 
ATOM   1451 C CD1   . LEU A 1 177 ? 45.257 46.616  -14.502 1.00 18.45  ? 177 LEU A CD1   1 
ATOM   1452 C CD2   . LEU A 1 177 ? 45.293 48.124  -16.472 1.00 17.45  ? 177 LEU A CD2   1 
ATOM   1453 N N     . LEU A 1 178 ? 39.954 47.918  -15.773 1.00 19.30  ? 178 LEU A N     1 
ATOM   1454 C CA    . LEU A 1 178 ? 38.666 47.277  -16.028 1.00 19.74  ? 178 LEU A CA    1 
ATOM   1455 C C     . LEU A 1 178 ? 37.946 47.910  -17.198 1.00 20.97  ? 178 LEU A C     1 
ATOM   1456 O O     . LEU A 1 178 ? 37.339 47.188  -18.024 1.00 21.92  ? 178 LEU A O     1 
ATOM   1457 C CB    . LEU A 1 178 ? 37.782 47.310  -14.788 1.00 19.12  ? 178 LEU A CB    1 
ATOM   1458 C CG    . LEU A 1 178 ? 38.231 46.318  -13.710 1.00 19.79  ? 178 LEU A CG    1 
ATOM   1459 C CD1   . LEU A 1 178 ? 37.594 46.696  -12.356 1.00 16.38  ? 178 LEU A CD1   1 
ATOM   1460 C CD2   . LEU A 1 178 ? 38.005 44.817  -14.112 1.00 15.01  ? 178 LEU A CD2   1 
ATOM   1461 N N     . ILE A 1 179 ? 38.016 49.244  -17.277 1.00 20.61  ? 179 ILE A N     1 
ATOM   1462 C CA    . ILE A 1 179 ? 37.459 49.944  -18.414 1.00 21.81  ? 179 ILE A CA    1 
ATOM   1463 C C     . ILE A 1 179 ? 38.225 49.583  -19.690 1.00 23.05  ? 179 ILE A C     1 
ATOM   1464 O O     . ILE A 1 179 ? 37.606 49.327  -20.721 1.00 24.31  ? 179 ILE A O     1 
ATOM   1465 C CB    . ILE A 1 179 ? 37.401 51.483  -18.246 1.00 22.21  ? 179 ILE A CB    1 
ATOM   1466 C CG1   . ILE A 1 179 ? 36.757 51.908  -16.903 1.00 21.86  ? 179 ILE A CG1   1 
ATOM   1467 C CG2   . ILE A 1 179 ? 36.712 52.086  -19.442 1.00 22.81  ? 179 ILE A CG2   1 
ATOM   1468 C CD1   . ILE A 1 179 ? 35.303 51.517  -16.703 1.00 21.95  ? 179 ILE A CD1   1 
ATOM   1469 N N     . VAL A 1 180 ? 39.556 49.551  -19.641 1.00 23.07  ? 180 VAL A N     1 
ATOM   1470 C CA    . VAL A 1 180 ? 40.304 49.148  -20.842 1.00 24.08  ? 180 VAL A CA    1 
ATOM   1471 C C     . VAL A 1 180 ? 39.843 47.758  -21.242 1.00 24.69  ? 180 VAL A C     1 
ATOM   1472 O O     . VAL A 1 180 ? 39.545 47.520  -22.412 1.00 26.03  ? 180 VAL A O     1 
ATOM   1473 C CB    . VAL A 1 180 ? 41.858 49.231  -20.690 1.00 24.25  ? 180 VAL A CB    1 
ATOM   1474 C CG1   . VAL A 1 180 ? 42.567 48.710  -21.929 1.00 23.40  ? 180 VAL A CG1   1 
ATOM   1475 C CG2   . VAL A 1 180 ? 42.291 50.675  -20.445 1.00 23.62  ? 180 VAL A CG2   1 
ATOM   1476 N N     . PHE A 1 181 ? 39.722 46.857  -20.274 1.00 23.99  ? 181 PHE A N     1 
ATOM   1477 C CA    . PHE A 1 181 ? 39.221 45.510  -20.583 1.00 25.30  ? 181 PHE A CA    1 
ATOM   1478 C C     . PHE A 1 181 ? 37.806 45.462  -21.188 1.00 26.54  ? 181 PHE A C     1 
ATOM   1479 O O     . PHE A 1 181 ? 37.601 44.868  -22.231 1.00 27.73  ? 181 PHE A O     1 
ATOM   1480 C CB    . PHE A 1 181 ? 39.288 44.613  -19.357 1.00 24.12  ? 181 PHE A CB    1 
ATOM   1481 C CG    . PHE A 1 181 ? 39.268 43.174  -19.674 1.00 24.73  ? 181 PHE A CG    1 
ATOM   1482 C CD1   . PHE A 1 181 ? 40.387 42.552  -20.205 1.00 25.66  ? 181 PHE A CD1   1 
ATOM   1483 C CD2   . PHE A 1 181 ? 38.130 42.416  -19.444 1.00 26.34  ? 181 PHE A CD2   1 
ATOM   1484 C CE1   . PHE A 1 181 ? 40.369 41.183  -20.510 1.00 26.19  ? 181 PHE A CE1   1 
ATOM   1485 C CE2   . PHE A 1 181 ? 38.114 41.040  -19.737 1.00 25.37  ? 181 PHE A CE2   1 
ATOM   1486 C CZ    . PHE A 1 181 ? 39.237 40.437  -20.275 1.00 25.80  ? 181 PHE A CZ    1 
ATOM   1487 N N     . TYR A 1 182 ? 36.839 46.090  -20.524 1.00 27.09  ? 182 TYR A N     1 
ATOM   1488 C CA    . TYR A 1 182 ? 35.422 45.982  -20.912 1.00 28.24  ? 182 TYR A CA    1 
ATOM   1489 C C     . TYR A 1 182 ? 34.947 47.044  -21.883 1.00 29.52  ? 182 TYR A C     1 
ATOM   1490 O O     . TYR A 1 182 ? 34.076 46.783  -22.689 1.00 31.18  ? 182 TYR A O     1 
ATOM   1491 C CB    . TYR A 1 182 ? 34.510 45.939  -19.671 1.00 27.63  ? 182 TYR A CB    1 
ATOM   1492 C CG    . TYR A 1 182 ? 34.701 44.667  -18.897 1.00 27.65  ? 182 TYR A CG    1 
ATOM   1493 C CD1   . TYR A 1 182 ? 34.304 43.441  -19.437 1.00 27.94  ? 182 TYR A CD1   1 
ATOM   1494 C CD2   . TYR A 1 182 ? 35.312 44.673  -17.640 1.00 26.58  ? 182 TYR A CD2   1 
ATOM   1495 C CE1   . TYR A 1 182 ? 34.491 42.256  -18.744 1.00 29.32  ? 182 TYR A CE1   1 
ATOM   1496 C CE2   . TYR A 1 182 ? 35.518 43.486  -16.933 1.00 25.86  ? 182 TYR A CE2   1 
ATOM   1497 C CZ    . TYR A 1 182 ? 35.112 42.281  -17.491 1.00 28.29  ? 182 TYR A CZ    1 
ATOM   1498 O OH    . TYR A 1 182 ? 35.297 41.093  -16.810 1.00 28.42  ? 182 TYR A OH    1 
ATOM   1499 N N     . GLY A 1 183 ? 35.498 48.245  -21.790 1.00 29.50  ? 183 GLY A N     1 
ATOM   1500 C CA    . GLY A 1 183 ? 35.143 49.308  -22.712 1.00 31.41  ? 183 GLY A CA    1 
ATOM   1501 C C     . GLY A 1 183 ? 34.247 50.355  -22.103 1.00 32.02  ? 183 GLY A C     1 
ATOM   1502 O O     . GLY A 1 183 ? 34.255 51.496  -22.541 1.00 33.09  ? 183 GLY A O     1 
ATOM   1503 N N     . SER A 1 184 ? 33.470 49.980  -21.093 1.00 31.74  ? 184 SER A N     1 
ATOM   1504 C CA    . SER A 1 184 ? 32.611 50.951  -20.407 1.00 32.43  ? 184 SER A CA    1 
ATOM   1505 C C     . SER A 1 184 ? 32.319 50.519  -18.972 1.00 31.33  ? 184 SER A C     1 
ATOM   1506 O O     . SER A 1 184 ? 32.596 49.364  -18.593 1.00 30.21  ? 184 SER A O     1 
ATOM   1507 C CB    . SER A 1 184 ? 31.287 51.109  -21.154 1.00 34.35  ? 184 SER A CB    1 
ATOM   1508 O OG    . SER A 1 184 ? 30.554 49.886  -21.122 1.00 35.11  ? 184 SER A OG    1 
ATOM   1509 N N     . PHE A 1 185 ? 31.744 51.445  -18.195 1.00 31.36  ? 185 PHE A N     1 
ATOM   1510 C CA    . PHE A 1 185 ? 31.237 51.136  -16.864 1.00 30.95  ? 185 PHE A CA    1 
ATOM   1511 C C     . PHE A 1 185 ? 30.116 50.126  -16.951 1.00 32.07  ? 185 PHE A C     1 
ATOM   1512 O O     . PHE A 1 185 ? 30.136 49.108  -16.280 1.00 31.76  ? 185 PHE A O     1 
ATOM   1513 C CB    . PHE A 1 185 ? 30.707 52.375  -16.166 1.00 31.03  ? 185 PHE A CB    1 
ATOM   1514 C CG    . PHE A 1 185 ? 29.864 52.069  -14.953 1.00 30.65  ? 185 PHE A CG    1 
ATOM   1515 C CD1   . PHE A 1 185 ? 28.470 52.056  -15.034 1.00 31.97  ? 185 PHE A CD1   1 
ATOM   1516 C CD2   . PHE A 1 185 ? 30.461 51.783  -13.729 1.00 28.18  ? 185 PHE A CD2   1 
ATOM   1517 C CE1   . PHE A 1 185 ? 27.693 51.768  -13.903 1.00 30.57  ? 185 PHE A CE1   1 
ATOM   1518 C CE2   . PHE A 1 185 ? 29.688 51.505  -12.604 1.00 27.14  ? 185 PHE A CE2   1 
ATOM   1519 C CZ    . PHE A 1 185 ? 28.309 51.501  -12.695 1.00 28.61  ? 185 PHE A CZ    1 
ATOM   1520 N N     . LEU A 1 186 ? 29.128 50.433  -17.776 1.00 34.44  ? 186 LEU A N     1 
ATOM   1521 C CA    . LEU A 1 186 ? 28.034 49.522  -18.031 1.00 35.88  ? 186 LEU A CA    1 
ATOM   1522 C C     . LEU A 1 186 ? 28.508 48.097  -18.336 1.00 35.43  ? 186 LEU A C     1 
ATOM   1523 O O     . LEU A 1 186 ? 28.036 47.162  -17.711 1.00 35.71  ? 186 LEU A O     1 
ATOM   1524 C CB    . LEU A 1 186 ? 27.138 50.057  -19.149 1.00 37.79  ? 186 LEU A CB    1 
ATOM   1525 C CG    . LEU A 1 186 ? 25.800 49.321  -19.241 1.00 40.13  ? 186 LEU A CG    1 
ATOM   1526 C CD1   . LEU A 1 186 ? 24.971 49.494  -17.928 1.00 40.14  ? 186 LEU A CD1   1 
ATOM   1527 C CD2   . LEU A 1 186 ? 25.008 49.755  -20.472 1.00 40.65  ? 186 LEU A CD2   1 
ATOM   1528 N N     . GLU A 1 187 ? 29.445 47.943  -19.271 1.00 35.53  ? 187 GLU A N     1 
ATOM   1529 C CA    . GLU A 1 187 ? 29.947 46.619  -19.650 1.00 35.81  ? 187 GLU A CA    1 
ATOM   1530 C C     . GLU A 1 187 ? 30.684 45.948  -18.491 1.00 33.69  ? 187 GLU A C     1 
ATOM   1531 O O     . GLU A 1 187 ? 30.514 44.757  -18.233 1.00 33.61  ? 187 GLU A O     1 
ATOM   1532 C CB    . GLU A 1 187 ? 30.842 46.700  -20.893 1.00 36.71  ? 187 GLU A CB    1 
ATOM   1533 C CG    . GLU A 1 187 ? 30.958 45.386  -21.678 1.00 39.54  ? 187 GLU A CG    1 
ATOM   1534 C CD    . GLU A 1 187 ? 29.644 45.000  -22.355 1.00 45.10  ? 187 GLU A CD    1 
ATOM   1535 O OE1   . GLU A 1 187 ? 29.501 43.843  -22.820 1.00 47.03  ? 187 GLU A OE1   1 
ATOM   1536 O OE2   . GLU A 1 187 ? 28.740 45.861  -22.415 1.00 46.99  ? 187 GLU A OE2   1 
ATOM   1537 N N     . THR A 1 188 ? 31.490 46.723  -17.780 1.00 32.22  ? 188 THR A N     1 
ATOM   1538 C CA    . THR A 1 188 ? 32.099 46.241  -16.548 1.00 30.74  ? 188 THR A CA    1 
ATOM   1539 C C     . THR A 1 188 ? 31.043 45.602  -15.649 1.00 31.11  ? 188 THR A C     1 
ATOM   1540 O O     . THR A 1 188 ? 31.113 44.407  -15.364 1.00 32.14  ? 188 THR A O     1 
ATOM   1541 C CB    . THR A 1 188 ? 32.808 47.362  -15.808 1.00 29.37  ? 188 THR A CB    1 
ATOM   1542 O OG1   . THR A 1 188 ? 33.821 47.903  -16.658 1.00 29.94  ? 188 THR A OG1   1 
ATOM   1543 C CG2   . THR A 1 188 ? 33.446 46.842  -14.559 1.00 28.03  ? 188 THR A CG2   1 
ATOM   1544 N N     . VAL A 1 189 ? 30.053 46.390  -15.239 1.00 31.13  ? 189 VAL A N     1 
ATOM   1545 C CA    . VAL A 1 189 ? 29.002 45.946  -14.330 1.00 30.89  ? 189 VAL A CA    1 
ATOM   1546 C C     . VAL A 1 189 ? 28.267 44.702  -14.839 1.00 31.91  ? 189 VAL A C     1 
ATOM   1547 O O     . VAL A 1 189 ? 28.096 43.721  -14.110 1.00 31.31  ? 189 VAL A O     1 
ATOM   1548 C CB    . VAL A 1 189 ? 28.008 47.079  -14.095 1.00 31.88  ? 189 VAL A CB    1 
ATOM   1549 C CG1   . VAL A 1 189 ? 26.769 46.579  -13.374 1.00 32.69  ? 189 VAL A CG1   1 
ATOM   1550 C CG2   . VAL A 1 189 ? 28.683 48.196  -13.309 1.00 30.79  ? 189 VAL A CG2   1 
ATOM   1551 N N     . LYS A 1 190 ? 27.843 44.753  -16.098 1.00 32.89  ? 190 LYS A N     1 
ATOM   1552 C CA    . LYS A 1 190 ? 27.166 43.639  -16.723 1.00 34.11  ? 190 LYS A CA    1 
ATOM   1553 C C     . LYS A 1 190 ? 27.984 42.351  -16.563 1.00 32.74  ? 190 LYS A C     1 
ATOM   1554 O O     . LYS A 1 190 ? 27.446 41.287  -16.285 1.00 33.35  ? 190 LYS A O     1 
ATOM   1555 C CB    . LYS A 1 190 ? 26.915 43.947  -18.202 1.00 35.72  ? 190 LYS A CB    1 
ATOM   1556 C CG    . LYS A 1 190 ? 25.464 44.257  -18.562 1.00 38.78  ? 190 LYS A CG    1 
ATOM   1557 C CD    . LYS A 1 190 ? 25.281 44.430  -20.080 1.00 40.47  ? 190 LYS A CD    1 
ATOM   1558 C CE    . LYS A 1 190 ? 25.458 43.095  -20.834 1.00 44.49  ? 190 LYS A CE    1 
ATOM   1559 N NZ    . LYS A 1 190 ? 25.062 43.161  -22.290 1.00 46.14  ? 190 LYS A NZ    1 
ATOM   1560 N N     . ASN A 1 191 ? 29.291 42.460  -16.724 1.00 30.88  ? 191 ASN A N     1 
ATOM   1561 C CA    . ASN A 1 191 ? 30.143 41.295  -16.660 1.00 30.10  ? 191 ASN A CA    1 
ATOM   1562 C C     . ASN A 1 191 ? 30.533 40.888  -15.269 1.00 28.66  ? 191 ASN A C     1 
ATOM   1563 O O     . ASN A 1 191 ? 30.658 39.706  -15.001 1.00 29.04  ? 191 ASN A O     1 
ATOM   1564 C CB    . ASN A 1 191 ? 31.387 41.524  -17.483 1.00 29.84  ? 191 ASN A CB    1 
ATOM   1565 C CG    . ASN A 1 191 ? 31.105 41.440  -18.921 1.00 31.56  ? 191 ASN A CG    1 
ATOM   1566 O OD1   . ASN A 1 191 ? 30.997 40.351  -19.464 1.00 34.12  ? 191 ASN A OD1   1 
ATOM   1567 N ND2   . ASN A 1 191 ? 30.921 42.584  -19.559 1.00 32.72  ? 191 ASN A ND2   1 
ATOM   1568 N N     . ALA A 1 192 ? 30.737 41.860  -14.385 1.00 27.30  ? 192 ALA A N     1 
ATOM   1569 C CA    . ALA A 1 192 ? 31.095 41.554  -12.999 1.00 26.48  ? 192 ALA A CA    1 
ATOM   1570 C C     . ALA A 1 192 ? 30.099 40.583  -12.350 1.00 27.52  ? 192 ALA A C     1 
ATOM   1571 O O     . ALA A 1 192 ? 30.456 39.855  -11.419 1.00 28.00  ? 192 ALA A O     1 
ATOM   1572 C CB    . ALA A 1 192 ? 31.242 42.815  -12.175 1.00 24.76  ? 192 ALA A CB    1 
ATOM   1573 N N     . ARG A 1 193 ? 28.873 40.545  -12.859 1.00 28.19  ? 193 ARG A N     1 
ATOM   1574 C CA    . ARG A 1 193 ? 27.834 39.724  -12.261 1.00 29.88  ? 193 ARG A CA    1 
ATOM   1575 C C     . ARG A 1 193 ? 28.206 38.246  -12.268 1.00 30.70  ? 193 ARG A C     1 
ATOM   1576 O O     . ARG A 1 193 ? 27.675 37.463  -11.485 1.00 31.33  ? 193 ARG A O     1 
ATOM   1577 C CB    . ARG A 1 193 ? 26.504 39.946  -12.979 1.00 31.57  ? 193 ARG A CB    1 
ATOM   1578 C CG    . ARG A 1 193 ? 26.037 41.380  -12.920 1.00 32.37  ? 193 ARG A CG    1 
ATOM   1579 C CD    . ARG A 1 193 ? 24.703 41.555  -13.562 1.00 36.03  ? 193 ARG A CD    1 
ATOM   1580 N NE    . ARG A 1 193 ? 24.748 41.286  -14.994 1.00 38.69  ? 193 ARG A NE    1 
ATOM   1581 C CZ    . ARG A 1 193 ? 23.701 41.367  -15.799 1.00 40.22  ? 193 ARG A CZ    1 
ATOM   1582 N NH1   . ARG A 1 193 ? 22.529 41.726  -15.317 1.00 42.65  ? 193 ARG A NH1   1 
ATOM   1583 N NH2   . ARG A 1 193 ? 23.828 41.088  -17.080 1.00 41.94  ? 193 ARG A NH2   1 
ATOM   1584 N N     . ARG A 1 194 ? 29.139 37.897  -13.149 1.00 30.76  ? 194 ARG A N     1 
ATOM   1585 C CA    . ARG A 1 194 ? 29.540 36.530  -13.395 1.00 32.04  ? 194 ARG A CA    1 
ATOM   1586 C C     . ARG A 1 194 ? 30.933 36.255  -12.850 1.00 30.26  ? 194 ARG A C     1 
ATOM   1587 O O     . ARG A 1 194 ? 31.428 35.137  -12.999 1.00 31.09  ? 194 ARG A O     1 
ATOM   1588 C CB    . ARG A 1 194 ? 29.490 36.220  -14.898 1.00 33.77  ? 194 ARG A CB    1 
ATOM   1589 C CG    . ARG A 1 194 ? 28.243 35.445  -15.390 1.00 39.99  ? 194 ARG A CG    1 
ATOM   1590 C CD    . ARG A 1 194 ? 27.034 36.359  -15.718 1.00 47.08  ? 194 ARG A CD    1 
ATOM   1591 N NE    . ARG A 1 194 ? 27.344 37.433  -16.687 1.00 50.80  ? 194 ARG A NE    1 
ATOM   1592 C CZ    . ARG A 1 194 ? 26.774 37.578  -17.895 1.00 52.67  ? 194 ARG A CZ    1 
ATOM   1593 N NH1   . ARG A 1 194 ? 25.838 36.727  -18.318 1.00 55.29  ? 194 ARG A NH1   1 
ATOM   1594 N NH2   . ARG A 1 194 ? 27.139 38.587  -18.688 1.00 50.16  ? 194 ARG A NH2   1 
ATOM   1595 N N     . TRP A 1 195 ? 31.562 37.254  -12.217 1.00 28.04  ? 195 TRP A N     1 
ATOM   1596 C CA    . TRP A 1 195 ? 32.890 37.054  -11.595 1.00 26.43  ? 195 TRP A CA    1 
ATOM   1597 C C     . TRP A 1 195 ? 32.814 36.077  -10.448 1.00 26.55  ? 195 TRP A C     1 
ATOM   1598 O O     . TRP A 1 195 ? 31.842 36.071  -9.713  1.00 27.28  ? 195 TRP A O     1 
ATOM   1599 C CB    . TRP A 1 195 ? 33.472 38.330  -11.012 1.00 24.55  ? 195 TRP A CB    1 
ATOM   1600 C CG    . TRP A 1 195 ? 33.922 39.326  -11.970 1.00 24.54  ? 195 TRP A CG    1 
ATOM   1601 C CD1   . TRP A 1 195 ? 34.034 39.190  -13.331 1.00 25.32  ? 195 TRP A CD1   1 
ATOM   1602 C CD2   . TRP A 1 195 ? 34.380 40.648  -11.652 1.00 22.26  ? 195 TRP A CD2   1 
ATOM   1603 N NE1   . TRP A 1 195 ? 34.503 40.379  -13.882 1.00 24.28  ? 195 TRP A NE1   1 
ATOM   1604 C CE2   . TRP A 1 195 ? 34.725 41.279  -12.872 1.00 21.26  ? 195 TRP A CE2   1 
ATOM   1605 C CE3   . TRP A 1 195 ? 34.520 41.359  -10.454 1.00 21.58  ? 195 TRP A CE3   1 
ATOM   1606 C CZ2   . TRP A 1 195 ? 35.188 42.581  -12.929 1.00 20.93  ? 195 TRP A CZ2   1 
ATOM   1607 C CZ3   . TRP A 1 195 ? 34.974 42.651  -10.510 1.00 21.50  ? 195 TRP A CZ3   1 
ATOM   1608 C CH2   . TRP A 1 195 ? 35.305 43.253  -11.743 1.00 22.22  ? 195 TRP A CH2   1 
ATOM   1609 N N     . THR A 1 196 ? 33.861 35.282  -10.269 1.00 26.23  ? 196 THR A N     1 
ATOM   1610 C CA    . THR A 1 196 ? 33.922 34.345  -9.168  1.00 26.59  ? 196 THR A CA    1 
ATOM   1611 C C     . THR A 1 196 ? 35.261 34.497  -8.470  1.00 26.40  ? 196 THR A C     1 
ATOM   1612 O O     . THR A 1 196 ? 36.186 35.094  -9.012  1.00 26.16  ? 196 THR A O     1 
ATOM   1613 C CB    . THR A 1 196 ? 33.783 32.892  -9.647  1.00 27.87  ? 196 THR A CB    1 
ATOM   1614 O OG1   . THR A 1 196 ? 34.976 32.514  -10.339 1.00 27.95  ? 196 THR A OG1   1 
ATOM   1615 C CG2   . THR A 1 196 ? 32.594 32.725  -10.574 1.00 27.46  ? 196 THR A CG2   1 
ATOM   1616 N N     . ARG A 1 197 ? 35.354 33.928  -7.273  1.00 27.06  ? 197 ARG A N     1 
ATOM   1617 C CA    . ARG A 1 197 ? 36.581 33.860  -6.503  1.00 26.79  ? 197 ARG A CA    1 
ATOM   1618 C C     . ARG A 1 197 ? 37.715 33.106  -7.227  1.00 27.43  ? 197 ARG A C     1 
ATOM   1619 O O     . ARG A 1 197 ? 38.776 32.893  -6.641  1.00 27.57  ? 197 ARG A O     1 
ATOM   1620 C CB    . ARG A 1 197 ? 36.289 33.187  -5.139  1.00 27.93  ? 197 ARG A CB    1 
ATOM   1621 C CG    . ARG A 1 197 ? 36.088 31.667  -5.213  1.00 29.62  ? 197 ARG A CG    1 
ATOM   1622 C CD    . ARG A 1 197 ? 35.509 31.091  -3.955  1.00 31.52  ? 197 ARG A CD    1 
ATOM   1623 N NE    . ARG A 1 197 ? 34.133 31.539  -3.747  1.00 32.81  ? 197 ARG A NE    1 
ATOM   1624 C CZ    . ARG A 1 197 ? 33.492 31.494  -2.583  1.00 33.25  ? 197 ARG A CZ    1 
ATOM   1625 N NH1   . ARG A 1 197 ? 32.242 31.918  -2.500  1.00 32.58  ? 197 ARG A NH1   1 
ATOM   1626 N NH2   . ARG A 1 197 ? 34.100 31.022  -1.500  1.00 34.44  ? 197 ARG A NH2   1 
ATOM   1627 N N     . ARG A 1 198 ? 37.492 32.674  -8.466  1.00 27.53  ? 198 ARG A N     1 
ATOM   1628 C CA    . ARG A 1 198 ? 38.557 32.029  -9.221  1.00 28.91  ? 198 ARG A CA    1 
ATOM   1629 C C     . ARG A 1 198 ? 38.884 32.799  -10.478 1.00 27.47  ? 198 ARG A C     1 
ATOM   1630 O O     . ARG A 1 198 ? 39.841 32.486  -11.199 1.00 27.53  ? 198 ARG A O     1 
ATOM   1631 C CB    . ARG A 1 198 ? 38.179 30.598  -9.587  1.00 31.70  ? 198 ARG A CB    1 
ATOM   1632 C CG    . ARG A 1 198 ? 37.713 29.759  -8.437  1.00 36.18  ? 198 ARG A CG    1 
ATOM   1633 C CD    . ARG A 1 198 ? 38.811 29.545  -7.412  1.00 42.41  ? 198 ARG A CD    1 
ATOM   1634 N NE    . ARG A 1 198 ? 39.764 28.504  -7.808  1.00 49.25  ? 198 ARG A NE    1 
ATOM   1635 C CZ    . ARG A 1 198 ? 39.544 27.188  -7.720  1.00 53.77  ? 198 ARG A CZ    1 
ATOM   1636 N NH1   . ARG A 1 198 ? 38.383 26.722  -7.258  1.00 55.18  ? 198 ARG A NH1   1 
ATOM   1637 N NH2   . ARG A 1 198 ? 40.491 26.330  -8.102  1.00 56.57  ? 198 ARG A NH2   1 
ATOM   1638 N N     . THR A 1 199 ? 38.080 33.824  -10.735 1.00 26.42  ? 199 THR A N     1 
ATOM   1639 C CA    . THR A 1 199 ? 38.226 34.639  -11.946 1.00 25.51  ? 199 THR A CA    1 
ATOM   1640 C C     . THR A 1 199 ? 39.601 35.311  -12.065 1.00 24.65  ? 199 THR A C     1 
ATOM   1641 O O     . THR A 1 199 ? 40.121 35.851  -11.110 1.00 23.97  ? 199 THR A O     1 
ATOM   1642 C CB    . THR A 1 199 ? 37.068 35.609  -12.060 1.00 24.23  ? 199 THR A CB    1 
ATOM   1643 O OG1   . THR A 1 199 ? 35.866 34.832  -12.171 1.00 24.81  ? 199 THR A OG1   1 
ATOM   1644 C CG2   . THR A 1 199 ? 37.207 36.500  -13.288 1.00 23.97  ? 199 THR A CG2   1 
ATOM   1645 N N     . VAL A 1 200 ? 40.189 35.204  -13.242 1.00 25.19  ? 200 VAL A N     1 
ATOM   1646 C CA    . VAL A 1 200 ? 41.485 35.754  -13.558 1.00 24.72  ? 200 VAL A CA    1 
ATOM   1647 C C     . VAL A 1 200 ? 41.215 36.575  -14.774 1.00 24.61  ? 200 VAL A C     1 
ATOM   1648 O O     . VAL A 1 200 ? 40.788 36.041  -15.786 1.00 25.04  ? 200 VAL A O     1 
ATOM   1649 C CB    . VAL A 1 200 ? 42.473 34.663  -14.034 1.00 26.60  ? 200 VAL A CB    1 
ATOM   1650 C CG1   . VAL A 1 200 ? 43.829 35.264  -14.359 1.00 24.96  ? 200 VAL A CG1   1 
ATOM   1651 C CG2   . VAL A 1 200 ? 42.573 33.510  -13.031 1.00 27.99  ? 200 VAL A CG2   1 
ATOM   1652 N N     . ILE A 1 201 ? 41.464 37.873  -14.678 1.00 24.28  ? 201 ILE A N     1 
ATOM   1653 C CA    . ILE A 1 201 ? 41.325 38.764  -15.812 1.00 24.45  ? 201 ILE A CA    1 
ATOM   1654 C C     . ILE A 1 201 ? 42.716 39.159  -16.282 1.00 25.37  ? 201 ILE A C     1 
ATOM   1655 O O     . ILE A 1 201 ? 43.454 39.855  -15.560 1.00 25.55  ? 201 ILE A O     1 
ATOM   1656 C CB    . ILE A 1 201 ? 40.520 40.017  -15.421 1.00 23.42  ? 201 ILE A CB    1 
ATOM   1657 C CG1   . ILE A 1 201 ? 39.109 39.604  -15.012 1.00 23.61  ? 201 ILE A CG1   1 
ATOM   1658 C CG2   . ILE A 1 201 ? 40.515 41.055  -16.556 1.00 21.86  ? 201 ILE A CG2   1 
ATOM   1659 C CD1   . ILE A 1 201 ? 38.355 40.715  -14.353 1.00 24.53  ? 201 ILE A CD1   1 
ATOM   1660 N N     . ASP A 1 202 ? 43.071 38.720  -17.485 1.00 26.49  ? 202 ASP A N     1 
ATOM   1661 C CA    . ASP A 1 202 ? 44.375 39.030  -18.054 1.00 27.35  ? 202 ASP A CA    1 
ATOM   1662 C C     . ASP A 1 202 ? 44.284 40.026  -19.229 1.00 27.05  ? 202 ASP A C     1 
ATOM   1663 O O     . ASP A 1 202 ? 44.154 39.624  -20.382 1.00 27.78  ? 202 ASP A O     1 
ATOM   1664 C CB    . ASP A 1 202 ? 45.076 37.731  -18.457 1.00 29.25  ? 202 ASP A CB    1 
ATOM   1665 C CG    . ASP A 1 202 ? 46.539 37.940  -18.801 1.00 32.13  ? 202 ASP A CG    1 
ATOM   1666 O OD1   . ASP A 1 202 ? 46.980 39.129  -18.871 1.00 33.55  ? 202 ASP A OD1   1 
ATOM   1667 O OD2   . ASP A 1 202 ? 47.241 36.916  -19.000 1.00 34.48  ? 202 ASP A OD2   1 
ATOM   1668 N N     . VAL A 1 203 ? 44.381 41.320  -18.912 1.00 26.10  ? 203 VAL A N     1 
ATOM   1669 C CA    . VAL A 1 203 ? 44.047 42.410  -19.839 1.00 25.63  ? 203 VAL A CA    1 
ATOM   1670 C C     . VAL A 1 203 ? 44.952 42.441  -21.043 1.00 27.05  ? 203 VAL A C     1 
ATOM   1671 O O     . VAL A 1 203 ? 44.464 42.428  -22.174 1.00 28.21  ? 203 VAL A O     1 
ATOM   1672 C CB    . VAL A 1 203 ? 44.131 43.822  -19.206 1.00 24.81  ? 203 VAL A CB    1 
ATOM   1673 C CG1   . VAL A 1 203 ? 43.201 44.771  -19.971 1.00 24.92  ? 203 VAL A CG1   1 
ATOM   1674 C CG2   . VAL A 1 203 ? 43.780 43.799  -17.719 1.00 24.49  ? 203 VAL A CG2   1 
ATOM   1675 N N     . ALA A 1 204 ? 46.267 42.508  -20.813 1.00 27.00  ? 204 ALA A N     1 
ATOM   1676 C CA    . ALA A 1 204 ? 47.241 42.432  -21.922 1.00 27.62  ? 204 ALA A CA    1 
ATOM   1677 C C     . ALA A 1 204 ? 46.926 41.312  -22.916 1.00 28.24  ? 204 ALA A C     1 
ATOM   1678 O O     . ALA A 1 204 ? 47.097 41.498  -24.115 1.00 28.89  ? 204 ALA A O     1 
ATOM   1679 C CB    . ALA A 1 204 ? 48.680 42.295  -21.406 1.00 28.04  ? 204 ALA A CB    1 
ATOM   1680 N N     . LYS A 1 205 ? 46.474 40.165  -22.413 1.00 28.00  ? 205 LYS A N     1 
ATOM   1681 C CA    . LYS A 1 205 ? 46.183 39.014  -23.269 1.00 29.82  ? 205 LYS A CA    1 
ATOM   1682 C C     . LYS A 1 205 ? 44.710 39.009  -23.674 1.00 29.33  ? 205 LYS A C     1 
ATOM   1683 O O     . LYS A 1 205 ? 44.284 38.244  -24.534 1.00 30.93  ? 205 LYS A O     1 
ATOM   1684 C CB    . LYS A 1 205 ? 46.633 37.696  -22.623 1.00 30.69  ? 205 LYS A CB    1 
ATOM   1685 C CG    . LYS A 1 205 ? 48.164 37.605  -22.425 1.00 33.37  ? 205 LYS A CG    1 
ATOM   1686 C CD    . LYS A 1 205 ? 48.774 36.234  -22.819 1.00 38.88  ? 205 LYS A CD    1 
ATOM   1687 C CE    . LYS A 1 205 ? 48.499 35.119  -21.801 1.00 40.28  ? 205 LYS A CE    1 
ATOM   1688 N NZ    . LYS A 1 205 ? 49.392 35.109  -20.598 1.00 40.43  ? 205 LYS A NZ    1 
ATOM   1689 N N     . GLY A 1 206 ? 43.949 39.913  -23.079 1.00 27.89  ? 206 GLY A N     1 
ATOM   1690 C CA    . GLY A 1 206 ? 42.566 40.140  -23.472 1.00 28.03  ? 206 GLY A CA    1 
ATOM   1691 C C     . GLY A 1 206 ? 41.714 38.938  -23.164 1.00 28.77  ? 206 GLY A C     1 
ATOM   1692 O O     . GLY A 1 206 ? 40.831 38.588  -23.942 1.00 29.72  ? 206 GLY A O     1 
ATOM   1693 N N     . GLU A 1 207 ? 41.967 38.346  -21.998 1.00 28.32  ? 207 GLU A N     1 
ATOM   1694 C CA    . GLU A 1 207 ? 41.470 37.033  -21.662 1.00 29.32  ? 207 GLU A CA    1 
ATOM   1695 C C     . GLU A 1 207 ? 40.965 36.933  -20.223 1.00 28.45  ? 207 GLU A C     1 
ATOM   1696 O O     . GLU A 1 207 ? 41.541 37.513  -19.299 1.00 27.60  ? 207 GLU A O     1 
ATOM   1697 C CB    . GLU A 1 207 ? 42.578 36.022  -21.858 1.00 30.29  ? 207 GLU A CB    1 
ATOM   1698 C CG    . GLU A 1 207 ? 42.169 34.632  -21.464 1.00 33.10  ? 207 GLU A CG    1 
ATOM   1699 C CD    . GLU A 1 207 ? 43.231 33.609  -21.774 1.00 36.98  ? 207 GLU A CD    1 
ATOM   1700 O OE1   . GLU A 1 207 ? 44.281 33.614  -21.090 1.00 36.57  ? 207 GLU A OE1   1 
ATOM   1701 O OE2   . GLU A 1 207 ? 43.006 32.800  -22.706 1.00 40.79  ? 207 GLU A OE2   1 
ATOM   1702 N N     . VAL A 1 208 ? 39.888 36.172  -20.063 1.00 29.03  ? 208 VAL A N     1 
ATOM   1703 C CA    . VAL A 1 208 ? 39.305 35.852  -18.787 1.00 28.00  ? 208 VAL A CA    1 
ATOM   1704 C C     . VAL A 1 208 ? 39.501 34.374  -18.607 1.00 29.65  ? 208 VAL A C     1 
ATOM   1705 O O     . VAL A 1 208 ? 39.186 33.591  -19.484 1.00 30.94  ? 208 VAL A O     1 
ATOM   1706 C CB    . VAL A 1 208 ? 37.829 36.162  -18.786 1.00 27.70  ? 208 VAL A CB    1 
ATOM   1707 C CG1   . VAL A 1 208 ? 37.212 35.781  -17.461 1.00 27.17  ? 208 VAL A CG1   1 
ATOM   1708 C CG2   . VAL A 1 208 ? 37.658 37.631  -19.019 1.00 27.88  ? 208 VAL A CG2   1 
ATOM   1709 N N     . ARG A 1 209 ? 40.013 33.999  -17.449 1.00 29.78  ? 209 ARG A N     1 
ATOM   1710 C CA    . ARG A 1 209 ? 40.521 32.663  -17.243 1.00 32.35  ? 209 ARG A CA    1 
ATOM   1711 C C     . ARG A 1 209 ? 40.097 32.207  -15.845 1.00 32.09  ? 209 ARG A C     1 
ATOM   1712 O O     . ARG A 1 209 ? 39.760 33.059  -15.000 1.00 30.03  ? 209 ARG A O     1 
ATOM   1713 C CB    . ARG A 1 209 ? 42.043 32.727  -17.372 1.00 32.73  ? 209 ARG A CB    1 
ATOM   1714 C CG    . ARG A 1 209 ? 42.743 31.400  -17.560 1.00 36.21  ? 209 ARG A CG    1 
ATOM   1715 C CD    . ARG A 1 209 ? 44.182 31.590  -18.089 1.00 36.00  ? 209 ARG A CD    1 
ATOM   1716 N NE    . ARG A 1 209 ? 45.067 32.407  -17.239 1.00 34.41  ? 209 ARG A NE    1 
ATOM   1717 C CZ    . ARG A 1 209 ? 45.482 33.652  -17.523 1.00 33.35  ? 209 ARG A CZ    1 
ATOM   1718 N NH1   . ARG A 1 209 ? 45.086 34.294  -18.625 1.00 33.55  ? 209 ARG A NH1   1 
ATOM   1719 N NH2   . ARG A 1 209 ? 46.316 34.269  -16.704 1.00 31.75  ? 209 ARG A NH2   1 
ATOM   1720 N N     . LYS A 1 210 ? 40.076 30.888  -15.596 1.00 33.48  ? 210 LYS A N     1 
ATOM   1721 C CA    . LYS A 1 210 ? 39.843 30.426  -14.226 1.00 34.01  ? 210 LYS A CA    1 
ATOM   1722 C C     . LYS A 1 210 ? 41.184 30.072  -13.571 1.00 34.80  ? 210 LYS A C     1 
ATOM   1723 O O     . LYS A 1 210 ? 42.123 29.689  -14.272 1.00 36.45  ? 210 LYS A O     1 
ATOM   1724 C CB    . LYS A 1 210 ? 38.787 29.319  -14.149 1.00 35.56  ? 210 LYS A CB    1 
ATOM   1725 C CG    . LYS A 1 210 ? 39.321 27.856  -14.159 1.00 40.35  ? 210 LYS A CG    1 
ATOM   1726 C CD    . LYS A 1 210 ? 39.414 27.246  -12.734 1.00 42.42  ? 210 LYS A CD    1 
ATOM   1727 C CE    . LYS A 1 210 ? 38.167 26.456  -12.351 1.00 44.13  ? 210 LYS A CE    1 
ATOM   1728 N NZ    . LYS A 1 210 ? 37.052 27.336  -11.936 1.00 43.42  ? 210 LYS A NZ    1 
ATOM   1729 N N     . GLY A 1 211 ? 41.295 30.241  -12.253 1.00 34.30  ? 211 GLY A N     1 
ATOM   1730 C CA    . GLY A 1 211 ? 42.552 29.995  -11.547 1.00 35.40  ? 211 GLY A CA    1 
ATOM   1731 C C     . GLY A 1 211 ? 42.310 29.592  -10.109 1.00 36.84  ? 211 GLY A C     1 
ATOM   1732 O O     . GLY A 1 211 ? 41.216 29.127  -9.777  1.00 37.15  ? 211 GLY A O     1 
ATOM   1733 N N     . GLU A 1 212 ? 43.328 29.773  -9.257  1.00 37.86  ? 212 GLU A N     1 
ATOM   1734 C CA    . GLU A 1 212 ? 43.238 29.479  -7.807  1.00 38.74  ? 212 GLU A CA    1 
ATOM   1735 C C     . GLU A 1 212 ? 42.615 30.642  -7.012  1.00 36.08  ? 212 GLU A C     1 
ATOM   1736 O O     . GLU A 1 212 ? 41.971 30.417  -5.989  1.00 36.17  ? 212 GLU A O     1 
ATOM   1737 C CB    . GLU A 1 212 ? 44.601 29.085  -7.185  1.00 40.73  ? 212 GLU A CB    1 
ATOM   1738 C CG    . GLU A 1 212 ? 45.547 28.273  -8.058  1.00 45.07  ? 212 GLU A CG    1 
ATOM   1739 C CD    . GLU A 1 212 ? 45.363 26.755  -7.935  1.00 53.48  ? 212 GLU A CD    1 
ATOM   1740 O OE1   . GLU A 1 212 ? 45.314 26.062  -8.982  1.00 56.49  ? 212 GLU A OE1   1 
ATOM   1741 O OE2   . GLU A 1 212 ? 45.294 26.235  -6.799  1.00 56.57  ? 212 GLU A OE2   1 
ATOM   1742 N N     . GLU A 1 213 ? 42.806 31.880  -7.456  1.00 33.84  ? 213 GLU A N     1 
ATOM   1743 C CA    . GLU A 1 213 ? 42.070 32.992  -6.835  1.00 32.21  ? 213 GLU A CA    1 
ATOM   1744 C C     . GLU A 1 213 ? 41.764 34.152  -7.739  1.00 29.72  ? 213 GLU A C     1 
ATOM   1745 O O     . GLU A 1 213 ? 42.317 34.264  -8.810  1.00 29.65  ? 213 GLU A O     1 
ATOM   1746 C CB    . GLU A 1 213 ? 42.680 33.505  -5.510  1.00 32.72  ? 213 GLU A CB    1 
ATOM   1747 C CG    . GLU A 1 213 ? 44.145 33.211  -5.226  1.00 37.57  ? 213 GLU A CG    1 
ATOM   1748 C CD    . GLU A 1 213 ? 45.085 34.050  -6.049  1.00 40.82  ? 213 GLU A CD    1 
ATOM   1749 O OE1   . GLU A 1 213 ? 45.984 34.692  -5.455  1.00 43.41  ? 213 GLU A OE1   1 
ATOM   1750 O OE2   . GLU A 1 213 ? 44.926 34.067  -7.290  1.00 43.12  ? 213 GLU A OE2   1 
ATOM   1751 N N     . PHE A 1 214 ? 40.861 35.020  -7.291  1.00 28.17  ? 214 PHE A N     1 
ATOM   1752 C CA    . PHE A 1 214 ? 40.513 36.158  -8.068  1.00 26.29  ? 214 PHE A CA    1 
ATOM   1753 C C     . PHE A 1 214 ? 41.801 36.869  -8.286  1.00 26.43  ? 214 PHE A C     1 
ATOM   1754 O O     . PHE A 1 214 ? 42.473 37.225  -7.321  1.00 27.59  ? 214 PHE A O     1 
ATOM   1755 C CB    . PHE A 1 214 ? 39.555 37.072  -7.338  1.00 25.04  ? 214 PHE A CB    1 
ATOM   1756 C CG    . PHE A 1 214 ? 39.033 38.190  -8.192  1.00 22.68  ? 214 PHE A CG    1 
ATOM   1757 C CD1   . PHE A 1 214 ? 37.963 37.981  -9.061  1.00 22.54  ? 214 PHE A CD1   1 
ATOM   1758 C CD2   . PHE A 1 214 ? 39.604 39.447  -8.132  1.00 21.51  ? 214 PHE A CD2   1 
ATOM   1759 C CE1   . PHE A 1 214 ? 37.472 39.022  -9.872  1.00 23.30  ? 214 PHE A CE1   1 
ATOM   1760 C CE2   . PHE A 1 214 ? 39.105 40.515  -8.935  1.00 19.76  ? 214 PHE A CE2   1 
ATOM   1761 C CZ    . PHE A 1 214 ? 38.046 40.297  -9.803  1.00 20.06  ? 214 PHE A CZ    1 
ATOM   1762 N N     . PHE A 1 215 ? 42.144 37.035  -9.558  1.00 26.16  ? 215 PHE A N     1 
ATOM   1763 C CA    . PHE A 1 215 ? 43.414 37.588  -10.013 1.00 25.65  ? 215 PHE A CA    1 
ATOM   1764 C C     . PHE A 1 215 ? 43.197 38.518  -11.213 1.00 23.74  ? 215 PHE A C     1 
ATOM   1765 O O     . PHE A 1 215 ? 42.564 38.149  -12.198 1.00 22.75  ? 215 PHE A O     1 
ATOM   1766 C CB    . PHE A 1 215 ? 44.357 36.435  -10.403 1.00 27.76  ? 215 PHE A CB    1 
ATOM   1767 C CG    . PHE A 1 215 ? 45.817 36.790  -10.354 1.00 29.60  ? 215 PHE A CG    1 
ATOM   1768 C CD1   . PHE A 1 215 ? 46.689 36.055  -9.562  1.00 30.73  ? 215 PHE A CD1   1 
ATOM   1769 C CD2   . PHE A 1 215 ? 46.325 37.864  -11.099 1.00 30.66  ? 215 PHE A CD2   1 
ATOM   1770 C CE1   . PHE A 1 215 ? 48.044 36.370  -9.500  1.00 31.86  ? 215 PHE A CE1   1 
ATOM   1771 C CE2   . PHE A 1 215 ? 47.691 38.180  -11.057 1.00 32.15  ? 215 PHE A CE2   1 
ATOM   1772 C CZ    . PHE A 1 215 ? 48.550 37.431  -10.236 1.00 32.07  ? 215 PHE A CZ    1 
ATOM   1773 N N     . VAL A 1 216 ? 43.727 39.732  -11.115 1.00 22.97  ? 216 VAL A N     1 
ATOM   1774 C CA    . VAL A 1 216 ? 43.726 40.686  -12.241 1.00 22.24  ? 216 VAL A CA    1 
ATOM   1775 C C     . VAL A 1 216 ? 45.166 41.029  -12.647 1.00 22.53  ? 216 VAL A C     1 
ATOM   1776 O O     . VAL A 1 216 ? 45.865 41.810  -11.930 1.00 23.13  ? 216 VAL A O     1 
ATOM   1777 C CB    . VAL A 1 216 ? 42.892 41.929  -11.899 1.00 21.33  ? 216 VAL A CB    1 
ATOM   1778 C CG1   . VAL A 1 216 ? 43.024 43.039  -12.954 1.00 20.62  ? 216 VAL A CG1   1 
ATOM   1779 C CG2   . VAL A 1 216 ? 41.428 41.523  -11.724 1.00 21.25  ? 216 VAL A CG2   1 
ATOM   1780 N N     . VAL A 1 217 ? 45.619 40.432  -13.765 1.00 21.88  ? 217 VAL A N     1 
ATOM   1781 C CA    . VAL A 1 217 ? 47.026 40.570  -14.188 1.00 21.44  ? 217 VAL A CA    1 
ATOM   1782 C C     . VAL A 1 217 ? 47.342 42.003  -14.589 1.00 21.59  ? 217 VAL A C     1 
ATOM   1783 O O     . VAL A 1 217 ? 46.649 42.597  -15.414 1.00 20.84  ? 217 VAL A O     1 
ATOM   1784 C CB    . VAL A 1 217 ? 47.426 39.632  -15.325 1.00 21.84  ? 217 VAL A CB    1 
ATOM   1785 C CG1   . VAL A 1 217 ? 48.898 39.764  -15.599 1.00 20.60  ? 217 VAL A CG1   1 
ATOM   1786 C CG2   . VAL A 1 217 ? 47.073 38.183  -14.991 1.00 21.21  ? 217 VAL A CG2   1 
ATOM   1787 N N     . ASP A 1 218 ? 48.375 42.559  -13.972 1.00 22.66  ? 218 ASP A N     1 
ATOM   1788 C CA    . ASP A 1 218 ? 48.934 43.845  -14.392 1.00 23.86  ? 218 ASP A CA    1 
ATOM   1789 C C     . ASP A 1 218 ? 49.531 43.702  -15.789 1.00 25.10  ? 218 ASP A C     1 
ATOM   1790 O O     . ASP A 1 218 ? 50.273 42.761  -16.022 1.00 26.73  ? 218 ASP A O     1 
ATOM   1791 C CB    . ASP A 1 218 ? 50.041 44.236  -13.424 1.00 24.71  ? 218 ASP A CB    1 
ATOM   1792 C CG    . ASP A 1 218 ? 50.223 45.726  -13.322 1.00 25.52  ? 218 ASP A CG    1 
ATOM   1793 O OD1   . ASP A 1 218 ? 50.327 46.393  -14.381 1.00 25.50  ? 218 ASP A OD1   1 
ATOM   1794 O OD2   . ASP A 1 218 ? 50.277 46.215  -12.168 1.00 25.45  ? 218 ASP A OD2   1 
ATOM   1795 N N     . PRO A 1 219 ? 49.234 44.632  -16.726 1.00 25.17  ? 219 PRO A N     1 
ATOM   1796 C CA    . PRO A 1 219 ? 49.798 44.482  -18.075 1.00 25.91  ? 219 PRO A CA    1 
ATOM   1797 C C     . PRO A 1 219 ? 51.301 44.718  -18.065 1.00 27.39  ? 219 PRO A C     1 
ATOM   1798 O O     . PRO A 1 219 ? 52.032 44.131  -18.861 1.00 29.52  ? 219 PRO A O     1 
ATOM   1799 C CB    . PRO A 1 219 ? 49.119 45.589  -18.861 1.00 25.01  ? 219 PRO A CB    1 
ATOM   1800 C CG    . PRO A 1 219 ? 47.957 45.992  -18.058 1.00 23.65  ? 219 PRO A CG    1 
ATOM   1801 C CD    . PRO A 1 219 ? 48.391 45.830  -16.645 1.00 24.04  ? 219 PRO A CD    1 
ATOM   1802 N N     . VAL A 1 220 ? 51.737 45.526  -17.113 1.00 26.76  ? 220 VAL A N     1 
ATOM   1803 C CA    . VAL A 1 220 ? 53.109 45.944  -16.922 1.00 28.00  ? 220 VAL A CA    1 
ATOM   1804 C C     . VAL A 1 220 ? 54.013 44.916  -16.203 1.00 29.56  ? 220 VAL A C     1 
ATOM   1805 O O     . VAL A 1 220 ? 55.249 44.994  -16.293 1.00 30.84  ? 220 VAL A O     1 
ATOM   1806 C CB    . VAL A 1 220 ? 53.026 47.249  -16.125 1.00 27.49  ? 220 VAL A CB    1 
ATOM   1807 C CG1   . VAL A 1 220 ? 53.963 47.277  -14.946 1.00 28.44  ? 220 VAL A CG1   1 
ATOM   1808 C CG2   . VAL A 1 220 ? 53.138 48.430  -17.037 1.00 27.58  ? 220 VAL A CG2   1 
ATOM   1809 N N     . ASP A 1 221 ? 53.394 43.974  -15.483 1.00 29.47  ? 221 ASP A N     1 
ATOM   1810 C CA    . ASP A 1 221 ? 54.097 42.979  -14.662 1.00 31.54  ? 221 ASP A CA    1 
ATOM   1811 C C     . ASP A 1 221 ? 53.167 41.811  -14.394 1.00 31.40  ? 221 ASP A C     1 
ATOM   1812 O O     . ASP A 1 221 ? 52.392 41.836  -13.447 1.00 30.11  ? 221 ASP A O     1 
ATOM   1813 C CB    . ASP A 1 221 ? 54.561 43.578  -13.325 1.00 31.97  ? 221 ASP A CB    1 
ATOM   1814 C CG    . ASP A 1 221 ? 55.290 42.559  -12.411 1.00 34.74  ? 221 ASP A CG    1 
ATOM   1815 O OD1   . ASP A 1 221 ? 55.497 41.385  -12.812 1.00 35.82  ? 221 ASP A OD1   1 
ATOM   1816 O OD2   . ASP A 1 221 ? 55.666 42.950  -11.273 1.00 36.51  ? 221 ASP A OD2   1 
ATOM   1817 N N     . GLU A 1 222 ? 53.284 40.784  -15.226 1.00 33.05  ? 222 GLU A N     1 
ATOM   1818 C CA    . GLU A 1 222 ? 52.426 39.617  -15.201 1.00 34.15  ? 222 GLU A CA    1 
ATOM   1819 C C     . GLU A 1 222 ? 52.334 38.930  -13.846 1.00 34.20  ? 222 GLU A C     1 
ATOM   1820 O O     . GLU A 1 222 ? 51.415 38.144  -13.607 1.00 33.83  ? 222 GLU A O     1 
ATOM   1821 C CB    . GLU A 1 222 ? 52.918 38.597  -16.232 1.00 35.94  ? 222 GLU A CB    1 
ATOM   1822 C CG    . GLU A 1 222 ? 54.286 37.973  -15.926 1.00 39.62  ? 222 GLU A CG    1 
ATOM   1823 C CD    . GLU A 1 222 ? 54.509 36.656  -16.670 1.00 42.60  ? 222 GLU A CD    1 
ATOM   1824 O OE1   . GLU A 1 222 ? 53.657 36.301  -17.519 1.00 46.14  ? 222 GLU A OE1   1 
ATOM   1825 O OE2   . GLU A 1 222 ? 55.533 35.968  -16.412 1.00 47.86  ? 222 GLU A OE2   1 
ATOM   1826 N N     . LYS A 1 223 ? 53.300 39.181  -12.974 1.00 35.24  ? 223 LYS A N     1 
ATOM   1827 C CA    . LYS A 1 223 ? 53.306 38.518  -11.685 1.00 35.75  ? 223 LYS A CA    1 
ATOM   1828 C C     . LYS A 1 223 ? 52.445 39.269  -10.695 1.00 33.92  ? 223 LYS A C     1 
ATOM   1829 O O     . LYS A 1 223 ? 52.000 38.707  -9.711  1.00 34.67  ? 223 LYS A O     1 
ATOM   1830 C CB    . LYS A 1 223 ? 54.731 38.369  -11.154 1.00 38.32  ? 223 LYS A CB    1 
ATOM   1831 C CG    . LYS A 1 223 ? 55.554 37.284  -11.841 1.00 40.94  ? 223 LYS A CG    1 
ATOM   1832 C CD    . LYS A 1 223 ? 55.004 35.870  -11.552 1.00 43.10  ? 223 LYS A CD    1 
ATOM   1833 C CE    . LYS A 1 223 ? 55.626 34.814  -12.488 1.00 45.01  ? 223 LYS A CE    1 
ATOM   1834 N NZ    . LYS A 1 223 ? 55.287 35.016  -13.941 1.00 43.25  ? 223 LYS A NZ    1 
ATOM   1835 N N     . ARG A 1 224 ? 52.197 40.541  -10.960 1.00 32.51  ? 224 ARG A N     1 
ATOM   1836 C CA    . ARG A 1 224 ? 51.406 41.385  -10.065 1.00 30.82  ? 224 ARG A CA    1 
ATOM   1837 C C     . ARG A 1 224 ? 49.910 41.053  -10.135 1.00 29.14  ? 224 ARG A C     1 
ATOM   1838 O O     . ARG A 1 224 ? 49.330 40.955  -11.224 1.00 29.14  ? 224 ARG A O     1 
ATOM   1839 C CB    . ARG A 1 224 ? 51.595 42.852  -10.460 1.00 30.35  ? 224 ARG A CB    1 
ATOM   1840 C CG    . ARG A 1 224 ? 51.654 43.830  -9.328  1.00 30.48  ? 224 ARG A CG    1 
ATOM   1841 C CD    . ARG A 1 224 ? 50.343 44.092  -8.654  1.00 29.52  ? 224 ARG A CD    1 
ATOM   1842 N NE    . ARG A 1 224 ? 50.589 44.086  -7.219  1.00 32.98  ? 224 ARG A NE    1 
ATOM   1843 C CZ    . ARG A 1 224 ? 50.025 44.886  -6.324  1.00 33.58  ? 224 ARG A CZ    1 
ATOM   1844 N NH1   . ARG A 1 224 ? 49.149 45.818  -6.682  1.00 33.80  ? 224 ARG A NH1   1 
ATOM   1845 N NH2   . ARG A 1 224 ? 50.361 44.751  -5.050  1.00 35.78  ? 224 ARG A NH2   1 
ATOM   1846 N N     . ASN A 1 225 ? 49.275 40.900  -8.982  1.00 27.90  ? 225 ASN A N     1 
ATOM   1847 C CA    . ASN A 1 225 ? 47.826 40.886  -8.958  1.00 25.42  ? 225 ASN A CA    1 
ATOM   1848 C C     . ASN A 1 225 ? 47.289 42.254  -8.588  1.00 23.99  ? 225 ASN A C     1 
ATOM   1849 O O     . ASN A 1 225 ? 47.222 42.600  -7.412  1.00 24.32  ? 225 ASN A O     1 
ATOM   1850 C CB    . ASN A 1 225 ? 47.313 39.815  -7.995  1.00 25.33  ? 225 ASN A CB    1 
ATOM   1851 C CG    . ASN A 1 225 ? 45.805 39.787  -7.903  1.00 23.13  ? 225 ASN A CG    1 
ATOM   1852 O OD1   . ASN A 1 225 ? 45.096 40.520  -8.599  1.00 22.66  ? 225 ASN A OD1   1 
ATOM   1853 N ND2   . ASN A 1 225 ? 45.306 38.952  -7.030  1.00 21.20  ? 225 ASN A ND2   1 
ATOM   1854 N N     . VAL A 1 226 ? 46.884 43.044  -9.568  1.00 22.83  ? 226 VAL A N     1 
ATOM   1855 C CA    . VAL A 1 226 ? 46.342 44.370  -9.225  1.00 21.64  ? 226 VAL A CA    1 
ATOM   1856 C C     . VAL A 1 226 ? 45.264 44.293  -8.109  1.00 21.11  ? 226 VAL A C     1 
ATOM   1857 O O     . VAL A 1 226 ? 45.154 45.224  -7.297  1.00 20.87  ? 226 VAL A O     1 
ATOM   1858 C CB    . VAL A 1 226 ? 45.805 45.133  -10.451 1.00 20.63  ? 226 VAL A CB    1 
ATOM   1859 C CG1   . VAL A 1 226 ? 45.442 46.548  -10.074 1.00 20.35  ? 226 VAL A CG1   1 
ATOM   1860 C CG2   . VAL A 1 226 ? 46.833 45.185  -11.521 1.00 21.65  ? 226 VAL A CG2   1 
ATOM   1861 N N     . ALA A 1 227 ? 44.513 43.174  -8.068  1.00 20.38  ? 227 ALA A N     1 
ATOM   1862 C CA    . ALA A 1 227 ? 43.463 42.914  -7.064  1.00 19.44  ? 227 ALA A CA    1 
ATOM   1863 C C     . ALA A 1 227 ? 43.958 42.158  -5.819  1.00 20.61  ? 227 ALA A C     1 
ATOM   1864 O O     . ALA A 1 227 ? 43.184 41.536  -5.090  1.00 21.48  ? 227 ALA A O     1 
ATOM   1865 C CB    . ALA A 1 227 ? 42.310 42.172  -7.695  1.00 17.99  ? 227 ALA A CB    1 
ATOM   1866 N N     . ALA A 1 228 ? 45.253 42.188  -5.576  1.00 21.49  ? 228 ALA A N     1 
ATOM   1867 C CA    . ALA A 1 228 ? 45.818 41.450  -4.459  1.00 22.93  ? 228 ALA A CA    1 
ATOM   1868 C C     . ALA A 1 228 ? 45.128 41.741  -3.120  1.00 23.13  ? 228 ALA A C     1 
ATOM   1869 O O     . ALA A 1 228 ? 44.799 40.840  -2.386  1.00 23.58  ? 228 ALA A O     1 
ATOM   1870 C CB    . ALA A 1 228 ? 47.287 41.757  -4.370  1.00 23.97  ? 228 ALA A CB    1 
ATOM   1871 N N     . ASN A 1 229 ? 44.898 43.015  -2.818  1.00 23.38  ? 229 ASN A N     1 
ATOM   1872 C CA    . ASN A 1 229 ? 44.303 43.404  -1.548  1.00 24.06  ? 229 ASN A CA    1 
ATOM   1873 C C     . ASN A 1 229 ? 42.808 43.650  -1.551  1.00 23.82  ? 229 ASN A C     1 
ATOM   1874 O O     . ASN A 1 229 ? 42.273 44.104  -0.523  1.00 24.80  ? 229 ASN A O     1 
ATOM   1875 C CB    . ASN A 1 229 ? 44.964 44.641  -0.996  1.00 24.42  ? 229 ASN A CB    1 
ATOM   1876 C CG    . ASN A 1 229 ? 44.932 44.675  0.492   1.00 26.25  ? 229 ASN A CG    1 
ATOM   1877 O OD1   . ASN A 1 229 ? 44.757 43.642  1.142   1.00 29.05  ? 229 ASN A OD1   1 
ATOM   1878 N ND2   . ASN A 1 229 ? 45.112 45.857  1.061   1.00 27.08  ? 229 ASN A ND2   1 
ATOM   1879 N N     . LEU A 1 230 ? 42.135 43.367  -2.671  1.00 22.50  ? 230 LEU A N     1 
ATOM   1880 C CA    . LEU A 1 230 ? 40.674 43.330  -2.690  1.00 21.77  ? 230 LEU A CA    1 
ATOM   1881 C C     . LEU A 1 230 ? 40.205 42.129  -1.859  1.00 22.35  ? 230 LEU A C     1 
ATOM   1882 O O     . LEU A 1 230 ? 40.415 40.994  -2.246  1.00 23.19  ? 230 LEU A O     1 
ATOM   1883 C CB    . LEU A 1 230 ? 40.149 43.197  -4.120  1.00 20.90  ? 230 LEU A CB    1 
ATOM   1884 C CG    . LEU A 1 230 ? 38.655 42.877  -4.187  1.00 21.16  ? 230 LEU A CG    1 
ATOM   1885 C CD1   . LEU A 1 230 ? 37.833 44.100  -3.759  1.00 21.17  ? 230 LEU A CD1   1 
ATOM   1886 C CD2   . LEU A 1 230 ? 38.252 42.398  -5.576  1.00 21.83  ? 230 LEU A CD2   1 
ATOM   1887 N N     . SER A 1 231 ? 39.565 42.377  -0.728  1.00 22.02  ? 231 SER A N     1 
ATOM   1888 C CA    . SER A 1 231 ? 39.152 41.295  0.128   1.00 23.20  ? 231 SER A CA    1 
ATOM   1889 C C     . SER A 1 231 ? 38.134 40.435  -0.602  1.00 23.22  ? 231 SER A C     1 
ATOM   1890 O O     . SER A 1 231 ? 37.361 40.946  -1.402  1.00 23.56  ? 231 SER A O     1 
ATOM   1891 C CB    . SER A 1 231 ? 38.534 41.840  1.421   1.00 23.62  ? 231 SER A CB    1 
ATOM   1892 O OG    . SER A 1 231 ? 37.139 42.016  1.286   1.00 22.41  ? 231 SER A OG    1 
ATOM   1893 N N     . LEU A 1 232 ? 38.114 39.139  -0.322  1.00 23.65  ? 232 LEU A N     1 
ATOM   1894 C CA    . LEU A 1 232 ? 37.074 38.266  -0.855  1.00 23.26  ? 232 LEU A CA    1 
ATOM   1895 C C     . LEU A 1 232 ? 35.664 38.852  -0.639  1.00 23.48  ? 232 LEU A C     1 
ATOM   1896 O O     . LEU A 1 232 ? 34.947 39.072  -1.591  1.00 23.41  ? 232 LEU A O     1 
ATOM   1897 C CB    . LEU A 1 232 ? 37.191 36.871  -0.237  1.00 24.40  ? 232 LEU A CB    1 
ATOM   1898 C CG    . LEU A 1 232 ? 35.995 35.934  -0.348  1.00 24.74  ? 232 LEU A CG    1 
ATOM   1899 C CD1   . LEU A 1 232 ? 35.534 35.905  -1.784  1.00 25.17  ? 232 LEU A CD1   1 
ATOM   1900 C CD2   . LEU A 1 232 ? 36.353 34.522  0.113   1.00 27.11  ? 232 LEU A CD2   1 
ATOM   1901 N N     . ASP A 1 233 ? 35.279 39.120  0.605   1.00 24.33  ? 233 ASP A N     1 
ATOM   1902 C CA    . ASP A 1 233 ? 33.960 39.656  0.887   1.00 24.74  ? 233 ASP A CA    1 
ATOM   1903 C C     . ASP A 1 233 ? 33.617 40.911  0.093   1.00 23.69  ? 233 ASP A C     1 
ATOM   1904 O O     . ASP A 1 233 ? 32.542 40.987  -0.465  1.00 24.01  ? 233 ASP A O     1 
ATOM   1905 C CB    . ASP A 1 233 ? 33.764 39.851  2.385   1.00 26.14  ? 233 ASP A CB    1 
ATOM   1906 C CG    . ASP A 1 233 ? 33.863 38.539  3.149   1.00 29.55  ? 233 ASP A CG    1 
ATOM   1907 O OD1   . ASP A 1 233 ? 33.930 37.485  2.485   1.00 32.31  ? 233 ASP A OD1   1 
ATOM   1908 O OD2   . ASP A 1 233 ? 33.875 38.541  4.402   1.00 32.76  ? 233 ASP A OD2   1 
ATOM   1909 N N     . ASN A 1 234 ? 34.525 41.873  -0.006  1.00 23.26  ? 234 ASN A N     1 
ATOM   1910 C CA    . ASN A 1 234 ? 34.274 43.031  -0.867  1.00 22.82  ? 234 ASN A CA    1 
ATOM   1911 C C     . ASN A 1 234 ? 34.086 42.684  -2.369  1.00 23.14  ? 234 ASN A C     1 
ATOM   1912 O O     . ASN A 1 234 ? 33.275 43.323  -3.073  1.00 23.51  ? 234 ASN A O     1 
ATOM   1913 C CB    . ASN A 1 234 ? 35.374 44.067  -0.719  1.00 21.97  ? 234 ASN A CB    1 
ATOM   1914 C CG    . ASN A 1 234 ? 35.349 44.770  0.607   1.00 22.91  ? 234 ASN A CG    1 
ATOM   1915 O OD1   . ASN A 1 234 ? 36.410 45.101  1.138   1.00 26.43  ? 234 ASN A OD1   1 
ATOM   1916 N ND2   . ASN A 1 234 ? 34.158 45.030  1.151   1.00 23.01  ? 234 ASN A ND2   1 
ATOM   1917 N N     . LEU A 1 235 ? 34.836 41.695  -2.868  1.00 23.23  ? 235 LEU A N     1 
ATOM   1918 C CA    . LEU A 1 235 ? 34.566 41.135  -4.193  1.00 23.15  ? 235 LEU A CA    1 
ATOM   1919 C C     . LEU A 1 235 ? 33.093 40.714  -4.272  1.00 23.83  ? 235 LEU A C     1 
ATOM   1920 O O     . LEU A 1 235 ? 32.367 41.143  -5.176  1.00 23.62  ? 235 LEU A O     1 
ATOM   1921 C CB    . LEU A 1 235 ? 35.485 39.933  -4.477  1.00 23.57  ? 235 LEU A CB    1 
ATOM   1922 C CG    . LEU A 1 235 ? 35.230 39.038  -5.699  1.00 23.31  ? 235 LEU A CG    1 
ATOM   1923 C CD1   . LEU A 1 235 ? 35.456 39.817  -6.956  1.00 22.88  ? 235 LEU A CD1   1 
ATOM   1924 C CD2   . LEU A 1 235 ? 36.159 37.837  -5.669  1.00 24.53  ? 235 LEU A CD2   1 
ATOM   1925 N N     . ALA A 1 236 ? 32.657 39.925  -3.291  1.00 24.73  ? 236 ALA A N     1 
ATOM   1926 C CA    . ALA A 1 236 ? 31.310 39.388  -3.270  1.00 26.49  ? 236 ALA A CA    1 
ATOM   1927 C C     . ALA A 1 236 ? 30.304 40.528  -3.195  1.00 26.92  ? 236 ALA A C     1 
ATOM   1928 O O     . ALA A 1 236 ? 29.282 40.506  -3.883  1.00 28.32  ? 236 ALA A O     1 
ATOM   1929 C CB    . ALA A 1 236 ? 31.126 38.405  -2.117  1.00 27.42  ? 236 ALA A CB    1 
ATOM   1930 N N     . ARG A 1 237 ? 30.606 41.542  -2.395  1.00 26.92  ? 237 ARG A N     1 
ATOM   1931 C CA    . ARG A 1 237 ? 29.755 42.719  -2.314  1.00 26.83  ? 237 ARG A CA    1 
ATOM   1932 C C     . ARG A 1 237 ? 29.641 43.380  -3.673  1.00 26.56  ? 237 ARG A C     1 
ATOM   1933 O O     . ARG A 1 237 ? 28.528 43.637  -4.151  1.00 27.77  ? 237 ARG A O     1 
ATOM   1934 C CB    . ARG A 1 237 ? 30.280 43.680  -1.267  1.00 26.48  ? 237 ARG A CB    1 
ATOM   1935 C CG    . ARG A 1 237 ? 29.750 43.359  0.128   1.00 28.75  ? 237 ARG A CG    1 
ATOM   1936 C CD    . ARG A 1 237 ? 30.582 43.983  1.258   1.00 30.41  ? 237 ARG A CD    1 
ATOM   1937 N NE    . ARG A 1 237 ? 30.531 43.108  2.419   1.00 34.06  ? 237 ARG A NE    1 
ATOM   1938 C CZ    . ARG A 1 237 ? 31.523 42.906  3.277   1.00 35.13  ? 237 ARG A CZ    1 
ATOM   1939 N NH1   . ARG A 1 237 ? 32.671 43.547  3.126   1.00 36.46  ? 237 ARG A NH1   1 
ATOM   1940 N NH2   . ARG A 1 237 ? 31.361 42.054  4.285   1.00 34.01  ? 237 ARG A NH2   1 
ATOM   1941 N N     . PHE A 1 238 ? 30.775 43.628  -4.323  1.00 25.48  ? 238 PHE A N     1 
ATOM   1942 C CA    . PHE A 1 238 ? 30.737 44.207  -5.662  1.00 24.72  ? 238 PHE A CA    1 
ATOM   1943 C C     . PHE A 1 238 ? 29.939 43.380  -6.691  1.00 25.86  ? 238 PHE A C     1 
ATOM   1944 O O     . PHE A 1 238 ? 29.104 43.943  -7.402  1.00 26.21  ? 238 PHE A O     1 
ATOM   1945 C CB    . PHE A 1 238 ? 32.134 44.509  -6.172  1.00 23.14  ? 238 PHE A CB    1 
ATOM   1946 C CG    . PHE A 1 238 ? 32.151 45.169  -7.517  1.00 22.72  ? 238 PHE A CG    1 
ATOM   1947 C CD1   . PHE A 1 238 ? 31.590 46.428  -7.702  1.00 22.07  ? 238 PHE A CD1   1 
ATOM   1948 C CD2   . PHE A 1 238 ? 32.740 44.543  -8.605  1.00 22.35  ? 238 PHE A CD2   1 
ATOM   1949 C CE1   . PHE A 1 238 ? 31.618 47.033  -8.949  1.00 20.50  ? 238 PHE A CE1   1 
ATOM   1950 C CE2   . PHE A 1 238 ? 32.775 45.161  -9.860  1.00 19.89  ? 238 PHE A CE2   1 
ATOM   1951 C CZ    . PHE A 1 238 ? 32.219 46.394  -10.024 1.00 20.06  ? 238 PHE A CZ    1 
ATOM   1952 N N     . VAL A 1 239 ? 30.151 42.060  -6.788  1.00 26.35  ? 239 VAL A N     1 
ATOM   1953 C CA    . VAL A 1 239 ? 29.367 41.349  -7.810  1.00 27.33  ? 239 VAL A CA    1 
ATOM   1954 C C     . VAL A 1 239 ? 27.894 41.489  -7.467  1.00 28.49  ? 239 VAL A C     1 
ATOM   1955 O O     . VAL A 1 239 ? 27.064 41.736  -8.344  1.00 29.85  ? 239 VAL A O     1 
ATOM   1956 C CB    . VAL A 1 239 ? 29.789 39.858  -8.132  1.00 28.03  ? 239 VAL A CB    1 
ATOM   1957 C CG1   . VAL A 1 239 ? 31.243 39.615  -7.862  1.00 28.20  ? 239 VAL A CG1   1 
ATOM   1958 C CG2   . VAL A 1 239 ? 28.897 38.806  -7.453  1.00 29.13  ? 239 VAL A CG2   1 
ATOM   1959 N N     . HIS A 1 240 ? 27.573 41.361  -6.184  1.00 28.61  ? 240 HIS A N     1 
ATOM   1960 C CA    . HIS A 1 240 ? 26.199 41.532  -5.752  1.00 29.67  ? 240 HIS A CA    1 
ATOM   1961 C C     . HIS A 1 240 ? 25.628 42.897  -6.138  1.00 30.12  ? 240 HIS A C     1 
ATOM   1962 O O     . HIS A 1 240 ? 24.536 42.941  -6.727  1.00 31.11  ? 240 HIS A O     1 
ATOM   1963 C CB    . HIS A 1 240 ? 26.030 41.285  -4.262  1.00 29.67  ? 240 HIS A CB    1 
ATOM   1964 C CG    . HIS A 1 240 ? 24.612 41.034  -3.869  1.00 31.05  ? 240 HIS A CG    1 
ATOM   1965 N ND1   . HIS A 1 240 ? 23.894 41.904  -3.074  1.00 29.60  ? 240 HIS A ND1   1 
ATOM   1966 C CD2   . HIS A 1 240 ? 23.767 40.021  -4.191  1.00 31.49  ? 240 HIS A CD2   1 
ATOM   1967 C CE1   . HIS A 1 240 ? 22.673 41.428  -2.909  1.00 33.52  ? 240 HIS A CE1   1 
ATOM   1968 N NE2   . HIS A 1 240 ? 22.566 40.294  -3.590  1.00 34.15  ? 240 HIS A NE2   1 
ATOM   1969 N N     . LEU A 1 241 ? 26.372 43.980  -5.838  1.00 29.03  ? 241 LEU A N     1 
ATOM   1970 C CA    . LEU A 1 241 ? 25.963 45.347  -6.180  1.00 29.90  ? 241 LEU A CA    1 
ATOM   1971 C C     . LEU A 1 241 ? 25.574 45.450  -7.621  1.00 31.15  ? 241 LEU A C     1 
ATOM   1972 O O     . LEU A 1 241 ? 24.560 46.074  -7.970  1.00 33.18  ? 241 LEU A O     1 
ATOM   1973 C CB    . LEU A 1 241 ? 27.091 46.342  -5.963  1.00 28.93  ? 241 LEU A CB    1 
ATOM   1974 C CG    . LEU A 1 241 ? 27.080 47.230  -4.729  1.00 29.94  ? 241 LEU A CG    1 
ATOM   1975 C CD1   . LEU A 1 241 ? 25.666 47.779  -4.502  1.00 31.50  ? 241 LEU A CD1   1 
ATOM   1976 C CD2   . LEU A 1 241 ? 27.581 46.413  -3.511  1.00 30.76  ? 241 LEU A CD2   1 
ATOM   1977 N N     . CYS A 1 242 ? 26.409 44.832  -8.452  1.00 30.58  ? 242 CYS A N     1 
ATOM   1978 C CA    . CYS A 1 242 ? 26.209 44.765  -9.882  1.00 30.84  ? 242 CYS A CA    1 
ATOM   1979 C C     . CYS A 1 242 ? 24.936 44.043  -10.222 1.00 31.94  ? 242 CYS A C     1 
ATOM   1980 O O     . CYS A 1 242 ? 24.134 44.550  -11.005 1.00 33.06  ? 242 CYS A O     1 
ATOM   1981 C CB    . CYS A 1 242 ? 27.422 44.119  -10.550 1.00 29.92  ? 242 CYS A CB    1 
ATOM   1982 S SG    . CYS A 1 242 ? 28.852 45.249  -10.508 1.00 30.61  ? 242 CYS A SG    1 
ATOM   1983 N N     . ARG A 1 243 ? 24.722 42.875  -9.629  1.00 31.89  ? 243 ARG A N     1 
ATOM   1984 C CA    . ARG A 1 243 ? 23.517 42.127  -9.969  1.00 33.53  ? 243 ARG A CA    1 
ATOM   1985 C C     . ARG A 1 243 ? 22.274 42.930  -9.619  1.00 35.31  ? 243 ARG A C     1 
ATOM   1986 O O     . ARG A 1 243 ? 21.318 42.978  -10.397 1.00 36.99  ? 243 ARG A O     1 
ATOM   1987 C CB    . ARG A 1 243 ? 23.486 40.771  -9.303  1.00 33.46  ? 243 ARG A CB    1 
ATOM   1988 C CG    . ARG A 1 243 ? 24.476 39.818  -9.864  1.00 31.31  ? 243 ARG A CG    1 
ATOM   1989 C CD    . ARG A 1 243 ? 24.565 38.652  -8.942  1.00 30.91  ? 243 ARG A CD    1 
ATOM   1990 N NE    . ARG A 1 243 ? 25.476 37.622  -9.427  1.00 29.42  ? 243 ARG A NE    1 
ATOM   1991 C CZ    . ARG A 1 243 ? 25.881 36.581  -8.709  1.00 27.25  ? 243 ARG A CZ    1 
ATOM   1992 N NH1   . ARG A 1 243 ? 25.464 36.414  -7.458  1.00 27.46  ? 243 ARG A NH1   1 
ATOM   1993 N NH2   . ARG A 1 243 ? 26.718 35.713  -9.240  1.00 26.76  ? 243 ARG A NH2   1 
ATOM   1994 N N     . GLU A 1 244 ? 22.319 43.594  -8.470  1.00 35.21  ? 244 GLU A N     1 
ATOM   1995 C CA    . GLU A 1 244 ? 21.215 44.419  -7.997  1.00 37.24  ? 244 GLU A CA    1 
ATOM   1996 C C     . GLU A 1 244 ? 20.966 45.605  -8.903  1.00 37.54  ? 244 GLU A C     1 
ATOM   1997 O O     . GLU A 1 244 ? 19.820 45.969  -9.173  1.00 39.29  ? 244 GLU A O     1 
ATOM   1998 C CB    . GLU A 1 244 ? 21.515 44.936  -6.599  1.00 36.64  ? 244 GLU A CB    1 
ATOM   1999 C CG    . GLU A 1 244 ? 21.199 43.958  -5.470  1.00 37.67  ? 244 GLU A CG    1 
ATOM   2000 C CD    . GLU A 1 244 ? 21.434 44.590  -4.091  1.00 37.77  ? 244 GLU A CD    1 
ATOM   2001 O OE1   . GLU A 1 244 ? 22.536 45.143  -3.842  1.00 36.73  ? 244 GLU A OE1   1 
ATOM   2002 O OE2   . GLU A 1 244 ? 20.507 44.535  -3.253  1.00 41.28  ? 244 GLU A OE2   1 
ATOM   2003 N N     . PHE A 1 245 ? 22.056 46.205  -9.361  1.00 36.18  ? 245 PHE A N     1 
ATOM   2004 C CA    . PHE A 1 245 ? 21.986 47.429  -10.142 1.00 36.62  ? 245 PHE A CA    1 
ATOM   2005 C C     . PHE A 1 245 ? 21.359 47.173  -11.492 1.00 38.08  ? 245 PHE A C     1 
ATOM   2006 O O     . PHE A 1 245 ? 20.521 47.945  -11.941 1.00 39.88  ? 245 PHE A O     1 
ATOM   2007 C CB    . PHE A 1 245 ? 23.363 48.081  -10.310 1.00 34.53  ? 245 PHE A CB    1 
ATOM   2008 C CG    . PHE A 1 245 ? 23.330 49.316  -11.154 1.00 35.50  ? 245 PHE A CG    1 
ATOM   2009 C CD1   . PHE A 1 245 ? 23.072 50.557  -10.583 1.00 36.06  ? 245 PHE A CD1   1 
ATOM   2010 C CD2   . PHE A 1 245 ? 23.521 49.240  -12.528 1.00 36.13  ? 245 PHE A CD2   1 
ATOM   2011 C CE1   . PHE A 1 245 ? 23.020 51.705  -11.369 1.00 38.02  ? 245 PHE A CE1   1 
ATOM   2012 C CE2   . PHE A 1 245 ? 23.470 50.380  -13.323 1.00 36.93  ? 245 PHE A CE2   1 
ATOM   2013 C CZ    . PHE A 1 245 ? 23.218 51.615  -12.741 1.00 38.23  ? 245 PHE A CZ    1 
ATOM   2014 N N     . MET A 1 246 ? 21.767 46.092  -12.138 1.00 37.75  ? 246 MET A N     1 
ATOM   2015 C CA    . MET A 1 246 ? 21.190 45.731  -13.423 1.00 40.01  ? 246 MET A CA    1 
ATOM   2016 C C     . MET A 1 246 ? 19.686 45.453  -13.392 1.00 42.90  ? 246 MET A C     1 
ATOM   2017 O O     . MET A 1 246 ? 18.992 45.710  -14.375 1.00 45.11  ? 246 MET A O     1 
ATOM   2018 C CB    . MET A 1 246 ? 21.938 44.562  -14.047 1.00 39.36  ? 246 MET A CB    1 
ATOM   2019 C CG    . MET A 1 246 ? 23.341 44.919  -14.412 1.00 39.17  ? 246 MET A CG    1 
ATOM   2020 S SD    . MET A 1 246 ? 23.607 46.301  -15.560 1.00 44.01  ? 246 MET A SD    1 
ATOM   2021 C CE    . MET A 1 246 ? 22.221 47.416  -15.324 1.00 46.70  ? 246 MET A CE    1 
ATOM   2022 N N     . GLU A 1 247 ? 19.197 44.922  -12.275 1.00 43.12  ? 247 GLU A N     1 
ATOM   2023 C CA    . GLU A 1 247 ? 17.794 44.605  -12.115 1.00 45.91  ? 247 GLU A CA    1 
ATOM   2024 C C     . GLU A 1 247 ? 16.953 45.845  -11.823 1.00 46.40  ? 247 GLU A C     1 
ATOM   2025 O O     . GLU A 1 247 ? 15.804 45.945  -12.243 1.00 49.07  ? 247 GLU A O     1 
ATOM   2026 C CB    . GLU A 1 247 ? 17.632 43.560  -11.012 1.00 46.45  ? 247 GLU A CB    1 
ATOM   2027 C CG    . GLU A 1 247 ? 18.396 42.277  -11.329 1.00 50.16  ? 247 GLU A CG    1 
ATOM   2028 C CD    . GLU A 1 247 ? 17.934 41.052  -10.529 1.00 56.82  ? 247 GLU A CD    1 
ATOM   2029 O OE1   . GLU A 1 247 ? 17.236 40.181  -11.128 1.00 60.81  ? 247 GLU A OE1   1 
ATOM   2030 O OE2   . GLU A 1 247 ? 18.281 40.956  -9.317  1.00 57.80  ? 247 GLU A OE2   1 
ATOM   2031 N N     . ALA A 1 248 ? 17.526 46.789  -11.096 1.00 44.18  ? 248 ALA A N     1 
ATOM   2032 C CA    . ALA A 1 248 ? 16.800 47.985  -10.692 1.00 44.91  ? 248 ALA A CA    1 
ATOM   2033 C C     . ALA A 1 248 ? 17.758 49.156  -10.541 1.00 42.59  ? 248 ALA A C     1 
ATOM   2034 O O     . ALA A 1 248 ? 18.044 49.587  -9.417  1.00 41.52  ? 248 ALA A O     1 
ATOM   2035 C CB    . ALA A 1 248 ? 16.026 47.741  -9.394  1.00 45.84  ? 248 ALA A CB    1 
ATOM   2036 N N     . PRO A 1 249 ? 18.222 49.695  -11.681 1.00 41.88  ? 249 PRO A N     1 
ATOM   2037 C CA    . PRO A 1 249 ? 19.175 50.789  -11.720 1.00 40.36  ? 249 PRO A CA    1 
ATOM   2038 C C     . PRO A 1 249 ? 18.590 52.067  -11.114 1.00 41.79  ? 249 PRO A C     1 
ATOM   2039 O O     . PRO A 1 249 ? 17.434 52.395  -11.376 1.00 44.31  ? 249 PRO A O     1 
ATOM   2040 C CB    . PRO A 1 249 ? 19.403 51.008  -13.223 1.00 40.88  ? 249 PRO A CB    1 
ATOM   2041 C CG    . PRO A 1 249 ? 18.798 49.858  -13.917 1.00 41.55  ? 249 PRO A CG    1 
ATOM   2042 C CD    . PRO A 1 249 ? 17.772 49.301  -13.028 1.00 43.29  ? 249 PRO A CD    1 
ATOM   2043 N N     . SER A 1 250 ? 19.384 52.776  -10.311 1.00 40.22  ? 250 SER A N     1 
ATOM   2044 C CA    . SER A 1 250 ? 19.024 54.116  -9.849  1.00 41.11  ? 250 SER A CA    1 
ATOM   2045 C C     . SER A 1 250 ? 20.265 54.969  -9.558  1.00 39.30  ? 250 SER A C     1 
ATOM   2046 O O     . SER A 1 250 ? 21.379 54.451  -9.452  1.00 36.74  ? 250 SER A O     1 
ATOM   2047 C CB    . SER A 1 250 ? 18.125 54.044  -8.609  1.00 41.98  ? 250 SER A CB    1 
ATOM   2048 O OG    . SER A 1 250 ? 18.901 53.889  -7.432  1.00 39.98  ? 250 SER A OG    1 
ATOM   2049 N N     . LEU A 1 251 ? 20.048 56.281  -9.439  1.00 40.86  ? 251 LEU A N     1 
ATOM   2050 C CA    . LEU A 1 251 ? 21.052 57.223  -8.926  1.00 39.77  ? 251 LEU A CA    1 
ATOM   2051 C C     . LEU A 1 251 ? 21.489 56.860  -7.503  1.00 38.82  ? 251 LEU A C     1 
ATOM   2052 O O     . LEU A 1 251 ? 22.622 57.121  -7.115  1.00 37.53  ? 251 LEU A O     1 
ATOM   2053 C CB    . LEU A 1 251 ? 20.522 58.666  -8.958  1.00 42.07  ? 251 LEU A CB    1 
ATOM   2054 C CG    . LEU A 1 251 ? 21.562 59.784  -9.097  1.00 40.39  ? 251 LEU A CG    1 
ATOM   2055 C CD1   . LEU A 1 251 ? 22.553 59.459  -10.204 1.00 36.44  ? 251 LEU A CD1   1 
ATOM   2056 C CD2   . LEU A 1 251 ? 20.900 61.134  -9.345  1.00 43.72  ? 251 LEU A CD2   1 
ATOM   2057 N N     . GLY A 1 252 ? 20.589 56.255  -6.733  1.00 39.84  ? 252 GLY A N     1 
ATOM   2058 C CA    . GLY A 1 252 ? 20.937 55.672  -5.435  1.00 38.80  ? 252 GLY A CA    1 
ATOM   2059 C C     . GLY A 1 252 ? 22.346 55.103  -5.354  1.00 35.97  ? 252 GLY A C     1 
ATOM   2060 O O     . GLY A 1 252 ? 23.107 55.481  -4.479  1.00 35.65  ? 252 GLY A O     1 
ATOM   2061 N N     . PHE A 1 253 ? 22.706 54.230  -6.290  1.00 34.73  ? 253 PHE A N     1 
ATOM   2062 C CA    . PHE A 1 253 ? 23.979 53.510  -6.234  1.00 32.27  ? 253 PHE A CA    1 
ATOM   2063 C C     . PHE A 1 253 ? 25.209 54.409  -6.287  1.00 31.49  ? 253 PHE A C     1 
ATOM   2064 O O     . PHE A 1 253 ? 26.303 53.967  -5.984  1.00 30.24  ? 253 PHE A O     1 
ATOM   2065 C CB    . PHE A 1 253 ? 24.059 52.471  -7.346  1.00 30.91  ? 253 PHE A CB    1 
ATOM   2066 C CG    . PHE A 1 253 ? 23.130 51.308  -7.166  1.00 32.19  ? 253 PHE A CG    1 
ATOM   2067 C CD1   . PHE A 1 253 ? 21.750 51.461  -7.308  1.00 34.41  ? 253 PHE A CD1   1 
ATOM   2068 C CD2   . PHE A 1 253 ? 23.628 50.036  -6.887  1.00 31.29  ? 253 PHE A CD2   1 
ATOM   2069 C CE1   . PHE A 1 253 ? 20.877 50.366  -7.161  1.00 33.55  ? 253 PHE A CE1   1 
ATOM   2070 C CE2   . PHE A 1 253 ? 22.763 48.941  -6.745  1.00 31.26  ? 253 PHE A CE2   1 
ATOM   2071 C CZ    . PHE A 1 253 ? 21.391 49.112  -6.888  1.00 32.67  ? 253 PHE A CZ    1 
ATOM   2072 N N     . PHE A 1 254 ? 25.032 55.665  -6.661  1.00 32.94  ? 254 PHE A N     1 
ATOM   2073 C CA    . PHE A 1 254 ? 26.160 56.591  -6.785  1.00 32.95  ? 254 PHE A CA    1 
ATOM   2074 C C     . PHE A 1 254 ? 26.148 57.615  -5.676  1.00 33.96  ? 254 PHE A C     1 
ATOM   2075 O O     . PHE A 1 254 ? 27.021 58.486  -5.639  1.00 34.14  ? 254 PHE A O     1 
ATOM   2076 C CB    . PHE A 1 254 ? 26.152 57.311  -8.150  1.00 33.92  ? 254 PHE A CB    1 
ATOM   2077 C CG    . PHE A 1 254 ? 26.325 56.379  -9.327  1.00 34.24  ? 254 PHE A CG    1 
ATOM   2078 C CD1   . PHE A 1 254 ? 25.223 55.750  -9.911  1.00 36.13  ? 254 PHE A CD1   1 
ATOM   2079 C CD2   . PHE A 1 254 ? 27.590 56.114  -9.844  1.00 33.11  ? 254 PHE A CD2   1 
ATOM   2080 C CE1   . PHE A 1 254 ? 25.384 54.879  -10.989 1.00 34.96  ? 254 PHE A CE1   1 
ATOM   2081 C CE2   . PHE A 1 254 ? 27.755 55.252  -10.925 1.00 32.37  ? 254 PHE A CE2   1 
ATOM   2082 C CZ    . PHE A 1 254 ? 26.652 54.633  -11.492 1.00 33.11  ? 254 PHE A CZ    1 
ATOM   2083 N N     . LYS A 1 255 ? 25.150 57.523  -4.796  1.00 35.14  ? 255 LYS A N     1 
ATOM   2084 C CA    . LYS A 1 255 ? 25.033 58.405  -3.630  1.00 36.80  ? 255 LYS A CA    1 
ATOM   2085 C C     . LYS A 1 255 ? 25.509 57.641  -2.394  1.00 35.57  ? 255 LYS A C     1 
ATOM   2086 O O     . LYS A 1 255 ? 25.095 56.517  -2.174  1.00 35.10  ? 255 LYS A O     1 
ATOM   2087 C CB    . LYS A 1 255 ? 23.588 58.840  -3.412  1.00 39.08  ? 255 LYS A CB    1 
ATOM   2088 C CG    . LYS A 1 255 ? 22.894 59.403  -4.641  1.00 42.41  ? 255 LYS A CG    1 
ATOM   2089 C CD    . LYS A 1 255 ? 22.505 60.870  -4.492  1.00 46.07  ? 255 LYS A CD    1 
ATOM   2090 C CE    . LYS A 1 255 ? 21.203 61.124  -5.260  1.00 49.34  ? 255 LYS A CE    1 
ATOM   2091 N NZ    . LYS A 1 255 ? 20.656 62.498  -5.074  1.00 52.69  ? 255 LYS A NZ    1 
ATOM   2092 N N     . PRO A 1 256 ? 26.380 58.251  -1.581  1.00 35.44  ? 256 PRO A N     1 
ATOM   2093 C CA    . PRO A 1 256 ? 26.857 57.501  -0.432  1.00 34.62  ? 256 PRO A CA    1 
ATOM   2094 C C     . PRO A 1 256 ? 25.899 57.589  0.766   1.00 36.02  ? 256 PRO A C     1 
ATOM   2095 O O     . PRO A 1 256 ? 25.235 58.615  0.957   1.00 38.04  ? 256 PRO A O     1 
ATOM   2096 C CB    . PRO A 1 256 ? 28.220 58.149  -0.114  1.00 34.14  ? 256 PRO A CB    1 
ATOM   2097 C CG    . PRO A 1 256 ? 28.214 59.500  -0.823  1.00 35.83  ? 256 PRO A CG    1 
ATOM   2098 C CD    . PRO A 1 256 ? 26.951 59.608  -1.646  1.00 36.52  ? 256 PRO A CD    1 
ATOM   2099 N N     . LYS A 1 257 ? 25.822 56.508  1.539   1.00 34.96  ? 257 LYS A N     1 
ATOM   2100 C CA    . LYS A 1 257 ? 25.069 56.515  2.779   1.00 36.34  ? 257 LYS A CA    1 
ATOM   2101 C C     . LYS A 1 257 ? 25.938 56.927  3.962   1.00 36.27  ? 257 LYS A C     1 
ATOM   2102 O O     . LYS A 1 257 ? 27.142 56.696  3.969   1.00 34.81  ? 257 LYS A O     1 
ATOM   2103 C CB    . LYS A 1 257 ? 24.394 55.163  3.028   1.00 36.13  ? 257 LYS A CB    1 
ATOM   2104 C CG    . LYS A 1 257 ? 23.350 54.797  1.968   1.00 36.96  ? 257 LYS A CG    1 
ATOM   2105 C CD    . LYS A 1 257 ? 22.539 53.571  2.379   1.00 37.13  ? 257 LYS A CD    1 
ATOM   2106 C CE    . LYS A 1 257 ? 21.330 53.335  1.480   1.00 38.03  ? 257 LYS A CE    1 
ATOM   2107 N NZ    . LYS A 1 257 ? 20.211 52.749  2.292   1.00 40.44  ? 257 LYS A NZ    1 
ATOM   2108 N N     . HIS A 1 258 ? 25.313 57.567  4.943   1.00 38.06  ? 258 HIS A N     1 
ATOM   2109 C CA    . HIS A 1 258 ? 25.975 57.960  6.172   1.00 38.92  ? 258 HIS A CA    1 
ATOM   2110 C C     . HIS A 1 258 ? 25.117 57.414  7.279   1.00 39.61  ? 258 HIS A C     1 
ATOM   2111 O O     . HIS A 1 258 ? 23.899 57.505  7.194   1.00 40.85  ? 258 HIS A O     1 
ATOM   2112 C CB    . HIS A 1 258 ? 26.085 59.484  6.246   1.00 41.09  ? 258 HIS A CB    1 
ATOM   2113 C CG    . HIS A 1 258 ? 26.668 60.100  5.001   1.00 43.66  ? 258 HIS A CG    1 
ATOM   2114 N ND1   . HIS A 1 258 ? 25.988 61.026  4.230   1.00 46.87  ? 258 HIS A ND1   1 
ATOM   2115 C CD2   . HIS A 1 258 ? 27.850 59.881  4.367   1.00 42.91  ? 258 HIS A CD2   1 
ATOM   2116 C CE1   . HIS A 1 258 ? 26.733 61.363  3.189   1.00 46.55  ? 258 HIS A CE1   1 
ATOM   2117 N NE2   . HIS A 1 258 ? 27.866 60.681  3.248   1.00 44.56  ? 258 HIS A NE2   1 
ATOM   2118 N N     . PRO A 1 259 ? 25.736 56.809  8.307   1.00 39.10  ? 259 PRO A N     1 
ATOM   2119 C CA    . PRO A 1 259 ? 25.003 56.254  9.439   1.00 40.33  ? 259 PRO A CA    1 
ATOM   2120 C C     . PRO A 1 259 ? 24.163 57.287  10.175  1.00 43.00  ? 259 PRO A C     1 
ATOM   2121 O O     . PRO A 1 259 ? 24.434 58.482  10.111  1.00 43.92  ? 259 PRO A O     1 
ATOM   2122 C CB    . PRO A 1 259 ? 26.110 55.725  10.359  1.00 39.65  ? 259 PRO A CB    1 
ATOM   2123 C CG    . PRO A 1 259 ? 27.311 56.397  9.953   1.00 38.63  ? 259 PRO A CG    1 
ATOM   2124 C CD    . PRO A 1 259 ? 27.180 56.597  8.468   1.00 38.03  ? 259 PRO A CD    1 
ATOM   2125 N N     . LEU A 1 260 ? 23.135 56.816  10.854  1.00 37.15  ? 260 LEU A N     1 
ATOM   2126 C CA    . LEU A 1 260 ? 22.252 57.683  11.581  1.00 39.48  ? 260 LEU A CA    1 
ATOM   2127 C C     . LEU A 1 260 ? 22.609 57.709  13.074  1.00 39.75  ? 260 LEU A C     1 
ATOM   2128 O O     . LEU A 1 260 ? 23.115 56.728  13.623  1.00 38.19  ? 260 LEU A O     1 
ATOM   2129 C CB    . LEU A 1 260 ? 20.824 57.180  11.377  1.00 39.66  ? 260 LEU A CB    1 
ATOM   2130 C CG    . LEU A 1 260 ? 19.837 57.728  10.331  1.00 41.01  ? 260 LEU A CG    1 
ATOM   2131 C CD1   . LEU A 1 260 ? 20.391 58.774  9.354   1.00 39.79  ? 260 LEU A CD1   1 
ATOM   2132 C CD2   . LEU A 1 260 ? 19.166 56.577  9.598   1.00 37.61  ? 260 LEU A CD2   1 
ATOM   2133 N N     . GLU A 1 261 ? 22.340 58.832  13.728  1.00 42.78  ? 261 GLU A N     1 
ATOM   2134 C CA    . GLU A 1 261 ? 22.368 58.885  15.183  1.00 43.83  ? 261 GLU A CA    1 
ATOM   2135 C C     . GLU A 1 261 ? 21.289 57.937  15.661  1.00 43.70  ? 261 GLU A C     1 
ATOM   2136 O O     . GLU A 1 261 ? 20.142 58.016  15.221  1.00 44.70  ? 261 GLU A O     1 
ATOM   2137 C CB    . GLU A 1 261 ? 22.032 60.280  15.710  1.00 46.53  ? 261 GLU A CB    1 
ATOM   2138 C CG    . GLU A 1 261 ? 22.698 61.441  15.005  1.00 50.16  ? 261 GLU A CG    1 
ATOM   2139 C CD    . GLU A 1 261 ? 21.938 62.757  15.231  1.00 56.96  ? 261 GLU A CD    1 
ATOM   2140 O OE1   . GLU A 1 261 ? 22.010 63.653  14.351  1.00 59.28  ? 261 GLU A OE1   1 
ATOM   2141 O OE2   . GLU A 1 261 ? 21.255 62.894  16.283  1.00 57.97  ? 261 GLU A OE2   1 
ATOM   2142 N N     . ILE A 1 262 ? 21.638 57.040  16.564  1.00 43.02  ? 262 ILE A N     1 
ATOM   2143 C CA    . ILE A 1 262 ? 20.613 56.190  17.140  1.00 43.91  ? 262 ILE A CA    1 
ATOM   2144 C C     . ILE A 1 262 ? 20.530 56.448  18.640  1.00 45.24  ? 262 ILE A C     1 
ATOM   2145 O O     . ILE A 1 262 ? 21.552 56.428  19.328  1.00 44.68  ? 262 ILE A O     1 
ATOM   2146 C CB    . ILE A 1 262 ? 20.861 54.704  16.808  1.00 41.04  ? 262 ILE A CB    1 
ATOM   2147 C CG1   . ILE A 1 262 ? 19.630 53.863  17.131  1.00 42.05  ? 262 ILE A CG1   1 
ATOM   2148 C CG2   . ILE A 1 262 ? 22.037 54.170  17.585  1.00 39.95  ? 262 ILE A CG2   1 
ATOM   2149 C CD1   . ILE A 1 262 ? 19.733 52.399  16.658  1.00 40.25  ? 262 ILE A CD1   1 
ATOM   2150 N N     . GLU A 1 263 ? 19.325 56.731  19.135  1.00 47.96  ? 263 GLU A N     1 
ATOM   2151 C CA    . GLU A 1 263 ? 19.117 56.876  20.573  1.00 50.37  ? 263 GLU A CA    1 
ATOM   2152 C C     . GLU A 1 263 ? 19.675 55.599  21.249  1.00 48.39  ? 263 GLU A C     1 
ATOM   2153 O O     . GLU A 1 263 ? 19.449 54.480  20.780  1.00 46.68  ? 263 GLU A O     1 
ATOM   2154 C CB    . GLU A 1 263 ? 17.625 57.105  20.955  1.00 52.94  ? 263 GLU A CB    1 
ATOM   2155 C CG    . GLU A 1 263 ? 16.712 57.947  19.991  1.00 57.16  ? 263 GLU A CG    1 
ATOM   2156 C CD    . GLU A 1 263 ? 15.790 57.091  19.044  1.00 59.42  ? 263 GLU A CD    1 
ATOM   2157 O OE1   . GLU A 1 263 ? 14.532 57.181  19.142  1.00 60.19  ? 263 GLU A OE1   1 
ATOM   2158 O OE2   . GLU A 1 263 ? 16.326 56.332  18.188  1.00 58.33  ? 263 GLU A OE2   1 
ATOM   2159 N N     . PRO A 1 264 ? 20.432 55.762  22.338  1.00 49.12  ? 264 PRO A N     1 
ATOM   2160 C CA    . PRO A 1 264 ? 20.923 54.589  23.084  1.00 47.71  ? 264 PRO A CA    1 
ATOM   2161 C C     . PRO A 1 264 ? 19.805 53.672  23.600  1.00 48.26  ? 264 PRO A C     1 
ATOM   2162 O O     . PRO A 1 264 ? 20.072 52.558  24.039  1.00 46.63  ? 264 PRO A O     1 
ATOM   2163 C CB    . PRO A 1 264 ? 21.676 55.213  24.268  1.00 48.70  ? 264 PRO A CB    1 
ATOM   2164 C CG    . PRO A 1 264 ? 22.009 56.613  23.816  1.00 50.32  ? 264 PRO A CG    1 
ATOM   2165 C CD    . PRO A 1 264 ? 20.878 57.036  22.930  1.00 51.03  ? 264 PRO A CD    1 
ATOM   2166 N N     . GLU A 1 265 ? 18.565 54.141  23.556  1.00 51.05  ? 265 GLU A N     1 
ATOM   2167 C CA    . GLU A 1 265 ? 17.454 53.348  24.031  1.00 52.63  ? 265 GLU A CA    1 
ATOM   2168 C C     . GLU A 1 265 ? 17.031 52.333  22.987  1.00 51.26  ? 265 GLU A C     1 
ATOM   2169 O O     . GLU A 1 265 ? 16.960 51.141  23.294  1.00 50.22  ? 265 GLU A O     1 
ATOM   2170 C CB    . GLU A 1 265 ? 16.276 54.228  24.435  1.00 56.15  ? 265 GLU A CB    1 
ATOM   2171 C CG    . GLU A 1 265 ? 15.435 53.621  25.552  1.00 60.33  ? 265 GLU A CG    1 
ATOM   2172 C CD    . GLU A 1 265 ? 16.231 53.432  26.858  1.00 65.00  ? 265 GLU A CD    1 
ATOM   2173 O OE1   . GLU A 1 265 ? 16.407 54.430  27.593  1.00 68.29  ? 265 GLU A OE1   1 
ATOM   2174 O OE2   . GLU A 1 265 ? 16.680 52.291  27.154  1.00 65.04  ? 265 GLU A OE2   1 
ATOM   2175 N N     . ARG A 1 266 ? 16.770 52.791  21.756  1.00 51.72  ? 266 ARG A N     1 
ATOM   2176 C CA    . ARG A 1 266 ? 16.402 51.884  20.656  1.00 50.51  ? 266 ARG A CA    1 
ATOM   2177 C C     . ARG A 1 266 ? 17.420 50.779  20.655  1.00 47.53  ? 266 ARG A C     1 
ATOM   2178 O O     . ARG A 1 266 ? 17.074 49.608  20.519  1.00 46.55  ? 266 ARG A O     1 
ATOM   2179 C CB    . ARG A 1 266 ? 16.340 52.598  19.288  1.00 50.77  ? 266 ARG A CB    1 
ATOM   2180 C CG    . ARG A 1 266 ? 15.969 51.704  18.063  1.00 49.99  ? 266 ARG A CG    1 
ATOM   2181 C CD    . ARG A 1 266 ? 15.568 52.552  16.795  1.00 52.52  ? 266 ARG A CD    1 
ATOM   2182 N NE    . ARG A 1 266 ? 16.062 52.027  15.494  1.00 52.76  ? 266 ARG A NE    1 
ATOM   2183 C CZ    . ARG A 1 266 ? 15.944 52.649  14.303  1.00 54.76  ? 266 ARG A CZ    1 
ATOM   2184 N NH1   . ARG A 1 266 ? 15.345 53.838  14.194  1.00 58.83  ? 266 ARG A NH1   1 
ATOM   2185 N NH2   . ARG A 1 266 ? 16.435 52.093  13.198  1.00 52.15  ? 266 ARG A NH2   1 
ATOM   2186 N N     . LEU A 1 267 ? 18.670 51.168  20.872  1.00 46.64  ? 267 LEU A N     1 
ATOM   2187 C CA    . LEU A 1 267 ? 19.794 50.244  20.837  1.00 44.58  ? 267 LEU A CA    1 
ATOM   2188 C C     . LEU A 1 267 ? 19.725 49.214  21.967  1.00 44.12  ? 267 LEU A C     1 
ATOM   2189 O O     . LEU A 1 267 ? 20.089 48.055  21.766  1.00 42.66  ? 267 LEU A O     1 
ATOM   2190 C CB    . LEU A 1 267 ? 21.116 51.027  20.860  1.00 44.18  ? 267 LEU A CB    1 
ATOM   2191 C CG    . LEU A 1 267 ? 22.342 50.488  20.109  1.00 42.05  ? 267 LEU A CG    1 
ATOM   2192 C CD1   . LEU A 1 267 ? 22.025 50.168  18.685  1.00 39.32  ? 267 LEU A CD1   1 
ATOM   2193 C CD2   . LEU A 1 267 ? 23.454 51.515  20.146  1.00 43.19  ? 267 LEU A CD2   1 
ATOM   2194 N N     . ARG A 1 268 ? 19.245 49.639  23.138  1.00 45.48  ? 268 ARG A N     1 
ATOM   2195 C CA    . ARG A 1 268 ? 19.101 48.767  24.291  1.00 45.36  ? 268 ARG A CA    1 
ATOM   2196 C C     . ARG A 1 268 ? 18.054 47.722  24.007  1.00 45.22  ? 268 ARG A C     1 
ATOM   2197 O O     . ARG A 1 268 ? 18.254 46.531  24.263  1.00 44.19  ? 268 ARG A O     1 
ATOM   2198 C CB    . ARG A 1 268 ? 18.656 49.562  25.510  1.00 47.85  ? 268 ARG A CB    1 
ATOM   2199 C CG    . ARG A 1 268 ? 18.906 48.859  26.841  1.00 48.73  ? 268 ARG A CG    1 
ATOM   2200 C CD    . ARG A 1 268 ? 17.847 49.187  27.875  1.00 52.48  ? 268 ARG A CD    1 
ATOM   2201 N NE    . ARG A 1 268 ? 16.671 48.338  27.681  1.00 54.99  ? 268 ARG A NE    1 
ATOM   2202 C CZ    . ARG A 1 268 ? 15.446 48.780  27.392  1.00 57.80  ? 268 ARG A CZ    1 
ATOM   2203 N NH1   . ARG A 1 268 ? 14.448 47.914  27.229  1.00 57.68  ? 268 ARG A NH1   1 
ATOM   2204 N NH2   . ARG A 1 268 ? 15.207 50.084  27.277  1.00 59.86  ? 268 ARG A NH2   1 
ATOM   2205 N N     . LYS A 1 269 ? 16.926 48.194  23.492  1.00 46.51  ? 269 LYS A N     1 
ATOM   2206 C CA    . LYS A 1 269 ? 15.803 47.340  23.128  1.00 46.68  ? 269 LYS A CA    1 
ATOM   2207 C C     . LYS A 1 269 ? 16.155 46.297  22.088  1.00 44.16  ? 269 LYS A C     1 
ATOM   2208 O O     . LYS A 1 269 ? 15.689 45.161  22.159  1.00 44.27  ? 269 LYS A O     1 
ATOM   2209 C CB    . LYS A 1 269 ? 14.633 48.174  22.616  1.00 48.84  ? 269 LYS A CB    1 
ATOM   2210 C CG    . LYS A 1 269 ? 13.763 48.749  23.723  1.00 52.18  ? 269 LYS A CG    1 
ATOM   2211 C CD    . LYS A 1 269 ? 12.284 48.317  23.581  1.00 55.06  ? 269 LYS A CD    1 
ATOM   2212 C CE    . LYS A 1 269 ? 11.618 48.823  22.302  1.00 55.65  ? 269 LYS A CE    1 
ATOM   2213 N NZ    . LYS A 1 269 ? 11.519 50.305  22.280  1.00 58.39  ? 269 LYS A NZ    1 
ATOM   2214 N N     . ILE A 1 270 ? 16.971 46.683  21.119  1.00 42.52  ? 270 ILE A N     1 
ATOM   2215 C CA    . ILE A 1 270 ? 17.340 45.772  20.041  1.00 40.39  ? 270 ILE A CA    1 
ATOM   2216 C C     . ILE A 1 270 ? 18.196 44.660  20.607  1.00 39.04  ? 270 ILE A C     1 
ATOM   2217 O O     . ILE A 1 270 ? 17.938 43.491  20.358  1.00 38.51  ? 270 ILE A O     1 
ATOM   2218 C CB    . ILE A 1 270 ? 18.056 46.515  18.898  1.00 39.57  ? 270 ILE A CB    1 
ATOM   2219 C CG1   . ILE A 1 270 ? 17.043 47.336  18.112  1.00 39.88  ? 270 ILE A CG1   1 
ATOM   2220 C CG2   . ILE A 1 270 ? 18.813 45.551  17.983  1.00 37.36  ? 270 ILE A CG2   1 
ATOM   2221 C CD1   . ILE A 1 270 ? 17.663 48.476  17.372  1.00 40.40  ? 270 ILE A CD1   1 
ATOM   2222 N N     . VAL A 1 271 ? 19.192 45.039  21.396  1.00 38.84  ? 271 VAL A N     1 
ATOM   2223 C CA    . VAL A 1 271 ? 20.096 44.093  22.005  1.00 38.16  ? 271 VAL A CA    1 
ATOM   2224 C C     . VAL A 1 271 ? 19.372 43.093  22.910  1.00 39.60  ? 271 VAL A C     1 
ATOM   2225 O O     . VAL A 1 271 ? 19.670 41.895  22.856  1.00 39.68  ? 271 VAL A O     1 
ATOM   2226 C CB    . VAL A 1 271 ? 21.217 44.815  22.758  1.00 38.06  ? 271 VAL A CB    1 
ATOM   2227 C CG1   . VAL A 1 271 ? 21.938 43.868  23.732  1.00 36.39  ? 271 VAL A CG1   1 
ATOM   2228 C CG2   . VAL A 1 271 ? 22.192 45.431  21.754  1.00 36.99  ? 271 VAL A CG2   1 
ATOM   2229 N N     . GLU A 1 272 ? 18.410 43.548  23.713  1.00 41.48  ? 272 GLU A N     1 
ATOM   2230 C CA    . GLU A 1 272 ? 17.640 42.589  24.532  1.00 42.99  ? 272 GLU A CA    1 
ATOM   2231 C C     . GLU A 1 272 ? 16.645 41.707  23.754  1.00 42.66  ? 272 GLU A C     1 
ATOM   2232 O O     . GLU A 1 272 ? 16.344 40.602  24.190  1.00 42.79  ? 272 GLU A O     1 
ATOM   2233 C CB    . GLU A 1 272 ? 17.023 43.226  25.807  1.00 44.90  ? 272 GLU A CB    1 
ATOM   2234 C CG    . GLU A 1 272 ? 15.694 43.978  25.672  1.00 47.18  ? 272 GLU A CG    1 
ATOM   2235 C CD    . GLU A 1 272 ? 15.314 44.701  26.978  1.00 50.14  ? 272 GLU A CD    1 
ATOM   2236 O OE1   . GLU A 1 272 ? 16.232 45.146  27.722  1.00 52.52  ? 272 GLU A OE1   1 
ATOM   2237 O OE2   . GLU A 1 272 ? 14.099 44.832  27.270  1.00 53.69  ? 272 GLU A OE2   1 
ATOM   2238 N N     . GLU A 1 273 ? 16.160 42.180  22.610  1.00 42.54  ? 273 GLU A N     1 
ATOM   2239 C CA    . GLU A 1 273 ? 15.413 41.333  21.689  1.00 42.41  ? 273 GLU A CA    1 
ATOM   2240 C C     . GLU A 1 273 ? 16.237 40.142  21.215  1.00 40.16  ? 273 GLU A C     1 
ATOM   2241 O O     . GLU A 1 273 ? 15.735 39.002  21.137  1.00 40.36  ? 273 GLU A O     1 
ATOM   2242 C CB    . GLU A 1 273 ? 15.028 42.126  20.460  1.00 43.39  ? 273 GLU A CB    1 
ATOM   2243 C CG    . GLU A 1 273 ? 13.581 41.994  20.087  1.00 47.40  ? 273 GLU A CG    1 
ATOM   2244 C CD    . GLU A 1 273 ? 12.760 43.130  20.676  1.00 52.16  ? 273 GLU A CD    1 
ATOM   2245 O OE1   . GLU A 1 273 ? 13.061 43.572  21.822  1.00 53.16  ? 273 GLU A OE1   1 
ATOM   2246 O OE2   . GLU A 1 273 ? 11.824 43.587  19.982  1.00 54.37  ? 273 GLU A OE2   1 
ATOM   2247 N N     . ARG A 1 274 ? 17.497 40.416  20.875  1.00 37.69  ? 274 ARG A N     1 
ATOM   2248 C CA    . ARG A 1 274 ? 18.371 39.388  20.328  1.00 35.75  ? 274 ARG A CA    1 
ATOM   2249 C C     . ARG A 1 274 ? 18.810 38.502  21.472  1.00 34.82  ? 274 ARG A C     1 
ATOM   2250 O O     . ARG A 1 274 ? 19.103 37.328  21.275  1.00 33.95  ? 274 ARG A O     1 
ATOM   2251 C CB    . ARG A 1 274 ? 19.565 40.002  19.587  1.00 34.52  ? 274 ARG A CB    1 
ATOM   2252 C CG    . ARG A 1 274 ? 19.181 41.083  18.590  1.00 34.80  ? 274 ARG A CG    1 
ATOM   2253 C CD    . ARG A 1 274 ? 20.350 41.974  18.162  1.00 34.44  ? 274 ARG A CD    1 
ATOM   2254 N NE    . ARG A 1 274 ? 20.809 41.603  16.826  1.00 36.68  ? 274 ARG A NE    1 
ATOM   2255 C CZ    . ARG A 1 274 ? 21.706 40.656  16.578  1.00 34.74  ? 274 ARG A CZ    1 
ATOM   2256 N NH1   . ARG A 1 274 ? 22.247 40.001  17.585  1.00 34.98  ? 274 ARG A NH1   1 
ATOM   2257 N NH2   . ARG A 1 274 ? 22.058 40.366  15.334  1.00 32.10  ? 274 ARG A NH2   1 
ATOM   2258 N N     . GLY A 1 275 ? 18.826 39.100  22.665  1.00 34.91  ? 275 GLY A N     1 
ATOM   2259 C CA    . GLY A 1 275 ? 19.136 38.435  23.927  1.00 34.22  ? 275 GLY A CA    1 
ATOM   2260 C C     . GLY A 1 275 ? 20.585 38.044  24.054  1.00 32.62  ? 275 GLY A C     1 
ATOM   2261 O O     . GLY A 1 275 ? 20.883 36.952  24.518  1.00 33.16  ? 275 GLY A O     1 
ATOM   2262 N N     . THR A 1 276 ? 21.487 38.923  23.637  1.00 31.27  ? 276 THR A N     1 
ATOM   2263 C CA    . THR A 1 276 ? 22.896 38.561  23.466  1.00 29.84  ? 276 THR A CA    1 
ATOM   2264 C C     . THR A 1 276 ? 23.745 39.412  24.359  1.00 29.37  ? 276 THR A C     1 
ATOM   2265 O O     . THR A 1 276 ? 23.289 40.456  24.801  1.00 30.11  ? 276 THR A O     1 
ATOM   2266 C CB    . THR A 1 276 ? 23.389 38.901  22.060  1.00 28.97  ? 276 THR A CB    1 
ATOM   2267 O OG1   . THR A 1 276 ? 23.018 40.248  21.757  1.00 30.60  ? 276 THR A OG1   1 
ATOM   2268 C CG2   . THR A 1 276 ? 22.801 38.001  21.021  1.00 29.05  ? 276 THR A CG2   1 
ATOM   2269 N N     . ALA A 1 277 ? 24.987 38.993  24.600  1.00 28.26  ? 277 ALA A N     1 
ATOM   2270 C CA    . ALA A 1 277 ? 25.960 39.867  25.236  1.00 27.70  ? 277 ALA A CA    1 
ATOM   2271 C C     . ALA A 1 277 ? 26.695 40.639  24.160  1.00 26.90  ? 277 ALA A C     1 
ATOM   2272 O O     . ALA A 1 277 ? 27.185 40.047  23.177  1.00 25.91  ? 277 ALA A O     1 
ATOM   2273 C CB    . ALA A 1 277 ? 26.922 39.088  26.064  1.00 27.92  ? 277 ALA A CB    1 
ATOM   2274 N N     . VAL A 1 278 ? 26.724 41.966  24.323  1.00 27.03  ? 278 VAL A N     1 
ATOM   2275 C CA    . VAL A 1 278 ? 27.498 42.831  23.441  1.00 26.69  ? 278 VAL A CA    1 
ATOM   2276 C C     . VAL A 1 278 ? 28.430 43.715  24.260  1.00 27.14  ? 278 VAL A C     1 
ATOM   2277 O O     . VAL A 1 278 ? 28.015 44.302  25.261  1.00 28.59  ? 278 VAL A O     1 
ATOM   2278 C CB    . VAL A 1 278 ? 26.630 43.663  22.425  1.00 26.89  ? 278 VAL A CB    1 
ATOM   2279 C CG1   . VAL A 1 278 ? 25.278 43.019  22.178  1.00 26.14  ? 278 VAL A CG1   1 
ATOM   2280 C CG2   . VAL A 1 278 ? 26.511 45.165  22.834  1.00 28.42  ? 278 VAL A CG2   1 
ATOM   2281 N N     . PHE A 1 279 ? 29.691 43.794  23.833  1.00 26.19  ? 279 PHE A N     1 
ATOM   2282 C CA    . PHE A 1 279 ? 30.716 44.541  24.565  1.00 25.95  ? 279 PHE A CA    1 
ATOM   2283 C C     . PHE A 1 279 ? 31.882 44.877  23.667  1.00 25.38  ? 279 PHE A C     1 
ATOM   2284 O O     . PHE A 1 279 ? 32.109 44.226  22.649  1.00 24.73  ? 279 PHE A O     1 
ATOM   2285 C CB    . PHE A 1 279 ? 31.214 43.754  25.777  1.00 25.71  ? 279 PHE A CB    1 
ATOM   2286 C CG    . PHE A 1 279 ? 31.825 42.422  25.435  1.00 24.84  ? 279 PHE A CG    1 
ATOM   2287 C CD1   . PHE A 1 279 ? 33.201 42.284  25.313  1.00 23.21  ? 279 PHE A CD1   1 
ATOM   2288 C CD2   . PHE A 1 279 ? 31.022 41.293  25.245  1.00 23.70  ? 279 PHE A CD2   1 
ATOM   2289 C CE1   . PHE A 1 279 ? 33.758 41.047  25.005  1.00 21.25  ? 279 PHE A CE1   1 
ATOM   2290 C CE2   . PHE A 1 279 ? 31.586 40.054  24.950  1.00 21.68  ? 279 PHE A CE2   1 
ATOM   2291 C CZ    . PHE A 1 279 ? 32.946 39.937  24.829  1.00 21.44  ? 279 PHE A CZ    1 
ATOM   2292 N N     . ALA A 1 280 ? 32.591 45.933  24.031  1.00 26.36  ? 280 ALA A N     1 
ATOM   2293 C CA    . ALA A 1 280 ? 33.782 46.370  23.305  1.00 26.09  ? 280 ALA A CA    1 
ATOM   2294 C C     . ALA A 1 280 ? 34.954 46.282  24.257  1.00 26.57  ? 280 ALA A C     1 
ATOM   2295 O O     . ALA A 1 280 ? 34.771 46.361  25.489  1.00 27.82  ? 280 ALA A O     1 
ATOM   2296 C CB    . ALA A 1 280 ? 33.608 47.795  22.835  1.00 26.33  ? 280 ALA A CB    1 
ATOM   2297 N N     . VAL A 1 281 ? 36.155 46.108  23.725  1.00 25.72  ? 281 VAL A N     1 
ATOM   2298 C CA    . VAL A 1 281 ? 37.316 46.322  24.585  1.00 25.88  ? 281 VAL A CA    1 
ATOM   2299 C C     . VAL A 1 281 ? 37.938 47.632  24.120  1.00 26.65  ? 281 VAL A C     1 
ATOM   2300 O O     . VAL A 1 281 ? 38.303 47.775  22.957  1.00 26.73  ? 281 VAL A O     1 
ATOM   2301 C CB    . VAL A 1 281 ? 38.278 45.076  24.725  1.00 24.59  ? 281 VAL A CB    1 
ATOM   2302 C CG1   . VAL A 1 281 ? 37.649 43.827  24.165  1.00 23.42  ? 281 VAL A CG1   1 
ATOM   2303 C CG2   . VAL A 1 281 ? 39.615 45.299  24.145  1.00 23.62  ? 281 VAL A CG2   1 
ATOM   2304 N N     . LYS A 1 282 ? 37.974 48.604  25.013  1.00 27.50  ? 282 LYS A N     1 
ATOM   2305 C CA    . LYS A 1 282 ? 38.339 49.951  24.636  1.00 29.02  ? 282 LYS A CA    1 
ATOM   2306 C C     . LYS A 1 282 ? 39.748 50.241  25.132  1.00 30.21  ? 282 LYS A C     1 
ATOM   2307 O O     . LYS A 1 282 ? 40.104 49.876  26.259  1.00 31.83  ? 282 LYS A O     1 
ATOM   2308 C CB    . LYS A 1 282 ? 37.322 50.938  25.211  1.00 30.15  ? 282 LYS A CB    1 
ATOM   2309 C CG    . LYS A 1 282 ? 37.749 52.391  25.254  1.00 31.93  ? 282 LYS A CG    1 
ATOM   2310 C CD    . LYS A 1 282 ? 36.691 53.237  25.950  1.00 33.27  ? 282 LYS A CD    1 
ATOM   2311 C CE    . LYS A 1 282 ? 37.040 54.696  25.879  1.00 35.44  ? 282 LYS A CE    1 
ATOM   2312 N NZ    . LYS A 1 282 ? 35.859 55.551  26.172  1.00 39.04  ? 282 LYS A NZ    1 
ATOM   2313 N N     . PHE A 1 283 ? 40.550 50.877  24.282  1.00 29.92  ? 283 PHE A N     1 
ATOM   2314 C CA    . PHE A 1 283 ? 41.936 51.182  24.602  1.00 29.81  ? 283 PHE A CA    1 
ATOM   2315 C C     . PHE A 1 283 ? 42.426 52.345  23.781  1.00 30.44  ? 283 PHE A C     1 
ATOM   2316 O O     . PHE A 1 283 ? 41.941 52.596  22.688  1.00 30.04  ? 283 PHE A O     1 
ATOM   2317 C CB    . PHE A 1 283 ? 42.833 49.974  24.357  1.00 28.69  ? 283 PHE A CB    1 
ATOM   2318 C CG    . PHE A 1 283 ? 42.800 49.445  22.942  1.00 27.18  ? 283 PHE A CG    1 
ATOM   2319 C CD1   . PHE A 1 283 ? 43.750 49.843  22.010  1.00 27.81  ? 283 PHE A CD1   1 
ATOM   2320 C CD2   . PHE A 1 283 ? 41.854 48.503  22.554  1.00 26.56  ? 283 PHE A CD2   1 
ATOM   2321 C CE1   . PHE A 1 283 ? 43.742 49.330  20.712  1.00 25.93  ? 283 PHE A CE1   1 
ATOM   2322 C CE2   . PHE A 1 283 ? 41.838 47.989  21.247  1.00 24.42  ? 283 PHE A CE2   1 
ATOM   2323 C CZ    . PHE A 1 283 ? 42.782 48.404  20.335  1.00 24.68  ? 283 PHE A CZ    1 
ATOM   2324 N N     . ARG A 1 284 ? 43.400 53.043  24.334  1.00 31.69  ? 284 ARG A N     1 
ATOM   2325 C CA    . ARG A 1 284 ? 44.046 54.163  23.705  1.00 32.86  ? 284 ARG A CA    1 
ATOM   2326 C C     . ARG A 1 284 ? 44.540 53.782  22.297  1.00 31.08  ? 284 ARG A C     1 
ATOM   2327 O O     . ARG A 1 284 ? 44.967 52.635  22.065  1.00 29.28  ? 284 ARG A O     1 
ATOM   2328 C CB    . ARG A 1 284 ? 45.212 54.554  24.598  1.00 35.04  ? 284 ARG A CB    1 
ATOM   2329 C CG    . ARG A 1 284 ? 45.456 56.026  24.680  1.00 40.73  ? 284 ARG A CG    1 
ATOM   2330 C CD    . ARG A 1 284 ? 44.823 56.655  25.920  1.00 47.29  ? 284 ARG A CD    1 
ATOM   2331 N NE    . ARG A 1 284 ? 44.971 58.107  25.794  1.00 52.95  ? 284 ARG A NE    1 
ATOM   2332 C CZ    . ARG A 1 284 ? 44.008 59.016  25.968  1.00 55.49  ? 284 ARG A CZ    1 
ATOM   2333 N NH1   . ARG A 1 284 ? 42.775 58.667  26.329  1.00 54.43  ? 284 ARG A NH1   1 
ATOM   2334 N NH2   . ARG A 1 284 ? 44.303 60.305  25.812  1.00 58.45  ? 284 ARG A NH2   1 
ATOM   2335 N N     . LYS A 1 285 ? 44.450 54.727  21.355  1.00 30.62  ? 285 LYS A N     1 
ATOM   2336 C CA    . LYS A 1 285 ? 44.837 54.463  19.954  1.00 29.33  ? 285 LYS A CA    1 
ATOM   2337 C C     . LYS A 1 285 ? 46.328 54.692  19.702  1.00 29.76  ? 285 LYS A C     1 
ATOM   2338 O O     . LYS A 1 285 ? 46.821 55.797  19.909  1.00 32.17  ? 285 LYS A O     1 
ATOM   2339 C CB    . LYS A 1 285 ? 43.997 55.297  18.989  1.00 29.43  ? 285 LYS A CB    1 
ATOM   2340 C CG    . LYS A 1 285 ? 44.543 55.411  17.584  1.00 29.45  ? 285 LYS A CG    1 
ATOM   2341 C CD    . LYS A 1 285 ? 43.477 55.909  16.648  1.00 30.46  ? 285 LYS A CD    1 
ATOM   2342 C CE    . LYS A 1 285 ? 44.069 56.699  15.508  1.00 33.51  ? 285 LYS A CE    1 
ATOM   2343 N NZ    . LYS A 1 285 ? 43.928 58.152  15.778  1.00 38.55  ? 285 LYS A NZ    1 
ATOM   2344 N N     . PRO A 1 286 ? 47.052 53.649  19.264  1.00 28.03  ? 286 PRO A N     1 
ATOM   2345 C CA    . PRO A 1 286 ? 48.494 53.782  19.069  1.00 28.36  ? 286 PRO A CA    1 
ATOM   2346 C C     . PRO A 1 286 ? 48.717 54.775  17.959  1.00 28.92  ? 286 PRO A C     1 
ATOM   2347 O O     . PRO A 1 286 ? 48.003 54.724  16.960  1.00 27.90  ? 286 PRO A O     1 
ATOM   2348 C CB    . PRO A 1 286 ? 48.926 52.375  18.620  1.00 26.94  ? 286 PRO A CB    1 
ATOM   2349 C CG    . PRO A 1 286 ? 47.822 51.488  18.996  1.00 25.66  ? 286 PRO A CG    1 
ATOM   2350 C CD    . PRO A 1 286 ? 46.571 52.297  18.943  1.00 25.97  ? 286 PRO A CD    1 
ATOM   2351 N N     . ASP A 1 287 ? 49.675 55.683  18.130  1.00 30.67  ? 287 ASP A N     1 
ATOM   2352 C CA    . ASP A 1 287 ? 49.845 56.781  17.170  1.00 31.87  ? 287 ASP A CA    1 
ATOM   2353 C C     . ASP A 1 287 ? 50.706 56.364  15.971  1.00 31.81  ? 287 ASP A C     1 
ATOM   2354 O O     . ASP A 1 287 ? 51.926 56.568  15.947  1.00 33.20  ? 287 ASP A O     1 
ATOM   2355 C CB    . ASP A 1 287 ? 50.380 58.036  17.858  1.00 34.10  ? 287 ASP A CB    1 
ATOM   2356 C CG    . ASP A 1 287 ? 50.745 59.154  16.875  1.00 35.56  ? 287 ASP A CG    1 
ATOM   2357 O OD1   . ASP A 1 287 ? 50.176 59.238  15.759  1.00 34.84  ? 287 ASP A OD1   1 
ATOM   2358 O OD2   . ASP A 1 287 ? 51.628 59.955  17.239  1.00 38.33  ? 287 ASP A OD2   1 
ATOM   2359 N N     . ILE A 1 288 ? 50.034 55.792  14.976  1.00 30.23  ? 288 ILE A N     1 
ATOM   2360 C CA    . ILE A 1 288 ? 50.669 55.143  13.828  1.00 29.51  ? 288 ILE A CA    1 
ATOM   2361 C C     . ILE A 1 288 ? 49.759 55.288  12.621  1.00 29.08  ? 288 ILE A C     1 
ATOM   2362 O O     . ILE A 1 288 ? 48.590 55.680  12.753  1.00 28.36  ? 288 ILE A O     1 
ATOM   2363 C CB    . ILE A 1 288 ? 50.907 53.619  14.086  1.00 28.12  ? 288 ILE A CB    1 
ATOM   2364 C CG1   . ILE A 1 288 ? 49.590 52.847  14.186  1.00 25.47  ? 288 ILE A CG1   1 
ATOM   2365 C CG2   . ILE A 1 288 ? 51.720 53.403  15.339  1.00 27.88  ? 288 ILE A CG2   1 
ATOM   2366 C CD1   . ILE A 1 288 ? 49.778 51.377  14.524  1.00 24.81  ? 288 ILE A CD1   1 
ATOM   2367 N N     . VAL A 1 289 ? 50.277 54.961  11.444  1.00 29.42  ? 289 VAL A N     1 
ATOM   2368 C CA    . VAL A 1 289 ? 49.500 55.132  10.218  1.00 29.05  ? 289 VAL A CA    1 
ATOM   2369 C C     . VAL A 1 289 ? 48.413 54.053  10.086  1.00 27.89  ? 289 VAL A C     1 
ATOM   2370 O O     . VAL A 1 289 ? 48.549 52.927  10.582  1.00 26.91  ? 289 VAL A O     1 
ATOM   2371 C CB    . VAL A 1 289 ? 50.395 55.141  8.988   1.00 30.06  ? 289 VAL A CB    1 
ATOM   2372 C CG1   . VAL A 1 289 ? 51.405 56.278  9.068   1.00 31.32  ? 289 VAL A CG1   1 
ATOM   2373 C CG2   . VAL A 1 289 ? 51.101 53.797  8.829   1.00 29.09  ? 289 VAL A CG2   1 
ATOM   2374 N N     . ASP A 1 290 ? 47.322 54.414  9.427   1.00 28.26  ? 290 ASP A N     1 
ATOM   2375 C CA    . ASP A 1 290 ? 46.227 53.493  9.184   1.00 27.22  ? 290 ASP A CA    1 
ATOM   2376 C C     . ASP A 1 290 ? 46.685 52.140  8.706   1.00 26.22  ? 290 ASP A C     1 
ATOM   2377 O O     . ASP A 1 290 ? 46.208 51.146  9.195   1.00 25.76  ? 290 ASP A O     1 
ATOM   2378 C CB    . ASP A 1 290 ? 45.244 54.073  8.166   1.00 28.03  ? 290 ASP A CB    1 
ATOM   2379 C CG    . ASP A 1 290 ? 44.286 55.067  8.777   1.00 30.12  ? 290 ASP A CG    1 
ATOM   2380 O OD1   . ASP A 1 290 ? 44.304 55.215  10.014  1.00 32.42  ? 290 ASP A OD1   1 
ATOM   2381 O OD2   . ASP A 1 290 ? 43.502 55.692  8.021   1.00 34.73  ? 290 ASP A OD2   1 
ATOM   2382 N N     . ASP A 1 291 ? 47.606 52.099  7.754   1.00 27.03  ? 291 ASP A N     1 
ATOM   2383 C CA    . ASP A 1 291 ? 48.017 50.847  7.143   1.00 26.77  ? 291 ASP A CA    1 
ATOM   2384 C C     . ASP A 1 291 ? 48.759 49.922  8.103   1.00 26.51  ? 291 ASP A C     1 
ATOM   2385 O O     . ASP A 1 291 ? 48.816 48.698  7.911   1.00 26.79  ? 291 ASP A O     1 
ATOM   2386 C CB    . ASP A 1 291 ? 48.815 51.150  5.897   1.00 28.46  ? 291 ASP A CB    1 
ATOM   2387 C CG    . ASP A 1 291 ? 48.208 52.297  5.107   1.00 30.72  ? 291 ASP A CG    1 
ATOM   2388 O OD1   . ASP A 1 291 ? 48.682 53.428  5.325   1.00 33.89  ? 291 ASP A OD1   1 
ATOM   2389 O OD2   . ASP A 1 291 ? 47.230 52.095  4.335   1.00 29.81  ? 291 ASP A OD2   1 
ATOM   2390 N N     . ASN A 1 292 ? 49.286 50.490  9.174   1.00 26.85  ? 292 ASN A N     1 
ATOM   2391 C CA    . ASN A 1 292 ? 49.813 49.675  10.251  1.00 26.35  ? 292 ASN A CA    1 
ATOM   2392 C C     . ASN A 1 292 ? 48.704 49.321  11.218  1.00 24.99  ? 292 ASN A C     1 
ATOM   2393 O O     . ASN A 1 292 ? 48.579 48.167  11.623  1.00 24.21  ? 292 ASN A O     1 
ATOM   2394 C CB    . ASN A 1 292 ? 50.998 50.365  10.919  1.00 27.05  ? 292 ASN A CB    1 
ATOM   2395 C CG    . ASN A 1 292 ? 52.184 50.519  9.966   1.00 29.13  ? 292 ASN A CG    1 
ATOM   2396 O OD1   . ASN A 1 292 ? 52.308 49.772  8.996   1.00 28.81  ? 292 ASN A OD1   1 
ATOM   2397 N ND2   . ASN A 1 292 ? 53.066 51.483  10.244  1.00 31.25  ? 292 ASN A ND2   1 
ATOM   2398 N N     . LEU A 1 293 ? 47.869 50.307  11.538  1.00 25.34  ? 293 LEU A N     1 
ATOM   2399 C CA    . LEU A 1 293 ? 46.792 50.136  12.507  1.00 24.74  ? 293 LEU A CA    1 
ATOM   2400 C C     . LEU A 1 293 ? 45.822 49.013  12.194  1.00 24.05  ? 293 LEU A C     1 
ATOM   2401 O O     . LEU A 1 293 ? 45.557 48.179  13.058  1.00 23.87  ? 293 LEU A O     1 
ATOM   2402 C CB    . LEU A 1 293 ? 45.987 51.421  12.669  1.00 25.05  ? 293 LEU A CB    1 
ATOM   2403 C CG    . LEU A 1 293 ? 45.726 51.901  14.117  1.00 25.82  ? 293 LEU A CG    1 
ATOM   2404 C CD1   . LEU A 1 293 ? 44.746 53.090  14.143  1.00 25.43  ? 293 LEU A CD1   1 
ATOM   2405 C CD2   . LEU A 1 293 ? 45.313 50.797  15.114  1.00 21.21  ? 293 LEU A CD2   1 
ATOM   2406 N N     . TYR A 1 294 ? 45.295 48.991  10.972  1.00 24.42  ? 294 TYR A N     1 
ATOM   2407 C CA    . TYR A 1 294 ? 44.078 48.236  10.682  1.00 23.83  ? 294 TYR A CA    1 
ATOM   2408 C C     . TYR A 1 294 ? 44.224 46.744  10.665  1.00 23.50  ? 294 TYR A C     1 
ATOM   2409 O O     . TYR A 1 294 ? 43.347 46.073  11.180  1.00 22.55  ? 294 TYR A O     1 
ATOM   2410 C CB    . TYR A 1 294 ? 43.411 48.711  9.405   1.00 24.44  ? 294 TYR A CB    1 
ATOM   2411 C CG    . TYR A 1 294 ? 42.537 49.852  9.702   1.00 25.68  ? 294 TYR A CG    1 
ATOM   2412 C CD1   . TYR A 1 294 ? 43.060 51.154  9.723   1.00 29.10  ? 294 TYR A CD1   1 
ATOM   2413 C CD2   . TYR A 1 294 ? 41.212 49.659  10.040  1.00 24.63  ? 294 TYR A CD2   1 
ATOM   2414 C CE1   . TYR A 1 294 ? 42.273 52.250  10.037  1.00 29.17  ? 294 TYR A CE1   1 
ATOM   2415 C CE2   . TYR A 1 294 ? 40.400 50.749  10.359  1.00 28.12  ? 294 TYR A CE2   1 
ATOM   2416 C CZ    . TYR A 1 294 ? 40.943 52.053  10.350  1.00 28.38  ? 294 TYR A CZ    1 
ATOM   2417 O OH    . TYR A 1 294 ? 40.169 53.159  10.645  1.00 28.09  ? 294 TYR A OH    1 
ATOM   2418 N N     . PRO A 1 295 ? 45.298 46.228  10.033  1.00 24.36  ? 295 PRO A N     1 
ATOM   2419 C CA    . PRO A 1 295 ? 45.678 44.825  10.127  1.00 24.77  ? 295 PRO A CA    1 
ATOM   2420 C C     . PRO A 1 295 ? 45.784 44.350  11.563  1.00 24.11  ? 295 PRO A C     1 
ATOM   2421 O O     . PRO A 1 295 ? 45.413 43.211  11.872  1.00 23.16  ? 295 PRO A O     1 
ATOM   2422 C CB    . PRO A 1 295 ? 47.057 44.800  9.469   1.00 26.06  ? 295 PRO A CB    1 
ATOM   2423 C CG    . PRO A 1 295 ? 46.980 45.852  8.467   1.00 26.29  ? 295 PRO A CG    1 
ATOM   2424 C CD    . PRO A 1 295 ? 46.194 46.952  9.116   1.00 25.90  ? 295 PRO A CD    1 
ATOM   2425 N N     . GLN A 1 296 ? 46.273 45.233  12.422  1.00 24.38  ? 296 GLN A N     1 
ATOM   2426 C CA    . GLN A 1 296 ? 46.461 44.895  13.833  1.00 24.44  ? 296 GLN A CA    1 
ATOM   2427 C C     . GLN A 1 296 ? 45.124 44.831  14.539  1.00 24.22  ? 296 GLN A C     1 
ATOM   2428 O O     . GLN A 1 296 ? 44.923 43.955  15.400  1.00 24.09  ? 296 GLN A O     1 
ATOM   2429 C CB    . GLN A 1 296 ? 47.403 45.882  14.546  1.00 24.96  ? 296 GLN A CB    1 
ATOM   2430 C CG    . GLN A 1 296 ? 48.883 45.700  14.213  1.00 24.81  ? 296 GLN A CG    1 
ATOM   2431 C CD    . GLN A 1 296 ? 49.759 46.791  14.790  1.00 26.47  ? 296 GLN A CD    1 
ATOM   2432 O OE1   . GLN A 1 296 ? 49.679 47.107  15.984  1.00 26.73  ? 296 GLN A OE1   1 
ATOM   2433 N NE2   . GLN A 1 296 ? 50.623 47.354  13.957  1.00 24.20  ? 296 GLN A NE2   1 
ATOM   2434 N N     . LEU A 1 297 ? 44.218 45.754  14.189  1.00 24.28  ? 297 LEU A N     1 
ATOM   2435 C CA    . LEU A 1 297 ? 42.865 45.730  14.752  1.00 23.74  ? 297 LEU A CA    1 
ATOM   2436 C C     . LEU A 1 297 ? 42.147 44.445  14.327  1.00 23.68  ? 297 LEU A C     1 
ATOM   2437 O O     . LEU A 1 297 ? 41.482 43.799  15.139  1.00 23.29  ? 297 LEU A O     1 
ATOM   2438 C CB    . LEU A 1 297 ? 42.071 46.980  14.378  1.00 22.95  ? 297 LEU A CB    1 
ATOM   2439 C CG    . LEU A 1 297 ? 42.551 48.265  15.058  1.00 23.63  ? 297 LEU A CG    1 
ATOM   2440 C CD1   . LEU A 1 297 ? 41.851 49.532  14.527  1.00 22.66  ? 297 LEU A CD1   1 
ATOM   2441 C CD2   . LEU A 1 297 ? 42.443 48.213  16.582  1.00 23.83  ? 297 LEU A CD2   1 
ATOM   2442 N N     . GLU A 1 298 ? 42.321 44.082  13.060  1.00 24.66  ? 298 GLU A N     1 
ATOM   2443 C CA    . GLU A 1 298 ? 41.858 42.823  12.513  1.00 25.79  ? 298 GLU A CA    1 
ATOM   2444 C C     . GLU A 1 298 ? 42.485 41.696  13.287  1.00 25.59  ? 298 GLU A C     1 
ATOM   2445 O O     . GLU A 1 298 ? 41.806 40.744  13.633  1.00 25.41  ? 298 GLU A O     1 
ATOM   2446 C CB    . GLU A 1 298 ? 42.243 42.691  11.034  1.00 26.16  ? 298 GLU A CB    1 
ATOM   2447 C CG    . GLU A 1 298 ? 41.203 43.184  10.045  1.00 27.69  ? 298 GLU A CG    1 
ATOM   2448 C CD    . GLU A 1 298 ? 41.681 43.197  8.566   1.00 30.96  ? 298 GLU A CD    1 
ATOM   2449 O OE1   . GLU A 1 298 ? 42.912 43.088  8.275   1.00 35.53  ? 298 GLU A OE1   1 
ATOM   2450 O OE2   . GLU A 1 298 ? 40.802 43.329  7.668   1.00 36.52  ? 298 GLU A OE2   1 
ATOM   2451 N N     . ARG A 1 299 ? 43.781 41.794  13.567  1.00 26.80  ? 299 ARG A N     1 
ATOM   2452 C CA    . ARG A 1 299 ? 44.431 40.726  14.305  1.00 27.67  ? 299 ARG A CA    1 
ATOM   2453 C C     . ARG A 1 299 ? 43.780 40.595  15.694  1.00 28.05  ? 299 ARG A C     1 
ATOM   2454 O O     . ARG A 1 299 ? 43.386 39.500  16.117  1.00 28.70  ? 299 ARG A O     1 
ATOM   2455 C CB    . ARG A 1 299 ? 45.957 40.895  14.392  1.00 27.92  ? 299 ARG A CB    1 
ATOM   2456 C CG    . ARG A 1 299 ? 46.551 39.950  15.461  1.00 28.60  ? 299 ARG A CG    1 
ATOM   2457 C CD    . ARG A 1 299 ? 48.015 39.657  15.361  1.00 28.71  ? 299 ARG A CD    1 
ATOM   2458 N NE    . ARG A 1 299 ? 48.209 38.315  14.839  1.00 30.90  ? 299 ARG A NE    1 
ATOM   2459 C CZ    . ARG A 1 299 ? 48.565 37.253  15.557  1.00 31.59  ? 299 ARG A CZ    1 
ATOM   2460 N NH1   . ARG A 1 299 ? 48.789 37.341  16.863  1.00 30.18  ? 299 ARG A NH1   1 
ATOM   2461 N NH2   . ARG A 1 299 ? 48.705 36.085  14.951  1.00 32.42  ? 299 ARG A NH2   1 
ATOM   2462 N N     . ALA A 1 300 ? 43.642 41.716  16.388  1.00 28.52  ? 300 ALA A N     1 
ATOM   2463 C CA    . ALA A 1 300 ? 43.044 41.714  17.715  1.00 28.85  ? 300 ALA A CA    1 
ATOM   2464 C C     . ALA A 1 300 ? 41.668 41.058  17.672  1.00 28.47  ? 300 ALA A C     1 
ATOM   2465 O O     . ALA A 1 300 ? 41.361 40.193  18.511  1.00 28.96  ? 300 ALA A O     1 
ATOM   2466 C CB    . ALA A 1 300 ? 42.946 43.143  18.259  1.00 28.86  ? 300 ALA A CB    1 
ATOM   2467 N N     . SER A 1 301 ? 40.859 41.455  16.686  1.00 27.93  ? 301 SER A N     1 
ATOM   2468 C CA    . SER A 1 301 ? 39.481 41.001  16.604  1.00 27.77  ? 301 SER A CA    1 
ATOM   2469 C C     . SER A 1 301 ? 39.459 39.516  16.538  1.00 27.57  ? 301 SER A C     1 
ATOM   2470 O O     . SER A 1 301 ? 38.834 38.865  17.352  1.00 28.06  ? 301 SER A O     1 
ATOM   2471 C CB    . SER A 1 301 ? 38.772 41.563  15.379  1.00 27.75  ? 301 SER A CB    1 
ATOM   2472 O OG    . SER A 1 301 ? 38.214 42.805  15.713  1.00 29.03  ? 301 SER A OG    1 
ATOM   2473 N N     . ARG A 1 302 ? 40.182 38.991  15.567  1.00 27.97  ? 302 ARG A N     1 
ATOM   2474 C CA    . ARG A 1 302 ? 40.233 37.581  15.321  1.00 27.79  ? 302 ARG A CA    1 
ATOM   2475 C C     . ARG A 1 302 ? 40.695 36.879  16.584  1.00 27.85  ? 302 ARG A C     1 
ATOM   2476 O O     . ARG A 1 302 ? 40.082 35.906  17.030  1.00 28.26  ? 302 ARG A O     1 
ATOM   2477 C CB    . ARG A 1 302 ? 41.196 37.297  14.169  1.00 28.39  ? 302 ARG A CB    1 
ATOM   2478 C CG    . ARG A 1 302 ? 40.912 35.994  13.440  1.00 28.89  ? 302 ARG A CG    1 
ATOM   2479 C CD    . ARG A 1 302 ? 42.013 35.668  12.447  1.00 30.27  ? 302 ARG A CD    1 
ATOM   2480 N NE    . ARG A 1 302 ? 43.205 35.190  13.146  1.00 32.26  ? 302 ARG A NE    1 
ATOM   2481 C CZ    . ARG A 1 302 ? 44.411 35.746  13.056  1.00 33.73  ? 302 ARG A CZ    1 
ATOM   2482 N NH1   . ARG A 1 302 ? 44.624 36.814  12.264  1.00 34.98  ? 302 ARG A NH1   1 
ATOM   2483 N NH2   . ARG A 1 302 ? 45.412 35.221  13.752  1.00 33.13  ? 302 ARG A NH2   1 
ATOM   2484 N N     . LYS A 1 303 ? 41.775 37.378  17.169  1.00 27.46  ? 303 LYS A N     1 
ATOM   2485 C CA    . LYS A 1 303 ? 42.422 36.634  18.236  1.00 27.47  ? 303 LYS A CA    1 
ATOM   2486 C C     . LYS A 1 303 ? 41.486 36.414  19.414  1.00 26.72  ? 303 LYS A C     1 
ATOM   2487 O O     . LYS A 1 303 ? 41.414 35.287  19.972  1.00 26.83  ? 303 LYS A O     1 
ATOM   2488 C CB    . LYS A 1 303 ? 43.722 37.315  18.665  1.00 28.00  ? 303 LYS A CB    1 
ATOM   2489 C CG    . LYS A 1 303 ? 44.886 37.060  17.719  1.00 27.58  ? 303 LYS A CG    1 
ATOM   2490 C CD    . LYS A 1 303 ? 44.929 35.613  17.252  1.00 28.06  ? 303 LYS A CD    1 
ATOM   2491 C CE    . LYS A 1 303 ? 45.198 34.674  18.409  1.00 28.80  ? 303 LYS A CE    1 
ATOM   2492 N NZ    . LYS A 1 303 ? 46.213 33.658  18.043  1.00 31.75  ? 303 LYS A NZ    1 
ATOM   2493 N N     . ILE A 1 304 ? 40.762 37.487  19.753  1.00 24.94  ? 304 ILE A N     1 
ATOM   2494 C CA    . ILE A 1 304 ? 39.805 37.459  20.833  1.00 24.33  ? 304 ILE A CA    1 
ATOM   2495 C C     . ILE A 1 304 ? 38.618 36.645  20.387  1.00 24.44  ? 304 ILE A C     1 
ATOM   2496 O O     . ILE A 1 304 ? 38.060 35.841  21.149  1.00 24.30  ? 304 ILE A O     1 
ATOM   2497 C CB    . ILE A 1 304 ? 39.351 38.863  21.216  1.00 23.93  ? 304 ILE A CB    1 
ATOM   2498 C CG1   . ILE A 1 304 ? 40.521 39.663  21.784  1.00 23.40  ? 304 ILE A CG1   1 
ATOM   2499 C CG2   . ILE A 1 304 ? 38.251 38.797  22.262  1.00 22.86  ? 304 ILE A CG2   1 
ATOM   2500 C CD1   . ILE A 1 304 ? 40.200 41.115  22.031  1.00 21.90  ? 304 ILE A CD1   1 
ATOM   2501 N N     . PHE A 1 305 ? 38.244 36.850  19.129  1.00 24.64  ? 305 PHE A N     1 
ATOM   2502 C CA    . PHE A 1 305 ? 37.098 36.157  18.566  1.00 25.05  ? 305 PHE A CA    1 
ATOM   2503 C C     . PHE A 1 305 ? 37.311 34.667  18.775  1.00 26.19  ? 305 PHE A C     1 
ATOM   2504 O O     . PHE A 1 305 ? 36.435 34.003  19.288  1.00 27.14  ? 305 PHE A O     1 
ATOM   2505 C CB    . PHE A 1 305 ? 36.882 36.502  17.082  1.00 24.11  ? 305 PHE A CB    1 
ATOM   2506 C CG    . PHE A 1 305 ? 35.554 36.036  16.529  1.00 24.03  ? 305 PHE A CG    1 
ATOM   2507 C CD1   . PHE A 1 305 ? 34.428 36.855  16.598  1.00 23.41  ? 305 PHE A CD1   1 
ATOM   2508 C CD2   . PHE A 1 305 ? 35.426 34.779  15.932  1.00 22.54  ? 305 PHE A CD2   1 
ATOM   2509 C CE1   . PHE A 1 305 ? 33.187 36.406  16.075  1.00 23.54  ? 305 PHE A CE1   1 
ATOM   2510 C CE2   . PHE A 1 305 ? 34.200 34.338  15.407  1.00 20.80  ? 305 PHE A CE2   1 
ATOM   2511 C CZ    . PHE A 1 305 ? 33.085 35.136  15.486  1.00 21.04  ? 305 PHE A CZ    1 
ATOM   2512 N N     . GLU A 1 306 ? 38.490 34.161  18.427  1.00 27.31  ? 306 GLU A N     1 
ATOM   2513 C CA    . GLU A 1 306 ? 38.735 32.730  18.469  1.00 29.05  ? 306 GLU A CA    1 
ATOM   2514 C C     . GLU A 1 306 ? 38.762 32.234  19.901  1.00 29.82  ? 306 GLU A C     1 
ATOM   2515 O O     . GLU A 1 306 ? 38.428 31.081  20.175  1.00 31.01  ? 306 GLU A O     1 
ATOM   2516 C CB    . GLU A 1 306 ? 40.013 32.370  17.723  1.00 29.33  ? 306 GLU A CB    1 
ATOM   2517 C CG    . GLU A 1 306 ? 39.878 32.499  16.200  1.00 30.28  ? 306 GLU A CG    1 
ATOM   2518 C CD    . GLU A 1 306 ? 41.231 32.508  15.469  1.00 32.30  ? 306 GLU A CD    1 
ATOM   2519 O OE1   . GLU A 1 306 ? 42.295 32.438  16.154  1.00 35.42  ? 306 GLU A OE1   1 
ATOM   2520 O OE2   . GLU A 1 306 ? 41.233 32.604  14.211  1.00 33.00  ? 306 GLU A OE2   1 
ATOM   2521 N N     . PHE A 1 307 ? 39.148 33.115  20.820  1.00 29.80  ? 307 PHE A N     1 
ATOM   2522 C CA    . PHE A 1 307 ? 39.096 32.787  22.238  1.00 30.13  ? 307 PHE A CA    1 
ATOM   2523 C C     . PHE A 1 307 ? 37.652 32.607  22.657  1.00 29.94  ? 307 PHE A C     1 
ATOM   2524 O O     . PHE A 1 307 ? 37.282 31.578  23.229  1.00 30.48  ? 307 PHE A O     1 
ATOM   2525 C CB    . PHE A 1 307 ? 39.724 33.905  23.056  1.00 29.75  ? 307 PHE A CB    1 
ATOM   2526 C CG    . PHE A 1 307 ? 39.420 33.832  24.513  1.00 29.20  ? 307 PHE A CG    1 
ATOM   2527 C CD1   . PHE A 1 307 ? 40.257 33.135  25.370  1.00 30.68  ? 307 PHE A CD1   1 
ATOM   2528 C CD2   . PHE A 1 307 ? 38.311 34.478  25.037  1.00 29.08  ? 307 PHE A CD2   1 
ATOM   2529 C CE1   . PHE A 1 307 ? 39.999 33.081  26.743  1.00 31.39  ? 307 PHE A CE1   1 
ATOM   2530 C CE2   . PHE A 1 307 ? 38.031 34.425  26.408  1.00 30.45  ? 307 PHE A CE2   1 
ATOM   2531 C CZ    . PHE A 1 307 ? 38.885 33.726  27.263  1.00 30.77  ? 307 PHE A CZ    1 
ATOM   2532 N N     . LEU A 1 308 ? 36.844 33.626  22.381  1.00 29.16  ? 308 LEU A N     1 
ATOM   2533 C CA    . LEU A 1 308 ? 35.434 33.564  22.699  1.00 29.55  ? 308 LEU A CA    1 
ATOM   2534 C C     . LEU A 1 308 ? 34.797 32.283  22.154  1.00 30.50  ? 308 LEU A C     1 
ATOM   2535 O O     . LEU A 1 308 ? 33.987 31.650  22.856  1.00 31.11  ? 308 LEU A O     1 
ATOM   2536 C CB    . LEU A 1 308 ? 34.705 34.795  22.186  1.00 28.52  ? 308 LEU A CB    1 
ATOM   2537 C CG    . LEU A 1 308 ? 34.940 36.070  23.000  1.00 28.69  ? 308 LEU A CG    1 
ATOM   2538 C CD1   . LEU A 1 308 ? 34.378 37.300  22.287  1.00 27.19  ? 308 LEU A CD1   1 
ATOM   2539 C CD2   . LEU A 1 308 ? 34.360 35.963  24.390  1.00 29.35  ? 308 LEU A CD2   1 
ATOM   2540 N N     . GLU A 1 309 ? 35.172 31.889  20.934  1.00 30.61  ? 309 GLU A N     1 
ATOM   2541 C CA    . GLU A 1 309 ? 34.604 30.675  20.367  1.00 32.69  ? 309 GLU A CA    1 
ATOM   2542 C C     . GLU A 1 309 ? 35.069 29.422  21.081  1.00 32.51  ? 309 GLU A C     1 
ATOM   2543 O O     . GLU A 1 309 ? 34.241 28.624  21.446  1.00 33.81  ? 309 GLU A O     1 
ATOM   2544 C CB    . GLU A 1 309 ? 34.677 30.561  18.816  1.00 32.74  ? 309 GLU A CB    1 
ATOM   2545 C CG    . GLU A 1 309 ? 35.871 31.217  18.090  1.00 34.80  ? 309 GLU A CG    1 
ATOM   2546 C CD    . GLU A 1 309 ? 35.963 30.871  16.556  1.00 36.35  ? 309 GLU A CD    1 
ATOM   2547 O OE1   . GLU A 1 309 ? 36.950 30.189  16.141  1.00 41.30  ? 309 GLU A OE1   1 
ATOM   2548 O OE2   . GLU A 1 309 ? 35.060 31.277  15.768  1.00 39.73  ? 309 GLU A OE2   1 
ATOM   2549 N N     . ARG A 1 310 ? 36.359 29.273  21.337  1.00 32.11  ? 310 ARG A N     1 
ATOM   2550 C CA    . ARG A 1 310 ? 36.841 28.060  21.987  1.00 33.09  ? 310 ARG A CA    1 
ATOM   2551 C C     . ARG A 1 310 ? 36.462 27.917  23.469  1.00 33.60  ? 310 ARG A C     1 
ATOM   2552 O O     . ARG A 1 310 ? 36.539 26.818  24.054  1.00 35.04  ? 310 ARG A O     1 
ATOM   2553 C CB    . ARG A 1 310 ? 38.341 27.856  21.767  1.00 33.84  ? 310 ARG A CB    1 
ATOM   2554 C CG    . ARG A 1 310 ? 39.248 28.692  22.600  1.00 33.20  ? 310 ARG A CG    1 
ATOM   2555 C CD    . ARG A 1 310 ? 40.693 28.344  22.284  1.00 35.91  ? 310 ARG A CD    1 
ATOM   2556 N NE    . ARG A 1 310 ? 41.590 29.270  22.962  1.00 37.38  ? 310 ARG A NE    1 
ATOM   2557 C CZ    . ARG A 1 310 ? 42.091 30.379  22.424  1.00 36.97  ? 310 ARG A CZ    1 
ATOM   2558 N NH1   . ARG A 1 310 ? 41.816 30.690  21.165  1.00 35.53  ? 310 ARG A NH1   1 
ATOM   2559 N NH2   . ARG A 1 310 ? 42.877 31.175  23.154  1.00 38.21  ? 310 ARG A NH2   1 
ATOM   2560 N N     . GLU A 1 311 ? 36.042 29.022  24.074  1.00 32.29  ? 311 GLU A N     1 
ATOM   2561 C CA    . GLU A 1 311 ? 35.554 28.990  25.442  1.00 31.96  ? 311 GLU A CA    1 
ATOM   2562 C C     . GLU A 1 311 ? 34.044 28.854  25.434  1.00 30.89  ? 311 GLU A C     1 
ATOM   2563 O O     . GLU A 1 311 ? 33.412 28.946  26.488  1.00 31.92  ? 311 GLU A O     1 
ATOM   2564 C CB    . GLU A 1 311 ? 35.976 30.251  26.207  1.00 31.77  ? 311 GLU A CB    1 
ATOM   2565 C CG    . GLU A 1 311 ? 37.479 30.459  26.344  1.00 32.78  ? 311 GLU A CG    1 
ATOM   2566 C CD    . GLU A 1 311 ? 38.175 29.416  27.208  1.00 36.08  ? 311 GLU A CD    1 
ATOM   2567 O OE1   . GLU A 1 311 ? 39.424 29.351  27.141  1.00 38.37  ? 311 GLU A OE1   1 
ATOM   2568 O OE2   . GLU A 1 311 ? 37.498 28.680  27.958  1.00 36.32  ? 311 GLU A OE2   1 
ATOM   2569 N N     . ASN A 1 312 ? 33.478 28.662  24.245  1.00 28.87  ? 312 ASN A N     1 
ATOM   2570 C CA    . ASN A 1 312 ? 32.054 28.380  24.053  1.00 28.00  ? 312 ASN A CA    1 
ATOM   2571 C C     . ASN A 1 312 ? 31.070 29.493  24.330  1.00 26.85  ? 312 ASN A C     1 
ATOM   2572 O O     . ASN A 1 312 ? 29.921 29.243  24.693  1.00 26.26  ? 312 ASN A O     1 
ATOM   2573 C CB    . ASN A 1 312 ? 31.659 27.134  24.826  1.00 29.47  ? 312 ASN A CB    1 
ATOM   2574 C CG    . ASN A 1 312 ? 32.342 25.918  24.301  1.00 29.80  ? 312 ASN A CG    1 
ATOM   2575 O OD1   . ASN A 1 312 ? 33.285 25.410  24.910  1.00 29.52  ? 312 ASN A OD1   1 
ATOM   2576 N ND2   . ASN A 1 312 ? 31.908 25.464  23.133  1.00 28.19  ? 312 ASN A ND2   1 
ATOM   2577 N N     . PHE A 1 313 ? 31.516 30.724  24.127  1.00 26.19  ? 313 PHE A N     1 
ATOM   2578 C CA    . PHE A 1 313 ? 30.631 31.858  24.277  1.00 26.01  ? 313 PHE A CA    1 
ATOM   2579 C C     . PHE A 1 313 ? 29.874 32.094  22.988  1.00 26.58  ? 313 PHE A C     1 
ATOM   2580 O O     . PHE A 1 313 ? 28.976 32.938  22.921  1.00 26.12  ? 313 PHE A O     1 
ATOM   2581 C CB    . PHE A 1 313 ? 31.403 33.068  24.767  1.00 24.85  ? 313 PHE A CB    1 
ATOM   2582 C CG    . PHE A 1 313 ? 31.859 32.926  26.184  1.00 25.62  ? 313 PHE A CG    1 
ATOM   2583 C CD1   . PHE A 1 313 ? 30.937 32.951  27.231  1.00 25.32  ? 313 PHE A CD1   1 
ATOM   2584 C CD2   . PHE A 1 313 ? 33.194 32.717  26.480  1.00 25.27  ? 313 PHE A CD2   1 
ATOM   2585 C CE1   . PHE A 1 313 ? 31.339 32.800  28.541  1.00 25.19  ? 313 PHE A CE1   1 
ATOM   2586 C CE2   . PHE A 1 313 ? 33.603 32.561  27.788  1.00 25.69  ? 313 PHE A CE2   1 
ATOM   2587 C CZ    . PHE A 1 313 ? 32.675 32.603  28.821  1.00 26.60  ? 313 PHE A CZ    1 
ATOM   2588 N N     . MET A 1 314 ? 30.217 31.280  21.986  1.00 28.36  ? 314 MET A N     1 
ATOM   2589 C CA    . MET A 1 314 ? 29.569 31.268  20.684  1.00 29.42  ? 314 MET A CA    1 
ATOM   2590 C C     . MET A 1 314 ? 29.381 32.673  20.176  1.00 28.91  ? 314 MET A C     1 
ATOM   2591 O O     . MET A 1 314 ? 28.237 33.175  20.165  1.00 29.55  ? 314 MET A O     1 
ATOM   2592 C CB    . MET A 1 314 ? 28.198 30.600  20.742  1.00 30.14  ? 314 MET A CB    1 
ATOM   2593 C CG    . MET A 1 314 ? 28.088 29.419  21.643  1.00 31.63  ? 314 MET A CG    1 
ATOM   2594 S SD    . MET A 1 314 ? 26.560 28.560  21.238  1.00 34.38  ? 314 MET A SD    1 
ATOM   2595 C CE    . MET A 1 314 ? 26.486 27.410  22.589  1.00 34.53  ? 314 MET A CE    1 
ATOM   2596 N N     . PRO A 1 315 ? 30.482 33.319  19.730  1.00 28.71  ? 315 PRO A N     1 
ATOM   2597 C CA    . PRO A 1 315 ? 30.308 34.683  19.257  1.00 27.99  ? 315 PRO A CA    1 
ATOM   2598 C C     . PRO A 1 315 ? 29.688 34.688  17.843  1.00 28.41  ? 315 PRO A C     1 
ATOM   2599 O O     . PRO A 1 315 ? 30.021 33.858  16.986  1.00 28.51  ? 315 PRO A O     1 
ATOM   2600 C CB    . PRO A 1 315 ? 31.732 35.237  19.268  1.00 27.53  ? 315 PRO A CB    1 
ATOM   2601 C CG    . PRO A 1 315 ? 32.602 34.051  19.024  1.00 27.74  ? 315 PRO A CG    1 
ATOM   2602 C CD    . PRO A 1 315 ? 31.874 32.850  19.565  1.00 28.69  ? 315 PRO A CD    1 
ATOM   2603 N N     . LEU A 1 316 ? 28.760 35.610  17.637  1.00 28.51  ? 316 LEU A N     1 
ATOM   2604 C CA    . LEU A 1 316 ? 28.117 35.802  16.376  1.00 28.50  ? 316 LEU A CA    1 
ATOM   2605 C C     . LEU A 1 316 ? 29.027 36.536  15.431  1.00 28.06  ? 316 LEU A C     1 
ATOM   2606 O O     . LEU A 1 316 ? 29.377 36.017  14.391  1.00 29.84  ? 316 LEU A O     1 
ATOM   2607 C CB    . LEU A 1 316 ? 26.856 36.624  16.595  1.00 29.24  ? 316 LEU A CB    1 
ATOM   2608 C CG    . LEU A 1 316 ? 25.492 35.939  16.752  1.00 31.10  ? 316 LEU A CG    1 
ATOM   2609 C CD1   . LEU A 1 316 ? 25.597 34.443  16.832  1.00 31.35  ? 316 LEU A CD1   1 
ATOM   2610 C CD2   . LEU A 1 316 ? 24.823 36.481  18.005  1.00 32.85  ? 316 LEU A CD2   1 
ATOM   2611 N N     . ARG A 1 317 ? 29.396 37.757  15.773  1.00 27.19  ? 317 ARG A N     1 
ATOM   2612 C CA    . ARG A 1 317 ? 30.106 38.640  14.850  1.00 26.26  ? 317 ARG A CA    1 
ATOM   2613 C C     . ARG A 1 317 ? 31.030 39.552  15.617  1.00 26.03  ? 317 ARG A C     1 
ATOM   2614 O O     . ARG A 1 317 ? 30.800 39.804  16.787  1.00 25.71  ? 317 ARG A O     1 
ATOM   2615 C CB    . ARG A 1 317 ? 29.121 39.484  14.066  1.00 25.60  ? 317 ARG A CB    1 
ATOM   2616 C CG    . ARG A 1 317 ? 28.719 38.861  12.781  1.00 25.66  ? 317 ARG A CG    1 
