data_3OV7
# 
_entry.id   3OV7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OV7         
NDB   NA0759       
RCSB  RCSB061614   
WWPDB D_1000061614 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OUY . unspecified 
PDB 3OV7 . unspecified 
PDB 3OVA . unspecified 
PDB 3OVB . unspecified 
PDB 3OVS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OV7 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, B.C.'    1 
'Xiong, Y.'    2 
'Steitz, T.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            330 
_citation.page_first                937 
_citation.page_last                 940 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21071662 
_citation.pdbx_database_id_DOI      10.1126/science.1194985 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, B.'      1 
primary 'Xiong, Y.'    2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           3OV7 
_cell.length_a           111.393 
_cell.length_b           216.095 
_cell.length_c           58.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OV7 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CCA-Adding Enzyme'         51909.758 2  '2.7.7.25, 2.7.7.21' ? ? ? 
2 polymer     syn 'RNA (34-MER)'              10837.447 2  ?                    ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   2  ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'               96.063    2  ?                    ? ? ? 
5 non-polymer syn 'MANGANESE (II) ION'        54.938    1  ?                    ? ? ? 
6 non-polymer syn 1,2-ETHANEDIOL              62.068    1  ?                    ? ? ? 
7 water       nat water                       18.015    52 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
2 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCM
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCM
;
A,B ? 
2 polyribonucleotide no no GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 CYS n 
1 439 CYS n 
1 440 CYS n 
1 441 MET n 
2 1   G   n 
2 2   G   n 
2 3   A   n 
2 4   A   n 
2 5   G   n 
2 6   U   n 
2 7   A   n 
2 8   G   n 
2 9   A   n 
2 10  U   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  A   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  A   n 
2 23  U   n 
2 24  U   n 
2 25  U   n 
2 26  A   n 
2 27  C   n 
2 28  U   n 
2 29  U   n 
2 30  C   n 
2 31  C   n 
2 32  A   n 
2 33  C   n 
2 34  C   n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Archaeoglobus fulgidus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      2234 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Chemical Synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 O28126 ? 
2 PDB 3OV7      2 ? ? 3OV7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OV7 A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 1 3OV7 B 1 ? 437 ? O28126 1 ? 437 ? 1 437 
3 2 3OV7 C 1 ? 34  ? 3OV7   1 ? 34  ? 1 34  
4 2 3OV7 D 1 ? 34  ? 3OV7   1 ? 34  ? 1 34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OV7 CYS A 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 1 
1 3OV7 CYS A 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 2 
1 3OV7 CYS A 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 3 
1 3OV7 MET A 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 4 
2 3OV7 CYS B 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 5 
2 3OV7 CYS B 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 6 
2 3OV7 CYS B 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 7 
2 3OV7 MET B 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"  ?                 'C10 H16 N5 O13 P3' 507.181 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL               'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ?                 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'         ?                 'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ?                 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                ?                 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                    ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ?                 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OV7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 0.2 M tri-lithium citrate, 80 mM ammonium sulfate, 50 mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-10-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3OV7 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   31817 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.157 
_reflns.pdbx_netI_over_sigmaI        8.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
3.00 3.12 99.9  ? ? ? ? ? ? ? ? ? ? ? 1 
3.12 3.27 100.0 ? ? ? ? ? ? ? ? ? ? ? 2 
3.27 3.44 100.0 ? ? ? ? ? ? ? ? ? ? ? 3 
3.44 3.65 100.0 ? ? ? ? ? ? ? ? ? ? ? 4 
3.65 3.94 100.0 ? ? ? ? ? ? ? ? ? ? ? 5 
3.94 4.33 100.0 ? ? ? ? ? ? ? ? ? ? ? 6 
# 
_refine.entry_id                                 3OV7 
_refine.ls_number_reflns_obs                     27529 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.7 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.51 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.20836 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20514 
_refine.ls_R_factor_R_free                       0.26723 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1458 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.920 
_refine.correlation_coeff_Fo_to_Fc_free          0.855 
_refine.B_iso_mean                               67.704 
_refine.aniso_B[1][1]                            -0.04 
_refine.aniso_B[2][2]                            0.13 
_refine.aniso_B[3][3]                            -0.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.462 
_refine.overall_SU_ML                            0.373 
_refine.overall_SU_B                             42.549 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7284 
_refine_hist.pdbx_number_atoms_nucleic_acid   1440 
_refine_hist.pdbx_number_atoms_ligand         77 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               8853 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        49.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 9125  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.369  2.179  ? 12610 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.722  5.000  ? 876   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.936 22.784 ? 388   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   21.120 15.000 ? 1396  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.600 15.000 ? 80    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.086  0.200  ? 1386  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 6400  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.211  0.200  ? 4323  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.308  0.200  ? 6121  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.168  0.200  ? 299   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.185  0.200  ? 60    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.176  0.200  ? 4     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.389  1.500  ? 4473  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.700  2.000  ? 7056  'X-RAY DIFFRACTION' ? 
r_scbond_it              0.985  3.000  ? 5630  'X-RAY DIFFRACTION' ? 
r_scangle_it             1.770  4.500  ? 5554  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.000 
_refine_ls_shell.d_res_low                        3.078 
_refine_ls_shell.number_reflns_R_work             2025 
_refine_ls_shell.R_factor_R_work                  0.312 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.419 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OV7 
_struct.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine in Position 76 of tRNA' 
_struct.pdbx_descriptor           'protein (E.C.2.7.7.25, 2.7.7.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OV7 
_struct_keywords.pdbx_keywords   Transferase/RNA 
_struct_keywords.text            'Protein-RNA, Rossmann Fold, CCA-adding, tRNA, nucleotidyltransfer, Transferase-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 3 ? 
I N N 4 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 2   ? ILE A 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP A 17  ? LEU A 38  ? ASP A 17  LEU A 38  1 ? 22 
HELX_P HELX_P3  3  GLY A 46  ? ARG A 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  ARG A 129 ? GLY A 139 ? ARG A 129 GLY A 139 1 ? 11 
HELX_P HELX_P6  6  LYS A 144 ? ASN A 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU A 265 ? GLY A 275 ? GLU A 265 GLY A 275 1 ? 11 
HELX_P HELX_P12 12 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP A 351 ? ARG A 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR A 384 ? TRP A 397 ? THR A 384 TRP A 397 1 ? 14 
HELX_P HELX_P15 15 HIS A 398 ? LEU A 400 ? HIS A 398 LEU A 400 5 ? 3  
HELX_P HELX_P16 16 ASN A 403 ? TYR A 411 ? ASN A 403 TYR A 411 1 ? 9  
HELX_P HELX_P17 17 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P19 19 GLU B 4   ? ILE B 15  ? GLU B 4   ILE B 15  1 ? 12 
HELX_P HELX_P20 20 ASP B 17  ? GLY B 39  ? ASP B 17  GLY B 39  1 ? 23 
HELX_P HELX_P21 21 GLY B 46  ? ARG B 50  ? GLY B 46  ARG B 50  1 ? 5  
HELX_P HELX_P22 22 SER B 71  ? LEU B 87  ? SER B 71  LEU B 87  1 ? 17 
HELX_P HELX_P23 23 ASP B 128 ? LYS B 142 ? ASP B 128 LYS B 142 1 ? 15 
HELX_P HELX_P24 24 LYS B 144 ? ALA B 157 ? LYS B 144 ALA B 157 1 ? 14 
HELX_P HELX_P25 25 SER B 171 ? GLY B 183 ? SER B 171 GLY B 183 1 ? 13 
HELX_P HELX_P26 26 SER B 184 ? ARG B 193 ? SER B 184 ARG B 193 1 ? 10 
HELX_P HELX_P27 27 SER B 231 ? ALA B 248 ? SER B 231 ALA B 248 1 ? 18 
HELX_P HELX_P28 28 SER B 250 ? PHE B 254 ? SER B 250 PHE B 254 5 ? 5  
HELX_P HELX_P29 29 GLU B 263 ? GLY B 275 ? GLU B 263 GLY B 275 1 ? 13 
HELX_P HELX_P30 30 VAL B 289 ? GLU B 311 ? VAL B 289 GLU B 311 1 ? 23 
HELX_P HELX_P31 31 ASP B 351 ? ARG B 361 ? ASP B 351 ARG B 361 1 ? 11 
HELX_P HELX_P32 32 THR B 384 ? TRP B 397 ? THR B 384 TRP B 397 1 ? 14 
HELX_P HELX_P33 33 HIS B 398 ? LEU B 400 ? HIS B 398 LEU B 400 5 ? 3  
HELX_P HELX_P34 34 GLY B 401 ? TYR B 411 ? GLY B 401 TYR B 411 1 ? 11 
HELX_P HELX_P35 35 GLY B 417 ? LYS B 422 ? GLY B 417 LYS B 422 1 ? 6  
HELX_P HELX_P36 36 VAL B 425 ? GLY B 434 ? VAL B 425 GLY B 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ATP .  O3G ? ? ? 1_555 G MN .  MN ? ? A ATP 501 A MN 701 1_555 ? ? ? ? ? ? ?                    2.763 ? 
metalc2  metalc ? ? E ATP .  O2B ? ? ? 1_555 G MN .  MN ? ? A ATP 501 A MN 701 1_555 ? ? ? ? ? ? ?                    2.777 ? 
hydrog1  hydrog ? ? C G   1  N1  ? ? ? 1_555 C C  31 N3 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? C G   1  N2  ? ? ? 1_555 C C  31 O2 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? C G   1  O6  ? ? ? 1_555 C C  31 N4 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? C G   2  N1  ? ? ? 1_555 C C  30 N3 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? C G   2  N2  ? ? ? 1_555 C C  30 O2 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? C G   2  O6  ? ? ? 1_555 C C  30 N4 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? C A   3  N1  ? ? ? 1_555 C U  29 N3 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? C A   3  N6  ? ? ? 1_555 C U  29 O4 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? C A   4  N1  ? ? ? 1_555 C U  28 N3 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? C A   4  N6  ? ? ? 1_555 C U  28 O4 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? C G   5  N1  ? ? ? 1_555 C C  27 O2 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog12 hydrog ? ? C U   6  N3  ? ? ? 1_555 C A  26 N1 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog13 hydrog ? ? C A   7  N1  ? ? ? 1_555 C U  25 N3 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? C A   7  N6  ? ? ? 1_555 C U  25 O4 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? C G   8  N1  ? ? ? 1_555 C U  24 O2 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog16 hydrog ? ? C G   8  O6  ? ? ? 1_555 C U  24 N3 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog17 hydrog ? ? C A   9  N1  ? ? ? 1_555 C U  23 N3 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18 hydrog ? ? C A   9  N6  ? ? ? 1_555 C U  23 O4 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? C U   10 N3  ? ? ? 1_555 C A  22 N1 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? C U   10 O4  ? ? ? 1_555 C A  22 N6 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? C G   11 N1  ? ? ? 1_555 C C  21 N3 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? C G   11 N2  ? ? ? 1_555 C C  21 O2 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? C G   11 O6  ? ? ? 1_555 C C  21 N4 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? C G   12 N1  ? ? ? 1_555 C C  20 N3 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? C G   12 N2  ? ? ? 1_555 C C  20 O2 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? C G   12 O6  ? ? ? 1_555 C C  20 N4 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? C U   13 N3  ? ? ? 1_555 C A  17 N7 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog28 hydrog ? ? C U   13 O2  ? ? ? 1_555 C A  17 N6 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog29 hydrog ? ? D G   1  N1  ? ? ? 1_555 D C  31 N3 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? D G   1  N2  ? ? ? 1_555 D C  31 O2 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? D G   1  O6  ? ? ? 1_555 D C  31 N4 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? D G   2  N1  ? ? ? 1_555 D C  30 O2 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog33 hydrog ? ? D A   3  N1  ? ? ? 1_555 D U  29 N3 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? D A   3  N6  ? ? ? 1_555 D U  29 O4 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? D G   5  N2  ? ? ? 1_555 D C  27 O2 ? ? D G   5   D C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog36 hydrog ? ? D U   6  N3  ? ? ? 1_555 D A  26 N1 ? ? D U   6   D A  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog37 hydrog ? ? D U   6  O4  ? ? ? 1_555 D A  26 N6 ? ? D U   6   D A  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog38 hydrog ? ? D A   7  N1  ? ? ? 1_555 D U  25 N3 ? ? D A   7   D U  25  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog39 hydrog ? ? D G   8  N1  ? ? ? 1_555 D U  24 O2 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog40 hydrog ? ? D G   8  O6  ? ? ? 1_555 D U  24 N3 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog41 hydrog ? ? D A   9  N1  ? ? ? 1_555 D U  23 N3 ? ? D A   9   D U  23  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog42 hydrog ? ? D U   10 N3  ? ? ? 1_555 D A  22 N1 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43 hydrog ? ? D U   10 O4  ? ? ? 1_555 D A  22 N6 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog44 hydrog ? ? D G   11 N1  ? ? ? 1_555 D C  21 N3 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45 hydrog ? ? D G   11 N2  ? ? ? 1_555 D C  21 O2 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? D G   11 O6  ? ? ? 1_555 D C  21 N4 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? D G   12 N1  ? ? ? 1_555 D C  20 N3 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? D G   12 N2  ? ? ? 1_555 D C  20 O2 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog49 hydrog ? ? D G   12 O6  ? ? ? 1_555 D C  20 N4 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
F ? 5 ? 
G ? 3 ? 
H ? 4 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
A 2 GLU A 59  ? PHE A 66  ? GLU A 59  PHE A 66  
A 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
A 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 
A 5 SER A 89  ? GLU A 91  ? SER A 89  GLU A 91  
B 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
B 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
B 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
B 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
C 1 HIS A 258 ? PRO A 259 ? HIS A 258 PRO A 259 
C 2 CYS A 439 ? CYS A 440 ? CYS A 439 CYS A 440 
D 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
D 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
D 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
D 4 PHE A 412 ? SER A 416 ? PHE A 412 SER A 416 
E 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
E 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
E 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
F 1 TYR B 42  ? VAL B 45  ? TYR B 42  VAL B 45  
F 2 ILE B 60  ? PHE B 66  ? ILE B 60  PHE B 66  
F 3 VAL B 107 ? TYR B 115 ? VAL B 107 TYR B 115 
F 4 VAL B 100 ? VAL B 104 ? VAL B 100 VAL B 104 
F 5 TYR B 90  ? GLU B 91  ? TYR B 90  GLU B 91  
G 1 GLU B 207 ? ARG B 209 ? GLU B 207 ARG B 209 
G 2 VAL B 200 ? ASP B 202 ? VAL B 200 ASP B 202 
G 3 PHE B 215 ? VAL B 216 ? PHE B 215 VAL B 216 
H 1 PRO B 315 ? ALA B 322 ? PRO B 315 ALA B 322 
H 2 PHE B 326 ? CYS B 333 ? PHE B 326 CYS B 333 
H 3 ALA B 277 ? ARG B 284 ? ALA B 277 ARG B 284 
H 4 GLU B 413 ? SER B 416 ? GLU B 413 SER B 416 
I 1 VAL B 341 ? GLN B 348 ? VAL B 341 GLN B 348 
I 2 ARG B 373 ? MET B 379 ? ARG B 373 MET B 379 
I 3 PHE B 368 ? GLU B 370 ? PHE B 368 GLU B 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
A 2 3 N PHE A 66  ? N PHE A 66  O CYS A 114 ? O CYS A 114 
A 3 4 O VAL A 109 ? O VAL A 109 N GLY A 102 ? N GLY A 102 
A 4 5 O HIS A 101 ? O HIS A 101 N GLU A 91  ? N GLU A 91  
B 1 2 O ARG A 209 ? O ARG A 209 N VAL A 200 ? N VAL A 200 
B 2 3 N ILE A 201 ? N ILE A 201 O PHE A 215 ? O PHE A 215 
B 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
C 1 2 N HIS A 258 ? N HIS A 258 O CYS A 440 ? O CYS A 440 
D 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
D 2 3 O CYS A 333 ? O CYS A 333 N ALA A 277 ? N ALA A 277 
D 3 4 N LYS A 282 ? N LYS A 282 O GLU A 413 ? O GLU A 413 
E 1 2 N PHE A 342 ? N PHE A 342 O GLU A 378 ? O GLU A 378 
E 2 3 O ARG A 373 ? O ARG A 373 N GLU A 370 ? N GLU A 370 
F 1 2 N VAL B 45  ? N VAL B 45  O ASP B 61  ? O ASP B 61  
F 2 3 N VAL B 62  ? N VAL B 62  O VAL B 112 ? O VAL B 112 
F 3 4 O VAL B 107 ? O VAL B 107 N VAL B 104 ? N VAL B 104 
F 4 5 O HIS B 101 ? O HIS B 101 N GLU B 91  ? N GLU B 91  
G 1 2 O ARG B 209 ? O ARG B 209 N VAL B 200 ? N VAL B 200 
G 2 3 N ILE B 201 ? N ILE B 201 O PHE B 215 ? O PHE B 215 
H 1 2 N LEU B 316 ? N LEU B 316 O GLU B 332 ? O GLU B 332 
H 2 3 O CYS B 333 ? O CYS B 333 N ALA B 277 ? N ALA B 277 
H 3 4 N LYS B 282 ? N LYS B 282 O GLU B 413 ? O GLU B 413 
I 1 2 N ARG B 344 ? N ARG B 344 O ALA B 376 ? O ALA B 376 
I 2 3 O ARG B 373 ? O ARG B 373 N GLU B 370 ? N GLU B 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ATP A 501' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 601' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MN A 701'  
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ATP B 502' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 603' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 GLY A 46  ? GLY A 46  . ? 1_555 ? 