ATOM   2617 C CD    . ARG A 1 317 ? 27.914 39.776  11.907  1.00 22.83  ? 317 ARG A CD    1 
ATOM   2618 N NE    . ARG A 1 317 ? 28.571 40.020  10.631  1.00 24.85  ? 317 ARG A NE    1 
ATOM   2619 C CZ    . ARG A 1 317 ? 28.356 41.104  9.886   1.00 25.81  ? 317 ARG A CZ    1 
ATOM   2620 N NH1   . ARG A 1 317 ? 27.501 42.042  10.305  1.00 25.92  ? 317 ARG A NH1   1 
ATOM   2621 N NH2   . ARG A 1 317 ? 28.992 41.257  8.733   1.00 23.91  ? 317 ARG A NH2   1 
ATOM   2622 N N     . SER A 1 318 ? 32.077 40.037  14.958  1.00 26.27  ? 318 SER A N     1 
ATOM   2623 C CA    . SER A 1 318 ? 32.975 41.017  15.567  1.00 26.76  ? 318 SER A CA    1 
ATOM   2624 C C     . SER A 1 318 ? 33.127 42.217  14.670  1.00 26.57  ? 318 SER A C     1 
ATOM   2625 O O     . SER A 1 318 ? 32.930 42.113  13.463  1.00 27.31  ? 318 SER A O     1 
ATOM   2626 C CB    . SER A 1 318 ? 34.351 40.415  15.839  1.00 26.82  ? 318 SER A CB    1 
ATOM   2627 O OG    . SER A 1 318 ? 35.002 40.044  14.624  1.00 29.18  ? 318 SER A OG    1 
ATOM   2628 N N     . ALA A 1 319 ? 33.503 43.345  15.260  1.00 26.12  ? 319 ALA A N     1 
ATOM   2629 C CA    . ALA A 1 319 ? 33.726 44.578  14.519  1.00 25.88  ? 319 ALA A CA    1 
ATOM   2630 C C     . ALA A 1 319 ? 34.783 45.397  15.225  1.00 26.30  ? 319 ALA A C     1 
ATOM   2631 O O     . ALA A 1 319 ? 35.164 45.083  16.334  1.00 26.04  ? 319 ALA A O     1 
ATOM   2632 C CB    . ALA A 1 319 ? 32.454 45.345  14.428  1.00 26.01  ? 319 ALA A CB    1 
ATOM   2633 N N     . PHE A 1 320 ? 35.274 46.450  14.598  1.00 27.80  ? 320 PHE A N     1 
ATOM   2634 C CA    . PHE A 1 320 ? 36.228 47.307  15.292  1.00 29.12  ? 320 PHE A CA    1 
ATOM   2635 C C     . PHE A 1 320 ? 36.160 48.718  14.787  1.00 30.67  ? 320 PHE A C     1 
ATOM   2636 O O     . PHE A 1 320 ? 35.833 48.928  13.628  1.00 31.33  ? 320 PHE A O     1 
ATOM   2637 C CB    . PHE A 1 320 ? 37.667 46.763  15.194  1.00 28.49  ? 320 PHE A CB    1 
ATOM   2638 C CG    . PHE A 1 320 ? 38.161 46.582  13.793  1.00 27.93  ? 320 PHE A CG    1 
ATOM   2639 C CD1   . PHE A 1 320 ? 38.515 47.670  13.016  1.00 27.63  ? 320 PHE A CD1   1 
ATOM   2640 C CD2   . PHE A 1 320 ? 38.295 45.309  13.253  1.00 28.22  ? 320 PHE A CD2   1 
ATOM   2641 C CE1   . PHE A 1 320 ? 38.973 47.504  11.713  1.00 27.43  ? 320 PHE A CE1   1 
ATOM   2642 C CE2   . PHE A 1 320 ? 38.770 45.128  11.947  1.00 27.69  ? 320 PHE A CE2   1 
ATOM   2643 C CZ    . PHE A 1 320 ? 39.119 46.237  11.184  1.00 27.42  ? 320 PHE A CZ    1 
ATOM   2644 N N     . LYS A 1 321 ? 36.480 49.676  15.654  1.00 32.21  ? 321 LYS A N     1 
ATOM   2645 C CA    . LYS A 1 321 ? 36.464 51.093  15.288  1.00 34.27  ? 321 LYS A CA    1 
ATOM   2646 C C     . LYS A 1 321 ? 37.698 51.814  15.791  1.00 35.27  ? 321 LYS A C     1 
ATOM   2647 O O     . LYS A 1 321 ? 38.055 51.655  16.949  1.00 36.04  ? 321 LYS A O     1 
ATOM   2648 C CB    . LYS A 1 321 ? 35.252 51.801  15.903  1.00 34.88  ? 321 LYS A CB    1 
ATOM   2649 C CG    . LYS A 1 321 ? 34.701 52.895  15.000  1.00 38.10  ? 321 LYS A CG    1 
ATOM   2650 C CD    . LYS A 1 321 ? 34.662 54.282  15.585  1.00 40.47  ? 321 LYS A CD    1 
ATOM   2651 C CE    . LYS A 1 321 ? 34.151 55.221  14.487  1.00 45.08  ? 321 LYS A CE    1 
ATOM   2652 N NZ    . LYS A 1 321 ? 34.038 56.690  14.863  1.00 49.46  ? 321 LYS A NZ    1 
ATOM   2653 N N     . ALA A 1 322 ? 38.332 52.623  14.945  1.00 36.42  ? 322 ALA A N     1 
ATOM   2654 C CA    . ALA A 1 322 ? 39.326 53.607  15.407  1.00 37.64  ? 322 ALA A CA    1 
ATOM   2655 C C     . ALA A 1 322 ? 38.677 54.975  15.460  1.00 39.24  ? 322 ALA A C     1 
ATOM   2656 O O     . ALA A 1 322 ? 38.088 55.411  14.495  1.00 40.14  ? 322 ALA A O     1 
ATOM   2657 C CB    . ALA A 1 322 ? 40.520 53.643  14.479  1.00 37.47  ? 322 ALA A CB    1 
ATOM   2658 N N     . SER A 1 323 ? 38.765 55.657  16.583  1.00 40.72  ? 323 SER A N     1 
ATOM   2659 C CA    . SER A 1 323 ? 38.241 57.006  16.646  1.00 43.18  ? 323 SER A CA    1 
ATOM   2660 C C     . SER A 1 323 ? 39.401 57.950  16.830  1.00 45.25  ? 323 SER A C     1 
ATOM   2661 O O     . SER A 1 323 ? 40.547 57.578  16.578  1.00 44.96  ? 323 SER A O     1 
ATOM   2662 C CB    . SER A 1 323 ? 37.222 57.167  17.780  1.00 43.89  ? 323 SER A CB    1 
ATOM   2663 O OG    . SER A 1 323 ? 37.843 57.134  19.063  1.00 45.30  ? 323 SER A OG    1 
ATOM   2664 N N     . GLU A 1 324 ? 39.100 59.171  17.267  1.00 48.11  ? 324 GLU A N     1 
ATOM   2665 C CA    . GLU A 1 324 ? 40.111 60.204  17.421  1.00 50.79  ? 324 GLU A CA    1 
ATOM   2666 C C     . GLU A 1 324 ? 41.215 59.760  18.365  1.00 50.28  ? 324 GLU A C     1 
ATOM   2667 O O     . GLU A 1 324 ? 42.384 59.787  17.987  1.00 50.57  ? 324 GLU A O     1 
ATOM   2668 C CB    . GLU A 1 324 ? 39.482 61.522  17.878  1.00 53.77  ? 324 GLU A CB    1 
ATOM   2669 C CG    . GLU A 1 324 ? 38.742 62.284  16.755  1.00 58.16  ? 324 GLU A CG    1 
ATOM   2670 C CD    . GLU A 1 324 ? 39.682 62.840  15.643  1.00 63.43  ? 324 GLU A CD    1 
ATOM   2671 O OE1   . GLU A 1 324 ? 39.166 63.290  14.582  1.00 63.95  ? 324 GLU A OE1   1 
ATOM   2672 O OE2   . GLU A 1 324 ? 40.931 62.827  15.826  1.00 65.74  ? 324 GLU A OE2   1 
ATOM   2673 N N     . GLU A 1 325 ? 40.842 59.309  19.566  1.00 49.56  ? 325 GLU A N     1 
ATOM   2674 C CA    . GLU A 1 325 ? 41.830 58.944  20.587  1.00 49.34  ? 325 GLU A CA    1 
ATOM   2675 C C     . GLU A 1 325 ? 41.760 57.488  21.053  1.00 45.52  ? 325 GLU A C     1 
ATOM   2676 O O     . GLU A 1 325 ? 42.727 56.963  21.584  1.00 45.05  ? 325 GLU A O     1 
ATOM   2677 C CB    . GLU A 1 325 ? 41.739 59.902  21.781  1.00 51.73  ? 325 GLU A CB    1 
ATOM   2678 C CG    . GLU A 1 325 ? 43.085 60.539  22.193  1.00 55.10  ? 325 GLU A CG    1 
ATOM   2679 C CD    . GLU A 1 325 ? 43.009 61.321  23.531  1.00 58.04  ? 325 GLU A CD    1 
ATOM   2680 O OE1   . GLU A 1 325 ? 42.136 60.981  24.385  1.00 61.56  ? 325 GLU A OE1   1 
ATOM   2681 O OE2   . GLU A 1 325 ? 43.829 62.262  23.745  1.00 61.63  ? 325 GLU A OE2   1 
ATOM   2682 N N     . PHE A 1 326 ? 40.629 56.830  20.850  1.00 42.93  ? 326 PHE A N     1 
ATOM   2683 C CA    . PHE A 1 326 ? 40.523 55.424  21.237  1.00 40.12  ? 326 PHE A CA    1 
ATOM   2684 C C     . PHE A 1 326 ? 40.290 54.453  20.076  1.00 37.51  ? 326 PHE A C     1 
ATOM   2685 O O     . PHE A 1 326 ? 40.059 54.844  18.935  1.00 37.15  ? 326 PHE A O     1 
ATOM   2686 C CB    . PHE A 1 326 ? 39.428 55.217  22.285  1.00 40.24  ? 326 PHE A CB    1 
ATOM   2687 C CG    . PHE A 1 326 ? 39.642 55.985  23.562  1.00 42.40  ? 326 PHE A CG    1 
ATOM   2688 C CD1   . PHE A 1 326 ? 38.906 57.134  23.826  1.00 44.59  ? 326 PHE A CD1   1 
ATOM   2689 C CD2   . PHE A 1 326 ? 40.564 55.551  24.511  1.00 42.07  ? 326 PHE A CD2   1 
ATOM   2690 C CE1   . PHE A 1 326 ? 39.090 57.845  25.012  1.00 46.36  ? 326 PHE A CE1   1 
ATOM   2691 C CE2   . PHE A 1 326 ? 40.752 56.250  25.696  1.00 42.44  ? 326 PHE A CE2   1 
ATOM   2692 C CZ    . PHE A 1 326 ? 40.009 57.394  25.949  1.00 45.63  ? 326 PHE A CZ    1 
ATOM   2693 N N     . CYS A 1 327 ? 40.377 53.171  20.395  1.00 35.21  ? 327 CYS A N     1 
ATOM   2694 C CA    . CYS A 1 327 ? 39.991 52.124  19.487  1.00 33.30  ? 327 CYS A CA    1 
ATOM   2695 C C     . CYS A 1 327 ? 39.042 51.215  20.212  1.00 31.89  ? 327 CYS A C     1 
ATOM   2696 O O     . CYS A 1 327 ? 39.073 51.133  21.440  1.00 32.47  ? 327 CYS A O     1 
ATOM   2697 C CB    . CYS A 1 327 ? 41.207 51.336  19.053  1.00 32.84  ? 327 CYS A CB    1 
ATOM   2698 S SG    . CYS A 1 327 ? 42.154 52.150  17.772  1.00 35.91  ? 327 CYS A SG    1 
ATOM   2699 N N     . TYR A 1 328 ? 38.196 50.526  19.471  1.00 30.20  ? 328 TYR A N     1 
ATOM   2700 C CA    . TYR A 1 328 ? 37.205 49.662  20.094  1.00 29.60  ? 328 TYR A CA    1 
ATOM   2701 C C     . TYR A 1 328 ? 37.180 48.325  19.387  1.00 27.68  ? 328 TYR A C     1 
ATOM   2702 O O     . TYR A 1 328 ? 37.164 48.274  18.165  1.00 27.62  ? 328 TYR A O     1 
ATOM   2703 C CB    . TYR A 1 328 ? 35.816 50.312  20.030  1.00 30.23  ? 328 TYR A CB    1 
ATOM   2704 C CG    . TYR A 1 328 ? 35.723 51.688  20.637  1.00 32.73  ? 328 TYR A CG    1 
ATOM   2705 C CD1   . TYR A 1 328 ? 36.114 52.831  19.919  1.00 34.78  ? 328 TYR A CD1   1 
ATOM   2706 C CD2   . TYR A 1 328 ? 35.227 51.865  21.931  1.00 34.26  ? 328 TYR A CD2   1 
ATOM   2707 C CE1   . TYR A 1 328 ? 36.014 54.113  20.484  1.00 35.99  ? 328 TYR A CE1   1 
ATOM   2708 C CE2   . TYR A 1 328 ? 35.131 53.142  22.510  1.00 34.40  ? 328 TYR A CE2   1 
ATOM   2709 C CZ    . TYR A 1 328 ? 35.519 54.261  21.788  1.00 36.92  ? 328 TYR A CZ    1 
ATOM   2710 O OH    . TYR A 1 328 ? 35.421 55.533  22.378  1.00 40.07  ? 328 TYR A OH    1 
ATOM   2711 N N     . LEU A 1 329 ? 37.198 47.242  20.143  1.00 27.02  ? 329 LEU A N     1 
ATOM   2712 C CA    . LEU A 1 329 ? 37.026 45.913  19.548  1.00 25.88  ? 329 LEU A CA    1 
ATOM   2713 C C     . LEU A 1 329 ? 35.695 45.406  20.015  1.00 25.79  ? 329 LEU A C     1 
ATOM   2714 O O     . LEU A 1 329 ? 35.535 45.096  21.200  1.00 26.31  ? 329 LEU A O     1 
ATOM   2715 C CB    . LEU A 1 329 ? 38.102 44.924  19.989  1.00 25.35  ? 329 LEU A CB    1 
ATOM   2716 C CG    . LEU A 1 329 ? 39.564 45.326  19.818  1.00 25.53  ? 329 LEU A CG    1 
ATOM   2717 C CD1   . LEU A 1 329 ? 40.444 44.140  20.152  1.00 24.73  ? 329 LEU A CD1   1 
ATOM   2718 C CD2   . LEU A 1 329 ? 39.858 45.870  18.411  1.00 24.46  ? 329 LEU A CD2   1 
ATOM   2719 N N     . LEU A 1 330 ? 34.756 45.334  19.078  1.00 24.91  ? 330 LEU A N     1 
ATOM   2720 C CA    . LEU A 1 330 ? 33.375 45.030  19.356  1.00 24.89  ? 330 LEU A CA    1 
ATOM   2721 C C     . LEU A 1 330 ? 33.078 43.560  19.169  1.00 23.90  ? 330 LEU A C     1 
ATOM   2722 O O     . LEU A 1 330 ? 33.505 42.970  18.188  1.00 23.99  ? 330 LEU A O     1 
ATOM   2723 C CB    . LEU A 1 330 ? 32.502 45.871  18.421  1.00 25.14  ? 330 LEU A CB    1 
ATOM   2724 C CG    . LEU A 1 330 ? 32.326 47.286  18.953  1.00 27.45  ? 330 LEU A CG    1 
ATOM   2725 C CD1   . LEU A 1 330 ? 32.371 48.345  17.863  1.00 30.41  ? 330 LEU A CD1   1 
ATOM   2726 C CD2   . LEU A 1 330 ? 31.021 47.345  19.677  1.00 30.63  ? 330 LEU A CD2   1 
ATOM   2727 N N     . PHE A 1 331 ? 32.338 42.967  20.101  1.00 24.16  ? 331 PHE A N     1 
ATOM   2728 C CA    . PHE A 1 331 ? 31.850 41.569  19.949  1.00 23.77  ? 331 PHE A CA    1 
ATOM   2729 C C     . PHE A 1 331 ? 30.423 41.365  20.432  1.00 24.18  ? 331 PHE A C     1 
ATOM   2730 O O     . PHE A 1 331 ? 29.955 42.039  21.355  1.00 24.55  ? 331 PHE A O     1 
ATOM   2731 C CB    . PHE A 1 331 ? 32.743 40.563  20.681  1.00 23.82  ? 331 PHE A CB    1 
ATOM   2732 C CG    . PHE A 1 331 ? 34.204 40.790  20.480  1.00 23.16  ? 331 PHE A CG    1 
ATOM   2733 C CD1   . PHE A 1 331 ? 34.882 40.125  19.494  1.00 22.09  ? 331 PHE A CD1   1 
ATOM   2734 C CD2   . PHE A 1 331 ? 34.894 41.679  21.285  1.00 24.88  ? 331 PHE A CD2   1 
ATOM   2735 C CE1   . PHE A 1 331 ? 36.220 40.334  19.299  1.00 23.70  ? 331 PHE A CE1   1 
ATOM   2736 C CE2   . PHE A 1 331 ? 36.244 41.904  21.096  1.00 25.81  ? 331 PHE A CE2   1 
ATOM   2737 C CZ    . PHE A 1 331 ? 36.907 41.232  20.100  1.00 25.40  ? 331 PHE A CZ    1 
ATOM   2738 N N     . GLU A 1 332 ? 29.749 40.410  19.803  1.00 24.75  ? 332 GLU A N     1 
ATOM   2739 C CA    . GLU A 1 332 ? 28.394 40.007  20.162  1.00 25.88  ? 332 GLU A CA    1 
ATOM   2740 C C     . GLU A 1 332 ? 28.370 38.499  20.321  1.00 25.84  ? 332 GLU A C     1 
ATOM   2741 O O     . GLU A 1 332 ? 28.702 37.794  19.375  1.00 25.61  ? 332 GLU A O     1 
ATOM   2742 C CB    . GLU A 1 332 ? 27.391 40.424  19.075  1.00 25.87  ? 332 GLU A CB    1 
ATOM   2743 C CG    . GLU A 1 332 ? 26.060 39.722  19.249  1.00 28.49  ? 332 GLU A CG    1 
ATOM   2744 C CD    . GLU A 1 332 ? 24.892 40.403  18.582  1.00 31.81  ? 332 GLU A CD    1 
ATOM   2745 O OE1   . GLU A 1 332 ? 24.852 40.427  17.319  1.00 34.20  ? 332 GLU A OE1   1 
ATOM   2746 O OE2   . GLU A 1 332 ? 23.980 40.868  19.320  1.00 31.66  ? 332 GLU A OE2   1 
ATOM   2747 N N     . CYS A 1 333 ? 27.970 38.005  21.493  1.00 26.35  ? 333 CYS A N     1 
ATOM   2748 C CA    . CYS A 1 333 ? 27.909 36.554  21.726  1.00 27.21  ? 333 CYS A CA    1 
ATOM   2749 C C     . CYS A 1 333 ? 26.530 36.039  22.064  1.00 27.51  ? 333 CYS A C     1 
ATOM   2750 O O     . CYS A 1 333 ? 25.713 36.747  22.648  1.00 27.61  ? 333 CYS A O     1 
ATOM   2751 C CB    . CYS A 1 333 ? 28.812 36.153  22.883  1.00 27.79  ? 333 CYS A CB    1 
ATOM   2752 S SG    . CYS A 1 333 ? 30.553 36.410  22.614  1.00 30.62  ? 333 CYS A SG    1 
ATOM   2753 N N     . GLN A 1 334 ? 26.311 34.769  21.748  1.00 27.63  ? 334 GLN A N     1 
ATOM   2754 C CA    . GLN A 1 334 ? 25.050 34.112  22.029  1.00 28.48  ? 334 GLN A CA    1 
ATOM   2755 C C     . GLN A 1 334 ? 24.865 33.671  23.480  1.00 29.00  ? 334 GLN A C     1 
ATOM   2756 O O     . GLN A 1 334 ? 23.741 33.414  23.908  1.00 30.05  ? 334 GLN A O     1 
ATOM   2757 C CB    . GLN A 1 334 ? 24.908 32.893  21.143  1.00 29.22  ? 334 GLN A CB    1 
ATOM   2758 C CG    . GLN A 1 334 ? 24.346 33.169  19.772  1.00 30.06  ? 334 GLN A CG    1 
ATOM   2759 C CD    . GLN A 1 334 ? 24.405 31.930  18.892  1.00 30.50  ? 334 GLN A CD    1 
ATOM   2760 O OE1   . GLN A 1 334 ? 25.467 31.569  18.391  1.00 30.88  ? 334 GLN A OE1   1 
ATOM   2761 N NE2   . GLN A 1 334 ? 23.270 31.279  18.706  1.00 29.47  ? 334 GLN A NE2   1 
ATOM   2762 N N     . ILE A 1 335 ? 25.958 33.559  24.225  1.00 28.63  ? 335 ILE A N     1 
ATOM   2763 C CA    . ILE A 1 335 ? 25.906 33.051  25.584  1.00 29.29  ? 335 ILE A CA    1 
ATOM   2764 C C     . ILE A 1 335 ? 26.328 34.152  26.512  1.00 29.59  ? 335 ILE A C     1 
ATOM   2765 O O     . ILE A 1 335 ? 27.494 34.526  26.509  1.00 29.79  ? 335 ILE A O     1 
ATOM   2766 C CB    . ILE A 1 335 ? 26.881 31.889  25.777  1.00 29.49  ? 335 ILE A CB    1 
ATOM   2767 C CG1   . ILE A 1 335 ? 26.551 30.747  24.805  1.00 29.93  ? 335 ILE A CG1   1 
ATOM   2768 C CG2   . ILE A 1 335 ? 26.892 31.420  27.252  1.00 30.49  ? 335 ILE A CG2   1 
ATOM   2769 C CD1   . ILE A 1 335 ? 25.237 30.052  25.084  1.00 30.15  ? 335 ILE A CD1   1 
ATOM   2770 N N     . LYS A 1 336 ? 25.391 34.671  27.302  1.00 30.27  ? 336 LYS A N     1 
ATOM   2771 C CA    . LYS A 1 336 ? 25.666 35.788  28.198  1.00 30.27  ? 336 LYS A CA    1 
ATOM   2772 C C     . LYS A 1 336 ? 26.377 35.257  29.427  1.00 31.16  ? 336 LYS A C     1 
ATOM   2773 O O     . LYS A 1 336 ? 27.121 35.989  30.094  1.00 31.95  ? 336 LYS A O     1 
ATOM   2774 C CB    . LYS A 1 336 ? 24.378 36.506  28.639  1.00 31.10  ? 336 LYS A CB    1 
ATOM   2775 C CG    . LYS A 1 336 ? 23.528 37.120  27.539  1.00 30.50  ? 336 LYS A CG    1 
ATOM   2776 C CD    . LYS A 1 336 ? 22.141 37.504  28.072  1.00 31.93  ? 336 LYS A CD    1 
ATOM   2777 C CE    . LYS A 1 336 ? 22.066 39.009  28.267  1.00 34.29  ? 336 LYS A CE    1 
ATOM   2778 N NZ    . LYS A 1 336 ? 21.512 39.476  29.595  1.00 38.57  ? 336 LYS A NZ    1 
ATOM   2779 N N     . GLU A 1 337 ? 26.138 33.989  29.731  1.00 31.44  ? 337 GLU A N     1 
ATOM   2780 C CA    . GLU A 1 337 ? 26.666 33.373  30.946  1.00 32.73  ? 337 GLU A CA    1 
ATOM   2781 C C     . GLU A 1 337 ? 26.701 31.865  30.793  1.00 32.48  ? 337 GLU A C     1 
ATOM   2782 O O     . GLU A 1 337 ? 25.738 31.269  30.334  1.00 33.09  ? 337 GLU A O     1 
ATOM   2783 C CB    . GLU A 1 337 ? 25.826 33.753  32.179  1.00 33.81  ? 337 GLU A CB    1 
ATOM   2784 C CG    . GLU A 1 337 ? 26.190 32.946  33.417  1.00 36.18  ? 337 GLU A CG    1 
ATOM   2785 C CD    . GLU A 1 337 ? 25.559 33.472  34.693  1.00 38.41  ? 337 GLU A CD    1 
ATOM   2786 O OE1   . GLU A 1 337 ? 24.327 33.313  34.863  1.00 41.80  ? 337 GLU A OE1   1 
ATOM   2787 O OE2   . GLU A 1 337 ? 26.304 34.016  35.544  1.00 40.70  ? 337 GLU A OE2   1 
ATOM   2788 N N     . ILE A 1 338 ? 27.816 31.264  31.176  1.00 32.45  ? 338 ILE A N     1 
ATOM   2789 C CA    . ILE A 1 338 ? 28.003 29.833  31.074  1.00 33.07  ? 338 ILE A CA    1 
ATOM   2790 C C     . ILE A 1 338 ? 28.188 29.281  32.471  1.00 34.90  ? 338 ILE A C     1 
ATOM   2791 O O     . ILE A 1 338 ? 28.522 30.028  33.389  1.00 35.22  ? 338 ILE A O     1 
ATOM   2792 C CB    . ILE A 1 338 ? 29.207 29.495  30.185  1.00 32.13  ? 338 ILE A CB    1 
ATOM   2793 C CG1   . ILE A 1 338 ? 29.235 28.001  29.885  1.00 33.24  ? 338 ILE A CG1   1 
ATOM   2794 C CG2   . ILE A 1 338 ? 30.502 29.936  30.838  1.00 31.67  ? 338 ILE A CG2   1 
ATOM   2795 C CD1   . ILE A 1 338 ? 29.872 27.649  28.574  1.00 31.95  ? 338 ILE A CD1   1 
ATOM   2796 N N     . SER A 1 339 ? 27.960 27.980  32.632  1.00 36.61  ? 339 SER A N     1 
ATOM   2797 C CA    . SER A 1 339 ? 27.986 27.338  33.952  1.00 38.88  ? 339 SER A CA    1 
ATOM   2798 C C     . SER A 1 339 ? 29.381 27.256  34.505  1.00 39.41  ? 339 SER A C     1 
ATOM   2799 O O     . SER A 1 339 ? 30.330 27.130  33.761  1.00 38.45  ? 339 SER A O     1 
ATOM   2800 C CB    . SER A 1 339 ? 27.418 25.925  33.876  1.00 40.50  ? 339 SER A CB    1 
ATOM   2801 O OG    . SER A 1 339 ? 28.351 25.019  33.311  1.00 41.09  ? 339 SER A OG    1 
ATOM   2802 N N     . ARG A 1 340 ? 29.504 27.301  35.821  1.00 32.83  ? 340 ARG A N     1 
ATOM   2803 C CA    . ARG A 1 340 ? 30.814 27.226  36.437  1.00 35.28  ? 340 ARG A CA    1 
ATOM   2804 C C     . ARG A 1 340 ? 31.487 25.853  36.174  1.00 35.49  ? 340 ARG A C     1 
ATOM   2805 O O     . ARG A 1 340 ? 32.643 25.804  35.789  1.00 35.86  ? 340 ARG A O     1 
ATOM   2806 C CB    . ARG A 1 340 ? 30.736 27.656  37.910  1.00 37.59  ? 340 ARG A CB    1 
ATOM   2807 C CG    . ARG A 1 340 ? 32.012 27.455  38.738  1.00 42.47  ? 340 ARG A CG    1 
ATOM   2808 C CD    . ARG A 1 340 ? 32.324 28.671  39.579  1.00 47.62  ? 340 ARG A CD    1 
ATOM   2809 N NE    . ARG A 1 340 ? 33.108 29.634  38.792  1.00 49.43  ? 340 ARG A NE    1 
ATOM   2810 C CZ    . ARG A 1 340 ? 32.940 30.959  38.810  1.00 50.03  ? 340 ARG A CZ    1 
ATOM   2811 N NH1   . ARG A 1 340 ? 32.003 31.509  39.572  1.00 51.41  ? 340 ARG A NH1   1 
ATOM   2812 N NH2   . ARG A 1 340 ? 33.707 31.738  38.056  1.00 51.04  ? 340 ARG A NH2   1 
ATOM   2813 N N     . VAL A 1 341 ? 30.759 24.751  36.307  1.00 35.93  ? 341 VAL A N     1 
ATOM   2814 C CA    . VAL A 1 341 ? 31.357 23.452  36.034  1.00 36.66  ? 341 VAL A CA    1 
ATOM   2815 C C     . VAL A 1 341 ? 31.428 23.149  34.536  1.00 35.86  ? 341 VAL A C     1 
ATOM   2816 O O     . VAL A 1 341 ? 30.554 23.564  33.779  1.00 34.96  ? 341 VAL A O     1 
ATOM   2817 C CB    . VAL A 1 341 ? 30.649 22.309  36.826  1.00 37.64  ? 341 VAL A CB    1 
ATOM   2818 C CG1   . VAL A 1 341 ? 29.440 21.762  36.088  1.00 36.24  ? 341 VAL A CG1   1 
ATOM   2819 C CG2   . VAL A 1 341 ? 31.618 21.200  37.134  1.00 38.46  ? 341 VAL A CG2   1 
ATOM   2820 N N     . PHE A 1 342 ? 32.482 22.450  34.114  1.00 37.06  ? 342 PHE A N     1 
ATOM   2821 C CA    . PHE A 1 342 ? 32.601 21.964  32.737  1.00 37.36  ? 342 PHE A CA    1 
ATOM   2822 C C     . PHE A 1 342 ? 33.322 20.621  32.729  1.00 39.64  ? 342 PHE A C     1 
ATOM   2823 O O     . PHE A 1 342 ? 33.979 20.281  33.714  1.00 41.30  ? 342 PHE A O     1 
ATOM   2824 C CB    . PHE A 1 342 ? 33.361 22.957  31.877  1.00 36.98  ? 342 PHE A CB    1 
ATOM   2825 C CG    . PHE A 1 342 ? 34.820 22.995  32.158  1.00 37.78  ? 342 PHE A CG    1 
ATOM   2826 C CD1   . PHE A 1 342 ? 35.693 22.166  31.461  1.00 38.14  ? 342 PHE A CD1   1 
ATOM   2827 C CD2   . PHE A 1 342 ? 35.331 23.858  33.135  1.00 38.54  ? 342 PHE A CD2   1 
ATOM   2828 C CE1   . PHE A 1 342 ? 37.062 22.194  31.728  1.00 41.11  ? 342 PHE A CE1   1 
ATOM   2829 C CE2   . PHE A 1 342 ? 36.693 23.906  33.416  1.00 39.32  ? 342 PHE A CE2   1 
ATOM   2830 C CZ    . PHE A 1 342 ? 37.568 23.076  32.709  1.00 41.41  ? 342 PHE A CZ    1 
ATOM   2831 N N     . ARG A 1 343 ? 33.202 19.868  31.625  1.00 40.90  ? 343 ARG A N     1 
ATOM   2832 C CA    . ARG A 1 343 ? 33.834 18.538  31.473  1.00 42.67  ? 343 ARG A CA    1 
ATOM   2833 C C     . ARG A 1 343 ? 35.259 18.647  30.962  1.00 44.63  ? 343 ARG A C     1 
ATOM   2834 O O     . ARG A 1 343 ? 35.549 19.430  30.053  1.00 44.86  ? 343 ARG A O     1 
ATOM   2835 C CB    . ARG A 1 343 ? 33.065 17.680  30.464  1.00 42.80  ? 343 ARG A CB    1 
ATOM   2836 C CG    . ARG A 1 343 ? 32.012 16.741  31.033  1.00 43.28  ? 343 ARG A CG    1 
ATOM   2837 C CD    . ARG A 1 343 ? 31.048 16.303  29.933  1.00 44.15  ? 343 ARG A CD    1 
ATOM   2838 N NE    . ARG A 1 343 ? 31.571 15.175  29.175  1.00 47.11  ? 343 ARG A NE    1 
ATOM   2839 C CZ    . ARG A 1 343 ? 31.000 13.968  29.109  1.00 50.04  ? 343 ARG A CZ    1 
ATOM   2840 N NH1   . ARG A 1 343 ? 29.852 13.706  29.740  1.00 49.15  ? 343 ARG A NH1   1 
ATOM   2841 N NH2   . ARG A 1 343 ? 31.576 13.012  28.391  1.00 51.72  ? 343 ARG A NH2   1 
ATOM   2842 N N     . ARG A 1 344 ? 36.145 17.842  31.532  1.00 46.52  ? 344 ARG A N     1 
ATOM   2843 C CA    . ARG A 1 344 ? 37.488 17.693  30.992  1.00 49.00  ? 344 ARG A CA    1 
ATOM   2844 C C     . ARG A 1 344 ? 37.744 16.205  30.886  1.00 49.65  ? 344 ARG A C     1 
ATOM   2845 O O     . ARG A 1 344 ? 37.418 15.450  31.798  1.00 49.39  ? 344 ARG A O     1 
ATOM   2846 C CB    . ARG A 1 344 ? 38.535 18.381  31.879  1.00 50.64  ? 344 ARG A CB    1 
ATOM   2847 C CG    . ARG A 1 344 ? 39.950 18.406  31.294  1.00 54.04  ? 344 ARG A CG    1 
ATOM   2848 C CD    . ARG A 1 344 ? 40.924 19.086  32.238  1.00 56.39  ? 344 ARG A CD    1 
ATOM   2849 N NE    . ARG A 1 344 ? 40.813 20.545  32.146  1.00 59.00  ? 344 ARG A NE    1 
ATOM   2850 C CZ    . ARG A 1 344 ? 41.346 21.412  33.010  1.00 61.58  ? 344 ARG A CZ    1 
ATOM   2851 N NH1   . ARG A 1 344 ? 42.043 20.996  34.066  1.00 64.85  ? 344 ARG A NH1   1 
ATOM   2852 N NH2   . ARG A 1 344 ? 41.177 22.711  32.815  1.00 61.74  ? 344 ARG A NH2   1 
ATOM   2853 N N     . MET A 1 345 ? 38.314 15.797  29.759  1.00 50.86  ? 345 MET A N     1 
ATOM   2854 C CA    . MET A 1 345 ? 38.506 14.387  29.447  1.00 51.80  ? 345 MET A CA    1 
ATOM   2855 C C     . MET A 1 345 ? 39.806 13.810  30.001  1.00 54.42  ? 345 MET A C     1 
ATOM   2856 O O     . MET A 1 345 ? 40.873 14.407  29.865  1.00 56.34  ? 345 MET A O     1 
ATOM   2857 C CB    . MET A 1 345 ? 38.423 14.171  27.939  1.00 52.12  ? 345 MET A CB    1 
ATOM   2858 C CG    . MET A 1 345 ? 39.359 13.121  27.410  1.00 54.39  ? 345 MET A CG    1 
ATOM   2859 S SD    . MET A 1 345 ? 39.121 12.842  25.667  1.00 56.64  ? 345 MET A SD    1 
ATOM   2860 C CE    . MET A 1 345 ? 39.973 14.258  24.934  1.00 58.10  ? 345 MET A CE    1 
ATOM   2861 N N     . GLY A 1 346 ? 39.690 12.638  30.620  1.00 55.11  ? 346 GLY A N     1 
ATOM   2862 C CA    . GLY A 1 346 ? 40.834 11.877  31.082  1.00 58.07  ? 346 GLY A CA    1 
ATOM   2863 C C     . GLY A 1 346 ? 41.083 10.675  30.198  1.00 59.96  ? 346 GLY A C     1 
ATOM   2864 O O     . GLY A 1 346 ? 40.410 10.491  29.185  1.00 59.10  ? 346 GLY A O     1 
ATOM   2865 N N     . PRO A 1 347 ? 42.049 9.835   30.586  1.00 62.95  ? 347 PRO A N     1 
ATOM   2866 C CA    . PRO A 1 347 ? 42.498 8.695   29.781  1.00 65.60  ? 347 PRO A CA    1 
ATOM   2867 C C     . PRO A 1 347 ? 41.505 7.537   29.736  1.00 64.95  ? 347 PRO A C     1 
ATOM   2868 O O     . PRO A 1 347 ? 40.501 7.548   30.454  1.00 62.73  ? 347 PRO A O     1 
ATOM   2869 C CB    . PRO A 1 347 ? 43.783 8.257   30.483  1.00 68.65  ? 347 PRO A CB    1 
ATOM   2870 C CG    . PRO A 1 347 ? 43.633 8.729   31.879  1.00 67.61  ? 347 PRO A CG    1 
ATOM   2871 C CD    . PRO A 1 347 ? 42.779 9.947   31.859  1.00 64.24  ? 347 PRO A CD    1 
ATOM   2872 N N     . GLN A 1 348 ? 41.800 6.549   28.895  1.00 67.50  ? 348 GLN A N     1 
ATOM   2873 C CA    . GLN A 1 348 ? 40.985 5.338   28.801  1.00 67.99  ? 348 GLN A CA    1 
ATOM   2874 C C     . GLN A 1 348 ? 41.211 4.466   30.026  1.00 68.79  ? 348 GLN A C     1 
ATOM   2875 O O     . GLN A 1 348 ? 42.199 4.645   30.736  1.00 70.60  ? 348 GLN A O     1 
ATOM   2876 C CB    . GLN A 1 348 ? 41.299 4.581   27.516  1.00 70.50  ? 348 GLN A CB    1 
ATOM   2877 C CG    . GLN A 1 348 ? 41.345 5.500   26.317  1.00 71.85  ? 348 GLN A CG    1 
ATOM   2878 C CD    . GLN A 1 348 ? 40.811 4.849   25.070  1.00 74.79  ? 348 GLN A CD    1 
ATOM   2879 O OE1   . GLN A 1 348 ? 41.204 3.732   24.716  1.00 77.30  ? 348 GLN A OE1   1 
ATOM   2880 N NE2   . GLN A 1 348 ? 39.908 5.550   24.380  1.00 74.57  ? 348 GLN A NE2   1 
ATOM   2881 N N     . PHE A 1 349 ? 40.302 3.531   30.280  1.00 68.32  ? 349 PHE A N     1 
ATOM   2882 C CA    . PHE A 1 349 ? 40.321 2.795   31.542  1.00 69.00  ? 349 PHE A CA    1 
ATOM   2883 C C     . PHE A 1 349 ? 41.476 1.813   31.681  1.00 72.44  ? 349 PHE A C     1 
ATOM   2884 O O     . PHE A 1 349 ? 41.775 1.369   32.782  1.00 73.28  ? 349 PHE A O     1 
ATOM   2885 C CB    . PHE A 1 349 ? 38.987 2.094   31.786  1.00 67.51  ? 349 PHE A CB    1 
ATOM   2886 C CG    . PHE A 1 349 ? 38.821 0.805   31.031  1.00 69.25  ? 349 PHE A CG    1 
ATOM   2887 C CD1   . PHE A 1 349 ? 39.197 -0.403  31.603  1.00 71.02  ? 349 PHE A CD1   1 
ATOM   2888 C CD2   . PHE A 1 349 ? 38.259 0.795   29.760  1.00 69.39  ? 349 PHE A CD2   1 
ATOM   2889 C CE1   . PHE A 1 349 ? 39.031 -1.607  30.911  1.00 73.19  ? 349 PHE A CE1   1 
ATOM   2890 C CE2   . PHE A 1 349 ? 38.079 -0.399  29.062  1.00 71.32  ? 349 PHE A CE2   1 
ATOM   2891 C CZ    . PHE A 1 349 ? 38.469 -1.605  29.638  1.00 73.09  ? 349 PHE A CZ    1 
ATOM   2892 N N     . GLU A 1 350 ? 42.117 1.482   30.565  1.00 75.06  ? 350 GLU A N     1 
ATOM   2893 C CA    . GLU A 1 350 ? 43.190 0.488   30.553  1.00 79.17  ? 350 GLU A CA    1 
ATOM   2894 C C     . GLU A 1 350 ? 44.576 1.037   30.929  1.00 82.00  ? 350 GLU A C     1 
ATOM   2895 O O     . GLU A 1 350 ? 45.489 0.262   31.247  1.00 85.32  ? 350 GLU A O     1 
ATOM   2896 C CB    . GLU A 1 350 ? 43.256 -0.223  29.199  1.00 81.14  ? 350 GLU A CB    1 
ATOM   2897 C CG    . GLU A 1 350 ? 41.967 -0.925  28.790  1.00 80.22  ? 350 GLU A CG    1 
ATOM   2898 C CD    . GLU A 1 350 ? 41.142 -0.130  27.786  1.00 79.65  ? 350 GLU A CD    1 
ATOM   2899 O OE1   . GLU A 1 350 ? 40.540 -0.771  26.898  1.00 80.95  ? 350 GLU A OE1   1 
ATOM   2900 O OE2   . GLU A 1 350 ? 41.092 1.121   27.876  1.00 77.91  ? 350 GLU A OE2   1 
ATOM   2901 N N     . ASP A 1 351 ? 44.733 2.361   30.895  1.00 81.25  ? 351 ASP A N     1 
ATOM   2902 C CA    . ASP A 1 351 ? 46.006 2.991   31.245  1.00 84.17  ? 351 ASP A CA    1 
ATOM   2903 C C     . ASP A 1 351 ? 46.148 3.195   32.758  1.00 84.34  ? 351 ASP A C     1 
ATOM   2904 O O     . ASP A 1 351 ? 46.013 4.317   33.265  1.00 83.18  ? 351 ASP A O     1 
ATOM   2905 C CB    . ASP A 1 351 ? 46.197 4.313   30.485  1.00 83.70  ? 351 ASP A CB    1 
ATOM   2906 C CG    . ASP A 1 351 ? 47.648 4.810   30.508  1.00 87.83  ? 351 ASP A CG    1 
ATOM   2907 O OD1   . ASP A 1 351 ? 47.961 5.745   29.745  1.00 88.13  ? 351 ASP A OD1   1 
ATOM   2908 O OD2   . ASP A 1 351 ? 48.479 4.279   31.278  1.00 91.18  ? 351 ASP A OD2   1 
ATOM   2909 N N     . GLU A 1 352 ? 46.437 2.097   33.458  1.00 86.45  ? 352 GLU A N     1 
ATOM   2910 C CA    . GLU A 1 352 ? 46.656 2.095   34.905  1.00 87.63  ? 352 GLU A CA    1 
ATOM   2911 C C     . GLU A 1 352 ? 47.532 3.273   35.312  1.00 89.35  ? 352 GLU A C     1 
ATOM   2912 O O     . GLU A 1 352 ? 47.165 4.056   36.187  1.00 88.21  ? 352 GLU A O     1 
ATOM   2913 C CB    . GLU A 1 352 ? 47.285 0.763   35.358  1.00 91.01  ? 352 GLU A CB    1 
ATOM   2914 C CG    . GLU A 1 352 ? 47.330 0.556   36.885  1.00 92.50  ? 352 GLU A CG    1 
ATOM   2915 C CD    . GLU A 1 352 ? 47.592 -0.896  37.311  1.00 95.15  ? 352 GLU A CD    1 
ATOM   2916 O OE1   . GLU A 1 352 ? 48.115 -1.694  36.501  1.00 97.28  ? 352 GLU A OE1   1 
ATOM   2917 O OE2   . GLU A 1 352 ? 47.271 -1.242  38.471  1.00 95.54  ? 352 GLU A OE2   1 
ATOM   2918 N N     . ARG A 1 353 ? 48.676 3.402   34.648  1.00 92.45  ? 353 ARG A N     1 
ATOM   2919 C CA    . ARG A 1 353 ? 49.617 4.476   34.927  1.00 94.92  ? 353 ARG A CA    1 
ATOM   2920 C C     . ARG A 1 353 ? 48.939 5.859   34.916  1.00 91.44  ? 353 ARG A C     1 
ATOM   2921 O O     . ARG A 1 353 ? 48.957 6.567   35.927  1.00 91.78  ? 353 ARG A O     1 
ATOM   2922 C CB    . ARG A 1 353 ? 50.805 4.405   33.950  1.00 98.71  ? 353 ARG A CB    1 
ATOM   2923 C CG    . ARG A 1 353 ? 51.970 5.351   34.242  1.00 102.76 ? 353 ARG A CG    1 
ATOM   2924 C CD    . ARG A 1 353 ? 52.511 5.210   35.670  1.00 106.69 ? 353 ARG A CD    1 
ATOM   2925 N NE    . ARG A 1 353 ? 53.838 5.813   35.843  1.00 112.60 ? 353 ARG A NE    1 
ATOM   2926 C CZ    . ARG A 1 353 ? 54.083 7.123   35.939  1.00 112.74 ? 353 ARG A CZ    1 
ATOM   2927 N NH1   . ARG A 1 353 ? 53.093 8.009   35.870  1.00 107.49 ? 353 ARG A NH1   1 
ATOM   2928 N NH2   . ARG A 1 353 ? 55.332 7.550   36.097  1.00 117.59 ? 353 ARG A NH2   1 
ATOM   2929 N N     . ASN A 1 354 ? 48.311 6.216   33.797  1.00 88.30  ? 354 ASN A N     1 
ATOM   2930 C CA    . ASN A 1 354 ? 47.795 7.576   33.607  1.00 85.39  ? 354 ASN A CA    1 
ATOM   2931 C C     . ASN A 1 354 ? 46.504 7.904   34.336  1.00 81.33  ? 354 ASN A C     1 
ATOM   2932 O O     . ASN A 1 354 ? 46.309 9.041   34.761  1.00 80.01  ? 354 ASN A O     1 
ATOM   2933 C CB    . ASN A 1 354 ? 47.652 7.907   32.125  1.00 84.27  ? 354 ASN A CB    1 
ATOM   2934 C CG    . ASN A 1 354 ? 48.909 8.511   31.539  1.00 88.16  ? 354 ASN A CG    1 
ATOM   2935 O OD1   . ASN A 1 354 ? 49.791 8.980   32.261  1.00 91.02  ? 354 ASN A OD1   1 
ATOM   2936 N ND2   . ASN A 1 354 ? 48.990 8.520   30.218  1.00 89.64  ? 354 ASN A ND2   1 
ATOM   2937 N N     . VAL A 1 355 ? 45.627 6.914   34.463  1.00 79.48  ? 355 VAL A N     1 
ATOM   2938 C CA    . VAL A 1 355 ? 44.387 7.075   35.215  1.00 76.56  ? 355 VAL A CA    1 
ATOM   2939 C C     . VAL A 1 355 ? 44.712 7.481   36.648  1.00 78.40  ? 355 VAL A C     1 
ATOM   2940 O O     . VAL A 1 355 ? 44.168 8.452   37.173  1.00 76.88  ? 355 VAL A O     1 
ATOM   2941 C CB    . VAL A 1 355 ? 43.529 5.775   35.184  1.00 75.41  ? 355 VAL A CB    1 
ATOM   2942 C CG1   . VAL A 1 355 ? 42.502 5.738   36.322  1.00 73.64  ? 355 VAL A CG1   1 
ATOM   2943 C CG2   . VAL A 1 355 ? 42.838 5.623   33.839  1.00 73.21  ? 355 VAL A CG2   1 
ATOM   2944 N N     . LYS A 1 356 ? 45.628 6.744   37.264  1.00 82.29  ? 356 LYS A N     1 
ATOM   2945 C CA    . LYS A 1 356 ? 45.987 6.986   38.656  1.00 85.15  ? 356 LYS A CA    1 
ATOM   2946 C C     . LYS A 1 356 ? 46.766 8.290   38.810  1.00 86.96  ? 356 LYS A C     1 
ATOM   2947 O O     . LYS A 1 356 ? 46.772 8.883   39.893  1.00 88.68  ? 356 LYS A O     1 
ATOM   2948 C CB    . LYS A 1 356 ? 46.719 5.775   39.259  1.00 88.85  ? 356 LYS A CB    1 
ATOM   2949 C CG    . LYS A 1 356 ? 45.772 4.581   39.525  1.00 87.40  ? 356 LYS A CG    1 
ATOM   2950 C CD    . LYS A 1 356 ? 46.510 3.331   39.997  1.00 91.45  ? 356 LYS A CD    1 
ATOM   2951 C CE    . LYS A 1 356 ? 45.559 2.150   40.187  1.00 89.96  ? 356 LYS A CE    1 
ATOM   2952 N NZ    . LYS A 1 356 ? 44.705 2.292   41.402  1.00 89.72  ? 356 LYS A NZ    1 
ATOM   2953 N N     . LYS A 1 357 ? 47.395 8.744   37.723  1.00 86.91  ? 357 LYS A N     1 
ATOM   2954 C CA    . LYS A 1 357 ? 47.954 10.093  37.663  1.00 87.59  ? 357 LYS A CA    1 
ATOM   2955 C C     . LYS A 1 357 ? 46.820 11.089  37.490  1.00 83.12  ? 357 LYS A C     1 
ATOM   2956 O O     . LYS A 1 357 ? 46.837 12.178  38.061  1.00 83.60  ? 357 LYS A O     1 
ATOM   2957 C CB    . LYS A 1 357 ? 48.954 10.238  36.507  1.00 89.78  ? 357 LYS A CB    1 
ATOM   2958 C CG    . LYS A 1 357 ? 50.434 10.154  36.904  1.00 95.42  ? 357 LYS A CG    1 
ATOM   2959 C CD    . LYS A 1 357 ? 51.341 10.828  35.875  1.00 97.26  ? 357 LYS A CD    1 
ATOM   2960 C CE    . LYS A 1 357 ? 51.480 12.324  36.129  1.00 97.23  ? 357 LYS A CE    1 
ATOM   2961 N NZ    . LYS A 1 357 ? 52.376 12.995  35.140  1.00 99.04  ? 357 LYS A NZ    1 
ATOM   2962 N N     . PHE A 1 358 ? 45.832 10.697  36.699  1.00 78.93  ? 358 PHE A N     1 
ATOM   2963 C CA    . PHE A 1 358 ? 44.709 11.553  36.386  1.00 74.63  ? 358 PHE A CA    1 
ATOM   2964 C C     . PHE A 1 358 ? 43.848 11.827  37.613  1.00 73.46  ? 358 PHE A C     1 
ATOM   2965 O O     . PHE A 1 358 ? 43.579 12.984  37.932  1.00 72.63  ? 358 PHE A O     1 
ATOM   2966 C CB    . PHE A 1 358 ? 43.888 10.919  35.266  1.00 71.65  ? 358 PHE A CB    1 
ATOM   2967 C CG    . PHE A 1 358 ? 42.651 11.677  34.904  1.00 68.00  ? 358 PHE A CG    1 
ATOM   2968 C CD1   . PHE A 1 358 ? 42.723 12.995  34.464  1.00 67.58  ? 358 PHE A CD1   1 
ATOM   2969 C CD2   . PHE A 1 358 ? 41.407 11.061  34.971  1.00 65.26  ? 358 PHE A CD2   1 
ATOM   2970 C CE1   . PHE A 1 358 ? 41.567 13.691  34.114  1.00 64.27  ? 358 PHE A CE1   1 
ATOM   2971 C CE2   . PHE A 1 358 ? 40.250 11.744  34.622  1.00 62.15  ? 358 PHE A CE2   1 
ATOM   2972 C CZ    . PHE A 1 358 ? 40.325 13.057  34.196  1.00 61.67  ? 358 PHE A CZ    1 
ATOM   2973 N N     . LEU A 1 359 ? 43.423 10.778  38.314  1.00 73.55  ? 359 LEU A N     1 
ATOM   2974 C CA    . LEU A 1 359 ? 42.543 10.992  39.464  1.00 72.87  ? 359 LEU A CA    1 
ATOM   2975 C C     . LEU A 1 359 ? 43.294 11.274  40.757  1.00 76.82  ? 359 LEU A C     1 
ATOM   2976 O O     . LEU A 1 359 ? 42.711 11.285  41.840  1.00 77.57  ? 359 LEU A O     1 
ATOM   2977 C CB    . LEU A 1 359 ? 41.485 9.893   39.623  1.00 70.97  ? 359 LEU A CB    1 
ATOM   2978 C CG    . LEU A 1 359 ? 41.797 8.428   39.391  1.00 71.83  ? 359 LEU A CG    1 
ATOM   2979 C CD1   . LEU A 1 359 ? 42.277 7.771   40.663  1.00 76.57  ? 359 LEU A CD1   1 
ATOM   2980 C CD2   . LEU A 1 359 ? 40.534 7.788   38.933  1.00 68.42  ? 359 LEU A CD2   1 
ATOM   2981 N N     . SER A 1 360 ? 44.591 11.525  40.628  1.00 79.96  ? 360 SER A N     1 
ATOM   2982 C CA    . SER A 1 360 ? 45.380 12.077  41.715  1.00 84.09  ? 360 SER A CA    1 
ATOM   2983 C C     . SER A 1 360 ? 44.864 13.467  42.096  1.00 83.18  ? 360 SER A C     1 
ATOM   2984 O O     . SER A 1 360 ? 44.699 13.769  43.273  1.00 85.20  ? 360 SER A O     1 
ATOM   2985 C CB    . SER A 1 360 ? 46.851 12.141  41.308  1.00 87.68  ? 360 SER A CB    1 
ATOM   2986 O OG    . SER A 1 360 ? 47.506 13.229  41.927  1.00 91.05  ? 360 SER A OG    1 
ATOM   2987 N N     . ARG A 1 361 ? 44.589 14.293  41.087  1.00 80.36  ? 361 ARG A N     1 
ATOM   2988 C CA    . ARG A 1 361 ? 44.215 15.693  41.291  1.00 79.86  ? 361 ARG A CA    1 
ATOM   2989 C C     . ARG A 1 361 ? 43.045 15.866  42.246  1.00 78.92  ? 361 ARG A C     1 
ATOM   2990 O O     . ARG A 1 361 ? 42.055 15.136  42.185  1.00 76.31  ? 361 ARG A O     1 
ATOM   2991 C CB    . ARG A 1 361 ? 43.885 16.381  39.961  1.00 76.28  ? 361 ARG A CB    1 
ATOM   2992 C CG    . ARG A 1 361 ? 44.787 16.006  38.791  1.00 77.31  ? 361 ARG A CG    1 
ATOM   2993 C CD    . ARG A 1 361 ? 46.225 16.458  38.993  1.00 83.13  ? 361 ARG A CD    1 
ATOM   2994 N NE    . ARG A 1 361 ? 46.449 17.831  38.548  1.00 83.60  ? 361 ARG A NE    1 
ATOM   2995 C CZ    . ARG A 1 361 ? 47.562 18.526  38.778  1.00 87.87  ? 361 ARG A CZ    1 
ATOM   2996 N NH1   . ARG A 1 361 ? 47.665 19.770  38.323  1.00 87.35  ? 361 ARG A NH1   1 
ATOM   2997 N NH2   . ARG A 1 361 ? 48.570 17.987  39.466  1.00 92.23  ? 361 ARG A NH2   1 
ATOM   2998 N N     . ASN A 1 362 ? 43.180 16.848  43.127  1.00 81.75  ? 362 ASN A N     1 
ATOM   2999 C CA    . ASN A 1 362 ? 42.146 17.190  44.098  1.00 81.85  ? 362 ASN A CA    1 
ATOM   3000 C C     . ASN A 1 362 ? 41.031 18.022  43.451  1.00 77.21  ? 362 ASN A C     1 
ATOM   3001 O O     . ASN A 1 362 ? 41.288 19.102  42.905  1.00 76.71  ? 362 ASN A O     1 
ATOM   3002 C CB    . ASN A 1 362 ? 42.782 17.925  45.286  1.00 87.24  ? 362 ASN A CB    1 
ATOM   3003 C CG    . ASN A 1 362 ? 41.765 18.390  46.311  1.00 88.85  ? 362 ASN A CG    1 
ATOM   3004 O OD1   . ASN A 1 362 ? 41.933 19.453  46.919  1.00 92.72  ? 362 ASN A OD1   1 
ATOM   3005 N ND2   . ASN A 1 362 ? 40.708 17.598  46.517  1.00 87.65  ? 362 ASN A ND2   1 
ATOM   3006 N N     . ARG A 1 363 ? 39.804 17.497  43.507  1.00 74.18  ? 363 ARG A N     1 
ATOM   3007 C CA    . ARG A 1 363 ? 38.638 18.084  42.818  1.00 69.40  ? 363 ARG A CA    1 
ATOM   3008 C C     . ARG A 1 363 ? 37.432 18.128  43.747  1.00 69.07  ? 363 ARG A C     1 
ATOM   3009 O O     . ARG A 1 363 ? 37.348 17.344  44.694  1.00 71.71  ? 363 ARG A O     1 
ATOM   3010 C CB    . ARG A 1 363 ? 38.276 17.251  41.589  1.00 65.86  ? 363 ARG A CB    1 
ATOM   3011 C CG    . ARG A 1 363 ? 39.459 16.847  40.735  1.00 66.29  ? 363 ARG A CG    1 
ATOM   3012 C CD    . ARG A 1 363 ? 38.998 16.112  39.519  1.00 63.51  ? 363 ARG A CD    1 
ATOM   3013 N NE    . ARG A 1 363 ? 39.922 16.271  38.405  1.00 63.26  ? 363 ARG A NE    1 
ATOM   3014 C CZ    . ARG A 1 363 ? 40.901 15.420  38.115  1.00 65.20  ? 363 ARG A CZ    1 
ATOM   3015 N NH1   . ARG A 1 363 ? 41.105 14.336  38.858  1.00 66.07  ? 363 ARG A NH1   1 
ATOM   3016 N NH2   . ARG A 1 363 ? 41.680 15.660  37.072  1.00 65.56  ? 363 ARG A NH2   1 
ATOM   3017 N N     . ALA A 1 364 ? 36.498 19.032  43.481  1.00 66.11  ? 364 ALA A N     1 
ATOM   3018 C CA    . ALA A 1 364 ? 35.292 19.110  44.290  1.00 65.92  ? 364 ALA A CA    1 
ATOM   3019 C C     . ALA A 1 364 ? 34.352 17.920  44.042  1.00 63.92  ? 364 ALA A C     1 
ATOM   3020 O O     . ALA A 1 364 ? 33.661 17.461  44.962  1.00 65.62  ? 364 ALA A O     1 
ATOM   3021 C CB    . ALA A 1 364 ? 34.581 20.417  44.062  1.00 64.35  ? 364 ALA A CB    1 
ATOM   3022 N N     . PHE A 1 365 ? 34.348 17.404  42.814  1.00 60.50  ? 365 PHE A N     1 
ATOM   3023 C CA    . PHE A 1 365 ? 33.412 16.343  42.450  1.00 58.39  ? 365 PHE A CA    1 
ATOM   3024 C C     . PHE A 1 365 ? 34.054 15.035  42.009  1.00 58.54  ? 365 PHE A C     1 
ATOM   3025 O O     . PHE A 1 365 ? 35.054 15.017  41.295  1.00 57.98  ? 365 PHE A O     1 
ATOM   3026 C CB    . PHE A 1 365 ? 32.444 16.824  41.378  1.00 54.70  ? 365 PHE A CB    1 
ATOM   3027 C CG    . PHE A 1 365 ? 31.707 18.058  41.752  1.00 53.95  ? 365 PHE A CG    1 
ATOM   3028 C CD1   . PHE A 1 365 ? 32.199 19.310  41.400  1.00 52.89  ? 365 PHE A CD1   1 
ATOM   3029 C CD2   . PHE A 1 365 ? 30.519 17.983  42.456  1.00 54.36  ? 365 PHE A CD2   1 
ATOM   3030 C CE1   . PHE A 1 365 ? 31.516 20.470  41.743  1.00 51.45  ? 365 PHE A CE1   1 
ATOM   3031 C CE2   . PHE A 1 365 ? 29.826 19.143  42.801  1.00 53.96  ? 365 PHE A CE2   1 
ATOM   3032 C CZ    . PHE A 1 365 ? 30.332 20.386  42.446  1.00 52.88  ? 365 PHE A CZ    1 
ATOM   3033 N N     . ARG A 1 366 ? 33.447 13.944  42.460  1.00 59.84  ? 366 ARG A N     1 
ATOM   3034 C CA    . ARG A 1 366 ? 33.833 12.591  42.090  1.00 60.67  ? 366 ARG A CA    1 
ATOM   3035 C C     . ARG A 1 366 ? 33.900 12.546  40.554  1.00 57.94  ? 366 ARG A C     1 
ATOM   3036 O O     . ARG A 1 366 ? 32.930 12.926  39.886  1.00 56.04  ? 366 ARG A O     1 
ATOM   3037 C CB    . ARG A 1 366 ? 32.804 11.593  42.672  1.00 61.70  ? 366 ARG A CB    1 
ATOM   3038 C CG    . ARG A 1 366 ? 33.109 10.101  42.517  1.00 64.25  ? 366 ARG A CG    1 
ATOM   3039 C CD    . ARG A 1 366 ? 34.031 9.580   43.616  1.00 71.76  ? 366 ARG A CD    1 
ATOM   3040 N NE    . ARG A 1 366 ? 34.557 8.230   43.354  1.00 75.04  ? 366 ARG A NE    1 
ATOM   3041 C CZ    . ARG A 1 366 ? 35.666 7.952   42.655  1.00 76.65  ? 366 ARG A CZ    1 
ATOM   3042 N NH1   . ARG A 1 366 ? 36.392 8.924   42.108  1.00 76.08  ? 366 ARG A NH1   1 
ATOM   3043 N NH2   . ARG A 1 366 ? 36.055 6.688   42.490  1.00 78.34  ? 366 ARG A NH2   1 
ATOM   3044 N N     . PRO A 1 367 ? 35.070 12.165  39.987  1.00 58.15  ? 367 PRO A N     1 
ATOM   3045 C CA    . PRO A 1 367 ? 35.166 11.946  38.542  1.00 55.86  ? 367 PRO A CA    1 
ATOM   3046 C C     . PRO A 1 367 ? 34.464 10.650  38.138  1.00 54.91  ? 367 PRO A C     1 
ATOM   3047 O O     . PRO A 1 367 ? 34.128 9.840   39.003  1.00 56.01  ? 367 PRO A O     1 
ATOM   3048 C CB    . PRO A 1 367 ? 36.677 11.869  38.292  1.00 57.43  ? 367 PRO A CB    1 
ATOM   3049 C CG    . PRO A 1 367 ? 37.269 11.473  39.575  1.00 60.33  ? 367 PRO A CG    1 
ATOM   3050 C CD    . PRO A 1 367 ? 36.365 11.957  40.664  1.00 61.02  ? 367 PRO A CD    1 
ATOM   3051 N N     . PHE A 1 368 ? 34.242 10.455  36.844  1.00 53.26  ? 368 PHE A N     1 
ATOM   3052 C CA    . PHE A 1 368 ? 33.398 9.351   36.395  1.00 53.05  ? 368 PHE A CA    1 
ATOM   3053 C C     . PHE A 1 368 ? 33.870 8.720   35.100  1.00 53.02  ? 368 PHE A C     1 
ATOM   3054 O O     . PHE A 1 368 ? 34.552 9.377   34.301  1.00 52.73  ? 368 PHE A O     1 
ATOM   3055 C CB    . PHE A 1 368 ? 31.948 9.826   36.225  1.00 51.88  ? 368 PHE A CB    1 
ATOM   3056 C CG    . PHE A 1 368 ? 31.771 10.858  35.143  1.00 50.25  ? 368 PHE A CG    1 
ATOM   3057 C CD1   . PHE A 1 368 ? 31.905 12.211  35.428  1.00 49.08  ? 368 PHE A CD1   1 
ATOM   3058 C CD2   . PHE A 1 368 ? 31.476 10.477  33.843  1.00 49.91  ? 368 PHE A CD2   1 
ATOM   3059 C CE1   . PHE A 1 368 ? 31.754 13.165  34.443  1.00 47.54  ? 368 PHE A CE1   1 
ATOM   3060 C CE2   . PHE A 1 368 ? 31.323 11.435  32.847  1.00 49.70  ? 368 PHE A CE2   1 
ATOM   3061 C CZ    . PHE A 1 368 ? 31.466 12.780  33.152  1.00 48.06  ? 368 PHE A CZ    1 
ATOM   3062 N N     . ILE A 1 369 ? 33.478 7.456   34.901  1.00 53.52  ? 369 ILE A N     1 
ATOM   3063 C CA    . ILE A 1 369 ? 33.738 6.729   33.654  1.00 54.00  ? 369 ILE A CA    1 
ATOM   3064 C C     . ILE A 1 369 ? 32.576 6.832   32.661  1.00 53.32  ? 369 ILE A C     1 
ATOM   3065 O O     . ILE A 1 369 ? 31.436 6.486   32.988  1.00 53.32  ? 369 ILE A O     1 
ATOM   3066 C CB    . ILE A 1 369 ? 34.009 5.221   33.883  1.00 55.68  ? 369 ILE A CB    1 
ATOM   3067 C CG1   . ILE A 1 369 ? 35.077 5.004   34.957  1.00 57.03  ? 369 ILE A CG1   1 
ATOM   3068 C CG2   . ILE A 1 369 ? 34.394 4.552   32.559  1.00 56.51  ? 369 ILE A CG2   1 
ATOM   3069 C CD1   . ILE A 1 369 ? 35.427 3.542   35.210  1.00 58.82  ? 369 ILE A CD1   1 
ATOM   3070 N N     . GLU A 1 370 ? 32.875 7.291   31.448  1.00 53.19  ? 370 GLU A N     1 
ATOM   3071 C CA    . GLU A 1 370 ? 31.906 7.285   30.354  1.00 53.21  ? 370 GLU A CA    1 
ATOM   3072 C C     . GLU A 1 370 ? 32.552 6.715   29.109  1.00 54.51  ? 370 GLU A C     1 
ATOM   3073 O O     . GLU A 1 370 ? 33.727 6.949   28.855  1.00 55.20  ? 370 GLU A O     1 
ATOM   3074 C CB    . GLU A 1 370 ? 31.414 8.696   30.082  1.00 51.92  ? 370 GLU A CB    1 
ATOM   3075 C CG    . GLU A 1 370 ? 30.369 8.819   28.993  1.00 53.04  ? 370 GLU A CG    1 
ATOM   3076 C CD    . GLU A 1 370 ? 29.972 10.264  28.781  1.00 53.81  ? 370 GLU A CD    1 
ATOM   3077 O OE1   . GLU A 1 370 ? 29.419 10.870  29.725  1.00 53.67  ? 370 GLU A OE1   1 
ATOM   3078 O OE2   . GLU A 1 370 ? 30.232 10.806  27.686  1.00 54.35  ? 370 GLU A OE2   1 
ATOM   3079 N N     . ASN A 1 371 ? 31.789 5.952   28.341  1.00 55.47  ? 371 ASN A N     1 
ATOM   3080 C CA    . ASN A 1 371 ? 32.312 5.321   27.137  1.00 57.61  ? 371 ASN A CA    1 
ATOM   3081 C C     . ASN A 1 371 ? 33.739 4.795   27.302  1.00 58.34  ? 371 ASN A C     1 
ATOM   3082 O O     . ASN A 1 371 ? 34.609 5.041   26.469  1.00 59.73  ? 371 ASN A O     1 
ATOM   3083 C CB    . ASN A 1 371 ? 32.196 6.277   25.956  1.00 57.79  ? 371 ASN A CB    1 
ATOM   3084 C CG    . ASN A 1 371 ? 30.761 6.464   25.527  1.00 59.15  ? 371 ASN A CG    1 
ATOM   3085 O OD1   . ASN A 1 371 ? 29.928 5.574   25.735  1.00 60.48  ? 371 ASN A OD1   1 
ATOM   3086 N ND2   . ASN A 1 371 ? 30.452 7.621   24.936  1.00 58.56  ? 371 ASN A ND2   1 
ATOM   3087 N N     . GLY A 1 372 ? 33.971 4.094   28.406  1.00 57.71  ? 372 GLY A N     1 
ATOM   3088 C CA    . GLY A 1 372 ? 35.251 3.448   28.659  1.00 58.62  ? 372 GLY A CA    1 
ATOM   3089 C C     . GLY A 1 372 ? 36.433 4.352   28.957  1.00 57.98  ? 372 GLY A C     1 
ATOM   3090 O O     . GLY A 1 372 ? 37.562 3.871   29.067  1.00 59.65  ? 372 GLY A O     1 
ATOM   3091 N N     . ARG A 1 373 ? 36.206 5.656   29.075  1.00 55.71  ? 373 ARG A N     1 
ATOM   3092 C CA    . ARG A 1 373 ? 37.283 6.524   29.528  1.00 55.27  ? 373 ARG A CA    1 
ATOM   3093 C C     . ARG A 1 373 ? 36.850 7.395   30.690  1.00 53.11  ? 373 ARG A C     1 
ATOM   3094 O O     . ARG A 1 373 ? 35.659 7.552   30.940  1.00 51.71  ? 373 ARG A O     1 
ATOM   3095 C CB    . ARG A 1 373 ? 37.906 7.320   28.378  1.00 55.90  ? 373 ARG A CB    1 
ATOM   3096 C CG    . ARG A 1 373 ? 37.112 8.486   27.868  1.00 54.16  ? 373 ARG A CG    1 
ATOM   3097 C CD    . ARG A 1 373 ? 38.031 9.468   27.130  1.00 54.63  ? 373 ARG A CD    1 
ATOM   3098 N NE    . ARG A 1 373 ? 38.535 8.928   25.866  1.00 56.11  ? 373 ARG A NE    1 
ATOM   3099 C CZ    . ARG A 1 373 ? 39.759 9.130   25.391  1.00 58.09  ? 373 ARG A CZ    1 
ATOM   3100 N NH1   . ARG A 1 373 ? 40.641 9.853   26.071  1.00 57.56  ? 373 ARG A NH1   1 
ATOM   3101 N NH2   . ARG A 1 373 ? 40.105 8.595   24.230  1.00 61.26  ? 373 ARG A NH2   1 
ATOM   3102 N N     . TRP A 1 374 ? 37.824 7.923   31.422  1.00 53.42  ? 374 TRP A N     1 
ATOM   3103 C CA    . TRP A 1 374 ? 37.533 8.726   32.598  1.00 52.01  ? 374 TRP A CA    1 
ATOM   3104 C C     . TRP A 1 374 ? 37.253 10.159  32.211  1.00 50.53  ? 374 TRP A C     1 
ATOM   3105 O O     . TRP A 1 374 ? 37.619 10.609  31.124  1.00 50.51  ? 374 TRP A O     1 
ATOM   3106 C CB    . TRP A 1 374 ? 38.672 8.660   33.609  1.00 53.75  ? 374 TRP A CB    1 
ATOM   3107 C CG    . TRP A 1 374 ? 38.660 7.408   34.430  1.00 55.04  ? 374 TRP A CG    1 
ATOM   3108 C CD1   . TRP A 1 374 ? 39.165 6.199   34.075  1.00 56.50  ? 374 TRP A CD1   1 
ATOM   3109 C CD2   . TRP A 1 374 ? 38.120 7.246   35.749  1.00 54.47  ? 374 TRP A CD2   1 
ATOM   3110 N NE1   . TRP A 1 374 ? 38.976 5.292   35.083  1.00 57.72  ? 374 TRP A NE1   1 
ATOM   3111 C CE2   . TRP A 1 374 ? 38.335 5.907   36.123  1.00 56.00  ? 374 TRP A CE2   1 
ATOM   3112 C CE3   . TRP A 1 374 ? 37.474 8.105   36.648  1.00 54.00  ? 374 TRP A CE3   1 
ATOM   3113 C CZ2   . TRP A 1 374 ? 37.929 5.397   37.359  1.00 57.24  ? 374 TRP A CZ2   1 
ATOM   3114 C CZ3   . TRP A 1 374 ? 37.069 7.603   37.879  1.00 54.84  ? 374 TRP A CZ3   1 
ATOM   3115 C CH2   . TRP A 1 374 ? 37.296 6.257   38.222  1.00 57.07  ? 374 TRP A CH2   1 
ATOM   3116 N N     . TRP A 1 375 ? 36.581 10.860  33.111  1.00 49.32  ? 375 TRP A N     1 
ATOM   3117 C CA    . TRP A 1 375 ? 36.201 12.237  32.897  1.00 48.19  ? 375 TRP A CA    1 
ATOM   3118 C C     . TRP A 1 375 ? 36.154 12.964  34.241  1.00 48.04  ? 375 TRP A C     1 
ATOM   3119 O O     . TRP A 1 375 ? 35.815 12.367  35.266  1.00 48.71  ? 375 TRP A O     1 
ATOM   3120 C CB    . TRP A 1 375 ? 34.829 12.302  32.205  1.00 47.05  ? 375 TRP A CB    1 
ATOM   3121 C CG    . TRP A 1 375 ? 34.810 11.750  30.794  1.00 47.50  ? 375 TRP A CG    1 
ATOM   3122 C CD1   . TRP A 1 375 ? 34.681 10.441  30.426  1.00 48.70  ? 375 TRP A CD1   1 
ATOM   3123 C CD2   . TRP A 1 375 ? 34.908 12.498  29.579  1.00 47.00  ? 375 TRP A CD2   1 
ATOM   3124 N NE1   . TRP A 1 375 ? 34.693 10.328  29.058  1.00 49.24  ? 375 TRP A NE1   1 
ATOM   3125 C CE2   . TRP A 1 375 ? 34.839 11.575  28.512  1.00 48.87  ? 375 TRP A CE2   1 
ATOM   3126 C CE3   . TRP A 1 375 ? 35.051 13.857  29.288  1.00 47.15  ? 375 TRP A CE3   1 
ATOM   3127 C CZ2   . TRP A 1 375 ? 34.913 11.968  27.168  1.00 49.96  ? 375 TRP A CZ2   1 
ATOM   3128 C CZ3   . TRP A 1 375 ? 35.123 14.251  27.946  1.00 48.24  ? 375 TRP A CZ3   1 
ATOM   3129 C CH2   . TRP A 1 375 ? 35.056 13.304  26.905  1.00 48.97  ? 375 TRP A CH2   1 
ATOM   3130 N N     . ALA A 1 376 ? 36.491 14.247  34.233  1.00 47.32  ? 376 ALA A N     1 
ATOM   3131 C CA    . ALA A 1 376 ? 36.491 15.041  35.448  1.00 47.69  ? 376 ALA A CA    1 
ATOM   3132 C C     . ALA A 1 376 ? 35.604 16.224  35.236  1.00 45.80  ? 376 ALA A C     1 
ATOM   3133 O O     . ALA A 1 376 ? 35.445 16.677  34.112  1.00 44.80  ? 376 ALA A O     1 
ATOM   3134 C CB    . ALA A 1 376 ? 37.893 15.521  35.764  1.00 49.88  ? 376 ALA A CB    1 
ATOM   3135 N N     . PHE A 1 377 ? 35.029 16.733  36.314  1.00 45.95  ? 377 PHE A N     1 
ATOM   3136 C CA    . PHE A 1 377 ? 34.397 18.041  36.268  1.00 44.98  ? 377 PHE A CA    1 
ATOM   3137 C C     . PHE A 1 377 ? 35.436 19.050  36.752  1.00 46.77  ? 377 PHE A C     1 
ATOM   3138 O O     . PHE A 1 377 ? 36.119 18.801  37.746  1.00 49.46  ? 377 PHE A O     1 
ATOM   3139 C CB    . PHE A 1 377 ? 33.174 18.104  37.186  1.00 44.62  ? 377 PHE A CB    1 
ATOM   3140 C CG    . PHE A 1 377 ? 32.009 17.257  36.743  1.00 43.31  ? 377 PHE A CG    1 
ATOM   3141 C CD1   . PHE A 1 377 ? 31.672 16.090  37.439  1.00 44.87  ? 377 PHE A CD1   1 
ATOM   3142 C CD2   . PHE A 1 377 ? 31.222 17.632  35.666  1.00 41.37  ? 377 PHE A CD2   1 
ATOM   3143 C CE1   . PHE A 1 377 ? 30.576 15.304  37.055  1.00 43.70  ? 377 PHE A CE1   1 
ATOM   3144 C CE2   . PHE A 1 377 ? 30.125 16.850  35.269  1.00 41.08  ? 377 PHE A CE2   1 
ATOM   3145 C CZ    . PHE A 1 377 ? 29.802 15.682  35.968  1.00 42.30  ? 377 PHE A CZ    1 
ATOM   3146 N N     . GLU A 1 378 ? 35.577 20.172  36.054  1.00 45.92  ? 378 GLU A N     1 
ATOM   3147 C CA    . GLU A 1 378 ? 36.348 21.294  36.589  1.00 47.48  ? 378 GLU A CA    1 
ATOM   3148 C C     . GLU A 1 378 ? 35.517 22.561  36.648  1.00 45.55  ? 378 GLU A C     1 
ATOM   3149 O O     . GLU A 1 378 ? 34.421 22.624  36.087  1.00 43.24  ? 378 GLU A O     1 
ATOM   3150 C CB    . GLU A 1 378 ? 37.629 21.558  35.788  1.00 49.16  ? 378 GLU A CB    1 
ATOM   3151 C CG    . GLU A 1 378 ? 38.922 21.212  36.524  1.00 54.80  ? 378 GLU A CG    1 
ATOM   3152 C CD    . GLU A 1 378 ? 39.276 19.740  36.377  1.00 58.65  ? 378 GLU A CD    1 
ATOM   3153 O OE1   . GLU A 1 378 ? 39.775 19.124  37.353  1.00 61.37  ? 378 GLU A OE1   1 
ATOM   3154 O OE2   . GLU A 1 378 ? 39.039 19.198  35.271  1.00 59.07  ? 378 GLU A OE2   1 
ATOM   3155 N N     . MET A 1 379 ? 36.066 23.560  37.337  1.00 46.47  ? 379 MET A N     1 
ATOM   3156 C CA    . MET A 1 379 ? 35.461 24.875  37.455  1.00 44.95  ? 379 MET A CA    1 
ATOM   3157 C C     . MET A 1 379 ? 36.129 25.819  36.491  1.00 43.69  ? 379 MET A C     1 
ATOM   3158 O O     . MET A 1 379 ? 37.355 25.855  36.387  1.00 45.57  ? 379 MET A O     1 
ATOM   3159 C CB    . MET A 1 379 ? 35.632 25.446  38.870  1.00 48.20  ? 379 MET A CB    1 
ATOM   3160 C CG    . MET A 1 379 ? 34.988 24.643  40.004  1.00 49.96  ? 379 MET A CG    1 
ATOM   3161 S SD    . MET A 1 379 ? 33.242 24.220  39.784  1.00 50.57  ? 379 MET A SD    1 
ATOM   3162 C CE    . MET A 1 379 ? 32.728 24.071  41.512  1.00 51.35  ? 379 MET A CE    1 
ATOM   3163 N N     . ARG A 1 380 ? 35.312 26.595  35.792  1.00 40.54  ? 380 ARG A N     1 
ATOM   3164 C CA    . ARG A 1 380 ? 35.808 27.715  35.019  1.00 39.07  ? 380 ARG A CA    1 
ATOM   3165 C C     . ARG A 1 380 ? 36.225 28.826  35.982  1.00 40.53  ? 380 ARG A C     1 
ATOM   3166 O O     . ARG A 1 380 ? 35.789 28.849  37.133  1.00 41.10  ? 380 ARG A O     1 
ATOM   3167 C CB    . ARG A 1 380 ? 34.735 28.218  34.063  1.00 36.55  ? 380 ARG A CB    1 
ATOM   3168 C CG    . ARG A 1 380 ? 34.482 27.346  32.874  1.00 32.64  ? 380 ARG A CG    1 
ATOM   3169 C CD    . ARG A 1 380 ? 33.398 27.957  32.004  1.00 28.27  ? 380 ARG A CD    1 
ATOM   3170 N NE    . ARG A 1 380 ? 33.129 27.096  30.871  1.00 25.72  ? 380 ARG A NE    1 
ATOM   3171 C CZ    . ARG A 1 380 ? 32.225 26.128  30.876  1.00 27.49  ? 380 ARG A CZ    1 
ATOM   3172 N NH1   . ARG A 1 380 ? 31.473 25.908  31.941  1.00 29.11  ? 380 ARG A NH1   1 
ATOM   3173 N NH2   . ARG A 1 380 ? 32.066 25.362  29.816  1.00 28.02  ? 380 ARG A NH2   1 
ATOM   3174 N N     . LYS A 1 381 ? 37.075 29.727  35.505  1.00 40.96  ? 381 LYS A N     1 
ATOM   3175 C CA    . LYS A 1 381 ? 37.537 30.850  36.309  1.00 43.24  ? 381 LYS A CA    1 
ATOM   3176 C C     . LYS A 1 381 ? 36.778 32.091  35.890  1.00 41.99  ? 381 LYS A C     1 
ATOM   3177 O O     . LYS A 1 381 ? 36.904 33.145  36.496  1.00 43.93  ? 381 LYS A O     1 
ATOM   3178 C CB    . LYS A 1 381 ? 39.049 31.055  36.180  1.00 45.52  ? 381 LYS A CB    1 
ATOM   3179 C CG    . LYS A 1 381 ? 39.851 30.125  37.053  1.00 49.14  ? 381 LYS A CG    1 
ATOM   3180 C CD    . LYS A 1 381 ? 41.313 30.548  37.214  1.00 56.32  ? 381 LYS A CD    1 
ATOM   3181 C CE    . LYS A 1 381 ? 42.216 29.939  36.141  1.00 58.76  ? 381 LYS A CE    1 
ATOM   3182 N NZ    . LYS A 1 381 ? 42.069 28.451  36.074  1.00 59.57  ? 381 LYS A NZ    1 
ATOM   3183 N N     . PHE A 1 382 ? 35.993 31.956  34.830  1.00 39.49  ? 382 PHE A N     1 
ATOM   3184 C CA    . PHE A 1 382 ? 35.129 33.038  34.351  1.00 37.94  ? 382 PHE A CA    1 
ATOM   3185 C C     . PHE A 1 382 ? 33.867 32.392  33.807  1.00 35.79  ? 382 PHE A C     1 
ATOM   3186 O O     . PHE A 1 382 ? 33.928 31.286  33.251  1.00 35.16  ? 382 PHE A O     1 
ATOM   3187 C CB    . PHE A 1 382 ? 35.815 33.911  33.287  1.00 37.26  ? 382 PHE A CB    1 
ATOM   3188 C CG    . PHE A 1 382 ? 36.606 33.137  32.271  1.00 36.57  ? 382 PHE A CG    1 
ATOM   3189 C CD1   . PHE A 1 382 ? 35.974 32.527  31.179  1.00 35.30  ? 382 PHE A CD1   1 
ATOM   3190 C CD2   . PHE A 1 382 ? 37.979 33.015  32.393  1.00 37.36  ? 382 PHE A CD2   1 
ATOM   3191 C CE1   . PHE A 1 382 ? 36.704 31.798  30.235  1.00 34.30  ? 382 PHE A CE1   1 
ATOM   3192 C CE2   . PHE A 1 382 ? 38.718 32.297  31.462  1.00 37.73  ? 382 PHE A CE2   1 
ATOM   3193 C CZ    . PHE A 1 382 ? 38.079 31.685  30.375  1.00 36.66  ? 382 PHE A CZ    1 
ATOM   3194 N N     . THR A 1 383 ? 32.731 33.063  33.989  1.00 35.24  ? 383 THR A N     1 
ATOM   3195 C CA    . THR A 1 383 ? 31.451 32.552  33.500  1.00 33.52  ? 383 THR A CA    1 
ATOM   3196 C C     . THR A 1 383 ? 30.760 33.430  32.452  1.00 32.66  ? 383 THR A C     1 
ATOM   3197 O O     . THR A 1 383 ? 29.788 32.993  31.848  1.00 32.13  ? 383 THR A O     1 
ATOM   3198 C CB    . THR A 1 383 ? 30.468 32.281  34.647  1.00 34.18  ? 383 THR A CB    1 
ATOM   3199 O OG1   . THR A 1 383 ? 30.202 33.502  35.342  1.00 35.30  ? 383 THR A OG1   1 
ATOM   3200 C CG2   . THR A 1 383 ? 31.034 31.224  35.621  1.00 35.09  ? 383 THR A CG2   1 
ATOM   3201 N N     . THR A 1 384 ? 31.240 34.656  32.237  1.00 33.94  ? 384 THR A N     1 
ATOM   3202 C CA    . THR A 1 384 ? 30.646 35.526  31.226  1.00 32.50  ? 384 THR A CA    1 
ATOM   3203 C C     . THR A 1 384 ? 31.720 35.883  30.208  1.00 31.54  ? 384 THR A C     1 
ATOM   3204 O O     . THR A 1 384 ? 32.909 35.884  30.560  1.00 31.81  ? 384 THR A O     1 
ATOM   3205 C CB    . THR A 1 384 ? 30.062 36.824  31.831  1.00 33.08  ? 384 THR A CB    1 
ATOM   3206 O OG1   . THR A 1 384 ? 31.123 37.706  32.214  1.00 33.36  ? 384 THR A OG1   1 
ATOM   3207 C CG2   . THR A 1 384 ? 29.198 36.527  33.043  1.00 33.91  ? 384 THR A CG2   1 
ATOM   3208 N N     . PRO A 1 385 ? 31.321 36.178  28.945  1.00 30.14  ? 385 PRO A N     1 
ATOM   3209 C CA    . PRO A 1 385 ? 32.356 36.477  27.974  1.00 29.37  ? 385 PRO A CA    1 
ATOM   3210 C C     . PRO A 1 385 ? 33.150 37.755  28.313  1.00 30.23  ? 385 PRO A C     1 
ATOM   3211 O O     . PRO A 1 385 ? 34.333 37.832  27.971  1.00 30.48  ? 385 PRO A O     1 
ATOM   3212 C CB    . PRO A 1 385 ? 31.594 36.597  26.646  1.00 28.32  ? 385 PRO A CB    1 
ATOM   3213 C CG    . PRO A 1 385 ? 30.188 36.689  26.966  1.00 27.62  ? 385 PRO A CG    1 
ATOM   3214 C CD    . PRO A 1 385 ? 29.969 36.234  28.359  1.00 29.72  ? 385 PRO A CD    1 
ATOM   3215 N N     . GLU A 1 386 ? 32.543 38.727  29.000  1.00 30.89  ? 386 GLU A N     1 
ATOM   3216 C CA    . GLU A 1 386 ? 33.299 39.918  29.422  1.00 31.81  ? 386 GLU A CA    1 
ATOM   3217 C C     . GLU A 1 386 ? 34.421 39.547  30.373  1.00 32.67  ? 386 GLU A C     1 
ATOM   3218 O O     . GLU A 1 386 ? 35.525 40.061  30.262  1.00 33.43  ? 386 GLU A O     1 
ATOM   3219 C CB    . GLU A 1 386 ? 32.425 40.995  30.067  1.00 32.16  ? 386 GLU A CB    1 
ATOM   3220 C CG    . GLU A 1 386 ? 31.391 41.580  29.153  1.00 32.85  ? 386 GLU A CG    1 
ATOM   3221 C CD    . GLU A 1 386 ? 30.071 40.812  29.156  1.00 35.28  ? 386 GLU A CD    1 
ATOM   3222 O OE1   . GLU A 1 386 ? 30.073 39.571  29.336  1.00 36.40  ? 386 GLU A OE1   1 
ATOM   3223 O OE2   . GLU A 1 386 ? 29.015 41.460  28.978  1.00 37.82  ? 386 GLU A OE2   1 
ATOM   3224 N N     . GLU A 1 387 ? 34.148 38.642  31.298  1.00 33.59  ? 387 GLU A N     1 
ATOM   3225 C CA    . GLU A 1 387 ? 35.171 38.237  32.255  1.00 34.67  ? 387 GLU A CA    1 
ATOM   3226 C C     . GLU A 1 387 ? 36.236 37.485  31.500  1.00 33.48  ? 387 GLU A C     1 
ATOM   3227 O O     . GLU A 1 387 ? 37.429 37.743  31.685  1.00 34.59  ? 387 GLU A O     1 
ATOM   3228 C CB    . GLU A 1 387 ? 34.590 37.393  33.400  1.00 35.89  ? 387 GLU A CB    1 
ATOM   3229 C CG    . GLU A 1 387 ? 33.631 38.157  34.288  1.00 37.86  ? 387 GLU A CG    1 
ATOM   3230 C CD    . GLU A 1 387 ? 32.941 37.264  35.296  1.00 43.17  ? 387 GLU A CD    1 
ATOM   3231 O OE1   . GLU A 1 387 ? 33.332 36.076  35.398  1.00 45.68  ? 387 GLU A OE1   1 
ATOM   3232 O OE2   . GLU A 1 387 ? 32.012 37.742  35.999  1.00 45.18  ? 387 GLU A OE2   1 
ATOM   3233 N N     . GLY A 1 388 ? 35.800 36.589  30.625  1.00 31.81  ? 388 GLY A N     1 
ATOM   3234 C CA    . GLY A 1 388 ? 36.713 35.871  29.752  1.00 30.80  ? 388 GLY A CA    1 
ATOM   3235 C C     . GLY A 1 388 ? 37.687 36.819  29.073  1.00 29.95  ? 388 GLY A C     1 
ATOM   3236 O O     . GLY A 1 388 ? 38.895 36.611  29.123  1.00 30.69  ? 388 GLY A O     1 
ATOM   3237 N N     . VAL A 1 389 ? 37.198 37.878  28.450  1.00 28.57  ? 389 VAL A N     1 
ATOM   3238 C CA    . VAL A 1 389 ? 38.140 38.688  27.698  1.00 28.67  ? 389 VAL A CA    1 
ATOM   3239 C C     . VAL A 1 389 ? 38.977 39.594  28.593  1.00 29.41  ? 389 VAL A C     1 
ATOM   3240 O O     . VAL A 1 389 ? 40.085 39.941  28.221  1.00 29.68  ? 389 VAL A O     1 
ATOM   3241 C CB    . VAL A 1 389 ? 37.516 39.430  26.497  1.00 27.62  ? 389 VAL A CB    1 
ATOM   3242 C CG1   . VAL A 1 389 ? 36.962 38.434  25.503  1.00 27.73  ? 389 VAL A CG1   1 
ATOM   3243 C CG2   . VAL A 1 389 ? 36.404 40.255  26.953  1.00 30.21  ? 389 VAL A CG2   1 
ATOM   3244 N N     . ARG A 1 390 ? 38.467 39.954  29.774  1.00 30.26  ? 390 ARG A N     1 
ATOM   3245 C CA    . ARG A 1 390 ? 39.264 40.695  30.756  1.00 30.98  ? 390 ARG A CA    1 
ATOM   3246 C C     . ARG A 1 390 ? 40.509 39.891  31.109  1.00 31.37  ? 390 ARG A C     1 
ATOM   3247 O O     . ARG A 1 390 ? 41.588 40.462  31.297  1.00 31.81  ? 390 ARG A O     1 
ATOM   3248 C CB    . ARG A 1 390 ? 38.484 40.969  32.045  1.00 32.34  ? 390 ARG A CB    1 
ATOM   3249 C CG    . ARG A 1 390 ? 39.167 42.029  32.901  1.00 33.78  ? 390 ARG A CG    1 
ATOM   3250 C CD    . ARG A 1 390 ? 39.206 41.663  34.349  1.00 37.55  ? 390 ARG A CD    1 
ATOM   3251 N NE    . ARG A 1 390 ? 37.891 41.697  34.982  1.00 38.96  ? 390 ARG A NE    1 
ATOM   3252 C CZ    . ARG A 1 390 ? 37.216 40.619  35.359  1.00 40.27  ? 390 ARG A CZ    1 
ATOM   3253 N NH1   . ARG A 1 390 ? 37.731 39.407  35.171  1.00 40.54  ? 390 ARG A NH1   1 
ATOM   3254 N NH2   . ARG A 1 390 ? 36.023 40.751  35.933  1.00 41.94  ? 390 ARG A NH2   1 
ATOM   3255 N N     . SER A 1 391 ? 40.338 38.571  31.206  1.00 30.56  ? 391 SER A N     1 
ATOM   3256 C CA    . SER A 1 391 ? 41.439 37.665  31.476  1.00 30.90  ? 391 SER A CA    1 
ATOM   3257 C C     . SER A 1 391 ? 42.333 37.503  30.260  1.00 29.95  ? 391 SER A C     1 
ATOM   3258 O O     . SER A 1 391 ? 43.561 37.658  30.360  1.00 30.66  ? 391 SER A O     1 
ATOM   3259 C CB    . SER A 1 391 ? 40.915 36.299  31.905  1.00 31.32  ? 391 SER A CB    1 
ATOM   3260 O OG    . SER A 1 391 ? 41.940 35.334  31.808  1.00 32.32  ? 391 SER A OG    1 
ATOM   3261 N N     . TYR A 1 392 ? 41.710 37.177  29.123  1.00 28.04  ? 392 TYR A N     1 
ATOM   3262 C CA    . TYR A 1 392 ? 42.440 36.919  27.901  1.00 26.99  ? 392 TYR A CA    1 
ATOM   3263 C C     . TYR A 1 392 ? 43.333 38.091  27.483  1.00 26.66  ? 392 TYR A C     1 
ATOM   3264 O O     . TYR A 1 392 ? 44.504 37.887  27.220  1.00 27.35  ? 392 TYR A O     1 
ATOM   3265 C CB    . TYR A 1 392 ? 41.507 36.512  26.754  1.00 25.94  ? 392 TYR A CB    1 
ATOM   3266 C CG    . TYR A 1 392 ? 42.264 36.241  25.460  1.00 25.43  ? 392 TYR A CG    1 
ATOM   3267 C CD1   . TYR A 1 392 ? 43.021 35.079  25.298  1.00 26.92  ? 392 TYR A CD1   1 
ATOM   3268 C CD2   . TYR A 1 392 ? 42.243 37.156  24.409  1.00 24.56  ? 392 TYR A CD2   1 
ATOM   3269 C CE1   . TYR A 1 392 ? 43.738 34.832  24.102  1.00 27.93  ? 392 TYR A CE1   1 
ATOM   3270 C CE2   . TYR A 1 392 ? 42.947 36.918  23.206  1.00 24.07  ? 392 TYR A CE2   1 
ATOM   3271 C CZ    . TYR A 1 392 ? 43.695 35.765  23.069  1.00 26.06  ? 392 TYR A CZ    1 
ATOM   3272 O OH    . TYR A 1 392 ? 44.390 35.533  21.912  1.00 26.16  ? 392 TYR A OH    1 
ATOM   3273 N N     . ALA A 1 393 ? 42.780 39.299  27.441  1.00 25.65  ? 393 ALA A N     1 
ATOM   3274 C CA    . ALA A 1 393 ? 43.511 40.486  27.006  1.00 25.97  ? 393 ALA A CA    1 
ATOM   3275 C C     . ALA A 1 393 ? 44.612 40.913  27.976  1.00 27.74  ? 393 ALA A C     1 
ATOM   3276 O O     . ALA A 1 393 ? 45.648 41.439  27.556  1.00 28.55  ? 393 ALA A O     1 
ATOM   3277 C CB    . ALA A 1 393 ? 42.556 41.641  26.758  1.00 25.18  ? 393 ALA A CB    1 
ATOM   3278 N N     . SER A 1 394 ? 44.383 40.707  29.270  1.00 28.82  ? 394 SER A N     1 
ATOM   3279 C CA    . SER A 1 394 ? 45.409 40.951  30.284  1.00 30.27  ? 394 SER A CA    1 
ATOM   3280 C C     . SER A 1 394 ? 46.615 40.035  30.132  1.00 31.06  ? 394 SER A C     1 
ATOM   3281 O O     . SER A 1 394 ? 47.736 40.464  30.329  1.00 32.41  ? 394 SER A O     1 
ATOM   3282 C CB    . SER A 1 394 ? 44.825 40.787  31.678  1.00 31.00  ? 394 SER A CB    1 
ATOM   3283 O OG    . SER A 1 394 ? 43.707 41.629  31.831  1.00 29.50  ? 394 SER A OG    1 
ATOM   3284 N N     . THR A 1 395 ? 46.387 38.784  29.761  1.00 31.03  ? 395 THR A N     1 
ATOM   3285 C CA    . THR A 1 395 ? 47.463 37.790  29.742  1.00 32.76  ? 395 THR A CA    1 
ATOM   3286 C C     . THR A 1 395 ? 48.026 37.476  28.349  1.00 32.14  ? 395 THR A C     1 
ATOM   3287 O O     . THR A 1 395 ? 49.112 36.928  28.236  1.00 33.53  ? 395 THR A O     1 
ATOM   3288 C CB    . THR A 1 395 ? 47.019 36.481  30.427  1.00 33.19  ? 395 THR A CB    1 
ATOM   3289 O OG1   . THR A 1 395 ? 45.878 35.949  29.745  1.00 33.62  ? 395 THR A OG1   1 
ATOM   3290 C CG2   . THR A 1 395 ? 46.621 36.746  31.874  1.00 35.55  ? 395 THR A CG2   1 
ATOM   3291 N N     . HIS A 1 396 ? 47.295 37.820  27.296  1.00 30.64  ? 396 HIS A N     1 
ATOM   3292 C CA    . HIS A 1 396 ? 47.740 37.562  25.939  1.00 29.93  ? 396 HIS A CA    1 
ATOM   3293 C C     . HIS A 1 396 ? 47.877 38.820  25.099  1.00 29.55  ? 396 HIS A C     1 
ATOM   3294 O O     . HIS A 1 396 ? 47.862 38.734  23.864  1.00 29.03  ? 396 HIS A O     1 
ATOM   3295 C CB    . HIS A 1 396 ? 46.743 36.671  25.230  1.00 28.77  ? 396 HIS A CB    1 
ATOM   3296 C CG    . HIS A 1 396 ? 46.647 35.303  25.803  1.00 29.74  ? 396 HIS A CG    1 
ATOM   3297 N ND1   . HIS A 1 396 ? 47.149 34.191  25.160  1.00 30.21  ? 396 HIS A ND1   1 
ATOM   3298 C CD2   . HIS A 1 396 ? 46.095 34.859  26.954  1.00 28.70  ? 396 HIS A CD2   1 
ATOM   3299 C CE1   . HIS A 1 396 ? 46.905 33.121  25.891  1.00 29.91  ? 396 HIS A CE1   1 
ATOM   3300 N NE2   . HIS A 1 396 ? 46.264 33.498  26.982  1.00 29.05  ? 396 HIS A NE2   1 
ATOM   3301 N N     . TRP A 1 397 ? 48.002 39.982  25.733  1.00 29.84  ? 397 TRP A N     1 
ATOM   3302 C CA    . TRP A 1 397 ? 48.202 41.225  24.984  1.00 29.87  ? 397 TRP A CA    1 
ATOM   3303 C C     . TRP A 1 397 ? 49.301 41.128  23.930  1.00 30.84  ? 397 TRP A C     1 
ATOM   3304 O O     . TRP A 1 397 ? 49.159 41.686  22.856  1.00 30.63  ? 397 TRP A O     1 
ATOM   3305 C CB    . TRP A 1 397 ? 48.493 42.385  25.920  1.00 30.48  ? 397 TRP A CB    1 
ATOM   3306 C CG    . TRP A 1 397 ? 49.737 42.179  26.681  1.00 31.73  ? 397 TRP A CG    1 
ATOM   3307 C CD1   . TRP A 1 397 ? 49.858 41.652  27.933  1.00 32.03  ? 397 TRP A CD1   1 
ATOM   3308 C CD2   . TRP A 1 397 ? 51.055 42.460  26.232  1.00 31.89  ? 397 TRP A CD2   1 
ATOM   3309 N NE1   . TRP A 1 397 ? 51.177 41.611  28.304  1.00 32.50  ? 397 TRP A NE1   1 
ATOM   3310 C CE2   . TRP A 1 397 ? 51.937 42.098  27.276  1.00 33.54  ? 397 TRP A CE2   1 
ATOM   3311 C CE3   . TRP A 1 397 ? 51.581 42.999  25.055  1.00 31.76  ? 397 TRP A CE3   1 
ATOM   3312 C CZ2   . TRP A 1 397 ? 53.321 42.242  27.172  1.00 34.39  ? 397 TRP A CZ2   1 
ATOM   3313 C CZ3   . TRP A 1 397 ? 52.957 43.149  24.953  1.00 33.72  ? 397 TRP A CZ3   1 
ATOM   3314 C CH2   . TRP A 1 397 ? 53.811 42.771  26.010  1.00 34.83  ? 397 TRP A CH2   1 
ATOM   3315 N N     . HIS A 1 398 ? 50.388 40.417  24.207  1.00 32.98  ? 398 HIS A N     1 
ATOM   3316 C CA    . HIS A 1 398 ? 51.449 40.353  23.211  1.00 34.56  ? 398 HIS A CA    1 
ATOM   3317 C C     . HIS A 1 398 ? 50.963 39.837  21.863  1.00 33.55  ? 398 HIS A C     1 
ATOM   3318 O O     . HIS A 1 398 ? 51.398 40.328  20.830  1.00 34.07  ? 398 HIS A O     1 
ATOM   3319 C CB    . HIS A 1 398 ? 52.705 39.598  23.669  1.00 36.52  ? 398 HIS A CB    1 
ATOM   3320 C CG    . HIS A 1 398 ? 53.938 39.962  22.879  1.00 40.40  ? 398 HIS A CG    1 
ATOM   3321 N ND1   . HIS A 1 398 ? 53.993 39.900  21.498  1.00 42.25  ? 398 HIS A ND1   1 
ATOM   3322 C CD2   . HIS A 1 398 ? 55.156 40.408  23.277  1.00 43.37  ? 398 HIS A CD2   1 
ATOM   3323 C CE1   . HIS A 1 398 ? 55.189 40.283  21.083  1.00 43.49  ? 398 HIS A CE1   1 
ATOM   3324 N NE2   . HIS A 1 398 ? 55.915 40.595  22.142  1.00 45.10  ? 398 HIS A NE2   1 
ATOM   3325 N N     . THR A 1 399 ? 50.061 38.863  21.864  1.00 32.85  ? 399 THR A N     1 
ATOM   3326 C CA    . THR A 1 399 ? 49.530 38.326  20.606  1.00 31.79  ? 399 THR A CA    1 
ATOM   3327 C C     . THR A 1 399 ? 48.619 39.310  19.852  1.00 30.64  ? 399 THR A C     1 
ATOM   3328 O O     . THR A 1 399 ? 48.233 39.057  18.717  1.00 30.92  ? 399 THR A O     1 
ATOM   3329 C CB    . THR A 1 399 ? 48.799 36.971  20.814  1.00 31.32  ? 399 THR A CB    1 
ATOM   3330 O OG1   . THR A 1 399 ? 48.765 36.261  19.580  1.00 31.50  ? 399 THR A OG1   1 
ATOM   3331 C CG2   . THR A 1 399 ? 47.388 37.170  21.292  1.00 29.59  ? 399 THR A CG2   1 
ATOM   3332 N N     . LEU A 1 400 ? 48.280 40.437  20.455  1.00 29.86  ? 400 LEU A N     1 
ATOM   3333 C CA    . LEU A 1 400 ? 47.198 41.216  19.885  1.00 28.66  ? 400 LEU A CA    1 
ATOM   3334 C C     . LEU A 1 400 ? 47.611 42.277  18.859  1.00 29.15  ? 400 LEU A C     1 
ATOM   3335 O O     . LEU A 1 400 ? 46.856 43.214  18.619  1.00 29.49  ? 400 LEU A O     1 
ATOM   3336 C CB    . LEU A 1 400 ? 46.302 41.787  20.992  1.00 28.00  ? 400 LEU A CB    1 
ATOM   3337 C CG    . LEU A 1 400 ? 45.563 40.742  21.867  1.00 27.01  ? 400 LEU A CG    1 
ATOM   3338 C CD1   . LEU A 1 400 ? 44.606 41.359  22.877  1.00 23.61  ? 400 LEU A CD1   1 
ATOM   3339 C CD2   . LEU A 1 400 ? 44.798 39.759  21.024  1.00 25.33  ? 400 LEU A CD2   1 
ATOM   3340 N N     . GLY A 1 401 ? 48.768 42.112  18.218  1.00 29.47  ? 401 GLY A N     1 
ATOM   3341 C CA    . GLY A 1 401 ? 49.299 43.144  17.325  1.00 29.57  ? 401 GLY A CA    1 
ATOM   3342 C C     . GLY A 1 401 ? 50.368 43.901  18.091  1.00 31.19  ? 401 GLY A C     1 
ATOM   3343 O O     . GLY A 1 401 ? 50.224 44.144  19.306  1.00 31.39  ? 401 GLY A O     1 
ATOM   3344 N N     . LYS A 1 402 ? 51.465 44.247  17.417  1.00 31.63  ? 402 LYS A N     1 
ATOM   3345 C CA    . LYS A 1 402 ? 52.600 44.843  18.111  1.00 32.55  ? 402 LYS A CA    1 
ATOM   3346 C C     . LYS A 1 402 ? 52.212 46.156  18.808  1.00 32.56  ? 402 LYS A C     1 
ATOM   3347 O O     . LYS A 1 402 ? 52.521 46.335  19.994  1.00 33.04  ? 402 LYS A O     1 
ATOM   3348 C CB    . LYS A 1 402 ? 53.782 45.040  17.169  1.00 33.86  ? 402 LYS A CB    1 
ATOM   3349 C CG    . LYS A 1 402 ? 54.875 45.926  17.722  1.00 36.21  ? 402 LYS A CG    1 
ATOM   3350 C CD    . LYS A 1 402 ? 56.236 45.583  17.123  1.00 39.42  ? 402 LYS A CD    1 
ATOM   3351 C CE    . LYS A 1 402 ? 57.335 46.485  17.667  1.00 40.54  ? 402 LYS A CE    1 
ATOM   3352 N NZ    . LYS A 1 402 ? 57.469 46.321  19.136  1.00 41.12  ? 402 LYS A NZ    1 
ATOM   3353 N N     . ASN A 1 403 ? 51.519 47.050  18.092  1.00 31.56  ? 403 ASN A N     1 
ATOM   3354 C CA    . ASN A 1 403 ? 51.145 48.340  18.664  1.00 31.41  ? 403 ASN A CA    1 
ATOM   3355 C C     . ASN A 1 403 ? 49.896 48.329  19.503  1.00 30.14  ? 403 ASN A C     1 
ATOM   3356 O O     . ASN A 1 403 ? 49.916 48.808  20.647  1.00 31.52  ? 403 ASN A O     1 
ATOM   3357 C CB    . ASN A 1 403 ? 51.062 49.416  17.607  1.00 32.01  ? 403 ASN A CB    1 
ATOM   3358 C CG    . ASN A 1 403 ? 52.352 49.582  16.880  1.00 33.67  ? 403 ASN A CG    1 
ATOM   3359 O OD1   . ASN A 1 403 ? 53.411 49.623  17.499  1.00 34.60  ? 403 ASN A OD1   1 
ATOM   3360 N ND2   . ASN A 1 403 ? 52.287 49.640  15.550  1.00 35.39  ? 403 ASN A ND2   1 
ATOM   3361 N N     . VAL A 1 404 ? 48.810 47.789  18.973  1.00 28.14  ? 404 VAL A N     1 
ATOM   3362 C CA    . VAL A 1 404 ? 47.633 47.591  19.822  1.00 26.58  ? 404 VAL A CA    1 
ATOM   3363 C C     . VAL A 1 404 ? 47.939 46.663  21.005  1.00 26.40  ? 404 VAL A C     1 
ATOM   3364 O O     . VAL A 1 404 ? 47.403 46.848  22.082  1.00 26.43  ? 404 VAL A O     1 
ATOM   3365 C CB    . VAL A 1 404 ? 46.360 47.114  19.054  1.00 25.25  ? 404 VAL A CB    1 
ATOM   3366 C CG1   . VAL A 1 404 ? 46.312 47.670  17.655  1.00 24.40  ? 404 VAL A CG1   1 
ATOM   3367 C CG2   . VAL A 1 404 ? 46.257 45.618  19.038  1.00 23.79  ? 404 VAL A CG2   1 
ATOM   3368 N N     . GLY A 1 405 ? 48.804 45.679  20.816  1.00 26.65  ? 405 GLY A N     1 
ATOM   3369 C CA    . GLY A 1 405 ? 49.141 44.776  21.909  1.00 27.69  ? 405 GLY A CA    1 
ATOM   3370 C C     . GLY A 1 405 ? 49.761 45.551  23.061  1.00 29.70  ? 405 GLY A C     1 
ATOM   3371 O O     . GLY A 1 405 ? 49.340 45.387  24.218  1.00 29.61  ? 405 GLY A O     1 
ATOM   3372 N N     . GLU A 1 406 ? 50.752 46.398  22.727  1.00 31.08  ? 406 GLU A N     1 
ATOM   3373 C CA    . GLU A 1 406 ? 51.433 47.289  23.669  1.00 33.46  ? 406 GLU A CA    1 
ATOM   3374 C C     . GLU A 1 406 ? 50.446 48.271  24.269  1.00 32.31  ? 406 GLU A C     1 
ATOM   3375 O O     . GLU A 1 406 ? 50.616 48.697  25.411  1.00 33.57  ? 406 GLU A O     1 
ATOM   3376 C CB    . GLU A 1 406 ? 52.520 48.119  22.988  1.00 34.69  ? 406 GLU A CB    1 
ATOM   3377 C CG    . GLU A 1 406 ? 53.875 47.457  22.701  1.00 38.53  ? 406 GLU A CG    1 
ATOM   3378 C CD    . GLU A 1 406 ? 54.880 48.426  21.984  1.00 40.51  ? 406 GLU A CD    1 
ATOM   3379 O OE1   . GLU A 1 406 ? 56.044 48.539  22.458  1.00 46.20  ? 406 GLU A OE1   1 
ATOM   3380 O OE2   . GLU A 1 406 ? 54.512 49.076  20.952  1.00 44.08  ? 406 GLU A OE2   1 
ATOM   3381 N N     . SER A 1 407 ? 49.424 48.647  23.506  1.00 30.36  ? 407 SER A N     1 
ATOM   3382 C CA    . SER A 1 407 ? 48.435 49.578  24.029  1.00 29.73  ? 407 SER A CA    1 
ATOM   3383 C C     . SER A 1 407 ? 47.549 48.918  25.065  1.00 28.88  ? 407 SER A C     1 
ATOM   3384 O O     . SER A 1 407 ? 47.443 49.400  26.188  1.00 29.55  ? 407 SER A O     1 
ATOM   3385 C CB    . SER A 1 407 ? 47.594 50.199  22.924  1.00 28.86  ? 407 SER A CB    1 
ATOM   3386 O OG    . SER A 1 407 ? 46.901 51.324  23.447  1.00 29.17  ? 407 SER A OG    1 
ATOM   3387 N N     . ILE A 1 408 ? 46.926 47.814  24.673  1.00 27.33  ? 408 ILE A N     1 
ATOM   3388 C CA    . ILE A 1 408 ? 46.096 47.010  25.563  1.00 27.07  ? 408 ILE A CA    1 
ATOM   3389 C C     . ILE A 1 408 ? 46.807 46.702  26.884  1.00 28.81  ? 408 ILE A C     1 
ATOM   3390 O O     . ILE A 1 408 ? 46.203 46.816  27.943  1.00 29.43  ? 408 ILE A O     1 
ATOM   3391 C CB    . ILE A 1 408 ? 45.606 45.722  24.851  1.00 25.83  ? 408 ILE A CB    1 
ATOM   3392 C CG1   . ILE A 1 408 ? 44.603 46.093  23.742  1.00 24.87  ? 408 ILE A CG1   1 
ATOM   3393 C CG2   . ILE A 1 408 ? 45.003 44.694  25.848  1.00 25.30  ? 408 ILE A CG2   1 
ATOM   3394 C CD1   . ILE A 1 408 ? 44.263 44.967  22.762  1.00 23.10  ? 408 ILE A CD1   1 
ATOM   3395 N N     . ARG A 1 409 ? 48.090 46.351  26.833  1.00 30.05  ? 409 ARG A N     1 
ATOM   3396 C CA    . ARG A 1 409 ? 48.847 46.073  28.055  1.00 31.95  ? 409 ARG A CA    1 
ATOM   3397 C C     . ARG A 1 409 ? 48.829 47.250  29.021  1.00 33.74  ? 409 ARG A C     1 
ATOM   3398 O O     . ARG A 1 409 ? 48.585 47.081  30.214  1.00 34.97  ? 409 ARG A O     1 
ATOM   3399 C CB    . ARG A 1 409 ? 50.287 45.715  27.723  1.00 32.88  ? 409 ARG A CB    1 
ATOM   3400 C CG    . ARG A 1 409 ? 51.163 45.490  28.935  1.00 35.77  ? 409 ARG A CG    1 
ATOM   3401 C CD    . ARG A 1 409 ? 52.634 45.478  28.556  1.00 39.89  ? 409 ARG A CD    1 
ATOM   3402 N NE    . ARG A 1 409 ? 53.397 44.683  29.515  1.00 45.03  ? 409 ARG A NE    1 
ATOM   3403 C CZ    . ARG A 1 409 ? 54.698 44.406  29.419  1.00 46.86  ? 409 ARG A CZ    1 
ATOM   3404 N NH1   . ARG A 1 409 ? 55.282 43.650  30.343  1.00 48.19  ? 409 ARG A NH1   1 
ATOM   3405 N NH2   . ARG A 1 409 ? 55.414 44.872  28.402  1.00 46.93  ? 409 ARG A NH2   1 
ATOM   3406 N N     . GLU A 1 410 ? 49.083 48.440  28.490  1.00 34.66  ? 410 GLU A N     1 
ATOM   3407 C CA    . GLU A 1 410 ? 49.177 49.654  29.277  1.00 36.58  ? 410 GLU A CA    1 
ATOM   3408 C C     . GLU A 1 410 ? 47.858 49.961  29.920  1.00 36.33  ? 410 GLU A C     1 
ATOM   3409 O O     . GLU A 1 410 ? 47.809 50.497  31.012  1.00 37.71  ? 410 GLU A O     1 
ATOM   3410 C CB    . GLU A 1 410 ? 49.576 50.824  28.382  1.00 37.13  ? 410 GLU A CB    1 
ATOM   3411 C CG    . GLU A 1 410 ? 51.001 50.737  27.938  1.00 40.42  ? 410 GLU A CG    1 
ATOM   3412 C CD    . GLU A 1 410 ? 51.429 51.868  27.019  1.00 44.72  ? 410 GLU A CD    1 
ATOM   3413 O OE1   . GLU A 1 410 ? 52.652 52.141  26.972  1.00 47.55  ? 410 GLU A OE1   1 
ATOM   3414 O OE2   . GLU A 1 410 ? 50.568 52.472  26.336  1.00 45.91  ? 410 GLU A OE2   1 
ATOM   3415 N N     . TYR A 1 411 ? 46.784 49.614  29.231  1.00 35.10  ? 411 TYR A N     1 
ATOM   3416 C CA    . TYR A 1 411 ? 45.448 49.966  29.662  1.00 35.80  ? 411 TYR A CA    1 
ATOM   3417 C C     . TYR A 1 411 ? 44.409 49.444  28.703  1.00 34.22  ? 411 TYR A C     1 
ATOM   3418 O O     . TYR A 1 411 ? 44.618 49.481  27.500  1.00 33.91  ? 411 TYR A O     1 
ATOM   3419 C CB    . TYR A 1 411 ? 45.299 51.490  29.728  1.00 37.53  ? 411 TYR A CB    1 
ATOM   3420 C CG    . TYR A 1 411 ? 43.882 51.958  29.506  1.00 37.22  ? 411 TYR A CG    1 
ATOM   3421 C CD1   . TYR A 1 411 ? 43.479 52.417  28.265  1.00 36.39  ? 411 TYR A CD1   1 
ATOM   3422 C CD2   . TYR A 1 411 ? 42.941 51.912  30.531  1.00 38.72  ? 411 TYR A CD2   1 
ATOM   3423 C CE1   . TYR A 1 411 ? 42.188 52.836  28.047  1.00 37.84  ? 411 TYR A CE1   1 
ATOM   3424 C CE2   . TYR A 1 411 ? 41.636 52.329  30.329  1.00 39.64  ? 411 TYR A CE2   1 
ATOM   3425 C CZ    . TYR A 1 411 ? 41.264 52.793  29.079  1.00 39.48  ? 411 TYR A CZ    1 
ATOM   3426 O OH    . TYR A 1 411 ? 39.966 53.214  28.842  1.00 39.82  ? 411 TYR A OH    1 
ATOM   3427 N N     . PHE A 1 412 ? 43.281 48.989  29.233  1.00 34.16  ? 412 PHE A N     1 
ATOM   3428 C CA    . PHE A 1 412 ? 42.070 48.771  28.437  1.00 33.35  ? 412 PHE A CA    1 
ATOM   3429 C C     . PHE A 1 412 ? 40.903 48.646  29.395  1.00 33.86  ? 412 PHE A C     1 
ATOM   3430 O O     . PHE A 1 412 ? 41.104 48.566  30.597  1.00 35.38  ? 412 PHE A O     1 
ATOM   3431 C CB    . PHE A 1 412 ? 42.185 47.525  27.567  1.00 31.82  ? 412 PHE A CB    1 
ATOM   3432 C CG    . PHE A 1 412 ? 42.058 46.245  28.329  1.00 32.70  ? 412 PHE A CG    1 
ATOM   3433 C CD1   . PHE A 1 412 ? 40.810 45.661  28.527  1.00 33.23  ? 412 PHE A CD1   1 
ATOM   3434 C CD2   . PHE A 1 412 ? 43.185 45.630  28.867  1.00 34.72  ? 412 PHE A CD2   1 
ATOM   3435 C CE1   . PHE A 1 412 ? 40.678 44.479  29.237  1.00 34.38  ? 412 PHE A CE1   1 
ATOM   3436 C CE2   . PHE A 1 412 ? 43.073 44.443  29.581  1.00 36.34  ? 412 PHE A CE2   1 
ATOM   3437 C CZ    . PHE A 1 412 ? 41.811 43.859  29.762  1.00 35.08  ? 412 PHE A CZ    1 
ATOM   3438 N N     . GLU A 1 413 ? 39.690 48.662  28.879  1.00 33.30  ? 413 GLU A N     1 
ATOM   3439 C CA    . GLU A 1 413 ? 38.526 48.416  29.706  1.00 34.63  ? 413 GLU A CA    1 
ATOM   3440 C C     . GLU A 1 413 ? 37.484 47.737  28.853  1.00 33.53  ? 413 GLU A C     1 
ATOM   3441 O O     . GLU A 1 413 ? 37.546 47.820  27.624  1.00 33.06  ? 413 GLU A O     1 
ATOM   3442 C CB    . GLU A 1 413 ? 37.976 49.715  30.311  1.00 36.07  ? 413 GLU A CB    1 
ATOM   3443 C CG    . GLU A 1 413 ? 37.388 50.705  29.314  1.00 36.90  ? 413 GLU A CG    1 
ATOM   3444 C CD    . GLU A 1 413 ? 37.002 52.048  29.957  1.00 39.67  ? 413 GLU A CD    1 
ATOM   3445 O OE1   . GLU A 1 413 ? 36.234 52.058  30.944  1.00 40.42  ? 413 GLU A OE1   1 
ATOM   3446 O OE2   . GLU A 1 413 ? 37.458 53.110  29.458  1.00 43.81  ? 413 GLU A OE2   1 
ATOM   3447 N N     . ILE A 1 414 ? 36.540 47.057  29.498  1.00 33.86  ? 414 ILE A N     1 
ATOM   3448 C CA    . ILE A 1 414 ? 35.433 46.426  28.800  1.00 32.80  ? 414 ILE A CA    1 
ATOM   3449 C C     . ILE A 1 414 ? 34.169 47.192  29.131  1.00 34.26  ? 414 ILE A C     1 
ATOM   3450 O O     . ILE A 1 414 ? 33.844 47.390  30.297  1.00 35.32  ? 414 ILE A O     1 
ATOM   3451 C CB    . ILE A 1 414 ? 35.287 44.946  29.164  1.00 31.95  ? 414 ILE A CB    1 
ATOM   3452 C CG1   . ILE A 1 414 ? 36.435 44.144  28.560  1.00 31.23  ? 414 ILE A CG1   1 
ATOM   3453 C CG2   . ILE A 1 414 ? 33.975 44.392  28.637  1.00 30.67  ? 414 ILE A CG2   1 
ATOM   3454 C CD1   . ILE A 1 414 ? 36.742 42.906  29.335  1.00 31.26  ? 414 ILE A CD1   1 
ATOM   3455 N N     . ILE A 1 415 ? 33.473 47.624  28.081  1.00 34.59  ? 415 ILE A N     1 
ATOM   3456 C CA    . ILE A 1 415 ? 32.262 48.430  28.193  1.00 36.16  ? 415 ILE A CA    1 
ATOM   3457 C C     . ILE A 1 415 ? 31.108 47.659  27.584  1.00 35.55  ? 415 ILE A C     1 
ATOM   3458 O O     . ILE A 1 415 ? 31.265 47.073  26.534  1.00 34.65  ? 415 ILE A O     1 
ATOM   3459 C CB    . ILE A 1 415 ? 32.399 49.748  27.393  1.00 36.67  ? 415 ILE A CB    1 
ATOM   3460 C CG1   . ILE A 1 415 ? 33.750 50.402  27.629  1.00 36.70  ? 415 ILE A CG1   1 
ATOM   3461 C CG2   . ILE A 1 415 ? 31.305 50.698  27.766  1.00 38.91  ? 415 ILE A CG2   1 
ATOM   3462 C CD1   . ILE A 1 415 ? 33.951 50.757  29.041  1.00 39.02  ? 415 ILE A CD1   1 
ATOM   3463 N N     . SER A 1 416 ? 29.949 47.682  28.222  1.00 37.41  ? 416 SER A N     1 
ATOM   3464 C CA    . SER A 1 416 ? 28.781 46.979  27.719  1.00 38.28  ? 416 SER A CA    1 
ATOM   3465 C C     . SER A 1 416 ? 27.525 47.694  28.173  1.00 40.89  ? 416 SER A C     1 
ATOM   3466 O O     . SER A 1 416 ? 27.602 48.619  28.978  1.00 42.76  ? 416 SER A O     1 
ATOM   3467 C CB    . SER A 1 416 ? 28.768 45.530  28.205  1.00 37.65  ? 416 SER A CB    1 
ATOM   3468 O OG    . SER A 1 416 ? 28.759 45.474  29.620  1.00 39.64  ? 416 SER A OG    1 
ATOM   3469 N N     . GLY A 1 417 ? 26.367 47.282  27.651  1.00 41.89  ? 417 GLY A N     1 
ATOM   3470 C CA    . GLY A 1 417 ? 25.096 47.933  28.003  1.00 44.24  ? 417 GLY A CA    1 
ATOM   3471 C C     . GLY A 1 417 ? 25.093 49.406  27.633  1.00 45.78  ? 417 GLY A C     1 
ATOM   3472 O O     . GLY A 1 417 ? 25.732 49.802  26.672  1.00 44.50  ? 417 GLY A O     1 
ATOM   3473 N N     . GLU A 1 418 ? 24.398 50.225  28.413  1.00 48.89  ? 418 GLU A N     1 
ATOM   3474 C CA    . GLU A 1 418 ? 24.265 51.641  28.054  1.00 51.50  ? 418 GLU A CA    1 
ATOM   3475 C C     . GLU A 1 418 ? 25.557 52.456  28.012  1.00 51.11  ? 418 GLU A C     1 
ATOM   3476 O O     . GLU A 1 418 ? 25.684 53.373  27.182  1.00 51.19  ? 418 GLU A O     1 
ATOM   3477 C CB    . GLU A 1 418 ? 23.149 52.347  28.843  1.00 53.95  ? 418 GLU A CB    1 
ATOM   3478 C CG    . GLU A 1 418 ? 21.835 52.348  28.032  1.00 55.83  ? 418 GLU A CG    1 
ATOM   3479 C CD    . GLU A 1 418 ? 20.679 53.117  28.665  1.00 59.07  ? 418 GLU A CD    1 
ATOM   3480 O OE1   . GLU A 1 418 ? 19.589 53.132  28.030  1.00 61.29  ? 418 GLU A OE1   1 
ATOM   3481 O OE2   . GLU A 1 418 ? 20.846 53.693  29.777  1.00 62.94  ? 418 GLU A OE2   1 
ATOM   3482 N N     . LYS A 1 419 ? 26.520 52.129  28.873  1.00 50.56  ? 419 LYS A N     1 
ATOM   3483 C CA    . LYS A 1 419 ? 27.780 52.853  28.805  1.00 50.24  ? 419 LYS A CA    1 
ATOM   3484 C C     . LYS A 1 419 ? 28.361 52.719  27.389  1.00 48.00  ? 419 LYS A C     1 
ATOM   3485 O O     . LYS A 1 419 ? 28.950 53.668  26.855  1.00 49.15  ? 419 LYS A O     1 
ATOM   3486 C CB    . LYS A 1 419 ? 28.774 52.393  29.868  1.00 50.28  ? 419 LYS A CB    1 
ATOM   3487 C CG    . LYS A 1 419 ? 29.776 53.496  30.226  1.00 52.06  ? 419 LYS A CG    1 
ATOM   3488 C CD    . LYS A 1 419 ? 31.151 52.978  30.640  1.00 50.89  ? 419 LYS A CD    1 
ATOM   3489 C CE    . LYS A 1 419 ? 32.095 54.141  30.949  1.00 52.57  ? 419 LYS A CE    1 
ATOM   3490 N NZ    . LYS A 1 419 ? 33.535 53.838  30.666  1.00 50.53  ? 419 LYS A NZ    1 
ATOM   3491 N N     . LEU A 1 420 ? 28.150 51.550  26.777  1.00 44.91  ? 420 LEU A N     1 
ATOM   3492 C CA    . LEU A 1 420 ? 28.615 51.260  25.412  1.00 41.80  ? 420 LEU A CA    1 
ATOM   3493 C C     . LEU A 1 420 ? 27.836 51.989  24.311  1.00 41.63  ? 420 LEU A C     1 
ATOM   3494 O O     . LEU A 1 420 ? 28.407 52.332  23.283  1.00 40.78  ? 420 LEU A O     1 
ATOM   3495 C CB    . LEU A 1 420 ? 28.590 49.749  25.144  1.00 39.50  ? 420 LEU A CB    1 
ATOM   3496 C CG    . LEU A 1 420 ? 29.065 49.286  23.773  1.00 36.03  ? 420 LEU A CG    1 
ATOM   3497 C CD1   . LEU A 1 420 ? 30.485 49.748  23.499  1.00 33.69  ? 420 LEU A CD1   1 
ATOM   3498 C CD2   . LEU A 1 420 ? 28.978 47.796  23.709  1.00 34.20  ? 420 LEU A CD2   1 
ATOM   3499 N N     . PHE A 1 421 ? 26.543 52.207  24.518  1.00 42.23  ? 421 PHE A N     1 
ATOM   3500 C CA    . PHE A 1 421 ? 25.731 52.855  23.498  1.00 42.96  ? 421 PHE A CA    1 
ATOM   3501 C C     . PHE A 1 421 ? 25.985 54.370  23.376  1.00 44.98  ? 421 PHE A C     1 
ATOM   3502 O O     . PHE A 1 421 ? 25.678 54.970  22.336  1.00 44.91  ? 421 PHE A O     1 
ATOM   3503 C CB    . PHE A 1 421 ? 24.240 52.580  23.699  1.00 43.64  ? 421 PHE A CB    1 
ATOM   3504 C CG    . PHE A 1 421 ? 23.901 51.136  23.877  1.00 42.07  ? 421 PHE A CG    1 
ATOM   3505 C CD1   . PHE A 1 421 ? 22.874 50.764  24.730  1.00 42.83  ? 421 PHE A CD1   1 
ATOM   3506 C CD2   . PHE A 1 421 ? 24.610 50.141  23.203  1.00 40.21  ? 421 PHE A CD2   1 
ATOM   3507 C CE1   . PHE A 1 421 ? 22.547 49.424  24.906  1.00 42.32  ? 421 PHE A CE1   1 
ATOM   3508 C CE2   . PHE A 1 421 ? 24.301 48.797  23.371  1.00 38.21  ? 421 PHE A CE2   1 
ATOM   3509 C CZ    . PHE A 1 421 ? 23.269 48.432  24.221  1.00 40.11  ? 421 PHE A CZ    1 
ATOM   3510 N N     . LYS A 1 422 ? 26.545 54.991  24.413  1.00 46.52  ? 422 LYS A N     1 
ATOM   3511 C CA    . LYS A 1 422 ? 26.831 56.419  24.305  1.00 49.70  ? 422 LYS A CA    1 
ATOM   3512 C C     . LYS A 1 422 ? 28.190 56.647  23.648  1.00 48.22  ? 422 LYS A C     1 
ATOM   3513 O O     . LYS A 1 422 ? 28.580 57.789  23.386  1.00 49.85  ? 422 LYS A O     1 
ATOM   3514 C CB    . LYS A 1 422 ? 26.680 57.173  25.642  1.00 52.45  ? 422 LYS A CB    1 
ATOM   3515 C CG    . LYS A 1 422 ? 27.870 57.009  26.604  1.00 55.78  ? 422 LYS A CG    1 
ATOM   3516 C CD    . LYS A 1 422 ? 28.246 58.342  27.318  1.00 62.82  ? 422 LYS A CD    1 
ATOM   3517 C CE    . LYS A 1 422 ? 27.439 58.581  28.611  1.00 66.70  ? 422 LYS A CE    1 
ATOM   3518 N NZ    . LYS A 1 422 ? 26.015 58.101  28.472  1.00 68.24  ? 422 LYS A NZ    1 
ATOM   3519 N N     . GLU A 1 423 ? 28.875 55.548  23.351  1.00 45.27  ? 423 GLU A N     1 
ATOM   3520 C CA    . GLU A 1 423 ? 30.197 55.574  22.742  1.00 44.26  ? 423 GLU A CA    1 
ATOM   3521 C C     . GLU A 1 423 ? 30.136 55.603  21.208  1.00 43.03  ? 423 GLU A C     1 
ATOM   3522 O O     . GLU A 1 423 ? 29.247 54.989  20.621  1.00 42.81  ? 423 GLU A O     1 
ATOM   3523 C CB    . GLU A 1 423 ? 30.937 54.327  23.186  1.00 42.83  ? 423 GLU A CB    1 
ATOM   3524 C CG    . GLU A 1 423 ? 32.399 54.555  23.432  1.00 44.63  ? 423 GLU A CG    1 
ATOM   3525 C CD    . GLU A 1 423 ? 32.696 54.925  24.869  1.00 47.46  ? 423 GLU A CD    1 
ATOM   3526 O OE1   . GLU A 1 423 ? 33.315 55.998  25.097  1.00 47.49  ? 423 GLU A OE1   1 
ATOM   3527 O OE2   . GLU A 1 423 ? 32.299 54.129  25.759  1.00 47.73  ? 423 GLU A OE2   1 
ATOM   3528 N N     . PRO A 1 424 ? 31.079 56.304  20.543  1.00 42.86  ? 424 PRO A N     1 
ATOM   3529 C CA    . PRO A 1 424 ? 31.046 56.400  19.062  1.00 41.74  ? 424 PRO A CA    1 
ATOM   3530 C C     . PRO A 1 424 ? 31.238 55.070  18.294  1.00 38.95  ? 424 PRO A C     1 
ATOM   3531 O O     . PRO A 1 424 ? 32.135 54.964  17.440  1.00 38.19  ? 424 PRO A O     1 
ATOM   3532 C CB    . PRO A 1 424 ? 32.190 57.366  18.749  1.00 42.44  ? 424 PRO A CB    1 
ATOM   3533 C CG    . PRO A 1 424 ? 33.108 57.248  19.919  1.00 42.98  ? 424 PRO A CG    1 
ATOM   3534 C CD    . PRO A 1 424 ? 32.208 57.070  21.105  1.00 43.88  ? 424 PRO A CD    1 
ATOM   3535 N N     . VAL A 1 425 ? 30.383 54.087  18.587  1.00 36.99  ? 425 VAL A N     1 
ATOM   3536 C CA    . VAL A 1 425 ? 30.413 52.784  17.918  1.00 34.49  ? 425 VAL A CA    1 
ATOM   3537 C C     . VAL A 1 425 ? 29.037 52.322  17.443  1.00 33.69  ? 425 VAL A C     1 
ATOM   3538 O O     . VAL A 1 425 ? 28.879 51.162  17.070  1.00 32.06  ? 425 VAL A O     1 
ATOM   3539 C CB    . VAL A 1 425 ? 30.966 51.664  18.836  1.00 33.31  ? 425 VAL A CB    1 
ATOM   3540 C CG1   . VAL A 1 425 ? 32.420 51.878  19.142  1.00 34.00  ? 425 VAL A CG1   1 
ATOM   3541 C CG2   . VAL A 1 425 ? 30.169 51.576  20.114  1.00 33.82  ? 425 VAL A CG2   1 
ATOM   3542 N N     . THR A 1 426 ? 28.052 53.216  17.454  1.00 34.49  ? 426 THR A N     1 
ATOM   3543 C CA    . THR A 1 426 ? 26.687 52.849  17.059  1.00 34.24  ? 426 THR A CA    1 
ATOM   3544 C C     . THR A 1 426 ? 26.629 52.400  15.596  1.00 33.42  ? 426 THR A C     1 
ATOM   3545 O O     . THR A 1 426 ? 25.956 51.423  15.242  1.00 32.79  ? 426 THR A O     1 
ATOM   3546 C CB    . THR A 1 426 ? 25.675 53.994  17.324  1.00 36.28  ? 426 THR A CB    1 
ATOM   3547 O OG1   . THR A 1 426 ? 25.989 55.121  16.506  1.00 37.98  ? 426 THR A OG1   1 
ATOM   3548 C CG2   . THR A 1 426 ? 25.677 54.416  18.808  1.00 35.72  ? 426 THR A CG2   1 
ATOM   3549 N N     . ALA A 1 427 ? 27.378 53.086  14.747  1.00 33.49  ? 427 ALA A N     1 
ATOM   3550 C CA    . ALA A 1 427 ? 27.458 52.679  13.359  1.00 33.15  ? 427 ALA A CA    1 
ATOM   3551 C C     . ALA A 1 427 ? 27.895 51.220  13.189  1.00 31.42  ? 427 ALA A C     1 
ATOM   3552 O O     . ALA A 1 427 ? 27.373 50.530  12.337  1.00 31.45  ? 427 ALA A O     1 
ATOM   3553 C CB    . ALA A 1 427 ? 28.365 53.609  12.579  1.00 33.52  ? 427 ALA A CB    1 
ATOM   3554 N N     . GLU A 1 428 ? 28.850 50.767  13.991  1.00 30.54  ? 428 GLU A N     1 
ATOM   3555 C CA    . GLU A 1 428 ? 29.426 49.445  13.848  1.00 29.83  ? 428 GLU A CA    1 
ATOM   3556 C C     . GLU A 1 428 ? 28.485 48.428  14.437  1.00 29.56  ? 428 GLU A C     1 
ATOM   3557 O O     . GLU A 1 428 ? 28.405 47.289  13.977  1.00 29.09  ? 428 GLU A O     1 
ATOM   3558 C CB    . GLU A 1 428 ? 30.737 49.364  14.608  1.00 29.42  ? 428 GLU A CB    1 
ATOM   3559 C CG    . GLU A 1 428 ? 31.928 49.994  13.915  1.00 32.21  ? 428 GLU A CG    1 
ATOM   3560 C CD    . GLU A 1 428 ? 31.812 51.508  13.690  1.00 35.30  ? 428 GLU A CD    1 
ATOM   3561 O OE1   . GLU A 1 428 ? 31.136 52.239  14.453  1.00 37.45  ? 428 GLU A OE1   1 
ATOM   3562 O OE2   . GLU A 1 428 ? 32.420 51.973  12.717  1.00 38.56  ? 428 GLU A OE2   1 
ATOM   3563 N N     . LEU A 1 429 ? 27.789 48.861  15.480  1.00 30.18  ? 429 LEU A N     1 
ATOM   3564 C CA    . LEU A 1 429 ? 26.812 48.055  16.176  1.00 29.64  ? 429 LEU A CA    1 
ATOM   3565 C C     . LEU A 1 429 ? 25.692 47.696  15.246  1.00 30.43  ? 429 LEU A C     1 
ATOM   3566 O O     . LEU A 1 429 ? 25.443 46.500  15.026  1.00 29.21  ? 429 LEU A O     1 
ATOM   3567 C CB    . LEU A 1 429 ? 26.285 48.819  17.381  1.00 30.23  ? 429 LEU A CB    1 
ATOM   3568 C CG    . LEU A 1 429 ? 27.178 48.602  18.595  1.00 29.07  ? 429 LEU A CG    1 
ATOM   3569 C CD1   . LEU A 1 429 ? 26.875 49.632  19.657  1.00 30.29  ? 429 LEU A CD1   1 
ATOM   3570 C CD2   . LEU A 1 429 ? 26.995 47.174  19.121  1.00 26.86  ? 429 LEU A CD2   1 
ATOM   3571 N N     . CYS A 1 430 ? 25.042 48.728  14.681  1.00 32.11  ? 430 CYS A N     1 
ATOM   3572 C CA    . CYS A 1 430 ? 23.989 48.515  13.697  1.00 33.58  ? 430 CYS A CA    1 
ATOM   3573 C C     . CYS A 1 430 ? 24.479 47.616  12.564  1.00 32.97  ? 430 CYS A C     1 
ATOM   3574 O O     . CYS A 1 430 ? 23.865 46.580  12.263  1.00 33.30  ? 430 CYS A O     1 
ATOM   3575 C CB    . CYS A 1 430 ? 23.471 49.823  13.150  1.00 35.35  ? 430 CYS A CB    1 
ATOM   3576 S SG    . CYS A 1 430 ? 22.593 50.881  14.336  1.00 40.10  ? 430 CYS A SG    1 
ATOM   3577 N N     . GLU A 1 431 ? 25.607 47.976  11.966  1.00 32.83  ? 431 GLU A N     1 
ATOM   3578 C CA    . GLU A 1 431 ? 26.188 47.160  10.901  1.00 33.08  ? 431 GLU A CA    1 
ATOM   3579 C C     . GLU A 1 431 ? 26.381 45.699  11.358  1.00 31.61  ? 431 GLU A C     1 
ATOM   3580 O O     . GLU A 1 431 ? 26.067 44.782  10.640  1.00 31.81  ? 431 GLU A O     1 
ATOM   3581 C CB    . GLU A 1 431 ? 27.479 47.810  10.371  1.00 32.89  ? 431 GLU A CB    1 
ATOM   3582 C CG    . GLU A 1 431 ? 28.400 46.938  9.498   1.00 36.52  ? 431 GLU A CG    1 
ATOM   3583 C CD    . GLU A 1 431 ? 27.834 46.548  8.113   1.00 42.05  ? 431 GLU A CD    1 
ATOM   3584 O OE1   . GLU A 1 431 ? 27.933 45.345  7.750   1.00 44.31  ? 431 GLU A OE1   1 
ATOM   3585 O OE2   . GLU A 1 431 ? 27.322 47.427  7.379   1.00 43.46  ? 431 GLU A OE2   1 
ATOM   3586 N N     . MET A 1 432 ? 26.839 45.500  12.579  1.00 30.72  ? 432 MET A N     1 
ATOM   3587 C CA    . MET A 1 432 ? 27.209 44.179  13.046  1.00 30.11  ? 432 MET A CA    1 
ATOM   3588 C C     . MET A 1 432 ? 25.996 43.292  13.273  1.00 29.57  ? 432 MET A C     1 
ATOM   3589 O O     . MET A 1 432 ? 26.039 42.089  12.987  1.00 29.65  ? 432 MET A O     1 
ATOM   3590 C CB    . MET A 1 432 ? 27.980 44.320  14.347  1.00 29.91  ? 432 MET A CB    1 
ATOM   3591 C CG    . MET A 1 432 ? 28.707 43.111  14.811  1.00 29.73  ? 432 MET A CG    1 
ATOM   3592 S SD    . MET A 1 432 ? 29.628 43.479  16.324  1.00 30.59  ? 432 MET A SD    1 
ATOM   3593 C CE    . MET A 1 432 ? 28.327 43.983  17.447  1.00 32.73  ? 432 MET A CE    1 
ATOM   3594 N N     . MET A 1 433 ? 24.920 43.886  13.789  1.00 28.83  ? 433 MET A N     1 
ATOM   3595 C CA    . MET A 1 433 ? 23.701 43.145  14.091  1.00 27.51  ? 433 MET A CA    1 
ATOM   3596 C C     . MET A 1 433 ? 22.709 43.198  12.943  1.00 27.42  ? 433 MET A C     1 
ATOM   3597 O O     . MET A 1 433 ? 21.653 42.589  12.987  1.00 27.73  ? 433 MET A O     1 
ATOM   3598 C CB    . MET A 1 433 ? 23.081 43.674  15.366  1.00 27.86  ? 433 MET A CB    1 
ATOM   3599 C CG    . MET A 1 433 ? 24.109 43.863  16.461  1.00 27.02  ? 433 MET A CG    1 
ATOM   3600 S SD    . MET A 1 433 ? 23.332 44.236  18.023  1.00 29.18  ? 433 MET A SD    1 
ATOM   3601 C CE    . MET A 1 433 ? 22.793 45.941  17.841  1.00 26.50  ? 433 MET A CE    1 
ATOM   3602 N N     . GLY A 1 434 ? 23.069 43.929  11.900  1.00 27.35  ? 434 GLY A N     1 
ATOM   3603 C CA    . GLY A 1 434 ? 22.264 43.995  10.693  1.00 26.86  ? 434 GLY A CA    1 
ATOM   3604 C C     . GLY A 1 434 ? 20.981 44.722  10.993  1.00 26.87  ? 434 GLY A C     1 
ATOM   3605 O O     . GLY A 1 434 ? 19.925 44.318  10.519  1.00 27.51  ? 434 GLY A O     1 
ATOM   3606 N N     . VAL A 1 435 ? 21.075 45.782  11.796  1.00 25.80  ? 435 VAL A N     1 
ATOM   3607 C CA    . VAL A 1 435 ? 19.911 46.611  12.075  1.00 26.86  ? 435 VAL A CA    1 
ATOM   3608 C C     . VAL A 1 435 ? 19.434 47.286  10.792  1.00 28.04  ? 435 VAL A C     1 
ATOM   3609 O O     . VAL A 1 435 ? 20.230 47.886  10.078  1.00 27.95  ? 435 VAL A O     1 
ATOM   3610 C CB    . VAL A 1 435 ? 20.172 47.646  13.186  1.00 27.04  ? 435 VAL A CB    1 
ATOM   3611 C CG1   . VAL A 1 435 ? 18.921 48.488  13.418  1.00 27.62  ? 435 VAL A CG1   1 
ATOM   3612 C CG2   . VAL A 1 435 ? 20.571 46.926  14.478  1.00 25.85  ? 435 VAL A CG2   1 
ATOM   3613 N N     . LYS A 1 436 ? 18.146 47.137  10.492  1.00 29.24  ? 436 LYS A N     1 
ATOM   3614 C CA    . LYS A 1 436 ? 17.539 47.739  9.312   1.00 30.99  ? 436 LYS A CA    1 
ATOM   3615 C C     . LYS A 1 436 ? 17.417 49.235  9.504   1.00 32.69  ? 436 LYS A C     1 
ATOM   3616 O O     . LYS A 1 436 ? 17.337 49.710  10.631  1.00 32.40  ? 436 LYS A O     1 
ATOM   3617 C CB    . LYS A 1 436 ? 16.147 47.156  9.054   1.00 31.78  ? 436 LYS A CB    1 
ATOM   3618 C CG    . LYS A 1 436 ? 16.136 45.787  8.404   1.00 30.88  ? 436 LYS A CG    1 
ATOM   3619 C CD    . LYS A 1 436 ? 14.770 45.107  8.557   1.00 30.19  ? 436 LYS A CD    1 
ATOM   3620 C CE    . LYS A 1 436 ? 14.750 43.675  8.027   1.00 26.53  ? 436 LYS A CE    1 
ATOM   3621 N NZ    . LYS A 1 436 ? 13.411 43.332  7.493   1.00 26.83  ? 436 LYS A NZ    1 
ATOM   3622 N N     . ASP A 1 437 ? 17.415 49.966  8.394   1.00 34.76  ? 437 ASP A N     1 
ATOM   3623 C CA    . ASP A 1 437 ? 17.063 51.397  8.385   1.00 37.67  ? 437 ASP A CA    1 
ATOM   3624 C C     . ASP A 1 437 ? 17.836 52.273  9.367   1.00 38.07  ? 437 ASP A C     1 
ATOM   3625 O O     . ASP A 1 437 ? 17.235 52.866  10.262  1.00 39.66  ? 437 ASP A O     1 
ATOM   3626 C CB    . ASP A 1 437 ? 15.567 51.567  8.660   1.00 39.24  ? 437 ASP A CB    1 
ATOM   3627 C CG    . ASP A 1 437 ? 14.700 50.890  7.624   1.00 40.32  ? 437 ASP A CG    1 
ATOM   3628 O OD1   . ASP A 1 437 ? 13.986 49.929  7.992   1.00 40.39  ? 437 ASP A OD1   1 
ATOM   3629 O OD2   . ASP A 1 437 ? 14.725 51.322  6.448   1.00 41.80  ? 437 ASP A OD2   1 
ATOM   3630 N N     . CYS A 1 438 ? 19.150 52.365  9.206   1.00 37.72  ? 438 CYS A N     1 
ATOM   3631 C CA    . CYS A 1 438 ? 19.968 53.189  10.098  1.00 39.03  ? 438 CYS A CA    1 
ATOM   3632 C C     . CYS A 1 438 ? 21.125 53.868  9.361   1.00 38.96  ? 438 CYS A C     1 
ATOM   3633 O O     . CYS A 1 438 ? 22.200 54.124  9.930   1.00 37.81  ? 438 CYS A O     1 
ATOM   3634 C CB    . CYS A 1 438 ? 20.497 52.335  11.227  1.00 37.58  ? 438 CYS A CB    1 
ATOM   3635 S SG    . CYS A 1 438 ? 21.360 50.910  10.594  1.00 41.22  ? 438 CYS A SG    1 
ATOM   3636 N N     . CYS A 1 439 ? 20.864 54.148  8.083   1.00 40.50  ? 439 CYS A N     1 
ATOM   3637 C CA    . CYS A 1 439 ? 21.801 54.724  7.138   1.00 40.93  ? 439 CYS A CA    1 
ATOM   3638 C C     . CYS A 1 439 ? 20.976 55.567  6.244   1.00 43.44  ? 439 CYS A C     1 
ATOM   3639 O O     . CYS A 1 439 ? 19.764 55.412  6.182   1.00 44.22  ? 439 CYS A O     1 
ATOM   3640 C CB    . CYS A 1 439 ? 22.418 53.637  6.292   1.00 39.50  ? 439 CYS A CB    1 
ATOM   3641 S SG    . CYS A 1 439 ? 23.433 52.535  7.249   1.00 38.53  ? 439 CYS A SG    1 
ATOM   3642 N N     . CYS A 1 440 ? 21.619 56.462  5.518   1.00 45.57  ? 440 CYS A N     1 
ATOM   3643 C CA    . CYS A 1 440 ? 20.837 57.376  4.757   1.00 48.55  ? 440 CYS A CA    1 
ATOM   3644 C C     . CYS A 1 440 ? 21.567 58.151  3.681   1.00 50.21  ? 440 CYS A C     1 
ATOM   3645 O O     . CYS A 1 440 ? 22.789 58.221  3.691   1.00 49.49  ? 440 CYS A O     1 
ATOM   3646 C CB    . CYS A 1 440 ? 20.144 58.327  5.707   1.00 49.88  ? 440 CYS A CB    1 
ATOM   3647 S SG    . CYS A 1 440 ? 18.757 59.051  4.918   1.00 54.72  ? 440 CYS A SG    1 
ATOM   3648 N N     . MET A 1 441 ? 20.765 58.765  2.801   1.00 52.91  ? 441 MET A N     1 
ATOM   3649 C CA    . MET A 1 441 ? 21.180 59.503  1.614   1.00 55.05  ? 441 MET A CA    1 
ATOM   3650 C C     . MET A 1 441 ? 21.959 58.663  0.638   1.00 54.11  ? 441 MET A C     1 
ATOM   3651 O O     . MET A 1 441 ? 21.355 58.053  -0.239  1.00 54.86  ? 441 MET A O     1 
ATOM   3652 C CB    . MET A 1 441 ? 21.916 60.776  1.959   1.00 56.39  ? 441 MET A CB    1 
ATOM   3653 C CG    . MET A 1 441 ? 21.030 61.965  1.843   1.00 60.45  ? 441 MET A CG    1 
ATOM   3654 S SD    . MET A 1 441 ? 20.970 62.727  3.465   1.00 65.15  ? 441 MET A SD    1 
ATOM   3655 C CE    . MET A 1 441 ? 19.385 62.132  4.086   1.00 62.24  ? 441 MET A CE    1 
ATOM   3656 N N     . MET B 2 1   ? 44.240 -4.202  55.649  1.00 120.00 ? 1   MET B N     1 
ATOM   3657 C CA    . MET B 2 1   ? 45.016 -5.210  56.441  1.00 125.05 ? 1   MET B CA    1 
ATOM   3658 C C     . MET B 2 1   ? 45.614 -6.293  55.529  1.00 124.21 ? 1   MET B C     1 
ATOM   3659 O O     . MET B 2 1   ? 45.631 -6.136  54.303  1.00 120.46 ? 1   MET B O     1 
ATOM   3660 C CB    . MET B 2 1   ? 44.126 -5.855  57.511  1.00 126.90 ? 1   MET B CB    1 
ATOM   3661 C CG    . MET B 2 1   ? 43.250 -4.896  58.311  1.00 127.11 ? 1   MET B CG    1 
ATOM   3662 S SD    . MET B 2 1   ? 42.059 -5.783  59.345  1.00 129.19 ? 1   MET B SD    1 
ATOM   3663 C CE    . MET B 2 1   ? 43.128 -6.454  60.635  1.00 136.42 ? 1   MET B CE    1 
ATOM   3664 N N     . LYS B 2 2   ? 46.111 -7.381  56.125  1.00 128.01 ? 2   LYS B N     1 
ATOM   3665 C CA    . LYS B 2 2   ? 46.538 -8.555  55.352  1.00 127.57 ? 2   LYS B CA    1 
ATOM   3666 C C     . LYS B 2 2   ? 45.331 -9.220  54.689  1.00 122.98 ? 2   LYS B C     1 
ATOM   3667 O O     . LYS B 2 2   ? 44.254 -9.325  55.285  1.00 122.02 ? 2   LYS B O     1 
ATOM   3668 C CB    . LYS B 2 2   ? 47.329 -9.547  56.206  1.00 133.41 ? 2   LYS B CB    1 
ATOM   3669 C CG    . LYS B 2 2   ? 48.736 -9.068  56.576  1.00 137.89 ? 2   LYS B CG    1 
ATOM   3670 C CD    . LYS B 2 2   ? 48.825 -8.553  58.013  1.00 141.76 ? 2   LYS B CD    1 
ATOM   3671 C CE    . LYS B 2 2   ? 49.122 -9.687  58.994  1.00 146.68 ? 2   LYS B CE    1 
ATOM   3672 N NZ    . LYS B 2 2   ? 49.289 -9.207  60.392  1.00 151.18 ? 2   LYS B NZ    1 
ATOM   3673 N N     . VAL B 2 3   ? 45.531 -9.669  53.453  1.00 120.30 ? 3   VAL B N     1 
ATOM   3674 C CA    . VAL B 2 3   ? 44.427 -9.919  52.522  1.00 114.97 ? 3   VAL B CA    1 
ATOM   3675 C C     . VAL B 2 3   ? 43.500 -11.086 52.885  1.00 114.86 ? 3   VAL B C     1 
ATOM   3676 O O     . VAL B 2 3   ? 42.295 -10.893 52.984  1.00 111.99 ? 3   VAL B O     1 
ATOM   3677 C CB    . VAL B 2 3   ? 44.907 -10.024 51.046  1.00 112.71 ? 3   VAL B CB    1 
ATOM   3678 C CG1   . VAL B 2 3   ? 43.777 -9.648  50.101  1.00 106.97 ? 3   VAL B CG1   1 
ATOM   3679 C CG2   . VAL B 2 3   ? 46.129 -9.131  50.795  1.00 114.15 ? 3   VAL B CG2   1 
ATOM   3680 N N     . GLU B 2 4   ? 44.045 -12.284 53.080  1.00 118.20 ? 4   GLU B N     1 
ATOM   3681 C CA    . GLU B 2 4   ? 43.209 -13.440 53.425  1.00 118.71 ? 4   GLU B CA    1 
ATOM   3682 C C     . GLU B 2 4   ? 42.376 -13.156 54.673  1.00 119.78 ? 4   GLU B C     1 
ATOM   3683 O O     . GLU B 2 4   ? 41.251 -13.639 54.785  1.00 118.18 ? 4   GLU B O     1 
ATOM   3684 C CB    . GLU B 2 4   ? 44.027 -14.723 53.610  1.00 123.44 ? 4   GLU B CB    1 
ATOM   3685 C CG    . GLU B 2 4   ? 45.025 -15.012 52.500  1.00 123.84 ? 4   GLU B CG    1 
ATOM   3686 C CD    . GLU B 2 4   ? 46.360 -14.304 52.723  1.00 127.59 ? 4   GLU B CD    1 
ATOM   3687 O OE1   . GLU B 2 4   ? 47.105 -14.697 53.661  1.00 132.51 ? 4   GLU B OE1   1 
ATOM   3688 O OE2   . GLU B 2 4   ? 46.661 -13.350 51.961  1.00 125.33 ? 4   GLU B OE2   1 
ATOM   3689 N N     . GLU B 2 5   ? 42.933 -12.361 55.590  1.00 122.72 ? 5   GLU B N     1 
ATOM   3690 C CA    . GLU B 2 5   ? 42.208 -11.864 56.764  1.00 124.18 ? 5   GLU B CA    1 
ATOM   3691 C C     . GLU B 2 5   ? 40.900 -11.228 56.336  1.00 118.86 ? 5   GLU B C     1 
ATOM   3692 O O     . GLU B 2 5   ? 39.854 -11.487 56.931  1.00 118.99 ? 5   GLU B O     1 
ATOM   3693 C CB    . GLU B 2 5   ? 43.020 -10.803 57.515  1.00 127.24 ? 5   GLU B CB    1 
ATOM   3694 C CG    . GLU B 2 5   ? 44.297 -11.291 58.201  1.00 133.83 ? 5   GLU B CG    1 
ATOM   3695 C CD    . GLU B 2 5   ? 45.064 -10.171 58.919  1.00 136.72 ? 5   GLU B CD    1 
ATOM   3696 O OE1   . GLU B 2 5   ? 44.811 -8.971  58.645  1.00 134.03 ? 5   GLU B OE1   1 
ATOM   3697 O OE2   . GLU B 2 5   ? 45.932 -10.501 59.758  1.00 142.71 ? 5   GLU B OE2   1 
ATOM   3698 N N     . ILE B 2 6   ? 40.977 -10.393 55.299  1.00 114.52 ? 6   ILE B N     1 
ATOM   3699 C CA    . ILE B 2 6   ? 39.817 -9.661  54.784  1.00 109.51 ? 6   ILE B CA    1 
ATOM   3700 C C     . ILE B 2 6   ? 38.726 -10.609 54.253  1.00 106.55 ? 6   ILE B C     1 
ATOM   3701 O O     . ILE B 2 6   ? 37.536 -10.367 54.471  1.00 104.68 ? 6   ILE B O     1 
ATOM   3702 C CB    . ILE B 2 6   ? 40.213 -8.593  53.686  1.00 106.05 ? 6   ILE B CB    1 
ATOM   3703 C CG1   . ILE B 2 6   ? 41.546 -7.882  54.009  1.00 108.80 ? 6   ILE B CG1   1 
ATOM   3704 C CG2   . ILE B 2 6   ? 39.065 -7.596  53.441  1.00 102.27 ? 6   ILE B CG2   1 
ATOM   3705 C CD1   . ILE B 2 6   ? 41.506 -6.873  55.153  1.00 110.78 ? 6   ILE B CD1   1 
ATOM   3706 N N     . LEU B 2 7   ? 39.136 -11.683 53.576  1.00 106.37 ? 7   LEU B N     1 
ATOM   3707 C CA    . LEU B 2 7   ? 38.189 -12.650 53.005  1.00 103.89 ? 7   LEU B CA    1 
ATOM   3708 C C     . LEU B 2 7   ? 37.476 -13.454 54.090  1.00 106.60 ? 7   LEU B C     1 
ATOM   3709 O O     . LEU B 2 7   ? 36.299 -13.790 53.945  1.00 104.46 ? 7   LEU B O     1 
ATOM   3710 C CB    . LEU B 2 7   ? 38.873 -13.600 52.003  1.00 103.88 ? 7   LEU B CB    1 
ATOM   3711 C CG    . LEU B 2 7   ? 39.798 -13.111 50.871  1.00 102.10 ? 7   LEU B CG    1 
ATOM   3712 C CD1   . LEU B 2 7   ? 40.023 -14.232 49.855  1.00 101.63 ? 7   LEU B CD1   1 
ATOM   3713 C CD2   . LEU B 2 7   ? 39.289 -11.859 50.164  1.00 96.84  ? 7   LEU B CD2   1 
ATOM   3714 N N     . GLU B 2 8   ? 38.201 -13.749 55.169  1.00 111.51 ? 8   GLU B N     1 
ATOM   3715 C CA    . GLU B 2 8   ? 37.681 -14.502 56.310  1.00 115.24 ? 8   GLU B CA    1 
ATOM   3716 C C     . GLU B 2 8   ? 36.395 -13.882 56.842  1.00 113.67 ? 8   GLU B C     1 
ATOM   3717 O O     . GLU B 2 8   ? 35.332 -14.508 56.819  1.00 112.65 ? 8   GLU B O     1 
ATOM   3718 C CB    . GLU B 2 8   ? 38.713 -14.540 57.446  1.00 121.17 ? 8   GLU B CB    1 
ATOM   3719 C CG    . GLU B 2 8   ? 40.091 -15.090 57.081  1.00 123.71 ? 8   GLU B CG    1 
ATOM   3720 C CD    . GLU B 2 8   ? 40.236 -16.582 57.336  1.00 127.09 ? 8   GLU B CD    1 
ATOM   3721 O OE1   . GLU B 2 8   ? 39.226 -17.312 57.244  1.00 125.81 ? 8   GLU B OE1   1 
ATOM   3722 O OE2   . GLU B 2 8   ? 41.369 -17.022 57.623  1.00 130.90 ? 8   GLU B OE2   1 
ATOM   3723 N N     . LYS B 2 9   ? 36.515 -12.646 57.321  1.00 113.75 ? 9   LYS B N     1 
ATOM   3724 C CA    . LYS B 2 9   ? 35.398 -11.892 57.887  1.00 112.91 ? 9   LYS B CA    1 
ATOM   3725 C C     . LYS B 2 9   ? 34.310 -11.622 56.844  1.00 107.39 ? 9   LYS B C     1 
ATOM   3726 O O     . LYS B 2 9   ? 33.135 -11.509 57.192  1.00 106.80 ? 9   LYS B O     1 
ATOM   3727 C CB    . LYS B 2 9   ? 35.893 -10.580 58.530  1.00 114.47 ? 9   LYS B CB    1 
ATOM   3728 C CG    . LYS B 2 9   ? 36.967 -9.837  57.724  1.00 112.44 ? 9   LYS B CG    1 
ATOM   3729 C CD    . LYS B 2 9   ? 37.172 -8.387  58.177  1.00 112.99 ? 9   LYS B CD    1 
ATOM   3730 C CE    . LYS B 2 9   ? 38.519 -8.162  58.868  1.00 116.83 ? 9   LYS B CE    1 
ATOM   3731 N NZ    . LYS B 2 9   ? 38.405 -8.142  60.343  1.00 121.68 ? 9   LYS B NZ    1 
ATOM   3732 N N     . ALA B 2 10  ? 34.714 -11.552 55.573  1.00 103.75 ? 10  ALA B N     1 
ATOM   3733 C CA    . ALA B 2 10  ? 33.817 -11.249 54.452  1.00 98.64  ? 10  ALA B CA    1 
ATOM   3734 C C     . ALA B 2 10  ? 33.006 -12.451 53.955  1.00 97.52  ? 10  ALA B C     1 
ATOM   3735 O O     . ALA B 2 10  ? 31.947 -12.276 53.336  1.00 94.08  ? 10  ALA B O     1 
ATOM   3736 C CB    . ALA B 2 10  ? 34.601 -10.637 53.307  1.00 95.73  ? 10  ALA B CB    1 
ATOM   3737 N N     . LEU B 2 11  ? 33.512 -13.657 54.212  1.00 100.60 ? 11  LEU B N     1 
ATOM   3738 C CA    . LEU B 2 11  ? 32.788 -14.891 53.912  1.00 100.53 ? 11  LEU B CA    1 
ATOM   3739 C C     . LEU B 2 11  ? 31.476 -14.974 54.677  1.00 101.29 ? 11  LEU B C     1 
ATOM   3740 O O     . LEU B 2 11  ? 30.474 -15.456 54.150  1.00 99.37  ? 11  LEU B O     1 
ATOM   3741 C CB    . LEU B 2 11  ? 33.635 -16.122 54.246  1.00 104.83 ? 11  LEU B CB    1 
ATOM   3742 C CG    . LEU B 2 11  ? 34.670 -16.602 53.228  1.00 104.42 ? 11  LEU B CG    1 
ATOM   3743 C CD1   . LEU B 2 11  ? 35.324 -17.866 53.739  1.00 108.37 ? 11  LEU B CD1   1 
ATOM   3744 C CD2   . LEU B 2 11  ? 34.048 -16.840 51.853  1.00 100.12 ? 11  LEU B CD2   1 
ATOM   3745 N N     . GLU B 2 12  ? 31.492 -14.498 55.919  1.00 104.47 ? 12  GLU B N     1 
ATOM   3746 C CA    . GLU B 2 12  ? 30.316 -14.524 56.779  1.00 106.02 ? 12  GLU B CA    1 
ATOM   3747 C C     . GLU B 2 12  ? 29.080 -13.847 56.168  1.00 101.84 ? 12  GLU B C     1 
ATOM   3748 O O     . GLU B 2 12  ? 27.951 -14.209 56.514  1.00 102.62 ? 12  GLU B O     1 
ATOM   3749 C CB    . GLU B 2 12  ? 30.635 -13.888 58.129  1.00 110.27 ? 12  GLU B CB    1 
ATOM   3750 C CG    . GLU B 2 12  ? 29.665 -14.295 59.221  1.00 113.88 ? 12  GLU B CG    1 
ATOM   3751 C CD    . GLU B 2 12  ? 29.522 -13.257 60.309  1.00 116.21 ? 12  GLU B CD    1 
ATOM   3752 O OE1   . GLU B 2 12  ? 29.295 -13.668 61.464  1.00 120.88 ? 12  GLU B OE1   1 
ATOM   3753 O OE2   . GLU B 2 12  ? 29.626 -12.043 60.014  1.00 113.19 ? 12  GLU B OE2   1 
ATOM   3754 N N     . LEU B 2 13  ? 29.294 -12.877 55.273  1.00 97.72  ? 13  LEU B N     1 
ATOM   3755 C CA    . LEU B 2 13  ? 28.185 -12.144 54.633  1.00 93.73  ? 13  LEU B CA    1 
ATOM   3756 C C     . LEU B 2 13  ? 27.731 -12.674 53.270  1.00 89.68  ? 13  LEU B C     1 
ATOM   3757 O O     . LEU B 2 13  ? 26.633 -12.356 52.815  1.00 87.03  ? 13  LEU B O     1 
ATOM   3758 C CB    . LEU B 2 13  ? 28.447 -10.630 54.588  1.00 92.02  ? 13  LEU B CB    1 
ATOM   3759 C CG    . LEU B 2 13  ? 27.505 -9.785  55.467  1.00 93.33  ? 13  LEU B CG    1 
ATOM   3760 C CD1   . LEU B 2 13  ? 26.120 -9.607  54.815  1.00 89.42  ? 13  LEU B CD1   1 
ATOM   3761 C CD2   . LEU B 2 13  ? 27.363 -10.330 56.911  1.00 98.19  ? 13  LEU B CD2   1 
ATOM   3762 N N     . VAL B 2 14  ? 28.562 -13.488 52.631  1.00 89.59  ? 14  VAL B N     1 
ATOM   3763 C CA    . VAL B 2 14  ? 28.154 -14.158 51.399  1.00 86.85  ? 14  VAL B CA    1 
ATOM   3764 C C     . VAL B 2 14  ? 27.603 -15.572 51.627  1.00 89.08  ? 14  VAL B C     1 
ATOM   3765 O O     . VAL B 2 14  ? 26.774 -16.048 50.855  1.00 86.85  ? 14  VAL B O     1 
ATOM   3766 C CB    . VAL B 2 14  ? 29.280 -14.167 50.335  1.00 85.15  ? 14  VAL B CB    1 
ATOM   3767 C CG1   . VAL B 2 14  ? 29.508 -12.771 49.815  1.00 82.58  ? 14  VAL B CG1   1 
ATOM   3768 C CG2   . VAL B 2 14  ? 30.571 -14.736 50.893  1.00 89.24  ? 14  VAL B CG2   1 
ATOM   3769 N N     . ILE B 2 15  ? 28.055 -16.231 52.691  1.00 93.89  ? 15  ILE B N     1 
ATOM   3770 C CA    . ILE B 2 15  ? 27.644 -17.606 52.970  1.00 97.03  ? 15  ILE B CA    1 
ATOM   3771 C C     . ILE B 2 15  ? 26.335 -17.688 53.775  1.00 98.85  ? 15  ILE B C     1 
ATOM   3772 O O     . ILE B 2 15  ? 26.230 -17.097 54.857  1.00 101.16 ? 15  ILE B O     1 
ATOM   3773 C CB    . ILE B 2 15  ? 28.787 -18.430 53.637  1.00 101.65 ? 15  ILE B CB    1 
ATOM   3774 C CG1   . ILE B 2 15  ? 29.759 -18.948 52.576  1.00 100.65 ? 15  ILE B CG1   1 
ATOM   3775 C CG2   . ILE B 2 15  ? 28.249 -19.629 54.430  1.00 105.81 ? 15  ILE B CG2   1 
ATOM   3776 C CD1   . ILE B 2 15  ? 30.991 -18.114 52.408  1.00 100.17 ? 15  ILE B CD1   1 
ATOM   3777 N N     . PRO B 2 16  ? 25.331 -18.417 53.233  1.00 93.60  ? 16  PRO B N     1 
ATOM   3778 C CA    . PRO B 2 16  ? 24.058 -18.692 53.910  1.00 93.94  ? 16  PRO B CA    1 
ATOM   3779 C C     . PRO B 2 16  ? 24.235 -19.565 55.154  1.00 98.35  ? 16  PRO B C     1 
ATOM   3780 O O     . PRO B 2 16  ? 25.091 -20.455 55.178  1.00 99.98  ? 16  PRO B O     1 
ATOM   3781 C CB    . PRO B 2 16  ? 23.246 -19.456 52.852  1.00 90.40  ? 16  PRO B CB    1 
ATOM   3782 C CG    . PRO B 2 16  ? 23.939 -19.220 51.560  1.00 87.81  ? 16  PRO B CG    1 
ATOM   3783 C CD    . PRO B 2 16  ? 25.374 -19.025 51.889  1.00 90.57  ? 16  PRO B CD    1 
ATOM   3784 N N     . ASP B 2 17  ? 23.428 -19.302 56.178  1.00 100.68 ? 17  ASP B N     1 
ATOM   3785 C CA    . ASP B 2 17  ? 23.443 -20.098 57.404  1.00 105.23 ? 17  ASP B CA    1 
ATOM   3786 C C     . ASP B 2 17  ? 22.516 -21.309 57.295  1.00 104.60 ? 17  ASP B C     1 
ATOM   3787 O O     . ASP B 2 17  ? 21.597 -21.328 56.470  1.00 101.02 ? 17  ASP B O     1 
ATOM   3788 C CB    . ASP B 2 17  ? 23.078 -19.235 58.625  1.00 108.73 ? 17  ASP B CB    1 
ATOM   3789 C CG    . ASP B 2 17  ? 21.901 -18.293 58.364  1.00 106.75 ? 17  ASP B CG    1 
ATOM   3790 O OD1   . ASP B 2 17  ? 20.936 -18.690 57.673  1.00 103.91 ? 17  ASP B OD1   1 
ATOM   3791 O OD2   . ASP B 2 17  ? 21.941 -17.149 58.865  1.00 108.73 ? 17  ASP B OD2   1 
ATOM   3792 N N     . GLU B 2 18  ? 22.766 -22.314 58.132  1.00 108.49 ? 18  GLU B N     1 
ATOM   3793 C CA    . GLU B 2 18  ? 21.936 -23.523 58.178  1.00 109.13 ? 18  GLU B CA    1 
ATOM   3794 C C     . GLU B 2 18  ? 20.446 -23.187 58.220  1.00 107.58 ? 18  GLU B C     1 
ATOM   3795 O O     . GLU B 2 18  ? 19.637 -23.806 57.523  1.00 105.05 ? 18  GLU B O     1 
ATOM   3796 C CB    . GLU B 2 18  ? 22.327 -24.403 59.375  1.00 114.72 ? 18  GLU B CB    1 
ATOM   3797 C CG    . GLU B 2 18  ? 23.577 -25.241 59.140  1.00 116.35 ? 18  GLU B CG    1 
ATOM   3798 C CD    . GLU B 2 18  ? 23.356 -26.322 58.094  1.00 114.31 ? 18  GLU B CD    1 
ATOM   3799 O OE1   . GLU B 2 18  ? 22.877 -27.412 58.466  1.00 116.73 ? 18  GLU B OE1   1 
ATOM   3800 O OE2   . GLU B 2 18  ? 23.659 -26.085 56.903  1.00 110.58 ? 18  GLU B OE2   1 
ATOM   3801 N N     . GLU B 2 19  ? 20.112 -22.200 59.046  1.00 109.41 ? 19  GLU B N     1 
ATOM   3802 C CA    . GLU B 2 19  ? 18.795 -21.587 59.073  1.00 108.33 ? 19  GLU B CA    1 
ATOM   3803 C C     . GLU B 2 19  ? 18.213 -21.464 57.653  1.00 103.02 ? 19  GLU B C     1 
ATOM   3804 O O     . GLU B 2 19  ? 17.184 -22.074 57.346  1.00 102.02 ? 19  GLU B O     1 
ATOM   3805 C CB    . GLU B 2 19  ? 18.892 -20.223 59.783  1.00 110.24 ? 19  GLU B CB    1 
ATOM   3806 C CG    . GLU B 2 19  ? 17.666 -19.313 59.673  1.00 109.12 ? 19  GLU B CG    1 
ATOM   3807 C CD    . GLU B 2 19  ? 16.426 -19.896 60.327  1.00 111.63 ? 19  GLU B CD    1 
ATOM   3808 O OE1   . GLU B 2 19  ? 15.343 -19.841 59.702  1.00 108.96 ? 19  GLU B OE1   1 
ATOM   3809 O OE2   . GLU B 2 19  ? 16.533 -20.412 61.460  1.00 116.64 ? 19  GLU B OE2   1 
ATOM   3810 N N     . GLU B 2 20  ? 18.895 -20.708 56.790  1.00 99.95  ? 20  GLU B N     1 
ATOM   3811 C CA    . GLU B 2 20  ? 18.440 -20.463 55.421  1.00 95.15  ? 20  GLU B CA    1 
ATOM   3812 C C     . GLU B 2 20  ? 18.543 -21.703 54.537  1.00 93.29  ? 20  GLU B C     1 
ATOM   3813 O O     . GLU B 2 20  ? 17.682 -21.942 53.688  1.00 90.60  ? 20  GLU B O     1 
ATOM   3814 C CB    . GLU B 2 20  ? 19.234 -19.316 54.804  1.00 93.24  ? 20  GLU B CB    1 
ATOM   3815 C CG    . GLU B 2 20  ? 18.993 -19.114 53.316  1.00 88.83  ? 20  GLU B CG    1 
ATOM   3816 C CD    . GLU B 2 20  ? 19.741 -17.928 52.755  1.00 87.78  ? 20  GLU B CD    1 
ATOM   3817 O OE1   . GLU B 2 20  ? 20.672 -17.430 53.425  1.00 90.70  ? 20  GLU B OE1   1 
ATOM   3818 O OE2   . GLU B 2 20  ? 19.394 -17.485 51.639  1.00 85.48  ? 20  GLU B OE2   1 
ATOM   3819 N N     . VAL B 2 21  ? 19.607 -22.473 54.736  1.00 95.17  ? 21  VAL B N     1 
ATOM   3820 C CA    . VAL B 2 21  ? 19.823 -23.725 54.012  1.00 94.55  ? 21  VAL B CA    1 
ATOM   3821 C C     . VAL B 2 21  ? 18.630 -24.680 54.180  1.00 95.18  ? 21  VAL B C     1 
ATOM   3822 O O     . VAL B 2 21  ? 17.946 -24.998 53.206  1.00 92.39  ? 21  VAL B O     1 
ATOM   3823 C CB    . VAL B 2 21  ? 21.150 -24.401 54.448  1.00 97.73  ? 21  VAL B CB    1 
ATOM   3824 C CG1   . VAL B 2 21  ? 21.294 -25.789 53.835  1.00 98.18  ? 21  VAL B CG1   1 
ATOM   3825 C CG2   . VAL B 2 21  ? 22.334 -23.530 54.066  1.00 96.95  ? 21  VAL B CG2   1 
ATOM   3826 N N     . ARG B 2 22  ? 18.386 -25.114 55.417  1.00 99.11  ? 22  ARG B N     1 
ATOM   3827 C CA    . ARG B 2 22  ? 17.249 -25.972 55.759  1.00 100.64 ? 22  ARG B CA    1 
ATOM   3828 C C     . ARG B 2 22  ? 15.965 -25.487 55.092  1.00 97.39  ? 22  ARG B C     1 
ATOM   3829 O O     . ARG B 2 22  ? 15.216 -26.285 54.533  1.00 96.51  ? 22  ARG B O     1 
ATOM   3830 C CB    . ARG B 2 22  ? 17.062 -25.992 57.275  1.00 105.35 ? 22  ARG B CB    1 
ATOM   3831 C CG    . ARG B 2 22  ? 16.153 -27.084 57.809  1.00 108.50 ? 22  ARG B CG    1 
ATOM   3832 C CD    . ARG B 2 22  ? 16.022 -26.984 59.328  1.00 113.91 ? 22  ARG B CD    1 
ATOM   3833 N NE    . ARG B 2 22  ? 17.254 -27.344 60.044  1.00 118.24 ? 22  ARG B NE    1 
ATOM   3834 C CZ    . ARG B 2 22  ? 18.180 -26.480 60.477  1.00 119.13 ? 22  ARG B CZ    1 
ATOM   3835 N NH1   . ARG B 2 22  ? 18.045 -25.173 60.274  1.00 116.63 ? 22  ARG B NH1   1 
ATOM   3836 N NH2   . ARG B 2 22  ? 19.255 -26.927 61.117  1.00 122.55 ? 22  ARG B NH2   1 
ATOM   3837 N N     . LYS B 2 23  ? 15.736 -24.173 55.154  1.00 95.96  ? 23  LYS B N     1 
ATOM   3838 C CA    . LYS B 2 23  ? 14.580 -23.515 54.536  1.00 93.21  ? 23  LYS B CA    1 
ATOM   3839 C C     . LYS B 2 23  ? 14.400 -23.968 53.086  1.00 89.69  ? 23  LYS B C     1 
ATOM   3840 O O     . LYS B 2 23  ? 13.306 -24.361 52.677  1.00 88.78  ? 23  LYS B O     1 
ATOM   3841 C CB    . LYS B 2 23  ? 14.741 -21.990 54.615  1.00 92.05  ? 23  LYS B CB    1 
ATOM   3842 C CG    . LYS B 2 23  ? 13.446 -21.199 54.530  1.00 90.92  ? 23  LYS B CG    1 
ATOM   3843 C CD    . LYS B 2 23  ? 13.646 -19.765 54.997  1.00 91.43  ? 23  LYS B CD    1 
ATOM   3844 C CE    . LYS B 2 23  ? 12.323 -19.005 55.039  1.00 91.63  ? 23  LYS B CE    1 
ATOM   3845 N NZ    . LYS B 2 23  ? 12.497 -17.567 55.425  1.00 92.13  ? 23  LYS B NZ    1 
ATOM   3846 N N     . GLY B 2 24  ? 15.492 -23.929 52.326  1.00 88.08  ? 24  GLY B N     1 
ATOM   3847 C CA    . GLY B 2 24  ? 15.502 -24.413 50.954  1.00 85.65  ? 24  GLY B CA    1 
ATOM   3848 C C     . GLY B 2 24  ? 15.380 -25.919 50.857  1.00 87.63  ? 24  GLY B C     1 
ATOM   3849 O O     . GLY B 2 24  ? 14.539 -26.428 50.121  1.00 86.43  ? 24  GLY B O     1 
ATOM   3850 N N     . ARG B 2 25  ? 16.218 -26.630 51.608  1.00 91.26  ? 25  ARG B N     1 
ATOM   3851 C CA    . ARG B 2 25  ? 16.251 -28.099 51.582  1.00 94.26  ? 25  ARG B CA    1 
ATOM   3852 C C     . ARG B 2 25  ? 14.852 -28.699 51.547  1.00 94.97  ? 25  ARG B C     1 
ATOM   3853 O O     . ARG B 2 25  ? 14.595 -29.646 50.799  1.00 95.05  ? 25  ARG B O     1 
ATOM   3854 C CB    . ARG B 2 25  ? 17.018 -28.665 52.791  1.00 98.59  ? 25  ARG B CB    1 
ATOM   3855 C CG    . ARG B 2 25  ? 18.492 -28.258 52.882  1.00 99.73  ? 25  ARG B CG    1 
ATOM   3856 C CD    . ARG B 2 25  ? 19.375 -28.972 51.849  1.00 100.26 ? 25  ARG B CD    1 
ATOM   3857 N NE    . ARG B 2 25  ? 20.523 -28.149 51.454  1.00 99.06  ? 25  ARG B NE    1 
ATOM   3858 C CZ    . ARG B 2 25  ? 20.579 -27.412 50.345  1.00 96.06  ? 25  ARG B CZ    1 
ATOM   3859 N NH1   . ARG B 2 25  ? 19.558 -27.395 49.497  1.00 93.57  ? 25  ARG B NH1   1 
ATOM   3860 N NH2   . ARG B 2 25  ? 21.661 -26.690 50.073  1.00 95.26  ? 25  ARG B NH2   1 
ATOM   3861 N N     . GLU B 2 26  ? 13.955 -28.123 52.350  1.00 96.01  ? 26  GLU B N     1 
ATOM   3862 C CA    . GLU B 2 26  ? 12.597 -28.651 52.541  1.00 97.56  ? 26  GLU B CA    1 
ATOM   3863 C C     . GLU B 2 26  ? 11.604 -28.115 51.516  1.00 93.83  ? 26  GLU B C     1 
ATOM   3864 O O     . GLU B 2 26  ? 10.577 -28.742 51.239  1.00 94.57  ? 26  GLU B O     1 
ATOM   3865 C CB    . GLU B 2 26  ? 12.102 -28.399 53.977  1.00 101.19 ? 26  GLU B CB    1 
ATOM   3866 C CG    . GLU B 2 26  ? 12.011 -26.927 54.396  1.00 100.27 ? 26  GLU B CG    1 
ATOM   3867 C CD    . GLU B 2 26  ? 11.647 -26.752 55.864  1.00 104.52 ? 26  GLU B CD    1 
ATOM   3868 O OE1   . GLU B 2 26  ? 12.404 -27.241 56.740  1.00 108.17 ? 26  GLU B OE1   1 
ATOM   3869 O OE2   . GLU B 2 26  ? 10.603 -26.115 56.133  1.00 104.91 ? 26  GLU B OE2   1 
ATOM   3870 N N     . ALA B 2 27  ? 11.918 -26.952 50.960  1.00 90.17  ? 27  ALA B N     1 
ATOM   3871 C CA    . ALA B 2 27  ? 11.166 -26.421 49.846  1.00 86.68  ? 27  ALA B CA    1 
ATOM   3872 C C     . ALA B 2 27  ? 11.491 -27.231 48.602  1.00 85.18  ? 27  ALA B C     1 
ATOM   3873 O O     . ALA B 2 27  ? 10.674 -27.328 47.692  1.00 83.53  ? 27  ALA B O     1 
ATOM   3874 C CB    . ALA B 2 27  ? 11.509 -24.974 49.638  1.00 84.34  ? 27  ALA B CB    1 
ATOM   3875 N N     . GLU B 2 28  ? 12.693 -27.805 48.581  1.00 86.23  ? 28  GLU B N     1 
ATOM   3876 C CA    . GLU B 2 28  ? 13.135 -28.730 47.532  1.00 86.13  ? 28  GLU B CA    1 
ATOM   3877 C C     . GLU B 2 28  ? 12.491 -30.103 47.685  1.00 89.18  ? 28  GLU B C     1 
ATOM   3878 O O     . GLU B 2 28  ? 12.226 -30.787 46.695  1.00 88.91  ? 28  GLU B O     1 
ATOM   3879 C CB    . GLU B 2 28  ? 14.653 -28.877 47.575  1.00 86.72  ? 28  GLU B CB    1 
ATOM   3880 C CG    . GLU B 2 28  ? 15.245 -29.736 46.475  1.00 86.70  ? 28  GLU B CG    1 
ATOM   3881 C CD    . GLU B 2 28  ? 16.727 -29.995 46.681  1.00 88.82  ? 28  GLU B CD    1 
ATOM   3882 O OE1   . GLU B 2 28  ? 17.260 -29.658 47.763  1.00 89.83  ? 28  GLU B OE1   1 
ATOM   3883 O OE2   . GLU B 2 28  ? 17.362 -30.542 45.755  1.00 89.88  ? 28  GLU B OE2   1 
ATOM   3884 N N     . GLU B 2 29  ? 12.259 -30.505 48.931  1.00 92.69  ? 29  GLU B N     1 
ATOM   3885 C CA    . GLU B 2 29  ? 11.596 -31.778 49.213  1.00 96.67  ? 29  GLU B CA    1 
ATOM   3886 C C     . GLU B 2 29  ? 10.140 -31.731 48.778  1.00 95.73  ? 29  GLU B C     1 
ATOM   3887 O O     . GLU B 2 29  ? 9.637  -32.693 48.195  1.00 97.03  ? 29  GLU B O     1 
ATOM   3888 C CB    . GLU B 2 29  ? 11.681 -32.148 50.701  1.00 100.92 ? 29  GLU B CB    1 
ATOM   3889 C CG    . GLU B 2 29  ? 13.080 -32.525 51.200  1.00 104.07 ? 29  GLU B CG    1 
ATOM   3890 C CD    . GLU B 2 29  ? 13.500 -33.934 50.813  1.00 107.92 ? 29  GLU B CD    1 
ATOM   3891 O OE1   . GLU B 2 29  ? 13.373 -34.290 49.618  1.00 107.15 ? 29  GLU B OE1   1 
ATOM   3892 O OE2   . GLU B 2 29  ? 13.972 -34.678 51.706  1.00 111.88 ? 29  GLU B OE2   1 
ATOM   3893 N N     . GLU B 2 30  ? 9.471  -30.612 49.062  1.00 93.64  ? 30  GLU B N     1 
ATOM   3894 C CA    . GLU B 2 30  ? 8.085  -30.437 48.648  1.00 92.76  ? 30  GLU B CA    1 
ATOM   3895 C C     . GLU B 2 30  ? 8.003  -30.493 47.127  1.00 90.00  ? 30  GLU B C     1 
ATOM   3896 O O     . GLU B 2 30  ? 7.177  -31.218 46.561  1.00 90.95  ? 30  GLU B O     1 
ATOM   3897 C CB    . GLU B 2 30  ? 7.502  -29.126 49.188  1.00 91.38  ? 30  GLU B CB    1 
ATOM   3898 C CG    . GLU B 2 30  ? 5.978  -29.043 49.089  1.00 91.85  ? 30  GLU B CG    1 
ATOM   3899 C CD    . GLU B 2 30  ? 5.288  -30.338 49.504  1.00 96.46  ? 30  GLU B CD    1 
ATOM   3900 O OE1   . GLU B 2 30  ? 5.481  -30.785 50.656  1.00 99.80  ? 30  GLU B OE1   1 
ATOM   3901 O OE2   . GLU B 2 30  ? 4.558  -30.917 48.674  1.00 96.40  ? 30  GLU B OE2   1 
ATOM   3902 N N     . LEU B 2 31  ? 8.903  -29.747 46.489  1.00 86.89  ? 31  LEU B N     1 
ATOM   3903 C CA    . LEU B 2 31  ? 9.013  -29.654 45.037  1.00 84.30  ? 31  LEU B CA    1 
ATOM   3904 C C     . LEU B 2 31  ? 9.159  -31.032 44.389  1.00 86.43  ? 31  LEU B C     1 
ATOM   3905 O O     . LEU B 2 31  ? 8.435  -31.357 43.444  1.00 86.26  ? 31  LEU B O     1 
ATOM   3906 C CB    . LEU B 2 31  ? 10.208 -28.760 44.683  1.00 81.80  ? 31  LEU B CB    1 
ATOM   3907 C CG    . LEU B 2 31  ? 10.089 -27.587 43.695  1.00 78.53  ? 31  LEU B CG    1 
ATOM   3908 C CD1   . LEU B 2 31  ? 8.738  -26.900 43.750  1.00 77.85  ? 31  LEU B CD1   1 
ATOM   3909 C CD2   . LEU B 2 31  ? 11.192 -26.572 43.956  1.00 76.73  ? 31  LEU B CD2   1 
ATOM   3910 N N     . ARG B 2 32  ? 10.078 -31.841 44.918  1.00 88.75  ? 32  ARG B N     1 
ATOM   3911 C CA    . ARG B 2 32  ? 10.348 -33.168 44.373  1.00 91.43  ? 32  ARG B CA    1 
ATOM   3912 C C     . ARG B 2 32  ? 9.129  -34.100 44.420  1.00 94.48  ? 32  ARG B C     1 
ATOM   3913 O O     . ARG B 2 32  ? 8.933  -34.912 43.513  1.00 95.88  ? 32  ARG B O     1 
ATOM   3914 C CB    . ARG B 2 32  ? 11.574 -33.802 45.041  1.00 93.78  ? 32  ARG B CB    1 
ATOM   3915 C CG    . ARG B 2 32  ? 12.880 -33.358 44.407  1.00 91.44  ? 32  ARG B CG    1 
ATOM   3916 C CD    . ARG B 2 32  ? 14.051 -34.290 44.713  1.00 93.61  ? 32  ARG B CD    1 
ATOM   3917 N NE    . ARG B 2 32  ? 15.011 -34.315 43.606  1.00 91.75  ? 32  ARG B NE    1 
ATOM   3918 C CZ    . ARG B 2 32  ? 15.975 -33.415 43.401  1.00 89.25  ? 32  ARG B CZ    1 
ATOM   3919 N NH1   . ARG B 2 32  ? 16.140 -32.390 44.231  1.00 86.80  ? 32  ARG B NH1   1 
ATOM   3920 N NH2   . ARG B 2 32  ? 16.779 -33.537 42.353  1.00 88.82  ? 32  ARG B NH2   1 
ATOM   3921 N N     . ARG B 2 33  ? 8.308  -33.970 45.462  1.00 95.85  ? 33  ARG B N     1 
ATOM   3922 C CA    . ARG B 2 33  ? 7.076  -34.754 45.574  1.00 98.65  ? 33  ARG B CA    1 
ATOM   3923 C C     . ARG B 2 33  ? 6.038  -34.273 44.563  1.00 96.42  ? 33  ARG B C     1 
ATOM   3924 O O     . ARG B 2 33  ? 5.515  -35.068 43.775  1.00 97.93  ? 33  ARG B O     1 
ATOM   3925 C CB    . ARG B 2 33  ? 6.512  -34.701 47.000  1.00 101.00 ? 33  ARG B CB    1 
ATOM   3926 C CG    . ARG B 2 33  ? 7.196  -35.657 47.981  1.00 105.38 ? 33  ARG B CG    1 
ATOM   3927 C CD    . ARG B 2 33  ? 6.768  -35.412 49.431  1.00 107.85 ? 33  ARG B CD    1 
ATOM   3928 N NE    . ARG B 2 33  ? 7.190  -34.094 49.911  1.00 105.51 ? 33  ARG B NE    1 
ATOM   3929 C CZ    . ARG B 2 33  ? 7.206  -33.710 51.187  1.00 107.27 ? 33  ARG B CZ    1 
ATOM   3930 N NH1   . ARG B 2 33  ? 6.824  -34.540 52.156  1.00 111.40 ? 33  ARG B NH1   1 
ATOM   3931 N NH2   . ARG B 2 33  ? 7.614  -32.483 51.490  1.00 104.31 ? 33  ARG B NH2   1 
ATOM   3932 N N     . ARG B 2 34  ? 5.778  -32.963 44.577  1.00 93.11  ? 34  ARG B N     1 
ATOM   3933 C CA    . ARG B 2 34  ? 4.734  -32.337 43.751  1.00 91.15  ? 34  ARG B CA    1 
ATOM   3934 C C     . ARG B 2 34  ? 4.946  -32.554 42.257  1.00 89.66  ? 34  ARG B C     1 
ATOM   3935 O O     . ARG B 2 34  ? 3.985  -32.718 41.503  1.00 90.17  ? 34  ARG B O     1 
ATOM   3936 C CB    . ARG B 2 34  ? 4.596  -30.839 44.076  1.00 88.19  ? 34  ARG B CB    1 
ATOM   3937 C CG    . ARG B 2 34  ? 4.040  -30.591 45.478  1.00 90.53  ? 34  ARG B CG    1 
ATOM   3938 C CD    . ARG B 2 34  ? 3.277  -29.282 45.611  1.00 89.23  ? 34  ARG B CD    1 
ATOM   3939 N NE    . ARG B 2 34  ? 4.015  -28.266 46.359  1.00 87.94  ? 34  ARG B NE    1 
ATOM   3940 C CZ    . ARG B 2 34  ? 3.457  -27.194 46.921  1.00 88.53  ? 34  ARG B CZ    1 
ATOM   3941 N NH1   . ARG B 2 34  ? 2.149  -26.988 46.839  1.00 89.48  ? 34  ARG B NH1   1 
ATOM   3942 N NH2   . ARG B 2 34  ? 4.208  -26.317 47.572  1.00 88.40  ? 34  ARG B NH2   1 
ATOM   3943 N N     . LEU B 2 35  ? 6.210  -32.571 41.849  1.00 88.26  ? 35  LEU B N     1 
ATOM   3944 C CA    . LEU B 2 35  ? 6.586  -32.795 40.460  1.00 87.10  ? 35  LEU B CA    1 
ATOM   3945 C C     . LEU B 2 35  ? 6.448  -34.257 40.014  1.00 90.98  ? 35  LEU B C     1 
ATOM   3946 O O     . LEU B 2 35  ? 6.154  -34.525 38.848  1.00 91.17  ? 35  LEU B O     1 
ATOM   3947 C CB    . LEU B 2 35  ? 8.017  -32.302 40.231  1.00 84.93  ? 35  LEU B CB    1 
ATOM   3948 C CG    . LEU B 2 35  ? 8.265  -30.814 39.961  1.00 78.91  ? 35  LEU B CG    1 
ATOM   3949 C CD1   . LEU B 2 35  ? 9.663  -30.440 40.400  1.00 76.59  ? 35  LEU B CD1   1 
ATOM   3950 C CD2   . LEU B 2 35  ? 8.091  -30.527 38.486  1.00 75.42  ? 35  LEU B CD2   1 
ATOM   3951 N N     . ASP B 2 36  ? 6.647  -35.188 40.943  1.00 94.39  ? 36  ASP B N     1 
ATOM   3952 C CA    . ASP B 2 36  ? 6.692  -36.617 40.612  1.00 99.07  ? 36  ASP B CA    1 
ATOM   3953 C C     . ASP B 2 36  ? 5.340  -37.312 40.561  1.00 102.35 ? 36  ASP B C     1 
ATOM   3954 O O     . ASP B 2 36  ? 5.216  -38.404 39.991  1.00 105.64 ? 36  ASP B O     1 
ATOM   3955 C CB    . ASP B 2 36  ? 7.617  -37.361 41.567  1.00 101.70 ? 36  ASP B CB    1 
ATOM   3956 C CG    . ASP B 2 36  ? 9.074  -37.096 41.281  1.00 100.28 ? 36  ASP B CG    1 
ATOM   3957 O OD1   . ASP B 2 36  ? 9.405  -36.674 40.151  1.00 98.18  ? 36  ASP B OD1   1 
ATOM   3958 O OD2   . ASP B 2 36  ? 9.894  -37.307 42.192  1.00 101.62 ? 36  ASP B OD2   1 
ATOM   3959 N N     . GLU B 2 37  ? 4.335  -36.690 41.170  1.00 101.92 ? 37  GLU B N     1 
ATOM   3960 C CA    . GLU B 2 37  ? 2.959  -37.171 41.054  1.00 105.02 ? 37  GLU B CA    1 
ATOM   3961 C C     . GLU B 2 37  ? 2.279  -36.470 39.871  1.00 102.58 ? 37  GLU B C     1 
ATOM   3962 O O     . GLU B 2 37  ? 1.067  -36.224 39.870  1.00 103.13 ? 37  GLU B O     1 
ATOM   3963 C CB    . GLU B 2 37  ? 2.188  -36.980 42.368  1.00 106.39 ? 37  GLU B CB    1 
ATOM   3964 C CG    . GLU B 2 37  ? 2.132  -35.534 42.869  1.00 102.80 ? 37  GLU B CG    1 
ATOM   3965 C CD    . GLU B 2 37  ? 1.598  -35.405 44.291  1.00 104.79 ? 37  GLU B CD    1 
ATOM   3966 O OE1   . GLU B 2 37  ? 1.518  -34.251 44.776  1.00 102.97 ? 37  GLU B OE1   1 
ATOM   3967 O OE2   . GLU B 2 37  ? 1.264  -36.439 44.923  1.00 108.38 ? 37  GLU B OE2   1 
ATOM   3968 N N     . LEU B 2 38  ? 3.092  -36.147 38.869  1.00 100.29 ? 38  LEU B N     1 
ATOM   3969 C CA    . LEU B 2 38  ? 2.624  -35.559 37.625  1.00 98.42  ? 38  LEU B CA    1 
ATOM   3970 C C     . LEU B 2 38  ? 3.436  -36.122 36.468  1.00 99.50  ? 38  LEU B C     1 
ATOM   3971 O O     . LEU B 2 38  ? 3.227  -35.742 35.315  1.00 98.85  ? 38  LEU B O     1 
ATOM   3972 C CB    . LEU B 2 38  ? 2.734  -34.032 37.670  1.00 93.53  ? 38  LEU B CB    1 
ATOM   3973 C CG    . LEU B 2 38  ? 1.724  -33.280 38.550  1.00 92.44  ? 38  LEU B CG    1 
ATOM   3974 C CD1   . LEU B 2 38  ? 2.154  -31.843 38.754  1.00 88.37  ? 38  LEU B CD1   1 
ATOM   3975 C CD2   . LEU B 2 38  ? 0.306  -33.333 37.986  1.00 93.44  ? 38  LEU B CD2   1 
ATOM   3976 N N     . GLY B 2 39  ? 4.357  -37.029 36.795  1.00 101.59 ? 39  GLY B N     1 
ATOM   3977 C CA    . GLY B 2 39  ? 5.280  -37.636 35.837  1.00 103.17 ? 39  GLY B CA    1 
ATOM   3978 C C     . GLY B 2 39  ? 5.927  -36.725 34.805  1.00 100.15 ? 39  GLY B C     1 
ATOM   3979 O O     . GLY B 2 39  ? 5.964  -37.071 33.628  1.00 101.70 ? 39  GLY B O     1 
ATOM   3980 N N     . VAL B 2 40  ? 6.433  -35.566 35.232  1.00 96.38  ? 40  VAL B N     1 
ATOM   3981 C CA    . VAL B 2 40  ? 7.103  -34.629 34.310  1.00 93.77  ? 40  VAL B CA    1 
ATOM   3982 C C     . VAL B 2 40  ? 8.612  -34.601 34.466  1.00 93.27  ? 40  VAL B C     1 
ATOM   3983 O O     . VAL B 2 40  ? 9.120  -34.465 35.574  1.00 92.50  ? 40  VAL B O     1 
ATOM   3984 C CB    . VAL B 2 40  ? 6.574  -33.183 34.410  1.00 89.85  ? 40  VAL B CB    1 
ATOM   3985 C CG1   . VAL B 2 40  ? 5.374  -33.005 33.495  1.00 90.52  ? 40  VAL B CG1   1 
ATOM   3986 C CG2   . VAL B 2 40  ? 6.259  -32.795 35.864  1.00 88.83  ? 40  VAL B CG2   1 
ATOM   3987 N N     . GLU B 2 41  ? 9.318  -34.711 33.345  1.00 94.07  ? 41  GLU B N     1 
ATOM   3988 C CA    . GLU B 2 41  ? 10.769 -34.718 33.360  1.00 94.30  ? 41  GLU B CA    1 
ATOM   3989 C C     . GLU B 2 41  ? 11.288 -33.338 33.743  1.00 90.33  ? 41  GLU B C     1 
ATOM   3990 O O     . GLU B 2 41  ? 10.798 -32.324 33.242  1.00 87.90  ? 41  GLU B O     1 
ATOM   3991 C CB    . GLU B 2 41  ? 11.316 -35.144 32.001  1.00 96.90  ? 41  GLU B CB    1 
ATOM   3992 C CG    . GLU B 2 41  ? 12.563 -36.021 32.094  1.00 99.91  ? 41  GLU B CG    1 
ATOM   3993 C CD    . GLU B 2 41  ? 13.261 -36.193 30.759  1.00 101.67 ? 41  GLU B CD    1 
ATOM   3994 O OE1   . GLU B 2 41  ? 12.603 -36.612 29.780  1.00 103.83 ? 41  GLU B OE1   1 
ATOM   3995 O OE2   . GLU B 2 41  ? 14.476 -35.911 30.695  1.00 101.04 ? 41  GLU B OE2   1 
ATOM   3996 N N     . TYR B 2 42  ? 12.266 -33.312 34.648  1.00 90.17  ? 42  TYR B N     1 
ATOM   3997 C CA    . TYR B 2 42  ? 12.795 -32.068 35.212  1.00 86.71  ? 42  TYR B CA    1 
ATOM   3998 C C     . TYR B 2 42  ? 14.201 -32.229 35.786  1.00 87.68  ? 42  TYR B C     1 
ATOM   3999 O O     . TYR B 2 42  ? 14.604 -33.323 36.168  1.00 91.16  ? 42  TYR B O     1 
ATOM   4000 C CB    . TYR B 2 42  ? 11.863 -31.540 36.313  1.00 84.71  ? 42  TYR B CB    1 
ATOM   4001 C CG    . TYR B 2 42  ? 11.835 -32.375 37.588  1.00 86.67  ? 42  TYR B CG    1 
ATOM   4002 C CD1   . TYR B 2 42  ? 12.774 -32.178 38.604  1.00 86.39  ? 42  TYR B CD1   1 
ATOM   4003 C CD2   . TYR B 2 42  ? 10.857 -33.349 37.786  1.00 88.91  ? 42  TYR B CD2   1 
ATOM   4004 C CE1   . TYR B 2 42  ? 12.744 -32.936 39.772  1.00 88.27  ? 42  TYR B CE1   1 
ATOM   4005 C CE2   . TYR B 2 42  ? 10.821 -34.108 38.952  1.00 91.17  ? 42  TYR B CE2   1 
ATOM   4006 C CZ    . TYR B 2 42  ? 11.765 -33.892 39.938  1.00 90.95  ? 42  TYR B CZ    1 
ATOM   4007 O OH    . TYR B 2 42  ? 11.733 -34.639 41.090  1.00 94.37  ? 42  TYR B OH    1 
ATOM   4008 N N     . VAL B 2 43  ? 14.937 -31.127 35.850  1.00 85.38  ? 43  VAL B N     1 
ATOM   4009 C CA    . VAL B 2 43  ? 16.185 -31.074 36.604  1.00 85.92  ? 43  VAL B CA    1 
ATOM   4010 C C     . VAL B 2 43  ? 16.325 -29.695 37.248  1.00 82.80  ? 43  VAL B C     1 
ATOM   4011 O O     . VAL B 2 43  ? 15.825 -28.694 36.721  1.00 80.29  ? 43  VAL B O     1 
ATOM   4012 C CB    . VAL B 2 43  ? 17.426 -31.418 35.727  1.00 88.24  ? 43  VAL B CB    1 
ATOM   4013 C CG1   . VAL B 2 43  ? 17.669 -30.347 34.650  1.00 86.19  ? 43  VAL B CG1   1 
ATOM   4014 C CG2   . VAL B 2 43  ? 18.678 -31.649 36.601  1.00 89.55  ? 43  VAL B CG2   1 
ATOM   4015 N N     . PHE B 2 44  ? 16.977 -29.665 38.406  1.00 83.25  ? 44  PHE B N     1 
ATOM   4016 C CA    . PHE B 2 44  ? 17.305 -28.420 39.086  1.00 80.70  ? 44  PHE B CA    1 
ATOM   4017 C C     . PHE B 2 44  ? 18.599 -27.873 38.503  1.00 80.38  ? 44  PHE B C     1 
ATOM   4018 O O     . PHE B 2 44  ? 19.496 -28.632 38.149  1.00 82.79  ? 44  PHE B O     1 
ATOM   4019 C CB    . PHE B 2 44  ? 17.484 -28.664 40.587  1.00 82.14  ? 44  PHE B CB    1 
ATOM   4020 C CG    . PHE B 2 44  ? 16.224 -29.078 41.299  1.00 82.50  ? 44  PHE B CG    1 
ATOM   4021 C CD1   . PHE B 2 44  ? 15.735 -30.380 41.190  1.00 85.73  ? 44  PHE B CD1   1 
ATOM   4022 C CD2   . PHE B 2 44  ? 15.544 -28.174 42.109  1.00 80.35  ? 44  PHE B CD2   1 
ATOM   4023 C CE1   . PHE B 2 44  ? 14.565 -30.758 41.858  1.00 86.70  ? 44  PHE B CE1   1 
ATOM   4024 C CE2   . PHE B 2 44  ? 14.387 -28.543 42.784  1.00 81.10  ? 44  PHE B CE2   1 
ATOM   4025 C CZ    . PHE B 2 44  ? 13.890 -29.835 42.659  1.00 84.01  ? 44  PHE B CZ    1 
ATOM   4026 N N     . VAL B 2 45  ? 18.695 -26.556 38.396  1.00 77.73  ? 45  VAL B N     1 
ATOM   4027 C CA    . VAL B 2 45  ? 19.901 -25.932 37.868  1.00 77.66  ? 45  VAL B CA    1 
ATOM   4028 C C     . VAL B 2 45  ? 20.215 -24.676 38.665  1.00 76.02  ? 45  VAL B C     1 
ATOM   4029 O O     . VAL B 2 45  ? 19.577 -24.399 39.684  1.00 74.99  ? 45  VAL B O     1 
ATOM   4030 C CB    . VAL B 2 45  ? 19.769 -25.577 36.363  1.00 77.16  ? 45  VAL B CB    1 
ATOM   4031 C CG1   . VAL B 2 45  ? 19.720 -26.831 35.489  1.00 79.19  ? 45  VAL B CG1   1 
ATOM   4032 C CG2   . VAL B 2 45  ? 18.547 -24.688 36.117  1.00 74.71  ? 45  VAL B CG2   1 
ATOM   4033 N N     . GLY B 2 46  ? 21.209 -23.927 38.197  1.00 76.16  ? 46  GLY B N     1 
ATOM   4034 C CA    . GLY B 2 46  ? 21.545 -22.635 38.778  1.00 74.92  ? 46  GLY B CA    1 
ATOM   4035 C C     . GLY B 2 46  ? 22.280 -22.682 40.101  1.00 76.17  ? 46  GLY B C     1 
ATOM   4036 O O     . GLY B 2 46  ? 22.654 -23.751 40.587  1.00 78.36  ? 46  GLY B O     1 
ATOM   4037 N N     . SER B 2 47  ? 22.475 -21.507 40.687  1.00 75.34  ? 47  SER B N     1 
ATOM   4038 C CA    . SER B 2 47  ? 23.271 -21.372 41.892  1.00 77.17  ? 47  SER B CA    1 
ATOM   4039 C C     . SER B 2 47  ? 22.748 -22.262 43.000  1.00 78.30  ? 47  SER B C     1 
ATOM   4040 O O     . SER B 2 47  ? 23.528 -22.777 43.806  1.00 81.01  ? 47  SER B O     1 
ATOM   4041 C CB    . SER B 2 47  ? 23.271 -19.936 42.374  1.00 76.21  ? 47  SER B CB    1 
ATOM   4042 O OG    . SER B 2 47  ? 22.038 -19.652 43.004  1.00 75.07  ? 47  SER B OG    1 
ATOM   4043 N N     . TYR B 2 48  ? 21.432 -22.443 43.051  1.00 76.76  ? 48  TYR B N     1 
ATOM   4044 C CA    . TYR B 2 48  ? 20.876 -23.336 44.048  1.00 77.93  ? 48  TYR B CA    1 
ATOM   4045 C C     . TYR B 2 48  ? 21.435 -24.736 43.879  1.00 80.22  ? 48  TYR B C     1 
ATOM   4046 O O     . TYR B 2 48  ? 21.954 -25.308 44.833  1.00 83.04  ? 48  TYR B O     1 
ATOM   4047 C CB    . TYR B 2 48  ? 19.352 -23.384 44.015  1.00 76.43  ? 48  TYR B CB    1 
ATOM   4048 C CG    . TYR B 2 48  ? 18.820 -24.289 45.095  1.00 78.02  ? 48  TYR B CG    1 
ATOM   4049 C CD1   . TYR B 2 48  ? 18.737 -23.849 46.415  1.00 79.41  ? 48  TYR B CD1   1 
ATOM   4050 C CD2   . TYR B 2 48  ? 18.443 -25.595 44.811  1.00 79.30  ? 48  TYR B CD2   1 
ATOM   4051 C CE1   . TYR B 2 48  ? 18.269 -24.679 47.427  1.00 81.78  ? 48  TYR B CE1   1 
ATOM   4052 C CE2   . TYR B 2 48  ? 17.975 -26.441 45.815  1.00 82.04  ? 48  TYR B CE2   1 
ATOM   4053 C CZ    . TYR B 2 48  ? 17.891 -25.977 47.122  1.00 83.15  ? 48  TYR B CZ    1 
ATOM   4054 O OH    . TYR B 2 48  ? 17.424 -26.809 48.120  1.00 85.71  ? 48  TYR B OH    1 
ATOM   4055 N N     . ALA B 2 49  ? 21.348 -25.275 42.665  1.00 79.66  ? 49  ALA B N     1 
ATOM   4056 C CA    . ALA B 2 49  ? 21.689 -26.680 42.415  1.00 82.03  ? 49  ALA B CA    1 
ATOM   4057 C C     . ALA B 2 49  ? 23.197 -26.991 42.368  1.00 84.61  ? 49  ALA B C     1 
ATOM   4058 O O     . ALA B 2 49  ? 23.595 -28.110 42.058  1.00 87.16  ? 49  ALA B O     1 
ATOM   4059 C CB    . ALA B 2 49  ? 20.990 -27.175 41.156  1.00 81.15  ? 49  ALA B CB    1 
ATOM   4060 N N     . ARG B 2 50  ? 24.025 -26.000 42.684  1.00 84.32  ? 50  ARG B N     1 
ATOM   4061 C CA    . ARG B 2 50  ? 25.472 -26.175 42.739  1.00 86.90  ? 50  ARG B CA    1 
ATOM   4062 C C     . ARG B 2 50  ? 26.049 -25.399 43.918  1.00 87.43  ? 50  ARG B C     1 
ATOM   4063 O O     . ARG B 2 50  ? 27.212 -24.990 43.891  1.00 88.99  ? 50  ARG B O     1 
ATOM   4064 C CB    . ARG B 2 50  ? 26.128 -25.676 41.448  1.00 86.83  ? 50  ARG B CB    1 
ATOM   4065 C CG    . ARG B 2 50  ? 25.669 -26.344 40.162  1.00 86.53  ? 50  ARG B CG    1 
ATOM   4066 C CD    . ARG B 2 50  ? 26.390 -25.761 38.946  1.00 86.81  ? 50  ARG B CD    1 
ATOM   4067 N NE    . ARG B 2 50  ? 26.116 -24.336 38.729  1.00 83.91  ? 50  ARG B NE    1 
ATOM   4068 C CZ    . ARG B 2 50  ? 25.151 -23.862 37.940  1.00 81.34  ? 50  ARG B CZ    1 
ATOM   4069 N NH1   . ARG B 2 50  ? 24.340 -24.685 37.289  1.00 81.67  ? 50  ARG B NH1   1 
ATOM   4070 N NH2   . ARG B 2 50  ? 24.989 -22.558 37.801  1.00 78.62  ? 50  ARG B NH2   1 
ATOM   4071 N N     . ASN B 2 51  ? 25.224 -25.179 44.940  1.00 86.42  ? 51  ASN B N     1 
ATOM   4072 C CA    . ASN B 2 51  ? 25.647 -24.490 46.158  1.00 87.43  ? 51  ASN B CA    1 
ATOM   4073 C C     . ASN B 2 51  ? 26.475 -23.231 45.921  1.00 86.85  ? 51  ASN B C     1 
ATOM   4074 O O     . ASN B 2 51  ? 27.621 -23.151 46.373  1.00 89.62  ? 51  ASN B O     1 
ATOM   4075 C CB    . ASN B 2 51  ? 26.418 -25.447 47.069  1.00 91.58  ? 51  ASN B CB    1 
ATOM   4076 C CG    . ASN B 2 51  ? 25.694 -25.727 48.360  1.00 93.16  ? 51  ASN B CG    1 
ATOM   4077 O OD1   . ASN B 2 51  ? 26.009 -25.137 49.395  1.00 95.20  ? 51  ASN B OD1   1 
ATOM   4078 N ND2   . ASN B 2 51  ? 24.711 -26.620 48.312  1.00 93.00  ? 51  ASN B ND2   1 
ATOM   4079 N N     . THR B 2 52  ? 25.893 -22.261 45.212  1.00 83.44  ? 52  THR B N     1 
ATOM   4080 C CA    . THR B 2 52  ? 26.546 -20.978 44.941  1.00 82.53  ? 52  THR B CA    1 
ATOM   4081 C C     . THR B 2 52  ? 25.600 -19.778 45.068  1.00 80.08  ? 52  THR B C     1 
ATOM   4082 O O     . THR B 2 52  ? 25.910 -18.694 44.576  1.00 79.09  ? 52  THR B O     1 
ATOM   4083 C CB    . THR B 2 52  ? 27.240 -20.941 43.541  1.00 82.44  ? 52  THR B CB    1 
ATOM   4084 O OG1   . THR B 2 52  ? 26.394 -21.531 42.550  1.00 80.31  ? 52  THR B OG1   1 
ATOM   4085 C CG2   . THR B 2 52  ? 28.563 -21.677 43.560  1.00 85.70  ? 52  THR B CG2   1 
ATOM   4086 N N     . TRP B 2 53  ? 24.453 -19.960 45.720  1.00 79.13  ? 53  TRP B N     1 
ATOM   4087 C CA    . TRP B 2 53  ? 23.565 -18.827 45.997  1.00 77.54  ? 53  TRP B CA    1 
ATOM   4088 C C     . TRP B 2 53  ? 24.104 -18.036 47.183  1.00 79.73  ? 53  TRP B C     1 
ATOM   4089 O O     . TRP B 2 53  ? 25.047 -18.476 47.846  1.00 82.53  ? 53  TRP B O     1 
ATOM   4090 C CB    . TRP B 2 53  ? 22.122 -19.273 46.249  1.00 76.37  ? 53  TRP B CB    1 
ATOM   4091 C CG    . TRP B 2 53  ? 21.878 -19.839 47.616  1.00 78.92  ? 53  TRP B CG    1 
ATOM   4092 C CD1   . TRP B 2 53  ? 21.461 -19.160 48.732  1.00 80.32  ? 53  TRP B CD1   1 
ATOM   4093 C CD2   . TRP B 2 53  ? 22.025 -21.203 48.010  1.00 80.62  ? 53  TRP B CD2   1 
ATOM   4094 N NE1   . TRP B 2 53  ? 21.348 -20.022 49.800  1.00 82.55  ? 53  TRP B NE1   1 
ATOM   4095 C CE2   . TRP B 2 53  ? 21.688 -21.282 49.383  1.00 82.95  ? 53  TRP B CE2   1 
ATOM   4096 C CE3   . TRP B 2 53  ? 22.413 -22.368 47.339  1.00 80.98  ? 53  TRP B CE3   1 
ATOM   4097 C CZ2   . TRP B 2 53  ? 21.728 -22.482 50.097  1.00 85.71  ? 53  TRP B CZ2   1 
ATOM   4098 C CZ3   . TRP B 2 53  ? 22.460 -23.565 48.053  1.00 84.11  ? 53  TRP B CZ3   1 
ATOM   4099 C CH2   . TRP B 2 53  ? 22.118 -23.611 49.418  1.00 86.09  ? 53  TRP B CH2   1 
ATOM   4100 N N     . LEU B 2 54  ? 23.498 -16.882 47.456  1.00 79.05  ? 54  LEU B N     1 
ATOM   4101 C CA    . LEU B 2 54  ? 24.000 -15.965 48.485  1.00 81.24  ? 54  LEU B CA    1 
ATOM   4102 C C     . LEU B 2 54  ? 23.148 -15.924 49.752  1.00 82.60  ? 54  LEU B C     1 
ATOM   4103 O O     . LEU B 2 54  ? 21.946 -16.203 49.722  1.00 80.97  ? 54  LEU B O     1 
ATOM   4104 C CB    . LEU B 2 54  ? 24.149 -14.546 47.913  1.00 80.45  ? 54  LEU B CB    1 
ATOM   4105 C CG    . LEU B 2 54  ? 25.414 -14.152 47.136  1.00 80.98  ? 54  LEU B CG    1 
ATOM   4106 C CD1   . LEU B 2 54  ? 25.530 -14.914 45.833  1.00 78.46  ? 54  LEU B CD1   1 
ATOM   4107 C CD2   . LEU B 2 54  ? 25.437 -12.644 46.864  1.00 81.34  ? 54  LEU B CD2   1 
ATOM   4108 N N     . LYS B 2 55  ? 23.795 -15.583 50.864  1.00 86.02  ? 55  LYS B N     1 
ATOM   4109 C CA    . LYS B 2 55  ? 23.105 -15.222 52.096  1.00 88.32  ? 55  LYS B CA    1 
ATOM   4110 C C     . LYS B 2 55  ? 22.128 -14.077 51.789  1.00 86.89  ? 55  LYS B C     1 
ATOM   4111 O O     . LYS B 2 55  ? 22.546 -12.956 51.474  1.00 86.89  ? 55  LYS B O     1 
ATOM   4112 C CB    . LYS B 2 55  ? 24.118 -14.783 53.161  1.00 92.35  ? 55  LYS B CB    1 
ATOM   4113 C CG    . LYS B 2 55  ? 23.632 -14.931 54.599  1.00 96.23  ? 55  LYS B CG    1 
ATOM   4114 C CD    . LYS B 2 55  ? 24.408 -14.024 55.559  1.00 100.95 ? 55  LYS B CD    1 
ATOM   4115 C CE    . LYS B 2 55  ? 24.750 -14.733 56.881  1.00 105.67 ? 55  LYS B CE    1 
ATOM   4116 N NZ    . LYS B 2 55  ? 23.598 -15.411 57.545  1.00 106.23 ? 55  LYS B NZ    1 
ATOM   4117 N N     . GLY B 2 56  ? 20.832 -14.381 51.861  1.00 85.79  ? 56  GLY B N     1 
ATOM   4118 C CA    . GLY B 2 56  ? 19.768 -13.407 51.603  1.00 84.66  ? 56  GLY B CA    1 
ATOM   4119 C C     . GLY B 2 56  ? 18.857 -13.892 50.492  1.00 81.19  ? 56  GLY B C     1 
ATOM   4120 O O     . GLY B 2 56  ? 17.957 -14.708 50.717  1.00 80.79  ? 56  GLY B O     1 
ATOM   4121 N N     . SER B 2 57  ? 19.107 -13.387 49.289  1.00 78.98  ? 57  SER B N     1 
ATOM   4122 C CA    . SER B 2 57  ? 18.411 -13.830 48.085  1.00 75.96  ? 57  SER B CA    1 
ATOM   4123 C C     . SER B 2 57  ? 18.653 -15.312 47.819  1.00 75.20  ? 57  SER B C     1 
ATOM   4124 O O     . SER B 2 57  ? 19.756 -15.714 47.444  1.00 75.40  ? 57  SER B O     1 
ATOM   4125 C CB    . SER B 2 57  ? 18.859 -12.997 46.870  1.00 74.61  ? 57  SER B CB    1 
ATOM   4126 O OG    . SER B 2 57  ? 20.242 -13.172 46.600  1.00 74.62  ? 57  SER B OG    1 
ATOM   4127 N N     . LEU B 2 58  ? 17.625 -16.122 48.033  1.00 74.81  ? 58  LEU B N     1 
ATOM   4128 C CA    . LEU B 2 58  ? 17.711 -17.537 47.724  1.00 74.19  ? 58  LEU B CA    1 
ATOM   4129 C C     . LEU B 2 58  ? 16.692 -17.870 46.662  1.00 72.10  ? 58  LEU B C     1 
ATOM   4130 O O     . LEU B 2 58  ? 15.498 -17.654 46.859  1.00 71.83  ? 58  LEU B O     1 
ATOM   4131 C CB    . LEU B 2 58  ? 17.478 -18.403 48.973  1.00 76.66  ? 58  LEU B CB    1 
ATOM   4132 C CG    . LEU B 2 58  ? 17.131 -19.896 48.785  1.00 76.18  ? 58  LEU B CG    1 
ATOM   4133 C CD1   . LEU B 2 58  ? 18.218 -20.680 48.049  1.00 74.97  ? 58  LEU B CD1   1 
ATOM   4134 C CD2   . LEU B 2 58  ? 16.803 -20.558 50.116  1.00 79.41  ? 58  LEU B CD2   1 
ATOM   4135 N N     . GLU B 2 59  ? 17.167 -18.403 45.541  1.00 71.11  ? 59  GLU B N     1 
ATOM   4136 C CA    . GLU B 2 59  ? 16.268 -18.900 44.511  1.00 69.76  ? 59  GLU B CA    1 
ATOM   4137 C C     . GLU B 2 59  ? 16.596 -20.316 44.049  1.00 70.35  ? 59  GLU B C     1 
ATOM   4138 O O     . GLU B 2 59  ? 17.749 -20.756 44.091  1.00 71.24  ? 59  GLU B O     1 
ATOM   4139 C CB    . GLU B 2 59  ? 16.217 -17.947 43.324  1.00 67.99  ? 59  GLU B CB    1 
ATOM   4140 C CG    . GLU B 2 59  ? 14.935 -18.074 42.503  1.00 67.38  ? 59  GLU B CG    1 
ATOM   4141 C CD    . GLU B 2 59  ? 14.443 -16.741 41.967  1.00 66.92  ? 59  GLU B CD    1 
ATOM   4142 O OE1   . GLU B 2 59  ? 13.405 -16.712 41.266  1.00 65.88  ? 59  GLU B OE1   1 
ATOM   4143 O OE2   . GLU B 2 59  ? 15.092 -15.714 42.258  1.00 68.17  ? 59  GLU B OE2   1 
ATOM   4144 N N     . ILE B 2 60  ? 15.543 -21.011 43.622  1.00 70.30  ? 60  ILE B N     1 
ATOM   4145 C CA    . ILE B 2 60  ? 15.619 -22.361 43.056  1.00 71.43  ? 60  ILE B CA    1 
ATOM   4146 C C     . ILE B 2 60  ? 15.156 -22.351 41.603  1.00 70.22  ? 60  ILE B C     1 
ATOM   4147 O O     . ILE B 2 60  ? 14.115 -21.763 41.269  1.00 69.04  ? 60  ILE B O     1 
ATOM   4148 C CB    . ILE B 2 60  ? 14.735 -23.359 43.834  1.00 72.79  ? 60  ILE B CB    1 
ATOM   4149 C CG1   . ILE B 2 60  ? 15.195 -23.454 45.289  1.00 74.49  ? 60  ILE B CG1   1 
ATOM   4150 C CG2   . ILE B 2 60  ? 14.737 -24.738 43.147  1.00 73.88  ? 60  ILE B CG2   1 
ATOM   4151 C CD1   . ILE B 2 60  ? 14.075 -23.674 46.257  1.00 75.24  ? 60  ILE B CD1   1 
ATOM   4152 N N     . ASP B 2 61  ? 15.927 -23.013 40.748  1.00 70.82  ? 61  ASP B N     1 
ATOM   4153 C CA    . ASP B 2 61  ? 15.612 -23.054 39.343  1.00 70.27  ? 61  ASP B CA    1 
ATOM   4154 C C     . ASP B 2 61  ? 15.220 -24.478 38.960  1.00 71.90  ? 61  ASP B C     1 
ATOM   4155 O O     . ASP B 2 61  ? 16.034 -25.409 39.065  1.00 74.01  ? 61  ASP B O     1 
ATOM   4156 C CB    . ASP B 2 61  ? 16.801 -22.530 38.526  1.00 70.43  ? 61  ASP B CB    1 
ATOM   4157 C CG    . ASP B 2 61  ? 17.097 -21.029 38.789  1.00 70.50  ? 61  ASP B CG    1 
ATOM   4158 O OD1   . ASP B 2 61  ? 18.212 -20.716 39.267  1.00 72.27  ? 61  ASP B OD1   1 
ATOM   4159 O OD2   . ASP B 2 61  ? 16.225 -20.157 38.525  1.00 69.18  ? 61  ASP B OD2   1 
ATOM   4160 N N     . VAL B 2 62  ? 13.959 -24.652 38.560  1.00 71.30  ? 62  VAL B N     1 
ATOM   4161 C CA    . VAL B 2 62  ? 13.489 -25.949 38.043  1.00 72.79  ? 62  VAL B CA    1 
ATOM   4162 C C     . VAL B 2 62  ? 13.225 -25.896 36.536  1.00 72.36  ? 62  VAL B C     1 
ATOM   4163 O O     . VAL B 2 62  ? 12.470 -25.051 36.044  1.00 70.69  ? 62  VAL B O     1 
ATOM   4164 C CB    . VAL B 2 62  ? 12.253 -26.492 38.804  1.00 73.52  ? 62  VAL B CB    1 
ATOM   4165 C CG1   . VAL B 2 62  ? 11.775 -27.800 38.192  1.00 75.05  ? 62  VAL B CG1   1 
ATOM   4166 C CG2   . VAL B 2 62  ? 12.589 -26.693 40.270  1.00 74.34  ? 62  VAL B CG2   1 
ATOM   4167 N N     . PHE B 2 63  ? 13.867 -26.808 35.815  1.00 74.11  ? 63  PHE B N     1 
ATOM   4168 C CA    . PHE B 2 63  ? 13.806 -26.814 34.364  1.00 74.33  ? 63  PHE B CA    1 
ATOM   4169 C C     . PHE B 2 63  ? 13.081 -28.026 33.819  1.00 76.29  ? 63  PHE B C     1 
ATOM   4170 O O     . PHE B 2 63  ? 13.484 -29.168 34.047  1.00 78.33  ? 63  PHE B O     1 
ATOM   4171 C CB    . PHE B 2 63  ? 15.208 -26.689 33.763  1.00 75.45  ? 63  PHE B CB    1 
ATOM   4172 C CG    . PHE B 2 63  ? 15.578 -25.284 33.379  1.00 73.32  ? 63  PHE B CG    1 
ATOM   4173 C CD1   . PHE B 2 63  ? 15.409 -24.233 34.272  1.00 70.82  ? 63  PHE B CD1   1 
ATOM   4174 C CD2   . PHE B 2 63  ? 16.107 -25.017 32.122  1.00 74.51  ? 63  PHE B CD2   1 
ATOM   4175 C CE1   . PHE B 2 63  ? 15.753 -22.935 33.916  1.00 70.14  ? 63  PHE B CE1   1 
ATOM   4176 C CE2   . PHE B 2 63  ? 16.456 -23.726 31.750  1.00 73.48  ? 63  PHE B CE2   1 
ATOM   4177 C CZ    . PHE B 2 63  ? 16.274 -22.676 32.651  1.00 71.27  ? 63  PHE B CZ    1 
ATOM   4178 N N     . LEU B 2 64  ? 12.001 -27.734 33.100  1.00 75.60  ? 64  LEU B N     1 
ATOM   4179 C CA    . LEU B 2 64  ? 11.132 -28.729 32.491  1.00 77.71  ? 64  LEU B CA    1 
ATOM   4180 C C     . LEU B 2 64  ? 11.675 -29.144 31.131  1.00 79.95  ? 64  LEU B C     1 
ATOM   4181 O O     . LEU B 2 64  ? 11.745 -28.324 30.206  1.00 79.18  ? 64  LEU B O     1 
ATOM   4182 C CB    . LEU B 2 64  ? 9.721  -28.161 32.324  1.00 76.24  ? 64  LEU B CB    1 
ATOM   4183 C CG    . LEU B 2 64  ? 9.079  -27.473 33.530  1.00 74.08  ? 64  LEU B CG    1 
ATOM   4184 C CD1   . LEU B 2 64  ? 7.887  -26.637 33.079  1.00 72.53  ? 64  LEU B CD1   1 
ATOM   4185 C CD2   . LEU B 2 64  ? 8.681  -28.472 34.622  1.00 74.84  ? 64  LEU B CD2   1 
ATOM   4186 N N     . LEU B 2 65  ? 12.043 -30.422 31.023  1.00 83.15  ? 65  LEU B N     1 
ATOM   4187 C CA    . LEU B 2 65  ? 12.617 -30.986 29.800  1.00 86.03  ? 65  LEU B CA    1 
ATOM   4188 C C     . LEU B 2 65  ? 11.510 -31.484 28.877  1.00 88.16  ? 65  LEU B C     1 
ATOM   4189 O O     . LEU B 2 65  ? 10.655 -32.276 29.286  1.00 89.48  ? 65  LEU B O     1 
ATOM   4190 C CB    . LEU B 2 65  ? 13.655 -32.072 30.128  1.00 88.80  ? 65  LEU B CB    1 
ATOM   4191 C CG    . LEU B 2 65  ? 14.902 -31.562 30.879  1.00 87.09  ? 65  LEU B CG    1 
ATOM   4192 C CD1   . LEU B 2 65  ? 15.717 -32.678 31.514  1.00 89.47  ? 65  LEU B CD1   1 
ATOM   4193 C CD2   . LEU B 2 65  ? 15.799 -30.695 29.994  1.00 86.63  ? 65  LEU B CD2   1 
ATOM   4194 N N     . PHE B 2 66  ? 11.532 -30.985 27.640  1.00 88.95  ? 66  PHE B N     1 
ATOM   4195 C CA    . PHE B 2 66  ? 10.453 -31.175 26.659  1.00 90.78  ? 66  PHE B CA    1 
ATOM   4196 C C     . PHE B 2 66  ? 10.946 -31.757 25.330  1.00 95.09  ? 66  PHE B C     1 
ATOM   4197 O O     . PHE B 2 66  ? 12.064 -31.456 24.897  1.00 95.49  ? 66  PHE B O     1 
ATOM   4198 C CB    . PHE B 2 66  ? 9.749  -29.838 26.374  1.00 87.67  ? 66  PHE B CB    1 
ATOM   4199 C CG    . PHE B 2 66  ? 8.573  -29.555 27.270  1.00 85.29  ? 66  PHE B CG    1 
ATOM   4200 C CD1   . PHE B 2 66  ? 7.287  -29.931 26.887  1.00 86.60  ? 66  PHE B CD1   1 
ATOM   4201 C CD2   . PHE B 2 66  ? 8.747  -28.893 28.485  1.00 81.60  ? 66  PHE B CD2   1 
ATOM   4202 C CE1   . PHE B 2 66  ? 6.195  -29.667 27.707  1.00 84.82  ? 66  PHE B CE1   1 
ATOM   4203 C CE2   . PHE B 2 66  ? 7.660  -28.624 29.310  1.00 79.64  ? 66  PHE B CE2   1 
ATOM   4204 C CZ    . PHE B 2 66  ? 6.381  -29.012 28.923  1.00 81.36  ? 66  PHE B CZ    1 
ATOM   4205 N N     . PRO B 2 67  ? 10.111 -32.598 24.684  1.00 98.65  ? 67  PRO B N     1 
ATOM   4206 C CA    . PRO B 2 67  ? 10.368 -33.053 23.317  1.00 103.28 ? 67  PRO B CA    1 
ATOM   4207 C C     . PRO B 2 67  ? 10.416 -31.886 22.330  1.00 102.54 ? 67  PRO B C     1 
ATOM   4208 O O     . PRO B 2 67  ? 9.634  -30.940 22.439  1.00 99.39  ? 67  PRO B O     1 
ATOM   4209 C CB    . PRO B 2 67  ? 9.188  -33.987 23.014  1.00 106.31 ? 67  PRO B CB    1 
ATOM   4210 C CG    . PRO B 2 67  ? 8.164  -33.678 24.034  1.00 102.91 ? 67  PRO B CG    1 
ATOM   4211 C CD    . PRO B 2 67  ? 8.885  -33.199 25.240  1.00 99.00  ? 67  PRO B CD    1 
ATOM   4212 N N     . GLU B 2 68  ? 11.335 -31.991 21.374  1.00 106.09 ? 68  GLU B N     1 
ATOM   4213 C CA    . GLU B 2 68  ? 11.734 -30.900 20.486  1.00 106.12 ? 68  GLU B CA    1 
ATOM   4214 C C     . GLU B 2 68  ? 10.684 -30.527 19.440  1.00 107.67 ? 68  GLU B C     1 
ATOM   4215 O O     . GLU B 2 68  ? 10.610 -29.371 19.007  1.00 105.89 ? 68  GLU B O     1 
ATOM   4216 C CB    . GLU B 2 68  ? 13.035 -31.290 19.791  1.00 110.17 ? 68  GLU B CB    1 
ATOM   4217 C CG    . GLU B 2 68  ? 13.902 -30.135 19.345  1.00 109.89 ? 68  GLU B CG    1 
ATOM   4218 C CD    . GLU B 2 68  ? 15.071 -30.606 18.503  1.00 116.01 ? 68  GLU B CD    1 
ATOM   4219 O OE1   . GLU B 2 68  ? 15.074 -30.318 17.287  1.00 120.05 ? 68  GLU B OE1   1 
ATOM   4220 O OE2   . GLU B 2 68  ? 15.973 -31.287 19.045  1.00 117.32 ? 68  GLU B OE2   1 
ATOM   4221 N N     . GLU B 2 69  ? 9.883  -31.510 19.038  1.00 111.30 ? 69  GLU B N     1 
ATOM   4222 C CA    . GLU B 2 69  ? 8.839  -31.314 18.033  1.00 113.81 ? 69  GLU B CA    1 
ATOM   4223 C C     . GLU B 2 69  ? 7.716  -30.405 18.544  1.00 109.71 ? 69  GLU B C     1 
ATOM   4224 O O     . GLU B 2 69  ? 6.882  -29.938 17.763  1.00 110.91 ? 69  GLU B O     1 
ATOM   4225 C CB    . GLU B 2 69  ? 8.249  -32.656 17.574  1.00 118.88 ? 69  GLU B CB    1 
ATOM   4226 C CG    . GLU B 2 69  ? 9.165  -33.862 17.734  1.00 122.68 ? 69  GLU B CG    1 
ATOM   4227 C CD    . GLU B 2 69  ? 9.161  -34.419 19.148  1.00 120.44 ? 69  GLU B CD    1 
ATOM   4228 O OE1   . GLU B 2 69  ? 10.223 -34.893 19.606  1.00 121.50 ? 69  GLU B OE1   1 
ATOM   4229 O OE2   . GLU B 2 69  ? 8.097  -34.374 19.804  1.00 118.27 ? 69  GLU B OE2   1 
ATOM   4230 N N     . PHE B 2 70  ? 7.700  -30.166 19.855  1.00 105.42 ? 70  PHE B N     1 
ATOM   4231 C CA    . PHE B 2 70  ? 6.710  -29.295 20.478  1.00 101.67 ? 70  PHE B CA    1 
ATOM   4232 C C     . PHE B 2 70  ? 6.935  -27.861 20.040  1.00 99.60  ? 70  PHE B C     1 
ATOM   4233 O O     . PHE B 2 70  ? 8.041  -27.346 20.148  1.00 98.44  ? 70  PHE B O     1 
ATOM   4234 C CB    . PHE B 2 70  ? 6.764  -29.427 22.004  1.00 98.14  ? 70  PHE B CB    1 
ATOM   4235 C CG    . PHE B 2 70  ? 6.005  -30.616 22.537  1.00 100.21 ? 70  PHE B CG    1 
ATOM   4236 C CD1   . PHE B 2 70  ? 6.091  -31.866 21.907  1.00 104.81 ? 70  PHE B CD1   1 
ATOM   4237 C CD2   . PHE B 2 70  ? 5.203  -30.493 23.667  1.00 97.75  ? 70  PHE B CD2   1 
ATOM   4238 C CE1   . PHE B 2 70  ? 5.386  -32.970 22.387  1.00 106.54 ? 70  PHE B CE1   1 
ATOM   4239 C CE2   . PHE B 2 70  ? 4.496  -31.599 24.159  1.00 100.14 ? 70  PHE B CE2   1 
ATOM   4240 C CZ    . PHE B 2 70  ? 4.593  -32.841 23.517  1.00 103.90 ? 70  PHE B CZ    1 
ATOM   4241 N N     . SER B 2 71  ? 5.887  -27.238 19.511  1.00 99.73  ? 71  SER B N     1 
ATOM   4242 C CA    . SER B 2 71  ? 5.957  -25.858 19.049  1.00 98.41  ? 71  SER B CA    1 
ATOM   4243 C C     . SER B 2 71  ? 5.980  -24.922 20.250  1.00 93.64  ? 71  SER B C     1 
ATOM   4244 O O     . SER B 2 71  ? 5.668  -25.346 21.363  1.00 91.78  ? 71  SER B O     1 
ATOM   4245 C CB    . SER B 2 71  ? 4.754  -25.541 18.163  1.00 100.54 ? 71  SER B CB    1 
ATOM   4246 O OG    . SER B 2 71  ? 3.544  -25.868 18.828  1.00 99.41  ? 71  SER B OG    1 
ATOM   4247 N N     . LYS B 2 72  ? 6.345  -23.658 20.020  1.00 92.32  ? 72  LYS B N     1 
ATOM   4248 C CA    . LYS B 2 72  ? 6.286  -22.594 21.040  1.00 88.17  ? 72  LYS B CA    1 
ATOM   4249 C C     . LYS B 2 72  ? 4.862  -22.464 21.608  1.00 86.86  ? 72  LYS B C     1 
ATOM   4250 O O     . LYS B 2 72  ? 4.642  -21.861 22.661  1.00 83.94  ? 72  LYS B O     1 
ATOM   4251 C CB    . LYS B 2 72  ? 6.785  -21.271 20.436  1.00 88.10  ? 72  LYS B CB    1 
ATOM   4252 C CG    . LYS B 2 72  ? 6.950  -20.100 21.414  1.00 85.14  ? 72  LYS B CG    1 
ATOM   4253 C CD    . LYS B 2 72  ? 5.851  -19.034 21.231  1.00 84.38  ? 72  LYS B CD    1 
ATOM   4254 C CE    . LYS B 2 72  ? 6.005  -17.891 22.223  1.00 81.01  ? 72  LYS B CE    1 
ATOM   4255 N NZ    . LYS B 2 72  ? 5.756  -18.316 23.627  1.00 77.70  ? 72  LYS B NZ    1 
ATOM   4256 N N     . GLU B 2 73  ? 3.912  -23.056 20.888  1.00 89.60  ? 73  GLU B N     1 
ATOM   4257 C CA    . GLU B 2 73  ? 2.529  -23.209 21.317  1.00 89.29  ? 73  GLU B CA    1 
ATOM   4258 C C     . GLU B 2 73  ? 2.433  -24.162 22.511  1.00 87.57  ? 73  GLU B C     1 
ATOM   4259 O O     . GLU B 2 73  ? 2.128  -23.735 23.629  1.00 84.82  ? 73  GLU B O     1 
ATOM   4260 C CB    . GLU B 2 73  ? 1.689  -23.732 20.137  1.00 93.58  ? 73  GLU B CB    1 
ATOM   4261 C CG    . GLU B 2 73  ? 0.208  -23.983 20.426  1.00 95.00  ? 73  GLU B CG    1 
ATOM   4262 C CD    . GLU B 2 73  ? -0.549 -22.719 20.798  1.00 93.67  ? 73  GLU B CD    1 
ATOM   4263 O OE1   . GLU B 2 73  ? -0.168 -21.619 20.336  1.00 92.85  ? 73  GLU B OE1   1 
ATOM   4264 O OE2   . GLU B 2 73  ? -1.535 -22.834 21.557  1.00 93.67  ? 73  GLU B OE2   1 
ATOM   4265 N N     . GLU B 2 74  ? 2.711  -25.443 22.262  1.00 89.45  ? 74  GLU B N     1 
ATOM   4266 C CA    . GLU B 2 74  ? 2.580  -26.504 23.270  1.00 88.65  ? 74  GLU B CA    1 
ATOM   4267 C C     . GLU B 2 74  ? 3.612  -26.375 24.384  1.00 85.20  ? 74  GLU B C     1 
ATOM   4268 O O     . GLU B 2 74  ? 3.437  -26.930 25.472  1.00 84.37  ? 74  GLU B O     1 
ATOM   4269 C CB    . GLU B 2 74  ? 2.687  -27.878 22.614  1.00 92.49  ? 74  GLU B CB    1 
ATOM   4270 C CG    . GLU B 2 74  ? 1.583  -28.153 21.614  1.00 96.08  ? 74  GLU B CG    1 
ATOM   4271 C CD    . GLU B 2 74  ? 1.979  -29.181 20.569  1.00 100.82 ? 74  GLU B CD    1 
ATOM   4272 O OE1   . GLU B 2 74  ? 1.109  -29.563 19.753  1.00 104.01 ? 74  GLU B OE1   1 
ATOM   4273 O OE2   . GLU B 2 74  ? 3.159  -29.603 20.556  1.00 100.96 ? 74  GLU B OE2   1 
ATOM   4274 N N     . LEU B 2 75  ? 4.679  -25.632 24.094  1.00 83.43  ? 75  LEU B N     1 
ATOM   4275 C CA    . LEU B 2 75  ? 5.767  -25.381 25.035  1.00 80.18  ? 75  LEU B CA    1 
ATOM   4276 C C     . LEU B 2 75  ? 5.268  -24.447 26.124  1.00 76.48  ? 75  LEU B C     1 
ATOM   4277 O O     . LEU B 2 75  ? 5.257  -24.805 27.304  1.00 75.30  ? 75  LEU B O     1 
ATOM   4278 C CB    . LEU B 2 75  ? 6.970  -24.771 24.295  1.00 80.43  ? 75  LEU B CB    1 
ATOM   4279 C CG    . LEU B 2 75  ? 8.416  -24.813 24.818  1.00 79.34  ? 75  LEU B CG    1 
ATOM   4280 C CD1   . LEU B 2 75  ? 8.753  -23.580 25.654  1.00 76.00  ? 75  LEU B CD1   1 
ATOM   4281 C CD2   . LEU B 2 75  ? 8.733  -26.093 25.585  1.00 79.53  ? 75  LEU B CD2   1 
ATOM   4282 N N     . ARG B 2 76  ? 4.834  -23.259 25.717  1.00 74.85  ? 76  ARG B N     1 
ATOM   4283 C CA    . ARG B 2 76  ? 4.244  -22.306 26.633  1.00 71.69  ? 76  ARG B CA    1 
ATOM   4284 C C     . ARG B 2 76  ? 3.116  -22.954 27.440  1.00 71.75  ? 76  ARG B C     1 
ATOM   4285 O O     . ARG B 2 76  ? 3.228  -23.097 28.654  1.00 70.16  ? 76  ARG B O     1 
ATOM   4286 C CB    . ARG B 2 76  ? 3.735  -21.080 25.870  1.00 71.95  ? 76  ARG B CB    1 
ATOM   4287 C CG    . ARG B 2 76  ? 3.322  -19.920 26.777  1.00 69.77  ? 76  ARG B CG    1 
ATOM   4288 C CD    . ARG B 2 76  ? 2.845  -18.698 26.013  1.00 69.89  ? 76  ARG B CD    1 
ATOM   4289 N NE    . ARG B 2 76  ? 1.661  -19.004 25.217  1.00 70.94  ? 76  ARG B NE    1 
ATOM   4290 C CZ    . ARG B 2 76  ? 1.621  -18.966 23.890  1.00 72.90  ? 76  ARG B CZ    1 
ATOM   4291 N NH1   . ARG B 2 76  ? 2.700  -18.613 23.193  1.00 71.99  ? 76  ARG B NH1   1 
ATOM   4292 N NH2   . ARG B 2 76  ? 0.494  -19.276 23.260  1.00 75.41  ? 76  ARG B NH2   1 
ATOM   4293 N N     . GLU B 2 77  ? 2.061  -23.391 26.755  1.00 73.68  ? 77  GLU B N     1 
ATOM   4294 C CA    . GLU B 2 77  ? 0.808  -23.775 27.415  1.00 74.14  ? 77  GLU B CA    1 
ATOM   4295 C C     . GLU B 2 77  ? 0.938  -24.855 28.484  1.00 74.06  ? 77  GLU B C     1 
ATOM   4296 O O     . GLU B 2 77  ? 0.482  -24.651 29.614  1.00 72.79  ? 77  GLU B O     1 
ATOM   4297 C CB    . GLU B 2 77  ? -0.270 -24.133 26.388  1.00 77.21  ? 77  GLU B CB    1 
ATOM   4298 C CG    . GLU B 2 77  ? -0.778 -22.930 25.580  1.00 78.07  ? 77  GLU B CG    1 
ATOM   4299 C CD    . GLU B 2 77  ? -1.329 -21.794 26.453  1.00 76.56  ? 77  GLU B CD    1 
ATOM   4300 O OE1   . GLU B 2 77  ? -0.657 -20.738 26.552  1.00 74.65  ? 77  GLU B OE1   1 
ATOM   4301 O OE2   . GLU B 2 77  ? -2.428 -21.960 27.039  1.00 77.20  ? 77  GLU B OE2   1 
ATOM   4302 N N     . ARG B 2 78  ? 1.558  -25.983 28.125  1.00 75.54  ? 78  ARG B N     1 
ATOM   4303 C CA    . ARG B 2 78  ? 1.838  -27.068 29.074  1.00 75.95  ? 78  ARG B CA    1 
ATOM   4304 C C     . ARG B 2 78  ? 2.848  -26.666 30.140  1.00 73.51  ? 78  ARG B C     1 
ATOM   4305 O O     . ARG B 2 78  ? 2.609  -26.874 31.326  1.00 73.05  ? 78  ARG B O     1 
ATOM   4306 C CB    . ARG B 2 78  ? 2.320  -28.342 28.363  1.00 78.78  ? 78  ARG B CB    1 
ATOM   4307 C CG    . ARG B 2 78  ? 1.304  -29.488 28.339  1.00 81.40  ? 78  ARG B CG    1 
ATOM   4308 C CD    . ARG B 2 78  ? 1.101  -30.150 29.720  1.00 80.24  ? 78  ARG B CD    1 
ATOM   4309 N NE    . ARG B 2 78  ? 2.184  -31.067 30.110  1.00 81.26  ? 78  ARG B NE    1 
ATOM   4310 C CZ    . ARG B 2 78  ? 2.320  -32.344 29.712  1.00 82.85  ? 78  ARG B CZ    1 
ATOM   4311 N NH1   . ARG B 2 78  ? 1.454  -32.907 28.880  1.00 85.10  ? 78  ARG B NH1   1 
ATOM   4312 N NH2   . ARG B 2 78  ? 3.345  -33.067 30.144  1.00 81.67  ? 78  ARG B NH2   1 
ATOM   4313 N N     . GLY B 2 79  ? 3.967  -26.086 29.712  1.00 72.33  ? 79  GLY B N     1 
ATOM   4314 C CA    . GLY B 2 79  ? 5.026  -25.659 30.624  1.00 70.51  ? 79  GLY B CA    1 
ATOM   4315 C C     . GLY B 2 79  ? 4.571  -24.648 31.664  1.00 68.79  ? 79  GLY B C     1 
ATOM   4316 O O     . GLY B 2 79  ? 5.092  -24.606 32.785  1.00 68.14  ? 79  GLY B O     1 
ATOM   4317 N N     . LEU B 2 80  ? 3.593  -23.828 31.303  1.00 68.45  ? 80  LEU B N     1 
ATOM   4318 C CA    . LEU B 2 80  ? 3.017  -22.905 32.268  1.00 67.17  ? 80  LEU B CA    1 
ATOM   4319 C C     . LEU B 2 80  ? 2.039  -23.585 33.221  1.00 68.25  ? 80  LEU B C     1 
ATOM   4320 O O     . LEU B 2 80  ? 2.124  -23.378 34.436  1.00 67.51  ? 80  LEU B O     1 
ATOM   4321 C CB    . LEU B 2 80  ? 2.374  -21.692 31.575  1.00 67.01  ? 80  LEU B CB    1 
ATOM   4322 C CG    . LEU B 2 80  ? 3.294  -20.492 31.308  1.00 65.97  ? 80  LEU B CG    1 
ATOM   4323 C CD1   . LEU B 2 80  ? 4.234  -20.206 32.490  1.00 64.91  ? 80  LEU B CD1   1 
ATOM   4324 C CD2   . LEU B 2 80  ? 4.107  -20.683 30.055  1.00 67.08  ? 80  LEU B CD2   1 
ATOM   4325 N N     . GLU B 2 81  ? 1.130  -24.402 32.673  1.00 70.29  ? 81  GLU B N     1 
ATOM   4326 C CA    . GLU B 2 81  ? 0.153  -25.153 33.478  1.00 71.80  ? 81  GLU B CA    1 
ATOM   4327 C C     . GLU B 2 81  ? 0.839  -25.855 34.647  1.00 71.43  ? 81  GLU B C     1 
ATOM   4328 O O     . GLU B 2 81  ? 0.393  -25.744 35.785  1.00 71.56  ? 81  GLU B O     1 
ATOM   4329 C CB    . GLU B 2 81  ? -0.626 -26.168 32.620  1.00 74.78  ? 81  GLU B CB    1 
ATOM   4330 C CG    . GLU B 2 81  ? -1.650 -25.562 31.624  1.00 76.47  ? 81  GLU B CG    1 
ATOM   4331 C CD    . GLU B 2 81  ? -3.098 -25.473 32.155  1.00 78.78  ? 81  GLU B CD    1 
ATOM   4332 O OE1   . GLU B 2 81  ? -3.316 -25.073 33.324  1.00 78.61  ? 81  GLU B OE1   1 
ATOM   4333 O OE2   . GLU B 2 81  ? -4.030 -25.779 31.378  1.00 80.41  ? 81  GLU B OE2   1 
ATOM   4334 N N     . ILE B 2 82  ? 1.945  -26.535 34.340  1.00 71.29  ? 82  ILE B N     1 
ATOM   4335 C CA    . ILE B 2 82  ? 2.708  -27.368 35.280  1.00 71.66  ? 82  ILE B CA    1 
ATOM   4336 C C     . ILE B 2 82  ? 3.184  -26.596 36.507  1.00 70.11  ? 82  ILE B C     1 
ATOM   4337 O O     . ILE B 2 82  ? 2.913  -27.005 37.639  1.00 71.18  ? 82  ILE B O     1 
ATOM   4338 C CB    . ILE B 2 82  ? 3.911  -28.055 34.564  1.00 72.05  ? 82  ILE B CB    1 
ATOM   4339 C CG1   . ILE B 2 82  ? 3.408  -29.163 33.620  1.00 75.06  ? 82  ILE B CG1   1 
ATOM   4340 C CG2   . ILE B 2 82  ? 4.926  -28.599 35.575  1.00 71.55  ? 82  ILE B CG2   1 
ATOM   4341 C CD1   . ILE B 2 82  ? 4.362  -29.521 32.474  1.00 75.56  ? 82  ILE B CD1   1 
ATOM   4342 N N     . GLY B 2 83  ? 3.889  -25.487 36.273  1.00 67.79  ? 83  GLY B N     1 
ATOM   4343 C CA    . GLY B 2 83  ? 4.338  -24.607 37.349  1.00 66.62  ? 83  GLY B CA    1 
ATOM   4344 C C     . GLY B 2 83  ? 3.159  -24.043 38.123  1.00 67.34  ? 83  GLY B C     1 
ATOM   4345 O O     . GLY B 2 83  ? 3.150  -24.060 39.360  1.00 68.08  ? 83  GLY B O     1 
ATOM   4346 N N     . LYS B 2 84  ? 2.155  -23.565 37.383  1.00 67.39  ? 84  LYS B N     1 
ATOM   4347 C CA    . LYS B 2 84  ? 0.888  -23.090 37.953  1.00 68.48  ? 84  LYS B CA    1 
ATOM   4348 C C     . LYS B 2 84  ? 0.221  -24.107 38.883  1.00 70.71  ? 84  LYS B C     1 
ATOM   4349 O O     . LYS B 2 84  ? -0.493 -23.742 39.817  1.00 71.71  ? 84  LYS B O     1 
ATOM   4350 C CB    . LYS B 2 84  ? -0.088 -22.681 36.838  1.00 68.93  ? 84  LYS B CB    1 
ATOM   4351 C CG    . LYS B 2 84  ? 0.169  -21.284 36.252  1.00 67.38  ? 84  LYS B CG    1 
ATOM   4352 C CD    . LYS B 2 84  ? -1.050 -20.702 35.511  1.00 68.36  ? 84  LYS B CD    1 
ATOM   4353 C CE    . LYS B 2 84  ? -1.061 -21.033 34.015  1.00 69.02  ? 84  LYS B CE    1 
ATOM   4354 N NZ    . LYS B 2 84  ? -1.686 -22.365 33.691  1.00 70.76  ? 84  LYS B NZ    1 
ATOM   4355 N N     . ALA B 2 85  ? 0.460  -25.384 38.617  1.00 72.05  ? 85  ALA B N     1 
ATOM   4356 C CA    . ALA B 2 85  ? -0.107 -26.454 39.424  1.00 74.74  ? 85  ALA B CA    1 
ATOM   4357 C C     . ALA B 2 85  ? 0.877  -26.941 40.482  1.00 75.02  ? 85  ALA B C     1 
ATOM   4358 O O     . ALA B 2 85  ? 0.523  -27.751 41.331  1.00 77.95  ? 85  ALA B O     1 
ATOM   4359 C CB    . ALA B 2 85  ? -0.551 -27.596 38.537  1.00 76.56  ? 85  ALA B CB    1 
ATOM   4360 N N     . VAL B 2 86  ? 2.107  -26.442 40.440  1.00 72.75  ? 86  VAL B N     1 
ATOM   4361 C CA    . VAL B 2 86  ? 3.136  -26.884 41.383  1.00 73.21  ? 86  VAL B CA    1 
ATOM   4362 C C     . VAL B 2 86  ? 3.424  -25.885 42.532  1.00 72.97  ? 86  VAL B C     1 
ATOM   4363 O O     . VAL B 2 86  ? 3.752  -26.308 43.646  1.00 74.93  ? 86  VAL B O     1 
ATOM   4364 C CB    . VAL B 2 86  ? 4.426  -27.332 40.636  1.00 71.96  ? 86  VAL B CB    1 
ATOM   4365 C CG1   . VAL B 2 86  ? 5.595  -27.482 41.581  1.00 71.81  ? 86  VAL B CG1   1 
ATOM   4366 C CG2   . VAL B 2 86  ? 4.181  -28.645 39.921  1.00 73.84  ? 86  VAL B CG2   1 
ATOM   4367 N N     . LEU B 2 87  ? 3.268  -24.581 42.279  1.00 70.88  ? 87  LEU B N     1 
ATOM   4368 C CA    . LEU B 2 87  ? 3.614  -23.551 43.273  1.00 70.54  ? 87  LEU B CA    1 
ATOM   4369 C C     . LEU B 2 87  ? 2.426  -23.106 44.142  1.00 72.94  ? 87  LEU B C     1 
ATOM   4370 O O     . LEU B 2 87  ? 1.267  -23.341 43.788  1.00 74.02  ? 87  LEU B O     1 
ATOM   4371 C CB    . LEU B 2 87  ? 4.281  -22.344 42.591  1.00 67.65  ? 87  LEU B CB    1 
ATOM   4372 C CG    . LEU B 2 87  ? 5.265  -22.657 41.449  1.00 65.21  ? 87  LEU B CG    1 
ATOM   4373 C CD1   . LEU B 2 87  ? 5.938  -21.394 40.928  1.00 60.64  ? 87  LEU B CD1   1 
ATOM   4374 C CD2   . LEU B 2 87  ? 6.310  -23.733 41.822  1.00 63.53  ? 87  LEU B CD2   1 
ATOM   4375 N N     . ASP B 2 88  ? 2.722  -22.470 45.281  1.00 74.03  ? 88  ASP B N     1 
ATOM   4376 C CA    . ASP B 2 88  ? 1.684  -22.026 46.225  1.00 76.70  ? 88  ASP B CA    1 
ATOM   4377 C C     . ASP B 2 88  ? 1.058  -20.729 45.781  1.00 75.90  ? 88  ASP B C     1 
ATOM   4378 O O     . ASP B 2 88  ? -0.113 -20.459 46.050  1.00 78.35  ? 88  ASP B O     1 
ATOM   4379 C CB    . ASP B 2 88  ? 2.257  -21.804 47.624  1.00 78.46  ? 88  ASP B CB    1 
ATOM   4380 C CG    . ASP B 2 88  ? 2.675  -23.083 48.298  1.00 80.69  ? 88  ASP B CG    1 
ATOM   4381 O OD1   . ASP B 2 88  ? 3.354  -22.969 49.336  1.00 82.36  ? 88  ASP B OD1   1 
ATOM   4382 O OD2   . ASP B 2 88  ? 2.341  -24.190 47.806  1.00 81.35  ? 88  ASP B OD2   1 
ATOM   4383 N N     . SER B 2 89  ? 1.863  -19.910 45.128  1.00 73.02  ? 89  SER B N     1 
ATOM   4384 C CA    . SER B 2 89  ? 1.443  -18.596 44.700  1.00 72.36  ? 89  SER B CA    1 
ATOM   4385 C C     . SER B 2 89  ? 2.385  -18.300 43.577  1.00 69.22  ? 89  SER B C     1 
ATOM   4386 O O     . SER B 2 89  ? 3.546  -18.712 43.640  1.00 68.07  ? 89  SER B O     1 
ATOM   4387 C CB    . SER B 2 89  ? 1.632  -17.583 45.827  1.00 73.99  ? 89  SER B CB    1 
ATOM   4388 O OG    . SER B 2 89  ? 2.935  -17.688 46.383  1.00 73.53  ? 89  SER B OG    1 
ATOM   4389 N N     . TYR B 2 90  ? 1.900  -17.616 42.546  1.00 68.13  ? 90  TYR B N     1 
ATOM   4390 C CA    . TYR B 2 90  ? 2.718  -17.407 41.360  1.00 65.78  ? 90  TYR B CA    1 
ATOM   4391 C C     . TYR B 2 90  ? 2.482  -16.112 40.605  1.00 65.39  ? 90  TYR B C     1 
ATOM   4392 O O     . TYR B 2 90  ? 1.419  -15.493 40.697  1.00 66.82  ? 90  TYR B O     1 
ATOM   4393 C CB    . TYR B 2 90  ? 2.571  -18.577 40.386  1.00 65.23  ? 90  TYR B CB    1 
ATOM   4394 C CG    . TYR B 2 90  ? 1.162  -18.827 39.893  1.00 66.78  ? 90  TYR B CG    1 
ATOM   4395 C CD1   . TYR B 2 90  ? 0.520  -17.921 39.041  1.00 66.71  ? 90  TYR B CD1   1 
ATOM   4396 C CD2   . TYR B 2 90  ? 0.479  -19.989 40.255  1.00 68.07  ? 90  TYR B CD2   1 
ATOM   4397 C CE1   . TYR B 2 90  ? -0.773 -18.157 38.585  1.00 68.47  ? 90  TYR B CE1   1 
ATOM   4398 C CE2   . TYR B 2 90  ? -0.811 -20.236 39.800  1.00 69.63  ? 90  TYR B CE2   1 
ATOM   4399 C CZ    . TYR B 2 90  ? -1.429 -19.320 38.965  1.00 70.02  ? 90  TYR B CZ    1 
ATOM   4400 O OH    . TYR B 2 90  ? -2.703 -19.565 38.512  1.00 72.20  ? 90  TYR B OH    1 
ATOM   4401 N N     . GLU B 2 91  ? 3.503  -15.738 39.843  1.00 63.67  ? 91  GLU B N     1 
ATOM   4402 C CA    . GLU B 2 91  ? 3.404  -14.695 38.847  1.00 63.41  ? 91  GLU B CA    1 
ATOM   4403 C C     . GLU B 2 91  ? 3.880  -15.221 37.505  1.00 61.93  ? 91  GLU B C     1 
ATOM   4404 O O     . GLU B 2 91  ? 4.695  -16.148 37.426  1.00 60.62  ? 91  GLU B O     1 
ATOM   4405 C CB    . GLU B 2 91  ? 4.229  -13.489 39.261  1.00 63.39  ? 91  GLU B CB    1 
ATOM   4406 C CG    . GLU B 2 91  ? 3.618  -12.741 40.421  1.00 67.05  ? 91  GLU B CG    1 
ATOM   4407 C CD    . GLU B 2 91  ? 4.655  -12.201 41.381  1.00 69.52  ? 91  GLU B CD    1 
ATOM   4408 O OE1   . GLU B 2 91  ? 4.296  -11.325 42.209  1.00 71.97  ? 91  GLU B OE1   1 
ATOM   4409 O OE2   . GLU B 2 91  ? 5.825  -12.654 41.305  1.00 68.52  ? 91  GLU B OE2   1 
ATOM   4410 N N     . ILE B 2 92  ? 3.347  -14.624 36.448  1.00 62.19  ? 92  ILE B N     1 
ATOM   4411 C CA    . ILE B 2 92  ? 3.774  -14.924 35.098  1.00 61.27  ? 92  ILE B CA    1 
ATOM   4412 C C     . ILE B 2 92  ? 3.935  -13.588 34.419  1.00 61.17  ? 92  ILE B C     1 
ATOM   4413 O O     . ILE B 2 92  ? 3.029  -13.131 33.735  1.00 62.56  ? 92  ILE B O     1 
ATOM   4414 C CB    . ILE B 2 92  ? 2.734  -15.757 34.341  1.00 62.03  ? 92  ILE B CB    1 
ATOM   4415 C CG1   . ILE B 2 92  ? 2.424  -17.055 35.095  1.00 62.62  ? 92  ILE B CG1   1 
ATOM   4416 C CG2   . ILE B 2 92  ? 3.215  -16.043 32.926  1.00 62.18  ? 92  ILE B CG2   1 
ATOM   4417 C CD1   . ILE B 2 92  ? 1.067  -17.693 34.653  1.00 64.47  ? 92  ILE B CD1   1 
ATOM   4418 N N     . ARG B 2 93  ? 5.069  -12.942 34.670  1.00 60.41  ? 93  ARG B N     1 
ATOM   4419 C CA    . ARG B 2 93  ? 5.504  -11.752 33.920  1.00 60.54  ? 93  ARG B CA    1 
ATOM   4420 C C     . ARG B 2 93  ? 6.847  -12.102 33.286  1.00 59.49  ? 93  ARG B C     1 
ATOM   4421 O O     . ARG B 2 93  ? 7.720  -12.654 33.956  1.00 59.03  ? 93  ARG B O     1 
ATOM   4422 C CB    . ARG B 2 93  ? 5.647  -10.535 34.844  1.00 61.32  ? 93  ARG B CB    1 
ATOM   4423 C CG    . ARG B 2 93  ? 4.405  -9.633  34.979  1.00 63.19  ? 93  ARG B CG    1 
ATOM   4424 C CD    . ARG B 2 93  ? 4.485  -8.374  34.078  1.00 64.49  ? 93  ARG B CD    1 
ATOM   4425 N NE    . ARG B 2 93  ? 3.568  -7.315  34.502  1.00 65.97  ? 93  ARG B NE    1 
ATOM   4426 C CZ    . ARG B 2 93  ? 3.352  -6.176  33.841  1.00 68.09  ? 93  ARG B CZ    1 
ATOM   4427 N NH1   . ARG B 2 93  ? 3.982  -5.913  32.699  1.00 67.60  ? 93  ARG B NH1   1 
ATOM   4428 N NH2   . ARG B 2 93  ? 2.486  -5.293  34.323  1.00 69.84  ? 93  ARG B NH2   1 
ATOM   4429 N N     . TYR B 2 94  ? 7.002  -11.828 31.992  1.00 59.70  ? 94  TYR B N     1 
ATOM   4430 C CA    . TYR B 2 94  ? 8.250  -12.145 31.274  1.00 58.81  ? 94  TYR B CA    1 
ATOM   4431 C C     . TYR B 2 94  ? 8.365  -11.361 29.963  1.00 60.15  ? 94  TYR B C     1 
ATOM   4432 O O     . TYR B 2 94  ? 7.351  -10.944 29.400  1.00 61.42  ? 94  TYR B O     1 
ATOM   4433 C CB    . TYR B 2 94  ? 8.376  -13.655 31.036  1.00 57.63  ? 94  TYR B CB    1 
ATOM   4434 C CG    . TYR B 2 94  ? 7.291  -14.258 30.168  1.00 57.95  ? 94  TYR B CG    1 
ATOM   4435 C CD1   . TYR B 2 94  ? 7.440  -14.328 28.772  1.00 58.77  ? 94  TYR B CD1   1 
ATOM   4436 C CD2   . TYR B 2 94  ? 6.127  -14.779 30.731  1.00 56.62  ? 94  TYR B CD2   1 
ATOM   4437 C CE1   . TYR B 2 94  ? 6.459  -14.892 27.966  1.00 58.15  ? 94  TYR B CE1   1 
ATOM   4438 C CE2   . TYR B 2 94  ? 5.145  -15.348 29.926  1.00 57.08  ? 94  TYR B CE2   1 
ATOM   4439 C CZ    . TYR B 2 94  ? 5.319  -15.396 28.553  1.00 58.00  ? 94  TYR B CZ    1 
ATOM   4440 O OH    . TYR B 2 94  ? 4.354  -15.952 27.766  1.00 59.98  ? 94  TYR B OH    1 
ATOM   4441 N N     . ALA B 2 95  ? 9.592  -11.162 29.482  1.00 60.32  ? 95  ALA B N     1 
ATOM   4442 C CA    . ALA B 2 95  ? 9.811  -10.335 28.291  1.00 62.11  ? 95  ALA B CA    1 
ATOM   4443 C C     . ALA B 2 95  ? 9.723  -11.096 26.962  1.00 63.35  ? 95  ALA B C     1 
ATOM   4444 O O     . ALA B 2 95  ? 9.068  -10.628 26.024  1.00 64.98  ? 95  ALA B O     1 
ATOM   4445 C CB    . ALA B 2 95  ? 11.121 -9.573  28.389  1.00 62.55  ? 95  ALA B CB    1 
ATOM   4446 N N     . GLU B 2 96  ? 10.389 -12.250 26.877  1.00 62.90  ? 96  GLU B N     1 
ATOM   4447 C CA    . GLU B 2 96  ? 10.349 -13.083 25.665  1.00 64.40  ? 96  GLU B CA    1 
ATOM   4448 C C     . GLU B 2 96  ? 9.968  -14.524 25.997  1.00 62.94  ? 96  GLU B C     1 
ATOM   4449 O O     . GLU B 2 96  ? 8.853  -14.950 25.706  1.00 62.92  ? 96  GLU B O     1 
ATOM   4450 C CB    . GLU B 2 96  ? 11.677 -13.005 24.882  1.00 66.37  ? 96  GLU B CB    1 
ATOM   4451 C CG    . GLU B 2 96  ? 11.704 -13.788 23.550  1.00 70.01  ? 96  GLU B CG    1 
ATOM   4452 C CD    . GLU B 2 96  ? 12.262 -15.200 23.695  1.00 72.02  ? 96  GLU B CD    1 
ATOM   4453 O OE1   . GLU B 2 96  ? 13.367 -15.350 24.258  1.00 72.66  ? 96  GLU B OE1   1 
ATOM   4454 O OE2   . GLU B 2 96  ? 11.605 -16.168 23.245  1.00 73.90  ? 96  GLU B OE2   1 
ATOM   4455 N N     . HIS B 2 97  ? 10.904 -15.244 26.617  1.00 61.88  ? 97  HIS B N     1 
ATOM   4456 C CA    . HIS B 2 97  ? 10.735 -16.644 27.008  1.00 61.37  ? 97  HIS B CA    1 
ATOM   4457 C C     . HIS B 2 97  ? 9.770  -16.798 28.193  1.00 59.80  ? 97  HIS B C     1 
ATOM   4458 O O     . HIS B 2 97  ? 9.915  -16.115 29.210  1.00 58.69  ? 97  HIS B O     1 
ATOM   4459 C CB    . HIS B 2 97  ? 12.092 -17.259 27.361  1.00 61.23  ? 97  HIS B CB    1 
ATOM   4460 C CG    . HIS B 2 97  ? 12.083 -18.757 27.415  1.00 61.83  ? 97  HIS B CG    1 
ATOM   4461 N ND1   . HIS B 2 97  ? 11.691 -19.459 28.533  1.00 59.68  ? 97  HIS B ND1   1 
ATOM   4462 C CD2   . HIS B 2 97  ? 12.419 -19.684 26.487  1.00 63.51  ? 97  HIS B CD2   1 
ATOM   4463 C CE1   . HIS B 2 97  ? 11.786 -20.752 28.292  1.00 61.30  ? 97  HIS B CE1   1 
ATOM   4464 N NE2   . HIS B 2 97  ? 12.226 -20.916 27.058  1.00 63.69  ? 97  HIS B NE2   1 
ATOM   4465 N N     . PRO B 2 98  ? 8.766  -17.683 28.059  1.00 60.21  ? 98  PRO B N     1 
ATOM   4466 C CA    . PRO B 2 98  ? 7.789  -17.895 29.117  1.00 59.03  ? 98  PRO B CA    1 
ATOM   4467 C C     . PRO B 2 98  ? 8.265  -18.827 30.233  1.00 58.34  ? 98  PRO B C     1 
ATOM   4468 O O     . PRO B 2 98  ? 8.853  -19.885 29.970  1.00 59.34  ? 98  PRO B O     1 
ATOM   4469 C CB    . PRO B 2 98  ? 6.605  -18.523 28.373  1.00 60.57  ? 98  PRO B CB    1 
ATOM   4470 C CG    . PRO B 2 98  ? 6.977  -18.487 26.897  1.00 62.50  ? 98  PRO B CG    1 
ATOM   4471 C CD    . PRO B 2 98  ? 8.452  -18.506 26.884  1.00 62.28  ? 98  PRO B CD    1 
ATOM   4472 N N     . TYR B 2 99  ? 8.007  -18.410 31.471  1.00 56.90  ? 99  TYR B N     1 
ATOM   4473 C CA    . TYR B 2 99  ? 8.218  -19.238 32.659  1.00 56.22  ? 99  TYR B CA    1 
ATOM   4474 C C     . TYR B 2 99  ? 7.234  -18.775 33.724  1.00 55.64  ? 99  TYR B C     1 
ATOM   4475 O O     . TYR B 2 99  ? 6.555  -17.766 33.544  1.00 55.76  ? 99  TYR B O     1 
ATOM   4476 C CB    . TYR B 2 99  ? 9.662  -19.115 33.172  1.00 55.75  ? 99  TYR B CB    1 
ATOM   4477 C CG    . TYR B 2 99  ? 10.011 -17.753 33.747  1.00 53.71  ? 99  TYR B CG    1 
ATOM   4478 C CD1   . TYR B 2 99  ? 10.052 -17.545 35.122  1.00 51.68  ? 99  TYR B CD1   1 
ATOM   4479 C CD2   . TYR B 2 99  ? 10.305 -16.686 32.906  1.00 53.83  ? 99  TYR B CD2   1 
ATOM   4480 C CE1   . TYR B 2 99  ? 10.370 -16.308 35.642  1.00 53.62  ? 99  TYR B CE1   1 
ATOM   4481 C CE2   . TYR B 2 99  ? 10.614 -15.444 33.405  1.00 54.69  ? 99  TYR B CE2   1 
ATOM   4482 C CZ    . TYR B 2 99  ? 10.647 -15.254 34.775  1.00 54.37  ? 99  TYR B CZ    1 
ATOM   4483 O OH    . TYR B 2 99  ? 10.958 -14.011 35.260  1.00 53.28  ? 99  TYR B OH    1 
ATOM   4484 N N     . VAL B 2 100 ? 7.152  -19.517 34.822  1.00 55.55  ? 100 VAL B N     1 
ATOM   4485 C CA    . VAL B 2 100 ? 6.323  -19.128 35.957  1.00 55.43  ? 100 VAL B CA    1 
ATOM   4486 C C     . VAL B 2 100 ? 7.161  -19.002 37.238  1.00 55.09  ? 100 VAL B C     1 
ATOM   4487 O O     . VAL B 2 100 ? 7.922  -19.897 37.588  1.00 55.59  ? 100 VAL B O     1 
ATOM   4488 C CB    . VAL B 2 100 ? 5.087  -20.070 36.122  1.00 56.64  ? 100 VAL B CB    1 
ATOM   4489 C CG1   . VAL B 2 100 ? 5.472  -21.518 35.887  1.00 57.64  ? 100 VAL B CG1   1 
ATOM   4490 C CG2   . VAL B 2 100 ? 4.430  -19.904 37.490  1.00 57.27  ? 100 VAL B CG2   1 
ATOM   4491 N N     . HIS B 2 101 ? 7.022  -17.867 37.913  1.00 54.92  ? 101 HIS B N     1 
ATOM   4492 C CA    . HIS B 2 101 ? 7.742  -17.586 39.154  1.00 55.00  ? 101 HIS B CA    1 
ATOM   4493 C C     . HIS B 2 101 ? 6.829  -17.781 40.366  1.00 56.28  ? 101 HIS B C     1 
ATOM   4494 O O     . HIS B 2 101 ? 5.675  -17.339 40.348  1.00 56.92  ? 101 HIS B O     1 
ATOM   4495 C CB    . HIS B 2 101 ? 8.256  -16.139 39.138  1.00 54.62  ? 101 HIS B CB    1 
ATOM   4496 C CG    . HIS B 2 101 ? 8.910  -15.727 40.414  1.00 54.80  ? 101 HIS B CG    1 
ATOM   4497 N ND1   . HIS B 2 101 ? 10.267 -15.850 40.626  1.00 55.17  ? 101 HIS B ND1   1 
ATOM   4498 C CD2   . HIS B 2 101 ? 8.390  -15.237 41.562  1.00 55.45  ? 101 HIS B CD2   1 
ATOM   4499 C CE1   . HIS B 2 101 ? 10.558 -15.433 41.846  1.00 56.16  ? 101 HIS B CE1   1 
ATOM   4500 N NE2   . HIS B 2 101 ? 9.437  -15.054 42.434  1.00 56.67  ? 101 HIS B NE2   1 
ATOM   4501 N N     . GLY B 2 102 ? 7.345  -18.398 41.431  1.00 56.87  ? 102 GLY B N     1 
ATOM   4502 C CA    . GLY B 2 102 ? 6.509  -18.629 42.618  1.00 58.46  ? 102 GLY B CA    1 
ATOM   4503 C C     . GLY B 2 102 ? 7.116  -19.017 43.952  1.00 59.62  ? 102 GLY B C     1 
ATOM   4504 O O     . GLY B 2 102 ? 8.339  -18.991 44.132  1.00 58.94  ? 102 GLY B O     1 
ATOM   4505 N N     . VAL B 2 103 ? 6.229  -19.366 44.884  1.00 61.63  ? 103 VAL B N     1 
ATOM   4506 C CA    . VAL B 2 103 ? 6.594  -19.659 46.262  1.00 64.05  ? 103 VAL B CA    1 
ATOM   4507 C C     . VAL B 2 103 ? 6.272  -21.107 46.603  1.00 66.20  ? 103 VAL B C     1 
ATOM   4508 O O     . VAL B 2 103 ? 5.179  -21.605 46.302  1.00 67.06  ? 103 VAL B O     1 
ATOM   4509 C CB    . VAL B 2 103 ? 5.861  -18.718 47.252  1.00 66.22  ? 103 VAL B CB    1 
ATOM   4510 C CG1   . VAL B 2 103 ? 6.018  -19.190 48.703  1.00 69.29  ? 103 VAL B CG1   1 
ATOM   4511 C CG2   . VAL B 2 103 ? 6.353  -17.276 47.101  1.00 65.23  ? 103 VAL B CG2   1 
ATOM   4512 N N     . VAL B 2 104 ? 7.243  -21.779 47.219  1.00 67.36  ? 104 VAL B N     1 
ATOM   4513 C CA    . VAL B 2 104 ? 7.045  -23.100 47.792  1.00 69.81  ? 104 VAL B CA    1 
ATOM   4514 C C     . VAL B 2 104 ? 7.604  -23.118 49.213  1.00 72.36  ? 104 VAL B C     1 
ATOM   4515 O O     . VAL B 2 104 ? 8.822  -23.025 49.418  1.00 71.81  ? 104 VAL B O     1 
ATOM   4516 C CB    . VAL B 2 104 ? 7.701  -24.211 46.931  1.00 69.28  ? 104 VAL B CB    1 
ATOM   4517 C CG1   . VAL B 2 104 ? 7.652  -25.570 47.652  1.00 72.30  ? 104 VAL B CG1   1 
ATOM   4518 C CG2   . VAL B 2 104 ? 7.015  -24.313 45.571  1.00 67.91  ? 104 VAL B CG2   1 
ATOM   4519 N N     . LYS B 2 105 ? 6.699  -23.254 50.181  1.00 75.29  ? 105 LYS B N     1 
ATOM   4520 C CA    . LYS B 2 105 ? 7.030  -23.186 51.602  1.00 78.55  ? 105 LYS B CA    1 
ATOM   4521 C C     . LYS B 2 105 ? 7.950  -22.018 51.875  1.00 77.84  ? 105 LYS B C     1 
ATOM   4522 O O     . LYS B 2 105 ? 9.080  -22.213 52.316  1.00 78.53  ? 105 LYS B O     1 
ATOM   4523 C CB    . LYS B 2 105 ? 7.676  -24.479 52.092  1.00 80.55  ? 105 LYS B CB    1 
ATOM   4524 C CG    . LYS B 2 105 ? 6.686  -25.517 52.526  1.00 83.53  ? 105 LYS B CG    1 
ATOM   4525 C CD    . LYS B 2 105 ? 7.388  -26.803 52.854  1.00 85.13  ? 105 LYS B CD    1 
ATOM   4526 C CE    . LYS B 2 105 ? 6.421  -27.958 52.783  1.00 88.26  ? 105 LYS B CE    1 
ATOM   4527 N NZ    . LYS B 2 105 ? 5.388  -27.897 53.854  1.00 92.25  ? 105 LYS B NZ    1 
ATOM   4528 N N     . GLY B 2 106 ? 7.467  -20.816 51.563  1.00 76.72  ? 106 GLY B N     1 
ATOM   4529 C CA    . GLY B 2 106 ? 8.167  -19.574 51.870  1.00 76.75  ? 106 GLY B CA    1 
ATOM   4530 C C     . GLY B 2 106 ? 9.452  -19.262 51.122  1.00 74.18  ? 106 GLY B C     1 
ATOM   4531 O O     . GLY B 2 106 ? 10.130 -18.297 51.466  1.00 74.51  ? 106 GLY B O     1 
ATOM   4532 N N     . VAL B 2 107 ? 9.808  -20.061 50.115  1.00 72.35  ? 107 VAL B N     1 
ATOM   4533 C CA    . VAL B 2 107 ? 11.027 -19.784 49.338  1.00 70.64  ? 107 VAL B CA    1 
ATOM   4534 C C     . VAL B 2 107 ? 10.765 -19.555 47.845  1.00 68.40  ? 107 VAL B C     1 
ATOM   4535 O O     . VAL B 2 107 ? 9.854  -20.157 47.264  1.00 67.81  ? 107 VAL B O     1 
ATOM   4536 C CB    . VAL B 2 107 ? 12.186 -20.830 49.551  1.00 71.26  ? 107 VAL B CB    1 
ATOM   4537 C CG1   . VAL B 2 107 ? 12.119 -21.489 50.927  1.00 74.42  ? 107 VAL B CG1   1 
ATOM   4538 C CG2   . VAL B 2 107 ? 12.205 -21.861 48.462  1.00 69.30  ? 107 VAL B CG2   1 
ATOM   4539 N N     . GLU B 2 108 ? 11.584 -18.676 47.255  1.00 67.84  ? 108 GLU B N     1 
ATOM   4540 C CA    . GLU B 2 108 ? 11.552 -18.296 45.829  1.00 66.11  ? 108 GLU B CA    1 
ATOM   4541 C C     . GLU B 2 108 ? 11.841 -19.458 44.871  1.00 65.42  ? 108 GLU B C     1 
ATOM   4542 O O     . GLU B 2 108 ? 12.824 -20.185 45.056  1.00 66.25  ? 108 GLU B O     1 
ATOM   4543 C CB    . GLU B 2 108 ? 12.630 -17.247 45.573  1.00 65.60  ? 108 GLU B CB    1 
ATOM   4544 C CG    . GLU B 2 108 ? 12.632 -16.076 46.526  1.00 68.10  ? 108 GLU B CG    1 
ATOM   4545 C CD    . GLU B 2 108 ? 11.983 -14.874 45.922  1.00 67.78  ? 108 GLU B CD    1 
ATOM   4546 O OE1   . GLU B 2 108 ? 12.667 -13.841 45.817  1.00 68.58  ? 108 GLU B OE1   1 
ATOM   4547 O OE2   . GLU B 2 108 ? 10.800 -14.969 45.534  1.00 68.24  ? 108 GLU B OE2   1 
ATOM   4548 N N     . VAL B 2 109 ? 11.012 -19.619 43.837  1.00 64.36  ? 109 VAL B N     1 
ATOM   4549 C CA    . VAL B 2 109 ? 11.258 -20.664 42.821  1.00 63.98  ? 109 VAL B CA    1 
ATOM   4550 C C     . VAL B 2 109 ? 10.941 -20.184 41.395  1.00 62.50  ? 109 VAL B C     1 
ATOM   4551 O O     . VAL B 2 109 ? 10.097 -19.296 41.199  1.00 62.51  ? 109 VAL B O     1 
ATOM   4552 C CB    . VAL B 2 109 ? 10.499 -22.003 43.103  1.00 65.19  ? 109 VAL B CB    1 
ATOM   4553 C CG1   . VAL B 2 109 ? 11.275 -23.172 42.521  1.00 65.66  ? 109 VAL B CG1   1 
ATOM   4554 C CG2   . VAL B 2 109 ? 10.274 -22.231 44.593  1.00 67.10  ? 109 VAL B CG2   1 
ATOM   4555 N N     . ASP B 2 110 ? 11.644 -20.763 40.419  1.00 61.91  ? 110 ASP B N     1 
ATOM   4556 C CA    . ASP B 2 110 ? 11.422 -20.511 39.001  1.00 60.73  ? 110 ASP B CA    1 
ATOM   4557 C C     . ASP B 2 110 ? 11.251 -21.834 38.290  1.00 61.36  ? 110 ASP B C     1 
ATOM   4558 O O     . ASP B 2 110 ? 12.088 -22.737 38.417  1.00 62.91  ? 110 ASP B O     1 
ATOM   4559 C CB    . ASP B 2 110 ? 12.613 -19.760 38.395  1.00 60.33  ? 110 ASP B CB    1 
ATOM   4560 C CG    . ASP B 2 110 ? 12.472 -18.253 38.496  1.00 60.37  ? 110 ASP B CG    1 
ATOM   4561 O OD1   . ASP B 2 110 ? 13.506 -17.547 38.370  1.00 61.40  ? 110 ASP B OD1   1 
ATOM   4562 O OD2   . ASP B 2 110 ? 11.329 -17.772 38.694  1.00 61.10  ? 110 ASP B OD2   1 
ATOM   4563 N N     . VAL B 2 111 ? 10.158 -21.977 37.558  1.00 60.97  ? 111 VAL B N     1 
ATOM   4564 C CA    . VAL B 2 111 ? 9.991  -23.167 36.720  1.00 61.85  ? 111 VAL B CA    1 
ATOM   4565 C C     . VAL B 2 111 ? 9.942  -22.747 35.242  1.00 61.84  ? 111 VAL B C     1 
ATOM   4566 O O     . VAL B 2 111 ? 9.189  -21.830 34.853  1.00 60.87  ? 111 VAL B O     1 
ATOM   4567 C CB    . VAL B 2 111 ? 8.859  -24.151 37.220  1.00 62.89  ? 111 VAL B CB    1 
ATOM   4568 C CG1   . VAL B 2 111 ? 7.909  -23.471 38.185  1.00 62.01  ? 111 VAL B CG1   1 
ATOM   4569 C CG2   . VAL B 2 111 ? 8.093  -24.790 36.065  1.00 63.26  ? 111 VAL B CG2   1 
ATOM   4570 N N     . VAL B 2 112 ? 10.805 -23.379 34.445  1.00 62.75  ? 112 VAL B N     1 
ATOM   4571 C CA    . VAL B 2 112 ? 11.090 -22.901 33.099  1.00 62.89  ? 112 VAL B CA    1 
ATOM   4572 C C     . VAL B 2 112 ? 11.054 -24.039 32.104  1.00 65.21  ? 112 VAL B C     1 
ATOM   4573 O O     . VAL B 2 112 ? 11.894 -24.952 32.169  1.00 66.81  ? 112 VAL B O     1 
ATOM   4574 C CB    . VAL B 2 112 ? 12.476 -22.188 32.993  1.00 62.52  ? 112 VAL B CB    1 
ATOM   4575 C CG1   . VAL B 2 112 ? 12.659 -21.555 31.605  1.00 62.64  ? 112 VAL B CG1   1 
ATOM   4576 C CG2   . VAL B 2 112 ? 12.657 -21.142 34.090  1.00 60.36  ? 112 VAL B CG2   1 
ATOM   4577 N N     . PRO B 2 113 ? 10.077 -23.995 31.179  1.00 65.89  ? 113 PRO B N     1 
ATOM   4578 C CA    . PRO B 2 113 ? 10.031 -24.934 30.058  1.00 68.52  ? 113 PRO B CA    1 
ATOM   4579 C C     . PRO B 2 113 ? 11.193 -24.685 29.103  1.00 69.78  ? 113 PRO B C     1 
ATOM   4580 O O     . PRO B 2 113 ? 11.517 -23.525 28.809  1.00 68.67  ? 113 PRO B O     1 
ATOM   4581 C CB    . PRO B 2 113 ? 8.707  -24.588 29.370  1.00 68.51  ? 113 PRO B CB    1 
ATOM   4582 C CG    . PRO B 2 113 ? 8.445  -23.188 29.750  1.00 65.95  ? 113 PRO B CG    1 
ATOM   4583 C CD    . PRO B 2 113 ? 8.941  -23.061 31.153  1.00 64.38  ? 113 PRO B CD    1 
ATOM   4584 N N     . CYS B 2 114 ? 11.826 -25.760 28.649  1.00 72.34  ? 114 CYS B N     1 
ATOM   4585 C CA    . CYS B 2 114 ? 12.856 -25.663 27.620  1.00 74.71  ? 114 CYS B CA    1 
ATOM   4586 C C     . CYS B 2 114 ? 12.979 -26.996 26.901  1.00 78.63  ? 114 CYS B C     1 
ATOM   4587 O O     . CYS B 2 114 ? 12.379 -27.992 27.326  1.00 79.86  ? 114 CYS B O     1 
ATOM   4588 C CB    . CYS B 2 114 ? 14.202 -25.244 28.215  1.00 73.88  ? 114 CYS B CB    1 
ATOM   4589 S SG    . CYS B 2 114 ? 15.051 -26.538 29.115  1.00 76.82  ? 114 CYS B SG    1 
ATOM   4590 N N     . TYR B 2 115 ? 13.753 -27.021 25.816  1.00 81.20  ? 115 TYR B N     1 
ATOM   4591 C CA    . TYR B 2 115 ? 13.915 -28.242 25.020  1.00 85.36  ? 115 TYR B CA    1 
ATOM   4592 C C     . TYR B 2 115 ? 15.083 -29.117 25.496  1.00 87.49  ? 115 TYR B C     1 
ATOM   4593 O O     . TYR B 2 115 ? 16.175 -28.612 25.783  1.00 87.00  ? 115 TYR B O     1 
ATOM   4594 C CB    . TYR B 2 115 ? 14.054 -27.900 23.534  1.00 87.71  ? 115 TYR B CB    1 
ATOM   4595 C CG    . TYR B 2 115 ? 12.819 -27.261 22.945  1.00 86.62  ? 115 TYR B CG    1 
ATOM   4596 C CD1   . TYR B 2 115 ? 12.743 -25.878 22.756  1.00 84.15  ? 115 TYR B CD1   1 
ATOM   4597 C CD2   . TYR B 2 115 ? 11.715 -28.037 22.588  1.00 88.24  ? 115 TYR B CD2   1 
ATOM   4598 C CE1   . TYR B 2 115 ? 11.601 -25.290 22.214  1.00 83.39  ? 115 TYR B CE1   1 
ATOM   4599 C CE2   . TYR B 2 115 ? 10.570 -27.458 22.050  1.00 87.63  ? 115 TYR B CE2   1 
ATOM   4600 C CZ    . TYR B 2 115 ? 10.521 -26.087 21.864  1.00 85.12  ? 115 TYR B CZ    1 
ATOM   4601 O OH    . TYR B 2 115 ? 9.390  -25.522 21.329  1.00 84.86  ? 115 TYR B OH    1 
ATOM   4602 N N     . LYS B 2 116 ? 14.843 -30.425 25.592  1.00 90.11  ? 116 LYS B N     1 
ATOM   4603 C CA    . LYS B 2 116 ? 15.894 -31.346 25.995  1.00 92.63  ? 116 LYS B CA    1 
ATOM   4604 C C     . LYS B 2 116 ? 16.681 -31.768 24.765  1.00 97.34  ? 116 LYS B C     1 
ATOM   4605 O O     . LYS B 2 116 ? 16.403 -32.802 24.162  1.00 101.31 ? 116 LYS B O     1 
ATOM   4606 C CB    . LYS B 2 116 ? 15.328 -32.564 26.734  1.00 93.85  ? 116 LYS B CB    1 
ATOM   4607 C CG    . LYS B 2 116 ? 16.383 -33.321 27.527  1.00 95.02  ? 116 LYS B CG    1 
ATOM   4608 C CD    . LYS B 2 116 ? 15.838 -34.618 28.077  1.00 96.65  ? 116 LYS B CD    1 
ATOM   4609 C CE    . LYS B 2 116 ? 16.950 -35.632 28.307  1.00 99.18  ? 116 LYS B CE    1 
ATOM   4610 N NZ    . LYS B 2 116 ? 16.366 -36.991 28.295  1.00 102.97 ? 116 LYS B NZ    1 
ATOM   4611 N N     . LEU B 2 117 ? 17.657 -30.948 24.393  1.00 97.28  ? 117 LEU B N     1 
ATOM   4612 C CA    . LEU B 2 117 ? 18.509 -31.233 23.241  1.00 102.17 ? 117 LEU B CA    1 
ATOM   4613 C C     . LEU B 2 117 ? 19.651 -32.215 23.579  1.00 105.89 ? 117 LEU B C     1 
ATOM   4614 O O     . LEU B 2 117 ? 19.763 -32.692 24.712  1.00 104.84 ? 117 LEU B O     1 
ATOM   4615 C CB    . LEU B 2 117 ? 19.051 -29.918 22.658  1.00 100.98 ? 117 LEU B CB    1 
ATOM   4616 C CG    . LEU B 2 117 ? 18.173 -29.173 21.639  1.00 100.50 ? 117 LEU B CG    1 
ATOM   4617 C CD1   . LEU B 2 117 ? 18.324 -27.661 21.752  1.00 95.66  ? 117 LEU B CD1   1 
ATOM   4618 C CD2   . LEU B 2 117 ? 18.474 -29.646 20.207  1.00 106.27 ? 117 LEU B CD2   1 
ATOM   4619 N N     . LYS B 2 118 ? 20.467 -32.541 22.579  1.00 110.82 ? 118 LYS B N     1 
ATOM   4620 C CA    . LYS B 2 118 ? 21.724 -33.251 22.796  1.00 114.65 ? 118 LYS B CA    1 
ATOM   4621 C C     . LYS B 2 118 ? 22.850 -32.355 22.282  1.00 115.70 ? 118 LYS B C     1 
ATOM   4622 O O     . LYS B 2 118 ? 23.925 -32.278 22.878  1.00 116.02 ? 118 LYS B O     1 
ATOM   4623 C CB    . LYS B 2 118 ? 21.718 -34.594 22.070  1.00 120.88 ? 118 LYS B CB    1 
ATOM   4624 C CG    . LYS B 2 118 ? 20.626 -35.557 22.531  1.00 120.59 ? 118 LYS B CG    1 
ATOM   4625 C CD    . LYS B 2 118 ? 20.272 -36.570 21.441  1.00 126.15 ? 118 LYS B CD    1 
ATOM   4626 C CE    . LYS B 2 118 ? 21.461 -37.442 21.058  1.00 132.56 ? 118 LYS B CE    1 
ATOM   4627 N NZ    . LYS B 2 118 ? 21.174 -38.296 19.872  1.00 139.20 ? 118 LYS B NZ    1 
ATOM   4628 N N     . GLU B 2 119 ? 22.571 -31.680 21.167  1.00 116.54 ? 119 GLU B N     1 
ATOM   4629 C CA    . GLU B 2 119 ? 23.421 -30.630 20.611  1.00 117.10 ? 119 GLU B CA    1 
ATOM   4630 C C     . GLU B 2 119 ? 22.901 -29.244 21.011  1.00 111.20 ? 119 GLU B C     1 
ATOM   4631 O O     . GLU B 2 119 ? 21.735 -28.937 20.759  1.00 108.77 ? 119 GLU B O     1 
ATOM   4632 C CB    . GLU B 2 119 ? 23.440 -30.729 19.081  1.00 122.20 ? 119 GLU B CB    1 
ATOM   4633 C CG    . GLU B 2 119 ? 24.530 -31.610 18.513  1.00 129.25 ? 119 GLU B CG    1 
ATOM   4634 C CD    . GLU B 2 119 ? 25.882 -30.918 18.462  1.00 130.91 ? 119 GLU B CD    1 
ATOM   4635 O OE1   . GLU B 2 119 ? 26.674 -31.239 17.550  1.00 136.73 ? 119 GLU B OE1   1 
ATOM   4636 O OE2   . GLU B 2 119 ? 26.156 -30.058 19.329  1.00 126.40 ? 119 GLU B OE2   1 
ATOM   4637 N N     . PRO B 2 120 ? 23.756 -28.409 21.645  1.00 109.22 ? 120 PRO B N     1 
ATOM   4638 C CA    . PRO B 2 120 ? 23.429 -26.986 21.875  1.00 104.82 ? 120 PRO B CA    1 
ATOM   4639 C C     . PRO B 2 120 ? 23.517 -26.093 20.616  1.00 106.86 ? 120 PRO B C     1 
ATOM   4640 O O     . PRO B 2 120 ? 23.026 -24.962 20.637  1.00 103.76 ? 120 PRO B O     1 
ATOM   4641 C CB    . PRO B 2 120 ? 24.457 -26.542 22.932  1.00 103.18 ? 120 PRO B CB    1 
ATOM   4642 C CG    . PRO B 2 120 ? 25.175 -27.803 23.365  1.00 106.26 ? 120 PRO B CG    1 
ATOM   4643 C CD    . PRO B 2 120 ? 25.061 -28.762 22.229  1.00 111.23 ? 120 PRO B CD    1 
ATOM   4644 N N     . LYS B 2 121 ? 24.137 -26.598 19.544  1.00 112.56 ? 121 LYS B N     1 
ATOM   4645 C CA    . LYS B 2 121 ? 24.148 -25.942 18.224  1.00 115.43 ? 121 LYS B CA    1 
ATOM   4646 C C     . LYS B 2 121 ? 22.715 -25.750 17.718  1.00 113.60 ? 121 LYS B C     1 
ATOM   4647 O O     . LYS B 2 121 ? 21.829 -26.548 18.051  1.00 112.55 ? 121 LYS B O     1 
ATOM   4648 C CB    . LYS B 2 121 ? 24.927 -26.795 17.209  1.00 122.48 ? 121 LYS B CB    1 
ATOM   4649 C CG    . LYS B 2 121 ? 26.340 -27.192 17.628  1.00 125.22 ? 121 LYS B CG    1 
ATOM   4650 C CD    . LYS B 2 121 ? 27.390 -26.274 17.022  1.00 128.48 ? 121 LYS B CD    1 
ATOM   4651 C CE    . LYS B 2 121 ? 28.800 -26.626 17.490  1.00 131.56 ? 121 LYS B CE    1 
ATOM   4652 N NZ    . LYS B 2 121 ? 29.090 -26.096 18.858  1.00 126.52 ? 121 LYS B NZ    1 
ATOM   4653 N N     . ASN B 2 122 ? 22.493 -24.702 16.917  1.00 113.65 ? 122 ASN B N     1 
ATOM   4654 C CA    . ASN B 2 122 ? 21.162 -24.381 16.360  1.00 112.04 ? 122 ASN B CA    1 
ATOM   4655 C C     . ASN B 2 122 ? 20.050 -24.418 17.417  1.00 106.06 ? 122 ASN B C     1 
ATOM   4656 O O     . ASN B 2 122 ? 19.056 -25.141 17.270  1.00 106.22 ? 122 ASN B O     1 
ATOM   4657 C CB    . ASN B 2 122 ? 20.816 -25.302 15.174  1.00 117.60 ? 122 ASN B CB    1 
ATOM   4658 C CG    . ASN B 2 122 ? 21.574 -24.946 13.902  1.00 123.43 ? 122 ASN B CG    1 
ATOM   4659 O OD1   . ASN B 2 122 ? 21.574 -23.795 13.464  1.00 123.44 ? 122 ASN B OD1   1 
ATOM   4660 N ND2   . ASN B 2 122 ? 22.206 -25.944 13.292  1.00 128.80 ? 122 ASN B ND2   1 
ATOM   4661 N N     . ILE B 2 123 ? 20.240 -23.631 18.478  1.00 101.06 ? 123 ILE B N     1 
ATOM   4662 C CA    . ILE B 2 123 ? 19.373 -23.620 19.670  1.00 95.28  ? 123 ILE B CA    1 
ATOM   4663 C C     . ILE B 2 123 ? 17.906 -23.311 19.318  1.00 93.17  ? 123 ILE B C     1 
ATOM   4664 O O     . ILE B 2 123 ? 17.642 -22.653 18.304  1.00 95.08  ? 123 ILE B O     1 
ATOM   4665 C CB    . ILE B 2 123 ? 19.944 -22.625 20.742  1.00 91.69  ? 123 ILE B CB    1 
ATOM   4666 C CG1   . ILE B 2 123 ? 19.635 -23.093 22.168  1.00 87.86  ? 123 ILE B CG1   1 
ATOM   4667 C CG2   . ILE B 2 123 ? 19.510 -21.159 20.471  1.00 90.13  ? 123 ILE B CG2   1 
ATOM   4668 C CD1   . ILE B 2 123 ? 20.137 -22.137 23.251  1.00 84.45  ? 123 ILE B CD1   1 
ATOM   4669 N N     . LYS B 2 124 ? 16.957 -23.797 20.122  1.00 89.45  ? 124 LYS B N     1 
ATOM   4670 C CA    . LYS B 2 124 ? 15.542 -23.491 19.862  1.00 87.38  ? 124 LYS B CA    1 
ATOM   4671 C C     . LYS B 2 124 ? 14.960 -22.406 20.781  1.00 82.32  ? 124 LYS B C     1 
ATOM   4672 O O     . LYS B 2 124 ? 14.778 -21.270 20.348  1.00 81.97  ? 124 LYS B O     1 
ATOM   4673 C CB    . LYS B 2 124 ? 14.670 -24.748 19.840  1.00 88.47  ? 124 LYS B CB    1 
ATOM   4674 C CG    . LYS B 2 124 ? 13.352 -24.526 19.115  1.00 88.66  ? 124 LYS B CG    1 
ATOM   4675 C CD    . LYS B 2 124 ? 12.675 -25.827 18.775  1.00 91.53  ? 124 LYS B CD    1 
ATOM   4676 C CE    . LYS B 2 124 ? 11.433 -25.594 17.937  1.00 92.58  ? 124 LYS B CE    1 
ATOM   4677 N NZ    . LYS B 2 124 ? 10.823 -26.896 17.543  1.00 96.54  ? 124 LYS B NZ    1 
ATOM   4678 N N     . SER B 2 125 ? 14.662 -22.748 22.032  1.00 78.73  ? 125 SER B N     1 
ATOM   4679 C CA    . SER B 2 125 ? 14.211 -21.750 22.994  1.00 74.29  ? 125 SER B CA    1 
ATOM   4680 C C     . SER B 2 125 ? 15.417 -21.039 23.586  1.00 72.91  ? 125 SER B C     1 
ATOM   4681 O O     . SER B 2 125 ? 16.484 -21.635 23.716  1.00 74.19  ? 125 SER B O     1 
ATOM   4682 C CB    . SER B 2 125 ? 13.378 -22.384 24.108  1.00 72.12  ? 125 SER B CB    1 
ATOM   4683 O OG    . SER B 2 125 ? 14.089 -22.410 25.337  1.00 70.18  ? 125 SER B OG    1 
ATOM   4684 N N     . ALA B 2 126 ? 15.219 -19.780 23.971  1.00 70.42  ? 126 ALA B N     1 
ATOM   4685 C CA    . ALA B 2 126 ? 16.287 -18.897 24.456  1.00 69.56  ? 126 ALA B CA    1 
ATOM   4686 C C     . ALA B 2 126 ? 17.105 -19.401 25.650  1.00 68.35  ? 126 ALA B C     1 
ATOM   4687 O O     . ALA B 2 126 ? 18.256 -18.999 25.813  1.00 69.01  ? 126 ALA B O     1 
ATOM   4688 C CB    . ALA B 2 126 ? 15.719 -17.522 24.767  1.00 67.67  ? 126 ALA B CB    1 
ATOM   4689 N N     . VAL B 2 127 ? 16.523 -20.275 26.472  1.00 66.95  ? 127 VAL B N     1 
ATOM   4690 C CA    . VAL B 2 127 ? 17.185 -20.743 27.701  1.00 66.02  ? 127 VAL B CA    1 
ATOM   4691 C C     . VAL B 2 127 ? 17.871 -22.099 27.570  1.00 68.58  ? 127 VAL B C     1 
ATOM   4692 O O     . VAL B 2 127 ? 18.516 -22.559 28.515  1.00 68.56  ? 127 VAL B O     1 
ATOM   4693 C CB    . VAL B 2 127 ? 16.200 -20.832 28.901  1.00 63.29  ? 127 VAL B CB    1 
ATOM   4694 C CG1   . VAL B 2 127 ? 15.729 -19.463 29.344  1.00 61.04  ? 127 VAL B CG1   1 
ATOM   4695 C CG2   . VAL B 2 127 ? 15.017 -21.700 28.555  1.00 64.19  ? 127 VAL B CG2   1 
ATOM   4696 N N     . ASP B 2 128 ? 17.733 -22.736 26.409  1.00 71.36  ? 128 ASP B N     1 
ATOM   4697 C CA    . ASP B 2 128 ? 18.102 -24.151 26.245  1.00 74.40  ? 128 ASP B CA    1 
ATOM   4698 C C     . ASP B 2 128 ? 19.543 -24.523 26.629  1.00 76.27  ? 128 ASP B C     1 
ATOM   4699 O O     . ASP B 2 128 ? 19.840 -25.698 26.857  1.00 78.27  ? 128 ASP B O     1 
ATOM   4700 C CB    . ASP B 2 128 ? 17.787 -24.639 24.825  1.00 77.67  ? 128 ASP B CB    1 
ATOM   4701 C CG    . ASP B 2 128 ? 16.291 -24.794 24.567  1.00 76.78  ? 128 ASP B CG    1 
ATOM   4702 O OD1   . ASP B 2 128 ? 15.477 -24.542 25.487  1.00 72.65  ? 128 ASP B OD1   1 
ATOM   4703 O OD2   . ASP B 2 128 ? 15.936 -25.178 23.428  1.00 79.45  ? 128 ASP B OD2   1 
ATOM   4704 N N     . ARG B 2 129 ? 20.421 -23.522 26.706  1.00 76.13  ? 129 ARG B N     1 
ATOM   4705 C CA    . ARG B 2 129 ? 21.809 -23.716 27.138  1.00 77.87  ? 129 ARG B CA    1 
ATOM   4706 C C     . ARG B 2 129 ? 21.882 -24.127 28.600  1.00 76.31  ? 129 ARG B C     1 
ATOM   4707 O O     . ARG B 2 129 ? 22.790 -24.854 29.000  1.00 78.89  ? 129 ARG B O     1 
ATOM   4708 C CB    . ARG B 2 129 ? 22.630 -22.432 26.960  1.00 77.66  ? 129 ARG B CB    1 
ATOM   4709 C CG    . ARG B 2 129 ? 23.095 -22.148 25.552  1.00 80.23  ? 129 ARG B CG    1 
ATOM   4710 C CD    . ARG B 2 129 ? 23.852 -20.838 25.506  1.00 79.33  ? 129 ARG B CD    1 
ATOM   4711 N NE    . ARG B 2 129 ? 23.784 -20.209 24.187  1.00 80.97  ? 129 ARG B NE    1 
ATOM   4712 C CZ    . ARG B 2 129 ? 22.848 -19.340 23.810  1.00 78.71  ? 129 ARG B CZ    1 
ATOM   4713 N NH1   . ARG B 2 129 ? 21.881 -18.982 24.643  1.00 74.75  ? 129 ARG B NH1   1 
ATOM   4714 N NH2   . ARG B 2 129 ? 22.882 -18.822 22.592  1.00 81.33  ? 129 ARG B NH2   1 
ATOM   4715 N N     . THR B 2 130 ? 20.919 -23.663 29.389  1.00 72.84  ? 130 THR B N     1 
ATOM   4716 C CA    . THR B 2 130 ? 21.015 -23.730 30.845  1.00 71.25  ? 130 THR B CA    1 
ATOM   4717 C C     . THR B 2 130 ? 21.181 -25.130 31.461  1.00 73.06  ? 130 THR B C     1 
ATOM   4718 O O     . THR B 2 130 ? 22.043 -25.310 32.327  1.00 73.71  ? 130 THR B O     1 
ATOM   4719 C CB    . THR B 2 130 ? 19.895 -22.894 31.520  1.00 67.86  ? 130 THR B CB    1 
ATOM   4720 O OG1   . THR B 2 130 ? 20.078 -21.505 31.195  1.00 65.98  ? 130 THR B OG1   1 
ATOM   4721 C CG2   . THR B 2 130 ? 19.911 -23.075 33.041  1.00 66.74  ? 130 THR B CG2   1 
ATOM   4722 N N     . PRO B 2 131 ? 20.381 -26.131 31.016  1.00 74.32  ? 131 PRO B N     1 
ATOM   4723 C CA    . PRO B 2 131 ? 20.655 -27.491 31.501  1.00 76.81  ? 131 PRO B CA    1 
ATOM   4724 C C     . PRO B 2 131 ? 22.058 -27.961 31.121  1.00 80.50  ? 131 PRO B C     1 
ATOM   4725 O O     . PRO B 2 131 ? 22.666 -28.739 31.848  1.00 82.30  ? 131 PRO B O     1 
ATOM   4726 C CB    . PRO B 2 131 ? 19.595 -28.345 30.791  1.00 77.79  ? 131 PRO B CB    1 
ATOM   4727 C CG    . PRO B 2 131 ? 19.148 -27.536 29.632  1.00 77.04  ? 131 PRO B CG    1 
ATOM   4728 C CD    . PRO B 2 131 ? 19.228 -26.114 30.097  1.00 73.87  ? 131 PRO B CD    1 
ATOM   4729 N N     . PHE B 2 132 ? 22.563 -27.468 29.996  1.00 82.11  ? 132 PHE B N     1 
ATOM   4730 C CA    . PHE B 2 132 ? 23.898 -27.814 29.529  1.00 86.47  ? 132 PHE B CA    1 
ATOM   4731 C C     . PHE B 2 132 ? 24.962 -27.056 30.309  1.00 85.94  ? 132 PHE B C     1 
ATOM   4732 O O     . PHE B 2 132 ? 26.087 -27.542 30.471  1.00 88.77  ? 132 PHE B O     1 
ATOM   4733 C CB    . PHE B 2 132 ? 24.010 -27.551 28.027  1.00 88.84  ? 132 PHE B CB    1 
ATOM   4734 C CG    . PHE B 2 132 ? 23.417 -28.639 27.182  1.00 92.24  ? 132 PHE B CG    1 
ATOM   4735 C CD1   . PHE B 2 132 ? 22.046 -28.890 27.202  1.00 90.90  ? 132 PHE B CD1   1 
ATOM   4736 C CD2   . PHE B 2 132 ? 24.230 -29.422 26.374  1.00 97.88  ? 132 PHE B CD2   1 
ATOM   4737 C CE1   . PHE B 2 132 ? 21.495 -29.904 26.432  1.00 93.77  ? 132 PHE B CE1   1 
ATOM   4738 C CE2   . PHE B 2 132 ? 23.692 -30.436 25.593  1.00 101.30 ? 132 PHE B CE2   1 
ATOM   4739 C CZ    . PHE B 2 132 ? 22.321 -30.678 25.623  1.00 99.14  ? 132 PHE B CZ    1 
ATOM   4740 N N     . HIS B 2 133 ? 24.589 -25.869 30.791  1.00 82.58  ? 133 HIS B N     1 
ATOM   4741 C CA    . HIS B 2 133 ? 25.428 -25.083 31.694  1.00 82.16  ? 133 HIS B CA    1 
ATOM   4742 C C     . HIS B 2 133 ? 25.719 -25.921 32.928  1.00 83.19  ? 133 HIS B C     1 
ATOM   4743 O O     . HIS B 2 133 ? 26.849 -25.992 33.403  1.00 85.27  ? 133 HIS B O     1 
ATOM   4744 C CB    . HIS B 2 133 ? 24.724 -23.790 32.141  1.00 78.12  ? 133 HIS B CB    1 
ATOM   4745 C CG    . HIS B 2 133 ? 24.667 -22.713 31.099  1.00 77.42  ? 133 HIS B CG    1 
ATOM   4746 N ND1   . HIS B 2 133 ? 23.880 -21.589 31.245  1.00 73.85  ? 133 HIS B ND1   1 
ATOM   4747 C CD2   . HIS B 2 133 ? 25.287 -22.584 29.901  1.00 79.75  ? 133 HIS B CD2   1 
ATOM   4748 C CE1   . HIS B 2 133 ? 24.021 -20.814 30.184  1.00 74.58  ? 133 HIS B CE1   1 
ATOM   4749 N NE2   . HIS B 2 133 ? 24.868 -21.394 29.354  1.00 78.11  ? 133 HIS B NE2   1 
ATOM   4750 N N     . HIS B 2 134 ? 24.672 -26.553 33.436  1.00 82.29  ? 134 HIS B N     1 
ATOM   4751 C CA    . HIS B 2 134 ? 24.743 -27.326 34.652  1.00 83.69  ? 134 HIS B CA    1 
ATOM   4752 C C     . HIS B 2 134 ? 25.569 -28.597 34.446  1.00 88.74  ? 134 HIS B C     1 
ATOM   4753 O O     . HIS B 2 134 ? 26.529 -28.850 35.179  1.00 90.78  ? 134 HIS B O     1 
ATOM   4754 C CB    . HIS B 2 134 ? 23.330 -27.673 35.094  1.00 81.57  ? 134 HIS B CB    1 
ATOM   4755 C CG    . HIS B 2 134 ? 23.247 -28.199 36.487  1.00 82.25  ? 134 HIS B CG    1 
ATOM   4756 N ND1   . HIS B 2 134 ? 23.522 -27.422 37.591  1.00 81.21  ? 134 HIS B ND1   1 
ATOM   4757 C CD2   . HIS B 2 134 ? 22.911 -29.421 36.958  1.00 84.80  ? 134 HIS B CD2   1 
ATOM   4758 C CE1   . HIS B 2 134 ? 23.365 -28.147 38.684  1.00 82.61  ? 134 HIS B CE1   1 
ATOM   4759 N NE2   . HIS B 2 134 ? 22.996 -29.364 38.327  1.00 85.01  ? 134 HIS B NE2   1 
ATOM   4760 N N     . LYS B 2 135 ? 25.186 -29.387 33.442  1.00 91.18  ? 135 LYS B N     1 
ATOM   4761 C CA    . LYS B 2 135 ? 25.919 -30.589 33.047  1.00 96.39  ? 135 LYS B CA    1 
ATOM   4762 C C     . LYS B 2 135 ? 27.424 -30.302 33.017  1.00 99.43  ? 135 LYS B C     1 
ATOM   4763 O O     . LYS B 2 135 ? 28.222 -31.101 33.523  1.00 102.95 ? 135 LYS B O     1 
ATOM   4764 C CB    . LYS B 2 135 ? 25.399 -31.111 31.689  1.00 98.26  ? 135 LYS B CB    1 
ATOM   4765 C CG    . LYS B 2 135 ? 26.381 -31.936 30.827  1.00 103.74 ? 135 LYS B CG    1 
ATOM   4766 C CD    . LYS B 2 135 ? 25.930 -31.938 29.352  1.00 104.82 ? 135 LYS B CD    1 
ATOM   4767 C CE    . LYS B 2 135 ? 27.104 -32.142 28.380  1.00 109.24 ? 135 LYS B CE    1 
ATOM   4768 N NZ    . LYS B 2 135 ? 27.350 -33.593 28.101  1.00 113.42 ? 135 LYS B NZ    1 
ATOM   4769 N N     . TRP B 2 136 ? 27.804 -29.151 32.456  1.00 98.36  ? 136 TRP B N     1 
ATOM   4770 C CA    . TRP B 2 136 ? 29.218 -28.799 32.351  1.00 101.29 ? 136 TRP B CA    1 
ATOM   4771 C C     . TRP B 2 136 ? 29.820 -28.469 33.714  1.00 100.54 ? 136 TRP B C     1 
ATOM   4772 O O     . TRP B 2 136 ? 30.969 -28.826 34.001  1.00 104.11 ? 136 TRP B O     1 
ATOM   4773 C CB    . TRP B 2 136 ? 29.437 -27.642 31.372  1.00 100.61 ? 136 TRP B CB    1 
ATOM   4774 C CG    . TRP B 2 136 ? 30.887 -27.468 31.007  1.00 104.96 ? 136 TRP B CG    1 
ATOM   4775 C CD1   . TRP B 2 136 ? 31.579 -28.151 30.042  1.00 110.44 ? 136 TRP B CD1   1 
ATOM   4776 C CD2   . TRP B 2 136 ? 31.828 -26.578 31.617  1.00 104.92 ? 136 TRP B CD2   1 
ATOM   4777 N NE1   . TRP B 2 136 ? 32.890 -27.735 30.009  1.00 113.39 ? 136 TRP B NE1   1 
ATOM   4778 C CE2   . TRP B 2 136 ? 33.070 -26.769 30.963  1.00 110.19 ? 136 TRP B CE2   1 
ATOM   4779 C CE3   . TRP B 2 136 ? 31.744 -25.637 32.648  1.00 101.29 ? 136 TRP B CE3   1 
ATOM   4780 C CZ2   . TRP B 2 136 ? 34.215 -26.051 31.307  1.00 111.59 ? 136 TRP B CZ2   1 
ATOM   4781 C CZ3   . TRP B 2 136 ? 32.882 -24.923 32.988  1.00 103.31 ? 136 TRP B CZ3   1 
ATOM   4782 C CH2   . TRP B 2 136 ? 34.103 -25.135 32.318  1.00 108.22 ? 136 TRP B CH2   1 
ATOM   4783 N N     . LEU B 2 137 ? 29.016 -27.827 34.555  1.00 96.27  ? 137 LEU B N     1 
ATOM   4784 C CA    . LEU B 2 137 ? 29.503 -27.224 35.790  1.00 95.30  ? 137 LEU B CA    1 
ATOM   4785 C C     . LEU B 2 137 ? 29.448 -28.136 37.018  1.00 96.32  ? 137 LEU B C     1 
ATOM   4786 O O     . LEU B 2 137 ? 30.346 -28.085 37.862  1.00 98.08  ? 137 LEU B O     1 
ATOM   4787 C CB    . LEU B 2 137 ? 28.751 -25.915 36.052  1.00 90.84  ? 137 LEU B CB    1 
ATOM   4788 C CG    . LEU B 2 137 ? 29.537 -24.729 36.621  1.00 90.46  ? 137 LEU B CG    1 
ATOM   4789 C CD1   . LEU B 2 137 ? 30.962 -24.666 36.072  1.00 94.23  ? 137 LEU B CD1   1 
ATOM   4790 C CD2   . LEU B 2 137 ? 28.795 -23.421 36.356  1.00 86.84  ? 137 LEU B CD2   1 
ATOM   4791 N N     . GLU B 2 138 ? 28.397 -28.958 37.097  1.00 95.53  ? 138 GLU B N     1 
ATOM   4792 C CA    . GLU B 2 138 ? 28.166 -29.937 38.184  1.00 96.80  ? 138 GLU B CA    1 
ATOM   4793 C C     . GLU B 2 138 ? 29.358 -30.277 39.066  1.00 100.08 ? 138 GLU B C     1 
ATOM   4794 O O     . GLU B 2 138 ? 29.429 -29.838 40.218  1.00 99.28  ? 138 GLU B O     1 
ATOM   4795 C CB    . GLU B 2 138 ? 27.597 -31.242 37.621  1.00 98.84  ? 138 GLU B CB    1 
ATOM   4796 C CG    . GLU B 2 138 ? 26.169 -31.510 38.026  1.00 96.78  ? 138 GLU B CG    1 
ATOM   4797 C CD    . GLU B 2 138 ? 25.475 -32.478 37.095  1.00 98.61  ? 138 GLU B CD    1 
ATOM   4798 O OE1   . GLU B 2 138 ? 24.352 -32.159 36.632  1.00 96.02  ? 138 GLU B OE1   1 
ATOM   4799 O OE2   . GLU B 2 138 ? 26.054 -33.552 36.823  1.00 103.11 ? 138 GLU B OE2   1 
ATOM   4800 N N     . GLY B 2 139 ? 30.280 -31.066 38.514  1.00 104.08 ? 139 GLY B N     1 
ATOM   4801 C CA    . GLY B 2 139 ? 31.418 -31.574 39.265  1.00 107.94 ? 139 GLY B CA    1 
ATOM   4802 C C     . GLY B 2 139 ? 32.645 -30.696 39.173  1.00 108.82 ? 139 GLY B C     1 
ATOM   4803 O O     . GLY B 2 139 ? 33.547 -30.795 40.010  1.00 111.70 ? 139 GLY B O     1 
ATOM   4804 N N     . ARG B 2 140 ? 32.683 -29.842 38.151  1.00 106.78 ? 140 ARG B N     1 
ATOM   4805 C CA    . ARG B 2 140 ? 33.803 -28.929 37.947  1.00 107.61 ? 140 ARG B CA    1 
ATOM   4806 C C     . ARG B 2 140 ? 33.917 -27.876 39.052  1.00 105.29 ? 140 ARG B C     1 
ATOM   4807 O O     . ARG B 2 140 ? 35.025 -27.516 39.451  1.00 108.03 ? 140 ARG B O     1 
ATOM   4808 C CB    . ARG B 2 140 ? 33.703 -28.235 36.590  1.00 106.34 ? 140 ARG B CB    1 
ATOM   4809 C CG    . ARG B 2 140 ? 34.085 -29.085 35.405  1.00 109.43 ? 140 ARG B CG    1 
ATOM   4810 C CD    . ARG B 2 140 ? 34.161 -28.216 34.180  1.00 107.66 ? 140 ARG B CD    1 
ATOM   4811 N NE    . ARG B 2 140 ? 33.918 -28.972 32.962  1.00 109.80 ? 140 ARG B NE    1 
ATOM   4812 C CZ    . ARG B 2 140 ? 34.872 -29.397 32.142  1.00 115.34 ? 140 ARG B CZ    1 
ATOM   4813 N NH1   . ARG B 2 140 ? 36.148 -29.141 32.402  1.00 118.73 ? 140 ARG B NH1   1 
ATOM   4814 N NH2   . ARG B 2 140 ? 34.547 -30.079 31.055  1.00 118.04 ? 140 ARG B NH2   1 
ATOM   4815 N N     . ILE B 2 141 ? 32.780 -27.387 39.542  1.00 100.62 ? 141 ILE B N     1 
ATOM   4816 C CA    . ILE B 2 141 ? 32.781 -26.326 40.550  1.00 98.36  ? 141 ILE B CA    1 
ATOM   4817 C C     . ILE B 2 141 ? 33.094 -26.813 41.964  1.00 100.22 ? 141 ILE B C     1 
ATOM   4818 O O     . ILE B 2 141 ? 33.447 -26.010 42.832  1.00 100.19 ? 141 ILE B O     1 
ATOM   4819 C CB    . ILE B 2 141 ? 31.445 -25.540 40.564  1.00 93.50  ? 141 ILE B CB    1 
ATOM   4820 C CG1   . ILE B 2 141 ? 31.627 -24.161 41.220  1.00 92.22  ? 141 ILE B CG1   1 
ATOM   4821 C CG2   . ILE B 2 141 ? 30.333 -26.344 41.263  1.00 92.08  ? 141 ILE B CG2   1 
ATOM   4822 C CD1   . ILE B 2 141 ? 32.563 -23.224 40.477  1.00 93.26  ? 141 ILE B CD1   1 
ATOM   4823 N N     . LYS B 2 142 ? 32.963 -28.121 42.185  1.00 102.11 ? 142 LYS B N     1 
ATOM   4824 C CA    . LYS B 2 142 ? 33.104 -28.711 43.512  1.00 103.91 ? 142 LYS B CA    1 
ATOM   4825 C C     . LYS B 2 142 ? 34.331 -28.163 44.242  1.00 106.39 ? 142 LYS B C     1 
ATOM   4826 O O     . LYS B 2 142 ? 35.442 -28.190 43.714  1.00 109.31 ? 142 LYS B O     1 
ATOM   4827 C CB    . LYS B 2 142 ? 33.137 -30.240 43.414  1.00 107.61 ? 142 LYS B CB    1 
ATOM   4828 C CG    . LYS B 2 142 ? 31.829 -30.862 42.920  1.00 105.36 ? 142 LYS B CG    1 
ATOM   4829 C CD    . LYS B 2 142 ? 30.763 -30.869 44.010  1.00 103.64 ? 142 LYS B CD    1 
ATOM   4830 C CE    . LYS B 2 142 ? 29.357 -30.906 43.429  1.00 99.82  ? 142 LYS B CE    1 
ATOM   4831 N NZ    . LYS B 2 142 ? 29.025 -32.231 42.831  1.00 101.65 ? 142 LYS B NZ    1 
ATOM   4832 N N     . GLY B 2 143 ? 34.103 -27.639 45.443  1.00 105.33 ? 143 GLY B N     1 
ATOM   4833 C CA    . GLY B 2 143 ? 35.135 -26.945 46.213  1.00 107.49 ? 143 GLY B CA    1 
ATOM   4834 C C     . GLY B 2 143 ? 35.040 -25.436 46.043  1.00 104.32 ? 143 GLY B C     1 
ATOM   4835 O O     . GLY B 2 143 ? 34.784 -24.697 47.000  1.00 103.49 ? 143 GLY B O     1 
ATOM   4836 N N     . LYS B 2 144 ? 35.216 -24.983 44.806  1.00 102.58 ? 144 LYS B N     1 
ATOM   4837 C CA    . LYS B 2 144 ? 35.316 -23.557 44.491  1.00 98.00  ? 144 LYS B CA    1 
ATOM   4838 C C     . LYS B 2 144 ? 34.001 -22.770 44.639  1.00 93.57  ? 144 LYS B C     1 
ATOM   4839 O O     . LYS B 2 144 ? 33.894 -21.644 44.157  1.00 89.85  ? 144 LYS B O     1 
ATOM   4840 C CB    . LYS B 2 144 ? 35.907 -23.376 43.083  1.00 96.63  ? 144 LYS B CB    1 
ATOM   4841 C CG    . LYS B 2 144 ? 37.244 -24.091 42.841  1.00 100.99 ? 144 LYS B CG    1 
ATOM   4842 C CD    . LYS B 2 144 ? 38.325 -23.656 43.832  1.00 103.43 ? 144 LYS B CD    1 
ATOM   4843 C CE    . LYS B 2 144 ? 39.716 -24.051 43.371  1.00 107.17 ? 144 LYS B CE    1 
ATOM   4844 N NZ    . LYS B 2 144 ? 39.888 -25.526 43.350  1.00 112.53 ? 144 LYS B NZ    1 
ATOM   4845 N N     . GLU B 2 145 ? 33.018 -23.354 45.324  1.00 94.27  ? 145 GLU B N     1 
ATOM   4846 C CA    . GLU B 2 145 ? 31.711 -22.711 45.529  1.00 90.63  ? 145 GLU B CA    1 
ATOM   4847 C C     . GLU B 2 145 ? 31.781 -21.437 46.373  1.00 89.16  ? 145 GLU B C     1 
ATOM   4848 O O     . GLU B 2 145 ? 31.035 -20.481 46.135  1.00 85.42  ? 145 GLU B O     1 
ATOM   4849 C CB    . GLU B 2 145 ? 30.699 -23.684 46.135  1.00 92.33  ? 145 GLU B CB    1 
ATOM   4850 C CG    . GLU B 2 145 ? 31.302 -24.753 47.022  1.00 98.02  ? 145 GLU B CG    1 
ATOM   4851 C CD    . GLU B 2 145 ? 31.626 -26.030 46.262  1.00 100.70 ? 145 GLU B CD    1 
ATOM   4852 O OE1   . GLU B 2 145 ? 31.592 -26.014 45.013  1.00 98.89  ? 145 GLU B OE1   1 
ATOM   4853 O OE2   . GLU B 2 145 ? 31.914 -27.053 46.913  1.00 104.74 ? 145 GLU B OE2   1 
ATOM   4854 N N     . ASN B 2 146 ? 32.678 -21.431 47.352  1.00 92.37  ? 146 ASN B N     1 
ATOM   4855 C CA    . ASN B 2 146 ? 32.899 -20.255 48.184  1.00 91.84  ? 146 ASN B CA    1 
ATOM   4856 C C     . ASN B 2 146 ? 33.483 -19.074 47.422  1.00 88.84  ? 146 ASN B C     1 
ATOM   4857 O O     . ASN B 2 146 ? 33.096 -17.918 47.651  1.00 86.00  ? 146 ASN B O     1 
ATOM   4858 C CB    . ASN B 2 146 ? 33.822 -20.609 49.335  1.00 96.58  ? 146 ASN B CB    1 
ATOM   4859 C CG    . ASN B 2 146 ? 33.139 -21.450 50.365  1.00 100.08 ? 146 ASN B CG    1 
ATOM   4860 O OD1   . ASN B 2 146 ? 33.589 -22.557 50.683  1.00 103.43 ? 146 ASN B OD1   1 
ATOM   4861 N ND2   . ASN B 2 146 ? 32.026 -20.941 50.892  1.00 98.26  ? 146 ASN B ND2   1 
ATOM   4862 N N     . GLU B 2 147 ? 34.423 -19.388 46.529  1.00 89.50  ? 147 GLU B N     1 
ATOM   4863 C CA    . GLU B 2 147 ? 35.153 -18.394 45.744  1.00 87.47  ? 147 GLU B CA    1 
ATOM   4864 C C     . GLU B 2 147 ? 34.225 -17.703 44.740  1.00 82.82  ? 147 GLU B C     1 
ATOM   4865 O O     . GLU B 2 147 ? 34.365 -16.506 44.480  1.00 80.21  ? 147 GLU B O     1 
ATOM   4866 C CB    . GLU B 2 147 ? 36.360 -19.041 45.050  1.00 90.02  ? 147 GLU B CB    1 
ATOM   4867 C CG    . GLU B 2 147 ? 37.320 -19.802 45.999  1.00 94.99  ? 147 GLU B CG    1 
ATOM   4868 C CD    . GLU B 2 147 ? 38.251 -18.894 46.809  1.00 95.96  ? 147 GLU B CD    1 
ATOM   4869 O OE1   . GLU B 2 147 ? 38.456 -17.721 46.418  1.00 93.01  ? 147 GLU B OE1   1 
ATOM   4870 O OE2   . GLU B 2 147 ? 38.792 -19.362 47.836  1.00 99.56  ? 147 GLU B OE2   1 
ATOM   4871 N N     . VAL B 2 148 ? 33.270 -18.467 44.203  1.00 81.88  ? 148 VAL B N     1 
ATOM   4872 C CA    . VAL B 2 148 ? 32.153 -17.905 43.448  1.00 77.78  ? 148 VAL B CA    1 
ATOM   4873 C C     . VAL B 2 148 ? 31.403 -16.930 44.342  1.00 76.35  ? 148 VAL B C     1 
ATOM   4874 O O     . VAL B 2 148 ? 31.372 -15.740 44.061  1.00 73.75  ? 148 VAL B O     1 
ATOM   4875 C CB    . VAL B 2 148 ? 31.188 -18.994 42.934  1.00 77.55  ? 148 VAL B CB    1 
ATOM   4876 C CG1   . VAL B 2 148 ? 29.993 -18.360 42.262  1.00 73.28  ? 148 VAL B CG1   1 
ATOM   4877 C CG2   . VAL B 2 148 ? 31.893 -19.916 41.966  1.00 78.90  ? 148 VAL B CG2   1 
ATOM   4878 N N     . ARG B 2 149 ? 30.838 -17.443 45.434  1.00 78.70  ? 149 ARG B N     1 
ATOM   4879 C CA    . ARG B 2 149 ? 30.079 -16.633 46.392  1.00 78.55  ? 149 ARG B CA    1 
ATOM   4880 C C     . ARG B 2 149 ? 30.724 -15.285 46.743  1.00 77.91  ? 149 ARG B C     1 
ATOM   4881 O O     . ARG B 2 149 ? 30.021 -14.289 46.896  1.00 76.05  ? 149 ARG B O     1 
ATOM   4882 C CB    . ARG B 2 149 ? 29.772 -17.429 47.666  1.00 81.98  ? 149 ARG B CB    1 
ATOM   4883 C CG    . ARG B 2 149 ? 28.509 -18.278 47.577  1.00 82.38  ? 149 ARG B CG    1 
ATOM   4884 C CD    . ARG B 2 149 ? 28.170 -18.925 48.918  1.00 86.35  ? 149 ARG B CD    1 
ATOM   4885 N NE    . ARG B 2 149 ? 27.146 -19.965 48.803  1.00 88.45  ? 149 ARG B NE    1 
ATOM   4886 C CZ    . ARG B 2 149 ? 27.066 -21.027 49.603  1.00 93.92  ? 149 ARG B CZ    1 
ATOM   4887 N NH1   . ARG B 2 149 ? 27.952 -21.198 50.578  1.00 98.05  ? 149 ARG B NH1   1 
ATOM   4888 N NH2   . ARG B 2 149 ? 26.107 -21.930 49.434  1.00 95.09  ? 149 ARG B NH2   1 
ATOM   4889 N N     . LEU B 2 150 ? 32.048 -15.250 46.862  1.00 80.09  ? 150 LEU B N     1 
ATOM   4890 C CA    . LEU B 2 150 ? 32.741 -14.004 47.158  1.00 80.11  ? 150 LEU B CA    1 
ATOM   4891 C C     . LEU B 2 150 ? 32.621 -13.025 45.989  1.00 76.82  ? 150 LEU B C     1 
ATOM   4892 O O     . LEU B 2 150 ? 32.379 -11.829 46.193  1.00 75.39  ? 150 LEU B O     1 
ATOM   4893 C CB    . LEU B 2 150 ? 34.210 -14.255 47.512  1.00 83.26  ? 150 LEU B CB    1 
ATOM   4894 C CG    . LEU B 2 150 ? 34.521 -14.650 48.958  1.00 87.51  ? 150 LEU B CG    1 
ATOM   4895 C CD1   . LEU B 2 150 ? 35.847 -15.403 49.057  1.00 90.30  ? 150 LEU B CD1   1 
ATOM   4896 C CD2   . LEU B 2 150 ? 34.507 -13.435 49.887  1.00 87.53  ? 150 LEU B CD2   1 
ATOM   4897 N N     . LEU B 2 151 ? 32.770 -13.547 44.770  1.00 76.01  ? 151 LEU B N     1 
ATOM   4898 C CA    . LEU B 2 151 ? 32.734 -12.731 43.559  1.00 73.13  ? 151 LEU B CA    1 
ATOM   4899 C C     . LEU B 2 151 ? 31.396 -12.027 43.403  1.00 70.61  ? 151 LEU B C     1 
ATOM   4900 O O     . LEU B 2 151 ? 31.353 -10.827 43.137  1.00 68.72  ? 151 LEU B O     1 
ATOM   4901 C CB    . LEU B 2 151 ? 33.054 -13.574 42.318  1.00 73.06  ? 151 LEU B CB    1 
ATOM   4902 C CG    . LEU B 2 151 ? 33.105 -12.847 40.969  1.00 70.11  ? 151 LEU B CG    1 
ATOM   4903 C CD1   . LEU B 2 151 ? 33.949 -11.578 41.044  1.00 69.46  ? 151 LEU B CD1   1 
ATOM   4904 C CD2   . LEU B 2 151 ? 33.628 -13.768 39.890  1.00 71.37  ? 151 LEU B CD2   1 
ATOM   4905 N N     . LYS B 2 152 ? 30.319 -12.787 43.580  1.00 70.99  ? 152 LYS B N     1 
ATOM   4906 C CA    . LYS B 2 152 ? 28.957 -12.258 43.520  1.00 69.45  ? 152 LYS B CA    1 
ATOM   4907 C C     . LYS B 2 152 ? 28.725 -11.149 44.558  1.00 69.75  ? 152 LYS B C     1 
ATOM   4908 O O     . LYS B 2 152 ? 28.374 -10.017 44.196  1.00 67.82  ? 152 LYS B O     1 
ATOM   4909 C CB    . LYS B 2 152 ? 27.943 -13.395 43.684  1.00 70.19  ? 152 LYS B CB    1 
ATOM   4910 C CG    . LYS B 2 152 ? 27.970 -14.403 42.533  1.00 70.94  ? 152 LYS B CG    1 
ATOM   4911 C CD    . LYS B 2 152 ? 27.265 -15.707 42.889  1.00 73.83  ? 152 LYS B CD    1 
ATOM   4912 C CE    . LYS B 2 152 ? 26.941 -16.528 41.638  1.00 74.58  ? 152 LYS B CE    1 
ATOM   4913 N NZ    . LYS B 2 152 ? 26.391 -17.902 41.926  1.00 77.17  ? 152 LYS B NZ    1 
ATOM   4914 N N     . GLY B 2 153 ? 28.943 -11.475 45.835  1.00 72.63  ? 153 GLY B N     1 
ATOM   4915 C CA    . GLY B 2 153 ? 28.887 -10.500 46.925  1.00 73.60  ? 153 GLY B CA    1 
ATOM   4916 C C     . GLY B 2 153 ? 29.621 -9.205  46.622  1.00 72.62  ? 153 GLY B C     1 
ATOM   4917 O O     . GLY B 2 153 ? 29.095 -8.123  46.874  1.00 71.84  ? 153 GLY B O     1 
ATOM   4918 N N     . PHE B 2 154 ? 30.828 -9.329  46.068  1.00 73.07  ? 154 PHE B N     1 
ATOM   4919 C CA    . PHE B 2 154 ? 31.664 -8.192  45.668  1.00 72.54  ? 154 PHE B CA    1 
ATOM   4920 C C     . PHE B 2 154 ? 30.953 -7.344  44.616  1.00 69.05  ? 154 PHE B C     1 
ATOM   4921 O O     . PHE B 2 154 ? 30.863 -6.111  44.728  1.00 68.46  ? 154 PHE B O     1 
ATOM   4922 C CB    . PHE B 2 154 ? 33.007 -8.711  45.125  1.00 74.25  ? 154 PHE B CB    1 
ATOM   4923 C CG    . PHE B 2 154 ? 34.080 -7.647  44.962  1.00 75.37  ? 154 PHE B CG    1 
ATOM   4924 C CD1   . PHE B 2 154 ? 34.589 -6.963  46.069  1.00 78.04  ? 154 PHE B CD1   1 
ATOM   4925 C CD2   . PHE B 2 154 ? 34.616 -7.373  43.703  1.00 74.34  ? 154 PHE B CD2   1 
ATOM   4926 C CE1   . PHE B 2 154 ? 35.592 -5.998  45.920  1.00 79.35  ? 154 PHE B CE1   1 
ATOM   4927 C CE2   . PHE B 2 154 ? 35.620 -6.414  43.540  1.00 75.81  ? 154 PHE B CE2   1 
ATOM   4928 C CZ    . PHE B 2 154 ? 36.109 -5.723  44.652  1.00 77.82  ? 154 PHE B CZ    1 
ATOM   4929 N N     . LEU B 2 155 ? 30.427 -8.019  43.604  1.00 66.85  ? 155 LEU B N     1 
ATOM   4930 C CA    . LEU B 2 155 ? 29.745 -7.343  42.524  1.00 63.79  ? 155 LEU B CA    1 
ATOM   4931 C C     . LEU B 2 155 ? 28.430 -6.708  42.966  1.00 62.80  ? 155 LEU B C     1 
ATOM   4932 O O     . LEU B 2 155 ? 28.106 -5.595  42.533  1.00 61.55  ? 155 LEU B O     1 
ATOM   4933 C CB    . LEU B 2 155 ? 29.527 -8.304  41.371  1.00 62.55  ? 155 LEU B CB    1 
ATOM   4934 C CG    . LEU B 2 155 ? 30.834 -8.663  40.677  1.00 63.12  ? 155 LEU B CG    1 
ATOM   4935 C CD1   . LEU B 2 155 ? 30.755 -10.055 40.152  1.00 64.07  ? 155 LEU B CD1   1 
ATOM   4936 C CD2   . LEU B 2 155 ? 31.118 -7.706  39.552  1.00 61.86  ? 155 LEU B CD2   1 
ATOM   4937 N N     . LYS B 2 156 ? 27.687 -7.408  43.829  1.00 63.43  ? 156 LYS B N     1 
ATOM   4938 C CA    . LYS B 2 156 ? 26.403 -6.904  44.328  1.00 62.62  ? 156 LYS B CA    1 
ATOM   4939 C C     . LYS B 2 156 ? 26.597 -5.663  45.198  1.00 63.51  ? 156 LYS B C     1 
ATOM   4940 O O     . LYS B 2 156 ? 25.823 -4.718  45.099  1.00 62.27  ? 156 LYS B O     1 
ATOM   4941 C CB    . LYS B 2 156 ? 25.606 -7.994  45.077  1.00 64.12  ? 156 LYS B CB    1 
ATOM   4942 C CG    . LYS B 2 156 ? 24.190 -7.568  45.517  1.00 63.38  ? 156 LYS B CG    1 
ATOM   4943 C CD    . LYS B 2 156 ? 23.312 -8.745  45.931  1.00 64.53  ? 156 LYS B CD    1 
ATOM   4944 C CE    . LYS B 2 156 ? 22.007 -8.247  46.560  1.00 65.98  ? 156 LYS B CE    1 
ATOM   4945 N NZ    . LYS B 2 156 ? 20.966 -9.304  46.799  1.00 66.96  ? 156 LYS B NZ    1 
ATOM   4946 N N     . ALA B 2 157 ? 27.638 -5.663  46.029  1.00 65.64  ? 157 ALA B N     1 
ATOM   4947 C CA    . ALA B 2 157 ? 27.922 -4.518  46.904  1.00 67.15  ? 157 ALA B CA    1 
ATOM   4948 C C     . ALA B 2 157 ? 28.398 -3.314  46.108  1.00 65.67  ? 157 ALA B C     1 