2  AC1 15 SER A 47  ? SER A 47  . ? 1_555 ? 
3  AC1 15 ARG A 50  ? ARG A 50  . ? 1_555 ? 
4  AC1 15 GLU A 59  ? GLU A 59  . ? 1_555 ? 
5  AC1 15 ASP A 61  ? ASP A 61  . ? 1_555 ? 
6  AC1 15 THR A 130 ? THR A 130 . ? 1_555 ? 
7  AC1 15 HIS A 133 ? HIS A 133 . ? 1_555 ? 
8  AC1 15 LYS A 152 ? LYS A 152 . ? 1_555 ? 
9  AC1 15 TYR A 161 ? TYR A 161 . ? 1_555 ? 
10 AC1 15 ARG A 224 ? ARG A 224 . ? 1_555 ? 
11 AC1 15 HOH K .   ? HOH A 464 . ? 1_555 ? 
12 AC1 15 MN  G .   ? MN  A 701 . ? 1_555 ? 
13 AC1 15 A   C 32  ? A   C 32  . ? 1_555 ? 
14 AC1 15 C   C 33  ? C   C 33  . ? 1_555 ? 
15 AC1 15 C   C 34  ? C   C 34  . ? 1_555 ? 
16 AC2 3  ARG A 299 ? ARG A 299 . ? 1_555 ? 
17 AC2 3  ARG A 302 ? ARG A 302 . ? 1_555 ? 
18 AC2 3  LYS A 303 ? LYS A 303 . ? 1_555 ? 
19 AC3 3  GLU A 59  ? GLU A 59  . ? 1_555 ? 
20 AC3 3  ASP A 61  ? ASP A 61  . ? 1_555 ? 
21 AC3 3  ATP E .   ? ATP A 501 . ? 1_555 ? 
22 AC4 14 GLY B 46  ? GLY B 46  . ? 1_555 ? 
23 AC4 14 SER B 47  ? SER B 47  . ? 1_555 ? 
24 AC4 14 ARG B 50  ? ARG B 50  . ? 1_555 ? 
25 AC4 14 ASP B 61  ? ASP B 61  . ? 1_555 ? 
26 AC4 14 THR B 130 ? THR B 130 . ? 1_555 ? 
27 AC4 14 HIS B 133 ? HIS B 133 . ? 1_555 ? 
28 AC4 14 LYS B 152 ? LYS B 152 . ? 1_555 ? 
29 AC4 14 TYR B 161 ? TYR B 161 . ? 1_555 ? 
30 AC4 14 TYR B 173 ? TYR B 173 . ? 1_555 ? 
31 AC4 14 ARG B 224 ? ARG B 224 . ? 1_555 ? 
32 AC4 14 HOH L .   ? HOH B 445 . ? 1_555 ? 
33 AC4 14 A   D 32  ? A   D 32  . ? 1_555 ? 
34 AC4 14 C   D 33  ? C   D 33  . ? 1_555 ? 
35 AC4 14 C   D 34  ? C   D 34  . ? 1_555 ? 
36 AC5 3  ARG B 299 ? ARG B 299 . ? 1_555 ? 
37 AC5 3  ARG B 302 ? ARG B 302 . ? 1_555 ? 
38 AC5 3  LYS B 303 ? LYS B 303 . ? 1_555 ? 
39 AC6 5  LYS A 257 ? LYS A 257 . ? 1_555 ? 
40 AC6 5  ASP A 437 ? ASP A 437 . ? 1_555 ? 
41 AC6 5  CYS A 438 ? CYS A 438 . ? 1_555 ? 
42 AC6 5  CYS A 439 ? CYS A 439 . ? 1_555 ? 
43 AC6 5  ARG B 366 ? ARG B 366 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OV7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OV7 
_atom_sites.fract_transf_matrix[1][1]   0.008977 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004628 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017194 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -16.809 51.765  13.781  1.00 111.18 ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -17.214 52.352  15.092  1.00 112.80 ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -18.048 51.341  15.888  1.00 107.93 ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -18.563 50.376  15.315  1.00 102.67 ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -18.023 53.640  14.875  1.00 110.48 ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -17.402 54.656  13.900  1.00 114.45 ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -18.248 56.267  13.920  1.00 114.17 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -17.433 57.064  15.322  1.00 123.44 ? 1   MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -18.168 51.562  17.201  1.00 110.08 ? 2   LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -19.117 50.814  18.037  1.00 105.54 ? 2   LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -20.543 50.985  17.522  1.00 97.08  ? 2   LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -20.915 52.063  17.048  1.00 95.88  ? 2   LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -19.035 51.256  19.506  1.00 110.64 ? 2   LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -18.640 50.152  20.495  1.00 113.69 ? 2   LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -17.290 49.509  20.169  1.00 118.40 ? 2   LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -16.131 50.467  20.393  1.00 126.44 ? 2   LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -14.953 50.133  19.548  1.00 129.65 ? 2   LYS A NZ    1 
ATOM   18   N  N     . VAL A 1 3   ? -21.337 49.921  17.626  1.00 91.52  ? 3   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 3   ? -22.716 49.913  17.119  1.00 83.35  ? 3   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 3   ? -23.589 51.015  17.730  1.00 81.97  ? 3   VAL A C     1 
ATOM   21   O  O     . VAL A 1 3   ? -24.434 51.581  17.046  1.00 77.69  ? 3   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 3   ? -23.415 48.552  17.345  1.00 79.59  ? 3   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 3   ? -24.375 48.265  16.214  1.00 73.04  ? 3   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 3   ? -22.402 47.419  17.494  1.00 83.63  ? 3   VAL A CG2   1 
ATOM   25   N  N     . GLU A 1 4   ? -23.376 51.313  19.012  1.00 85.83  ? 4   GLU A N     1 
ATOM   26   C  CA    . GLU A 1 4   ? -24.147 52.339  19.718  1.00 85.45  ? 4   GLU A CA    1 
ATOM   27   C  C     . GLU A 1 4   ? -23.970 53.728  19.099  1.00 85.72  ? 4   GLU A C     1 
ATOM   28   O  O     . GLU A 1 4   ? -24.922 54.505  19.044  1.00 83.17  ? 4   GLU A O     1 
ATOM   29   C  CB    . GLU A 1 4   ? -23.760 52.397  21.199  1.00 91.97  ? 4   GLU A CB    1 
ATOM   30   C  CG    . GLU A 1 4   ? -23.868 51.086  21.993  1.00 93.74  ? 4   GLU A CG    1 
ATOM   31   C  CD    . GLU A 1 4   ? -22.722 50.948  23.021  1.00 104.99 ? 4   GLU A CD    1 
ATOM   32   O  OE1   . GLU A 1 4   ? -22.983 51.006  24.258  1.00 109.06 ? 4   GLU A OE1   1 
ATOM   33   O  OE2   . GLU A 1 4   ? -21.544 50.807  22.580  1.00 109.18 ? 4   GLU A OE2   1 
ATOM   34   N  N     . GLU A 1 5   ? -22.756 54.039  18.643  1.00 88.75  ? 5   GLU A N     1 
ATOM   35   C  CA    . GLU A 1 5   ? -22.480 55.345  18.037  1.00 89.81  ? 5   GLU A CA    1 
ATOM   36   C  C     . GLU A 1 5   ? -22.997 55.417  16.612  1.00 83.00  ? 5   GLU A C     1 
ATOM   37   O  O     . GLU A 1 5   ? -23.411 56.482  16.155  1.00 82.60  ? 5   GLU A O     1 
ATOM   38   C  CB    . GLU A 1 5   ? -20.990 55.654  18.022  1.00 97.34  ? 5   GLU A CB    1 
ATOM   39   C  CG    . GLU A 1 5   ? -20.257 55.340  19.295  1.00 104.88 ? 5   GLU A CG    1 
ATOM   40   C  CD    . GLU A 1 5   ? -18.753 55.398  19.109  1.00 114.00 ? 5   GLU A CD    1 
ATOM   41   O  OE1   . GLU A 1 5   ? -18.275 54.959  18.031  1.00 113.03 ? 5   GLU A OE1   1 
ATOM   42   O  OE2   . GLU A 1 5   ? -18.053 55.880  20.038  1.00 121.85 ? 5   GLU A OE2   1 
ATOM   43   N  N     . ILE A 1 6   ? -22.944 54.289  15.909  1.00 77.67  ? 6   ILE A N     1 
ATOM   44   C  CA    . ILE A 1 6   ? -23.486 54.191  14.562  1.00 71.21  ? 6   ILE A CA    1 
ATOM   45   C  C     . ILE A 1 6   ? -24.984 54.499  14.587  1.00 65.33  ? 6   ILE A C     1 
ATOM   46   O  O     . ILE A 1 6   ? -25.503 55.126  13.676  1.00 63.04  ? 6   ILE A O     1 
ATOM   47   C  CB    . ILE A 1 6   ? -23.260 52.786  13.959  1.00 68.48  ? 6   ILE A CB    1 
ATOM   48   C  CG1   . ILE A 1 6   ? -21.773 52.480  13.777  1.00 73.62  ? 6   ILE A CG1   1 
ATOM   49   C  CG2   . ILE A 1 6   ? -23.985 52.641  12.627  1.00 63.41  ? 6   ILE A CG2   1 
ATOM   50   C  CD1   . ILE A 1 6   ? -21.179 52.962  12.459  1.00 75.62  ? 6   ILE A CD1   1 
ATOM   51   N  N     . LEU A 1 7   ? -25.666 54.060  15.641  1.00 63.26  ? 7   LEU A N     1 
ATOM   52   C  CA    . LEU A 1 7   ? -27.098 54.297  15.810  1.00 58.26  ? 7   LEU A CA    1 
ATOM   53   C  C     . LEU A 1 7   ? -27.445 55.734  16.212  1.00 60.89  ? 7   LEU A C     1 
ATOM   54   O  O     . LEU A 1 7   ? -28.422 56.287  15.721  1.00 57.86  ? 7   LEU A O     1 
ATOM   55   C  CB    . LEU A 1 7   ? -27.705 53.289  16.790  1.00 56.09  ? 7   LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 7   ? -27.776 51.860  16.258  1.00 51.16  ? 7   LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 7   ? -28.109 50.885  17.349  1.00 50.95  ? 7   LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 7   ? -28.792 51.763  15.179  1.00 44.27  ? 7   LEU A CD2   1 
ATOM   59   N  N     . GLU A 1 8   ? -26.658 56.346  17.091  1.00 66.88  ? 8   GLU A N     1 
ATOM   60   C  CA    . GLU A 1 8   ? -26.873 57.761  17.395  1.00 70.72  ? 8   GLU A CA    1 
ATOM   61   C  C     . GLU A 1 8   ? -26.789 58.632  16.140  1.00 69.95  ? 8   GLU A C     1 
ATOM   62   O  O     . GLU A 1 8   ? -27.622 59.517  15.936  1.00 69.01  ? 8   GLU A O     1 
ATOM   63   C  CB    . GLU A 1 8   ? -25.914 58.273  18.479  1.00 78.60  ? 8   GLU A CB    1 
ATOM   64   C  CG    . GLU A 1 8   ? -26.429 58.109  19.925  1.00 83.04  ? 8   GLU A CG    1 
ATOM   65   C  CD    . GLU A 1 8   ? -27.728 58.900  20.245  1.00 85.05  ? 8   GLU A CD    1 
ATOM   66   O  OE1   . GLU A 1 8   ? -28.318 59.524  19.329  1.00 83.55  ? 8   GLU A OE1   1 
ATOM   67   O  OE2   . GLU A 1 8   ? -28.164 58.896  21.427  1.00 88.18  ? 8   GLU A OE2   1 
ATOM   68   N  N     . LYS A 1 9   ? -25.789 58.364  15.302  1.00 70.60  ? 9   LYS A N     1 
ATOM   69   C  CA    . LYS A 1 9   ? -25.637 59.067  14.038  1.00 70.49  ? 9   LYS A CA    1 
ATOM   70   C  C     . LYS A 1 9   ? -26.764 58.744  13.065  1.00 63.88  ? 9   LYS A C     1 
ATOM   71   O  O     . LYS A 1 9   ? -27.133 59.582  12.254  1.00 64.16  ? 9   LYS A O     1 
ATOM   72   C  CB    . LYS A 1 9   ? -24.280 58.774  13.398  1.00 73.58  ? 9   LYS A CB    1 
ATOM   73   C  CG    . LYS A 1 9   ? -23.137 59.638  13.970  1.00 82.78  ? 9   LYS A CG    1 
ATOM   74   C  CD    . LYS A 1 9   ? -22.064 59.908  12.908  1.00 87.76  ? 9   LYS A CD    1 
ATOM   75   C  CE    . LYS A 1 9   ? -20.936 58.812  12.936  1.00 90.10  ? 9   LYS A CE    1 
ATOM   76   N  NZ    . LYS A 1 9   ? -20.031 59.033  14.135  1.00 98.59  ? 9   LYS A NZ    1 
ATOM   77   N  N     . ALA A 1 10  ? -27.316 57.538  13.151  1.00 58.60  ? 10  ALA A N     1 
ATOM   78   C  CA    . ALA A 1 10  ? -28.424 57.138  12.292  1.00 52.55  ? 10  ALA A CA    1 
ATOM   79   C  C     . ALA A 1 10  ? -29.717 57.861  12.657  1.00 51.15  ? 10  ALA A C     1 
ATOM   80   O  O     . ALA A 1 10  ? -30.598 58.038  11.819  1.00 48.12  ? 10  ALA A O     1 
ATOM   81   C  CB    . ALA A 1 10  ? -28.622 55.626  12.337  1.00 48.68  ? 10  ALA A CB    1 
ATOM   82   N  N     . LEU A 1 11  ? -29.826 58.281  13.910  1.00 53.95  ? 11  LEU A N     1 
ATOM   83   C  CA    . LEU A 1 11  ? -31.017 58.974  14.376  1.00 53.43  ? 11  LEU A CA    1 
ATOM   84   C  C     . LEU A 1 11  ? -31.199 60.316  13.676  1.00 55.80  ? 11  LEU A C     1 
ATOM   85   O  O     . LEU A 1 11  ? -32.331 60.727  13.432  1.00 53.98  ? 11  LEU A O     1 
ATOM   86   C  CB    . LEU A 1 11  ? -31.020 59.127  15.909  1.00 56.81  ? 11  LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 11  ? -31.404 57.889  16.757  1.00 53.83  ? 11  LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 11  ? -31.096 58.072  18.234  1.00 57.72  ? 11  LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 11  ? -32.865 57.487  16.594  1.00 48.72  ? 11  LEU A CD2   1 
ATOM   90   N  N     . GLU A 1 12  ? -30.101 60.985  13.329  1.00 60.30  ? 12  GLU A N     1 
ATOM   91   C  CA    . GLU A 1 12  ? -30.206 62.216  12.540  1.00 63.39  ? 12  GLU A CA    1 
ATOM   92   C  C     . GLU A 1 12  ? -30.746 61.970  11.127  1.00 59.28  ? 12  GLU A C     1 
ATOM   93   O  O     . GLU A 1 12  ? -31.159 62.904  10.440  1.00 60.78  ? 12  GLU A O     1 
ATOM   94   C  CB    . GLU A 1 12  ? -28.878 62.981  12.490  1.00 69.90  ? 12  GLU A CB    1 
ATOM   95   C  CG    . GLU A 1 12  ? -28.770 64.107  13.515  1.00 77.97  ? 12  GLU A CG    1 
ATOM   96   C  CD    . GLU A 1 12  ? -28.327 63.611  14.896  1.00 83.08  ? 12  GLU A CD    1 
ATOM   97   O  OE1   . GLU A 1 12  ? -27.188 63.096  14.990  1.00 86.95  ? 12  GLU A OE1   1 
ATOM   98   O  OE2   . GLU A 1 12  ? -29.102 63.738  15.883  1.00 82.62  ? 12  GLU A OE2   1 
ATOM   99   N  N     . LEU A 1 13  ? -30.745 60.714  10.695  1.00 54.88  ? 13  LEU A N     1 
ATOM   100  C  CA    . LEU A 1 13  ? -31.278 60.370  9.388   1.00 51.26  ? 13  LEU A CA    1 
ATOM   101  C  C     . LEU A 1 13  ? -32.753 60.040  9.431   1.00 47.23  ? 13  LEU A C     1 
ATOM   102  O  O     . LEU A 1 13  ? -33.407 60.061  8.395   1.00 45.85  ? 13  LEU A O     1 
ATOM   103  C  CB    . LEU A 1 13  ? -30.524 59.190  8.760   1.00 49.17  ? 13  LEU A CB    1 
ATOM   104  C  CG    . LEU A 1 13  ? -29.220 59.412  7.988   1.00 52.85  ? 13  LEU A CG    1 
ATOM   105  C  CD1   . LEU A 1 13  ? -29.114 60.830  7.424   1.00 57.72  ? 13  LEU A CD1   1 
ATOM   106  C  CD2   . LEU A 1 13  ? -28.022 59.120  8.848   1.00 56.42  ? 13  LEU A CD2   1 
ATOM   107  N  N     . VAL A 1 14  ? -33.281 59.709  10.610  1.00 46.29  ? 14  VAL A N     1 
ATOM   108  C  CA    . VAL A 1 14  ? -34.630 59.115  10.692  1.00 42.09  ? 14  VAL A CA    1 
ATOM   109  C  C     . VAL A 1 14  ? -35.626 59.886  11.568  1.00 43.45  ? 14  VAL A C     1 
ATOM   110  O  O     . VAL A 1 14  ? -36.811 59.591  11.550  1.00 41.32  ? 14  VAL A O     1 
ATOM   111  C  CB    . VAL A 1 14  ? -34.616 57.569  11.066  1.00 38.57  ? 14  VAL A CB    1 
ATOM   112  C  CG1   . VAL A 1 14  ? -33.613 56.788  10.209  1.00 37.61  ? 14  VAL A CG1   1 
ATOM   113  C  CG2   . VAL A 1 14  ? -34.328 57.336  12.536  1.00 40.10  ? 14  VAL A CG2   1 
ATOM   114  N  N     . ILE A 1 15  ? -35.157 60.870  12.322  1.00 47.72  ? 15  ILE A N     1 
ATOM   115  C  CA    . ILE A 1 15  ? -36.052 61.641  13.180  1.00 49.84  ? 15  ILE A CA    1 
ATOM   116  C  C     . ILE A 1 15  ? -36.471 62.947  12.507  1.00 52.54  ? 15  ILE A C     1 
ATOM   117  O  O     . ILE A 1 15  ? -35.631 63.784  12.186  1.00 56.34  ? 15  ILE A O     1 
ATOM   118  C  CB    . ILE A 1 15  ? -35.416 61.956  14.557  1.00 54.07  ? 15  ILE A CB    1 
ATOM   119  C  CG1   . ILE A 1 15  ? -35.151 60.672  15.340  1.00 52.19  ? 15  ILE A CG1   1 
ATOM   120  C  CG2   . ILE A 1 15  ? -36.303 62.885  15.377  1.00 56.53  ? 15  ILE A CG2   1 
ATOM   121  C  CD1   . ILE A 1 15  ? -34.259 60.896  16.549  1.00 57.53  ? 15  ILE A CD1   1 
ATOM   122  N  N     . PRO A 1 16  ? -37.779 63.129  12.293  1.00 64.22  ? 16  PRO A N     1 
ATOM   123  C  CA    . PRO A 1 16  ? -38.263 64.423  11.800  1.00 65.21  ? 16  PRO A CA    1 
ATOM   124  C  C     . PRO A 1 16  ? -37.754 65.539  12.688  1.00 71.14  ? 16  PRO A C     1 
ATOM   125  O  O     . PRO A 1 16  ? -37.691 65.374  13.895  1.00 72.46  ? 16  PRO A O     1 
ATOM   126  C  CB    . PRO A 1 16  ? -39.786 64.306  11.927  1.00 59.81  ? 16  PRO A CB    1 
ATOM   127  C  CG    . PRO A 1 16  ? -40.039 63.018  12.733  1.00 56.49  ? 16  PRO A CG    1 
ATOM   128  C  CD    . PRO A 1 16  ? -38.869 62.155  12.487  1.00 58.08  ? 16  PRO A CD    1 
ATOM   129  N  N     . ASP A 1 17  ? -37.355 66.652  12.098  1.00 75.73  ? 17  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 17  ? -36.947 67.800  12.896  1.00 82.38  ? 17  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 17  ? -38.141 68.699  13.136  1.00 81.53  ? 17  ASP A C     1 
ATOM   132  O  O     . ASP A 1 17  ? -39.205 68.485  12.559  1.00 76.05  ? 17  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 17  ? -35.800 68.570  12.235  1.00 89.34  ? 17  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 17  ? -35.988 68.757  10.736  1.00 87.83  ? 17  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 17  ? -37.144 68.868  10.257  1.00 82.76  ? 17  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 17  ? -34.952 68.802  10.037  1.00 92.01  ? 17  ASP A OD2   1 
ATOM   137  N  N     . GLU A 1 18  ? -37.962 69.708  13.980  1.00 87.82  ? 18  GLU A N     1 
ATOM   138  C  CA    . GLU A 1 18  ? -39.074 70.560  14.407  1.00 88.29  ? 18  GLU A CA    1 
ATOM   139  C  C     . GLU A 1 18  ? -39.683 71.454  13.319  1.00 88.02  ? 18  GLU A C     1 