ATOM   4949 O O     . ALA B 2 157 ? 28.242 -2.167  46.541  1.00 66.01  ? 157 ALA B O     1 
ATOM   4950 C CB    . ALA B 2 157 ? 28.943 -4.884  47.944  1.00 70.27  ? 157 ALA B CB    1 
ATOM   4951 N N     . ASN B 2 158 ? 28.990 -3.589  44.950  1.00 64.12  ? 158 ASN B N     1 
ATOM   4952 C CA    . ASN B 2 158 ? 29.387 -2.538  44.031  1.00 63.00  ? 158 ASN B CA    1 
ATOM   4953 C C     . ASN B 2 158 ? 28.422 -2.380  42.836  1.00 60.45  ? 158 ASN B C     1 
ATOM   4954 O O     . ASN B 2 158 ? 28.777 -1.803  41.805  1.00 59.55  ? 158 ASN B O     1 
ATOM   4955 C CB    . ASN B 2 158 ? 30.839 -2.745  43.585  1.00 63.85  ? 158 ASN B CB    1 
ATOM   4956 C CG    . ASN B 2 158 ? 31.840 -2.476  44.700  1.00 66.36  ? 158 ASN B CG    1 
ATOM   4957 O OD1   . ASN B 2 158 ? 32.077 -1.327  45.071  1.00 67.07  ? 158 ASN B OD1   1 
ATOM   4958 N ND2   . ASN B 2 158 ? 32.442 -3.537  45.228  1.00 67.91  ? 158 ASN B ND2   1 
ATOM   4959 N N     . GLY B 2 159 ? 27.205 -2.900  42.994  1.00 59.72  ? 159 GLY B N     1 
ATOM   4960 C CA    . GLY B 2 159 ? 26.108 -2.692  42.041  1.00 57.70  ? 159 GLY B CA    1 
ATOM   4961 C C     . GLY B 2 159 ? 26.314 -3.111  40.595  1.00 56.18  ? 159 GLY B C     1 
ATOM   4962 O O     . GLY B 2 159 ? 25.733 -2.524  39.696  1.00 54.84  ? 159 GLY B O     1 
ATOM   4963 N N     . ILE B 2 160 ? 27.123 -4.136  40.365  1.00 57.03  ? 160 ILE B N     1 
ATOM   4964 C CA    . ILE B 2 160 ? 27.387 -4.609  39.002  1.00 56.33  ? 160 ILE B CA    1 
ATOM   4965 C C     . ILE B 2 160 ? 27.220 -6.131  38.854  1.00 56.82  ? 160 ILE B C     1 
ATOM   4966 O O     . ILE B 2 160 ? 27.854 -6.773  38.012  1.00 56.91  ? 160 ILE B O     1 
ATOM   4967 C CB    . ILE B 2 160 ? 28.767 -4.153  38.517  1.00 56.92  ? 160 ILE B CB    1 
ATOM   4968 C CG1   . ILE B 2 160 ? 29.801 -4.375  39.617  1.00 59.42  ? 160 ILE B CG1   1 
ATOM   4969 C CG2   . ILE B 2 160 ? 28.735 -2.696  38.170  1.00 56.34  ? 160 ILE B CG2   1 
ATOM   4970 C CD1   . ILE B 2 160 ? 31.230 -4.132  39.176  1.00 61.75  ? 160 ILE B CD1   1 
ATOM   4971 N N     . TYR B 2 161 ? 26.352 -6.698  39.682  1.00 57.42  ? 161 TYR B N     1 
ATOM   4972 C CA    . TYR B 2 161 ? 25.946 -8.086  39.519  1.00 58.11  ? 161 TYR B CA    1 
ATOM   4973 C C     . TYR B 2 161 ? 24.605 -8.180  38.791  1.00 56.60  ? 161 TYR B C     1 
ATOM   4974 O O     . TYR B 2 161 ? 23.661 -7.433  39.091  1.00 56.01  ? 161 TYR B O     1 
ATOM   4975 C CB    . TYR B 2 161 ? 25.837 -8.759  40.874  1.00 60.17  ? 161 TYR B CB    1 
ATOM   4976 C CG    . TYR B 2 161 ? 25.453 -10.212 40.801  1.00 61.37  ? 161 TYR B CG    1 
ATOM   4977 C CD1   . TYR B 2 161 ? 26.241 -11.124 40.097  1.00 62.63  ? 161 TYR B CD1   1 
ATOM   4978 C CD2   . TYR B 2 161 ? 24.319 -10.682 41.459  1.00 61.91  ? 161 TYR B CD2   1 
ATOM   4979 C CE1   . TYR B 2 161 ? 25.908 -12.469 40.043  1.00 64.39  ? 161 TYR B CE1   1 
ATOM   4980 C CE2   . TYR B 2 161 ? 23.966 -12.029 41.409  1.00 63.64  ? 161 TYR B CE2   1 
ATOM   4981 C CZ    . TYR B 2 161 ? 24.767 -12.923 40.700  1.00 64.52  ? 161 TYR B CZ    1 
ATOM   4982 O OH    . TYR B 2 161 ? 24.430 -14.264 40.643  1.00 65.06  ? 161 TYR B OH    1 
ATOM   4983 N N     . GLY B 2 162 ? 24.521 -9.102  37.839  1.00 56.07  ? 162 GLY B N     1 
ATOM   4984 C CA    . GLY B 2 162 ? 23.313 -9.250  37.028  1.00 54.54  ? 162 GLY B CA    1 
ATOM   4985 C C     . GLY B 2 162 ? 23.597 -9.078  35.550  1.00 53.58  ? 162 GLY B C     1 
ATOM   4986 O O     . GLY B 2 162 ? 24.683 -8.664  35.165  1.00 53.55  ? 162 GLY B O     1 
ATOM   4987 N N     . ALA B 2 163 ? 22.623 -9.414  34.715  1.00 52.92  ? 163 ALA B N     1 
ATOM   4988 C CA    . ALA B 2 163 ? 22.795 -9.278  33.275  1.00 52.54  ? 163 ALA B CA    1 
ATOM   4989 C C     . ALA B 2 163 ? 21.685 -8.437  32.682  1.00 51.37  ? 163 ALA B C     1 
ATOM   4990 O O     . ALA B 2 163 ? 21.873 -7.797  31.660  1.00 51.76  ? 163 ALA B O     1 
ATOM   4991 C CB    . ALA B 2 163 ? 22.845 -10.624 32.621  1.00 53.75  ? 163 ALA B CB    1 
ATOM   4992 N N     . GLU B 2 164 ? 20.529 -8.438  33.333  1.00 50.61  ? 164 GLU B N     1 
ATOM   4993 C CA    . GLU B 2 164 ? 19.400 -7.598  32.937  1.00 49.75  ? 164 GLU B CA    1 
ATOM   4994 C C     . GLU B 2 164 ? 19.797 -6.162  32.615  1.00 48.55  ? 164 GLU B C     1 
ATOM   4995 O O     . GLU B 2 164 ? 20.759 -5.640  33.164  1.00 48.55  ? 164 GLU B O     1 
ATOM   4996 C CB    . GLU B 2 164 ? 18.340 -7.594  34.042  1.00 50.16  ? 164 GLU B CB    1 
ATOM   4997 C CG    . GLU B 2 164 ? 18.779 -6.900  35.341  1.00 51.17  ? 164 GLU B CG    1 
ATOM   4998 C CD    . GLU B 2 164 ? 19.424 -7.849  36.356  1.00 52.68  ? 164 GLU B CD    1 
ATOM   4999 O OE1   . GLU B 2 164 ? 19.036 -7.764  37.547  1.00 52.20  ? 164 GLU B OE1   1 
ATOM   5000 O OE2   . GLU B 2 164 ? 20.310 -8.664  35.972  1.00 53.22  ? 164 GLU B OE2   1 
ATOM   5001 N N     . TYR B 2 165 ? 19.023 -5.519  31.749  1.00 47.92  ? 165 TYR B N     1 
ATOM   5002 C CA    . TYR B 2 165 ? 19.356 -4.178  31.265  1.00 47.45  ? 165 TYR B CA    1 
ATOM   5003 C C     . TYR B 2 165 ? 19.422 -3.108  32.346  1.00 46.94  ? 165 TYR B C     1 
ATOM   5004 O O     . TYR B 2 165 ? 19.986 -2.033  32.122  1.00 47.48  ? 165 TYR B O     1 
ATOM   5005 C CB    . TYR B 2 165 ? 18.418 -3.751  30.134  1.00 47.56  ? 165 TYR B CB    1 
ATOM   5006 C CG    . TYR B 2 165 ? 18.722 -4.447  28.826  1.00 48.71  ? 165 TYR B CG    1 
ATOM   5007 C CD1   . TYR B 2 165 ? 17.775 -5.282  28.214  1.00 49.93  ? 165 TYR B CD1   1 
ATOM   5008 C CD2   . TYR B 2 165 ? 19.961 -4.294  28.204  1.00 49.27  ? 165 TYR B CD2   1 
ATOM   5009 C CE1   . TYR B 2 165 ? 18.051 -5.929  26.999  1.00 50.34  ? 165 TYR B CE1   1 
ATOM   5010 C CE2   . TYR B 2 165 ? 20.251 -4.943  27.003  1.00 50.35  ? 165 TYR B CE2   1 
ATOM   5011 C CZ    . TYR B 2 165 ? 19.295 -5.756  26.406  1.00 50.92  ? 165 TYR B CZ    1 
ATOM   5012 O OH    . TYR B 2 165 ? 19.583 -6.389  25.214  1.00 52.30  ? 165 TYR B OH    1 
ATOM   5013 N N     . LYS B 2 166 ? 18.852 -3.409  33.511  1.00 46.48  ? 166 LYS B N     1 
ATOM   5014 C CA    . LYS B 2 166 ? 18.873 -2.505  34.659  1.00 46.28  ? 166 LYS B CA    1 
ATOM   5015 C C     . LYS B 2 166 ? 20.301 -2.366  35.193  1.00 46.97  ? 166 LYS B C     1 
ATOM   5016 O O     . LYS B 2 166 ? 20.687 -1.301  35.706  1.00 47.24  ? 166 LYS B O     1 
ATOM   5017 C CB    . LYS B 2 166 ? 17.921 -3.017  35.740  1.00 46.26  ? 166 LYS B CB    1 
ATOM   5018 C CG    . LYS B 2 166 ? 17.835 -2.195  37.011  1.00 46.04  ? 166 LYS B CG    1 
ATOM   5019 C CD    . LYS B 2 166 ? 16.494 -2.433  37.691  1.00 46.05  ? 166 LYS B CD    1 
ATOM   5020 C CE    . LYS B 2 166 ? 16.443 -1.864  39.095  1.00 46.93  ? 166 LYS B CE    1 
ATOM   5021 N NZ    . LYS B 2 166 ? 15.035 -1.809  39.591  1.00 48.62  ? 166 LYS B NZ    1 
ATOM   5022 N N     . VAL B 2 167 ? 21.090 -3.430  35.030  1.00 47.01  ? 167 VAL B N     1 
ATOM   5023 C CA    . VAL B 2 167 ? 22.420 -3.490  35.615  1.00 47.89  ? 167 VAL B CA    1 
ATOM   5024 C C     . VAL B 2 167 ? 23.521 -3.554  34.562  1.00 48.64  ? 167 VAL B C     1 
ATOM   5025 O O     . VAL B 2 167 ? 24.617 -3.034  34.777  1.00 49.26  ? 167 VAL B O     1 
ATOM   5026 C CB    . VAL B 2 167 ? 22.544 -4.687  36.587  1.00 48.40  ? 167 VAL B CB    1 
ATOM   5027 C CG1   . VAL B 2 167 ? 23.909 -4.713  37.258  1.00 49.67  ? 167 VAL B CG1   1 
ATOM   5028 C CG2   . VAL B 2 167 ? 21.441 -4.647  37.630  1.00 47.96  ? 167 VAL B CG2   1 
ATOM   5029 N N     . ARG B 2 168 ? 23.229 -4.187  33.427  1.00 49.26  ? 168 ARG B N     1 
ATOM   5030 C CA    . ARG B 2 168 ? 24.254 -4.534  32.435  1.00 50.77  ? 168 ARG B CA    1 
ATOM   5031 C C     . ARG B 2 168 ? 25.590 -4.955  33.074  1.00 52.15  ? 168 ARG B C     1 
ATOM   5032 O O     . ARG B 2 168 ? 26.661 -4.485  32.670  1.00 53.05  ? 168 ARG B O     1 
ATOM   5033 C CB    . ARG B 2 168 ? 24.471 -3.372  31.487  1.00 51.06  ? 168 ARG B CB    1 
ATOM   5034 C CG    . ARG B 2 168 ? 23.246 -3.007  30.698  1.00 52.19  ? 168 ARG B CG    1 
ATOM   5035 C CD    . ARG B 2 168 ? 23.447 -1.661  30.029  1.00 55.29  ? 168 ARG B CD    1 
ATOM   5036 N NE    . ARG B 2 168 ? 22.444 -1.432  28.994  1.00 57.80  ? 168 ARG B NE    1 
ATOM   5037 C CZ    . ARG B 2 168 ? 22.490 -1.952  27.768  1.00 59.51  ? 168 ARG B CZ    1 
ATOM   5038 N NH1   . ARG B 2 168 ? 23.501 -2.749  27.403  1.00 58.76  ? 168 ARG B NH1   1 
ATOM   5039 N NH2   . ARG B 2 168 ? 21.512 -1.671  26.909  1.00 59.71  ? 168 ARG B NH2   1 
ATOM   5040 N N     . GLY B 2 169 ? 25.516 -5.837  34.074  1.00 52.64  ? 169 GLY B N     1 
ATOM   5041 C CA    . GLY B 2 169 ? 26.694 -6.261  34.836  1.00 53.93  ? 169 GLY B CA    1 
ATOM   5042 C C     . GLY B 2 169 ? 27.190 -7.645  34.462  1.00 55.13  ? 169 GLY B C     1 
ATOM   5043 O O     . GLY B 2 169 ? 27.332 -7.950  33.276  1.00 55.39  ? 169 GLY B O     1 
ATOM   5044 N N     . PHE B 2 170 ? 27.433 -8.478  35.482  1.00 56.31  ? 170 PHE B N     1 
ATOM   5045 C CA    . PHE B 2 170 ? 27.955 -9.848  35.326  1.00 57.74  ? 170 PHE B CA    1 
ATOM   5046 C C     . PHE B 2 170 ? 26.924 -10.908 35.717  1.00 57.83  ? 170 PHE B C     1 
ATOM   5047 O O     . PHE B 2 170 ? 26.466 -10.929 36.861  1.00 57.90  ? 170 PHE B O     1 
ATOM   5048 C CB    . PHE B 2 170 ? 29.178 -10.043 36.227  1.00 59.53  ? 170 PHE B CB    1 
ATOM   5049 C CG    . PHE B 2 170 ? 30.381 -9.253  35.816  1.00 60.37  ? 170 PHE B CG    1 
ATOM   5050 C CD1   . PHE B 2 170 ? 30.520 -7.922  36.187  1.00 60.33  ? 170 PHE B CD1   1 
ATOM   5051 C CD2   . PHE B 2 170 ? 31.396 -9.847  35.074  1.00 62.28  ? 170 PHE B CD2   1 
ATOM   5052 C CE1   . PHE B 2 170 ? 31.649 -7.187  35.809  1.00 61.94  ? 170 PHE B CE1   1 
ATOM   5053 C CE2   . PHE B 2 170 ? 32.528 -9.125  34.690  1.00 63.46  ? 170 PHE B CE2   1 
ATOM   5054 C CZ    . PHE B 2 170 ? 32.656 -7.797  35.059  1.00 62.82  ? 170 PHE B CZ    1 
ATOM   5055 N N     . SER B 2 171 ? 26.570 -11.799 34.791  1.00 58.36  ? 171 SER B N     1 
ATOM   5056 C CA    . SER B 2 171 ? 25.693 -12.927 35.136  1.00 59.19  ? 171 SER B CA    1 
ATOM   5057 C C     . SER B 2 171 ? 26.369 -13.832 36.162  1.00 61.55  ? 171 SER B C     1 
ATOM   5058 O O     . SER B 2 171 ? 27.593 -13.838 36.283  1.00 62.78  ? 171 SER B O     1 
ATOM   5059 C CB    . SER B 2 171 ? 25.236 -13.725 33.898  1.00 59.57  ? 171 SER B CB    1 
ATOM   5060 O OG    . SER B 2 171 ? 26.317 -14.116 33.069  1.00 60.81  ? 171 SER B OG    1 
ATOM   5061 N N     . GLY B 2 172 ? 25.563 -14.572 36.916  1.00 62.64  ? 172 GLY B N     1 
ATOM   5062 C CA    . GLY B 2 172 ? 26.079 -15.442 37.974  1.00 65.88  ? 172 GLY B CA    1 
ATOM   5063 C C     . GLY B 2 172 ? 26.588 -16.762 37.431  1.00 68.76  ? 172 GLY B C     1 
ATOM   5064 O O     . GLY B 2 172 ? 26.991 -17.649 38.176  1.00 71.17  ? 172 GLY B O     1 
ATOM   5065 N N     . TYR B 2 173 ? 26.540 -16.888 36.116  1.00 68.99  ? 173 TYR B N     1 
ATOM   5066 C CA    . TYR B 2 173 ? 27.124 -18.010 35.435  1.00 72.05  ? 173 TYR B CA    1 
ATOM   5067 C C     . TYR B 2 173 ? 28.493 -17.582 34.918  1.00 73.38  ? 173 TYR B C     1 
ATOM   5068 O O     . TYR B 2 173 ? 29.425 -18.392 34.874  1.00 76.53  ? 173 TYR B O     1 
ATOM   5069 C CB    . TYR B 2 173 ? 26.203 -18.446 34.301  1.00 71.71  ? 173 TYR B CB    1 
ATOM   5070 C CG    . TYR B 2 173 ? 26.800 -19.438 33.335  1.00 74.20  ? 173 TYR B CG    1 
ATOM   5071 C CD1   . TYR B 2 173 ? 27.157 -20.729 33.742  1.00 77.16  ? 173 TYR B CD1   1 
ATOM   5072 C CD2   . TYR B 2 173 ? 26.987 -19.090 32.004  1.00 74.14  ? 173 TYR B CD2   1 
ATOM   5073 C CE1   . TYR B 2 173 ? 27.701 -21.642 32.838  1.00 79.57  ? 173 TYR B CE1   1 
ATOM   5074 C CE2   . TYR B 2 173 ? 27.523 -19.987 31.103  1.00 77.20  ? 173 TYR B CE2   1 
ATOM   5075 C CZ    . TYR B 2 173 ? 27.878 -21.256 31.522  1.00 79.52  ? 173 TYR B CZ    1 
ATOM   5076 O OH    . TYR B 2 173 ? 28.406 -22.112 30.599  1.00 82.46  ? 173 TYR B OH    1 
ATOM   5077 N N     . LEU B 2 174 ? 28.604 -16.308 34.541  1.00 71.61  ? 174 LEU B N     1 
ATOM   5078 C CA    . LEU B 2 174 ? 29.881 -15.695 34.192  1.00 72.64  ? 174 LEU B CA    1 
ATOM   5079 C C     . LEU B 2 174 ? 30.768 -15.677 35.423  1.00 74.32  ? 174 LEU B C     1 
ATOM   5080 O O     . LEU B 2 174 ? 31.965 -15.919 35.325  1.00 76.69  ? 174 LEU B O     1 
ATOM   5081 C CB    . LEU B 2 174 ? 29.671 -14.253 33.723  1.00 70.34  ? 174 LEU B CB    1 
ATOM   5082 C CG    . LEU B 2 174 ? 30.608 -13.565 32.711  1.00 70.88  ? 174 LEU B CG    1 
ATOM   5083 C CD1   . LEU B 2 174 ? 30.438 -12.047 32.818  1.00 68.38  ? 174 LEU B CD1   1 
ATOM   5084 C CD2   . LEU B 2 174 ? 32.092 -13.968 32.793  1.00 72.29  ? 174 LEU B CD2   1 
ATOM   5085 N N     . CYS B 2 175 ? 30.174 -15.388 36.579  1.00 73.65  ? 175 CYS B N     1 
ATOM   5086 C CA    . CYS B 2 175 ? 30.897 -15.395 37.851  1.00 75.88  ? 175 CYS B CA    1 
ATOM   5087 C C     . CYS B 2 175 ? 31.500 -16.758 38.181  1.00 79.27  ? 175 CYS B C     1 
ATOM   5088 O O     . CYS B 2 175 ? 32.605 -16.842 38.723  1.00 81.67  ? 175 CYS B O     1 
ATOM   5089 C CB    . CYS B 2 175 ? 29.987 -14.958 38.994  1.00 74.68  ? 175 CYS B CB    1 
ATOM   5090 S SG    . CYS B 2 175 ? 29.942 -13.180 39.252  1.00 74.74  ? 175 CYS B SG    1 
ATOM   5091 N N     . GLU B 2 176 ? 30.767 -17.819 37.862  1.00 79.73  ? 176 GLU B N     1 
ATOM   5092 C CA    . GLU B 2 176 ? 31.240 -19.162 38.101  1.00 83.14  ? 176 GLU B CA    1 
ATOM   5093 C C     . GLU B 2 176 ? 32.393 -19.494 37.160  1.00 85.07  ? 176 GLU B C     1 
ATOM   5094 O O     . GLU B 2 176 ? 33.407 -20.065 37.582  1.00 88.00  ? 176 GLU B O     1 
ATOM   5095 C CB    . GLU B 2 176 ? 30.093 -20.150 37.937  1.00 83.67  ? 176 GLU B CB    1 
ATOM   5096 C CG    . GLU B 2 176 ? 29.041 -20.055 39.033  1.00 83.45  ? 176 GLU B CG    1 
ATOM   5097 C CD    . GLU B 2 176 ? 27.856 -20.968 38.777  1.00 85.04  ? 176 GLU B CD    1 
ATOM   5098 O OE1   . GLU B 2 176 ? 27.745 -22.029 39.446  1.00 88.57  ? 176 GLU B OE1   1 
ATOM   5099 O OE2   . GLU B 2 176 ? 27.045 -20.631 37.889  1.00 82.91  ? 176 GLU B OE2   1 
ATOM   5100 N N     . LEU B 2 177 ? 32.242 -19.105 35.893  1.00 83.37  ? 177 LEU B N     1 
ATOM   5101 C CA    . LEU B 2 177 ? 33.263 -19.356 34.871  1.00 85.49  ? 177 LEU B CA    1 
ATOM   5102 C C     . LEU B 2 177 ? 34.610 -18.716 35.218  1.00 86.57  ? 177 LEU B C     1 
ATOM   5103 O O     . LEU B 2 177 ? 35.660 -19.316 35.011  1.00 90.09  ? 177 LEU B O     1 
ATOM   5104 C CB    . LEU B 2 177 ? 32.791 -18.889 33.484  1.00 83.74  ? 177 LEU B CB    1 
ATOM   5105 C CG    . LEU B 2 177 ? 31.563 -19.525 32.806  1.00 82.94  ? 177 LEU B CG    1 
ATOM   5106 C CD1   . LEU B 2 177 ? 31.485 -19.122 31.338  1.00 82.32  ? 177 LEU B CD1   1 
ATOM   5107 C CD2   . LEU B 2 177 ? 31.549 -21.041 32.926  1.00 86.49  ? 177 LEU B CD2   1 
ATOM   5108 N N     . LEU B 2 178 ? 34.561 -17.502 35.753  1.00 83.85  ? 178 LEU B N     1 
ATOM   5109 C CA    . LEU B 2 178 ? 35.757 -16.760 36.134  1.00 84.68  ? 178 LEU B CA    1 
ATOM   5110 C C     . LEU B 2 178 ? 36.515 -17.425 37.264  1.00 87.74  ? 178 LEU B C     1 
ATOM   5111 O O     . LEU B 2 178 ? 37.744 -17.454 37.253  1.00 90.43  ? 178 LEU B O     1 
ATOM   5112 C CB    . LEU B 2 178 ? 35.386 -15.334 36.545  1.00 81.57  ? 178 LEU B CB    1 
ATOM   5113 C CG    . LEU B 2 178 ? 34.753 -14.446 35.478  1.00 78.26  ? 178 LEU B CG    1 
ATOM   5114 C CD1   . LEU B 2 178 ? 34.100 -13.230 36.114  1.00 75.25  ? 178 LEU B CD1   1 
ATOM   5115 C CD2   . LEU B 2 178 ? 35.789 -14.046 34.450  1.00 79.43  ? 178 LEU B CD2   1 
ATOM   5116 N N     . ILE B 2 179 ? 35.771 -17.936 38.243  1.00 87.72  ? 179 ILE B N     1 
ATOM   5117 C CA    . ILE B 2 179 ? 36.348 -18.675 39.365  1.00 91.20  ? 179 ILE B CA    1 
ATOM   5118 C C     . ILE B 2 179 ? 36.945 -19.971 38.851  1.00 94.90  ? 179 ILE B C     1 
ATOM   5119 O O     . ILE B 2 179 ? 38.085 -20.309 39.172  1.00 98.56  ? 179 ILE B O     1 
ATOM   5120 C CB    . ILE B 2 179 ? 35.305 -18.968 40.480  1.00 90.59  ? 179 ILE B CB    1 
ATOM   5121 C CG1   . ILE B 2 179 ? 34.869 -17.672 41.169  1.00 88.14  ? 179 ILE B CG1   1 
ATOM   5122 C CG2   . ILE B 2 179 ? 35.858 -19.944 41.513  1.00 94.68  ? 179 ILE B CG2   1 
ATOM   5123 C CD1   . ILE B 2 179 ? 36.018 -16.795 41.679  1.00 90.26  ? 179 ILE B CD1   1 
ATOM   5124 N N     . VAL B 2 180 ? 36.168 -20.682 38.041  1.00 94.25  ? 180 VAL B N     1 
ATOM   5125 C CA    . VAL B 2 180 ? 36.647 -21.884 37.372  1.00 97.80  ? 180 VAL B CA    1 
ATOM   5126 C C     . VAL B 2 180 ? 37.930 -21.578 36.584  1.00 99.71  ? 180 VAL B C     1 
ATOM   5127 O O     . VAL B 2 180 ? 38.912 -22.324 36.659  1.00 103.68 ? 180 VAL B O     1 
ATOM   5128 C CB    . VAL B 2 180 ? 35.535 -22.498 36.483  1.00 96.59  ? 180 VAL B CB    1 
ATOM   5129 C CG1   . VAL B 2 180 ? 36.107 -23.428 35.429  1.00 100.29 ? 180 VAL B CG1   1 
ATOM   5130 C CG2   . VAL B 2 180 ? 34.532 -23.241 37.346  1.00 96.46  ? 180 VAL B CG2   1 
ATOM   5131 N N     . PHE B 2 181 ? 37.923 -20.455 35.870  1.00 96.95  ? 181 PHE B N     1 
ATOM   5132 C CA    . PHE B 2 181 ? 39.072 -20.036 35.081  1.00 98.89  ? 181 PHE B CA    1 
ATOM   5133 C C     . PHE B 2 181 ? 40.279 -19.657 35.943  1.00 101.08 ? 181 PHE B C     1 
ATOM   5134 O O     . PHE B 2 181 ? 41.369 -20.213 35.770  1.00 105.20 ? 181 PHE B O     1 
ATOM   5135 C CB    . PHE B 2 181 ? 38.697 -18.886 34.144  1.00 95.48  ? 181 PHE B CB    1 
ATOM   5136 C CG    . PHE B 2 181 ? 39.736 -18.596 33.102  1.00 98.05  ? 181 PHE B CG    1 
ATOM   5137 C CD1   . PHE B 2 181 ? 39.923 -19.462 32.026  1.00 101.47 ? 181 PHE B CD1   1 
ATOM   5138 C CD2   . PHE B 2 181 ? 40.539 -17.463 33.199  1.00 97.97  ? 181 PHE B CD2   1 
ATOM   5139 C CE1   . PHE B 2 181 ? 40.889 -19.202 31.060  1.00 104.34 ? 181 PHE B CE1   1 
ATOM   5140 C CE2   . PHE B 2 181 ? 41.508 -17.186 32.234  1.00 100.44 ? 181 PHE B CE2   1 
ATOM   5141 C CZ    . PHE B 2 181 ? 41.684 -18.058 31.161  1.00 103.83 ? 181 PHE B CZ    1 
ATOM   5142 N N     . TYR B 2 182 ? 40.077 -18.721 36.869  1.00 98.62  ? 182 TYR B N     1 
ATOM   5143 C CA    . TYR B 2 182 ? 41.170 -18.175 37.676  1.00 100.45 ? 182 TYR B CA    1 
ATOM   5144 C C     . TYR B 2 182 ? 41.418 -18.901 38.989  1.00 103.35 ? 182 TYR B C     1 
ATOM   5145 O O     . TYR B 2 182 ? 42.283 -18.501 39.766  1.00 105.24 ? 182 TYR B O     1 
ATOM   5146 C CB    . TYR B 2 182 ? 40.954 -16.687 37.946  1.00 96.76  ? 182 TYR B CB    1 
ATOM   5147 C CG    . TYR B 2 182 ? 41.209 -15.817 36.746  1.00 95.29  ? 182 TYR B CG    1 
ATOM   5148 C CD1   . TYR B 2 182 ? 42.439 -15.856 36.086  1.00 98.12  ? 182 TYR B CD1   1 
ATOM   5149 C CD2   . TYR B 2 182 ? 40.227 -14.947 36.272  1.00 90.42  ? 182 TYR B CD2   1 
ATOM   5150 C CE1   . TYR B 2 182 ? 42.681 -15.060 34.977  1.00 97.45  ? 182 TYR B CE1   1 
ATOM   5151 C CE2   . TYR B 2 182 ? 40.460 -14.143 35.164  1.00 89.52  ? 182 TYR B CE2   1 
ATOM   5152 C CZ    . TYR B 2 182 ? 41.690 -14.201 34.521  1.00 93.50  ? 182 TYR B CZ    1 
ATOM   5153 O OH    . TYR B 2 182 ? 41.935 -13.406 33.420  1.00 93.29  ? 182 TYR B OH    1 
ATOM   5154 N N     . GLY B 2 183 ? 40.663 -19.965 39.235  1.00 104.03 ? 183 GLY B N     1 
ATOM   5155 C CA    . GLY B 2 183 ? 40.849 -20.765 40.437  1.00 107.47 ? 183 GLY B CA    1 
ATOM   5156 C C     . GLY B 2 183 ? 40.119 -20.210 41.644  1.00 105.44 ? 183 GLY B C     1 
ATOM   5157 O O     . GLY B 2 183 ? 39.369 -20.932 42.297  1.00 106.15 ? 183 GLY B O     1 
ATOM   5158 N N     . SER B 2 184 ? 40.335 -18.930 41.943  1.00 103.37 ? 184 SER B N     1 
ATOM   5159 C CA    . SER B 2 184 ? 39.780 -18.324 43.153  1.00 102.23 ? 184 SER B CA    1 
ATOM   5160 C C     . SER B 2 184 ? 39.403 -16.848 42.983  1.00 98.29  ? 184 SER B C     1 
ATOM   5161 O O     . SER B 2 184 ? 39.719 -16.224 41.968  1.00 96.80  ? 184 SER B O     1 
ATOM   5162 C CB    . SER B 2 184 ? 40.762 -18.482 44.317  1.00 106.44 ? 184 SER B CB    1 
ATOM   5163 O OG    . SER B 2 184 ? 41.869 -17.612 44.174  1.00 107.60 ? 184 SER B OG    1 
ATOM   5164 N N     . PHE B 2 185 ? 38.724 -16.307 43.994  1.00 96.98  ? 185 PHE B N     1 
ATOM   5165 C CA    . PHE B 2 185 ? 38.310 -14.909 44.024  1.00 93.58  ? 185 PHE B CA    1 
ATOM   5166 C C     . PHE B 2 185 ? 39.515 -13.981 43.939  1.00 94.54  ? 185 PHE B C     1 
ATOM   5167 O O     . PHE B 2 185 ? 39.475 -12.968 43.237  1.00 91.92  ? 185 PHE B O     1 
ATOM   5168 C CB    . PHE B 2 185 ? 37.512 -14.644 45.307  1.00 93.50  ? 185 PHE B CB    1 
ATOM   5169 C CG    . PHE B 2 185 ? 37.163 -13.195 45.536  1.00 91.08  ? 185 PHE B CG    1 
ATOM   5170 C CD1   . PHE B 2 185 ? 38.008 -12.366 46.272  1.00 92.70  ? 185 PHE B CD1   1 
ATOM   5171 C CD2   . PHE B 2 185 ? 35.972 -12.665 45.041  1.00 87.70  ? 185 PHE B CD2   1 
ATOM   5172 C CE1   . PHE B 2 185 ? 37.679 -11.026 46.497  1.00 90.94  ? 185 PHE B CE1   1 
ATOM   5173 C CE2   . PHE B 2 185 ? 35.630 -11.322 45.262  1.00 85.64  ? 185 PHE B CE2   1 
ATOM   5174 C CZ    . PHE B 2 185 ? 36.485 -10.503 45.987  1.00 87.14  ? 185 PHE B CZ    1 
ATOM   5175 N N     . LEU B 2 186 ? 40.583 -14.347 44.649  1.00 98.54  ? 186 LEU B N     1 
ATOM   5176 C CA    . LEU B 2 186 ? 41.786 -13.519 44.753  1.00 100.08 ? 186 LEU B CA    1 
ATOM   5177 C C     . LEU B 2 186 ? 42.581 -13.450 43.452  1.00 99.92  ? 186 LEU B C     1 
ATOM   5178 O O     . LEU B 2 186 ? 43.124 -12.402 43.118  1.00 99.24  ? 186 LEU B O     1 
ATOM   5179 C CB    . LEU B 2 186 ? 42.675 -14.011 45.897  1.00 105.07 ? 186 LEU B CB    1 
ATOM   5180 C CG    . LEU B 2 186 ? 43.685 -13.030 46.506  1.00 107.56 ? 186 LEU B CG    1 
ATOM   5181 C CD1   . LEU B 2 186 ? 43.936 -13.386 47.973  1.00 112.03 ? 186 LEU B CD1   1 
ATOM   5182 C CD2   . LEU B 2 186 ? 45.005 -12.983 45.728  1.00 110.00 ? 186 LEU B CD2   1 
ATOM   5183 N N     . GLU B 2 187 ? 42.652 -14.567 42.731  1.00 100.82 ? 187 GLU B N     1 
ATOM   5184 C CA    . GLU B 2 187 ? 43.333 -14.607 41.438  1.00 101.26 ? 187 GLU B CA    1 
ATOM   5185 C C     . GLU B 2 187 ? 42.489 -13.943 40.353  1.00 96.83  ? 187 GLU B C     1 
ATOM   5186 O O     . GLU B 2 187 ? 43.023 -13.439 39.363  1.00 96.75  ? 187 GLU B O     1 
ATOM   5187 C CB    . GLU B 2 187 ? 43.693 -16.051 41.052  1.00 104.63 ? 187 GLU B CB    1 
ATOM   5188 C CG    . GLU B 2 187 ? 44.600 -16.211 39.805  1.00 106.61 ? 187 GLU B CG    1 
ATOM   5189 C CD    . GLU B 2 187 ? 46.100 -15.986 40.068  1.00 110.57 ? 187 GLU B CD    1 
ATOM   5190 O OE1   . GLU B 2 187 ? 46.919 -16.564 39.315  1.00 113.60 ? 187 GLU B OE1   1 
ATOM   5191 O OE2   . GLU B 2 187 ? 46.467 -15.239 41.006  1.00 110.23 ? 187 GLU B OE2   1 
ATOM   5192 N N     . THR B 2 188 ? 41.174 -13.941 40.555  1.00 93.52  ? 188 THR B N     1 
ATOM   5193 C CA    . THR B 2 188 ? 40.243 -13.344 39.608  1.00 89.58  ? 188 THR B CA    1 
ATOM   5194 C C     . THR B 2 188 ? 40.379 -11.820 39.648  1.00 87.83  ? 188 THR B C     1 
ATOM   5195 O O     . THR B 2 188 ? 40.573 -11.173 38.614  1.00 86.77  ? 188 THR B O     1 
ATOM   5196 C CB    . THR B 2 188 ? 38.782 -13.776 39.895  1.00 87.10  ? 188 THR B CB    1 
ATOM   5197 O OG1   . THR B 2 188 ? 38.703 -15.204 39.998  1.00 89.26  ? 188 THR B OG1   1 
ATOM   5198 C CG2   . THR B 2 188 ? 37.850 -13.312 38.785  1.00 83.67  ? 188 THR B CG2   1 
ATOM   5199 N N     . VAL B 2 189 ? 40.296 -11.257 40.849  1.00 87.79  ? 189 VAL B N     1 
ATOM   5200 C CA    . VAL B 2 189 ? 40.516 -9.831  41.048  1.00 86.79  ? 189 VAL B CA    1 
ATOM   5201 C C     . VAL B 2 189 ? 41.904 -9.447  40.531  1.00 89.30  ? 189 VAL B C     1 
ATOM   5202 O O     . VAL B 2 189 ? 42.059 -8.418  39.870  1.00 88.39  ? 189 VAL B O     1 
ATOM   5203 C CB    . VAL B 2 189 ? 40.350 -9.446  42.535  1.00 87.46  ? 189 VAL B CB    1 
ATOM   5204 C CG1   . VAL B 2 189 ? 40.812 -8.018  42.798  1.00 87.62  ? 189 VAL B CG1   1 
ATOM   5205 C CG2   . VAL B 2 189 ? 38.905 -9.611  42.957  1.00 85.15  ? 189 VAL B CG2   1 
ATOM   5206 N N     . LYS B 2 190 ? 42.891 -10.298 40.821  1.00 92.99  ? 190 LYS B N     1 
ATOM   5207 C CA    . LYS B 2 190 ? 44.285 -10.113 40.400  1.00 95.95  ? 190 LYS B CA    1 
ATOM   5208 C C     . LYS B 2 190 ? 44.469 -9.838  38.906  1.00 95.26  ? 190 LYS B C     1 
ATOM   5209 O O     . LYS B 2 190 ? 45.155 -8.884  38.536  1.00 95.82  ? 190 LYS B O     1 
ATOM   5210 C CB    . LYS B 2 190 ? 45.137 -11.320 40.805  1.00 99.96  ? 190 LYS B CB    1 
ATOM   5211 C CG    . LYS B 2 190 ? 45.778 -11.203 42.175  1.00 102.47 ? 190 LYS B CG    1 
ATOM   5212 C CD    . LYS B 2 190 ? 46.984 -12.130 42.304  1.00 107.59 ? 190 LYS B CD    1 
ATOM   5213 C CE    . LYS B 2 190 ? 48.162 -11.632 41.471  1.00 109.62 ? 190 LYS B CE    1 
ATOM   5214 N NZ    . LYS B 2 190 ? 49.303 -12.579 41.507  1.00 114.74 ? 190 LYS B NZ    1 
ATOM   5215 N N     . ASN B 2 191 ? 43.861 -10.671 38.061  1.00 94.38  ? 191 ASN B N     1 
ATOM   5216 C CA    . ASN B 2 191 ? 44.022 -10.568 36.603  1.00 94.44  ? 191 ASN B CA    1 
ATOM   5217 C C     . ASN B 2 191 ? 43.065 -9.596  35.921  1.00 90.81  ? 191 ASN B C     1 
ATOM   5218 O O     . ASN B 2 191 ? 43.374 -9.054  34.852  1.00 91.32  ? 191 ASN B O     1 
ATOM   5219 C CB    . ASN B 2 191 ? 43.908 -11.939 35.954  1.00 95.80  ? 191 ASN B CB    1 
ATOM   5220 C CG    . ASN B 2 191 ? 45.060 -12.827 36.303  1.00 100.14 ? 191 ASN B CG    1 
ATOM   5221 O OD1   . ASN B 2 191 ? 46.192 -12.568 35.903  1.00 102.74 ? 191 ASN B OD1   1 
ATOM   5222 N ND2   . ASN B 2 191 ? 44.790 -13.879 37.066  1.00 100.86 ? 191 ASN B ND2   1 
ATOM   5223 N N     . ALA B 2 192 ? 41.904 -9.388  36.537  1.00 87.58  ? 192 ALA B N     1 
ATOM   5224 C CA    . ALA B 2 192 ? 40.926 -8.416  36.056  1.00 83.94  ? 192 ALA B CA    1 
ATOM   5225 C C     . ALA B 2 192 ? 41.580 -7.068  35.765  1.00 84.21  ? 192 ALA B C     1 
ATOM   5226 O O     . ALA B 2 192 ? 41.325 -6.439  34.728  1.00 83.20  ? 192 ALA B O     1 
ATOM   5227 C CB    . ALA B 2 192 ? 39.823 -8.251  37.074  1.00 81.50  ? 192 ALA B CB    1 
ATOM   5228 N N     . ARG B 2 193 ? 42.432 -6.644  36.692  1.00 85.71  ? 193 ARG B N     1 
ATOM   5229 C CA    . ARG B 2 193 ? 43.157 -5.394  36.576  1.00 86.43  ? 193 ARG B CA    1 
ATOM   5230 C C     . ARG B 2 193 ? 43.817 -5.242  35.206  1.00 87.84  ? 193 ARG B C     1 
ATOM   5231 O O     . ARG B 2 193 ? 43.852 -4.140  34.648  1.00 87.48  ? 193 ARG B O     1 
ATOM   5232 C CB    . ARG B 2 193 ? 44.200 -5.300  37.686  1.00 89.36  ? 193 ARG B CB    1 
ATOM   5233 C CG    . ARG B 2 193 ? 43.618 -5.442  39.088  1.00 88.57  ? 193 ARG B CG    1 
ATOM   5234 C CD    . ARG B 2 193 ? 44.698 -5.308  40.145  1.00 91.95  ? 193 ARG B CD    1 
ATOM   5235 N NE    . ARG B 2 193 ? 45.650 -6.414  40.092  1.00 95.68  ? 193 ARG B NE    1 
ATOM   5236 C CZ    . ARG B 2 193 ? 46.654 -6.582  40.945  1.00 99.18  ? 193 ARG B CZ    1 
ATOM   5237 N NH1   . ARG B 2 193 ? 46.852 -5.712  41.926  1.00 100.03 ? 193 ARG B NH1   1 
ATOM   5238 N NH2   . ARG B 2 193 ? 47.462 -7.622  40.816  1.00 102.38 ? 193 ARG B NH2   1 
ATOM   5239 N N     . ARG B 2 194 ? 44.309 -6.356  34.664  1.00 89.75  ? 194 ARG B N     1 
ATOM   5240 C CA    . ARG B 2 194 ? 45.043 -6.352  33.392  1.00 91.74  ? 194 ARG B CA    1 
ATOM   5241 C C     . ARG B 2 194 ? 44.176 -6.599  32.143  1.00 89.83  ? 194 ARG B C     1 
ATOM   5242 O O     . ARG B 2 194 ? 44.696 -6.632  31.026  1.00 91.90  ? 194 ARG B O     1 
ATOM   5243 C CB    . ARG B 2 194 ? 46.292 -7.267  33.444  1.00 96.23  ? 194 ARG B CB    1 
ATOM   5244 C CG    . ARG B 2 194 ? 46.470 -8.084  34.738  1.00 96.98  ? 194 ARG B CG    1 
ATOM   5245 C CD    . ARG B 2 194 ? 47.728 -8.958  34.713  1.00 101.88 ? 194 ARG B CD    1 
ATOM   5246 N NE    . ARG B 2 194 ? 47.863 -9.783  35.919  1.00 102.39 ? 194 ARG B NE    1 
ATOM   5247 C CZ    . ARG B 2 194 ? 48.868 -9.705  36.793  1.00 105.09 ? 194 ARG B CZ    1 
ATOM   5248 N NH1   . ARG B 2 194 ? 49.860 -8.844  36.607  1.00 106.93 ? 194 ARG B NH1   1 
ATOM   5249 N NH2   . ARG B 2 194 ? 48.887 -10.499 37.859  1.00 106.09 ? 194 ARG B NH2   1 
ATOM   5250 N N     . TRP B 2 195 ? 42.862 -6.754  32.331  1.00 86.14  ? 195 TRP B N     1 
ATOM   5251 C CA    . TRP B 2 195 ? 41.932 -6.917  31.199  1.00 84.38  ? 195 TRP B CA    1 
ATOM   5252 C C     . TRP B 2 195 ? 41.811 -5.648  30.399  1.00 83.62  ? 195 TRP B C     1 
ATOM   5253 O O     . TRP B 2 195 ? 41.824 -4.563  30.969  1.00 82.72  ? 195 TRP B O     1 
ATOM   5254 C CB    . TRP B 2 195 ? 40.522 -7.264  31.664  1.00 80.63  ? 195 TRP B CB    1 
ATOM   5255 C CG    . TRP B 2 195 ? 40.381 -8.587  32.302  1.00 80.82  ? 195 TRP B CG    1 
ATOM   5256 C CD1   . TRP B 2 195 ? 41.276 -9.610  32.283  1.00 83.64  ? 195 TRP B CD1   1 
ATOM   5257 C CD2   . TRP B 2 195 ? 39.247 -9.053  33.032  1.00 78.02  ? 195 TRP B CD2   1 
ATOM   5258 N NE1   . TRP B 2 195 ? 40.780 -10.682 32.978  1.00 83.61  ? 195 TRP B NE1   1 
ATOM   5259 C CE2   . TRP B 2 195 ? 39.533 -10.369 33.447  1.00 80.22  ? 195 TRP B CE2   1 
ATOM   5260 C CE3   . TRP B 2 195 ? 38.018 -8.482  33.385  1.00 74.35  ? 195 TRP B CE3   1 
ATOM   5261 C CZ2   . TRP B 2 195 ? 38.636 -11.127 34.204  1.00 78.91  ? 195 TRP B CZ2   1 
ATOM   5262 C CZ3   . TRP B 2 195 ? 37.125 -9.233  34.130  1.00 73.23  ? 195 TRP B CZ3   1 
ATOM   5263 C CH2   . TRP B 2 195 ? 37.440 -10.542 34.537  1.00 75.71  ? 195 TRP B CH2   1 
ATOM   5264 N N     . THR B 2 196 ? 41.677 -5.785  29.083  1.00 84.53  ? 196 THR B N     1 
ATOM   5265 C CA    . THR B 2 196 ? 41.363 -4.641  28.230  1.00 84.03  ? 196 THR B CA    1 
ATOM   5266 C C     . THR B 2 196 ? 39.958 -4.794  27.650  1.00 81.49  ? 196 THR B C     1 
ATOM   5267 O O     . THR B 2 196 ? 39.274 -5.790  27.917  1.00 80.17  ? 196 THR B O     1 
ATOM   5268 C CB    . THR B 2 196 ? 42.390 -4.436  27.095  1.00 87.76  ? 196 THR B CB    1 
ATOM   5269 O OG1   . THR B 2 196 ? 42.259 -5.485  26.130  1.00 89.16  ? 196 THR B OG1   1 
ATOM   5270 C CG2   . THR B 2 196 ? 43.813 -4.400  27.645  1.00 91.00  ? 196 THR B CG2   1 
ATOM   5271 N N     . ARG B 2 197 ? 39.530 -3.808  26.865  1.00 81.00  ? 197 ARG B N     1 
ATOM   5272 C CA    . ARG B 2 197 ? 38.223 -3.859  26.217  1.00 79.10  ? 197 ARG B CA    1 
ATOM   5273 C C     . ARG B 2 197 ? 38.142 -4.885  25.082  1.00 81.32  ? 197 ARG B C     1 
ATOM   5274 O O     . ARG B 2 197 ? 37.076 -5.081  24.499  1.00 80.26  ? 197 ARG B O     1 
ATOM   5275 C CB    . ARG B 2 197 ? 37.825 -2.477  25.698  1.00 78.52  ? 197 ARG B CB    1 
ATOM   5276 C CG    . ARG B 2 197 ? 38.658 -1.965  24.537  1.00 81.52  ? 197 ARG B CG    1 
ATOM   5277 C CD    . ARG B 2 197 ? 38.385 -0.500  24.316  1.00 80.79  ? 197 ARG B CD    1 
ATOM   5278 N NE    . ARG B 2 197 ? 38.711 0.301   25.496  1.00 79.18  ? 197 ARG B NE    1 
ATOM   5279 C CZ    . ARG B 2 197 ? 38.288 1.546   25.705  1.00 78.46  ? 197 ARG B CZ    1 
ATOM   5280 N NH1   . ARG B 2 197 ? 38.645 2.184   26.808  1.00 78.08  ? 197 ARG B NH1   1 
ATOM   5281 N NH2   . ARG B 2 197 ? 37.510 2.157   24.819  1.00 78.07  ? 197 ARG B NH2   1 
ATOM   5282 N N     . ARG B 2 198 ? 39.264 -5.530  24.764  1.00 84.99  ? 198 ARG B N     1 
ATOM   5283 C CA    . ARG B 2 198 ? 39.310 -6.493  23.661  1.00 87.69  ? 198 ARG B CA    1 
ATOM   5284 C C     . ARG B 2 198 ? 39.700 -7.898  24.128  1.00 88.91  ? 198 ARG B C     1 
ATOM   5285 O O     . ARG B 2 198 ? 39.818 -8.816  23.312  1.00 91.59  ? 198 ARG B O     1 
ATOM   5286 C CB    . ARG B 2 198 ? 40.231 -5.992  22.540  1.00 91.80  ? 198 ARG B CB    1 
ATOM   5287 C CG    . ARG B 2 198 ? 40.071 -4.500  22.248  1.00 91.77  ? 198 ARG B CG    1 
ATOM   5288 C CD    . ARG B 2 198 ? 39.881 -4.201  20.776  1.00 95.24  ? 198 ARG B CD    1 
ATOM   5289 N NE    . ARG B 2 198 ? 41.110 -4.404  20.015  1.00 101.19 ? 198 ARG B NE    1 
ATOM   5290 C CZ    . ARG B 2 198 ? 41.437 -3.720  18.921  1.00 104.93 ? 198 ARG B CZ    1 
ATOM   5291 N NH1   . ARG B 2 198 ? 40.631 -2.772  18.450  1.00 103.61 ? 198 ARG B NH1   1 
ATOM   5292 N NH2   . ARG B 2 198 ? 42.582 -3.978  18.301  1.00 110.27 ? 198 ARG B NH2   1 
ATOM   5293 N N     . THR B 2 199 ? 39.876 -8.045  25.446  1.00 87.25  ? 199 THR B N     1 
ATOM   5294 C CA    . THR B 2 199 ? 40.161 -9.327  26.108  1.00 88.24  ? 199 THR B CA    1 
ATOM   5295 C C     . THR B 2 199 ? 39.152 -10.400 25.674  1.00 87.79  ? 199 THR B C     1 
ATOM   5296 O O     . THR B 2 199 ? 37.955 -10.121 25.568  1.00 84.70  ? 199 THR B O     1 
ATOM   5297 C CB    . THR B 2 199 ? 40.152 -9.174  27.670  1.00 85.85  ? 199 THR B CB    1 
ATOM   5298 O OG1   . THR B 2 199 ? 41.024 -8.110  28.067  1.00 86.03  ? 199 THR B OG1   1 
ATOM   5299 C CG2   . THR B 2 199 ? 40.602 -10.449 28.363  1.00 87.67  ? 199 THR B CG2   1 
ATOM   5300 N N     . VAL B 2 200 ? 39.641 -11.610 25.401  1.00 91.10  ? 200 VAL B N     1 
ATOM   5301 C CA    . VAL B 2 200 ? 38.780 -12.727 24.998  1.00 91.42  ? 200 VAL B CA    1 
ATOM   5302 C C     . VAL B 2 200 ? 39.070 -13.954 25.863  1.00 93.09  ? 200 VAL B C     1 
ATOM   5303 O O     . VAL B 2 200 ? 40.149 -14.543 25.772  1.00 97.18  ? 200 VAL B O     1 
ATOM   5304 C CB    . VAL B 2 200 ? 38.940 -13.074 23.493  1.00 94.81  ? 200 VAL B CB    1 
ATOM   5305 C CG1   . VAL B 2 200 ? 38.120 -14.310 23.123  1.00 95.41  ? 200 VAL B CG1   1 
ATOM   5306 C CG2   . VAL B 2 200 ? 38.530 -11.901 22.620  1.00 93.56  ? 200 VAL B CG2   1 
ATOM   5307 N N     . ILE B 2 201 ? 38.099 -14.336 26.691  1.00 90.53  ? 201 ILE B N     1 
ATOM   5308 C CA    . ILE B 2 201 ? 38.275 -15.434 27.646  1.00 92.06  ? 201 ILE B CA    1 
ATOM   5309 C C     . ILE B 2 201 ? 37.578 -16.743 27.237  1.00 93.75  ? 201 ILE B C     1 
ATOM   5310 O O     . ILE B 2 201 ? 36.361 -16.790 27.031  1.00 91.22  ? 201 ILE B O     1 
ATOM   5311 C CB    . ILE B 2 201 ? 37.899 -14.998 29.091  1.00 88.79  ? 201 ILE B CB    1 
ATOM   5312 C CG1   . ILE B 2 201 ? 39.092 -14.291 29.744  1.00 90.03  ? 201 ILE B CG1   1 
ATOM   5313 C CG2   . ILE B 2 201 ? 37.463 -16.189 29.939  1.00 89.34  ? 201 ILE B CG2   1 
ATOM   5314 C CD1   . ILE B 2 201 ? 38.849 -13.806 31.174  1.00 87.55  ? 201 ILE B CD1   1 
ATOM   5315 N N     . ASP B 2 202 ? 38.378 -17.799 27.118  1.00 98.38  ? 202 ASP B N     1 
ATOM   5316 C CA    . ASP B 2 202 ? 37.874 -19.121 26.799  1.00 100.91 ? 202 ASP B CA    1 
ATOM   5317 C C     . ASP B 2 202 ? 38.262 -20.080 27.919  1.00 102.96 ? 202 ASP B C     1 
ATOM   5318 O O     . ASP B 2 202 ? 39.411 -20.096 28.367  1.00 105.48 ? 202 ASP B O     1 
ATOM   5319 C CB    . ASP B 2 202 ? 38.433 -19.592 25.453  1.00 105.41 ? 202 ASP B CB    1 
ATOM   5320 C CG    . ASP B 2 202 ? 37.882 -20.948 25.024  1.00 108.55 ? 202 ASP B CG    1 
ATOM   5321 O OD1   . ASP B 2 202 ? 36.949 -21.470 25.681  1.00 107.25 ? 202 ASP B OD1   1 
ATOM   5322 O OD2   . ASP B 2 202 ? 38.382 -21.490 24.016  1.00 113.20 ? 202 ASP B OD2   1 
ATOM   5323 N N     . VAL B 2 203 ? 37.301 -20.885 28.361  1.00 102.26 ? 203 VAL B N     1 
ATOM   5324 C CA    . VAL B 2 203 ? 37.506 -21.731 29.536  1.00 103.85 ? 203 VAL B CA    1 
ATOM   5325 C C     . VAL B 2 203 ? 37.809 -23.192 29.181  1.00 108.93 ? 203 VAL B C     1 
ATOM   5326 O O     . VAL B 2 203 ? 38.681 -23.814 29.795  1.00 112.31 ? 203 VAL B O     1 
ATOM   5327 C CB    . VAL B 2 203 ? 36.314 -21.651 30.527  1.00 100.17 ? 203 VAL B CB    1 
ATOM   5328 C CG1   . VAL B 2 203 ? 36.821 -21.766 31.961  1.00 100.44 ? 203 VAL B CG1   1 
ATOM   5329 C CG2   . VAL B 2 203 ? 35.510 -20.343 30.338  1.00 95.01  ? 203 VAL B CG2   1 
ATOM   5330 N N     . ALA B 2 204 ? 37.096 -23.731 28.190  1.00 109.79 ? 204 ALA B N     1 
ATOM   5331 C CA    . ALA B 2 204 ? 37.320 -25.105 27.728  1.00 114.95 ? 204 ALA B CA    1 
ATOM   5332 C C     . ALA B 2 204 ? 38.610 -25.210 26.915  1.00 119.66 ? 204 ALA B C     1 
ATOM   5333 O O     . ALA B 2 204 ? 38.911 -26.257 26.334  1.00 124.41 ? 204 ALA B O     1 
ATOM   5334 C CB    . ALA B 2 204 ? 36.124 -25.609 26.923  1.00 114.50 ? 204 ALA B CB    1 
ATOM   5335 N N     . LYS B 2 205 ? 39.354 -24.107 26.877  1.00 118.65 ? 205 LYS B N     1 
ATOM   5336 C CA    . LYS B 2 205 ? 40.691 -24.064 26.294  1.00 123.30 ? 205 LYS B CA    1 
ATOM   5337 C C     . LYS B 2 205 ? 41.668 -23.236 27.138  1.00 122.64 ? 205 LYS B C     1 
ATOM   5338 O O     . LYS B 2 205 ? 42.851 -23.157 26.814  1.00 126.55 ? 205 LYS B O     1 
ATOM   5339 C CB    . LYS B 2 205 ? 40.653 -23.529 24.858  1.00 123.98 ? 205 LYS B CB    1 
ATOM   5340 C CG    . LYS B 2 205 ? 40.304 -24.569 23.789  1.00 128.26 ? 205 LYS B CG    1 
ATOM   5341 C CD    . LYS B 2 205 ? 41.038 -24.306 22.461  1.00 132.58 ? 205 LYS B CD    1 
ATOM   5342 C CE    . LYS B 2 205 ? 40.810 -22.882 21.924  1.00 128.67 ? 205 LYS B CE    1 
ATOM   5343 N NZ    . LYS B 2 205 ? 39.368 -22.545 21.714  1.00 123.33 ? 205 LYS B NZ    1 
ATOM   5344 N N     . GLY B 2 206 ? 41.168 -22.619 28.207  1.00 118.23 ? 206 GLY B N     1 
ATOM   5345 C CA    . GLY B 2 206 ? 42.003 -21.870 29.153  1.00 117.62 ? 206 GLY B CA    1 
ATOM   5346 C C     . GLY B 2 206 ? 43.041 -20.937 28.552  1.00 119.01 ? 206 GLY B C     1 
ATOM   5347 O O     . GLY B 2 206 ? 44.206 -20.986 28.932  1.00 122.12 ? 206 GLY B O     1 
ATOM   5348 N N     . GLU B 2 207 ? 42.618 -20.083 27.620  1.00 116.96 ? 207 GLU B N     1 
ATOM   5349 C CA    . GLU B 2 207 ? 43.516 -19.128 26.962  1.00 118.40 ? 207 GLU B CA    1 
ATOM   5350 C C     . GLU B 2 207 ? 43.140 -17.675 27.272  1.00 113.85 ? 207 GLU B C     1 
ATOM   5351 O O     . GLU B 2 207 ? 42.011 -17.245 27.017  1.00 109.84 ? 207 GLU B O     1 
ATOM   5352 C CB    . GLU B 2 207 ? 43.530 -19.356 25.448  1.00 121.08 ? 207 GLU B CB    1 
ATOM   5353 C CG    . GLU B 2 207 ? 44.031 -20.734 25.027  1.00 126.76 ? 207 GLU B CG    1 
ATOM   5354 C CD    . GLU B 2 207 ? 43.735 -21.066 23.570  1.00 129.36 ? 207 GLU B CD    1 
ATOM   5355 O OE1   . GLU B 2 207 ? 43.341 -20.153 22.815  1.00 127.64 ? 207 GLU B OE1   1 
ATOM   5356 O OE2   . GLU B 2 207 ? 43.902 -22.242 23.175  1.00 133.71 ? 207 GLU B OE2   1 
ATOM   5357 N N     . VAL B 2 208 ? 44.096 -16.933 27.832  1.00 114.85 ? 208 VAL B N     1 
ATOM   5358 C CA    . VAL B 2 208 ? 43.959 -15.487 28.055  1.00 111.48 ? 208 VAL B CA    1 
ATOM   5359 C C     . VAL B 2 208 ? 44.256 -14.777 26.730  1.00 112.98 ? 208 VAL B C     1 
ATOM   5360 O O     . VAL B 2 208 ? 45.328 -14.185 26.562  1.00 115.65 ? 208 VAL B O     1 
ATOM   5361 C CB    . VAL B 2 208 ? 44.956 -14.958 29.141  1.00 112.34 ? 208 VAL B CB    1 
ATOM   5362 C CG1   . VAL B 2 208 ? 44.392 -13.717 29.854  1.00 107.32 ? 208 VAL B CG1   1 
ATOM   5363 C CG2   . VAL B 2 208 ? 45.362 -16.061 30.132  1.00 114.73 ? 208 VAL B CG2   1 
ATOM   5364 N N     . ARG B 2 209 ? 43.314 -14.847 25.789  1.00 111.69 ? 209 ARG B N     1 
ATOM   5365 C CA    . ARG B 2 209 ? 43.557 -14.412 24.404  1.00 114.02 ? 209 ARG B CA    1 
ATOM   5366 C C     . ARG B 2 209 ? 42.936 -13.041 24.097  1.00 110.44 ? 209 ARG B C     1 
ATOM   5367 O O     . ARG B 2 209 ? 42.084 -12.562 24.846  1.00 106.10 ? 209 ARG B O     1 
ATOM   5368 C CB    . ARG B 2 209 ? 43.032 -15.473 23.431  1.00 116.17 ? 209 ARG B CB    1 
ATOM   5369 C CG    . ARG B 2 209 ? 43.872 -15.658 22.174  1.00 121.67 ? 209 ARG B CG    1 
ATOM   5370 C CD    . ARG B 2 209 ? 43.135 -16.482 21.124  1.00 123.16 ? 209 ARG B CD    1 
ATOM   5371 N NE    . ARG B 2 209 ? 42.034 -15.731 20.514  1.00 119.12 ? 209 ARG B NE    1 
ATOM   5372 C CZ    . ARG B 2 209 ? 40.747 -15.888 20.811  1.00 114.20 ? 209 ARG B CZ    1 
ATOM   5373 N NH1   . ARG B 2 209 ? 40.367 -16.779 21.718  1.00 112.91 ? 209 ARG B NH1   1 
ATOM   5374 N NH2   . ARG B 2 209 ? 39.835 -15.152 20.191  1.00 111.21 ? 209 ARG B NH2   1 
ATOM   5375 N N     . LYS B 2 210 ? 43.363 -12.408 23.004  1.00 112.70 ? 210 LYS B N     1 
ATOM   5376 C CA    . LYS B 2 210 ? 42.821 -11.097 22.644  1.00 109.96 ? 210 LYS B CA    1 
ATOM   5377 C C     . LYS B 2 210 ? 42.138 -11.102 21.274  1.00 110.90 ? 210 LYS B C     1 
ATOM   5378 O O     . LYS B 2 210 ? 42.491 -11.888 20.391  1.00 114.90 ? 210 LYS B O     1 
ATOM   5379 C CB    . LYS B 2 210 ? 43.893 -10.000 22.772  1.00 111.47 ? 210 LYS B CB    1 
ATOM   5380 C CG    . LYS B 2 210 ? 44.531 -9.500  21.470  1.00 115.76 ? 210 LYS B CG    1 
ATOM   5381 C CD    . LYS B 2 210 ? 43.893 -8.188  20.976  1.00 113.70 ? 210 LYS B CD    1 
ATOM   5382 C CE    . LYS B 2 210 ? 44.306 -6.984  21.827  1.00 111.88 ? 210 LYS B CE    1 
ATOM   5383 N NZ    . LYS B 2 210 ? 43.665 -5.723  21.362  1.00 109.97 ? 210 LYS B NZ    1 
ATOM   5384 N N     . GLY B 2 211 ? 41.151 -10.222 21.119  1.00 107.49 ? 211 GLY B N     1 
ATOM   5385 C CA    . GLY B 2 211 ? 40.353 -10.147 19.900  1.00 108.31 ? 211 GLY B CA    1 
ATOM   5386 C C     . GLY B 2 211 ? 39.717 -8.789  19.648  1.00 105.87 ? 211 GLY B C     1 
ATOM   5387 O O     . GLY B 2 211 ? 40.341 -7.750  19.881  1.00 105.96 ? 211 GLY B O     1 
ATOM   5388 N N     . GLU B 2 212 ? 38.468 -8.806  19.179  1.00 103.90 ? 212 GLU B N     1 
ATOM   5389 C CA    . GLU B 2 212 ? 37.817 -7.608  18.632  1.00 102.58 ? 212 GLU B CA    1 
ATOM   5390 C C     . GLU B 2 212 ? 37.137 -6.763  19.710  1.00 97.60  ? 212 GLU B C     1 
ATOM   5391 O O     . GLU B 2 212 ? 37.104 -5.532  19.622  1.00 96.93  ? 212 GLU B O     1 
ATOM   5392 C CB    . GLU B 2 212 ? 36.823 -7.979  17.512  1.00 103.51 ? 212 GLU B CB    1 
ATOM   5393 C CG    . GLU B 2 212 ? 37.395 -8.882  16.383  1.00 109.20 ? 212 GLU B CG    1 
ATOM   5394 C CD    . GLU B 2 212 ? 38.402 -8.181  15.443  1.00 113.80 ? 212 GLU B CD    1 
ATOM   5395 O OE1   . GLU B 2 212 ? 39.580 -8.615  15.377  1.00 116.62 ? 212 GLU B OE1   1 
ATOM   5396 O OE2   . GLU B 2 212 ? 38.012 -7.209  14.759  1.00 114.01 ? 212 GLU B OE2   1 
ATOM   5397 N N     . GLU B 2 213 ? 36.599 -7.437  20.720  1.00 94.48  ? 213 GLU B N     1 
ATOM   5398 C CA    . GLU B 2 213 ? 35.949 -6.790  21.862  1.00 89.91  ? 213 GLU B CA    1 
ATOM   5399 C C     . GLU B 2 213 ? 35.792 -7.797  23.006  1.00 87.86  ? 213 GLU B C     1 
ATOM   5400 O O     . GLU B 2 213 ? 36.006 -8.995  22.805  1.00 89.69  ? 213 GLU B O     1 
ATOM   5401 C CB    . GLU B 2 213 ? 34.603 -6.172  21.455  1.00 87.76  ? 213 GLU B CB    1 
ATOM   5402 C CG    . GLU B 2 213 ? 33.779 -7.001  20.470  1.00 89.06  ? 213 GLU B CG    1 
ATOM   5403 C CD    . GLU B 2 213 ? 32.877 -8.014  21.154  1.00 87.50  ? 213 GLU B CD    1 
ATOM   5404 O OE1   . GLU B 2 213 ? 32.868 -8.078  22.404  1.00 85.15  ? 213 GLU B OE1   1 
ATOM   5405 O OE2   . GLU B 2 213 ? 32.163 -8.746  20.435  1.00 88.65  ? 213 GLU B OE2   1 
ATOM   5406 N N     . PHE B 2 214 ? 35.429 -7.322  24.196  1.00 84.32  ? 214 PHE B N     1 
ATOM   5407 C CA    . PHE B 2 214 ? 35.385 -8.195  25.376  1.00 83.00  ? 214 PHE B CA    1 
ATOM   5408 C C     . PHE B 2 214 ? 34.417 -9.378  25.209  1.00 82.19  ? 214 PHE B C     1 
ATOM   5409 O O     . PHE B 2 214 ? 33.196 -9.192  25.188  1.00 79.87  ? 214 PHE B O     1 
ATOM   5410 C CB    . PHE B 2 214 ? 35.086 -7.408  26.658  1.00 80.08  ? 214 PHE B CB    1 
ATOM   5411 C CG    . PHE B 2 214 ? 35.287 -8.214  27.914  1.00 79.87  ? 214 PHE B CG    1 
ATOM   5412 C CD1   . PHE B 2 214 ? 36.567 -8.498  28.377  1.00 82.60  ? 214 PHE B CD1   1 
ATOM   5413 C CD2   . PHE B 2 214 ? 34.202 -8.705  28.623  1.00 77.74  ? 214 PHE B CD2   1 
ATOM   5414 C CE1   . PHE B 2 214 ? 36.765 -9.254  29.534  1.00 82.74  ? 214 PHE B CE1   1 
ATOM   5415 C CE2   . PHE B 2 214 ? 34.391 -9.460  29.782  1.00 78.35  ? 214 PHE B CE2   1 
ATOM   5416 C CZ    . PHE B 2 214 ? 35.679 -9.735  30.237  1.00 80.20  ? 214 PHE B CZ    1 
ATOM   5417 N N     . PHE B 2 215 ? 34.979 -10.586 25.106  1.00 84.16  ? 215 PHE B N     1 
ATOM   5418 C CA    . PHE B 2 215 ? 34.242 -11.777 24.656  1.00 84.29  ? 215 PHE B CA    1 
ATOM   5419 C C     . PHE B 2 215 ? 34.616 -13.047 25.438  1.00 85.33  ? 215 PHE B C     1 
ATOM   5420 O O     . PHE B 2 215 ? 35.583 -13.727 25.088  1.00 88.84  ? 215 PHE B O     1 
ATOM   5421 C CB    . PHE B 2 215 ? 34.514 -12.005 23.157  1.00 87.43  ? 215 PHE B CB    1 
ATOM   5422 C CG    . PHE B 2 215 ? 33.487 -12.865 22.459  1.00 87.37  ? 215 PHE B CG    1 
ATOM   5423 C CD1   . PHE B 2 215 ? 32.785 -12.366 21.363  1.00 86.89  ? 215 PHE B CD1   1 
ATOM   5424 C CD2   . PHE B 2 215 ? 33.235 -14.172 22.874  1.00 87.24  ? 215 PHE B CD2   1 
ATOM   5425 C CE1   . PHE B 2 215 ? 31.842 -13.146 20.698  1.00 87.09  ? 215 PHE B CE1   1 
ATOM   5426 C CE2   . PHE B 2 215 ? 32.292 -14.955 22.220  1.00 87.84  ? 215 PHE B CE2   1 
ATOM   5427 C CZ    . PHE B 2 215 ? 31.593 -14.440 21.128  1.00 88.15  ? 215 PHE B CZ    1 
ATOM   5428 N N     . VAL B 2 216 ? 33.847 -13.366 26.481  1.00 82.51  ? 216 VAL B N     1 
ATOM   5429 C CA    . VAL B 2 216 ? 34.029 -14.615 27.234  1.00 83.30  ? 216 VAL B CA    1 
ATOM   5430 C C     . VAL B 2 216 ? 33.248 -15.720 26.546  1.00 84.38  ? 216 VAL B C     1 
ATOM   5431 O O     . VAL B 2 216 ? 32.031 -15.592 26.361  1.00 82.07  ? 216 VAL B O     1 
ATOM   5432 C CB    . VAL B 2 216 ? 33.528 -14.507 28.688  1.00 80.54  ? 216 VAL B CB    1 
ATOM   5433 C CG1   . VAL B 2 216 ? 33.682 -15.837 29.402  1.00 82.11  ? 216 VAL B CG1   1 
ATOM   5434 C CG2   . VAL B 2 216 ? 34.264 -13.412 29.437  1.00 79.43  ? 216 VAL B CG2   1 
ATOM   5435 N N     . VAL B 2 217 ? 33.933 -16.801 26.169  1.00 88.01  ? 217 VAL B N     1 
ATOM   5436 C CA    . VAL B 2 217 ? 33.261 -17.880 25.440  1.00 89.67  ? 217 VAL B CA    1 
ATOM   5437 C C     . VAL B 2 217 ? 32.711 -18.969 26.360  1.00 89.59  ? 217 VAL B C     1 
ATOM   5438 O O     . VAL B 2 217 ? 33.401 -19.490 27.250  1.00 91.12  ? 217 VAL B O     1 
ATOM   5439 C CB    . VAL B 2 217 ? 34.088 -18.468 24.233  1.00 94.28  ? 217 VAL B CB    1 
ATOM   5440 C CG1   . VAL B 2 217 ? 35.033 -17.422 23.638  1.00 94.76  ? 217 VAL B CG1   1 
ATOM   5441 C CG2   . VAL B 2 217 ? 34.839 -19.724 24.622  1.00 98.04  ? 217 VAL B CG2   1 
ATOM   5442 N N     . ASP B 2 218 ? 31.441 -19.278 26.130  1.00 88.18  ? 218 ASP B N     1 
ATOM   5443 C CA    . ASP B 2 218 ? 30.743 -20.356 26.801  1.00 88.42  ? 218 ASP B CA    1 
ATOM   5444 C C     . ASP B 2 218 ? 31.398 -21.666 26.387  1.00 93.04  ? 218 ASP B C     1 
ATOM   5445 O O     . ASP B 2 218 ? 31.809 -21.805 25.232  1.00 95.88  ? 218 ASP B O     1 
ATOM   5446 C CB    . ASP B 2 218 ? 29.273 -20.341 26.367  1.00 86.45  ? 218 ASP B CB    1 
ATOM   5447 C CG    . ASP B 2 218 ? 28.382 -21.170 27.267  1.00 85.89  ? 218 ASP B CG    1 
ATOM   5448 O OD1   . ASP B 2 218 ? 28.482 -22.412 27.242  1.00 89.11  ? 218 ASP B OD1   1 
ATOM   5449 O OD2   . ASP B 2 218 ? 27.558 -20.575 27.984  1.00 83.03  ? 218 ASP B OD2   1 
ATOM   5450 N N     . PRO B 2 219 ? 31.532 -22.619 27.328  1.00 94.36  ? 219 PRO B N     1 
ATOM   5451 C CA    . PRO B 2 219 ? 31.993 -23.952 26.938  1.00 99.00  ? 219 PRO B CA    1 
ATOM   5452 C C     . PRO B 2 219 ? 30.968 -24.661 26.062  1.00 100.00 ? 219 PRO B C     1 
ATOM   5453 O O     . PRO B 2 219 ? 31.332 -25.242 25.038  1.00 103.61 ? 219 PRO B O     1 
ATOM   5454 C CB    . PRO B 2 219 ? 32.140 -24.688 28.275  1.00 99.72  ? 219 PRO B CB    1 
ATOM   5455 C CG    . PRO B 2 219 ? 32.170 -23.627 29.307  1.00 96.27  ? 219 PRO B CG    1 
ATOM   5456 C CD    . PRO B 2 219 ? 31.314 -22.519 28.779  1.00 92.21  ? 219 PRO B CD    1 
ATOM   5457 N N     . VAL B 2 220 ? 29.696 -24.585 26.449  1.00 97.05  ? 220 VAL B N     1 
ATOM   5458 C CA    . VAL B 2 220 ? 28.644 -25.346 25.768  1.00 98.39  ? 220 VAL B CA    1 
ATOM   5459 C C     . VAL B 2 220 ? 28.151 -24.683 24.476  1.00 97.53  ? 220 VAL B C     1 
ATOM   5460 O O     . VAL B 2 220 ? 27.476 -25.321 23.661  1.00 99.52  ? 220 VAL B O     1 
ATOM   5461 C CB    . VAL B 2 220 ? 27.448 -25.674 26.693  1.00 96.37  ? 220 VAL B CB    1 
ATOM   5462 C CG1   . VAL B 2 220 ? 27.101 -27.156 26.568  1.00 100.27 ? 220 VAL B CG1   1 
ATOM   5463 C CG2   . VAL B 2 220 ? 27.764 -25.333 28.147  1.00 94.54  ? 220 VAL B CG2   1 
ATOM   5464 N N     . ASP B 2 221 ? 28.477 -23.405 24.302  1.00 94.83  ? 221 ASP B N     1 
ATOM   5465 C CA    . ASP B 2 221 ? 28.355 -22.757 22.998  1.00 94.98  ? 221 ASP B CA    1 
ATOM   5466 C C     . ASP B 2 221 ? 29.551 -21.860 22.714  1.00 95.08  ? 221 ASP B C     1 
ATOM   5467 O O     . ASP B 2 221 ? 29.589 -20.693 23.123  1.00 91.59  ? 221 ASP B O     1 
ATOM   5468 C CB    . ASP B 2 221 ? 27.042 -21.987 22.852  1.00 91.38  ? 221 ASP B CB    1 
ATOM   5469 C CG    . ASP B 2 221 ? 26.739 -21.610 21.402  1.00 93.17  ? 221 ASP B CG    1 
ATOM   5470 O OD1   . ASP B 2 221 ? 27.657 -21.623 20.541  1.00 96.19  ? 221 ASP B OD1   1 
ATOM   5471 O OD2   . ASP B 2 221 ? 25.565 -21.291 21.122  1.00 92.13  ? 221 ASP B OD2   1 
ATOM   5472 N N     . GLU B 2 222 ? 30.524 -22.422 22.003  1.00 99.32  ? 222 GLU B N     1 
ATOM   5473 C CA    . GLU B 2 222 ? 31.701 -21.684 21.562  1.00 100.44 ? 222 GLU B CA    1 
ATOM   5474 C C     . GLU B 2 222 ? 31.328 -20.287 21.071  1.00 97.31  ? 222 GLU B C     1 
ATOM   5475 O O     . GLU B 2 222 ? 32.009 -19.310 21.387  1.00 95.80  ? 222 GLU B O     1 
ATOM   5476 C CB    . GLU B 2 222 ? 32.438 -22.461 20.469  1.00 106.09 ? 222 GLU B CB    1 
ATOM   5477 C CG    . GLU B 2 222 ? 31.524 -23.140 19.454  1.00 108.37 ? 222 GLU B CG    1 
ATOM   5478 C CD    . GLU B 2 222 ? 32.255 -24.166 18.610  1.00 115.05 ? 222 GLU B CD    1 
ATOM   5479 O OE1   . GLU B 2 222 ? 33.442 -24.429 18.897  1.00 117.70 ? 222 GLU B OE1   1 
ATOM   5480 O OE2   . GLU B 2 222 ? 31.645 -24.713 17.663  1.00 117.38 ? 222 GLU B OE2   1 
ATOM   5481 N N     . LYS B 2 223 ? 30.220 -20.203 20.333  1.00 96.36  ? 223 LYS B N     1 
ATOM   5482 C CA    . LYS B 2 223 ? 29.775 -18.955 19.721  1.00 93.94  ? 223 LYS B CA    1 
ATOM   5483 C C     . LYS B 2 223 ? 29.031 -17.993 20.649  1.00 88.37  ? 223 LYS B C     1 
ATOM   5484 O O     . LYS B 2 223 ? 28.666 -16.900 20.215  1.00 86.68  ? 223 LYS B O     1 
ATOM   5485 C CB    . LYS B 2 223 ? 28.944 -19.240 18.460  1.00 96.16  ? 223 LYS B CB    1 
ATOM   5486 C CG    . LYS B 2 223 ? 29.626 -18.816 17.154  1.00 100.13 ? 223 LYS B CG    1 
ATOM   5487 C CD    . LYS B 2 223 ? 29.474 -17.301 16.916  1.00 97.97  ? 223 LYS B CD    1 
ATOM   5488 C CE    . LYS B 2 223 ? 30.215 -16.827 15.664  1.00 101.40 ? 223 LYS B CE    1 
ATOM   5489 N NZ    . LYS B 2 223 ? 31.675 -16.587 15.910  1.00 102.80 ? 223 LYS B NZ    1 
ATOM   5490 N N     . ARG B 2 224 ? 28.829 -18.382 21.911  1.00 85.84  ? 224 ARG B N     1 
ATOM   5491 C CA    . ARG B 2 224 ? 28.053 -17.570 22.859  1.00 81.06  ? 224 ARG B CA    1 
ATOM   5492 C C     . ARG B 2 224 ? 28.915 -16.637 23.696  1.00 79.09  ? 224 ARG B C     1 
ATOM   5493 O O     . ARG B 2 224 ? 29.860 -17.079 24.348  1.00 80.26  ? 224 ARG B O     1 
ATOM   5494 C CB    . ARG B 2 224 ? 27.227 -18.451 23.801  1.00 79.85  ? 224 ARG B CB    1 
ATOM   5495 C CG    . ARG B 2 224 ? 25.792 -17.968 24.016  1.00 76.68  ? 224 ARG B CG    1 
ATOM   5496 C CD    . ARG B 2 224 ? 25.648 -16.578 24.651  1.00 71.95  ? 224 ARG B CD    1 
ATOM   5497 N NE    . ARG B 2 224 ? 25.056 -16.604 25.991  1.00 69.15  ? 224 ARG B NE    1 
ATOM   5498 C CZ    . ARG B 2 224 ? 24.249 -15.659 26.479  1.00 65.80  ? 224 ARG B CZ    1 
ATOM   5499 N NH1   . ARG B 2 224 ? 23.906 -14.608 25.740  1.00 64.45  ? 224 ARG B NH1   1 
ATOM   5500 N NH2   . ARG B 2 224 ? 23.765 -15.772 27.706  1.00 63.71  ? 224 ARG B NH2   1 
ATOM   5501 N N     . ASN B 2 225 ? 28.566 -15.350 23.693  1.00 76.26  ? 225 ASN B N     1 
ATOM   5502 C CA    . ASN B 2 225 ? 29.258 -14.357 24.521  1.00 74.32  ? 225 ASN B CA    1 
ATOM   5503 C C     . ASN B 2 225 ? 28.608 -14.193 25.881  1.00 70.98  ? 225 ASN B C     1 
ATOM   5504 O O     . ASN B 2 225 ? 27.679 -13.403 26.038  1.00 68.27  ? 225 ASN B O     1 
ATOM   5505 C CB    . ASN B 2 225 ? 29.321 -12.999 23.820  1.00 73.66  ? 225 ASN B CB    1 
ATOM   5506 C CG    . ASN B 2 225 ? 30.290 -12.033 24.491  1.00 73.14  ? 225 ASN B CG    1 
ATOM   5507 O OD1   . ASN B 2 225 ? 30.740 -12.249 25.621  1.00 72.53  ? 225 ASN B OD1   1 
ATOM   5508 N ND2   . ASN B 2 225 ? 30.619 -10.958 23.787  1.00 73.79  ? 225 ASN B ND2   1 
ATOM   5509 N N     . VAL B 2 226 ? 29.116 -14.926 26.866  1.00 71.42  ? 226 VAL B N     1 
ATOM   5510 C CA    . VAL B 2 226 ? 28.537 -14.923 28.208  1.00 69.17  ? 226 VAL B CA    1 
ATOM   5511 C C     . VAL B 2 226 ? 28.564 -13.519 28.812  1.00 66.74  ? 226 VAL B C     1 
ATOM   5512 O O     . VAL B 2 226 ? 27.733 -13.187 29.663  1.00 64.69  ? 226 VAL B O     1 
ATOM   5513 C CB    . VAL B 2 226 ? 29.252 -15.932 29.133  1.00 70.96  ? 226 VAL B CB    1 
ATOM   5514 C CG1   . VAL B 2 226 ? 28.520 -16.089 30.472  1.00 68.91  ? 226 VAL B CG1   1 
ATOM   5515 C CG2   . VAL B 2 226 ? 29.374 -17.277 28.437  1.00 74.26  ? 226 VAL B CG2   1 
ATOM   5516 N N     . ALA B 2 227 ? 29.506 -12.700 28.348  1.00 67.29  ? 227 ALA B N     1 
ATOM   5517 C CA    . ALA B 2 227 ? 29.630 -11.311 28.791  1.00 65.38  ? 227 ALA B CA    1 
ATOM   5518 C C     . ALA B 2 227 ? 29.006 -10.328 27.806  1.00 64.28  ? 227 ALA B C     1 
ATOM   5519 O O     . ALA B 2 227 ? 29.304 -9.134  27.846  1.00 63.47  ? 227 ALA B O     1 
ATOM   5520 C CB    . ALA B 2 227 ? 31.088 -10.963 29.015  1.00 67.08  ? 227 ALA B CB    1 
ATOM   5521 N N     . ALA B 2 228 ? 28.140 -10.825 26.927  1.00 64.50  ? 228 ALA B N     1 
ATOM   5522 C CA    . ALA B 2 228 ? 27.554 -9.987  25.886  1.00 64.06  ? 228 ALA B CA    1 
ATOM   5523 C C     . ALA B 2 228 ? 26.946 -8.716  26.456  1.00 61.55  ? 228 ALA B C     1 
ATOM   5524 O O     . ALA B 2 228 ? 27.239 -7.624  25.968  1.00 61.65  ? 228 ALA B O     1 
ATOM   5525 C CB    . ALA B 2 228 ? 26.525 -10.753 25.083  1.00 64.61  ? 228 ALA B CB    1 
ATOM   5526 N N     . ASN B 2 229 ? 26.129 -8.848  27.501  1.00 59.48  ? 229 ASN B N     1 
ATOM   5527 C CA    . ASN B 2 229 ? 25.378 -7.695  27.994  1.00 57.45  ? 229 ASN B CA    1 
ATOM   5528 C C     . ASN B 2 229 ? 26.110 -6.756  28.956  1.00 56.66  ? 229 ASN B C     1 
ATOM   5529 O O     . ASN B 2 229 ? 25.569 -5.722  29.340  1.00 55.52  ? 229 ASN B O     1 
ATOM   5530 C CB    . ASN B 2 229 ? 24.031 -8.112  28.574  1.00 56.17  ? 229 ASN B CB    1 
ATOM   5531 C CG    . ASN B 2 229 ? 22.997 -7.023  28.432  1.00 55.41  ? 229 ASN B CG    1 
ATOM   5532 O OD1   . ASN B 2 229 ? 23.129 -6.153  27.581  1.00 56.31  ? 229 ASN B OD1   1 
ATOM   5533 N ND2   . ASN B 2 229 ? 21.970 -7.056  29.263  1.00 55.32  ? 229 ASN B ND2   1 
ATOM   5534 N N     . LEU B 2 230 ? 27.331 -7.125  29.335  1.00 57.62  ? 230 LEU B N     1 
ATOM   5535 C CA    . LEU B 2 230 ? 28.173 -6.307  30.195  1.00 57.38  ? 230 LEU B CA    1 
ATOM   5536 C C     . LEU B 2 230 ? 28.596 -5.042  29.462  1.00 58.00  ? 230 LEU B C     1 
ATOM   5537 O O     . LEU B 2 230 ? 29.265 -5.109  28.426  1.00 59.58  ? 230 LEU B O     1 
ATOM   5538 C CB    . LEU B 2 230 ? 29.404 -7.102  30.626  1.00 59.03  ? 230 LEU B CB    1 
ATOM   5539 C CG    . LEU B 2 230 ? 30.509 -6.433  31.445  1.00 59.69  ? 230 LEU B CG    1 
ATOM   5540 C CD1   . LEU B 2 230 ? 30.054 -6.096  32.858  1.00 59.66  ? 230 LEU B CD1   1 
ATOM   5541 C CD2   . LEU B 2 230 ? 31.713 -7.330  31.504  1.00 62.01  ? 230 LEU B CD2   1 
ATOM   5542 N N     . SER B 2 231 ? 28.202 -3.893  30.011  1.00 57.01  ? 231 SER B N     1 
ATOM   5543 C CA    . SER B 2 231 ? 28.460 -2.595  29.389  1.00 57.46  ? 231 SER B CA    1 
ATOM   5544 C C     . SER B 2 231 ? 29.925 -2.235  29.488  1.00 59.18  ? 231 SER B C     1 
ATOM   5545 O O     . SER B 2 231 ? 30.591 -2.599  30.458  1.00 59.60  ? 231 SER B O     1 
ATOM   5546 C CB    . SER B 2 231 ? 27.631 -1.506  30.057  1.00 56.19  ? 231 SER B CB    1 
ATOM   5547 O OG    . SER B 2 231 ? 28.208 -1.123  31.290  1.00 56.55  ? 231 SER B OG    1 
ATOM   5548 N N     . LEU B 2 232 ? 30.419 -1.506  28.492  1.00 60.56  ? 232 LEU B N     1 
ATOM   5549 C CA    . LEU B 2 232 ? 31.817 -1.122  28.456  1.00 62.58  ? 232 LEU B CA    1 
ATOM   5550 C C     . LEU B 2 232 ? 32.195 -0.425  29.757  1.00 62.24  ? 232 LEU B C     1 
ATOM   5551 O O     . LEU B 2 232 ? 33.190 -0.779  30.389  1.00 63.34  ? 232 LEU B O     1 
ATOM   5552 C CB    . LEU B 2 232 ? 32.102 -0.237  27.244  1.00 64.09  ? 232 LEU B CB    1 
ATOM   5553 C CG    . LEU B 2 232 ? 33.496 0.389   27.080  1.00 66.88  ? 232 LEU B CG    1 
ATOM   5554 C CD1   . LEU B 2 232 ? 34.627 -0.635  26.883  1.00 68.63  ? 232 LEU B CD1   1 
ATOM   5555 C CD2   . LEU B 2 232 ? 33.475 1.378   25.921  1.00 68.75  ? 232 LEU B CD2   1 
ATOM   5556 N N     . ASP B 2 233 ? 31.366 0.527   30.172  1.00 61.04  ? 233 ASP B N     1 
ATOM   5557 C CA    . ASP B 2 233 ? 31.604 1.294   31.385  1.00 61.10  ? 233 ASP B CA    1 
ATOM   5558 C C     . ASP B 2 233 ? 31.621 0.463   32.664  1.00 60.40  ? 233 ASP B C     1 
ATOM   5559 O O     . ASP B 2 233 ? 32.343 0.801   33.601  1.00 61.32  ? 233 ASP B O     1 
ATOM   5560 C CB    . ASP B 2 233 ? 30.575 2.408   31.503  1.00 60.38  ? 233 ASP B CB    1 
ATOM   5561 C CG    . ASP B 2 233 ? 30.659 3.400   30.353  1.00 62.65  ? 233 ASP B CG    1 
ATOM   5562 O OD1   . ASP B 2 233 ? 31.743 3.524   29.737  1.00 64.78  ? 233 ASP B OD1   1 
ATOM   5563 O OD2   . ASP B 2 233 ? 29.633 4.055   30.068  1.00 62.65  ? 233 ASP B OD2   1 
ATOM   5564 N N     . ASN B 2 234 ? 30.833 -0.614  32.705  1.00 58.91  ? 234 ASN B N     1 
ATOM   5565 C CA    . ASN B 2 234 ? 30.808 -1.497  33.877  1.00 58.66  ? 234 ASN B CA    1 
ATOM   5566 C C     . ASN B 2 234 ? 31.975 -2.481  33.908  1.00 60.39  ? 234 ASN B C     1 
ATOM   5567 O O     . ASN B 2 234 ? 32.450 -2.857  34.981  1.00 61.52  ? 234 ASN B O     1 
ATOM   5568 C CB    . ASN B 2 234 ? 29.471 -2.235  34.014  1.00 56.97  ? 234 ASN B CB    1 
ATOM   5569 C CG    . ASN B 2 234 ? 28.388 -1.384  34.675  1.00 55.48  ? 234 ASN B CG    1 
ATOM   5570 O OD1   . ASN B 2 234 ? 27.262 -1.330  34.197  1.00 54.63  ? 234 ASN B OD1   1 
ATOM   5571 N ND2   . ASN B 2 234 ? 28.725 -0.726  35.776  1.00 55.62  ? 234 ASN B ND2   1 
ATOM   5572 N N     . LEU B 2 235 ? 32.431 -2.907  32.732  1.00 61.17  ? 235 LEU B N     1 
ATOM   5573 C CA    . LEU B 2 235 ? 33.694 -3.629  32.630  1.00 62.78  ? 235 LEU B CA    1 
ATOM   5574 C C     . LEU B 2 235 ? 34.813 -2.680  33.064  1.00 64.29  ? 235 LEU B C     1 
ATOM   5575 O O     . LEU B 2 235 ? 35.722 -3.073  33.780  1.00 65.88  ? 235 LEU B O     1 
ATOM   5576 C CB    . LEU B 2 235 ? 33.922 -4.117  31.202  1.00 63.62  ? 235 LEU B CB    1 
ATOM   5577 C CG    . LEU B 2 235 ? 35.290 -4.709  30.873  1.00 65.56  ? 235 LEU B CG    1 
ATOM   5578 C CD1   . LEU B 2 235 ? 35.360 -6.152  31.296  1.00 65.95  ? 235 LEU B CD1   1 
ATOM   5579 C CD2   . LEU B 2 235 ? 35.545 -4.605  29.400  1.00 66.69  ? 235 LEU B CD2   1 
ATOM   5580 N N     . ALA B 2 236 ? 34.716 -1.422  32.646  1.00 64.05  ? 236 ALA B N     1 
ATOM   5581 C CA    . ALA B 2 236 ? 35.670 -0.388  33.044  1.00 65.79  ? 236 ALA B CA    1 
ATOM   5582 C C     . ALA B 2 236 ? 35.631 -0.134  34.543  1.00 65.71  ? 236 ALA B C     1 
ATOM   5583 O O     . ALA B 2 236 ? 36.664 0.121   35.157  1.00 67.59  ? 236 ALA B O     1 
ATOM   5584 C CB    . ALA B 2 236 ? 35.405 0.905   32.288  1.00 65.72  ? 236 ALA B CB    1 
ATOM   5585 N N     . ARG B 2 237 ? 34.435 -0.196  35.123  1.00 64.00  ? 237 ARG B N     1 
ATOM   5586 C CA    . ARG B 2 237 ? 34.270 -0.007  36.559  1.00 64.41  ? 237 ARG B CA    1 
ATOM   5587 C C     . ARG B 2 237 ? 34.847 -1.172  37.342  1.00 65.62  ? 237 ARG B C     1 
ATOM   5588 O O     . ARG B 2 237 ? 35.410 -0.969  38.420  1.00 67.28  ? 237 ARG B O     1 
ATOM   5589 C CB    . ARG B 2 237 ? 32.799 0.188   36.929  1.00 62.50  ? 237 ARG B CB    1 
ATOM   5590 C CG    . ARG B 2 237 ? 32.372 1.631   37.031  1.00 63.29  ? 237 ARG B CG    1 
ATOM   5591 C CD    . ARG B 2 237 ? 30.950 1.823   36.523  1.00 63.28  ? 237 ARG B CD    1 
ATOM   5592 N NE    . ARG B 2 237 ? 30.630 3.238   36.327  1.00 65.35  ? 237 ARG B NE    1 
ATOM   5593 C CZ    . ARG B 2 237 ? 29.828 3.712   35.372  1.00 65.13  ? 237 ARG B CZ    1 
ATOM   5594 N NH1   . ARG B 2 237 ? 29.258 2.882   34.497  1.00 63.93  ? 237 ARG B NH1   1 
ATOM   5595 N NH2   . ARG B 2 237 ? 29.604 5.021   35.289  1.00 64.24  ? 237 ARG B NH2   1 
ATOM   5596 N N     . PHE B 2 238 ? 34.714 -2.381  36.795  1.00 65.15  ? 238 PHE B N     1 
ATOM   5597 C CA    . PHE B 2 238 ? 35.129 -3.584  37.503  1.00 66.50  ? 238 PHE B CA    1 
ATOM   5598 C C     . PHE B 2 238 ? 36.638 -3.664  37.642  1.00 69.41  ? 238 PHE B C     1 
ATOM   5599 O O     . PHE B 2 238 ? 37.155 -3.865  38.748  1.00 70.95  ? 238 PHE B O     1 
ATOM   5600 C CB    . PHE B 2 238 ? 34.584 -4.850  36.830  1.00 65.85  ? 238 PHE B CB    1 
ATOM   5601 C CG    . PHE B 2 238 ? 35.083 -6.133  37.454  1.00 67.53  ? 238 PHE B CG    1 
ATOM   5602 C CD1   . PHE B 2 238 ? 34.778 -6.446  38.783  1.00 68.26  ? 238 PHE B CD1   1 
ATOM   5603 C CD2   . PHE B 2 238 ? 35.856 -7.026  36.719  1.00 68.69  ? 238 PHE B CD2   1 
ATOM   5604 C CE1   . PHE B 2 238 ? 35.246 -7.633  39.371  1.00 70.04  ? 238 PHE B CE1   1 
ATOM   5605 C CE2   . PHE B 2 238 ? 36.320 -8.214  37.294  1.00 70.63  ? 238 PHE B CE2   1 
ATOM   5606 C CZ    . PHE B 2 238 ? 36.017 -8.517  38.621  1.00 71.23  ? 238 PHE B CZ    1 
ATOM   5607 N N     . VAL B 2 239 ? 37.337 -3.490  36.520  1.00 70.55  ? 239 VAL B N     1 
ATOM   5608 C CA    . VAL B 2 239 ? 38.799 -3.617  36.500  1.00 73.70  ? 239 VAL B CA    1 
ATOM   5609 C C     . VAL B 2 239 ? 39.465 -2.491  37.286  1.00 74.92  ? 239 VAL B C     1 
ATOM   5610 O O     . VAL B 2 239 ? 40.627 -2.606  37.673  1.00 77.95  ? 239 VAL B O     1 
ATOM   5611 C CB    . VAL B 2 239 ? 39.412 -3.725  35.060  1.00 74.81  ? 239 VAL B CB    1 
ATOM   5612 C CG1   . VAL B 2 239 ? 38.590 -4.646  34.173  1.00 73.74  ? 239 VAL B CG1   1 
ATOM   5613 C CG2   . VAL B 2 239 ? 39.582 -2.369  34.426  1.00 74.58  ? 239 VAL B CG2   1 
ATOM   5614 N N     . HIS B 2 240 ? 38.725 -1.414  37.527  1.00 73.04  ? 240 HIS B N     1 
ATOM   5615 C CA    . HIS B 2 240 ? 39.246 -0.340  38.348  1.00 74.36  ? 240 HIS B CA    1 
ATOM   5616 C C     . HIS B 2 240 ? 38.989 -0.566  39.831  1.00 74.79  ? 240 HIS B C     1 
ATOM   5617 O O     . HIS B 2 240 ? 39.804 -0.165  40.675  1.00 77.09  ? 240 HIS B O     1 
ATOM   5618 C CB    . HIS B 2 240 ? 38.672 1.003   37.940  1.00 73.07  ? 240 HIS B CB    1 
ATOM   5619 C CG    . HIS B 2 240 ? 39.241 2.138   38.721  1.00 74.99  ? 240 HIS B CG    1 
ATOM   5620 N ND1   . HIS B 2 240 ? 38.596 2.690   39.807  1.00 74.65  ? 240 HIS B ND1   1 
ATOM   5621 C CD2   . HIS B 2 240 ? 40.417 2.797   38.605  1.00 77.86  ? 240 HIS B CD2   1 
ATOM   5622 C CE1   . HIS B 2 240 ? 39.337 3.660   40.309  1.00 77.10  ? 240 HIS B CE1   1 
ATOM   5623 N NE2   . HIS B 2 240 ? 40.446 3.746   39.597  1.00 79.57  ? 240 HIS B NE2   1 
ATOM   5624 N N     . LEU B 2 241 ? 37.852 -1.187  40.149  1.00 72.72  ? 241 LEU B N     1 
ATOM   5625 C CA    . LEU B 2 241 ? 37.532 -1.494  41.531  1.00 73.38  ? 241 LEU B CA    1 
ATOM   5626 C C     . LEU B 2 241 ? 38.542 -2.525  42.003  1.00 76.01  ? 241 LEU B C     1 
ATOM   5627 O O     . LEU B 2 241 ? 39.037 -2.440  43.130  1.00 78.55  ? 241 LEU B O     1 
ATOM   5628 C CB    . LEU B 2 241 ? 36.107 -2.030  41.675  1.00 71.13  ? 241 LEU B CB    1 
ATOM   5629 C CG    . LEU B 2 241 ? 35.139 -1.357  42.672  1.00 71.05  ? 241 LEU B CG    1 
ATOM   5630 C CD1   . LEU B 2 241 ? 35.807 -0.905  43.974  1.00 73.68  ? 241 LEU B CD1   1 
ATOM   5631 C CD2   . LEU B 2 241 ? 34.395 -0.182  42.026  1.00 69.39  ? 241 LEU B CD2   1 
ATOM   5632 N N     . CYS B 2 242 ? 38.866 -3.471  41.118  1.00 75.69  ? 242 CYS B N     1 
ATOM   5633 C CA    . CYS B 2 242 ? 39.872 -4.494  41.386  1.00 78.13  ? 242 CYS B CA    1 
ATOM   5634 C C     . CYS B 2 242 ? 41.244 -3.917  41.701  1.00 80.96  ? 242 CYS B C     1 
ATOM   5635 O O     . CYS B 2 242 ? 41.872 -4.323  42.682  1.00 83.49  ? 242 CYS B O     1 
ATOM   5636 C CB    . CYS B 2 242 ? 39.970 -5.454  40.209  1.00 77.95  ? 242 CYS B CB    1 
ATOM   5637 S SG    . CYS B 2 242 ? 38.567 -6.546  40.108  1.00 75.92  ? 242 CYS B SG    1 
ATOM   5638 N N     . ARG B 2 243 ? 41.699 -2.977  40.870  1.00 80.59  ? 243 ARG B N     1 
ATOM   5639 C CA    . ARG B 2 243 ? 42.969 -2.279  41.095  1.00 83.46  ? 243 ARG B CA    1 
ATOM   5640 C C     . ARG B 2 243 ? 42.956 -1.572  42.435  1.00 84.99  ? 243 ARG B C     1 
ATOM   5641 O O     . ARG B 2 243 ? 43.984 -1.481  43.117  1.00 88.26  ? 243 ARG B O     1 
ATOM   5642 C CB    . ARG B 2 243 ? 43.238 -1.248  40.006  1.00 82.64  ? 243 ARG B CB    1 
ATOM   5643 C CG    . ARG B 2 243 ? 43.670 -1.802  38.677  1.00 81.52  ? 243 ARG B CG    1 
ATOM   5644 C CD    . ARG B 2 243 ? 43.510 -0.720  37.643  1.00 78.78  ? 243 ARG B CD    1 
ATOM   5645 N NE    . ARG B 2 243 ? 43.848 -1.156  36.295  1.00 77.63  ? 243 ARG B NE    1 
ATOM   5646 C CZ    . ARG B 2 243 ? 43.844 -0.349  35.240  1.00 76.31  ? 243 ARG B CZ    1 
ATOM   5647 N NH1   . ARG B 2 243 ? 43.512 0.928   35.391  1.00 74.86  ? 243 ARG B NH1   1 
ATOM   5648 N NH2   . ARG B 2 243 ? 44.171 -0.815  34.041  1.00 75.81  ? 243 ARG B NH2   1 
ATOM   5649 N N     . GLU B 2 244 ? 41.780 -1.072  42.799  1.00 83.01  ? 244 GLU B N     1 
ATOM   5650 C CA    . GLU B 2 244 ? 41.613 -0.333  44.033  1.00 84.75  ? 244 GLU B CA    1 
ATOM   5651 C C     . GLU B 2 244 ? 41.599 -1.247  45.243  1.00 86.69  ? 244 GLU B C     1 
ATOM   5652 O O     . GLU B 2 244 ? 42.278 -0.981  46.239  1.00 89.85  ? 244 GLU B O     1 
ATOM   5653 C CB    . GLU B 2 244 ? 40.342 0.503   43.985  1.00 82.12  ? 244 GLU B CB    1 
ATOM   5654 C CG    . GLU B 2 244 ? 40.558 1.887   43.431  1.00 82.76  ? 244 GLU B CG    1 
ATOM   5655 C CD    . GLU B 2 244 ? 39.552 2.871   43.979  1.00 82.86  ? 244 GLU B CD    1 
ATOM   5656 O OE1   . GLU B 2 244 ? 38.339 2.547   43.982  1.00 80.08  ? 244 GLU B OE1   1 
ATOM   5657 O OE2   . GLU B 2 244 ? 39.985 3.961   44.416  1.00 85.29  ? 244 GLU B OE2   1 
ATOM   5658 N N     . PHE B 2 245 ? 40.832 -2.328  45.148  1.00 85.33  ? 245 PHE B N     1 
ATOM   5659 C CA    . PHE B 2 245 ? 40.755 -3.298  46.229  1.00 87.46  ? 245 PHE B CA    1 
ATOM   5660 C C     . PHE B 2 245 ? 42.136 -3.847  46.560  1.00 91.06  ? 245 PHE B C     1 
ATOM   5661 O O     . PHE B 2 245 ? 42.517 -3.910  47.727  1.00 94.14  ? 245 PHE B O     1 
ATOM   5662 C CB    . PHE B 2 245 ? 39.785 -4.443  45.899  1.00 85.77  ? 245 PHE B CB    1 
ATOM   5663 C CG    . PHE B 2 245 ? 39.653 -5.460  47.007  1.00 88.63  ? 245 PHE B CG    1 
ATOM   5664 C CD1   . PHE B 2 245 ? 38.759 -5.253  48.058  1.00 89.38  ? 245 PHE B CD1   1 
ATOM   5665 C CD2   . PHE B 2 245 ? 40.439 -6.614  47.009  1.00 91.60  ? 245 PHE B CD2   1 
ATOM   5666 C CE1   . PHE B 2 245 ? 38.647 -6.182  49.097  1.00 92.35  ? 245 PHE B CE1   1 
ATOM   5667 C CE2   . PHE B 2 245 ? 40.339 -7.550  48.043  1.00 94.37  ? 245 PHE B CE2   1 
ATOM   5668 C CZ    . PHE B 2 245 ? 39.439 -7.336  49.088  1.00 94.30  ? 245 PHE B CZ    1 
ATOM   5669 N N     . MET B 2 246 ? 42.887 -4.227  45.532  1.00 91.07  ? 246 MET B N     1 
ATOM   5670 C CA    . MET B 2 246 ? 44.184 -4.849  45.749  1.00 94.80  ? 246 MET B CA    1 
ATOM   5671 C C     . MET B 2 246 ? 45.130 -3.963  46.536  1.00 97.83  ? 246 MET B C     1 
ATOM   5672 O O     . MET B 2 246 ? 45.793 -4.441  47.448  1.00 101.57 ? 246 MET B O     1 
ATOM   5673 C CB    . MET B 2 246 ? 44.815 -5.305  44.439  1.00 94.89  ? 246 MET B CB    1 
ATOM   5674 C CG    . MET B 2 246 ? 44.192 -6.573  43.879  1.00 94.05  ? 246 MET B CG    1 
ATOM   5675 S SD    . MET B 2 246 ? 44.679 -8.086  44.735  1.00 99.50  ? 246 MET B SD    1 
ATOM   5676 C CE    . MET B 2 246 ? 43.669 -8.052  46.219  1.00 98.92  ? 246 MET B CE    1 
ATOM   5677 N N     . GLU B 2 247 ? 45.168 -2.675  46.212  1.00 96.56  ? 247 GLU B N     1 
ATOM   5678 C CA    . GLU B 2 247 ? 46.052 -1.753  46.918  1.00 99.56  ? 247 GLU B CA    1 
ATOM   5679 C C     . GLU B 2 247 ? 45.660 -1.480  48.379  1.00 101.08 ? 247 GLU B C     1 
ATOM   5680 O O     . GLU B 2 247 ? 46.533 -1.362  49.242  1.00 104.98 ? 247 GLU B O     1 
ATOM   5681 C CB    . GLU B 2 247 ? 46.205 -0.454  46.141  1.00 98.42  ? 247 GLU B CB    1 
ATOM   5682 C CG    . GLU B 2 247 ? 47.178 -0.556  44.984  1.00 99.42  ? 247 GLU B CG    1 
ATOM   5683 C CD    . GLU B 2 247 ? 47.782 0.786   44.617  1.00 101.04 ? 247 GLU B CD    1 
ATOM   5684 O OE1   . GLU B 2 247 ? 49.028 0.875   44.565  1.00 104.55 ? 247 GLU B OE1   1 
ATOM   5685 O OE2   . GLU B 2 247 ? 47.018 1.754   44.390  1.00 98.78  ? 247 GLU B OE2   1 
ATOM   5686 N N     . ALA B 2 248 ? 44.362 -1.387  48.659  1.00 98.33  ? 248 ALA B N     1 
ATOM   5687 C CA    . ALA B 2 248 ? 43.890 -1.199  50.034  1.00 100.03 ? 248 ALA B CA    1 
ATOM   5688 C C     . ALA B 2 248 ? 42.639 -2.036  50.342  1.00 97.97  ? 248 ALA B C     1 
ATOM   5689 O O     . ALA B 2 248 ? 41.520 -1.530  50.253  1.00 95.29  ? 248 ALA B O     1 
ATOM   5690 C CB    . ALA B 2 248 ? 43.651 0.286   50.326  1.00 99.87  ? 248 ALA B CB    1 
ATOM   5691 N N     . PRO B 2 249 ? 42.829 -3.324  50.703  1.00 99.68  ? 249 PRO B N     1 
ATOM   5692 C CA    . PRO B 2 249 ? 41.706 -4.237  50.961  1.00 98.23  ? 249 PRO B CA    1 
ATOM   5693 C C     . PRO B 2 249 ? 40.926 -3.879  52.226  1.00 99.70  ? 249 PRO B C     1 
ATOM   5694 O O     . PRO B 2 249 ? 41.515 -3.708  53.294  1.00 103.88 ? 249 PRO B O     1 
ATOM   5695 C CB    . PRO B 2 249 ? 42.387 -5.607  51.111  1.00 100.81 ? 249 PRO B CB    1 
ATOM   5696 C CG    . PRO B 2 249 ? 43.782 -5.423  50.573  1.00 102.55 ? 249 PRO B CG    1 
ATOM   5697 C CD    . PRO B 2 249 ? 44.123 -4.007  50.875  1.00 103.28 ? 249 PRO B CD    1 
ATOM   5698 N N     . SER B 2 250 ? 39.608 -3.771  52.089  1.00 96.71  ? 250 SER B N     1 
ATOM   5699 C CA    . SER B 2 250 ? 38.734 -3.322  53.170  1.00 97.92  ? 250 SER B CA    1 
ATOM   5700 C C     . SER B 2 250 ? 37.436 -4.123  53.177  1.00 96.16  ? 250 SER B C     1 
ATOM   5701 O O     . SER B 2 250 ? 37.045 -4.698  52.156  1.00 92.71  ? 250 SER B O     1 
ATOM   5702 C CB    . SER B 2 250 ? 38.433 -1.825  53.010  1.00 96.53  ? 250 SER B CB    1 
ATOM   5703 O OG    . SER B 2 250 ? 37.426 -1.382  53.904  1.00 96.83  ? 250 SER B OG    1 
ATOM   5704 N N     . LEU B 2 251 ? 36.770 -4.145  54.331  1.00 98.78  ? 251 LEU B N     1 
ATOM   5705 C CA    . LEU B 2 251 ? 35.462 -4.788  54.463  1.00 97.76  ? 251 LEU B CA    1 
ATOM   5706 C C     . LEU B 2 251 ? 34.364 -4.050  53.679  1.00 94.07  ? 251 LEU B C     1 
ATOM   5707 O O     . LEU B 2 251 ? 33.386 -4.671  53.241  1.00 91.75  ? 251 LEU B O     1 
ATOM   5708 C CB    . LEU B 2 251 ? 35.070 -4.915  55.940  1.00 101.88 ? 251 LEU B CB    1 
ATOM   5709 C CG    . LEU B 2 251 ? 33.906 -5.855  56.277  1.00 101.51 ? 251 LEU B CG    1 
ATOM   5710 C CD1   . LEU B 2 251 ? 34.283 -7.310  56.014  1.00 101.36 ? 251 LEU B CD1   1 
ATOM   5711 C CD2   . LEU B 2 251 ? 33.442 -5.662  57.715  1.00 106.02 ? 251 LEU B CD2   1 
ATOM   5712 N N     . GLY B 2 252 ? 34.543 -2.737  53.497  1.00 93.87  ? 252 GLY B N     1 
ATOM   5713 C CA    . GLY B 2 252 ? 33.571 -1.871  52.813  1.00 90.95  ? 252 GLY B CA    1 
ATOM   5714 C C     . GLY B 2 252 ? 33.381 -2.116  51.325  1.00 86.96  ? 252 GLY B C     1 
ATOM   5715 O O     . GLY B 2 252 ? 32.607 -1.421  50.676  1.00 84.35  ? 252 GLY B O     1 
ATOM   5716 N N     . PHE B 2 253 ? 34.090 -3.106  50.792  1.00 87.06  ? 253 PHE B N     1 
ATOM   5717 C CA    . PHE B 2 253 ? 33.986 -3.493  49.392  1.00 84.19  ? 253 PHE B CA    1 
ATOM   5718 C C     . PHE B 2 253 ? 33.017 -4.649  49.230  1.00 83.27  ? 253 PHE B C     1 
ATOM   5719 O O     . PHE B 2 253 ? 32.776 -5.111  48.118  1.00 80.71  ? 253 PHE B O     1 
ATOM   5720 C CB    . PHE B 2 253 ? 35.351 -3.914  48.855  1.00 85.19  ? 253 PHE B CB    1 
ATOM   5721 C CG    . PHE B 2 253 ? 36.279 -2.767  48.568  1.00 86.23  ? 253 PHE B CG    1 
ATOM   5722 C CD1   . PHE B 2 253 ? 36.812 -2.000  49.607  1.00 89.59  ? 253 PHE B CD1   1 
ATOM   5723 C CD2   . PHE B 2 253 ? 36.643 -2.466  47.260  1.00 84.32  ? 253 PHE B CD2   1 
ATOM   5724 C CE1   . PHE B 2 253 ? 37.676 -0.946  49.346  1.00 90.29  ? 253 PHE B CE1   1 
ATOM   5725 C CE2   . PHE B 2 253 ? 37.507 -1.414  46.988  1.00 85.26  ? 253 PHE B CE2   1 
ATOM   5726 C CZ    . PHE B 2 253 ? 38.025 -0.653  48.033  1.00 88.22  ? 253 PHE B CZ    1 
ATOM   5727 N N     . PHE B 2 254 ? 32.489 -5.127  50.350  1.00 86.06  ? 254 PHE B N     1 
ATOM   5728 C CA    . PHE B 2 254 ? 31.438 -6.134  50.350  1.00 85.92  ? 254 PHE B CA    1 
ATOM   5729 C C     . PHE B 2 254 ? 30.193 -5.608  51.058  1.00 86.77  ? 254 PHE B C     1 
ATOM   5730 O O     . PHE B 2 254 ? 29.124 -6.219  50.982  1.00 85.84  ? 254 PHE B O     1 
ATOM   5731 C CB    . PHE B 2 254 ? 31.911 -7.407  51.031  1.00 88.91  ? 254 PHE B CB    1 
ATOM   5732 C CG    . PHE B 2 254 ? 32.989 -8.131  50.289  1.00 89.12  ? 254 PHE B CG    1 
ATOM   5733 C CD1   . PHE B 2 254 ? 34.330 -7.894  50.580  1.00 91.77  ? 254 PHE B CD1   1 
ATOM   5734 C CD2   . PHE B 2 254 ? 32.669 -9.071  49.316  1.00 87.30  ? 254 PHE B CD2   1 
ATOM   5735 C CE1   . PHE B 2 254 ? 35.341 -8.579  49.904  1.00 92.05  ? 254 PHE B CE1   1 
ATOM   5736 C CE2   . PHE B 2 254 ? 33.673 -9.758  48.631  1.00 87.84  ? 254 PHE B CE2   1 
ATOM   5737 C CZ    . PHE B 2 254 ? 35.010 -9.511  48.928  1.00 89.98  ? 254 PHE B CZ    1 
ATOM   5738 N N     . LYS B 2 255 ? 30.355 -4.484  51.758  1.00 89.15  ? 255 LYS B N     1 
ATOM   5739 C CA    . LYS B 2 255 ? 29.255 -3.722  52.353  1.00 90.36  ? 255 LYS B CA    1 
ATOM   5740 C C     . LYS B 2 255 ? 28.506 -2.958  51.254  1.00 87.15  ? 255 LYS B C     1 
ATOM   5741 O O     . LYS B 2 255 ? 29.058 -2.012  50.681  1.00 86.16  ? 255 LYS B O     1 
ATOM   5742 C CB    . LYS B 2 255 ? 29.823 -2.716  53.364  1.00 93.81  ? 255 LYS B CB    1 
ATOM   5743 C CG    . LYS B 2 255 ? 29.562 -2.991  54.848  1.00 98.22  ? 255 LYS B CG    1 
ATOM   5744 C CD    . LYS B 2 255 ? 28.541 -1.979  55.390  1.00 99.19  ? 255 LYS B CD    1 
ATOM   5745 C CE    . LYS B 2 255 ? 29.054 -1.248  56.626  1.00 102.88 ? 255 LYS B CE    1 
ATOM   5746 N NZ    . LYS B 2 255 ? 28.988 -2.106  57.840  1.00 106.66 ? 255 LYS B NZ    1 
ATOM   5747 N N     . PRO B 2 256 ? 27.255 -3.357  50.944  1.00 85.93  ? 256 PRO B N     1 
ATOM   5748 C CA    . PRO B 2 256 ? 26.546 -2.546  49.955  1.00 83.43  ? 256 PRO B CA    1 
ATOM   5749 C C     . PRO B 2 256 ? 26.547 -1.088  50.406  1.00 85.37  ? 256 PRO B C     1 
ATOM   5750 O O     . PRO B 2 256 ? 26.055 -0.777  51.491  1.00 88.22  ? 256 PRO B O     1 
ATOM   5751 C CB    . PRO B 2 256 ? 25.125 -3.127  49.956  1.00 82.62  ? 256 PRO B CB    1 
ATOM   5752 C CG    . PRO B 2 256 ? 25.052 -4.039  51.144  1.00 85.52  ? 256 PRO B CG    1 
ATOM   5753 C CD    . PRO B 2 256 ? 26.439 -4.483  51.430  1.00 86.84  ? 256 PRO B CD    1 
ATOM   5754 N N     . LYS B 2 257 ? 27.156 -0.218  49.605  1.00 84.56  ? 257 LYS B N     1 
ATOM   5755 C CA    . LYS B 2 257 ? 27.214 1.207   49.921  1.00 86.59  ? 257 LYS B CA    1 
ATOM   5756 C C     . LYS B 2 257 ? 25.872 1.884   49.694  1.00 86.11  ? 257 LYS B C     1 
ATOM   5757 O O     . LYS B 2 257 ? 25.275 1.759   48.622  1.00 83.20  ? 257 LYS B O     1 
ATOM   5758 C CB    . LYS B 2 257 ? 28.290 1.898   49.091  1.00 85.68  ? 257 LYS B CB    1 
ATOM   5759 C CG    . LYS B 2 257 ? 29.451 2.429   49.901  1.00 89.24  ? 257 LYS B CG    1 
ATOM   5760 C CD    . LYS B 2 257 ? 30.381 3.254   49.021  1.00 88.91  ? 257 LYS B CD    1 
ATOM   5761 C CE    . LYS B 2 257 ? 31.025 4.388   49.797  1.00 92.55  ? 257 LYS B CE    1 
ATOM   5762 N NZ    . LYS B 2 257 ? 31.554 3.937   51.116  1.00 96.21  ? 257 LYS B NZ    1 
ATOM   5763 N N     . HIS B 2 258 ? 25.391 2.599   50.704  1.00 89.62  ? 258 HIS B N     1 
ATOM   5764 C CA    . HIS B 2 258 ? 24.110 3.280   50.567  1.00 90.14  ? 258 HIS B CA    1 
ATOM   5765 C C     . HIS B 2 258 ? 24.229 4.796   50.405  1.00 91.18  ? 258 HIS B C     1 
ATOM   5766 O O     . HIS B 2 258 ? 24.801 5.471   51.277  1.00 94.29  ? 258 HIS B O     1 
ATOM   5767 C CB    . HIS B 2 258 ? 23.143 2.911   51.697  1.00 93.04  ? 258 HIS B CB    1 
ATOM   5768 C CG    . HIS B 2 258 ? 22.023 2.017   51.257  1.00 92.19  ? 258 HIS B CG    1 
ATOM   5769 N ND1   . HIS B 2 258 ? 21.685 0.857   51.924  1.00 94.25  ? 258 HIS B ND1   1 
ATOM   5770 C CD2   . HIS B 2 258 ? 21.172 2.108   50.206  1.00 90.01  ? 258 HIS B CD2   1 
ATOM   5771 C CE1   . HIS B 2 258 ? 20.668 0.277   51.309  1.00 92.26  ? 258 HIS B CE1   1 
ATOM   5772 N NE2   . HIS B 2 258 ? 20.339 1.015   50.263  1.00 90.09  ? 258 HIS B NE2   1 
ATOM   5773 N N     . PRO B 2 259 ? 23.686 5.334   49.281  1.00 88.76  ? 259 PRO B N     1 
ATOM   5774 C CA    . PRO B 2 259 ? 23.650 6.787   49.123  1.00 89.80  ? 259 PRO B CA    1 
ATOM   5775 C C     . PRO B 2 259 ? 22.505 7.386   49.956  1.00 92.43  ? 259 PRO B C     1 
ATOM   5776 O O     . PRO B 2 259 ? 21.526 7.906   49.396  1.00 91.85  ? 259 PRO B O     1 
ATOM   5777 C CB    . PRO B 2 259 ? 23.455 6.988   47.607  1.00 86.49  ? 259 PRO B CB    1 
ATOM   5778 C CG    . PRO B 2 259 ? 22.881 5.702   47.087  1.00 83.69  ? 259 PRO B CG    1 
ATOM   5779 C CD    . PRO B 2 259 ? 23.078 4.626   48.130  1.00 85.21  ? 259 PRO B CD    1 
ATOM   5780 N N     . LEU B 2 260 ? 22.641 7.274   51.287  1.00 105.77 ? 260 LEU B N     1 
ATOM   5781 C CA    . LEU B 2 260 ? 21.738 7.897   52.272  1.00 107.00 ? 260 LEU B CA    1 
ATOM   5782 C C     . LEU B 2 260 ? 21.361 9.319   51.806  1.00 103.89 ? 260 LEU B C     1 
ATOM   5783 O O     . LEU B 2 260 ? 22.170 10.256  51.913  1.00 103.93 ? 260 LEU B O     1 
ATOM   5784 C CB    . LEU B 2 260 ? 22.390 7.918   53.673  1.00 111.54 ? 260 LEU B CB    1 
ATOM   5785 C CG    . LEU B 2 260 ? 22.372 6.705   54.631  1.00 116.00 ? 260 LEU B CG    1 
ATOM   5786 C CD1   . LEU B 2 260 ? 23.162 5.488   54.137  1.00 115.97 ? 260 LEU B CD1   1 
ATOM   5787 C CD2   . LEU B 2 260 ? 22.866 7.108   56.022  1.00 120.22 ? 260 LEU B CD2   1 
ATOM   5788 N N     . GLU B 2 261 ? 20.136 9.446   51.277  1.00 100.91 ? 261 GLU B N     1 
ATOM   5789 C CA    . GLU B 2 261 ? 19.666 10.625  50.513  1.00 96.86  ? 261 GLU B CA    1 
ATOM   5790 C C     . GLU B 2 261 ? 19.957 11.995  51.152  1.00 97.07  ? 261 GLU B C     1 
ATOM   5791 O O     . GLU B 2 261 ? 20.164 12.125  52.366  1.00 100.57 ? 261 GLU B O     1 
ATOM   5792 C CB    . GLU B 2 261 ? 18.169 10.501  50.174  1.00 96.10  ? 261 GLU B CB    1 
ATOM   5793 C CG    . GLU B 2 261 ? 17.755 9.172   49.530  1.00 95.52  ? 261 GLU B CG    1 
ATOM   5794 C CD    . GLU B 2 261 ? 16.555 8.514   50.236  1.00 98.89  ? 261 GLU B CD    1 
ATOM   5795 O OE1   . GLU B 2 261 ? 15.477 8.410   49.608  1.00 97.66  ? 261 GLU B OE1   1 
ATOM   5796 O OE2   . GLU B 2 261 ? 16.684 8.103   51.421  1.00 102.79 ? 261 GLU B OE2   1 
ATOM   5797 N N     . ILE B 2 262 ? 19.940 13.014  50.304  1.00 92.84  ? 262 ILE B N     1 
ATOM   5798 C CA    . ILE B 2 262 ? 20.433 14.341  50.633  1.00 91.89  ? 262 ILE B CA    1 
ATOM   5799 C C     . ILE B 2 262 ? 19.282 15.351  50.726  1.00 90.87  ? 262 ILE B C     1 
ATOM   5800 O O     . ILE B 2 262 ? 18.234 15.179  50.092  1.00 88.97  ? 262 ILE B O     1 
ATOM   5801 C CB    . ILE B 2 262 ? 21.477 14.762  49.568  1.00 89.16  ? 262 ILE B CB    1 
ATOM   5802 C CG1   . ILE B 2 262 ? 22.080 16.139  49.863  1.00 90.33  ? 262 ILE B CG1   1 
ATOM   5803 C CG2   . ILE B 2 262 ? 20.862 14.697  48.166  1.00 85.58  ? 262 ILE B CG2   1 
ATOM   5804 C CD1   . ILE B 2 262 ? 23.024 16.648  48.777  1.00 87.33  ? 262 ILE B CD1   1 
ATOM   5805 N N     . GLU B 2 263 ? 19.489 16.397  51.525  1.00 91.83  ? 263 GLU B N     1 
ATOM   5806 C CA    . GLU B 2 263 ? 18.479 17.440  51.758  1.00 91.45  ? 263 GLU B CA    1 
ATOM   5807 C C     . GLU B 2 263 ? 18.190 18.244  50.487  1.00 86.69  ? 263 GLU B C     1 
ATOM   5808 O O     . GLU B 2 263 ? 19.122 18.688  49.812  1.00 84.63  ? 263 GLU B O     1 
ATOM   5809 C CB    . GLU B 2 263 ? 18.906 18.403  52.883  1.00 95.19  ? 263 GLU B CB    1 
ATOM   5810 C CG    . GLU B 2 263 ? 19.767 17.797  53.990  1.00 98.72  ? 263 GLU B CG    1 
ATOM   5811 C CD    . GLU B 2 263 ? 21.262 17.949  53.733  1.00 98.53  ? 263 GLU B CD    1 
ATOM   5812 O OE1   . GLU B 2 263 ? 21.812 17.226  52.871  1.00 95.72  ? 263 GLU B OE1   1 
ATOM   5813 O OE2   . GLU B 2 263 ? 21.895 18.787  54.409  1.00 101.44 ? 263 GLU B OE2   1 
ATOM   5814 N N     . PRO B 2 264 ? 16.895 18.435  50.160  1.00 84.95  ? 264 PRO B N     1 
ATOM   5815 C CA    . PRO B 2 264 ? 16.487 19.300  49.049  1.00 81.44  ? 264 PRO B CA    1 
ATOM   5816 C C     . PRO B 2 264 ? 17.195 20.666  49.018  1.00 80.74  ? 264 PRO B C     1 
ATOM   5817 O O     . PRO B 2 264 ? 17.237 21.313  47.965  1.00 78.32  ? 264 PRO B O     1 
ATOM   5818 C CB    . PRO B 2 264 ? 14.983 19.475  49.288  1.00 82.98  ? 264 PRO B CB    1 
ATOM   5819 C CG    . PRO B 2 264 ? 14.577 18.208  49.941  1.00 84.64  ? 264 PRO B CG    1 
ATOM   5820 C CD    . PRO B 2 264 ? 15.730 17.811  50.818  1.00 86.86  ? 264 PRO B CD    1 
ATOM   5821 N N     . GLU B 2 265 ? 17.747 21.087  50.157  1.00 82.62  ? 265 GLU B N     1 
ATOM   5822 C CA    . GLU B 2 265 ? 18.432 22.373  50.265  1.00 82.40  ? 265 GLU B CA    1 
ATOM   5823 C C     . GLU B 2 265 ? 19.931 22.258  49.993  1.00 80.30  ? 265 GLU B C     1 
ATOM   5824 O O     . GLU B 2 265 ? 20.511 23.176  49.407  1.00 79.42  ? 265 GLU B O     1 
ATOM   5825 C CB    . GLU B 2 265 ? 18.154 23.048  51.620  1.00 87.03  ? 265 GLU B CB    1 
ATOM   5826 C CG    . GLU B 2 265 ? 19.000 24.304  51.926  1.00 88.59  ? 265 GLU B CG    1 
ATOM   5827 C CD    . GLU B 2 265 ? 18.591 25.547  51.129  1.00 87.31  ? 265 GLU B CD    1 
ATOM   5828 O OE1   . GLU B 2 265 ? 17.929 26.428  51.715  1.00 90.81  ? 265 GLU B OE1   1 
ATOM   5829 O OE2   . GLU B 2 265 ? 18.934 25.659  49.933  1.00 82.48  ? 265 GLU B OE2   1 
ATOM   5830 N N     . ARG B 2 266 ? 20.557 21.149  50.403  1.00 79.40  ? 266 ARG B N     1 
ATOM   5831 C CA    . ARG B 2 266 ? 21.986 20.933  50.114  1.00 77.39  ? 266 ARG B CA    1 
ATOM   5832 C C     . ARG B 2 266 ? 22.178 20.601  48.644  1.00 72.10  ? 266 ARG B C     1 
ATOM   5833 O O     . ARG B 2 266 ? 23.247 20.813  48.072  1.00 70.97  ? 266 ARG B O     1 
ATOM   5834 C CB    . ARG B 2 266 ? 22.614 19.835  50.973  1.00 79.61  ? 266 ARG B CB    1 
ATOM   5835 C CG    . ARG B 2 266 ? 24.134 19.989  51.100  1.00 81.94  ? 266 ARG B CG    1 
ATOM   5836 C CD    . ARG B 2 266 ? 24.865 18.657  51.206  1.00 84.97  ? 266 ARG B CD    1 
ATOM   5837 N NE    . ARG B 2 266 ? 26.234 18.755  50.684  1.00 86.47  ? 266 ARG B NE    1 
ATOM   5838 C CZ    . ARG B 2 266 ? 27.127 17.762  50.669  1.00 87.94  ? 266 ARG B CZ    1 
ATOM   5839 N NH1   . ARG B 2 266 ? 26.823 16.557  51.156  1.00 89.41  ? 266 ARG B NH1   1 
ATOM   5840 N NH2   . ARG B 2 266 ? 28.338 17.977  50.165  1.00 87.57  ? 266 ARG B NH2   1 
ATOM   5841 N N     . LEU B 2 267 ? 21.124 20.079  48.038  1.00 68.73  ? 267 LEU B N     1 
ATOM   5842 C CA    . LEU B 2 267 ? 21.122 19.803  46.627  1.00 63.53  ? 267 LEU B CA    1 
ATOM   5843 C C     . LEU B 2 267 ? 21.013 21.125  45.891  1.00 61.30  ? 267 LEU B C     1 
ATOM   5844 O O     . LEU B 2 267 ? 21.788 21.387  44.983  1.00 59.16  ? 267 LEU B O     1 
ATOM   5845 C CB    . LEU B 2 267 ? 19.946 18.888  46.302  1.00 62.63  ? 267 LEU B CB    1 
ATOM   5846 C CG    . LEU B 2 267 ? 20.054 17.827  45.201  1.00 60.16  ? 267 LEU B CG    1 
ATOM   5847 C CD1   . LEU B 2 267 ? 21.403 17.102  45.178  1.00 59.60  ? 267 LEU B CD1   1 
ATOM   5848 C CD2   . LEU B 2 267 ? 18.936 16.832  45.423  1.00 60.38  ? 267 LEU B CD2   1 
ATOM   5849 N N     . ARG B 2 268 ? 20.062 21.956  46.318  1.00 61.72  ? 268 ARG B N     1 
ATOM   5850 C CA    . ARG B 2 268 ? 19.805 23.261  45.720  1.00 60.39  ? 268 ARG B CA    1 
ATOM   5851 C C     . ARG B 2 268 ? 21.101 24.044  45.643  1.00 60.36  ? 268 ARG B C     1 
ATOM   5852 O O     . ARG B 2 268 ? 21.455 24.588  44.587  1.00 58.64  ? 268 ARG B O     1 
ATOM   5853 C CB    . ARG B 2 268 ? 18.804 24.055  46.564  1.00 63.24  ? 268 ARG B CB    1 
ATOM   5854 C CG    . ARG B 2 268 ? 17.709 24.754  45.772  1.00 62.07  ? 268 ARG B CG    1 
ATOM   5855 C CD    . ARG B 2 268 ? 17.481 26.200  46.183  1.00 63.39  ? 268 ARG B CD    1 
ATOM   5856 N NE    . ARG B 2 268 ? 18.152 27.084  45.229  1.00 64.46  ? 268 ARG B NE    1 
ATOM   5857 C CZ    . ARG B 2 268 ? 19.096 27.986  45.522  1.00 65.64  ? 268 ARG B CZ    1 
ATOM   5858 N NH1   . ARG B 2 268 ? 19.625 28.702  44.536  1.00 62.69  ? 268 ARG B NH1   1 
ATOM   5859 N NH2   . ARG B 2 268 ? 19.503 28.189  46.782  1.00 68.57  ? 268 ARG B NH2   1 
ATOM   5860 N N     . LYS B 2 269 ? 21.806 24.078  46.775  1.00 62.22  ? 269 LYS B N     1 
ATOM   5861 C CA    . LYS B 2 269 ? 23.046 24.825  46.925  1.00 62.41  ? 269 LYS B CA    1 
ATOM   5862 C C     . LYS B 2 269 ? 24.116 24.352  45.942  1.00 59.03  ? 269 LYS B C     1 
ATOM   5863 O O     . LYS B 2 269 ? 24.891 25.147  45.429  1.00 58.86  ? 269 LYS B O     1 
ATOM   5864 C CB    . LYS B 2 269 ? 23.568 24.690  48.354  1.00 65.83  ? 269 LYS B CB    1 
ATOM   5865 C CG    . LYS B 2 269 ? 24.479 25.832  48.760  1.00 69.02  ? 269 LYS B CG    1 
ATOM   5866 C CD    . LYS B 2 269 ? 25.784 25.332  49.357  1.00 71.67  ? 269 LYS B CD    1 
ATOM   5867 C CE    . LYS B 2 269 ? 25.552 24.482  50.597  1.00 75.09  ? 269 LYS B CE    1 
ATOM   5868 N NZ    . LYS B 2 269 ? 24.881 25.250  51.679  1.00 79.22  ? 269 LYS B NZ    1 
ATOM   5869 N N     . ILE B 2 270 ? 24.143 23.053  45.687  1.00 56.47  ? 270 ILE B N     1 
ATOM   5870 C CA    . ILE B 2 270 ? 25.145 22.448  44.835  1.00 53.77  ? 270 ILE B CA    1 
ATOM   5871 C C     . ILE B 2 270 ? 24.965 22.852  43.372  1.00 50.88  ? 270 ILE B C     1 
ATOM   5872 O O     . ILE B 2 270 ? 25.934 23.149  42.671  1.00 49.81  ? 270 ILE B O     1 
ATOM   5873 C CB    . ILE B 2 270 ? 25.132 20.907  45.012  1.00 53.42  ? 270 ILE B CB    1 
ATOM   5874 C CG1   . ILE B 2 270 ? 26.168 20.503  46.068  1.00 55.87  ? 270 ILE B CG1   1 
ATOM   5875 C CG2   . ILE B 2 270 ? 25.395 20.189  43.692  1.00 50.17  ? 270 ILE B CG2   1 
ATOM   5876 C CD1   . ILE B 2 270 ? 25.859 19.229  46.817  1.00 56.42  ? 270 ILE B CD1   1 
ATOM   5877 N N     . VAL B 2 271 ? 23.717 22.864  42.918  1.00 49.53  ? 271 VAL B N     1 
ATOM   5878 C CA    . VAL B 2 271 ? 23.409 23.142  41.520  1.00 46.62  ? 271 VAL B CA    1 
ATOM   5879 C C     . VAL B 2 271 ? 23.650 24.614  41.197  1.00 46.98  ? 271 VAL B C     1 
ATOM   5880 O O     . VAL B 2 271 ? 24.037 24.954  40.076  1.00 45.91  ? 271 VAL B O     1 
ATOM   5881 C CB    . VAL B 2 271 ? 21.961 22.717  41.171  1.00 45.58  ? 271 VAL B CB    1 
ATOM   5882 C CG1   . VAL B 2 271 ? 21.533 23.227  39.789  1.00 42.98  ? 271 VAL B CG1   1 
ATOM   5883 C CG2   . VAL B 2 271 ? 21.837 21.212  41.251  1.00 44.94  ? 271 VAL B CG2   1 
ATOM   5884 N N     . GLU B 2 272 ? 23.427 25.493  42.166  1.00 48.86  ? 272 GLU B N     1 
ATOM   5885 C CA    . GLU B 2 272 ? 23.702 26.889  41.896  1.00 49.61  ? 272 GLU B CA    1 
ATOM   5886 C C     . GLU B 2 272 ? 25.209 27.127  41.994  1.00 49.75  ? 272 GLU B C     1 
ATOM   5887 O O     . GLU B 2 272 ? 25.754 28.019  41.350  1.00 49.31  ? 272 GLU B O     1 
ATOM   5888 C CB    . GLU B 2 272 ? 22.846 27.829  42.750  1.00 52.20  ? 272 GLU B CB    1 
ATOM   5889 C CG    . GLU B 2 272 ? 23.219 27.925  44.206  1.00 56.89  ? 272 GLU B CG    1 
ATOM   5890 C CD    . GLU B 2 272 ? 23.332 29.381  44.677  1.00 61.79  ? 272 GLU B CD    1 
ATOM   5891 O OE1   . GLU B 2 272 ? 23.039 29.655  45.876  1.00 65.56  ? 272 GLU B OE1   1 
ATOM   5892 O OE2   . GLU B 2 272 ? 23.723 30.244  43.845  1.00 61.04  ? 272 GLU B OE2   1 
ATOM   5893 N N     . GLU B 2 273 ? 25.865 26.268  42.768  1.00 50.20  ? 273 GLU B N     1 
ATOM   5894 C CA    . GLU B 2 273 ? 27.316 26.208  42.871  1.00 50.56  ? 273 GLU B CA    1 
ATOM   5895 C C     . GLU B 2 273 ? 27.925 25.759  41.545  1.00 47.28  ? 273 GLU B C     1 
ATOM   5896 O O     . GLU B 2 273 ? 28.915 26.321  41.094  1.00 47.59  ? 273 GLU B O     1 
ATOM   5897 C CB    . GLU B 2 273 ? 27.679 25.226  43.978  1.00 52.58  ? 273 GLU B CB    1 
ATOM   5898 C CG    . GLU B 2 273 ? 29.129 24.873  44.101  1.00 55.57  ? 273 GLU B CG    1 
ATOM   5899 C CD    . GLU B 2 273 ? 29.772 25.662  45.186  1.00 62.96  ? 273 GLU B CD    1 
ATOM   5900 O OE1   . GLU B 2 273 ? 29.500 25.386  46.385  1.00 65.84  ? 273 GLU B OE1   1 
ATOM   5901 O OE2   . GLU B 2 273 ? 30.541 26.582  44.830  1.00 66.62  ? 273 GLU B OE2   1 
ATOM   5902 N N     . ARG B 2 274 ? 27.329 24.746  40.925  1.00 44.39  ? 274 ARG B N     1 
ATOM   5903 C CA    . ARG B 2 274 ? 27.780 24.284  39.616  1.00 41.72  ? 274 ARG B CA    1 
ATOM   5904 C C     . ARG B 2 274 ? 27.288 25.231  38.552  1.00 40.02  ? 274 ARG B C     1 
ATOM   5905 O O     . ARG B 2 274 ? 27.832 25.249  37.462  1.00 39.19  ? 274 ARG B O     1 
ATOM   5906 C CB    . ARG B 2 274 ? 27.291 22.867  39.293  1.00 39.83  ? 274 ARG B CB    1 
ATOM   5907 C CG    . ARG B 2 274 ? 27.459 21.876  40.412  1.00 41.34  ? 274 ARG B CG    1 
ATOM   5908 C CD    . ARG B 2 274 ? 27.048 20.471  39.979  1.00 40.65  ? 274 ARG B CD    1 
ATOM   5909 N NE    . ARG B 2 274 ? 28.212 19.685  39.587  1.00 41.07  ? 274 ARG B NE    1 
ATOM   5910 C CZ    . ARG B 2 274 ? 28.238 18.836  38.565  1.00 40.03  ? 274 ARG B CZ    1 
ATOM   5911 N NH1   . ARG B 2 274 ? 27.174 18.653  37.807  1.00 36.21  ? 274 ARG B NH1   1 
ATOM   5912 N NH2   . ARG B 2 274 ? 29.346 18.178  38.289  1.00 42.33  ? 274 ARG B NH2   1 
ATOM   5913 N N     . GLY B 2 275 ? 26.242 25.991  38.871  1.00 40.26  ? 275 GLY B N     1 
ATOM   5914 C CA    . GLY B 2 275 ? 25.705 27.040  37.990  1.00 39.79  ? 275 GLY B CA    1 
ATOM   5915 C C     . GLY B 2 275 ? 25.086 26.582  36.672  1.00 37.69  ? 275 GLY B C     1 
ATOM   5916 O O     . GLY B 2 275 ? 25.035 27.349  35.703  1.00 36.79  ? 275 GLY B O     1 
ATOM   5917 N N     . THR B 2 276 ? 24.603 25.340  36.649  1.00 36.35  ? 276 THR B N     1 
ATOM   5918 C CA    . THR B 2 276 ? 24.058 24.722  35.452  1.00 34.54  ? 276 THR B CA    1 
ATOM   5919 C C     . THR B 2 276 ? 22.551 24.544  35.541  1.00 34.32  ? 276 THR B C     1 
ATOM   5920 O O     . THR B 2 276 ? 21.963 24.689  36.601  1.00 35.91  ? 276 THR B O     1 
ATOM   5921 C CB    . THR B 2 276 ? 24.654 23.338  35.276  1.00 33.69  ? 276 THR B CB    1 
ATOM   5922 O OG1   . THR B 2 276 ? 24.309 22.535  36.403  1.00 34.47  ? 276 THR B OG1   1 
ATOM   5923 C CG2   . THR B 2 276 ? 26.136 23.430  35.214  1.00 35.16  ? 276 THR B CG2   1 
ATOM   5924 N N     . ALA B 2 277 ? 21.919 24.193  34.429  1.00 33.28  ? 277 ALA B N     1 
ATOM   5925 C CA    . ALA B 2 277 ? 20.484 23.945  34.441  1.00 32.98  ? 277 ALA B CA    1 
ATOM   5926 C C     . ALA B 2 277 ? 20.186 22.451  34.595  1.00 31.96  ? 277 ALA B C     1 
ATOM   5927 O O     . ALA B 2 277 ? 20.435 21.684  33.680  1.00 30.96  ? 277 ALA B O     1 
ATOM   5928 C CB    . ALA B 2 277 ? 19.847 24.503  33.192  1.00 32.45  ? 277 ALA B CB    1 
ATOM   5929 N N     . VAL B 2 278 ? 19.683 22.045  35.763  1.00 32.38  ? 278 VAL B N     1 
ATOM   5930 C CA    . VAL B 2 278 ? 19.245 20.657  35.967  1.00 31.73  ? 278 VAL B CA    1 
ATOM   5931 C C     . VAL B 2 278 ? 17.736 20.557  35.966  1.00 32.30  ? 278 VAL B C     1 
ATOM   5932 O O     . VAL B 2 278 ? 17.052 21.303  36.657  1.00 34.39  ? 278 VAL B O     1 
ATOM   5933 C CB    . VAL B 2 278 ? 19.749 20.019  37.274  1.00 32.31  ? 278 VAL B CB    1 
ATOM   5934 C CG1   . VAL B 2 278 ? 21.251 20.066  37.354  1.00 32.16  ? 278 VAL B CG1   1 
ATOM   5935 C CG2   . VAL B 2 278 ? 19.100 20.673  38.491  1.00 33.84  ? 278 VAL B CG2   1 
ATOM   5936 N N     . PHE B 2 279 ? 17.218 19.616  35.197  1.00 31.15  ? 279 PHE B N     1 
ATOM   5937 C CA    . PHE B 2 279 ? 15.793 19.438  35.101  1.00 31.49  ? 279 PHE B CA    1 
ATOM   5938 C C     . PHE B 2 279 ? 15.564 18.007  34.616  1.00 30.70  ? 279 PHE B C     1 
ATOM   5939 O O     . PHE B 2 279 ? 16.504 17.318  34.202  1.00 29.43  ? 279 PHE B O     1 
ATOM   5940 C CB    . PHE B 2 279 ? 15.221 20.443  34.112  1.00 31.86  ? 279 PHE B CB    1 
ATOM   5941 C CG    . PHE B 2 279 ? 15.723 20.238  32.726  1.00 31.16  ? 279 PHE B CG    1 
ATOM   5942 C CD1   . PHE B 2 279 ? 15.017 19.458  31.835  1.00 33.09  ? 279 PHE B CD1   1 
ATOM   5943 C CD2   . PHE B 2 279 ? 16.939 20.761  32.334  1.00 31.34  ? 279 PHE B CD2   1 
ATOM   5944 C CE1   . PHE B 2 279 ? 15.501 19.232  30.564  1.00 33.01  ? 279 PHE B CE1   1 
ATOM   5945 C CE2   . PHE B 2 279 ? 17.421 20.539  31.075  1.00 31.89  ? 279 PHE B CE2   1 
ATOM   5946 C CZ    . PHE B 2 279 ? 16.700 19.781  30.184  1.00 31.41  ? 279 PHE B CZ    1 
ATOM   5947 N N     . ALA B 2 280 ? 14.308 17.578  34.683  1.00 31.40  ? 280 ALA B N     1 
ATOM   5948 C CA    . ALA B 2 280 ? 13.902 16.208  34.381  1.00 30.96  ? 280 ALA B CA    1 
ATOM   5949 C C     . ALA B 2 280 ? 12.634 16.217  33.547  1.00 31.40  ? 280 ALA B C     1 
ATOM   5950 O O     . ALA B 2 280 ? 11.816 17.142  33.655  1.00 32.84  ? 280 ALA B O     1 
ATOM   5951 C CB    . ALA B 2 280 ? 13.654 15.474  35.639  1.00 31.72  ? 280 ALA B CB    1 
ATOM   5952 N N     . VAL B 2 281 ? 12.462 15.205  32.703  1.00 30.77  ? 281 VAL B N     1 
ATOM   5953 C CA    . VAL B 2 281 ? 11.177 15.043  32.045  1.00 31.24  ? 281 VAL B CA    1 
ATOM   5954 C C     . VAL B 2 281 ? 10.503 13.871  32.719  1.00 32.20  ? 281 VAL B C     1 
ATOM   5955 O O     . VAL B 2 281 ? 11.080 12.793  32.816  1.00 32.37  ? 281 VAL B O     1 
ATOM   5956 C CB    . VAL B 2 281 ? 11.279 14.899  30.509  1.00 30.61  ? 281 VAL B CB    1 
ATOM   5957 C CG1   . VAL B 2 281 ? 12.728 15.104  30.036  1.00 29.84  ? 281 VAL B CG1   1 
ATOM   5958 C CG2   . VAL B 2 281 ? 10.663 13.600  30.018  1.00 30.12  ? 281 VAL B CG2   1 
ATOM   5959 N N     . LYS B 2 282 ? 9.303  14.122  33.226  1.00 33.45  ? 282 LYS B N     1 
ATOM   5960 C CA    . LYS B 2 282 ? 8.569  13.174  34.050  1.00 34.47  ? 282 LYS B CA    1 
ATOM   5961 C C     . LYS B 2 282 ? 7.319  12.731  33.326  1.00 34.94  ? 282 LYS B C     1 
ATOM   5962 O O     . LYS B 2 282 ? 6.600  13.550  32.754  1.00 35.85  ? 282 LYS B O     1 
ATOM   5963 C CB    . LYS B 2 282 ? 8.185  13.856  35.364  1.00 36.12  ? 282 LYS B CB    1 
ATOM   5964 C CG    . LYS B 2 282 ? 7.241  13.071  36.267  1.00 38.87  ? 282 LYS B CG    1 
ATOM   5965 C CD    . LYS B 2 282 ? 6.752  13.939  37.438  1.00 39.70  ? 282 LYS B CD    1 
ATOM   5966 C CE    . LYS B 2 282 ? 6.018  13.095  38.460  1.00 40.65  ? 282 LYS B CE    1 
ATOM   5967 N NZ    . LYS B 2 282 ? 5.590  13.960  39.577  1.00 43.46  ? 282 LYS B NZ    1 
ATOM   5968 N N     . PHE B 2 283 ? 7.056  11.436  33.360  1.00 34.90  ? 283 PHE B N     1 
ATOM   5969 C CA    . PHE B 2 283 ? 5.885  10.873  32.706  1.00 35.75  ? 283 PHE B CA    1 
ATOM   5970 C C     . PHE B 2 283 ? 5.484  9.595   33.411  1.00 36.76  ? 283 PHE B C     1 
ATOM   5971 O O     . PHE B 2 283 ? 6.248  9.071   34.226  1.00 36.43  ? 283 PHE B O     1 
ATOM   5972 C CB    . PHE B 2 283 ? 6.159  10.612  31.211  1.00 34.92  ? 283 PHE B CB    1 
ATOM   5973 C CG    . PHE B 2 283 ? 7.421  9.825   30.945  1.00 33.90  ? 283 PHE B CG    1 
ATOM   5974 C CD1   . PHE B 2 283 ? 7.362  8.451   30.675  1.00 34.30  ? 283 PHE B CD1   1 
ATOM   5975 C CD2   . PHE B 2 283 ? 8.675  10.446  30.976  1.00 32.70  ? 283 PHE B CD2   1 
ATOM   5976 C CE1   . PHE B 2 283 ? 8.537  7.704   30.427  1.00 32.41  ? 283 PHE B CE1   1 
ATOM   5977 C CE2   . PHE B 2 283 ? 9.851  9.707   30.744  1.00 31.71  ? 283 PHE B CE2   1 
ATOM   5978 C CZ    . PHE B 2 283 ? 9.776  8.328   30.463  1.00 31.21  ? 283 PHE B CZ    1 
ATOM   5979 N N     . ARG B 2 284 ? 4.284  9.106   33.086  1.00 38.52  ? 284 ARG B N     1 
ATOM   5980 C CA    . ARG B 2 284 ? 3.719  7.862   33.634  1.00 39.94  ? 284 ARG B CA    1 
ATOM   5981 C C     . ARG B 2 284 ? 4.529  6.633   33.195  1.00 38.62  ? 284 ARG B C     1 
ATOM   5982 O O     . ARG B 2 284 ? 4.693  6.377   32.003  1.00 37.74  ? 284 ARG B O     1 
ATOM   5983 C CB    . ARG B 2 284 ? 2.267  7.728   33.177  1.00 42.22  ? 284 ARG B CB    1 
ATOM   5984 C CG    . ARG B 2 284 ? 1.309  7.375   34.278  1.00 46.81  ? 284 ARG B CG    1 
ATOM   5985 C CD    . ARG B 2 284 ? -0.066 7.976   34.033  1.00 51.75  ? 284 ARG B CD    1 
ATOM   5986 N NE    . ARG B 2 284 ? -0.546 8.669   35.232  1.00 56.44  ? 284 ARG B NE    1 
ATOM   5987 C CZ    . ARG B 2 284 ? -0.815 9.976   35.303  1.00 58.05  ? 284 ARG B CZ    1 
ATOM   5988 N NH1   . ARG B 2 284 ? -0.688 10.752  34.228  1.00 56.58  ? 284 ARG B NH1   1 
ATOM   5989 N NH2   . ARG B 2 284 ? -1.238 10.509  36.451  1.00 60.21  ? 284 ARG B NH2   1 
ATOM   5990 N N     . LYS B 2 285 ? 5.073  5.901   34.161  1.00 38.50  ? 285 LYS B N     1 
ATOM   5991 C CA    . LYS B 2 285 ? 5.840  4.699   33.861  1.00 37.80  ? 285 LYS B CA    1 
ATOM   5992 C C     . LYS B 2 285 ? 4.896  3.769   33.148  1.00 38.77  ? 285 LYS B C     1 
ATOM   5993 O O     . LYS B 2 285 ? 3.806  3.531   33.662  1.00 40.53  ? 285 LYS B O     1 
ATOM   5994 C CB    . LYS B 2 285 ? 6.293  4.047   35.154  1.00 38.74  ? 285 LYS B CB    1 
ATOM   5995 C CG    . LYS B 2 285 ? 7.179  2.837   35.008  1.00 39.19  ? 285 LYS B CG    1 
ATOM   5996 C CD    . LYS B 2 285 ? 7.065  2.043   36.288  1.00 43.27  ? 285 LYS B CD    1 
ATOM   5997 C CE    . LYS B 2 285 ? 8.282  1.177   36.553  1.00 46.11  ? 285 LYS B CE    1 
ATOM   5998 N NZ    . LYS B 2 285 ? 8.237  0.555   37.929  1.00 49.61  ? 285 LYS B NZ    1 
ATOM   5999 N N     . PRO B 2 286 ? 5.284  3.276   31.952  1.00 38.03  ? 286 PRO B N     1 
ATOM   6000 C CA    . PRO B 2 286 ? 4.460  2.329   31.185  1.00 39.65  ? 286 PRO B CA    1 
ATOM   6001 C C     . PRO B 2 286 ? 4.320  1.026   31.944  1.00 41.26  ? 286 PRO B C     1 
ATOM   6002 O O     . PRO B 2 286 ? 5.117  0.772   32.840  1.00 41.27  ? 286 PRO B O     1 
ATOM   6003 C CB    . PRO B 2 286 ? 5.266  2.104   29.897  1.00 38.72  ? 286 PRO B CB    1 
ATOM   6004 C CG    . PRO B 2 286 ? 6.207  3.245   29.821  1.00 36.73  ? 286 PRO B CG    1 
ATOM   6005 C CD    . PRO B 2 286 ? 6.532  3.598   31.242  1.00 36.38  ? 286 PRO B CD    1 
ATOM   6006 N N     . ASP B 2 287 ? 3.322  0.210   31.608  1.00 43.27  ? 287 ASP B N     1 
ATOM   6007 C CA    . ASP B 2 287 ? 3.153  -1.065  32.315  1.00 44.88  ? 287 ASP B CA    1 
ATOM   6008 C C     . ASP B 2 287 ? 3.863  -2.219  31.653  1.00 45.43  ? 287 ASP B C     1 
ATOM   6009 O O     . ASP B 2 287 ? 3.228  -3.146  31.171  1.00 48.11  ? 287 ASP B O     1 
ATOM   6010 C CB    . ASP B 2 287 ? 1.686  -1.419  32.526  1.00 47.14  ? 287 ASP B CB    1 
ATOM   6011 C CG    . ASP B 2 287 ? 1.505  -2.400  33.649  1.00 48.44  ? 287 ASP B CG    1 
ATOM   6012 O OD1   . ASP B 2 287 ? 2.499  -2.652  34.350  1.00 46.81  ? 287 ASP B OD1   1 
ATOM   6013 O OD2   . ASP B 2 287 ? 0.391  -2.923  33.836  1.00 52.63  ? 287 ASP B OD2   1 
ATOM   6014 N N     . ILE B 2 288 ? 5.186  -2.178  31.663  1.00 44.08  ? 288 ILE B N     1 
ATOM   6015 C CA    . ILE B 2 288 ? 6.001  -3.188  30.984  1.00 44.84  ? 288 ILE B CA    1 
ATOM   6016 C C     . ILE B 2 288 ? 7.122  -3.682  31.885  1.00 44.89  ? 288 ILE B C     1 
ATOM   6017 O O     . ILE B 2 288 ? 7.606  -2.921  32.720  1.00 43.65  ? 288 ILE B O     1 
ATOM   6018 C CB    . ILE B 2 288 ? 6.611  -2.615  29.686  1.00 43.70  ? 288 ILE B CB    1 
ATOM   6019 C CG1   . ILE B 2 288 ? 7.310  -1.271  29.954  1.00 40.67  ? 288 ILE B CG1   1 
ATOM   6020 C CG2   . ILE B 2 288 ? 5.526  -2.427  28.631  1.00 44.99  ? 288 ILE B CG2   1 
ATOM   6021 C CD1   . ILE B 2 288 ? 8.111  -0.749  28.784  1.00 38.77  ? 288 ILE B CD1   1 
ATOM   6022 N N     . VAL B 2 289 ? 7.542  -4.937  31.702  1.00 46.86  ? 289 VAL B N     1 
ATOM   6023 C CA    . VAL B 2 289 ? 8.660  -5.513  32.460  1.00 47.65  ? 289 VAL B CA    1 
ATOM   6024 C C     . VAL B 2 289 ? 9.934  -4.662  32.328  1.00 45.94  ? 289 VAL B C     1 
ATOM   6025 O O     . VAL B 2 289 ? 10.109 -3.919  31.352  1.00 44.24  ? 289 VAL B O     1 
ATOM   6026 C CB    . VAL B 2 289 ? 8.966  -6.986  32.074  1.00 50.41  ? 289 VAL B CB    1 
ATOM   6027 C CG1   . VAL B 2 289 ? 7.690  -7.829  32.055  1.00 53.66  ? 289 VAL B CG1   1 
ATOM   6028 C CG2   . VAL B 2 289 ? 9.663  -7.076  30.738  1.00 50.20  ? 289 VAL B CG2   1 
ATOM   6029 N N     . ASP B 2 290 ? 10.805 -4.768  33.328  1.00 46.41  ? 290 ASP B N     1 
ATOM   6030 C CA    . ASP B 2 290 ? 12.023 -3.982  33.375  1.00 45.04  ? 290 ASP B CA    1 
ATOM   6031 C C     . ASP B 2 290 ? 12.848 -4.099  32.094  1.00 45.15  ? 290 ASP B C     1 
ATOM   6032 O O     . ASP B 2 290 ? 13.333 -3.070  31.551  1.00 43.13  ? 290 ASP B O     1 
ATOM   6033 C CB    . ASP B 2 290 ? 12.878 -4.396  34.577  1.00 46.56  ? 290 ASP B CB    1 
ATOM   6034 C CG    . ASP B 2 290 ? 12.454 -3.717  35.866  1.00 46.24  ? 290 ASP B CG    1 
ATOM   6035 O OD1   . ASP B 2 290 ? 11.731 -2.691  35.796  1.00 45.31  ? 290 ASP B OD1   1 
ATOM   6036 O OD2   . ASP B 2 290 ? 12.859 -4.209  36.947  1.00 47.01  ? 290 ASP B OD2   1 
ATOM   6037 N N     . ASP B 2 291 ? 12.993 -5.341  31.619  1.00 47.22  ? 291 ASP B N     1 
ATOM   6038 C CA    . ASP B 2 291 ? 13.874 -5.660  30.499  1.00 48.15  ? 291 ASP B CA    1 
ATOM   6039 C C     . ASP B 2 291 ? 13.382 -5.105  29.171  1.00 47.07  ? 291 ASP B C     1 
ATOM   6040 O O     . ASP B 2 291 ? 14.159 -5.021  28.214  1.00 47.37  ? 291 ASP B O     1 
ATOM   6041 C CB    . ASP B 2 291 ? 14.069 -7.155  30.406  1.00 52.09  ? 291 ASP B CB    1 
ATOM   6042 C CG    . ASP B 2 291 ? 14.222 -7.778  31.754  1.00 54.76  ? 291 ASP B CG    1 
ATOM   6043 O OD1   . ASP B 2 291 ? 13.211 -8.313  32.257  1.00 57.03  ? 291 ASP B OD1   1 
ATOM   6044 O OD2   . ASP B 2 291 ? 15.333 -7.685  32.323  1.00 56.60  ? 291 ASP B OD2   1 
ATOM   6045 N N     . ASN B 2 292 ? 12.098 -4.741  29.113  1.00 46.14  ? 292 ASN B N     1 
ATOM   6046 C CA    . ASN B 2 292 ? 11.597 -3.848  28.059  1.00 44.53  ? 292 ASN B CA    1 
ATOM   6047 C C     . ASN B 2 292 ? 11.821 -2.385  28.378  1.00 41.45  ? 292 ASN B C     1 
ATOM   6048 O O     . ASN B 2 292 ? 12.182 -1.630  27.497  1.00 40.90  ? 292 ASN B O     1 
ATOM   6049 C CB    . ASN B 2 292 ? 10.123 -4.103  27.763  1.00 45.19  ? 292 ASN B CB    1 
ATOM   6050 C CG    . ASN B 2 292 ? 9.895  -5.462  27.140  1.00 48.65  ? 292 ASN B CG    1 
ATOM   6051 O OD1   . ASN B 2 292 ? 10.726 -5.945  26.378  1.00 50.51  ? 292 ASN B OD1   1 
ATOM   6052 N ND2   . ASN B 2 292 ? 8.779  -6.097  27.474  1.00 50.68  ? 292 ASN B ND2   1 
ATOM   6053 N N     . LEU B 2 293 ? 11.637 -1.996  29.634  1.00 40.43  ? 293 LEU B N     1 
ATOM   6054 C CA    . LEU B 2 293 ? 11.634 -0.583  30.020  1.00 38.64  ? 293 LEU B CA    1 
ATOM   6055 C C     . LEU B 2 293 ? 12.968 0.169   29.857  1.00 37.42  ? 293 LEU B C     1 
ATOM   6056 O O     . LEU B 2 293 ? 13.028 1.183   29.166  1.00 35.66  ? 293 LEU B O     1 
ATOM   6057 C CB    . LEU B 2 293 ? 11.152 -0.423  31.465  1.00 38.68  ? 293 LEU B CB    1 
ATOM   6058 C CG    . LEU B 2 293 ? 10.361 0.827   31.911  1.00 37.27  ? 293 LEU B CG    1 
ATOM   6059 C CD1   . LEU B 2 293 ? 10.852 1.296   33.261  1.00 37.39  ? 293 LEU B CD1   1 
ATOM   6060 C CD2   . LEU B 2 293 ? 10.325 1.983   30.918  1.00 34.91  ? 293 LEU B CD2   1 
ATOM   6061 N N     . TYR B 2 294 ? 14.018 -0.337  30.505  1.00 38.52  ? 294 TYR B N     1 
ATOM   6062 C CA    . TYR B 2 294 ? 15.298 0.355   30.600  1.00 37.54  ? 294 TYR B CA    1 
ATOM   6063 C C     . TYR B 2 294 ? 15.993 0.625   29.276  1.00 37.61  ? 294 TYR B C     1 
ATOM   6064 O O     . TYR B 2 294 ? 16.437 1.758   29.045  1.00 36.29  ? 294 TYR B O     1 
ATOM   6065 C CB    . TYR B 2 294 ? 16.231 -0.351  31.582  1.00 39.24  ? 294 TYR B CB    1 
ATOM   6066 C CG    . TYR B 2 294 ? 15.825 -0.148  33.025  1.00 39.23  ? 294 TYR B CG    1 
ATOM   6067 C CD1   . TYR B 2 294 ? 15.094 -1.113  33.696  1.00 42.01  ? 294 TYR B CD1   1 
ATOM   6068 C CD2   . TYR B 2 294 ? 16.155 1.018   33.711  1.00 37.47  ? 294 TYR B CD2   1 
ATOM   6069 C CE1   . TYR B 2 294 ? 14.709 -0.937  35.023  1.00 42.92  ? 294 TYR B CE1   1 
ATOM   6070 C CE2   . TYR B 2 294 ? 15.777 1.211   35.041  1.00 38.36  ? 294 TYR B CE2   1 
ATOM   6071 C CZ    . TYR B 2 294 ? 15.052 0.227   35.693  1.00 41.12  ? 294 TYR B CZ    1 
ATOM   6072 O OH    . TYR B 2 294 ? 14.660 0.383   37.010  1.00 41.61  ? 294 TYR B OH    1 
ATOM   6073 N N     . PRO B 2 295 ? 16.071 -0.382  28.384  1.00 39.85  ? 295 PRO B N     1 
ATOM   6074 C CA    . PRO B 2 295 ? 16.677 -0.040  27.104  1.00 40.12  ? 295 PRO B CA    1 
ATOM   6075 C C     . PRO B 2 295 ? 15.924 1.140   26.488  1.00 38.76  ? 295 PRO B C     1 
ATOM   6076 O O     . PRO B 2 295 ? 16.548 2.051   25.928  1.00 37.74  ? 295 PRO B O     1 
ATOM   6077 C CB    . PRO B 2 295 ? 16.461 -1.297  26.267  1.00 42.49  ? 295 PRO B CB    1 
ATOM   6078 C CG    . PRO B 2 295 ? 16.267 -2.361  27.219  1.00 43.78  ? 295 PRO B CG    1 
ATOM   6079 C CD    . PRO B 2 295 ? 15.637 -1.790  28.424  1.00 42.28  ? 295 PRO B CD    1 
ATOM   6080 N N     . GLN B 2 296 ? 14.596 1.124   26.630  1.00 38.96  ? 296 GLN B N     1 
ATOM   6081 C CA    . GLN B 2 296 ? 13.731 2.175   26.110  1.00 38.25  ? 296 GLN B CA    1 
ATOM   6082 C C     . GLN B 2 296 ? 14.040 3.506   26.731  1.00 36.92  ? 296 GLN B C     1 
ATOM   6083 O O     . GLN B 2 296 ? 14.081 4.533   26.030  1.00 36.41  ? 296 GLN B O     1 
ATOM   6084 C CB    . GLN B 2 296 ? 12.267 1.844   26.352  1.00 38.56  ? 296 GLN B CB    1 
ATOM   6085 C CG    . GLN B 2 296 ? 11.718 0.864   25.356  1.00 40.35  ? 296 GLN B CG    1 
ATOM   6086 C CD    . GLN B 2 296 ? 10.224 0.868   25.305  1.00 39.02  ? 296 GLN B CD    1 
ATOM   6087 O OE1   . GLN B 2 296 ? 9.588  1.905   25.492  1.00 36.04  ? 296 GLN B OE1   1 
ATOM   6088 N NE2   . GLN B 2 296 ? 9.644  -0.296  25.032  1.00 39.73  ? 296 GLN B NE2   1 
ATOM   6089 N N     . LEU B 2 297 ? 14.262 3.488   28.045  1.00 37.22  ? 297 LEU B N     1 
ATOM   6090 C CA    . LEU B 2 297 ? 14.550 4.713   28.785  1.00 36.47  ? 297 LEU B CA    1 
ATOM   6091 C C     . LEU B 2 297 ? 15.904 5.254   28.377  1.00 36.14  ? 297 LEU B C     1 
ATOM   6092 O O     . LEU B 2 297 ? 16.059 6.454   28.244  1.00 34.88  ? 297 LEU B O     1 
ATOM   6093 C CB    . LEU B 2 297 ? 14.530 4.466   30.296  1.00 37.04  ? 297 LEU B CB    1 
ATOM   6094 C CG    . LEU B 2 297 ? 13.227 4.201   31.055  1.00 37.23  ? 297 LEU B CG    1 
ATOM   6095 C CD1   . LEU B 2 297 ? 13.560 3.796   32.485  1.00 36.91  ? 297 LEU B CD1   1 
ATOM   6096 C CD2   . LEU B 2 297 ? 12.317 5.424   31.041  1.00 35.72  ? 297 LEU B CD2   1 
ATOM   6097 N N     . GLU B 2 298 ? 16.868 4.345   28.197  1.00 37.59  ? 298 GLU B N     1 
ATOM   6098 C CA    . GLU B 2 298 ? 18.194 4.664   27.695  1.00 38.08  ? 298 GLU B CA    1 
ATOM   6099 C C     . GLU B 2 298 ? 18.066 5.359   26.371  1.00 37.37  ? 298 GLU B C     1 
ATOM   6100 O O     . GLU B 2 298 ? 18.741 6.349   26.105  1.00 36.49  ? 298 GLU B O     1 
ATOM   6101 C CB    . GLU B 2 298 ? 18.962 3.391   27.403  1.00 40.77  ? 298 GLU B CB    1 
ATOM   6102 C CG    . GLU B 2 298 ? 19.593 2.681   28.554  1.00 45.19  ? 298 GLU B CG    1 
ATOM   6103 C CD    . GLU B 2 298 ? 20.602 1.653   28.049  1.00 52.54  ? 298 GLU B CD    1 
ATOM   6104 O OE1   . GLU B 2 298 ? 21.489 2.055   27.255  1.00 56.03  ? 298 GLU B OE1   1 
ATOM   6105 O OE2   . GLU B 2 298 ? 20.512 0.455   28.417  1.00 55.70  ? 298 GLU B OE2   1 
ATOM   6106 N N     . ARG B 2 299 ? 17.216 4.797   25.519  1.00 38.28  ? 299 ARG B N     1 
ATOM   6107 C CA    . ARG B 2 299 ? 16.989 5.351   24.205  1.00 38.31  ? 299 ARG B CA    1 
ATOM   6108 C C     . ARG B 2 299 ? 16.402 6.750   24.309  1.00 36.75  ? 299 ARG B C     1 
ATOM   6109 O O     . ARG B 2 299 ? 16.897 7.668   23.671  1.00 35.93  ? 299 ARG B O     1 
ATOM   6110 C CB    . ARG B 2 299 ? 16.061 4.462   23.403  1.00 39.63  ? 299 ARG B CB    1 
ATOM   6111 C CG    . ARG B 2 299 ? 15.518 5.151   22.192  1.00 39.83  ? 299 ARG B CG    1 
ATOM   6112 C CD    . ARG B 2 299 ? 15.171 4.195   21.134  1.00 42.67  ? 299 ARG B CD    1 
ATOM   6113 N NE    . ARG B 2 299 ? 15.738 4.652   19.884  1.00 45.09  ? 299 ARG B NE    1 
ATOM   6114 C CZ    . ARG B 2 299 ? 15.032 5.231   18.931  1.00 46.83  ? 299 ARG B CZ    1 
ATOM   6115 N NH1   . ARG B 2 299 ? 13.719 5.395   19.094  1.00 47.86  ? 299 ARG B NH1   1 
ATOM   6116 N NH2   . ARG B 2 299 ? 15.636 5.634   17.825  1.00 46.75  ? 299 ARG B NH2   1 
ATOM   6117 N N     . ALA B 2 300 ? 15.352 6.898   25.117  1.00 36.33  ? 300 ALA B N     1 
ATOM   6118 C CA    . ALA B 2 300 ? 14.667 8.175   25.262  1.00 35.65  ? 300 ALA B CA    1 
ATOM   6119 C C     . ALA B 2 300 ? 15.645 9.245   25.735  1.00 34.82  ? 300 ALA B C     1 
ATOM   6120 O O     . ALA B 2 300 ? 15.658 10.363  25.216  1.00 34.37  ? 300 ALA B O     1 
ATOM   6121 C CB    . ALA B 2 300 ? 13.532 8.041   26.234  1.00 35.51  ? 300 ALA B CB    1 
ATOM   6122 N N     . SER B 2 301 ? 16.465 8.853   26.711  1.00 34.93  ? 301 SER B N     1 
ATOM   6123 C CA    . SER B 2 301 ? 17.486 9.659   27.343  1.00 34.53  ? 301 SER B CA    1 
ATOM   6124 C C     . SER B 2 301 ? 18.477 10.212  26.315  1.00 35.24  ? 301 SER B C     1 
ATOM   6125 O O     . SER B 2 301 ? 18.766 11.427  26.256  1.00 34.18  ? 301 SER B O     1 
ATOM   6126 C CB    . SER B 2 301 ? 18.212 8.751   28.334  1.00 34.81  ? 301 SER B CB    1 
ATOM   6127 O OG    . SER B 2 301 ? 19.079 9.460   29.193  1.00 35.80  ? 301 SER B OG    1 
ATOM   6128 N N     . ARG B 2 302 ? 18.976 9.294   25.493  1.00 37.13  ? 302 ARG B N     1 
ATOM   6129 C CA    . ARG B 2 302 ? 20.019 9.570   24.520  1.00 38.34  ? 302 ARG B CA    1 
ATOM   6130 C C     . ARG B 2 302 ? 19.535 10.530  23.451  1.00 38.76  ? 302 ARG B C     1 
ATOM   6131 O O     . ARG B 2 302 ? 20.287 11.406  23.005  1.00 39.45  ? 302 ARG B O     1 
ATOM   6132 C CB    . ARG B 2 302 ? 20.446 8.271   23.859  1.00 40.05  ? 302 ARG B CB    1 
ATOM   6133 C CG    . ARG B 2 302 ? 21.878 8.228   23.437  1.00 41.94  ? 302 ARG B CG    1 
ATOM   6134 C CD    . ARG B 2 302 ? 22.104 7.141   22.400  1.00 44.75  ? 302 ARG B CD    1 
ATOM   6135 N NE    . ARG B 2 302 ? 21.808 7.642   21.059  1.00 46.62  ? 302 ARG B NE    1 
ATOM   6136 C CZ    . ARG B 2 302 ? 20.928 7.114   20.209  1.00 47.63  ? 302 ARG B CZ    1 
ATOM   6137 N NH1   . ARG B 2 302 ? 20.235 6.024   20.524  1.00 47.21  ? 302 ARG B NH1   1 
ATOM   6138 N NH2   . ARG B 2 302 ? 20.752 7.686   19.022  1.00 48.16  ? 302 ARG B NH2   1 
ATOM   6139 N N     . LYS B 2 303 ? 18.280 10.370  23.038  1.00 39.03  ? 303 LYS B N     1 
ATOM   6140 C CA    . LYS B 2 303 ? 17.752 11.151  21.923  1.00 39.72  ? 303 LYS B CA    1 
ATOM   6141 C C     . LYS B 2 303 ? 17.629 12.627  22.315  1.00 38.57  ? 303 LYS B C     1 
ATOM   6142 O O     . LYS B 2 303 ? 18.019 13.526  21.558  1.00 38.81  ? 303 LYS B O     1 
ATOM   6143 C CB    . LYS B 2 303 ? 16.415 10.581  21.444  1.00 40.35  ? 303 LYS B CB    1 
ATOM   6144 C CG    . LYS B 2 303 ? 16.533 9.252   20.702  1.00 42.76  ? 303 LYS B CG    1 
ATOM   6145 C CD    . LYS B 2 303 ? 17.283 9.381   19.375  1.00 45.19  ? 303 LYS B CD    1 
ATOM   6146 C CE    . LYS B 2 303 ? 16.488 10.185  18.362  1.00 46.31  ? 303 LYS B CE    1 
ATOM   6147 N NZ    . LYS B 2 303 ? 17.214 10.334  17.085  1.00 48.40  ? 303 LYS B NZ    1 
ATOM   6148 N N     . ILE B 2 304 ? 17.112 12.850  23.520  1.00 37.29  ? 304 ILE B N     1 
ATOM   6149 C CA    . ILE B 2 304 ? 17.006 14.175  24.070  1.00 36.36  ? 304 ILE B CA    1 
ATOM   6150 C C     . ILE B 2 304 ? 18.399 14.777  24.268  1.00 36.06  ? 304 ILE B C     1 
ATOM   6151 O O     . ILE B 2 304 ? 18.612 15.957  23.960  1.00 36.26  ? 304 ILE B O     1 
ATOM   6152 C CB    . ILE B 2 304 ? 16.230 14.176  25.390  1.00 35.58  ? 304 ILE B CB    1 
ATOM   6153 C CG1   . ILE B 2 304 ? 14.808 13.664  25.166  1.00 35.83  ? 304 ILE B CG1   1 
ATOM   6154 C CG2   . ILE B 2 304 ? 16.190 15.587  25.981  1.00 35.07  ? 304 ILE B CG2   1 
ATOM   6155 C CD1   . ILE B 2 304 ? 14.207 13.004  26.400  1.00 35.81  ? 304 ILE B CD1   1 
ATOM   6156 N N     . PHE B 2 305 ? 19.333 13.970  24.767  1.00 35.67  ? 305 PHE B N     1 
ATOM   6157 C CA    . PHE B 2 305 ? 20.690 14.440  25.016  1.00 35.22  ? 305 PHE B CA    1 
ATOM   6158 C C     . PHE B 2 305 ? 21.229 14.940  23.705  1.00 36.20  ? 305 PHE B C     1 
ATOM   6159 O O     . PHE B 2 305 ? 21.708 16.075  23.591  1.00 36.00  ? 305 PHE B O     1 
ATOM   6160 C CB    . PHE B 2 305 ? 21.566 13.297  25.525  1.00 35.72  ? 305 PHE B CB    1 
ATOM   6161 C CG    . PHE B 2 305 ? 22.926 13.728  25.995  1.00 34.54  ? 305 PHE B CG    1 
ATOM   6162 C CD1   . PHE B 2 305 ? 23.117 14.180  27.294  1.00 33.84  ? 305 PHE B CD1   1 
ATOM   6163 C CD2   . PHE B 2 305 ? 24.024 13.654  25.153  1.00 36.23  ? 305 PHE B CD2   1 
ATOM   6164 C CE1   . PHE B 2 305 ? 24.385 14.579  27.746  1.00 34.32  ? 305 PHE B CE1   1 
ATOM   6165 C CE2   . PHE B 2 305 ? 25.303 14.046  25.590  1.00 37.10  ? 305 PHE B CE2   1 
ATOM   6166 C CZ    . PHE B 2 305 ? 25.480 14.513  26.889  1.00 35.87  ? 305 PHE B CZ    1 
ATOM   6167 N N     . GLU B 2 306 ? 21.125 14.089  22.694  1.00 37.65  ? 306 GLU B N     1 
ATOM   6168 C CA    . GLU B 2 306 ? 21.640 14.441  21.381  1.00 39.12  ? 306 GLU B CA    1 
ATOM   6169 C C     . GLU B 2 306 ? 20.960 15.707  20.848  1.00 38.54  ? 306 GLU B C     1 
ATOM   6170 O O     . GLU B 2 306 ? 21.637 16.597  20.326  1.00 39.00  ? 306 GLU B O     1 
ATOM   6171 C CB    . GLU B 2 306 ? 21.542 13.263  20.423  1.00 40.75  ? 306 GLU B CB    1 
ATOM   6172 C CG    . GLU B 2 306 ? 22.703 12.298  20.568  1.00 43.52  ? 306 GLU B CG    1 
ATOM   6173 C CD    . GLU B 2 306 ? 22.455 10.964  19.861  1.00 49.10  ? 306 GLU B CD    1 
ATOM   6174 O OE1   . GLU B 2 306 ? 21.473 10.868  19.081  1.00 50.74  ? 306 GLU B OE1   1 
ATOM   6175 O OE2   . GLU B 2 306 ? 23.234 10.004  20.088  1.00 50.74  ? 306 GLU B OE2   1 
ATOM   6176 N N     . PHE B 2 307 ? 19.639 15.802  21.018  1.00 37.63  ? 307 PHE B N     1 
ATOM   6177 C CA    . PHE B 2 307 ? 18.917 17.039  20.689  1.00 37.53  ? 307 PHE B CA    1 
ATOM   6178 C C     . PHE B 2 307 ? 19.581 18.270  21.314  1.00 36.47  ? 307 PHE B C     1 
ATOM   6179 O O     . PHE B 2 307 ? 19.911 19.225  20.629  1.00 36.37  ? 307 PHE B O     1 
ATOM   6180 C CB    . PHE B 2 307 ? 17.440 16.966  21.108  1.00 37.09  ? 307 PHE B CB    1 
ATOM   6181 C CG    . PHE B 2 307 ? 16.754 18.318  21.148  1.00 37.22  ? 307 PHE B CG    1 
ATOM   6182 C CD1   . PHE B 2 307 ? 16.200 18.867  20.000  1.00 38.71  ? 307 PHE B CD1   1 
ATOM   6183 C CD2   . PHE B 2 307 ? 16.668 19.039  22.340  1.00 36.01  ? 307 PHE B CD2   1 
ATOM   6184 C CE1   . PHE B 2 307 ? 15.572 20.097  20.036  1.00 38.60  ? 307 PHE B CE1   1 
ATOM   6185 C CE2   . PHE B 2 307 ? 16.059 20.267  22.384  1.00 36.17  ? 307 PHE B CE2   1 
ATOM   6186 C CZ    . PHE B 2 307 ? 15.506 20.802  21.225  1.00 38.22  ? 307 PHE B CZ    1 
ATOM   6187 N N     . LEU B 2 308 ? 19.782 18.199  22.628  1.00 35.24  ? 308 LEU B N     1 
ATOM   6188 C CA    . LEU B 2 308 ? 20.319 19.284  23.422  1.00 34.68  ? 308 LEU B CA    1 
ATOM   6189 C C     . LEU B 2 308 ? 21.695 19.716  22.961  1.00 35.51  ? 308 LEU B C     1 
ATOM   6190 O O     . LEU B 2 308 ? 22.082 20.880  23.130  1.00 35.44  ? 308 LEU B O     1 
ATOM   6191 C CB    . LEU B 2 308 ? 20.415 18.839  24.879  1.00 33.54  ? 308 LEU B CB    1 
ATOM   6192 C CG    . LEU B 2 308 ? 19.131 18.863  25.702  1.00 33.72  ? 308 LEU B CG    1 
ATOM   6193 C CD1   . LEU B 2 308 ? 19.233 17.900  26.870  1.00 32.17  ? 308 LEU B CD1   1 
ATOM   6194 C CD2   . LEU B 2 308 ? 18.776 20.303  26.171  1.00 33.64  ? 308 LEU B CD2   1 
ATOM   6195 N N     . GLU B 2 309 ? 22.460 18.769  22.430  1.00 36.19  ? 309 GLU B N     1 
ATOM   6196 C CA    . GLU B 2 309 ? 23.823 19.095  22.126  1.00 37.40  ? 309 GLU B CA    1 
ATOM   6197 C C     . GLU B 2 309 ? 23.907 19.735  20.779  1.00 38.18  ? 309 GLU B C     1 
ATOM   6198 O O     . GLU B 2 309 ? 24.665 20.682  20.592  1.00 39.05  ? 309 GLU B O     1 
ATOM   6199 C CB    . GLU B 2 309 ? 24.799 17.926  22.335  1.00 37.77  ? 309 GLU B CB    1 
ATOM   6200 C CG    . GLU B 2 309 ? 24.650 16.676  21.520  1.00 40.37  ? 309 GLU B CG    1 
ATOM   6201 C CD    . GLU B 2 309 ? 25.664 15.608  21.946  1.00 41.77  ? 309 GLU B CD    1 
ATOM   6202 O OE1   . GLU B 2 309 ? 25.403 14.397  21.714  1.00 46.46  ? 309 GLU B OE1   1 
ATOM   6203 O OE2   . GLU B 2 309 ? 26.716 15.973  22.529  1.00 43.85  ? 309 GLU B OE2   1 
ATOM   6204 N N     . ARG B 2 310 ? 23.082 19.254  19.858  1.00 38.66  ? 310 ARG B N     1 
ATOM   6205 C CA    . ARG B 2 310 ? 23.010 19.852  18.531  1.00 40.19  ? 310 ARG B CA    1 
ATOM   6206 C C     . ARG B 2 310 ? 22.251 21.170  18.558  1.00 39.44  ? 310 ARG B C     1 
ATOM   6207 O O     . ARG B 2 310 ? 22.312 21.943  17.619  1.00 40.76  ? 310 ARG B O     1 
ATOM   6208 C CB    . ARG B 2 310 ? 22.399 18.887  17.512  1.00 41.64  ? 310 ARG B CB    1 
ATOM   6209 C CG    . ARG B 2 310 ? 20.930 18.662  17.659  1.00 40.13  ? 310 ARG B CG    1 
ATOM   6210 C CD    . ARG B 2 310 ? 20.411 17.859  16.499  1.00 40.75  ? 310 ARG B CD    1 
ATOM   6211 N NE    . ARG B 2 310 ? 18.980 17.711  16.646  1.00 38.65  ? 310 ARG B NE    1 
ATOM   6212 C CZ    . ARG B 2 310 ? 18.413 16.699  17.274  1.00 37.77  ? 310 ARG B CZ    1 
ATOM   6213 N NH1   . ARG B 2 310 ? 19.167 15.729  17.787  1.00 38.51  ? 310 ARG B NH1   1 
ATOM   6214 N NH2   . ARG B 2 310 ? 17.095 16.655  17.386  1.00 37.50  ? 310 ARG B NH2   1 
ATOM   6215 N N     . GLU B 2 311 ? 21.552 21.398  19.660  1.00 37.84  ? 311 GLU B N     1 
ATOM   6216 C CA    . GLU B 2 311 ? 20.789 22.601  19.880  1.00 37.78  ? 311 GLU B CA    1 
ATOM   6217 C C     . GLU B 2 311 ? 21.633 23.559  20.705  1.00 37.10  ? 311 GLU B C     1 
ATOM   6218 O O     . GLU B 2 311 ? 21.221 24.681  20.982  1.00 37.73  ? 311 GLU B O     1 
ATOM   6219 C CB    . GLU B 2 311 ? 19.468 22.269  20.571  1.00 36.66  ? 311 GLU B CB    1 
ATOM   6220 C CG    . GLU B 2 311 ? 18.318 23.172  20.189  1.00 38.76  ? 311 GLU B CG    1 
ATOM   6221 C CD    . GLU B 2 311 ? 18.104 23.303  18.682  1.00 42.06  ? 311 GLU B CD    1 
ATOM   6222 O OE1   . GLU B 2 311 ? 17.486 22.403  18.074  1.00 44.11  ? 311 GLU B OE1   1 
ATOM   6223 O OE2   . GLU B 2 311 ? 18.530 24.322  18.106  1.00 44.12  ? 311 GLU B OE2   1 
ATOM   6224 N N     . ASN B 2 312 ? 22.832 23.104  21.055  1.00 36.46  ? 312 ASN B N     1 
ATOM   6225 C CA    . ASN B 2 312 ? 23.870 23.909  21.712  1.00 36.37  ? 312 ASN B CA    1 
ATOM   6226 C C     . ASN B 2 312 ? 23.621 24.310  23.141  1.00 35.30  ? 312 ASN B C     1 
ATOM   6227 O O     . ASN B 2 312 ? 24.033 25.399  23.546  1.00 35.81  ? 312 ASN B O     1 
ATOM   6228 C CB    . ASN B 2 312 ? 24.216 25.160  20.903  1.00 37.84  ? 312 ASN B CB    1 
ATOM   6229 C CG    . ASN B 2 312 ? 25.101 24.854  19.741  1.00 39.08  ? 312 ASN B CG    1 
ATOM   6230 O OD1   . ASN B 2 312 ? 24.719 25.070  18.596  1.00 39.23  ? 312 ASN B OD1   1 
ATOM   6231 N ND2   . ASN B 2 312 ? 26.288 24.314  20.018  1.00 38.03  ? 312 ASN B ND2   1 
ATOM   6232 N N     . PHE B 2 313 ? 22.974 23.442  23.910  1.00 34.29  ? 313 PHE B N     1 
ATOM   6233 C CA    . PHE B 2 313 ? 22.826 23.715  25.336  1.00 33.83  ? 313 PHE B CA    1 
ATOM   6234 C C     . PHE B 2 313 ? 23.967 23.108  26.135  1.00 34.02  ? 313 PHE B C     1 
ATOM   6235 O O     . PHE B 2 313 ? 24.108 23.404  27.326  1.00 33.90  ? 313 PHE B O     1 
ATOM   6236 C CB    . PHE B 2 313 ? 21.446 23.319  25.868  1.00 32.84  ? 313 PHE B CB    1 
ATOM   6237 C CG    . PHE B 2 313 ? 20.350 24.237  25.416  1.00 32.56  ? 313 PHE B CG    1 
ATOM   6238 C CD1   . PHE B 2 313 ? 20.297 25.552  25.869  1.00 33.27  ? 313 PHE B CD1   1 
ATOM   6239 C CD2   . PHE B 2 313 ? 19.382 23.802  24.520  1.00 32.77  ? 313 PHE B CD2   1 
ATOM   6240 C CE1   . PHE B 2 313 ? 19.272 26.425  25.447  1.00 33.81  ? 313 PHE B CE1   1 
ATOM   6241 C CE2   . PHE B 2 313 ? 18.354 24.669  24.081  1.00 33.26  ? 313 PHE B CE2   1 
ATOM   6242 C CZ    . PHE B 2 313 ? 18.302 25.978  24.554  1.00 34.33  ? 313 PHE B CZ    1 
ATOM   6243 N N     . MET B 2 314 ? 24.778 22.286  25.452  1.00 34.96  ? 314 MET B N     1 
ATOM   6244 C CA    . MET B 2 314 ? 25.976 21.635  26.012  1.00 35.62  ? 314 MET B CA    1 
ATOM   6245 C C     . MET B 2 314 ? 25.637 20.759  27.200  1.00 34.79  ? 314 MET B C     1 
ATOM   6246 O O     . MET B 2 314 ? 26.108 21.013  28.298  1.00 34.80  ? 314 MET B O     1 
ATOM   6247 C CB    . MET B 2 314 ? 27.036 22.659  26.425  1.00 36.19  ? 314 MET B CB    1 
ATOM   6248 C CG    . MET B 2 314 ? 27.612 23.468  25.279  1.00 38.19  ? 314 MET B CG    1 
ATOM   6249 S SD    . MET B 2 314 ? 28.284 25.014  25.890  1.00 39.35  ? 314 MET B SD    1 
ATOM   6250 C CE    . MET B 2 314 ? 28.672 25.903  24.386  1.00 41.14  ? 314 MET B CE    1 
ATOM   6251 N N     . PRO B 2 315 ? 24.857 19.694  26.976  1.00 34.59  ? 315 PRO B N     1 
ATOM   6252 C CA    . PRO B 2 315 ? 24.433 18.851  28.077  1.00 34.48  ? 315 PRO B CA    1 
ATOM   6253 C C     . PRO B 2 315 ? 25.669 18.259  28.710  1.00 35.82  ? 315 PRO B C     1 
ATOM   6254 O O     . PRO B 2 315 ? 26.637 17.929  28.010  1.00 36.98  ? 315 PRO B O     1 
ATOM   6255 C CB    . PRO B 2 315 ? 23.660 17.732  27.380  1.00 33.94  ? 315 PRO B CB    1 
ATOM   6256 C CG    . PRO B 2 315 ? 24.205 17.710  26.010  1.00 34.14  ? 315 PRO B CG    1 
ATOM   6257 C CD    . PRO B 2 315 ? 24.418 19.147  25.687  1.00 34.75  ? 315 PRO B CD    1 
ATOM   6258 N N     . LEU B 2 316 ? 25.631 18.133  30.026  1.00 36.17  ? 316 LEU B N     1 
ATOM   6259 C CA    . LEU B 2 316 ? 26.736 17.576  30.773  1.00 37.27  ? 316 LEU B CA    1 
ATOM   6260 C C     . LEU B 2 316 ? 26.686 16.058  30.821  1.00 37.33  ? 316 LEU B C     1 
ATOM   6261 O O     . LEU B 2 316 ? 27.621 15.429  30.342  1.00 38.49  ? 316 LEU B O     1 
ATOM   6262 C CB    . LEU B 2 316 ? 26.780 18.182  32.173  1.00 37.75  ? 316 LEU B CB    1 
ATOM   6263 C CG    . LEU B 2 316 ? 28.114 18.853  32.438  1.00 39.36  ? 316 LEU B CG    1 
ATOM   6264 C CD1   . LEU B 2 316 ? 28.748 19.297  31.121  1.00 39.13  ? 316 LEU B CD1   1 
ATOM   6265 C CD2   . LEU B 2 316 ? 27.878 20.036  33.340  1.00 40.45  ? 316 LEU B CD2   1 
ATOM   6266 N N     . ARG B 2 317 ? 25.611 15.491  31.397  1.00 36.88  ? 317 ARG B N     1 
ATOM   6267 C CA    . ARG B 2 317 ? 25.339 14.019  31.422  1.00 37.20  ? 317 ARG B CA    1 
ATOM   6268 C C     . ARG B 2 317 ? 23.846 13.729  31.496  1.00 36.56  ? 317 ARG B C     1 
ATOM   6269 O O     . ARG B 2 317 ? 23.039 14.643  31.655  1.00 36.26  ? 317 ARG B O     1 
ATOM   6270 C CB    . ARG B 2 317 ? 25.991 13.342  32.617  1.00 38.11  ? 317 ARG B CB    1 
ATOM   6271 C CG    . ARG B 2 317 ? 27.503 13.408  32.660  1.00 39.91  ? 317 ARG B CG    1 
ATOM   6272 C CD    . ARG B 2 317 ? 28.043 12.923  33.999  1.00 40.67  ? 317 ARG B CD    1 
ATOM   6273 N NE    . ARG B 2 317 ? 28.194 11.475  34.035  1.00 40.52  ? 317 ARG B NE    1 
ATOM   6274 C CZ    . ARG B 2 317 ? 28.392 10.772  35.144  1.00 42.02  ? 317 ARG B CZ    1 
ATOM   6275 N NH1   . ARG B 2 317 ? 28.458 11.389  36.320  1.00 40.65  ? 317 ARG B NH1   1 
ATOM   6276 N NH2   . ARG B 2 317 ? 28.533 9.445   35.073  1.00 42.42  ? 317 ARG B NH2   1 
ATOM   6277 N N     . SER B 2 318 ? 23.483 12.453  31.383  1.00 37.09  ? 318 SER B N     1 
ATOM   6278 C CA    . SER B 2 318 ? 22.102 12.013  31.553  1.00 36.39  ? 318 SER B CA    1 
ATOM   6279 C C     . SER B 2 318 ? 22.005 11.055  32.704  1.00 37.17  ? 318 SER B C     1 
ATOM   6280 O O     . SER B 2 318 ? 23.005 10.471  33.118  1.00 38.35  ? 318 SER B O     1 
ATOM   6281 C CB    . SER B 2 318 ? 21.635 11.231  30.341  1.00 36.39  ? 318 SER B CB    1 
ATOM   6282 O OG    . SER B 2 318 ? 21.899 11.924  29.163  1.00 37.40  ? 318 SER B OG    1 
ATOM   6283 N N     . ALA B 2 319 ? 20.786 10.857  33.188  1.00 37.00  ? 319 ALA B N     1 
ATOM   6284 C CA    . ALA B 2 319 ? 20.463 9.704   34.024  1.00 38.46  ? 319 ALA B CA    1 
ATOM   6285 C C     . ALA B 2 319 ? 18.982 9.380   33.857  1.00 38.47  ? 319 ALA B C     1 
ATOM   6286 O O     . ALA B 2 319 ? 18.309 10.007  33.050  1.00 38.29  ? 319 ALA B O     1 
ATOM   6287 C CB    . ALA B 2 319 ? 20.824 9.960   35.495  1.00 39.29  ? 319 ALA B CB    1 
ATOM   6288 N N     . PHE B 2 320 ? 18.491 8.388   34.591  1.00 39.62  ? 320 PHE B N     1 
ATOM   6289 C CA    . PHE B 2 320 ? 17.071 8.012   34.573  1.00 39.75  ? 320 PHE B CA    1 
ATOM   6290 C C     . PHE B 2 320 ? 16.686 7.109   35.757  1.00 41.31  ? 320 PHE B C     1 
ATOM   6291 O O     . PHE B 2 320 ? 17.479 6.291   36.240  1.00 42.82  ? 320 PHE B O     1 
ATOM   6292 C CB    . PHE B 2 320 ? 16.641 7.391   33.229  1.00 39.32  ? 320 PHE B CB    1 
ATOM   6293 C CG    . PHE B 2 320 ? 17.521 6.268   32.758  1.00 39.85  ? 320 PHE B CG    1 
ATOM   6294 C CD1   . PHE B 2 320 ? 17.378 4.983   33.278  1.00 41.77  ? 320 PHE B CD1   1 
ATOM   6295 C CD2   . PHE B 2 320 ? 18.489 6.491   31.785  1.00 39.34  ? 320 PHE B CD2   1 
ATOM   6296 C CE1   . PHE B 2 320 ? 18.205 3.919   32.832  1.00 43.11  ? 320 PHE B CE1   1 
ATOM   6297 C CE2   . PHE B 2 320 ? 19.318 5.450   31.332  1.00 41.02  ? 320 PHE B CE2   1 
ATOM   6298 C CZ    . PHE B 2 320 ? 19.172 4.158   31.856  1.00 42.82  ? 320 PHE B CZ    1 
ATOM   6299 N N     . LYS B 2 321 ? 15.465 7.287   36.235  1.00 41.36  ? 321 LYS B N     1 
ATOM   6300 C CA    . LYS B 2 321 ? 14.972 6.521   37.358  1.00 42.94  ? 321 LYS B CA    1 
ATOM   6301 C C     . LYS B 2 321 ? 13.603 6.015   36.987  1.00 42.70  ? 321 LYS B C     1 
ATOM   6302 O O     . LYS B 2 321 ? 12.894 6.654   36.221  1.00 41.76  ? 321 LYS B O     1 
ATOM   6303 C CB    . LYS B 2 321 ? 14.861 7.436   38.574  1.00 43.66  ? 321 LYS B CB    1 
ATOM   6304 C CG    . LYS B 2 321 ? 15.189 6.773   39.884  1.00 47.19  ? 321 LYS B CG    1 
ATOM   6305 C CD    . LYS B 2 321 ? 13.954 6.275   40.604  1.00 51.62  ? 321 LYS B CD    1 
ATOM   6306 C CE    . LYS B 2 321 ? 14.304 5.922   42.045  1.00 56.45  ? 321 LYS B CE    1 
ATOM   6307 N NZ    . LYS B 2 321 ? 13.308 4.989   42.667  1.00 60.80  ? 321 LYS B NZ    1 
ATOM   6308 N N     . ALA B 2 322 ? 13.212 4.873   37.518  1.00 43.92  ? 322 ALA B N     1 
ATOM   6309 C CA    . ALA B 2 322 ? 11.808 4.505   37.423  1.00 44.53  ? 322 ALA B CA    1 
ATOM   6310 C C     . ALA B 2 322 ? 11.247 4.109   38.794  1.00 46.63  ? 322 ALA B C     1 
ATOM   6311 O O     . ALA B 2 322 ? 11.834 3.282   39.500  1.00 48.64  ? 322 ALA B O     1 
ATOM   6312 C CB    . ALA B 2 322 ? 11.606 3.429   36.387  1.00 44.60  ? 322 ALA B CB    1 
ATOM   6313 N N     . SER B 2 323 ? 10.132 4.729   39.173  1.00 47.01  ? 323 SER B N     1 
ATOM   6314 C CA    . SER B 2 323 ? 9.509  4.509   40.481  1.00 49.49  ? 323 SER B CA    1 
ATOM   6315 C C     . SER B 2 323 ? 8.287  3.578   40.375  1.00 51.28  ? 323 SER B C     1 
ATOM   6316 O O     . SER B 2 323 ? 8.118  2.887   39.372  1.00 50.59  ? 323 SER B O     1 
ATOM   6317 C CB    . SER B 2 323 ? 9.130  5.856   41.123  1.00 49.39  ? 323 SER B CB    1 
ATOM   6318 O OG    . SER B 2 323 ? 8.061  6.475   40.427  1.00 48.79  ? 323 SER B OG    1 
ATOM   6319 N N     . GLU B 2 324 ? 7.459  3.548   41.421  1.00 53.92  ? 324 GLU B N     1 
ATOM   6320 C CA    . GLU B 2 324 ? 6.140  2.912   41.364  1.00 56.18  ? 324 GLU B CA    1 
ATOM   6321 C C     . GLU B 2 324 ? 5.384  3.437   40.148  1.00 54.29  ? 324 GLU B C     1 
ATOM   6322 O O     . GLU B 2 324 ? 4.980  2.682   39.274  1.00 54.08  ? 324 GLU B O     1 
ATOM   6323 C CB    . GLU B 2 324 ? 5.316  3.264   42.614  1.00 59.25  ? 324 GLU B CB    1 
ATOM   6324 C CG    . GLU B 2 324 ? 5.772  2.660   43.937  1.00 64.29  ? 324 GLU B CG    1 
ATOM   6325 C CD    . GLU B 2 324 ? 5.255  1.239   44.137  1.00 70.47  ? 324 GLU B CD    1 
ATOM   6326 O OE1   . GLU B 2 324 ? 5.545  0.372   43.275  1.00 71.72  ? 324 GLU B OE1   1 
ATOM   6327 O OE2   . GLU B 2 324 ? 4.566  0.984   45.157  1.00 74.21  ? 324 GLU B OE2   1 
ATOM   6328 N N     . GLU B 2 325 ? 5.234  4.757   40.100  1.00 53.12  ? 325 GLU B N     1 
ATOM   6329 C CA    . GLU B 2 325 ? 4.293  5.404   39.200  1.00 52.29  ? 325 GLU B CA    1 
ATOM   6330 C C     . GLU B 2 325 ? 4.918  6.124   38.009  1.00 48.76  ? 325 GLU B C     1 
ATOM   6331 O O     . GLU B 2 325 ? 4.311  6.201   36.940  1.00 48.11  ? 325 GLU B O     1 
ATOM   6332 C CB    . GLU B 2 325 ? 3.441  6.399   39.989  1.00 54.33  ? 325 GLU B CB    1 
ATOM   6333 C CG    . GLU B 2 325 ? 1.988  5.916   40.269  1.00 58.16  ? 325 GLU B CG    1 
ATOM   6334 C CD    . GLU B 2 325 ? 1.035  7.129   40.344  1.00 60.49  ? 325 GLU B CD    1 
ATOM   6335 O OE1   . GLU B 2 325 ? 1.341  8.135   41.045  1.00 59.54  ? 325 GLU B OE1   1 
ATOM   6336 O OE2   . GLU B 2 325 ? -0.031 7.067   39.692  1.00 62.74  ? 325 GLU B OE2   1 
ATOM   6337 N N     . PHE B 2 326 ? 6.115  6.661   38.181  1.00 46.29  ? 326 PHE B N     1 
ATOM   6338 C CA    . PHE B 2 326 ? 6.643  7.535   37.152  1.00 43.90  ? 326 PHE B CA    1 
ATOM   6339 C C     . PHE B 2 326 ? 8.047  7.180   36.730  1.00 42.01  ? 326 PHE B C     1 
ATOM   6340 O O     . PHE B 2 326 ? 8.773  6.523   37.475  1.00 42.57  ? 326 PHE B O     1 
ATOM   6341 C CB    . PHE B 2 326 ? 6.606  8.988   37.625  1.00 43.76  ? 326 PHE B CB    1 
ATOM   6342 C CG    . PHE B 2 326 ? 5.242  9.449   38.064  1.00 46.27  ? 326 PHE B CG    1 
ATOM   6343 C CD1   . PHE B 2 326 ? 4.925  9.533   39.407  1.00 48.00  ? 326 PHE B CD1   1 
ATOM   6344 C CD2   . PHE B 2 326 ? 4.271  9.800   37.132  1.00 47.01  ? 326 PHE B CD2   1 
ATOM   6345 C CE1   . PHE B 2 326 ? 3.660  9.962   39.811  1.00 50.22  ? 326 PHE B CE1   1 
ATOM   6346 C CE2   . PHE B 2 326 ? 3.006  10.233  37.538  1.00 48.22  ? 326 PHE B CE2   1 
ATOM   6347 C CZ    . PHE B 2 326 ? 2.707  10.310  38.872  1.00 50.30  ? 326 PHE B CZ    1 
ATOM   6348 N N     . CYS B 2 327 ? 8.412  7.618   35.526  1.00 39.79  ? 327 CYS B N     1 
ATOM   6349 C CA    . CYS B 2 327 ? 9.795  7.631   35.096  1.00 37.86  ? 327 CYS B CA    1 
ATOM   6350 C C     . CYS B 2 327 ? 10.282 9.049   35.059  1.00 36.49  ? 327 CYS B C     1 
ATOM   6351 O O     . CYS B 2 327 ? 9.510  9.979   34.854  1.00 36.47  ? 327 CYS B O     1 
ATOM   6352 C CB    . CYS B 2 327 ? 9.942  7.071   33.702  1.00 37.21  ? 327 CYS B CB    1 
ATOM   6353 S SG    . CYS B 2 327 ? 9.382  5.426   33.533  1.00 39.77  ? 327 CYS B SG    1 
ATOM   6354 N N     . TYR B 2 328 ? 11.585 9.193   35.221  1.00 35.66  ? 328 TYR B N     1 
ATOM   6355 C CA    . TYR B 2 328 ? 12.239 10.479  35.242  1.00 34.76  ? 328 TYR B CA    1 
ATOM   6356 C C     . TYR B 2 328 ? 13.440 10.385  34.321  1.00 33.84  ? 328 TYR B C     1 
ATOM   6357 O O     . TYR B 2 328 ? 14.161 9.382   34.343  1.00 34.29  ? 328 TYR B O     1 
ATOM   6358 C CB    . TYR B 2 328 ? 12.686 10.794  36.658  1.00 35.54  ? 328 TYR B CB    1 
ATOM   6359 C CG    . TYR B 2 328 ? 11.552 10.917  37.649  1.00 37.43  ? 328 TYR B CG    1 
ATOM   6360 C CD1   . TYR B 2 328 ? 11.041 9.795   38.318  1.00 39.75  ? 328 TYR B CD1   1 
ATOM   6361 C CD2   . TYR B 2 328 ? 10.990 12.163  37.925  1.00 38.96  ? 328 TYR B CD2   1 
ATOM   6362 C CE1   . TYR B 2 328 ? 9.990  9.921   39.240  1.00 41.77  ? 328 TYR B CE1   1 
ATOM   6363 C CE2   . TYR B 2 328 ? 9.957  12.307  38.833  1.00 40.51  ? 328 TYR B CE2   1 
ATOM   6364 C CZ    . TYR B 2 328 ? 9.460  11.192  39.493  1.00 42.41  ? 328 TYR B CZ    1 
ATOM   6365 O OH    . TYR B 2 328 ? 8.432  11.375  40.397  1.00 44.42  ? 328 TYR B OH    1 
ATOM   6366 N N     . LEU B 2 329 ? 13.629 11.408  33.489  1.00 32.69  ? 329 LEU B N     1 
ATOM   6367 C CA    . LEU B 2 329 ? 14.765 11.482  32.596  1.00 32.13  ? 329 LEU B CA    1 
ATOM   6368 C C     . LEU B 2 329 ? 15.530 12.709  32.998  1.00 32.08  ? 329 LEU B C     1 
ATOM   6369 O O     . LEU B 2 329 ? 15.013 13.829  32.865  1.00 32.69  ? 329 LEU B O     1 
ATOM   6370 C CB    . LEU B 2 329 ? 14.300 11.606  31.144  1.00 31.95  ? 329 LEU B CB    1 
ATOM   6371 C CG    . LEU B 2 329 ? 13.539 10.405  30.565  1.00 33.28  ? 329 LEU B CG    1 
ATOM   6372 C CD1   . LEU B 2 329 ? 13.269 10.604  29.088  1.00 33.62  ? 329 LEU B CD1   1 
ATOM   6373 C CD2   . LEU B 2 329 ? 14.273 9.098   30.789  1.00 32.91  ? 329 LEU B CD2   1 
ATOM   6374 N N     . LEU B 2 330 ? 16.749 12.526  33.500  1.00 31.93  ? 330 LEU B N     1 
ATOM   6375 C CA    . LEU B 2 330 ? 17.443 13.628  34.173  1.00 31.61  ? 330 LEU B CA    1 
ATOM   6376 C C     . LEU B 2 330 ? 18.548 14.183  33.318  1.00 30.89  ? 330 LEU B C     1 
ATOM   6377 O O     . LEU B 2 330 ? 19.312 13.409  32.741  1.00 31.51  ? 330 LEU B O     1 
ATOM   6378 C CB    . LEU B 2 330 ? 18.018 13.149  35.496  1.00 32.11  ? 330 LEU B CB    1 
ATOM   6379 C CG    . LEU B 2 330 ? 17.001 12.428  36.358  1.00 33.29  ? 330 LEU B CG    1 
ATOM   6380 C CD1   . LEU B 2 330 ? 17.699 11.647  37.451  1.00 36.69  ? 330 LEU B CD1   1 
ATOM   6381 C CD2   . LEU B 2 330 ? 16.031 13.395  36.946  1.00 33.09  ? 330 LEU B CD2   1 
ATOM   6382 N N     . PHE B 2 331 ? 18.650 15.509  33.257  1.00 30.35  ? 331 PHE B N     1 
ATOM   6383 C CA    . PHE B 2 331 ? 19.684 16.170  32.446  1.00 29.88  ? 331 PHE B CA    1 
ATOM   6384 C C     . PHE B 2 331 ? 20.342 17.359  33.120  1.00 30.65  ? 331 PHE B C     1 
ATOM   6385 O O     . PHE B 2 331 ? 19.713 18.069  33.930  1.00 31.48  ? 331 PHE B O     1 
ATOM   6386 C CB    . PHE B 2 331 ? 19.095 16.671  31.139  1.00 28.99  ? 331 PHE B CB    1 
ATOM   6387 C CG    . PHE B 2 331 ? 18.454 15.614  30.335  1.00 28.30  ? 331 PHE B CG    1 
ATOM   6388 C CD1   . PHE B 2 331 ? 19.196 14.864  29.452  1.00 27.37  ? 331 PHE B CD1   1 
ATOM   6389 C CD2   . PHE B 2 331 ? 17.100 15.359  30.468  1.00 28.28  ? 331 PHE B CD2   1 
ATOM   6390 C CE1   . PHE B 2 331 ? 18.605 13.892  28.709  1.00 27.65  ? 331 PHE B CE1   1 
ATOM   6391 C CE2   . PHE B 2 331 ? 16.509 14.395  29.732  1.00 27.69  ? 331 PHE B CE2   1 
ATOM   6392 C CZ    . PHE B 2 331 ? 17.265 13.654  28.851  1.00 28.98  ? 331 PHE B CZ    1 
ATOM   6393 N N     . GLU B 2 332 ? 21.598 17.601  32.758  1.00 30.60  ? 332 GLU B N     1 
ATOM   6394 C CA    . GLU B 2 332 ? 22.278 18.785  33.238  1.00 31.57  ? 332 GLU B CA    1 
ATOM   6395 C C     . GLU B 2 332 ? 23.013 19.492  32.107  1.00 31.31  ? 332 GLU B C     1 
ATOM   6396 O O     . GLU B 2 332 ? 23.788 18.875  31.391  1.00 31.71  ? 332 GLU B O     1 
ATOM   6397 C CB    . GLU B 2 332 ? 23.224 18.427  34.373  1.00 32.66  ? 332 GLU B CB    1 
ATOM   6398 C CG    . GLU B 2 332 ? 23.754 19.651  35.091  1.00 35.48  ? 332 GLU B CG    1 
ATOM   6399 C CD    . GLU B 2 332 ? 24.942 19.359  35.994  1.00 38.03  ? 332 GLU B CD    1 
ATOM   6400 O OE1   . GLU B 2 332 ? 25.460 18.214  35.962  1.00 37.76  ? 332 GLU B OE1   1 
ATOM   6401 O OE2   . GLU B 2 332 ? 25.360 20.288  36.733  1.00 39.48  ? 332 GLU B OE2   1 
ATOM   6402 N N     . CYS B 2 333 ? 22.759 20.785  31.941  1.00 31.18  ? 333 CYS B N     1 
ATOM   6403 C CA    . CYS B 2 333 ? 23.332 21.538  30.834  1.00 31.19  ? 333 CYS B CA    1 
ATOM   6404 C C     . CYS B 2 333 ? 24.155 22.661  31.340  1.00 31.12  ? 333 CYS B C     1 
ATOM   6405 O O     . CYS B 2 333 ? 23.895 23.187  32.416  1.00 32.06  ? 333 CYS B O     1 
ATOM   6406 C CB    . CYS B 2 333 ? 22.240 22.138  29.972  1.00 31.53  ? 333 CYS B CB    1 
ATOM   6407 S SG    . CYS B 2 333 ? 21.320 20.888  29.134  1.00 34.79  ? 333 CYS B SG    1 
ATOM   6408 N N     . GLN B 2 334 ? 25.130 23.058  30.539  1.00 30.40  ? 334 GLN B N     1 
ATOM   6409 C CA    . GLN B 2 334 ? 26.009 24.149  30.917  1.00 30.51  ? 334 GLN B CA    1 
ATOM   6410 C C     . GLN B 2 334 ? 25.346 25.491  30.610  1.00 30.33  ? 334 GLN B C     1 
ATOM   6411 O O     . GLN B 2 334 ? 25.764 26.528  31.131  1.00 31.34  ? 334 GLN B O     1 
ATOM   6412 C CB    . GLN B 2 334 ? 27.351 24.019  30.191  1.00 30.85  ? 334 GLN B CB    1 
ATOM   6413 C CG    . GLN B 2 334 ? 28.048 22.699  30.438  1.00 29.82  ? 334 GLN B CG    1 
ATOM   6414 C CD    . GLN B 2 334 ? 29.445 22.660  29.867  1.00 30.66  ? 334 GLN B CD    1 
ATOM   6415 O OE1   . GLN B 2 334 ? 29.929 21.611  29.464  1.00 31.44  ? 334 GLN B OE1   1 
ATOM   6416 N NE2   . GLN B 2 334 ? 30.111 23.802  29.847  1.00 31.83  ? 334 GLN B NE2   1 
ATOM   6417 N N     . ILE B 2 335 ? 24.316 25.453  29.762  1.00 28.92  ? 335 ILE B N     1 
ATOM   6418 C CA    . ILE B 2 335 ? 23.657 26.659  29.262  1.00 28.97  ? 335 ILE B CA    1 
ATOM   6419 C C     . ILE B 2 335 ? 22.238 26.749  29.806  1.00 28.88  ? 335 ILE B C     1 
ATOM   6420 O O     . ILE B 2 335 ? 21.350 26.026  29.359  1.00 28.06  ? 335 ILE B O     1 
ATOM   6421 C CB    . ILE B 2 335 ? 23.597 26.700  27.703  1.00 28.68  ? 335 ILE B CB    1 
ATOM   6422 C CG1   . ILE B 2 335 ? 24.980 26.488  27.062  1.00 28.42  ? 335 ILE B CG1   1 
ATOM   6423 C CG2   . ILE B 2 335 ? 22.947 27.989  27.225  1.00 30.44  ? 335 ILE B CG2   1 
ATOM   6424 C CD1   . ILE B 2 335 ? 26.114 27.368  27.586  1.00 29.70  ? 335 ILE B CD1   1 
ATOM   6425 N N     . LYS B 2 336 ? 22.029 27.639  30.775  1.00 29.90  ? 336 LYS B N     1 
ATOM   6426 C CA    . LYS B 2 336 ? 20.686 27.898  31.323  1.00 30.22  ? 336 LYS B CA    1 
ATOM   6427 C C     . LYS B 2 336 ? 19.869 28.744  30.339  1.00 30.92  ? 336 LYS B C     1 
ATOM   6428 O O     . LYS B 2 336 ? 18.625 28.676  30.305  1.00 31.26  ? 336 LYS B O     1 
ATOM   6429 C CB    . LYS B 2 336 ? 20.764 28.607  32.680  1.00 31.34  ? 336 LYS B CB    1 
ATOM   6430 C CG    . LYS B 2 336 ? 21.509 27.828  33.741  1.00 30.64  ? 336 LYS B CG    1 
ATOM   6431 C CD    . LYS B 2 336 ? 21.811 28.704  34.955  1.00 35.70  ? 336 LYS B CD    1 
ATOM   6432 C CE    . LYS B 2 336 ? 20.792 28.508  36.090  1.00 37.90  ? 336 LYS B CE    1 
ATOM   6433 N NZ    . LYS B 2 336 ? 21.228 29.161  37.384  1.00 38.91  ? 336 LYS B NZ    1 
ATOM   6434 N N     . GLU B 2 337 ? 20.574 29.525  29.525  1.00 30.74  ? 337 GLU B N     1 
ATOM   6435 C CA    . GLU B 2 337 ? 19.893 30.442  28.649  1.00 31.86  ? 337 GLU B CA    1 
ATOM   6436 C C     . GLU B 2 337 ? 20.726 30.847  27.438  1.00 31.68  ? 337 GLU B C     1 
ATOM   6437 O O     . GLU B 2 337 ? 21.864 31.276  27.573  1.00 32.76  ? 337 GLU B O     1 
ATOM   6438 C CB    . GLU B 2 337 ? 19.474 31.657  29.447  1.00 33.56  ? 337 GLU B CB    1 
ATOM   6439 C CG    . GLU B 2 337 ? 18.171 32.214  28.985  1.00 37.44  ? 337 GLU B CG    1 
ATOM   6440 C CD    . GLU B 2 337 ? 18.073 33.718  29.186  1.00 41.90  ? 337 GLU B CD    1 
ATOM   6441 O OE1   . GLU B 2 337 ? 19.112 34.363  29.445  1.00 42.67  ? 337 GLU B OE1   1 
ATOM   6442 O OE2   . GLU B 2 337 ? 16.948 34.251  29.080  1.00 45.38  ? 337 GLU B OE2   1 
ATOM   6443 N N     . ILE B 2 338 ? 20.155 30.714  26.247  1.00 31.29  ? 338 ILE B N     1 
ATOM   6444 C CA    . ILE B 2 338 ? 20.862 31.083  25.022  1.00 31.19  ? 338 ILE B CA    1 
ATOM   6445 C C     . ILE B 2 338 ? 20.143 32.244  24.385  1.00 32.75  ? 338 ILE B C     1 
ATOM   6446 O O     . ILE B 2 338 ? 18.964 32.443  24.652  1.00 33.91  ? 338 ILE B O     1 
ATOM   6447 C CB    . ILE B 2 338 ? 20.987 29.887  24.054  1.00 30.22  ? 338 ILE B CB    1 
ATOM   6448 C CG1   . ILE B 2 338 ? 22.006 30.191  22.950  1.00 31.12  ? 338 ILE B CG1   1 
ATOM   6449 C CG2   . ILE B 2 338 ? 19.621 29.480  23.487  1.00 30.15  ? 338 ILE B CG2   1 
ATOM   6450 C CD1   . ILE B 2 338 ? 22.623 28.946  22.356  1.00 31.32  ? 338 ILE B CD1   1 
ATOM   6451 N N     . SER B 2 339 ? 20.834 33.022  23.564  1.00 33.32  ? 339 SER B N     1 
ATOM   6452 C CA    . SER B 2 339 ? 20.193 34.180  22.935  1.00 35.21  ? 339 SER B CA    1 
ATOM   6453 C C     . SER B 2 339 ? 19.129 33.765  21.912  1.00 35.35  ? 339 SER B C     1 
ATOM   6454 O O     . SER B 2 339 ? 19.168 32.663  21.371  1.00 33.56  ? 339 SER B O     1 
ATOM   6455 C CB    . SER B 2 339 ? 21.233 35.091  22.293  1.00 36.57  ? 339 SER B CB    1 
ATOM   6456 O OG    . SER B 2 339 ? 21.606 34.621  21.014  1.00 36.68  ? 339 SER B OG    1 
ATOM   6457 N N     . ARG B 2 340 ? 18.174 34.659  21.687  1.00 27.18  ? 340 ARG B N     1 
ATOM   6458 C CA    . ARG B 2 340 ? 17.095 34.463  20.739  1.00 28.73  ? 340 ARG B CA    1 
ATOM   6459 C C     . ARG B 2 340 ? 17.643 34.378  19.322  1.00 27.46  ? 340 ARG B C     1 
ATOM   6460 O O     . ARG B 2 340 ? 17.390 33.409  18.593  1.00 28.60  ? 340 ARG B O     1 
ATOM   6461 C CB    . ARG B 2 340 ? 16.131 35.630  20.823  1.00 30.38  ? 340 ARG B CB    1 
ATOM   6462 C CG    . ARG B 2 340 ? 14.787 35.405  20.148  1.00 34.98  ? 340 ARG B CG    1 
ATOM   6463 C CD    . ARG B 2 340 ? 13.677 35.424  21.186  1.00 41.02  ? 340 ARG B CD    1 
ATOM   6464 N NE    . ARG B 2 340 ? 12.939 34.167  21.200  1.00 45.83  ? 340 ARG B NE    1 
ATOM   6465 C CZ    . ARG B 2 340 ? 12.329 33.663  22.269  1.00 50.20  ? 340 ARG B CZ    1 
ATOM   6466 N NH1   . ARG B 2 340 ? 12.360 34.313  23.428  1.00 51.11  ? 340 ARG B NH1   1 
ATOM   6467 N NH2   . ARG B 2 340 ? 11.692 32.496  22.184  1.00 54.40  ? 340 ARG B NH2   1 
ATOM   6468 N N     . VAL B 2 341 ? 18.415 35.380  18.934  1.00 25.80  ? 341 VAL B N     1 
ATOM   6469 C CA    . VAL B 2 341 ? 19.035 35.395  17.614  1.00 24.47  ? 341 VAL B CA    1 
ATOM   6470 C C     . VAL B 2 341 ? 20.090 34.261  17.420  1.00 23.86  ? 341 VAL B C     1 
ATOM   6471 O O     . VAL B 2 341 ? 20.715 33.824  18.373  1.00 23.30  ? 341 VAL B O     1 
ATOM   6472 C CB    . VAL B 2 341 ? 19.620 36.795  17.311  1.00 23.06  ? 341 VAL B CB    1 
ATOM   6473 C CG1   . VAL B 2 341 ? 21.063 36.892  17.755  1.00 21.64  ? 341 VAL B CG1   1 
ATOM   6474 C CG2   . VAL B 2 341 ? 19.486 37.112  15.855  1.00 22.27  ? 341 VAL B CG2   1 
ATOM   6475 N N     . PHE B 2 342 ? 20.246 33.789  16.187  1.00 23.96  ? 342 PHE B N     1 
ATOM   6476 C CA    . PHE B 2 342 ? 21.318 32.850  15.843  1.00 25.20  ? 342 PHE B CA    1 
ATOM   6477 C C     . PHE B 2 342 ? 21.738 33.018  14.373  1.00 25.14  ? 342 PHE B C     1 
ATOM   6478 O O     . PHE B 2 342 ? 21.167 33.860  13.657  1.00 24.88  ? 342 PHE B O     1 
ATOM   6479 C CB    . PHE B 2 342 ? 20.912 31.395  16.125  1.00 26.92  ? 342 PHE B CB    1 
ATOM   6480 C CG    . PHE B 2 342 ? 19.913 30.858  15.168  1.00 28.80  ? 342 PHE B CG    1 
ATOM   6481 C CD1   . PHE B 2 342 ? 20.303 29.972  14.165  1.00 31.97  ? 342 PHE B CD1   1 
ATOM   6482 C CD2   . PHE B 2 342 ? 18.584 31.239  15.247  1.00 30.42  ? 342 PHE B CD2   1 
ATOM   6483 C CE1   . PHE B 2 342 ? 19.379 29.464  13.259  1.00 32.60  ? 342 PHE B CE1   1 
ATOM   6484 C CE2   . PHE B 2 342 ? 17.653 30.751  14.350  1.00 32.70  ? 342 PHE B CE2   1 
ATOM   6485 C CZ    . PHE B 2 342 ? 18.050 29.868  13.348  1.00 33.57  ? 342 PHE B CZ    1 
ATOM   6486 N N     . ARG B 2 343 ? 22.710 32.214  13.933  1.00 25.19  ? 343 ARG B N     1 
ATOM   6487 C CA    . ARG B 2 343 ? 23.315 32.383  12.610  1.00 25.23  ? 343 ARG B CA    1 
ATOM   6488 C C     . ARG B 2 343 ? 22.917 31.286  11.638  1.00 26.45  ? 343 ARG B C     1 
ATOM   6489 O O     . ARG B 2 343 ? 23.232 30.112  11.866  1.00 27.62  ? 343 ARG B O     1 
ATOM   6490 C CB    . ARG B 2 343 ? 24.842 32.397  12.721  1.00 24.78  ? 343 ARG B CB    1 
ATOM   6491 C CG    . ARG B 2 343 ? 25.472 33.753  12.640  1.00 24.50  ? 343 ARG B CG    1 
ATOM   6492 C CD    . ARG B 2 343 ? 26.925 33.742  13.157  1.00 25.12  ? 343 ARG B CD    1 
ATOM   6493 N NE    . ARG B 2 343 ? 27.814 33.030  12.247  1.00 26.63  ? 343 ARG B NE    1 
ATOM   6494 C CZ    . ARG B 2 343 ? 28.633 33.595  11.361  1.00 28.33  ? 343 ARG B CZ    1 
ATOM   6495 N NH1   . ARG B 2 343 ? 28.704 34.923  11.243  1.00 28.26  ? 343 ARG B NH1   1 
ATOM   6496 N NH2   . ARG B 2 343 ? 29.391 32.816  10.579  1.00 29.34  ? 343 ARG B NH2   1 
ATOM   6497 N N     . ARG B 2 344 ? 22.248 31.663  10.554  1.00 26.51  ? 344 ARG B N     1 
ATOM   6498 C CA    . ARG B 2 344 ? 21.947 30.694  9.531   1.00 29.16  ? 344 ARG B CA    1 
ATOM   6499 C C     . ARG B 2 344 ? 22.763 30.927  8.265   1.00 28.87  ? 344 ARG B C     1 
ATOM   6500 O O     . ARG B 2 344 ? 22.820 32.055  7.741   1.00 27.88  ? 344 ARG B O     1 
ATOM   6501 C CB    . ARG B 2 344 ? 20.456 30.616  9.233   1.00 30.82  ? 344 ARG B CB    1 
ATOM   6502 C CG    . ARG B 2 344 ? 20.156 29.752  8.021   1.00 35.50  ? 344 ARG B CG    1 
ATOM   6503 C CD    . ARG B 2 344 ? 18.703 29.376  7.918   1.00 41.51  ? 344 ARG B CD    1 
ATOM   6504 N NE    . ARG B 2 344 ? 18.335 28.538  9.049   1.00 45.45  ? 344 ARG B NE    1 
ATOM   6505 C CZ    . ARG B 2 344 ? 17.106 28.449  9.538   1.00 48.47  ? 344 ARG B CZ    1 
ATOM   6506 N NH1   . ARG B 2 344 ? 16.126 29.165  8.981   1.00 49.66  ? 344 ARG B NH1   1 
ATOM   6507 N NH2   . ARG B 2 344 ? 16.867 27.654  10.588  1.00 48.14  ? 344 ARG B NH2   1 
ATOM   6508 N N     . MET B 2 345 ? 23.362 29.831  7.784   1.00 29.84  ? 345 MET B N     1 
ATOM   6509 C CA    . MET B 2 345 ? 24.300 29.823  6.677   1.00 29.81  ? 345 MET B CA    1 
ATOM   6510 C C     . MET B 2 345 ? 23.555 29.827  5.366   1.00 30.64  ? 345 MET B C     1 
ATOM   6511 O O     . MET B 2 345 ? 22.736 28.950  5.128   1.00 32.28  ? 345 MET B O     1 
ATOM   6512 C CB    . MET B 2 345 ? 25.162 28.569  6.768   1.00 31.48  ? 345 MET B CB    1 
ATOM   6513 C CG    . MET B 2 345 ? 26.355 28.504  5.802   1.00 32.92  ? 345 MET B CG    1 
ATOM   6514 S SD    . MET B 2 345 ? 27.008 26.805  5.698   1.00 35.81  ? 345 MET B SD    1 
ATOM   6515 C CE    . MET B 2 345 ? 25.720 25.980  4.766   1.00 37.37  ? 345 MET B CE    1 
ATOM   6516 N N     . GLY B 2 346 ? 23.825 30.841  4.535   1.00 29.95  ? 346 GLY B N     1 
ATOM   6517 C CA    . GLY B 2 346 ? 23.293 30.938  3.174   1.00 30.52  ? 346 GLY B CA    1 
ATOM   6518 C C     . GLY B 2 346 ? 24.245 30.308  2.171   1.00 31.35  ? 346 GLY B C     1 
ATOM   6519 O O     . GLY B 2 346 ? 25.212 29.671  2.570   1.00 32.44  ? 346 GLY B O     1 
ATOM   6520 N N     . PRO B 2 347 ? 23.963 30.450  0.865   1.00 31.64  ? 347 PRO B N     1 
ATOM   6521 C CA    . PRO B 2 347 ? 24.868 30.021  -0.178  1.00 32.50  ? 347 PRO B CA    1 
ATOM   6522 C C     . PRO B 2 347 ? 26.055 30.953  -0.414  1.00 31.38  ? 347 PRO B C     1 
ATOM   6523 O O     . PRO B 2 347 ? 26.140 32.043  0.157   1.00 30.04  ? 347 PRO B O     1 
ATOM   6524 C CB    . PRO B 2 347 ? 23.984 30.039  -1.426  1.00 33.94  ? 347 PRO B CB    1 
ATOM   6525 C CG    . PRO B 2 347 ? 22.976 31.055  -1.167  1.00 32.77  ? 347 PRO B CG    1 
ATOM   6526 C CD    . PRO B 2 347 ? 22.717 31.003  0.307   1.00 32.54  ? 347 PRO B CD    1 
ATOM   6527 N N     . GLN B 2 348 ? 26.944 30.512  -1.299  1.00 32.50  ? 348 GLN B N     1 
ATOM   6528 C CA    . GLN B 2 348 ? 28.108 31.261  -1.701  1.00 31.42  ? 348 GLN B CA    1 
ATOM   6529 C C     . GLN B 2 348 ? 27.717 32.330  -2.682  1.00 30.98  ? 348 GLN B C     1 
ATOM   6530 O O     . GLN B 2 348 ? 26.861 32.119  -3.537  1.00 32.19  ? 348 GLN B O     1 
ATOM   6531 C CB    . GLN B 2 348 ? 29.113 30.313  -2.339  1.00 33.65  ? 348 GLN B CB    1 
ATOM   6532 C CG    . GLN B 2 348 ? 29.683 29.325  -1.353  1.00 34.55  ? 348 GLN B CG    1 
ATOM   6533 C CD    . GLN B 2 348 ? 30.864 28.582  -1.899  1.00 38.04  ? 348 GLN B CD    1 
ATOM   6534 O OE1   . GLN B 2 348 ? 30.815 28.049  -2.999  1.00 39.98  ? 348 GLN B OE1   1 
ATOM   6535 N NE2   . GLN B 2 348 ? 31.944 28.530  -1.121  1.00 40.36  ? 348 GLN B NE2   1 
ATOM   6536 N N     . PHE B 2 349 ? 28.386 33.470  -2.582  1.00 29.70  ? 349 PHE B N     1 
ATOM   6537 C CA    . PHE B 2 349 ? 27.996 34.652  -3.324  1.00 29.29  ? 349 PHE B CA    1 
ATOM   6538 C C     . PHE B 2 349 ? 27.830 34.446  -4.828  1.00 31.07  ? 349 PHE B C     1 
ATOM   6539 O O     . PHE B 2 349 ? 27.131 35.218  -5.460  1.00 31.66  ? 349 PHE B O     1 
ATOM   6540 C CB    . PHE B 2 349 ? 28.979 35.779  -3.053  1.00 28.82  ? 349 PHE B CB    1 
ATOM   6541 C CG    . PHE B 2 349 ? 30.249 35.679  -3.839  1.00 30.18  ? 349 PHE B CG    1 
ATOM   6542 C CD1   . PHE B 2 349 ? 30.368 36.308  -5.072  1.00 31.87  ? 349 PHE B CD1   1 
ATOM   6543 C CD2   . PHE B 2 349 ? 31.326 34.965  -3.347  1.00 30.45  ? 349 PHE B CD2   1 
ATOM   6544 C CE1   . PHE B 2 349 ? 31.540 36.213  -5.811  1.00 34.05  ? 349 PHE B CE1   1 
ATOM   6545 C CE2   . PHE B 2 349 ? 32.503 34.873  -4.069  1.00 32.35  ? 349 PHE B CE2   1 
ATOM   6546 C CZ    . PHE B 2 349 ? 32.616 35.499  -5.298  1.00 33.29  ? 349 PHE B CZ    1 
ATOM   6547 N N     . GLU B 2 350 ? 28.453 33.421  -5.401  1.00 32.54  ? 350 GLU B N     1 
ATOM   6548 C CA    . GLU B 2 350 ? 28.397 33.230  -6.855  1.00 34.37  ? 350 GLU B CA    1 
ATOM   6549 C C     . GLU B 2 350 ? 27.034 32.735  -7.311  1.00 36.49  ? 350 GLU B C     1 
ATOM   6550 O O     . GLU B 2 350 ? 26.533 33.181  -8.344  1.00 37.77  ? 350 GLU B O     1 
ATOM   6551 C CB    . GLU B 2 350 ? 29.477 32.260  -7.346  1.00 35.47  ? 350 GLU B CB    1 
ATOM   6552 C CG    . GLU B 2 350 ? 30.908 32.778  -7.208  1.00 33.00  ? 350 GLU B CG    1 
ATOM   6553 C CD    . GLU B 2 350 ? 31.592 32.373  -5.895  1.00 29.33  ? 350 GLU B CD    1 
ATOM   6554 O OE1   . GLU B 2 350 ? 32.850 32.294  -5.893  1.00 28.95  ? 350 GLU B OE1   1 
ATOM   6555 O OE2   . GLU B 2 350 ? 30.885 32.140  -4.877  1.00 24.53  ? 350 GLU B OE2   1 
ATOM   6556 N N     . ASP B 2 351 ? 26.444 31.818  -6.538  1.00 37.38  ? 351 ASP B N     1 
ATOM   6557 C CA    . ASP B 2 351 ? 25.223 31.100  -6.913  1.00 39.71  ? 351 ASP B CA    1 
ATOM   6558 C C     . ASP B 2 351 ? 23.994 32.026  -6.932  1.00 39.49  ? 351 ASP B C     1 
ATOM   6559 O O     . ASP B 2 351 ? 23.223 32.051  -5.984  1.00 39.09  ? 351 ASP B O     1 
ATOM   6560 C CB    . ASP B 2 351 ? 25.029 29.954  -5.924  1.00 40.39  ? 351 ASP B CB    1 
ATOM   6561 C CG    . ASP B 2 351 ? 23.926 28.987  -6.333  1.00 44.76  ? 351 ASP B CG    1 
ATOM   6562 O OD1   . ASP B 2 351 ? 23.573 28.125  -5.490  1.00 44.44  ? 351 ASP B OD1   1 
ATOM   6563 O OD2   . ASP B 2 351 ? 23.415 29.080  -7.478  1.00 49.54  ? 351 ASP B OD2   1 
ATOM   6564 N N     . GLU B 2 352 ? 23.814 32.770  -8.025  1.00 40.41  ? 352 GLU B N     1 
ATOM   6565 C CA    . GLU B 2 352 ? 22.846 33.876  -8.094  1.00 40.15  ? 352 GLU B CA    1 
ATOM   6566 C C     . GLU B 2 352 ? 21.397 33.513  -7.765  1.00 41.57  ? 352 GLU B C     1 
ATOM   6567 O O     . GLU B 2 352 ? 20.702 34.241  -7.038  1.00 40.11  ? 352 GLU B O     1 
ATOM   6568 C CB    . GLU B 2 352 ? 22.886 34.565  -9.460  1.00 41.24  ? 352 GLU B CB    1 
ATOM   6569 C CG    . GLU B 2 352 ? 22.356 35.977  -9.350  1.00 41.73  ? 352 GLU B CG    1 
ATOM   6570 C CD    . GLU B 2 352 ? 21.969 36.631  -10.665 1.00 46.61  ? 352 GLU B CD    1 
ATOM   6571 O OE1   . GLU B 2 352 ? 22.652 36.436  -11.707 1.00 48.31  ? 352 GLU B OE1   1 
ATOM   6572 O OE2   . GLU B 2 352 ? 20.975 37.388  -10.636 1.00 48.71  ? 352 GLU B OE2   1 
ATOM   6573 N N     . ARG B 2 353 ? 20.946 32.397  -8.332  1.00 44.48  ? 353 ARG B N     1 
ATOM   6574 C CA    . ARG B 2 353 ? 19.581 31.923  -8.147  1.00 46.71  ? 353 ARG B CA    1 
ATOM   6575 C C     . ARG B 2 353 ? 19.313 31.674  -6.672  1.00 44.50  ? 353 ARG B C     1 
ATOM   6576 O O     . ARG B 2 353 ? 18.312 32.133  -6.131  1.00 44.68  ? 353 ARG B O     1 
ATOM   6577 C CB    . ARG B 2 353 ? 19.358 30.671  -8.988  1.00 50.48  ? 353 ARG B CB    1 
ATOM   6578 C CG    . ARG B 2 353 ? 18.167 29.815  -8.614  1.00 56.02  ? 353 ARG B CG    1 
ATOM   6579 C CD    . ARG B 2 353 ? 16.942 30.095  -9.469  1.00 64.25  ? 353 ARG B CD    1 
ATOM   6580 N NE    . ARG B 2 353 ? 16.157 28.885  -9.780  1.00 72.45  ? 353 ARG B NE    1 
ATOM   6581 C CZ    . ARG B 2 353 ? 15.484 28.125  -8.903  1.00 75.18  ? 353 ARG B CZ    1 
ATOM   6582 N NH1   . ARG B 2 353 ? 15.490 28.395  -7.596  1.00 73.42  ? 353 ARG B NH1   1 
ATOM   6583 N NH2   . ARG B 2 353 ? 14.802 27.065  -9.340  1.00 80.03  ? 353 ARG B NH2   1 
ATOM   6584 N N     . ASN B 2 354 ? 20.235 30.991  -6.009  1.00 42.46  ? 354 ASN B N     1 
ATOM   6585 C CA    . ASN B 2 354 ? 20.031 30.648  -4.609  1.00 40.83  ? 354 ASN B CA    1 
ATOM   6586 C C     . ASN B 2 354 ? 20.200 31.780  -3.616  1.00 36.86  ? 354 ASN B C     1 
ATOM   6587 O O     . ASN B 2 354 ? 19.579 31.787  -2.558  1.00 36.36  ? 354 ASN B O     1 
ATOM   6588 C CB    . ASN B 2 354 ? 20.880 29.447  -4.236  1.00 41.42  ? 354 ASN B CB    1 
ATOM   6589 C CG    . ASN B 2 354 ? 20.370 28.189  -4.866  1.00 47.12  ? 354 ASN B CG    1 
ATOM   6590 O OD1   . ASN B 2 354 ? 19.227 27.774  -4.628  1.00 51.16  ? 354 ASN B OD1   1 
ATOM   6591 N ND2   . ASN B 2 354 ? 21.194 27.582  -5.711  1.00 51.09  ? 354 ASN B ND2   1 
ATOM   6592 N N     . VAL B 2 355 ? 21.034 32.741  -3.970  1.00 34.14  ? 355 VAL B N     1 
ATOM   6593 C CA    . VAL B 2 355 ? 21.163 33.956  -3.196  1.00 31.05  ? 355 VAL B CA    1 
ATOM   6594 C C     . VAL B 2 355 ? 19.830 34.712  -3.140  1.00 32.21  ? 355 VAL B C     1 
ATOM   6595 O O     . VAL B 2 355 ? 19.335 35.006  -2.057  1.00 31.90  ? 355 VAL B O     1 
ATOM   6596 C CB    . VAL B 2 355 ? 22.318 34.835  -3.710  1.00 29.23  ? 355 VAL B CB    1 
ATOM   6597 C CG1   . VAL B 2 355 ? 22.347 36.148  -2.975  1.00 26.85  ? 355 VAL B CG1   1 
ATOM   6598 C CG2   . VAL B 2 355 ? 23.632 34.114  -3.527  1.00 27.05  ? 355 VAL B CG2   1 
ATOM   6599 N N     . LYS B 2 356 ? 19.249 35.008  -4.295  1.00 34.38  ? 356 LYS B N     1 
ATOM   6600 C CA    . LYS B 2 356 ? 17.930 35.614  -4.357  1.00 36.53  ? 356 LYS B CA    1 
ATOM   6601 C C     . LYS B 2 356 ? 16.955 34.925  -3.428  1.00 37.44  ? 356 LYS B C     1 
ATOM   6602 O O     . LYS B 2 356 ? 16.196 35.578  -2.722  1.00 37.82  ? 356 LYS B O     1 
ATOM   6603 C CB    . LYS B 2 356 ? 17.379 35.518  -5.766  1.00 39.27  ? 356 LYS B CB    1 
ATOM   6604 C CG    . LYS B 2 356 ? 17.835 36.612  -6.651  1.00 41.51  ? 356 LYS B CG    1 
ATOM   6605 C CD    . LYS B 2 356 ? 16.817 36.877  -7.725  1.00 47.26  ? 356 LYS B CD    1 
ATOM   6606 C CE    . LYS B 2 356 ? 15.547 37.480  -7.152  1.00 49.37  ? 356 LYS B CE    1 
ATOM   6607 N NZ    . LYS B 2 356 ? 14.838 38.173  -8.268  1.00 53.80  ? 356 LYS B NZ    1 
ATOM   6608 N N     . LYS B 2 357 ? 16.971 33.598  -3.454  1.00 38.69  ? 357 LYS B N     1 
ATOM   6609 C CA    . LYS B 2 357 ? 16.065 32.788  -2.649  1.00 40.67  ? 357 LYS B CA    1 
ATOM   6610 C C     . LYS B 2 357 ? 16.291 33.006  -1.153  1.00 37.98  ? 357 LYS B C     1 
ATOM   6611 O O     . LYS B 2 357 ? 15.349 33.214  -0.385  1.00 38.72  ? 357 LYS B O     1 
ATOM   6612 C CB    . LYS B 2 357 ? 16.214 31.299  -3.001  1.00 42.71  ? 357 LYS B CB    1 
ATOM   6613 C CG    . LYS B 2 357 ? 15.633 30.921  -4.361  1.00 47.79  ? 357 LYS B CG    1 
ATOM   6614 C CD    . LYS B 2 357 ? 14.848 29.611  -4.318  1.00 53.97  ? 357 LYS B CD    1 
ATOM   6615 C CE    . LYS B 2 357 ? 13.766 29.630  -3.240  1.00 56.51  ? 357 LYS B CE    1 
ATOM   6616 N NZ    . LYS B 2 357 ? 13.091 28.302  -3.137  1.00 62.16  ? 357 LYS B NZ    1 
ATOM   6617 N N     . PHE B 2 358 ? 17.558 32.962  -0.763  1.00 35.11  ? 358 PHE B N     1 
ATOM   6618 C CA    . PHE B 2 358 ? 17.969 33.156  0.613   1.00 32.50  ? 358 PHE B CA    1 
ATOM   6619 C C     . PHE B 2 358 ? 17.642 34.574  1.053   1.00 30.83  ? 358 PHE B C     1 
ATOM   6620 O O     . PHE B 2 358 ? 17.335 34.814  2.221   1.00 29.88  ? 358 PHE B O     1 
ATOM   6621 C CB    . PHE B 2 358 ? 19.472 32.877  0.735   1.00 30.87  ? 358 PHE B CB    1 
ATOM   6622 C CG    . PHE B 2 358 ? 19.985 32.889  2.144   1.00 29.72  ? 358 PHE B CG    1 
ATOM   6623 C CD1   . PHE B 2 358 ? 19.663 31.846  3.026   1.00 31.12  ? 358 PHE B CD1   1 
ATOM   6624 C CD2   . PHE B 2 358 ? 20.775 33.937  2.598   1.00 26.29  ? 358 PHE B CD2   1 
ATOM   6625 C CE1   . PHE B 2 358 ? 20.130 31.846  4.340   1.00 28.02  ? 358 PHE B CE1   1 
ATOM   6626 C CE2   . PHE B 2 358 ? 21.237 33.952  3.905   1.00 27.08  ? 358 PHE B CE2   1 
ATOM   6627 C CZ    . PHE B 2 358 ? 20.928 32.885  4.778   1.00 27.34  ? 358 PHE B CZ    1 
ATOM   6628 N N     . LEU B 2 359 ? 17.710 35.505  0.106   1.00 30.46  ? 359 LEU B N     1 
ATOM   6629 C CA    . LEU B 2 359 ? 17.423 36.907  0.382   1.00 29.85  ? 359 LEU B CA    1 
ATOM   6630 C C     . LEU B 2 359 ? 15.932 37.233  0.338   1.00 31.92  ? 359 LEU B C     1 
ATOM   6631 O O     . LEU B 2 359 ? 15.506 38.274  0.832   1.00 32.06  ? 359 LEU B O     1 
ATOM   6632 C CB    . LEU B 2 359 ? 18.178 37.814  -0.582  1.00 29.50  ? 359 LEU B CB    1 
ATOM   6633 C CG    . LEU B 2 359 ? 19.397 38.530  -0.018  1.00 28.76  ? 359 LEU B CG    1 
ATOM   6634 C CD1   . LEU B 2 359 ? 20.554 37.572  0.105   1.00 31.68  ? 359 LEU B CD1   1 
ATOM   6635 C CD2   . LEU B 2 359 ? 19.793 39.726  -0.880  1.00 31.17  ? 359 LEU B CD2   1 
ATOM   6636 N N     . SER B 2 360 ? 15.128 36.350  -0.243  1.00 33.68  ? 360 SER B N     1 
ATOM   6637 C CA    . SER B 2 360 ? 13.715 36.646  -0.357  1.00 36.01  ? 360 SER B CA    1 
ATOM   6638 C C     . SER B 2 360 ? 12.972 36.453  0.963   1.00 36.36  ? 360 SER B C     1 
ATOM   6639 O O     . SER B 2 360 ? 11.833 36.889  1.085   1.00 38.86  ? 360 SER B O     1 
ATOM   6640 C CB    . SER B 2 360 ? 13.073 35.817  -1.460  1.00 38.81  ? 360 SER B CB    1 
ATOM   6641 O OG    . SER B 2 360 ? 12.758 34.515  -1.007  1.00 39.93  ? 360 SER B OG    1 
ATOM   6642 N N     . ARG B 2 361 ? 13.605 35.815  1.947   1.00 34.03  ? 361 ARG B N     1 
ATOM   6643 C CA    . ARG B 2 361 ? 12.913 35.474  3.192   1.00 34.89  ? 361 ARG B CA    1 
ATOM   6644 C C     . ARG B 2 361 ? 12.803 36.669  4.106   1.00 33.99  ? 361 ARG B C     1 
ATOM   6645 O O     . ARG B 2 361 ? 13.756 37.417  4.271   1.00 31.96  ? 361 ARG B O     1 
ATOM   6646 C CB    . ARG B 2 361 ? 13.604 34.327  3.950   1.00 33.43  ? 361 ARG B CB    1 
ATOM   6647 C CG    . ARG B 2 361 ? 14.143 33.196  3.099   1.00 34.70  ? 361 ARG B CG    1 
ATOM   6648 C CD    . ARG B 2 361 ? 13.135 32.638  2.103   1.00 39.53  ? 361 ARG B CD    1 
ATOM   6649 N NE    . ARG B 2 361 ? 12.432 31.500  2.670   1.00 44.60  ? 361 ARG B NE    1 
ATOM   6650 C CZ    . ARG B 2 361 ? 11.953 30.459  1.982   1.00 47.85  ? 361 ARG B CZ    1 
ATOM   6651 N NH1   . ARG B 2 361 ? 11.322 29.498  2.636   1.00 50.49  ? 361 ARG B NH1   1 
ATOM   6652 N NH2   . ARG B 2 361 ? 12.102 30.359  0.663   1.00 48.06  ? 361 ARG B NH2   1 
ATOM   6653 N N     . ASN B 2 362 ? 11.643 36.838  4.720   1.00 36.61  ? 362 ASN B N     1 
ATOM   6654 C CA    . ASN B 2 362 ? 11.465 37.875  5.730   1.00 36.65  ? 362 ASN B CA    1 
ATOM   6655 C C     . ASN B 2 362 ? 12.166 37.578  7.047   1.00 35.38  ? 362 ASN B C     1 
ATOM   6656 O O     . ASN B 2 362 ? 12.016 36.491  7.633   1.00 36.06  ? 362 ASN B O     1 
ATOM   6657 C CB    . ASN B 2 362 ? 9.998  38.122  5.978   1.00 39.70  ? 362 ASN B CB    1 
ATOM   6658 C CG    . ASN B 2 362 ? 9.278  38.572  4.738   1.00 41.54  ? 362 ASN B CG    1 
ATOM   6659 O OD1   . ASN B 2 362 ? 8.100  38.263  4.562   1.00 44.53  ? 362 ASN B OD1   1 
ATOM   6660 N ND2   . ASN B 2 362 ? 9.978  39.307  3.863   1.00 37.47  ? 362 ASN B ND2   1 
ATOM   6661 N N     . ARG B 2 363 ? 12.946 38.556  7.497   1.00 34.16  ? 363 ARG B N     1 
ATOM   6662 C CA    . ARG B 2 363 ? 13.748 38.431  8.696   1.00 32.09  ? 363 ARG B CA    1 
ATOM   6663 C C     . ARG B 2 363 ? 13.755 39.809  9.320   1.00 32.77  ? 363 ARG B C     1 
ATOM   6664 O O     . ARG B 2 363 ? 13.303 40.766  8.695   1.00 34.81  ? 363 ARG B O     1 
ATOM   6665 C CB    . ARG B 2 363 ? 15.159 37.960  8.338   1.00 29.60  ? 363 ARG B CB    1 
ATOM   6666 C CG    . ARG B 2 363 ? 15.190 36.643  7.542   1.00 29.27  ? 363 ARG B CG    1 
ATOM   6667 C CD    . ARG B 2 363 ? 16.453 35.830  7.781   1.00 26.95  ? 363 ARG B CD    1 
ATOM   6668 N NE    . ARG B 2 363 ? 16.658 34.760  6.791   1.00 27.57  ? 363 ARG B NE    1 
ATOM   6669 C CZ    . ARG B 2 363 ? 17.102 34.971  5.553   1.00 27.49  ? 363 ARG B CZ    1 
ATOM   6670 N NH1   . ARG B 2 363 ? 17.368 36.211  5.138   1.00 27.92  ? 363 ARG B NH1   1 
ATOM   6671 N NH2   . ARG B 2 363 ? 17.274 33.957  4.721   1.00 27.42  ? 363 ARG B NH2   1 
ATOM   6672 N N     . ALA B 2 364 ? 14.223 39.915  10.559  1.00 32.18  ? 364 ALA B N     1 
ATOM   6673 C CA    . ALA B 2 364 ? 14.136 41.181  11.295  1.00 32.84  ? 364 ALA B CA    1 
ATOM   6674 C C     . ALA B 2 364 ? 15.408 41.978  11.112  1.00 31.35  ? 364 ALA B C     1 
ATOM   6675 O O     . ALA B 2 364 ? 15.453 43.190  11.378  1.00 32.41  ? 364 ALA B O     1 
ATOM   6676 C CB    . ALA B 2 364 ? 13.883 40.925  12.757  1.00 32.96  ? 364 ALA B CB    1 
ATOM   6677 N N     . PHE B 2 365 ? 16.438 41.288  10.639  1.00 29.38  ? 365 PHE B N     1 
ATOM   6678 C CA    . PHE B 2 365 ? 17.740 41.880  10.479  1.00 28.17  ? 365 PHE B CA    1 
ATOM   6679 C C     . PHE B 2 365 ? 18.339 41.578  9.123   1.00 27.76  ? 365 PHE B C     1 
ATOM   6680 O O     . PHE B 2 365 ? 18.189 40.463  8.634   1.00 27.62  ? 365 PHE B O     1 
ATOM   6681 C CB    . PHE B 2 365 ? 18.654 41.345  11.555  1.00 26.36  ? 365 PHE B CB    1 
ATOM   6682 C CG    . PHE B 2 365 ? 18.136 41.548  12.944  1.00 27.41  ? 365 PHE B CG    1 
ATOM   6683 C CD1   . PHE B 2 365 ? 17.708 40.451  13.714  1.00 27.11  ? 365 PHE B CD1   1 
ATOM   6684 C CD2   . PHE B 2 365 ? 18.091 42.826  13.506  1.00 27.23  ? 365 PHE B CD2   1 
ATOM   6685 C CE1   . PHE B 2 365 ? 17.245 40.628  15.015  1.00 25.70  ? 365 PHE B CE1   1 
ATOM   6686 C CE2   . PHE B 2 365 ? 17.625 43.007  14.815  1.00 27.45  ? 365 PHE B CE2   1 
ATOM   6687 C CZ    . PHE B 2 365 ? 17.203 41.909  15.561  1.00 27.67  ? 365 PHE B CZ    1 
ATOM   6688 N N     . ARG B 2 366 ? 18.998 42.586  8.534   1.00 28.34  ? 366 ARG B N     1 
ATOM   6689 C CA    . ARG B 2 366 ? 19.754 42.474  7.274   1.00 28.80  ? 366 ARG B CA    1 
ATOM   6690 C C     . ARG B 2 366 ? 20.683 41.253  7.334   1.00 26.64  ? 366 ARG B C     1 
ATOM   6691 O O     . ARG B 2 366 ? 21.340 41.054  8.338   1.00 25.57  ? 366 ARG B O     1 
ATOM   6692 C CB    . ARG B 2 366 ? 20.624 43.731  7.049   1.00 27.98  ? 366 ARG B CB    1 
ATOM   6693 C CG    . ARG B 2 366 ? 19.916 44.965  6.570   1.00 31.98  ? 366 ARG B CG    1 
ATOM   6694 C CD    . ARG B 2 366 ? 20.921 45.989  5.964   1.00 34.31  ? 366 ARG B CD    1 
ATOM   6695 N NE    . ARG B 2 366 ? 21.392 46.984  6.946   1.00 41.47  ? 366 ARG B NE    1 
ATOM   6696 C CZ    . ARG B 2 366 ? 22.435 46.839  7.783   1.00 43.36  ? 366 ARG B CZ    1 
ATOM   6697 N NH1   . ARG B 2 366 ? 23.184 45.725  7.795   1.00 43.89  ? 366 ARG B NH1   1 
ATOM   6698 N NH2   . ARG B 2 366 ? 22.733 47.819  8.638   1.00 44.78  ? 366 ARG B NH2   1 
ATOM   6699 N N     . PRO B 2 367 ? 20.726 40.420  6.280   1.00 26.95  ? 367 PRO B N     1 
ATOM   6700 C CA    . PRO B 2 367 ? 21.746 39.353  6.225   1.00 26.34  ? 367 PRO B CA    1 
ATOM   6701 C C     . PRO B 2 367 ? 23.115 39.913  5.809   1.00 26.27  ? 367 PRO B C     1 
ATOM   6702 O O     . PRO B 2 367 ? 23.217 41.064  5.393   1.00 27.22  ? 367 PRO B O     1 
ATOM   6703 C CB    . PRO B 2 367 ? 21.213 38.406  5.141   1.00 26.67  ? 367 PRO B CB    1 
ATOM   6704 C CG    . PRO B 2 367 ? 19.815 38.850  4.870   1.00 28.27  ? 367 PRO B CG    1 
ATOM   6705 C CD    . PRO B 2 367 ? 19.827 40.343  5.127   1.00 28.27  ? 367 PRO B CD    1 
ATOM   6706 N N     . PHE B 2 368 ? 24.168 39.119  5.914   1.00 25.70  ? 368 PHE B N     1 
ATOM   6707 C CA    . PHE B 2 368 ? 25.504 39.664  5.668   1.00 25.14  ? 368 PHE B CA    1 
ATOM   6708 C C     . PHE B 2 368 ? 26.324 38.598  4.957   1.00 25.34  ? 368 PHE B C     1 
ATOM   6709 O O     . PHE B 2 368 ? 25.911 37.435  4.901   1.00 25.11  ? 368 PHE B O     1 
ATOM   6710 C CB    . PHE B 2 368 ? 26.174 40.090  6.993   1.00 24.72  ? 368 PHE B CB    1 
ATOM   6711 C CG    . PHE B 2 368 ? 26.216 39.013  8.015   1.00 23.90  ? 368 PHE B CG    1 
ATOM   6712 C CD1   . PHE B 2 368 ? 25.169 38.852  8.917   1.00 25.59  ? 368 PHE B CD1   1 
ATOM   6713 C CD2   . PHE B 2 368 ? 27.274 38.109  8.049   1.00 24.60  ? 368 PHE B CD2   1 
ATOM   6714 C CE1   . PHE B 2 368 ? 25.195 37.787  9.872   1.00 25.51  ? 368 PHE B CE1   1 
ATOM   6715 C CE2   . PHE B 2 368 ? 27.313 37.043  8.989   1.00 25.61  ? 368 PHE B CE2   1 
ATOM   6716 C CZ    . PHE B 2 368 ? 26.277 36.886  9.901   1.00 24.24  ? 368 PHE B CZ    1 
ATOM   6717 N N     . ILE B 2 369 ? 27.477 39.009  4.429   1.00 25.55  ? 369 ILE B N     1 
ATOM   6718 C CA    . ILE B 2 369 ? 28.422 38.119  3.755   1.00 25.84  ? 369 ILE B CA    1 
ATOM   6719 C C     . ILE B 2 369 ? 29.640 37.908  4.651   1.00 25.93  ? 369 ILE B C     1 
ATOM   6720 O O     . ILE B 2 369 ? 30.117 38.857  5.306   1.00 25.33  ? 369 ILE B O     1 
ATOM   6721 C CB    . ILE B 2 369 ? 28.907 38.725  2.418   1.00 26.75  ? 369 ILE B CB    1 
ATOM   6722 C CG1   . ILE B 2 369 ? 27.725 39.104  1.523   1.00 27.40  ? 369 ILE B CG1   1 
ATOM   6723 C CG2   . ILE B 2 369 ? 29.819 37.768  1.695   1.00 27.07  ? 369 ILE B CG2   1 
ATOM   6724 C CD1   . ILE B 2 369 ? 28.094 40.151  0.455   1.00 30.07  ? 369 ILE B CD1   1 
ATOM   6725 N N     . GLU B 2 370 ? 30.137 36.669  4.684   1.00 26.27  ? 370 GLU B N     1 
ATOM   6726 C CA    . GLU B 2 370 ? 31.289 36.342  5.503   1.00 27.26  ? 370 GLU B CA    1 
ATOM   6727 C C     . GLU B 2 370 ? 32.083 35.211  4.893   1.00 28.89  ? 370 GLU B C     1 
ATOM   6728 O O     . GLU B 2 370 ? 31.532 34.136  4.590   1.00 29.67  ? 370 GLU B O     1 
ATOM   6729 C CB    . GLU B 2 370 ? 30.856 35.961  6.915   1.00 27.01  ? 370 GLU B CB    1 
ATOM   6730 C CG    . GLU B 2 370 ? 31.962 36.121  7.950   1.00 29.15  ? 370 GLU B CG    1 
ATOM   6731 C CD    . GLU B 2 370 ? 31.464 35.890  9.367   1.00 32.77  ? 370 GLU B CD    1 
ATOM   6732 O OE1   . GLU B 2 370 ? 31.097 36.913  10.031  1.00 32.98  ? 370 GLU B OE1   1 
ATOM   6733 O OE2   . GLU B 2 370 ? 31.429 34.695  9.801   1.00 32.18  ? 370 GLU B OE2   1 
ATOM   6734 N N     . ASN B 2 371 ? 33.387 35.447  4.735   1.00 29.84  ? 371 ASN B N     1 
ATOM   6735 C CA    . ASN B 2 371 ? 34.261 34.566  3.962   1.00 31.00  ? 371 ASN B CA    1 
ATOM   6736 C C     . ASN B 2 371 ? 33.527 34.030  2.734   1.00 30.57  ? 371 ASN B C     1 
ATOM   6737 O O     . ASN B 2 371 ? 33.433 32.813  2.512   1.00 31.87  ? 371 ASN B O     1 
ATOM   6738 C CB    . ASN B 2 371 ? 34.835 33.455  4.828   1.00 32.55  ? 371 ASN B CB    1 
ATOM   6739 C CG    . ASN B 2 371 ? 35.192 33.938  6.227   1.00 33.89  ? 371 ASN B CG    1 
ATOM   6740 O OD1   . ASN B 2 371 ? 36.347 34.238  6.524   1.00 38.25  ? 371 ASN B OD1   1 
ATOM   6741 N ND2   . ASN B 2 371 ? 34.193 34.031  7.088   1.00 32.51  ? 371 ASN B ND2   1 
ATOM   6742 N N     . GLY B 2 372 ? 32.975 34.972  1.963   1.00 28.92  ? 372 GLY B N     1 
ATOM   6743 C CA    . GLY B 2 372 ? 32.387 34.705  0.657   1.00 28.50  ? 372 GLY B CA    1 
ATOM   6744 C C     . GLY B 2 372 ? 31.045 34.000  0.592   1.00 27.56  ? 372 GLY B C     1 
ATOM   6745 O O     . GLY B 2 372 ? 30.559 33.658  -0.505  1.00 27.88  ? 372 GLY B O     1 
ATOM   6746 N N     . ARG B 2 373 ? 30.437 33.746  1.741   1.00 26.08  ? 373 ARG B N     1 
ATOM   6747 C CA    . ARG B 2 373 ? 29.069 33.294  1.673   1.00 25.80  ? 373 ARG B CA    1 
ATOM   6748 C C     . ARG B 2 373 ? 28.105 34.170  2.448   1.00 24.19  ? 373 ARG B C     1 
ATOM   6749 O O     . ARG B 2 373 ? 28.514 34.951  3.333   1.00 23.47  ? 373 ARG B O     1 
ATOM   6750 C CB    . ARG B 2 373 ? 28.903 31.790  1.942   1.00 26.87  ? 373 ARG B CB    1 
ATOM   6751 C CG    . ARG B 2 373 ? 29.292 31.273  3.264   1.00 27.09  ? 373 ARG B CG    1 
ATOM   6752 C CD    . ARG B 2 373 ? 28.770 29.821  3.432   1.00 28.95  ? 373 ARG B CD    1 
ATOM   6753 N NE    . ARG B 2 373 ? 29.383 28.813  2.562   1.00 32.20  ? 373 ARG B NE    1 
ATOM   6754 C CZ    . ARG B 2 373 ? 28.704 27.892  1.869   1.00 34.90  ? 373 ARG B CZ    1 
ATOM   6755 N NH1   . ARG B 2 373 ? 27.381 27.848  1.916   1.00 34.90  ? 373 ARG B NH1   1 
ATOM   6756 N NH2   . ARG B 2 373 ? 29.343 26.994  1.131   1.00 35.80  ? 373 ARG B NH2   1 
ATOM   6757 N N     . TRP B 2 374 ? 26.834 34.086  2.060   1.00 23.57  ? 374 TRP B N     1 
ATOM   6758 C CA    . TRP B 2 374 ? 25.790 34.747  2.813   1.00 22.13  ? 374 TRP B CA    1 
ATOM   6759 C C     . TRP B 2 374 ? 25.408 34.003  4.071   1.00 22.48  ? 374 TRP B C     1 
ATOM   6760 O O     . TRP B 2 374 ? 25.465 32.762  4.141   1.00 23.52  ? 374 TRP B O     1 
ATOM   6761 C CB    . TRP B 2 374 ? 24.556 34.952  1.983   1.00 22.08  ? 374 TRP B CB    1 
ATOM   6762 C CG    . TRP B 2 374 ? 24.753 35.875  0.907   1.00 20.99  ? 374 TRP B CG    1 
ATOM   6763 C CD1   . TRP B 2 374 ? 25.168 35.574  -0.333  1.00 21.05  ? 374 TRP B CD1   1 
ATOM   6764 C CD2   . TRP B 2 374 ? 24.535 37.270  0.937   1.00 20.79  ? 374 TRP B CD2   1 
ATOM   6765 N NE1   . TRP B 2 374 ? 25.227 36.685  -1.098  1.00 20.66  ? 374 TRP B NE1   1 
ATOM   6766 C CE2   . TRP B 2 374 ? 24.848 37.759  -0.345  1.00 21.62  ? 374 TRP B CE2   1 
ATOM   6767 C CE3   . TRP B 2 374 ? 24.098 38.167  1.917   1.00 20.30  ? 374 TRP B CE3   1 
ATOM   6768 C CZ2   . TRP B 2 374 ? 24.737 39.116  -0.688  1.00 21.48  ? 374 TRP B CZ2   1 
ATOM   6769 C CZ3   . TRP B 2 374 ? 23.996 39.523  1.580   1.00 20.16  ? 374 TRP B CZ3   1 
ATOM   6770 C CH2   . TRP B 2 374 ? 24.314 39.978  0.286   1.00 21.11  ? 374 TRP B CH2   1 
ATOM   6771 N N     . TRP B 2 375 ? 25.035 34.805  5.056   1.00 21.80  ? 375 TRP B N     1 
ATOM   6772 C CA    . TRP B 2 375 ? 24.528 34.358  6.318   1.00 22.50  ? 375 TRP B CA    1 
ATOM   6773 C C     . TRP B 2 375 ? 23.385 35.309  6.671   1.00 23.11  ? 375 TRP B C     1 
ATOM   6774 O O     . TRP B 2 375 ? 23.297 36.462  6.166   1.00 23.08  ? 375 TRP B O     1 
ATOM   6775 C CB    . TRP B 2 375 ? 25.604 34.459  7.396   1.00 21.57  ? 375 TRP B CB    1 
ATOM   6776 C CG    . TRP B 2 375 ? 26.809 33.595  7.177   1.00 21.97  ? 375 TRP B CG    1 
ATOM   6777 C CD1   . TRP B 2 375 ? 27.872 33.863  6.367   1.00 22.97  ? 375 TRP B CD1   1 
ATOM   6778 C CD2   . TRP B 2 375 ? 27.090 32.344  7.802   1.00 21.66  ? 375 TRP B CD2   1 
ATOM   6779 N NE1   . TRP B 2 375 ? 28.794 32.847  6.432   1.00 23.29  ? 375 TRP B NE1   1 
ATOM   6780 C CE2   . TRP B 2 375 ? 28.337 31.902  7.311   1.00 23.16  ? 375 TRP B CE2   1 
ATOM   6781 C CE3   . TRP B 2 375 ? 26.403 31.549  8.717   1.00 22.37  ? 375 TRP B CE3   1 
ATOM   6782 C CZ2   . TRP B 2 375 ? 28.909 30.687  7.690   1.00 24.83  ? 375 TRP B CZ2   1 
ATOM   6783 C CZ3   . TRP B 2 375 ? 26.980 30.351  9.118   1.00 25.98  ? 375 TRP B CZ3   1 
ATOM   6784 C CH2   . TRP B 2 375 ? 28.221 29.922  8.588   1.00 26.54  ? 375 TRP B CH2   1 
ATOM   6785 N N     . ALA B 2 376 ? 22.535 34.822  7.568   1.00 23.21  ? 376 ALA B N     1 
ATOM   6786 C CA    . ALA B 2 376 ? 21.428 35.589  8.076   1.00 23.20  ? 376 ALA B CA    1 
ATOM   6787 C C     . ALA B 2 376 ? 21.293 35.351  9.566   1.00 22.93  ? 376 ALA B C     1 
ATOM   6788 O O     . ALA B 2 376 ? 21.775 34.355  10.097  1.00 22.85  ? 376 ALA B O     1 
ATOM   6789 C CB    . ALA B 2 376 ? 20.171 35.188  7.372   1.00 24.60  ? 376 ALA B CB    1 
ATOM   6790 N N     . PHE B 2 377 ? 20.649 36.286  10.241  1.00 23.37  ? 377 PHE B N     1 
ATOM   6791 C CA    . PHE B 2 377 ? 20.285 36.094  11.623  1.00 24.33  ? 377 PHE B CA    1 
ATOM   6792 C C     . PHE B 2 377 ? 18.856 35.611  11.607  1.00 26.54  ? 377 PHE B C     1 
ATOM   6793 O O     . PHE B 2 377 ? 18.058 36.055  10.808  1.00 27.32  ? 377 PHE B O     1 
ATOM   6794 C CB    . PHE B 2 377 ? 20.367 37.393  12.411  1.00 23.88  ? 377 PHE B CB    1 
ATOM   6795 C CG    . PHE B 2 377 ? 21.767 37.957  12.569  1.00 22.46  ? 377 PHE B CG    1 
ATOM   6796 C CD1   . PHE B 2 377 ? 22.051 39.261  12.130  1.00 19.36  ? 377 PHE B CD1   1 
ATOM   6797 C CD2   . PHE B 2 377 ? 22.781 37.219  13.197  1.00 20.30  ? 377 PHE B CD2   1 
ATOM   6798 C CE1   . PHE B 2 377 ? 23.322 39.820  12.290  1.00 16.97  ? 377 PHE B CE1   1 
ATOM   6799 C CE2   . PHE B 2 377 ? 24.063 37.774  13.358  1.00 20.05  ? 377 PHE B CE2   1 
ATOM   6800 C CZ    . PHE B 2 377 ? 24.320 39.103  12.894  1.00 18.59  ? 377 PHE B CZ    1 
ATOM   6801 N N     . GLU B 2 378 ? 18.535 34.679  12.477  1.00 28.51  ? 378 GLU B N     1 
ATOM   6802 C CA    . GLU B 2 378 ? 17.184 34.185  12.562  1.00 32.04  ? 378 GLU B CA    1 
ATOM   6803 C C     . GLU B 2 378 ? 16.890 34.083  14.063  1.00 32.75  ? 378 GLU B C     1 
ATOM   6804 O O     . GLU B 2 378 ? 17.819 34.223  14.889  1.00 31.74  ? 378 GLU B O     1 
ATOM   6805 C CB    . GLU B 2 378 ? 17.089 32.838  11.848  1.00 33.68  ? 378 GLU B CB    1 
ATOM   6806 C CG    . GLU B 2 378 ? 15.917 32.716  10.852  1.00 39.98  ? 378 GLU B CG    1 
ATOM   6807 C CD    . GLU B 2 378 ? 16.349 32.714  9.371   1.00 43.19  ? 378 GLU B CD    1 
ATOM   6808 O OE1   . GLU B 2 378 ? 15.486 32.537  8.482   1.00 46.76  ? 378 GLU B OE1   1 
ATOM   6809 O OE2   . GLU B 2 378 ? 17.550 32.876  9.082   1.00 43.65  ? 378 GLU B OE2   1 
ATOM   6810 N N     . MET B 2 379 ? 15.628 33.863  14.432  1.00 34.79  ? 379 MET B N     1 
ATOM   6811 C CA    . MET B 2 379 ? 15.260 33.799  15.857  1.00 35.52  ? 379 MET B CA    1 
ATOM   6812 C C     . MET B 2 379 ? 14.928 32.383  16.317  1.00 36.83  ? 379 MET B C     1 
ATOM   6813 O O     . MET B 2 379 ? 14.229 31.640  15.634  1.00 38.82  ? 379 MET B O     1 
ATOM   6814 C CB    . MET B 2 379 ? 14.093 34.737  16.173  1.00 36.87  ? 379 MET B CB    1 
ATOM   6815 C CG    . MET B 2 379 ? 14.245 36.097  15.600  1.00 37.77  ? 379 MET B CG    1 
ATOM   6816 S SD    . MET B 2 379 ? 15.574 37.002  16.394  1.00 39.96  ? 379 MET B SD    1 
ATOM   6817 C CE    . MET B 2 379 ? 14.643 38.169  17.405  1.00 38.60  ? 379 MET B CE    1 
ATOM   6818 N N     . ARG B 2 380 ? 15.415 32.013  17.492  1.00 36.12  ? 380 ARG B N     1 
ATOM   6819 C CA    . ARG B 2 380 ? 15.085 30.717  18.029  1.00 37.90  ? 380 ARG B CA    1 
ATOM   6820 C C     . ARG B 2 380 ? 13.632 30.694  18.473  1.00 40.63  ? 380 ARG B C     1 
ATOM   6821 O O     . ARG B 2 380 ? 13.016 31.742  18.694  1.00 40.11  ? 380 ARG B O     1 
ATOM   6822 C CB    . ARG B 2 380 ? 15.995 30.386  19.199  1.00 37.29  ? 380 ARG B CB    1 
ATOM   6823 C CG    . ARG B 2 380 ? 17.405 30.060  18.807  1.00 35.05  ? 380 ARG B CG    1 
ATOM   6824 C CD    . ARG B 2 380 ? 18.137 29.448  19.990  1.00 35.53  ? 380 ARG B CD    1 
ATOM   6825 N NE    . ARG B 2 380 ? 19.438 28.895  19.618  1.00 33.65  ? 380 ARG B NE    1 
ATOM   6826 C CZ    . ARG B 2 380 ? 20.536 29.623  19.432  1.00 29.81  ? 380 ARG B CZ    1 
ATOM   6827 N NH1   . ARG B 2 380 ? 20.511 30.949  19.590  1.00 25.70  ? 380 ARG B NH1   1 
ATOM   6828 N NH2   . ARG B 2 380 ? 21.655 29.009  19.071  1.00 28.47  ? 380 ARG B NH2   1 
ATOM   6829 N N     . LYS B 2 381 ? 13.083 29.491  18.598  1.00 43.33  ? 381 LYS B N     1 
ATOM   6830 C CA    . LYS B 2 381 ? 11.733 29.336  19.162  1.00 46.64  ? 381 LYS B CA    1 
ATOM   6831 C C     . LYS B 2 381 ? 11.741 29.134  20.694  1.00 47.12  ? 381 LYS B C     1 
ATOM   6832 O O     . LYS B 2 381 ? 10.744 29.374  21.374  1.00 49.25  ? 381 LYS B O     1 
ATOM   6833 C CB    . LYS B 2 381 ? 10.959 28.231  18.433  1.00 49.68  ? 381 LYS B CB    1 
ATOM   6834 C CG    . LYS B 2 381 ? 10.997 28.362  16.903  1.00 50.00  ? 381 LYS B CG    1 
ATOM   6835 C CD    . LYS B 2 381 ? 9.616  28.079  16.297  1.00 56.47  ? 381 LYS B CD    1 
ATOM   6836 C CE    . LYS B 2 381 ? 9.566  28.355  14.796  1.00 57.49  ? 381 LYS B CE    1 
ATOM   6837 N NZ    . LYS B 2 381 ? 9.833  29.795  14.439  1.00 54.92  ? 381 LYS B NZ    1 
ATOM   6838 N N     . PHE B 2 382 ? 12.886 28.721  21.228  1.00 45.30  ? 382 PHE B N     1 
ATOM   6839 C CA    . PHE B 2 382 ? 13.058 28.506  22.662  1.00 45.78  ? 382 PHE B CA    1 
ATOM   6840 C C     . PHE B 2 382 ? 14.449 28.988  23.010  1.00 42.42  ? 382 PHE B C     1 
ATOM   6841 O O     . PHE B 2 382 ? 15.313 29.000  22.154  1.00 40.03  ? 382 PHE B O     1 
ATOM   6842 C CB    . PHE B 2 382 ? 12.913 27.021  23.001  1.00 48.30  ? 382 PHE B CB    1 
ATOM   6843 C CG    . PHE B 2 382 ? 13.536 26.124  21.992  1.00 48.94  ? 382 PHE B CG    1 
ATOM   6844 C CD1   . PHE B 2 382 ? 14.918 26.004  21.902  1.00 47.84  ? 382 PHE B CD1   1 
ATOM   6845 C CD2   . PHE B 2 382 ? 12.746 25.413  21.098  1.00 52.43  ? 382 PHE B CD2   1 
ATOM   6846 C CE1   . PHE B 2 382 ? 15.499 25.185  20.929  1.00 47.68  ? 382 PHE B CE1   1 
ATOM   6847 C CE2   . PHE B 2 382 ? 13.327 24.582  20.129  1.00 52.02  ? 382 PHE B CE2   1 
ATOM   6848 C CZ    . PHE B 2 382 ? 14.700 24.471  20.050  1.00 48.78  ? 382 PHE B CZ    1 
ATOM   6849 N N     . THR B 2 383 ? 14.667 29.371  24.262  1.00 42.56  ? 383 THR B N     1 
ATOM   6850 C CA    . THR B 2 383 ? 15.955 29.939  24.669  1.00 40.42  ? 383 THR B CA    1 
ATOM   6851 C C     . THR B 2 383 ? 16.575 29.268  25.884  1.00 41.47  ? 383 THR B C     1 
ATOM   6852 O O     . THR B 2 383 ? 17.729 29.516  26.202  1.00 40.28  ? 383 THR B O     1 
ATOM   6853 C CB    . THR B 2 383 ? 15.809 31.407  24.992  1.00 39.41  ? 383 THR B CB    1 
ATOM   6854 O OG1   . THR B 2 383 ? 14.699 31.573  25.887  1.00 42.69  ? 383 THR B OG1   1 
ATOM   6855 C CG2   . THR B 2 383 ? 15.570 32.195  23.729  1.00 37.54  ? 383 THR B CG2   1 
ATOM   6856 N N     . THR B 2 384 ? 15.797 28.437  26.566  1.00 32.44  ? 384 THR B N     1 
ATOM   6857 C CA    . THR B 2 384 ? 16.278 27.619  27.682  1.00 31.26  ? 384 THR B CA    1 
ATOM   6858 C C     . THR B 2 384 ? 16.154 26.143  27.310  1.00 29.43  ? 384 THR B C     1 
ATOM   6859 O O     . THR B 2 384 ? 15.289 25.797  26.509  1.00 29.27  ? 384 THR B O     1 
ATOM   6860 C CB    . THR B 2 384 ? 15.401 27.815  28.933  1.00 32.46  ? 384 THR B CB    1 
ATOM   6861 O OG1   . THR B 2 384 ? 14.139 27.138  28.738  1.00 33.32  ? 384 THR B OG1   1 
ATOM   6862 C CG2   . THR B 2 384 ? 15.201 29.294  29.244  1.00 32.98  ? 384 THR B CG2   1 
ATOM   6863 N N     . PRO B 2 385 ? 16.989 25.273  27.904  1.00 28.15  ? 385 PRO B N     1 
ATOM   6864 C CA    . PRO B 2 385 ? 16.912 23.827  27.609  1.00 27.84  ? 385 PRO B CA    1 
ATOM   6865 C C     . PRO B 2 385 ? 15.567 23.179  27.974  1.00 28.70  ? 385 PRO B C     1 
ATOM   6866 O O     . PRO B 2 385 ? 15.083 22.359  27.234  1.00 29.15  ? 385 PRO B O     1 
ATOM   6867 C CB    . PRO B 2 385 ? 18.056 23.225  28.426  1.00 26.74  ? 385 PRO B CB    1 
ATOM   6868 C CG    . PRO B 2 385 ? 18.455 24.268  29.392  1.00 26.82  ? 385 PRO B CG    1 
ATOM   6869 C CD    . PRO B 2 385 ? 18.062 25.590  28.854  1.00 27.62  ? 385 PRO B CD    1 
ATOM   6870 N N     . GLU B 2 386 ? 14.963 23.568  29.090  1.00 30.42  ? 386 GLU B N     1 
ATOM   6871 C CA    . GLU B 2 386 ? 13.586 23.195  29.418  1.00 31.75  ? 386 GLU B CA    1 
ATOM   6872 C C     . GLU B 2 386 ? 12.580 23.470  28.281  1.00 33.42  ? 386 GLU B C     1 
ATOM   6873 O O     . GLU B 2 386 ? 11.983 22.531  27.777  1.00 33.21  ? 386 GLU B O     1 
ATOM   6874 C CB    . GLU B 2 386 ? 13.146 23.896  30.704  1.00 33.15  ? 386 GLU B CB    1 
ATOM   6875 C CG    . GLU B 2 386 ? 13.943 23.516  31.955  1.00 34.21  ? 386 GLU B CG    1 
ATOM   6876 C CD    . GLU B 2 386 ? 15.164 24.400  32.222  1.00 37.36  ? 386 GLU B CD    1 
ATOM   6877 O OE1   . GLU B 2 386 ? 15.621 25.140  31.307  1.00 38.40  ? 386 GLU B OE1   1 
ATOM   6878 O OE2   . GLU B 2 386 ? 15.663 24.356  33.381  1.00 39.53  ? 386 GLU B OE2   1 
ATOM   6879 N N     . GLU B 2 387 ? 12.402 24.740  27.872  1.00 35.62  ? 387 GLU B N     1 
ATOM   6880 C CA    . GLU B 2 387 ? 11.506 25.095  26.749  1.00 37.79  ? 387 GLU B CA    1 
ATOM   6881 C C     . GLU B 2 387 ? 11.828 24.240  25.523  1.00 36.43  ? 387 GLU B C     1 
ATOM   6882 O O     . GLU B 2 387 ? 10.931 23.843  24.772  1.00 37.20  ? 387 GLU B O     1 
ATOM   6883 C CB    . GLU B 2 387 ? 11.667 26.555  26.314  1.00 39.00  ? 387 GLU B CB    1 
ATOM   6884 C CG    . GLU B 2 387 ? 11.226 27.658  27.257  1.00 43.15  ? 387 GLU B CG    1 
ATOM   6885 C CD    . GLU B 2 387 ? 11.815 29.064  26.862  1.00 44.82  ? 387 GLU B CD    1 
ATOM   6886 O OE1   . GLU B 2 387 ? 11.303 29.754  25.934  1.00 48.31  ? 387 GLU B OE1   1 
ATOM   6887 O OE2   . GLU B 2 387 ? 12.805 29.482  27.503  1.00 47.70  ? 387 GLU B OE2   1 
ATOM   6888 N N     . GLY B 2 388 ? 13.122 23.992  25.327  1.00 35.08  ? 388 GLY B N     1 
ATOM   6889 C CA    . GLY B 2 388 ? 13.642 23.282  24.165  1.00 34.98  ? 388 GLY B CA    1 
ATOM   6890 C C     . GLY B 2 388 ? 13.197 21.841  24.198  1.00 34.84  ? 388 GLY B C     1 
ATOM   6891 O O     . GLY B 2 388 ? 12.588 21.346  23.246  1.00 36.12  ? 388 GLY B O     1 
ATOM   6892 N N     . VAL B 2 389 ? 13.463 21.164  25.307  1.00 33.75  ? 389 VAL B N     1 
ATOM   6893 C CA    . VAL B 2 389 ? 13.024 19.786  25.434  1.00 33.74  ? 389 VAL B CA    1 
ATOM   6894 C C     . VAL B 2 389 ? 11.484 19.647  25.450  1.00 34.95  ? 389 VAL B C     1 
ATOM   6895 O O     . VAL B 2 389 ? 10.962 18.642  24.967  1.00 35.36  ? 389 VAL B O     1 
ATOM   6896 C CB    . VAL B 2 389 ? 13.707 19.078  26.603  1.00 32.26  ? 389 VAL B CB    1 
ATOM   6897 C CG1   . VAL B 2 389 ? 13.427 19.814  27.851  1.00 33.82  ? 389 VAL B CG1   1 
ATOM   6898 C CG2   . VAL B 2 389 ? 13.223 17.621  26.719  1.00 31.77  ? 389 VAL B CG2   1 
ATOM   6899 N N     . ARG B 2 390 ? 10.765 20.654  25.952  1.00 35.85  ? 390 ARG B N     1 
ATOM   6900 C CA    . ARG B 2 390 ? 9.299  20.656  25.837  1.00 37.75  ? 390 ARG B CA    1 
ATOM   6901 C C     . ARG B 2 390 ? 8.908  20.450  24.368  1.00 38.59  ? 390 ARG B C     1 
ATOM   6902 O O     . ARG B 2 390 ? 8.124  19.543  24.034  1.00 39.66  ? 390 ARG B O     1 
ATOM   6903 C CB    . ARG B 2 390 ? 8.660  21.937  26.402  1.00 38.78  ? 390 ARG B CB    1 
ATOM   6904 C CG    . ARG B 2 390 ? 7.258  21.710  26.986  1.00 40.44  ? 390 ARG B CG    1 
ATOM   6905 C CD    . ARG B 2 390 ? 6.601  22.953  27.592  1.00 44.12  ? 390 ARG B CD    1 
ATOM   6906 N NE    . ARG B 2 390 ? 7.352  23.594  28.687  1.00 48.33  ? 390 ARG B NE    1 
ATOM   6907 C CZ    . ARG B 2 390 ? 8.017  24.766  28.595  1.00 51.03  ? 390 ARG B CZ    1 
ATOM   6908 N NH1   . ARG B 2 390 ? 8.056  25.462  27.452  1.00 51.55  ? 390 ARG B NH1   1 
ATOM   6909 N NH2   . ARG B 2 390 ? 8.667  25.256  29.654  1.00 50.98  ? 390 ARG B NH2   1 
ATOM   6910 N N     . SER B 2 391 ? 9.494  21.266  23.494  1.00 38.61  ? 391 SER B N     1 
ATOM   6911 C CA    . SER B 2 391 ? 9.246  21.188  22.056  1.00 39.49  ? 391 SER B CA    1 
ATOM   6912 C C     . SER B 2 391 ? 9.624  19.819  21.483  1.00 38.46  ? 391 SER B C     1 
ATOM   6913 O O     . SER B 2 391 ? 8.778  19.128  20.918  1.00 39.24  ? 391 SER B O     1 
ATOM   6914 C CB    . SER B 2 391 ? 10.005 22.301  21.340  1.00 39.98  ? 391 SER B CB    1 
ATOM   6915 O OG    . SER B 2 391 ? 9.836  22.205  19.939  1.00 42.67  ? 391 SER B OG    1 
ATOM   6916 N N     . TYR B 2 392 ? 10.885 19.430  21.672  1.00 36.59  ? 392 TYR B N     1 
ATOM   6917 C CA    . TYR B 2 392 ? 11.399 18.181  21.142  1.00 36.45  ? 392 TYR B CA    1 
ATOM   6918 C C     . TYR B 2 392 ? 10.563 16.995  21.583  1.00 36.96  ? 392 TYR B C     1 
ATOM   6919 O O     . TYR B 2 392 ? 10.268 16.121  20.771  1.00 37.92  ? 392 TYR B O     1 
ATOM   6920 C CB    . TYR B 2 392 ? 12.858 17.957  21.538  1.00 34.52  ? 392 TYR B CB    1 
ATOM   6921 C CG    . TYR B 2 392 ? 13.427 16.675  20.967  1.00 34.01  ? 392 TYR B CG    1 
ATOM   6922 C CD1   . TYR B 2 392 ? 13.625 16.532  19.590  1.00 34.76  ? 392 TYR B CD1   1 
ATOM   6923 C CD2   . TYR B 2 392 ? 13.756 15.601  21.796  1.00 32.56  ? 392 TYR B CD2   1 
ATOM   6924 C CE1   . TYR B 2 392 ? 14.145 15.361  19.044  1.00 35.48  ? 392 TYR B CE1   1 
ATOM   6925 C CE2   . TYR B 2 392 ? 14.280 14.412  21.263  1.00 33.85  ? 392 TYR B CE2   1 
ATOM   6926 C CZ    . TYR B 2 392 ? 14.468 14.300  19.878  1.00 35.74  ? 392 TYR B CZ    1 
ATOM   6927 O OH    . TYR B 2 392 ? 14.968 13.134  19.331  1.00 35.89  ? 392 TYR B OH    1 
ATOM   6928 N N     . ALA B 2 393 ? 10.184 16.980  22.863  1.00 36.74  ? 393 ALA B N     1 
ATOM   6929 C CA    . ALA B 2 393 ? 9.359  15.907  23.446  1.00 37.43  ? 393 ALA B CA    1 
ATOM   6930 C C     . ALA B 2 393 ? 7.941  15.847  22.872  1.00 39.63  ? 393 ALA B C     1 
ATOM   6931 O O     . ALA B 2 393 ? 7.408  14.760  22.648  1.00 40.47  ? 393 ALA B O     1 
ATOM   6932 C CB    . ALA B 2 393 ? 9.306  16.030  24.964  1.00 36.59  ? 393 ALA B CB    1 
ATOM   6933 N N     . SER B 2 394 ? 7.333  17.006  22.638  1.00 40.91  ? 394 SER B N     1 
ATOM   6934 C CA    . SER B 2 394 ? 6.036  17.045  21.983  1.00 43.29  ? 394 SER B CA    1 
ATOM   6935 C C     . SER B 2 394 ? 6.133  16.618  20.527  1.00 44.72  ? 394 SER B C     1 
ATOM   6936 O O     . SER B 2 394 ? 5.313  15.845  20.059  1.00 46.72  ? 394 SER B O     1 
ATOM   6937 C CB    . SER B 2 394 ? 5.437  18.430  22.075  1.00 44.51  ? 394 SER B CB    1 
ATOM   6938 O OG    . SER B 2 394 ? 5.212  18.740  23.424  1.00 44.32  ? 394 SER B OG    1 
ATOM   6939 N N     . THR B 2 395 ? 7.137  17.109  19.811  1.00 44.50  ? 395 THR B N     1 
ATOM   6940 C CA    . THR B 2 395 ? 7.282  16.764  18.403  1.00 45.81  ? 395 THR B CA    1 
ATOM   6941 C C     . THR B 2 395 ? 7.837  15.353  18.177  1.00 45.25  ? 395 THR B C     1 
ATOM   6942 O O     . THR B 2 395 ? 7.497  14.725  17.198  1.00 47.46  ? 395 THR B O     1 
ATOM   6943 C CB    . THR B 2 395 ? 8.029  17.879  17.546  1.00 46.64  ? 395 THR B CB    1 
ATOM   6944 O OG1   . THR B 2 395 ? 9.136  18.452  18.261  1.00 43.93  ? 395 THR B OG1   1 
ATOM   6945 C CG2   . THR B 2 395 ? 7.075  19.000  17.195  1.00 48.68  ? 395 THR B CG2   1 
ATOM   6946 N N     . HIS B 2 396 ? 8.640  14.823  19.091  1.00 43.33  ? 396 HIS B N     1 
ATOM   6947 C CA    . HIS B 2 396 ? 9.376  13.584  18.776  1.00 43.31  ? 396 HIS B CA    1 
ATOM   6948 C C     . HIS B 2 396 ? 9.102  12.387  19.660  1.00 42.62  ? 396 HIS B C     1 
ATOM   6949 O O     . HIS B 2 396 ? 9.886  11.425  19.677  1.00 42.40  ? 396 HIS B O     1 
ATOM   6950 C CB    . HIS B 2 396 ? 10.878 13.847  18.725  1.00 41.98  ? 396 HIS B CB    1 
ATOM   6951 C CG    . HIS B 2 396 ? 11.276 14.751  17.610  1.00 43.38  ? 396 HIS B CG    1 
ATOM   6952 N ND1   . HIS B 2 396 ? 11.884 14.291  16.465  1.00 44.79  ? 396 HIS B ND1   1 
ATOM   6953 C CD2   . HIS B 2 396 ? 11.119 16.086  17.448  1.00 43.88  ? 396 HIS B CD2   1 
ATOM   6954 C CE1   . HIS B 2 396 ? 12.106 15.310  15.654  1.00 46.96  ? 396 HIS B CE1   1 
ATOM   6955 N NE2   . HIS B 2 396 ? 11.652 16.411  16.226  1.00 44.89  ? 396 HIS B NE2   1 
ATOM   6956 N N     . TRP B 2 397 ? 7.983  12.427  20.375  1.00 42.56  ? 397 TRP B N     1 
ATOM   6957 C CA    . TRP B 2 397 ? 7.577  11.292  21.195  1.00 41.98  ? 397 TRP B CA    1 
ATOM   6958 C C     . TRP B 2 397 ? 7.798  9.960   20.460  1.00 43.43  ? 397 TRP B C     1 
ATOM   6959 O O     . TRP B 2 397 ? 8.371  9.033   21.041  1.00 42.94  ? 397 TRP B O     1 
ATOM   6960 C CB    . TRP B 2 397 ? 6.127  11.450  21.661  1.00 42.58  ? 397 TRP B CB    1 
ATOM   6961 C CG    . TRP B 2 397 ? 5.157  11.444  20.535  1.00 44.58  ? 397 TRP B CG    1 
ATOM   6962 C CD1   . TRP B 2 397 ? 4.715  12.522  19.822  1.00 45.36  ? 397 TRP B CD1   1 
ATOM   6963 C CD2   . TRP B 2 397 ? 4.524  10.300  19.967  1.00 45.93  ? 397 TRP B CD2   1 
ATOM   6964 N NE1   . TRP B 2 397 ? 3.838  12.120  18.855  1.00 47.51  ? 397 TRP B NE1   1 
ATOM   6965 C CE2   . TRP B 2 397 ? 3.704  10.758  18.918  1.00 48.51  ? 397 TRP B CE2   1 
ATOM   6966 C CE3   . TRP B 2 397 ? 4.562  8.925   20.251  1.00 45.96  ? 397 TRP B CE3   1 
ATOM   6967 C CZ2   . TRP B 2 397 ? 2.923  9.889   18.145  1.00 51.78  ? 397 TRP B CZ2   1 
ATOM   6968 C CZ3   . TRP B 2 397 ? 3.798  8.064   19.484  1.00 48.66  ? 397 TRP B CZ3   1 
ATOM   6969 C CH2   . TRP B 2 397 ? 2.983  8.550   18.442  1.00 51.42  ? 397 TRP B CH2   1 
ATOM   6970 N N     . HIS B 2 398 ? 7.399  9.874   19.181  1.00 45.76  ? 398 HIS B N     1 
ATOM   6971 C CA    . HIS B 2 398 ? 7.448  8.599   18.451  1.00 47.55  ? 398 HIS B CA    1 
ATOM   6972 C C     . HIS B 2 398 ? 8.824  7.976   18.449  1.00 46.21  ? 398 HIS B C     1 
ATOM   6973 O O     . HIS B 2 398 ? 8.953  6.757   18.388  1.00 47.35  ? 398 HIS B O     1 
ATOM   6974 C CB    . HIS B 2 398 ? 6.973  8.718   17.013  1.00 50.70  ? 398 HIS B CB    1 
ATOM   6975 C CG    . HIS B 2 398 ? 6.536  7.404   16.421  1.00 56.63  ? 398 HIS B CG    1 
ATOM   6976 N ND1   . HIS B 2 398 ? 7.350  6.286   16.390  1.00 59.43  ? 398 HIS B ND1   1 
ATOM   6977 C CD2   . HIS B 2 398 ? 5.365  7.027   15.841  1.00 61.31  ? 398 HIS B CD2   1 
ATOM   6978 C CE1   . HIS B 2 398 ? 6.700  5.281   15.823  1.00 61.96  ? 398 HIS B CE1   1 
ATOM   6979 N NE2   . HIS B 2 398 ? 5.493  5.704   15.482  1.00 62.93  ? 398 HIS B NE2   1 
ATOM   6980 N N     . THR B 2 399 ? 9.857  8.804   18.521  1.00 44.14  ? 399 THR B N     1 
ATOM   6981 C CA    . THR B 2 399 ? 11.204 8.277   18.464  1.00 43.07  ? 399 THR B CA    1 
ATOM   6982 C C     . THR B 2 399 ? 11.849 7.981   19.805  1.00 40.73  ? 399 THR B C     1 
ATOM   6983 O O     . THR B 2 399 ? 13.034 7.707   19.852  1.00 40.37  ? 399 THR B O     1 
ATOM   6984 C CB    . THR B 2 399 ? 12.134 9.186   17.678  1.00 43.19  ? 399 THR B CB    1 
ATOM   6985 O OG1   . THR B 2 399 ? 13.211 8.388   17.178  1.00 44.51  ? 399 THR B OG1   1 
ATOM   6986 C CG2   . THR B 2 399 ? 12.682 10.335  18.559  1.00 39.89  ? 399 THR B CG2   1 
ATOM   6987 N N     . LEU B 2 400 ? 11.094 8.030   20.891  1.00 39.50  ? 400 LEU B N     1 
ATOM   6988 C CA    . LEU B 2 400 ? 11.726 7.897   22.193  1.00 37.81  ? 400 LEU B CA    1 
ATOM   6989 C C     . LEU B 2 400 ? 11.401 6.569   22.843  1.00 38.82  ? 400 LEU B C     1 
ATOM   6990 O O     . LEU B 2 400 ? 11.214 6.502   24.051  1.00 38.53  ? 400 LEU B O     1 
ATOM   6991 C CB    . LEU B 2 400 ? 11.342 9.052   23.110  1.00 36.04  ? 400 LEU B CB    1 
ATOM   6992 C CG    . LEU B 2 400 ? 11.492 10.481  22.590  1.00 35.49  ? 400 LEU B CG    1 
ATOM   6993 C CD1   . LEU B 2 400 ? 10.870 11.428  23.578  1.00 35.43  ? 400 LEU B CD1   1 
ATOM   6994 C CD2   . LEU B 2 400 ? 12.934 10.862  22.384  1.00 34.85  ? 400 LEU B CD2   1 
ATOM   6995 N N     . GLY B 2 401 ? 11.366 5.511   22.037  1.00 40.65  ? 401 GLY B N     1 
ATOM   6996 C CA    . GLY B 2 401 ? 11.005 4.178   22.499  1.00 41.38  ? 401 GLY B CA    1 
ATOM   6997 C C     . GLY B 2 401 ? 9.531  3.885   22.314  1.00 42.47  ? 401 GLY B C     1 
ATOM   6998 O O     . GLY B 2 401 ? 8.693  4.772   22.476  1.00 41.69  ? 401 GLY B O     1 
ATOM   6999 N N     . LYS B 2 402 ? 9.220  2.630   21.997  1.00 44.38  ? 402 LYS B N     1 
ATOM   7000 C CA    . LYS B 2 402 ? 7.842  2.193   21.798  1.00 46.01  ? 402 LYS B CA    1 
ATOM   7001 C C     . LYS B 2 402 ? 6.891  2.562   22.931  1.00 44.81  ? 402 LYS B C     1 
ATOM   7002 O O     . LYS B 2 402 ? 5.886  3.211   22.687  1.00 45.57  ? 402 LYS B O     1 
ATOM   7003 C CB    . LYS B 2 402 ? 7.779  0.695   21.556  1.00 48.83  ? 402 LYS B CB    1 
ATOM   7004 C CG    . LYS B 2 402 ? 6.360  0.113   21.541  1.00 51.76  ? 402 LYS B CG    1 
ATOM   7005 C CD    . LYS B 2 402 ? 5.716  0.236   20.181  1.00 55.47  ? 402 LYS B CD    1 
ATOM   7006 C CE    . LYS B 2 402 ? 4.420  -0.552  20.155  1.00 58.81  ? 402 LYS B CE    1 
ATOM   7007 N NZ    . LYS B 2 402 ? 3.885  -0.674  18.769  1.00 63.16  ? 402 LYS B NZ    1 
ATOM   7008 N N     . ASN B 2 403 ? 7.189  2.149   24.156  1.00 43.36  ? 403 ASN B N     1 
ATOM   7009 C CA    . ASN B 2 403 ? 6.258  2.362   25.243  1.00 42.77  ? 403 ASN B CA    1 
ATOM   7010 C C     . ASN B 2 403 ? 6.452  3.685   25.971  1.00 41.29  ? 403 ASN B C     1 
ATOM   7011 O O     . ASN B 2 403 ? 5.486  4.286   26.430  1.00 41.50  ? 403 ASN B O     1 
ATOM   7012 C CB    . ASN B 2 403 ? 6.320  1.201   26.206  1.00 43.57  ? 403 ASN B CB    1 
ATOM   7013 C CG    . ASN B 2 403 ? 5.847  -0.106  25.575  1.00 46.15  ? 403 ASN B CG    1 
ATOM   7014 O OD1   . ASN B 2 403 ? 4.666  -0.287  25.323  1.00 47.92  ? 403 ASN B OD1   1 
ATOM   7015 N ND2   . ASN B 2 403 ? 6.769  -1.017  25.328  1.00 46.80  ? 403 ASN B ND2   1 
ATOM   7016 N N     . VAL B 2 404 ? 7.691  4.157   26.062  1.00 39.93  ? 404 VAL B N     1 
ATOM   7017 C CA    . VAL B 2 404 ? 7.977  5.412   26.740  1.00 38.33  ? 404 VAL B CA    1 
ATOM   7018 C C     . VAL B 2 404 ? 7.563  6.615   25.903  1.00 38.59  ? 404 VAL B C     1 
ATOM   7019 O O     . VAL B 2 404 ? 7.097  7.631   26.444  1.00 37.98  ? 404 VAL B O     1 
ATOM   7020 C CB    . VAL B 2 404 ? 9.460  5.534   27.132  1.00 37.14  ? 404 VAL B CB    1 
ATOM   7021 C CG1   . VAL B 2 404 ? 9.696  4.896   28.466  1.00 37.47  ? 404 VAL B CG1   1 
ATOM   7022 C CG2   . VAL B 2 404 ? 10.343 4.864   26.104  1.00 38.51  ? 404 VAL B CG2   1 
ATOM   7023 N N     . GLY B 2 405 ? 7.736  6.498   24.587  1.00 39.48  ? 405 GLY B N     1 
ATOM   7024 C CA    . GLY B 2 405 ? 7.248  7.507   23.656  1.00 40.03  ? 405 GLY B CA    1 
ATOM   7025 C C     . GLY B 2 405 ? 5.744  7.678   23.759  1.00 41.64  ? 405 GLY B C     1 
ATOM   7026 O O     . GLY B 2 405 ? 5.258  8.785   23.986  1.00 41.69  ? 405 GLY B O     1 
ATOM   7027 N N     . GLU B 2 406 ? 5.003  6.580   23.622  1.00 43.57  ? 406 GLU B N     1 
ATOM   7028 C CA    . GLU B 2 406 ? 3.543  6.617   23.768  1.00 45.80  ? 406 GLU B CA    1 
ATOM   7029 C C     . GLU B 2 406 ? 3.081  7.279   25.077  1.00 44.40  ? 406 GLU B C     1 
ATOM   7030 O O     . GLU B 2 406 ? 2.065  7.960   25.100  1.00 45.66  ? 406 GLU B O     1 
ATOM   7031 C CB    . GLU B 2 406 ? 2.940  5.214   23.656  1.00 47.55  ? 406 GLU B CB    1 
ATOM   7032 C CG    . GLU B 2 406 ? 3.001  4.563   22.264  1.00 50.40  ? 406 GLU B CG    1 
ATOM   7033 C CD    . GLU B 2 406 ? 2.830  3.030   22.318  1.00 53.41  ? 406 GLU B CD    1 
ATOM   7034 O OE1   . GLU B 2 406 ? 2.580  2.415   21.248  1.00 59.21  ? 406 GLU B OE1   1 
ATOM   7035 O OE2   . GLU B 2 406 ? 2.948  2.422   23.423  1.00 55.38  ? 406 GLU B OE2   1 
ATOM   7036 N N     . SER B 2 407 ? 3.831  7.087   26.155  1.00 42.35  ? 407 SER B N     1 
ATOM   7037 C CA    . SER B 2 407 ? 3.418  7.578   27.457  1.00 41.84  ? 407 SER B CA    1 
ATOM   7038 C C     . SER B 2 407 ? 3.593  9.073   27.536  1.00 42.05  ? 407 SER B C     1 
ATOM   7039 O O     . SER B 2 407 ? 2.761  9.797   28.104  1.00 42.70  ? 407 SER B O     1 
ATOM   7040 C CB    . SER B 2 407 ? 4.260  6.945   28.533  1.00 40.13  ? 407 SER B CB    1 
ATOM   7041 O OG    . SER B 2 407 ? 3.919  7.490   29.771  1.00 38.41  ? 407 SER B OG    1 
ATOM   7042 N N     . ILE B 2 408 ? 4.721  9.513   26.983  1.00 41.40  ? 408 ILE B N     1 
ATOM   7043 C CA    . ILE B 2 408 ? 5.074  10.914  26.911  1.00 40.90  ? 408 ILE B CA    1 
ATOM   7044 C C     . ILE B 2 408 ? 4.077  11.608  26.001  1.00 43.05  ? 408 ILE B C     1 
ATOM   7045 O O     . ILE B 2 408 ? 3.798  12.818  26.161  1.00 43.35  ? 408 ILE B O     1 
ATOM   7046 C CB    . ILE B 2 408 ? 6.511  11.096  26.362  1.00 39.32  ? 408 ILE B CB    1 
ATOM   7047 C CG1   . ILE B 2 408 ? 7.532  10.573  27.385  1.00 38.07  ? 408 ILE B CG1   1 
ATOM   7048 C CG2   . ILE B 2 408 ? 6.793  12.587  26.039  1.00 39.64  ? 408 ILE B CG2   1 
ATOM   7049 C CD1   . ILE B 2 408 ? 8.950  10.450  26.891  1.00 36.52  ? 408 ILE B CD1   1 
ATOM   7050 N N     . ARG B 2 409 ? 3.538  10.843  25.048  1.00 44.52  ? 409 ARG B N     1 
ATOM   7051 C CA    . ARG B 2 409 ? 2.572  11.407  24.130  1.00 46.65  ? 409 ARG B CA    1 
ATOM   7052 C C     . ARG B 2 409 ? 1.325  11.822  24.895  1.00 48.34  ? 409 ARG B C     1 
ATOM   7053 O O     . ARG B 2 409 ? 0.831  12.931  24.711  1.00 49.25  ? 409 ARG B O     1 
ATOM   7054 C CB    . ARG B 2 409 ? 2.219  10.455  22.997  1.00 47.91  ? 409 ARG B CB    1 
ATOM   7055 C CG    . ARG B 2 409 ? 1.598  11.186  21.838  1.00 49.65  ? 409 ARG B CG    1 
ATOM   7056 C CD    . ARG B 2 409 ? 0.405  10.454  21.264  1.00 53.19  ? 409 ARG B CD    1 
ATOM   7057 N NE    . ARG B 2 409 ? 0.184  10.893  19.892  1.00 54.54  ? 409 ARG B NE    1 
ATOM   7058 C CZ    . ARG B 2 409 ? -0.526 10.232  18.992  1.00 56.78  ? 409 ARG B CZ    1 
ATOM   7059 N NH1   . ARG B 2 409 ? -0.637 10.723  17.772  1.00 58.63  ? 409 ARG B NH1   1 
ATOM   7060 N NH2   . ARG B 2 409 ? -1.121 9.089   19.305  1.00 59.34  ? 409 ARG B NH2   1 
ATOM   7061 N N     . GLU B 2 410 ? 0.839  10.944  25.766  1.00 49.01  ? 410 GLU B N     1 
ATOM   7062 C CA    . GLU B 2 410 ? -0.352 11.253  26.557  1.00 51.48  ? 410 GLU B CA    1 
ATOM   7063 C C     . GLU B 2 410 ? -0.096 12.446  27.458  1.00 50.57  ? 410 GLU B C     1 
ATOM   7064 O O     . GLU B 2 410 ? -0.805 13.438  27.410  1.00 51.69  ? 410 GLU B O     1 
ATOM   7065 C CB    . GLU B 2 410 ? -0.794 10.053  27.405  1.00 52.09  ? 410 GLU B CB    1 
ATOM   7066 C CG    . GLU B 2 410 ? -1.385 8.922   26.629  1.00 54.82  ? 410 GLU B CG    1 
ATOM   7067 C CD    . GLU B 2 410 ? -1.310 7.600   27.377  1.00 57.54  ? 410 GLU B CD    1 
ATOM   7068 O OE1   . GLU B 2 410 ? -1.519 6.545   26.730  1.00 60.35  ? 410 GLU B OE1   1 
ATOM   7069 O OE2   . GLU B 2 410 ? -1.046 7.604   28.603  1.00 57.65  ? 410 GLU B OE2   1 
ATOM   7070 N N     . TYR B 2 411 ? 0.932  12.323  28.280  1.00 49.19  ? 411 TYR B N     1 
ATOM   7071 C CA    . TYR B 2 411 ? 1.279  13.350  29.232  1.00 49.86  ? 411 TYR B CA    1 
ATOM   7072 C C     . TYR B 2 411 ? 2.758  13.282  29.611  1.00 47.35  ? 411 TYR B C     1 
ATOM   7073 O O     . TYR B 2 411 ? 3.325  12.186  29.724  1.00 47.18  ? 411 TYR B O     1 
ATOM   7074 C CB    . TYR B 2 411 ? 0.408  13.194  30.480  1.00 52.14  ? 411 TYR B CB    1 
ATOM   7075 C CG    . TYR B 2 411 ? 1.070  13.679  31.745  1.00 52.29  ? 411 TYR B CG    1 
ATOM   7076 C CD1   . TYR B 2 411 ? 1.822  12.801  32.542  1.00 51.62  ? 411 TYR B CD1   1 
ATOM   7077 C CD2   . TYR B 2 411 ? 0.962  15.016  32.138  1.00 53.81  ? 411 TYR B CD2   1 
ATOM   7078 C CE1   . TYR B 2 411 ? 2.442  13.237  33.702  1.00 51.28  ? 411 TYR B CE1   1 
ATOM   7079 C CE2   . TYR B 2 411 ? 1.580  15.469  33.295  1.00 53.59  ? 411 TYR B CE2   1 
ATOM   7080 C CZ    . TYR B 2 411 ? 2.318  14.574  34.068  1.00 52.56  ? 411 TYR B CZ    1 
ATOM   7081 O OH    . TYR B 2 411 ? 2.932  15.017  35.211  1.00 52.63  ? 411 TYR B OH    1 
ATOM   7082 N N     . PHE B 2 412 ? 3.367  14.449  29.798  1.00 46.29  ? 412 PHE B N     1 
ATOM   7083 C CA    . PHE B 2 412 ? 4.668  14.567  30.467  1.00 44.46  ? 412 PHE B CA    1 
ATOM   7084 C C     . PHE B 2 412 ? 4.812  15.956  31.087  1.00 44.50  ? 412 PHE B C     1 
ATOM   7085 O O     . PHE B 2 412 ? 4.099  16.881  30.706  1.00 45.74  ? 412 PHE B O     1 
ATOM   7086 C CB    . PHE B 2 412 ? 5.821  14.318  29.490  1.00 43.07  ? 412 PHE B CB    1 
ATOM   7087 C CG    . PHE B 2 412 ? 6.066  15.457  28.532  1.00 43.84  ? 412 PHE B CG    1 
ATOM   7088 C CD1   . PHE B 2 412 ? 7.032  16.414  28.802  1.00 43.14  ? 412 PHE B CD1   1 
ATOM   7089 C CD2   . PHE B 2 412 ? 5.322  15.574  27.363  1.00 46.63  ? 412 PHE B CD2   1 
ATOM   7090 C CE1   . PHE B 2 412 ? 7.253  17.471  27.924  1.00 44.24  ? 412 PHE B CE1   1 
ATOM   7091 C CE2   . PHE B 2 412 ? 5.533  16.634  26.483  1.00 47.33  ? 412 PHE B CE2   1 
ATOM   7092 C CZ    . PHE B 2 412 ? 6.505  17.582  26.762  1.00 45.15  ? 412 PHE B CZ    1 
ATOM   7093 N N     . GLU B 2 413 ? 5.719  16.114  32.042  1.00 43.37  ? 413 GLU B N     1 
ATOM   7094 C CA    . GLU B 2 413 ? 6.065  17.469  32.455  1.00 43.94  ? 413 GLU B CA    1 
ATOM   7095 C C     . GLU B 2 413 ? 7.553  17.713  32.600  1.00 42.42  ? 413 GLU B C     1 
ATOM   7096 O O     . GLU B 2 413 ? 8.328  16.774  32.802  1.00 41.01  ? 413 GLU B O     1 
ATOM   7097 C CB    . GLU B 2 413 ? 5.261  17.961  33.676  1.00 46.16  ? 413 GLU B CB    1 
ATOM   7098 C CG    . GLU B 2 413 ? 5.325  17.132  34.971  1.00 46.11  ? 413 GLU B CG    1 
ATOM   7099 C CD    . GLU B 2 413 ? 4.178  17.465  35.957  1.00 49.05  ? 413 GLU B CD    1 
ATOM   7100 O OE1   . GLU B 2 413 ? 3.151  18.048  35.545  1.00 51.41  ? 413 GLU B OE1   1 
ATOM   7101 O OE2   . GLU B 2 413 ? 4.278  17.122  37.151  1.00 49.95  ? 413 GLU B OE2   1 
ATOM   7102 N N     . ILE B 2 414 ? 7.935  18.980  32.441  1.00 43.04  ? 414 ILE B N     1 
ATOM   7103 C CA    . ILE B 2 414 ? 9.316  19.431  32.632  1.00 42.34  ? 414 ILE B CA    1 
ATOM   7104 C C     . ILE B 2 414 ? 9.477  19.939  34.056  1.00 43.73  ? 414 ILE B C     1 
ATOM   7105 O O     . ILE B 2 414 ? 8.789  20.859  34.498  1.00 45.91  ? 414 ILE B O     1 
ATOM   7106 C CB    . ILE B 2 414 ? 9.743  20.503  31.593  1.00 41.86  ? 414 ILE B CB    1 
ATOM   7107 C CG1   . ILE B 2 414 ? 10.577 19.874  30.484  1.00 39.89  ? 414 ILE B CG1   1 
ATOM   7108 C CG2   . ILE B 2 414 ? 10.597 21.584  32.239  1.00 42.99  ? 414 ILE B CG2   1 
ATOM   7109 C CD1   . ILE B 2 414 ? 9.786  19.138  29.440  1.00 39.99  ? 414 ILE B CD1   1 
ATOM   7110 N N     . ILE B 2 415 ? 10.418 19.336  34.756  1.00 43.47  ? 415 ILE B N     1 
ATOM   7111 C CA    . ILE B 2 415 ? 10.475 19.403  36.199  1.00 45.40  ? 415 ILE B CA    1 
ATOM   7112 C C     . ILE B 2 415 ? 11.834 19.988  36.530  1.00 45.37  ? 415 ILE B C     1 
ATOM   7113 O O     . ILE B 2 415 ? 12.856 19.480  36.066  1.00 43.50  ? 415 ILE B O     1 
ATOM   7114 C CB    . ILE B 2 415 ? 10.272 17.956  36.779  1.00 45.37  ? 415 ILE B CB    1 
ATOM   7115 C CG1   . ILE B 2 415 ? 8.823  17.498  36.618  1.00 46.35  ? 415 ILE B CG1   1 
ATOM   7116 C CG2   . ILE B 2 415 ? 10.670 17.841  38.215  1.00 46.69  ? 415 ILE B CG2   1 
ATOM   7117 C CD1   . ILE B 2 415 ? 7.814  18.399  37.278  1.00 49.02  ? 415 ILE B CD1   1 
ATOM   7118 N N     . SER B 2 416 ? 11.856 21.069  37.301  1.00 48.09  ? 416 SER B N     1 
ATOM   7119 C CA    . SER B 2 416 ? 13.130 21.696  37.666  1.00 49.21  ? 416 SER B CA    1 
ATOM   7120 C C     . SER B 2 416 ? 13.105 22.450  39.007  1.00 52.25  ? 416 SER B C     1 
ATOM   7121 O O     . SER B 2 416 ? 12.037 22.742  39.563  1.00 54.25  ? 416 SER B O     1 
ATOM   7122 C CB    . SER B 2 416 ? 13.614 22.611  36.541  1.00 47.97  ? 416 SER B CB    1 
ATOM   7123 O OG    . SER B 2 416 ? 13.077 23.905  36.710  1.00 51.38  ? 416 SER B OG    1 
ATOM   7124 N N     . GLY B 2 417 ? 14.296 22.753  39.518  1.00 53.26  ? 417 GLY B N     1 
ATOM   7125 C CA    . GLY B 2 417 ? 14.426 23.476  40.774  1.00 57.08  ? 417 GLY B CA    1 
ATOM   7126 C C     . GLY B 2 417 ? 13.904 22.664  41.934  1.00 59.76  ? 417 GLY B C     1 
ATOM   7127 O O     . GLY B 2 417 ? 13.991 21.438  41.925  1.00 58.90  ? 417 GLY B O     1 
ATOM   7128 N N     . GLU B 2 418 ? 13.338 23.347  42.926  1.00 63.82  ? 418 GLU B N     1 
ATOM   7129 C CA    . GLU B 2 418 ? 12.962 22.705  44.188  1.00 67.20  ? 418 GLU B CA    1 
ATOM   7130 C C     . GLU B 2 418 ? 11.821 21.714  44.007  1.00 67.46  ? 418 GLU B C     1 
ATOM   7131 O O     . GLU B 2 418 ? 11.676 20.767  44.789  1.00 68.91  ? 418 GLU B O     1 
ATOM   7132 C CB    . GLU B 2 418 ? 12.612 23.757  45.254  1.00 71.24  ? 418 GLU B CB    1 
ATOM   7133 C CG    . GLU B 2 418 ? 13.015 23.377  46.699  1.00 74.70  ? 418 GLU B CG    1 
ATOM   7134 C CD    . GLU B 2 418 ? 13.885 24.454  47.383  1.00 78.22  ? 418 GLU B CD    1 
ATOM   7135 O OE1   . GLU B 2 418 ? 14.262 25.448  46.716  1.00 77.84  ? 418 GLU B OE1   1 
ATOM   7136 O OE2   . GLU B 2 418 ? 14.204 24.307  48.588  1.00 80.97  ? 418 GLU B OE2   1 
ATOM   7137 N N     . LYS B 2 419 ? 11.016 21.938  42.972  1.00 66.69  ? 419 LYS B N     1 
ATOM   7138 C CA    . LYS B 2 419 ? 9.959  21.017  42.608  1.00 66.74  ? 419 LYS B CA    1 
ATOM   7139 C C     . LYS B 2 419 ? 10.607 19.673  42.291  1.00 64.22  ? 419 LYS B C     1 
ATOM   7140 O O     . LYS B 2 419 ? 10.064 18.618  42.623  1.00 64.87  ? 419 LYS B O     1 
ATOM   7141 C CB    . LYS B 2 419 ? 9.209  21.555  41.382  1.00 66.22  ? 419 LYS B CB    1 
ATOM   7142 C CG    . LYS B 2 419 ? 7.964  20.744  40.944  1.00 67.20  ? 419 LYS B CG    1 
ATOM   7143 C CD    . LYS B 2 419 ? 7.530  21.067  39.491  1.00 65.69  ? 419 LYS B CD    1 
ATOM   7144 C CE    . LYS B 2 419 ? 6.736  22.387  39.351  1.00 68.74  ? 419 LYS B CE    1 
ATOM   7145 N NZ    . LYS B 2 419 ? 5.251  22.218  39.421  1.00 70.17  ? 419 LYS B NZ    1 
ATOM   7146 N N     . LEU B 2 420 ? 11.784 19.735  41.665  1.00 61.67  ? 420 LEU B N     1 
ATOM   7147 C CA    . LEU B 2 420 ? 12.519 18.557  41.221  1.00 59.12  ? 420 LEU B CA    1 
ATOM   7148 C C     . LEU B 2 420 ? 13.166 17.821  42.378  1.00 60.27  ? 420 LEU B C     1 
ATOM   7149 O O     . LEU B 2 420 ? 13.138 16.585  42.443  1.00 60.22  ? 420 LEU B O     1 
ATOM   7150 C CB    . LEU B 2 420 ? 13.593 18.964  40.207  1.00 56.80  ? 420 LEU B CB    1 
ATOM   7151 C CG    . LEU B 2 420 ? 14.665 17.938  39.817  1.00 54.81  ? 420 LEU B CG    1 
ATOM   7152 C CD1   . LEU B 2 420 ? 14.051 16.646  39.275  1.00 51.62  ? 420 LEU B CD1   1 
ATOM   7153 C CD2   . LEU B 2 420 ? 15.658 18.552  38.827  1.00 53.05  ? 420 LEU B CD2   1 
ATOM   7154 N N     . PHE B 2 421 ? 13.748 18.590  43.289  1.00 61.51  ? 421 PHE B N     1 
ATOM   7155 C CA    . PHE B 2 421 ? 14.519 18.026  44.388  1.00 62.55  ? 421 PHE B CA    1 
ATOM   7156 C C     . PHE B 2 421 ? 13.675 17.226  45.379  1.00 64.57  ? 421 PHE B C     1 
ATOM   7157 O O     . PHE B 2 421 ? 14.200 16.373  46.096  1.00 65.42  ? 421 PHE B O     1 
ATOM   7158 C CB    . PHE B 2 421 ? 15.347 19.118  45.091  1.00 64.08  ? 421 PHE B CB    1 
ATOM   7159 C CG    . PHE B 2 421 ? 16.220 19.911  44.156  1.00 61.57  ? 421 PHE B CG    1 
ATOM   7160 C CD1   . PHE B 2 421 ? 16.392 21.270  44.340  1.00 62.98  ? 421 PHE B CD1   1 
ATOM   7161 C CD2   . PHE B 2 421 ? 16.846 19.299  43.072  1.00 59.18  ? 421 PHE B CD2   1 
ATOM   7162 C CE1   . PHE B 2 421 ? 17.188 22.007  43.467  1.00 61.41  ? 421 PHE B CE1   1 
ATOM   7163 C CE2   . PHE B 2 421 ? 17.636 20.022  42.196  1.00 57.51  ? 421 PHE B CE2   1 
ATOM   7164 C CZ    . PHE B 2 421 ? 17.812 21.378  42.396  1.00 58.72  ? 421 PHE B CZ    1 
ATOM   7165 N N     . LYS B 2 422 ? 12.372 17.481  45.410  1.00 65.48  ? 422 LYS B N     1 
ATOM   7166 C CA    . LYS B 2 422 ? 11.501 16.681  46.267  1.00 67.81  ? 422 LYS B CA    1 
ATOM   7167 C C     . LYS B 2 422 ? 10.865 15.532  45.495  1.00 65.81  ? 422 LYS B C     1 
ATOM   7168 O O     . LYS B 2 422 ? 9.870  14.969  45.938  1.00 67.79  ? 422 LYS B O     1 
ATOM   7169 C CB    . LYS B 2 422 ? 10.451 17.542  47.009  1.00 71.17  ? 422 LYS B CB    1 
ATOM   7170 C CG    . LYS B 2 422 ? 9.414  18.244  46.118  1.00 71.15  ? 422 LYS B CG    1 
ATOM   7171 C CD    . LYS B 2 422 ? 8.317  18.962  46.931  1.00 74.73  ? 422 LYS B CD    1 
ATOM   7172 C CE    . LYS B 2 422 ? 8.520  20.484  46.999  1.00 76.49  ? 422 LYS B CE    1 
ATOM   7173 N NZ    . LYS B 2 422 ? 9.211  20.941  48.240  1.00 78.96  ? 422 LYS B NZ    1 
ATOM   7174 N N     . GLU B 2 423 ? 11.447 15.184  44.347  1.00 62.11  ? 423 GLU B N     1 
ATOM   7175 C CA    . GLU B 2 423 ? 11.055 13.980  43.612  1.00 60.40  ? 423 GLU B CA    1 
ATOM   7176 C C     . GLU B 2 423 ? 12.106 12.887  43.846  1.00 59.35  ? 423 GLU B C     1 
ATOM   7177 O O     . GLU B 2 423 ? 13.256 13.206  44.106  1.00 59.28  ? 423 GLU B O     1 
ATOM   7178 C CB    . GLU B 2 423 ? 10.908 14.309  42.136  1.00 58.04  ? 423 GLU B CB    1 
ATOM   7179 C CG    . GLU B 2 423 ? 9.956  15.464  41.877  1.00 59.72  ? 423 GLU B CG    1 
ATOM   7180 C CD    . GLU B 2 423 ? 8.525  15.008  41.622  1.00 62.19  ? 423 GLU B CD    1 
ATOM   7181 O OE1   . GLU B 2 423 ? 7.606  15.476  42.345  1.00 65.29  ? 423 GLU B OE1   1 
ATOM   7182 O OE2   . GLU B 2 423 ? 8.313  14.185  40.688  1.00 62.48  ? 423 GLU B OE2   1 
ATOM   7183 N N     . PRO B 2 424 ? 11.728 11.598  43.749  1.00 58.99  ? 424 PRO B N     1 
ATOM   7184 C CA    . PRO B 2 424 ? 12.615 10.525  44.248  1.00 59.37  ? 424 PRO B CA    1 
ATOM   7185 C C     . PRO B 2 424 ? 13.863 10.242  43.376  1.00 56.79  ? 424 PRO B C     1 
ATOM   7186 O O     . PRO B 2 424 ? 14.164 9.084   43.036  1.00 56.71  ? 424 PRO B O     1 
ATOM   7187 C CB    . PRO B 2 424 ? 11.686 9.308   44.301  1.00 60.18  ? 424 PRO B CB    1 
ATOM   7188 C CG    . PRO B 2 424 ? 10.724 9.552   43.204  1.00 59.11  ? 424 PRO B CG    1 
ATOM   7189 C CD    . PRO B 2 424 ? 10.493 11.051  43.167  1.00 58.96  ? 424 PRO B CD    1 
ATOM   7190 N N     . VAL B 2 425 ? 14.595 11.298  43.052  1.00 54.78  ? 425 VAL B N     1 
ATOM   7191 C CA    . VAL B 2 425 ? 15.732 11.199  42.147  1.00 52.32  ? 425 VAL B CA    1 
ATOM   7192 C C     . VAL B 2 425 ? 17.030 11.715  42.778  1.00 52.68  ? 425 VAL B C     1 
ATOM   7193 O O     . VAL B 2 425 ? 18.063 11.800  42.112  1.00 51.30  ? 425 VAL B O     1 
ATOM   7194 C CB    . VAL B 2 425 ? 15.447 11.948  40.832  1.00 50.01  ? 425 VAL B CB    1 
ATOM   7195 C CG1   . VAL B 2 425 ? 14.260 11.315  40.121  1.00 49.07  ? 425 VAL B CG1   1 
ATOM   7196 C CG2   . VAL B 2 425 ? 15.203 13.444  41.091  1.00 49.95  ? 425 VAL B CG2   1 
ATOM   7197 N N     . THR B 2 426 ? 16.963 12.046  44.064  1.00 54.71  ? 426 THR B N     1 
ATOM   7198 C CA    . THR B 2 426 ? 18.110 12.565  44.809  1.00 55.87  ? 426 THR B CA    1 
ATOM   7199 C C     . THR B 2 426 ? 19.401 11.793  44.555  1.00 55.37  ? 426 THR B C     1 
ATOM   7200 O O     . THR B 2 426 ? 20.398 12.390  44.143  1.00 54.67  ? 426 THR B O     1 
ATOM   7201 C CB    . THR B 2 426 ? 17.826 12.626  46.316  1.00 59.06  ? 426 THR B CB    1 
ATOM   7202 O OG1   . THR B 2 426 ? 16.778 11.704  46.636  1.00 61.06  ? 426 THR B OG1   1 
ATOM   7203 C CG2   . THR B 2 426 ? 17.374 14.016  46.700  1.00 59.98  ? 426 THR B CG2   1 
ATOM   7204 N N     . ALA B 2 427 ? 19.370 10.479  44.770  1.00 55.91  ? 427 ALA B N     1 
ATOM   7205 C CA    . ALA B 2 427 ? 20.536 9.622   44.570  1.00 56.15  ? 427 ALA B CA    1 
ATOM   7206 C C     . ALA B 2 427 ? 21.139 9.692   43.159  1.00 53.77  ? 427 ALA B C     1 
ATOM   7207 O O     . ALA B 2 427 ? 22.365 9.774   43.009  1.00 53.84  ? 427 ALA B O     1 
ATOM   7208 C CB    . ALA B 2 427 ? 20.194 8.194   44.918  1.00 58.18  ? 427 ALA B CB    1 
ATOM   7209 N N     . GLU B 2 428 ? 20.285 9.664   42.133  1.00 51.71  ? 428 GLU B N     1 
ATOM   7210 C CA    . GLU B 2 428 ? 20.750 9.663   40.741  1.00 49.51  ? 428 GLU B CA    1 
ATOM   7211 C C     . GLU B 2 428 ? 21.286 11.009  40.343  1.00 47.53  ? 428 GLU B C     1 
ATOM   7212 O O     . GLU B 2 428 ? 22.238 11.082  39.587  1.00 46.64  ? 428 GLU B O     1 
ATOM   7213 C CB    . GLU B 2 428 ? 19.666 9.199   39.762  1.00 48.45  ? 428 GLU B CB    1 
ATOM   7214 C CG    . GLU B 2 428 ? 19.260 7.744   39.947  1.00 52.26  ? 428 GLU B CG    1 
ATOM   7215 C CD    . GLU B 2 428 ? 18.503 7.520   41.253  1.00 58.12  ? 428 GLU B CD    1 
ATOM   7216 O OE1   . GLU B 2 428 ? 17.652 8.384   41.582  1.00 59.80  ? 428 GLU B OE1   1 
ATOM   7217 O OE2   . GLU B 2 428 ? 18.761 6.506   41.954  1.00 61.03  ? 428 GLU B OE2   1 
ATOM   7218 N N     . LEU B 2 429 ? 20.689 12.073  40.862  1.00 47.38  ? 429 LEU B N     1 
ATOM   7219 C CA    . LEU B 2 429 ? 21.248 13.420  40.679  1.00 47.04  ? 429 LEU B CA    1 
ATOM   7220 C C     . LEU B 2 429 ? 22.691 13.568  41.215  1.00 48.39  ? 429 LEU B C     1 
ATOM   7221 O O     . LEU B 2 429 ? 23.504 14.268  40.624  1.00 47.02  ? 429 LEU B O     1 
ATOM   7222 C CB    . LEU B 2 429 ? 20.333 14.472  41.299  1.00 47.32  ? 429 LEU B CB    1 
ATOM   7223 C CG    . LEU B 2 429 ? 19.108 14.896  40.493  1.00 45.92  ? 429 LEU B CG    1 
ATOM   7224 C CD1   . LEU B 2 429 ? 18.185 15.770  41.338  1.00 46.54  ? 429 LEU B CD1   1 
ATOM   7225 C CD2   . LEU B 2 429 ? 19.547 15.648  39.233  1.00 45.37  ? 429 LEU B CD2   1 
ATOM   7226 N N     . CYS B 2 430 ? 22.991 12.883  42.320  1.00 50.99  ? 430 CYS B N     1 
ATOM   7227 C CA    . CYS B 2 430 ? 24.334 12.858  42.905  1.00 53.09  ? 430 CYS B CA    1 
ATOM   7228 C C     . CYS B 2 430 ? 25.307 12.075  42.060  1.00 52.75  ? 430 CYS B C     1 
ATOM   7229 O O     . CYS B 2 430 ? 26.334 12.605  41.643  1.00 52.96  ? 430 CYS B O     1 
ATOM   7230 C CB    . CYS B 2 430 ? 24.299 12.230  44.292  1.00 56.07  ? 430 CYS B CB    1 
ATOM   7231 S SG    . CYS B 2 430 ? 23.484 13.269  45.470  1.00 58.06  ? 430 CYS B SG    1 
ATOM   7232 N N     . GLU B 2 431 ? 24.982 10.804  41.837  1.00 53.01  ? 431 GLU B N     1 
ATOM   7233 C CA    . GLU B 2 431 ? 25.739 9.923   40.957  1.00 53.16  ? 431 GLU B CA    1 
ATOM   7234 C C     . GLU B 2 431 ? 26.077 10.656  39.657  1.00 51.07  ? 431 GLU B C     1 
ATOM   7235 O O     . GLU B 2 431 ? 27.201 10.595  39.166  1.00 51.37  ? 431 GLU B O     1 
ATOM   7236 C CB    . GLU B 2 431 ? 24.917 8.657   40.684  1.00 53.36  ? 431 GLU B CB    1 
ATOM   7237 C CG    . GLU B 2 431 ? 25.504 7.697   39.669  1.00 54.92  ? 431 GLU B CG    1 
ATOM   7238 C CD    . GLU B 2 431 ? 26.965 7.398   39.949  1.00 59.74  ? 431 GLU B CD    1 
ATOM   7239 O OE1   . GLU B 2 431 ? 27.807 7.754   39.087  1.00 60.59  ? 431 GLU B OE1   1 
ATOM   7240 O OE2   . GLU B 2 431 ? 27.271 6.835   41.032  1.00 61.99  ? 431 GLU B OE2   1 
ATOM   7241 N N     . MET B 2 432 ? 25.093 11.377  39.138  1.00 49.17  ? 432 MET B N     1 
ATOM   7242 C CA    . MET B 2 432 ? 25.242 12.173  37.936  1.00 47.75  ? 432 MET B CA    1 
ATOM   7243 C C     . MET B 2 432 ? 26.146 13.387  38.082  1.00 47.46  ? 432 MET B C     1 
ATOM   7244 O O     . MET B 2 432 ? 26.914 13.694  37.171  1.00 47.62  ? 432 MET B O     1 
ATOM   7245 C CB    . MET B 2 432 ? 23.878 12.656  37.483  1.00 46.11  ? 432 MET B CB    1 
ATOM   7246 C CG    . MET B 2 432 ? 23.867 13.171  36.102  1.00 44.55  ? 432 MET B CG    1 
ATOM   7247 S SD    . MET B 2 432 ? 22.174 13.461  35.678  1.00 44.66  ? 432 MET B SD    1 
ATOM   7248 C CE    . MET B 2 432 ? 22.052 15.220  35.987  1.00 43.82  ? 432 MET B CE    1 
ATOM   7249 N N     . MET B 2 433 ? 26.036 14.107  39.190  1.00 47.80  ? 433 MET B N     1 
ATOM   7250 C CA    . MET B 2 433 ? 26.798 15.347  39.337  1.00 47.73  ? 433 MET B CA    1 
ATOM   7251 C C     . MET B 2 433 ? 28.170 15.119  39.956  1.00 49.79  ? 433 MET B C     1 
ATOM   7252 O O     . MET B 2 433 ? 28.986 16.036  40.014  1.00 49.79  ? 433 MET B O     1 
ATOM   7253 C CB    . MET B 2 433 ? 26.009 16.364  40.143  1.00 47.76  ? 433 MET B CB    1 
ATOM   7254 C CG    . MET B 2 433 ? 24.811 16.906  39.405  1.00 46.11  ? 433 MET B CG    1 
ATOM   7255 S SD    . MET B 2 433 ? 24.015 18.244  40.303  1.00 47.46  ? 433 MET B SD    1 
ATOM   7256 C CE    . MET B 2 433 ? 22.807 17.323  41.251  1.00 50.51  ? 433 MET B CE    1 
ATOM   7257 N N     . GLY B 2 434 ? 28.411 13.886  40.402  1.00 51.28  ? 434 GLY B N     1 
ATOM   7258 C CA    . GLY B 2 434 ? 29.661 13.511  41.048  1.00 54.07  ? 434 GLY B CA    1 
ATOM   7259 C C     . GLY B 2 434 ? 29.806 14.089  42.441  1.00 56.51  ? 434 GLY B C     1 
ATOM   7260 O O     . GLY B 2 434 ? 30.902 14.453  42.851  1.00 58.57  ? 434 GLY B O     1 
ATOM   7261 N N     . VAL B 2 435 ? 28.704 14.166  43.178  1.00 56.94  ? 435 VAL B N     1 
ATOM   7262 C CA    . VAL B 2 435 ? 28.719 14.729  44.530  1.00 59.70  ? 435 VAL B CA    1 
ATOM   7263 C C     . VAL B 2 435 ? 29.441 13.817  45.525  1.00 63.32  ? 435 VAL B C     1 
ATOM   7264 O O     . VAL B 2 435 ? 29.340 12.599  45.443  1.00 63.78  ? 435 VAL B O     1 
ATOM   7265 C CB    . VAL B 2 435 ? 27.289 15.035  45.015  1.00 59.15  ? 435 VAL B CB    1 
ATOM   7266 C CG1   . VAL B 2 435 ? 27.310 15.749  46.356  1.00 61.05  ? 435 VAL B CG1   1 
ATOM   7267 C CG2   . VAL B 2 435 ? 26.574 15.892  43.987  1.00 56.39  ? 435 VAL B CG2   1 
ATOM   7268 N N     . LYS B 2 436 ? 30.172 14.417  46.459  1.00 66.50  ? 436 LYS B N     1 
ATOM   7269 C CA    . LYS B 2 436 ? 30.979 13.667  47.427  1.00 70.43  ? 436 LYS B CA    1 
ATOM   7270 C C     . LYS B 2 436 ? 30.331 13.509  48.824  1.00 73.70  ? 436 LYS B C     1 
ATOM   7271 O O     . LYS B 2 436 ? 29.380 14.214  49.161  1.00 73.50  ? 436 LYS B O     1 
ATOM   7272 C CB    . LYS B 2 436 ? 32.353 14.332  47.549  1.00 71.98  ? 436 LYS B CB    1 
ATOM   7273 C CG    . LYS B 2 436 ? 33.202 14.265  46.288  1.00 69.79  ? 436 LYS B CG    1 
ATOM   7274 C CD    . LYS B 2 436 ? 34.636 14.693  46.592  1.00 71.74  ? 436 LYS B CD    1 
ATOM   7275 C CE    . LYS B 2 436 ? 35.532 14.564  45.371  1.00 70.35  ? 436 LYS B CE    1 
ATOM   7276 N NZ    . LYS B 2 436 ? 36.921 14.998  45.641  1.00 71.88  ? 436 LYS B NZ    1 
ATOM   7277 N N     . ASP B 2 437 ? 30.866 12.589  49.634  1.00 77.47  ? 437 ASP B N     1 
ATOM   7278 C CA    . ASP B 2 437 ? 30.427 12.375  51.027  1.00 81.26  ? 437 ASP B CA    1 
ATOM   7279 C C     . ASP B 2 437 ? 29.019 11.806  51.115  1.00 80.48  ? 437 ASP B C     1 
ATOM   7280 O O     . ASP B 2 437 ? 28.661 11.172  52.109  1.00 83.46  ? 437 ASP B O     1 