ATOM   140  O  O     . GLU A 1 18  ? -40.793 71.960  13.480  1.00 86.51  ? 18  GLU A O     1 
ATOM   141  C  CB    . GLU A 1 18  ? -38.697 71.360  15.658  1.00 95.71  ? 18  GLU A CB    1 
ATOM   142  C  CG    . GLU A 1 18  ? -39.085 70.648  16.950  1.00 95.37  ? 18  GLU A CG    1 
ATOM   143  C  CD    . GLU A 1 18  ? -40.552 70.859  17.341  1.00 94.00  ? 18  GLU A CD    1 
ATOM   144  O  OE1   . GLU A 1 18  ? -41.466 70.555  16.532  1.00 88.64  ? 18  GLU A OE1   1 
ATOM   145  O  OE2   . GLU A 1 18  ? -40.789 71.327  18.476  1.00 98.82  ? 18  GLU A OE2   1 
ATOM   146  N  N     . GLU A 1 19  ? -38.952 71.633  12.224  1.00 90.11  ? 19  GLU A N     1 
ATOM   147  C  CA    . GLU A 1 19  ? -39.502 72.177  10.985  1.00 89.37  ? 19  GLU A CA    1 
ATOM   148  C  C     . GLU A 1 19  ? -40.746 71.402  10.565  1.00 81.05  ? 19  GLU A C     1 
ATOM   149  O  O     . GLU A 1 19  ? -41.812 71.980  10.357  1.00 79.74  ? 19  GLU A O     1 
ATOM   150  C  CB    . GLU A 1 19  ? -38.459 72.048  9.872   1.00 92.24  ? 19  GLU A CB    1 
ATOM   151  C  CG    . GLU A 1 19  ? -38.922 72.562  8.526   1.00 93.06  ? 19  GLU A CG    1 
ATOM   152  C  CD    . GLU A 1 19  ? -38.858 74.077  8.454   1.00 101.60 ? 19  GLU A CD    1 
ATOM   153  O  OE1   . GLU A 1 19  ? -39.897 74.721  8.744   1.00 101.09 ? 19  GLU A OE1   1 
ATOM   154  O  OE2   . GLU A 1 19  ? -37.765 74.613  8.134   1.00 107.86 ? 19  GLU A OE2   1 
ATOM   155  N  N     . GLU A 1 20  ? -40.577 70.082  10.468  1.00 76.02  ? 20  GLU A N     1 
ATOM   156  C  CA    . GLU A 1 20  ? -41.553 69.154  9.909   1.00 68.66  ? 20  GLU A CA    1 
ATOM   157  C  C     . GLU A 1 20  ? -42.667 68.809  10.905  1.00 63.79  ? 20  GLU A C     1 
ATOM   158  O  O     . GLU A 1 20  ? -43.820 68.636  10.518  1.00 59.37  ? 20  GLU A O     1 
ATOM   159  C  CB    . GLU A 1 20  ? -40.825 67.885  9.454   1.00 66.03  ? 20  GLU A CB    1 
ATOM   160  C  CG    . GLU A 1 20  ? -41.046 67.503  7.989   1.00 64.93  ? 20  GLU A CG    1 
ATOM   161  C  CD    . GLU A 1 20  ? -40.858 65.997  7.716   1.00 61.25  ? 20  GLU A CD    1 
ATOM   162  O  OE1   . GLU A 1 20  ? -39.983 65.366  8.358   1.00 64.53  ? 20  GLU A OE1   1 
ATOM   163  O  OE2   . GLU A 1 20  ? -41.589 65.445  6.853   1.00 58.86  ? 20  GLU A OE2   1 
ATOM   164  N  N     . VAL A 1 21  ? -42.316 68.704  12.183  1.00 65.21  ? 21  VAL A N     1 
ATOM   165  C  CA    . VAL A 1 21  ? -43.292 68.418  13.231  1.00 62.29  ? 21  VAL A CA    1 
ATOM   166  C  C     . VAL A 1 21  ? -44.287 69.575  13.321  1.00 63.81  ? 21  VAL A C     1 
ATOM   167  O  O     . VAL A 1 21  ? -45.496 69.351  13.324  1.00 59.92  ? 21  VAL A O     1 
ATOM   168  C  CB    . VAL A 1 21  ? -42.624 68.218  14.616  1.00 65.74  ? 21  VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1 21  ? -43.655 67.813  15.644  1.00 63.34  ? 21  VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1 21  ? -41.523 67.180  14.557  1.00 65.22  ? 21  VAL A CG2   1 
ATOM   171  N  N     . ARG A 1 22  ? -43.770 70.803  13.397  1.00 69.72  ? 22  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 22  ? -44.602 72.005  13.403  1.00 72.31  ? 22  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 22  ? -45.593 71.979  12.261  1.00 67.49  ? 22  ARG A C     1 
ATOM   174  O  O     . ARG A 1 22  ? -46.787 72.193  12.453  1.00 65.58  ? 22  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 22  ? -43.747 73.275  13.280  1.00 80.63  ? 22  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 22  ? -43.919 74.271  14.410  1.00 87.61  ? 22  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 22  ? -43.105 75.520  14.138  1.00 98.78  ? 22  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 22  ? -41.709 75.411  14.590  1.00 105.55 ? 22  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 22  ? -40.644 75.259  13.792  1.00 107.86 ? 22  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 22  ? -40.783 75.184  12.470  1.00 106.26 ? 22  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 22  ? -39.427 75.180  14.319  1.00 112.44 ? 22  ARG A NH2   1 
ATOM   182  N  N     . LYS A 1 23  ? -45.065 71.715  11.071  1.00 65.98  ? 23  LYS A N     1 
ATOM   183  C  CA    . LYS A 1 23  ? -45.828 71.677  9.831   1.00 62.54  ? 23  LYS A CA    1 
ATOM   184  C  C     . LYS A 1 23  ? -46.936 70.609  9.929   1.00 55.14  ? 23  LYS A C     1 
ATOM   185  O  O     . LYS A 1 23  ? -47.981 70.754  9.307   1.00 53.44  ? 23  LYS A O     1 
ATOM   186  C  CB    . LYS A 1 23  ? -44.861 71.373  8.675   1.00 63.48  ? 23  LYS A CB    1 
ATOM   187  C  CG    . LYS A 1 23  ? -45.072 72.083  7.337   1.00 65.72  ? 23  LYS A CG    1 
ATOM   188  C  CD    . LYS A 1 23  ? -44.147 71.433  6.280   1.00 66.27  ? 23  LYS A CD    1 
ATOM   189  C  CE    . LYS A 1 23  ? -43.783 72.345  5.093   1.00 73.37  ? 23  LYS A CE    1 
ATOM   190  N  NZ    . LYS A 1 23  ? -44.801 72.388  3.992   1.00 71.68  ? 23  LYS A NZ    1 
ATOM   191  N  N     . GLY A 1 24  ? -46.705 69.559  10.723  1.00 51.37  ? 24  GLY A N     1 
ATOM   192  C  CA    . GLY A 1 24  ? -47.692 68.504  10.951  1.00 44.76  ? 24  GLY A CA    1 
ATOM   193  C  C     . GLY A 1 24  ? -48.727 68.808  12.021  1.00 44.42  ? 24  GLY A C     1 
ATOM   194  O  O     . GLY A 1 24  ? -49.905 68.543  11.836  1.00 41.09  ? 24  GLY A O     1 
ATOM   195  N  N     . ARG A 1 25  ? -48.287 69.344  13.155  1.00 48.49  ? 25  ARG A N     1 
ATOM   196  C  CA    . ARG A 1 25  ? -49.201 69.775  14.214  1.00 49.97  ? 25  ARG A CA    1 
ATOM   197  C  C     . ARG A 1 25  ? -50.253 70.762  13.676  1.00 50.61  ? 25  ARG A C     1 
ATOM   198  O  O     . ARG A 1 25  ? -51.451 70.558  13.861  1.00 48.13  ? 25  ARG A O     1 
ATOM   199  C  CB    . ARG A 1 25  ? -48.433 70.396  15.397  1.00 56.27  ? 25  ARG A CB    1 
ATOM   200  C  CG    . ARG A 1 25  ? -47.438 69.477  16.125  1.00 58.11  ? 25  ARG A CG    1 
ATOM   201  C  CD    . ARG A 1 25  ? -48.128 68.479  17.064  1.00 58.67  ? 25  ARG A CD    1 
ATOM   202  N  NE    . ARG A 1 25  ? -47.225 67.421  17.553  1.00 60.90  ? 25  ARG A NE    1 
ATOM   203  C  CZ    . ARG A 1 25  ? -47.009 66.240  16.950  1.00 57.08  ? 25  ARG A CZ    1 
ATOM   204  N  NH1   . ARG A 1 25  ? -47.612 65.935  15.805  1.00 52.65  ? 25  ARG A NH1   1 
ATOM   205  N  NH2   . ARG A 1 25  ? -46.178 65.348  17.491  1.00 57.32  ? 25  ARG A NH2   1 
ATOM   206  N  N     . GLU A 1 26  ? -49.815 71.821  12.996  1.00 54.17  ? 26  GLU A N     1 
ATOM   207  C  CA    . GLU A 1 26  ? -50.766 72.802  12.482  1.00 55.91  ? 26  GLU A CA    1 
ATOM   208  C  C     . GLU A 1 26  ? -51.545 72.304  11.275  1.00 50.67  ? 26  GLU A C     1 
ATOM   209  O  O     . GLU A 1 26  ? -52.553 72.902  10.898  1.00 51.46  ? 26  GLU A O     1 
ATOM   210  C  CB    . GLU A 1 26  ? -50.141 74.185  12.245  1.00 62.85  ? 26  GLU A CB    1 
ATOM   211  C  CG    . GLU A 1 26  ? -48.782 74.202  11.586  1.00 65.59  ? 26  GLU A CG    1 
ATOM   212  C  CD    . GLU A 1 26  ? -48.132 75.600  11.587  1.00 74.22  ? 26  GLU A CD    1 
ATOM   213  O  OE1   . GLU A 1 26  ? -48.467 76.441  12.464  1.00 80.06  ? 26  GLU A OE1   1 
ATOM   214  O  OE2   . GLU A 1 26  ? -47.275 75.856  10.705  1.00 77.78  ? 26  GLU A OE2   1 
ATOM   215  N  N     . ALA A 1 27  ? -51.091 71.197  10.687  1.00 45.90  ? 27  ALA A N     1 
ATOM   216  C  CA    . ALA A 1 27  ? -51.882 70.498  9.674   1.00 40.57  ? 27  ALA A CA    1 
ATOM   217  C  C     . ALA A 1 27  ? -52.927 69.690  10.375  1.00 36.37  ? 27  ALA A C     1 
ATOM   218  O  O     . ALA A 1 27  ? -54.018 69.540  9.867   1.00 34.32  ? 27  ALA A O     1 
ATOM   219  C  CB    . ALA A 1 27  ? -51.036 69.608  8.830   1.00 37.96  ? 27  ALA A CB    1 
ATOM   220  N  N     . GLU A 1 28  ? -52.581 69.176  11.550  1.00 36.14  ? 28  GLU A N     1 
ATOM   221  C  CA    . GLU A 1 28  ? -53.494 68.380  12.365  1.00 33.82  ? 28  GLU A CA    1 
ATOM   222  C  C     . GLU A 1 28  ? -54.617 69.262  12.914  1.00 36.90  ? 28  GLU A C     1 
ATOM   223  O  O     . GLU A 1 28  ? -55.795 68.889  12.832  1.00 34.67  ? 28  GLU A O     1 
ATOM   224  C  CB    . GLU A 1 28  ? -52.714 67.676  13.481  1.00 33.72  ? 28  GLU A CB    1 
ATOM   225  C  CG    . GLU A 1 28  ? -53.522 67.180  14.679  1.00 33.71  ? 28  GLU A CG    1 
ATOM   226  C  CD    . GLU A 1 28  ? -52.649 66.486  15.727  1.00 34.83  ? 28  GLU A CD    1 
ATOM   227  O  OE1   . GLU A 1 28  ? -51.440 66.783  15.802  1.00 37.40  ? 28  GLU A OE1   1 
ATOM   228  O  OE2   . GLU A 1 28  ? -53.168 65.633  16.481  1.00 34.47  ? 28  GLU A OE2   1 
ATOM   229  N  N     . GLU A 1 29  ? -54.250 70.433  13.445  1.00 42.45  ? 29  GLU A N     1 
ATOM   230  C  CA    . GLU A 1 29  ? -55.230 71.376  13.964  1.00 46.61  ? 29  GLU A CA    1 
ATOM   231  C  C     . GLU A 1 29  ? -56.242 71.802  12.912  1.00 45.57  ? 29  GLU A C     1 
ATOM   232  O  O     . GLU A 1 29  ? -57.424 71.931  13.214  1.00 46.24  ? 29  GLU A O     1 
ATOM   233  C  CB    . GLU A 1 29  ? -54.563 72.618  14.568  1.00 53.92  ? 29  GLU A CB    1 
ATOM   234  C  CG    . GLU A 1 29  ? -54.426 72.600  16.104  1.00 60.78  ? 29  GLU A CG    1 
ATOM   235  C  CD    . GLU A 1 29  ? -55.709 72.139  16.831  1.00 63.58  ? 29  GLU A CD    1 
ATOM   236  O  OE1   . GLU A 1 29  ? -56.669 72.946  16.939  1.00 67.67  ? 29  GLU A OE1   1 
ATOM   237  O  OE2   . GLU A 1 29  ? -55.746 70.967  17.297  1.00 61.16  ? 29  GLU A OE2   1 
ATOM   238  N  N     . GLU A 1 30  ? -55.784 72.031  11.684  1.00 44.70  ? 30  GLU A N     1 
ATOM   239  C  CA    . GLU A 1 30  ? -56.671 72.485  10.628  1.00 44.33  ? 30  GLU A CA    1 
ATOM   240  C  C     . GLU A 1 30  ? -57.638 71.391  10.243  1.00 39.58  ? 30  GLU A C     1 
ATOM   241  O  O     . GLU A 1 30  ? -58.825 71.645  10.057  1.00 40.13  ? 30  GLU A O     1 
ATOM   242  C  CB    . GLU A 1 30  ? -55.885 72.944  9.401   1.00 45.79  ? 30  GLU A CB    1 
ATOM   243  C  CG    . GLU A 1 30  ? -56.750 73.565  8.310   1.00 46.68  ? 30  GLU A CG    1 
ATOM   244  C  CD    . GLU A 1 30  ? -57.624 74.693  8.826   1.00 51.17  ? 30  GLU A CD    1 
ATOM   245  O  OE1   . GLU A 1 30  ? -57.267 75.320  9.847   1.00 54.54  ? 30  GLU A OE1   1 
ATOM   246  O  OE2   . GLU A 1 30  ? -58.676 74.955  8.215   1.00 51.53  ? 30  GLU A OE2   1 
ATOM   247  N  N     . LEU A 1 31  ? -57.114 70.173  10.132  1.00 35.45  ? 31  LEU A N     1 
ATOM   248  C  CA    . LEU A 1 31  ? -57.867 69.008  9.707   1.00 31.09  ? 31  LEU A CA    1 
ATOM   249  C  C     . LEU A 1 31  ? -58.996 68.763  10.705  1.00 31.09  ? 31  LEU A C     1 
ATOM   250  O  O     . LEU A 1 31  ? -60.148 68.551  10.317  1.00 30.42  ? 31  LEU A O     1 
ATOM   251  C  CB    . LEU A 1 31  ? -56.910 67.831  9.659   1.00 27.70  ? 31  LEU A CB    1 
ATOM   252  C  CG    . LEU A 1 31  ? -57.014 66.626  8.725   1.00 24.38  ? 31  LEU A CG    1 
ATOM   253  C  CD1   . LEU A 1 31  ? -57.566 66.967  7.367   1.00 24.11  ? 31  LEU A CD1   1 
ATOM   254  C  CD2   . LEU A 1 31  ? -55.605 66.030  8.594   1.00 23.51  ? 31  LEU A CD2   1 
ATOM   255  N  N     . ARG A 1 32  ? -58.663 68.839  11.992  1.00 32.64  ? 32  ARG A N     1 
ATOM   256  C  CA    . ARG A 1 32  ? -59.655 68.767  13.069  1.00 34.00  ? 32  ARG A CA    1 
ATOM   257  C  C     . ARG A 1 32  ? -60.721 69.852  13.052  1.00 36.95  ? 32  ARG A C     1 
ATOM   258  O  O     . ARG A 1 32  ? -61.886 69.550  13.239  1.00 36.81  ? 32  ARG A O     1 
ATOM   259  C  CB    . ARG A 1 32  ? -58.978 68.756  14.430  1.00 36.50  ? 32  ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 32  ? -58.580 67.373  14.853  1.00 35.36  ? 32  ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 32  ? -57.789 67.393  16.134  1.00 41.41  ? 32  ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 32  ? -57.657 66.032  16.630  1.00 42.66  ? 32  ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 32  ? -56.554 65.549  17.184  1.00 45.72  ? 32  ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 32  ? -55.484 66.324  17.315  1.00 49.84  ? 32  ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 32  ? -56.516 64.289  17.597  1.00 45.22  ? 32  ARG A NH2   1 
ATOM   266  N  N     . ARG A 1 33  ? -60.338 71.105  12.837  1.00 40.26  ? 33  ARG A N     1 
ATOM   267  C  CA    . ARG A 1 33  ? -61.325 72.186  12.796  1.00 44.29  ? 33  ARG A CA    1 
ATOM   268  C  C     . ARG A 1 33  ? -62.335 71.945  11.690  1.00 41.65  ? 33  ARG A C     1 
ATOM   269  O  O     . ARG A 1 33  ? -63.502 72.296  11.818  1.00 43.84  ? 33  ARG A O     1 
ATOM   270  C  CB    . ARG A 1 33  ? -60.674 73.556  12.589  1.00 49.69  ? 33  ARG A CB    1 
ATOM   271  C  CG    . ARG A 1 33  ? -59.985 74.136  13.801  1.00 55.81  ? 33  ARG A CG    1 
ATOM   272  C  CD    . ARG A 1 33  ? -59.637 75.596  13.546  1.00 66.58  ? 33  ARG A CD    1 
ATOM   273  N  NE    . ARG A 1 33  ? -58.369 75.957  14.179  1.00 73.26  ? 33  ARG A NE    1 
ATOM   274  C  CZ    . ARG A 1 33  ? -57.165 75.784  13.625  1.00 74.09  ? 33  ARG A CZ    1 
ATOM   275  N  NH1   . ARG A 1 33  ? -57.037 75.262  12.404  1.00 69.61  ? 33  ARG A NH1   1 
ATOM   276  N  NH2   . ARG A 1 33  ? -56.077 76.139  14.300  1.00 79.17  ? 33  ARG A NH2   1 
ATOM   277  N  N     . ARG A 1 34  ? -61.868 71.343  10.605  1.00 37.54  ? 34  ARG A N     1 
ATOM   278  C  CA    . ARG A 1 34  ? -62.694 71.117  9.427   1.00 35.69  ? 34  ARG A CA    1 
ATOM   279  C  C     . ARG A 1 34  ? -63.641 69.972  9.662   1.00 32.56  ? 34  ARG A C     1 
ATOM   280  O  O     . ARG A 1 34  ? -64.835 70.105  9.392   1.00 33.92  ? 34  ARG A O     1 
ATOM   281  C  CB    . ARG A 1 34  ? -61.825 70.830  8.204   1.00 33.55  ? 34  ARG A CB    1 
ATOM   282  C  CG    . ARG A 1 34  ? -61.078 72.038  7.742   1.00 36.16  ? 34  ARG A CG    1 
ATOM   283  C  CD    . ARG A 1 34  ? -60.303 71.739  6.509   1.00 33.63  ? 34  ARG A CD    1 
ATOM   284  N  NE    . ARG A 1 34  ? -59.561 72.908  6.064   1.00 35.71  ? 34  ARG A NE    1 
ATOM   285  C  CZ    . ARG A 1 34  ? -58.584 72.864  5.173   1.00 34.65  ? 34  ARG A CZ    1 
ATOM   286  N  NH1   . ARG A 1 34  ? -58.226 71.710  4.645   1.00 30.49  ? 34  ARG A NH1   1 
ATOM   287  N  NH2   . ARG A 1 34  ? -57.958 73.969  4.818   1.00 39.88  ? 34  ARG A NH2   1 
ATOM   288  N  N     . LEU A 1 35  ? -63.089 68.861  10.161  1.00 28.61  ? 35  LEU A N     1 
ATOM   289  C  CA    . LEU A 1 35  ? -63.840 67.652  10.440  1.00 25.95  ? 35  LEU A CA    1 
ATOM   290  C  C     . LEU A 1 35  ? -64.864 67.869  11.556  1.00 28.98  ? 35  LEU A C     1 
ATOM   291  O  O     . LEU A 1 35  ? -65.986 67.371  11.489  1.00 29.47  ? 35  LEU A O     1 
ATOM   292  C  CB    . LEU A 1 35  ? -62.895 66.506  10.796  1.00 22.22  ? 35  LEU A CB    1 
ATOM   293  C  CG    . LEU A 1 35  ? -62.082 65.862  9.675   1.00 18.51  ? 35  LEU A CG    1 
ATOM   294  C  CD1   . LEU A 1 35  ? -60.888 65.139  10.246  1.00 14.50  ? 35  LEU A CD1   1 
ATOM   295  C  CD2   . LEU A 1 35  ? -62.940 64.936  8.849   1.00 15.93  ? 35  LEU A CD2   1 
ATOM   296  N  N     . ASP A 1 36  ? -64.484 68.616  12.581  1.00 31.95  ? 36  ASP A N     1 
ATOM   297  C  CA    . ASP A 1 36  ? -65.428 68.964  13.629  1.00 35.73  ? 36  ASP A CA    1 
ATOM   298  C  C     . ASP A 1 36  ? -66.582 69.769  13.077  1.00 38.78  ? 36  ASP A C     1 
ATOM   299  O  O     . ASP A 1 36  ? -67.726 69.483  13.367  1.00 40.40  ? 36  ASP A O     1 
ATOM   300  C  CB    . ASP A 1 36  ? -64.735 69.750  14.728  1.00 39.32  ? 36  ASP A CB    1 
ATOM   301  C  CG    . ASP A 1 36  ? -63.705 68.935  15.436  1.00 37.50  ? 36  ASP A CG    1 
ATOM   302  O  OD1   . ASP A 1 36  ? -63.807 67.688  15.393  1.00 33.88  ? 36  ASP A OD1   1 