ATOM   7281 C CB    . ASP B 2 437 ? 30.499 13.670  51.842  1.00 83.11  ? 437 ASP B CB    1 
ATOM   7282 C CG    . ASP B 2 437 ? 31.863 14.321  51.774  1.00 85.27  ? 437 ASP B CG    1 
ATOM   7283 O OD1   . ASP B 2 437 ? 31.979 15.377  51.118  1.00 84.24  ? 437 ASP B OD1   1 
ATOM   7284 O OD2   . ASP B 2 437 ? 32.825 13.771  52.355  1.00 89.89  ? 437 ASP B OD2   1 
ATOM   7285 O OP3   . G   C 3 1   ? 58.375 47.712  14.734  1.00 62.14  ? 1   G   C OP3   1 
ATOM   7286 P P     . G   C 3 1   ? 57.632 47.209  13.312  0.00 39.10  ? 1   G   C P     1 
ATOM   7287 O OP1   . G   C 3 1   ? 58.261 46.348  14.340  0.00 40.43  ? 1   G   C OP1   1 
ATOM   7288 O OP2   . G   C 3 1   ? 58.458 47.689  12.180  0.00 39.61  ? 1   G   C OP2   1 
ATOM   7289 O "O5'" . G   C 3 1   ? 56.221 46.533  12.997  1.00 36.63  ? 1   G   C "O5'" 1 
ATOM   7290 C "C5'" . G   C 3 1   ? 55.001 46.388  13.671  1.00 32.46  ? 1   G   C "C5'" 1 
ATOM   7291 C "C4'" . G   C 3 1   ? 53.858 46.512  12.692  1.00 29.94  ? 1   G   C "C4'" 1 
ATOM   7292 O "O4'" . G   C 3 1   ? 54.197 47.171  11.450  1.00 28.85  ? 1   G   C "O4'" 1 
ATOM   7293 C "C3'" . G   C 3 1   ? 53.300 45.197  12.228  1.00 29.26  ? 1   G   C "C3'" 1 
ATOM   7294 O "O3'" . G   C 3 1   ? 52.563 44.699  13.278  1.00 28.89  ? 1   G   C "O3'" 1 
ATOM   7295 C "C2'" . G   C 3 1   ? 52.384 45.681  11.116  1.00 28.95  ? 1   G   C "C2'" 1 
ATOM   7296 O "O2'" . G   C 3 1   ? 51.212 46.314  11.613  1.00 28.10  ? 1   G   C "O2'" 1 
ATOM   7297 C "C1'" . G   C 3 1   ? 53.319 46.686  10.445  1.00 29.77  ? 1   G   C "C1'" 1 
ATOM   7298 N N9    . G   C 3 1   ? 54.151 46.171  9.343   1.00 30.78  ? 1   G   C N9    1 
ATOM   7299 C C8    . G   C 3 1   ? 55.526 46.109  9.354   1.00 32.59  ? 1   G   C C8    1 
ATOM   7300 N N7    . G   C 3 1   ? 56.057 45.637  8.275   1.00 33.12  ? 1   G   C N7    1 
ATOM   7301 C C5    . G   C 3 1   ? 54.963 45.384  7.466   1.00 31.69  ? 1   G   C C5    1 
ATOM   7302 C C6    . G   C 3 1   ? 54.933 44.875  6.144   1.00 30.96  ? 1   G   C C6    1 
ATOM   7303 O O6    . G   C 3 1   ? 55.877 44.549  5.428   1.00 32.59  ? 1   G   C O6    1 
ATOM   7304 N N1    . G   C 3 1   ? 53.649 44.741  5.657   1.00 29.32  ? 1   G   C N1    1 
ATOM   7305 C C2    . G   C 3 1   ? 52.522 45.086  6.367   1.00 28.65  ? 1   G   C C2    1 
ATOM   7306 N N2    . G   C 3 1   ? 51.371 44.877  5.703   1.00 27.91  ? 1   G   C N2    1 
ATOM   7307 N N3    . G   C 3 1   ? 52.519 45.576  7.611   1.00 28.11  ? 1   G   C N3    1 
ATOM   7308 C C4    . G   C 3 1   ? 53.778 45.696  8.103   1.00 29.75  ? 1   G   C C4    1 
ATOM   7309 P P     . G   C 3 2   ? 52.437 43.132  13.452  1.00 28.54  ? 2   G   C P     1 
ATOM   7310 O OP1   . G   C 3 2   ? 51.617 42.914  14.676  1.00 30.68  ? 2   G   C OP1   1 
ATOM   7311 O OP2   . G   C 3 2   ? 53.751 42.481  13.309  1.00 29.87  ? 2   G   C OP2   1 
ATOM   7312 O "O5'" . G   C 3 2   ? 51.574 42.726  12.171  1.00 26.55  ? 2   G   C "O5'" 1 
ATOM   7313 C "C5'" . G   C 3 2   ? 50.183 42.955  12.175  1.00 24.60  ? 2   G   C "C5'" 1 
ATOM   7314 C "C4'" . G   C 3 2   ? 49.605 42.597  10.832  1.00 24.99  ? 2   G   C "C4'" 1 
ATOM   7315 O "O4'" . G   C 3 2   ? 50.192 43.421  9.791   1.00 25.95  ? 2   G   C "O4'" 1 
ATOM   7316 C "C3'" . G   C 3 2   ? 49.874 41.176  10.374  1.00 25.27  ? 2   G   C "C3'" 1 
ATOM   7317 O "O3'" . G   C 3 2   ? 48.896 40.333  10.937  1.00 26.32  ? 2   G   C "O3'" 1 
ATOM   7318 C "C2'" . G   C 3 2   ? 49.559 41.371  8.909   1.00 24.12  ? 2   G   C "C2'" 1 
ATOM   7319 O "O2'" . G   C 3 2   ? 48.184 41.601  8.759   1.00 22.17  ? 2   G   C "O2'" 1 
ATOM   7320 C "C1'" . G   C 3 2   ? 50.280 42.660  8.607   1.00 24.57  ? 2   G   C "C1'" 1 
ATOM   7321 N N9    . G   C 3 2   ? 51.669 42.432  8.252   1.00 26.02  ? 2   G   C N9    1 
ATOM   7322 C C8    . G   C 3 2   ? 52.764 42.594  9.058   1.00 27.26  ? 2   G   C C8    1 
ATOM   7323 N N7    . G   C 3 2   ? 53.888 42.317  8.450   1.00 29.28  ? 2   G   C N7    1 
ATOM   7324 C C5    . G   C 3 2   ? 53.512 41.958  7.157   1.00 28.12  ? 2   G   C C5    1 
ATOM   7325 C C6    . G   C 3 2   ? 54.288 41.554  6.059   1.00 28.99  ? 2   G   C C6    1 
ATOM   7326 O O6    . G   C 3 2   ? 55.510 41.426  5.999   1.00 32.08  ? 2   G   C O6    1 
ATOM   7327 N N1    . G   C 3 2   ? 53.527 41.273  4.944   1.00 29.44  ? 2   G   C N1    1 
ATOM   7328 C C2    . G   C 3 2   ? 52.168 41.366  4.886   1.00 28.10  ? 2   G   C C2    1 
ATOM   7329 N N2    . G   C 3 2   ? 51.596 41.072  3.708   1.00 28.28  ? 2   G   C N2    1 
ATOM   7330 N N3    . G   C 3 2   ? 51.427 41.738  5.911   1.00 27.17  ? 2   G   C N3    1 
ATOM   7331 C C4    . G   C 3 2   ? 52.154 42.018  7.019   1.00 26.95  ? 2   G   C C4    1 
ATOM   7332 P P     . A   C 3 3   ? 49.128 38.768  11.136  1.00 29.04  ? 3   A   C P     1 
ATOM   7333 O OP1   . A   C 3 3   ? 47.943 38.340  11.944  1.00 27.92  ? 3   A   C OP1   1 
ATOM   7334 O OP2   . A   C 3 3   ? 50.536 38.561  11.537  1.00 28.87  ? 3   A   C OP2   1 
ATOM   7335 O "O5'" . A   C 3 3   ? 49.061 38.117  9.673   1.00 29.38  ? 3   A   C "O5'" 1 
ATOM   7336 C "C5'" . A   C 3 3   ? 47.854 38.127  8.928   1.00 30.49  ? 3   A   C "C5'" 1 
ATOM   7337 C "C4'" . A   C 3 3   ? 48.121 37.628  7.532   1.00 33.65  ? 3   A   C "C4'" 1 
ATOM   7338 O "O4'" . A   C 3 3   ? 49.007 38.572  6.890   1.00 34.69  ? 3   A   C "O4'" 1 
ATOM   7339 C "C3'" . A   C 3 3   ? 48.892 36.316  7.445   1.00 35.83  ? 3   A   C "C3'" 1 
ATOM   7340 O "O3'" . A   C 3 3   ? 48.036 35.175  7.589   1.00 36.63  ? 3   A   C "O3'" 1 
ATOM   7341 C "C2'" . A   C 3 3   ? 49.425 36.430  6.029   1.00 36.72  ? 3   A   C "C2'" 1 
ATOM   7342 O "O2'" . A   C 3 3   ? 48.383 36.140  5.147   1.00 35.73  ? 3   A   C "O2'" 1 
ATOM   7343 C "C1'" . A   C 3 3   ? 49.780 37.906  5.918   1.00 38.06  ? 3   A   C "C1'" 1 
ATOM   7344 N N9    . A   C 3 3   ? 51.197 38.108  6.183   1.00 39.75  ? 3   A   C N9    1 
ATOM   7345 C C8    . A   C 3 3   ? 51.790 38.616  7.304   1.00 39.47  ? 3   A   C C8    1 
ATOM   7346 N N7    . A   C 3 3   ? 53.104 38.642  7.235   1.00 40.33  ? 3   A   C N7    1 
ATOM   7347 C C5    . A   C 3 3   ? 53.371 38.112  5.996   1.00 41.35  ? 3   A   C C5    1 
ATOM   7348 C C6    . A   C 3 3   ? 54.568 37.859  5.322   1.00 44.90  ? 3   A   C C6    1 
ATOM   7349 N N6    . A   C 3 3   ? 55.757 38.146  5.854   1.00 46.62  ? 3   A   C N6    1 
ATOM   7350 N N1    . A   C 3 3   ? 54.504 37.309  4.086   1.00 46.38  ? 3   A   C N1    1 
ATOM   7351 C C2    . A   C 3 3   ? 53.300 37.035  3.569   1.00 45.16  ? 3   A   C C2    1 
ATOM   7352 N N3    . A   C 3 3   ? 52.102 37.231  4.118   1.00 42.83  ? 3   A   C N3    1 
ATOM   7353 C C4    . A   C 3 3   ? 52.216 37.775  5.335   1.00 40.92  ? 3   A   C C4    1 
ATOM   7354 P P     . A   C 3 4   ? 48.703 33.720  7.758   1.00 42.16  ? 4   A   C P     1 
ATOM   7355 O OP1   . A   C 3 4   ? 47.628 32.749  8.120   1.00 41.35  ? 4   A   C OP1   1 
ATOM   7356 O OP2   . A   C 3 4   ? 49.920 33.883  8.594   1.00 40.61  ? 4   A   C OP2   1 
ATOM   7357 O "O5'" . A   C 3 4   ? 49.284 33.325  6.317   1.00 43.43  ? 4   A   C "O5'" 1 
ATOM   7358 C "C5'" . A   C 3 4   ? 48.468 32.815  5.312   1.00 45.04  ? 4   A   C "C5'" 1 
ATOM   7359 C "C4'" . A   C 3 4   ? 49.414 32.486  4.204   1.00 49.34  ? 4   A   C "C4'" 1 
ATOM   7360 O "O4'" . A   C 3 4   ? 50.263 33.628  4.005   1.00 49.70  ? 4   A   C "O4'" 1 
ATOM   7361 C "C3'" . A   C 3 4   ? 50.450 31.448  4.555   1.00 52.77  ? 4   A   C "C3'" 1 
ATOM   7362 O "O3'" . A   C 3 4   ? 49.934 30.155  4.465   1.00 55.72  ? 4   A   C "O3'" 1 
ATOM   7363 C "C2'" . A   C 3 4   ? 51.401 31.698  3.410   1.00 55.47  ? 4   A   C "C2'" 1 
ATOM   7364 O "O2'" . A   C 3 4   ? 50.788 31.355  2.188   1.00 57.76  ? 4   A   C "O2'" 1 
ATOM   7365 C "C1'" . A   C 3 4   ? 51.515 33.204  3.501   1.00 53.02  ? 4   A   C "C1'" 1 
ATOM   7366 N N9    . A   C 3 4   ? 52.610 33.650  4.364   1.00 52.90  ? 4   A   C N9    1 
ATOM   7367 C C8    . A   C 3 4   ? 52.528 34.157  5.639   1.00 50.90  ? 4   A   C C8    1 
ATOM   7368 N N7    . A   C 3 4   ? 53.694 34.482  6.151   1.00 51.56  ? 4   A   C N7    1 
ATOM   7369 C C5    . A   C 3 4   ? 54.610 34.171  5.146   1.00 54.71  ? 4   A   C C5    1 
ATOM   7370 C C6    . A   C 3 4   ? 56.029 34.269  5.042   1.00 57.08  ? 4   A   C C6    1 
ATOM   7371 N N6    . A   C 3 4   ? 56.828 34.734  6.013   1.00 57.10  ? 4   A   C N6    1 
ATOM   7372 N N1    . A   C 3 4   ? 56.619 33.864  3.893   1.00 59.16  ? 4   A   C N1    1 
ATOM   7373 C C2    . A   C 3 4   ? 55.848 33.390  2.904   1.00 59.58  ? 4   A   C C2    1 
ATOM   7374 N N3    . A   C 3 4   ? 54.518 33.252  2.885   1.00 58.24  ? 4   A   C N3    1 
ATOM   7375 C C4    . A   C 3 4   ? 53.951 33.659  4.039   1.00 55.03  ? 4   A   C C4    1 
ATOM   7376 P P     . G   C 3 5   ? 50.637 29.036  5.360   1.00 60.47  ? 5   G   C P     1 
ATOM   7377 O OP1   . G   C 3 5   ? 49.886 27.762  5.206   1.00 62.12  ? 5   G   C OP1   1 
ATOM   7378 O OP2   . G   C 3 5   ? 50.894 29.616  6.697   1.00 56.88  ? 5   G   C OP2   1 
ATOM   7379 O "O5'" . G   C 3 5   ? 52.049 28.831  4.663   1.00 63.49  ? 5   G   C "O5'" 1 
ATOM   7380 C "C5'" . G   C 3 5   ? 52.145 27.749  3.783   1.00 69.58  ? 5   G   C "C5'" 1 
ATOM   7381 C "C4'" . G   C 3 5   ? 53.498 27.783  3.134   1.00 74.59  ? 5   G   C "C4'" 1 
ATOM   7382 O "O4'" . G   C 3 5   ? 53.939 29.156  3.002   1.00 72.65  ? 5   G   C "O4'" 1 
ATOM   7383 C "C3'" . G   C 3 5   ? 54.600 27.148  3.953   1.00 77.59  ? 5   G   C "C3'" 1 
ATOM   7384 O "O3'" . G   C 3 5   ? 54.556 25.749  3.808   1.00 83.38  ? 5   G   C "O3'" 1 
ATOM   7385 C "C2'" . G   C 3 5   ? 55.791 27.738  3.218   1.00 78.90  ? 5   G   C "C2'" 1 
ATOM   7386 O "O2'" . G   C 3 5   ? 55.955 27.199  1.920   1.00 81.84  ? 5   G   C "O2'" 1 
ATOM   7387 C "C1'" . G   C 3 5   ? 55.346 29.188  3.141   1.00 74.30  ? 5   G   C "C1'" 1 
ATOM   7388 N N9    . G   C 3 5   ? 55.716 29.963  4.324   1.00 71.62  ? 5   G   C N9    1 
ATOM   7389 C C8    . G   C 3 5   ? 54.890 30.513  5.287   1.00 67.99  ? 5   G   C C8    1 
ATOM   7390 N N7    . G   C 3 5   ? 55.542 31.169  6.218   1.00 66.84  ? 5   G   C N7    1 
ATOM   7391 C C5    . G   C 3 5   ? 56.888 31.044  5.850   1.00 70.27  ? 5   G   C C5    1 
ATOM   7392 C C6    . G   C 3 5   ? 58.087 31.538  6.458   1.00 71.28  ? 5   G   C C6    1 
ATOM   7393 O O6    . G   C 3 5   ? 58.218 32.212  7.494   1.00 69.49  ? 5   G   C O6    1 
ATOM   7394 N N1    . G   C 3 5   ? 59.234 31.177  5.737   1.00 74.93  ? 5   G   C N1    1 
ATOM   7395 C C2    . G   C 3 5   ? 59.237 30.427  4.575   1.00 77.52  ? 5   G   C C2    1 
ATOM   7396 N N2    . G   C 3 5   ? 60.433 30.165  4.011   1.00 81.59  ? 5   G   C N2    1 
ATOM   7397 N N3    . G   C 3 5   ? 58.129 29.965  4.002   1.00 76.35  ? 5   G   C N3    1 
ATOM   7398 C C4    . G   C 3 5   ? 57.001 30.305  4.684   1.00 72.78  ? 5   G   C C4    1 
ATOM   7399 P P     . U   C 3 6   ? 55.269 24.804  4.885   1.00 87.30  ? 6   U   C P     1 
ATOM   7400 O OP1   . U   C 3 6   ? 55.116 23.406  4.403   1.00 90.95  ? 6   U   C OP1   1 
ATOM   7401 O OP2   . U   C 3 6   ? 54.776 25.248  6.216   1.00 82.52  ? 6   U   C OP2   1 
ATOM   7402 O "O5'" . U   C 3 6   ? 56.829 25.148  4.811   1.00 88.87  ? 6   U   C "O5'" 1 
ATOM   7403 C "C5'" . U   C 3 6   ? 57.621 24.681  3.731   1.00 93.41  ? 6   U   C "C5'" 1 
ATOM   7404 C "C4'" . U   C 3 6   ? 59.072 25.040  3.975   1.00 95.67  ? 6   U   C "C4'" 1 
ATOM   7405 O "O4'" . U   C 3 6   ? 59.220 26.479  4.110   1.00 91.87  ? 6   U   C "O4'" 1 
ATOM   7406 C "C3'" . U   C 3 6   ? 59.656 24.478  5.263   1.00 97.00  ? 6   U   C "C3'" 1 
ATOM   7407 O "O3'" . U   C 3 6   ? 60.041 23.110  5.074   1.00 102.66 ? 6   U   C "O3'" 1 
ATOM   7408 C "C2'" . U   C 3 6   ? 60.832 25.430  5.466   1.00 96.87  ? 6   U   C "C2'" 1 
ATOM   7409 O "O2'" . U   C 3 6   ? 61.930 25.181  4.615   1.00 102.14 ? 6   U   C "O2'" 1 
ATOM   7410 C "C1'" . U   C 3 6   ? 60.217 26.771  5.075   1.00 91.66  ? 6   U   C "C1'" 1 
ATOM   7411 N N1    . U   C 3 6   ? 59.657 27.492  6.272   1.00 86.24  ? 6   U   C N1    1 
ATOM   7412 C C2    . U   C 3 6   ? 60.540 28.127  7.135   1.00 85.78  ? 6   U   C C2    1 
ATOM   7413 O O2    . U   C 3 6   ? 61.749 28.156  6.990   1.00 89.31  ? 6   U   C O2    1 
ATOM   7414 N N3    . U   C 3 6   ? 59.950 28.745  8.204   1.00 82.27  ? 6   U   C N3    1 
ATOM   7415 C C4    . U   C 3 6   ? 58.598 28.793  8.501   1.00 78.87  ? 6   U   C C4    1 
ATOM   7416 O O4    . U   C 3 6   ? 58.235 29.393  9.508   1.00 76.43  ? 6   U   C O4    1 
ATOM   7417 C C5    . U   C 3 6   ? 57.736 28.107  7.564   1.00 78.75  ? 6   U   C C5    1 
ATOM   7418 C C6    . U   C 3 6   ? 58.289 27.496  6.508   1.00 82.11  ? 6   U   C C6    1 
ATOM   7419 P P     . A   C 3 7   ? 59.894 22.023  6.239   1.00 103.34 ? 7   A   C P     1 
ATOM   7420 O OP1   . A   C 3 7   ? 60.087 20.705  5.604   1.00 109.26 ? 7   A   C OP1   1 
ATOM   7421 O OP2   . A   C 3 7   ? 58.660 22.268  7.012   1.00 97.95  ? 7   A   C OP2   1 
ATOM   7422 O "O5'" . A   C 3 7   ? 61.148 22.373  7.166   1.00 105.68 ? 7   A   C "O5'" 1 
ATOM   7423 C "C5'" . A   C 3 7   ? 62.468 22.152  6.664   1.00 113.09 ? 7   A   C "C5'" 1 
ATOM   7424 C "C4'" . A   C 3 7   ? 63.518 22.891  7.471   1.00 114.77 ? 7   A   C "C4'" 1 
ATOM   7425 O "O4'" . A   C 3 7   ? 63.305 24.322  7.378   1.00 110.50 ? 7   A   C "O4'" 1 
ATOM   7426 C "C3'" . A   C 3 7   ? 63.496 22.695  8.981   1.00 114.72 ? 7   A   C "C3'" 1 
ATOM   7427 O "O3'" . A   C 3 7   ? 63.955 21.412  9.406   1.00 121.01 ? 7   A   C "O3'" 1 
ATOM   7428 C "C2'" . A   C 3 7   ? 64.418 23.845  9.376   1.00 113.98 ? 7   A   C "C2'" 1 
ATOM   7429 O "O2'" . A   C 3 7   ? 65.755 23.679  8.929   1.00 119.93 ? 7   A   C "O2'" 1 
ATOM   7430 C "C1'" . A   C 3 7   ? 63.733 24.947  8.579   1.00 108.73 ? 7   A   C "C1'" 1 
ATOM   7431 N N9    . A   C 3 7   ? 62.582 25.548  9.262   1.00 102.76 ? 7   A   C N9    1 
ATOM   7432 C C8    . A   C 3 7   ? 61.258 25.248  9.078   1.00 99.51  ? 7   A   C C8    1 
ATOM   7433 N N7    . A   C 3 7   ? 60.442 25.946  9.829   1.00 94.49  ? 7   A   C N7    1 
ATOM   7434 C C5    . A   C 3 7   ? 61.281 26.768  10.563  1.00 94.77  ? 7   A   C C5    1 
ATOM   7435 C C6    . A   C 3 7   ? 61.035 27.759  11.549  1.00 91.49  ? 7   A   C C6    1 
ATOM   7436 N N6    . A   C 3 7   ? 59.808 28.088  11.974  1.00 87.00  ? 7   A   C N6    1 
ATOM   7437 N N1    . A   C 3 7   ? 62.105 28.400  12.088  1.00 93.13  ? 7   A   C N1    1 
ATOM   7438 C C2    . A   C 3 7   ? 63.339 28.068  11.669  1.00 97.68  ? 7   A   C C2    1 
ATOM   7439 N N3    . A   C 3 7   ? 63.690 27.159  10.749  1.00 101.34 ? 7   A   C N3    1 
ATOM   7440 C C4    . A   C 3 7   ? 62.608 26.536  10.227  1.00 99.74  ? 7   A   C C4    1 
ATOM   7441 P P     . G   C 3 8   ? 63.071 20.569  10.452  1.00 120.51 ? 8   G   C P     1 
ATOM   7442 O OP1   . G   C 3 8   ? 64.016 19.669  11.151  1.00 126.13 ? 8   G   C OP1   1 
ATOM   7443 O OP2   . G   C 3 8   ? 61.925 19.981  9.719   1.00 119.41 ? 8   G   C OP2   1 
ATOM   7444 O "O5'" . G   C 3 8   ? 62.470 21.661  11.475  1.00 114.80 ? 8   G   C "O5'" 1 
ATOM   7445 C "C5'" . G   C 3 8   ? 62.550 21.529  12.907  1.00 114.68 ? 8   G   C "C5'" 1 
ATOM   7446 C "C4'" . G   C 3 8   ? 63.668 22.399  13.464  1.00 115.96 ? 8   G   C "C4'" 1 
ATOM   7447 O "O4'" . G   C 3 8   ? 63.586 23.717  12.869  1.00 113.50 ? 8   G   C "O4'" 1 
ATOM   7448 C "C3'" . G   C 3 8   ? 63.651 22.678  14.964  1.00 114.03 ? 8   G   C "C3'" 1 
ATOM   7449 O "O3'" . G   C 3 8   ? 64.271 21.625  15.685  1.00 117.72 ? 8   G   C "O3'" 1 
ATOM   7450 C "C2'" . G   C 3 8   ? 64.417 24.005  15.044  1.00 113.73 ? 8   G   C "C2'" 1 
ATOM   7451 O "O2'" . G   C 3 8   ? 65.819 23.946  14.857  1.00 117.74 ? 8   G   C "O2'" 1 
ATOM   7452 C "C1'" . G   C 3 8   ? 63.798 24.719  13.853  1.00 111.71 ? 8   G   C "C1'" 1 
ATOM   7453 N N9    . G   C 3 8   ? 62.548 25.430  14.165  1.00 106.05 ? 8   G   C N9    1 
ATOM   7454 C C8    . G   C 3 8   ? 61.278 25.125  13.735  1.00 103.10 ? 8   G   C C8    1 
ATOM   7455 N N7    . G   C 3 8   ? 60.368 25.947  14.176  1.00 98.39  ? 8   G   C N7    1 
ATOM   7456 C C5    . G   C 3 8   ? 61.077 26.857  14.950  1.00 98.40  ? 8   G   C C5    1 
ATOM   7457 C C6    . G   C 3 8   ? 60.625 27.983  15.688  1.00 95.14  ? 8   G   C C6    1 
ATOM   7458 O O6    . G   C 3 8   ? 59.464 28.412  15.808  1.00 91.02  ? 8   G   C O6    1 
ATOM   7459 N N1    . G   C 3 8   ? 61.681 28.635  16.337  1.00 97.03  ? 8   G   C N1    1 
ATOM   7460 C C2    . G   C 3 8   ? 63.005 28.254  16.284  1.00 101.50 ? 8   G   C C2    1 
ATOM   7461 N N2    . G   C 3 8   ? 63.880 29.004  16.974  1.00 103.08 ? 8   G   C N2    1 
ATOM   7462 N N3    . G   C 3 8   ? 63.433 27.202  15.596  1.00 104.86 ? 8   G   C N3    1 
ATOM   7463 C C4    . G   C 3 8   ? 62.422 26.553  14.955  1.00 102.90 ? 8   G   C C4    1 
ATOM   7464 P P     . A   C 3 9   ? 64.019 21.417  17.251  1.00 116.52 ? 9   A   C P     1 
ATOM   7465 O OP1   . A   C 3 9   ? 64.966 20.363  17.682  1.00 122.55 ? 9   A   C OP1   1 
ATOM   7466 O OP2   . A   C 3 9   ? 62.566 21.240  17.494  1.00 112.23 ? 9   A   C OP2   1 
ATOM   7467 O "O5'" . A   C 3 9   ? 64.419 22.831  17.892  1.00 113.65 ? 9   A   C "O5'" 1 
ATOM   7468 C "C5'" . A   C 3 9   ? 65.661 23.076  18.554  1.00 115.90 ? 9   A   C "C5'" 1 
ATOM   7469 C "C4'" . A   C 3 9   ? 65.500 24.242  19.512  1.00 111.28 ? 9   A   C "C4'" 1 
ATOM   7470 O "O4'" . A   C 3 9   ? 65.038 25.409  18.781  1.00 107.21 ? 9   A   C "O4'" 1 
ATOM   7471 C "C3'" . A   C 3 9   ? 64.419 24.065  20.569  1.00 106.52 ? 9   A   C "C3'" 1 
ATOM   7472 O "O3'" . A   C 3 9   ? 64.817 23.245  21.661  1.00 108.61 ? 9   A   C "O3'" 1 
ATOM   7473 C "C2'" . A   C 3 9   ? 64.180 25.519  20.958  1.00 102.76 ? 9   A   C "C2'" 1 
ATOM   7474 O "O2'" . A   C 3 9   ? 65.223 26.088  21.720  1.00 104.98 ? 9   A   C "O2'" 1 
ATOM   7475 C "C1'" . A   C 3 9   ? 64.113 26.138  19.572  1.00 102.04 ? 9   A   C "C1'" 1 
ATOM   7476 N N9    . A   C 3 9   ? 62.752 26.042  19.035  1.00 97.94  ? 9   A   C N9    1 
ATOM   7477 C C8    . A   C 3 9   ? 62.275 25.142  18.118  1.00 98.11  ? 9   A   C C8    1 
ATOM   7478 N N7    . A   C 3 9   ? 61.003 25.291  17.838  1.00 94.18  ? 9   A   C N7    1 
ATOM   7479 C C5    . A   C 3 9   ? 60.604 26.363  18.628  1.00 91.00  ? 9   A   C C5    1 
ATOM   7480 C C6    . A   C 3 9   ? 59.366 27.032  18.799  1.00 85.89  ? 9   A   C C6    1 
ATOM   7481 N N6    . A   C 3 9   ? 58.249 26.698  18.150  1.00 83.65  ? 9   A   C N6    1 
ATOM   7482 N N1    . A   C 3 9   ? 59.310 28.062  19.669  1.00 84.11  ? 9   A   C N1    1 
ATOM   7483 C C2    . A   C 3 9   ? 60.420 28.415  20.325  1.00 86.91  ? 9   A   C C2    1 
ATOM   7484 N N3    . A   C 3 9   ? 61.636 27.868  20.246  1.00 91.78  ? 9   A   C N3    1 
ATOM   7485 C C4    . A   C 3 9   ? 61.670 26.836  19.375  1.00 93.41  ? 9   A   C C4    1 
ATOM   7486 P P     . U   C 3 10  ? 63.756 22.910  22.817  1.00 104.99 ? 10  U   C P     1 
ATOM   7487 O OP1   . U   C 3 10  ? 64.307 21.798  23.627  1.00 109.40 ? 10  U   C OP1   1 
ATOM   7488 O OP2   . U   C 3 10  ? 62.389 22.794  22.248  1.00 99.83  ? 10  U   C OP2   1 
ATOM   7489 O "O5'" . U   C 3 10  ? 63.837 24.239  23.692  1.00 102.23 ? 10  U   C "O5'" 1 
ATOM   7490 C "C5'" . U   C 3 10  ? 63.074 24.340  24.860  1.00 99.67  ? 10  U   C "C5'" 1 
ATOM   7491 C "C4'" . U   C 3 10  ? 62.645 25.770  25.027  1.00 96.28  ? 10  U   C "C4'" 1 
ATOM   7492 O "O4'" . U   C 3 10  ? 62.332 26.324  23.732  1.00 94.91  ? 10  U   C "O4'" 1 
ATOM   7493 C "C3'" . U   C 3 10  ? 61.342 25.896  25.774  1.00 92.53  ? 10  U   C "C3'" 1 
ATOM   7494 O "O3'" . U   C 3 10  ? 61.622 25.903  27.128  1.00 94.19  ? 10  U   C "O3'" 1 
ATOM   7495 C "C2'" . U   C 3 10  ? 60.820 27.237  25.297  1.00 89.68  ? 10  U   C "C2'" 1 
ATOM   7496 O "O2'" . U   C 3 10  ? 61.502 28.340  25.864  1.00 91.26  ? 10  U   C "O2'" 1 
ATOM   7497 C "C1'" . U   C 3 10  ? 61.143 27.095  23.812  1.00 90.29  ? 10  U   C "C1'" 1 
ATOM   7498 N N1    . U   C 3 10  ? 60.039 26.472  22.973  1.00 87.79  ? 10  U   C N1    1 
ATOM   7499 C C2    . U   C 3 10  ? 58.790 27.084  22.931  1.00 83.72  ? 10  U   C C2    1 
ATOM   7500 O O2    . U   C 3 10  ? 58.519 28.104  23.544  1.00 82.11  ? 10  U   C O2    1 
ATOM   7501 N N3    . U   C 3 10  ? 57.854 26.460  22.136  1.00 81.55  ? 10  U   C N3    1 
ATOM   7502 C C4    . U   C 3 10  ? 58.035 25.307  21.395  1.00 83.65  ? 10  U   C C4    1 
ATOM   7503 O O4    . U   C 3 10  ? 57.102 24.871  20.733  1.00 81.95  ? 10  U   C O4    1 
ATOM   7504 C C5    . U   C 3 10  ? 59.355 24.722  21.482  1.00 88.29  ? 10  U   C C5    1 
ATOM   7505 C C6    . U   C 3 10  ? 60.286 25.313  22.247  1.00 89.82  ? 10  U   C C6    1 
ATOM   7506 P P     . G   C 3 11  ? 60.998 24.728  28.013  1.00 95.05  ? 11  G   C P     1 
ATOM   7507 O OP1   . G   C 3 11  ? 62.059 24.292  28.952  1.00 100.22 ? 11  G   C OP1   1 
ATOM   7508 O OP2   . G   C 3 11  ? 60.353 23.728  27.128  1.00 93.92  ? 11  G   C OP2   1 
ATOM   7509 O "O5'" . G   C 3 11  ? 59.853 25.491  28.831  1.00 89.54  ? 11  G   C "O5'" 1 
ATOM   7510 C "C5'" . G   C 3 11  ? 60.109 26.819  29.264  1.00 87.53  ? 11  G   C "C5'" 1 
ATOM   7511 C "C4'" . G   C 3 11  ? 58.839 27.636  29.241  1.00 81.63  ? 11  G   C "C4'" 1 
ATOM   7512 O "O4'" . G   C 3 11  ? 58.507 28.058  27.892  1.00 78.39  ? 11  G   C "O4'" 1 
ATOM   7513 C "C3'" . G   C 3 11  ? 57.620 26.869  29.705  1.00 78.45  ? 11  G   C "C3'" 1 
ATOM   7514 O "O3'" . G   C 3 11  ? 57.592 26.777  31.118  1.00 79.33  ? 11  G   C "O3'" 1 
ATOM   7515 C "C2'" . G   C 3 11  ? 56.521 27.761  29.147  1.00 74.12  ? 11  G   C "C2'" 1 
ATOM   7516 O "O2'" . G   C 3 11  ? 56.250 28.873  29.977  1.00 73.32  ? 11  G   C "O2'" 1 
ATOM   7517 C "C1'" . G   C 3 11  ? 57.103 28.148  27.785  1.00 73.71  ? 11  G   C "C1'" 1 
ATOM   7518 N N9    . G   C 3 11  ? 56.651 27.212  26.759  1.00 72.83  ? 11  G   C N9    1 
ATOM   7519 C C8    . G   C 3 11  ? 57.370 26.195  26.169  1.00 75.21  ? 11  G   C C8    1 
ATOM   7520 N N7    . G   C 3 11  ? 56.681 25.513  25.292  1.00 74.08  ? 11  G   C N7    1 
ATOM   7521 C C5    . G   C 3 11  ? 55.423 26.109  25.305  1.00 70.33  ? 11  G   C C5    1 
ATOM   7522 C C6    . G   C 3 11  ? 54.252 25.811  24.564  1.00 67.93  ? 11  G   C C6    1 
ATOM   7523 O O6    . G   C 3 11  ? 54.089 24.929  23.716  1.00 68.79  ? 11  G   C O6    1 
ATOM   7524 N N1    . G   C 3 11  ? 53.191 26.653  24.873  1.00 64.81  ? 11  G   C N1    1 
ATOM   7525 C C2    . G   C 3 11  ? 53.256 27.668  25.795  1.00 64.21  ? 11  G   C C2    1 
ATOM   7526 N N2    . G   C 3 11  ? 52.143 28.387  25.962  1.00 61.56  ? 11  G   C N2    1 
ATOM   7527 N N3    . G   C 3 11  ? 54.340 27.968  26.496  1.00 66.54  ? 11  G   C N3    1 
ATOM   7528 C C4    . G   C 3 11  ? 55.386 27.151  26.206  1.00 69.62  ? 11  G   C C4    1 
ATOM   7529 P P     . G   C 3 12  ? 56.721 25.620  31.807  1.00 78.81  ? 12  G   C P     1 
ATOM   7530 O OP1   . G   C 3 12  ? 56.985 25.659  33.255  1.00 80.72  ? 12  G   C OP1   1 
ATOM   7531 O OP2   . G   C 3 12  ? 56.873 24.365  31.036  1.00 79.70  ? 12  G   C OP2   1 
ATOM   7532 O "O5'" . G   C 3 12  ? 55.222 26.107  31.590  1.00 74.72  ? 12  G   C "O5'" 1 
ATOM   7533 C "C5'" . G   C 3 12  ? 54.719 27.258  32.261  1.00 72.45  ? 12  G   C "C5'" 1 
ATOM   7534 C "C4'" . G   C 3 12  ? 53.348 27.530  31.689  1.00 68.23  ? 12  G   C "C4'" 1 
ATOM   7535 O "O4'" . G   C 3 12  ? 53.451 27.688  30.249  1.00 67.10  ? 12  G   C "O4'" 1 
ATOM   7536 C "C3'" . G   C 3 12  ? 52.384 26.367  31.831  1.00 66.36  ? 12  G   C "C3'" 1 
ATOM   7537 O "O3'" . G   C 3 12  ? 51.808 26.348  33.101  1.00 66.55  ? 12  G   C "O3'" 1 
ATOM   7538 C "C2'" . G   C 3 12  ? 51.355 26.708  30.772  1.00 63.28  ? 12  G   C "C2'" 1 
ATOM   7539 O "O2'" . G   C 3 12  ? 50.470 27.741  31.158  1.00 61.25  ? 12  G   C "O2'" 1 
ATOM   7540 C "C1'" . G   C 3 12  ? 52.288 27.145  29.651  1.00 63.51  ? 12  G   C "C1'" 1 
ATOM   7541 N N9    . G   C 3 12  ? 52.611 26.026  28.769  1.00 64.12  ? 12  G   C N9    1 
ATOM   7542 C C8    . G   C 3 12  ? 53.778 25.311  28.639  1.00 66.94  ? 12  G   C C8    1 
ATOM   7543 N N7    . G   C 3 12  ? 53.697 24.371  27.737  1.00 67.50  ? 12  G   C N7    1 
ATOM   7544 C C5    . G   C 3 12  ? 52.399 24.474  27.245  1.00 64.55  ? 12  G   C C5    1 
ATOM   7545 C C6    . G   C 3 12  ? 51.702 23.734  26.251  1.00 64.19  ? 12  G   C C6    1 
ATOM   7546 O O6    . G   C 3 12  ? 52.101 22.786  25.562  1.00 66.31  ? 12  G   C O6    1 
ATOM   7547 N N1    . G   C 3 12  ? 50.395 24.188  26.078  1.00 61.33  ? 12  G   C N1    1 
ATOM   7548 C C2    . G   C 3 12  ? 49.817 25.223  26.776  1.00 59.21  ? 12  G   C C2    1 
ATOM   7549 N N2    . G   C 3 12  ? 48.543 25.527  26.488  1.00 57.34  ? 12  G   C N2    1 
ATOM   7550 N N3    . G   C 3 12  ? 50.452 25.916  27.703  1.00 59.56  ? 12  G   C N3    1 
ATOM   7551 C C4    . G   C 3 12  ? 51.726 25.487  27.880  1.00 62.20  ? 12  G   C C4    1 
ATOM   7552 P P     . U   C 3 13  ? 51.417 24.933  33.724  1.00 67.48  ? 13  U   C P     1 
ATOM   7553 O OP1   . U   C 3 13  ? 51.247 25.150  35.176  1.00 68.12  ? 13  U   C OP1   1 
ATOM   7554 O OP2   . U   C 3 13  ? 52.396 23.934  33.246  1.00 70.36  ? 13  U   C OP2   1 
ATOM   7555 O "O5'" . U   C 3 13  ? 50.024 24.541  33.026  1.00 64.52  ? 13  U   C "O5'" 1 
ATOM   7556 C "C5'" . U   C 3 13  ? 48.901 25.430  32.936  1.00 61.48  ? 13  U   C "C5'" 1 
ATOM   7557 C "C4'" . U   C 3 13  ? 47.906 24.925  31.905  1.00 58.60  ? 13  U   C "C4'" 1 
ATOM   7558 O "O4'" . U   C 3 13  ? 48.466 25.018  30.566  1.00 57.29  ? 13  U   C "O4'" 1 
ATOM   7559 C "C3'" . U   C 3 13  ? 47.574 23.452  32.060  1.00 59.30  ? 13  U   C "C3'" 1 
ATOM   7560 O "O3'" . U   C 3 13  ? 46.601 23.253  33.086  1.00 61.18  ? 13  U   C "O3'" 1 
ATOM   7561 C "C2'" . U   C 3 13  ? 47.120 23.083  30.649  1.00 56.74  ? 13  U   C "C2'" 1 
ATOM   7562 O "O2'" . U   C 3 13  ? 45.802 23.477  30.362  1.00 53.19  ? 13  U   C "O2'" 1 
ATOM   7563 C "C1'" . U   C 3 13  ? 48.120 23.869  29.807  1.00 56.16  ? 13  U   C "C1'" 1 
ATOM   7564 N N1    . U   C 3 13  ? 49.346 23.050  29.477  1.00 58.15  ? 13  U   C N1    1 
ATOM   7565 C C2    . U   C 3 13  ? 49.267 22.089  28.481  1.00 58.30  ? 13  U   C C2    1 
ATOM   7566 O O2    . U   C 3 13  ? 48.260 21.881  27.846  1.00 57.49  ? 13  U   C O2    1 
ATOM   7567 N N3    . U   C 3 13  ? 50.411 21.372  28.236  1.00 61.30  ? 13  U   C N3    1 
ATOM   7568 C C4    . U   C 3 13  ? 51.624 21.523  28.890  1.00 64.15  ? 13  U   C C4    1 
ATOM   7569 O O4    . U   C 3 13  ? 52.577 20.810  28.577  1.00 66.96  ? 13  U   C O4    1 
ATOM   7570 C C5    . U   C 3 13  ? 51.643 22.541  29.922  1.00 62.82  ? 13  U   C C5    1 
ATOM   7571 C C6    . U   C 3 13  ? 50.533 23.250  30.169  1.00 59.70  ? 13  U   C C6    1 
ATOM   7572 P P     . U   C 3 14  ? 46.882 22.161  34.239  1.00 63.80  ? 14  U   C P     1 
ATOM   7573 O OP1   . U   C 3 14  ? 45.935 22.359  35.354  1.00 63.70  ? 14  U   C OP1   1 
ATOM   7574 O OP2   . U   C 3 14  ? 48.333 22.109  34.536  1.00 66.10  ? 14  U   C OP2   1 
ATOM   7575 O "O5'" . U   C 3 14  ? 46.465 20.830  33.487  1.00 64.37  ? 14  U   C "O5'" 1 
ATOM   7576 C "C5'" . U   C 3 14  ? 45.185 20.700  32.910  1.00 63.51  ? 14  U   C "C5'" 1 
ATOM   7577 C "C4'" . U   C 3 14  ? 45.314 19.636  31.848  1.00 65.71  ? 14  U   C "C4'" 1 
ATOM   7578 O "O4'" . U   C 3 14  ? 46.256 20.077  30.843  1.00 66.85  ? 14  U   C "O4'" 1 
ATOM   7579 C "C3'" . U   C 3 14  ? 45.984 18.355  32.306  1.00 67.32  ? 14  U   C "C3'" 1 
ATOM   7580 O "O3'" . U   C 3 14  ? 45.086 17.621  33.041  1.00 67.60  ? 14  U   C "O3'" 1 
ATOM   7581 C "C2'" . U   C 3 14  ? 46.268 17.723  30.965  1.00 68.83  ? 14  U   C "C2'" 1 
ATOM   7582 O "O2'" . U   C 3 14  ? 45.077 17.371  30.302  1.00 68.46  ? 14  U   C "O2'" 1 
ATOM   7583 C "C1'" . U   C 3 14  ? 46.873 18.932  30.271  1.00 68.90  ? 14  U   C "C1'" 1 
ATOM   7584 N N1    . U   C 3 14  ? 48.340 18.979  30.461  1.00 70.98  ? 14  U   C N1    1 
ATOM   7585 C C2    . U   C 3 14  ? 49.133 18.272  29.579  1.00 73.40  ? 14  U   C C2    1 
ATOM   7586 O O2    . U   C 3 14  ? 48.681 17.620  28.651  1.00 73.73  ? 14  U   C O2    1 
ATOM   7587 N N3    . U   C 3 14  ? 50.485 18.359  29.840  1.00 76.06  ? 14  U   C N3    1 
ATOM   7588 C C4    . U   C 3 14  ? 51.101 19.064  30.872  1.00 75.98  ? 14  U   C C4    1 
ATOM   7589 O O4    . U   C 3 14  ? 52.325 19.056  30.988  1.00 78.15  ? 14  U   C O4    1 
ATOM   7590 C C5    . U   C 3 14  ? 50.198 19.779  31.747  1.00 73.55  ? 14  U   C C5    1 
ATOM   7591 C C6    . U   C 3 14  ? 48.880 19.710  31.511  1.00 71.25  ? 14  U   C C6    1 
ATOM   7592 P P     . C   C 3 15  ? 45.542 17.096  34.468  1.00 69.99  ? 15  C   C P     1 
ATOM   7593 O OP1   . C   C 3 15  ? 44.318 17.166  35.283  1.00 69.03  ? 15  C   C OP1   1 
ATOM   7594 O OP2   . C   C 3 15  ? 46.741 17.845  34.915  1.00 71.21  ? 15  C   C OP2   1 
ATOM   7595 O "O5'" . C   C 3 15  ? 45.959 15.565  34.157  1.00 72.79  ? 15  C   C "O5'" 1 
ATOM   7596 C "C5'" . C   C 3 15  ? 47.026 14.897  34.835  1.00 75.95  ? 15  C   C "C5'" 1 
ATOM   7597 C "C4'" . C   C 3 15  ? 47.501 13.613  34.149  1.00 80.20  ? 15  C   C "C4'" 1 
ATOM   7598 O "O4'" . C   C 3 15  ? 46.414 12.777  33.657  1.00 80.41  ? 15  C   C "O4'" 1 
ATOM   7599 C "C3'" . C   C 3 15  ? 48.338 13.759  32.881  1.00 81.99  ? 15  C   C "C3'" 1 
ATOM   7600 O "O3'" . C   C 3 15  ? 49.663 14.254  33.112  1.00 83.97  ? 15  C   C "O3'" 1 
ATOM   7601 C "C2'" . C   C 3 15  ? 48.356 12.314  32.370  1.00 84.82  ? 15  C   C "C2'" 1 
ATOM   7602 O "O2'" . C   C 3 15  ? 49.303 11.454  32.986  1.00 88.60  ? 15  C   C "O2'" 1 
ATOM   7603 C "C1'" . C   C 3 15  ? 46.928 11.875  32.676  1.00 82.81  ? 15  C   C "C1'" 1 
ATOM   7604 N N1    . C   C 3 15  ? 46.128 11.871  31.407  1.00 81.34  ? 15  C   C N1    1 
ATOM   7605 C C2    . C   C 3 15  ? 45.231 12.909  31.104  1.00 78.26  ? 15  C   C C2    1 
ATOM   7606 O O2    . C   C 3 15  ? 45.073 13.844  31.894  1.00 76.15  ? 15  C   C O2    1 
ATOM   7607 N N3    . C   C 3 15  ? 44.539 12.871  29.937  1.00 78.10  ? 15  C   C N3    1 
ATOM   7608 C C4    . C   C 3 15  ? 44.721 11.864  29.085  1.00 81.26  ? 15  C   C C4    1 
ATOM   7609 N N4    . C   C 3 15  ? 44.007 11.893  27.955  1.00 81.29  ? 15  C   C N4    1 
ATOM   7610 C C5    . C   C 3 15  ? 45.639 10.802  29.364  1.00 84.37  ? 15  C   C C5    1 
ATOM   7611 C C6    . C   C 3 15  ? 46.313 10.848  30.517  1.00 84.19  ? 15  C   C C6    1 
ATOM   7612 P P     . A   C 3 16  ? 50.245 15.445  32.216  1.00 82.37  ? 16  A   C P     1 
ATOM   7613 O OP1   . A   C 3 16  ? 51.626 15.685  32.678  1.00 85.15  ? 16  A   C OP1   1 
ATOM   7614 O OP2   . A   C 3 16  ? 49.264 16.561  32.239  1.00 78.58  ? 16  A   C OP2   1 
ATOM   7615 O "O5'" . A   C 3 16  ? 50.313 14.827  30.745  1.00 83.59  ? 16  A   C "O5'" 1 
ATOM   7616 C "C5'" . A   C 3 16  ? 51.209 13.785  30.466  1.00 88.19  ? 16  A   C "C5'" 1 
ATOM   7617 C "C4'" . A   C 3 16  ? 50.787 13.143  29.174  1.00 90.82  ? 16  A   C "C4'" 1 
ATOM   7618 O "O4'" . A   C 3 16  ? 49.385 12.794  29.225  1.00 89.71  ? 16  A   C "O4'" 1 
ATOM   7619 C "C3'" . A   C 3 16  ? 50.845 14.082  27.992  1.00 90.15  ? 16  A   C "C3'" 1 
ATOM   7620 O "O3'" . A   C 3 16  ? 52.206 14.304  27.598  1.00 94.54  ? 16  A   C "O3'" 1 
ATOM   7621 C "C2'" . A   C 3 16  ? 49.956 13.329  26.993  1.00 90.90  ? 16  A   C "C2'" 1 
ATOM   7622 O "O2'" . A   C 3 16  ? 50.563 12.250  26.311  1.00 94.51  ? 16  A   C "O2'" 1 
ATOM   7623 C "C1'" . A   C 3 16  ? 48.849 12.810  27.912  1.00 90.56  ? 16  A   C "C1'" 1 
ATOM   7624 N N9    . A   C 3 16  ? 47.697 13.705  27.827  1.00 87.02  ? 16  A   C N9    1 
ATOM   7625 C C8    . A   C 3 16  ? 47.320 14.663  28.726  1.00 84.16  ? 16  A   C C8    1 
ATOM   7626 N N7    . A   C 3 16  ? 46.255 15.336  28.365  1.00 81.61  ? 16  A   C N7    1 
ATOM   7627 C C5    . A   C 3 16  ? 45.911 14.797  27.138  1.00 82.65  ? 16  A   C C5    1 
ATOM   7628 C C6    . A   C 3 16  ? 44.872 15.074  26.228  1.00 81.23  ? 16  A   C C6    1 
ATOM   7629 N N6    . A   C 3 16  ? 43.951 16.007  26.431  1.00 78.69  ? 16  A   C N6    1 
ATOM   7630 N N1    . A   C 3 16  ? 44.801 14.359  25.091  1.00 83.96  ? 16  A   C N1    1 
ATOM   7631 C C2    . A   C 3 16  ? 45.725 13.413  24.885  1.00 87.79  ? 16  A   C C2    1 
ATOM   7632 N N3    . A   C 3 16  ? 46.750 13.056  25.667  1.00 89.34  ? 16  A   C N3    1 
ATOM   7633 C C4    . A   C 3 16  ? 46.791 13.793  26.790  1.00 86.42  ? 16  A   C C4    1 
ATOM   7634 P P     . A   C 3 17  ? 52.690 15.661  26.881  1.00 93.25  ? 17  A   C P     1 
ATOM   7635 O OP1   . A   C 3 17  ? 53.896 16.162  27.574  1.00 93.42  ? 17  A   C OP1   1 
ATOM   7636 O OP2   . A   C 3 17  ? 51.525 16.552  26.752  1.00 90.29  ? 17  A   C OP2   1 
ATOM   7637 O "O5'" . A   C 3 17  ? 53.043 15.158  25.396  1.00 98.16  ? 17  A   C "O5'" 1 
ATOM   7638 C "C5'" . A   C 3 17  ? 52.025 14.853  24.409  1.00 100.62 ? 17  A   C "C5'" 1 
ATOM   7639 C "C4'" . A   C 3 17  ? 52.127 15.726  23.158  1.00 102.46 ? 17  A   C "C4'" 1 
ATOM   7640 O "O4'" . A   C 3 17  ? 50.910 16.502  22.977  1.00 99.50  ? 17  A   C "O4'" 1 
ATOM   7641 C "C3'" . A   C 3 17  ? 53.238 16.776  23.144  1.00 103.51 ? 17  A   C "C3'" 1 
ATOM   7642 O "O3'" . A   C 3 17  ? 53.620 17.096  21.798  1.00 105.67 ? 17  A   C "O3'" 1 
ATOM   7643 C "C2'" . A   C 3 17  ? 52.556 17.945  23.854  1.00 99.14  ? 17  A   C "C2'" 1 
ATOM   7644 O "O2'" . A   C 3 17  ? 53.180 19.190  23.627  1.00 97.64  ? 17  A   C "O2'" 1 
ATOM   7645 C "C1'" . A   C 3 17  ? 51.176 17.881  23.206  1.00 97.90  ? 17  A   C "C1'" 1 
ATOM   7646 N N9    . A   C 3 17  ? 50.083 18.454  23.995  1.00 94.98  ? 17  A   C N9    1 
ATOM   7647 C C8    . A   C 3 17  ? 50.038 18.691  25.345  1.00 93.85  ? 17  A   C C8    1 
ATOM   7648 N N7    . A   C 3 17  ? 48.909 19.208  25.758  1.00 91.00  ? 17  A   C N7    1 
ATOM   7649 C C5    . A   C 3 17  ? 48.160 19.326  24.597  1.00 90.50  ? 17  A   C C5    1 
ATOM   7650 C C6    . A   C 3 17  ? 46.859 19.810  24.331  1.00 88.23  ? 17  A   C C6    1 
ATOM   7651 N N6    . A   C 3 17  ? 46.059 20.290  25.286  1.00 86.35  ? 17  A   C N6    1 
ATOM   7652 N N1    . A   C 3 17  ? 46.405 19.793  23.051  1.00 88.30  ? 17  A   C N1    1 
ATOM   7653 C C2    . A   C 3 17  ? 47.198 19.307  22.086  1.00 90.37  ? 17  A   C C2    1 
ATOM   7654 N N3    . A   C 3 17  ? 48.438 18.830  22.216  1.00 93.37  ? 17  A   C N3    1 
ATOM   7655 C C4    . A   C 3 17  ? 48.866 18.866  23.500  1.00 92.93  ? 17  A   C C4    1 
ATOM   7656 P P     . G   C 3 18  ? 54.825 16.331  21.059  1.00 111.83 ? 18  G   C P     1 
ATOM   7657 O OP1   . G   C 3 18  ? 54.254 15.145  20.374  1.00 114.54 ? 18  G   C OP1   1 
ATOM   7658 O OP2   . G   C 3 18  ? 55.934 16.152  22.022  1.00 114.11 ? 18  G   C OP2   1 
ATOM   7659 O "O5'" . G   C 3 18  ? 55.310 17.424  19.993  1.00 110.81 ? 18  G   C "O5'" 1 
ATOM   7660 C "C5'" . G   C 3 18  ? 55.799 17.053  18.710  1.00 114.25 ? 18  G   C "C5'" 1 
ATOM   7661 C "C4'" . G   C 3 18  ? 55.032 17.733  17.587  1.00 112.21 ? 18  G   C "C4'" 1 
ATOM   7662 O "O4'" . G   C 3 18  ? 55.040 16.829  16.442  1.00 115.75 ? 18  G   C "O4'" 1 
ATOM   7663 C "C3'" . G   C 3 18  ? 53.555 18.088  17.844  1.00 108.40 ? 18  G   C "C3'" 1 
ATOM   7664 O "O3'" . G   C 3 18  ? 53.339 19.418  18.475  1.00 104.13 ? 18  G   C "O3'" 1 
ATOM   7665 C "C2'" . G   C 3 18  ? 52.991 17.930  16.424  1.00 109.08 ? 18  G   C "C2'" 1 
ATOM   7666 O "O2'" . G   C 3 18  ? 53.290 19.040  15.594  1.00 106.23 ? 18  G   C "O2'" 1 
ATOM   7667 C "C1'" . G   C 3 18  ? 53.728 16.679  15.925  1.00 114.97 ? 18  G   C "C1'" 1 
ATOM   7668 N N9    . G   C 3 18  ? 53.175 15.364  16.326  1.00 117.82 ? 18  G   C N9    1 
ATOM   7669 C C8    . G   C 3 18  ? 52.110 15.129  17.174  1.00 115.58 ? 18  G   C C8    1 
ATOM   7670 N N7    . G   C 3 18  ? 51.831 13.868  17.360  1.00 118.71 ? 18  G   C N7    1 
ATOM   7671 C C5    . G   C 3 18  ? 52.764 13.196  16.585  1.00 123.69 ? 18  G   C C5    1 
ATOM   7672 C C6    . G   C 3 18  ? 52.952 11.795  16.393  1.00 129.31 ? 18  G   C C6    1 
ATOM   7673 O O6    . G   C 3 18  ? 52.307 10.854  16.882  1.00 130.66 ? 18  G   C O6    1 
ATOM   7674 N N1    . G   C 3 18  ? 54.015 11.512  15.532  1.00 133.69 ? 18  G   C N1    1 
ATOM   7675 C C2    . G   C 3 18  ? 54.799 12.471  14.929  1.00 132.84 ? 18  G   C C2    1 
ATOM   7676 N N2    . G   C 3 18  ? 55.773 12.003  14.131  1.00 137.93 ? 18  G   C N2    1 
ATOM   7677 N N3    . G   C 3 18  ? 54.633 13.789  15.099  1.00 127.82 ? 18  G   C N3    1 
ATOM   7678 C C4    . G   C 3 18  ? 53.600 14.095  15.940  1.00 123.33 ? 18  G   C C4    1 
ATOM   7679 P P     . U   C 3 19  ? 51.922 19.929  19.098  1.00 99.29  ? 19  U   C P     1 
ATOM   7680 O OP1   . U   C 3 19  ? 52.100 21.256  19.732  1.00 94.93  ? 19  U   C OP1   1 
ATOM   7681 O OP2   . U   C 3 19  ? 51.308 18.833  19.884  1.00 99.82  ? 19  U   C OP2   1 
ATOM   7682 O "O5'" . U   C 3 19  ? 51.086 20.113  17.743  1.00 98.42  ? 19  U   C "O5'" 1 
ATOM   7683 C "C5'" . U   C 3 19  ? 49.826 20.725  17.720  1.00 95.10  ? 19  U   C "C5'" 1 
ATOM   7684 C "C4'" . U   C 3 19  ? 48.745 19.792  17.207  1.00 96.61  ? 19  U   C "C4'" 1 
ATOM   7685 O "O4'" . U   C 3 19  ? 49.132 18.386  17.216  1.00 101.14 ? 19  U   C "O4'" 1 
ATOM   7686 C "C3'" . U   C 3 19  ? 47.484 19.885  18.069  1.00 94.51  ? 19  U   C "C3'" 1 
ATOM   7687 O "O3'" . U   C 3 19  ? 46.408 20.444  17.313  1.00 91.55  ? 19  U   C "O3'" 1 
ATOM   7688 C "C2'" . U   C 3 19  ? 47.218 18.449  18.531  1.00 98.13  ? 19  U   C "C2'" 1 
ATOM   7689 O "O2'" . U   C 3 19  ? 45.840 18.113  18.626  1.00 98.68  ? 19  U   C "O2'" 1 
ATOM   7690 C "C1'" . U   C 3 19  ? 47.927 17.668  17.423  1.00 101.64 ? 19  U   C "C1'" 1 
ATOM   7691 N N1    . U   C 3 19  ? 48.159 16.214  17.706  1.00 105.42 ? 19  U   C N1    1 
ATOM   7692 C C2    . U   C 3 19  ? 48.733 15.421  16.723  1.00 109.90 ? 19  U   C C2    1 
ATOM   7693 O O2    . U   C 3 19  ? 49.087 15.844  15.629  1.00 110.00 ? 19  U   C O2    1 
ATOM   7694 N N3    . U   C 3 19  ? 48.883 14.094  17.088  1.00 113.91 ? 19  U   C N3    1 
ATOM   7695 C C4    . U   C 3 19  ? 48.521 13.498  18.296  1.00 113.37 ? 19  U   C C4    1 
ATOM   7696 O O4    . U   C 3 19  ? 48.717 12.299  18.472  1.00 117.04 ? 19  U   C O4    1 
ATOM   7697 C C5    . U   C 3 19  ? 47.921 14.385  19.265  1.00 108.60 ? 19  U   C C5    1 
ATOM   7698 C C6    . U   C 3 19  ? 47.767 15.676  18.932  1.00 105.38 ? 19  U   C C6    1 
ATOM   7699 P P     . C   C 3 20  ? 46.129 22.028  17.340  1.00 87.42  ? 20  C   C P     1 
ATOM   7700 O OP1   . C   C 3 20  ? 44.880 22.247  16.572  1.00 87.28  ? 20  C   C OP1   1 
ATOM   7701 O OP2   . C   C 3 20  ? 47.365 22.735  16.905  1.00 86.92  ? 20  C   C OP2   1 
ATOM   7702 O "O5'" . C   C 3 20  ? 45.871 22.363  18.893  1.00 81.45  ? 20  C   C "O5'" 1 
ATOM   7703 C "C5'" . C   C 3 20  ? 44.653 22.032  19.571  1.00 75.16  ? 20  C   C "C5'" 1 
ATOM   7704 C "C4'" . C   C 3 20  ? 44.363 23.035  20.681  1.00 68.58  ? 20  C   C "C4'" 1 
ATOM   7705 O "O4'" . C   C 3 20  ? 44.773 22.461  21.954  1.00 67.74  ? 20  C   C "O4'" 1 
ATOM   7706 C "C3'" . C   C 3 20  ? 45.107 24.366  20.587  1.00 64.46  ? 20  C   C "C3'" 1 
ATOM   7707 O "O3'" . C   C 3 20  ? 44.395 25.386  19.890  1.00 58.93  ? 20  C   C "O3'" 1 
ATOM   7708 C "C2'" . C   C 3 20  ? 45.253 24.734  22.055  1.00 64.21  ? 20  C   C "C2'" 1 
ATOM   7709 O "O2'" . C   C 3 20  ? 44.065 25.284  22.586  1.00 63.95  ? 20  C   C "O2'" 1 
ATOM   7710 C "C1'" . C   C 3 20  ? 45.552 23.386  22.674  1.00 65.72  ? 20  C   C "C1'" 1 
ATOM   7711 N N1    . C   C 3 20  ? 47.014 23.018  22.650  1.00 67.72  ? 20  C   C N1    1 
ATOM   7712 C C2    . C   C 3 20  ? 47.713 23.089  23.854  1.00 68.34  ? 20  C   C C2    1 
ATOM   7713 O O2    . C   C 3 20  ? 47.090 23.446  24.856  1.00 67.46  ? 20  C   C O2    1 
ATOM   7714 N N3    . C   C 3 20  ? 49.036 22.765  23.897  1.00 70.36  ? 20  C   C N3    1 
ATOM   7715 C C4    . C   C 3 20  ? 49.676 22.382  22.793  1.00 71.77  ? 20  C   C C4    1 
ATOM   7716 N N4    . C   C 3 20  ? 50.972 22.068  22.899  1.00 74.14  ? 20  C   C N4    1 
ATOM   7717 C C5    . C   C 3 20  ? 48.993 22.308  21.543  1.00 71.69  ? 20  C   C C5    1 
ATOM   7718 C C6    . C   C 3 20  ? 47.688 22.632  21.519  1.00 69.45  ? 20  C   C C6    1 
ATOM   7719 P P     . C   C 3 21  ? 45.210 26.682  19.415  1.00 55.82  ? 21  C   C P     1 
ATOM   7720 O OP1   . C   C 3 21  ? 44.342 27.644  18.697  1.00 54.23  ? 21  C   C OP1   1 
ATOM   7721 O OP2   . C   C 3 21  ? 46.462 26.197  18.809  1.00 58.19  ? 21  C   C OP2   1 
ATOM   7722 O "O5'" . C   C 3 21  ? 45.632 27.408  20.758  1.00 53.19  ? 21  C   C "O5'" 1 
ATOM   7723 C "C5'" . C   C 3 21  ? 44.787 28.363  21.369  1.00 46.77  ? 21  C   C "C5'" 1 
ATOM   7724 C "C4'" . C   C 3 21  ? 45.410 28.835  22.664  1.00 41.92  ? 21  C   C "C4'" 1 
ATOM   7725 O "O4'" . C   C 3 21  ? 45.979 27.749  23.438  1.00 42.47  ? 21  C   C "O4'" 1 
ATOM   7726 C "C3'" . C   C 3 21  ? 46.540 29.816  22.473  1.00 39.54  ? 21  C   C "C3'" 1 
ATOM   7727 O "O3'" . C   C 3 21  ? 45.871 31.012  22.368  1.00 37.98  ? 21  C   C "O3'" 1 
ATOM   7728 C "C2'" . C   C 3 21  ? 47.186 29.707  23.840  1.00 40.08  ? 21  C   C "C2'" 1 
ATOM   7729 O "O2'" . C   C 3 21  ? 46.399 30.347  24.838  1.00 37.98  ? 21  C   C "O2'" 1 
ATOM   7730 C "C1'" . C   C 3 21  ? 47.172 28.194  24.045  1.00 41.12  ? 21  C   C "C1'" 1 
ATOM   7731 N N1    . C   C 3 21  ? 48.331 27.447  23.455  1.00 42.71  ? 21  C   C N1    1 
ATOM   7732 C C2    . C   C 3 21  ? 49.555 27.492  24.118  1.00 44.26  ? 21  C   C C2    1 
ATOM   7733 O O2    . C   C 3 21  ? 49.618 28.155  25.150  1.00 45.06  ? 21  C   C O2    1 
ATOM   7734 N N3    . C   C 3 21  ? 50.627 26.818  23.615  1.00 46.18  ? 21  C   C N3    1 
ATOM   7735 C C4    . C   C 3 21  ? 50.500 26.116  22.481  1.00 46.83  ? 21  C   C C4    1 
ATOM   7736 N N4    . C   C 3 21  ? 51.579 25.479  22.024  1.00 49.56  ? 21  C   C N4    1 
ATOM   7737 C C5    . C   C 3 21  ? 49.260 26.042  21.770  1.00 45.11  ? 21  C   C C5    1 
ATOM   7738 C C6    . C   C 3 21  ? 48.221 26.714  22.295  1.00 43.06  ? 21  C   C C6    1 
ATOM   7739 P P     . A   C 3 22  ? 46.310 32.220  21.443  1.00 35.79  ? 22  A   C P     1 
ATOM   7740 O OP1   . A   C 3 22  ? 45.200 33.205  21.522  1.00 34.85  ? 22  A   C OP1   1 
ATOM   7741 O OP2   . A   C 3 22  ? 46.723 31.654  20.142  1.00 37.99  ? 22  A   C OP2   1 
ATOM   7742 O "O5'" . A   C 3 22  ? 47.609 32.739  22.190  1.00 36.13  ? 22  A   C "O5'" 1 
ATOM   7743 C "C5'" . A   C 3 22  ? 48.851 32.724  21.536  1.00 37.08  ? 22  A   C "C5'" 1 
ATOM   7744 C "C4'" . A   C 3 22  ? 49.893 32.753  22.622  1.00 38.84  ? 22  A   C "C4'" 1 
ATOM   7745 O "O4'" . A   C 3 22  ? 50.057 31.409  23.117  1.00 40.61  ? 22  A   C "O4'" 1 
ATOM   7746 C "C3'" . A   C 3 22  ? 51.284 33.169  22.203  1.00 40.27  ? 22  A   C "C3'" 1 
ATOM   7747 O "O3'" . A   C 3 22  ? 51.400 34.589  22.238  1.00 41.54  ? 22  A   C "O3'" 1 
ATOM   7748 C "C2'" . A   C 3 22  ? 52.151 32.471  23.258  1.00 41.23  ? 22  A   C "C2'" 1 
ATOM   7749 O "O2'" . A   C 3 22  ? 52.199 33.115  24.510  1.00 40.62  ? 22  A   C "O2'" 1 
ATOM   7750 C "C1'" . A   C 3 22  ? 51.409 31.176  23.471  1.00 40.48  ? 22  A   C "C1'" 1 
ATOM   7751 N N9    . A   C 3 22  ? 51.911 30.098  22.651  1.00 41.10  ? 22  A   C N9    1 
ATOM   7752 C C8    . A   C 3 22  ? 51.226 29.482  21.644  1.00 40.78  ? 22  A   C C8    1 
ATOM   7753 N N7    . A   C 3 22  ? 51.909 28.532  21.059  1.00 43.66  ? 22  A   C N7    1 
ATOM   7754 C C5    . A   C 3 22  ? 53.120 28.524  21.745  1.00 45.38  ? 22  A   C C5    1 
ATOM   7755 C C6    . A   C 3 22  ? 54.283 27.742  21.615  1.00 47.33  ? 22  A   C C6    1 
ATOM   7756 N N6    . A   C 3 22  ? 54.411 26.782  20.708  1.00 48.62  ? 22  A   C N6    1 
ATOM   7757 N N1    . A   C 3 22  ? 55.311 27.989  22.445  1.00 49.75  ? 22  A   C N1    1 
ATOM   7758 C C2    . A   C 3 22  ? 55.185 28.964  23.354  1.00 49.05  ? 22  A   C C2    1 
ATOM   7759 N N3    . A   C 3 22  ? 54.144 29.767  23.573  1.00 46.25  ? 22  A   C N3    1 
ATOM   7760 C C4    . A   C 3 22  ? 53.136 29.494  22.729  1.00 43.94  ? 22  A   C C4    1 
ATOM   7761 P P     . U   C 3 23  ? 52.430 35.281  21.231  1.00 44.33  ? 23  U   C P     1 
ATOM   7762 O OP1   . U   C 3 23  ? 52.420 36.755  21.450  1.00 43.67  ? 23  U   C OP1   1 
ATOM   7763 O OP2   . U   C 3 23  ? 52.140 34.717  19.892  1.00 42.02  ? 23  U   C OP2   1 
ATOM   7764 O "O5'" . U   C 3 23  ? 53.832 34.696  21.710  1.00 48.22  ? 23  U   C "O5'" 1 
ATOM   7765 C "C5'" . U   C 3 23  ? 54.381 35.197  22.902  1.00 54.20  ? 23  U   C "C5'" 1 
ATOM   7766 C "C4'" . U   C 3 23  ? 55.818 34.748  23.133  1.00 60.65  ? 23  U   C "C4'" 1 
ATOM   7767 O "O4'" . U   C 3 23  ? 55.841 33.342  23.476  1.00 61.48  ? 23  U   C "O4'" 1 
ATOM   7768 C "C3'" . U   C 3 23  ? 56.828 34.897  21.990  1.00 63.16  ? 23  U   C "C3'" 1 
ATOM   7769 O "O3'" . U   C 3 23  ? 57.371 36.211  21.917  1.00 66.22  ? 23  U   C "O3'" 1 
ATOM   7770 C "C2'" . U   C 3 23  ? 57.889 33.923  22.471  1.00 66.19  ? 23  U   C "C2'" 1 
ATOM   7771 O "O2'" . U   C 3 23  ? 58.669 34.441  23.530  1.00 68.17  ? 23  U   C "O2'" 1 
ATOM   7772 C "C1'" . U   C 3 23  ? 57.018 32.778  22.960  1.00 64.51  ? 23  U   C "C1'" 1 
ATOM   7773 N N1    . U   C 3 23  ? 56.644 31.881  21.852  1.00 63.94  ? 23  U   C N1    1 
ATOM   7774 C C2    . U   C 3 23  ? 57.508 30.828  21.584  1.00 67.17  ? 23  U   C C2    1 
ATOM   7775 O O2    . U   C 3 23  ? 58.539 30.611  22.212  1.00 69.74  ? 23  U   C O2    1 
ATOM   7776 N N3    . U   C 3 23  ? 57.106 30.026  20.542  1.00 66.64  ? 23  U   C N3    1 
ATOM   7777 C C4    . U   C 3 23  ? 55.959 30.178  19.777  1.00 63.45  ? 23  U   C C4    1 
ATOM   7778 O O4    . U   C 3 23  ? 55.752 29.371  18.880  1.00 63.66  ? 23  U   C O4    1 
ATOM   7779 C C5    . U   C 3 23  ? 55.111 31.304  20.118  1.00 60.37  ? 23  U   C C5    1 
ATOM   7780 C C6    . U   C 3 23  ? 55.481 32.100  21.124  1.00 59.82  ? 23  U   C C6    1 
ATOM   7781 P P     . U   C 3 24  ? 57.804 36.846  20.517  1.00 67.73  ? 24  U   C P     1 
ATOM   7782 O OP1   . U   C 3 24  ? 58.060 38.274  20.784  1.00 68.91  ? 24  U   C OP1   1 
ATOM   7783 O OP2   . U   C 3 24  ? 56.809 36.455  19.493  1.00 65.74  ? 24  U   C OP2   1 
ATOM   7784 O "O5'" . U   C 3 24  ? 59.158 36.098  20.127  1.00 72.26  ? 24  U   C "O5'" 1 
ATOM   7785 C "C5'" . U   C 3 24  ? 60.281 36.104  20.998  1.00 78.03  ? 24  U   C "C5'" 1 
ATOM   7786 C "C4'" . U   C 3 24  ? 61.225 34.962  20.654  1.00 82.68  ? 24  U   C "C4'" 1 
ATOM   7787 O "O4'" . U   C 3 24  ? 60.595 33.671  20.901  1.00 81.64  ? 24  U   C "O4'" 1 
ATOM   7788 C "C3'" . U   C 3 24  ? 61.667 34.859  19.194  1.00 83.76  ? 24  U   C "C3'" 1 
ATOM   7789 O "O3'" . U   C 3 24  ? 62.625 35.861  18.818  1.00 86.71  ? 24  U   C "O3'" 1 
ATOM   7790 C "C2'" . U   C 3 24  ? 62.206 33.426  19.199  1.00 86.39  ? 24  U   C "C2'" 1 
ATOM   7791 O "O2'" . U   C 3 24  ? 63.408 33.238  19.919  1.00 90.47  ? 24  U   C "O2'" 1 
ATOM   7792 C "C1'" . U   C 3 24  ? 61.082 32.726  19.955  1.00 83.83  ? 24  U   C "C1'" 1 
ATOM   7793 N N1    . U   C 3 24  ? 60.000 32.276  19.017  1.00 80.94  ? 24  U   C N1    1 
ATOM   7794 C C2    . U   C 3 24  ? 60.227 31.180  18.199  1.00 82.12  ? 24  U   C C2    1 
ATOM   7795 O O2    . U   C 3 24  ? 61.260 30.542  18.201  1.00 86.08  ? 24  U   C O2    1 
ATOM   7796 N N3    . U   C 3 24  ? 59.189 30.844  17.368  1.00 79.37  ? 24  U   C N3    1 
ATOM   7797 C C4    . U   C 3 24  ? 57.967 31.494  17.279  1.00 76.03  ? 24  U   C C4    1 
ATOM   7798 O O4    . U   C 3 24  ? 57.118 31.095  16.494  1.00 74.56  ? 24  U   C O4    1 
ATOM   7799 C C5    . U   C 3 24  ? 57.799 32.628  18.155  1.00 74.96  ? 24  U   C C5    1 
ATOM   7800 C C6    . U   C 3 24  ? 58.801 32.969  18.972  1.00 77.47  ? 24  U   C C6    1 
ATOM   7801 P P     . U   C 3 25  ? 62.979 36.108  17.267  1.00 88.34  ? 25  U   C P     1 
ATOM   7802 O OP1   . U   C 3 25  ? 63.500 37.483  17.124  1.00 89.32  ? 25  U   C OP1   1 
ATOM   7803 O OP2   . U   C 3 25  ? 61.882 35.678  16.370  1.00 84.06  ? 25  U   C OP2   1 
ATOM   7804 O "O5'" . U   C 3 25  ? 64.153 35.043  17.089  1.00 94.02  ? 25  U   C "O5'" 1 
ATOM   7805 C "C5'" . U   C 3 25  ? 65.487 35.223  17.551  1.00 99.94  ? 25  U   C "C5'" 1 
ATOM   7806 C "C4'" . U   C 3 25  ? 66.341 34.171  16.873  1.00 104.98 ? 25  U   C "C4'" 1 
ATOM   7807 O "O4'" . U   C 3 25  ? 65.696 32.879  17.089  1.00 104.60 ? 25  U   C "O4'" 1 
ATOM   7808 C "C3'" . U   C 3 25  ? 66.431 34.247  15.344  1.00 105.68 ? 25  U   C "C3'" 1 
ATOM   7809 O "O3'" . U   C 3 25  ? 67.356 35.231  14.787  1.00 108.15 ? 25  U   C "O3'" 1 
ATOM   7810 C "C2'" . U   C 3 25  ? 66.803 32.791  15.054  1.00 108.96 ? 25  U   C "C2'" 1 
ATOM   7811 O "O2'" . U   C 3 25  ? 68.095 32.439  15.526  1.00 114.13 ? 25  U   C "O2'" 1 
ATOM   7812 C "C1'" . U   C 3 25  ? 65.737 32.099  15.901  1.00 106.23 ? 25  U   C "C1'" 1 
ATOM   7813 N N1    . U   C 3 25  ? 64.351 31.953  15.252  1.00 101.80 ? 25  U   C N1    1 
ATOM   7814 C C2    . U   C 3 25  ? 64.064 30.878  14.419  1.00 102.31 ? 25  U   C C2    1 
ATOM   7815 O O2    . U   C 3 25  ? 64.845 29.990  14.141  1.00 106.69 ? 25  U   C O2    1 
ATOM   7816 N N3    . U   C 3 25  ? 62.794 30.853  13.902  1.00 98.25  ? 25  U   C N3    1 
ATOM   7817 C C4    . U   C 3 25  ? 61.789 31.775  14.126  1.00 94.32  ? 25  U   C C4    1 
ATOM   7818 O O4    . U   C 3 25  ? 60.694 31.626  13.600  1.00 92.00  ? 25  U   C O4    1 
ATOM   7819 C C5    . U   C 3 25  ? 62.144 32.867  14.990  1.00 94.00  ? 25  U   C C5    1 
ATOM   7820 C C6    . U   C 3 25  ? 63.376 32.904  15.500  1.00 97.62  ? 25  U   C C6    1 
ATOM   7821 P P     . A   C 3 26  ? 66.995 36.063  13.448  1.00 105.71 ? 26  A   C P     1 
ATOM   7822 O OP1   . A   C 3 26  ? 67.940 37.192  13.307  1.00 108.08 ? 26  A   C OP1   1 
ATOM   7823 O OP2   . A   C 3 26  ? 65.542 36.339  13.483  1.00 100.55 ? 26  A   C OP2   1 
ATOM   7824 O "O5'" . A   C 3 26  ? 67.248 35.045  12.240  1.00 106.97 ? 26  A   C "O5'" 1 
ATOM   7825 C "C5'" . A   C 3 26  ? 68.549 34.586  11.905  1.00 111.67 ? 26  A   C "C5'" 1 
ATOM   7826 C "C4'" . A   C 3 26  ? 68.426 33.335  11.062  1.00 112.97 ? 26  A   C "C4'" 1 
ATOM   7827 O "O4'" . A   C 3 26  ? 67.489 32.431  11.689  1.00 110.20 ? 26  A   C "O4'" 1 
ATOM   7828 C "C3'" . A   C 3 26  ? 67.774 33.545  9.710   1.00 111.02 ? 26  A   C "C3'" 1 
ATOM   7829 O "O3'" . A   C 3 26  ? 68.651 34.112  8.759   1.00 115.45 ? 26  A   C "O3'" 1 
ATOM   7830 C "C2'" . A   C 3 26  ? 67.300 32.145  9.343   1.00 110.89 ? 26  A   C "C2'" 1 
ATOM   7831 O "O2'" . A   C 3 26  ? 68.306 31.257  8.900   1.00 115.93 ? 26  A   C "O2'" 1 
ATOM   7832 C "C1'" . A   C 3 26  ? 66.766 31.714  10.701  1.00 108.77 ? 26  A   C "C1'" 1 
ATOM   7833 N N9    . A   C 3 26  ? 65.332 31.971  10.820  1.00 103.12 ? 26  A   C N9    1 
ATOM   7834 C C8    . A   C 3 26  ? 64.691 32.900  11.592  1.00 99.36  ? 26  A   C C8    1 
ATOM   7835 N N7    . A   C 3 26  ? 63.385 32.873  11.476  1.00 95.16  ? 26  A   C N7    1 
ATOM   7836 C C5    . A   C 3 26  ? 63.154 31.861  10.558  1.00 96.28  ? 26  A   C C5    1 
ATOM   7837 C C6    . A   C 3 26  ? 61.979 31.315  9.988   1.00 94.16  ? 26  A   C C6    1 
ATOM   7838 N N6    . A   C 3 26  ? 60.742 31.738  10.270  1.00 89.73  ? 26  A   C N6    1 
ATOM   7839 N N1    . A   C 3 26  ? 62.117 30.306  9.097   1.00 96.98  ? 26  A   C N1    1 
ATOM   7840 C C2    . A   C 3 26  ? 63.345 29.862  8.796   1.00 101.52 ? 26  A   C C2    1 
ATOM   7841 N N3    . A   C 3 26  ? 64.514 30.293  9.264   1.00 103.96 ? 26  A   C N3    1 
ATOM   7842 C C4    . A   C 3 26  ? 64.347 31.298  10.145  1.00 101.09 ? 26  A   C C4    1 
ATOM   7843 P P     . C   C 3 27  ? 68.055 35.325  7.892   1.00 113.40 ? 27  C   C P     1 
ATOM   7844 O OP1   . C   C 3 27  ? 69.212 36.156  7.470   1.00 117.22 ? 27  C   C OP1   1 
ATOM   7845 O OP2   . C   C 3 27  ? 66.932 35.915  8.670   1.00 107.81 ? 27  C   C OP2   1 
ATOM   7846 O "O5'" . C   C 3 27  ? 67.425 34.633  6.584   1.00 111.81 ? 27  C   C "O5'" 1 
ATOM   7847 C "C5'" . C   C 3 27  ? 68.250 33.961  5.623   1.00 115.03 ? 27  C   C "C5'" 1 
ATOM   7848 C "C4'" . C   C 3 27  ? 67.488 32.861  4.901   1.00 113.73 ? 27  C   C "C4'" 1 
ATOM   7849 O "O4'" . C   C 3 27  ? 66.802 32.000  5.852   1.00 112.31 ? 27  C   C "O4'" 1 
ATOM   7850 C "C3'" . C   C 3 27  ? 66.366 33.327  3.981   1.00 108.92 ? 27  C   C "C3'" 1 
ATOM   7851 O "O3'" . C   C 3 27  ? 66.893 33.892  2.768   1.00 109.94 ? 27  C   C "O3'" 1 
ATOM   7852 C "C2'" . C   C 3 27  ? 65.570 32.017  3.862   1.00 108.76 ? 27  C   C "C2'" 1 
ATOM   7853 O "O2'" . C   C 3 27  ? 66.180 30.988  3.099   1.00 112.55 ? 27  C   C "O2'" 1 
ATOM   7854 C "C1'" . C   C 3 27  ? 65.530 31.623  5.336   1.00 108.44 ? 27  C   C "C1'" 1 
ATOM   7855 N N1    . C   C 3 27  ? 64.365 32.266  6.099   1.00 103.21 ? 27  C   C N1    1 
ATOM   7856 C C2    . C   C 3 27  ? 63.103 31.629  6.112   1.00 100.73 ? 27  C   C C2    1 
ATOM   7857 O O2    . C   C 3 27  ? 62.956 30.544  5.516   1.00 102.35 ? 27  C   C O2    1 
ATOM   7858 N N3    . C   C 3 27  ? 62.074 32.228  6.791   1.00 95.96  ? 27  C   C N3    1 
ATOM   7859 C C4    . C   C 3 27  ? 62.252 33.393  7.428   1.00 93.52  ? 27  C   C C4    1 
ATOM   7860 N N4    . C   C 3 27  ? 61.217 33.929  8.075   1.00 89.30  ? 27  C   C N4    1 
ATOM   7861 C C5    . C   C 3 27  ? 63.515 34.054  7.432   1.00 96.40  ? 27  C   C C5    1 
ATOM   7862 C C6    . C   C 3 27  ? 64.519 33.464  6.763   1.00 101.04 ? 27  C   C C6    1 
ATOM   7863 P P     . U   C 3 28  ? 65.977 34.438  1.563   1.00 106.35 ? 28  U   C P     1 
ATOM   7864 O OP1   . U   C 3 28  ? 66.893 34.985  0.532   1.00 109.36 ? 28  U   C OP1   1 
ATOM   7865 O OP2   . U   C 3 28  ? 64.870 35.282  2.100   1.00 99.93  ? 28  U   C OP2   1 
ATOM   7866 O "O5'" . U   C 3 28  ? 65.428 33.038  1.005   1.00 107.17 ? 28  U   C "O5'" 1 
ATOM   7867 C "C5'" . U   C 3 28  ? 64.757 32.917  -0.229  1.00 105.39 ? 28  U   C "C5'" 1 
ATOM   7868 C "C4'" . U   C 3 28  ? 63.270 32.693  -0.003  1.00 99.99  ? 28  U   C "C4'" 1 
ATOM   7869 O "O4'" . U   C 3 28  ? 62.893 32.543  1.394   1.00 97.95  ? 28  U   C "O4'" 1 
ATOM   7870 C "C3'" . U   C 3 28  ? 62.386 33.865  -0.363  1.00 94.23  ? 28  U   C "C3'" 1 
ATOM   7871 O "O3'" . U   C 3 28  ? 62.412 34.122  -1.753  1.00 92.38  ? 28  U   C "O3'" 1 
ATOM   7872 C "C2'" . U   C 3 28  ? 61.060 33.314  0.131   1.00 92.25  ? 28  U   C "C2'" 1 
ATOM   7873 O "O2'" . U   C 3 28  ? 60.585 32.245  -0.666  1.00 95.05  ? 28  U   C "O2'" 1 
ATOM   7874 C "C1'" . U   C 3 28  ? 61.494 32.788  1.493   1.00 93.26  ? 28  U   C "C1'" 1 
ATOM   7875 N N1    . U   C 3 28  ? 61.125 33.662  2.675   1.00 89.69  ? 28  U   C N1    1 
ATOM   7876 C C2    . U   C 3 28  ? 59.822 33.624  3.149   1.00 86.35  ? 28  U   C C2    1 
ATOM   7877 O O2    . U   C 3 28  ? 58.964 32.929  2.642   1.00 86.28  ? 28  U   C O2    1 
ATOM   7878 N N3    . U   C 3 28  ? 59.541 34.429  4.235   1.00 83.17  ? 28  U   C N3    1 
ATOM   7879 C C4    . U   C 3 28  ? 60.434 35.260  4.891   1.00 83.58  ? 28  U   C C4    1 
ATOM   7880 O O4    . U   C 3 28  ? 60.060 35.931  5.851   1.00 80.75  ? 28  U   C O4    1 
ATOM   7881 C C5    . U   C 3 28  ? 61.772 35.255  4.339   1.00 87.79  ? 28  U   C C5    1 
ATOM   7882 C C6    . U   C 3 28  ? 62.065 34.479  3.281   1.00 90.49  ? 28  U   C C6    1 
ATOM   7883 P P     . U   C 3 29  ? 62.949 35.556  -2.206  1.00 89.04  ? 29  U   C P     1 
ATOM   7884 O OP1   . U   C 3 29  ? 63.812 35.331  -3.396  1.00 92.65  ? 29  U   C OP1   1 
ATOM   7885 O OP2   . U   C 3 29  ? 63.450 36.267  -1.003  1.00 88.81  ? 29  U   C OP2   1 
ATOM   7886 O "O5'" . U   C 3 29  ? 61.615 36.352  -2.586  1.00 80.97  ? 29  U   C "O5'" 1 
ATOM   7887 C "C5'" . U   C 3 29  ? 60.616 36.609  -1.599  1.00 71.56  ? 29  U   C "C5'" 1 
ATOM   7888 C "C4'" . U   C 3 29  ? 59.306 35.896  -1.924  1.00 66.33  ? 29  U   C "C4'" 1 
ATOM   7889 O "O4'" . U   C 3 29  ? 58.941 35.023  -0.831  1.00 64.16  ? 29  U   C "O4'" 1 
ATOM   7890 C "C3'" . U   C 3 29  ? 58.120 36.837  -2.080  1.00 59.93  ? 29  U   C "C3'" 1 
ATOM   7891 O "O3'" . U   C 3 29  ? 57.846 37.042  -3.419  1.00 57.24  ? 29  U   C "O3'" 1 
ATOM   7892 C "C2'" . U   C 3 29  ? 56.948 36.157  -1.405  1.00 58.26  ? 29  U   C "C2'" 1 
ATOM   7893 O "O2'" . U   C 3 29  ? 56.233 35.301  -2.273  1.00 60.26  ? 29  U   C "O2'" 1 
ATOM   7894 C "C1'" . U   C 3 29  ? 57.676 35.390  -0.305  1.00 59.54  ? 29  U   C "C1'" 1 
ATOM   7895 N N1    . U   C 3 29  ? 57.817 36.175  0.981   1.00 56.25  ? 29  U   C N1    1 
ATOM   7896 C C2    . U   C 3 29  ? 56.670 36.516  1.665   1.00 53.38  ? 29  U   C C2    1 
ATOM   7897 O O2    . U   C 3 29  ? 55.556 36.219  1.269   1.00 51.95  ? 29  U   C O2    1 
ATOM   7898 N N3    . U   C 3 29  ? 56.876 37.223  2.835   1.00 52.29  ? 29  U   C N3    1 
ATOM   7899 C C4    . U   C 3 29  ? 58.087 37.622  3.372   1.00 52.68  ? 29  U   C C4    1 
ATOM   7900 O O4    . U   C 3 29  ? 58.109 38.252  4.414   1.00 51.00  ? 29  U   C O4    1 
ATOM   7901 C C5    . U   C 3 29  ? 59.238 37.241  2.606   1.00 55.89  ? 29  U   C C5    1 
ATOM   7902 C C6    . U   C 3 29  ? 59.058 36.544  1.474   1.00 57.94  ? 29  U   C C6    1 
ATOM   7903 P P     . C   C 3 30  ? 57.735 38.576  -3.870  1.00 54.80  ? 30  C   C P     1 
ATOM   7904 O OP1   . C   C 3 30  ? 57.820 38.495  -5.350  1.00 56.63  ? 30  C   C OP1   1 
ATOM   7905 O OP2   . C   C 3 30  ? 58.671 39.420  -3.083  1.00 53.43  ? 30  C   C OP2   1 
ATOM   7906 O "O5'" . C   C 3 30  ? 56.274 39.043  -3.385  1.00 46.88  ? 30  C   C "O5'" 1 
ATOM   7907 C "C5'" . C   C 3 30  ? 55.144 38.321  -3.834  1.00 43.05  ? 30  C   C "C5'" 1 
ATOM   7908 C "C4'" . C   C 3 30  ? 53.980 38.589  -2.923  1.00 37.76  ? 30  C   C "C4'" 1 
ATOM   7909 O "O4'" . C   C 3 30  ? 54.191 37.995  -1.608  1.00 39.07  ? 30  C   C "O4'" 1 
ATOM   7910 C "C3'" . C   C 3 30  ? 53.736 40.059  -2.653  1.00 32.65  ? 30  C   C "C3'" 1 
ATOM   7911 O "O3'" . C   C 3 30  ? 53.075 40.570  -3.783  1.00 28.23  ? 30  C   C "O3'" 1 
ATOM   7912 C "C2'" . C   C 3 30  ? 52.829 39.879  -1.450  1.00 31.86  ? 30  C   C "C2'" 1 
ATOM   7913 O "O2'" . C   C 3 30  ? 51.633 39.242  -1.811  1.00 33.39  ? 30  C   C "O2'" 1 
ATOM   7914 C "C1'" . C   C 3 30  ? 53.587 38.842  -0.639  1.00 34.88  ? 30  C   C "C1'" 1 
ATOM   7915 N N1    . C   C 3 30  ? 54.536 39.475  0.344   1.00 33.87  ? 30  C   C N1    1 
ATOM   7916 C C2    . C   C 3 30  ? 54.006 39.826  1.588   1.00 32.98  ? 30  C   C C2    1 
ATOM   7917 O O2    . C   C 3 30  ? 52.818 39.584  1.788   1.00 31.77  ? 30  C   C O2    1 
ATOM   7918 N N3    . C   C 3 30  ? 54.799 40.422  2.526   1.00 34.85  ? 30  C   C N3    1 
ATOM   7919 C C4    . C   C 3 30  ? 56.096 40.667  2.239   1.00 36.04  ? 30  C   C C4    1 
ATOM   7920 N N4    . C   C 3 30  ? 56.863 41.242  3.174   1.00 34.09  ? 30  C   C N4    1 
ATOM   7921 C C5    . C   C 3 30  ? 56.656 40.314  0.961   1.00 37.00  ? 30  C   C C5    1 
ATOM   7922 C C6    . C   C 3 30  ? 55.852 39.731  0.055   1.00 35.54  ? 30  C   C C6    1 
ATOM   7923 P P     . C   C 3 31  ? 52.625 42.096  -3.920  1.00 24.16  ? 31  C   C P     1 
ATOM   7924 O OP1   . C   C 3 31  ? 51.787 42.203  -5.146  1.00 22.76  ? 31  C   C OP1   1 
ATOM   7925 O OP2   . C   C 3 31  ? 53.800 42.973  -3.708  1.00 23.92  ? 31  C   C OP2   1 
ATOM   7926 O "O5'" . C   C 3 31  ? 51.692 42.269  -2.646  1.00 19.88  ? 31  C   C "O5'" 1 
ATOM   7927 C "C5'" . C   C 3 31  ? 50.317 42.259  -2.850  1.00 19.41  ? 31  C   C "C5'" 1 
ATOM   7928 C "C4'" . C   C 3 31  ? 49.618 42.769  -1.619  1.00 20.85  ? 31  C   C "C4'" 1 
ATOM   7929 O "O4'" . C   C 3 31  ? 50.278 42.227  -0.447  1.00 21.30  ? 31  C   C "O4'" 1 
ATOM   7930 C "C3'" . C   C 3 31  ? 49.685 44.287  -1.444  1.00 21.10  ? 31  C   C "C3'" 1 
ATOM   7931 O "O3'" . C   C 3 31  ? 48.685 44.985  -2.215  1.00 20.08  ? 31  C   C "O3'" 1 
ATOM   7932 C "C2'" . C   C 3 31  ? 49.388 44.348  0.044   1.00 21.62  ? 31  C   C "C2'" 1 
ATOM   7933 O "O2'" . C   C 3 31  ? 48.033 44.033  0.292   1.00 23.31  ? 31  C   C "O2'" 1 
ATOM   7934 C "C1'" . C   C 3 31  ? 50.211 43.196  0.591   1.00 22.22  ? 31  C   C "C1'" 1 
ATOM   7935 N N1    . C   C 3 31  ? 51.581 43.484  1.108   1.00 23.75  ? 31  C   C N1    1 
ATOM   7936 C C2    . C   C 3 31  ? 51.783 44.011  2.413   1.00 24.86  ? 31  C   C C2    1 
ATOM   7937 O O2    . C   C 3 31  ? 50.838 44.296  3.172   1.00 23.20  ? 31  C   C O2    1 
ATOM   7938 N N3    . C   C 3 31  ? 53.065 44.220  2.824   1.00 25.65  ? 31  C   C N3    1 
ATOM   7939 C C4    . C   C 3 31  ? 54.096 43.915  2.015   1.00 26.80  ? 31  C   C C4    1 
ATOM   7940 N N4    . C   C 3 31  ? 55.325 44.138  2.478   1.00 27.88  ? 31  C   C N4    1 
ATOM   7941 C C5    . C   C 3 31  ? 53.923 43.384  0.702   1.00 26.71  ? 31  C   C C5    1 
ATOM   7942 C C6    . C   C 3 31  ? 52.657 43.189  0.309   1.00 26.15  ? 31  C   C C6    1 
ATOM   7943 P P     . A   C 3 32  ? 48.942 46.487  -2.720  1.00 23.06  ? 32  A   C P     1 
ATOM   7944 O OP1   . A   C 3 32  ? 47.915 46.862  -3.698  1.00 20.81  ? 32  A   C OP1   1 
ATOM   7945 O OP2   . A   C 3 32  ? 50.375 46.638  -3.041  1.00 22.82  ? 32  A   C OP2   1 
ATOM   7946 O "O5'" . A   C 3 32  ? 48.754 47.351  -1.373  1.00 21.70  ? 32  A   C "O5'" 1 
ATOM   7947 C "C5'" . A   C 3 32  ? 47.493 47.389  -0.767  1.00 20.45  ? 32  A   C "C5'" 1 
ATOM   7948 C "C4'" . A   C 3 32  ? 47.620 48.106  0.543   1.00 19.71  ? 32  A   C "C4'" 1 
ATOM   7949 O "O4'" . A   C 3 32  ? 48.556 47.369  1.335   1.00 21.69  ? 32  A   C "O4'" 1 
ATOM   7950 C "C3'" . A   C 3 32  ? 48.296 49.448  0.540   1.00 20.22  ? 32  A   C "C3'" 1 
ATOM   7951 O "O3'" . A   C 3 32  ? 47.360 50.374  0.099   1.00 20.62  ? 32  A   C "O3'" 1 
ATOM   7952 C "C2'" . A   C 3 32  ? 48.581 49.596  2.033   1.00 20.20  ? 32  A   C "C2'" 1 
ATOM   7953 O "O2'" . A   C 3 32  ? 47.411 49.782  2.779   1.00 18.77  ? 32  A   C "O2'" 1 
ATOM   7954 C "C1'" . A   C 3 32  ? 49.040 48.198  2.380   1.00 20.06  ? 32  A   C "C1'" 1 
ATOM   7955 N N9    . A   C 3 32  ? 50.473 47.974  2.385   1.00 21.39  ? 32  A   C N9    1 
ATOM   7956 C C8    . A   C 3 32  ? 51.206 47.622  1.282   1.00 21.20  ? 32  A   C C8    1 
ATOM   7957 N N7    . A   C 3 32  ? 52.476 47.455  1.534   1.00 22.31  ? 32  A   C N7    1 
ATOM   7958 C C5    . A   C 3 32  ? 52.584 47.705  2.897   1.00 23.18  ? 32  A   C C5    1 
ATOM   7959 C C6    . A   C 3 32  ? 53.676 47.706  3.789   1.00 22.25  ? 32  A   C C6    1 
ATOM   7960 N N6    . A   C 3 32  ? 54.919 47.418  3.417   1.00 23.99  ? 32  A   C N6    1 
ATOM   7961 N N1    . A   C 3 32  ? 53.428 47.988  5.087   1.00 23.02  ? 32  A   C N1    1 
ATOM   7962 C C2    . A   C 3 32  ? 52.194 48.288  5.488   1.00 21.69  ? 32  A   C C2    1 
ATOM   7963 N N3    . A   C 3 32  ? 51.098 48.327  4.733   1.00 22.98  ? 32  A   C N3    1 
ATOM   7964 C C4    . A   C 3 32  ? 51.349 48.022  3.443   1.00 22.38  ? 32  A   C C4    1 
ATOM   7965 P P     . C   C 3 33  ? 47.794 51.371  -1.055  1.00 20.06  ? 33  C   C P     1 
ATOM   7966 O OP1   . C   C 3 33  ? 46.654 52.215  -1.463  1.00 22.31  ? 33  C   C OP1   1 
ATOM   7967 O OP2   . C   C 3 33  ? 48.571 50.592  -2.031  1.00 17.40  ? 33  C   C OP2   1 
ATOM   7968 O "O5'" . C   C 3 33  ? 48.719 52.362  -0.199  1.00 24.04  ? 33  C   C "O5'" 1 
ATOM   7969 C "C5'" . C   C 3 33  ? 48.111 53.049  0.871   1.00 23.34  ? 33  C   C "C5'" 1 
ATOM   7970 C "C4'" . C   C 3 33  ? 49.112 53.842  1.657   1.00 24.53  ? 33  C   C "C4'" 1 
ATOM   7971 O "O4'" . C   C 3 33  ? 49.979 52.913  2.320   1.00 25.67  ? 33  C   C "O4'" 1 
ATOM   7972 C "C3'" . C   C 3 33  ? 50.044 54.679  0.822   1.00 26.49  ? 33  C   C "C3'" 1 
ATOM   7973 O "O3'" . C   C 3 33  ? 49.439 55.915  0.621   1.00 28.01  ? 33  C   C "O3'" 1 
ATOM   7974 C "C2'" . C   C 3 33  ? 51.195 54.863  1.775   1.00 27.90  ? 33  C   C "C2'" 1 
ATOM   7975 O "O2'" . C   C 3 33  ? 50.838 55.840  2.724   1.00 27.90  ? 33  C   C "O2'" 1 
ATOM   7976 C "C1'" . C   C 3 33  ? 51.266 53.486  2.433   1.00 26.42  ? 33  C   C "C1'" 1 
ATOM   7977 N N1    . C   C 3 33  ? 52.284 52.566  1.817   1.00 25.84  ? 33  C   C N1    1 
ATOM   7978 C C2    . C   C 3 33  ? 53.637 52.646  2.192   1.00 27.32  ? 33  C   C C2    1 
ATOM   7979 O O2    . C   C 3 33  ? 54.012 53.480  3.039   1.00 27.62  ? 33  C   C O2    1 
ATOM   7980 N N3    . C   C 3 33  ? 54.526 51.787  1.616   1.00 27.53  ? 33  C   C N3    1 
ATOM   7981 C C4    . C   C 3 33  ? 54.120 50.894  0.723   1.00 26.11  ? 33  C   C C4    1 
ATOM   7982 N N4    . C   C 3 33  ? 55.039 50.091  0.197   1.00 27.38  ? 33  C   C N4    1 
ATOM   7983 C C5    . C   C 3 33  ? 52.753 50.785  0.336   1.00 25.01  ? 33  C   C C5    1 
ATOM   7984 C C6    . C   C 3 33  ? 51.883 51.630  0.903   1.00 25.44  ? 33  C   C C6    1 
ATOM   7985 P P     . C   C 3 34  ? 48.817 56.187  -0.814  1.00 28.11  ? 34  C   C P     1 
ATOM   7986 O OP1   . C   C 3 34  ? 48.202 57.524  -0.837  1.00 32.64  ? 34  C   C OP1   1 
ATOM   7987 O OP2   . C   C 3 34  ? 48.020 55.000  -1.198  1.00 30.37  ? 34  C   C OP2   1 
ATOM   7988 O "O5'" . C   C 3 34  ? 50.111 56.291  -1.722  1.00 29.73  ? 34  C   C "O5'" 1 
ATOM   7989 C "C5'" . C   C 3 34  ? 50.686 57.566  -1.943  1.00 31.26  ? 34  C   C "C5'" 1 
ATOM   7990 C "C4'" . C   C 3 34  ? 51.184 57.601  -3.366  1.00 31.01  ? 34  C   C "C4'" 1 
ATOM   7991 O "O4'" . C   C 3 34  ? 52.337 56.726  -3.392  1.00 28.80  ? 34  C   C "O4'" 1 
ATOM   7992 C "C3'" . C   C 3 34  ? 50.264 57.022  -4.444  1.00 31.07  ? 34  C   C "C3'" 1 
ATOM   7993 O "O3'" . C   C 3 34  ? 49.203 57.921  -4.889  1.00 33.49  ? 34  C   C "O3'" 1 
ATOM   7994 C "C2'" . C   C 3 34  ? 51.339 56.761  -5.503  1.00 30.35  ? 34  C   C "C2'" 1 
ATOM   7995 O "O2'" . C   C 3 34  ? 51.848 57.939  -6.085  1.00 31.20  ? 34  C   C "O2'" 1 
ATOM   7996 C "C1'" . C   C 3 34  ? 52.446 56.140  -4.670  1.00 29.27  ? 34  C   C "C1'" 1 
ATOM   7997 N N1    . C   C 3 34  ? 52.273 54.681  -4.580  1.00 28.83  ? 34  C   C N1    1 
ATOM   7998 C C2    . C   C 3 34  ? 52.536 53.914  -5.728  1.00 28.90  ? 34  C   C C2    1 
ATOM   7999 O O2    . C   C 3 34  ? 52.929 54.486  -6.747  1.00 30.08  ? 34  C   C O2    1 
ATOM   8000 N N3    . C   C 3 34  ? 52.384 52.570  -5.673  1.00 27.37  ? 34  C   C N3    1 
ATOM   8001 C C4    . C   C 3 34  ? 51.972 52.006  -4.521  1.00 27.45  ? 34  C   C C4    1 
ATOM   8002 N N4    . C   C 3 34  ? 51.811 50.675  -4.494  1.00 26.95  ? 34  C   C N4    1 
ATOM   8003 C C5    . C   C 3 34  ? 51.690 52.769  -3.338  1.00 26.22  ? 34  C   C C5    1 
ATOM   8004 C C6    . C   C 3 34  ? 51.855 54.093  -3.412  1.00 26.99  ? 34  C   C C6    1 
ATOM   8005 P P     . A   C 3 35  ? 47.926 57.408  -5.773  1.00 35.35  ? 35  A   C P     1 
ATOM   8006 O OP1   . A   C 3 35  ? 47.372 58.640  -6.394  1.00 37.13  ? 35  A   C OP1   1 
ATOM   8007 O OP2   . A   C 3 35  ? 47.066 56.565  -4.922  1.00 33.66  ? 35  A   C OP2   1 
ATOM   8008 O "O5'" . A   C 3 35  ? 48.493 56.416  -6.928  1.00 32.29  ? 35  A   C "O5'" 1 
ATOM   8009 C "C5'" . A   C 3 35  ? 48.978 56.879  -8.189  1.00 31.37  ? 35  A   C "C5'" 1 
ATOM   8010 C "C4'" . A   C 3 35  ? 49.300 55.699  -9.088  1.00 31.51  ? 35  A   C "C4'" 1 
ATOM   8011 O "O4'" . A   C 3 35  ? 50.112 54.705  -8.394  1.00 31.40  ? 35  A   C "O4'" 1 
ATOM   8012 C "C3'" . A   C 3 35  ? 48.094 54.905  -9.564  1.00 30.53  ? 35  A   C "C3'" 1 
ATOM   8013 O "O3'" . A   C 3 35  ? 47.550 55.526  -10.689 1.00 28.31  ? 35  A   C "O3'" 1 
ATOM   8014 C "C2'" . A   C 3 35  ? 48.710 53.533  -9.875  1.00 30.05  ? 35  A   C "C2'" 1 
ATOM   8015 O "O2'" . A   C 3 35  ? 49.363 53.462  -11.115 1.00 30.84  ? 35  A   C "O2'" 1 
ATOM   8016 C "C1'" . A   C 3 35  ? 49.765 53.393  -8.795  1.00 28.74  ? 35  A   C "C1'" 1 
ATOM   8017 N N9    . A   C 3 35  ? 49.278 52.709  -7.611  1.00 27.50  ? 35  A   C N9    1 
ATOM   8018 C C8    . A   C 3 35  ? 49.197 53.254  -6.370  1.00 26.29  ? 35  A   C C8    1 
ATOM   8019 N N7    . A   C 3 35  ? 48.734 52.414  -5.476  1.00 25.70  ? 35  A   C N7    1 
ATOM   8020 C C5    . A   C 3 35  ? 48.499 51.236  -6.160  1.00 25.91  ? 35  A   C C5    1 
ATOM   8021 C C6    . A   C 3 35  ? 47.995 49.961  -5.758  1.00 26.11  ? 35  A   C C6    1 
ATOM   8022 N N6    . A   C 3 35  ? 47.643 49.666  -4.500  1.00 24.23  ? 35  A   C N6    1 
ATOM   8023 N N1    . A   C 3 35  ? 47.871 48.984  -6.703  1.00 26.67  ? 35  A   C N1    1 
ATOM   8024 C C2    . A   C 3 35  ? 48.263 49.305  -7.961  1.00 27.98  ? 35  A   C C2    1 
ATOM   8025 N N3    . A   C 3 35  ? 48.751 50.457  -8.453  1.00 26.72  ? 35  A   C N3    1 
ATOM   8026 C C4    . A   C 3 35  ? 48.838 51.401  -7.496  1.00 27.26  ? 35  A   C C4    1 
ATOM   8027 O OP3   . G   D 3 1   ? 7.536  -6.807  21.539  1.00 44.63  ? 1   G   D OP3   1 
ATOM   8028 P P     . G   D 3 1   ? 7.330  -5.518  20.888  0.00 75.57  ? 1   G   D P     1 
ATOM   8029 O OP1   . G   D 3 1   ? 6.123  -4.867  20.328  0.00 77.84  ? 1   G   D OP1   1 
ATOM   8030 O OP2   . G   D 3 1   ? 7.934  -6.653  20.150  0.00 77.01  ? 1   G   D OP2   1 
ATOM   8031 O "O5'" . G   D 3 1   ? 7.933  -3.765  21.312  1.00 56.05  ? 1   G   D "O5'" 1 
ATOM   8032 C "C5'" . G   D 3 1   ? 8.057  -2.982  22.473  1.00 54.65  ? 1   G   D "C5'" 1 
ATOM   8033 C "C4'" . G   D 3 1   ? 9.395  -3.187  23.169  1.00 53.20  ? 1   G   D "C4'" 1 
ATOM   8034 O "O4'" . G   D 3 1   ? 9.676  -4.593  23.344  1.00 54.06  ? 1   G   D "O4'" 1 
ATOM   8035 C "C3'" . G   D 3 1   ? 10.663 -2.705  22.477  1.00 52.07  ? 1   G   D "C3'" 1 
ATOM   8036 O "O3'" . G   D 3 1   ? 10.744 -1.272  22.440  1.00 52.82  ? 1   G   D "O3'" 1 
ATOM   8037 C "C2'" . G   D 3 1   ? 11.709 -3.356  23.392  1.00 50.85  ? 1   G   D "C2'" 1 
ATOM   8038 O "O2'" . G   D 3 1   ? 11.852 -2.774  24.686  1.00 48.56  ? 1   G   D "O2'" 1 
ATOM   8039 C "C1'" . G   D 3 1   ? 11.074 -4.730  23.565  1.00 52.36  ? 1   G   D "C1'" 1 
ATOM   8040 N N9    . G   D 3 1   ? 11.587 -5.806  22.717  1.00 53.65  ? 1   G   D N9    1 
ATOM   8041 C C8    . G   D 3 1   ? 10.899 -6.438  21.712  1.00 56.10  ? 1   G   D C8    1 
ATOM   8042 N N7    . G   D 3 1   ? 11.589 -7.368  21.122  1.00 57.95  ? 1   G   D N7    1 
ATOM   8043 C C5    . G   D 3 1   ? 12.814 -7.366  21.772  1.00 56.02  ? 1   G   D C5    1 
ATOM   8044 C C6    . G   D 3 1   ? 13.965 -8.176  21.565  1.00 57.61  ? 1   G   D C6    1 
ATOM   8045 O O6    . G   D 3 1   ? 14.149 -9.094  20.742  1.00 59.91  ? 1   G   D O6    1 
ATOM   8046 N N1    . G   D 3 1   ? 14.988 -7.826  22.445  1.00 55.94  ? 1   G   D N1    1 
ATOM   8047 C C2    . G   D 3 1   ? 14.908 -6.836  23.398  1.00 53.14  ? 1   G   D C2    1 
ATOM   8048 N N2    . G   D 3 1   ? 15.995 -6.652  24.160  1.00 52.73  ? 1   G   D N2    1 
ATOM   8049 N N3    . G   D 3 1   ? 13.832 -6.091  23.602  1.00 51.95  ? 1   G   D N3    1 
ATOM   8050 C C4    . G   D 3 1   ? 12.824 -6.408  22.762  1.00 53.08  ? 1   G   D C4    1 
ATOM   8051 P P     . G   D 3 2   ? 11.443 -0.524  21.200  1.00 53.29  ? 2   G   D P     1 
ATOM   8052 O OP1   . G   D 3 2   ? 11.184 0.937   21.277  1.00 52.30  ? 2   G   D OP1   1 
ATOM   8053 O OP2   . G   D 3 2   ? 10.998 -1.292  20.015  1.00 55.79  ? 2   G   D OP2   1 
ATOM   8054 O "O5'" . G   D 3 2   ? 13.014 -0.769  21.394  1.00 52.49  ? 2   G   D "O5'" 1 
ATOM   8055 C "C5'" . G   D 3 2   ? 13.781 0.080   22.227  1.00 53.27  ? 2   G   D "C5'" 1 
ATOM   8056 C "C4'" . G   D 3 2   ? 15.095 -0.576  22.634  1.00 55.08  ? 2   G   D "C4'" 1 
ATOM   8057 O "O4'" . G   D 3 2   ? 14.921 -1.955  23.060  1.00 56.65  ? 2   G   D "O4'" 1 
ATOM   8058 C "C3'" . G   D 3 2   ? 16.161 -0.664  21.556  1.00 56.51  ? 2   G   D "C3'" 1 
ATOM   8059 O "O3'" . G   D 3 2   ? 16.862 0.564   21.432  1.00 57.22  ? 2   G   D "O3'" 1 
ATOM   8060 C "C2'" . G   D 3 2   ? 17.066 -1.732  22.146  1.00 57.44  ? 2   G   D "C2'" 1 
ATOM   8061 O "O2'" . G   D 3 2   ? 17.862 -1.208  23.186  1.00 56.80  ? 2   G   D "O2'" 1 
ATOM   8062 C "C1'" . G   D 3 2   ? 16.038 -2.731  22.663  1.00 57.65  ? 2   G   D "C1'" 1 
ATOM   8063 N N9    . G   D 3 2   ? 15.626 -3.670  21.616  1.00 59.08  ? 2   G   D N9    1 
ATOM   8064 C C8    . G   D 3 2   ? 14.448 -3.657  20.906  1.00 59.34  ? 2   G   D C8    1 
ATOM   8065 N N7    . G   D 3 2   ? 14.358 -4.605  20.022  1.00 61.65  ? 2   G   D N7    1 
ATOM   8066 C C5    . G   D 3 2   ? 15.557 -5.296  20.146  1.00 62.89  ? 2   G   D C5    1 
ATOM   8067 C C6    . G   D 3 2   ? 16.036 -6.437  19.444  1.00 66.02  ? 2   G   D C6    1 
ATOM   8068 O O6    . G   D 3 2   ? 15.474 -7.083  18.543  1.00 68.45  ? 2   G   D O6    1 
ATOM   8069 N N1    . G   D 3 2   ? 17.308 -6.823  19.877  1.00 66.54  ? 2   G   D N1    1 
ATOM   8070 C C2    . G   D 3 2   ? 18.020 -6.180  20.863  1.00 64.45  ? 2   G   D C2    1 
ATOM   8071 N N2    . G   D 3 2   ? 19.226 -6.687  21.140  1.00 66.27  ? 2   G   D N2    1 
ATOM   8072 N N3    . G   D 3 2   ? 17.580 -5.115  21.527  1.00 61.92  ? 2   G   D N3    1 
ATOM   8073 C C4    . G   D 3 2   ? 16.349 -4.727  21.120  1.00 60.83  ? 2   G   D C4    1 
ATOM   8074 P P     . A   D 3 3   ? 17.427 0.981   19.998  1.00 58.00  ? 3   A   D P     1 
ATOM   8075 O OP1   . A   D 3 3   ? 17.898 2.382   20.142  1.00 57.92  ? 3   A   D OP1   1 
ATOM   8076 O OP2   . A   D 3 3   ? 16.418 0.606   18.980  1.00 57.84  ? 3   A   D OP2   1 
ATOM   8077 O "O5'" . A   D 3 3   ? 18.692 0.015   19.782  1.00 61.26  ? 3   A   D "O5'" 1 
ATOM   8078 C "C5'" . A   D 3 3   ? 19.865 0.114   20.613  1.00 62.54  ? 3   A   D "C5'" 1 
ATOM   8079 C "C4'" . A   D 3 3   ? 20.908 -0.943  20.273  1.00 66.15  ? 3   A   D "C4'" 1 
ATOM   8080 O "O4'" . A   D 3 3   ? 20.414 -2.266  20.607  1.00 66.52  ? 3   A   D "O4'" 1 
ATOM   8081 C "C3'" . A   D 3 3   ? 21.276 -1.091  18.804  1.00 68.62  ? 3   A   D "C3'" 1 
ATOM   8082 O "O3'" . A   D 3 3   ? 22.200 -0.110  18.398  1.00 70.53  ? 3   A   D "O3'" 1 
ATOM   8083 C "C2'" . A   D 3 3   ? 21.890 -2.483  18.790  1.00 71.13  ? 3   A   D "C2'" 1 
ATOM   8084 O "O2'" . A   D 3 3   ? 23.178 -2.523  19.376  1.00 72.52  ? 3   A   D "O2'" 1 
ATOM   8085 C "C1'" . A   D 3 3   ? 20.855 -3.201  19.639  1.00 69.11  ? 3   A   D "C1'" 1 
ATOM   8086 N N9    . A   D 3 3   ? 19.710 -3.674  18.857  1.00 69.17  ? 3   A   D N9    1 
ATOM   8087 C C8    . A   D 3 3   ? 18.459 -3.116  18.767  1.00 66.71  ? 3   A   D C8    1 
ATOM   8088 N N7    . A   D 3 3   ? 17.642 -3.779  17.983  1.00 67.97  ? 3   A   D N7    1 
ATOM   8089 C C5    . A   D 3 3   ? 18.405 -4.844  17.523  1.00 71.24  ? 3   A   D C5    1 
ATOM   8090 C C6    . A   D 3 3   ? 18.128 -5.927  16.658  1.00 74.90  ? 3   A   D C6    1 
ATOM   8091 N N6    . A   D 3 3   ? 16.944 -6.108  16.070  1.00 75.71  ? 3   A   D N6    1 
ATOM   8092 N N1    . A   D 3 3   ? 19.110 -6.827  16.411  1.00 78.26  ? 3   A   D N1    1 
ATOM   8093 C C2    . A   D 3 3   ? 20.300 -6.648  16.999  1.00 78.22  ? 3   A   D C2    1 
ATOM   8094 N N3    . A   D 3 3   ? 20.680 -5.673  17.828  1.00 75.30  ? 3   A   D N3    1 
ATOM   8095 C C4    . A   D 3 3   ? 19.681 -4.797  18.054  1.00 71.98  ? 3   A   D C4    1 
ATOM   8096 P P     . A   D 3 4   ? 22.266 0.259   16.851  1.00 72.38  ? 4   A   D P     1 
ATOM   8097 O OP1   . A   D 3 4   ? 23.098 1.473   16.767  1.00 73.14  ? 4   A   D OP1   1 
ATOM   8098 O OP2   . A   D 3 4   ? 20.897 0.250   16.293  1.00 70.06  ? 4   A   D OP2   1 
ATOM   8099 O "O5'" . A   D 3 4   ? 23.046 -0.983  16.211  1.00 78.58  ? 4   A   D "O5'" 1 
ATOM   8100 C "C5'" . A   D 3 4   ? 24.366 -1.357  16.632  1.00 84.65  ? 4   A   D "C5'" 1 
ATOM   8101 C "C4'" . A   D 3 4   ? 24.797 -2.644  15.949  1.00 91.20  ? 4   A   D "C4'" 1 
ATOM   8102 O "O4'" . A   D 3 4   ? 23.976 -3.756  16.402  1.00 90.26  ? 4   A   D "O4'" 1 
ATOM   8103 C "C3'" . A   D 3 4   ? 24.607 -2.642  14.436  1.00 95.16  ? 4   A   D "C3'" 1 
ATOM   8104 O "O3'" . A   D 3 4   ? 25.678 -2.029  13.726  1.00 99.72  ? 4   A   D "O3'" 1 
ATOM   8105 C "C2'" . A   D 3 4   ? 24.507 -4.125  14.129  1.00 98.64  ? 4   A   D "C2'" 1 
ATOM   8106 O "O2'" . A   D 3 4   ? 25.776 -4.741  14.128  1.00 104.43 ? 4   A   D "O2'" 1 
ATOM   8107 C "C1'" . A   D 3 4   ? 23.645 -4.587  15.296  1.00 94.68  ? 4   A   D "C1'" 1 
ATOM   8108 N N9    . A   D 3 4   ? 22.226 -4.465  14.957  1.00 92.24  ? 4   A   D N9    1 
ATOM   8109 C C8    . A   D 3 4   ? 21.361 -3.487  15.363  1.00 88.09  ? 4   A   D C8    1 
ATOM   8110 N N7    . A   D 3 4   ? 20.142 -3.612  14.898  1.00 87.21  ? 4   A   D N7    1 
ATOM   8111 C C5    . A   D 3 4   ? 20.204 -4.751  14.125  1.00 91.13  ? 4   A   D C5    1 
ATOM   8112 C C6    . A   D 3 4   ? 19.227 -5.421  13.363  1.00 93.21  ? 4   A   D C6    1 
ATOM   8113 N N6    . A   D 3 4   ? 17.965 -4.992  13.274  1.00 90.99  ? 4   A   D N6    1 
ATOM   8114 N N1    . A   D 3 4   ? 19.599 -6.543  12.700  1.00 98.43  ? 4   A   D N1    1 
ATOM   8115 C C2    . A   D 3 4   ? 20.875 -6.955  12.804  1.00 101.26 ? 4   A   D C2    1 
ATOM   8116 N N3    . A   D 3 4   ? 21.881 -6.405  13.497  1.00 99.85  ? 4   A   D N3    1 
ATOM   8117 C C4    . A   D 3 4   ? 21.480 -5.292  14.143  1.00 94.57  ? 4   A   D C4    1 
ATOM   8118 P P     . G   D 3 5   ? 25.322 -1.271  12.357  1.00 101.73 ? 5   G   D P     1 
ATOM   8119 O OP1   . G   D 3 5   ? 26.493 -0.462  11.961  1.00 104.55 ? 5   G   D OP1   1 
ATOM   8120 O OP2   . G   D 3 5   ? 24.018 -0.591  12.545  1.00 95.95  ? 5   G   D OP2   1 
ATOM   8121 O "O5'" . G   D 3 5   ? 25.092 -2.468  11.305  1.00 106.84 ? 5   G   D "O5'" 1 
ATOM   8122 C "C5'" . G   D 3 5   ? 26.157 -3.301  10.820  1.00 113.78 ? 5   G   D "C5'" 1 
ATOM   8123 C "C4'" . G   D 3 5   ? 25.647 -4.464  9.974   1.00 118.02 ? 5   G   D "C4'" 1 
ATOM   8124 O "O4'" . G   D 3 5   ? 24.670 -5.239  10.719  1.00 113.91 ? 5   G   D "O4'" 1 
ATOM   8125 C "C3'" . G   D 3 5   ? 24.914 -4.100  8.687   1.00 120.14 ? 5   G   D "C3'" 1 
ATOM   8126 O "O3'" . G   D 3 5   ? 25.810 -3.863  7.603   1.00 128.07 ? 5   G   D "O3'" 1 
ATOM   8127 C "C2'" . G   D 3 5   ? 24.068 -5.346  8.446   1.00 121.24 ? 5   G   D "C2'" 1 
ATOM   8128 O "O2'" . G   D 3 5   ? 24.795 -6.434  7.916   1.00 128.71 ? 5   G   D "O2'" 1 
ATOM   8129 C "C1'" . G   D 3 5   ? 23.623 -5.662  9.861   1.00 114.66 ? 5   G   D "C1'" 1 
ATOM   8130 N N9    . G   D 3 5   ? 22.363 -4.988  10.183  1.00 108.59 ? 5   G   D N9    1 
ATOM   8131 C C8    . G   D 3 5   ? 22.159 -3.921  11.029  1.00 102.61 ? 5   G   D C8    1 
ATOM   8132 N N7    . G   D 3 5   ? 20.912 -3.542  11.105  1.00 98.89  ? 5   G   D N7    1 
ATOM   8133 C C5    . G   D 3 5   ? 20.242 -4.410  10.251  1.00 102.51 ? 5   G   D C5    1 
ATOM   8134 C C6    . G   D 3 5   ? 18.862 -4.489  9.919   1.00 101.74 ? 5   G   D C6    1 
ATOM   8135 O O6    . G   D 3 5   ? 17.937 -3.774  10.336  1.00 97.26  ? 5   G   D O6    1 
ATOM   8136 N N1    . G   D 3 5   ? 18.603 -5.522  9.007   1.00 107.46 ? 5   G   D N1    1 
ATOM   8137 C C2    . G   D 3 5   ? 19.559 -6.369  8.482   1.00 113.01 ? 5   G   D C2    1 
ATOM   8138 N N2    . G   D 3 5   ? 19.138 -7.302  7.624   1.00 118.58 ? 5   G   D N2    1 
ATOM   8139 N N3    . G   D 3 5   ? 20.851 -6.305  8.784   1.00 113.81 ? 5   G   D N3    1 
ATOM   8140 C C4    . G   D 3 5   ? 21.122 -5.306  9.672   1.00 108.62 ? 5   G   D C4    1 
ATOM   8141 P P     . U   D 3 6   ? 25.340 -3.041  6.303   1.00 130.73 ? 6   U   D P     1 
ATOM   8142 O OP1   . U   D 3 6   ? 26.512 -2.957  5.399   1.00 137.83 ? 6   U   D OP1   1 
ATOM   8143 O OP2   . U   D 3 6   ? 24.686 -1.790  6.759   1.00 122.86 ? 6   U   D OP2   1 
ATOM   8144 O "O5'" . U   D 3 6   ? 24.234 -3.984  5.617   1.00 132.91 ? 6   U   D "O5'" 1 
ATOM   8145 C "C5'" . U   D 3 6   ? 24.633 -4.929  4.629   1.00 141.58 ? 6   U   D "C5'" 1 
ATOM   8146 C "C4'" . U   D 3 6   ? 23.479 -5.754  4.090   1.00 143.80 ? 6   U   D "C4'" 1 
ATOM   8147 O "O4'" . U   D 3 6   ? 22.614 -6.194  5.169   1.00 137.28 ? 6   U   D "O4'" 1 
ATOM   8148 C "C3'" . U   D 3 6   ? 22.498 -5.059  3.153   1.00 143.97 ? 6   U   D "C3'" 1 
ATOM   8149 O "O3'" . U   D 3 6   ? 23.041 -4.775  1.860   1.00 152.14 ? 6   U   D "O3'" 1 
ATOM   8150 C "C2'" . U   D 3 6   ? 21.410 -6.127  3.143   1.00 144.62 ? 6   U   D "C2'" 1 
ATOM   8151 O "O2'" . U   D 3 6   ? 21.783 -7.332  2.491   1.00 152.16 ? 6   U   D "O2'" 1 
ATOM   8152 C "C1'" . U   D 3 6   ? 21.300 -6.331  4.654   1.00 137.03 ? 6   U   D "C1'" 1 
ATOM   8153 N N1    . U   D 3 6   ? 20.388 -5.339  5.326   1.00 128.87 ? 6   U   D N1    1 
ATOM   8154 C C2    . U   D 3 6   ? 19.019 -5.475  5.169   1.00 127.81 ? 6   U   D C2    1 
ATOM   8155 O O2    . U   D 3 6   ? 18.500 -6.364  4.515   1.00 132.99 ? 6   U   D O2    1 
ATOM   8156 N N3    . U   D 3 6   ? 18.265 -4.525  5.819   1.00 120.96 ? 6   U   D N3    1 
ATOM   8157 C C4    . U   D 3 6   ? 18.721 -3.467  6.588   1.00 115.21 ? 6   U   D C4    1 
ATOM   8158 O O4    . U   D 3 6   ? 17.915 -2.702  7.101   1.00 109.84 ? 6   U   D O4    1 
ATOM   8159 C C5    . U   D 3 6   ? 20.156 -3.381  6.708   1.00 116.83 ? 6   U   D C5    1 
ATOM   8160 C C6    . U   D 3 6   ? 20.912 -4.300  6.086   1.00 123.63 ? 6   U   D C6    1 
ATOM   8161 P P     . A   D 3 7   ? 22.983 -3.277  1.275   1.00 150.55 ? 7   A   D P     1 
ATOM   8162 O OP1   . A   D 3 7   ? 23.980 -3.193  0.183   1.00 158.51 ? 7   A   D OP1   1 
ATOM   8163 O OP2   . A   D 3 7   ? 23.044 -2.316  2.405   1.00 141.28 ? 7   A   D OP2   1 
ATOM   8164 O "O5'" . A   D 3 7   ? 21.515 -3.185  0.646   1.00 150.40 ? 7   A   D "O5'" 1 
ATOM   8165 C "C5'" . A   D 3 7   ? 21.286 -3.135  -0.764  1.00 157.66 ? 7   A   D "C5'" 1 
ATOM   8166 C "C4'" . A   D 3 7   ? 19.851 -3.519  -1.083  1.00 158.57 ? 7   A   D "C4'" 1 
ATOM   8167 O "O4'" . A   D 3 7   ? 19.334 -4.349  -0.004  1.00 154.70 ? 7   A   D "O4'" 1 
ATOM   8168 C "C3'" . A   D 3 7   ? 18.857 -2.363  -1.183  1.00 153.96 ? 7   A   D "C3'" 1 
ATOM   8169 O "O3'" . A   D 3 7   ? 18.787 -1.784  -2.493  1.00 160.13 ? 7   A   D "O3'" 1 
ATOM   8170 C "C2'" . A   D 3 7   ? 17.557 -3.059  -0.777  1.00 152.15 ? 7   A   D "C2'" 1 
ATOM   8171 O "O2'" . A   D 3 7   ? 17.012 -3.902  -1.772  1.00 159.71 ? 7   A   D "O2'" 1 
ATOM   8172 C "C1'" . A   D 3 7   ? 18.056 -3.889  0.400   1.00 148.98 ? 7   A   D "C1'" 1 
ATOM   8173 N N9    . A   D 3 7   ? 18.138 -3.098  1.632   1.00 139.73 ? 7   A   D N9    1 
ATOM   8174 C C8    . A   D 3 7   ? 19.262 -2.649  2.268   1.00 136.68 ? 7   A   D C8    1 
ATOM   8175 N N7    . A   D 3 7   ? 19.027 -1.951  3.348   1.00 129.36 ? 7   A   D N7    1 
ATOM   8176 C C5    . A   D 3 7   ? 17.647 -1.936  3.429   1.00 127.18 ? 7   A   D C5    1 
ATOM   8177 C C6    . A   D 3 7   ? 16.757 -1.358  4.358   1.00 120.53 ? 7   A   D C6    1 
ATOM   8178 N N6    . A   D 3 7   ? 17.178 -0.660  5.415   1.00 114.82 ? 7   A   D N6    1 
ATOM   8179 N N1    . A   D 3 7   ? 15.427 -1.522  4.161   1.00 120.71 ? 7   A   D N1    1 
ATOM   8180 C C2    . A   D 3 7   ? 15.022 -2.227  3.095   1.00 127.40 ? 7   A   D C2    1 
ATOM   8181 N N3    . A   D 3 7   ? 15.766 -2.818  2.155   1.00 133.89 ? 7   A   D N3    1 
ATOM   8182 C C4    . A   D 3 7   ? 17.080 -2.636  2.380   1.00 133.36 ? 7   A   D C4    1 
ATOM   8183 P P     . G   D 3 8   ? 19.346 -0.308  -2.808  1.00 158.65 ? 8   G   D P     1 
ATOM   8184 O OP1   . G   D 3 8   ? 18.969 0.000   -4.208  1.00 164.92 ? 8   G   D OP1   1 
ATOM   8185 O OP2   . G   D 3 8   ? 20.775 -0.286  -2.421  1.00 159.13 ? 8   G   D OP2   1 
ATOM   8186 O "O5'" . G   D 3 8   ? 18.585 0.682   -1.791  1.00 149.23 ? 8   G   D "O5'" 1 
ATOM   8187 C "C5'" . G   D 3 8   ? 17.470 1.503   -2.168  1.00 147.90 ? 8   G   D "C5'" 1 
ATOM   8188 C "C4'" . G   D 3 8   ? 16.159 0.746   -2.006  1.00 149.31 ? 8   G   D "C4'" 1 
ATOM   8189 O "O4'" . G   D 3 8   ? 16.235 -0.172  -0.878  1.00 146.85 ? 8   G   D "O4'" 1 
ATOM   8190 C "C3'" . G   D 3 8   ? 14.922 1.578   -1.691  1.00 144.65 ? 8   G   D "C3'" 1 
ATOM   8191 O "O3'" . G   D 3 8   ? 14.395 2.238   -2.846  1.00 149.03 ? 8   G   D "O3'" 1 
ATOM   8192 C "C2'" . G   D 3 8   ? 14.004 0.489   -1.124  1.00 144.75 ? 8   G   D "C2'" 1 
ATOM   8193 O "O2'" . G   D 3 8   ? 13.479 -0.425  -2.071  1.00 151.75 ? 8   G   D "O2'" 1 
ATOM   8194 C "C1'" . G   D 3 8   ? 14.994 -0.213  -0.198  1.00 142.11 ? 8   G   D "C1'" 1 
ATOM   8195 N N9    . G   D 3 8   ? 15.146 0.478   1.079   1.00 133.64 ? 8   G   D N9    1 
ATOM   8196 C C8    . G   D 3 8   ? 16.319 0.900   1.662   1.00 130.43 ? 8   G   D C8    1 
ATOM   8197 N N7    . G   D 3 8   ? 16.145 1.501   2.807   1.00 123.66 ? 8   G   D N7    1 
ATOM   8198 C C5    . G   D 3 8   ? 14.766 1.477   2.994   1.00 122.34 ? 8   G   D C5    1 
ATOM   8199 C C6    . G   D 3 8   ? 13.972 1.975   4.059   1.00 116.65 ? 8   G   D C6    1 
ATOM   8200 O O6    . G   D 3 8   ? 14.350 2.562   5.082   1.00 111.36 ? 8   G   D O6    1 
ATOM   8201 N N1    . G   D 3 8   ? 12.607 1.744   3.855   1.00 117.91 ? 8   G   D N1    1 
ATOM   8202 C C2    . G   D 3 8   ? 12.070 1.108   2.758   1.00 123.96 ? 8   G   D C2    1 
ATOM   8203 N N2    . G   D 3 8   ? 10.737 0.980   2.728   1.00 125.11 ? 8   G   D N2    1 
ATOM   8204 N N3    . G   D 3 8   ? 12.802 0.636   1.757   1.00 129.48 ? 8   G   D N3    1 
ATOM   8205 C C4    . G   D 3 8   ? 14.134 0.853   1.937   1.00 128.34 ? 8   G   D C4    1 
ATOM   8206 P P     . A   D 3 9   ? 13.496 3.564   -2.702  1.00 144.67 ? 9   A   D P     1 
ATOM   8207 O OP1   . A   D 3 9   ? 13.308 4.119   -4.063  1.00 150.38 ? 9   A   D OP1   1 
ATOM   8208 O OP2   . A   D 3 9   ? 14.085 4.427   -1.652  1.00 136.99 ? 9   A   D OP2   1 
ATOM   8209 O "O5'" . A   D 3 9   ? 12.097 2.979   -2.166  1.00 143.88 ? 9   A   D "O5'" 1 
ATOM   8210 C "C5'" . A   D 3 9   ? 10.826 3.334   -2.735  1.00 145.35 ? 9   A   D "C5'" 1 
ATOM   8211 C "C4'" . A   D 3 9   ? 9.818  3.696   -1.654  1.00 138.93 ? 9   A   D "C4'" 1 
ATOM   8212 O "O4'" . A   D 3 9   ? 10.048 2.885   -0.467  1.00 135.59 ? 9   A   D "O4'" 1 
ATOM   8213 C "C3'" . A   D 3 9   ? 9.917  5.111   -1.099  1.00 131.63 ? 9   A   D "C3'" 1 
ATOM   8214 O "O3'" . A   D 3 9   ? 9.335  6.092   -1.945  1.00 132.35 ? 9   A   D "O3'" 1 
ATOM   8215 C "C2'" . A   D 3 9   ? 9.207  4.951   0.240   1.00 126.80 ? 9   A   D "C2'" 1 
ATOM   8216 O "O2'" . A   D 3 9   ? 7.811  4.726   0.148   1.00 128.81 ? 9   A   D "O2'" 1 
ATOM   8217 C "C1'" . A   D 3 9   ? 9.939  3.695   0.694   1.00 127.73 ? 9   A   D "C1'" 1 
ATOM   8218 N N9    . A   D 3 9   ? 11.269 3.973   1.257   1.00 123.74 ? 9   A   D N9    1 
ATOM   8219 C C8    . A   D 3 9   ? 12.491 3.630   0.744   1.00 126.28 ? 9   A   D C8    1 
ATOM   8220 N N7    . A   D 3 9   ? 13.513 4.016   1.469   1.00 122.12 ? 9   A   D N7    1 
ATOM   8221 C C5    . A   D 3 9   ? 12.925 4.663   2.541   1.00 116.17 ? 9   A   D C5    1 
ATOM   8222 C C6    . A   D 3 9   ? 13.461 5.301   3.681   1.00 110.45 ? 9   A   D C6    1 
ATOM   8223 N N6    . A   D 3 9   ? 14.769 5.392   3.928   1.00 109.60 ? 9   A   D N6    1 
ATOM   8224 N N1    . A   D 3 9   ? 12.597 5.849   4.562   1.00 106.40 ? 9   A   D N1    1 
ATOM   8225 C C2    . A   D 3 9   ? 11.282 5.755   4.315   1.00 108.02 ? 9   A   D C2    1 
ATOM   8226 N N3    . A   D 3 9   ? 10.659 5.183   3.287   1.00 113.04 ? 9   A   D N3    1 
ATOM   8227 C C4    . A   D 3 9   ? 11.544 4.647   2.427   1.00 117.09 ? 9   A   D C4    1 
ATOM   8228 P P     . U   D 3 10  ? 10.317 7.036   -2.782  1.00 131.91 ? 10  U   D P     1 
ATOM   8229 O OP1   . U   D 3 10  ? 10.105 6.697   -4.213  1.00 139.21 ? 10  U   D OP1   1 
ATOM   8230 O OP2   . U   D 3 10  ? 11.670 6.954   -2.172  1.00 128.46 ? 10  U   D OP2   1 
ATOM   8231 O "O5'" . U   D 3 10  ? 9.751  8.511   -2.499  1.00 125.73 ? 10  U   D "O5'" 1 
ATOM   8232 C "C5'" . U   D 3 10  ? 10.074 9.204   -1.305  1.00 116.12 ? 10  U   D "C5'" 1 
ATOM   8233 C "C4'" . U   D 3 10  ? 8.941  9.063   -0.307  1.00 112.45 ? 10  U   D "C4'" 1 
ATOM   8234 O "O4'" . U   D 3 10  ? 9.206  7.969   0.613   1.00 111.55 ? 10  U   D "O4'" 1 
ATOM   8235 C "C3'" . U   D 3 10  ? 8.759  10.289  0.561   1.00 105.42 ? 10  U   D "C3'" 1 
ATOM   8236 O "O3'" . U   D 3 10  ? 7.704  11.050  0.029   1.00 104.43 ? 10  U   D "O3'" 1 
ATOM   8237 C "C2'" . U   D 3 10  ? 8.497  9.768   1.975   1.00 102.77 ? 10  U   D "C2'" 1 
ATOM   8238 O "O2'" . U   D 3 10  ? 7.131  9.627   2.326   1.00 104.13 ? 10  U   D "O2'" 1 
ATOM   8239 C "C1'" . U   D 3 10  ? 9.232  8.425   1.955   1.00 105.45 ? 10  U   D "C1'" 1 
ATOM   8240 N N1    . U   D 3 10  ? 10.664 8.561   2.396   1.00 102.78 ? 10  U   D N1    1 
ATOM   8241 C C2    . U   D 3 10  ? 10.954 9.109   3.643   1.00 97.34  ? 10  U   D C2    1 
ATOM   8242 O O2    . U   D 3 10  ? 10.107 9.490   4.435   1.00 94.73  ? 10  U   D O2    1 
ATOM   8243 N N3    . U   D 3 10  ? 12.298 9.194   3.938   1.00 95.59  ? 10  U   D N3    1 
ATOM   8244 C C4    . U   D 3 10  ? 13.358 8.802   3.131   1.00 98.91  ? 10  U   D C4    1 
ATOM   8245 O O4    . U   D 3 10  ? 14.510 8.943   3.530   1.00 97.45  ? 10  U   D O4    1 
ATOM   8246 C C5    . U   D 3 10  ? 12.982 8.250   1.849   1.00 104.56 ? 10  U   D C5    1 
ATOM   8247 C C6    . U   D 3 10  ? 11.681 8.150   1.542   1.00 106.19 ? 10  U   D C6    1 
ATOM   8248 P P     . G   D 3 11  ? 8.058  12.543  -0.414  1.00 100.83 ? 11  G   D P     1 
ATOM   8249 O OP1   . G   D 3 11  ? 6.990  13.051  -1.298  1.00 103.84 ? 11  G   D OP1   1 
ATOM   8250 O OP2   . G   D 3 11  ? 9.465  12.562  -0.882  1.00 100.02 ? 11  G   D OP2   1 
ATOM   8251 O "O5'" . G   D 3 11  ? 7.896  13.300  0.985   1.00 95.10  ? 11  G   D "O5'" 1 
ATOM   8252 C "C5'" . G   D 3 11  ? 6.569  13.373  1.510   1.00 95.36  ? 11  G   D "C5'" 1 
ATOM   8253 C "C4'" . G   D 3 11  ? 6.555  13.546  3.012   1.00 90.56  ? 11  G   D "C4'" 1 
ATOM   8254 O "O4'" . G   D 3 11  ? 7.356  12.529  3.670   1.00 88.96  ? 11  G   D "O4'" 1 
ATOM   8255 C "C3'" . G   D 3 11  ? 7.197  14.839  3.448   1.00 86.10  ? 11  G   D "C3'" 1 
ATOM   8256 O "O3'" . G   D 3 11  ? 6.319  15.932  3.268   1.00 86.39  ? 11  G   D "O3'" 1 
ATOM   8257 C "C2'" . G   D 3 11  ? 7.521  14.553  4.911   1.00 82.75  ? 11  G   D "C2'" 1 
ATOM   8258 O "O2'" . G   D 3 11  ? 6.447  14.745  5.816   1.00 82.27  ? 11  G   D "O2'" 1 
ATOM   8259 C "C1'" . G   D 3 11  ? 7.989  13.099  4.809   1.00 83.57  ? 11  G   D "C1'" 1 
ATOM   8260 N N9    . G   D 3 11  ? 9.447  13.068  4.671   1.00 81.90  ? 11  G   D N9    1 
ATOM   8261 C C8    . G   D 3 11  ? 10.201 12.671  3.586   1.00 84.43  ? 11  G   D C8    1 
ATOM   8262 N N7    . G   D 3 11  ? 11.490 12.781  3.780   1.00 82.85  ? 11  G   D N7    1 
ATOM   8263 C C5    . G   D 3 11  ? 11.597 13.297  5.069   1.00 79.02  ? 11  G   D C5    1 
ATOM   8264 C C6    . G   D 3 11  ? 12.735 13.638  5.846   1.00 76.60  ? 11  G   D C6    1 
ATOM   8265 O O6    . G   D 3 11  ? 13.923 13.546  5.521   1.00 77.54  ? 11  G   D O6    1 
ATOM   8266 N N1    . G   D 3 11  ? 12.405 14.135  7.114   1.00 73.40  ? 11  G   D N1    1 
ATOM   8267 C C2    . G   D 3 11  ? 11.122 14.288  7.580   1.00 73.07  ? 11  G   D C2    1 
ATOM   8268 N N2    . G   D 3 11  ? 10.965 14.773  8.818   1.00 70.89  ? 11  G   D N2    1 
ATOM   8269 N N3    . G   D 3 11  ? 10.051 13.972  6.863   1.00 76.05  ? 11  G   D N3    1 
ATOM   8270 C C4    . G   D 3 11  ? 10.352 13.483  5.627   1.00 78.38  ? 11  G   D C4    1 
ATOM   8271 P P     . G   D 3 12  ? 6.998  17.345  2.954   1.00 84.60  ? 12  G   D P     1 
ATOM   8272 O OP1   . G   D 3 12  ? 5.932  18.319  2.633   1.00 85.93  ? 12  G   D OP1   1 
ATOM   8273 O OP2   . G   D 3 12  ? 8.095  17.127  1.983   1.00 84.84  ? 12  G   D OP2   1 
ATOM   8274 O "O5'" . G   D 3 12  ? 7.652  17.719  4.373   1.00 80.41  ? 12  G   D "O5'" 1 
ATOM   8275 C "C5'" . G   D 3 12  ? 6.850  18.226  5.450   1.00 79.05  ? 12  G   D "C5'" 1 
ATOM   8276 C "C4'" . G   D 3 12  ? 7.716  18.505  6.661   1.00 75.41  ? 12  G   D "C4'" 1 
ATOM   8277 O "O4'" . G   D 3 12  ? 8.550  17.348  6.913   1.00 74.18  ? 12  G   D "O4'" 1 
ATOM   8278 C "C3'" . G   D 3 12  ? 8.737  19.622  6.512   1.00 73.99  ? 12  G   D "C3'" 1 
ATOM   8279 O "O3'" . G   D 3 12  ? 8.147  20.900  6.690   1.00 75.42  ? 12  G   D "O3'" 1 
ATOM   8280 C "C2'" . G   D 3 12  ? 9.724  19.265  7.623   1.00 71.40  ? 12  G   D "C2'" 1 
ATOM   8281 O "O2'" . G   D 3 12  ? 9.284  19.499  8.954   1.00 71.20  ? 12  G   D "O2'" 1 
ATOM   8282 C "C1'" . G   D 3 12  ? 9.817  17.770  7.383   1.00 70.37  ? 12  G   D "C1'" 1 
ATOM   8283 N N9    . G   D 3 12  ? 10.860 17.444  6.417   1.00 70.46  ? 12  G   D N9    1 
ATOM   8284 C C8    . G   D 3 12  ? 10.706 17.059  5.111   1.00 72.53  ? 12  G   D C8    1 
ATOM   8285 N N7    . G   D 3 12  ? 11.843 16.831  4.520   1.00 73.37  ? 12  G   D N7    1 
ATOM   8286 C C5    . G   D 3 12  ? 12.806 17.081  5.485   1.00 70.74  ? 12  G   D C5    1 
ATOM   8287 C C6    . G   D 3 12  ? 14.215 16.997  5.432   1.00 71.10  ? 12  G   D C6    1 
ATOM   8288 O O6    . G   D 3 12  ? 14.917 16.681  4.468   1.00 73.68  ? 12  G   D O6    1 
ATOM   8289 N N1    . G   D 3 12  ? 14.823 17.326  6.646   1.00 68.99  ? 12  G   D N1    1 
ATOM   8290 C C2    . G   D 3 12  ? 14.145 17.698  7.780   1.00 66.95  ? 12  G   D C2    1 
ATOM   8291 N N2    . G   D 3 12  ? 14.876 17.987  8.866   1.00 65.95  ? 12  G   D N2    1 
ATOM   8292 N N3    . G   D 3 12  ? 12.824 17.778  7.840   1.00 67.18  ? 12  G   D N3    1 
ATOM   8293 C C4    . G   D 3 12  ? 12.217 17.460  6.663   1.00 69.12  ? 12  G   D C4    1 
ATOM   8294 P P     . U   D 3 13  ? 8.753  22.200  5.966   1.00 75.24  ? 13  U   D P     1 
ATOM   8295 O OP1   . U   D 3 13  ? 7.851  23.326  6.298   1.00 76.33  ? 13  U   D OP1   1 
ATOM   8296 O OP2   . U   D 3 13  ? 9.013  21.874  4.546   1.00 77.24  ? 13  U   D OP2   1 
ATOM   8297 O "O5'" . U   D 3 13  ? 10.166 22.430  6.681   1.00 71.51  ? 13  U   D "O5'" 1 
ATOM   8298 C "C5'" . U   D 3 13  ? 10.221 22.797  8.046   1.00 68.42  ? 13  U   D "C5'" 1 
ATOM   8299 C "C4'" . U   D 3 13  ? 11.655 22.722  8.495   1.00 66.21  ? 13  U   D "C4'" 1 
ATOM   8300 O "O4'" . U   D 3 13  ? 12.148 21.397  8.197   1.00 65.24  ? 13  U   D "O4'" 1 
ATOM   8301 C "C3'" . U   D 3 13  ? 12.614 23.577  7.689   1.00 66.15  ? 13  U   D "C3'" 1 
ATOM   8302 O "O3'" . U   D 3 13  ? 12.543 24.944  8.012   1.00 66.26  ? 13  U   D "O3'" 1 
ATOM   8303 C "C2'" . U   D 3 13  ? 13.953 22.933  8.031   1.00 65.33  ? 13  U   D "C2'" 1 
ATOM   8304 O "O2'" . U   D 3 13  ? 14.470 23.269  9.303   1.00 65.77  ? 13  U   D "O2'" 1 
ATOM   8305 C "C1'" . U   D 3 13  ? 13.539 21.461  7.924   1.00 64.87  ? 13  U   D "C1'" 1 
ATOM   8306 N N1    . U   D 3 13  ? 13.827 20.981  6.535   1.00 66.17  ? 13  U   D N1    1 
ATOM   8307 C C2    . U   D 3 13  ? 15.164 20.789  6.188   1.00 66.65  ? 13  U   D C2    1 
ATOM   8308 O O2    . U   D 3 13  ? 16.096 20.957  6.954   1.00 66.08  ? 13  U   D O2    1 
ATOM   8309 N N3    . U   D 3 13  ? 15.377 20.378  4.897   1.00 68.48  ? 13  U   D N3    1 
ATOM   8310 C C4    . U   D 3 13  ? 14.400 20.154  3.941   1.00 70.24  ? 13  U   D C4    1 
ATOM   8311 O O4    . U   D 3 13  ? 14.770 19.787  2.836   1.00 73.00  ? 13  U   D O4    1 
ATOM   8312 C C5    . U   D 3 13  ? 13.025 20.380  4.354   1.00 68.72  ? 13  U   D C5    1 
ATOM   8313 C C6    . U   D 3 13  ? 12.794 20.784  5.613   1.00 66.98  ? 13  U   D C6    1 
ATOM   8314 P P     . U   D 3 14  ? 12.276 25.958  6.810   1.00 67.28  ? 14  U   D P     1 
ATOM   8315 O OP1   . U   D 3 14  ? 11.905 27.264  7.394   1.00 68.09  ? 14  U   D OP1   1 
ATOM   8316 O OP2   . U   D 3 14  ? 11.388 25.293  5.830   1.00 68.04  ? 14  U   D OP2   1 
ATOM   8317 O "O5'" . U   D 3 14  ? 13.708 26.112  6.128   1.00 66.76  ? 14  U   D "O5'" 1 
ATOM   8318 C "C5'" . U   D 3 14  ? 14.871 26.393  6.900   1.00 65.90  ? 14  U   D "C5'" 1 
ATOM   8319 C "C4'" . U   D 3 14  ? 16.101 26.087  6.068   1.00 65.40  ? 14  U   D "C4'" 1 
ATOM   8320 O "O4'" . U   D 3 14  ? 16.112 24.676  5.749   1.00 66.06  ? 14  U   D "O4'" 1 
ATOM   8321 C "C3'" . U   D 3 14  ? 16.111 26.754  4.708   1.00 64.88  ? 14  U   D "C3'" 1 
ATOM   8322 O "O3'" . U   D 3 14  ? 16.632 28.057  4.843   1.00 64.00  ? 14  U   D "O3'" 1 
ATOM   8323 C "C2'" . U   D 3 14  ? 17.021 25.819  3.925   1.00 66.99  ? 14  U   D "C2'" 1 
ATOM   8324 O "O2'" . U   D 3 14  ? 18.391 25.993  4.215   1.00 68.45  ? 14  U   D "O2'" 1 
ATOM   8325 C "C1'" . U   D 3 14  ? 16.577 24.458  4.435   1.00 67.24  ? 14  U   D "C1'" 1 
ATOM   8326 N N1    . U   D 3 14  ? 15.478 23.891  3.617   1.00 68.49  ? 14  U   D N1    1 
ATOM   8327 C C2    . U   D 3 14  ? 15.771 23.106  2.515   1.00 70.62  ? 14  U   D C2    1 
ATOM   8328 O O2    . U   D 3 14  ? 16.902 22.831  2.168   1.00 72.15  ? 14  U   D O2    1 
ATOM   8329 N N3    . U   D 3 14  ? 14.667 22.658  1.825   1.00 71.41  ? 14  U   D N3    1 
ATOM   8330 C C4    . U   D 3 14  ? 13.333 22.912  2.132   1.00 70.53  ? 14  U   D C4    1 
ATOM   8331 O O4    . U   D 3 14  ? 12.438 22.445  1.443   1.00 72.64  ? 14  U   D O4    1 
ATOM   8332 C C5    . U   D 3 14  ? 13.098 23.735  3.286   1.00 68.43  ? 14  U   D C5    1 
ATOM   8333 C C6    . U   D 3 14  ? 14.162 24.174  3.966   1.00 67.96  ? 14  U   D C6    1 
ATOM   8334 P P     . C   D 3 15  ? 15.955 29.256  4.034   1.00 62.88  ? 15  C   D P     1 
ATOM   8335 O OP1   . C   D 3 15  ? 16.607 30.465  4.595   1.00 61.91  ? 15  C   D OP1   1 
ATOM   8336 O OP2   . C   D 3 15  ? 14.481 29.095  4.022   1.00 62.27  ? 15  C   D OP2   1 
ATOM   8337 O "O5'" . C   D 3 15  ? 16.382 28.947  2.515   1.00 62.82  ? 15  C   D "O5'" 1 
ATOM   8338 C "C5'" . C   D 3 15  ? 15.938 29.700  1.397   1.00 60.46  ? 15  C   D "C5'" 1 
ATOM   8339 C "C4'" . C   D 3 15  ? 16.720 29.313  0.148   1.00 61.44  ? 15  C   D "C4'" 1 
ATOM   8340 O "O4'" . C   D 3 15  ? 18.117 29.732  0.141   1.00 62.87  ? 15  C   D "O4'" 1 
ATOM   8341 C "C3'" . C   D 3 15  ? 16.866 27.830  -0.068  1.00 61.95  ? 15  C   D "C3'" 1 
ATOM   8342 O "O3'" . C   D 3 15  ? 15.578 27.241  -0.314  1.00 63.71  ? 15  C   D "O3'" 1 
ATOM   8343 C "C2'" . C   D 3 15  ? 17.841 27.859  -1.244  1.00 64.29  ? 15  C   D "C2'" 1 
ATOM   8344 O "O2'" . C   D 3 15  ? 17.272 28.320  -2.441  1.00 64.82  ? 15  C   D "O2'" 1 
ATOM   8345 C "C1'" . C   D 3 15  ? 18.839 28.910  -0.775  1.00 64.45  ? 15  C   D "C1'" 1 
ATOM   8346 N N1    . C   D 3 15  ? 20.155 28.310  -0.228  1.00 65.69  ? 15  C   D N1    1 
ATOM   8347 C C2    . C   D 3 15  ? 20.421 28.085  1.143   1.00 63.91  ? 15  C   D C2    1 
ATOM   8348 O O2    . C   D 3 15  ? 19.576 28.386  1.987   1.00 61.36  ? 15  C   D O2    1 
ATOM   8349 N N3    . C   D 3 15  ? 21.616 27.539  1.533   1.00 65.69  ? 15  C   D N3    1 
ATOM   8350 C C4    . C   D 3 15  ? 22.540 27.207  0.616   1.00 69.89  ? 15  C   D C4    1 
ATOM   8351 N N4    . C   D 3 15  ? 23.703 26.676  1.025   1.00 72.41  ? 15  C   D N4    1 
ATOM   8352 C C5    . C   D 3 15  ? 22.295 27.408  -0.778  1.00 71.14  ? 15  C   D C5    1 
ATOM   8353 C C6    . C   D 3 15  ? 21.118 27.951  -1.136  1.00 69.05  ? 15  C   D C6    1 
ATOM   8354 P P     . A   D 3 16  ? 15.370 25.655  -0.140  1.00 66.25  ? 16  A   D P     1 
ATOM   8355 O OP1   . A   D 3 16  ? 13.958 25.237  -0.291  1.00 66.96  ? 16  A   D OP1   1 
ATOM   8356 O OP2   . A   D 3 16  ? 16.021 25.195  1.093   1.00 64.49  ? 16  A   D OP2   1 
ATOM   8357 O "O5'" . A   D 3 16  ? 16.226 25.244  -1.430  1.00 71.17  ? 16  A   D "O5'" 1 
ATOM   8358 C "C5'" . A   D 3 16  ? 16.433 23.907  -1.775  1.00 75.98  ? 16  A   D "C5'" 1 
ATOM   8359 C "C4'" . A   D 3 16  ? 17.822 23.652  -2.336  1.00 80.62  ? 16  A   D "C4'" 1 
ATOM   8360 O "O4'" . A   D 3 16  ? 18.824 24.603  -1.902  1.00 79.40  ? 16  A   D "O4'" 1 
ATOM   8361 C "C3'" . A   D 3 16  ? 18.378 22.346  -1.829  1.00 83.06  ? 16  A   D "C3'" 1 
ATOM   8362 O "O3'" . A   D 3 16  ? 17.779 21.303  -2.533  1.00 90.39  ? 16  A   D "O3'" 1 
ATOM   8363 C "C2'" . A   D 3 16  ? 19.870 22.482  -2.064  1.00 84.40  ? 16  A   D "C2'" 1 
ATOM   8364 O "O2'" . A   D 3 16  ? 20.231 22.351  -3.425  1.00 89.27  ? 16  A   D "O2'" 1 
ATOM   8365 C "C1'" . A   D 3 16  ? 20.027 23.918  -1.589  1.00 80.19  ? 16  A   D "C1'" 1 
ATOM   8366 N N9    . A   D 3 16  ? 20.249 24.033  -0.154  1.00 76.18  ? 16  A   D N9    1 
ATOM   8367 C C8    . A   D 3 16  ? 19.394 24.556  0.771   1.00 72.35  ? 16  A   D C8    1 
ATOM   8368 N N7    . A   D 3 16  ? 19.849 24.548  2.001   1.00 70.78  ? 16  A   D N7    1 
ATOM   8369 C C5    . A   D 3 16  ? 21.103 23.979  1.881   1.00 73.97  ? 16  A   D C5    1 
ATOM   8370 C C6    . A   D 3 16  ? 22.119 23.690  2.830   1.00 74.97  ? 16  A   D C6    1 
ATOM   8371 N N6    . A   D 3 16  ? 22.018 23.935  4.145   1.00 72.27  ? 16  A   D N6    1 
ATOM   8372 N N1    . A   D 3 16  ? 23.256 23.131  2.361   1.00 78.68  ? 16  A   D N1    1 
ATOM   8373 C C2    . A   D 3 16  ? 23.365 22.872  1.049   1.00 82.02  ? 16  A   D C2    1 
ATOM   8374 N N3    . A   D 3 16  ? 22.486 23.099  0.068   1.00 81.72  ? 16  A   D N3    1 
ATOM   8375 C C4    . A   D 3 16  ? 21.363 23.657  0.554   1.00 77.27  ? 16  A   D C4    1 
ATOM   8376 P P     . A   D 3 17  ? 16.933 20.280  -1.660  1.00 91.64  ? 17  A   D P     1 
ATOM   8377 O OP1   . A   D 3 17  ? 16.580 19.175  -2.568  1.00 96.44  ? 17  A   D OP1   1 
ATOM   8378 O OP2   . A   D 3 17  ? 15.864 21.033  -0.963  1.00 87.37  ? 17  A   D OP2   1 
ATOM   8379 O "O5'" . A   D 3 17  ? 18.021 19.727  -0.619  1.00 95.87  ? 17  A   D "O5'" 1 
ATOM   8380 C "C5'" . A   D 3 17  ? 18.315 20.305  0.667   1.00 100.53 ? 17  A   D "C5'" 1 
ATOM   8381 C "C4'" . A   D 3 17  ? 19.433 19.509  1.328   1.00 107.30 ? 17  A   D "C4'" 1 
ATOM   8382 O "O4'" . A   D 3 17  ? 20.080 20.223  2.422   1.00 107.51 ? 17  A   D "O4'" 1 
ATOM   8383 C "C3'" . A   D 3 17  ? 18.999 18.142  1.886   1.00 109.50 ? 17  A   D "C3'" 1 
ATOM   8384 O "O3'" . A   D 3 17  ? 19.600 17.053  1.140   1.00 115.61 ? 17  A   D "O3'" 1 
ATOM   8385 C "C2'" . A   D 3 17  ? 19.428 18.195  3.362   1.00 107.52 ? 17  A   D "C2'" 1 
ATOM   8386 O "O2'" . A   D 3 17  ? 19.952 16.987  3.870   1.00 108.49 ? 17  A   D "O2'" 1 
ATOM   8387 C "C1'" . A   D 3 17  ? 20.564 19.207  3.283   1.00 109.93 ? 17  A   D "C1'" 1 
ATOM   8388 N N9    . A   D 3 17  ? 21.024 19.751  4.562   1.00 108.65 ? 17  A   D N9    1 
ATOM   8389 C C8    . A   D 3 17  ? 20.383 19.742  5.778   1.00 105.64 ? 17  A   D C8    1 
ATOM   8390 N N7    . A   D 3 17  ? 21.079 20.311  6.739   1.00 105.76 ? 17  A   D N7    1 
ATOM   8391 C C5    . A   D 3 17  ? 22.260 20.716  6.113   1.00 109.04 ? 17  A   D C5    1 
ATOM   8392 C C6    . A   D 3 17  ? 23.433 21.385  6.568   1.00 110.91 ? 17  A   D C6    1 
ATOM   8393 N N6    . A   D 3 17  ? 23.622 21.788  7.832   1.00 109.87 ? 17  A   D N6    1 
ATOM   8394 N N1    . A   D 3 17  ? 24.420 21.633  5.670   1.00 114.58 ? 17  A   D N1    1 
ATOM   8395 C C2    . A   D 3 17  ? 24.252 21.230  4.400   1.00 116.18 ? 17  A   D C2    1 
ATOM   8396 N N3    . A   D 3 17  ? 23.206 20.599  3.854   1.00 114.57 ? 17  A   D N3    1 
ATOM   8397 C C4    . A   D 3 17  ? 22.238 20.373  4.768   1.00 110.88 ? 17  A   D C4    1 
ATOM   8398 P P     . G   D 3 18  ? 20.044 17.167  -0.410  1.00 122.47 ? 18  G   D P     1 
ATOM   8399 O OP1   . G   D 3 18  ? 21.261 18.011  -0.497  1.00 123.46 ? 18  G   D OP1   1 
ATOM   8400 O OP2   . G   D 3 18  ? 18.869 17.509  -1.238  1.00 122.19 ? 18  G   D OP2   1 
ATOM   8401 O "O5'" . G   D 3 18  ? 20.412 15.654  -0.778  1.00 127.28 ? 18  G   D "O5'" 1 
ATOM   8402 C "C5'" . G   D 3 18  ? 19.606 14.566  -0.320  1.00 126.86 ? 18  G   D "C5'" 1 
ATOM   8403 C "C4'" . G   D 3 18  ? 20.432 13.298  -0.358  1.00 131.60 ? 18  G   D "C4'" 1 
ATOM   8404 O "O4'" . G   D 3 18  ? 21.007 13.189  -1.676  1.00 138.35 ? 18  G   D "O4'" 1 
ATOM   8405 C "C3'" . G   D 3 18  ? 21.617 13.276  0.602   1.00 131.21 ? 18  G   D "C3'" 1 
ATOM   8406 O "O3'" . G   D 3 18  ? 21.236 12.558  1.793   1.00 127.65 ? 18  G   D "O3'" 1 
ATOM   8407 C "C2'" . G   D 3 18  ? 22.765 12.619  -0.191  1.00 138.21 ? 18  G   D "C2'" 1 
ATOM   8408 O "O2'" . G   D 3 18  ? 23.133 11.332  0.264   1.00 140.11 ? 18  G   D "O2'" 1 
ATOM   8409 C "C1'" . G   D 3 18  ? 22.234 12.492  -1.617  1.00 143.04 ? 18  G   D "C1'" 1 
ATOM   8410 N N9    . G   D 3 18  ? 23.120 13.030  -2.654  1.00 148.59 ? 18  G   D N9    1 
ATOM   8411 C C8    . G   D 3 18  ? 23.227 14.346  -3.046  1.00 147.78 ? 18  G   D C8    1 
ATOM   8412 N N7    . G   D 3 18  ? 24.089 14.548  -4.007  1.00 153.83 ? 18  G   D N7    1 
ATOM   8413 C C5    . G   D 3 18  ? 24.591 13.282  -4.279  1.00 159.29 ? 18  G   D C5    1 
ATOM   8414 C C6    . G   D 3 18  ? 25.565 12.877  -5.229  1.00 167.35 ? 18  G   D C6    1 
ATOM   8415 O O6    . G   D 3 18  ? 26.187 13.590  -6.033  1.00 171.38 ? 18  G   D O6    1 
ATOM   8416 N N1    . G   D 3 18  ? 25.792 11.497  -5.185  1.00 171.42 ? 18  G   D N1    1 
ATOM   8417 C C2    . G   D 3 18  ? 25.153 10.621  -4.326  1.00 167.71 ? 18  G   D C2    1 
ATOM   8418 N N2    . G   D 3 18  ? 25.494 9.326   -4.419  1.00 172.71 ? 18  G   D N2    1 
ATOM   8419 N N3    . G   D 3 18  ? 24.239 10.991  -3.431  1.00 160.01 ? 18  G   D N3    1 
ATOM   8420 C C4    . G   D 3 18  ? 24.004 12.333  -3.457  1.00 156.29 ? 18  G   D C4    1 
ATOM   8421 P P     . U   D 3 19  ? 21.493 13.119  3.281   1.00 122.43 ? 19  U   D P     1 
ATOM   8422 O OP1   . U   D 3 19  ? 20.567 12.393  4.188   1.00 118.42 ? 19  U   D OP1   1 
ATOM   8423 O OP2   . U   D 3 19  ? 21.472 14.604  3.236   1.00 119.98 ? 19  U   D OP2   1 
ATOM   8424 O "O5'" . U   D 3 19  ? 23.010 12.643  3.544   1.00 125.07 ? 19  U   D "O5'" 1 
ATOM   8425 C "C5'" . U   D 3 19  ? 23.524 12.274  4.828   1.00 121.60 ? 19  U   D "C5'" 1 
ATOM   8426 C "C4'" . U   D 3 19  ? 24.437 13.355  5.404   1.00 120.26 ? 19  U   D "C4'" 1 
ATOM   8427 O "O4'" . U   D 3 19  ? 25.429 13.808  4.447   1.00 124.68 ? 19  U   D "O4'" 1 
ATOM   8428 C "C3'" . U   D 3 19  ? 23.740 14.622  5.904   1.00 114.90 ? 19  U   D "C3'" 1 
ATOM   8429 O "O3'" . U   D 3 19  ? 24.245 14.974  7.210   1.00 112.29 ? 19  U   D "O3'" 1 
ATOM   8430 C "C2'" . U   D 3 19  ? 24.029 15.671  4.823   1.00 116.30 ? 19  U   D "C2'" 1 
ATOM   8431 O "O2'" . U   D 3 19  ? 24.090 16.980  5.356   1.00 113.20 ? 19  U   D "O2'" 1 
ATOM   8432 C "C1'" . U   D 3 19  ? 25.382 15.215  4.266   1.00 122.30 ? 19  U   D "C1'" 1 
ATOM   8433 N N1    . U   D 3 19  ? 25.643 15.440  2.794   1.00 126.46 ? 19  U   D N1    1 
ATOM   8434 C C2    . U   D 3 19  ? 25.556 16.691  2.187   1.00 126.07 ? 19  U   D C2    1 
ATOM   8435 O O2    . U   D 3 19  ? 25.257 17.731  2.755   1.00 122.10 ? 19  U   D O2    1 
ATOM   8436 N N3    . U   D 3 19  ? 25.838 16.680  0.835   1.00 130.84 ? 19  U   D N3    1 
ATOM   8437 C C4    . U   D 3 19  ? 26.193 15.590  0.045   1.00 136.08 ? 19  U   D C4    1 
ATOM   8438 O O4    . U   D 3 19  ? 26.415 15.739  -1.150  1.00 140.51 ? 19  U   D O4    1 
ATOM   8439 C C5    . U   D 3 19  ? 26.270 14.332  0.740   1.00 136.05 ? 19  U   D C5    1 
ATOM   8440 C C6    . U   D 3 19  ? 26.000 14.319  2.051   1.00 131.43 ? 19  U   D C6    1 
ATOM   8441 P P     . C   D 3 20  ? 24.119 13.965  8.464   1.00 109.51 ? 20  C   D P     1 
ATOM   8442 O OP1   . C   D 3 20  ? 25.497 13.580  8.851   1.00 113.07 ? 20  C   D OP1   1 
ATOM   8443 O OP2   . C   D 3 20  ? 23.135 12.897  8.158   1.00 107.66 ? 20  C   D OP2   1 
ATOM   8444 O "O5'" . C   D 3 20  ? 23.462 14.874  9.613   1.00 103.66 ? 20  C   D "O5'" 1 
ATOM   8445 C "C5'" . C   D 3 20  ? 23.673 16.283  9.675   1.00 100.65 ? 20  C   D "C5'" 1 
ATOM   8446 C "C4'" . C   D 3 20  ? 22.464 17.013  10.236  1.00 94.83  ? 20  C   D "C4'" 1 