ATOM   303  O  OD2   . ASP A 1 36  ? -62.793 69.546  16.024  1.00 41.16  ? 36  ASP A OD2   1 
ATOM   304  N  N     . GLU A 1 37  ? -66.277 70.777  12.276  1.00 40.53  ? 37  GLU A N     1 
ATOM   305  C  CA    . GLU A 1 37  ? -67.301 71.588  11.665  1.00 43.95  ? 37  GLU A CA    1 
ATOM   306  C  C     . GLU A 1 37  ? -68.284 70.688  10.937  1.00 41.89  ? 37  GLU A C     1 
ATOM   307  O  O     . GLU A 1 37  ? -69.471 70.991  10.857  1.00 44.87  ? 37  GLU A O     1 
ATOM   308  C  CB    . GLU A 1 37  ? -66.656 72.570  10.708  1.00 45.47  ? 37  GLU A CB    1 
ATOM   309  C  CG    . GLU A 1 37  ? -67.623 73.365  9.917   1.00 49.66  ? 37  GLU A CG    1 
ATOM   310  C  CD    . GLU A 1 37  ? -66.950 74.305  8.974   1.00 53.89  ? 37  GLU A CD    1 
ATOM   311  O  OE1   . GLU A 1 37  ? -65.698 74.331  8.929   1.00 52.76  ? 37  GLU A OE1   1 
ATOM   312  O  OE2   . GLU A 1 37  ? -67.684 75.033  8.275   1.00 59.98  ? 37  GLU A OE2   1 
ATOM   313  N  N     . LEU A 1 38  ? -67.777 69.562  10.443  1.00 37.74  ? 38  LEU A N     1 
ATOM   314  C  CA    . LEU A 1 38  ? -68.570 68.590  9.702   1.00 36.49  ? 38  LEU A CA    1 
ATOM   315  C  C     . LEU A 1 38  ? -69.284 67.581  10.591  1.00 36.66  ? 38  LEU A C     1 
ATOM   316  O  O     . LEU A 1 38  ? -70.013 66.724  10.097  1.00 36.42  ? 38  LEU A O     1 
ATOM   317  C  CB    . LEU A 1 38  ? -67.678 67.843  8.729   1.00 32.29  ? 38  LEU A CB    1 
ATOM   318  C  CG    . LEU A 1 38  ? -67.608 68.443  7.336   1.00 33.67  ? 38  LEU A CG    1 
ATOM   319  C  CD1   . LEU A 1 38  ? -66.354 67.978  6.608   1.00 30.15  ? 38  LEU A CD1   1 
ATOM   320  C  CD2   . LEU A 1 38  ? -68.854 68.045  6.589   1.00 35.43  ? 38  LEU A CD2   1 
ATOM   321  N  N     . GLY A 1 39  ? -69.052 67.673  11.896  1.00 38.36  ? 39  GLY A N     1 
ATOM   322  C  CA    . GLY A 1 39  ? -69.656 66.784  12.885  1.00 39.23  ? 39  GLY A CA    1 
ATOM   323  C  C     . GLY A 1 39  ? -69.634 65.309  12.547  1.00 36.05  ? 39  GLY A C     1 
ATOM   324  O  O     . GLY A 1 39  ? -70.648 64.649  12.680  1.00 37.33  ? 39  GLY A O     1 
ATOM   325  N  N     . VAL A 1 40  ? -68.491 64.788  12.110  1.00 32.89  ? 40  VAL A N     1 
ATOM   326  C  CA    . VAL A 1 40  ? -68.397 63.363  11.745  1.00 30.73  ? 40  VAL A CA    1 
ATOM   327  C  C     . VAL A 1 40  ? -67.467 62.577  12.661  1.00 29.66  ? 40  VAL A C     1 
ATOM   328  O  O     . VAL A 1 40  ? -66.496 63.128  13.178  1.00 30.00  ? 40  VAL A O     1 
ATOM   329  C  CB    . VAL A 1 40  ? -67.983 63.136  10.268  1.00 28.10  ? 40  VAL A CB    1 
ATOM   330  C  CG1   . VAL A 1 40  ? -69.183 63.315  9.349   1.00 30.30  ? 40  VAL A CG1   1 
ATOM   331  C  CG2   . VAL A 1 40  ? -66.812 64.043  9.870   1.00 26.61  ? 40  VAL A CG2   1 
ATOM   332  N  N     . GLU A 1 41  ? -67.783 61.299  12.865  1.00 29.39  ? 41  GLU A N     1 
ATOM   333  C  CA    . GLU A 1 41  ? -66.949 60.390  13.650  1.00 28.83  ? 41  GLU A CA    1 
ATOM   334  C  C     . GLU A 1 41  ? -65.655 60.109  12.916  1.00 25.06  ? 41  GLU A C     1 
ATOM   335  O  O     . GLU A 1 41  ? -65.674 59.585  11.806  1.00 24.18  ? 41  GLU A O     1 
ATOM   336  C  CB    . GLU A 1 41  ? -67.679 59.072  13.866  1.00 29.85  ? 41  GLU A CB    1 
ATOM   337  C  CG    . GLU A 1 41  ? -68.384 58.962  15.185  1.00 36.70  ? 41  GLU A CG    1 
ATOM   338  C  CD    . GLU A 1 41  ? -67.765 57.895  16.084  1.00 41.30  ? 41  GLU A CD    1 
ATOM   339  O  OE1   . GLU A 1 41  ? -66.656 58.102  16.655  1.00 41.77  ? 41  GLU A OE1   1 
ATOM   340  O  OE2   . GLU A 1 41  ? -68.419 56.839  16.225  1.00 44.61  ? 41  GLU A OE2   1 
ATOM   341  N  N     . TYR A 1 42  ? -64.532 60.456  13.524  1.00 24.04  ? 42  TYR A N     1 
ATOM   342  C  CA    . TYR A 1 42  ? -63.239 60.205  12.906  1.00 20.90  ? 42  TYR A CA    1 
ATOM   343  C  C     . TYR A 1 42  ? -62.188 59.882  13.956  1.00 21.00  ? 42  TYR A C     1 
ATOM   344  O  O     . TYR A 1 42  ? -62.412 60.093  15.143  1.00 23.89  ? 42  TYR A O     1 
ATOM   345  C  CB    . TYR A 1 42  ? -62.798 61.416  12.080  1.00 20.55  ? 42  TYR A CB    1 
ATOM   346  C  CG    . TYR A 1 42  ? -62.549 62.662  12.895  1.00 22.53  ? 42  TYR A CG    1 
ATOM   347  C  CD1   . TYR A 1 42  ? -61.336 62.862  13.542  1.00 22.14  ? 42  TYR A CD1   1 
ATOM   348  C  CD2   . TYR A 1 42  ? -63.526 63.641  13.013  1.00 25.40  ? 42  TYR A CD2   1 
ATOM   349  C  CE1   . TYR A 1 42  ? -61.103 64.003  14.296  1.00 26.51  ? 42  TYR A CE1   1 
ATOM   350  C  CE2   . TYR A 1 42  ? -63.306 64.793  13.769  1.00 28.92  ? 42  TYR A CE2   1 
ATOM   351  C  CZ    . TYR A 1 42  ? -62.091 64.974  14.405  1.00 29.02  ? 42  TYR A CZ    1 
ATOM   352  O  OH    . TYR A 1 42  ? -61.856 66.115  15.140  1.00 31.21  ? 42  TYR A OH    1 
ATOM   353  N  N     . VAL A 1 43  ? -61.036 59.391  13.526  1.00 18.63  ? 43  VAL A N     1 
ATOM   354  C  CA    . VAL A 1 43  ? -59.962 59.070  14.457  1.00 19.19  ? 43  VAL A CA    1 
ATOM   355  C  C     . VAL A 1 43  ? -58.643 59.109  13.699  1.00 17.90  ? 43  VAL A C     1 
ATOM   356  O  O     . VAL A 1 43  ? -58.561 58.600  12.569  1.00 16.32  ? 43  VAL A O     1 
ATOM   357  C  CB    . VAL A 1 43  ? -60.189 57.692  15.168  1.00 19.55  ? 43  VAL A CB    1 
ATOM   358  C  CG1   . VAL A 1 43  ? -60.449 56.578  14.176  1.00 17.22  ? 43  VAL A CG1   1 
ATOM   359  C  CG2   . VAL A 1 43  ? -59.026 57.340  16.038  1.00 20.75  ? 43  VAL A CG2   1 
ATOM   360  N  N     . PHE A 1 44  ? -57.638 59.755  14.295  1.00 19.24  ? 44  PHE A N     1 
ATOM   361  C  CA    . PHE A 1 44  ? -56.279 59.734  13.768  1.00 18.34  ? 44  PHE A CA    1 
ATOM   362  C  C     . PHE A 1 44  ? -55.632 58.381  14.068  1.00 17.82  ? 44  PHE A C     1 
ATOM   363  O  O     . PHE A 1 44  ? -55.564 57.928  15.219  1.00 20.00  ? 44  PHE A O     1 
ATOM   364  C  CB    . PHE A 1 44  ? -55.462 60.891  14.340  1.00 20.82  ? 44  PHE A CB    1 
ATOM   365  C  CG    . PHE A 1 44  ? -55.857 62.229  13.786  1.00 23.34  ? 44  PHE A CG    1 
ATOM   366  C  CD1   . PHE A 1 44  ? -57.005 62.872  14.227  1.00 26.09  ? 44  PHE A CD1   1 
ATOM   367  C  CD2   . PHE A 1 44  ? -55.091 62.847  12.804  1.00 24.68  ? 44  PHE A CD2   1 
ATOM   368  C  CE1   . PHE A 1 44  ? -57.385 64.102  13.693  1.00 27.30  ? 44  PHE A CE1   1 
ATOM   369  C  CE2   . PHE A 1 44  ? -55.465 64.084  12.269  1.00 26.01  ? 44  PHE A CE2   1 
ATOM   370  C  CZ    . PHE A 1 44  ? -56.612 64.706  12.713  1.00 26.62  ? 44  PHE A CZ    1 
ATOM   371  N  N     . VAL A 1 45  ? -55.195 57.716  13.015  1.00 15.79  ? 45  VAL A N     1 
ATOM   372  C  CA    . VAL A 1 45  ? -54.484 56.446  13.141  1.00 15.56  ? 45  VAL A CA    1 
ATOM   373  C  C     . VAL A 1 45  ? -53.086 56.601  12.517  1.00 15.52  ? 45  VAL A C     1 
ATOM   374  O  O     . VAL A 1 45  ? -52.681 57.715  12.192  1.00 16.97  ? 45  VAL A O     1 
ATOM   375  C  CB    . VAL A 1 45  ? -55.273 55.304  12.446  1.00 14.25  ? 45  VAL A CB    1 
ATOM   376  C  CG1   . VAL A 1 45  ? -56.566 55.034  13.190  1.00 14.46  ? 45  VAL A CG1   1 
ATOM   377  C  CG2   . VAL A 1 45  ? -55.544 55.645  10.969  1.00 11.54  ? 45  VAL A CG2   1 
ATOM   378  N  N     . GLY A 1 46  ? -52.354 55.506  12.341  1.00 14.80  ? 46  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 46  ? -51.109 55.550  11.582  1.00 14.13  ? 46  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 46  ? -49.928 56.190  12.290  1.00 15.92  ? 46  GLY A C     1 
ATOM   381  O  O     . GLY A 1 46  ? -50.027 56.645  13.440  1.00 17.58  ? 46  GLY A O     1 
ATOM   382  N  N     . SER A 1 47  ? -48.811 56.237  11.576  1.00 15.88  ? 47  SER A N     1 
ATOM   383  C  CA    . SER A 1 47  ? -47.542 56.692  12.111  1.00 18.08  ? 47  SER A CA    1 
ATOM   384  C  C     . SER A 1 47  ? -47.552 58.103  12.700  1.00 19.68  ? 47  SER A C     1 
ATOM   385  O  O     . SER A 1 47  ? -46.756 58.395  13.605  1.00 22.48  ? 47  SER A O     1 
ATOM   386  C  CB    . SER A 1 47  ? -46.467 56.599  11.031  1.00 18.88  ? 47  SER A CB    1 
ATOM   387  O  OG    . SER A 1 47  ? -46.725 57.496  9.965   1.00 18.64  ? 47  SER A OG    1 
ATOM   388  N  N     . TYR A 1 48  ? -48.415 58.981  12.175  1.00 18.20  ? 48  TYR A N     1 
ATOM   389  C  CA    . TYR A 1 48  ? -48.445 60.359  12.654  1.00 19.93  ? 48  TYR A CA    1 
ATOM   390  C  C     . TYR A 1 48  ? -49.029 60.386  14.040  1.00 21.36  ? 48  TYR A C     1 
ATOM   391  O  O     . TYR A 1 48  ? -48.504 61.050  14.942  1.00 25.04  ? 48  TYR A O     1 
ATOM   392  C  CB    . TYR A 1 48  ? -49.243 61.292  11.748  1.00 18.69  ? 48  TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 48  ? -49.355 62.686  12.335  1.00 20.64  ? 48  TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 48  ? -48.286 63.578  12.280  1.00 24.52  ? 48  TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 48  ? -50.505 63.096  12.979  1.00 19.61  ? 48  TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 48  ? -48.375 64.837  12.838  1.00 26.81  ? 48  TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 48  ? -50.601 64.344  13.546  1.00 22.68  ? 48  TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 48  ? -49.540 65.209  13.468  1.00 27.13  ? 48  TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 48  ? -49.655 66.458  14.023  1.00 32.20  ? 48  TYR A OH    1 
ATOM   400  N  N     . ALA A 1 49  ? -50.112 59.644  14.208  1.00 19.32  ? 49  ALA A N     1 
ATOM   401  C  CA    . ALA A 1 49  ? -50.797 59.585  15.482  1.00 21.10  ? 49  ALA A CA    1 
ATOM   402  C  C     . ALA A 1 49  ? -50.000 58.839  16.538  1.00 23.69  ? 49  ALA A C     1 
ATOM   403  O  O     . ALA A 1 49  ? -50.258 58.993  17.706  1.00 26.56  ? 49  ALA A O     1 
ATOM   404  C  CB    . ALA A 1 49  ? -52.140 58.956  15.309  1.00 19.10  ? 49  ALA A CB    1 
ATOM   405  N  N     . ARG A 1 50  ? -49.033 58.029  16.142  1.00 23.74  ? 50  ARG A N     1 
ATOM   406  C  CA    . ARG A 1 50  ? -48.192 57.383  17.140  1.00 27.30  ? 50  ARG A CA    1 
ATOM   407  C  C     . ARG A 1 50  ? -46.755 57.911  17.148  1.00 30.80  ? 50  ARG A C     1 
ATOM   408  O  O     . ARG A 1 50  ? -45.899 57.386  17.859  1.00 33.78  ? 50  ARG A O     1 
ATOM   409  C  CB    . ARG A 1 50  ? -48.219 55.871  16.965  1.00 25.82  ? 50  ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 50  ? -49.608 55.299  16.985  1.00 23.37  ? 50  ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 50  ? -49.560 53.791  16.885  1.00 23.27  ? 50  ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 50  ? -49.241 53.318  15.541  1.00 19.52  ? 50  ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 50  ? -50.135 53.158  14.574  1.00 15.97  ? 50  ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 50  ? -51.407 53.438  14.798  1.00 15.23  ? 50  ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 50  ? -49.758 52.717  13.383  1.00 14.11  ? 50  ARG A NH2   1 
ATOM   416  N  N     . ASN A 1 51  ? -46.516 58.974  16.382  1.00 31.37  ? 51  ASN A N     1 
ATOM   417  C  CA    . ASN A 1 51  ? -45.189 59.589  16.229  1.00 35.29  ? 51  ASN A CA    1 
ATOM   418  C  C     . ASN A 1 51  ? -44.118 58.596  15.852  1.00 35.51  ? 51  ASN A C     1 
ATOM   419  O  O     . ASN A 1 51  ? -43.008 58.680  16.366  1.00 39.82  ? 51  ASN A O     1 
ATOM   420  C  CB    . ASN A 1 51  ? -44.756 60.358  17.483  1.00 40.43  ? 51  ASN A CB    1 
ATOM   421  C  CG    . ASN A 1 51  ? -45.761 61.411  17.888  1.00 43.42  ? 51  ASN A CG    1 
ATOM   422  O  OD1   . ASN A 1 51  ? -46.089 62.323  17.108  1.00 45.42  ? 51  ASN A OD1   1 
ATOM   423  N  ND2   . ASN A 1 51  ? -46.272 61.293  19.113  1.00 46.81  ? 51  ASN A ND2   1 
ATOM   424  N  N     . THR A 1 52  ? -44.454 57.658  14.970  1.00 31.69  ? 52  THR A N     1 
ATOM   425  C  CA    . THR A 1 52  ? -43.471 56.703  14.471  1.00 32.08  ? 52  THR A CA    1 
ATOM   426  C  C     . THR A 1 52  ? -43.186 56.908  12.968  1.00 30.83  ? 52  THR A C     1 
ATOM   427  O  O     . THR A 1 52  ? -42.840 55.947  12.250  1.00 30.07  ? 52  THR A O     1 
ATOM   428  C  CB    . THR A 1 52  ? -43.864 55.216  14.789  1.00 30.78  ? 52  THR A CB    1 
ATOM   429  O  OG1   . THR A 1 52  ? -44.946 54.784  13.957  1.00 26.88  ? 52  THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 52  ? -44.271 55.051  16.211  1.00 32.01  ? 52  THR A CG2   1 
ATOM   431  N  N     . TRP A 1 53  ? -43.328 58.153  12.498  1.00 31.01  ? 53  TRP A N     1 
ATOM   432  C  CA    . TRP A 1 53  ? -43.083 58.469  11.082  1.00 30.58  ? 53  TRP A CA    1 
ATOM   433  C  C     . TRP A 1 53  ? -41.638 58.850  10.847  1.00 34.38  ? 53  TRP A C     1 
ATOM   434  O  O     . TRP A 1 53  ? -41.010 59.340  11.771  1.00 37.76  ? 53  TRP A O     1 
ATOM   435  C  CB    . TRP A 1 53  ? -44.055 59.536  10.567  1.00 29.61  ? 53  TRP A CB    1 
ATOM   436  C  CG    . TRP A 1 53  ? -43.666 60.966  10.742  1.00 33.22  ? 53  TRP A CG    1 
ATOM   437  C  CD1   . TRP A 1 53  ? -42.906 61.726  9.886   1.00 37.21  ? 53  TRP A CD1   1 
ATOM   438  C  CD2   . TRP A 1 53  ? -44.082 61.842  11.791  1.00 35.13  ? 53  TRP A CD2   1 
ATOM   439  N  NE1   . TRP A 1 53  ? -42.794 63.020  10.362  1.00 40.96  ? 53  TRP A NE1   1 
ATOM   440  C  CE2   . TRP A 1 53  ? -43.506 63.118  11.528  1.00 39.45  ? 53  TRP A CE2   1 
ATOM   441  C  CE3   . TRP A 1 53  ? -44.866 61.672  12.941  1.00 34.50  ? 53  TRP A CE3   1 
ATOM   442  C  CZ2   . TRP A 1 53  ? -43.688 64.212  12.375  1.00 42.01  ? 53  TRP A CZ2   1 
ATOM   443  C  CZ3   . TRP A 1 53  ? -45.049 62.764  13.790  1.00 37.92  ? 53  TRP A CZ3   1 
ATOM   444  C  CH2   . TRP A 1 53  ? -44.462 64.019  13.500  1.00 41.77  ? 53  TRP A CH2   1 
ATOM   445  N  N     . LEU A 1 54  ? -41.109 58.611  9.641   1.00 34.81  ? 54  LEU A N     1 
ATOM   446  C  CA    . LEU A 1 54  ? -39.712 58.987  9.314   1.00 39.40  ? 54  LEU A CA    1 
ATOM   447  C  C     . LEU A 1 54  ? -39.548 60.426  8.874   1.00 42.16  ? 54  LEU A C     1 
ATOM   448  O  O     . LEU A 1 54  ? -40.452 61.029  8.286   1.00 40.49  ? 54  LEU A O     1 
ATOM   449  C  CB    . LEU A 1 54  ? -39.100 58.118  8.229   1.00 39.89  ? 54  LEU A CB    1 
ATOM   450  C  CG    . LEU A 1 54  ? -39.017 56.628  8.496   1.00 39.55  ? 54  LEU A CG    1 
ATOM   451  C  CD1   . LEU A 1 54  ? -39.997 55.931  7.560   1.00 38.27  ? 54  LEU A CD1   1 
ATOM   452  C  CD2   . LEU A 1 54  ? -37.621 56.148  8.244   1.00 43.11  ? 54  LEU A CD2   1 
ATOM   453  N  N     . LYS A 1 55  ? -38.371 60.963  9.162   1.00 47.13  ? 55  LYS A N     1 
ATOM   454  C  CA    . LYS A 1 55  ? -37.954 62.256  8.662   1.00 51.31  ? 55  LYS A CA    1 
ATOM   455  C  C     . LYS A 1 55  ? -38.250 62.347  7.163   1.00 50.77  ? 55  LYS A C     1 
ATOM   456  O  O     . LYS A 1 55  ? -37.930 61.434  6.396   1.00 50.22  ? 55  LYS A O     1 
ATOM   457  C  CB    . LYS A 1 55  ? -36.462 62.430  8.921   1.00 57.16  ? 55  LYS A CB    1 
ATOM   458  C  CG    . LYS A 1 55  ? -35.969 63.840  8.835   1.00 62.72  ? 55  LYS A CG    1 
ATOM   459  C  CD    . LYS A 1 55  ? -34.457 63.866  8.937   1.00 69.25  ? 55  LYS A CD    1 
ATOM   460  C  CE    . LYS A 1 55  ? -33.934 65.280  8.874   1.00 75.95  ? 55  LYS A CE    1 
ATOM   461  N  NZ    . LYS A 1 55  ? -34.656 66.003  7.794   1.00 76.33  ? 55  LYS A NZ    1 
ATOM   462  N  N     . GLY A 1 56  ? -38.902 63.433  6.765   1.00 51.40  ? 56  GLY A N     1 
ATOM   463  C  CA    . GLY A 1 56  ? -39.183 63.708  5.362   1.00 52.28  ? 56  GLY A CA    1 
ATOM   464  C  C     . GLY A 1 56  ? -40.173 62.778  4.695   1.00 47.63  ? 56  GLY A C     1 
ATOM   465  O  O     . GLY A 1 56  ? -40.246 62.731  3.476   1.00 49.02  ? 56  GLY A O     1 
ATOM   466  N  N     . SER A 1 57  ? -40.953 62.054  5.486   1.00 43.28  ? 57  SER A N     1 
ATOM   467  C  CA    . SER A 1 57  ? -41.894 61.088  4.943   1.00 39.24  ? 57  SER A CA    1 
ATOM   468  C  C     . SER A 1 57  ? -43.250 61.192  5.640   1.00 35.62  ? 57  SER A C     1 
ATOM   469  O  O     . SER A 1 57  ? -43.906 60.167  5.888   1.00 32.44  ? 57  SER A O     1 
ATOM   470  C  CB    . SER A 1 57  ? -41.328 59.683  5.137   1.00 38.38  ? 57  SER A CB    1 
ATOM   471  O  OG    . SER A 1 57  ? -41.342 58.952  3.928   1.00 38.65  ? 57  SER A OG    1 
ATOM   472  N  N     . LEU A 1 58  ? -43.672 62.418  5.961   1.00 36.83  ? 58  LEU A N     1 
ATOM   473  C  CA    . LEU A 1 58  ? -44.893 62.640  6.739   1.00 33.85  ? 58  LEU A CA    1 
ATOM   474  C  C     . LEU A 1 58  ? -46.172 62.436  5.919   1.00 31.37  ? 58  LEU A C     1 
ATOM   475  O  O     . LEU A 1 58  ? -46.333 63.036  4.852   1.00 33.13  ? 58  LEU A O     1 
ATOM   476  C  CB    . LEU A 1 58  ? -44.880 64.033  7.373   1.00 36.54  ? 58  LEU A CB    1 
ATOM   477  C  CG    . LEU A 1 58  ? -46.166 64.546  8.045   1.00 34.95  ? 58  LEU A CG    1 
ATOM   478  C  CD1   . LEU A 1 58  ? -46.506 63.801  9.327   1.00 32.09  ? 58  LEU A CD1   1 
ATOM   479  C  CD2   . LEU A 1 58  ? -46.074 66.040  8.328   1.00 39.50  ? 58  LEU A CD2   1 
ATOM   480  N  N     . GLU A 1 59  ? -47.060 61.572  6.422   1.00 27.91  ? 59  GLU A N     1 
ATOM   481  C  CA    . GLU A 1 59  ? -48.413 61.434  5.895   1.00 26.19  ? 59  GLU A CA    1 
ATOM   482  C  C     . GLU A 1 59  ? -49.398 61.180  7.029   1.00 23.30  ? 59  GLU A C     1 
ATOM   483  O  O     . GLU A 1 59  ? -49.264 60.197  7.755   1.00 22.52  ? 59  GLU A O     1 
ATOM   484  C  CB    . GLU A 1 59  ? -48.504 60.298  4.878   1.00 25.03  ? 59  GLU A CB    1 
ATOM   485  C  CG    . GLU A 1 59  ? -49.938 60.096  4.326   1.00 25.53  ? 59  GLU A CG    1 
ATOM   486  C  CD    . GLU A 1 59  ? -50.174 58.713  3.710   1.00 24.18  ? 59  GLU A CD    1 
ATOM   487  O  OE1   . GLU A 1 59  ? -50.846 57.864  4.362   1.00 22.80  ? 59  GLU A OE1   1 
ATOM   488  O  OE2   . GLU A 1 59  ? -49.688 58.492  2.575   1.00 29.45  ? 59  GLU A OE2   1 
ATOM   489  N  N     . ILE A 1 60  ? -50.387 62.060  7.183   1.00 22.84  ? 60  ILE A N     1 
ATOM   490  C  CA    . ILE A 1 60  ? -51.381 61.916  8.239   1.00 20.47  ? 60  ILE A CA    1 
ATOM   491  C  C     . ILE A 1 60  ? -52.497 60.999  7.785   1.00 17.60  ? 60  ILE A C     1 
ATOM   492  O  O     . ILE A 1 60  ? -52.925 61.062  6.641   1.00 17.62  ? 60  ILE A O     1 
ATOM   493  C  CB    . ILE A 1 60  ? -51.992 63.257  8.632   1.00 22.24  ? 60  ILE A CB    1 
ATOM   494  C  CG1   . ILE A 1 60  ? -50.928 64.162  9.255   1.00 26.13  ? 60  ILE A CG1   1 
ATOM   495  C  CG2   . ILE A 1 60  ? -53.148 63.050  9.620   1.00 21.43  ? 60  ILE A CG2   1 
ATOM   496  C  CD1   . ILE A 1 60  ? -51.367 65.639  9.446   1.00 28.68  ? 60  ILE A CD1   1 
ATOM   497  N  N     . ASP A 1 61  ? -52.975 60.155  8.694   1.00 15.82  ? 61  ASP A N     1 
ATOM   498  C  CA    . ASP A 1 61  ? -54.083 59.251  8.404   1.00 13.24  ? 61  ASP A CA    1 
ATOM   499  C  C     . ASP A 1 61  ? -55.337 59.582  9.194   1.00 12.86  ? 61  ASP A C     1 
ATOM   500  O  O     . ASP A 1 61  ? -55.371 59.373  10.419  1.00 13.36  ? 61  ASP A O     1 
ATOM   501  C  CB    . ASP A 1 61  ? -53.674 57.825  8.728   1.00 12.24  ? 61  ASP A CB    1 
ATOM   502  C  CG    . ASP A 1 61  ? -52.732 57.268  7.726   1.00 12.49  ? 61  ASP A CG    1 
ATOM   503  O  OD1   . ASP A 1 61  ? -51.597 56.963  8.118   1.00 14.61  ? 61  ASP A OD1   1 
ATOM   504  O  OD2   . ASP A 1 61  ? -53.116 57.152  6.548   1.00 12.11  ? 61  ASP A OD2   1 
ATOM   505  N  N     . VAL A 1 62  ? -56.371 60.065  8.500   1.00 12.14  ? 62  VAL A N     1 
ATOM   506  C  CA    . VAL A 1 62  ? -57.675 60.279  9.134   1.00 11.80  ? 62  VAL A CA    1 
ATOM   507  C  C     . VAL A 1 62  ? -58.626 59.175  8.743   1.00 10.72  ? 62  VAL A C     1 
ATOM   508  O  O     . VAL A 1 62  ? -58.895 58.979  7.555   1.00 10.52  ? 62  VAL A O     1 
ATOM   509  C  CB    . VAL A 1 62  ? -58.330 61.628  8.761   1.00 13.10  ? 62  VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 62  ? -59.651 61.791  9.505   1.00 13.43  ? 62  VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 62  ? -57.425 62.765  9.110   1.00 15.23  ? 62  VAL A CG2   1 
ATOM   512  N  N     . PHE A 1 63  ? -59.140 58.460  9.743   1.00 10.56  ? 63  PHE A N     1 
ATOM   513  C  CA    . PHE A 1 63  ? -60.173 57.471  9.498   1.00 10.54  ? 63  PHE A CA    1 
ATOM   514  C  C     . PHE A 1 63  ? -61.534 58.010  9.869   1.00 12.25  ? 63  PHE A C     1 
ATOM   515  O  O     . PHE A 1 63  ? -61.689 58.618  10.923  1.00 14.05  ? 63  PHE A O     1 
ATOM   516  C  CB    . PHE A 1 63  ? -59.889 56.183  10.260  1.00 10.28  ? 63  PHE A CB    1 
ATOM   517  C  CG    . PHE A 1 63  ? -59.221 55.121  9.426   1.00 9.20   ? 63  PHE A CG    1 
ATOM   518  C  CD1   . PHE A 1 63  ? -58.062 55.401  8.709   1.00 6.85   ? 63  PHE A CD1   1 
ATOM   519  C  CD2   . PHE A 1 63  ? -59.748 53.833  9.376   1.00 9.43   ? 63  PHE A CD2   1 
ATOM   520  C  CE1   . PHE A 1 63  ? -57.448 54.420  7.956   1.00 8.16   ? 63  PHE A CE1   1 
ATOM   521  C  CE2   . PHE A 1 63  ? -59.141 52.843  8.612   1.00 9.98   ? 63  PHE A CE2   1 
ATOM   522  C  CZ    . PHE A 1 63  ? -57.987 53.133  7.897   1.00 8.78   ? 63  PHE A CZ    1 
ATOM   523  N  N     . LEU A 1 64  ? -62.502 57.795  8.986   1.00 12.69  ? 64  LEU A N     1 
ATOM   524  C  CA    . LEU A 1 64  ? -63.889 58.151  9.220   1.00 14.78  ? 64  LEU A CA    1 
ATOM   525  C  C     . LEU A 1 64  ? -64.643 56.877  9.529   1.00 16.33  ? 64  LEU A C     1 
ATOM   526  O  O     . LEU A 1 64  ? -64.595 55.909  8.747   1.00 16.28  ? 64  LEU A O     1 
ATOM   527  C  CB    . LEU A 1 64  ? -64.511 58.805  7.988   1.00 15.39  ? 64  LEU A CB    1 
ATOM   528  C  CG    . LEU A 1 64  ? -63.731 59.909  7.278   1.00 15.02  ? 64  LEU A CG    1 
ATOM   529  C  CD1   . LEU A 1 64  ? -64.322 60.147  5.909   1.00 15.07  ? 64  LEU A CD1   1 
ATOM   530  C  CD2   . LEU A 1 64  ? -63.690 61.190  8.106   1.00 14.99  ? 64  LEU A CD2   1 
ATOM   531  N  N     . LEU A 1 65  ? -65.350 56.884  10.659  1.00 18.41  ? 65  LEU A N     1 
ATOM   532  C  CA    . LEU A 1 65  ? -66.050 55.699  11.137  1.00 20.39  ? 65  LEU A CA    1 
ATOM   533  C  C     . LEU A 1 65  ? -67.514 55.745  10.779  1.00 22.78  ? 65  LEU A C     1 
ATOM   534  O  O     . LEU A 1 65  ? -68.271 56.526  11.362  1.00 25.24  ? 65  LEU A O     1 
ATOM   535  C  CB    . LEU A 1 65  ? -65.895 55.567  12.645  1.00 21.84  ? 65  LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 65  ? -64.431 55.508  13.047  1.00 21.00  ? 65  LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 65  ? -64.250 56.294  14.331  1.00 23.72  ? 65  LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 65  ? -63.950 54.047  13.167  1.00 21.14  ? 65  LEU A CD2   1 
ATOM   539  N  N     . PHE A 1 66  ? -67.906 54.908  9.819   1.00 22.85  ? 66  PHE A N     1 
ATOM   540  C  CA    . PHE A 1 66  ? -69.297 54.810  9.388   1.00 25.26  ? 66  PHE A CA    1 
ATOM   541  C  C     . PHE A 1 66  ? -70.003 53.652  10.080  1.00 28.12  ? 66  PHE A C     1 
ATOM   542  O  O     . PHE A 1 66  ? -69.335 52.760  10.609  1.00 27.37  ? 66  PHE A O     1 
ATOM   543  C  CB    . PHE A 1 66  ? -69.374 54.667  7.878   1.00 25.03  ? 66  PHE A CB    1 
ATOM   544  C  CG    . PHE A 1 66  ? -68.975 55.907  7.132   1.00 23.62  ? 66  PHE A CG    1 
ATOM   545  C  CD1   . PHE A 1 66  ? -69.817 57.011  7.087   1.00 26.75  ? 66  PHE A CD1   1 
ATOM   546  C  CD2   . PHE A 1 66  ? -67.765 55.968  6.458   1.00 20.69  ? 66  PHE A CD2   1 
ATOM   547  C  CE1   . PHE A 1 66  ? -69.452 58.159  6.385   1.00 25.38  ? 66  PHE A CE1   1 
ATOM   548  C  CE2   . PHE A 1 66  ? -67.396 57.099  5.754   1.00 19.63  ? 66  PHE A CE2   1 
ATOM   549  C  CZ    . PHE A 1 66  ? -68.239 58.195  5.717   1.00 22.42  ? 66  PHE A CZ    1 
ATOM   550  N  N     . PRO A 1 67  ? -71.357 53.686  10.124  1.00 31.72  ? 67  PRO A N     1 
ATOM   551  C  CA    . PRO A 1 67  ? -72.117 52.601  10.744  1.00 35.76  ? 67  PRO A CA    1 
ATOM   552  C  C     . PRO A 1 67  ? -71.949 51.286  9.993   1.00 36.90  ? 67  PRO A C     1 
ATOM   553  O  O     . PRO A 1 67  ? -71.923 51.273  8.762   1.00 36.30  ? 67  PRO A O     1 
ATOM   554  C  CB    . PRO A 1 67  ? -73.567 53.097  10.649  1.00 39.38  ? 67  PRO A CB    1 
ATOM   555  C  CG    . PRO A 1 67  ? -73.451 54.570  10.516  1.00 36.79  ? 67  PRO A CG    1 
ATOM   556  C  CD    . PRO A 1 67  ? -72.257 54.754  9.653   1.00 32.80  ? 67  PRO A CD    1 
ATOM   557  N  N     . GLU A 1 68  ? -71.831 50.188  10.727  1.00 39.41  ? 68  GLU A N     1 
ATOM   558  C  CA    . GLU A 1 68  ? -71.663 48.880  10.090  1.00 41.70  ? 68  GLU A CA    1 
ATOM   559  C  C     . GLU A 1 68  ? -72.760 48.541  9.070   1.00 45.21  ? 68  GLU A C     1 
ATOM   560  O  O     . GLU A 1 68  ? -72.514 47.771  8.139   1.00 45.95  ? 68  GLU A O     1 
ATOM   561  C  CB    . GLU A 1 68  ? -71.546 47.755  11.122  1.00 44.68  ? 68  GLU A CB    1 
ATOM   562  C  CG    . GLU A 1 68  ? -71.033 46.475  10.493  1.00 47.95  ? 68  GLU A CG    1 
ATOM   563  C  CD    . GLU A 1 68  ? -71.306 45.239  11.324  1.00 56.61  ? 68  GLU A CD    1 
ATOM   564  O  OE1   . GLU A 1 68  ? -71.802 44.233  10.748  1.00 61.20  ? 68  GLU A OE1   1 
ATOM   565  O  OE2   . GLU A 1 68  ? -71.018 45.273  12.548  1.00 58.50  ? 68  GLU A OE2   1 
ATOM   566  N  N     . GLU A 1 69  ? -73.952 49.116  9.250   1.00 47.98  ? 69  GLU A N     1 
ATOM   567  C  CA    . GLU A 1 69  ? -75.107 48.804  8.404   1.00 52.45  ? 69  GLU A CA    1 
ATOM   568  C  C     . GLU A 1 69  ? -74.944 49.279  6.969   1.00 50.41  ? 69  GLU A C     1 
ATOM   569  O  O     . GLU A 1 69  ? -75.485 48.657  6.056   1.00 54.10  ? 69  GLU A O     1 
ATOM   570  C  CB    . GLU A 1 69  ? -76.406 49.364  8.988   1.00 56.56  ? 69  GLU A CB    1 
ATOM   571  C  CG    . GLU A 1 69  ? -76.948 48.596  10.189  1.00 62.57  ? 69  GLU A CG    1 
ATOM   572  C  CD    . GLU A 1 69  ? -76.639 49.266  11.529  1.00 63.08  ? 69  GLU A CD    1 
ATOM   573  O  OE1   . GLU A 1 69  ? -75.464 49.650  11.774  1.00 58.16  ? 69  GLU A OE1   1 
ATOM   574  O  OE2   . GLU A 1 69  ? -77.589 49.406  12.341  1.00 68.30  ? 69  GLU A OE2   1 
ATOM   575  N  N     . PHE A 1 70  ? -74.200 50.370  6.787   1.00 45.24  ? 70  PHE A N     1 
ATOM   576  C  CA    . PHE A 1 70  ? -73.905 50.942  5.467   1.00 43.60  ? 70  PHE A CA    1 
ATOM   577  C  C     . PHE A 1 70  ? -73.420 49.934  4.443   1.00 45.05  ? 70  PHE A C     1 
ATOM   578  O  O     . PHE A 1 70  ? -72.582 49.078  4.738   1.00 43.39  ? 70  PHE A O     1 
ATOM   579  C  CB    . PHE A 1 70  ? -72.847 52.032  5.577   1.00 37.80  ? 70  PHE A CB    1 
ATOM   580  C  CG    . PHE A 1 70  ? -73.397 53.390  5.859   1.00 36.43  ? 70  PHE A CG    1 
ATOM   581  C  CD1   . PHE A 1 70  ? -74.572 53.552  6.581   1.00 38.69  ? 70  PHE A CD1   1 
ATOM   582  C  CD2   . PHE A 1 70  ? -72.711 54.520  5.429   1.00 32.46  ? 70  PHE A CD2   1 
ATOM   583  C  CE1   . PHE A 1 70  ? -75.066 54.820  6.851   1.00 39.10  ? 70  PHE A CE1   1 
ATOM   584  C  CE2   . PHE A 1 70  ? -73.192 55.786  5.699   1.00 32.58  ? 70  PHE A CE2   1 
ATOM   585  C  CZ    . PHE A 1 70  ? -74.379 55.939  6.409   1.00 36.55  ? 70  PHE A CZ    1 
ATOM   586  N  N     . SER A 1 71  ? -73.951 50.063  3.231   1.00 48.78  ? 71  SER A N     1 
ATOM   587  C  CA    . SER A 1 71  ? -73.537 49.234  2.116   1.00 51.73  ? 71  SER A CA    1 
ATOM   588  C  C     . SER A 1 71  ? -72.104 49.600  1.739   1.00 47.91  ? 71  SER A C     1 
ATOM   589  O  O     . SER A 1 71  ? -71.538 50.555  2.277   1.00 43.79  ? 71  SER A O     1 
ATOM   590  C  CB    . SER A 1 71  ? -74.490 49.405  0.928   1.00 56.43  ? 71  SER A CB    1 
ATOM   591  O  OG    . SER A 1 71  ? -74.161 50.544  0.159   1.00 54.48  ? 71  SER A OG    1 
ATOM   592  N  N     . LYS A 1 72  ? -71.508 48.816  0.846   1.00 50.38  ? 72  LYS A N     1 
ATOM   593  C  CA    . LYS A 1 72  ? -70.200 49.135  0.299   1.00 48.04  ? 72  LYS A CA    1 
ATOM   594  C  C     . LYS A 1 72  ? -70.283 50.424  -0.544  1.00 47.98  ? 72  LYS A C     1 
ATOM   595  O  O     . LYS A 1 72  ? -69.353 51.237  -0.566  1.00 44.32  ? 72  LYS A O     1 
ATOM   596  C  CB    . LYS A 1 72  ? -69.665 47.926  -0.483  1.00 51.13  ? 72  LYS A CB    1 
ATOM   597  C  CG    . LYS A 1 72  ? -69.096 48.182  -1.897  1.00 54.43  ? 72  LYS A CG    1 
ATOM   598  C  CD    . LYS A 1 72  ? -70.168 48.023  -3.003  1.00 63.32  ? 72  LYS A CD    1 
ATOM   599  C  CE    . LYS A 1 72  ? -69.642 47.228  -4.208  1.00 68.22  ? 72  LYS A CE    1 
ATOM   600  N  NZ    . LYS A 1 72  ? -68.367 47.788  -4.755  1.00 66.15  ? 72  LYS A NZ    1 
ATOM   601  N  N     . GLU A 1 73  ? -71.421 50.614  -1.204  1.00 52.57  ? 73  GLU A N     1 
ATOM   602  C  CA    . GLU A 1 73  ? -71.610 51.760  -2.068  1.00 53.80  ? 73  GLU A CA    1 
ATOM   603  C  C     . GLU A 1 73  ? -71.730 53.079  -1.289  1.00 49.92  ? 73  GLU A C     1 
ATOM   604  O  O     . GLU A 1 73  ? -71.205 54.109  -1.711  1.00 48.39  ? 73  GLU A O     1 
ATOM   605  C  CB    . GLU A 1 73  ? -72.815 51.518  -2.988  1.00 60.80  ? 73  GLU A CB    1 
ATOM   606  C  CG    . GLU A 1 73  ? -73.190 52.685  -3.930  1.00 65.73  ? 73  GLU A CG    1 
ATOM   607  C  CD    . GLU A 1 73  ? -72.023 53.231  -4.785  1.00 67.52  ? 73  GLU A CD    1 
ATOM   608  O  OE1   . GLU A 1 73  ? -70.982 52.535  -4.959  1.00 67.36  ? 73  GLU A OE1   1 
ATOM   609  O  OE2   . GLU A 1 73  ? -72.159 54.377  -5.286  1.00 69.06  ? 73  GLU A OE2   1 
ATOM   610  N  N     . GLU A 1 74  ? -72.413 53.044  -0.152  1.00 48.94  ? 74  GLU A N     1 
ATOM   611  C  CA    . GLU A 1 74  ? -72.621 54.248  0.651   1.00 46.39  ? 74  GLU A CA    1 
ATOM   612  C  C     . GLU A 1 74  ? -71.334 54.668  1.350   1.00 41.24  ? 74  GLU A C     1 
ATOM   613  O  O     . GLU A 1 74  ? -71.033 55.862  1.481   1.00 39.39  ? 74  GLU A O     1 
ATOM   614  C  CB    . GLU A 1 74  ? -73.715 54.007  1.675   1.00 47.83  ? 74  GLU A CB    1 
ATOM   615  C  CG    . GLU A 1 74  ? -75.060 53.768  1.055   1.00 53.41  ? 74  GLU A CG    1 
ATOM   616  C  CD    . GLU A 1 74  ? -76.105 53.378  2.068   1.00 55.85  ? 74  GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1 74  ? -75.777 52.641  3.011   1.00 54.00  ? 74  GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1 74  ? -77.266 53.801  1.914   1.00 61.51  ? 74  GLU A OE2   1 
ATOM   619  N  N     . LEU A 1 75  ? -70.588 53.657  1.790   1.00 39.41  ? 75  LEU A N     1 
ATOM   620  C  CA    . LEU A 1 75  ? -69.274 53.801  2.399   1.00 35.03  ? 75  LEU A CA    1 
ATOM   621  C  C     . LEU A 1 75  ? -68.341 54.576  1.458   1.00 34.03  ? 75  LEU A C     1 
ATOM   622  O  O     . LEU A 1 75  ? -67.633 55.483  1.875   1.00 31.17  ? 75  LEU A O     1 
ATOM   623  C  CB    . LEU A 1 75  ? -68.744 52.396  2.685   1.00 34.47  ? 75  LEU A CB    1 
ATOM   624  C  CG    . LEU A 1 75  ? -67.583 52.008  3.606   1.00 31.11  ? 75  LEU A CG    1 
ATOM   625  C  CD1   . LEU A 1 75  ? -66.239 52.297  2.967   1.00 29.32  ? 75  LEU A CD1   1 
ATOM   626  C  CD2   . LEU A 1 75  ? -67.679 52.598  5.018   1.00 29.11  ? 75  LEU A CD2   1 
ATOM   627  N  N     . ARG A 1 76  ? -68.373 54.214  0.180   1.00 37.30  ? 76  ARG A N     1 