ATOM   8447 O "O4'" . C   D 3 20  ? 21.843 17.778  9.170   1.00 94.70  ? 20  C   D "O4'" 1 
ATOM   8448 C "C3'" . C   D 3 20  ? 21.327 16.151  10.778  1.00 90.02  ? 20  C   D "C3'" 1 
ATOM   8449 O "O3'" . C   D 3 20  ? 21.517 15.746  12.117  1.00 85.87  ? 20  C   D "O3'" 1 
ATOM   8450 C "C2'" . C   D 3 20  ? 20.112 17.069  10.652  1.00 88.71  ? 20  C   D "C2'" 1 
ATOM   8451 O "O2'" . C   D 3 20  ? 19.922 17.962  11.740  1.00 86.52  ? 20  C   D "O2'" 1 
ATOM   8452 C "C1'" . C   D 3 20  ? 20.433 17.771  9.336   1.00 92.18  ? 20  C   D "C1'" 1 
ATOM   8453 N N1    . C   D 3 20  ? 19.754 17.052  8.207   1.00 93.48  ? 20  C   D N1    1 
ATOM   8454 C C2    . C   D 3 20  ? 18.494 17.506  7.775   1.00 92.37  ? 20  C   D C2    1 
ATOM   8455 O O2    . C   D 3 20  ? 17.976 18.497  8.316   1.00 90.24  ? 20  C   D O2    1 
ATOM   8456 N N3    . C   D 3 20  ? 17.881 16.837  6.757   1.00 93.85  ? 20  C   D N3    1 
ATOM   8457 C C4    . C   D 3 20  ? 18.467 15.767  6.198   1.00 95.84  ? 20  C   D C4    1 
ATOM   8458 N N4    . C   D 3 20  ? 17.824 15.151  5.203   1.00 97.44  ? 20  C   D N4    1 
ATOM   8459 C C5    . C   D 3 20  ? 19.741 15.283  6.629   1.00 97.39  ? 20  C   D C5    1 
ATOM   8460 C C6    . C   D 3 20  ? 20.337 15.948  7.626   1.00 96.18  ? 20  C   D C6    1 
ATOM   8461 P P     . C   D 3 21  ? 20.674 14.479  12.608  1.00 82.10  ? 21  C   D P     1 
ATOM   8462 O OP1   . C   D 3 21  ? 21.140 14.068  13.949  1.00 82.52  ? 21  C   D OP1   1 
ATOM   8463 O OP2   . C   D 3 21  ? 20.708 13.488  11.513  1.00 83.94  ? 21  C   D OP2   1 
ATOM   8464 O "O5'" . C   D 3 21  ? 19.170 15.031  12.681  1.00 76.77  ? 21  C   D "O5'" 1 
ATOM   8465 C "C5'" . C   D 3 21  ? 18.665 15.781  13.784  1.00 70.42  ? 21  C   D "C5'" 1 
ATOM   8466 C "C4'" . C   D 3 21  ? 17.164 15.955  13.642  1.00 64.89  ? 21  C   D "C4'" 1 
ATOM   8467 O "O4'" . C   D 3 21  ? 16.848 16.497  12.332  1.00 63.77  ? 21  C   D "O4'" 1 
ATOM   8468 C "C3'" . C   D 3 21  ? 16.374 14.655  13.749  1.00 62.08  ? 21  C   D "C3'" 1 
ATOM   8469 O "O3'" . C   D 3 21  ? 16.118 14.342  15.121  1.00 58.70  ? 21  C   D "O3'" 1 
ATOM   8470 C "C2'" . C   D 3 21  ? 15.110 15.032  12.998  1.00 61.80  ? 21  C   D "C2'" 1 
ATOM   8471 O "O2'" . C   D 3 21  ? 14.251 15.816  13.783  1.00 61.63  ? 21  C   D "O2'" 1 
ATOM   8472 C "C1'" . C   D 3 21  ? 15.649 15.901  11.867  1.00 63.36  ? 21  C   D "C1'" 1 
ATOM   8473 N N1    . C   D 3 21  ? 15.844 15.115  10.582  1.00 65.12  ? 21  C   D N1    1 
ATOM   8474 C C2    . C   D 3 21  ? 14.755 14.928  9.706   1.00 65.36  ? 21  C   D C2    1 
ATOM   8475 O O2    . C   D 3 21  ? 13.650 15.415  9.976   1.00 64.15  ? 21  C   D O2    1 
ATOM   8476 N N3    . C   D 3 21  ? 14.944 14.224  8.559   1.00 67.34  ? 21  C   D N3    1 
ATOM   8477 C C4    . C   D 3 21  ? 16.140 13.704  8.277   1.00 68.73  ? 21  C   D C4    1 
ATOM   8478 N N4    . C   D 3 21  ? 16.271 13.016  7.142   1.00 71.17  ? 21  C   D N4    1 
ATOM   8479 C C5    . C   D 3 21  ? 17.255 13.866  9.151   1.00 68.40  ? 21  C   D C5    1 
ATOM   8480 C C6    . C   D 3 21  ? 17.064 14.570  10.274  1.00 66.70  ? 21  C   D C6    1 
ATOM   8481 P P     . A   D 3 22  ? 15.856 12.857  15.659  1.00 55.91  ? 22  A   D P     1 
ATOM   8482 O OP1   . A   D 3 22  ? 15.610 12.941  17.109  1.00 56.07  ? 22  A   D OP1   1 
ATOM   8483 O OP2   . A   D 3 22  ? 16.893 11.937  15.153  1.00 56.89  ? 22  A   D OP2   1 
ATOM   8484 O "O5'" . A   D 3 22  ? 14.466 12.530  14.953  1.00 57.02  ? 22  A   D "O5'" 1 
ATOM   8485 C "C5'" . A   D 3 22  ? 14.090 11.253  14.462  1.00 56.48  ? 22  A   D "C5'" 1 
ATOM   8486 C "C4'" . A   D 3 22  ? 12.762 11.492  13.788  1.00 55.85  ? 22  A   D "C4'" 1 
ATOM   8487 O "O4'" . A   D 3 22  ? 12.952 12.485  12.747  1.00 56.89  ? 22  A   D "O4'" 1 
ATOM   8488 C "C3'" . A   D 3 22  ? 12.143 10.293  13.115  1.00 56.99  ? 22  A   D "C3'" 1 
ATOM   8489 O "O3'" . A   D 3 22  ? 11.252 9.724   14.035  1.00 56.69  ? 22  A   D "O3'" 1 
ATOM   8490 C "C2'" . A   D 3 22  ? 11.367 10.960  11.991  1.00 59.05  ? 22  A   D "C2'" 1 
ATOM   8491 O "O2'" . A   D 3 22  ? 10.161 11.530  12.434  1.00 61.03  ? 22  A   D "O2'" 1 
ATOM   8492 C "C1'" . A   D 3 22  ? 12.282 12.093  11.566  1.00 58.67  ? 22  A   D "C1'" 1 
ATOM   8493 N N9    . A   D 3 22  ? 13.199 11.617  10.532  1.00 60.31  ? 22  A   D N9    1 
ATOM   8494 C C8    . A   D 3 22  ? 14.560 11.461  10.594  1.00 60.51  ? 22  A   D C8    1 
ATOM   8495 N N7    . A   D 3 22  ? 15.091 10.982  9.496   1.00 61.92  ? 22  A   D N7    1 
ATOM   8496 C C5    . A   D 3 22  ? 14.005 10.812  8.659   1.00 63.42  ? 22  A   D C5    1 
ATOM   8497 C C6    . A   D 3 22  ? 13.887 10.347  7.334   1.00 66.92  ? 22  A   D C6    1 
ATOM   8498 N N6    . A   D 3 22  ? 14.930 9.944   6.605   1.00 69.52  ? 22  A   D N6    1 
ATOM   8499 N N1    . A   D 3 22  ? 12.649 10.307  6.786   1.00 68.69  ? 22  A   D N1    1 
ATOM   8500 C C2    . A   D 3 22  ? 11.594 10.710  7.513   1.00 66.89  ? 22  A   D C2    1 
ATOM   8501 N N3    . A   D 3 22  ? 11.582 11.170  8.767   1.00 64.12  ? 22  A   D N3    1 
ATOM   8502 C C4    . A   D 3 22  ? 12.830 11.195  9.282   1.00 62.29  ? 22  A   D C4    1 
ATOM   8503 P P     . U   D 3 23  ? 10.866 8.173   14.020  1.00 57.28  ? 23  U   D P     1 
ATOM   8504 O OP1   . U   D 3 23  ? 10.021 7.955   15.222  1.00 56.33  ? 23  U   D OP1   1 
ATOM   8505 O OP2   . U   D 3 23  ? 12.107 7.407   13.769  1.00 56.64  ? 23  U   D OP2   1 
ATOM   8506 O "O5'" . U   D 3 23  ? 9.967  7.983   12.717  1.00 62.19  ? 23  U   D "O5'" 1 
ATOM   8507 C "C5'" . U   D 3 23  ? 8.625  8.481   12.658  1.00 66.94  ? 23  U   D "C5'" 1 
ATOM   8508 C "C4'" . U   D 3 23  ? 8.027  8.243   11.285  1.00 72.53  ? 23  U   D "C4'" 1 
ATOM   8509 O "O4'" . U   D 3 23  ? 8.803  8.931   10.271  1.00 73.94  ? 23  U   D "O4'" 1 
ATOM   8510 C "C3'" . U   D 3 23  ? 8.073  6.800   10.821  1.00 76.19  ? 23  U   D "C3'" 1 
ATOM   8511 O "O3'" . U   D 3 23  ? 6.986  6.109   11.348  1.00 78.95  ? 23  U   D "O3'" 1 
ATOM   8512 C "C2'" . U   D 3 23  ? 7.944  6.932   9.315   1.00 79.71  ? 23  U   D "C2'" 1 
ATOM   8513 O "O2'" . U   D 3 23  ? 6.600  7.079   8.909   1.00 82.53  ? 23  U   D "O2'" 1 
ATOM   8514 C "C1'" . U   D 3 23  ? 8.762  8.196   9.057   1.00 78.39  ? 23  U   D "C1'" 1 
ATOM   8515 N N1    . U   D 3 23  ? 10.160 7.867   8.631   1.00 79.35  ? 23  U   D N1    1 
ATOM   8516 C C2    . U   D 3 23  ? 10.418 7.511   7.310   1.00 82.84  ? 23  U   D C2    1 
ATOM   8517 O O2    . U   D 3 23  ? 9.561  7.454   6.443   1.00 86.12  ? 23  U   D O2    1 
ATOM   8518 N N3    . U   D 3 23  ? 11.741 7.222   7.042   1.00 82.94  ? 23  U   D N3    1 
ATOM   8519 C C4    . U   D 3 23  ? 12.799 7.243   7.942   1.00 80.10  ? 23  U   D C4    1 
ATOM   8520 O O4    . U   D 3 23  ? 13.929 6.960   7.572   1.00 81.33  ? 23  U   D O4    1 
ATOM   8521 C C5    . U   D 3 23  ? 12.452 7.613   9.293   1.00 77.25  ? 23  U   D C5    1 
ATOM   8522 C C6    . U   D 3 23  ? 11.176 7.901   9.581   1.00 76.80  ? 23  U   D C6    1 
ATOM   8523 P P     . U   D 3 24  ? 7.212  4.610   11.834  1.00 80.37  ? 24  U   D P     1 
ATOM   8524 O OP1   . U   D 3 24  ? 6.045  4.293   12.676  1.00 82.28  ? 24  U   D OP1   1 
ATOM   8525 O OP2   . U   D 3 24  ? 8.573  4.460   12.390  1.00 77.15  ? 24  U   D OP2   1 
ATOM   8526 O "O5'" . U   D 3 24  ? 7.145  3.758   10.479  1.00 85.90  ? 24  U   D "O5'" 1 
ATOM   8527 C "C5'" . U   D 3 24  ? 6.013  3.810   9.609   1.00 90.67  ? 24  U   D "C5'" 1 
ATOM   8528 C "C4'" . U   D 3 24  ? 6.396  3.214   8.276   1.00 95.32  ? 24  U   D "C4'" 1 
ATOM   8529 O "O4'" . U   D 3 24  ? 7.398  4.037   7.631   1.00 94.19  ? 24  U   D "O4'" 1 
ATOM   8530 C "C3'" . U   D 3 24  ? 7.098  1.873   8.364   1.00 97.22  ? 24  U   D "C3'" 1 
ATOM   8531 O "O3'" . U   D 3 24  ? 6.185  0.818   8.624   1.00 101.10 ? 24  U   D "O3'" 1 
ATOM   8532 C "C2'" . U   D 3 24  ? 7.678  1.798   6.960   1.00 101.11 ? 24  U   D "C2'" 1 
ATOM   8533 O "O2'" . U   D 3 24  ? 6.714  1.507   5.962   1.00 107.03 ? 24  U   D "O2'" 1 
ATOM   8534 C "C1'" . U   D 3 24  ? 8.207  3.219   6.801   1.00 97.46  ? 24  U   D "C1'" 1 
ATOM   8535 N N1    . U   D 3 24  ? 9.658  3.332   7.168   1.00 94.31  ? 24  U   D N1    1 
ATOM   8536 C C2    . U   D 3 24  ? 10.613 2.592   6.484   1.00 97.39  ? 24  U   D C2    1 
ATOM   8537 O O2    . U   D 3 24  ? 10.374 1.823   5.573   1.00 102.97 ? 24  U   D O2    1 
ATOM   8538 N N3    . U   D 3 24  ? 11.906 2.768   6.897   1.00 94.74  ? 24  U   D N3    1 
ATOM   8539 C C4    . U   D 3 24  ? 12.343 3.591   7.908   1.00 89.93  ? 24  U   D C4    1 
ATOM   8540 O O4    . U   D 3 24  ? 13.541 3.638   8.158   1.00 89.04  ? 24  U   D O4    1 
ATOM   8541 C C5    . U   D 3 24  ? 11.303 4.329   8.581   1.00 87.47  ? 24  U   D C5    1 
ATOM   8542 C C6    . U   D 3 24  ? 10.031 4.177   8.193   1.00 89.68  ? 24  U   D C6    1 
ATOM   8543 P P     . U   D 3 25  ? 6.742  -0.655  8.891   1.00 103.11 ? 25  U   D P     1 
ATOM   8544 O OP1   . U   D 3 25  ? 5.648  -1.438  9.503   1.00 106.07 ? 25  U   D OP1   1 
ATOM   8545 O OP2   . U   D 3 25  ? 8.053  -0.583  9.568   1.00 98.29  ? 25  U   D OP2   1 
ATOM   8546 O "O5'" . U   D 3 25  ? 6.999  -1.192  7.412   1.00 109.92 ? 25  U   D "O5'" 1 
ATOM   8547 C "C5'" . U   D 3 25  ? 5.929  -1.701  6.630   1.00 117.73 ? 25  U   D "C5'" 1 
ATOM   8548 C "C4'" . U   D 3 25  ? 6.494  -2.393  5.409   1.00 124.38 ? 25  U   D "C4'" 1 
ATOM   8549 O "O4'" . U   D 3 25  ? 7.437  -1.494  4.768   1.00 122.80 ? 25  U   D "O4'" 1 
ATOM   8550 C "C3'" . U   D 3 25  ? 7.317  -3.643  5.702   1.00 126.15 ? 25  U   D "C3'" 1 
ATOM   8551 O "O3'" . U   D 3 25  ? 6.512  -4.813  5.856   1.00 131.51 ? 25  U   D "O3'" 1 
ATOM   8552 C "C2'" . U   D 3 25  ? 8.199  -3.707  4.459   1.00 130.13 ? 25  U   D "C2'" 1 
ATOM   8553 O "O2'" . U   D 3 25  ? 7.536  -4.237  3.326   1.00 137.84 ? 25  U   D "O2'" 1 
ATOM   8554 C "C1'" . U   D 3 25  ? 8.532  -2.234  4.259   1.00 125.84 ? 25  U   D "C1'" 1 
ATOM   8555 N N1    . U   D 3 25  ? 9.830  -1.850  4.927   1.00 120.65 ? 25  U   D N1    1 
ATOM   8556 C C2    . U   D 3 25  ? 10.988 -1.868  4.165   1.00 122.94 ? 25  U   D C2    1 
ATOM   8557 O O2    . U   D 3 25  ? 11.009 -2.162  2.983   1.00 128.96 ? 25  U   D O2    1 
ATOM   8558 N N3    . U   D 3 25  ? 12.138 -1.515  4.835   1.00 118.51 ? 25  U   D N3    1 
ATOM   8559 C C4    . U   D 3 25  ? 12.244 -1.158  6.167   1.00 112.32 ? 25  U   D C4    1 
ATOM   8560 O O4    . U   D 3 25  ? 13.341 -0.868  6.623   1.00 109.82 ? 25  U   D O4    1 
ATOM   8561 C C5    . U   D 3 25  ? 11.005 -1.163  6.906   1.00 110.35 ? 25  U   D C5    1 
ATOM   8562 C C6    . U   D 3 25  ? 9.873  -1.504  6.273   1.00 114.49 ? 25  U   D C6    1 
ATOM   8563 P P     . A   D 3 26  ? 7.030  -6.031  6.763   1.00 131.35 ? 26  A   D P     1 
ATOM   8564 O OP1   . A   D 3 26  ? 5.918  -7.006  6.860   1.00 135.57 ? 26  A   D OP1   1 
ATOM   8565 O OP2   . A   D 3 26  ? 7.626  -5.461  7.996   1.00 123.34 ? 26  A   D OP2   1 
ATOM   8566 O "O5'" . A   D 3 26  ? 8.222  -6.682  5.908   1.00 135.52 ? 26  A   D "O5'" 1 
ATOM   8567 C "C5'" . A   D 3 26  ? 7.936  -7.407  4.715   1.00 144.70 ? 26  A   D "C5'" 1 
ATOM   8568 C "C4'" . A   D 3 26  ? 9.166  -7.627  3.851   1.00 148.88 ? 26  A   D "C4'" 1 
ATOM   8569 O "O4'" . A   D 3 26  ? 9.826  -6.377  3.531   1.00 145.59 ? 26  A   D "O4'" 1 
ATOM   8570 C "C3'" . A   D 3 26  ? 10.284 -8.439  4.481   1.00 148.06 ? 26  A   D "C3'" 1 
ATOM   8571 O "O3'" . A   D 3 26  ? 9.971  -9.814  4.497   1.00 154.05 ? 26  A   D "O3'" 1 
ATOM   8572 C "C2'" . A   D 3 26  ? 11.439 -8.107  3.546   1.00 150.66 ? 26  A   D "C2'" 1 
ATOM   8573 O "O2'" . A   D 3 26  ? 11.379 -8.764  2.295   1.00 159.66 ? 26  A   D "O2'" 1 
ATOM   8574 C "C1'" . A   D 3 26  ? 11.218 -6.606  3.393   1.00 146.56 ? 26  A   D "C1'" 1 
ATOM   8575 N N9    . A   D 3 26  ? 11.952 -5.864  4.418   1.00 139.16 ? 26  A   D N9    1 
ATOM   8576 C C8    . A   D 3 26  ? 11.461 -5.274  5.558   1.00 132.45 ? 26  A   D C8    1 
ATOM   8577 N N7    . A   D 3 26  ? 12.376 -4.684  6.294   1.00 127.11 ? 26  A   D N7    1 
ATOM   8578 C C5    . A   D 3 26  ? 13.552 -4.909  5.592   1.00 130.61 ? 26  A   D C5    1 
ATOM   8579 C C6    . A   D 3 26  ? 14.895 -4.545  5.835   1.00 128.57 ? 26  A   D C6    1 
ATOM   8580 N N6    . A   D 3 26  ? 15.284 -3.842  6.903   1.00 122.27 ? 26  A   D N6    1 
ATOM   8581 N N1    . A   D 3 26  ? 15.823 -4.933  4.927   1.00 134.28 ? 26  A   D N1    1 
ATOM   8582 C C2    . A   D 3 26  ? 15.445 -5.639  3.847   1.00 141.29 ? 26  A   D C2    1 
ATOM   8583 N N3    . A   D 3 26  ? 14.218 -6.037  3.513   1.00 143.81 ? 26  A   D N3    1 
ATOM   8584 C C4    . A   D 3 26  ? 13.311 -5.638  4.434   1.00 138.19 ? 26  A   D C4    1 
ATOM   8585 P P     . C   D 3 27  ? 10.188 -10.642 5.850   1.00 150.97 ? 27  C   D P     1 
ATOM   8586 O OP1   . C   D 3 27  ? 9.453  -11.919 5.686   1.00 157.04 ? 27  C   D OP1   1 
ATOM   8587 O OP2   . C   D 3 27  ? 9.885  -9.762  7.007   1.00 142.50 ? 27  C   D OP2   1 
ATOM   8588 O "O5'" . C   D 3 27  ? 11.769 -10.923 5.852   1.00 151.11 ? 27  C   D "O5'" 1 
ATOM   8589 C "C5'" . C   D 3 27  ? 12.368 -11.793 4.882   1.00 159.12 ? 27  C   D "C5'" 1 
ATOM   8590 C "C4'" . C   D 3 27  ? 13.809 -11.410 4.579   1.00 159.04 ? 27  C   D "C4'" 1 
ATOM   8591 O "O4'" . C   D 3 27  ? 13.924 -9.972  4.421   1.00 154.48 ? 27  C   D "O4'" 1 
ATOM   8592 C "C3'" . C   D 3 27  ? 14.823 -11.756 5.663   1.00 154.73 ? 27  C   D "C3'" 1 
ATOM   8593 O "O3'" . C   D 3 27  ? 15.288 -13.098 5.529   1.00 159.87 ? 27  C   D "O3'" 1 
ATOM   8594 C "C2'" . C   D 3 27  ? 15.933 -10.745 5.391   1.00 153.18 ? 27  C   D "C2'" 1 
ATOM   8595 O "O2'" . C   D 3 27  ? 16.768 -11.090 4.301   1.00 160.79 ? 27  C   D "O2'" 1 
ATOM   8596 C "C1'" . C   D 3 27  ? 15.120 -9.511  5.032   1.00 150.39 ? 27  C   D "C1'" 1 
ATOM   8597 N N1    . C   D 3 27  ? 14.838 -8.588  6.202   1.00 141.67 ? 27  C   D N1    1 
ATOM   8598 C C2    . C   D 3 27  ? 15.900 -7.894  6.822   1.00 137.24 ? 27  C   D C2    1 
ATOM   8599 O O2    . C   D 3 27  ? 17.062 -8.050  6.421   1.00 140.43 ? 27  C   D O2    1 
ATOM   8600 N N3    . C   D 3 27  ? 15.629 -7.060  7.862   1.00 129.98 ? 27  C   D N3    1 
ATOM   8601 C C4    . C   D 3 27  ? 14.370 -6.901  8.287   1.00 127.35 ? 27  C   D C4    1 
ATOM   8602 N N4    . C   D 3 27  ? 14.161 -6.068  9.313   1.00 120.81 ? 27  C   D N4    1 
ATOM   8603 C C5    . C   D 3 27  ? 13.274 -7.592  7.675   1.00 131.89 ? 27  C   D C5    1 
ATOM   8604 C C6    . C   D 3 27  ? 13.552 -8.410  6.650   1.00 138.82 ? 27  C   D C6    1 
ATOM   8605 P P     . U   D 3 28  ? 16.229 -13.734 6.664   1.00 156.33 ? 28  U   D P     1 
ATOM   8606 O OP1   . U   D 3 28  ? 15.924 -15.181 6.727   1.00 161.21 ? 28  U   D OP1   1 
ATOM   8607 O OP2   . U   D 3 28  ? 16.129 -12.898 7.891   1.00 146.28 ? 28  U   D OP2   1 
ATOM   8608 O "O5'" . U   D 3 28  ? 17.688 -13.561 6.021   1.00 158.76 ? 28  U   D "O5'" 1 
ATOM   8609 C "C5'" . U   D 3 28  ? 18.813 -14.235 6.576   1.00 157.26 ? 28  U   D "C5'" 1 
ATOM   8610 C "C4'" . U   D 3 28  ? 19.577 -13.375 7.573   1.00 148.28 ? 28  U   D "C4'" 1 
ATOM   8611 O "O4'" . U   D 3 28  ? 19.200 -11.968 7.553   1.00 142.06 ? 28  U   D "O4'" 1 
ATOM   8612 C "C3'" . U   D 3 28  ? 19.359 -13.663 9.050   1.00 140.78 ? 28  U   D "C3'" 1 
ATOM   8613 O "O3'" . U   D 3 28  ? 19.812 -14.948 9.480   1.00 142.84 ? 28  U   D "O3'" 1 
ATOM   8614 C "C2'" . U   D 3 28  ? 20.202 -12.532 9.625   1.00 135.36 ? 28  U   D "C2'" 1 
ATOM   8615 O "O2'" . U   D 3 28  ? 21.599 -12.769 9.571   1.00 139.18 ? 28  U   D "O2'" 1 
ATOM   8616 C "C1'" . U   D 3 28  ? 19.797 -11.379 8.703   1.00 134.46 ? 28  U   D "C1'" 1 
ATOM   8617 N N1    . U   D 3 28  ? 18.888 -10.430 9.424   1.00 126.13 ? 28  U   D N1    1 
ATOM   8618 C C2    . U   D 3 28  ? 19.466 -9.475  10.246  1.00 120.68 ? 28  U   D C2    1 
ATOM   8619 O O2    . U   D 3 28  ? 20.671 -9.364  10.400  1.00 121.55 ? 28  U   D O2    1 
ATOM   8620 N N3    . U   D 3 28  ? 18.583 -8.639  10.892  1.00 114.57 ? 28  U   D N3    1 
ATOM   8621 C C4    . U   D 3 28  ? 17.201 -8.661  10.801  1.00 113.48 ? 28  U   D C4    1 
ATOM   8622 O O4    . U   D 3 28  ? 16.538 -7.848  11.443  1.00 107.97 ? 28  U   D O4    1 
ATOM   8623 C C5    . U   D 3 28  ? 16.672 -9.690  9.931   1.00 119.24 ? 28  U   D C5    1 
ATOM   8624 C C6    . U   D 3 28  ? 17.513 -10.518 9.291   1.00 125.14 ? 28  U   D C6    1 
ATOM   8625 P P     . U   D 3 29  ? 19.056 -15.687 10.696  1.00 137.69 ? 29  U   D P     1 
ATOM   8626 O OP1   . U   D 3 29  ? 18.887 -17.099 10.287  1.00 144.32 ? 29  U   D OP1   1 
ATOM   8627 O OP2   . U   D 3 29  ? 17.871 -14.892 11.095  1.00 131.68 ? 29  U   D OP2   1 
ATOM   8628 O "O5'" . U   D 3 29  ? 20.091 -15.630 11.914  1.00 131.70 ? 29  U   D "O5'" 1 
ATOM   8629 C "C5'" . U   D 3 29  ? 19.943 -14.705 12.968  1.00 121.22 ? 29  U   D "C5'" 1 
ATOM   8630 C "C4'" . U   D 3 29  ? 21.245 -13.954 13.143  1.00 119.00 ? 29  U   D "C4'" 1 
ATOM   8631 O "O4'" . U   D 3 29  ? 21.242 -12.728 12.366  1.00 118.35 ? 29  U   D "O4'" 1 
ATOM   8632 C "C3'" . U   D 3 29  ? 21.482 -13.508 14.572  1.00 111.72 ? 29  U   D "C3'" 1 
ATOM   8633 O "O3'" . U   D 3 29  ? 22.218 -14.498 15.247  1.00 110.99 ? 29  U   D "O3'" 1 
ATOM   8634 C "C2'" . U   D 3 29  ? 22.232 -12.191 14.398  1.00 110.95 ? 29  U   D "C2'" 1 
ATOM   8635 O "O2'" . U   D 3 29  ? 23.600 -12.348 14.071  1.00 115.66 ? 29  U   D "O2'" 1 
ATOM   8636 C "C1'" . U   D 3 29  ? 21.456 -11.611 13.218  1.00 112.83 ? 29  U   D "C1'" 1 
ATOM   8637 N N1    . U   D 3 29  ? 20.129 -10.945 13.586  1.00 107.45 ? 29  U   D N1    1 
ATOM   8638 C C2    . U   D 3 29  ? 20.094 -9.861  14.456  1.00 101.97 ? 29  U   D C2    1 
ATOM   8639 O O2    . U   D 3 29  ? 21.079 -9.364  14.979  1.00 100.90 ? 29  U   D O2    1 
ATOM   8640 N N3    . U   D 3 29  ? 18.834 -9.356  14.703  1.00 98.70  ? 29  U   D N3    1 
ATOM   8641 C C4    . U   D 3 29  ? 17.624 -9.809  14.191  1.00 99.79  ? 29  U   D C4    1 
ATOM   8642 O O4    . U   D 3 29  ? 16.570 -9.258  14.504  1.00 96.41  ? 29  U   D O4    1 
ATOM   8643 C C5    . U   D 3 29  ? 17.736 -10.935 13.299  1.00 105.47 ? 29  U   D C5    1 
ATOM   8644 C C6    . U   D 3 29  ? 18.950 -11.434 13.041  1.00 109.06 ? 29  U   D C6    1 
ATOM   8645 P P     . C   D 3 30  ? 21.563 -15.150 16.547  1.00 105.21 ? 30  C   D P     1 
ATOM   8646 O OP1   . C   D 3 30  ? 22.214 -16.459 16.767  1.00 108.94 ? 30  C   D OP1   1 
ATOM   8647 O OP2   . C   D 3 30  ? 20.082 -15.081 16.442  1.00 102.35 ? 30  C   D OP2   1 
ATOM   8648 O "O5'" . C   D 3 30  ? 22.046 -14.126 17.681  1.00 98.15  ? 30  C   D "O5'" 1 
ATOM   8649 C "C5'" . C   D 3 30  ? 23.424 -13.758 17.805  1.00 97.12  ? 30  C   D "C5'" 1 
ATOM   8650 C "C4'" . C   D 3 30  ? 23.536 -12.410 18.488  1.00 90.41  ? 30  C   D "C4'" 1 
ATOM   8651 O "O4'" . C   D 3 30  ? 22.883 -11.412 17.665  1.00 88.36  ? 30  C   D "O4'" 1 
ATOM   8652 C "C3'" . C   D 3 30  ? 22.807 -12.297 19.818  1.00 83.81  ? 30  C   D "C3'" 1 
ATOM   8653 O "O3'" . C   D 3 30  ? 23.596 -12.751 20.882  1.00 82.82  ? 30  C   D "O3'" 1 
ATOM   8654 C "C2'" . C   D 3 30  ? 22.627 -10.798 19.915  1.00 80.38  ? 30  C   D "C2'" 1 
ATOM   8655 O "O2'" . C   D 3 30  ? 23.829 -10.138 20.250  1.00 81.59  ? 30  C   D "O2'" 1 
ATOM   8656 C "C1'" . C   D 3 30  ? 22.214 -10.473 18.485  1.00 82.50  ? 30  C   D "C1'" 1 
ATOM   8657 N N1    . C   D 3 30  ? 20.720 -10.533 18.279  1.00 80.20  ? 30  C   D N1    1 
ATOM   8658 C C2    . C   D 3 30  ? 19.895 -9.511  18.814  1.00 75.40  ? 30  C   D C2    1 
ATOM   8659 O O2    . C   D 3 30  ? 20.397 -8.574  19.447  1.00 72.64  ? 30  C   D O2    1 
ATOM   8660 N N3    . C   D 3 30  ? 18.545 -9.576  18.624  1.00 74.17  ? 30  C   D N3    1 
ATOM   8661 C C4    . C   D 3 30  ? 18.023 -10.608 17.934  1.00 77.90  ? 30  C   D C4    1 
ATOM   8662 N N4    . C   D 3 30  ? 16.695 -10.640 17.761  1.00 77.19  ? 30  C   D N4    1 
ATOM   8663 C C5    . C   D 3 30  ? 18.838 -11.654 17.384  1.00 81.77  ? 30  C   D C5    1 
ATOM   8664 C C6    . C   D 3 30  ? 20.161 -11.576 17.580  1.00 82.77  ? 30  C   D C6    1 
ATOM   8665 P P     . C   D 3 31  ? 22.971 -13.713 21.998  1.00 80.02  ? 31  C   D P     1 
ATOM   8666 O OP1   . C   D 3 31  ? 24.001 -14.717 22.315  1.00 84.94  ? 31  C   D OP1   1 
ATOM   8667 O OP2   . C   D 3 31  ? 21.612 -14.111 21.571  1.00 78.34  ? 31  C   D OP2   1 
ATOM   8668 O "O5'" . C   D 3 31  ? 22.823 -12.828 23.314  1.00 76.64  ? 31  C   D "O5'" 1 
ATOM   8669 C "C5'" . C   D 3 31  ? 23.610 -11.664 23.454  1.00 76.39  ? 31  C   D "C5'" 1 
ATOM   8670 C "C4'" . C   D 3 31  ? 22.784 -10.514 23.985  1.00 72.03  ? 31  C   D "C4'" 1 
ATOM   8671 O "O4'" . C   D 3 31  ? 21.957 -9.916  22.952  1.00 71.80  ? 31  C   D "O4'" 1 
ATOM   8672 C "C3'" . C   D 3 31  ? 21.781 -10.893 25.052  1.00 68.42  ? 31  C   D "C3'" 1 
ATOM   8673 O "O3'" . C   D 3 31  ? 22.467 -11.070 26.261  1.00 67.52  ? 31  C   D "O3'" 1 
ATOM   8674 C "C2'" . C   D 3 31  ? 20.882 -9.664  25.057  1.00 65.92  ? 31  C   D "C2'" 1 
ATOM   8675 O "O2'" . C   D 3 31  ? 21.469 -8.552  25.711  1.00 65.83  ? 31  C   D "O2'" 1 
ATOM   8676 C "C1'" . C   D 3 31  ? 20.797 -9.364  23.562  1.00 67.12  ? 31  C   D "C1'" 1 
ATOM   8677 N N1    . C   D 3 31  ? 19.551 -9.845  22.861  1.00 66.43  ? 31  C   D N1    1 
ATOM   8678 C C2    . C   D 3 31  ? 18.345 -9.153  23.044  1.00 63.74  ? 31  C   D C2    1 
ATOM   8679 O O2    . C   D 3 31  ? 18.310 -8.166  23.792  1.00 61.48  ? 31  C   D O2    1 
ATOM   8680 N N3    . C   D 3 31  ? 17.232 -9.585  22.392  1.00 64.39  ? 31  C   D N3    1 
ATOM   8681 C C4    . C   D 3 31  ? 17.290 -10.649 21.591  1.00 67.36  ? 31  C   D C4    1 
ATOM   8682 N N4    . C   D 3 31  ? 16.162 -11.016 20.981  1.00 68.66  ? 31  C   D N4    1 
ATOM   8683 C C5    . C   D 3 31  ? 18.502 -11.374 21.390  1.00 70.07  ? 31  C   D C5    1 
ATOM   8684 C C6    . C   D 3 31  ? 19.593 -10.935 22.033  1.00 69.53  ? 31  C   D C6    1 
ATOM   8685 P P     . A   D 3 32  ? 21.928 -12.191 27.260  1.00 66.89  ? 32  A   D P     1 
ATOM   8686 O OP1   . A   D 3 32  ? 22.994 -12.433 28.252  1.00 68.10  ? 32  A   D OP1   1 
ATOM   8687 O OP2   . A   D 3 32  ? 21.448 -13.332 26.441  1.00 69.16  ? 32  A   D OP2   1 
ATOM   8688 O "O5'" . A   D 3 32  ? 20.690 -11.472 27.983  1.00 62.32  ? 32  A   D "O5'" 1 
ATOM   8689 C "C5'" . A   D 3 32  ? 20.970 -10.312 28.771  1.00 61.07  ? 32  A   D "C5'" 1 
ATOM   8690 C "C4'" . A   D 3 32  ? 19.735 -9.590  29.268  1.00 58.24  ? 32  A   D "C4'" 1 
ATOM   8691 O "O4'" . A   D 3 32  ? 19.056 -8.939  28.175  1.00 56.40  ? 32  A   D "O4'" 1 
ATOM   8692 C "C3'" . A   D 3 32  ? 18.696 -10.485 29.903  1.00 57.81  ? 32  A   D "C3'" 1 
ATOM   8693 O "O3'" . A   D 3 32  ? 18.976 -10.576 31.265  1.00 58.47  ? 32  A   D "O3'" 1 
ATOM   8694 C "C2'" . A   D 3 32  ? 17.411 -9.702  29.718  1.00 56.23  ? 32  A   D "C2'" 1 
ATOM   8695 O "O2'" . A   D 3 32  ? 17.182 -8.811  30.792  1.00 56.61  ? 32  A   D "O2'" 1 
ATOM   8696 C "C1'" . A   D 3 32  ? 17.666 -8.951  28.422  1.00 56.06  ? 32  A   D "C1'" 1 
ATOM   8697 N N9    . A   D 3 32  ? 16.979 -9.558  27.284  1.00 56.71  ? 32  A   D N9    1 
ATOM   8698 C C8    . A   D 3 32  ? 17.409 -10.605 26.520  1.00 58.47  ? 32  A   D C8    1 
ATOM   8699 N N7    . A   D 3 32  ? 16.572 -10.935 25.565  1.00 59.59  ? 32  A   D N7    1 
ATOM   8700 C C5    . A   D 3 32  ? 15.519 -10.044 25.703  1.00 57.91  ? 32  A   D C5    1 
ATOM   8701 C C6    . A   D 3 32  ? 14.306 -9.862  24.987  1.00 58.30  ? 32  A   D C6    1 
ATOM   8702 N N6    . A   D 3 32  ? 13.950 -10.616 23.936  1.00 59.95  ? 32  A   D N6    1 
ATOM   8703 N N1    . A   D 3 32  ? 13.468 -8.869  25.403  1.00 56.72  ? 32  A   D N1    1 
ATOM   8704 C C2    . A   D 3 32  ? 13.828 -8.114  26.454  1.00 54.85  ? 32  A   D C2    1 
ATOM   8705 N N3    . A   D 3 32  ? 14.939 -8.194  27.195  1.00 54.45  ? 32  A   D N3    1 
ATOM   8706 C C4    . A   D 3 32  ? 15.752 -9.185  26.768  1.00 56.11  ? 32  A   D C4    1 
ATOM   8707 P P     . C   D 3 33  ? 18.570 -11.911 32.030  1.00 59.89  ? 33  C   D P     1 
ATOM   8708 O OP1   . C   D 3 33  ? 19.007 -11.753 33.437  1.00 61.55  ? 33  C   D OP1   1 
ATOM   8709 O OP2   . C   D 3 33  ? 19.030 -13.047 31.206  1.00 60.20  ? 33  C   D OP2   1 
ATOM   8710 O "O5'" . C   D 3 33  ? 16.976 -11.920 31.995  1.00 59.65  ? 33  C   D "O5'" 1 
ATOM   8711 C "C5'" . C   D 3 33  ? 16.219 -11.018 32.799  1.00 59.43  ? 33  C   D "C5'" 1 
ATOM   8712 C "C4'" . C   D 3 33  ? 14.756 -11.399 32.716  1.00 59.36  ? 33  C   D "C4'" 1 
ATOM   8713 O "O4'" . C   D 3 33  ? 14.292 -11.143 31.372  1.00 58.19  ? 33  C   D "O4'" 1 
ATOM   8714 C "C3'" . C   D 3 33  ? 14.481 -12.879 32.958  1.00 59.74  ? 33  C   D "C3'" 1 
ATOM   8715 O "O3'" . C   D 3 33  ? 14.268 -13.109 34.339  1.00 61.27  ? 33  C   D "O3'" 1 
ATOM   8716 C "C2'" . C   D 3 33  ? 13.213 -13.119 32.160  1.00 59.66  ? 33  C   D "C2'" 1 
ATOM   8717 O "O2'" . C   D 3 33  ? 12.055 -12.839 32.914  1.00 60.07  ? 33  C   D "O2'" 1 
ATOM   8718 C "C1'" . C   D 3 33  ? 13.349 -12.126 31.006  1.00 58.75  ? 33  C   D "C1'" 1 
ATOM   8719 N N1    . C   D 3 33  ? 13.811 -12.764 29.745  1.00 59.16  ? 33  C   D N1    1 
ATOM   8720 C C2    . C   D 3 33  ? 12.871 -13.394 28.903  1.00 60.56  ? 33  C   D C2    1 
ATOM   8721 O O2    . C   D 3 33  ? 11.669 -13.412 29.211  1.00 61.12  ? 33  C   D O2    1 
ATOM   8722 N N3    . C   D 3 33  ? 13.314 -13.972 27.754  1.00 61.89  ? 33  C   D N3    1 
ATOM   8723 C C4    . C   D 3 33  ? 14.617 -13.935 27.442  1.00 61.99  ? 33  C   D C4    1 
ATOM   8724 N N4    . C   D 3 33  ? 14.996 -14.517 26.301  1.00 64.37  ? 33  C   D N4    1 
ATOM   8725 C C5    . C   D 3 33  ? 15.589 -13.304 28.284  1.00 60.52  ? 33  C   D C5    1 
ATOM   8726 C C6    . C   D 3 33  ? 15.144 -12.737 29.414  1.00 59.09  ? 33  C   D C6    1 
ATOM   8727 P P     . C   D 3 34  ? 15.332 -13.914 35.229  1.00 63.28  ? 34  C   D P     1 
ATOM   8728 O OP1   . C   D 3 34  ? 14.816 -13.986 36.622  1.00 64.91  ? 34  C   D OP1   1 
ATOM   8729 O OP2   . C   D 3 34  ? 16.685 -13.345 35.000  1.00 62.46  ? 34  C   D OP2   1 
ATOM   8730 O "O5'" . C   D 3 34  ? 15.223 -15.365 34.556  1.00 63.54  ? 34  C   D "O5'" 1 
ATOM   8731 C "C5'" . C   D 3 34  ? 14.420 -16.368 35.144  1.00 64.38  ? 34  C   D "C5'" 1 
ATOM   8732 C "C4'" . C   D 3 34  ? 15.162 -17.690 35.095  1.00 66.27  ? 34  C   D "C4'" 1 
ATOM   8733 O "O4'" . C   D 3 34  ? 15.065 -18.198 33.741  1.00 66.40  ? 34  C   D "O4'" 1 
ATOM   8734 C "C3'" . C   D 3 34  ? 16.669 -17.663 35.333  1.00 67.08  ? 34  C   D "C3'" 1 
ATOM   8735 O "O3'" . C   D 3 34  ? 17.012 -17.644 36.721  1.00 69.52  ? 34  C   D "O3'" 1 
ATOM   8736 C "C2'" . C   D 3 34  ? 17.037 -18.987 34.677  1.00 67.88  ? 34  C   D "C2'" 1 
ATOM   8737 O "O2'" . C   D 3 34  ? 16.609 -20.112 35.421  1.00 69.04  ? 34  C   D "O2'" 1 
ATOM   8738 C "C1'" . C   D 3 34  ? 16.253 -18.875 33.385  1.00 66.20  ? 34  C   D "C1'" 1 
ATOM   8739 N N1    . C   D 3 34  ? 17.015 -18.141 32.322  1.00 65.53  ? 34  C   D N1    1 
ATOM   8740 C C2    . C   D 3 34  ? 18.006 -18.824 31.594  1.00 68.02  ? 34  C   D C2    1 
ATOM   8741 O O2    . C   D 3 34  ? 18.242 -20.023 31.823  1.00 69.31  ? 34  C   D O2    1 
ATOM   8742 N N3    . C   D 3 34  ? 18.690 -18.149 30.636  1.00 67.89  ? 34  C   D N3    1 
ATOM   8743 C C4    . C   D 3 34  ? 18.424 -16.871 30.405  1.00 65.26  ? 34  C   D C4    1 
ATOM   8744 N N4    . C   D 3 34  ? 19.132 -16.267 29.461  1.00 66.36  ? 34  C   D N4    1 
ATOM   8745 C C5    . C   D 3 34  ? 17.430 -16.158 31.128  1.00 63.38  ? 34  C   D C5    1 
ATOM   8746 C C6    . C   D 3 34  ? 16.759 -16.823 32.065  1.00 63.42  ? 34  C   D C6    1 
ATOM   8747 P P     . A   D 3 35  ? 18.522 -17.379 37.221  1.00 70.96  ? 35  A   D P     1 
ATOM   8748 O OP1   . A   D 3 35  ? 18.632 -17.887 38.617  1.00 71.22  ? 35  A   D OP1   1 
ATOM   8749 O OP2   . A   D 3 35  ? 18.805 -15.951 36.911  1.00 70.70  ? 35  A   D OP2   1 
ATOM   8750 O "O5'" . A   D 3 35  ? 19.435 -18.319 36.287  1.00 70.51  ? 35  A   D "O5'" 1 
ATOM   8751 C "C5'" . A   D 3 35  ? 19.704 -19.683 36.636  1.00 70.28  ? 35  A   D "C5'" 1 
ATOM   8752 C "C4'" . A   D 3 35  ? 20.845 -20.270 35.824  1.00 70.90  ? 35  A   D "C4'" 1 
ATOM   8753 O "O4'" . A   D 3 35  ? 20.527 -20.166 34.418  1.00 70.50  ? 35  A   D "O4'" 1 
ATOM   8754 C "C3'" . A   D 3 35  ? 22.182 -19.561 35.947  1.00 71.61  ? 35  A   D "C3'" 1 
ATOM   8755 O "O3'" . A   D 3 35  ? 22.867 -20.030 37.085  1.00 72.33  ? 35  A   D "O3'" 1 
ATOM   8756 C "C2'" . A   D 3 35  ? 22.843 -19.959 34.633  1.00 73.33  ? 35  A   D "C2'" 1 
ATOM   8757 O "O2'" . A   D 3 35  ? 23.251 -21.312 34.595  1.00 75.83  ? 35  A   D "O2'" 1 
ATOM   8758 C "C1'" . A   D 3 35  ? 21.670 -19.784 33.683  1.00 71.25  ? 35  A   D "C1'" 1 
ATOM   8759 N N9    . A   D 3 35  ? 21.442 -18.434 33.171  1.00 69.21  ? 35  A   D N9    1 
ATOM   8760 C C8    . A   D 3 35  ? 20.410 -17.594 33.493  1.00 66.43  ? 35  A   D C8    1 
ATOM   8761 N N7    . A   D 3 35  ? 20.434 -16.445 32.870  1.00 65.32  ? 35  A   D N7    1 
ATOM   8762 C C5    . A   D 3 35  ? 21.564 -16.538 32.077  1.00 67.78  ? 35  A   D C5    1 
ATOM   8763 C C6    . A   D 3 35  ? 22.159 -15.644 31.168  1.00 68.51  ? 35  A   D C6    1 
ATOM   8764 N N6    . A   D 3 35  ? 21.654 -14.435 30.916  1.00 66.18  ? 35  A   D N6    1 
ATOM   8765 N N1    . A   D 3 35  ? 23.286 -16.040 30.527  1.00 71.92  ? 35  A   D N1    1 
ATOM   8766 C C2    . A   D 3 35  ? 23.791 -17.256 30.782  1.00 74.09  ? 35  A   D C2    1 
ATOM   8767 N N3    . A   D 3 35  ? 23.318 -18.177 31.622  1.00 73.67  ? 35  A   D N3    1 
ATOM   8768 C C4    . A   D 3 35  ? 22.196 -17.757 32.242  1.00 70.36  ? 35  A   D C4    1 
HETATM 8769 S S     . SO4 E 4 .   ? 48.046 32.949  14.812  1.00 53.08  ? 601 SO4 A S     1 
HETATM 8770 O O1    . SO4 E 4 .   ? 49.429 32.484  14.710  1.00 51.44  ? 601 SO4 A O1    1 
HETATM 8771 O O2    . SO4 E 4 .   ? 47.908 33.800  15.996  1.00 53.25  ? 601 SO4 A O2    1 
HETATM 8772 O O3    . SO4 E 4 .   ? 47.763 33.714  13.604  1.00 54.86  ? 601 SO4 A O3    1 
HETATM 8773 O O4    . SO4 E 4 .   ? 47.065 31.872  14.899  1.00 52.27  ? 601 SO4 A O4    1 
HETATM 8774 S S     . SO4 F 4 .   ? 47.391 57.668  8.178   1.00 97.41  ? 602 SO4 A S     1 
HETATM 8775 O O1    . SO4 F 4 .   ? 47.706 56.323  7.733   1.00 97.73  ? 602 SO4 A O1    1 
HETATM 8776 O O2    . SO4 F 4 .   ? 45.984 57.902  7.872   1.00 97.44  ? 602 SO4 A O2    1 
HETATM 8777 O O3    . SO4 F 4 .   ? 47.616 57.778  9.615   1.00 97.77  ? 602 SO4 A O3    1 
HETATM 8778 O O4    . SO4 F 4 .   ? 48.251 58.631  7.484   1.00 97.73  ? 602 SO4 A O4    1 
HETATM 8779 C C1    . EDO G 5 .   ? 67.206 62.336  -10.297 1.00 42.50  ? 801 EDO A C1    1 
HETATM 8780 O O1    . EDO G 5 .   ? 67.977 62.597  -11.478 1.00 43.75  ? 801 EDO A O1    1 
HETATM 8781 C C2    . EDO G 5 .   ? 66.194 63.445  -10.092 1.00 41.34  ? 801 EDO A C2    1 
HETATM 8782 O O2    . EDO G 5 .   ? 64.904 62.844  -9.920  1.00 40.88  ? 801 EDO A O2    1 
HETATM 8783 S S     . SO4 H 4 .   ? 18.258 6.479   16.116  1.00 90.11  ? 603 SO4 B S     1 
HETATM 8784 O O1    . SO4 H 4 .   ? 19.047 6.377   14.887  1.00 89.62  ? 603 SO4 B O1    1 
HETATM 8785 O O2    . SO4 H 4 .   ? 16.953 7.081   15.839  1.00 89.16  ? 603 SO4 B O2    1 
HETATM 8786 O O3    . SO4 H 4 .   ? 18.099 5.143   16.690  1.00 90.49  ? 603 SO4 B O3    1 
HETATM 8787 O O4    . SO4 H 4 .   ? 18.956 7.320   17.086  1.00 90.16  ? 603 SO4 B O4    1 
HETATM 8788 P P1    . POP I 6 .   ? 22.226 -16.297 41.886  1.00 98.37  ? 702 POP B P1    1 
HETATM 8789 O O1    . POP I 6 .   ? 21.873 -14.978 41.245  1.00 98.44  ? 702 POP B O1    1 
HETATM 8790 O O2    . POP I 6 .   ? 23.724 -16.458 41.865  1.00 98.42  ? 702 POP B O2    1 
HETATM 8791 O O3    . POP I 6 .   ? 21.760 -16.287 43.328  1.00 97.88  ? 702 POP B O3    1 
HETATM 8792 O O     . POP I 6 .   ? 21.509 -17.490 41.045  1.00 98.59  ? 702 POP B O     1 
HETATM 8793 P P2    . POP I 6 .   ? 21.929 -18.036 39.567  1.00 98.96  ? 702 POP B P2    1 
HETATM 8794 O O4    . POP I 6 .   ? 23.433 -18.175 39.456  1.00 99.16  ? 702 POP B O4    1 
HETATM 8795 O O5    . POP I 6 .   ? 21.290 -19.387 39.353  1.00 98.47  ? 702 POP B O5    1 
HETATM 8796 O O6    . POP I 6 .   ? 21.463 -17.107 38.473  1.00 98.70  ? 702 POP B O6    1 
HETATM 8797 P P1    . POP J 6 .   ? 42.790 58.287  -7.328  1.00 64.41  ? 701 POP C P1    1 
HETATM 8798 O O1    . POP J 6 .   ? 42.030 57.252  -8.109  1.00 64.70  ? 701 POP C O1    1 
HETATM 8799 O O2    . POP J 6 .   ? 42.122 59.622  -7.596  1.00 64.55  ? 701 POP C O2    1 
HETATM 8800 O O3    . POP J 6 .   ? 42.639 57.952  -5.860  1.00 64.40  ? 701 POP C O3    1 
HETATM 8801 O O     . POP J 6 .   ? 44.369 58.316  -7.766  1.00 64.54  ? 701 POP C O     1 
HETATM 8802 P P2    . POP J 6 .   ? 45.272 57.263  -8.649  1.00 64.52  ? 701 POP C P2    1 
HETATM 8803 O O4    . POP J 6 .   ? 46.497 58.034  -9.074  1.00 63.82  ? 701 POP C O4    1 
HETATM 8804 O O5    . POP J 6 .   ? 45.701 56.035  -7.879  1.00 65.32  ? 701 POP C O5    1 
HETATM 8805 O O6    . POP J 6 .   ? 44.576 56.711  -9.858  1.00 64.28  ? 701 POP C O6    1 
HETATM 8806 O O     . HOH K 7 .   ? 62.439 75.333  -7.082  1.00 22.03  ? 442 HOH A O     1 
HETATM 8807 O O     . HOH K 7 .   ? 55.031 64.654  -17.370 1.00 19.85  ? 443 HOH A O     1 
HETATM 8808 O O     . HOH K 7 .   ? 67.662 68.936  -5.418  1.00 15.00  ? 444 HOH A O     1 
HETATM 8809 O O     . HOH K 7 .   ? 44.197 53.913  -5.831  1.00 16.91  ? 445 HOH A O     1 
HETATM 8810 O O     . HOH K 7 .   ? 63.312 78.353  -5.799  1.00 30.89  ? 446 HOH A O     1 
HETATM 8811 O O     . HOH K 7 .   ? 57.927 76.306  -1.223  1.00 35.32  ? 447 HOH A O     1 
HETATM 8812 O O     . HOH K 7 .   ? 34.123 69.888  -8.340  1.00 34.98  ? 448 HOH A O     1 
HETATM 8813 O O     . HOH K 7 .   ? 53.418 54.480  11.778  1.00 29.91  ? 449 HOH A O     1 
HETATM 8814 O O     . HOH K 7 .   ? 33.307 41.864  10.659  1.00 25.01  ? 450 HOH A O     1 
HETATM 8815 O O     . HOH K 7 .   ? 36.583 46.462  4.971   1.00 28.18  ? 451 HOH A O     1 
HETATM 8816 O O     . HOH K 7 .   ? 34.691 46.429  11.280  1.00 20.83  ? 452 HOH A O     1 
HETATM 8817 O O     . HOH K 7 .   ? 42.178 41.659  1.976   1.00 20.70  ? 453 HOH A O     1 
HETATM 8818 O O     . HOH K 7 .   ? 40.108 59.943  13.648  1.00 35.19  ? 454 HOH A O     1 
HETATM 8819 O O     . HOH K 7 .   ? 43.968 53.661  5.183   1.00 25.49  ? 455 HOH A O     1 
HETATM 8820 O O     . HOH K 7 .   ? 49.261 59.779  9.799   1.00 34.39  ? 456 HOH A O     1 
HETATM 8821 O O     . HOH K 7 .   ? 31.735 59.211  14.863  1.00 27.06  ? 457 HOH A O     1 
HETATM 8822 O O     . HOH K 7 .   ? 52.785 47.931  -24.290 1.00 29.62  ? 458 HOH A O     1 
HETATM 8823 O O     . HOH K 7 .   ? 37.428 37.009  3.290   1.00 30.96  ? 459 HOH A O     1 
HETATM 8824 O O     . HOH K 7 .   ? 59.530 45.861  -3.391  1.00 29.68  ? 460 HOH A O     1 
HETATM 8825 O O     . HOH K 7 .   ? 45.639 51.394  26.046  1.00 29.78  ? 461 HOH A O     1 
HETATM 8826 O O     . HOH K 7 .   ? 14.111 37.436  23.637  1.00 33.41  ? 462 HOH A O     1 
HETATM 8827 O O     . HOH K 7 .   ? 49.271 54.634  23.575  1.00 13.48  ? 463 HOH A O     1 
HETATM 8828 O O     . HOH K 7 .   ? 32.940 39.222  12.568  1.00 23.30  ? 464 HOH A O     1 
HETATM 8829 O O     . HOH K 7 .   ? 54.976 71.906  6.570   1.00 42.89  ? 465 HOH A O     1 
HETATM 8830 O O     . HOH K 7 .   ? 30.208 59.160  -6.155  1.00 30.75  ? 466 HOH A O     1 
HETATM 8831 O O     . HOH K 7 .   ? 40.596 37.697  1.714   1.00 22.84  ? 467 HOH A O     1 
HETATM 8832 O O     . HOH K 7 .   ? 55.305 40.886  -8.212  1.00 23.63  ? 468 HOH A O     1 
HETATM 8833 O O     . HOH K 7 .   ? 43.860 48.429  32.246  1.00 21.54  ? 469 HOH A O     1 
HETATM 8834 O O     . HOH K 7 .   ? 37.873 52.969  11.930  1.00 28.00  ? 470 HOH A O     1 
HETATM 8835 O O     . HOH K 7 .   ? 49.417 76.161  -0.641  1.00 54.95  ? 471 HOH A O     1 
HETATM 8836 O O     . HOH K 7 .   ? 24.803 53.140  -2.924  1.00 34.79  ? 472 HOH A O     1 
HETATM 8837 O O     . HOH K 7 .   ? 29.847 55.109  14.744  1.00 48.60  ? 473 HOH A O     1 
HETATM 8838 O O     . HOH K 7 .   ? 20.936 40.814  -19.062 1.00 42.61  ? 474 HOH A O     1 
HETATM 8839 O O     . HOH K 7 .   ? 44.502 32.824  14.383  1.00 28.38  ? 475 HOH A O     1 
HETATM 8840 O O     . HOH K 7 .   ? 52.564 40.814  31.231  1.00 36.55  ? 476 HOH A O     1 
HETATM 8841 O O     . HOH K 7 .   ? 42.910 30.417  26.099  1.00 21.87  ? 477 HOH A O     1 
HETATM 8842 O O     . HOH K 7 .   ? 36.216 58.984  21.118  1.00 41.49  ? 478 HOH A O     1 
HETATM 8843 O O     . HOH K 7 .   ? 53.223 48.759  26.264  1.00 16.51  ? 479 HOH A O     1 
HETATM 8844 O O     . HOH K 7 .   ? 53.279 48.256  29.140  1.00 42.70  ? 480 HOH A O     1 
HETATM 8845 O O     . HOH K 7 .   ? 17.751 47.850  5.791   1.00 24.41  ? 481 HOH A O     1 
HETATM 8846 O O     . HOH K 7 .   ? 37.730 6.369   22.680  1.00 29.00  ? 482 HOH A O     1 
HETATM 8847 O O     . HOH K 7 .   ? 39.737 45.245  -25.237 1.00 29.64  ? 483 HOH A O     1 
HETATM 8848 O O     . HOH K 7 .   ? 36.541 45.019  -25.183 1.00 44.15  ? 484 HOH A O     1 
HETATM 8849 O O     . HOH K 7 .   ? 40.765 50.907  -24.964 1.00 37.34  ? 485 HOH A O     1 
HETATM 8850 O O     . HOH K 7 .   ? 38.148 28.457  -4.569  1.00 36.39  ? 486 HOH A O     1 
HETATM 8851 O O     . HOH K 7 .   ? 41.220 27.737  -17.092 1.00 30.71  ? 487 HOH A O     1 
HETATM 8852 O O     . HOH K 7 .   ? 45.755 46.771  31.738  1.00 17.68  ? 488 HOH A O     1 
HETATM 8853 O O     . HOH K 7 .   ? 53.101 50.602  -7.931  1.00 29.26  ? 489 HOH A O     1 
HETATM 8854 O O     . HOH K 7 .   ? 46.207 61.375  -6.728  1.00 24.87  ? 490 HOH A O     1 
HETATM 8855 O O     . HOH K 7 .   ? 39.174 59.373  -4.777  1.00 24.54  ? 491 HOH A O     1 
HETATM 8856 O O     . HOH K 7 .   ? 55.709 43.753  -5.615  1.00 15.67  ? 492 HOH A O     1 
HETATM 8857 O O     . HOH K 7 .   ? 49.707 46.894  -9.525  1.00 20.27  ? 493 HOH A O     1 
HETATM 8858 O O     . HOH K 7 .   ? 53.971 46.725  -5.159  1.00 14.35  ? 494 HOH A O     1 
HETATM 8859 O O     . HOH K 7 .   ? 57.485 49.037  7.338   1.00 38.75  ? 495 HOH A O     1 
HETATM 8860 O O     . HOH K 7 .   ? 69.645 69.921  -15.798 1.00 25.07  ? 496 HOH A O     1 
HETATM 8861 O O     . HOH K 7 .   ? 45.468 45.277  -4.425  1.00 13.51  ? 497 HOH A O     1 
HETATM 8862 O O     . HOH K 7 .   ? 64.193 69.821  -14.500 1.00 44.30  ? 498 HOH A O     1 
HETATM 8863 O O     . HOH K 7 .   ? 14.674 63.055  -14.829 1.00 58.55  ? 499 HOH A O     1 
HETATM 8864 O O     . HOH K 7 .   ? 30.754 43.855  10.616  1.00 33.44  ? 500 HOH A O     1 
HETATM 8865 O O     . HOH K 7 .   ? 43.795 56.779  1.256   1.00 25.63  ? 501 HOH A O     1 
HETATM 8866 O O     . HOH K 7 .   ? 33.669 55.128  1.683   1.00 29.73  ? 502 HOH A O     1 
HETATM 8867 O O     . HOH K 7 .   ? 64.007 45.271  -3.682  1.00 38.16  ? 503 HOH A O     1 
HETATM 8868 O O     . HOH K 7 .   ? 50.187 45.065  -23.345 1.00 25.60  ? 504 HOH A O     1 
HETATM 8869 O O     . HOH K 7 .   ? 69.811 51.761  2.014   1.00 34.96  ? 505 HOH A O     1 
HETATM 8870 O O     . HOH K 7 .   ? 57.069 54.994  -27.866 1.00 51.82  ? 506 HOH A O     1 
HETATM 8871 O O     . HOH K 7 .   ? 52.049 50.518  -25.553 1.00 31.81  ? 507 HOH A O     1 
HETATM 8872 O O     . HOH K 7 .   ? 27.912 47.619  -0.379  1.00 35.38  ? 508 HOH A O     1 
HETATM 8873 O O     . HOH K 7 .   ? 35.035 53.486  -0.520  1.00 43.30  ? 509 HOH A O     1 
HETATM 8874 O O     . HOH K 7 .   ? 13.646 56.345  24.567  1.00 52.14  ? 510 HOH A O     1 
HETATM 8875 O O     . HOH K 7 .   ? 71.965 50.060  -2.559  1.00 43.10  ? 511 HOH A O     1 
HETATM 8876 O O     . HOH K 7 .   ? 61.167 53.287  -15.068 1.00 33.86  ? 512 HOH A O     1 
HETATM 8877 O O     . HOH K 7 .   ? 33.884 56.785  5.871   1.00 38.77  ? 513 HOH A O     1 
HETATM 8878 O O     . HOH K 7 .   ? 46.796 55.576  4.440   1.00 27.52  ? 515 HOH A O     1 
HETATM 8879 O O     . HOH K 7 .   ? 17.204 57.303  -9.932  1.00 40.67  ? 516 HOH A O     1 
HETATM 8880 O O     . HOH K 7 .   ? 73.094 60.532  -3.037  1.00 33.11  ? 517 HOH A O     1 
HETATM 8881 O O     . HOH K 7 .   ? 27.922 57.034  -20.488 1.00 31.76  ? 518 HOH A O     1 
HETATM 8882 O O     . HOH K 7 .   ? 36.321 42.233  4.370   1.00 27.74  ? 519 HOH A O     1 
HETATM 8883 O O     . HOH K 7 .   ? 13.385 54.519  21.101  1.00 45.18  ? 520 HOH A O     1 
HETATM 8884 O O     . HOH K 7 .   ? 60.583 47.265  -0.757  1.00 28.25  ? 521 HOH A O     1 
HETATM 8885 O O     . HOH K 7 .   ? 14.193 47.584  -14.902 1.00 36.03  ? 522 HOH A O     1 
HETATM 8886 O O     . HOH K 7 .   ? 24.420 38.115  32.125  1.00 31.91  ? 523 HOH A O     1 
HETATM 8887 O O     . HOH K 7 .   ? 28.306 56.300  16.637  1.00 37.35  ? 524 HOH A O     1 
HETATM 8888 O O     . HOH K 7 .   ? 36.915 31.696  39.581  1.00 29.46  ? 525 HOH A O     1 
HETATM 8889 O O     . HOH K 7 .   ? 36.476 23.643  27.478  1.00 39.78  ? 526 HOH A O     1 
HETATM 8890 O O     . HOH K 7 .   ? 52.710 43.371  21.074  1.00 34.62  ? 527 HOH A O     1 
HETATM 8891 O O     . HOH K 7 .   ? 38.245 26.865  30.350  1.00 29.78  ? 528 HOH A O     1 
HETATM 8892 O O     . HOH K 7 .   ? 32.188 6.096   20.826  1.00 33.91  ? 529 HOH A O     1 
HETATM 8893 O O     . HOH K 7 .   ? 27.102 30.284  35.686  1.00 41.78  ? 530 HOH A O     1 
HETATM 8894 O O     . HOH K 7 .   ? 67.880 59.663  -12.918 1.00 35.09  ? 531 HOH A O     1 
HETATM 8895 O O     . HOH K 7 .   ? 37.145 30.342  -0.888  1.00 31.07  ? 532 HOH A O     1 
HETATM 8896 O O     . HOH K 7 .   ? 16.324 66.851  -16.216 1.00 38.20  ? 533 HOH A O     1 
HETATM 8897 O O     . HOH K 7 .   ? 49.030 60.784  -23.481 1.00 50.03  ? 534 HOH A O     1 
HETATM 8898 O O     . HOH K 7 .   ? 61.889 65.905  -16.724 1.00 21.80  ? 535 HOH A O     1 
HETATM 8899 O O     . HOH K 7 .   ? 49.563 38.521  -19.667 1.00 40.35  ? 536 HOH A O     1 
HETATM 8900 O O     . HOH K 7 .   ? 35.525 33.005  -14.588 1.00 36.38  ? 537 HOH A O     1 
HETATM 8901 O O     . HOH K 7 .   ? 47.562 33.897  -12.514 1.00 30.19  ? 538 HOH A O     1 
HETATM 8902 O O     . HOH K 7 .   ? 21.259 49.271  29.203  1.00 31.85  ? 539 HOH A O     1 
HETATM 8903 O O     . HOH K 7 .   ? 44.228 33.673  30.021  1.00 34.61  ? 540 HOH A O     1 
HETATM 8904 O O     . HOH K 7 .   ? 38.633 21.379  45.440  1.00 30.83  ? 541 HOH A O     1 
HETATM 8905 O O     . HOH K 7 .   ? 52.259 63.858  10.609  1.00 49.12  ? 542 HOH A O     1 
HETATM 8906 O O     . HOH K 7 .   ? 43.037 56.017  -11.645 1.00 23.24  ? 543 HOH A O     1 
HETATM 8907 O O     . HOH L 7 .   ? 17.554 34.475  25.148  1.00 19.56  ? 438 HOH B O     1 
HETATM 8908 O O     . HOH L 7 .   ? 28.004 42.058  4.381   1.00 36.30  ? 439 HOH B O     1 
HETATM 8909 O O     . HOH L 7 .   ? 20.938 50.060  5.852   1.00 18.12  ? 440 HOH B O     1 
HETATM 8910 O O     . HOH L 7 .   ? 32.795 20.804  27.691  1.00 53.51  ? 441 HOH B O     1 
HETATM 8911 O O     . HOH L 7 .   ? 33.369 27.932  1.940   1.00 31.15  ? 442 HOH B O     1 
HETATM 8912 O O     . HOH L 7 .   ? 5.218  38.490  5.100   1.00 25.44  ? 443 HOH B O     1 
HETATM 8913 O O     . HOH L 7 .   ? 32.540 28.978  4.185   1.00 24.18  ? 444 HOH B O     1 
HETATM 8914 O O     . HOH L 7 .   ? 14.255 40.652  5.824   1.00 30.23  ? 445 HOH B O     1 
HETATM 8915 O O     . HOH L 7 .   ? 27.302 -12.846 21.778  1.00 37.85  ? 447 HOH B O     1 
HETATM 8916 O O     . HOH L 7 .   ? 28.725 1.554   29.214  1.00 46.05  ? 448 HOH B O     1 
HETATM 8917 O O     . HOH L 7 .   ? 16.206 26.447  54.065  1.00 33.37  ? 449 HOH B O     1 
HETATM 8918 O O     . HOH L 7 .   ? 1.515  16.068  25.383  1.00 27.50  ? 450 HOH B O     1 
HETATM 8919 O O     . HOH L 7 .   ? 9.288  -24.993 12.522  1.00 32.56  ? 451 HOH B O     1 
HETATM 8920 O O     . HOH L 7 .   ? 13.043 32.865  6.854   1.00 37.04  ? 452 HOH B O     1 
HETATM 8921 O O     . HOH L 7 .   ? 27.375 20.267  19.005  1.00 32.27  ? 453 HOH B O     1 
HETATM 8922 O O     . HOH L 7 .   ? 45.130 -4.582  15.305  1.00 51.30  ? 454 HOH B O     1 
HETATM 8923 O O     . HOH L 7 .   ? 17.423 -33.607 39.750  1.00 39.97  ? 455 HOH B O     1 
HETATM 8924 O O     . HOH L 7 .   ? 15.179 -5.568  36.690  1.00 54.12  ? 456 HOH B O     1 
HETATM 8925 O O     . HOH L 7 .   ? 36.770 -32.150 30.282  1.00 46.93  ? 457 HOH B O     1 
HETATM 8926 O O     . HOH L 7 .   ? 27.604 30.613  13.217  1.00 30.67  ? 458 HOH B O     1 
HETATM 8927 O O     . HOH L 7 .   ? 41.459 29.498  6.298   1.00 37.99  ? 459 HOH B O     1 
HETATM 8928 O O     . HOH L 7 .   ? 28.168 23.949  21.607  1.00 38.10  ? 460 HOH B O     1 
HETATM 8929 O O     . HOH L 7 .   ? 19.674 38.604  8.895   1.00 41.47  ? 461 HOH B O     1 
HETATM 8930 O O     . HOH L 7 .   ? 27.321 9.638   47.996  1.00 35.52  ? 462 HOH B O     1 
HETATM 8931 O O     . HOH L 7 .   ? 16.624 19.811  16.172  1.00 45.09  ? 463 HOH B O     1 
HETATM 8932 O O     . HOH L 7 .   ? 4.618  -36.982 52.159  1.00 50.27  ? 514 HOH B O     1 
HETATM 8933 O O     . HOH M 7 .   ? 50.566 39.560  -6.368  1.00 35.34  ? 36  HOH C O     1 
HETATM 8934 O O     . HOH M 7 .   ? 50.460 55.284  -12.803 1.00 29.95  ? 37  HOH C O     1 
HETATM 8935 O O     . HOH M 7 .   ? 50.352 55.722  5.251   1.00 31.28  ? 38  HOH C O     1 
HETATM 8936 O O     . HOH M 7 .   ? 51.564 36.802  24.270  1.00 31.02  ? 41  HOH C O     1 
HETATM 8937 O O     . HOH M 7 .   ? 53.464 45.698  -2.576  1.00 21.37  ? 64  HOH C O     1 
HETATM 8938 O O     . HOH M 7 .   ? 50.936 49.505  -2.078  1.00 16.99  ? 68  HOH C O     1 
HETATM 8939 O O     . HOH M 7 .   ? 59.683 41.245  3.047   1.00 27.87  ? 84  HOH C O     1 
HETATM 8940 O O     . HOH M 7 .   ? 45.679 9.513   27.226  1.00 42.04  ? 106 HOH C O     1 
HETATM 8941 O O     . HOH N 7 .   ? 29.109 -3.206  14.761  1.00 40.50  ? 135 HOH D O     1 
HETATM 8942 O O     . HOH N 7 .   ? 23.250 16.881  -1.245  1.00 97.80  ? 446 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.7749 1.3122 1.1117 0.1944  -0.1544 0.1596  1   MET A N     
2    C CA    . MET A 1   ? 0.7851 1.2437 1.0639 0.1946  -0.1507 0.1629  1   MET A CA    
3    C C     . MET A 1   ? 0.7698 1.2138 1.0133 0.1600  -0.1647 0.1512  1   MET A C     
4    O O     . MET A 1   ? 0.7474 1.1805 0.9876 0.1300  -0.1566 0.1334  1   MET A O     
5    C CB    . MET A 1   ? 0.7822 1.1762 1.0459 0.1978  -0.1208 0.1562  1   MET A CB    
6    C CG    . MET A 1   ? 0.8122 1.1898 1.0884 0.2371  -0.1052 0.1703  1   MET A CG    
7    S SD    . MET A 1   ? 0.8208 1.1069 1.0608 0.2391  -0.0740 0.1629  1   MET A SD    
8    C CE    . MET A 1   ? 0.8326 1.0598 1.0147 0.2323  -0.0847 0.1697  1   MET A CE    
9    N N     . LYS A 2   ? 0.7831 1.2253 0.9986 0.1652  -0.1846 0.1618  2   LYS A N     
10   C CA    . LYS A 2   ? 0.7725 1.1953 0.9500 0.1354  -0.1959 0.1511  2   LYS A CA    
11   C C     . LYS A 2   ? 0.7575 1.1034 0.8969 0.1244  -0.1758 0.1428  2   LYS A C     
12   O O     . LYS A 2   ? 0.7642 1.0667 0.8946 0.1439  -0.1588 0.1504  2   LYS A O     
13   C CB    . LYS A 2   ? 0.8032 1.2380 0.9543 0.1455  -0.2197 0.1653  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.8080 1.3223 0.9845 0.1368  -0.2469 0.1640  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.8310 1.3956 1.0365 0.1736  -0.2603 0.1865  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.8519 1.4013 1.0150 0.1919  -0.2776 0.2061  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.8668 1.4522 1.0546 0.2342  -0.2866 0.2319  2   LYS A NZ    
18   N N     . VAL A 3   ? 0.7356 1.0654 0.8534 0.0931  -0.1776 0.1268  3   VAL A N     
19   C CA    . VAL A 3   ? 0.7189 0.9838 0.8045 0.0814  -0.1604 0.1181  3   VAL A CA    
20   C C     . VAL A 3   ? 0.7366 0.9510 0.7851 0.0984  -0.1563 0.1307  3   VAL A C     
21   O O     . VAL A 3   ? 0.7373 0.9023 0.7707 0.0999  -0.1384 0.1283  3   VAL A O     
22   C CB    . VAL A 3   ? 0.7046 0.9629 0.7741 0.0471  -0.1638 0.0999  3   VAL A CB    
23   C CG1   . VAL A 3   ? 0.7250 0.9878 0.7647 0.0384  -0.1827 0.1005  3   VAL A CG1   
24   C CG2   . VAL A 3   ? 0.6895 0.8918 0.7381 0.0368  -0.1447 0.0908  3   VAL A CG2   
25   N N     . GLU A 4   ? 0.7582 0.9867 0.7926 0.1111  -0.1728 0.1446  4   GLU A N     
26   C CA    . GLU A 4   ? 0.7792 0.9602 0.7756 0.1253  -0.1690 0.1579  4   GLU A CA    
27   C C     . GLU A 4   ? 0.7864 0.9483 0.7937 0.1567  -0.1561 0.1738  4   GLU A C     
28   O O     . GLU A 4   ? 0.8071 0.9189 0.7855 0.1676  -0.1459 0.1834  4   GLU A O     
29   C CB    . GLU A 4   ? 0.8110 1.0135 0.7832 0.1271  -0.1915 0.1680  4   GLU A CB    
30   C CG    . GLU A 4   ? 0.8168 1.0433 0.7784 0.0959  -0.2059 0.1508  4   GLU A CG    
31   C CD    . GLU A 4   ? 0.8278 1.1270 0.8257 0.0888  -0.2252 0.1456  4   GLU A CD    
32   O OE1   . GLU A 4   ? 0.8554 1.1846 0.8382 0.0782  -0.2460 0.1439  4   GLU A OE1   
33   O OE2   . GLU A 4   ? 0.8022 1.1300 0.8431 0.0920  -0.2193 0.1422  4   GLU A OE2   
34   N N     . GLU A 5   ? 0.7666 0.9675 0.8160 0.1704  -0.1549 0.1757  5   GLU A N     
35   C CA    . GLU A 5   ? 0.7779 0.9660 0.8423 0.2028  -0.1423 0.1901  5   GLU A CA    
36   C C     . GLU A 5   ? 0.7459 0.8918 0.8141 0.1980  -0.1158 0.1775  5   GLU A C     
37   O O     . GLU A 5   ? 0.7714 0.8694 0.8260 0.2148  -0.0993 0.1845  5   GLU A O     
38   C CB    . GLU A 5   ? 0.7821 1.0399 0.8930 0.2214  -0.1542 0.1983  5   GLU A CB    
39   C CG    . GLU A 5   ? 0.8210 1.0735 0.9530 0.2600  -0.1420 0.2149  5   GLU A CG    
40   C CD    . GLU A 5   ? 0.8107 1.1340 1.0002 0.2721  -0.1454 0.2145  5   GLU A CD    
41   O OE1   . GLU A 5   ? 0.8197 1.2100 1.0311 0.2638  -0.1684 0.2143  5   GLU A OE1   
42   O OE2   . GLU A 5   ? 0.8272 1.1404 1.0403 0.2886  -0.1241 0.2133  5   GLU A OE2   
43   N N     . ILE A 6   ? 0.6904 0.8531 0.7747 0.1742  -0.1119 0.1589  6   ILE A N     
44   C CA    . ILE A 6   ? 0.6574 0.7830 0.7396 0.1647  -0.0895 0.1451  6   ILE A CA    
45   C C     . ILE A 6   ? 0.6582 0.7193 0.6981 0.1559  -0.0802 0.1424  6   ILE A C     
46   O O     . ILE A 6   ? 0.6625 0.6808 0.6934 0.1617  -0.0613 0.1397  6   ILE A O     
47   C CB    . ILE A 6   ? 0.6197 0.7743 0.7193 0.1374  -0.0902 0.1275  6   ILE A CB    
48   C CG1   . ILE A 6   ? 0.6070 0.8249 0.7528 0.1452  -0.0947 0.1291  6   ILE A CG1   
49   C CG2   . ILE A 6   ? 0.6003 0.7158 0.6905 0.1259  -0.0698 0.1142  6   ILE A CG2   
50   C CD1   . ILE A 6   ? 0.5722 0.8350 0.7325 0.1196  -0.1087 0.1192  6   ILE A CD1   
51   N N     . LEU A 7   ? 0.6456 0.7018 0.6599 0.1409  -0.0932 0.1421  7   LEU A N     
52   C CA    . LEU A 7   ? 0.6400 0.6437 0.6176 0.1308  -0.0855 0.1395  7   LEU A CA    
53   C C     . LEU A 7   ? 0.6756 0.6394 0.6345 0.1524  -0.0769 0.1550  7   LEU A C     
54   O O     . LEU A 7   ? 0.6819 0.5983 0.6238 0.1488  -0.0605 0.1505  7   LEU A O     
55   C CB    . LEU A 7   ? 0.6285 0.6403 0.5849 0.1115  -0.1002 0.1357  7   LEU A CB    
56   C CG    . LEU A 7   ? 0.5829 0.6193 0.5512 0.0871  -0.1049 0.1187  7   LEU A CG    
57   C CD1   . LEU A 7   ? 0.5611 0.5946 0.5033 0.0698  -0.1158 0.1142  7   LEU A CD1   
58   C CD2   . LEU A 7   ? 0.5499 0.5604 0.5212 0.0765  -0.0878 0.1056  7   LEU A CD2   
59   N N     . GLU A 8   ? 0.7020 0.6843 0.6634 0.1745  -0.0877 0.1734  8   GLU A N     
60   C CA    . GLU A 8   ? 0.7502 0.6907 0.6944 0.1979  -0.0773 0.1903  8   GLU A CA    
61   C C     . GLU A 8   ? 0.7537 0.6635 0.7111 0.2108  -0.0546 0.1867  8   GLU A C     
62   O O     . GLU A 8   ? 0.7803 0.6339 0.7143 0.2136  -0.0382 0.1890  8   GLU A O     
63   C CB    . GLU A 8   ? 0.7868 0.7548 0.7323 0.2234  -0.0936 0.2133  8   GLU A CB    
64   C CG    . GLU A 8   ? 0.8453 0.7984 0.7505 0.2176  -0.1049 0.2239  8   GLU A CG    
65   C CD    . GLU A 8   ? 0.9238 0.8065 0.7922 0.2221  -0.0866 0.2331  8   GLU A CD    
66   O OE1   . GLU A 8   ? 0.9495 0.7917 0.8221 0.2262  -0.0651 0.2283  8   GLU A OE1   
67   O OE2   . GLU A 8   ? 0.9642 0.8316 0.7981 0.2203  -0.0930 0.2445  8   GLU A OE2   
68   N N     . LYS A 9   ? 0.7299 0.6753 0.7235 0.2168  -0.0524 0.1800  9   LYS A N     
69   C CA    . LYS A 9   ? 0.7317 0.6492 0.7360 0.2246  -0.0293 0.1718  9   LYS A CA    
70   C C     . LYS A 9   ? 0.7064 0.5894 0.6930 0.1965  -0.0169 0.1510  9   LYS A C     
71   O O     . LYS A 9   ? 0.7260 0.5632 0.7012 0.1986  0.0027  0.1451  9   LYS A O     
72   C CB    . LYS A 9   ? 0.7170 0.6849 0.7646 0.2363  -0.0285 0.1687  9   LYS A CB    
73   C CG    . LYS A 9   ? 0.7409 0.7514 0.8151 0.2670  -0.0396 0.1882  9   LYS A CG    
74   C CD    . LYS A 9   ? 0.7600 0.7927 0.8725 0.2858  -0.0248 0.1850  9   LYS A CD    
75   C CE    . LYS A 9   ? 0.7600 0.8702 0.9165 0.3019  -0.0415 0.1951  9   LYS A CE    
76   N NZ    . LYS A 9   ? 0.8002 0.9245 0.9550 0.3298  -0.0578 0.2201  9   LYS A NZ    
77   N N     . ALA A 10  ? 0.6640 0.5693 0.6481 0.1706  -0.0283 0.1399  10  ALA A N     
78   C CA    . ALA A 10  ? 0.6443 0.5238 0.6137 0.1458  -0.0192 0.1219  10  ALA A CA    
79   C C     . ALA A 10  ? 0.6648 0.4923 0.6006 0.1380  -0.0118 0.1222  10  ALA A C     
80   O O     . ALA A 10  ? 0.6609 0.4606 0.5854 0.1229  -0.0005 0.1086  10  ALA A O     
81   C CB    . ALA A 10  ? 0.6041 0.5179 0.5794 0.1231  -0.0324 0.1119  10  ALA A CB    
82   N N     . LEU A 11  ? 0.6894 0.5059 0.6094 0.1479  -0.0181 0.1378  11  LEU A N     
83   C CA    . LEU A 11  ? 0.7135 0.4813 0.6025 0.1406  -0.0092 0.1399  11  LEU A CA    
84   C C     . LEU A 11  ? 0.7498 0.4698 0.6326 0.1501  0.0124  0.1386  11  LEU A C     
85   O O     . LEU A 11  ? 0.7617 0.4433 0.6255 0.1346  0.0240  0.1299  11  LEU A O     
86   C CB    . LEU A 11  ? 0.7365 0.5028 0.6068 0.1501  -0.0197 0.1589  11  LEU A CB    
87   C CG    . LEU A 11  ? 0.7103 0.5149 0.5768 0.1378  -0.0399 0.1590  11  LEU A CG    
88   C CD1   . LEU A 11  ? 0.7293 0.5399 0.5795 0.1538  -0.0517 0.1802  11  LEU A CD1   
89   C CD2   . LEU A 11  ? 0.6907 0.4806 0.5399 0.1110  -0.0372 0.1451  11  LEU A CD2   
90   N N     . GLU A 12  ? 0.7780 0.5010 0.6778 0.1749  0.0184  0.1463  12  GLU A N     
91   C CA    . GLU A 12  ? 0.8208 0.4953 0.7148 0.1852  0.0413  0.1431  12  GLU A CA    
92   C C     . GLU A 12  ? 0.7974 0.4604 0.6920 0.1645  0.0533  0.1190  12  GLU A C     
93   O O     . GLU A 12  ? 0.8315 0.4455 0.7102 0.1606  0.0719  0.1108  12  GLU A O     
94   C CB    . GLU A 12  ? 0.8480 0.5332 0.7640 0.2185  0.0460  0.1554  12  GLU A CB    
95   C CG    . GLU A 12  ? 0.9439 0.6031 0.8471 0.2446  0.0472  0.1798  12  GLU A CG    
96   C CD    . GLU A 12  ? 0.9931 0.7038 0.9060 0.2565  0.0224  0.1982  12  GLU A CD    
97   O OE1   . GLU A 12  ? 0.9983 0.7621 0.9445 0.2710  0.0126  0.2009  12  GLU A OE1   
98   O OE2   . GLU A 12  ? 1.0179 0.7173 0.9049 0.2504  0.0131  0.2093  12  GLU A OE2   
99   N N     . LEU A 13  ? 0.7418 0.4482 0.6528 0.1510  0.0430  0.1077  13  LEU A N     
100  C CA    . LEU A 13  ? 0.7184 0.4179 0.6262 0.1305  0.0512  0.0866  13  LEU A CA    
101  C C     . LEU A 13  ? 0.7068 0.3877 0.5926 0.1041  0.0487  0.0773  13  LEU A C     
102  O O     . LEU A 13  ? 0.7075 0.3760 0.5860 0.0874  0.0560  0.0606  13  LEU A O     
103  C CB    . LEU A 13  ? 0.6804 0.4296 0.6110 0.1254  0.0425  0.0795  13  LEU A CB    
104  C CG    . LEU A 13  ? 0.6696 0.4441 0.6262 0.1425  0.0495  0.0792  13  LEU A CG    
105  C CD1   . LEU A 13  ? 0.7184 0.4548 0.6722 0.1636  0.0696  0.0811  13  LEU A CD1   
106  C CD2   . LEU A 13  ? 0.6447 0.4700 0.6273 0.1547  0.0335  0.0928  13  LEU A CD2   
107  N N     . VAL A 14  ? 0.6946 0.3766 0.5702 0.1001  0.0383  0.0876  14  VAL A N     
108  C CA    . VAL A 14  ? 0.6691 0.3425 0.5292 0.0757  0.0356  0.0789  14  VAL A CA    
109  C C     . VAL A 14  ? 0.6987 0.3331 0.5364 0.0719  0.0428  0.0862  14  VAL A C     
110  O O     . VAL A 14  ? 0.7018 0.3169 0.5284 0.0522  0.0495  0.0750  14  VAL A O     
111  C CB    . VAL A 14  ? 0.6225 0.3386 0.4906 0.0641  0.0178  0.0767  14  VAL A CB    
112  C CG1   . VAL A 14  ? 0.5917 0.3388 0.4788 0.0639  0.0142  0.0685  14  VAL A CG1   
113  C CG2   . VAL A 14  ? 0.6225 0.3583 0.4908 0.0744  0.0047  0.0926  14  VAL A CG2   
114  N N     . ILE A 15  ? 0.7236 0.3475 0.5545 0.0899  0.0419  0.1053  15  ILE A N     
115  C CA    . ILE A 15  ? 0.7613 0.3424 0.5676 0.0865  0.0519  0.1140  15  ILE A CA    
116  C C     . ILE A 15  ? 0.7967 0.3270 0.5938 0.0840  0.0737  0.1059  15  ILE A C     
117  O O     . ILE A 15  ? 0.8149 0.3307 0.6183 0.1027  0.0824  0.1084  15  ILE A O     
118  C CB    . ILE A 15  ? 0.7891 0.3668 0.5848 0.1083  0.0461  0.1391  15  ILE A CB    
119  C CG1   . ILE A 15  ? 0.7728 0.3875 0.5647 0.1017  0.0275  0.1447  15  ILE A CG1   
120  C CG2   . ILE A 15  ? 0.8440 0.3663 0.6128 0.1081  0.0623  0.1492  15  ILE A CG2   
121  C CD1   . ILE A 15  ? 0.7486 0.4171 0.5639 0.0990  0.0107  0.1360  15  ILE A CD1   
122  N N     . PRO A 16  ? 0.5267 0.5186 0.5729 0.0658  -0.0509 -0.0172 16  PRO A N     
123  C CA    . PRO A 16  ? 0.5328 0.5184 0.6003 0.0748  -0.0430 -0.0284 16  PRO A CA    
124  C C     . PRO A 16  ? 0.5609 0.5313 0.6574 0.0878  -0.0603 -0.0196 16  PRO A C     
125  O O     . PRO A 16  ? 0.5721 0.5241 0.6501 0.0870  -0.0764 0.0005  16  PRO A O     
126  C CB    . PRO A 16  ? 0.5271 0.4880 0.5544 0.0680  -0.0353 -0.0240 16  PRO A CB    
127  C CG    . PRO A 16  ? 0.5174 0.4791 0.5066 0.0555  -0.0347 -0.0157 16  PRO A CG    
128  C CD    . PRO A 16  ? 0.5205 0.4918 0.5178 0.0557  -0.0493 -0.0073 16  PRO A CD    
129  N N     . ASP A 17  ? 0.5795 0.5590 0.7223 0.0995  -0.0578 -0.0350 17  ASP A N     
130  C CA    . ASP A 17  ? 0.6155 0.5781 0.7938 0.1129  -0.0758 -0.0268 17  ASP A CA    
131  C C     . ASP A 17  ? 0.6302 0.5579 0.7954 0.1138  -0.0766 -0.0198 17  ASP A C     
132  O O     . ASP A 17  ? 0.6215 0.5428 0.7558 0.1057  -0.0617 -0.0255 17  ASP A O     
133  C CB    . ASP A 17  ? 0.6223 0.6100 0.8628 0.1264  -0.0732 -0.0494 17  ASP A CB    
134  C CG    . ASP A 17  ? 0.6351 0.6338 0.8851 0.1279  -0.0512 -0.0775 17  ASP A CG    
135  O OD1   . ASP A 17  ? 0.6476 0.6486 0.8546 0.1151  -0.0358 -0.0804 17  ASP A OD1   
136  O OD2   . ASP A 17  ? 0.6483 0.6535 0.9485 0.1418  -0.0506 -0.0973 17  ASP A OD2   
137  N N     . GLU A 18  ? 0.6595 0.5658 0.8521 0.1233  -0.0950 -0.0064 18  GLU A N     
138  C CA    . GLU A 18  ? 0.6807 0.5516 0.8606 0.1219  -0.1005 0.0089  18  GLU A CA    
139  C C     . GLU A 18  ? 0.6682 0.5305 0.8520 0.1216  -0.0840 -0.0107 18  GLU A C     
140  O O     . GLU A 18  ? 0.6631 0.5080 0.8097 0.1118  -0.0778 -0.0016 18  GLU A O     
141  C CB    . GLU A 18  ? 0.7137 0.5653 0.9305 0.1318  -0.1261 0.0289  18  GLU A CB    
142  C CG    . GLU A 18  ? 0.7623 0.6139 0.9564 0.1275  -0.1458 0.0576  18  GLU A CG    
143  C CD    . GLU A 18  ? 0.8144 0.6596 0.9384 0.1116  -0.1398 0.0739  18  GLU A CD    
144  O OE1   . GLU A 18  ? 0.8414 0.6650 0.9405 0.1052  -0.1353 0.0849  18  GLU A OE1   
145  O OE2   . GLU A 18  ? 0.8092 0.6722 0.9064 0.1057  -0.1396 0.0744  18  GLU A OE2   
146  N N     . GLU A 19  ? 0.6678 0.5444 0.8973 0.1322  -0.0772 -0.0389 19  GLU A N     
147  C CA    . GLU A 19  ? 0.6709 0.5415 0.9095 0.1333  -0.0637 -0.0620 19  GLU A CA    
148  C C     . GLU A 19  ? 0.6510 0.5262 0.8360 0.1184  -0.0453 -0.0653 19  GLU A C     
149  O O     . GLU A 19  ? 0.6556 0.5124 0.8302 0.1144  -0.0403 -0.0684 19  GLU A O     
150  C CB    . GLU A 19  ? 0.6723 0.5705 0.9618 0.1461  -0.0554 -0.0975 19  GLU A CB    
151  C CG    . GLU A 19  ? 0.6891 0.5989 0.9750 0.1440  -0.0348 -0.1295 19  GLU A CG    
152  C CD    . GLU A 19  ? 0.7345 0.6145 1.0508 0.1515  -0.0407 -0.1408 19  GLU A CD    
153  O OE1   . GLU A 19  ? 0.7448 0.6147 1.0335 0.1426  -0.0308 -0.1476 19  GLU A OE1   
154  O OE2   . GLU A 19  ? 0.7373 0.6037 1.1078 0.1660  -0.0565 -0.1429 19  GLU A OE2   
155  N N     . GLU A 20  ? 0.6348 0.5340 0.7893 0.1100  -0.0371 -0.0635 20  GLU A N     
156  C CA    . GLU A 20  ? 0.6192 0.5256 0.7269 0.0961  -0.0214 -0.0661 20  GLU A CA    
157  C C     . GLU A 20  ? 0.6156 0.4975 0.6791 0.0862  -0.0270 -0.0393 20  GLU A C     
158  O O     . GLU A 20  ? 0.6082 0.4849 0.6398 0.0767  -0.0169 -0.0397 20  GLU A O     
159  C CB    . GLU A 20  ? 0.6022 0.5445 0.7021 0.0909  -0.0122 -0.0745 20  GLU A CB    
160  C CG    . GLU A 20  ? 0.5958 0.5479 0.6527 0.0762  0.0019  -0.0762 20  GLU A CG    
161  C CD    . GLU A 20  ? 0.5866 0.5770 0.6449 0.0704  0.0117  -0.0862 20  GLU A CD    
162  O OE1   . GLU A 20  ? 0.6137 0.6282 0.7101 0.0786  0.0127  -0.0995 20  GLU A OE1   
163  O OE2   . GLU A 20  ? 0.5974 0.5945 0.6217 0.0574  0.0180  -0.0802 20  GLU A OE2   
164  N N     . VAL A 21  ? 0.6198 0.4893 0.6818 0.0884  -0.0431 -0.0165 21  VAL A N     
165  C CA    . VAL A 21  ? 0.6180 0.4679 0.6396 0.0799  -0.0480 0.0078  21  VAL A CA    
166  C C     . VAL A 21  ? 0.6323 0.4553 0.6609 0.0802  -0.0500 0.0150  21  VAL A C     
167  O O     . VAL A 21  ? 0.6260 0.4382 0.6234 0.0712  -0.0432 0.0228  21  VAL A O     
168  C CB    . VAL A 21  ? 0.6301 0.4785 0.6445 0.0810  -0.0655 0.0295  21  VAL A CB    
169  C CG1   . VAL A 21  ? 0.6387 0.4692 0.6113 0.0725  -0.0697 0.0534  21  VAL A CG1   
170  C CG2   . VAL A 21  ? 0.6064 0.4803 0.6132 0.0787  -0.0641 0.0223  21  VAL A CG2   
171  N N     . ARG A 22  ? 0.6500 0.4629 0.7239 0.0906  -0.0596 0.0114  22  ARG A N     
172  C CA    . ARG A 22  ? 0.6715 0.4571 0.7591 0.0904  -0.0638 0.0188  22  ARG A CA    
173  C C     . ARG A 22  ? 0.6545 0.4411 0.7356 0.0857  -0.0472 -0.0025 22  ARG A C     
174  O O     . ARG A 22  ? 0.6543 0.4246 0.7162 0.0772  -0.0443 0.0082  22  ARG A O     
175  C CB    . ARG A 22  ? 0.6943 0.4672 0.8386 0.1034  -0.0796 0.0174  22  ARG A CB    
176  C CG    . ARG A 22  ? 0.7572 0.5080 0.9063 0.1032  -0.1010 0.0525  22  ARG A CG    
177  C CD    . ARG A 22  ? 0.8373 0.5647 1.0460 0.1136  -0.1170 0.0528  22  ARG A CD    
178  N NE    . ARG A 22  ? 0.8759 0.6181 1.1363 0.1293  -0.1168 0.0210  22  ARG A NE    
179  C CZ    . ARG A 22  ? 0.8826 0.6329 1.1639 0.1342  -0.1024 -0.0147 22  ARG A CZ    
180  N NH1   . ARG A 22  ? 0.8791 0.6220 1.1349 0.1246  -0.0888 -0.0225 22  ARG A NH1   
181  N NH2   . ARG A 22  ? 0.8829 0.6514 1.2110 0.1487  -0.1016 -0.0437 22  ARG A NH2   
182  N N     . LYS A 23  ? 0.6417 0.4505 0.7377 0.0902  -0.0364 -0.0322 23  LYS A N     
183  C CA    . LYS A 23  ? 0.6379 0.4510 0.7261 0.0853  -0.0219 -0.0538 23  LYS A CA    
184  C C     . LYS A 23  ? 0.6235 0.4349 0.6620 0.0715  -0.0139 -0.0400 23  LYS A C     
185  O O     . LYS A 23  ? 0.6265 0.4231 0.6566 0.0653  -0.0108 -0.0384 23  LYS A O     
186  C CB    . LYS A 23  ? 0.6289 0.4741 0.7298 0.0894  -0.0098 -0.0849 23  LYS A CB    
187  C CG    . LYS A 23  ? 0.6584 0.5037 0.8103 0.1020  -0.0113 -0.1123 23  LYS A CG    
188  C CD    . LYS A 23  ? 0.6898 0.5736 0.8474 0.1039  0.0045  -0.1449 23  LYS A CD    
189  C CE    . LYS A 23  ? 0.7105 0.6050 0.8301 0.0910  0.0195  -0.1566 23  LYS A CE    
190  N NZ    . LYS A 23  ? 0.7070 0.6431 0.8076 0.0849  0.0347  -0.1706 23  LYS A NZ    
191  N N     . GLY A 24  ? 0.6136 0.4398 0.6234 0.0671  -0.0121 -0.0303 24  GLY A N     
192  C CA    . GLY A 24  ? 0.6034 0.4277 0.5693 0.0559  -0.0068 -0.0164 24  GLY A CA    
193  C C     . GLY A 24  ? 0.6207 0.4212 0.5744 0.0518  -0.0129 0.0071  24  GLY A C     
194  O O     . GLY A 24  ? 0.6200 0.4152 0.5532 0.0437  -0.0055 0.0099  24  GLY A O     
195  N N     . ARG A 25  ? 0.6382 0.4265 0.6051 0.0566  -0.0264 0.0252  25  ARG A N     
196  C CA    . ARG A 25  ? 0.6566 0.4266 0.6087 0.0506  -0.0319 0.0512  25  ARG A CA    
197  C C     . ARG A 25  ? 0.6569 0.4099 0.6248 0.0471  -0.0287 0.0496  25  ARG A C     
198  O O     . ARG A 25  ? 0.6653 0.4121 0.6120 0.0379  -0.0239 0.0631  25  ARG A O     
199  C CB    . ARG A 25  ? 0.6899 0.4505 0.6544 0.0552  -0.0496 0.0737  25  ARG A CB    
200  C CG    . ARG A 25  ? 0.7042 0.4800 0.6467 0.0563  -0.0558 0.0811  25  ARG A CG    
201  C CD    . ARG A 25  ? 0.7457 0.5250 0.6390 0.0464  -0.0523 0.0978  25  ARG A CD    
202  N NE    . ARG A 25  ? 0.7482 0.5443 0.6187 0.0466  -0.0551 0.0949  25  ARG A NE    
203  C CZ    . ARG A 25  ? 0.7561 0.5671 0.6159 0.0455  -0.0454 0.0758  25  ARG A CZ    
204  N NH1   . ARG A 25  ? 0.7434 0.5568 0.6104 0.0440  -0.0321 0.0584  25  ARG A NH1   
205  N NH2   . ARG A 25  ? 0.7447 0.5684 0.5876 0.0449  -0.0505 0.0748  25  ARG A NH2   
206  N N     . GLU A 26  ? 0.6515 0.3987 0.6585 0.0542  -0.0310 0.0311  26  GLU A N     
207  C CA    . GLU A 26  ? 0.6556 0.3846 0.6821 0.0508  -0.0307 0.0282  26  GLU A CA    
208  C C     . GLU A 26  ? 0.6264 0.3652 0.6396 0.0452  -0.0166 0.0064  26  GLU A C     
209  O O     . GLU A 26  ? 0.6279 0.3538 0.6498 0.0397  -0.0155 0.0052  26  GLU A O     
210  C CB    . GLU A 26  ? 0.6809 0.3936 0.7600 0.0609  -0.0431 0.0194  26  GLU A CB    
211  C CG    . GLU A 26  ? 0.7000 0.4288 0.8046 0.0737  -0.0435 -0.0062 26  GLU A CG    
212  C CD    . GLU A 26  ? 0.7625 0.4738 0.9200 0.0855  -0.0611 -0.0040 26  GLU A CD    
213  O OE1   . GLU A 26  ? 0.7776 0.4974 0.9474 0.0939  -0.0696 0.0011  26  GLU A OE1   
214  O OE2   . GLU A 26  ? 0.7954 0.4833 0.9849 0.0861  -0.0681 -0.0066 26  GLU A OE2   
215  N N     . ALA A 27  ? 0.6004 0.3626 0.5933 0.0455  -0.0072 -0.0092 27  ALA A N     
216  C CA    . ALA A 27  ? 0.5802 0.3541 0.5521 0.0380  0.0048  -0.0235 27  ALA A CA    
217  C C     . ALA A 27  ? 0.5719 0.3431 0.5108 0.0281  0.0088  -0.0030 27  ALA A C     
218  O O     . ALA A 27  ? 0.5654 0.3326 0.4986 0.0208  0.0137  -0.0042 27  ALA A O     
219  C CB    . ALA A 27  ? 0.5623 0.3625 0.5232 0.0396  0.0121  -0.0413 27  ALA A CB    
220  N N     . GLU A 28  ? 0.5699 0.3444 0.4890 0.0284  0.0062  0.0146  28  GLU A N     
221  C CA    . GLU A 28  ? 0.5684 0.3441 0.4563 0.0209  0.0105  0.0314  28  GLU A CA    
222  C C     . GLU A 28  ? 0.5841 0.3444 0.4779 0.0149  0.0098  0.0480  28  GLU A C     
223  O O     . GLU A 28  ? 0.5765 0.3397 0.4572 0.0075  0.0177  0.0497  28  GLU A O     
224  C CB    . GLU A 28  ? 0.5720 0.3533 0.4415 0.0234  0.0053  0.0449  28  GLU A CB    
225  C CG    . GLU A 28  ? 0.5811 0.3665 0.4182 0.0170  0.0100  0.0586  28  GLU A CG    
226  C CD    . GLU A 28  ? 0.6313 0.4208 0.4508 0.0194  0.0023  0.0719  28  GLU A CD    
227  O OE1   . GLU A 28  ? 0.6410 0.4332 0.4731 0.0259  -0.0062 0.0678  28  GLU A OE1   
228  O OE2   . GLU A 28  ? 0.6471 0.4396 0.4410 0.0146  0.0046  0.0855  28  GLU A OE2   
229  N N     . GLU A 29  ? 0.6086 0.3533 0.5249 0.0176  -0.0006 0.0615  29  GLU A N     
230  C CA    . GLU A 29  ? 0.6339 0.3633 0.5612 0.0102  -0.0028 0.0804  29  GLU A CA    
231  C C     . GLU A 29  ? 0.6225 0.3461 0.5674 0.0056  0.0021  0.0657  29  GLU A C     
232  O O     . GLU A 29  ? 0.6256 0.3496 0.5626 -0.0037 0.0082  0.0756  29  GLU A O     
233  C CB    . GLU A 29  ? 0.6641 0.3753 0.6192 0.0138  -0.0180 0.0977  29  GLU A CB    
234  C CG    . GLU A 29  ? 0.7256 0.4413 0.6575 0.0130  -0.0243 0.1233  29  GLU A CG    
235  C CD    . GLU A 29  ? 0.8026 0.5254 0.7025 0.0009  -0.0163 0.1460  29  GLU A CD    
236  O OE1   . GLU A 29  ? 0.8109 0.5220 0.7227 -0.0071 -0.0208 0.1697  29  GLU A OE1   
237  O OE2   . GLU A 29  ? 0.8289 0.5704 0.6939 -0.0007 -0.0054 0.1398  29  GLU A OE2   
238  N N     . GLU A 30  ? 0.6090 0.3302 0.5777 0.0120  -0.0003 0.0407  30  GLU A N     
239  C CA    . GLU A 30  ? 0.5991 0.3162 0.5830 0.0076  0.0027  0.0237  30  GLU A CA    
240  C C     . GLU A 30  ? 0.5727 0.3060 0.5268 -0.0002 0.0141  0.0203  30  GLU A C     
241  O O     . GLU A 30  ? 0.5698 0.2991 0.5283 -0.0085 0.0165  0.0241  30  GLU A O     
242  C CB    . GLU A 30  ? 0.6033 0.3219 0.6108 0.0162  0.0000  -0.0069 30  GLU A CB    
243  C CG    . GLU A 30  ? 0.6222 0.3344 0.6487 0.0121  -0.0001 -0.0269 30  GLU A CG    
244  C CD    . GLU A 30  ? 0.6737 0.3620 0.7249 0.0050  -0.0077 -0.0093 30  GLU A CD    
245  O OE1   . GLU A 30  ? 0.7138 0.3840 0.7886 0.0083  -0.0181 0.0076  30  GLU A OE1   
246  O OE2   . GLU A 30  ? 0.6739 0.3622 0.7226 -0.0046 -0.0044 -0.0105 30  GLU A OE2   
247  N N     . LEU A 31  ? 0.5558 0.3071 0.4831 0.0025  0.0199  0.0141  31  LEU A N     
248  C CA    . LEU A 31  ? 0.5407 0.3065 0.4414 -0.0037 0.0285  0.0135  31  LEU A CA    
249  C C     . LEU A 31  ? 0.5480 0.3120 0.4388 -0.0106 0.0325  0.0354  31  LEU A C     
250  O O     . LEU A 31  ? 0.5388 0.3054 0.4313 -0.0176 0.0369  0.0349  31  LEU A O     
251  C CB    . LEU A 31  ? 0.5268 0.3084 0.4042 0.0003  0.0311  0.0083  31  LEU A CB    
252  C CG    . LEU A 31  ? 0.5108 0.3077 0.3764 -0.0026 0.0355  -0.0084 31  LEU A CG    
253  C CD1   . LEU A 31  ? 0.4919 0.2886 0.3753 -0.0036 0.0344  -0.0276 31  LEU A CD1   
254  C CD2   . LEU A 31  ? 0.4969 0.3068 0.3497 0.0014  0.0354  -0.0127 31  LEU A CD2   
255  N N     . ARG A 32  ? 0.5633 0.3250 0.4448 -0.0091 0.0307  0.0544  32  ARG A N     
256  C CA    . ARG A 32  ? 0.5839 0.3480 0.4550 -0.0162 0.0357  0.0757  32  ARG A CA    
257  C C     . ARG A 32  ? 0.5930 0.3471 0.4891 -0.0245 0.0357  0.0826  32  ARG A C     
258  O O     . ARG A 32  ? 0.5942 0.3580 0.4867 -0.0311 0.0437  0.0834  32  ARG A O     
259  C CB    . ARG A 32  ? 0.5993 0.3626 0.4565 -0.0144 0.0315  0.0960  32  ARG A CB    
260  C CG    . ARG A 32  ? 0.6116 0.3892 0.4390 -0.0090 0.0334  0.0898  32  ARG A CG    
261  C CD    . ARG A 32  ? 0.6299 0.4073 0.4435 -0.0062 0.0257  0.1064  32  ARG A CD    
262  N NE    . ARG A 32  ? 0.6582 0.4520 0.4372 -0.0071 0.0317  0.1086  32  ARG A NE    
263  C CZ    . ARG A 32  ? 0.6611 0.4647 0.4251 -0.0026 0.0335  0.0919  32  ARG A CZ    
264  N NH1   . ARG A 32  ? 0.6699 0.4712 0.4476 0.0019  0.0307  0.0747  32  ARG A NH1   
265  N NH2   . ARG A 32  ? 0.6737 0.4904 0.4097 -0.0032 0.0379  0.0920  32  ARG A NH2   
266  N N     . ARG A 33  ? 0.6068 0.3419 0.5324 -0.0240 0.0257  0.0857  33  ARG A N     
267  C CA    . ARG A 33  ? 0.6181 0.3403 0.5732 -0.0327 0.0229  0.0924  33  ARG A CA    
268  C C     . ARG A 33  ? 0.5973 0.3265 0.5574 -0.0371 0.0281  0.0741  33  ARG A C     
269  O O     . ARG A 33  ? 0.6026 0.3350 0.5708 -0.0468 0.0323  0.0843  33  ARG A O     
270  C CB    . ARG A 33  ? 0.6357 0.3341 0.6272 -0.0289 0.0090  0.0893  33  ARG A CB    
271  C CG    . ARG A 33  ? 0.6967 0.3833 0.6948 -0.0287 0.0001  0.1162  33  ARG A CG    
272  C CD    . ARG A 33  ? 0.7708 0.4383 0.8010 -0.0185 -0.0140 0.1047  33  ARG A CD    
273  N NE    . ARG A 33  ? 0.8332 0.4931 0.8646 -0.0150 -0.0243 0.1284  33  ARG A NE    
274  C CZ    . ARG A 33  ? 0.8644 0.5217 0.9045 -0.0025 -0.0326 0.1183  33  ARG A CZ    
275  N NH1   . ARG A 33  ? 0.8569 0.5209 0.9036 0.0074  -0.0296 0.0844  33  ARG A NH1   
276  N NH2   . ARG A 33  ? 0.8916 0.5423 0.9333 -0.0004 -0.0440 0.1429  33  ARG A NH2   
277  N N     . ARG A 34  ? 0.5778 0.3118 0.5334 -0.0307 0.0274  0.0482  34  ARG A N     
278  C CA    . ARG A 34  ? 0.5656 0.3077 0.5227 -0.0351 0.0300  0.0306  34  ARG A CA    
279  C C     . ARG A 34  ? 0.5548 0.3157 0.4900 -0.0395 0.0397  0.0374  34  ARG A C     
280  O O     . ARG A 34  ? 0.5664 0.3314 0.5123 -0.0472 0.0417  0.0386  34  ARG A O     
281  C CB    . ARG A 34  ? 0.5545 0.3012 0.5076 -0.0285 0.0273  0.0035  34  ARG A CB    
282  C CG    . ARG A 34  ? 0.5658 0.2965 0.5467 -0.0233 0.0183  -0.0096 34  ARG A CG    
283  C CD    . ARG A 34  ? 0.5375 0.2796 0.5123 -0.0175 0.0185  -0.0380 34  ARG A CD    
284  N NE    . ARG A 34  ? 0.5442 0.2734 0.5483 -0.0100 0.0111  -0.0534 34  ARG A NE    
285  C CZ    . ARG A 34  ? 0.5490 0.2888 0.5548 -0.0034 0.0116  -0.0803 34  ARG A CZ    
286  N NH1   . ARG A 34  ? 0.5490 0.3127 0.5265 -0.0050 0.0188  -0.0920 34  ARG A NH1   
287  N NH2   . ARG A 34  ? 0.5663 0.2941 0.6044 0.0048  0.0048  -0.0956 34  ARG A NH2   
288  N N     . LEU A 35  ? 0.5339 0.3062 0.4421 -0.0343 0.0448  0.0409  35  LEU A N     
289  C CA    . LEU A 35  ? 0.5129 0.3021 0.4047 -0.0368 0.0531  0.0441  35  LEU A CA    
290  C C     . LEU A 35  ? 0.5279 0.3227 0.4228 -0.0431 0.0606  0.0643  35  LEU A C     
291  O O     . LEU A 35  ? 0.5199 0.3294 0.4129 -0.0463 0.0678  0.0647  35  LEU A O     
292  C CB    . LEU A 35  ? 0.5015 0.2997 0.3665 -0.0296 0.0551  0.0403  35  LEU A CB    
293  C CG    . LEU A 35  ? 0.4610 0.2604 0.3219 -0.0257 0.0499  0.0218  35  LEU A CG    
294  C CD1   . LEU A 35  ? 0.4391 0.2407 0.2826 -0.0188 0.0488  0.0225  35  LEU A CD1   
295  C CD2   . LEU A 35  ? 0.4395 0.2504 0.2954 -0.0290 0.0511  0.0136  35  LEU A CD2   
296  N N     . ASP A 36  ? 0.5485 0.3334 0.4492 -0.0452 0.0587  0.0818  36  ASP A N     
297  C CA    . ASP A 36  ? 0.5623 0.3547 0.4672 -0.0540 0.0660  0.1042  36  ASP A CA    
298  C C     . ASP A 36  ? 0.5575 0.3465 0.4942 -0.0637 0.0651  0.1052  36  ASP A C     
299  O O     . ASP A 36  ? 0.5534 0.3592 0.4948 -0.0704 0.0743  0.1111  36  ASP A O     
300  C CB    . ASP A 36  ? 0.5896 0.3719 0.4922 -0.0555 0.0616  0.1265  36  ASP A CB    
301  C CG    . ASP A 36  ? 0.6048 0.3935 0.4749 -0.0473 0.0619  0.1277  36  ASP A CG    
302  O OD1   . ASP A 36  ? 0.5704 0.3748 0.4177 -0.0424 0.0689  0.1156  36  ASP A OD1   
303  O OD2   . ASP A 36  ? 0.6566 0.4335 0.5269 -0.0458 0.0533  0.1414  36  ASP A OD2   
304  N N     . GLU A 37  ? 0.5562 0.3246 0.5168 -0.0641 0.0535  0.0975  37  GLU A N     
305  C CA    . GLU A 37  ? 0.5595 0.3215 0.5524 -0.0732 0.0493  0.0953  37  GLU A CA    
306  C C     . GLU A 37  ? 0.5446 0.3246 0.5372 -0.0758 0.0547  0.0827  37  GLU A C     
307  O O     . GLU A 37  ? 0.5566 0.3410 0.5731 -0.0857 0.0556  0.0885  37  GLU A O     
308  C CB    . GLU A 37  ? 0.5635 0.3027 0.5772 -0.0696 0.0355  0.0779  37  GLU A CB    
309  C CG    . GLU A 37  ? 0.5844 0.3090 0.6376 -0.0800 0.0274  0.0809  37  GLU A CG    
310  C CD    . GLU A 37  ? 0.6026 0.3049 0.6779 -0.0751 0.0135  0.0588  37  GLU A CD    
311  O OE1   . GLU A 37  ? 0.5875 0.2915 0.6462 -0.0644 0.0122  0.0372  37  GLU A OE1   
312  O OE2   . GLU A 37  ? 0.6299 0.3141 0.7413 -0.0824 0.0038  0.0621  37  GLU A OE2   
313  N N     . LEU A 38  ? 0.5256 0.3160 0.4943 -0.0676 0.0568  0.0668  38  LEU A N     
314  C CA    . LEU A 38  ? 0.5092 0.3153 0.4789 -0.0692 0.0588  0.0555  38  LEU A CA    
315  C C     . LEU A 38  ? 0.5110 0.3393 0.4711 -0.0691 0.0713  0.0648  38  LEU A C     
316  O O     . LEU A 38  ? 0.5086 0.3509 0.4772 -0.0706 0.0727  0.0582  38  LEU A O     
317  C CB    . LEU A 38  ? 0.4946 0.3009 0.4464 -0.0620 0.0529  0.0351  38  LEU A CB    
318  C CG    . LEU A 38  ? 0.4839 0.2782 0.4454 -0.0629 0.0416  0.0171  38  LEU A CG    
319  C CD1   . LEU A 38  ? 0.4630 0.2634 0.3991 -0.0560 0.0398  0.0031  38  LEU A CD1   
320  C CD2   . LEU A 38  ? 0.4783 0.2763 0.4617 -0.0718 0.0359  0.0107  38  LEU A CD2   
321  N N     . GLY A 39  ? 0.5211 0.3537 0.4640 -0.0667 0.0796  0.0787  39  GLY A N     
322  C CA    . GLY A 39  ? 0.5181 0.3743 0.4521 -0.0669 0.0933  0.0866  39  GLY A CA    
323  C C     . GLY A 39  ? 0.5009 0.3687 0.4211 -0.0583 0.0948  0.0702  39  GLY A C     
324  O O     . GLY A 39  ? 0.5024 0.3890 0.4330 -0.0588 0.1018  0.0673  39  GLY A O     
325  N N     . VAL A 40  ? 0.4927 0.3495 0.3927 -0.0505 0.0875  0.0599  40  VAL A N     
326  C CA    . VAL A 40  ? 0.4733 0.3373 0.3617 -0.0431 0.0857  0.0459  40  VAL A CA    
327  C C     . VAL A 40  ? 0.4784 0.3450 0.3391 -0.0356 0.0895  0.0458  40  VAL A C     
328  O O     . VAL A 40  ? 0.4921 0.3506 0.3395 -0.0351 0.0892  0.0542  40  VAL A O     
329  C CB    . VAL A 40  ? 0.4600 0.3128 0.3500 -0.0426 0.0728  0.0330  40  VAL A CB    
330  C CG1   . VAL A 40  ? 0.4558 0.3126 0.3708 -0.0493 0.0681  0.0291  40  VAL A CG1   
331  C CG2   . VAL A 40  ? 0.4486 0.2843 0.3330 -0.0424 0.0666  0.0325  40  VAL A CG2   
332  N N     . GLU A 41  ? 0.4738 0.3513 0.3284 -0.0297 0.0916  0.0362  41  GLU A N     
333  C CA    . GLU A 41  ? 0.4816 0.3601 0.3110 -0.0224 0.0923  0.0322  41  GLU A CA    
334  C C     . GLU A 41  ? 0.4671 0.3306 0.2850 -0.0194 0.0806  0.0265  41  GLU A C     
335  O O     . GLU A 41  ? 0.4588 0.3190 0.2840 -0.0194 0.0726  0.0184  41  GLU A O     
336  C CB    . GLU A 41  ? 0.4816 0.3746 0.3133 -0.0166 0.0965  0.0210  41  GLU A CB    
337  C CG    . GLU A 41  ? 0.5443 0.4569 0.3705 -0.0158 0.1112  0.0236  41  GLU A CG    
338  C CD    . GLU A 41  ? 0.6138 0.5412 0.4470 -0.0080 0.1151  0.0076  41  GLU A CD    
339  O OE1   . GLU A 41  ? 0.6474 0.5929 0.5034 -0.0086 0.1240  0.0048  41  GLU A OE1   
340  O OE2   . GLU A 41  ? 0.6368 0.5580 0.4561 -0.0012 0.1085  -0.0029 41  GLU A OE2   
341  N N     . TYR A 42  ? 0.4675 0.3243 0.2682 -0.0174 0.0792  0.0319  42  TYR A N     
342  C CA    . TYR A 42  ? 0.4547 0.3018 0.2464 -0.0143 0.0695  0.0262  42  TYR A CA    
343  C C     . TYR A 42  ? 0.4625 0.3101 0.2328 -0.0096 0.0691  0.0289  42  TYR A C     
344  O O     . TYR A 42  ? 0.4748 0.3290 0.2351 -0.0098 0.0758  0.0368  42  TYR A O     
345  C CB    . TYR A 42  ? 0.4526 0.2883 0.2543 -0.0173 0.0645  0.0284  42  TYR A CB    
346  C CG    . TYR A 42  ? 0.4681 0.2976 0.2700 -0.0183 0.0664  0.0416  42  TYR A CG    
347  C CD1   . TYR A 42  ? 0.4689 0.2931 0.2589 -0.0141 0.0617  0.0458  42  TYR A CD1   
348  C CD2   . TYR A 42  ? 0.4620 0.2917 0.2781 -0.0244 0.0716  0.0520  42  TYR A CD2   
349  C CE1   . TYR A 42  ? 0.4884 0.3061 0.2803 -0.0155 0.0608  0.0610  42  TYR A CE1   
350  C CE2   . TYR A 42  ? 0.4903 0.3135 0.3080 -0.0269 0.0716  0.0679  42  TYR A CE2   
351  C CZ    . TYR A 42  ? 0.5005 0.3170 0.3058 -0.0223 0.0655  0.0729  42  TYR A CZ    
352  O OH    . TYR A 42  ? 0.5198 0.3285 0.3289 -0.0252 0.0627  0.0914  42  TYR A OH    
353  N N     . VAL A 43  ? 0.4545 0.2971 0.2178 -0.0066 0.0609  0.0230  43  VAL A N     
354  C CA    . VAL A 43  ? 0.4590 0.3019 0.2041 -0.0025 0.0575  0.0243  43  VAL A CA    
355  C C     . VAL A 43  ? 0.4490 0.2858 0.1972 -0.0014 0.0486  0.0208  43  VAL A C     
356  O O     . VAL A 43  ? 0.4279 0.2645 0.1862 -0.0037 0.0459  0.0142  43  VAL A O     
357  C CB    . VAL A 43  ? 0.4644 0.3154 0.1977 0.0013  0.0583  0.0151  43  VAL A CB    
358  C CG1   . VAL A 43  ? 0.4241 0.2723 0.1656 0.0019  0.0504  0.0043  43  VAL A CG1   
359  C CG2   . VAL A 43  ? 0.4779 0.3313 0.1897 0.0044  0.0557  0.0172  43  VAL A CG2   
360  N N     . PHE A 44  ? 0.4638 0.2983 0.2039 0.0014  0.0440  0.0259  44  PHE A N     
361  C CA    . PHE A 44  ? 0.4644 0.2975 0.2098 0.0030  0.0364  0.0218  44  PHE A CA    
362  C C     . PHE A 44  ? 0.4637 0.3013 0.1974 0.0049  0.0305  0.0166  44  PHE A C     
363  O O     . PHE A 44  ? 0.4852 0.3245 0.2033 0.0072  0.0291  0.0192  44  PHE A O     
364  C CB    . PHE A 44  ? 0.4821 0.3101 0.2322 0.0057  0.0325  0.0305  44  PHE A CB    
365  C CG    . PHE A 44  ? 0.4954 0.3161 0.2633 0.0041  0.0352  0.0339  44  PHE A CG    
366  C CD1   . PHE A 44  ? 0.5314 0.3496 0.3006 0.0002  0.0417  0.0404  44  PHE A CD1   
367  C CD2   . PHE A 44  ? 0.5286 0.3460 0.3151 0.0066  0.0311  0.0288  44  PHE A CD2   
368  C CE1   . PHE A 44  ? 0.5682 0.3778 0.3575 -0.0023 0.0424  0.0432  44  PHE A CE1   
369  C CE2   . PHE A 44  ? 0.5422 0.3509 0.3484 0.0056  0.0320  0.0288  44  PHE A CE2   
370  C CZ    . PHE A 44  ? 0.5496 0.3528 0.3574 0.0008  0.0368  0.0366  44  PHE A CZ    
371  N N     . VAL A 45  ? 0.4472 0.2878 0.1881 0.0028  0.0265  0.0095  45  VAL A N     
372  C CA    . VAL A 45  ? 0.4433 0.2867 0.1783 0.0029  0.0192  0.0048  45  VAL A CA    
373  C C     . VAL A 45  ? 0.4397 0.2887 0.1847 0.0011  0.0139  0.0039  45  VAL A C     
374  O O     . VAL A 45  ? 0.4465 0.2971 0.2007 0.0023  0.0163  0.0055  45  VAL A O     
375  C CB    . VAL A 45  ? 0.4392 0.2822 0.1766 0.0002  0.0189  -0.0009 45  VAL A CB    
376  C CG1   . VAL A 45  ? 0.4477 0.2896 0.1774 0.0035  0.0249  -0.0027 45  VAL A CG1   
377  C CG2   . VAL A 45  ? 0.4182 0.2630 0.1683 -0.0054 0.0211  -0.0008 45  VAL A CG2   
378  N N     . GLY A 46  ? 0.4352 0.2882 0.1816 -0.0019 0.0068  0.0008  46  GLY A N     
379  C CA    . GLY A 46  ? 0.4230 0.2862 0.1806 -0.0051 0.0030  0.0007  46  GLY A CA    
380  C C     . GLY A 46  ? 0.4306 0.2978 0.1917 -0.0002 -0.0014 0.0026  46  GLY A C     
381  O O     . GLY A 46  ? 0.4554 0.3162 0.2063 0.0051  -0.0043 0.0058  46  GLY A O     
382  N N     . SER A 47  ? 0.4177 0.2979 0.1938 -0.0024 -0.0021 0.0011  47  SER A N     
383  C CA    . SER A 47  ? 0.4280 0.3148 0.2134 0.0019  -0.0086 0.0024  47  SER A CA    
384  C C     . SER A 47  ? 0.4341 0.3152 0.2244 0.0102  -0.0075 0.0054  47  SER A C     
385  O O     . SER A 47  ? 0.4456 0.3260 0.2375 0.0150  -0.0160 0.0101  47  SER A O     
386  C CB    . SER A 47  ? 0.4183 0.3251 0.2226 -0.0031 -0.0084 -0.0007 47  SER A CB    
387  O OG    . SER A 47  ? 0.4310 0.3469 0.2450 -0.0037 0.0022  -0.0061 47  SER A OG    
388  N N     . TYR A 48  ? 0.4332 0.3095 0.2273 0.0112  0.0011  0.0036  48  TYR A N     
389  C CA    . TYR A 48  ? 0.4433 0.3114 0.2468 0.0182  0.0006  0.0077  48  TYR A CA    
390  C C     . TYR A 48  ? 0.4663 0.3216 0.2507 0.0200  -0.0039 0.0190  48  TYR A C     
391  O O     . TYR A 48  ? 0.4854 0.3368 0.2734 0.0249  -0.0118 0.0278  48  TYR A O     
392  C CB    . TYR A 48  ? 0.4364 0.3004 0.2497 0.0180  0.0094  0.0022  48  TYR A CB    
393  C CG    . TYR A 48  ? 0.4416 0.2927 0.2672 0.0242  0.0066  0.0085  48  TYR A CG    
394  C CD1   . TYR A 48  ? 0.4539 0.3082 0.3056 0.0314  0.0014  0.0058  48  TYR A CD1   
395  C CD2   . TYR A 48  ? 0.4635 0.3000 0.2777 0.0227  0.0084  0.0184  48  TYR A CD2   
396  C CE1   . TYR A 48  ? 0.4698 0.3097 0.3374 0.0370  -0.0041 0.0135  48  TYR A CE1   
397  C CE2   . TYR A 48  ? 0.4975 0.3212 0.3247 0.0266  0.0041  0.0280  48  TYR A CE2   
398  C CZ    . TYR A 48  ? 0.4922 0.3158 0.3469 0.0339  -0.0033 0.0260  48  TYR A CZ    
399  O OH    . TYR A 48  ? 0.4915 0.2997 0.3640 0.0376  -0.0103 0.0372  48  TYR A OH    
400  N N     . ALA A 49  ? 0.4650 0.3155 0.2299 0.0160  0.0008  0.0193  49  ALA A N     
401  C CA    . ALA A 49  ? 0.4870 0.3300 0.2316 0.0168  -0.0002 0.0285  49  ALA A CA    
402  C C     . ALA A 49  ? 0.5018 0.3487 0.2292 0.0176  -0.0096 0.0296  49  ALA A C     
403  O O     . ALA A 49  ? 0.5186 0.3636 0.2246 0.0176  -0.0098 0.0352  49  ALA A O     
404  C CB    . ALA A 49  ? 0.4780 0.3174 0.2122 0.0132  0.0099  0.0266  49  ALA A CB    
405  N N     . ARG A 50  ? 0.5007 0.3550 0.2372 0.0174  -0.0170 0.0236  50  ARG A N     
406  C CA    . ARG A 50  ? 0.5146 0.3726 0.2388 0.0176  -0.0287 0.0228  50  ARG A CA    
407  C C     . ARG A 50  ? 0.5246 0.3896 0.2669 0.0206  -0.0395 0.0268  50  ARG A C     
408  O O     . ARG A 50  ? 0.5387 0.4078 0.2749 0.0208  -0.0516 0.0273  50  ARG A O     
409  C CB    . ARG A 50  ? 0.5068 0.3673 0.2294 0.0131  -0.0304 0.0117  50  ARG A CB    
410  C CG    . ARG A 50  ? 0.5004 0.3547 0.2071 0.0118  -0.0234 0.0059  50  ARG A CG    
411  C CD    . ARG A 50  ? 0.5021 0.3557 0.2092 0.0087  -0.0303 -0.0048 50  ARG A CD    
412  N NE    . ARG A 50  ? 0.5014 0.3578 0.2297 0.0029  -0.0311 -0.0060 50  ARG A NE    
413  C CZ    . ARG A 50  ? 0.4924 0.3472 0.2285 -0.0005 -0.0231 -0.0059 50  ARG A CZ    
414  N NH1   . ARG A 50  ? 0.4882 0.3380 0.2165 0.0021  -0.0135 -0.0059 50  ARG A NH1   
415  N NH2   . ARG A 50  ? 0.4495 0.3097 0.2013 -0.0075 -0.0251 -0.0046 50  ARG A NH2   
416  N N     . ASN A 51  ? 0.5265 0.3937 0.2934 0.0233  -0.0354 0.0280  51  ASN A N     
417  C CA    . ASN A 51  ? 0.5361 0.4117 0.3284 0.0279  -0.0442 0.0300  51  ASN A CA    
418  C C     . ASN A 51  ? 0.5236 0.4148 0.3301 0.0248  -0.0491 0.0225  51  ASN A C     
419  O O     . ASN A 51  ? 0.5345 0.4330 0.3517 0.0274  -0.0616 0.0257  51  ASN A O     
420  C CB    . ASN A 51  ? 0.5643 0.4350 0.3485 0.0320  -0.0576 0.0431  51  ASN A CB    
421  C CG    . ASN A 51  ? 0.6040 0.4697 0.4126 0.0386  -0.0602 0.0514  51  ASN A CG    
422  O OD1   . ASN A 51  ? 0.6135 0.4870 0.4560 0.0429  -0.0588 0.0441  51  ASN A OD1   
423  N ND2   . ASN A 51  ? 0.6389 0.4925 0.4323 0.0392  -0.0643 0.0668  51  ASN A ND2   
424  N N     . THR A 52  ? 0.5031 0.4002 0.3115 0.0184  -0.0403 0.0143  52  THR A N     
425  C CA    . THR A 52  ? 0.4923 0.4051 0.3142 0.0125  -0.0444 0.0097  52  THR A CA    
426  C C     . THR A 52  ? 0.4742 0.4042 0.3178 0.0087  -0.0331 0.0035  52  THR A C     
427  O O     . THR A 52  ? 0.4720 0.4168 0.3248 0.0005  -0.0332 0.0017  52  THR A O     
428  C CB    . THR A 52  ? 0.4958 0.4013 0.2981 0.0055  -0.0485 0.0079  52  THR A CB    
429  O OG1   . THR A 52  ? 0.4994 0.3929 0.2853 0.0042  -0.0384 0.0064  52  THR A OG1   
430  C CG2   . THR A 52  ? 0.5052 0.4025 0.2899 0.0085  -0.0621 0.0100  52  THR A CG2   
431  N N     . TRP A 53  ? 0.4682 0.3972 0.3200 0.0139  -0.0237 0.0003  53  TRP A N     
432  C CA    . TRP A 53  ? 0.4490 0.3964 0.3181 0.0110  -0.0120 -0.0085 53  TRP A CA    
433  C C     . TRP A 53  ? 0.4477 0.4168 0.3489 0.0158  -0.0143 -0.0131 53  TRP A C     
434  O O     . TRP A 53  ? 0.4596 0.4234 0.3713 0.0239  -0.0252 -0.0086 53  TRP A O     
435  C CB    . TRP A 53  ? 0.4536 0.3906 0.3199 0.0149  -0.0024 -0.0133 53  TRP A CB    
436  C CG    . TRP A 53  ? 0.4687 0.4032 0.3578 0.0259  -0.0034 -0.0168 53  TRP A CG    
437  C CD1   . TRP A 53  ? 0.4823 0.4350 0.4010 0.0307  0.0027  -0.0297 53  TRP A CD1   
438  C CD2   . TRP A 53  ? 0.4759 0.3890 0.3628 0.0335  -0.0115 -0.0075 53  TRP A CD2   
439  N NE1   . TRP A 53  ? 0.4942 0.4346 0.4330 0.0420  -0.0029 -0.0296 53  TRP A NE1   
440  C CE2   . TRP A 53  ? 0.4905 0.4063 0.4096 0.0430  -0.0122 -0.0138 53  TRP A CE2   
441  C CE3   . TRP A 53  ? 0.4937 0.3875 0.3551 0.0327  -0.0182 0.0057  53  TRP A CE3   
442  C CZ2   . TRP A 53  ? 0.5056 0.4022 0.4333 0.0508  -0.0215 -0.0039 53  TRP A CZ2   
443  C CZ3   . TRP A 53  ? 0.5247 0.4034 0.3903 0.0393  -0.0255 0.0159  53  TRP A CZ3   
444  C CH2   . TRP A 53  ? 0.5218 0.4005 0.4211 0.0479  -0.0282 0.0127  53  TRP A CH2   
445  N N     . LEU A 54  ? 0.4375 0.4330 0.3544 0.0103  -0.0043 -0.0216 54  LEU A N     
446  C CA    . LEU A 54  ? 0.4313 0.4562 0.3819 0.0126  -0.0036 -0.0278 54  LEU A CA    
447  C C     . LEU A 54  ? 0.4339 0.4661 0.4118 0.0249  0.0031  -0.0411 54  LEU A C     
448  O O     . LEU A 54  ? 0.4340 0.4590 0.4047 0.0265  0.0127  -0.0494 54  LEU A O     
449  C CB    . LEU A 54  ? 0.4219 0.4758 0.3742 -0.0013 0.0062  -0.0301 54  LEU A CB    
450  C CG    . LEU A 54  ? 0.4255 0.5046 0.3981 -0.0083 0.0007  -0.0255 54  LEU A CG    
451  C CD1   . LEU A 54  ? 0.4436 0.5006 0.4012 -0.0118 -0.0165 -0.0128 54  LEU A CD1   
452  C CD2   . LEU A 54  ? 0.4252 0.5330 0.3968 -0.0238 0.0125  -0.0254 54  LEU A CD2   
453  N N     . LYS A 55  ? 0.4336 0.4798 0.4460 0.0338  -0.0034 -0.0442 55  LYS A N     
454  C CA    . LYS A 55  ? 0.4380 0.4962 0.4864 0.0462  0.0024  -0.0601 55  LYS A CA    
455  C C     . LYS A 55  ? 0.4368 0.5209 0.4857 0.0404  0.0224  -0.0775 55  LYS A C     
456  O O     . LYS A 55  ? 0.4312 0.5458 0.4794 0.0291  0.0307  -0.0789 55  LYS A O     
457  C CB    . LYS A 55  ? 0.4363 0.5176 0.5268 0.0537  -0.0055 -0.0624 55  LYS A CB    
458  C CG    . LYS A 55  ? 0.4406 0.5356 0.5768 0.0688  -0.0013 -0.0808 55  LYS A CG    
459  C CD    . LYS A 55  ? 0.4473 0.5763 0.6285 0.0735  -0.0056 -0.0853 55  LYS A CD    
460  C CE    . LYS A 55  ? 0.4574 0.5844 0.6888 0.0931  -0.0143 -0.0950 55  LYS A CE    
461  N NZ    . LYS A 55  ? 0.4761 0.6226 0.7350 0.1012  0.0035  -0.1234 55  LYS A NZ    
462  N N     . GLY A 56  ? 0.4435 0.5155 0.4917 0.0464  0.0292  -0.0897 56  GLY A N     
463  C CA    . GLY A 56  ? 0.4500 0.5489 0.5008 0.0427  0.0472  -0.1101 56  GLY A CA    
464  C C     . GLY A 56  ? 0.4546 0.5437 0.4643 0.0301  0.0542  -0.1066 56  GLY A C     
465  O O     . GLY A 56  ? 0.4634 0.5678 0.4700 0.0277  0.0668  -0.1237 56  GLY A O     
466  N N     . SER A 57  ? 0.4584 0.5234 0.4372 0.0221  0.0455  -0.0859 57  SER A N     
467  C CA    . SER A 57  ? 0.4662 0.5217 0.4097 0.0105  0.0503  -0.0814 57  SER A CA    
468  C C     . SER A 57  ? 0.4694 0.4839 0.3916 0.0129  0.0406  -0.0681 57  SER A C     
469  O O     . SER A 57  ? 0.4677 0.4698 0.3667 0.0052  0.0348  -0.0532 57  SER A O     
470  C CB    . SER A 57  ? 0.4585 0.5359 0.3859 -0.0060 0.0531  -0.0713 57  SER A CB    
471  O OG    . SER A 57  ? 0.4567 0.5149 0.3733 -0.0092 0.0401  -0.0528 57  SER A OG    
472  N N     . LEU A 58  ? 0.4840 0.4791 0.4174 0.0237  0.0388  -0.0744 58  LEU A N     
473  C CA    . LEU A 58  ? 0.4935 0.4539 0.4108 0.0259  0.0317  -0.0625 58  LEU A CA    
474  C C     . LEU A 58  ? 0.4998 0.4541 0.3955 0.0179  0.0386  -0.0658 58  LEU A C     
475  O O     . LEU A 58  ? 0.5033 0.4660 0.4075 0.0187  0.0461  -0.0823 58  LEU A O     
476  C CB    . LEU A 58  ? 0.5043 0.4472 0.4472 0.0390  0.0259  -0.0657 58  LEU A CB    
477  C CG    . LEU A 58  ? 0.5037 0.4157 0.4366 0.0400  0.0229  -0.0584 58  LEU A CG    
478  C CD1   . LEU A 58  ? 0.4735 0.3647 0.3880 0.0394  0.0129  -0.0358 58  LEU A CD1   
479  C CD2   . LEU A 58  ? 0.4863 0.3884 0.4523 0.0504  0.0209  -0.0701 58  LEU A CD2   
480  N N     . GLU A 59  ? 0.5071 0.4471 0.3768 0.0110  0.0350  -0.0514 59  GLU A N     
481  C CA    . GLU A 59  ? 0.5165 0.4481 0.3672 0.0038  0.0388  -0.0510 59  GLU A CA    
482  C C     . GLU A 59  ? 0.5145 0.4201 0.3497 0.0044  0.0327  -0.0361 59  GLU A C     
483  O O     . GLU A 59  ? 0.5236 0.4256 0.3495 0.0037  0.0269  -0.0256 59  GLU A O     
484  C CB    . GLU A 59  ? 0.5138 0.4658 0.3501 -0.0085 0.0424  -0.0504 59  GLU A CB    
485  C CG    . GLU A 59  ? 0.5559 0.5065 0.3769 -0.0166 0.0458  -0.0528 59  GLU A CG    
486  C CD    . GLU A 59  ? 0.5857 0.5475 0.3896 -0.0297 0.0439  -0.0428 59  GLU A CD    
487  O OE1   . GLU A 59  ? 0.5918 0.5381 0.3874 -0.0312 0.0366  -0.0295 59  GLU A OE1   
488  O OE2   . GLU A 59  ? 0.5820 0.5687 0.3819 -0.0386 0.0492  -0.0484 59  GLU A OE2   
489  N N     . ILE A 60  ? 0.5133 0.4028 0.3472 0.0054  0.0342  -0.0363 60  ILE A N     
490  C CA    . ILE A 60  ? 0.5069 0.3767 0.3280 0.0057  0.0310  -0.0229 60  ILE A CA    
491  C C     . ILE A 60  ? 0.4996 0.3693 0.3049 -0.0025 0.0334  -0.0212 60  ILE A C     
492  O O     . ILE A 60  ? 0.5057 0.3809 0.3126 -0.0072 0.0370  -0.0292 60  ILE A O     
493  C CB    . ILE A 60  ? 0.5202 0.3728 0.3534 0.0105  0.0306  -0.0209 60  ILE A CB    
494  C CG1   . ILE A 60  ? 0.5217 0.3717 0.3767 0.0195  0.0255  -0.0215 60  ILE A CG1   
495  C CG2   . ILE A 60  ? 0.5241 0.3625 0.3428 0.0088  0.0297  -0.0064 60  ILE A CG2   
496  C CD1   . ILE A 60  ? 0.5250 0.3575 0.3983 0.0234  0.0230  -0.0195 60  ILE A CD1   
497  N N     . ASP A 61  ? 0.4967 0.3612 0.2880 -0.0040 0.0304  -0.0120 61  ASP A N     
498  C CA    . ASP A 61  ? 0.4916 0.3536 0.2731 -0.0099 0.0311  -0.0097 61  ASP A CA    
499  C C     . ASP A 61  ? 0.4946 0.3433 0.2735 -0.0073 0.0334  -0.0038 61  ASP A C     
500  O O     . ASP A 61  ? 0.5185 0.3615 0.2910 -0.0029 0.0323  0.0027  61  ASP A O     
501  C CB    . ASP A 61  ? 0.4806 0.3467 0.2536 -0.0133 0.0259  -0.0062 61  ASP A CB    
502  C CG    . ASP A 61  ? 0.5037 0.3858 0.2803 -0.0184 0.0238  -0.0087 61  ASP A CG    
503  O OD1   . ASP A 61  ? 0.5177 0.4033 0.2963 -0.0160 0.0199  -0.0071 61  ASP A OD1   
504  O OD2   . ASP A 61  ? 0.5104 0.4039 0.2875 -0.0259 0.0258  -0.0116 61  ASP A OD2   
505  N N     . VAL A 62  ? 0.4896 0.3359 0.2731 -0.0108 0.0366  -0.0056 62  VAL A N     
506  C CA    . VAL A 62  ? 0.4883 0.3263 0.2721 -0.0104 0.0400  0.0004  62  VAL A CA    
507  C C     . VAL A 62  ? 0.4743 0.3162 0.2558 -0.0147 0.0393  -0.0005 62  VAL A C     
508  O O     . VAL A 62  ? 0.4740 0.3215 0.2585 -0.0200 0.0367  -0.0049 62  VAL A O     
509  C CB    . VAL A 62  ? 0.4929 0.3248 0.2909 -0.0118 0.0426  -0.0009 62  VAL A CB    
510  C CG1   . VAL A 62  ? 0.5008 0.3269 0.3013 -0.0127 0.0467  0.0083  62  VAL A CG1   
511  C CG2   . VAL A 62  ? 0.5072 0.3344 0.3141 -0.0071 0.0409  -0.0018 62  VAL A CG2   
512  N N     . PHE A 63  ? 0.4710 0.3115 0.2479 -0.0123 0.0410  0.0033  63  PHE A N     
513  C CA    . PHE A 63  ? 0.4588 0.3024 0.2392 -0.0144 0.0391  0.0015  63  PHE A CA    
514  C C     . PHE A 63  ? 0.4639 0.3081 0.2537 -0.0146 0.0453  0.0035  63  PHE A C     
515  O O     . PHE A 63  ? 0.4812 0.3250 0.2680 -0.0120 0.0522  0.0080  63  PHE A O     
516  C CB    . PHE A 63  ? 0.4496 0.2934 0.2225 -0.0107 0.0354  -0.0003 63  PHE A CB    
517  C CG    . PHE A 63  ? 0.4476 0.2930 0.2210 -0.0146 0.0262  -0.0015 63  PHE A CG    
518  C CD1   . PHE A 63  ? 0.4445 0.2939 0.2150 -0.0179 0.0242  -0.0010 63  PHE A CD1   
519  C CD2   . PHE A 63  ? 0.4143 0.2586 0.1943 -0.0152 0.0193  -0.0029 63  PHE A CD2   
520  C CE1   . PHE A 63  ? 0.4315 0.2860 0.2025 -0.0237 0.0166  0.0003  63  PHE A CE1   
521  C CE2   . PHE A 63  ? 0.3844 0.2296 0.1666 -0.0209 0.0094  -0.0004 63  PHE A CE2   
522  C CZ    . PHE A 63  ? 0.4091 0.2606 0.1854 -0.0259 0.0086  0.0023  63  PHE A CZ    
523  N N     . LEU A 64  ? 0.4513 0.2986 0.2531 -0.0189 0.0422  0.0017  64  LEU A N     
524  C CA    . LEU A 64  ? 0.4427 0.2935 0.2588 -0.0198 0.0472  0.0032  64  LEU A CA    
525  C C     . LEU A 64  ? 0.4414 0.2974 0.2647 -0.0160 0.0464  0.0001  64  LEU A C     
526  O O     . LEU A 64  ? 0.4355 0.2908 0.2627 -0.0167 0.0368  -0.0022 64  LEU A O     
527  C CB    . LEU A 64  ? 0.4364 0.2881 0.2651 -0.0268 0.0428  0.0024  64  LEU A CB    
528  C CG    . LEU A 64  ? 0.4460 0.2933 0.2705 -0.0303 0.0412  -0.0001 64  LEU A CG    
529  C CD1   . LEU A 64  ? 0.4427 0.2945 0.2734 -0.0376 0.0336  -0.0044 64  LEU A CD1   
530  C CD2   . LEU A 64  ? 0.4432 0.2842 0.2746 -0.0299 0.0478  0.0033  64  LEU A CD2   
531  N N     . LEU A 65  ? 0.4450 0.3075 0.2717 -0.0123 0.0564  0.0002  65  LEU A N     
532  C CA    . LEU A 65  ? 0.4455 0.3158 0.2810 -0.0065 0.0584  -0.0067 65  LEU A CA    
533  C C     . LEU A 65  ? 0.4437 0.3238 0.3060 -0.0080 0.0608  -0.0073 65  LEU A C     
534  O O     . LEU A 65  ? 0.4550 0.3440 0.3238 -0.0101 0.0717  -0.0032 65  LEU A O     
535  C CB    . LEU A 65  ? 0.4561 0.3328 0.2756 -0.0013 0.0692  -0.0085 65  LEU A CB    
536  C CG    . LEU A 65  ? 0.4598 0.3277 0.2545 -0.0001 0.0654  -0.0067 65  LEU A CG    
537  C CD1   . LEU A 65  ? 0.4491 0.3255 0.2255 0.0034  0.0749  -0.0066 65  LEU A CD1   
538  C CD2   . LEU A 65  ? 0.4484 0.3084 0.2415 0.0021  0.0527  -0.0136 65  LEU A CD2   
539  N N     . PHE A 66  ? 0.4315 0.3105 0.3113 -0.0079 0.0495  -0.0107 66  PHE A N     
540  C CA    . PHE A 66  ? 0.4173 0.3056 0.3268 -0.0092 0.0477  -0.0109 66  PHE A CA    
541  C C     . PHE A 66  ? 0.4164 0.3142 0.3481 -0.0001 0.0490  -0.0212 66  PHE A C     
542  O O     . PHE A 66  ? 0.4188 0.3114 0.3441 0.0065  0.0454  -0.0288 66  PHE A O     
543  C CB    . PHE A 66  ? 0.4149 0.2964 0.3308 -0.0165 0.0314  -0.0058 66  PHE A CB    
544  C CG    . PHE A 66  ? 0.4224 0.3002 0.3267 -0.0254 0.0314  -0.0002 66  PHE A CG    
545  C CD1   . PHE A 66  ? 0.4368 0.3209 0.3572 -0.0302 0.0355  0.0021  66  PHE A CD1   
546  C CD2   . PHE A 66  ? 0.4458 0.3147 0.3263 -0.0288 0.0272  0.0012  66  PHE A CD2   
547  C CE1   . PHE A 66  ? 0.4385 0.3173 0.3515 -0.0378 0.0341  0.0042  66  PHE A CE1   
548  C CE2   . PHE A 66  ? 0.4469 0.3131 0.3197 -0.0355 0.0274  0.0022  66  PHE A CE2   
549  C CZ    . PHE A 66  ? 0.4466 0.3164 0.3357 -0.0397 0.0302  0.0029  66  PHE A CZ    
550  N N     . PRO A 67  ? 0.4123 0.3248 0.3734 0.0007  0.0535  -0.0229 67  PRO A N     
551  C CA    . PRO A 67  ? 0.4197 0.3436 0.4090 0.0106  0.0545  -0.0353 67  PRO A CA    
552  C C     . PRO A 67  ? 0.4272 0.3378 0.4309 0.0140  0.0341  -0.0379 67  PRO A C     
553  O O     . PRO A 67  ? 0.4200 0.3216 0.4286 0.0067  0.0182  -0.0275 67  PRO A O     
554  C CB    . PRO A 67  ? 0.4155 0.3572 0.4379 0.0081  0.0594  -0.0331 67  PRO A CB    
555  C CG    . PRO A 67  ? 0.4120 0.3542 0.4174 -0.0023 0.0682  -0.0214 67  PRO A CG    
556  C CD    . PRO A 67  ? 0.4136 0.3340 0.3871 -0.0074 0.0580  -0.0148 67  PRO A CD    
557  N N     . GLU A 68  ? 0.4476 0.3578 0.4586 0.0246  0.0338  -0.0518 68  GLU A N     
558  C CA    . GLU A 68  ? 0.4618 0.3567 0.4897 0.0277  0.0128  -0.0535 68  GLU A CA    
559  C C     . GLU A 68  ? 0.4510 0.3461 0.5156 0.0251  -0.0038 -0.0457 68  GLU A C     
560  O O     . GLU A 68  ? 0.4476 0.3275 0.5168 0.0204  -0.0248 -0.0358 68  GLU A O     
561  C CB    . GLU A 68  ? 0.4821 0.3791 0.5242 0.0414  0.0155  -0.0742 68  GLU A CB    
562  C CG    . GLU A 68  ? 0.5417 0.4168 0.5735 0.0417  -0.0006 -0.0747 68  GLU A CG    
563  C CD    . GLU A 68  ? 0.6174 0.4847 0.6907 0.0516  -0.0167 -0.0870 68  GLU A CD    
564  O OE1   . GLU A 68  ? 0.6293 0.4902 0.7337 0.0488  -0.0350 -0.0762 68  GLU A OE1   
565  O OE2   . GLU A 68  ? 0.6755 0.5430 0.7510 0.0623  -0.0124 -0.1078 68  GLU A OE2   
566  N N     . GLU A 69  ? 0.4451 0.3592 0.5359 0.0270  0.0049  -0.0485 69  GLU A N     
567  C CA    . GLU A 69  ? 0.4431 0.3611 0.5754 0.0263  -0.0112 -0.0432 69  GLU A CA    
568  C C     . GLU A 69  ? 0.4270 0.3383 0.5479 0.0115  -0.0254 -0.0234 69  GLU A C     
569  O O     . GLU A 69  ? 0.4398 0.3501 0.5891 0.0090  -0.0450 -0.0156 69  GLU A O     
570  C CB    . GLU A 69  ? 0.4451 0.3893 0.6143 0.0335  0.0032  -0.0541 69  GLU A CB    
571  C CG    . GLU A 69  ? 0.4723 0.4298 0.6529 0.0483  0.0198  -0.0769 69  GLU A CG    
572  C CD    . GLU A 69  ? 0.4842 0.4562 0.6294 0.0463  0.0470  -0.0808 69  GLU A CD    
573  O OE1   . GLU A 69  ? 0.4804 0.4804 0.6449 0.0502  0.0659  -0.0896 69  GLU A OE1   
574  O OE2   . GLU A 69  ? 0.4759 0.4330 0.5762 0.0403  0.0490  -0.0739 69  GLU A OE2   
575  N N     . PHE A 70  ? 0.4040 0.3117 0.4851 0.0020  -0.0165 -0.0165 70  PHE A N     
576  C CA    . PHE A 70  ? 0.3918 0.2942 0.4564 -0.0119 -0.0283 -0.0021 70  PHE A CA    
577  C C     . PHE A 70  ? 0.4060 0.2957 0.4696 -0.0172 -0.0527 0.0088  70  PHE A C     
578  O O     . PHE A 70  ? 0.4095 0.2875 0.4659 -0.0135 -0.0579 0.0080  70  PHE A O     
579  C CB    . PHE A 70  ? 0.3708 0.2680 0.3929 -0.0184 -0.0158 -0.0002 70  PHE A CB    
580  C CG    . PHE A 70  ? 0.3431 0.2507 0.3655 -0.0216 -0.0004 -0.0013 70  PHE A CG    
581  C CD1   . PHE A 70  ? 0.3290 0.2530 0.3816 -0.0161 0.0108  -0.0069 70  PHE A CD1   
582  C CD2   . PHE A 70  ? 0.3248 0.2265 0.3190 -0.0304 0.0033  0.0029  70  PHE A CD2   
583  C CE1   . PHE A 70  ? 0.3252 0.2589 0.3795 -0.0214 0.0246  -0.0049 70  PHE A CE1   
584  C CE2   . PHE A 70  ? 0.2940 0.2021 0.2917 -0.0342 0.0154  0.0031  70  PHE A CE2   
585  C CZ    . PHE A 70  ? 0.3058 0.2294 0.3330 -0.0307 0.0258  0.0009  70  PHE A CZ    
586  N N     . SER A 71  ? 0.4169 0.3098 0.4873 -0.0273 -0.0686 0.0202  71  SER A N     
587  C CA    . SER A 71  ? 0.4356 0.3199 0.4989 -0.0363 -0.0920 0.0350  71  SER A CA    
588  C C     . SER A 71  ? 0.4442 0.3226 0.4604 -0.0458 -0.0877 0.0397  71  SER A C     
589  O O     . SER A 71  ? 0.4380 0.3198 0.4301 -0.0475 -0.0709 0.0330  71  SER A O     
590  C CB    . SER A 71  ? 0.4414 0.3342 0.5221 -0.0455 -0.1108 0.0460  71  SER A CB    
591  O OG    . SER A 71  ? 0.4377 0.3383 0.4941 -0.0558 -0.1043 0.0457  71  SER A OG    
592  N N     . LYS A 72  ? 0.4685 0.3390 0.4753 -0.0522 -0.1039 0.0519  72  LYS A N     
593  C CA    . LYS A 72  ? 0.4858 0.3552 0.4520 -0.0626 -0.1019 0.0580  72  LYS A CA    
594  C C     . LYS A 72  ? 0.4895 0.3706 0.4322 -0.0733 -0.0984 0.0580  72  LYS A C     
595  O O     . LYS A 72  ? 0.4833 0.3667 0.3949 -0.0770 -0.0861 0.0529  72  LYS A O     
596  C CB    . LYS A 72  ? 0.5018 0.3657 0.4683 -0.0714 -0.1237 0.0759  72  LYS A CB    
597  C CG    . LYS A 72  ? 0.5548 0.4093 0.5058 -0.0701 -0.1188 0.0757  72  LYS A CG    
598  C CD    . LYS A 72  ? 0.6256 0.4891 0.5361 -0.0844 -0.1159 0.0838  72  LYS A CD    
599  C CE    . LYS A 72  ? 0.6337 0.4941 0.5242 -0.0787 -0.0971 0.0721  72  LYS A CE    
600  N NZ    . LYS A 72  ? 0.6231 0.4905 0.4988 -0.0742 -0.0774 0.0571  72  LYS A NZ    
601  N N     . GLU A 73  ? 0.5013 0.3901 0.4620 -0.0776 -0.1100 0.0620  73  GLU A N     
602  C CA    . GLU A 73  ? 0.5191 0.4189 0.4605 -0.0884 -0.1101 0.0602  73  GLU A CA    
603  C C     . GLU A 73  ? 0.5048 0.4054 0.4467 -0.0821 -0.0893 0.0440  73  GLU A C     
604  O O     . GLU A 73  ? 0.4994 0.4041 0.4181 -0.0885 -0.0828 0.0373  73  GLU A O     
605  C CB    . GLU A 73  ? 0.5341 0.4421 0.4967 -0.0955 -0.1317 0.0699  73  GLU A CB    
606  C CG    . GLU A 73  ? 0.6008 0.5205 0.5311 -0.1130 -0.1447 0.0777  73  GLU A CG    
607  C CD    . GLU A 73  ? 0.6514 0.5775 0.5507 -0.1172 -0.1284 0.0616  73  GLU A CD    
608  O OE1   . GLU A 73  ? 0.6741 0.6034 0.5388 -0.1225 -0.1212 0.0599  73  GLU A OE1   
609  O OE2   . GLU A 73  ? 0.6674 0.5955 0.5806 -0.1152 -0.1231 0.0503  73  GLU A OE2   
610  N N     . GLU A 74  ? 0.4993 0.3967 0.4693 -0.0697 -0.0792 0.0378  74  GLU A N     
611  C CA    . GLU A 74  ? 0.4870 0.3859 0.4606 -0.0645 -0.0593 0.0264  74  GLU A CA    
612  C C     . GLU A 74  ? 0.4823 0.3737 0.4269 -0.0611 -0.0431 0.0207  74  GLU A C     
613  O O     . GLU A 74  ? 0.4757 0.3666 0.4079 -0.0632 -0.0321 0.0145  74  GLU A O     
614  C CB    . GLU A 74  ? 0.4749 0.3783 0.4856 -0.0536 -0.0524 0.0224  74  GLU A CB    
615  C CG    . GLU A 74  ? 0.4842 0.3990 0.5233 -0.0574 -0.0555 0.0219  74  GLU A CG    
616  C CD    . GLU A 74  ? 0.4868 0.4113 0.5701 -0.0477 -0.0545 0.0197  74  GLU A CD    
617  O OE1   . GLU A 74  ? 0.4654 0.3861 0.5600 -0.0392 -0.0593 0.0195  74  GLU A OE1   
618  O OE2   . GLU A 74  ? 0.4899 0.4268 0.5994 -0.0490 -0.0494 0.0173  74  GLU A OE2   
619  N N     . LEU A 75  ? 0.4782 0.3629 0.4154 -0.0561 -0.0441 0.0232  75  LEU A N     
620  C CA    . LEU A 75  ? 0.4734 0.3514 0.3853 -0.0525 -0.0317 0.0190  75  LEU A CA    
621  C C     . LEU A 75  ? 0.4799 0.3603 0.3644 -0.0619 -0.0316 0.0186  75  LEU A C     
622  O O     . LEU A 75  ? 0.4886 0.3663 0.3584 -0.0596 -0.0190 0.0121  75  LEU A O     
623  C CB    . LEU A 75  ? 0.4711 0.3423 0.3815 -0.0491 -0.0388 0.0232  75  LEU A CB    
624  C CG    . LEU A 75  ? 0.4653 0.3294 0.3637 -0.0408 -0.0276 0.0172  75  LEU A CG    
625  C CD1   . LEU A 75  ? 0.4621 0.3250 0.3315 -0.0468 -0.0261 0.0195  75  LEU A CD1   
626  C CD2   . LEU A 75  ? 0.4416 0.3076 0.3430 -0.0323 -0.0096 0.0079  75  LEU A CD2   
627  N N     . ARG A 76  ? 0.4936 0.3806 0.3729 -0.0725 -0.0466 0.0251  76  ARG A N     
628  C CA    . ARG A 76  ? 0.5035 0.3980 0.3556 -0.0826 -0.0479 0.0231  76  ARG A CA    
629  C C     . ARG A 76  ? 0.5101 0.4077 0.3610 -0.0851 -0.0416 0.0114  76  ARG A C     
630  O O     . ARG A 76  ? 0.5111 0.4081 0.3463 -0.0844 -0.0313 0.0018  76  ARG A O     
631  C CB    . ARG A 76  ? 0.5185 0.4219 0.3657 -0.0943 -0.0672 0.0355  76  ARG A CB    
632  C CG    . ARG A 76  ? 0.5381 0.4546 0.3535 -0.1061 -0.0690 0.0350  76  ARG A CG    
633  C CD    . ARG A 76  ? 0.5701 0.4975 0.3818 -0.1192 -0.0898 0.0497  76  ARG A CD    
634  N NE    . ARG A 76  ? 0.6117 0.5567 0.3940 -0.1312 -0.0902 0.0432  76  ARG A NE    
635  C CZ    . ARG A 76  ? 0.6295 0.5790 0.4100 -0.1324 -0.0870 0.0277  76  ARG A CZ    
636  N NH1   . ARG A 76  ? 0.6260 0.5638 0.4337 -0.1237 -0.0835 0.0202  76  ARG A NH1   
637  N NH2   . ARG A 76  ? 0.6596 0.6270 0.4114 -0.1432 -0.0875 0.0189  76  ARG A NH2   
638  N N     . GLU A 77  ? 0.5115 0.4122 0.3824 -0.0880 -0.0494 0.0119  77  GLU A N     
639  C CA    . GLU A 77  ? 0.5277 0.4299 0.4028 -0.0914 -0.0463 0.0011  77  GLU A CA    
640  C C     . GLU A 77  ? 0.5121 0.4041 0.3931 -0.0830 -0.0286 -0.0065 77  GLU A C     
641  O O     . GLU A 77  ? 0.5081 0.3976 0.3806 -0.0849 -0.0235 -0.0171 77  GLU A O     
642  C CB    . GLU A 77  ? 0.5281 0.4350 0.4314 -0.0946 -0.0572 0.0046  77  GLU A CB    
643  C CG    . GLU A 77  ? 0.5756 0.4938 0.4728 -0.1060 -0.0781 0.0110  77  GLU A CG    
644  C CD    . GLU A 77  ? 0.5815 0.5051 0.5109 -0.1090 -0.0897 0.0132  77  GLU A CD    
645  O OE1   . GLU A 77  ? 0.6388 0.5722 0.5654 -0.1190 -0.1093 0.0191  77  GLU A OE1   
646  O OE2   . GLU A 77  ? 0.6129 0.5329 0.5709 -0.1021 -0.0796 0.0102  77  GLU A OE2   
647  N N     . ARG A 78  ? 0.4990 0.3860 0.3953 -0.0740 -0.0202 -0.0012 78  ARG A N     
648  C CA    . ARG A 78  ? 0.4949 0.3745 0.3968 -0.0676 -0.0046 -0.0043 78  ARG A CA    
649  C C     . ARG A 78  ? 0.4951 0.3678 0.3728 -0.0637 0.0035  -0.0079 78  ARG A C     
650  O O     . ARG A 78  ? 0.4943 0.3607 0.3703 -0.0631 0.0102  -0.0136 78  ARG A O     
651  C CB    . ARG A 78  ? 0.4850 0.3666 0.4075 -0.0601 0.0030  0.0014  78  ARG A CB    
652  C CG    . ARG A 78  ? 0.4764 0.3675 0.4301 -0.0631 -0.0031 0.0038  78  ARG A CG    
653  C CD    . ARG A 78  ? 0.4745 0.3675 0.4484 -0.0650 0.0069  0.0036  78  ARG A CD    
654  N NE    . ARG A 78  ? 0.4638 0.3468 0.4265 -0.0698 0.0096  -0.0007 78  ARG A NE    
655  C CZ    . ARG A 78  ? 0.4688 0.3444 0.4275 -0.0668 0.0222  0.0013  78  ARG A CZ    
656  N NH1   . ARG A 78  ? 0.4445 0.3238 0.4040 -0.0602 0.0347  0.0076  78  ARG A NH1   
657  N NH2   . ARG A 78  ? 0.4884 0.3533 0.4430 -0.0707 0.0216  -0.0033 78  ARG A NH2   
658  N N     . GLY A 79  ? 0.4863 0.3602 0.3494 -0.0613 0.0011  -0.0042 79  GLY A N     
659  C CA    . GLY A 79  ? 0.4879 0.3586 0.3303 -0.0585 0.0068  -0.0072 79  GLY A CA    
660  C C     . GLY A 79  ? 0.4954 0.3687 0.3270 -0.0635 0.0068  -0.0175 79  GLY A C     
661  O O     . GLY A 79  ? 0.4945 0.3619 0.3234 -0.0590 0.0148  -0.0233 79  GLY A O     
662  N N     . LEU A 80  ? 0.4994 0.3826 0.3261 -0.0726 -0.0031 -0.0204 80  LEU A N     
663  C CA    . LEU A 80  ? 0.5161 0.4061 0.3303 -0.0778 -0.0035 -0.0337 80  LEU A CA    
664  C C     . LEU A 80  ? 0.5205 0.4015 0.3518 -0.0764 -0.0004 -0.0438 80  LEU A C     
665  O O     . LEU A 80  ? 0.5243 0.4019 0.3543 -0.0738 0.0048  -0.0563 80  LEU A O     
666  C CB    . LEU A 80  ? 0.5307 0.4367 0.3314 -0.0895 -0.0159 -0.0331 80  LEU A CB    
667  C CG    . LEU A 80  ? 0.5479 0.4670 0.3262 -0.0943 -0.0182 -0.0259 80  LEU A CG    
668  C CD1   . LEU A 80  ? 0.5457 0.4557 0.3283 -0.0867 -0.0145 -0.0134 80  LEU A CD1   
669  C CD2   . LEU A 80  ? 0.5451 0.4793 0.3117 -0.1074 -0.0334 -0.0173 80  LEU A CD2   
670  N N     . GLU A 81  ? 0.5185 0.3954 0.3698 -0.0780 -0.0042 -0.0381 81  GLU A N     
671  C CA    . GLU A 81  ? 0.5282 0.3963 0.4002 -0.0789 -0.0029 -0.0446 81  GLU A CA    
672  C C     . GLU A 81  ? 0.5156 0.3703 0.3921 -0.0706 0.0085  -0.0450 81  GLU A C     
673  O O     . GLU A 81  ? 0.5205 0.3679 0.4030 -0.0704 0.0089  -0.0571 81  GLU A O     
674  C CB    . GLU A 81  ? 0.5174 0.3858 0.4135 -0.0807 -0.0056 -0.0341 81  GLU A CB    
675  C CG    . GLU A 81  ? 0.5520 0.4231 0.4650 -0.0896 -0.0158 -0.0408 81  GLU A CG    
676  C CD    . GLU A 81  ? 0.5692 0.4417 0.5136 -0.0906 -0.0154 -0.0300 81  GLU A CD    
677  O OE1   . GLU A 81  ? 0.5941 0.4746 0.5437 -0.0878 -0.0159 -0.0195 81  GLU A OE1   
678  O OE2   . GLU A 81  ? 0.6141 0.4804 0.5810 -0.0944 -0.0147 -0.0326 81  GLU A OE2   
679  N N     . ILE A 82  ? 0.4950 0.3468 0.3690 -0.0639 0.0161  -0.0326 82  ILE A N     
680  C CA    . ILE A 82  ? 0.4904 0.3306 0.3681 -0.0569 0.0251  -0.0286 82  ILE A CA    
681  C C     . ILE A 82  ? 0.4910 0.3293 0.3553 -0.0524 0.0268  -0.0380 82  ILE A C     
682  O O     . ILE A 82  ? 0.4888 0.3160 0.3632 -0.0488 0.0291  -0.0415 82  ILE A O     
683  C CB    . ILE A 82  ? 0.4777 0.3187 0.3529 -0.0515 0.0323  -0.0146 82  ILE A CB    
684  C CG1   . ILE A 82  ? 0.4814 0.3270 0.3757 -0.0545 0.0337  -0.0069 82  ILE A CG1   
685  C CG2   . ILE A 82  ? 0.4838 0.3149 0.3588 -0.0459 0.0398  -0.0086 82  ILE A CG2   
686  C CD1   . ILE A 82  ? 0.4984 0.3517 0.3886 -0.0493 0.0383  0.0005  82  ILE A CD1   
687  N N     . GLY A 83  ? 0.4848 0.3348 0.3295 -0.0531 0.0248  -0.0409 83  GLY A N     
688  C CA    . GLY A 83  ? 0.4805 0.3348 0.3132 -0.0495 0.0273  -0.0495 83  GLY A CA    
689  C C     . GLY A 83  ? 0.4934 0.3485 0.3332 -0.0512 0.0256  -0.0681 83  GLY A C     
690  O O     . GLY A 83  ? 0.5030 0.3505 0.3526 -0.0447 0.0289  -0.0755 83  GLY A O     
691  N N     . LYS A 84  ? 0.4969 0.3613 0.3333 -0.0596 0.0192  -0.0766 84  LYS A N     
692  C CA    . LYS A 84  ? 0.5129 0.3772 0.3580 -0.0620 0.0161  -0.0974 84  LYS A CA    
693  C C     . LYS A 84  ? 0.5153 0.3577 0.3895 -0.0578 0.0160  -0.0993 84  LYS A C     
694  O O     . LYS A 84  ? 0.5346 0.3721 0.4211 -0.0550 0.0151  -0.1181 84  LYS A O     
695  C CB    . LYS A 84  ? 0.5188 0.3948 0.3567 -0.0731 0.0069  -0.1026 84  LYS A CB    
696  C CG    . LYS A 84  ? 0.5421 0.4425 0.3511 -0.0800 0.0046  -0.1062 84  LYS A CG    
697  C CD    . LYS A 84  ? 0.5594 0.4715 0.3607 -0.0920 -0.0072 -0.1112 84  LYS A CD    
698  C CE    . LYS A 84  ? 0.6021 0.5128 0.4061 -0.0964 -0.0150 -0.0881 84  LYS A CE    
699  N NZ    . LYS A 84  ? 0.6116 0.5201 0.4303 -0.1034 -0.0266 -0.0890 84  LYS A NZ    
700  N N     . ALA A 85  ? 0.5014 0.3318 0.3886 -0.0577 0.0169  -0.0806 85  ALA A N     
701  C CA    . ALA A 85  ? 0.5105 0.3216 0.4266 -0.0571 0.0156  -0.0783 85  ALA A CA    
702  C C     . ALA A 85  ? 0.5152 0.3131 0.4398 -0.0480 0.0200  -0.0743 85  ALA A C     
703  O O     . ALA A 85  ? 0.5235 0.3039 0.4737 -0.0470 0.0169  -0.0748 85  ALA A O     
704  C CB    . ALA A 85  ? 0.4988 0.3070 0.4267 -0.0619 0.0162  -0.0593 85  ALA A CB    
705  N N     . VAL A 86  ? 0.5064 0.3124 0.4114 -0.0420 0.0254  -0.0694 86  VAL A N     
706  C CA    . VAL A 86  ? 0.5111 0.3070 0.4209 -0.0337 0.0286  -0.0601 86  VAL A CA    
707  C C     . VAL A 86  ? 0.5216 0.3218 0.4317 -0.0261 0.0289  -0.0771 86  VAL A C     
708  O O     . VAL A 86  ? 0.5369 0.3247 0.4642 -0.0188 0.0274  -0.0756 86  VAL A O     
709  C CB    . VAL A 86  ? 0.4917 0.2934 0.3826 -0.0323 0.0340  -0.0409 86  VAL A CB    
710  C CG1   . VAL A 86  ? 0.4907 0.2945 0.3719 -0.0242 0.0361  -0.0398 86  VAL A CG1   
711  C CG2   . VAL A 86  ? 0.4973 0.2893 0.3986 -0.0349 0.0361  -0.0214 86  VAL A CG2   
712  N N     . LEU A 87  ? 0.5148 0.3346 0.4078 -0.0282 0.0303  -0.0924 87  LEU A N     
713  C CA    . LEU A 87  ? 0.5116 0.3429 0.4048 -0.0221 0.0328  -0.1105 87  LEU A CA    
714  C C     . LEU A 87  ? 0.5352 0.3631 0.4501 -0.0203 0.0294  -0.1370 87  LEU A C     
715  O O     . LEU A 87  ? 0.5403 0.3645 0.4598 -0.0272 0.0246  -0.1451 87  LEU A O     
716  C CB    . LEU A 87  ? 0.4976 0.3550 0.3622 -0.0272 0.0367  -0.1129 87  LEU A CB    
717  C CG    . LEU A 87  ? 0.4619 0.3200 0.3100 -0.0282 0.0382  -0.0896 87  LEU A CG    
718  C CD1   . LEU A 87  ? 0.4497 0.3303 0.2742 -0.0348 0.0394  -0.0895 87  LEU A CD1   
719  C CD2   . LEU A 87  ? 0.4507 0.3004 0.3071 -0.0186 0.0400  -0.0812 87  LEU A CD2   
720  N N     . ASP A 88  ? 0.5481 0.3775 0.4793 -0.0105 0.0310  -0.1516 88  ASP A N     
721  C CA    . ASP A 88  ? 0.5745 0.4016 0.5305 -0.0061 0.0280  -0.1816 88  ASP A CA    
722  C C     . ASP A 88  ? 0.5876 0.4436 0.5223 -0.0125 0.0321  -0.2067 88  ASP A C     
723  O O     . ASP A 88  ? 0.6031 0.4591 0.5493 -0.0139 0.0283  -0.2325 88  ASP A O     
724  C CB    . ASP A 88  ? 0.5817 0.4065 0.5632 0.0075  0.0289  -0.1910 88  ASP A CB    
725  C CG    . ASP A 88  ? 0.5997 0.3919 0.6124 0.0137  0.0204  -0.1728 88  ASP A CG    
726  O OD1   . ASP A 88  ? 0.6184 0.3895 0.6407 0.0075  0.0139  -0.1618 88  ASP A OD1   
727  O OD2   . ASP A 88  ? 0.6023 0.3913 0.6310 0.0240  0.0194  -0.1684 88  ASP A OD2   
728  N N     . SER A 89  ? 0.5772 0.4586 0.4810 -0.0170 0.0391  -0.1991 89  SER A N     
729  C CA    . SER A 89  ? 0.5962 0.5097 0.4736 -0.0256 0.0434  -0.2164 89  SER A CA    
730  C C     . SER A 89  ? 0.5853 0.5147 0.4318 -0.0331 0.0468  -0.1921 89  SER A C     
731  O O     . SER A 89  ? 0.5763 0.4980 0.4255 -0.0281 0.0486  -0.1722 89  SER A O     
732  C CB    . SER A 89  ? 0.6075 0.5439 0.4945 -0.0183 0.0510  -0.2481 89  SER A CB    
733  O OG    . SER A 89  ? 0.5920 0.5335 0.4879 -0.0095 0.0569  -0.2395 89  SER A OG    
734  N N     . TYR A 90  ? 0.5897 0.5402 0.4081 -0.0457 0.0458  -0.1926 90  TYR A N     
735  C CA    . TYR A 90  ? 0.5753 0.5338 0.3698 -0.0540 0.0449  -0.1660 90  TYR A CA    
736  C C     . TYR A 90  ? 0.5856 0.5790 0.3501 -0.0665 0.0469  -0.1703 90  TYR A C     
737  O O     . TYR A 90  ? 0.6138 0.6297 0.3726 -0.0686 0.0513  -0.1957 90  TYR A O     
738  C CB    . TYR A 90  ? 0.5676 0.5026 0.3639 -0.0577 0.0359  -0.1449 90  TYR A CB    
739  C CG    . TYR A 90  ? 0.5891 0.5227 0.3845 -0.0655 0.0280  -0.1550 90  TYR A CG    
740  C CD1   . TYR A 90  ? 0.5991 0.5538 0.3689 -0.0786 0.0226  -0.1529 90  TYR A CD1   
741  C CD2   . TYR A 90  ? 0.6081 0.5193 0.4298 -0.0608 0.0240  -0.1654 90  TYR A CD2   
742  C CE1   . TYR A 90  ? 0.6047 0.5593 0.3736 -0.0864 0.0131  -0.1627 90  TYR A CE1   
743  C CE2   . TYR A 90  ? 0.6196 0.5298 0.4429 -0.0689 0.0151  -0.1759 90  TYR A CE2   
744  C CZ    . TYR A 90  ? 0.6145 0.5470 0.4106 -0.0813 0.0096  -0.1751 90  TYR A CZ    
745  O OH    . TYR A 90  ? 0.6424 0.5750 0.4398 -0.0896 -0.0009 -0.1851 90  TYR A OH    
746  N N     . GLU A 91  ? 0.5764 0.5748 0.3223 -0.0753 0.0431  -0.1451 91  GLU A N     
747  C CA    . GLU A 91  ? 0.5872 0.6185 0.3049 -0.0888 0.0441  -0.1402 91  GLU A CA    
748  C C     . GLU A 91  ? 0.5613 0.5822 0.2717 -0.0948 0.0356  -0.1087 91  GLU A C     
749  O O     . GLU A 91  ? 0.5463 0.5482 0.2702 -0.0867 0.0362  -0.0951 91  GLU A O     
750  C CB    . GLU A 91  ? 0.5922 0.6482 0.3096 -0.0860 0.0563  -0.1480 91  GLU A CB    
751  C CG    . GLU A 91  ? 0.6540 0.7507 0.3421 -0.1018 0.0597  -0.1461 91  GLU A CG    
752  C CD    . GLU A 91  ? 0.7140 0.8371 0.4062 -0.0997 0.0726  -0.1497 91  GLU A CD    
753  O OE1   . GLU A 91  ? 0.6728 0.7778 0.3844 -0.0903 0.0733  -0.1375 91  GLU A OE1   
754  O OE2   . GLU A 91  ? 0.7371 0.9007 0.4132 -0.1080 0.0819  -0.1654 91  GLU A OE2   
755  N N     . ILE A 92  ? 0.5645 0.5972 0.2550 -0.1087 0.0262  -0.0980 92  ILE A N     
756  C CA    . ILE A 92  ? 0.5451 0.5657 0.2342 -0.1140 0.0152  -0.0695 92  ILE A CA    
757  C C     . ILE A 92  ? 0.5620 0.6109 0.2273 -0.1295 0.0119  -0.0548 92  ILE A C     
758  O O     . ILE A 92  ? 0.5870 0.6571 0.2313 -0.1428 0.0061  -0.0555 92  ILE A O     
759  C CB    . ILE A 92  ? 0.5383 0.5415 0.2345 -0.1156 0.0030  -0.0653 92  ILE A CB    
760  C CG1   . ILE A 92  ? 0.5135 0.4879 0.2364 -0.1013 0.0069  -0.0731 92  ILE A CG1   
761  C CG2   . ILE A 92  ? 0.5309 0.5271 0.2271 -0.1217 -0.0094 -0.0382 92  ILE A CG2   
762  C CD1   . ILE A 92  ? 0.5031 0.4645 0.2375 -0.1027 -0.0020 -0.0751 92  ILE A CD1   
763  N N     . ARG A 93  ? 0.5552 0.6061 0.2237 -0.1288 0.0156  -0.0413 93  ARG A N     
764  C CA    . ARG A 93  ? 0.5715 0.6462 0.2222 -0.1447 0.0112  -0.0215 93  ARG A CA    
765  C C     . ARG A 93  ? 0.5458 0.5983 0.2123 -0.1414 0.0040  0.0012  93  ARG A C     
766  O O     . ARG A 93  ? 0.5374 0.5799 0.2184 -0.1306 0.0115  -0.0025 93  ARG A O     
767  C CB    . ARG A 93  ? 0.5895 0.7002 0.2286 -0.1494 0.0261  -0.0337 93  ARG A CB    
768  C CG    . ARG A 93  ? 0.6450 0.7871 0.2630 -0.1563 0.0328  -0.0569 93  ARG A CG    
769  C CD    . ARG A 93  ? 0.7251 0.8957 0.3112 -0.1789 0.0231  -0.0399 93  ARG A CD    
770  N NE    . ARG A 93  ? 0.7778 0.9945 0.3430 -0.1930 0.0341  -0.0384 93  ARG A NE    
771  C CZ    . ARG A 93  ? 0.8322 1.0816 0.3661 -0.2150 0.0281  -0.0222 93  ARG A CZ    
772  N NH1   . ARG A 93  ? 0.8534 1.0935 0.3739 -0.2251 0.0091  -0.0058 93  ARG A NH1   
773  N NH2   . ARG A 93  ? 0.8547 1.1490 0.3713 -0.2278 0.0408  -0.0211 93  ARG A NH2   
774  N N     . TYR A 94  ? 0.5412 0.5850 0.2070 -0.1500 -0.0121 0.0236  94  TYR A N     
775  C CA    . TYR A 94  ? 0.5157 0.5392 0.1984 -0.1474 -0.0206 0.0432  94  TYR A CA    
776  C C     . TYR A 94  ? 0.5318 0.5632 0.2080 -0.1649 -0.0377 0.0711  94  TYR A C     
777  O O     . TYR A 94  ? 0.5505 0.6010 0.2080 -0.1784 -0.0442 0.0768  94  TYR A O     
778  C CB    . TYR A 94  ? 0.4830 0.4729 0.1876 -0.1315 -0.0234 0.0384  94  TYR A CB    
779  C CG    . TYR A 94  ? 0.4751 0.4571 0.1825 -0.1329 -0.0336 0.0393  94  TYR A CG    
780  C CD1   . TYR A 94  ? 0.4513 0.4249 0.1674 -0.1393 -0.0515 0.0597  94  TYR A CD1   
781  C CD2   . TYR A 94  ? 0.4516 0.4332 0.1577 -0.1275 -0.0269 0.0198  94  TYR A CD2   
782  C CE1   . TYR A 94  ? 0.4538 0.4216 0.1767 -0.1401 -0.0620 0.0609  94  TYR A CE1   
783  C CE2   . TYR A 94  ? 0.4273 0.4026 0.1392 -0.1294 -0.0373 0.0208  94  TYR A CE2   
784  C CZ    . TYR A 94  ? 0.4629 0.4327 0.1828 -0.1357 -0.0546 0.0416  94  TYR A CZ    
785  O OH    . TYR A 94  ? 0.4748 0.4403 0.2043 -0.1376 -0.0663 0.0436  94  TYR A OH    
786  N N     . ALA A 95  ? 0.5280 0.5450 0.2200 -0.1653 -0.0464 0.0887  95  ALA A N     
787  C CA    . ALA A 95  ? 0.5490 0.5710 0.2400 -0.1825 -0.0648 0.1177  95  ALA A CA    
788  C C     . ALA A 95  ? 0.5515 0.5450 0.2644 -0.1778 -0.0839 0.1291  95  ALA A C     
789  O O     . ALA A 95  ? 0.5750 0.5733 0.2851 -0.1912 -0.1014 0.1496  95  ALA A O     
790  C CB    . ALA A 95  ? 0.5498 0.5765 0.2477 -0.1893 -0.0654 0.1322  95  ALA A CB    
791  N N     . GLU A 96  ? 0.5392 0.5049 0.2747 -0.1591 -0.0809 0.1164  96  GLU A N     
792  C CA    . GLU A 96  ? 0.5433 0.4847 0.3040 -0.1521 -0.0963 0.1224  96  GLU A CA    
793  C C     . GLU A 96  ? 0.5262 0.4509 0.2994 -0.1328 -0.0850 0.1002  96  GLU A C     
794  O O     . GLU A 96  ? 0.5393 0.4606 0.3193 -0.1298 -0.0892 0.0965  96  GLU A O     
795  C CB    . GLU A 96  ? 0.5500 0.4738 0.3347 -0.1536 -0.1122 0.1400  96  GLU A CB    
796  C CG    . GLU A 96  ? 0.5440 0.4437 0.3606 -0.1447 -0.1285 0.1437  96  GLU A CG    
797  C CD    . GLU A 96  ? 0.5343 0.4154 0.3680 -0.1231 -0.1166 0.1202  96  GLU A CD    
798  O OE1   . GLU A 96  ? 0.5084 0.3847 0.3395 -0.1155 -0.1047 0.1093  96  GLU A OE1   
799  O OE2   . GLU A 96  ? 0.5580 0.4317 0.4077 -0.1143 -0.1190 0.1134  96  GLU A OE2   
800  N N     . HIS A 97  ? 0.5128 0.4286 0.2898 -0.1207 -0.0717 0.0868  97  HIS A N     
801  C CA    . HIS A 97  ? 0.5013 0.4035 0.2882 -0.1043 -0.0609 0.0688  97  HIS A CA    
802  C C     . HIS A 97  ? 0.5017 0.4158 0.2721 -0.1030 -0.0463 0.0535  97  HIS A C     
803  O O     . HIS A 97  ? 0.5054 0.4318 0.2608 -0.1049 -0.0358 0.0469  97  HIS A O     
804  C CB    . HIS A 97  ? 0.4935 0.3817 0.2895 -0.0925 -0.0544 0.0617  97  HIS A CB    
805  C CG    . HIS A 97  ? 0.4853 0.3604 0.2925 -0.0772 -0.0456 0.0476  97  HIS A CG    
806  N ND1   . HIS A 97  ? 0.4983 0.3755 0.2960 -0.0702 -0.0299 0.0343  97  HIS A ND1   
807  C CD2   . HIS A 97  ? 0.4883 0.3505 0.3170 -0.0684 -0.0503 0.0453  97  HIS A CD2   
808  C CE1   . HIS A 97  ? 0.4943 0.3610 0.3043 -0.0593 -0.0250 0.0270  97  HIS A CE1   
809  N NE2   . HIS A 97  ? 0.4832 0.3425 0.3117 -0.0576 -0.0359 0.0320  97  HIS A NE2   
810  N N     . PRO A 98  ? 0.5033 0.4138 0.2806 -0.0993 -0.0463 0.0467  98  PRO A N     
811  C CA    . PRO A 98  ? 0.5019 0.4208 0.2680 -0.0988 -0.0355 0.0317  98  PRO A CA    
812  C C     . PRO A 98  ? 0.4894 0.3989 0.2590 -0.0860 -0.0200 0.0182  98  PRO A C     
813  O O     . PRO A 98  ? 0.4804 0.3750 0.2637 -0.0760 -0.0178 0.0186  98  PRO A O     
814  C CB    . PRO A 98  ? 0.5058 0.4195 0.2864 -0.0980 -0.0426 0.0312  98  PRO A CB    
815  C CG    . PRO A 98  ? 0.4975 0.3949 0.3026 -0.0890 -0.0477 0.0381  98  PRO A CG    
816  C CD    . PRO A 98  ? 0.5087 0.4067 0.3095 -0.0946 -0.0565 0.0515  98  PRO A CD    
817  N N     . TYR A 99  ? 0.4914 0.4107 0.2492 -0.0864 -0.0101 0.0059  99  TYR A N     
818  C CA    . TYR A 99  ? 0.4778 0.3884 0.2405 -0.0751 0.0024  -0.0060 99  TYR A CA    
819  C C     . TYR A 99  ? 0.4818 0.4058 0.2359 -0.0780 0.0087  -0.0208 99  TYR A C     
820  O O     . TYR A 99  ? 0.4940 0.4369 0.2339 -0.0887 0.0053  -0.0216 99  TYR A O     
821  C CB    . TYR A 99  ? 0.4768 0.3843 0.2388 -0.0697 0.0063  -0.0023 99  TYR A CB    
822  C CG    . TYR A 99  ? 0.4983 0.4250 0.2480 -0.0774 0.0072  -0.0010 99  TYR A CG    
823  C CD1   . TYR A 99  ? 0.4883 0.4251 0.2356 -0.0737 0.0175  -0.0134 99  TYR A CD1   
824  C CD2   . TYR A 99  ? 0.5114 0.4472 0.2555 -0.0886 -0.0025 0.0137  99  TYR A CD2   
825  C CE1   . TYR A 99  ? 0.5004 0.4594 0.2395 -0.0808 0.0202  -0.0128 99  TYR A CE1   
826  C CE2   . TYR A 99  ? 0.5157 0.4724 0.2497 -0.0975 -0.0006 0.0172  99  TYR A CE2   
827  C CZ    . TYR A 99  ? 0.5153 0.4853 0.2465 -0.0935 0.0119  0.0031  99  TYR A CZ    
828  O OH    . TYR A 99  ? 0.5160 0.5116 0.2399 -0.1025 0.0157  0.0056  99  TYR A OH    
829  N N     . VAL A 100 ? 0.4727 0.3879 0.2355 -0.0687 0.0175  -0.0325 100 VAL A N     
830  C CA    . VAL A 100 ? 0.4762 0.4021 0.2367 -0.0691 0.0231  -0.0505 100 VAL A CA    
831  C C     . VAL A 100 ? 0.4735 0.4002 0.2390 -0.0604 0.0317  -0.0573 100 VAL A C     
832  O O     . VAL A 100 ? 0.4720 0.3823 0.2479 -0.0514 0.0336  -0.0518 100 VAL A O     
833  C CB    . VAL A 100 ? 0.4802 0.3954 0.2527 -0.0677 0.0218  -0.0608 100 VAL A CB    
834  C CG1   . VAL A 100 ? 0.4666 0.3631 0.2524 -0.0640 0.0190  -0.0485 100 VAL A CG1   
835  C CG2   . VAL A 100 ? 0.4750 0.3855 0.2594 -0.0598 0.0288  -0.0785 100 VAL A CG2   
836  N N     . HIS A 101 ? 0.4816 0.4305 0.2396 -0.0638 0.0365  -0.0690 101 HIS A N     
837  C CA    . HIS A 101 ? 0.4737 0.4281 0.2414 -0.0553 0.0444  -0.0788 101 HIS A CA    
838  C C     . HIS A 101 ? 0.4813 0.4320 0.2637 -0.0485 0.0483  -0.1007 101 HIS A C     
839  O O     . HIS A 101 ? 0.4932 0.4495 0.2712 -0.0539 0.0466  -0.1128 101 HIS A O     
840  C CB    . HIS A 101 ? 0.4766 0.4623 0.2319 -0.0631 0.0489  -0.0810 101 HIS A CB    
841  C CG    . HIS A 101 ? 0.4687 0.4631 0.2375 -0.0546 0.0564  -0.0887 101 HIS A CG    
842  N ND1   . HIS A 101 ? 0.4548 0.4314 0.2360 -0.0453 0.0545  -0.0786 101 HIS A ND1   
843  C CD2   . HIS A 101 ? 0.4725 0.4945 0.2454 -0.0541 0.0653  -0.1059 101 HIS A CD2   
844  C CE1   . HIS A 101 ? 0.4465 0.4376 0.2406 -0.0395 0.0603  -0.0876 101 HIS A CE1   
845  N NE2   . HIS A 101 ? 0.4632 0.4824 0.2543 -0.0442 0.0678  -0.1048 101 HIS A NE2   
846  N N     . GLY A 102 ? 0.4733 0.4145 0.2749 -0.0368 0.0518  -0.1063 102 GLY A N     
847  C CA    . GLY A 102 ? 0.4832 0.4190 0.3044 -0.0297 0.0535  -0.1275 102 GLY A CA    
848  C C     . GLY A 102 ? 0.4822 0.4107 0.3276 -0.0168 0.0557  -0.1320 102 GLY A C     
849  O O     . GLY A 102 ? 0.4752 0.4115 0.3196 -0.0140 0.0576  -0.1230 102 GLY A O     
850  N N     . VAL A 103 ? 0.4884 0.4005 0.3580 -0.0092 0.0534  -0.1455 103 VAL A N     
851  C CA    . VAL A 103 ? 0.4874 0.3903 0.3866 0.0037  0.0527  -0.1519 103 VAL A CA    
852  C C     . VAL A 103 ? 0.4932 0.3619 0.4137 0.0083  0.0446  -0.1439 103 VAL A C     
853  O O     . VAL A 103 ? 0.5002 0.3579 0.4246 0.0038  0.0413  -0.1504 103 VAL A O     
854  C CB    . VAL A 103 ? 0.5078 0.4324 0.4232 0.0088  0.0584  -0.1842 103 VAL A CB    
855  C CG1   . VAL A 103 ? 0.5184 0.4280 0.4749 0.0239  0.0545  -0.1944 103 VAL A CG1   
856  C CG2   . VAL A 103 ? 0.5002 0.4628 0.3971 0.0037  0.0678  -0.1890 103 VAL A CG2   
857  N N     . VAL A 104 ? 0.4878 0.3410 0.4220 0.0159  0.0404  -0.1278 104 VAL A N     
858  C CA    . VAL A 104 ? 0.4926 0.3159 0.4502 0.0201  0.0323  -0.1175 104 VAL A CA    
859  C C     . VAL A 104 ? 0.5042 0.3222 0.4927 0.0328  0.0275  -0.1210 104 VAL A C     
860  O O     . VAL A 104 ? 0.4911 0.3186 0.4739 0.0368  0.0280  -0.1111 104 VAL A O     
861  C CB    . VAL A 104 ? 0.4793 0.2886 0.4182 0.0140  0.0303  -0.0875 104 VAL A CB    
862  C CG1   . VAL A 104 ? 0.4952 0.2792 0.4557 0.0186  0.0223  -0.0699 104 VAL A CG1   
863  C CG2   . VAL A 104 ? 0.4722 0.2804 0.3978 0.0037  0.0319  -0.0873 104 VAL A CG2   
864  N N     . LYS A 105 ? 0.5247 0.3279 0.5488 0.0394  0.0216  -0.1367 105 LYS A N     
865  C CA    . LYS A 105 ? 0.5399 0.3359 0.6019 0.0528  0.0146  -0.1418 105 LYS A CA    
866  C C     . LYS A 105 ? 0.5337 0.3604 0.5935 0.0591  0.0216  -0.1536 105 LYS A C     
867  O O     . LYS A 105 ? 0.5272 0.3535 0.5955 0.0655  0.0168  -0.1390 105 LYS A O     
868  C CB    . LYS A 105 ? 0.5454 0.3143 0.6163 0.0541  0.0033  -0.1087 105 LYS A CB    
869  C CG    . LYS A 105 ? 0.5501 0.2878 0.6467 0.0520  -0.0067 -0.1016 105 LYS A CG    
870  C CD    . LYS A 105 ? 0.5602 0.2785 0.6486 0.0470  -0.0141 -0.0625 105 LYS A CD    
871  C CE    . LYS A 105 ? 0.5933 0.2834 0.7260 0.0536  -0.0307 -0.0497 105 LYS A CE    
872  N NZ    . LYS A 105 ? 0.6043 0.2754 0.7807 0.0568  -0.0382 -0.0708 105 LYS A NZ    
873  N N     . GLY A 106 ? 0.5366 0.3918 0.5841 0.0559  0.0328  -0.1789 106 GLY A N     
874  C CA    . GLY A 106 ? 0.5420 0.4314 0.5898 0.0600  0.0414  -0.1925 106 GLY A CA    
875  C C     . GLY A 106 ? 0.5315 0.4365 0.5461 0.0524  0.0454  -0.1699 106 GLY A C     
876  O O     . GLY A 106 ? 0.5282 0.4616 0.5462 0.0548  0.0515  -0.1771 106 GLY A O     
877  N N     . VAL A 107 ? 0.5289 0.4173 0.5144 0.0433  0.0421  -0.1440 107 VAL A N     
878  C CA    . VAL A 107 ? 0.5239 0.4243 0.4815 0.0370  0.0440  -0.1247 107 VAL A CA    
879  C C     . VAL A 107 ? 0.5212 0.4269 0.4415 0.0231  0.0485  -0.1166 107 VAL A C     
880  O O     . VAL A 107 ? 0.5272 0.4175 0.4400 0.0184  0.0470  -0.1147 107 VAL A O     
881  C CB    . VAL A 107 ? 0.5203 0.4012 0.4816 0.0420  0.0339  -0.0994 107 VAL A CB    
882  C CG1   . VAL A 107 ? 0.5238 0.3825 0.5213 0.0531  0.0243  -0.0997 107 VAL A CG1   
883  C CG2   . VAL A 107 ? 0.5212 0.3866 0.4516 0.0333  0.0319  -0.0766 107 VAL A CG2   
884  N N     . GLU A 108 ? 0.5194 0.4471 0.4204 0.0166  0.0527  -0.1113 108 GLU A N     
885  C CA    . GLU A 108 ? 0.5209 0.4572 0.3912 0.0035  0.0554  -0.1041 108 GLU A CA    
886  C C     . GLU A 108 ? 0.5144 0.4287 0.3669 -0.0004 0.0494  -0.0812 108 GLU A C     
887  O O     . GLU A 108 ? 0.5107 0.4147 0.3631 0.0037  0.0446  -0.0667 108 GLU A O     
888  C CB    . GLU A 108 ? 0.5238 0.4912 0.3842 -0.0032 0.0606  -0.1044 108 GLU A CB    
889  C CG    . GLU A 108 ? 0.5581 0.5544 0.4377 0.0011  0.0687  -0.1265 108 GLU A CG    
890  C CD    . GLU A 108 ? 0.6172 0.6382 0.4839 -0.0077 0.0772  -0.1442 108 GLU A CD    
891  O OE1   . GLU A 108 ? 0.6580 0.7148 0.5260 -0.0114 0.0862  -0.1551 108 GLU A OE1   
892  O OE2   . GLU A 108 ? 0.6448 0.6525 0.5000 -0.0117 0.0748  -0.1473 108 GLU A OE2   
893  N N     . VAL A 109 ? 0.5107 0.4207 0.3485 -0.0084 0.0495  -0.0795 109 VAL A N     
894  C CA    . VAL A 109 ? 0.4999 0.3919 0.3254 -0.0111 0.0452  -0.0620 109 VAL A CA    
895  C C     . VAL A 109 ? 0.4947 0.3968 0.3008 -0.0222 0.0447  -0.0574 109 VAL A C     
896  O O     . VAL A 109 ? 0.5035 0.4185 0.3047 -0.0288 0.0465  -0.0675 109 VAL A O     
897  C CB    . VAL A 109 ? 0.5065 0.3770 0.3428 -0.0084 0.0435  -0.0613 109 VAL A CB    
898  C CG1   . VAL A 109 ? 0.4983 0.3534 0.3259 -0.0088 0.0411  -0.0427 109 VAL A CG1   
899  C CG2   . VAL A 109 ? 0.5127 0.3738 0.3746 0.0013  0.0422  -0.0693 109 VAL A CG2   
900  N N     . ASP A 110 ? 0.4833 0.3803 0.2788 -0.0243 0.0411  -0.0427 110 ASP A N     
901  C CA    . ASP A 110 ? 0.4775 0.3757 0.2611 -0.0330 0.0377  -0.0358 110 ASP A CA    
902  C C     . ASP A 110 ? 0.4712 0.3497 0.2585 -0.0293 0.0365  -0.0294 110 ASP A C     
903  O O     . ASP A 110 ? 0.4643 0.3312 0.2536 -0.0226 0.0368  -0.0228 110 ASP A O     
904  C CB    . ASP A 110 ? 0.4753 0.3792 0.2504 -0.0373 0.0332  -0.0250 110 ASP A CB    
905  C CG    . ASP A 110 ? 0.4956 0.4231 0.2676 -0.0439 0.0347  -0.0279 110 ASP A CG    
906  O OD1   . ASP A 110 ? 0.5428 0.4740 0.3145 -0.0453 0.0314  -0.0200 110 ASP A OD1   
907  O OD2   . ASP A 110 ? 0.5082 0.4524 0.2784 -0.0484 0.0393  -0.0383 110 ASP A OD2   
908  N N     . VAL A 111 ? 0.4596 0.3367 0.2475 -0.0345 0.0352  -0.0309 111 VAL A N     
909  C CA    . VAL A 111 ? 0.4425 0.3066 0.2346 -0.0332 0.0343  -0.0230 111 VAL A CA    
910  C C     . VAL A 111 ? 0.4307 0.2997 0.2179 -0.0397 0.0283  -0.0167 111 VAL A C     
911  O O     . VAL A 111 ? 0.4305 0.3081 0.2154 -0.0475 0.0241  -0.0192 111 VAL A O     
912  C CB    . VAL A 111 ? 0.4404 0.2942 0.2463 -0.0313 0.0370  -0.0270 111 VAL A CB    
913  C CG1   . VAL A 111 ? 0.4520 0.3117 0.2628 -0.0334 0.0371  -0.0418 111 VAL A CG1   
914  C CG2   . VAL A 111 ? 0.4288 0.2782 0.2413 -0.0349 0.0358  -0.0215 111 VAL A CG2   
915  N N     . VAL A 112 ? 0.4248 0.2886 0.2109 -0.0364 0.0267  -0.0091 112 VAL A N     
916  C CA    . VAL A 112 ? 0.4299 0.2965 0.2155 -0.0409 0.0188  -0.0030 112 VAL A CA    
917  C C     . VAL A 112 ? 0.4360 0.2950 0.2325 -0.0367 0.0189  -0.0003 112 VAL A C     
918  O O     . VAL A 112 ? 0.4398 0.2929 0.2364 -0.0293 0.0244  -0.0004 112 VAL A O     
919  C CB    . VAL A 112 ? 0.4269 0.2941 0.2066 -0.0398 0.0152  0.0009  112 VAL A CB    
920  C CG1   . VAL A 112 ? 0.4309 0.2974 0.2155 -0.0444 0.0045  0.0080  112 VAL A CG1   
921  C CG2   . VAL A 112 ? 0.4257 0.3044 0.1979 -0.0434 0.0168  -0.0017 112 VAL A CG2   
922  N N     . PRO A 113 ? 0.4356 0.2972 0.2416 -0.0415 0.0131  0.0018  113 PRO A N     
923  C CA    . PRO A 113 ? 0.4331 0.2915 0.2545 -0.0371 0.0132  0.0031  113 PRO A CA    
924  C C     . PRO A 113 ? 0.4433 0.2987 0.2690 -0.0340 0.0062  0.0054  113 PRO A C     
925  O O     . PRO A 113 ? 0.4415 0.2982 0.2646 -0.0399 -0.0044 0.0106  113 PRO A O     
926  C CB    . PRO A 113 ? 0.4348 0.2984 0.2675 -0.0441 0.0062  0.0048  113 PRO A CB    
927  C CG    . PRO A 113 ? 0.4312 0.3013 0.2505 -0.0532 -0.0018 0.0069  113 PRO A CG    
928  C CD    . PRO A 113 ? 0.4400 0.3104 0.2434 -0.0514 0.0060  0.0023  113 PRO A CD    
929  N N     . CYS A 114 ? 0.4531 0.3056 0.2862 -0.0253 0.0118  0.0013  114 CYS A N     
930  C CA    . CYS A 114 ? 0.4619 0.3108 0.3061 -0.0207 0.0043  -0.0007 114 CYS A CA    
931  C C     . CYS A 114 ? 0.4630 0.3156 0.3262 -0.0130 0.0102  -0.0073 114 CYS A C     
932  O O     . CYS A 114 ? 0.4632 0.3225 0.3297 -0.0126 0.0206  -0.0078 114 CYS A O     
933  C CB    . CYS A 114 ? 0.4663 0.3102 0.2963 -0.0167 0.0050  -0.0040 114 CYS A CB    
934  S SG    . CYS A 114 ? 0.5084 0.3546 0.3285 -0.0071 0.0203  -0.0122 114 CYS A SG    
935  N N     . TYR A 115 ? 0.4679 0.3175 0.3461 -0.0068 0.0037  -0.0132 115 TYR A N     
936  C CA    . TYR A 115 ? 0.4738 0.3306 0.3730 0.0021  0.0102  -0.0233 115 TYR A CA    
937  C C     . TYR A 115 ? 0.4862 0.3468 0.3721 0.0106  0.0227  -0.0349 115 TYR A C     
938  O O     . TYR A 115 ? 0.5012 0.3540 0.3769 0.0134  0.0173  -0.0399 115 TYR A O     
939  C CB    . TYR A 115 ? 0.4749 0.3269 0.4041 0.0053  -0.0053 -0.0260 115 TYR A CB    
940  C CG    . TYR A 115 ? 0.4820 0.3340 0.4277 -0.0029 -0.0187 -0.0138 115 TYR A CG    
941  C CD1   . TYR A 115 ? 0.4824 0.3247 0.4280 -0.0111 -0.0374 -0.0020 115 TYR A CD1   
942  C CD2   . TYR A 115 ? 0.4665 0.3298 0.4280 -0.0039 -0.0137 -0.0127 115 TYR A CD2   
943  C CE1   . TYR A 115 ? 0.4531 0.2976 0.4101 -0.0198 -0.0509 0.0105  115 TYR A CE1   
944  C CE2   . TYR A 115 ? 0.4501 0.3143 0.4256 -0.0120 -0.0281 -0.0018 115 TYR A CE2   
945  C CZ    . TYR A 115 ? 0.4495 0.3046 0.4207 -0.0197 -0.0465 0.0096  115 TYR A CZ    
946  O OH    . TYR A 115 ? 0.4815 0.3399 0.4627 -0.0287 -0.0611 0.0214  115 TYR A OH    
947  N N     . LYS A 116 ? 0.4908 0.3651 0.3769 0.0138  0.0387  -0.0388 116 LYS A N     
948  C CA    . LYS A 116 ? 0.5052 0.3877 0.3760 0.0208  0.0511  -0.0492 116 LYS A CA    
949  C C     . LYS A 116 ? 0.5256 0.4116 0.4160 0.0312  0.0481  -0.0678 116 LYS A C     
950  O O     . LYS A 116 ? 0.5358 0.4340 0.4540 0.0362  0.0526  -0.0756 116 LYS A O     
951  C CB    . LYS A 116 ? 0.5065 0.4056 0.3729 0.0189  0.0692  -0.0450 116 LYS A CB    
952  C CG    . LYS A 116 ? 0.5060 0.4185 0.3517 0.0239  0.0833  -0.0531 116 LYS A CG    
953  C CD    . LYS A 116 ? 0.4869 0.4118 0.3217 0.0176  0.0982  -0.0404 116 LYS A CD    
954  C CE    . LYS A 116 ? 0.5157 0.4530 0.3210 0.0194  0.1098  -0.0427 116 LYS A CE    
955  N NZ    . LYS A 116 ? 0.5185 0.4703 0.3174 0.0118  0.1243  -0.0274 116 LYS A NZ    
956  N N     . LEU A 117 ? 0.5416 0.4171 0.4214 0.0349  0.0398  -0.0763 117 LEU A N     
957  C CA    . LEU A 117 ? 0.5618 0.4375 0.4636 0.0455  0.0345  -0.0968 117 LEU A CA    
958  C C     . LEU A 117 ? 0.5947 0.4830 0.4746 0.0526  0.0472  -0.1141 117 LEU A C     
959  O O     . LEU A 117 ? 0.5967 0.4874 0.4417 0.0482  0.0542  -0.1070 117 LEU A O     
960  C CB    . LEU A 117 ? 0.5544 0.4080 0.4663 0.0442  0.0124  -0.0959 117 LEU A CB    
961  C CG    . LEU A 117 ? 0.5350 0.3760 0.4548 0.0334  -0.0021 -0.0747 117 LEU A CG    
962  C CD1   . LEU A 117 ? 0.5360 0.3581 0.4641 0.0306  -0.0227 -0.0724 117 LEU A CD1   
963  C CD2   . LEU A 117 ? 0.5381 0.3851 0.4897 0.0338  -0.0043 -0.0710 117 LEU A CD2   
964  N N     . LYS A 118 ? 0.6296 0.5268 0.5303 0.0638  0.0494  -0.1377 118 LYS A N     
965  C CA    . LYS A 118 ? 0.6746 0.5840 0.5520 0.0706  0.0589  -0.1582 118 LYS A CA    
966  C C     . LYS A 118 ? 0.6915 0.5798 0.5600 0.0717  0.0410  -0.1662 118 LYS A C     
967  O O     . LYS A 118 ? 0.7119 0.6047 0.5475 0.0718  0.0447  -0.1728 118 LYS A O     
968  C CB    . LYS A 118 ? 0.6948 0.6280 0.5954 0.0826  0.0719  -0.1848 118 LYS A CB    
969  C CG    . LYS A 118 ? 0.7162 0.6505 0.6681 0.0874  0.0673  -0.1869 118 LYS A CG    
970  C CD    . LYS A 118 ? 0.7600 0.6697 0.7489 0.0944  0.0428  -0.1987 118 LYS A CD    
971  C CE    . LYS A 118 ? 0.7758 0.6932 0.7774 0.1092  0.0444  -0.2356 118 LYS A CE    
972  N NZ    . LYS A 118 ? 0.7969 0.6864 0.8401 0.1150  0.0178  -0.2442 118 LYS A NZ    
973  N N     . GLU A 119 ? 0.6953 0.5614 0.5942 0.0714  0.0205  -0.1637 119 GLU A N     
974  C CA    . GLU A 119 ? 0.7163 0.5605 0.6148 0.0705  0.0008  -0.1682 119 GLU A CA    
975  C C     . GLU A 119 ? 0.6986 0.5227 0.6096 0.0595  -0.0164 -0.1427 119 GLU A C     
976  O O     . GLU A 119 ? 0.6889 0.5133 0.6217 0.0568  -0.0181 -0.1305 119 GLU A O     
977  C CB    . GLU A 119 ? 0.7433 0.5815 0.6769 0.0827  -0.0096 -0.1967 119 GLU A CB    
978  C CG    . GLU A 119 ? 0.7955 0.6503 0.7127 0.0932  0.0019  -0.2280 119 GLU A CG    
979  C CD    . GLU A 119 ? 0.8714 0.7076 0.8111 0.1006  -0.0178 -0.2528 119 GLU A CD    
980  O OE1   . GLU A 119 ? 0.9078 0.7509 0.8768 0.1141  -0.0163 -0.2831 119 GLU A OE1   
981  O OE2   . GLU A 119 ? 0.8939 0.7087 0.8257 0.0928  -0.0354 -0.2426 119 GLU A OE2   
982  N N     . PRO A 120 ? 0.7014 0.5108 0.5989 0.0524  -0.0295 -0.1347 120 PRO A N     
983  C CA    . PRO A 120 ? 0.6907 0.4846 0.6018 0.0412  -0.0458 -0.1117 120 PRO A CA    
984  C C     . PRO A 120 ? 0.7113 0.4853 0.6612 0.0422  -0.0692 -0.1162 120 PRO A C     
985  O O     . PRO A 120 ? 0.7135 0.4740 0.6670 0.0316  -0.0851 -0.1001 120 PRO A O     
986  C CB    . PRO A 120 ? 0.6782 0.4711 0.5567 0.0322  -0.0458 -0.0994 120 PRO A CB    
987  C CG    . PRO A 120 ? 0.6976 0.4971 0.5537 0.0398  -0.0387 -0.1195 120 PRO A CG    
988  C CD    . PRO A 120 ? 0.7135 0.5223 0.5824 0.0527  -0.0300 -0.1441 120 PRO A CD    
989  N N     . LYS A 121 ? 0.7331 0.5060 0.7143 0.0546  -0.0717 -0.1378 121 LYS A N     
990  C CA    . LYS A 121 ? 0.7496 0.5027 0.7781 0.0556  -0.0953 -0.1373 121 LYS A CA    
991  C C     . LYS A 121 ? 0.7334 0.4906 0.7779 0.0502  -0.0964 -0.1156 121 LYS A C     
992  O O     . LYS A 121 ? 0.7221 0.4981 0.7465 0.0496  -0.0773 -0.1103 121 LYS A O     
993  C CB    . LYS A 121 ? 0.7765 0.5281 0.8380 0.0729  -0.0976 -0.1716 121 LYS A CB    
994  C CG    . LYS A 121 ? 0.8216 0.5729 0.8661 0.0803  -0.0954 -0.2001 121 LYS A CG    
995  C CD    . LYS A 121 ? 0.8554 0.5864 0.8904 0.0691  -0.1141 -0.1893 121 LYS A CD    
996  C CE    . LYS A 121 ? 0.8463 0.5900 0.8272 0.0604  -0.1002 -0.1782 121 LYS A CE    
997  N NZ    . LYS A 121 ? 0.8482 0.5769 0.8228 0.0530  -0.1168 -0.1773 121 LYS A NZ    
998  N N     . ASN A 122 ? 0.7346 0.4745 0.8155 0.0454  -0.1199 -0.1018 122 ASN A N     
999  C CA    . ASN A 122 ? 0.7166 0.4604 0.8165 0.0403  -0.1250 -0.0817 122 ASN A CA    
1000 C C     . ASN A 122 ? 0.6800 0.4431 0.7421 0.0317  -0.1060 -0.0658 122 ASN A C     
1001 O O     . ASN A 122 ? 0.6721 0.4509 0.7381 0.0368  -0.0927 -0.0696 122 ASN A O     
1002 C CB    . ASN A 122 ? 0.7312 0.4780 0.8765 0.0561  -0.1267 -0.1015 122 ASN A CB    
1003 C CG    . ASN A 122 ? 0.7812 0.5095 0.9647 0.0672  -0.1434 -0.1240 122 ASN A CG    
1004 O OD1   . ASN A 122 ? 0.8161 0.5209 1.0255 0.0604  -0.1699 -0.1101 122 ASN A OD1   
1005 N ND2   . ASN A 122 ? 0.8105 0.5498 0.9973 0.0837  -0.1284 -0.1594 122 ASN A ND2   
1006 N N     . ILE A 123 ? 0.6540 0.4159 0.6820 0.0189  -0.1051 -0.0497 123 ILE A N     
1007 C CA    . ILE A 123 ? 0.6148 0.3905 0.6084 0.0085  -0.0921 -0.0329 123 ILE A CA    
1008 C C     . ILE A 123 ? 0.5877 0.3676 0.5982 0.0023  -0.0996 -0.0163 123 ILE A C     
1009 O O     . ILE A 123 ? 0.6001 0.3686 0.6398 -0.0017 -0.1212 -0.0050 123 ILE A O     
1010 C CB    . ILE A 123 ? 0.6137 0.3845 0.5831 -0.0046 -0.0980 -0.0181 123 ILE A CB    
1011 C CG1   . ILE A 123 ? 0.6338 0.4075 0.5772 0.0009  -0.0852 -0.0332 123 ILE A CG1   
1012 C CG2   . ILE A 123 ? 0.6214 0.4029 0.5684 -0.0182 -0.0943 0.0028  123 ILE A CG2   
1013 C CD1   . ILE A 123 ? 0.7078 0.4658 0.6675 0.0048  -0.0996 -0.0453 123 ILE A CD1   
1014 N N     . LYS A 124 ? 0.5444 0.3400 0.5393 0.0015  -0.0838 -0.0145 124 LYS A N     
1015 C CA    . LYS A 124 ? 0.5176 0.3183 0.5266 -0.0053 -0.0922 0.0004  124 LYS A CA    
1016 C C     . LYS A 124 ? 0.5021 0.3071 0.4822 -0.0221 -0.0953 0.0215  124 LYS A C     
1017 O O     . LYS A 124 ? 0.5070 0.3104 0.4970 -0.0324 -0.1127 0.0395  124 LYS A O     
1018 C CB    . LYS A 124 ? 0.5090 0.3247 0.5255 0.0023  -0.0766 -0.0097 124 LYS A CB    
1019 C CG    . LYS A 124 ? 0.4995 0.3181 0.5512 0.0016  -0.0904 -0.0019 124 LYS A CG    
1020 C CD    . LYS A 124 ? 0.4822 0.3187 0.5370 0.0044  -0.0747 -0.0072 124 LYS A CD    
1021 C CE    . LYS A 124 ? 0.4860 0.3268 0.5841 0.0066  -0.0890 -0.0032 124 LYS A CE    
1022 N NZ    . LYS A 124 ? 0.4858 0.3421 0.5805 0.0001  -0.0824 0.0032  124 LYS A NZ    
1023 N N     . SER A 125 ? 0.4801 0.2924 0.4253 -0.0246 -0.0786 0.0187  125 SER A N     
1024 C CA    . SER A 125 ? 0.4587 0.2782 0.3756 -0.0389 -0.0783 0.0334  125 SER A CA    
1025 C C     . SER A 125 ? 0.4602 0.2745 0.3632 -0.0420 -0.0795 0.0345  125 SER A C     
1026 O O     . SER A 125 ? 0.4552 0.2611 0.3638 -0.0323 -0.0772 0.0215  125 SER A O     
1027 C CB    . SER A 125 ? 0.4428 0.2748 0.3369 -0.0390 -0.0597 0.0283  125 SER A CB    
1028 O OG    . SER A 125 ? 0.4125 0.2454 0.2851 -0.0345 -0.0450 0.0194  125 SER A OG    
1029 N N     . ALA A 126 ? 0.4561 0.2779 0.3409 -0.0557 -0.0826 0.0487  126 ALA A N     
1030 C CA    . ALA A 126 ? 0.4483 0.2673 0.3262 -0.0605 -0.0862 0.0524  126 ALA A CA    
1031 C C     . ALA A 126 ? 0.4285 0.2529 0.2843 -0.0542 -0.0685 0.0396  126 ALA A C     
1032 O O     . ALA A 126 ? 0.4312 0.2547 0.2822 -0.0568 -0.0704 0.0404  126 ALA A O     
1033 C CB    . ALA A 126 ? 0.4534 0.2824 0.3235 -0.0789 -0.0965 0.0740  126 ALA A CB    
1034 N N     . VAL A 127 ? 0.4046 0.2344 0.2497 -0.0466 -0.0530 0.0292  127 VAL A N     
1035 C CA    . VAL A 127 ? 0.3970 0.2303 0.2238 -0.0407 -0.0388 0.0197  127 VAL A CA    
1036 C C     . VAL A 127 ? 0.4000 0.2259 0.2298 -0.0270 -0.0321 0.0050  127 VAL A C     
1037 O O     . VAL A 127 ? 0.4016 0.2300 0.2161 -0.0217 -0.0218 -0.0015 127 VAL A O     
1038 C CB    . VAL A 127 ? 0.3877 0.2329 0.1984 -0.0432 -0.0262 0.0198  127 VAL A CB    
1039 C CG1   . VAL A 127 ? 0.4010 0.2588 0.2043 -0.0570 -0.0309 0.0309  127 VAL A CG1   
1040 C CG2   . VAL A 127 ? 0.3709 0.2159 0.1882 -0.0387 -0.0206 0.0156  127 VAL A CG2   
1041 N N     . ASP A 128 ? 0.4036 0.2222 0.2537 -0.0213 -0.0386 -0.0003 128 ASP A N     
1042 C CA    . ASP A 128 ? 0.4085 0.2261 0.2618 -0.0087 -0.0297 -0.0160 128 ASP A CA    
1043 C C     . ASP A 128 ? 0.4171 0.2318 0.2567 -0.0025 -0.0268 -0.0271 128 ASP A C     
1044 O O     . ASP A 128 ? 0.4211 0.2411 0.2511 0.0058  -0.0148 -0.0381 128 ASP A O     
1045 C CB    . ASP A 128 ? 0.4174 0.2297 0.3015 -0.0035 -0.0387 -0.0215 128 ASP A CB    
1046 C CG    . ASP A 128 ? 0.4119 0.2313 0.3081 -0.0061 -0.0369 -0.0145 128 ASP A CG    
1047 O OD1   . ASP A 128 ? 0.3496 0.1780 0.2290 -0.0103 -0.0258 -0.0094 128 ASP A OD1   
1048 O OD2   . ASP A 128 ? 0.3958 0.2112 0.3216 -0.0037 -0.0482 -0.0149 128 ASP A OD2   
1049 N N     . ARG A 129 ? 0.4197 0.2282 0.2580 -0.0077 -0.0380 -0.0233 129 ARG A N     
1050 C CA    . ARG A 129 ? 0.4186 0.2239 0.2467 -0.0026 -0.0391 -0.0344 129 ARG A CA    
1051 C C     . ARG A 129 ? 0.4239 0.2384 0.2258 -0.0025 -0.0272 -0.0320 129 ARG A C     
1052 O O     . ARG A 129 ? 0.4376 0.2533 0.2255 0.0036  -0.0239 -0.0416 129 ARG A O     
1053 C CB    . ARG A 129 ? 0.4206 0.2166 0.2601 -0.0096 -0.0565 -0.0299 129 ARG A CB    
1054 C CG    . ARG A 129 ? 0.4145 0.1977 0.2848 -0.0117 -0.0732 -0.0283 129 ARG A CG    
1055 C CD    . ARG A 129 ? 0.4238 0.1961 0.3071 -0.0188 -0.0914 -0.0246 129 ARG A CD    
1056 N NE    . ARG A 129 ? 0.3912 0.1494 0.3075 -0.0228 -0.1100 -0.0182 129 ARG A NE    
1057 C CZ    . ARG A 129 ? 0.3836 0.1433 0.3095 -0.0355 -0.1184 0.0045  129 ARG A CZ    
1058 N NH1   . ARG A 129 ? 0.3320 0.1084 0.2357 -0.0451 -0.1082 0.0197  129 ARG A NH1   
1059 N NH2   . ARG A 129 ? 0.3447 0.0897 0.3032 -0.0387 -0.1379 0.0116  129 ARG A NH2   
1060 N N     . THR A 130 ? 0.4201 0.2415 0.2160 -0.0092 -0.0219 -0.0196 130 THR A N     
1061 C CA    . THR A 130 ? 0.4250 0.2537 0.2026 -0.0094 -0.0133 -0.0161 130 THR A CA    
1062 C C     . THR A 130 ? 0.4336 0.2649 0.1953 -0.0010 -0.0026 -0.0225 130 THR A C     
1063 O O     . THR A 130 ? 0.4498 0.2826 0.1989 0.0008  -0.0035 -0.0231 130 THR A O     
1064 C CB    . THR A 130 ? 0.4136 0.2498 0.1910 -0.0166 -0.0085 -0.0061 130 THR A CB    
1065 O OG1   . THR A 130 ? 0.4179 0.2556 0.2055 -0.0262 -0.0186 0.0016  130 THR A OG1   
1066 C CG2   . THR A 130 ? 0.3978 0.2406 0.1639 -0.0160 -0.0026 -0.0042 130 THR A CG2   
1067 N N     . PRO A 131 ? 0.4341 0.2677 0.1967 0.0031  0.0068  -0.0255 131 PRO A N     
1068 C CA    . PRO A 131 ? 0.4332 0.2723 0.1791 0.0089  0.0170  -0.0289 131 PRO A CA    
1069 C C     . PRO A 131 ? 0.4465 0.2855 0.1819 0.0144  0.0126  -0.0410 131 PRO A C     
1070 O O     . PRO A 131 ? 0.4589 0.3030 0.1740 0.0167  0.0162  -0.0407 131 PRO A O     
1071 C CB    . PRO A 131 ? 0.4273 0.2716 0.1821 0.0110  0.0270  -0.0309 131 PRO A CB    
1072 C CG    . PRO A 131 ? 0.4326 0.2737 0.2052 0.0054  0.0229  -0.0248 131 PRO A CG    
1073 C CD    . PRO A 131 ? 0.4249 0.2589 0.2042 0.0017  0.0086  -0.0245 131 PRO A CD    
1074 N N     . PHE A 132 ? 0.4478 0.2811 0.1979 0.0163  0.0036  -0.0518 132 PHE A N     
1075 C CA    . PHE A 132 ? 0.4624 0.2940 0.2059 0.0216  -0.0030 -0.0674 132 PHE A CA    
1076 C C     . PHE A 132 ? 0.4645 0.2915 0.1999 0.0176  -0.0147 -0.0635 132 PHE A C     
1077 O O     . PHE A 132 ? 0.4746 0.3041 0.1938 0.0209  -0.0179 -0.0725 132 PHE A O     
1078 C CB    . PHE A 132 ? 0.4624 0.2859 0.2313 0.0249  -0.0120 -0.0805 132 PHE A CB    
1079 C CG    . PHE A 132 ? 0.4686 0.2993 0.2493 0.0310  -0.0016 -0.0890 132 PHE A CG    
1080 C CD1   . PHE A 132 ? 0.4708 0.2992 0.2740 0.0280  -0.0019 -0.0799 132 PHE A CD1   
1081 C CD2   . PHE A 132 ? 0.4868 0.3294 0.2571 0.0395  0.0082  -0.1070 132 PHE A CD2   
1082 C CE1   . PHE A 132 ? 0.4710 0.3079 0.2906 0.0340  0.0070  -0.0881 132 PHE A CE1   
1083 C CE2   . PHE A 132 ? 0.4811 0.3347 0.2665 0.0454  0.0194  -0.1163 132 PHE A CE2   
1084 C CZ    . PHE A 132 ? 0.4852 0.3355 0.2976 0.0430  0.0184  -0.1067 132 PHE A CZ    
1085 N N     . HIS A 133 ? 0.4524 0.2753 0.1999 0.0099  -0.0213 -0.0507 133 HIS A N     
1086 C CA    . HIS A 133 ? 0.4510 0.2736 0.1956 0.0054  -0.0309 -0.0458 133 HIS A CA    
1087 C C     . HIS A 133 ? 0.4586 0.2892 0.1806 0.0086  -0.0236 -0.0422 133 HIS A C     
1088 O O     . HIS A 133 ? 0.4758 0.3079 0.1860 0.0103  -0.0305 -0.0469 133 HIS A O     
1089 C CB    . HIS A 133 ? 0.4325 0.2568 0.1905 -0.0038 -0.0335 -0.0314 133 HIS A CB    
1090 C CG    . HIS A 133 ? 0.4353 0.2524 0.2151 -0.0103 -0.0448 -0.0292 133 HIS A CG    
1091 N ND1   . HIS A 133 ? 0.4100 0.2314 0.2000 -0.0196 -0.0452 -0.0157 133 HIS A ND1   
1092 C CD2   . HIS A 133 ? 0.4715 0.2773 0.2660 -0.0094 -0.0574 -0.0380 133 HIS A CD2   
1093 C CE1   . HIS A 133 ? 0.4278 0.2410 0.2368 -0.0253 -0.0581 -0.0129 133 HIS A CE1   
1094 N NE2   . HIS A 133 ? 0.4428 0.2447 0.2575 -0.0189 -0.0663 -0.0265 133 HIS A NE2   
1095 N N     . HIS A 134 ? 0.4517 0.2870 0.1690 0.0089  -0.0114 -0.0334 134 HIS A N     
1096 C CA    . HIS A 134 ? 0.4638 0.3048 0.1634 0.0112  -0.0062 -0.0267 134 HIS A CA    
1097 C C     . HIS A 134 ? 0.4916 0.3368 0.1695 0.0162  -0.0052 -0.0353 134 HIS A C     
1098 O O     . HIS A 134 ? 0.5135 0.3624 0.1755 0.0170  -0.0104 -0.0322 134 HIS A O     
1099 C CB    . HIS A 134 ? 0.4510 0.2940 0.1518 0.0107  0.0059  -0.0171 134 HIS A CB    
1100 C CG    . HIS A 134 ? 0.4702 0.3162 0.1588 0.0120  0.0081  -0.0069 134 HIS A CG    
1101 N ND1   . HIS A 134 ? 0.4745 0.3203 0.1709 0.0109  0.0028  0.0006  134 HIS A ND1   
1102 C CD2   . HIS A 134 ? 0.5000 0.3503 0.1707 0.0140  0.0137  -0.0020 134 HIS A CD2   
1103 C CE1   . HIS A 134 ? 0.4734 0.3203 0.1601 0.0129  0.0035  0.0101  134 HIS A CE1   
1104 N NE2   . HIS A 134 ? 0.5103 0.3598 0.1794 0.0139  0.0098  0.0103  134 HIS A NE2   
1105 N N     . LYS A 135 ? 0.4992 0.3462 0.1764 0.0196  0.0014  -0.0464 135 LYS A N     
1106 C CA    . LYS A 135 ? 0.5228 0.3794 0.1769 0.0240  0.0058  -0.0562 135 LYS A CA    
1107 C C     . LYS A 135 ? 0.5295 0.3844 0.1737 0.0255  -0.0083 -0.0685 135 LYS A C     
1108 O O     . LYS A 135 ? 0.5526 0.4155 0.1716 0.0261  -0.0102 -0.0677 135 LYS A O     
1109 C CB    . LYS A 135 ? 0.5325 0.3948 0.1935 0.0281  0.0165  -0.0689 135 LYS A CB    
1110 C CG    . LYS A 135 ? 0.5839 0.4633 0.2218 0.0297  0.0311  -0.0682 135 LYS A CG    
1111 C CD    . LYS A 135 ? 0.6438 0.5334 0.2810 0.0364  0.0361  -0.0929 135 LYS A CD    
1112 C CE    . LYS A 135 ? 0.6705 0.5822 0.2745 0.0372  0.0475  -0.0969 135 LYS A CE    
1113 N NZ    . LYS A 135 ? 0.7265 0.6490 0.3359 0.0451  0.0525  -0.1260 135 LYS A NZ    
1114 N N     . TRP A 136 ? 0.5202 0.3643 0.1856 0.0248  -0.0201 -0.0777 136 TRP A N     
1115 C CA    . TRP A 136 ? 0.5300 0.3699 0.1933 0.0251  -0.0361 -0.0907 136 TRP A CA    
1116 C C     . TRP A 136 ? 0.5402 0.3822 0.1938 0.0211  -0.0460 -0.0788 136 TRP A C     
1117 O O     . TRP A 136 ? 0.5699 0.4161 0.2056 0.0223  -0.0549 -0.0871 136 TRP A O     
1118 C CB    . TRP A 136 ? 0.5070 0.3330 0.2015 0.0232  -0.0474 -0.0983 136 TRP A CB    
1119 C CG    . TRP A 136 ? 0.5127 0.3325 0.2098 0.0248  -0.0634 -0.1173 136 TRP A CG    
1120 C CD1   . TRP A 136 ? 0.5276 0.3459 0.2252 0.0319  -0.0651 -0.1424 136 TRP A CD1   
1121 C CD2   . TRP A 136 ? 0.5110 0.3260 0.2134 0.0191  -0.0805 -0.1147 136 TRP A CD2   
1122 N NE1   . TRP A 136 ? 0.5460 0.3565 0.2478 0.0310  -0.0836 -0.1569 136 TRP A NE1   
1123 C CE2   . TRP A 136 ? 0.5322 0.3406 0.2371 0.0226  -0.0936 -0.1390 136 TRP A CE2   
1124 C CE3   . TRP A 136 ? 0.4878 0.3052 0.1954 0.0117  -0.0859 -0.0956 136 TRP A CE3   
1125 C CZ2   . TRP A 136 ? 0.5411 0.3436 0.2537 0.0176  -0.1132 -0.1431 136 TRP A CZ2   
1126 C CZ3   . TRP A 136 ? 0.5071 0.3215 0.2233 0.0070  -0.1039 -0.0989 136 TRP A CZ3   
1127 C CH2   . TRP A 136 ? 0.5308 0.3370 0.2493 0.0094  -0.1181 -0.1217 136 TRP A CH2   
1128 N N     . LEU A 137 ? 0.5317 0.3728 0.1982 0.0166  -0.0445 -0.0607 137 LEU A N     
1129 C CA    . LEU A 137 ? 0.5426 0.3873 0.2084 0.0136  -0.0531 -0.0491 137 LEU A CA    
1130 C C     . LEU A 137 ? 0.5686 0.4216 0.2112 0.0161  -0.0487 -0.0383 137 LEU A C     
1131 O O     . LEU A 137 ? 0.5820 0.4393 0.2163 0.0158  -0.0600 -0.0348 137 LEU A O     
1132 C CB    . LEU A 137 ? 0.5136 0.3574 0.2049 0.0085  -0.0514 -0.0365 137 LEU A CB    
1133 C CG    . LEU A 137 ? 0.5122 0.3558 0.2264 0.0019  -0.0637 -0.0350 137 LEU A CG    
1134 C CD1   . LEU A 137 ? 0.5369 0.3737 0.2550 0.0005  -0.0787 -0.0490 137 LEU A CD1   
1135 C CD2   . LEU A 137 ? 0.4786 0.3224 0.2136 -0.0039 -0.0575 -0.0273 137 LEU A CD2   
1136 N N     . GLU A 138 ? 0.5833 0.4386 0.2180 0.0177  -0.0339 -0.0313 138 GLU A N     
1137 C CA    . GLU A 138 ? 0.6167 0.4783 0.2326 0.0184  -0.0299 -0.0168 138 GLU A CA    
1138 C C     . GLU A 138 ? 0.6472 0.5153 0.2409 0.0187  -0.0430 -0.0150 138 GLU A C     
1139 O O     . GLU A 138 ? 0.6622 0.5312 0.2596 0.0182  -0.0504 0.0003  138 GLU A O     
1140 C CB    . GLU A 138 ? 0.6355 0.5027 0.2354 0.0194  -0.0145 -0.0174 138 GLU A CB    
1141 C CG    . GLU A 138 ? 0.6703 0.5358 0.2796 0.0177  -0.0035 -0.0005 138 GLU A CG    
1142 C CD    . GLU A 138 ? 0.7408 0.6150 0.3361 0.0172  0.0119  0.0003  138 GLU A CD    
1143 O OE1   . GLU A 138 ? 0.7565 0.6282 0.3645 0.0151  0.0214  0.0116  138 GLU A OE1   
1144 O OE2   . GLU A 138 ? 0.7701 0.6555 0.3434 0.0187  0.0147  -0.0115 138 GLU A OE2   
1145 N N     . GLY A 139 ? 0.6632 0.5366 0.2353 0.0199  -0.0465 -0.0314 139 GLY A N     
1146 C CA    . GLY A 139 ? 0.6852 0.5674 0.2297 0.0195  -0.0592 -0.0317 139 GLY A CA    
1147 C C     . GLY A 139 ? 0.6927 0.5719 0.2434 0.0191  -0.0776 -0.0473 139 GLY A C     
1148 O O     . GLY A 139 ? 0.7301 0.6173 0.2552 0.0189  -0.0886 -0.0550 139 GLY A O     
1149 N N     . ARG A 140 ? 0.6595 0.5286 0.2435 0.0179  -0.0821 -0.0516 140 ARG A N     
1150 C CA    . ARG A 140 ? 0.6530 0.5194 0.2483 0.0155  -0.1013 -0.0620 140 ARG A CA    
1151 C C     . ARG A 140 ? 0.6315 0.4989 0.2525 0.0124  -0.1094 -0.0451 140 ARG A C     
1152 O O     . ARG A 140 ? 0.6439 0.5144 0.2717 0.0100  -0.1268 -0.0468 140 ARG A O     
1153 C CB    . ARG A 140 ? 0.6442 0.5000 0.2594 0.0150  -0.1030 -0.0809 140 ARG A CB    
1154 C CG    . ARG A 140 ? 0.6320 0.4877 0.2329 0.0198  -0.0897 -0.0960 140 ARG A CG    
1155 C CD    . ARG A 140 ? 0.6013 0.4488 0.2116 0.0216  -0.0984 -0.1221 140 ARG A CD    
1156 N NE    . ARG A 140 ? 0.6090 0.4569 0.2180 0.0270  -0.0824 -0.1329 140 ARG A NE    
1157 C CZ    . ARG A 140 ? 0.6484 0.4953 0.2558 0.0325  -0.0832 -0.1600 140 ARG A CZ    
1158 N NH1   . ARG A 140 ? 0.6750 0.5183 0.2803 0.0330  -0.1004 -0.1806 140 ARG A NH1   
1159 N NH2   . ARG A 140 ? 0.6666 0.5170 0.2773 0.0379  -0.0670 -0.1678 140 ARG A NH2   
1160 N N     . ILE A 141 ? 0.5980 0.4647 0.2343 0.0128  -0.0969 -0.0304 141 ILE A N     
1161 C CA    . ILE A 141 ? 0.5799 0.4504 0.2437 0.0111  -0.1008 -0.0173 141 ILE A CA    
1162 C C     . ILE A 141 ? 0.5921 0.4692 0.2494 0.0143  -0.1057 -0.0011 141 ILE A C     
1163 O O     . ILE A 141 ? 0.5752 0.4580 0.2579 0.0144  -0.1125 0.0071  141 ILE A O     
1164 C CB    . ILE A 141 ? 0.5546 0.4219 0.2420 0.0095  -0.0858 -0.0134 141 ILE A CB    
1165 C CG1   . ILE A 141 ? 0.5329 0.4066 0.2534 0.0046  -0.0912 -0.0108 141 ILE A CG1   
1166 C CG2   . ILE A 141 ? 0.5442 0.4110 0.2272 0.0132  -0.0721 -0.0012 141 ILE A CG2   
1167 C CD1   . ILE A 141 ? 0.5399 0.4119 0.2702 -0.0013 -0.1043 -0.0211 141 ILE A CD1   
1168 N N     . LYS A 142 ? 0.6210 0.4987 0.2469 0.0164  -0.1031 0.0044  142 LYS A N     
1169 C CA    . LYS A 142 ? 0.6457 0.5281 0.2675 0.0183  -0.1112 0.0231  142 LYS A CA    
1170 C C     . LYS A 142 ? 0.6577 0.5470 0.2889 0.0176  -0.1328 0.0226  142 LYS A C     
1171 O O     . LYS A 142 ? 0.6732 0.5649 0.2903 0.0150  -0.1434 0.0084  142 LYS A O     
1172 C CB    . LYS A 142 ? 0.6860 0.5717 0.2672 0.0179  -0.1094 0.0311  142 LYS A CB    
1173 C CG    . LYS A 142 ? 0.7126 0.5956 0.2796 0.0176  -0.0888 0.0316  142 LYS A CG    
1174 C CD    . LYS A 142 ? 0.7216 0.5972 0.3133 0.0189  -0.0778 0.0466  142 LYS A CD    
1175 C CE    . LYS A 142 ? 0.7378 0.6127 0.3141 0.0172  -0.0589 0.0477  142 LYS A CE    
1176 N NZ    . LYS A 142 ? 0.7872 0.6736 0.3218 0.0142  -0.0591 0.0528  142 LYS A NZ    
1177 N N     . GLY A 143 ? 0.6469 0.5397 0.3047 0.0201  -0.1401 0.0368  143 GLY A N     
1178 C CA    . GLY A 143 ? 0.6505 0.5523 0.3230 0.0200  -0.1616 0.0394  143 GLY A CA    
1179 C C     . GLY A 143 ? 0.6286 0.5355 0.3353 0.0171  -0.1636 0.0273  143 GLY A C     
1180 O O     . GLY A 143 ? 0.6345 0.5511 0.3605 0.0161  -0.1806 0.0280  143 GLY A O     
1181 N N     . LYS A 144 ? 0.6391 0.3597 0.3333 0.0019  -0.0132 0.1200  144 LYS A N     
1182 C CA    . LYS A 144 ? 0.6088 0.3569 0.3304 0.0026  -0.0251 0.1088  144 LYS A CA    
1183 C C     . LYS A 144 ? 0.5887 0.3289 0.3348 0.0029  -0.0184 0.1030  144 LYS A C     
1184 O O     . LYS A 144 ? 0.5578 0.3169 0.3254 0.0045  -0.0259 0.0955  144 LYS A O     
1185 C CB    . LYS A 144 ? 0.5830 0.3499 0.3090 -0.0100 -0.0280 0.0933  144 LYS A CB    
1186 C CG    . LYS A 144 ? 0.6227 0.4001 0.3246 -0.0107 -0.0364 0.0956  144 LYS A CG    
1187 C CD    . LYS A 144 ? 0.6635 0.4567 0.3712 -0.0215 -0.0391 0.0789  144 LYS A CD    
1188 C CE    . LYS A 144 ? 0.7098 0.5160 0.3941 -0.0229 -0.0507 0.0786  144 LYS A CE    
1189 N NZ    . LYS A 144 ? 0.7532 0.5460 0.4020 -0.0192 -0.0479 0.0920  144 LYS A NZ    
1190 N N     . GLU A 145 ? 0.6102 0.3207 0.3506 -0.0001 -0.0032 0.1061  145 GLU A N     
1191 C CA    . GLU A 145 ? 0.6073 0.3071 0.3663 -0.0029 0.0045  0.0982  145 GLU A CA    
1192 C C     . GLU A 145 ? 0.5999 0.3081 0.3745 0.0114  -0.0029 0.1006  145 GLU A C     
1193 O O     . GLU A 145 ? 0.5867 0.3009 0.3797 0.0079  -0.0018 0.0895  145 GLU A O     
1194 C CB    . GLU A 145 ? 0.6411 0.3038 0.3886 -0.0093 0.0227  0.1016  145 GLU A CB    
1195 C CG    . GLU A 145 ? 0.7010 0.3354 0.4220 0.0010  0.0285  0.1211  145 GLU A CG    
1196 C CD    . GLU A 145 ? 0.7407 0.3778 0.4384 -0.0048 0.0292  0.1270  145 GLU A CD    
1197 O OE1   . GLU A 145 ? 0.7396 0.3705 0.4344 -0.0216 0.0415  0.1195  145 GLU A OE1   
1198 O OE2   . GLU A 145 ? 0.7672 0.4146 0.4497 0.0077  0.0175  0.1390  145 GLU A OE2   
1199 N N     . ASN A 146 ? 0.6189 0.3310 0.3865 0.0278  -0.0107 0.1151  146 ASN A N     
1200 C CA    . ASN A 146 ? 0.6101 0.3377 0.3970 0.0417  -0.0175 0.1169  146 ASN A CA    
1201 C C     . ASN A 146 ? 0.5698 0.3370 0.3753 0.0374  -0.0313 0.1069  146 ASN A C     
1202 O O     . ASN A 146 ? 0.5587 0.3376 0.3847 0.0403  -0.0318 0.1008  146 ASN A O     
1203 C CB    . ASN A 146 ? 0.6434 0.3645 0.4216 0.0634  -0.0209 0.1366  146 ASN A CB    
1204 C CG    . ASN A 146 ? 0.6906 0.3667 0.4579 0.0706  -0.0038 0.1447  146 ASN A CG    
1205 O OD1   . ASN A 146 ? 0.7131 0.3661 0.4833 0.0585  0.0100  0.1331  146 ASN A OD1   
1206 N ND2   . ASN A 146 ? 0.7510 0.4134 0.5047 0.0901  -0.0044 0.1647  146 ASN A ND2   
1207 N N     . GLU A 147 ? 0.5565 0.3418 0.3534 0.0293  -0.0407 0.1045  147 GLU A N     
1208 C CA    . GLU A 147 ? 0.5217 0.3376 0.3347 0.0214  -0.0508 0.0928  147 GLU A CA    
1209 C C     . GLU A 147 ? 0.4926 0.3042 0.3194 0.0105  -0.0430 0.0785  147 GLU A C     
1210 O O     . GLU A 147 ? 0.4732 0.3020 0.3177 0.0094  -0.0468 0.0720  147 GLU A O     
1211 C CB    . GLU A 147 ? 0.5221 0.3514 0.3201 0.0130  -0.0596 0.0902  147 GLU A CB    
1212 C CG    . GLU A 147 ? 0.5493 0.3892 0.3308 0.0224  -0.0707 0.1034  147 GLU A CG    
1213 C CD    . GLU A 147 ? 0.5495 0.4222 0.3500 0.0317  -0.0847 0.1073  147 GLU A CD    
1214 O OE1   . GLU A 147 ? 0.5487 0.4388 0.3731 0.0268  -0.0865 0.0975  147 GLU A OE1   
1215 O OE2   . GLU A 147 ? 0.5895 0.4725 0.3808 0.0441  -0.0940 0.1211  147 GLU A OE2   
1216 N N     . VAL A 148 ? 0.4877 0.2777 0.3063 0.0023  -0.0321 0.0744  148 VAL A N     
1217 C CA    . VAL A 148 ? 0.4596 0.2471 0.2899 -0.0070 -0.0259 0.0622  148 VAL A CA    
1218 C C     . VAL A 148 ? 0.4532 0.2368 0.2961 -0.0006 -0.0223 0.0608  148 VAL A C     
1219 O O     . VAL A 148 ? 0.4257 0.2231 0.2812 -0.0034 -0.0250 0.0530  148 VAL A O     
1220 C CB    . VAL A 148 ? 0.4671 0.2351 0.2889 -0.0168 -0.0146 0.0587  148 VAL A CB    
1221 C CG1   . VAL A 148 ? 0.4512 0.2230 0.2860 -0.0259 -0.0113 0.0463  148 VAL A CG1   
1222 C CG2   . VAL A 148 ? 0.4680 0.2403 0.2779 -0.0230 -0.0152 0.0589  148 VAL A CG2   
1223 N N     . ARG A 149 ? 0.4746 0.2367 0.3119 0.0085  -0.0149 0.0686  149 ARG A N     
1224 C CA    . ARG A 149 ? 0.4778 0.2308 0.3246 0.0154  -0.0081 0.0662  149 ARG A CA    
1225 C C     . ARG A 149 ? 0.4649 0.2450 0.3289 0.0244  -0.0157 0.0667  149 ARG A C     
1226 O O     . ARG A 149 ? 0.4539 0.2391 0.3278 0.0216  -0.0124 0.0577  149 ARG A O     
1227 C CB    . ARG A 149 ? 0.5084 0.2292 0.3445 0.0260  0.0025  0.0760  149 ARG A CB    
1228 C CG    . ARG A 149 ? 0.5090 0.2000 0.3308 0.0131  0.0141  0.0722  149 ARG A CG    
1229 C CD    . ARG A 149 ? 0.5499 0.2076 0.3557 0.0231  0.0234  0.0861  149 ARG A CD    
1230 N NE    . ARG A 149 ? 0.5801 0.2019 0.3755 0.0101  0.0395  0.0798  149 ARG A NE    
1231 C CZ    . ARG A 149 ? 0.6394 0.2303 0.4162 0.0086  0.0495  0.0897  149 ARG A CZ    
1232 N NH1   . ARG A 149 ? 0.6418 0.2347 0.4061 0.0209  0.0437  0.1071  149 ARG A NH1   
1233 N NH2   . ARG A 149 ? 0.6786 0.2371 0.4478 -0.0066 0.0654  0.0821  149 ARG A NH2   
1234 N N     . LEU A 150 ? 0.4668 0.2664 0.3338 0.0338  -0.0259 0.0768  150 LEU A N     
1235 C CA    . LEU A 150 ? 0.4434 0.2763 0.3296 0.0380  -0.0345 0.0761  150 LEU A CA    
1236 C C     . LEU A 150 ? 0.4100 0.2556 0.3031 0.0234  -0.0361 0.0634  150 LEU A C     
1237 O O     . LEU A 150 ? 0.4008 0.2567 0.3076 0.0246  -0.0329 0.0588  150 LEU A O     
1238 C CB    . LEU A 150 ? 0.4487 0.3060 0.3349 0.0433  -0.0485 0.0856  150 LEU A CB    
1239 C CG    . LEU A 150 ? 0.4840 0.3402 0.3697 0.0636  -0.0500 0.1015  150 LEU A CG    
1240 C CD1   . LEU A 150 ? 0.4949 0.3805 0.3778 0.0661  -0.0668 0.1096  150 LEU A CD1   
1241 C CD2   . LEU A 150 ? 0.4806 0.3453 0.3887 0.0787  -0.0441 0.1035  150 LEU A CD2   
1242 N N     . LEU A 151 ? 0.3930 0.2363 0.2758 0.0110  -0.0394 0.0583  151 LEU A N     
1243 C CA    . LEU A 151 ? 0.3781 0.2302 0.2658 -0.0003 -0.0406 0.0484  151 LEU A CA    
1244 C C     . LEU A 151 ? 0.3865 0.2262 0.2751 -0.0037 -0.0316 0.0408  151 LEU A C     
1245 O O     . LEU A 151 ? 0.3752 0.2244 0.2703 -0.0076 -0.0315 0.0356  151 LEU A O     
1246 C CB    . LEU A 151 ? 0.3755 0.2263 0.2526 -0.0100 -0.0447 0.0451  151 LEU A CB    
1247 C CG    . LEU A 151 ? 0.3491 0.2079 0.2297 -0.0190 -0.0471 0.0374  151 LEU A CG    
1248 C CD1   . LEU A 151 ? 0.3418 0.2199 0.2343 -0.0193 -0.0522 0.0378  151 LEU A CD1   
1249 C CD2   . LEU A 151 ? 0.3171 0.1724 0.1869 -0.0251 -0.0495 0.0349  151 LEU A CD2   
1250 N N     . LYS A 152 ? 0.4024 0.2199 0.2824 -0.0033 -0.0238 0.0401  152 LYS A N     
1251 C CA    . LYS A 152 ? 0.4078 0.2143 0.2858 -0.0090 -0.0165 0.0311  152 LYS A CA    
1252 C C     . LYS A 152 ? 0.4222 0.2275 0.3064 -0.0009 -0.0102 0.0301  152 LYS A C     
1253 O O     . LYS A 152 ? 0.4234 0.2313 0.3078 -0.0053 -0.0073 0.0225  152 LYS A O     
1254 C CB    . LYS A 152 ? 0.4334 0.2166 0.3009 -0.0142 -0.0092 0.0288  152 LYS A CB    
1255 C CG    . LYS A 152 ? 0.4343 0.2209 0.2976 -0.0239 -0.0124 0.0272  152 LYS A CG    
1256 C CD    . LYS A 152 ? 0.4806 0.2461 0.3362 -0.0317 -0.0031 0.0240  152 LYS A CD    
1257 C CE    . LYS A 152 ? 0.4791 0.2548 0.3354 -0.0420 -0.0052 0.0206  152 LYS A CE    
1258 N NZ    . LYS A 152 ? 0.4839 0.2446 0.3363 -0.0530 0.0044  0.0162  152 LYS A NZ    
1259 N N     . GLY A 153 ? 0.4473 0.2496 0.3363 0.0122  -0.0077 0.0384  153 GLY A N     
1260 C CA    . GLY A 153 ? 0.4712 0.2724 0.3685 0.0227  0.0007  0.0378  153 GLY A CA    
1261 C C     . GLY A 153 ? 0.4593 0.2909 0.3718 0.0232  -0.0039 0.0374  153 GLY A C     
1262 O O     . GLY A 153 ? 0.4622 0.2967 0.3801 0.0257  0.0043  0.0324  153 GLY A O     
1263 N N     . PHE A 154 ? 0.4524 0.3050 0.3704 0.0193  -0.0156 0.0419  154 PHE A N     
1264 C CA    . PHE A 154 ? 0.4453 0.3259 0.3775 0.0163  -0.0202 0.0415  154 PHE A CA    
1265 C C     . PHE A 154 ? 0.4438 0.3204 0.3688 0.0045  -0.0170 0.0329  154 PHE A C     
1266 O O     . PHE A 154 ? 0.4489 0.3365 0.3814 0.0037  -0.0117 0.0305  154 PHE A O     
1267 C CB    . PHE A 154 ? 0.4364 0.3337 0.3708 0.0119  -0.0331 0.0460  154 PHE A CB    
1268 C CG    . PHE A 154 ? 0.4318 0.3570 0.3811 0.0055  -0.0379 0.0448  154 PHE A CG    
1269 C CD1   . PHE A 154 ? 0.4374 0.3893 0.4086 0.0136  -0.0376 0.0488  154 PHE A CD1   
1270 C CD2   . PHE A 154 ? 0.4112 0.3362 0.3539 -0.0086 -0.0417 0.0397  154 PHE A CD2   
1271 C CE1   . PHE A 154 ? 0.4125 0.3922 0.3996 0.0045  -0.0410 0.0467  154 PHE A CE1   
1272 C CE2   . PHE A 154 ? 0.4095 0.3555 0.3645 -0.0169 -0.0443 0.0381  154 PHE A CE2   
1273 C CZ    . PHE A 154 ? 0.4095 0.3839 0.3871 -0.0119 -0.0440 0.0411  154 PHE A CZ    
1274 N N     . LEU A 155 ? 0.4442 0.3062 0.3545 -0.0040 -0.0196 0.0290  155 LEU A N     
1275 C CA    . LEU A 155 ? 0.4391 0.2991 0.3412 -0.0133 -0.0188 0.0228  155 LEU A CA    
1276 C C     . LEU A 155 ? 0.4587 0.3067 0.3527 -0.0128 -0.0092 0.0162  155 LEU A C     
1277 O O     . LEU A 155 ? 0.4669 0.3192 0.3568 -0.0164 -0.0059 0.0131  155 LEU A O     
1278 C CB    . LEU A 155 ? 0.4293 0.2827 0.3219 -0.0204 -0.0250 0.0212  155 LEU A CB    
1279 C CG    . LEU A 155 ? 0.4074 0.2699 0.3033 -0.0231 -0.0329 0.0249  155 LEU A CG    
1280 C CD1   . LEU A 155 ? 0.4309 0.2849 0.3189 -0.0263 -0.0356 0.0234  155 LEU A CD1   
1281 C CD2   . LEU A 155 ? 0.3859 0.2557 0.2829 -0.0286 -0.0345 0.0243  155 LEU A CD2   
1282 N N     . LYS A 156 ? 0.4695 0.2999 0.3586 -0.0091 -0.0038 0.0140  156 LYS A N     
1283 C CA    . LYS A 156 ? 0.4897 0.3040 0.3686 -0.0097 0.0065  0.0055  156 LYS A CA    
1284 C C     . LYS A 156 ? 0.4953 0.3164 0.3802 -0.0027 0.0157  0.0046  156 LYS A C     
1285 O O     . LYS A 156 ? 0.5141 0.3307 0.3876 -0.0070 0.0222  -0.0033 156 LYS A O     
1286 C CB    . LYS A 156 ? 0.5102 0.3005 0.3847 -0.0060 0.0130  0.0045  156 LYS A CB    
1287 C CG    . LYS A 156 ? 0.5483 0.3172 0.4114 -0.0065 0.0261  -0.0061 156 LYS A CG    
1288 C CD    . LYS A 156 ? 0.5806 0.3358 0.4281 -0.0216 0.0255  -0.0170 156 LYS A CD    
1289 C CE    . LYS A 156 ? 0.5889 0.3154 0.4315 -0.0228 0.0327  -0.0180 156 LYS A CE    
1290 N NZ    . LYS A 156 ? 0.6223 0.3212 0.4507 -0.0271 0.0463  -0.0312 156 LYS A NZ    
1291 N N     . ALA A 157 ? 0.4897 0.3243 0.3927 0.0082  0.0163  0.0126  157 ALA A N     
1292 C CA    . ALA A 157 ? 0.4941 0.3393 0.4085 0.0169  0.0268  0.0124  157 ALA A CA    
1293 C C     . ALA A 157 ? 0.4814 0.3475 0.3991 0.0089  0.0260  0.0120  157 ALA A C     
1294 O O     . ALA A 157 ? 0.4952 0.3703 0.4193 0.0127  0.0371  0.0100  157 ALA A O     
1295 C CB    . ALA A 157 ? 0.4899 0.3486 0.4262 0.0321  0.0261  0.0222  157 ALA A CB    
1296 N N     . ASN A 158 ? 0.4572 0.3290 0.3700 -0.0017 0.0148  0.0141  158 ASN A N     
1297 C CA    . ASN A 158 ? 0.4480 0.3333 0.3612 -0.0098 0.0152  0.0151  158 ASN A CA    
1298 C C     . ASN A 158 ? 0.4512 0.3224 0.3404 -0.0188 0.0128  0.0110  158 ASN A C     
1299 O O     . ASN A 158 ? 0.4433 0.3189 0.3267 -0.0260 0.0103  0.0139  158 ASN A O     
1300 C CB    . ASN A 158 ? 0.4354 0.3389 0.3638 -0.0136 0.0055  0.0216  158 ASN A CB    
1301 C CG    . ASN A 158 ? 0.4358 0.3618 0.3896 -0.0051 0.0064  0.0259  158 ASN A CG    
1302 O OD1   . ASN A 158 ? 0.4233 0.3715 0.3933 -0.0079 0.0104  0.0274  158 ASN A OD1   
1303 N ND2   . ASN A 158 ? 0.4268 0.3484 0.3848 0.0057  0.0031  0.0287  158 ASN A ND2   
1304 N N     . GLY A 159 ? 0.4540 0.3081 0.3294 -0.0183 0.0138  0.0045  159 GLY A N     
1305 C CA    . GLY A 159 ? 0.4637 0.3084 0.3166 -0.0258 0.0118  -0.0013 159 GLY A CA    
1306 C C     . GLY A 159 ? 0.4498 0.2983 0.2979 -0.0316 -0.0007 0.0028  159 GLY A C     
1307 O O     . GLY A 159 ? 0.4604 0.3085 0.2920 -0.0361 -0.0032 0.0020  159 GLY A O     
1308 N N     . ILE A 160 ? 0.4271 0.2791 0.2882 -0.0304 -0.0082 0.0076  160 ILE A N     
1309 C CA    . ILE A 160 ? 0.4087 0.2625 0.2671 -0.0339 -0.0183 0.0108  160 ILE A CA    
1310 C C     . ILE A 160 ? 0.4051 0.2553 0.2673 -0.0342 -0.0237 0.0088  160 ILE A C     
1311 O O     . ILE A 160 ? 0.3853 0.2385 0.2504 -0.0351 -0.0302 0.0118  160 ILE A O     
1312 C CB    . ILE A 160 ? 0.4020 0.2620 0.2681 -0.0348 -0.0207 0.0179  160 ILE A CB    
1313 C CG1   . ILE A 160 ? 0.3820 0.2495 0.2653 -0.0323 -0.0202 0.0201  160 ILE A CG1   
1314 C CG2   . ILE A 160 ? 0.4072 0.2683 0.2654 -0.0374 -0.0148 0.0207  160 ILE A CG2   
1315 C CD1   . ILE A 160 ? 0.3793 0.2532 0.2697 -0.0368 -0.0234 0.0244  160 ILE A CD1   
1316 N N     . TYR A 161 ? 0.4218 0.2634 0.2831 -0.0339 -0.0191 0.0035  161 TYR A N     
1317 C CA    . TYR A 161 ? 0.4268 0.2629 0.2889 -0.0369 -0.0216 0.0008  161 TYR A CA    
1318 C C     . TYR A 161 ? 0.4406 0.2776 0.2934 -0.0447 -0.0240 -0.0073 161 TYR A C     
1319 O O     . TYR A 161 ? 0.4616 0.2922 0.3040 -0.0481 -0.0192 -0.0149 161 TYR A O     
1320 C CB    . TYR A 161 ? 0.4440 0.2661 0.3086 -0.0332 -0.0141 0.0001  161 TYR A CB    
1321 C CG    . TYR A 161 ? 0.4532 0.2671 0.3181 -0.0371 -0.0146 -0.0005 161 TYR A CG    
1322 C CD1   . TYR A 161 ? 0.4183 0.2392 0.2887 -0.0364 -0.0204 0.0057  161 TYR A CD1   
1323 C CD2   . TYR A 161 ? 0.4658 0.2632 0.3240 -0.0429 -0.0077 -0.0079 161 TYR A CD2   
1324 C CE1   . TYR A 161 ? 0.4486 0.2625 0.3182 -0.0404 -0.0188 0.0055  161 TYR A CE1   
1325 C CE2   . TYR A 161 ? 0.4860 0.2750 0.3446 -0.0484 -0.0060 -0.0081 161 TYR A CE2   
1326 C CZ    . TYR A 161 ? 0.4797 0.2781 0.3442 -0.0467 -0.0115 -0.0007 161 TYR A CZ    
1327 O OH    . TYR A 161 ? 0.4830 0.2736 0.3468 -0.0524 -0.0079 -0.0002 161 TYR A OH    
1328 N N     . GLY A 162 ? 0.4307 0.2773 0.2876 -0.0478 -0.0312 -0.0066 162 GLY A N     
1329 C CA    . GLY A 162 ? 0.4334 0.2907 0.2863 -0.0547 -0.0366 -0.0132 162 GLY A CA    
1330 C C     . GLY A 162 ? 0.4269 0.3004 0.2813 -0.0505 -0.0457 -0.0073 162 GLY A C     
1331 O O     . GLY A 162 ? 0.4370 0.3091 0.2857 -0.0451 -0.0464 -0.0009 162 GLY A O     
1332 N N     . ALA A 163 ? 0.4118 0.3000 0.2745 -0.0525 -0.0516 -0.0087 163 ALA A N     
1333 C CA    . ALA A 163 ? 0.3976 0.3009 0.2624 -0.0457 -0.0598 -0.0026 163 ALA A CA    
1334 C C     . ALA A 163 ? 0.4087 0.3282 0.2640 -0.0477 -0.0680 -0.0055 163 ALA A C     
1335 O O     . ALA A 163 ? 0.4150 0.3462 0.2691 -0.0395 -0.0756 0.0019  163 ALA A O     
1336 C CB    . ALA A 163 ? 0.3852 0.2995 0.2665 -0.0436 -0.0613 -0.0016 163 ALA A CB    
1337 N N     . GLU A 164 ? 0.4132 0.3322 0.2599 -0.0582 -0.0666 -0.0160 164 GLU A N     
1338 C CA    . GLU A 164 ? 0.4242 0.3595 0.2574 -0.0629 -0.0752 -0.0212 164 GLU A CA    
1339 C C     . GLU A 164 ? 0.4399 0.3712 0.2532 -0.0546 -0.0778 -0.0124 164 GLU A C     
1340 O O     . GLU A 164 ? 0.4377 0.3507 0.2475 -0.0484 -0.0703 -0.0048 164 GLU A O     
1341 C CB    . GLU A 164 ? 0.4315 0.3600 0.2558 -0.0778 -0.0704 -0.0367 164 GLU A CB    
1342 C CG    . GLU A 164 ? 0.4381 0.3377 0.2483 -0.0785 -0.0576 -0.0398 164 GLU A CG    
1343 C CD    . GLU A 164 ? 0.4706 0.3496 0.2938 -0.0780 -0.0463 -0.0395 164 GLU A CD    
1344 O OE1   . GLU A 164 ? 0.4749 0.3317 0.2900 -0.0793 -0.0352 -0.0444 164 GLU A OE1   
1345 O OE2   . GLU A 164 ? 0.4746 0.3589 0.3150 -0.0749 -0.0479 -0.0336 164 GLU A OE2   
1346 N N     . TYR A 165 ? 0.4645 0.4142 0.2640 -0.0552 -0.0884 -0.0129 165 TYR A N     
1347 C CA    . TYR A 165 ? 0.4846 0.4290 0.2627 -0.0462 -0.0903 -0.0016 165 TYR A CA    
1348 C C     . TYR A 165 ? 0.4949 0.4167 0.2524 -0.0505 -0.0784 -0.0048 165 TYR A C     
1349 O O     . TYR A 165 ? 0.4967 0.4057 0.2439 -0.0437 -0.0731 0.0058  165 TYR A O     
1350 C CB    . TYR A 165 ? 0.5122 0.4828 0.2779 -0.0429 -0.1060 0.0019  165 TYR A CB    
1351 C CG    . TYR A 165 ? 0.5092 0.4962 0.2928 -0.0288 -0.1150 0.0146  165 TYR A CG    
1352 C CD1   . TYR A 165 ? 0.5107 0.5329 0.3119 -0.0292 -0.1280 0.0106  165 TYR A CD1   
1353 C CD2   . TYR A 165 ? 0.5116 0.4789 0.2962 -0.0155 -0.1094 0.0295  165 TYR A CD2   
1354 C CE1   . TYR A 165 ? 0.5097 0.5482 0.3300 -0.0135 -0.1347 0.0223  165 TYR A CE1   
1355 C CE2   . TYR A 165 ? 0.5233 0.5009 0.3234 -0.0010 -0.1154 0.0404  165 TYR A CE2   
1356 C CZ    . TYR A 165 ? 0.5206 0.5343 0.3391 0.0014  -0.1278 0.0372  165 TYR A CZ    
1357 O OH    . TYR A 165 ? 0.5254 0.5507 0.3617 0.0181  -0.1322 0.0478  165 TYR A OH    
1358 N N     . LYS A 166 ? 0.5023 0.4180 0.2553 -0.0619 -0.0722 -0.0198 166 LYS A N     
1359 C CA    . LYS A 166 ? 0.5191 0.4133 0.2560 -0.0644 -0.0582 -0.0243 166 LYS A CA    
1360 C C     . LYS A 166 ? 0.4991 0.3773 0.2505 -0.0569 -0.0470 -0.0155 166 LYS A C     
1361 O O     . LYS A 166 ? 0.5066 0.3722 0.2489 -0.0560 -0.0354 -0.0155 166 LYS A O     
1362 C CB    . LYS A 166 ? 0.5304 0.4155 0.2645 -0.0762 -0.0512 -0.0423 166 LYS A CB    
1363 C CG    . LYS A 166 ? 0.5695 0.4376 0.2793 -0.0794 -0.0388 -0.0504 166 LYS A CG    
1364 C CD    . LYS A 166 ? 0.6075 0.4593 0.3172 -0.0896 -0.0292 -0.0681 166 LYS A CD    
1365 C CE    . LYS A 166 ? 0.6335 0.4677 0.3157 -0.0934 -0.0159 -0.0795 166 LYS A CE    
1366 N NZ    . LYS A 166 ? 0.7048 0.5227 0.3822 -0.1061 -0.0093 -0.0989 166 LYS A NZ    
1367 N N     . VAL A 167 ? 0.4839 0.3649 0.2583 -0.0521 -0.0503 -0.0088 167 VAL A N     
1368 C CA    . VAL A 167 ? 0.4706 0.3396 0.2603 -0.0475 -0.0415 -0.0030 167 VAL A CA    
1369 C C     . VAL A 167 ? 0.4621 0.3327 0.2609 -0.0404 -0.0457 0.0096  167 VAL A C     
1370 O O     . VAL A 167 ? 0.4625 0.3249 0.2624 -0.0380 -0.0393 0.0164  167 VAL A O     
1371 C CB    . VAL A 167 ? 0.4558 0.3191 0.2626 -0.0501 -0.0374 -0.0096 167 VAL A CB    
1372 C CG1   . VAL A 167 ? 0.4386 0.2926 0.2575 -0.0451 -0.0289 -0.0044 167 VAL A CG1   
1373 C CG2   . VAL A 167 ? 0.4707 0.3276 0.2680 -0.0581 -0.0327 -0.0233 167 VAL A CG2   
1374 N N     . ARG A 168 ? 0.4574 0.3389 0.2638 -0.0378 -0.0554 0.0117  168 ARG A N     
1375 C CA    . ARG A 168 ? 0.4519 0.3312 0.2675 -0.0304 -0.0578 0.0217  168 ARG A CA    
1376 C C     . ARG A 168 ? 0.4364 0.3043 0.2654 -0.0312 -0.0505 0.0224  168 ARG A C     
1377 O O     . ARG A 168 ? 0.4361 0.2944 0.2642 -0.0292 -0.0470 0.0293  168 ARG A O     
1378 C CB    . ARG A 168 ? 0.4721 0.3463 0.2710 -0.0245 -0.0592 0.0328  168 ARG A CB    
1379 C CG    . ARG A 168 ? 0.4842 0.3732 0.2684 -0.0213 -0.0696 0.0346  168 ARG A CG    
1380 C CD    . ARG A 168 ? 0.5221 0.4009 0.2870 -0.0140 -0.0693 0.0483  168 ARG A CD    
1381 N NE    . ARG A 168 ? 0.5829 0.4771 0.3307 -0.0084 -0.0809 0.0531  168 ARG A NE    
1382 C CZ    . ARG A 168 ? 0.5867 0.4883 0.3360 0.0044  -0.0902 0.0642  168 ARG A CZ    
1383 N NH1   . ARG A 168 ? 0.5461 0.4369 0.3124 0.0123  -0.0869 0.0701  168 ARG A NH1   
1384 N NH2   . ARG A 168 ? 0.5801 0.5004 0.3130 0.0100  -0.1026 0.0691  168 ARG A NH2   
1385 N N     . GLY A 169 ? 0.4222 0.2912 0.2623 -0.0349 -0.0484 0.0153  169 GLY A N     
1386 C CA    . GLY A 169 ? 0.4160 0.2778 0.2667 -0.0353 -0.0432 0.0158  169 GLY A CA    
1387 C C     . GLY A 169 ? 0.4135 0.2769 0.2753 -0.0347 -0.0456 0.0148  169 GLY A C     
1388 O O     . GLY A 169 ? 0.4240 0.2912 0.2882 -0.0315 -0.0497 0.0173  169 GLY A O     
1389 N N     . PHE A 170 ? 0.4032 0.2630 0.2708 -0.0366 -0.0421 0.0119  170 PHE A N     
1390 C CA    . PHE A 170 ? 0.3945 0.2536 0.2690 -0.0365 -0.0426 0.0121  170 PHE A CA    
1391 C C     . PHE A 170 ? 0.4027 0.2616 0.2788 -0.0408 -0.0404 0.0067  170 PHE A C     
1392 O O     . PHE A 170 ? 0.4158 0.2668 0.2889 -0.0427 -0.0358 0.0040  170 PHE A O     
1393 C CB    . PHE A 170 ? 0.3927 0.2466 0.2699 -0.0352 -0.0405 0.0153  170 PHE A CB    
1394 C CG    . PHE A 170 ? 0.3931 0.2477 0.2708 -0.0347 -0.0420 0.0190  170 PHE A CG    
1395 C CD1   . PHE A 170 ? 0.4001 0.2559 0.2763 -0.0352 -0.0399 0.0207  170 PHE A CD1   
1396 C CD2   . PHE A 170 ? 0.3925 0.2453 0.2708 -0.0353 -0.0440 0.0199  170 PHE A CD2   
1397 C CE1   . PHE A 170 ? 0.4171 0.2723 0.2945 -0.0376 -0.0397 0.0236  170 PHE A CE1   
1398 C CE2   . PHE A 170 ? 0.3943 0.2450 0.2721 -0.0379 -0.0445 0.0213  170 PHE A CE2   
1399 C CZ    . PHE A 170 ? 0.4048 0.2569 0.2833 -0.0396 -0.0423 0.0234  170 PHE A CZ    
1400 N N     . SER A 171 ? 0.4018 0.2678 0.2834 -0.0427 -0.0418 0.0049  171 SER A N     
1401 C CA    . SER A 171 ? 0.4076 0.2724 0.2916 -0.0499 -0.0376 -0.0006 171 SER A CA    
1402 C C     . SER A 171 ? 0.4103 0.2601 0.2920 -0.0496 -0.0314 0.0026  171 SER A C     
1403 O O     . SER A 171 ? 0.4087 0.2548 0.2884 -0.0441 -0.0325 0.0084  171 SER A O     
1404 C CB    . SER A 171 ? 0.4066 0.2881 0.3006 -0.0528 -0.0397 -0.0036 171 SER A CB    
1405 O OG    . SER A 171 ? 0.4146 0.3013 0.3123 -0.0451 -0.0420 0.0012  171 SER A OG    
1406 N N     . GLY A 172 ? 0.4162 0.2570 0.2967 -0.0563 -0.0251 -0.0009 172 GLY A N     
1407 C CA    . GLY A 172 ? 0.4163 0.2401 0.2913 -0.0549 -0.0187 0.0043  172 GLY A CA    
1408 C C     . GLY A 172 ? 0.4082 0.2380 0.2845 -0.0544 -0.0187 0.0078  172 GLY A C     
1409 O O     . GLY A 172 ? 0.4153 0.2379 0.2845 -0.0492 -0.0186 0.0145  172 GLY A O     
1410 N N     . TYR A 173 ? 0.4011 0.2463 0.2864 -0.0595 -0.0191 0.0026  173 TYR A N     
1411 C CA    . TYR A 173 ? 0.3966 0.2498 0.2848 -0.0584 -0.0173 0.0040  173 TYR A CA    
1412 C C     . TYR A 173 ? 0.3847 0.2380 0.2682 -0.0495 -0.0227 0.0080  173 TYR A C     
1413 O O     . TYR A 173 ? 0.3916 0.2386 0.2668 -0.0478 -0.0203 0.0110  173 TYR A O     
1414 C CB    . TYR A 173 ? 0.3895 0.2654 0.2933 -0.0621 -0.0179 -0.0022 173 TYR A CB    
1415 C CG    . TYR A 173 ? 0.3874 0.2720 0.2960 -0.0594 -0.0133 -0.0018 173 TYR A CG    
1416 C CD1   . TYR A 173 ? 0.3930 0.2673 0.2943 -0.0641 -0.0033 0.0001  173 TYR A CD1   
1417 C CD2   . TYR A 173 ? 0.3774 0.2782 0.2960 -0.0513 -0.0176 -0.0027 173 TYR A CD2   
1418 C CE1   . TYR A 173 ? 0.4089 0.2906 0.3124 -0.0618 0.0030  -0.0007 173 TYR A CE1   
1419 C CE2   . TYR A 173 ? 0.3795 0.2863 0.3024 -0.0473 -0.0110 -0.0034 173 TYR A CE2   
1420 C CZ    . TYR A 173 ? 0.3914 0.2893 0.3065 -0.0531 -0.0005 -0.0032 173 TYR A CZ    
1421 O OH    . TYR A 173 ? 0.3803 0.2837 0.2977 -0.0498 0.0081  -0.0051 173 TYR A OH    
1422 N N     . LEU A 174 ? 0.3744 0.2334 0.2609 -0.0453 -0.0295 0.0076  174 LEU A N     
1423 C CA    . LEU A 174 ? 0.3692 0.2254 0.2512 -0.0396 -0.0335 0.0106  174 LEU A CA    
1424 C C     . LEU A 174 ? 0.3707 0.2166 0.2432 -0.0391 -0.0337 0.0148  174 LEU A C     
1425 O O     . LEU A 174 ? 0.3721 0.2156 0.2380 -0.0381 -0.0350 0.0157  174 LEU A O     
1426 C CB    . LEU A 174 ? 0.3600 0.2197 0.2441 -0.0367 -0.0388 0.0111  174 LEU A CB    
1427 C CG    . LEU A 174 ? 0.3675 0.2245 0.2496 -0.0324 -0.0410 0.0128  174 LEU A CG    
1428 C CD1   . LEU A 174 ? 0.3639 0.2199 0.2442 -0.0309 -0.0443 0.0154  174 LEU A CD1   
1429 C CD2   . LEU A 174 ? 0.3769 0.2255 0.2519 -0.0337 -0.0401 0.0132  174 LEU A CD2   
1430 N N     . CYS A 175 ? 0.3632 0.2036 0.2345 -0.0395 -0.0326 0.0170  175 CYS A N     
1431 C CA    . CYS A 175 ? 0.3738 0.2079 0.2387 -0.0360 -0.0336 0.0229  175 CYS A CA    
1432 C C     . CYS A 175 ? 0.3786 0.2062 0.2329 -0.0368 -0.0306 0.0262  175 CYS A C     
1433 O O     . CYS A 175 ? 0.3733 0.2016 0.2194 -0.0341 -0.0347 0.0304  175 CYS A O     
1434 C CB    . CYS A 175 ? 0.3830 0.2092 0.2492 -0.0337 -0.0303 0.0247  175 CYS A CB    
1435 S SG    . CYS A 175 ? 0.4160 0.2490 0.2901 -0.0314 -0.0325 0.0221  175 CYS A SG    
1436 N N     . GLU A 176 ? 0.3875 0.2106 0.2413 -0.0415 -0.0233 0.0240  176 GLU A N     
1437 C CA    . GLU A 176 ? 0.4035 0.2184 0.2445 -0.0431 -0.0179 0.0279  176 GLU A CA    
1438 C C     . GLU A 176 ? 0.3904 0.2124 0.2258 -0.0428 -0.0204 0.0252  176 GLU A C     
1439 O O     . GLU A 176 ? 0.4090 0.2275 0.2293 -0.0411 -0.0230 0.0292  176 GLU A O     
1440 C CB    . GLU A 176 ? 0.4159 0.2254 0.2597 -0.0508 -0.0073 0.0254  176 GLU A CB    
1441 C CG    . GLU A 176 ? 0.4597 0.2529 0.3017 -0.0520 -0.0028 0.0283  176 GLU A CG    
1442 C CD    . GLU A 176 ? 0.5305 0.3188 0.3780 -0.0636 0.0076  0.0228  176 GLU A CD    
1443 O OE1   . GLU A 176 ? 0.5665 0.3337 0.4031 -0.0673 0.0175  0.0279  176 GLU A OE1   
1444 O OE2   . GLU A 176 ? 0.5541 0.3600 0.4169 -0.0695 0.0059  0.0137  176 GLU A OE2   
1445 N N     . LEU A 177 ? 0.3650 0.1965 0.2113 -0.0438 -0.0200 0.0184  177 LEU A N     
1446 C CA    . LEU A 177 ? 0.3597 0.1930 0.2003 -0.0427 -0.0203 0.0144  177 LEU A CA    
1447 C C     . LEU A 177 ? 0.3605 0.1912 0.1909 -0.0416 -0.0286 0.0158  177 LEU A C     
1448 O O     . LEU A 177 ? 0.3727 0.1998 0.1889 -0.0431 -0.0282 0.0134  177 LEU A O     
1449 C CB    . LEU A 177 ? 0.3427 0.1847 0.1980 -0.0403 -0.0196 0.0088  177 LEU A CB    
1450 C CG    . LEU A 177 ? 0.3317 0.1846 0.2005 -0.0417 -0.0123 0.0059  177 LEU A CG    
1451 C CD1   . LEU A 177 ? 0.3189 0.1817 0.2006 -0.0354 -0.0136 0.0024  177 LEU A CD1   
1452 C CD2   . LEU A 177 ? 0.3176 0.1676 0.1778 -0.0452 -0.0018 0.0051  177 LEU A CD2   
1453 N N     . LEU A 178 ? 0.3538 0.1881 0.1914 -0.0399 -0.0355 0.0186  178 LEU A N     
1454 C CA    . LEU A 178 ? 0.3596 0.1974 0.1931 -0.0408 -0.0434 0.0189  178 LEU A CA    
1455 C C     . LEU A 178 ? 0.3795 0.2184 0.1990 -0.0402 -0.0475 0.0244  178 LEU A C     
1456 O O     . LEU A 178 ? 0.3938 0.2363 0.2026 -0.0438 -0.0531 0.0218  178 LEU A O     
1457 C CB    . LEU A 178 ? 0.3449 0.1893 0.1921 -0.0392 -0.0477 0.0207  178 LEU A CB    
1458 C CG    . LEU A 178 ? 0.3511 0.1942 0.2066 -0.0400 -0.0459 0.0164  178 LEU A CG    
1459 C CD1   . LEU A 178 ? 0.3026 0.1509 0.1688 -0.0383 -0.0472 0.0190  178 LEU A CD1   
1460 C CD2   . LEU A 178 ? 0.2941 0.1320 0.1440 -0.0441 -0.0469 0.0113  178 LEU A CD2   
1461 N N     . ILE A 179 ? 0.3768 0.2115 0.1946 -0.0360 -0.0448 0.0320  179 ILE A N     
1462 C CA    . ILE A 179 ? 0.3980 0.2312 0.1995 -0.0328 -0.0481 0.0402  179 ILE A CA    
1463 C C     . ILE A 179 ? 0.4231 0.2495 0.2033 -0.0372 -0.0438 0.0377  179 ILE A C     
1464 O O     . ILE A 179 ? 0.4433 0.2741 0.2063 -0.0379 -0.0505 0.0395  179 ILE A O     
1465 C CB    . ILE A 179 ? 0.4064 0.2295 0.2080 -0.0261 -0.0437 0.0502  179 ILE A CB    
1466 C CG1   . ILE A 179 ? 0.3941 0.2209 0.2155 -0.0214 -0.0447 0.0507  179 ILE A CG1   
1467 C CG2   . ILE A 179 ? 0.4206 0.2426 0.2035 -0.0201 -0.0487 0.0613  179 ILE A CG2   
1468 C CD1   . ILE A 179 ? 0.3858 0.2312 0.2171 -0.0169 -0.0551 0.0528  179 ILE A CD1   
1469 N N     . VAL A 180 ? 0.4257 0.2441 0.2069 -0.0406 -0.0325 0.0331  180 VAL A N     
1470 C CA    . VAL A 180 ? 0.4470 0.2595 0.2084 -0.0445 -0.0256 0.0297  180 VAL A CA    
1471 C C     . VAL A 180 ? 0.4556 0.2727 0.2097 -0.0478 -0.0317 0.0207  180 VAL A C     
1472 O O     . VAL A 180 ? 0.4813 0.2965 0.2113 -0.0505 -0.0341 0.0200  180 VAL A O     
1473 C CB    . VAL A 180 ? 0.4478 0.2566 0.2171 -0.0475 -0.0112 0.0250  180 VAL A CB    
1474 C CG1   . VAL A 180 ? 0.4451 0.2492 0.1946 -0.0508 -0.0021 0.0203  180 VAL A CG1   
1475 C CG2   . VAL A 180 ? 0.4409 0.2425 0.2139 -0.0482 -0.0041 0.0327  180 VAL A CG2   
1476 N N     . PHE A 181 ? 0.4395 0.2607 0.2114 -0.0483 -0.0343 0.0140  181 PHE A N     
1477 C CA    . PHE A 181 ? 0.4587 0.2792 0.2235 -0.0533 -0.0386 0.0048  181 PHE A CA    
1478 C C     . PHE A 181 ? 0.4749 0.3050 0.2284 -0.0573 -0.0518 0.0064  181 PHE A C     
1479 O O     . PHE A 181 ? 0.4978 0.3257 0.2300 -0.0634 -0.0539 0.0001  181 PHE A O     
1480 C CB    . PHE A 181 ? 0.4373 0.2570 0.2220 -0.0527 -0.0381 -0.0001 181 PHE A CB    
1481 C CG    . PHE A 181 ? 0.4513 0.2607 0.2277 -0.0575 -0.0359 -0.0108 181 PHE A CG    
1482 C CD1   . PHE A 181 ? 0.4698 0.2671 0.2380 -0.0558 -0.0244 -0.0179 181 PHE A CD1   
1483 C CD2   . PHE A 181 ? 0.4709 0.2817 0.2483 -0.0644 -0.0437 -0.0144 181 PHE A CD2   
1484 C CE1   . PHE A 181 ? 0.4851 0.2668 0.2434 -0.0595 -0.0202 -0.0288 181 PHE A CE1   
1485 C CE2   . PHE A 181 ? 0.4670 0.2622 0.2346 -0.0709 -0.0398 -0.0256 181 PHE A CE2   
1486 C CZ    . PHE A 181 ? 0.4818 0.2601 0.2386 -0.0677 -0.0278 -0.0328 181 PHE A CZ    
1487 N N     . TYR A 182 ? 0.4727 0.3155 0.2411 -0.0539 -0.0604 0.0142  182 TYR A N     
1488 C CA    . TYR A 182 ? 0.4823 0.3424 0.2485 -0.0569 -0.0741 0.0157  182 TYR A CA    
1489 C C     . TYR A 182 ? 0.5009 0.3692 0.2516 -0.0512 -0.0812 0.0268  182 TYR A C     
1490 O O     . TYR A 182 ? 0.5208 0.4039 0.2599 -0.0552 -0.0928 0.0261  182 TYR A O     
1491 C CB    . TYR A 182 ? 0.4611 0.3345 0.2542 -0.0558 -0.0789 0.0176  182 TYR A CB    
1492 C CG    . TYR A 182 ? 0.4609 0.3264 0.2631 -0.0631 -0.0742 0.0075  182 TYR A CG    
1493 C CD1   . TYR A 182 ? 0.4683 0.3322 0.2610 -0.0749 -0.0772 -0.0032 182 TYR A CD1   
1494 C CD2   . TYR A 182 ? 0.4451 0.3022 0.2626 -0.0587 -0.0665 0.0086  182 TYR A CD2   
1495 C CE1   . TYR A 182 ? 0.4885 0.3386 0.2869 -0.0810 -0.0709 -0.0112 182 TYR A CE1   
1496 C CE2   . TYR A 182 ? 0.4375 0.2846 0.2604 -0.0633 -0.0620 0.0019  182 TYR A CE2   
1497 C CZ    . TYR A 182 ? 0.4734 0.3148 0.2867 -0.0739 -0.0633 -0.0074 182 TYR A CZ    
1498 O OH    . TYR A 182 ? 0.4794 0.3048 0.2956 -0.0779 -0.0572 -0.0128 182 TYR A OH    
1499 N N     . GLY A 183 ? 0.5041 0.3627 0.2540 -0.0423 -0.0745 0.0372  183 GLY A N     
1500 C CA    . GLY A 183 ? 0.5339 0.3937 0.2657 -0.0348 -0.0790 0.0504  183 GLY A CA    
1501 C C     . GLY A 183 ? 0.5328 0.4018 0.2819 -0.0230 -0.0844 0.0629  183 GLY A C     
1502 O O     . GLY A 183 ? 0.5531 0.4130 0.2909 -0.0133 -0.0825 0.0762  183 GLY A O     
1503 N N     . SER A 184 ? 0.5152 0.4000 0.2908 -0.0231 -0.0892 0.0590  184 SER A N     
1504 C CA    . SER A 184 ? 0.5145 0.4083 0.3093 -0.0105 -0.0918 0.0694  184 SER A CA    
1505 C C     . SER A 184 ? 0.4889 0.3895 0.3118 -0.0132 -0.0886 0.0620  184 SER A C     
1506 O O     . SER A 184 ? 0.4732 0.3744 0.3002 -0.0246 -0.0873 0.0503  184 SER A O     
1507 C CB    . SER A 184 ? 0.5297 0.4514 0.3240 -0.0039 -0.1077 0.0778  184 SER A CB    
1508 O OG    . SER A 184 ? 0.5272 0.4746 0.3322 -0.0157 -0.1177 0.0667  184 SER A OG    
1509 N N     . PHE A 185 ? 0.4829 0.3861 0.3225 -0.0018 -0.0862 0.0693  185 PHE A N     
1510 C CA    . PHE A 185 ? 0.4662 0.3792 0.3306 -0.0030 -0.0834 0.0639  185 PHE A CA    
1511 C C     . PHE A 185 ? 0.4656 0.4096 0.3434 -0.0098 -0.0941 0.0593  185 PHE A C     
1512 O O     . PHE A 185 ? 0.4581 0.4043 0.3442 -0.0209 -0.0919 0.0496  185 PHE A O     
1513 C CB    . PHE A 185 ? 0.4636 0.3743 0.3412 0.0117  -0.0780 0.0723  185 PHE A CB    
1514 C CG    . PHE A 185 ? 0.4447 0.3726 0.3474 0.0119  -0.0760 0.0678  185 PHE A CG    
1515 C CD1   . PHE A 185 ? 0.4440 0.4044 0.3664 0.0185  -0.0838 0.0724  185 PHE A CD1   
1516 C CD2   . PHE A 185 ? 0.4165 0.3309 0.3232 0.0052  -0.0662 0.0592  185 PHE A CD2   
1517 C CE1   . PHE A 185 ? 0.4127 0.3898 0.3588 0.0177  -0.0794 0.0680  185 PHE A CE1   
1518 C CE2   . PHE A 185 ? 0.3923 0.3207 0.3180 0.0049  -0.0627 0.0557  185 PHE A CE2   
1519 C CZ    . PHE A 185 ? 0.3942 0.3529 0.3398 0.0107  -0.0681 0.0599  185 PHE A CZ    
1520 N N     . LEU A 186 ? 0.4868 0.4551 0.3668 -0.0032 -0.1058 0.0670  186 LEU A N     
1521 C CA    . LEU A 186 ? 0.4890 0.4921 0.3823 -0.0121 -0.1178 0.0620  186 LEU A CA    
1522 C C     . LEU A 186 ? 0.4897 0.4861 0.3704 -0.0323 -0.1188 0.0478  186 LEU A C     
1523 O O     . LEU A 186 ? 0.4847 0.4916 0.3806 -0.0439 -0.1181 0.0391  186 LEU A O     
1524 C CB    . LEU A 186 ? 0.5046 0.5358 0.3956 -0.0025 -0.1330 0.0726  186 LEU A CB    
1525 C CG    . LEU A 186 ? 0.5111 0.5884 0.4252 -0.0106 -0.1463 0.0680  186 LEU A CG    
1526 C CD1   . LEU A 186 ? 0.4928 0.5885 0.4439 -0.0053 -0.1392 0.0684  186 LEU A CD1   
1527 C CD2   . LEU A 186 ? 0.5087 0.6183 0.4174 -0.0020 -0.1647 0.0781  186 LEU A CD2   
1528 N N     . GLU A 187 ? 0.5072 0.4832 0.3595 -0.0360 -0.1184 0.0456  187 GLU A N     
1529 C CA    . GLU A 187 ? 0.5193 0.4844 0.3569 -0.0531 -0.1174 0.0317  187 GLU A CA    
1530 C C     . GLU A 187 ? 0.4970 0.4401 0.3429 -0.0583 -0.1042 0.0241  187 GLU A C     
1531 O O     . GLU A 187 ? 0.4955 0.4371 0.3444 -0.0714 -0.1031 0.0138  187 GLU A O     
1532 C CB    . GLU A 187 ? 0.5475 0.4950 0.3522 -0.0538 -0.1170 0.0313  187 GLU A CB    
1533 C CG    . GLU A 187 ? 0.5908 0.5348 0.3768 -0.0708 -0.1198 0.0165  187 GLU A CG    
1534 C CD    . GLU A 187 ? 0.6495 0.6273 0.4369 -0.0798 -0.1369 0.0132  187 GLU A CD    
1535 O OE1   . GLU A 187 ? 0.6778 0.6550 0.4540 -0.0972 -0.1396 -0.0014 187 GLU A OE1   
1536 O OE2   . GLU A 187 ? 0.6595 0.6656 0.4601 -0.0695 -0.1475 0.0250  187 GLU A OE2   
1537 N N     . THR A 188 ? 0.4834 0.4088 0.3320 -0.0483 -0.0944 0.0296  188 THR A N     
1538 C CA    . THR A 188 ? 0.4666 0.3769 0.3245 -0.0506 -0.0842 0.0249  188 THR A CA    
1539 C C     . THR A 188 ? 0.4594 0.3855 0.3373 -0.0568 -0.0856 0.0221  188 THR A C     
1540 O O     . THR A 188 ? 0.4753 0.3937 0.3523 -0.0677 -0.0827 0.0142  188 THR A O     
1541 C CB    . THR A 188 ? 0.4522 0.3500 0.3138 -0.0398 -0.0762 0.0312  188 THR A CB    
1542 O OG1   . THR A 188 ? 0.4703 0.3532 0.3141 -0.0369 -0.0730 0.0334  188 THR A OG1   
1543 C CG2   . THR A 188 ? 0.4368 0.3229 0.3054 -0.0423 -0.0682 0.0265  188 THR A CG2   
1544 N N     . VAL A 189 ? 0.4466 0.3937 0.3424 -0.0494 -0.0884 0.0289  189 VAL A N     
1545 C CA    . VAL A 189 ? 0.4301 0.3957 0.3478 -0.0545 -0.0874 0.0271  189 VAL A CA    
1546 C C     . VAL A 189 ? 0.4373 0.4178 0.3575 -0.0715 -0.0938 0.0188  189 VAL A C     
1547 O O     . VAL A 189 ? 0.4297 0.4045 0.3556 -0.0829 -0.0877 0.0129  189 VAL A O     
1548 C CB    . VAL A 189 ? 0.4280 0.4181 0.3652 -0.0416 -0.0897 0.0359  189 VAL A CB    
1549 C CG1   . VAL A 189 ? 0.4205 0.4382 0.3832 -0.0482 -0.0889 0.0336  189 VAL A CG1   
1550 C CG2   . VAL A 189 ? 0.4218 0.3915 0.3566 -0.0281 -0.0798 0.0412  189 VAL A CG2   
1551 N N     . LYS A 190 ? 0.4460 0.4439 0.3597 -0.0741 -0.1058 0.0182  190 LYS A N     
1552 C CA    . LYS A 190 ? 0.4567 0.4695 0.3699 -0.0926 -0.1133 0.0081  190 LYS A CA    
1553 C C     . LYS A 190 ? 0.4563 0.4347 0.3529 -0.1063 -0.1041 -0.0029 190 LYS A C     
1554 O O     . LYS A 190 ? 0.4615 0.4411 0.3644 -0.1228 -0.1019 -0.0113 190 LYS A O     
1555 C CB    . LYS A 190 ? 0.4759 0.5064 0.3747 -0.0923 -0.1280 0.0088  190 LYS A CB    
1556 C CG    . LYS A 190 ? 0.4908 0.5709 0.4118 -0.0928 -0.1426 0.0123  190 LYS A CG    
1557 C CD    . LYS A 190 ? 0.5134 0.6105 0.4138 -0.0938 -0.1591 0.0127  190 LYS A CD    
1558 C CE    . LYS A 190 ? 0.5750 0.6618 0.4534 -0.1180 -0.1620 -0.0048 190 LYS A CE    
1559 N NZ    . LYS A 190 ? 0.5947 0.7056 0.4528 -0.1226 -0.1802 -0.0066 190 LYS A NZ    
1560 N N     . ASN A 191 ? 0.4498 0.3972 0.3262 -0.0989 -0.0976 -0.0024 191 ASN A N     
1561 C CA    . ASN A 191 ? 0.4561 0.3709 0.3169 -0.1075 -0.0886 -0.0115 191 ASN A CA    
1562 C C     . ASN A 191 ? 0.4410 0.3373 0.3106 -0.1051 -0.0770 -0.0093 191 ASN A C     
1563 O O     . ASN A 191 ? 0.4545 0.3304 0.3185 -0.1153 -0.0703 -0.0159 191 ASN A O     
1564 C CB    . ASN A 191 ? 0.4673 0.3613 0.3051 -0.1002 -0.0860 -0.0124 191 ASN A CB    
1565 C CG    . ASN A 191 ? 0.4922 0.3953 0.3118 -0.1073 -0.0952 -0.0181 191 ASN A CG    
1566 O OD1   . ASN A 191 ? 0.5322 0.4253 0.3389 -0.1218 -0.0949 -0.0305 191 ASN A OD1   
1567 N ND2   . ASN A 191 ? 0.5019 0.4229 0.3183 -0.0977 -0.1035 -0.0092 191 ASN A ND2   
1568 N N     . ALA A 192 ? 0.4187 0.3195 0.2992 -0.0918 -0.0741 0.0002  192 ALA A N     
1569 C CA    . ALA A 192 ? 0.4115 0.2974 0.2973 -0.0890 -0.0643 0.0032  192 ALA A CA    
1570 C C     . ALA A 192 ? 0.4202 0.3096 0.3159 -0.1027 -0.0606 0.0002  192 ALA A C     
1571 O O     . ALA A 192 ? 0.4346 0.3029 0.3264 -0.1042 -0.0516 0.0013  192 ALA A O     
1572 C CB    . ALA A 192 ? 0.3840 0.2778 0.2790 -0.0754 -0.0626 0.0116  192 ALA A CB    
1573 N N     . ARG A 193 ? 0.4154 0.3320 0.3236 -0.1130 -0.0675 -0.0030 193 ARG A N     
1574 C CA    . ARG A 193 ? 0.4294 0.3547 0.3511 -0.1284 -0.0630 -0.0062 193 ARG A CA    
1575 C C     . ARG A 193 ? 0.4565 0.3478 0.3622 -0.1426 -0.0552 -0.0138 193 ARG A C     
1576 O O     . ARG A 193 ? 0.4651 0.3490 0.3763 -0.1542 -0.0464 -0.0144 193 ARG A O     
1577 C CB    . ARG A 193 ? 0.4307 0.3976 0.3710 -0.1379 -0.0737 -0.0096 193 ARG A CB    
1578 C CG    . ARG A 193 ? 0.4244 0.4234 0.3822 -0.1212 -0.0799 -0.0004 193 ARG A CG    
1579 C CD    . ARG A 193 ? 0.4481 0.4932 0.4278 -0.1281 -0.0913 -0.0021 193 ARG A CD    
1580 N NE    . ARG A 193 ? 0.4846 0.5358 0.4496 -0.1357 -0.1046 -0.0087 193 ARG A NE    
1581 C CZ    . ARG A 193 ? 0.4852 0.5786 0.4643 -0.1429 -0.1185 -0.0113 193 ARG A CZ    
1582 N NH1   . ARG A 193 ? 0.4909 0.6262 0.5034 -0.1421 -0.1204 -0.0073 193 ARG A NH1   
1583 N NH2   . ARG A 193 ? 0.5127 0.6085 0.4723 -0.1506 -0.1305 -0.0181 193 ARG A NH2   
1584 N N     . ARG A 194 ? 0.4718 0.3401 0.3568 -0.1408 -0.0566 -0.0193 194 ARG A N     
1585 C CA    . ARG A 194 ? 0.5057 0.3384 0.3732 -0.1524 -0.0488 -0.0280 194 ARG A CA    
1586 C C     . ARG A 194 ? 0.4998 0.2968 0.3529 -0.1372 -0.0395 -0.0227 194 ARG A C     
1587 O O     . ARG A 194 ? 0.5271 0.2893 0.3648 -0.1418 -0.0311 -0.0282 194 ARG A O     
1588 C CB    . ARG A 194 ? 0.5319 0.3658 0.3854 -0.1628 -0.0563 -0.0406 194 ARG A CB    
1589 C CG    . ARG A 194 ? 0.6043 0.4522 0.4628 -0.1888 -0.0601 -0.0526 194 ARG A CG    
1590 C CD    . ARG A 194 ? 0.6682 0.5711 0.5495 -0.1922 -0.0750 -0.0505 194 ARG A CD    
1591 N NE    . ARG A 194 ? 0.7110 0.6338 0.5854 -0.1782 -0.0877 -0.0469 194 ARG A NE    
1592 C CZ    . ARG A 194 ? 0.7275 0.6769 0.5968 -0.1869 -0.1019 -0.0538 194 ARG A CZ    
1593 N NH1   . ARG A 194 ? 0.7549 0.7185 0.6275 -0.2115 -0.1067 -0.0669 194 ARG A NH1   
1594 N NH2   . ARG A 194 ? 0.6948 0.6568 0.5542 -0.1719 -0.1114 -0.0475 194 ARG A NH2   
1595 N N     . TRP A 195 ? 0.4672 0.2727 0.3257 -0.1193 -0.0406 -0.0125 195 TRP A N     
1596 C CA    . TRP A 195 ? 0.4585 0.2384 0.3074 -0.1045 -0.0337 -0.0068 195 TRP A CA    
1597 C C     . TRP A 195 ? 0.4690 0.2252 0.3145 -0.1070 -0.0238 -0.0019 195 TRP A C     
1598 O O     . TRP A 195 ? 0.4718 0.2384 0.3265 -0.1153 -0.0217 0.0013  195 TRP A O     
1599 C CB    . TRP A 195 ? 0.4267 0.2232 0.2830 -0.0887 -0.0373 0.0018  195 TRP A CB    
1600 C CG    . TRP A 195 ? 0.4220 0.2326 0.2778 -0.0822 -0.0439 0.0001  195 TRP A CG    
1601 C CD1   . TRP A 195 ? 0.4355 0.2449 0.2817 -0.0867 -0.0471 -0.0074 195 TRP A CD1   
1602 C CD2   . TRP A 195 ? 0.3862 0.2114 0.2483 -0.0707 -0.0469 0.0061  195 TRP A CD2   
1603 N NE1   . TRP A 195 ? 0.4178 0.2407 0.2639 -0.0779 -0.0516 -0.0045 195 TRP A NE1   
1604 C CE2   . TRP A 195 ? 0.3733 0.2046 0.2300 -0.0686 -0.0511 0.0035  195 TRP A CE2   
1605 C CE3   . TRP A 195 ? 0.3729 0.2045 0.2424 -0.0633 -0.0454 0.0128  195 TRP A CE3   
1606 C CZ2   . TRP A 195 ? 0.3648 0.2061 0.2245 -0.0598 -0.0530 0.0080  195 TRP A CZ2   
1607 C CZ3   . TRP A 195 ? 0.3674 0.2094 0.2401 -0.0553 -0.0479 0.0153  195 TRP A CZ3   
1608 C CH2   . TRP A 195 ? 0.3767 0.2223 0.2452 -0.0537 -0.0512 0.0133  195 TRP A CH2   
1609 N N     . THR A 196 ? 0.4799 0.2046 0.3121 -0.0982 -0.0167 0.0000  196 THR A N     
1610 C CA    . THR A 196 ? 0.4960 0.1935 0.3209 -0.0972 -0.0070 0.0077  196 THR A CA    
1611 C C     . THR A 196 ? 0.4976 0.1875 0.3179 -0.0756 -0.0065 0.0176  196 THR A C     
1612 O O     . THR A 196 ? 0.4901 0.1909 0.3131 -0.0644 -0.0115 0.0156  196 THR A O     
1613 C CB    . THR A 196 ? 0.5296 0.1887 0.3406 -0.1085 0.0030  0.0006  196 THR A CB    
1614 O OG1   . THR A 196 ? 0.5411 0.1793 0.3416 -0.0959 0.0056  -0.0030 196 THR A OG1   
1615 C CG2   . THR A 196 ? 0.5193 0.1897 0.3345 -0.1320 0.0004  -0.0127 196 THR A CG2   
1616 N N     . ARG A 197 ? 0.5144 0.1865 0.3273 -0.0706 -0.0004 0.0284  197 ARG A N     
1617 C CA    . ARG A 197 ? 0.5154 0.1801 0.3224 -0.0502 -0.0007 0.0391  197 ARG A CA    
1618 C C     . ARG A 197 ? 0.5330 0.1749 0.3342 -0.0379 0.0031  0.0367  197 ARG A C     
1619 O O     . ARG A 197 ? 0.5374 0.1740 0.3359 -0.0192 0.0030  0.0461  197 ARG A O     
1620 C CB    . ARG A 197 ? 0.5406 0.1855 0.3353 -0.0490 0.0062  0.0523  197 ARG A CB    
1621 C CG    . ARG A 197 ? 0.5825 0.1809 0.3619 -0.0541 0.0193  0.0542  197 ARG A CG    
1622 C CD    . ARG A 197 ? 0.6175 0.1966 0.3837 -0.0581 0.0278  0.0671  197 ARG A CD    
1623 N NE    . ARG A 197 ? 0.6242 0.2233 0.3992 -0.0790 0.0294  0.0625  197 ARG A NE    
1624 C CZ    . ARG A 197 ? 0.6326 0.2304 0.4004 -0.0841 0.0357  0.0725  197 ARG A CZ    
1625 N NH1   . ARG A 197 ? 0.6124 0.2327 0.3927 -0.1026 0.0382  0.0669  197 ARG A NH1   
1626 N NH2   . ARG A 197 ? 0.6617 0.2374 0.4096 -0.0700 0.0396  0.0885  197 ARG A NH2   
1627 N N     . ARG A 198 ? 0.5393 0.1685 0.3381 -0.0476 0.0069  0.0240  198 ARG A N     
1628 C CA    . ARG A 198 ? 0.5657 0.1738 0.3589 -0.0355 0.0126  0.0198  198 ARG A CA    
1629 C C     . ARG A 198 ? 0.5378 0.1684 0.3375 -0.0373 0.0075  0.0080  198 ARG A C     
1630 O O     . ARG A 198 ? 0.5427 0.1634 0.3400 -0.0267 0.0125  0.0032  198 ARG A O     
1631 C CB    . ARG A 198 ? 0.6221 0.1832 0.3992 -0.0442 0.0260  0.0143  198 ARG A CB    
1632 C CG    . ARG A 198 ? 0.6918 0.2241 0.4588 -0.0460 0.0338  0.0262  198 ARG A CG    
1633 C CD    . ARG A 198 ? 0.7740 0.2989 0.5385 -0.0197 0.0343  0.0435  198 ARG A CD    
1634 N NE    . ARG A 198 ? 0.8759 0.3637 0.6316 -0.0030 0.0449  0.0441  198 ARG A NE    
1635 C CZ    . ARG A 198 ? 0.9570 0.3914 0.6947 -0.0047 0.0599  0.0463  198 ARG A CZ    
1636 N NH1   . ARG A 198 ? 0.9856 0.3985 0.7126 -0.0254 0.0663  0.0477  198 ARG A NH1   
1637 N NH2   . ARG A 198 ? 1.0057 0.4070 0.7369 0.0142  0.0703  0.0468  198 ARG A NH2   
1638 N N     . THR A 199 ? 0.5119 0.1727 0.3194 -0.0496 -0.0015 0.0042  199 THR A N     
1639 C CA    . THR A 199 ? 0.4925 0.1740 0.3028 -0.0527 -0.0068 -0.0051 199 THR A CA    
1640 C C     . THR A 199 ? 0.4740 0.1707 0.2919 -0.0355 -0.0081 -0.0021 199 THR A C     
1641 O O     . THR A 199 ? 0.4570 0.1691 0.2847 -0.0251 -0.0120 0.0072  199 THR A O     
1642 C CB    . THR A 199 ? 0.4642 0.1742 0.2821 -0.0659 -0.0163 -0.0065 199 THR A CB    
1643 O OG1   . THR A 199 ? 0.4770 0.1753 0.2901 -0.0838 -0.0140 -0.0120 199 THR A OG1   
1644 C CG2   . THR A 199 ? 0.4546 0.1842 0.2721 -0.0675 -0.0221 -0.0132 199 THR A CG2   
1645 N N     . VAL A 200 ? 0.4843 0.1762 0.2965 -0.0340 -0.0038 -0.0111 200 VAL A N     
1646 C CA    . VAL A 200 ? 0.4708 0.1775 0.2910 -0.0204 -0.0022 -0.0104 200 VAL A CA    
1647 C C     . VAL A 200 ? 0.4665 0.1874 0.2812 -0.0302 -0.0052 -0.0183 200 VAL A C     
1648 O O     . VAL A 200 ? 0.4823 0.1878 0.2815 -0.0397 -0.0015 -0.0284 200 VAL A O     
1649 C CB    . VAL A 200 ? 0.5047 0.1866 0.3193 -0.0085 0.0104  -0.0149 200 VAL A CB    
1650 C CG1   . VAL A 200 ? 0.4723 0.1761 0.2999 0.0051  0.0130  -0.0144 200 VAL A CG1   
1651 C CG2   . VAL A 200 ? 0.5318 0.1869 0.3448 0.0013  0.0157  -0.0072 200 VAL A CG2   
1652 N N     . ILE A 201 ? 0.4497 0.1981 0.2748 -0.0285 -0.0115 -0.0136 201 ILE A N     
1653 C CA    . ILE A 201 ? 0.4500 0.2105 0.2683 -0.0353 -0.0136 -0.0180 201 ILE A CA    
1654 C C     . ILE A 201 ? 0.4572 0.2261 0.2807 -0.0260 -0.0062 -0.0189 201 ILE A C     
1655 O O     . ILE A 201 ? 0.4480 0.2347 0.2881 -0.0190 -0.0078 -0.0127 201 ILE A O     
1656 C CB    . ILE A 201 ? 0.4277 0.2092 0.2529 -0.0406 -0.0238 -0.0116 201 ILE A CB    
1657 C CG1   . ILE A 201 ? 0.4317 0.2100 0.2553 -0.0502 -0.0297 -0.0113 201 ILE A CG1   
1658 C CG2   . ILE A 201 ? 0.4070 0.1993 0.2241 -0.0444 -0.0254 -0.0127 201 ILE A CG2   
1659 C CD1   . ILE A 201 ? 0.4333 0.2313 0.2674 -0.0515 -0.0375 -0.0042 201 ILE A CD1   
1660 N N     . ASP A 202 ? 0.4800 0.2373 0.2892 -0.0273 0.0023  -0.0277 202 ASP A N     
1661 C CA    . ASP A 202 ? 0.4864 0.2523 0.3005 -0.0195 0.0121  -0.0297 202 ASP A CA    
1662 C C     . ASP A 202 ? 0.4845 0.2587 0.2844 -0.0280 0.0128  -0.0317 202 ASP A C     
1663 O O     . ASP A 202 ? 0.5055 0.2666 0.2834 -0.0331 0.0186  -0.0401 202 ASP A O     
1664 C CB    . ASP A 202 ? 0.5193 0.2640 0.3281 -0.0108 0.0255  -0.0377 202 ASP A CB    
1665 C CG    . ASP A 202 ? 0.5466 0.3055 0.3687 0.0005  0.0372  -0.0387 202 ASP A CG    
1666 O OD1   . ASP A 202 ? 0.5528 0.3367 0.3851 -0.0021 0.0354  -0.0345 202 ASP A OD1   
1667 O OD2   . ASP A 202 ? 0.5808 0.3253 0.4039 0.0118  0.0495  -0.0440 202 ASP A OD2   
1668 N N     . VAL A 203 ? 0.4626 0.2562 0.2730 -0.0294 0.0077  -0.0239 203 VAL A N     
1669 C CA    . VAL A 203 ? 0.4600 0.2584 0.2555 -0.0372 0.0063  -0.0216 203 VAL A CA    
1670 C C     . VAL A 203 ? 0.4832 0.2788 0.2658 -0.0372 0.0198  -0.0268 203 VAL A C     
1671 O O     . VAL A 203 ? 0.5100 0.2963 0.2658 -0.0437 0.0205  -0.0304 203 VAL A O     
1672 C CB    . VAL A 203 ? 0.4397 0.2538 0.2493 -0.0379 0.0017  -0.0122 203 VAL A CB    
1673 C CG1   . VAL A 203 ? 0.4479 0.2601 0.2388 -0.0444 -0.0041 -0.0070 203 VAL A CG1   
1674 C CG2   . VAL A 203 ? 0.4270 0.2478 0.2558 -0.0348 -0.0071 -0.0079 203 VAL A CG2   
1675 N N     . ALA A 204 ? 0.4728 0.2792 0.2741 -0.0304 0.0306  -0.0274 204 ALA A N     
1676 C CA    . ALA A 204 ? 0.4838 0.2894 0.2760 -0.0296 0.0470  -0.0334 204 ALA A CA    
1677 C C     . ALA A 204 ? 0.5083 0.2915 0.2732 -0.0305 0.0534  -0.0442 204 ALA A C     
1678 O O     . ALA A 204 ? 0.5265 0.3037 0.2674 -0.0355 0.0626  -0.0485 204 ALA A O     
1679 C CB    . ALA A 204 ? 0.4728 0.2970 0.2955 -0.0200 0.0578  -0.0343 204 ALA A CB    
1680 N N     . LYS A 205 ? 0.5095 0.2784 0.2758 -0.0268 0.0495  -0.0490 205 LYS A N     
1681 C CA    . LYS A 205 ? 0.5498 0.2930 0.2901 -0.0293 0.0566  -0.0617 205 LYS A CA    
1682 C C     . LYS A 205 ? 0.5553 0.2890 0.2703 -0.0434 0.0426  -0.0637 205 LYS A C     
1683 O O     . LYS A 205 ? 0.5910 0.3055 0.2787 -0.0507 0.0458  -0.0755 205 LYS A O     
1684 C CB    . LYS A 205 ? 0.5616 0.2892 0.3153 -0.0174 0.0641  -0.0667 205 LYS A CB    
1685 C CG    . LYS A 205 ? 0.5826 0.3239 0.3615 -0.0013 0.0789  -0.0659 205 LYS A CG    
1686 C CD    . LYS A 205 ? 0.6624 0.3790 0.4358 0.0105  0.0965  -0.0771 205 LYS A CD    
1687 C CE    . LYS A 205 ? 0.6839 0.3800 0.4667 0.0201  0.0931  -0.0750 205 LYS A CE    
1688 N NZ    . LYS A 205 ? 0.6661 0.3841 0.4860 0.0386  0.0913  -0.0634 205 LYS A NZ    
1689 N N     . GLY A 206 ? 0.5286 0.2780 0.2531 -0.0474 0.0274  -0.0528 206 GLY A N     
1690 C CA    . GLY A 206 ? 0.5362 0.2865 0.2424 -0.0591 0.0129  -0.0522 206 GLY A CA    
1691 C C     . GLY A 206 ? 0.5517 0.2869 0.2544 -0.0654 0.0080  -0.0606 206 GLY A C     
1692 O O     . GLY A 206 ? 0.5733 0.3031 0.2527 -0.0775 0.0019  -0.0685 206 GLY A O     
1693 N N     . GLU A 207 ? 0.5405 0.2699 0.2658 -0.0581 0.0103  -0.0584 207 GLU A N     
1694 C CA    . GLU A 207 ? 0.5618 0.2684 0.2836 -0.0624 0.0119  -0.0665 207 GLU A CA    
1695 C C     . GLU A 207 ? 0.5418 0.2527 0.2866 -0.0600 0.0043  -0.0571 207 GLU A C     
1696 O O     . GLU A 207 ? 0.5191 0.2441 0.2855 -0.0490 0.0033  -0.0464 207 GLU A O     
1697 C CB    . GLU A 207 ? 0.5832 0.2658 0.3018 -0.0522 0.0297  -0.0748 207 GLU A CB    
1698 C CG    . GLU A 207 ? 0.6309 0.2822 0.3446 -0.0551 0.0344  -0.0822 207 GLU A CG    
1699 C CD    . GLU A 207 ? 0.6913 0.3144 0.3993 -0.0430 0.0538  -0.0909 207 GLU A CD    
1700 O OE1   . GLU A 207 ? 0.6766 0.3058 0.4071 -0.0241 0.0604  -0.0825 207 GLU A OE1   
1701 O OE2   . GLU A 207 ? 0.7577 0.3534 0.4388 -0.0523 0.0624  -0.1068 207 GLU A OE2   
1702 N N     . VAL A 208 ? 0.5553 0.2541 0.2937 -0.0721 -0.0003 -0.0623 208 VAL A N     
1703 C CA    . VAL A 208 ? 0.5373 0.2346 0.2921 -0.0726 -0.0046 -0.0552 208 VAL A CA    
1704 C C     . VAL A 208 ? 0.5731 0.2335 0.3197 -0.0725 0.0073  -0.0627 208 VAL A C     
1705 O O     . VAL A 208 ? 0.6035 0.2427 0.3295 -0.0840 0.0124  -0.0766 208 VAL A O     
1706 C CB    . VAL A 208 ? 0.5278 0.2415 0.2830 -0.0883 -0.0176 -0.0551 208 VAL A CB    
1707 C CG1   . VAL A 208 ? 0.5167 0.2278 0.2878 -0.0900 -0.0191 -0.0483 208 VAL A CG1   
1708 C CG2   . VAL A 208 ? 0.5173 0.2629 0.2789 -0.0853 -0.0279 -0.0467 208 VAL A CG2   
1709 N N     . ARG A 209 ? 0.5731 0.2244 0.3341 -0.0596 0.0119  -0.0532 209 ARG A N     
1710 C CA    . ARG A 209 ? 0.6207 0.2337 0.3747 -0.0525 0.0258  -0.0568 209 ARG A CA    
1711 C C     . ARG A 209 ? 0.6174 0.2206 0.3812 -0.0504 0.0245  -0.0454 209 ARG A C     
1712 O O     . ARG A 209 ? 0.5771 0.2079 0.3558 -0.0497 0.0139  -0.0344 209 ARG A O     
1713 C CB    . ARG A 209 ? 0.6224 0.2371 0.3840 -0.0308 0.0351  -0.0543 209 ARG A CB    
1714 C CG    . ARG A 209 ? 0.6831 0.2578 0.4351 -0.0197 0.0523  -0.0604 209 ARG A CG    
1715 C CD    . ARG A 209 ? 0.6745 0.2589 0.4343 -0.0007 0.0624  -0.0618 209 ARG A CD    
1716 N NE    . ARG A 209 ? 0.6332 0.2534 0.4209 0.0159  0.0562  -0.0473 209 ARG A NE    
1717 C CZ    . ARG A 209 ? 0.6034 0.2613 0.4026 0.0150  0.0500  -0.0451 209 ARG A CZ    
1718 N NH1   . ARG A 209 ? 0.6081 0.2738 0.3927 0.0005  0.0486  -0.0538 209 ARG A NH1   
1719 N NH2   . ARG A 209 ? 0.5647 0.2525 0.3891 0.0282  0.0453  -0.0339 209 ARG A NH2   
1720 N N     . LYS A 210 ? 0.6525 0.2140 0.4056 -0.0500 0.0362  -0.0480 210 LYS A N     
1721 C CA    . LYS A 210 ? 0.6614 0.2101 0.4208 -0.0450 0.0371  -0.0343 210 LYS A CA    
1722 C C     . LYS A 210 ? 0.6722 0.2112 0.4389 -0.0172 0.0440  -0.0228 210 LYS A C     
1723 O O     . LYS A 210 ? 0.6984 0.2246 0.4620 -0.0047 0.0537  -0.0290 210 LYS A O     
1724 C CB    . LYS A 210 ? 0.6985 0.2099 0.4428 -0.0642 0.0445  -0.0407 210 LYS A CB    
1725 C CG    . LYS A 210 ? 0.7835 0.2378 0.5117 -0.0558 0.0631  -0.0433 210 LYS A CG    
1726 C CD    . LYS A 210 ? 0.8167 0.2482 0.5467 -0.0436 0.0682  -0.0248 210 LYS A CD    
1727 C CE    . LYS A 210 ? 0.8525 0.2534 0.5707 -0.0675 0.0743  -0.0270 210 LYS A CE    
1728 N NZ    . LYS A 210 ? 0.8256 0.2676 0.5564 -0.0859 0.0608  -0.0245 210 LYS A NZ    
1729 N N     . GLY A 211 ? 0.6593 0.2079 0.4361 -0.0067 0.0388  -0.0062 211 GLY A N     
1730 C CA    . GLY A 211 ? 0.6702 0.2186 0.4561 0.0206  0.0415  0.0066  211 GLY A CA    
1731 C C     . GLY A 211 ? 0.6931 0.2300 0.4766 0.0270  0.0397  0.0237  211 GLY A C     
1732 O O     . GLY A 211 ? 0.7088 0.2229 0.4799 0.0104  0.0427  0.0240  211 GLY A O     
1733 N N     . GLU A 212 ? 0.6963 0.2511 0.4910 0.0502  0.0349  0.0380  212 GLU A N     
1734 C CA    . GLU A 212 ? 0.7114 0.2598 0.5009 0.0592  0.0314  0.0565  212 GLU A CA    
1735 C C     . GLU A 212 ? 0.6632 0.2493 0.4584 0.0471  0.0174  0.0606  212 GLU A C     
1736 O O     . GLU A 212 ? 0.6716 0.2469 0.4558 0.0429  0.0169  0.0711  212 GLU A O     
1737 C CB    . GLU A 212 ? 0.7326 0.2852 0.5298 0.0909  0.0307  0.0711  212 GLU A CB    
1738 C CG    . GLU A 212 ? 0.7937 0.3245 0.5944 0.1090  0.0435  0.0660  212 GLU A CG    
1739 C CD    . GLU A 212 ? 0.9285 0.3954 0.7081 0.1174  0.0602  0.0719  212 GLU A CD    
1740 O OE1   . GLU A 212 ? 0.9812 0.4127 0.7523 0.1134  0.0752  0.0580  212 GLU A OE1   
1741 O OE2   . GLU A 212 ? 0.9772 0.4261 0.7460 0.1281  0.0595  0.0905  212 GLU A OE2   
1742 N N     . GLU A 213 ? 0.6158 0.2434 0.4265 0.0418  0.0078  0.0526  213 GLU A N     
1743 C CA    . GLU A 213 ? 0.5841 0.2411 0.3985 0.0286  -0.0027 0.0537  213 GLU A CA    
1744 C C     . GLU A 213 ? 0.5397 0.2247 0.3647 0.0152  -0.0081 0.0411  213 GLU A C     
1745 O O     . GLU A 213 ? 0.5357 0.2246 0.3662 0.0171  -0.0056 0.0323  213 GLU A O     
1746 C CB    . GLU A 213 ? 0.5811 0.2630 0.3992 0.0414  -0.0126 0.0668  213 GLU A CB    
1747 C CG    . GLU A 213 ? 0.6360 0.3286 0.4628 0.0658  -0.0155 0.0750  213 GLU A CG    
1748 C CD    . GLU A 213 ? 0.6589 0.3854 0.5068 0.0691  -0.0195 0.0654  213 GLU A CD    
1749 O OE1   . GLU A 213 ? 0.6756 0.4372 0.5367 0.0786  -0.0294 0.0698  213 GLU A OE1   
1750 O OE2   . GLU A 213 ? 0.6899 0.4084 0.5402 0.0610  -0.0125 0.0531  213 GLU A OE2   
1751 N N     . PHE A 214 ? 0.5137 0.2166 0.3402 0.0024  -0.0144 0.0411  214 PHE A N     
1752 C CA    . PHE A 214 ? 0.4789 0.2059 0.3142 -0.0081 -0.0194 0.0318  214 PHE A CA    
1753 C C     . PHE A 214 ? 0.4690 0.2190 0.3160 0.0033  -0.0234 0.0311  214 PHE A C     
1754 O O     . PHE A 214 ? 0.4765 0.2428 0.3289 0.0127  -0.0288 0.0382  214 PHE A O     
1755 C CB    . PHE A 214 ? 0.4563 0.2012 0.2940 -0.0178 -0.0250 0.0340  214 PHE A CB    
1756 C CG    . PHE A 214 ? 0.4172 0.1821 0.2625 -0.0273 -0.0292 0.0260  214 PHE A CG    
1757 C CD1   . PHE A 214 ? 0.4178 0.1777 0.2609 -0.0405 -0.0278 0.0193  214 PHE A CD1   
1758 C CD2   . PHE A 214 ? 0.3916 0.1802 0.2456 -0.0235 -0.0347 0.0255  214 PHE A CD2   
1759 C CE1   . PHE A 214 ? 0.4190 0.1984 0.2679 -0.0467 -0.0330 0.0142  214 PHE A CE1   
1760 C CE2   . PHE A 214 ? 0.3632 0.1657 0.2219 -0.0306 -0.0375 0.0203  214 PHE A CE2   
1761 C CZ    . PHE A 214 ? 0.3693 0.1677 0.2251 -0.0406 -0.0372 0.0157  214 PHE A CZ    
1762 N N     . PHE A 215 ? 0.4641 0.2159 0.3139 0.0015  -0.0203 0.0220  215 PHE A N     
1763 C CA    . PHE A 215 ? 0.4469 0.2188 0.3089 0.0105  -0.0205 0.0197  215 PHE A CA    
1764 C C     . PHE A 215 ? 0.4190 0.2017 0.2813 -0.0001 -0.0204 0.0109  215 PHE A C     
1765 O O     . PHE A 215 ? 0.4154 0.1826 0.2664 -0.0084 -0.0165 0.0040  215 PHE A O     
1766 C CB    . PHE A 215 ? 0.4791 0.2343 0.3412 0.0248  -0.0116 0.0193  215 PHE A CB    
1767 C CG    . PHE A 215 ? 0.4876 0.2691 0.3680 0.0389  -0.0120 0.0210  215 PHE A CG    
1768 C CD1   . PHE A 215 ? 0.4989 0.2819 0.3869 0.0577  -0.0121 0.0299  215 PHE A CD1   
1769 C CD2   . PHE A 215 ? 0.4893 0.2956 0.3800 0.0334  -0.0122 0.0143  215 PHE A CD2   
1770 C CE1   . PHE A 215 ? 0.4955 0.3101 0.4050 0.0707  -0.0135 0.0313  215 PHE A CE1   
1771 C CE2   . PHE A 215 ? 0.4921 0.3264 0.4031 0.0441  -0.0115 0.0150  215 PHE A CE2   
1772 C CZ    . PHE A 215 ? 0.4849 0.3265 0.4073 0.0628  -0.0129 0.0230  215 PHE A CZ    
1773 N N     . VAL A 216 ? 0.3972 0.2053 0.2703 -0.0006 -0.0246 0.0112  216 VAL A N     
1774 C CA    . VAL A 216 ? 0.3853 0.2021 0.2575 -0.0084 -0.0230 0.0054  216 VAL A CA    
1775 C C     . VAL A 216 ? 0.3794 0.2126 0.2640 -0.0018 -0.0180 0.0032  216 VAL A C     
1776 O O     . VAL A 216 ? 0.3748 0.2303 0.2737 -0.0002 -0.0218 0.0058  216 VAL A O     
1777 C CB    . VAL A 216 ? 0.3703 0.1975 0.2425 -0.0174 -0.0298 0.0075  216 VAL A CB    
1778 C CG1   . VAL A 216 ? 0.3596 0.1941 0.2299 -0.0232 -0.0278 0.0045  216 VAL A CG1   
1779 C CG2   . VAL A 216 ? 0.3764 0.1915 0.2394 -0.0243 -0.0329 0.0085  216 VAL A CG2   
1780 N N     . VAL A 217 ? 0.3761 0.1996 0.2556 0.0009  -0.0086 -0.0026 217 VAL A N     
1781 C CA    . VAL A 217 ? 0.3602 0.2005 0.2540 0.0083  -0.0008 -0.0052 217 VAL A CA    
1782 C C     . VAL A 217 ? 0.3540 0.2133 0.2530 -0.0011 -0.0005 -0.0062 217 VAL A C     
1783 O O     . VAL A 217 ? 0.3528 0.2029 0.2363 -0.0111 0.0003  -0.0080 217 VAL A O     
1784 C CB    . VAL A 217 ? 0.3737 0.1974 0.2588 0.0135  0.0120  -0.0123 217 VAL A CB    
1785 C CG1   . VAL A 217 ? 0.3439 0.1901 0.2489 0.0228  0.0211  -0.0141 217 VAL A CG1   
1786 C CG2   . VAL A 217 ? 0.3774 0.1740 0.2543 0.0219  0.0142  -0.0120 217 VAL A CG2   
1787 N N     . ASP A 218 ? 0.3516 0.2375 0.2720 0.0017  -0.0015 -0.0047 218 ASP A N     
1788 C CA    . ASP A 218 ? 0.3587 0.2615 0.2864 -0.0081 0.0024  -0.0068 218 ASP A CA    
1789 C C     . ASP A 218 ? 0.3768 0.2768 0.3001 -0.0084 0.0168  -0.0120 218 ASP A C     
1790 O O     . ASP A 218 ? 0.3932 0.2971 0.3253 0.0027  0.0242  -0.0147 218 ASP A O     
1791 C CB    . ASP A 218 ? 0.3498 0.2851 0.3041 -0.0058 -0.0013 -0.0062 218 ASP A CB    
1792 C CG    . ASP A 218 ? 0.3545 0.3017 0.3136 -0.0206 -0.0016 -0.0079 218 ASP A CG    
1793 O OD1   . ASP A 218 ? 0.3587 0.2996 0.3108 -0.0293 0.0085  -0.0101 218 ASP A OD1   
1794 O OD2   . ASP A 218 ? 0.3461 0.3070 0.3137 -0.0239 -0.0111 -0.0071 218 ASP A OD2   
1795 N N     . PRO A 219 ? 0.3853 0.2774 0.2938 -0.0199 0.0220  -0.0127 219 PRO A N     
1796 C CA    . PRO A 219 ? 0.3989 0.2871 0.2984 -0.0207 0.0369  -0.0174 219 PRO A CA    
1797 C C     . PRO A 219 ? 0.3989 0.3162 0.3257 -0.0188 0.0475  -0.0202 219 PRO A C     
1798 O O     . PRO A 219 ? 0.4240 0.3444 0.3531 -0.0131 0.0612  -0.0252 219 PRO A O     
1799 C CB    . PRO A 219 ? 0.3995 0.2743 0.2765 -0.0331 0.0379  -0.0144 219 PRO A CB    
1800 C CG    . PRO A 219 ? 0.3868 0.2534 0.2586 -0.0357 0.0232  -0.0090 219 PRO A CG    
1801 C CD    . PRO A 219 ? 0.3774 0.2617 0.2743 -0.0309 0.0160  -0.0086 219 PRO A CD    
1802 N N     . VAL A 220 ? 0.3762 0.3162 0.3245 -0.0239 0.0412  -0.0181 220 VAL A N     
1803 C CA    . VAL A 220 ? 0.3699 0.3449 0.3489 -0.0261 0.0482  -0.0210 220 VAL A CA    
1804 C C     . VAL A 220 ? 0.3706 0.3736 0.3789 -0.0096 0.0455  -0.0220 220 VAL A C     
1805 O O     . VAL A 220 ? 0.3660 0.4028 0.4029 -0.0080 0.0538  -0.0254 220 VAL A O     
1806 C CB    . VAL A 220 ? 0.3583 0.3424 0.3439 -0.0407 0.0404  -0.0196 220 VAL A CB    
1807 C CG1   . VAL A 220 ? 0.3463 0.3691 0.3653 -0.0390 0.0325  -0.0217 220 VAL A CG1   
1808 C CG2   . VAL A 220 ? 0.3662 0.3408 0.3408 -0.0567 0.0529  -0.0199 220 VAL A CG2   
1809 N N     . ASP A 221 ? 0.3759 0.3658 0.3779 0.0030  0.0343  -0.0183 221 ASP A N     
1810 C CA    . ASP A 221 ? 0.3875 0.3983 0.4127 0.0215  0.0294  -0.0158 221 ASP A CA    
1811 C C     . ASP A 221 ? 0.4039 0.3810 0.4083 0.0335  0.0241  -0.0117 221 ASP A C     
1812 O O     . ASP A 221 ? 0.3936 0.3614 0.3889 0.0319  0.0107  -0.0065 221 ASP A O     
1813 C CB    . ASP A 221 ? 0.3738 0.4193 0.4217 0.0186  0.0148  -0.0130 221 ASP A CB    
1814 C CG    . ASP A 221 ? 0.3929 0.4634 0.4636 0.0400  0.0070  -0.0077 221 ASP A CG    
1815 O OD1   . ASP A 221 ? 0.4102 0.4693 0.4815 0.0587  0.0149  -0.0060 221 ASP A OD1   
1816 O OD2   . ASP A 221 ? 0.4000 0.5009 0.4865 0.0386  -0.0071 -0.0052 221 ASP A OD2   
1817 N N     . GLU A 222 ? 0.4336 0.3917 0.4304 0.0447  0.0365  -0.0149 222 GLU A N     
1818 C CA    . GLU A 222 ? 0.4677 0.3877 0.4423 0.0532  0.0357  -0.0134 222 GLU A CA    
1819 C C     . GLU A 222 ? 0.4655 0.3865 0.4474 0.0665  0.0235  -0.0041 222 GLU A C     
1820 O O     . GLU A 222 ? 0.4789 0.3661 0.4403 0.0688  0.0209  -0.0014 222 GLU A O     
1821 C CB    . GLU A 222 ? 0.4970 0.4008 0.4676 0.0652  0.0536  -0.0200 222 GLU A CB    
1822 C CG    . GLU A 222 ? 0.5235 0.4550 0.5268 0.0873  0.0604  -0.0179 222 GLU A CG    
1823 C CD    . GLU A 222 ? 0.5741 0.4760 0.5683 0.1039  0.0776  -0.0233 222 GLU A CD    
1824 O OE1   . GLU A 222 ? 0.6434 0.5052 0.6047 0.0946  0.0846  -0.0308 222 GLU A OE1   
1825 O OE2   . GLU A 222 ? 0.6264 0.5455 0.6464 0.1265  0.0842  -0.0204 222 GLU A OE2   
1826 N N     . LYS A 223 ? 0.4562 0.4162 0.4666 0.0750  0.0163  0.0008  223 LYS A N     
1827 C CA    . LYS A 223 ? 0.4601 0.4231 0.4751 0.0895  0.0043  0.0113  223 LYS A CA    
1828 C C     . LYS A 223 ? 0.4411 0.4038 0.4438 0.0755  -0.0112 0.0152  223 LYS A C     
1829 O O     . LYS A 223 ? 0.4577 0.4087 0.4509 0.0829  -0.0200 0.0238  223 LYS A O     
1830 C CB    . LYS A 223 ? 0.4655 0.4745 0.5160 0.1070  0.0015  0.0155  223 LYS A CB    
1831 C CG    . LYS A 223 ? 0.4952 0.5012 0.5590 0.1295  0.0169  0.0148  223 LYS A CG    
1832 C CD    . LYS A 223 ? 0.5446 0.5051 0.5880 0.1476  0.0194  0.0225  223 LYS A CD    
1833 C CE    . LYS A 223 ? 0.5728 0.5160 0.6216 0.1673  0.0397  0.0183  223 LYS A CE    
1834 N NZ    . LYS A 223 ? 0.5640 0.4837 0.5955 0.1518  0.0565  0.0035  223 LYS A NZ    
1835 N N     . ARG A 224 ? 0.4204 0.3932 0.4216 0.0556  -0.0128 0.0093  224 ARG A N     
1836 C CA    . ARG A 224 ? 0.4027 0.3751 0.3931 0.0421  -0.0251 0.0113  224 ARG A CA    
1837 C C     . ARG A 224 ? 0.4047 0.3363 0.3661 0.0364  -0.0255 0.0130  224 ARG A C     
1838 O O     . ARG A 224 ? 0.4171 0.3255 0.3648 0.0304  -0.0169 0.0082  224 ARG A O     
1839 C CB    . ARG A 224 ? 0.3891 0.3783 0.3856 0.0233  -0.0235 0.0040  224 ARG A CB    
1840 C CG    . ARG A 224 ? 0.3820 0.3924 0.3837 0.0134  -0.0354 0.0039  224 ARG A CG    
1841 C CD    . ARG A 224 ? 0.3860 0.3715 0.3641 0.0066  -0.0424 0.0066  224 ARG A CD    
1842 N NE    . ARG A 224 ? 0.4223 0.4271 0.4038 0.0100  -0.0554 0.0103  224 ARG A NE    
1843 C CZ    . ARG A 224 ? 0.4340 0.4376 0.4044 -0.0007 -0.0625 0.0088  224 ARG A CZ    
1844 N NH1   . ARG A 224 ? 0.4477 0.4312 0.4054 -0.0143 -0.0578 0.0043  224 ARG A NH1   
1845 N NH2   . ARG A 224 ? 0.4552 0.4782 0.4262 0.0035  -0.0744 0.0120  224 ARG A NH2   
1846 N N     . ASN A 225 ? 0.3942 0.3196 0.3461 0.0373  -0.0354 0.0195  225 ASN A N     
1847 C CA    . ASN A 225 ? 0.3802 0.2760 0.3096 0.0277  -0.0360 0.0202  225 ASN A CA    
1848 C C     . ASN A 225 ? 0.3600 0.2650 0.2866 0.0128  -0.0415 0.0173  225 ASN A C     
1849 O O     . ASN A 225 ? 0.3608 0.2764 0.2867 0.0118  -0.0499 0.0205  225 ASN A O     
1850 C CB    . ASN A 225 ? 0.3891 0.2665 0.3068 0.0369  -0.0396 0.0291  225 ASN A CB    
1851 C CG    . ASN A 225 ? 0.3762 0.2280 0.2747 0.0255  -0.0394 0.0294  225 ASN A CG    
1852 O OD1   . ASN A 225 ? 0.3728 0.2212 0.2671 0.0129  -0.0377 0.0233  225 ASN A OD1   
1853 N ND2   . ASN A 225 ? 0.3610 0.1962 0.2482 0.0305  -0.0409 0.0373  225 ASN A ND2   
1854 N N     . VAL A 226 ? 0.3487 0.2476 0.2712 0.0017  -0.0364 0.0117  226 VAL A N     
1855 C CA    . VAL A 226 ? 0.3335 0.2361 0.2525 -0.0105 -0.0399 0.0098  226 VAL A CA    
1856 C C     . VAL A 226 ? 0.3339 0.2267 0.2415 -0.0116 -0.0462 0.0140  226 VAL A C     
1857 O O     . VAL A 226 ? 0.3282 0.2294 0.2354 -0.0176 -0.0502 0.0126  226 VAL A O     
1858 C CB    . VAL A 226 ? 0.3272 0.2181 0.2386 -0.0195 -0.0336 0.0064  226 VAL A CB    
1859 C CG1   . VAL A 226 ? 0.3235 0.2164 0.2333 -0.0293 -0.0353 0.0051  226 VAL A CG1   
1860 C CG2   . VAL A 226 ? 0.3348 0.2336 0.2541 -0.0193 -0.0254 0.0027  226 VAL A CG2   
1861 N N     . ALA A 227 ? 0.3342 0.2084 0.2319 -0.0068 -0.0454 0.0182  227 ALA A N     
1862 C CA    . ALA A 227 ? 0.3293 0.1933 0.2160 -0.0083 -0.0486 0.0228  227 ALA A CA    
1863 C C     . ALA A 227 ? 0.3435 0.2115 0.2280 0.0012  -0.0533 0.0298  227 ALA A C     
1864 O O     . ALA A 227 ? 0.3631 0.2172 0.2357 0.0020  -0.0533 0.0355  227 ALA A O     
1865 C CB    . ALA A 227 ? 0.3212 0.1636 0.1987 -0.0116 -0.0444 0.0232  227 ALA A CB    
1866 N N     . ALA A 228 ? 0.3440 0.2325 0.2398 0.0086  -0.0572 0.0302  228 ALA A N     
1867 C CA    . ALA A 228 ? 0.3607 0.2563 0.2542 0.0203  -0.0634 0.0387  228 ALA A CA    
1868 C C     . ALA A 228 ? 0.3689 0.2633 0.2466 0.0160  -0.0688 0.0426  228 ALA A C     
1869 O O     . ALA A 228 ? 0.3837 0.2644 0.2480 0.0230  -0.0693 0.0519  228 ALA A O     
1870 C CB    . ALA A 228 ? 0.3567 0.2851 0.2690 0.0266  -0.0690 0.0370  228 ALA A CB    
1871 N N     . ASN A 229 ? 0.3684 0.2742 0.2458 0.0043  -0.0710 0.0352  229 ASN A N     
1872 C CA    . ASN A 229 ? 0.3825 0.2880 0.2437 -0.0003 -0.0744 0.0366  229 ASN A CA    
1873 C C     . ASN A 229 ? 0.3900 0.2748 0.2404 -0.0086 -0.0669 0.0354  229 ASN A C     
1874 O O     . ASN A 229 ? 0.4068 0.2916 0.2440 -0.0130 -0.0672 0.0349  229 ASN A O     
1875 C CB    . ASN A 229 ? 0.3780 0.3072 0.2427 -0.0083 -0.0806 0.0279  229 ASN A CB    
1876 C CG    . ASN A 229 ? 0.4049 0.3412 0.2513 -0.0081 -0.0876 0.0307  229 ASN A CG    
1877 O OD1   . ASN A 229 ? 0.4474 0.3759 0.2806 0.0016  -0.0896 0.0420  229 ASN A OD1   
1878 N ND2   . ASN A 229 ? 0.4125 0.3614 0.2552 -0.0192 -0.0906 0.0204  229 ASN A ND2   
1879 N N     . LEU A 230 ? 0.3763 0.2463 0.2323 -0.0107 -0.0601 0.0344  230 LEU A N     
1880 C CA    . LEU A 230 ? 0.3743 0.2292 0.2237 -0.0170 -0.0538 0.0350  230 LEU A CA    
1881 C C     . LEU A 230 ? 0.3910 0.2316 0.2266 -0.0134 -0.0516 0.0444  230 LEU A C     
1882 O O     . LEU A 230 ? 0.4063 0.2336 0.2410 -0.0080 -0.0498 0.0495  230 LEU A O     
1883 C CB    . LEU A 230 ? 0.3631 0.2097 0.2212 -0.0205 -0.0495 0.0318  230 LEU A CB    
1884 C CG    . LEU A 230 ? 0.3710 0.2070 0.2259 -0.0268 -0.0443 0.0331  230 LEU A CG    
1885 C CD1   . LEU A 230 ? 0.3678 0.2123 0.2243 -0.0315 -0.0426 0.0298  230 LEU A CD1   
1886 C CD2   . LEU A 230 ? 0.3801 0.2089 0.2404 -0.0302 -0.0424 0.0304  230 LEU A CD2   
1887 N N     . SER A 231 ? 0.3912 0.2314 0.2142 -0.0166 -0.0499 0.0466  231 SER A N     
1888 C CA    . SER A 231 ? 0.4166 0.2416 0.2234 -0.0141 -0.0462 0.0569  231 SER A CA    
1889 C C     . SER A 231 ? 0.4218 0.2281 0.2323 -0.0197 -0.0377 0.0584  231 SER A C     
1890 O O     . SER A 231 ? 0.4205 0.2312 0.2433 -0.0275 -0.0349 0.0512  231 SER A O     
1891 C CB    . SER A 231 ? 0.4259 0.2544 0.2170 -0.0185 -0.0436 0.0575  231 SER A CB    
1892 O OG    . SER A 231 ? 0.4113 0.2343 0.2061 -0.0274 -0.0337 0.0548  231 SER A OG    
1893 N N     . LEU A 232 ? 0.4380 0.2232 0.2373 -0.0162 -0.0336 0.0678  232 LEU A N     
1894 C CA    . LEU A 232 ? 0.4393 0.2047 0.2397 -0.0253 -0.0242 0.0682  232 LEU A CA    
1895 C C     . LEU A 232 ? 0.4374 0.2120 0.2426 -0.0383 -0.0179 0.0638  232 LEU A C     
1896 O O     . LEU A 232 ? 0.4294 0.2104 0.2497 -0.0466 -0.0167 0.0563  232 LEU A O     
1897 C CB    . LEU A 232 ? 0.4694 0.2059 0.2516 -0.0206 -0.0181 0.0806  232 LEU A CB    
189