ATOM   628  C  CA    . ARG A 1 76  ? -67.635 54.910  -0.861  1.00 38.09  ? 76  ARG A CA    1 
ATOM   629  C  C     . ARG A 1 76  ? -68.112 56.361  -0.944  1.00 38.91  ? 76  ARG A C     1 
ATOM   630  O  O     . ARG A 1 76  ? -67.351 57.287  -0.644  1.00 36.57  ? 76  ARG A O     1 
ATOM   631  C  CB    . ARG A 1 76  ? -67.865 54.205  -2.200  1.00 42.61  ? 76  ARG A CB    1 
ATOM   632  C  CG    . ARG A 1 76  ? -66.692 54.181  -3.152  1.00 43.80  ? 76  ARG A CG    1 
ATOM   633  C  CD    . ARG A 1 76  ? -67.153 53.828  -4.555  1.00 52.07  ? 76  ARG A CD    1 
ATOM   634  N  NE    . ARG A 1 76  ? -67.439 55.050  -5.296  1.00 57.10  ? 76  ARG A NE    1 
ATOM   635  C  CZ    . ARG A 1 76  ? -68.647 55.592  -5.443  1.00 61.80  ? 76  ARG A CZ    1 
ATOM   636  N  NH1   . ARG A 1 76  ? -69.715 55.009  -4.919  1.00 63.02  ? 76  ARG A NH1   1 
ATOM   637  N  NH2   . ARG A 1 76  ? -68.793 56.724  -6.130  1.00 65.18  ? 76  ARG A NH2   1 
ATOM   638  N  N     . GLU A 1 77  ? -69.382 56.538  -1.316  1.00 42.61  ? 77  GLU A N     1 
ATOM   639  C  CA    . GLU A 1 77  ? -69.982 57.850  -1.578  1.00 44.77  ? 77  GLU A CA    1 
ATOM   640  C  C     . GLU A 1 77  ? -69.721 58.909  -0.523  1.00 41.37  ? 77  GLU A C     1 
ATOM   641  O  O     . GLU A 1 77  ? -69.380 60.040  -0.860  1.00 41.99  ? 77  GLU A O     1 
ATOM   642  C  CB    . GLU A 1 77  ? -71.481 57.717  -1.719  1.00 49.15  ? 77  GLU A CB    1 
ATOM   643  C  CG    . GLU A 1 77  ? -71.942 57.043  -2.974  1.00 56.65  ? 77  GLU A CG    1 
ATOM   644  C  CD    . GLU A 1 77  ? -73.411 57.334  -3.233  1.00 65.67  ? 77  GLU A CD    1 
ATOM   645  O  OE1   . GLU A 1 77  ? -73.991 56.733  -4.176  1.00 71.77  ? 77  GLU A OE1   1 
ATOM   646  O  OE2   . GLU A 1 77  ? -73.979 58.178  -2.483  1.00 65.95  ? 77  GLU A OE2   1 
ATOM   647  N  N     . ARG A 1 78  ? -69.911 58.549  0.746   1.00 38.54  ? 78  ARG A N     1 
ATOM   648  C  CA    . ARG A 1 78  ? -69.695 59.486  1.844   1.00 35.77  ? 78  ARG A CA    1 
ATOM   649  C  C     . ARG A 1 78  ? -68.201 59.641  2.078   1.00 31.99  ? 78  ARG A C     1 
ATOM   650  O  O     . ARG A 1 78  ? -67.697 60.754  2.203   1.00 31.70  ? 78  ARG A O     1 
ATOM   651  C  CB    . ARG A 1 78  ? -70.413 59.039  3.124   1.00 35.31  ? 78  ARG A CB    1 
ATOM   652  C  CG    . ARG A 1 78  ? -71.932 58.927  2.999   1.00 38.78  ? 78  ARG A CG    1 
ATOM   653  C  CD    . ARG A 1 78  ? -72.706 60.195  3.403   1.00 39.98  ? 78  ARG A CD    1 
ATOM   654  N  NE    . ARG A 1 78  ? -71.965 61.448  3.255   1.00 38.34  ? 78  ARG A NE    1 
ATOM   655  C  CZ    . ARG A 1 78  ? -71.743 62.319  4.244   1.00 37.55  ? 78  ARG A CZ    1 
ATOM   656  N  NH1   . ARG A 1 78  ? -72.208 62.112  5.468   1.00 36.06  ? 78  ARG A NH1   1 
ATOM   657  N  NH2   . ARG A 1 78  ? -71.051 63.420  4.007   1.00 39.00  ? 78  ARG A NH2   1 
ATOM   658  N  N     . GLY A 1 79  ? -67.489 58.523  2.110   1.00 29.59  ? 79  GLY A N     1 
ATOM   659  C  CA    . GLY A 1 79  ? -66.044 58.567  2.264   1.00 26.36  ? 79  GLY A CA    1 
ATOM   660  C  C     . GLY A 1 79  ? -65.456 59.689  1.437   1.00 27.03  ? 79  GLY A C     1 
ATOM   661  O  O     . GLY A 1 79  ? -64.905 60.648  1.978   1.00 25.45  ? 79  GLY A O     1 
ATOM   662  N  N     . LEU A 1 80  ? -65.617 59.569  0.119   1.00 29.82  ? 80  LEU A N     1 
ATOM   663  C  CA    . LEU A 1 80  ? -65.052 60.515  -0.839  1.00 31.58  ? 80  LEU A CA    1 
ATOM   664  C  C     . LEU A 1 80  ? -65.625 61.913  -0.671  1.00 33.29  ? 80  LEU A C     1 
ATOM   665  O  O     . LEU A 1 80  ? -64.908 62.893  -0.890  1.00 34.05  ? 80  LEU A O     1 
ATOM   666  C  CB    . LEU A 1 80  ? -65.246 60.044  -2.292  1.00 35.40  ? 80  LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 80  ? -64.566 58.802  -2.901  1.00 34.99  ? 80  LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 80  ? -63.260 58.435  -2.198  1.00 31.86  ? 80  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 80  ? -65.500 57.626  -2.904  1.00 35.82  ? 80  LEU A CD2   1 
ATOM   670  N  N     . GLU A 1 81  ? -66.902 62.004  -0.281  1.00 34.15  ? 81  GLU A N     1 
ATOM   671  C  CA    . GLU A 1 81  ? -67.529 63.313  -0.004  1.00 36.15  ? 81  GLU A CA    1 
ATOM   672  C  C     . GLU A 1 81  ? -66.773 64.095  1.062   1.00 33.05  ? 81  GLU A C     1 
ATOM   673  O  O     . GLU A 1 81  ? -66.288 65.187  0.807   1.00 34.66  ? 81  GLU A O     1 
ATOM   674  C  CB    . GLU A 1 81  ? -68.996 63.174  0.397   1.00 38.06  ? 81  GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 81  ? -69.918 63.088  -0.790  1.00 45.09  ? 81  GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 81  ? -71.371 63.413  -0.465  1.00 52.19  ? 81  GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 81  ? -71.651 64.135  0.532   1.00 51.98  ? 81  GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 81  ? -72.239 62.948  -1.244  1.00 58.03  ? 81  GLU A OE2   1 
ATOM   679  N  N     . ILE A 1 82  ? -66.668 63.510  2.247   1.00 29.03  ? 82  ILE A N     1 
ATOM   680  C  CA    . ILE A 1 82  ? -65.964 64.118  3.355   1.00 26.63  ? 82  ILE A CA    1 
ATOM   681  C  C     . ILE A 1 82  ? -64.518 64.386  2.986   1.00 25.48  ? 82  ILE A C     1 
ATOM   682  O  O     . ILE A 1 82  ? -63.981 65.467  3.238   1.00 27.01  ? 82  ILE A O     1 
ATOM   683  C  CB    . ILE A 1 82  ? -66.028 63.221  4.580   1.00 23.79  ? 82  ILE A CB    1 
ATOM   684  C  CG1   . ILE A 1 82  ? -67.488 62.906  4.890   1.00 25.32  ? 82  ILE A CG1   1 
ATOM   685  C  CG2   . ILE A 1 82  ? -65.366 63.896  5.774   1.00 22.77  ? 82  ILE A CG2   1 
ATOM   686  C  CD1   . ILE A 1 82  ? -67.678 61.651  5.670   1.00 23.33  ? 82  ILE A CD1   1 
ATOM   687  N  N     . GLY A 1 83  ? -63.898 63.401  2.363   1.00 23.62  ? 83  GLY A N     1 
ATOM   688  C  CA    . GLY A 1 83  ? -62.504 63.506  1.998   1.00 22.33  ? 83  GLY A CA    1 
ATOM   689  C  C     . GLY A 1 83  ? -62.268 64.688  1.108   1.00 25.32  ? 83  GLY A C     1 
ATOM   690  O  O     . GLY A 1 83  ? -61.413 65.518  1.397   1.00 25.99  ? 83  GLY A O     1 
ATOM   691  N  N     . LYS A 1 84  ? -63.042 64.760  0.028   1.00 27.94  ? 84  LYS A N     1 
ATOM   692  C  CA    . LYS A 1 84  ? -63.044 65.930  -0.843  1.00 31.88  ? 84  LYS A CA    1 
ATOM   693  C  C     . LYS A 1 84  ? -63.331 67.207  -0.043  1.00 32.88  ? 84  LYS A C     1 
ATOM   694  O  O     . LYS A 1 84  ? -62.731 68.232  -0.300  1.00 35.75  ? 84  LYS A O     1 
ATOM   695  C  CB    . LYS A 1 84  ? -64.083 65.773  -1.951  1.00 35.27  ? 84  LYS A CB    1 
ATOM   696  C  CG    . LYS A 1 84  ? -63.730 64.806  -3.073  1.00 36.33  ? 84  LYS A CG    1 
ATOM   697  C  CD    . LYS A 1 84  ? -65.017 64.335  -3.740  1.00 40.41  ? 84  LYS A CD    1 
ATOM   698  C  CE    . LYS A 1 84  ? -64.876 64.212  -5.248  1.00 46.81  ? 84  LYS A CE    1 
ATOM   699  N  NZ    . LYS A 1 84  ? -66.164 63.843  -5.930  1.00 50.73  ? 84  LYS A NZ    1 
ATOM   700  N  N     . ALA A 1 85  ? -64.226 67.117  0.941   1.00 31.18  ? 85  ALA A N     1 
ATOM   701  C  CA    . ALA A 1 85  ? -64.761 68.279  1.650   1.00 33.14  ? 85  ALA A CA    1 
ATOM   702  C  C     . ALA A 1 85  ? -63.713 68.909  2.537   1.00 32.61  ? 85  ALA A C     1 
ATOM   703  O  O     . ALA A 1 85  ? -63.829 70.067  2.954   1.00 35.62  ? 85  ALA A O     1 
ATOM   704  C  CB    . ALA A 1 85  ? -65.949 67.870  2.487   1.00 31.54  ? 85  ALA A CB    1 
ATOM   705  N  N     . VAL A 1 86  ? -62.670 68.141  2.797   1.00 29.09  ? 86  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 86  ? -61.808 68.393  3.935   1.00 27.75  ? 86  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 86  ? -60.366 68.763  3.543   1.00 28.65  ? 86  VAL A C     1 
ATOM   708  O  O     . VAL A 1 86  ? -59.585 69.180  4.399   1.00 28.28  ? 86  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 86  ? -61.917 67.165  4.897   1.00 23.44  ? 86  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 86  ? -60.574 66.574  5.290   1.00 20.67  ? 86  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 86  ? -62.779 67.495  6.096   1.00 24.42  ? 86  VAL A CG2   1 
ATOM   712  N  N     . LEU A 1 87  ? -60.050 68.652  2.246   1.00 30.15  ? 87  LEU A N     1 
ATOM   713  C  CA    . LEU A 1 87  ? -58.673 68.787  1.741   1.00 31.92  ? 87  LEU A CA    1 
ATOM   714  C  C     . LEU A 1 87  ? -58.430 70.012  0.828   1.00 38.47  ? 87  LEU A C     1 
ATOM   715  O  O     . LEU A 1 87  ? -59.262 70.321  -0.022  1.00 41.64  ? 87  LEU A O     1 
ATOM   716  C  CB    . LEU A 1 87  ? -58.251 67.481  1.050   1.00 28.71  ? 87  LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 87  ? -58.269 66.263  1.989   1.00 22.55  ? 87  LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 87  ? -58.052 64.951  1.250   1.00 18.43  ? 87  LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 87  ? -57.263 66.433  3.122   1.00 19.18  ? 87  LEU A CD2   1 
ATOM   720  N  N     . ASP A 1 88  ? -57.304 70.712  1.001   1.00 41.81  ? 88  ASP A N     1 
ATOM   721  C  CA    . ASP A 1 88  ? -56.998 71.887  0.160   1.00 49.27  ? 88  ASP A CA    1 
ATOM   722  C  C     . ASP A 1 88  ? -57.045 71.541  -1.331  1.00 51.83  ? 88  ASP A C     1 
ATOM   723  O  O     . ASP A 1 88  ? -57.422 72.375  -2.170  1.00 57.51  ? 88  ASP A O     1 
ATOM   724  C  CB    . ASP A 1 88  ? -55.614 72.476  0.474   1.00 52.23  ? 88  ASP A CB    1 
ATOM   725  C  CG    . ASP A 1 88  ? -55.512 73.063  1.873   1.00 53.18  ? 88  ASP A CG    1 
ATOM   726  O  OD1   . ASP A 1 88  ? -56.555 73.281  2.524   1.00 53.18  ? 88  ASP A OD1   1 
ATOM   727  O  OD2   . ASP A 1 88  ? -54.368 73.313  2.316   1.00 55.36  ? 88  ASP A OD2   1 
ATOM   728  N  N     . SER A 1 89  ? -56.615 70.322  -1.646  1.00 48.68  ? 89  SER A N     1 
ATOM   729  C  CA    . SER A 1 89  ? -56.706 69.750  -2.983  1.00 50.70  ? 89  SER A CA    1 
ATOM   730  C  C     . SER A 1 89  ? -56.436 68.272  -2.808  1.00 45.80  ? 89  SER A C     1 
ATOM   731  O  O     . SER A 1 89  ? -55.854 67.868  -1.800  1.00 42.22  ? 89  SER A O     1 
ATOM   732  C  CB    . SER A 1 89  ? -55.678 70.361  -3.915  1.00 56.16  ? 89  SER A CB    1 
ATOM   733  O  OG    . SER A 1 89  ? -54.388 70.047  -3.447  1.00 55.17  ? 89  SER A OG    1 
ATOM   734  N  N     . TYR A 1 90  ? -56.857 67.474  -3.783  1.00 46.43  ? 90  TYR A N     1 
ATOM   735  C  CA    . TYR A 1 90  ? -56.974 66.037  -3.587  1.00 42.34  ? 90  TYR A CA    1 
ATOM   736  C  C     . TYR A 1 90  ? -56.706 65.220  -4.837  1.00 44.70  ? 90  TYR A C     1 
ATOM   737  O  O     . TYR A 1 90  ? -56.334 65.765  -5.874  1.00 50.33  ? 90  TYR A O     1 
ATOM   738  C  CB    . TYR A 1 90  ? -58.363 65.696  -3.043  1.00 39.79  ? 90  TYR A CB    1 
ATOM   739  C  CG    . TYR A 1 90  ? -59.520 66.019  -3.971  1.00 43.51  ? 90  TYR A CG    1 
ATOM   740  C  CD1   . TYR A 1 90  ? -60.007 65.069  -4.868  1.00 44.53  ? 90  TYR A CD1   1 
ATOM   741  C  CD2   . TYR A 1 90  ? -60.144 67.272  -3.934  1.00 47.03  ? 90  TYR A CD2   1 
ATOM   742  C  CE1   . TYR A 1 90  ? -61.079 65.364  -5.717  1.00 49.22  ? 90  TYR A CE1   1 
ATOM   743  C  CE2   . TYR A 1 90  ? -61.219 67.578  -4.782  1.00 50.92  ? 90  TYR A CE2   1 
ATOM   744  C  CZ    . TYR A 1 90  ? -61.680 66.617  -5.664  1.00 51.70  ? 90  TYR A CZ    1 
ATOM   745  O  OH    . TYR A 1 90  ? -62.732 66.902  -6.498  1.00 55.75  ? 90  TYR A OH    1 
ATOM   746  N  N     . GLU A 1 91  ? -56.931 63.912  -4.724  1.00 41.32  ? 91  GLU A N     1 
ATOM   747  C  CA    . GLU A 1 91  ? -56.621 62.943  -5.770  1.00 43.20  ? 91  GLU A CA    1 
ATOM   748  C  C     . GLU A 1 91  ? -57.264 61.594  -5.419  1.00 39.17  ? 91  GLU A C     1 
ATOM   749  O  O     . GLU A 1 91  ? -57.112 61.089  -4.284  1.00 34.60  ? 91  GLU A O     1 
ATOM   750  C  CB    . GLU A 1 91  ? -55.116 62.784  -5.858  1.00 44.00  ? 91  GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 91  ? -54.596 62.244  -7.151  1.00 50.97  ? 91  GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 91  ? -53.083 62.391  -7.238  1.00 57.00  ? 91  GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 91  ? -52.386 62.122  -6.215  1.00 53.89  ? 91  GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 91  ? -52.596 62.789  -8.327  1.00 64.57  ? 91  GLU A OE2   1 
ATOM   755  N  N     . ILE A 1 92  ? -57.990 61.015  -6.373  1.00 40.87  ? 92  ILE A N     1 
ATOM   756  C  CA    . ILE A 1 92  ? -58.685 59.767  -6.097  1.00 37.70  ? 92  ILE A CA    1 
ATOM   757  C  C     . ILE A 1 92  ? -58.257 58.647  -7.044  1.00 40.96  ? 92  ILE A C     1 
ATOM   758  O  O     . ILE A 1 92  ? -58.568 58.655  -8.231  1.00 46.39  ? 92  ILE A O     1 
ATOM   759  C  CB    . ILE A 1 92  ? -60.215 59.962  -6.028  1.00 37.62  ? 92  ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1 92  ? -60.562 60.877  -4.850  1.00 32.87  ? 92  ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1 92  ? -60.921 58.626  -5.870  1.00 35.66  ? 92  ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1 92  ? -61.934 61.486  -4.893  1.00 32.09  ? 92  ILE A CD1   1 
ATOM   763  N  N     . ARG A 1 93  ? -57.501 57.702  -6.494  1.00 38.25  ? 93  ARG A N     1 
ATOM   764  C  CA    . ARG A 1 93  ? -57.062 56.503  -7.197  1.00 40.76  ? 93  ARG A CA    1 
ATOM   765  C  C     . ARG A 1 93  ? -56.950 55.435  -6.134  1.00 36.16  ? 93  ARG A C     1 
ATOM   766  O  O     . ARG A 1 93  ? -56.333 55.660  -5.089  1.00 32.43  ? 93  ARG A O     1 
ATOM   767  C  CB    . ARG A 1 93  ? -55.681 56.704  -7.823  1.00 43.74  ? 93  ARG A CB    1 
ATOM   768  C  CG    . ARG A 1 93  ? -55.675 57.387  -9.174  1.00 52.69  ? 93  ARG A CG    1 
ATOM   769  C  CD    . ARG A 1 93  ? -56.258 56.492  -10.288 1.00 61.29  ? 93  ARG A CD    1 
ATOM   770  N  NE    . ARG A 1 93  ? -55.288 56.116  -11.323 1.00 68.03  ? 93  ARG A NE    1 
ATOM   771  C  CZ    . ARG A 1 93  ? -55.592 55.376  -12.389 1.00 75.80  ? 93  ARG A CZ    1 
ATOM   772  N  NH1   . ARG A 1 93  ? -56.835 54.923  -12.550 1.00 77.07  ? 93  ARG A NH1   1 
ATOM   773  N  NH2   . ARG A 1 93  ? -54.659 55.080  -13.298 1.00 82.00  ? 93  ARG A NH2   1 
ATOM   774  N  N     . TYR A 1 94  ? -57.559 54.283  -6.371  1.00 36.79  ? 94  TYR A N     1 
ATOM   775  C  CA    . TYR A 1 94  ? -57.414 53.170  -5.448  1.00 33.28  ? 94  TYR A CA    1 
ATOM   776  C  C     . TYR A 1 94  ? -57.737 51.905  -6.179  1.00 36.96  ? 94  TYR A C     1 
ATOM   777  O  O     . TYR A 1 94  ? -58.465 51.936  -7.160  1.00 41.54  ? 94  TYR A O     1 
ATOM   778  C  CB    . TYR A 1 94  ? -58.326 53.315  -4.244  1.00 29.22  ? 94  TYR A CB    1 
ATOM   779  C  CG    . TYR A 1 94  ? -59.761 53.581  -4.585  1.00 31.17  ? 94  TYR A CG    1 
ATOM   780  C  CD1   . TYR A 1 94  ? -60.668 52.535  -4.692  1.00 33.41  ? 94  TYR A CD1   1 
ATOM   781  C  CD2   . TYR A 1 94  ? -60.220 54.884  -4.785  1.00 31.08  ? 94  TYR A CD2   1 
ATOM   782  C  CE1   . TYR A 1 94  ? -61.997 52.774  -5.004  1.00 36.61  ? 94  TYR A CE1   1 
ATOM   783  C  CE2   . TYR A 1 94  ? -61.537 55.137  -5.088  1.00 33.58  ? 94  TYR A CE2   1 
ATOM   784  C  CZ    . TYR A 1 94  ? -62.428 54.080  -5.198  1.00 36.07  ? 94  TYR A CZ    1 
ATOM   785  O  OH    . TYR A 1 94  ? -63.750 54.317  -5.499  1.00 38.16  ? 94  TYR A OH    1 
ATOM   786  N  N     . ALA A 1 95  ? -57.197 50.792  -5.704  1.00 35.67  ? 95  ALA A N     1 
ATOM   787  C  CA    . ALA A 1 95  ? -57.335 49.543  -6.413  1.00 39.20  ? 95  ALA A CA    1 
ATOM   788  C  C     . ALA A 1 95  ? -58.641 48.869  -6.024  1.00 39.15  ? 95  ALA A C     1 
ATOM   789  O  O     . ALA A 1 95  ? -59.286 48.259  -6.864  1.00 44.07  ? 95  ALA A O     1 
ATOM   790  C  CB    . ALA A 1 95  ? -56.174 48.660  -6.117  1.00 39.27  ? 95  ALA A CB    1 
ATOM   791  N  N     . GLU A 1 96  ? -59.044 48.987  -4.762  1.00 34.09  ? 96  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 96  ? -60.265 48.331  -4.311  1.00 34.13  ? 96  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 96  ? -60.944 49.114  -3.191  1.00 30.00  ? 96  GLU A C     1 
ATOM   794  O  O     . GLU A 1 96  ? -62.103 49.480  -3.292  1.00 30.74  ? 96  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 96  ? -59.973 46.870  -3.922  1.00 35.24  ? 96  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 96  ? -61.171 46.050  -3.454  1.00 35.12  ? 96  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 96  ? -61.432 46.181  -1.956  1.00 29.15  ? 96  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 96  ? -60.501 46.013  -1.148  1.00 24.25  ? 96  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 96  ? -62.582 46.454  -1.576  1.00 29.78  ? 96  GLU A OE2   1 
ATOM   800  N  N     . HIS A 1 97  ? -60.223 49.382  -2.125  1.00 26.42  ? 97  HIS A N     1 
ATOM   801  C  CA    . HIS A 1 97  ? -60.815 50.126  -1.041  1.00 24.25  ? 97  HIS A CA    1 
ATOM   802  C  C     . HIS A 1 97  ? -60.751 51.670  -1.199  1.00 23.08  ? 97  HIS A C     1 
ATOM   803  O  O     . HIS A 1 97  ? -59.670 52.255  -1.181  1.00 21.60  ? 97  HIS A O     1 
ATOM   804  C  CB    . HIS A 1 97  ? -60.235 49.690  0.301   1.00 21.40  ? 97  HIS A CB    1 
ATOM   805  C  CG    . HIS A 1 97  ? -60.992 50.243  1.462   1.00 20.05  ? 97  HIS A CG    1 
ATOM   806  N  ND1   . HIS A 1 97  ? -60.697 51.465  2.021   1.00 17.75  ? 97  HIS A ND1   1 
ATOM   807  C  CD2   . HIS A 1 97  ? -62.077 49.775  2.120   1.00 21.64  ? 97  HIS A CD2   1 
ATOM   808  C  CE1   . HIS A 1 97  ? -61.550 51.712  2.998   1.00 18.41  ? 97  HIS A CE1   1 
ATOM   809  N  NE2   . HIS A 1 97  ? -62.400 50.704  3.077   1.00 19.88  ? 97  HIS A NE2   1 
ATOM   810  N  N     . PRO A 1 98  ? -61.922 52.335  -1.281  1.00 24.29  ? 98  PRO A N     1 
ATOM   811  C  CA    . PRO A 1 98  ? -61.996 53.770  -1.577  1.00 24.37  ? 98  PRO A CA    1 
ATOM   812  C  C     . PRO A 1 98  ? -61.465 54.660  -0.458  1.00 20.80  ? 98  PRO A C     1 
ATOM   813  O  O     . PRO A 1 98  ? -61.681 54.380  0.734   1.00 18.41  ? 98  PRO A O     1 
ATOM   814  C  CB    . PRO A 1 98  ? -63.494 54.008  -1.756  1.00 26.42  ? 98  PRO A CB    1 
ATOM   815  C  CG    . PRO A 1 98  ? -64.115 52.981  -0.872  1.00 25.67  ? 98  PRO A CG    1 
ATOM   816  C  CD    . PRO A 1 98  ? -63.265 51.772  -1.044  1.00 26.01  ? 98  PRO A CD    1 
ATOM   817  N  N     . TYR A 1 99  ? -60.761 55.710  -0.874  1.00 20.91  ? 99  TYR A N     1 
ATOM   818  C  CA    . TYR A 1 99  ? -60.230 56.740  0.017   1.00 18.76  ? 99  TYR A CA    1 
ATOM   819  C  C     . TYR A 1 99  ? -59.867 57.954  -0.824  1.00 20.89  ? 99  TYR A C     1 
ATOM   820  O  O     . TYR A 1 99  ? -59.903 57.893  -2.049  1.00 24.34  ? 99  TYR A O     1 
ATOM   821  C  CB    . TYR A 1 99  ? -59.015 56.230  0.821   1.00 16.19  ? 99  TYR A CB    1 
ATOM   822  C  CG    . TYR A 1 99  ? -57.786 55.908  0.011   1.00 16.95  ? 99  TYR A CG    1 
ATOM   823  C  CD1   . TYR A 1 99  ? -56.680 56.754  0.029   1.00 16.63  ? 99  TYR A CD1   1 
ATOM   824  C  CD2   . TYR A 1 99  ? -57.721 54.748  -0.767  1.00 18.90  ? 99  TYR A CD2   1 
ATOM   825  C  CE1   . TYR A 1 99  ? -55.528 56.457  -0.721  1.00 19.17  ? 99  TYR A CE1   1 
ATOM   826  C  CE2   . TYR A 1 99  ? -56.579 54.434  -1.515  1.00 20.51  ? 99  TYR A CE2   1 
ATOM   827  C  CZ    . TYR A 1 99  ? -55.487 55.290  -1.492  1.00 21.06  ? 99  TYR A CZ    1 
ATOM   828  O  OH    . TYR A 1 99  ? -54.363 54.979  -2.229  1.00 22.59  ? 99  TYR A OH    1 
ATOM   829  N  N     . VAL A 1 100 ? -59.529 59.056  -0.174  1.00 19.81  ? 100 VAL A N     1 
ATOM   830  C  CA    . VAL A 1 100 ? -59.098 60.247  -0.894  1.00 22.30  ? 100 VAL A CA    1 
ATOM   831  C  C     . VAL A 1 100 ? -57.741 60.656  -0.347  1.00 21.41  ? 100 VAL A C     1 
ATOM   832  O  O     . VAL A 1 100 ? -57.552 60.711  0.862   1.00 18.88  ? 100 VAL A O     1 
ATOM   833  C  CB    . VAL A 1 100 ? -60.148 61.390  -0.815  1.00 23.50  ? 100 VAL A CB    1 
ATOM   834  C  CG1   . VAL A 1 100 ? -60.690 61.489  0.570   1.00 21.65  ? 100 VAL A CG1   1 
ATOM   835  C  CG2   . VAL A 1 100 ? -59.558 62.730  -1.238  1.00 25.64  ? 100 VAL A CG2   1 
ATOM   836  N  N     . HIS A 1 101 ? -56.793 60.883  -1.257  1.00 24.28  ? 101 HIS A N     1 
ATOM   837  C  CA    . HIS A 1 101 ? -55.454 61.368  -0.926  1.00 24.55  ? 101 HIS A CA    1 
ATOM   838  C  C     . HIS A 1 101 ? -55.410 62.872  -1.202  1.00 27.15  ? 101 HIS A C     1 
ATOM   839  O  O     . HIS A 1 101 ? -56.008 63.357  -2.161  1.00 30.35  ? 101 HIS A O     1 
ATOM   840  C  CB    . HIS A 1 101 ? -54.416 60.622  -1.760  1.00 26.45  ? 101 HIS A CB    1 
ATOM   841  C  CG    . HIS A 1 101 ? -53.022 61.146  -1.613  1.00 29.70  ? 101 HIS A CG    1 
ATOM   842  N  ND1   . HIS A 1 101 ? -52.369 61.200  -0.400  1.00 29.03  ? 101 HIS A ND1   1 
ATOM   843  C  CD2   . HIS A 1 101 ? -52.145 61.619  -2.534  1.00 34.87  ? 101 HIS A CD2   1 
ATOM   844  C  CE1   . HIS A 1 101 ? -51.158 61.702  -0.577  1.00 31.94  ? 101 HIS A CE1   1 
ATOM   845  N  NE2   . HIS A 1 101 ? -50.995 61.959  -1.863  1.00 35.33  ? 101 HIS A NE2   1 
ATOM   846  N  N     . GLY A 1 102 ? -54.729 63.622  -0.359  1.00 26.00  ? 102 GLY A N     1 
ATOM   847  C  CA    . GLY A 1 102 ? -54.774 65.040  -0.532  1.00 28.93  ? 102 GLY A CA    1 
ATOM   848  C  C     . GLY A 1 102 ? -53.792 65.780  0.325   1.00 29.58  ? 102 GLY A C     1 
ATOM   849  O  O     . GLY A 1 102 ? -52.886 65.179  0.911   1.00 27.82  ? 102 GLY A O     1 
ATOM   850  N  N     . VAL A 1 103 ? -53.986 67.093  0.392   1.00 32.46  ? 103 VAL A N     1 
ATOM   851  C  CA    . VAL A 1 103 ? -53.077 67.965  1.093   1.00 34.48  ? 103 VAL A CA    1 
ATOM   852  C  C     . VAL A 1 103 ? -53.821 69.024  1.920   1.00 35.89  ? 103 VAL A C     1 
ATOM   853  O  O     . VAL A 1 103 ? -54.750 69.665  1.438   1.00 38.28  ? 103 VAL A O     1 
ATOM   854  C  CB    . VAL A 1 103 ? -52.075 68.567  0.100   1.00 39.02  ? 103 VAL A CB    1 
ATOM   855  C  CG1   . VAL A 1 103 ? -51.585 69.932  0.551   1.00 44.45  ? 103 VAL A CG1   1 
ATOM   856  C  CG2   . VAL A 1 103 ? -50.917 67.622  -0.082  1.00 37.64  ? 103 VAL A CG2   1 
ATOM   857  N  N     . VAL A 1 104 ? -53.434 69.161  3.183   1.00 35.15  ? 104 VAL A N     1 
ATOM   858  C  CA    . VAL A 1 104 ? -53.843 70.292  4.014   1.00 38.01  ? 104 VAL A CA    1 
ATOM   859  C  C     . VAL A 1 104 ? -52.586 71.013  4.446   1.00 42.12  ? 104 VAL A C     1 
ATOM   860  O  O     . VAL A 1 104 ? -51.610 70.372  4.860   1.00 40.95  ? 104 VAL A O     1 
ATOM   861  C  CB    . VAL A 1 104 ? -54.601 69.858  5.269   1.00 34.46  ? 104 VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 104 ? -54.778 71.018  6.219   1.00 37.31  ? 104 VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 104 ? -55.931 69.332  4.888   1.00 33.08  ? 104 VAL A CG2   1 
ATOM   864  N  N     . LYS A 1 105 ? -52.614 72.341  4.346   1.00 47.61  ? 105 LYS A N     1 
ATOM   865  C  CA    . LYS A 1 105 ? -51.474 73.188  4.688   1.00 52.82  ? 105 LYS A CA    1 
ATOM   866  C  C     . LYS A 1 105 ? -50.142 72.511  4.319   1.00 52.62  ? 105 LYS A C     1 
ATOM   867  O  O     . LYS A 1 105 ? -49.270 72.299  5.167   1.00 52.57  ? 105 LYS A O     1 
ATOM   868  C  CB    . LYS A 1 105 ? -51.524 73.608  6.170   1.00 53.75  ? 105 LYS A CB    1 
ATOM   869  C  CG    . LYS A 1 105 ? -52.834 74.255  6.605   1.00 54.90  ? 105 LYS A CG    1 
ATOM   870  C  CD    . LYS A 1 105 ? -52.635 75.428  7.551   1.00 61.22  ? 105 LYS A CD    1 
ATOM   871  C  CE    . LYS A 1 105 ? -53.930 76.232  7.661   1.00 64.91  ? 105 LYS A CE    1 
ATOM   872  N  NZ    . LYS A 1 105 ? -53.748 77.622  8.221   1.00 74.05  ? 105 LYS A NZ    1 
ATOM   873  N  N     . GLY A 1 106 ? -50.023 72.143  3.047   1.00 52.98  ? 106 GLY A N     1 
ATOM   874  C  CA    . GLY A 1 106 ? -48.789 71.603  2.499   1.00 54.60  ? 106 GLY A CA    1 
ATOM   875  C  C     . GLY A 1 106 ? -48.353 70.232  2.990   1.00 50.06  ? 106 GLY A C     1 
ATOM   876  O  O     . GLY A 1 106 ? -47.250 69.784  2.661   1.00 51.31  ? 106 GLY A O     1 
ATOM   877  N  N     . VAL A 1 107 ? -49.194 69.559  3.773   1.00 45.46  ? 107 VAL A N     1 
ATOM   878  C  CA    . VAL A 1 107 ? -48.860 68.214  4.248   1.00 41.59  ? 107 VAL A CA    1 
ATOM   879  C  C     . VAL A 1 107 ? -49.854 67.166  3.776   1.00 37.71  ? 107 VAL A C     1 
ATOM   880  O  O     . VAL A 1 107 ? -51.057 67.404  3.737   1.00 36.66  ? 107 VAL A O     1 
ATOM   881  C  CB    . VAL A 1 107 ? -48.545 68.142  5.799   1.00 40.74  ? 107 VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 107 ? -48.684 69.496  6.463   1.00 44.79  ? 107 VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 107 ? -49.362 67.066  6.533   1.00 35.01  ? 107 VAL A CG2   1 
ATOM   884  N  N     . GLU A 1 108 ? -49.312 66.007  3.408   1.00 36.78  ? 108 GLU A N     1 
ATOM   885  C  CA    . GLU A 1 108 ? -50.078 64.919  2.802   1.00 34.23  ? 108 GLU A CA    1 
ATOM   886  C  C     . GLU A 1 108 ? -50.968 64.186  3.778   1.00 29.76  ? 108 GLU A C     1 
ATOM   887  O  O     . GLU A 1 108 ? -50.566 63.877  4.901   1.00 28.44  ? 108 GLU A O     1 
ATOM   888  C  CB    . GLU A 1 108 ? -49.155 63.934  2.090   1.00 34.74  ? 108 GLU A CB    1 
ATOM   889  C  CG    . GLU A 1 108 ? -48.940 64.284  0.627   1.00 40.76  ? 108 GLU A CG    1 
ATOM   890  C  CD    . GLU A 1 108 ? -47.739 63.571  0.034   1.00 46.00  ? 108 GLU A CD    1 
ATOM   891  O  OE1   . GLU A 1 108 ? -47.827 63.111  -1.128  1.00 49.72  ? 108 GLU A OE1   1 
ATOM   892  O  OE2   . GLU A 1 108 ? -46.704 63.460  0.732   1.00 47.26  ? 108 GLU A OE2   1 
ATOM   893  N  N     . VAL A 1 109 ? -52.182 63.909  3.314   1.00 28.13  ? 109 VAL A N     1 
ATOM   894  C  CA    . VAL A 1 109 ? -53.209 63.255  4.112   1.00 24.56  ? 109 VAL A CA    1 
ATOM   895  C  C     . VAL A 1 109 ? -53.871 62.097  3.351   1.00 22.78  ? 109 VAL A C     1 
ATOM   896  O  O     . VAL A 1 109 ? -54.045 62.152  2.126   1.00 24.74  ? 109 VAL A O     1 
ATOM   897  C  CB    . VAL A 1 109 ? -54.301 64.261  4.529   1.00 25.22  ? 109 VAL A CB    1 
ATOM   898  C  CG1   . VAL A 1 109 ? -55.171 63.688  5.642   1.00 22.03  ? 109 VAL A CG1   1 
ATOM   899  C  CG2   . VAL A 1 109 ? -53.680 65.602  4.933   1.00 27.84  ? 109 VAL A CG2   1 
ATOM   900  N  N     . ASP A 1 110 ? -54.218 61.046  4.084   1.00 19.67  ? 110 ASP A N     1 
ATOM   901  C  CA    . ASP A 1 110 ? -55.128 60.039  3.583   1.00 18.26  ? 110 ASP A CA    1 
ATOM   902  C  C     . ASP A 1 110 ? -56.361 60.070  4.446   1.00 16.64  ? 110 ASP A C     1 
ATOM   903  O  O     . ASP A 1 110 ? -56.296 59.844  5.653   1.00 15.89  ? 110 ASP A O     1 
ATOM   904  C  CB    . ASP A 1 110 ? -54.496 58.656  3.603   1.00 17.30  ? 110 ASP A CB    1 
ATOM   905  C  CG    . ASP A 1 110 ? -53.824 58.315  2.300   1.00 21.69  ? 110 ASP A CG    1 
ATOM   906  O  OD1   . ASP A 1 110 ? -53.116 57.291  2.262   1.00 24.35  ? 110 ASP A OD1   1 
ATOM   907  O  OD2   . ASP A 1 110 ? -53.995 59.064  1.300   1.00 26.98  ? 110 ASP A OD2   1 
ATOM   908  N  N     . VAL A 1 111 ? -57.490 60.404  3.845   1.00 17.13  ? 111 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 111 ? -58.741 60.261  4.556   1.00 15.89  ? 111 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 111 ? -59.457 59.028  4.040   1.00 15.60  ? 111 VAL A C     1 
ATOM   911  O  O     . VAL A 1 111 ? -59.695 58.847  2.840   1.00 16.94  ? 111 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 111 ? -59.579 61.590  4.681   1.00 17.15  ? 111 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 111 ? -59.015 62.649  3.817   1.00 19.14  ? 111 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 111 ? -61.047 61.363  4.392   1.00 17.11  ? 111 VAL A CG2   1 
ATOM   915  N  N     . VAL A 1 112 ? -59.739 58.151  4.983   1.00 14.19  ? 112 VAL A N     1 
ATOM   916  C  CA    . VAL A 1 112 ? -60.146 56.826  4.658   1.00 14.84  ? 112 VAL A CA    1 
ATOM   917  C  C     . VAL A 1 112 ? -61.468 56.524  5.331   1.00 15.67  ? 112 VAL A C     1 
ATOM   918  O  O     . VAL A 1 112 ? -61.620 56.752  6.516   1.00 15.90  ? 112 VAL A O     1 
ATOM   919  C  CB    . VAL A 1 112 ? -59.092 55.818  5.138   1.00 13.70  ? 112 VAL A CB    1 
ATOM   920  C  CG1   . VAL A 1 112 ? -59.511 54.414  4.761   1.00 15.23  ? 112 VAL A CG1   1 
ATOM   921  C  CG2   . VAL A 1 112 ? -57.710 56.146  4.558   1.00 13.05  ? 112 VAL A CG2   1 
ATOM   922  N  N     . PRO A 1 113 ? -62.435 55.995  4.581   1.00 17.50  ? 113 PRO A N     1 
ATOM   923  C  CA    . PRO A 1 113 ? -63.648 55.601  5.258   1.00 18.43  ? 113 PRO A CA    1 
ATOM   924  C  C     . PRO A 1 113 ? -63.525 54.150  5.716   1.00 18.36  ? 113 PRO A C     1 
ATOM   925  O  O     . PRO A 1 113 ? -62.842 53.360  5.062   1.00 18.29  ? 113 PRO A O     1 
ATOM   926  C  CB    . PRO A 1 113 ? -64.703 55.729  4.157   1.00 21.08  ? 113 PRO A CB    1 
ATOM   927  C  CG    . PRO A 1 113 ? -63.952 55.566  2.854   1.00 21.52  ? 113 PRO A CG    1 
ATOM   928  C  CD    . PRO A 1 113 ? -62.485 55.709  3.136   1.00 19.43  ? 113 PRO A CD    1 
ATOM   929  N  N     . CYS A 1 114 ? -64.166 53.811  6.832   1.00 18.66  ? 114 CYS A N     1 
ATOM   930  C  CA    . CYS A 1 114 ? -64.222 52.424  7.297   1.00 19.85  ? 114 CYS A CA    1 
ATOM   931  C  C     . CYS A 1 114 ? -65.447 52.237  8.163   1.00 21.91  ? 114 CYS A C     1 
ATOM   932  O  O     . CYS A 1 114 ? -66.146 53.203  8.457   1.00 22.44  ? 114 CYS A O     1 
ATOM   933  C  CB    . CYS A 1 114 ? -62.982 52.065  8.117   1.00 18.24  ? 114 CYS A CB    1 
ATOM   934  S  SG    . CYS A 1 114 ? -63.144 52.519  9.852   1.00 18.69  ? 114 CYS A SG    1 
ATOM   935  N  N     . TYR A 1 115 ? -65.671 51.001  8.605   1.00 23.68  ? 115 TYR A N     1 
ATOM   936  C  CA    . TYR A 1 115 ? -66.758 50.677  9.534   1.00 26.38  ? 115 TYR A CA    1 
ATOM   937  C  C     . TYR A 1 115 ? -66.370 50.707  11.034  1.00 26.51  ? 115 TYR A C     1 
ATOM   938  O  O     . TYR A 1 115 ? -65.335 50.172  11.436  1.00 25.71  ? 115 TYR A O     1 
ATOM   939  C  CB    . TYR A 1 115 ? -67.318 49.297  9.201   1.00 29.47  ? 115 TYR A CB    1 
ATOM   940  C  CG    . TYR A 1 115 ? -67.876 49.155  7.816   1.00 30.70  ? 115 TYR A CG    1 
ATOM   941  C  CD1   . TYR A 1 115 ? -67.086 48.713  6.769   1.00 30.69  ? 115 TYR A CD1   1 
ATOM   942  C  CD2   . TYR A 1 115 ? -69.206 49.440  7.553   1.00 33.69  ? 115 TYR A CD2   1 
ATOM   943  C  CE1   . TYR A 1 115 ? -67.609 48.570  5.483   1.00 31.59  ? 115 TYR A CE1   1 
ATOM   944  C  CE2   . TYR A 1 115 ? -69.733 49.296  6.280   1.00 35.08  ? 115 TYR A CE2   1 
ATOM   945  C  CZ    . TYR A 1 115 ? -68.928 48.861  5.254   1.00 33.97  ? 115 TYR A CZ    1 
ATOM   946  O  OH    . TYR A 1 115 ? -69.451 48.719  3.994   1.00 37.53  ? 115 TYR A OH    1 
ATOM   947  N  N     . LYS A 1 116 ? -67.224 51.306  11.855  1.00 28.38  ? 116 LYS A N     1 
ATOM   948  C  CA    . LYS A 1 116 ? -67.072 51.275  13.309  1.00 30.48  ? 116 LYS A CA    1 
ATOM   949  C  C     . LYS A 1 116 ? -67.533 49.923  13.872  1.00 34.92  ? 116 LYS A C     1 
ATOM   950  O  O     . LYS A 1 116 ? -68.732 49.606  13.841  1.00 38.21  ? 116 LYS A O     1 
ATOM   951  C  CB    . LYS A 1 116 ? -67.859 52.440  13.928  1.00 31.83  ? 116 LYS A CB    1 
ATOM   952  C  CG    . LYS A 1 116 ? -67.886 52.518  15.451  1.00 34.32  ? 116 LYS A CG    1 
ATOM   953  C  CD    . LYS A 1 116 ? -67.735 53.971  15.872  1.00 33.74  ? 116 LYS A CD    1 
ATOM   954  C  CE    . LYS A 1 116 ? -67.930 54.197  17.367  1.00 38.15  ? 116 LYS A CE    1 
ATOM   955  N  NZ    . LYS A 1 116 ? -69.216 54.907  17.661  1.00 40.79  ? 116 LYS A NZ    1 
ATOM   956  N  N     . LEU A 1 117 ? -66.586 49.133  14.384  1.00 35.75  ? 117 LEU A N     1 
ATOM   957  C  CA    . LEU A 1 117 ? -66.878 47.762  14.868  1.00 40.58  ? 117 LEU A CA    1 
ATOM   958  C  C     . LEU A 1 117 ? -66.631 47.598  16.369  1.00 44.36  ? 117 LEU A C     1 
ATOM   959  O  O     . LEU A 1 117 ? -65.882 48.370  16.976  1.00 42.82  ? 117 LEU A O     1 
ATOM   960  C  CB    . LEU A 1 117 ? -66.091 46.709  14.074  1.00 39.29  ? 117 LEU A CB    1 
ATOM   961  C  CG    . LEU A 1 117 ? -66.132 46.793  12.539  1.00 36.41  ? 117 LEU A CG    1 
ATOM   962  C  CD1   . LEU A 1 117 ? -65.289 45.717  11.891  1.00 36.43  ? 117 LEU A CD1   1 
ATOM   963  C  CD2   . LEU A 1 117 ? -67.559 46.742  12.005  1.00 38.40  ? 117 LEU A CD2   1 
ATOM   964  N  N     . LYS A 1 118 ? -67.295 46.620  16.978  1.00 50.46  ? 118 LYS A N     1 
ATOM   965  C  CA    . LYS A 1 118 ? -66.999 46.292  18.365  1.00 55.14  ? 118 LYS A CA    1 
ATOM   966  C  C     . LYS A 1 118 ? -65.882 45.253  18.420  1.00 56.00  ? 118 LYS A C     1 
ATOM   967  O  O     . LYS A 1 118 ? -65.020 45.286  19.300  1.00 56.63  ? 118 LYS A O     1 
ATOM   968  C  CB    . LYS A 1 118 ? -68.257 45.870  19.144  1.00 61.77  ? 118 LYS A CB    1 
ATOM   969  C  CG    . LYS A 1 118 ? -69.163 44.792  18.526  1.00 66.74  ? 118 LYS A CG    1 
ATOM   970  C  CD    . LYS A 1 118 ? -68.895 43.352  19.047  1.00 74.70  ? 118 LYS A CD    1 
ATOM   971  C  CE    . LYS A 1 118 ? -68.834 43.207  20.599  1.00 80.63  ? 118 LYS A CE    1 
ATOM   972  N  NZ    . LYS A 1 118 ? -70.079 43.555  21.353  1.00 85.37  ? 118 LYS A NZ    1 
ATOM   973  N  N     . GLU A 1 119 ? -65.894 44.349  17.448  1.00 56.84  ? 119 GLU A N     1 
ATOM   974  C  CA    . GLU A 1 119 ? -64.836 43.366  17.285  1.00 58.04  ? 119 GLU A CA    1 
ATOM   975  C  C     . GLU A 1 119 ? -64.273 43.404  15.864  1.00 53.75  ? 119 GLU A C     1 
ATOM   976  O  O     . GLU A 1 119 ? -65.035 43.431  14.895  1.00 53.52  ? 119 GLU A O     1 
ATOM   977  C  CB    . GLU A 1 119 ? -65.361 41.952  17.590  1.00 64.98  ? 119 GLU A CB    1 
ATOM   978  C  CG    . GLU A 1 119 ? -65.782 41.698  19.045  1.00 72.02  ? 119 GLU A CG    1 
ATOM   979  C  CD    . GLU A 1 119 ? -64.606 41.637  20.027  1.00 74.72  ? 119 GLU A CD    1 
ATOM   980  O  OE1   . GLU A 1 119 ? -63.557 42.285  19.784  1.00 70.06  ? 119 GLU A OE1   1 
ATOM   981  O  OE2   . GLU A 1 119 ? -64.740 40.942  21.060  1.00 81.96  ? 119 GLU A OE2   1 
ATOM   982  N  N     . PRO A 1 120 ? -62.936 43.407  15.730  1.00 51.25  ? 120 PRO A N     1 
ATOM   983  C  CA    . PRO A 1 120 ? -62.302 43.210  14.417  1.00 48.40  ? 120 PRO A CA    1 
ATOM   984  C  C     . PRO A 1 120 ? -62.295 41.751  13.914  1.00 52.56  ? 120 PRO A C     1 
ATOM   985  O  O     . PRO A 1 120 ? -61.737 41.487  12.849  1.00 51.10  ? 120 PRO A O     1 
ATOM   986  C  CB    . PRO A 1 120 ? -60.874 43.713  14.631  1.00 45.08  ? 120 PRO A CB    1 
ATOM   987  C  CG    . PRO A 1 120 ? -60.634 43.605  16.085  1.00 48.11  ? 120 PRO A CG    1 
ATOM   988  C  CD    . PRO A 1 120 ? -61.951 43.624  16.805  1.00 51.42  ? 120 PRO A CD    1 
ATOM   989  N  N     . LYS A 1 121 ? -62.890 40.822  14.671  1.00 58.40  ? 121 LYS A N     1 
ATOM   990  C  CA    . LYS A 1 121 ? -63.202 39.471  14.171  1.00 63.35  ? 121 LYS A CA    1 
ATOM   991  C  C     . LYS A 1 121 ? -64.346 39.614  13.168  1.00 63.16  ? 121 LYS A C     1 
ATOM   992  O  O     . LYS A 1 121 ? -65.402 40.168  13.514  1.00 63.47  ? 121 LYS A O     1 
ATOM   993  C  CB    . LYS A 1 121 ? -63.645 38.548  15.310  1.00 70.31  ? 121 LYS A CB    1 
ATOM   994  C  CG    . LYS A 1 121 ? -62.689 38.461  16.497  1.00 72.68  ? 121 LYS A CG    1 
ATOM   995  C  CD    . LYS A 1 121 ? -61.641 37.339  16.301  1.00 76.86  ? 121 LYS A CD    1 
ATOM   996  C  CE    . LYS A 1 121 ? -61.194 36.829  17.788  1.00 82.28  ? 121 LYS A CE    1 
ATOM   997  N  NZ    . LYS A 1 121 ? -59.877 35.943  17.485  1.00 83.39  ? 121 LYS A NZ    1 
ATOM   998  N  N     . ASN A 1 122 ? -64.136 39.117  11.941  1.00 62.87  ? 122 ASN A N     1 
ATOM   999  C  CA    . ASN A 1 122 ? -64.994 39.428  10.772  1.00 61.87  ? 122 ASN A CA    1 
ATOM   1000 C  C     . ASN A 1 122 ? -65.075 40.929  10.483  1.00 55.60  ? 122 ASN A C     1 
ATOM   1001 O  O     . ASN A 1 122 ? -65.240 41.750  11.392  1.00 54.22  ? 122 ASN A O     1 
ATOM   1002 C  CB    . ASN A 1 122 ? -66.388 38.834  10.914  1.00 67.72  ? 122 ASN A CB    1 
ATOM   1003 C  CG    . ASN A 1 122 ? -66.361 37.330  11.049  1.00 74.83  ? 122 ASN A CG    1 
ATOM   1004 O  OD1   . ASN A 1 122 ? -65.695 36.645  10.273  1.00 76.77  ? 122 ASN A OD1   1 
ATOM   1005 N  ND2   . ASN A 1 122 ? -67.090 36.804  12.034  1.00 79.74  ? 122 ASN A ND2   1 
ATOM   1006 N  N     . ILE A 1 123 ? -64.978 41.281  9.207   1.00 52.40  ? 123 ILE A N     1 
ATOM   1007 C  CA    . ILE A 1 123 ? -64.597 42.629  8.813   1.00 45.41  ? 123 ILE A CA    1 
ATOM   1008 C  C     . ILE A 1 123 ? -65.304 42.998  7.516   1.00 44.48  ? 123 ILE A C     1 
ATOM   1009 O  O     . ILE A 1 123 ? -65.209 42.277  6.543   1.00 46.94  ? 123 ILE A O     1 
ATOM   1010 C  CB    . ILE A 1 123 ? -63.042 42.668  8.695   1.00 42.67  ? 123 ILE A CB    1 
ATOM   1011 C  CG1   . ILE A 1 123 ? -62.438 43.235  9.970   1.00 40.53  ? 123 ILE A CG1   1 
ATOM   1012 C  CG2   . ILE A 1 123 ? -62.540 43.454  7.495   1.00 39.44  ? 123 ILE A CG2   1 
ATOM   1013 C  CD1   . ILE A 1 123 ? -60.998 43.633  9.799   1.00 37.69  ? 123 ILE A CD1   1 
ATOM   1014 N  N     . LYS A 1 124 ? -66.041 44.097  7.499   1.00 41.62  ? 124 LYS A N     1 
ATOM   1015 C  CA    . LYS A 1 124 ? -66.735 44.474  6.270   1.00 41.61  ? 124 LYS A CA    1 
ATOM   1016 C  C     . LYS A 1 124 ? -65.758 44.992  5.233   1.00 38.31  ? 124 LYS A C     1 
ATOM   1017 O  O     . LYS A 1 124 ? -65.574 44.366  4.199   1.00 40.89  ? 124 LYS A O     1 
ATOM   1018 C  CB    . LYS A 1 124 ? -67.874 45.464  6.506   1.00 41.20  ? 124 LYS A CB    1 
ATOM   1019 C  CG    . LYS A 1 124 ? -69.254 44.851  6.373   1.00 46.60  ? 124 LYS A CG    1 
ATOM   1020 C  CD    . LYS A 1 124 ? -70.293 45.830  5.825   1.00 46.19  ? 124 LYS A CD    1 
ATOM   1021 C  CE    . LYS A 1 124 ? -71.671 45.186  5.755   1.00 52.29  ? 124 LYS A CE    1 
ATOM   1022 N  NZ    . LYS A 1 124 ? -72.717 46.138  5.305   1.00 53.42  ? 124 LYS A NZ    1 
ATOM   1023 N  N     . SER A 1 125 ? -65.115 46.122  5.505   1.00 33.29  ? 125 SER A N     1 
ATOM   1024 C  CA    . SER A 1 125 ? -64.156 46.678  4.550   1.00 30.50  ? 125 SER A CA    1 
ATOM   1025 C  C     . SER A 1 125 ? -62.812 45.965  4.699   1.00 29.63  ? 125 SER A C     1 
ATOM   1026 O  O     . SER A 1 125 ? -62.691 45.034  5.488   1.00 30.93  ? 125 SER A O     1 
ATOM   1027 C  CB    . SER A 1 125 ? -64.006 48.185  4.737   1.00 26.64  ? 125 SER A CB    1 
ATOM   1028 O  OG    . SER A 1 125 ? -63.116 48.462  5.794   1.00 23.92  ? 125 SER A OG    1 
ATOM   1029 N  N     . ALA A 1 126 ? -61.809 46.381  3.932   1.00 27.57  ? 126 ALA A N     1 
ATOM   1030 C  CA    . ALA A 1 126 ? -60.493 45.775  4.062   1.00 26.65  ? 126 ALA A CA    1 
ATOM   1031 C  C     . ALA A 1 126 ? -59.606 46.529  5.043   1.00 22.95  ? 126 ALA A C     1 
ATOM   1032 O  O     . ALA A 1 126 ? -58.535 46.045  5.388   1.00 23.11  ? 126 ALA A O     1 
ATOM   1033 C  CB    . ALA A 1 126 ? -59.822 45.659  2.721   1.00 27.91  ? 126 ALA A CB    1 
ATOM   1034 N  N     . VAL A 1 127 ? -60.045 47.696  5.509   1.00 20.23  ? 127 VAL A N     1 
ATOM   1035 C  CA    . VAL A 1 127 ? -59.201 48.520  6.388   1.00 17.29  ? 127 VAL A CA    1 
ATOM   1036 C  C     . VAL A 1 127 ? -59.702 48.593  7.840   1.00 17.22  ? 127 VAL A C     1 
ATOM   1037 O  O     . VAL A 1 127 ? -59.177 49.360  8.661   1.00 15.71  ? 127 VAL A O     1 
ATOM   1038 C  CB    . VAL A 1 127 ? -58.986 49.933  5.800   1.00 15.02  ? 127 VAL A CB    1 
ATOM   1039 C  CG1   . VAL A 1 127 ? -58.716 49.828  4.316   1.00 16.34  ? 127 VAL A CG1   1 
ATOM   1040 C  CG2   . VAL A 1 127 ? -60.191 50.811  6.018   1.00 14.24  ? 127 VAL A CG2   1 
ATOM   1041 N  N     . ASP A 1 128 ? -60.701 47.770  8.150   1.00 19.28  ? 128 ASP A N     1 
ATOM   1042 C  CA    . ASP A 1 128 ? -61.383 47.817  9.438   1.00 20.19  ? 128 ASP A CA    1 
ATOM   1043 C  C     . ASP A 1 128 ? -60.515 47.523  10.684  1.00 20.18  ? 128 ASP A C     1 
ATOM   1044 O  O     . ASP A 1 128 ? -60.985 47.680  11.810  1.00 21.90  ? 128 ASP A O     1 
ATOM   1045 C  CB    . ASP A 1 128 ? -62.591 46.873  9.420   1.00 24.00  ? 128 ASP A CB    1 
ATOM   1046 C  CG    . ASP A 1 128 ? -63.769 47.423  8.620   1.00 26.09  ? 128 ASP A CG    1 
ATOM   1047 O  OD1   . ASP A 1 128 ? -63.848 48.668  8.432   1.00 25.61  ? 128 ASP A OD1   1 
ATOM   1048 O  OD2   . ASP A 1 128 ? -64.629 46.605  8.193   1.00 29.35  ? 128 ASP A OD2   1 
ATOM   1049 N  N     . ARG A 1 129 ? -59.271 47.087  10.505  1.00 19.04  ? 129 ARG A N     1 
ATOM   1050 C  CA    . ARG A 1 129 ? -58.437 46.725  11.651  1.00 18.86  ? 129 ARG A CA    1 
ATOM   1051 C  C     . ARG A 1 129 ? -57.650 47.922  12.099  1.00 16.20  ? 129 ARG A C     1 
ATOM   1052 O  O     . ARG A 1 129 ? -57.171 47.978  13.220  1.00 17.08  ? 129 ARG A O     1 
ATOM   1053 C  CB    . ARG A 1 129 ? -57.435 45.635  11.282  1.00 20.36  ? 129 ARG A CB    1 
ATOM   1054 C  CG    . ARG A 1 129 ? -57.991 44.271  11.003  1.00 22.12  ? 129 ARG A CG    1 
ATOM   1055 C  CD    . ARG A 1 129 ? -56.839 43.335  10.775  1.00 22.12  ? 129 ARG A CD    1 
ATOM   1056 N  NE    . ARG A 1 129 ? -57.242 42.099  10.126  1.00 25.24  ? 129 ARG A NE    1 
ATOM   1057 C  CZ    . ARG A 1 129 ? -57.282 41.908  8.808   1.00 25.31  ? 129 ARG A CZ    1 
ATOM   1058 N  NH1   . ARG A 1 129 ? -56.946 42.869  7.957   1.00 21.52  ? 129 ARG A NH1   1 
ATOM   1059 N  NH2   . ARG A 1 129 ? -57.664 40.734  8.336   1.00 30.87  ? 129 ARG A NH2   1 
ATOM   1060 N  N     . THR A 1 130 ? -57.504 48.880  11.202  1.00 13.46  ? 130 THR A N     1 
ATOM   1061 C  CA    . THR A 1 130 ? -56.601 49.992  11.428  1.00 12.05  ? 130 THR A CA    1 
ATOM   1062 C  C     . THR A 1 130 ? -56.889 50.801  12.706  1.00 12.60  ? 130 THR A C     1 
ATOM   1063 O  O     . THR A 1 130 ? -55.961 51.099  13.463  1.00 13.27  ? 130 THR A O     1 
ATOM   1064 C  CB    . THR A 1 130 ? -56.529 50.878  10.195  1.00 9.99   ? 130 THR A CB    1 
ATOM   1065 O  OG1   . THR A 1 130 ? -56.059 50.085  9.094   1.00 11.90  ? 130 THR A OG1   1 
ATOM   1066 C  CG2   . THR A 1 130 ? -55.593 52.034  10.415  1.00 8.79   ? 130 THR A CG2   1 
ATOM   1067 N  N     . PRO A 1 131 ? -58.165 51.138  12.972  1.00 13.08  ? 131 PRO A N     1 
ATOM   1068 C  CA    . PRO A 1 131 ? -58.301 51.880  14.210  1.00 14.00  ? 131 PRO A CA    1 
ATOM   1069 C  C     . PRO A 1 131 ? -58.093 50.998  15.444  1.00 17.05  ? 131 PRO A C     1 
ATOM   1070 O  O     . PRO A 1 131 ? -57.700 51.522  16.505  1.00 18.79  ? 131 PRO A O     1 
ATOM   1071 C  CB    . PRO A 1 131 ? -59.707 52.482  14.119  1.00 14.21  ? 131 PRO A CB    1 
ATOM   1072 C  CG    . PRO A 1 131 ? -60.440 51.662  13.135  1.00 14.16  ? 131 PRO A CG    1 
ATOM   1073 C  CD    . PRO A 1 131 ? -59.457 50.932  12.284  1.00 13.41  ? 131 PRO A CD    1 
ATOM   1074 N  N     . PHE A 1 132 ? -58.305 49.681  15.299  1.00 18.06  ? 132 PHE A N     1 
ATOM   1075 C  CA    . PHE A 1 132 ? -57.953 48.710  16.360  1.00 21.34  ? 132 PHE A CA    1 
ATOM   1076 C  C     . PHE A 1 132 ? -56.454 48.541  16.554  1.00 21.62  ? 132 PHE A C     1 
ATOM   1077 O  O     . PHE A 1 132 ? -55.997 48.284  17.678  1.00 24.67  ? 132 PHE A O     1 
ATOM   1078 C  CB    . PHE A 1 132 ? -58.497 47.328  16.063  1.00 22.97  ? 132 PHE A CB    1 
ATOM   1079 C  CG    . PHE A 1 132 ? -59.960 47.233  16.124  1.00 24.09  ? 132 PHE A CG    1 
ATOM   1080 C  CD1   . PHE A 1 132 ? -60.701 47.147  14.958  1.00 22.86  ? 132 PHE A CD1   1 
ATOM   1081 C  CD2   . PHE A 1 132 ? -60.610 47.207  17.342  1.00 26.28  ? 132 PHE A CD2   1 
ATOM   1082 C  CE1   . PHE A 1 132 ? -62.076 47.049  15.006  1.00 24.77  ? 132 PHE A CE1   1 
ATOM   1083 C  CE2   . PHE A 1 132 ? -61.979 47.112  17.401  1.00 28.37  ? 132 PHE A CE2   1 
ATOM   1084 C  CZ    . PHE A 1 132 ? -62.718 47.032  16.235  1.00 27.91  ? 132 PHE A CZ    1 
ATOM   1085 N  N     . HIS A 1 133 ? -55.706 48.623  15.451  1.00 18.92  ? 133 HIS A N     1 
ATOM   1086 C  CA    . HIS A 1 133 ? -54.254 48.533  15.500  1.00 19.32  ? 133 HIS A CA    1 
ATOM   1087 C  C     . HIS A 1 133 ? -53.752 49.599  16.417  1.00 19.96  ? 133 HIS A C     1 
ATOM   1088 O  O     . HIS A 1 133 ? -53.002 49.334  17.354  1.00 22.87  ? 133 HIS A O     1 
ATOM   1089 C  CB    . HIS A 1 133 ? -53.639 48.785  14.129  1.00 16.59  ? 133 HIS A CB    1 
ATOM   1090 C  CG    . HIS A 1 133 ? -53.777 47.634  13.193  1.00 17.32  ? 133 HIS A CG    1 
ATOM   1091 N  ND1   . HIS A 1 133 ? -53.709 47.777  11.825  1.00 13.96  ? 133 HIS A ND1   1 
ATOM   1092 C  CD2   . HIS A 1 133 ? -53.997 46.319  13.430  1.00 19.69  ? 133 HIS A CD2   1 
ATOM   1093 C  CE1   . HIS A 1 133 ? -53.871 46.596  11.261  1.00 16.54  ? 133 HIS A CE1   1 
ATOM   1094 N  NE2   . HIS A 1 133 ? -54.056 45.696  12.211  1.00 18.98  ? 133 HIS A NE2   1 
ATOM   1095 N  N     . HIS A 1 134 ? -54.196 50.813  16.129  1.00 17.81  ? 134 HIS A N     1 
ATOM   1096 C  CA    . HIS A 1 134 ? -53.743 51.966  16.823  1.00 18.45  ? 134 HIS A CA    1 
ATOM   1097 C  C     . HIS A 1 134 ? -54.041 51.815  18.292  1.00 22.54  ? 134 HIS A C     1 
ATOM   1098 O  O     . HIS A 1 134 ? -53.165 51.985  19.138  1.00 25.46  ? 134 HIS A O     1 
ATOM   1099 C  CB    . HIS A 1 134 ? -54.455 53.181  16.298  1.00 16.46  ? 134 HIS A CB    1 
ATOM   1100 C  CG    . HIS A 1 134 ? -54.064 54.415  17.011  1.00 18.08  ? 134 HIS A CG    1 
ATOM   1101 N  ND1   . HIS A 1 134 ? -52.892 55.080  16.733  1.00 18.81  ? 134 HIS A ND1   1 
ATOM   1102 C  CD2   . HIS A 1 134 ? -54.640 55.065  18.044  1.00 21.68  ? 134 HIS A CD2   1 
ATOM   1103 C  CE1   . HIS A 1 134 ? -52.782 56.117  17.540  1.00 23.19  ? 134 HIS A CE1   1 
ATOM   1104 N  NE2   . HIS A 1 134 ? -53.829 56.130  18.347  1.00 26.00  ? 134 HIS A NE2   1 
ATOM   1105 N  N     . LYS A 1 135 ? -55.284 51.475  18.596  1.00 23.42  ? 135 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 135 ? -55.699 51.264  19.973  1.00 27.96  ? 135 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 135 ? -54.774 50.228  20.674  1.00 30.77  ? 135 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 135 ? -54.385 50.424  21.827  1.00 34.81  ? 135 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 135 ? -57.179 50.867  19.964  1.00 28.79  ? 135 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 135 ? -57.912 50.865  21.294  1.00 34.97  ? 135 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 135 ? -59.211 50.028  21.168  1.00 36.03  ? 135 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 135 ? -59.349 49.000  22.295  1.00 42.26  ? 135 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 135 ? -59.879 49.635  23.541  1.00 47.49  ? 135 LYS A NZ    1 
ATOM   1114 N  N     . TRP A 1 136 ? -54.385 49.167  19.957  1.00 29.25  ? 136 TRP A N     1 
ATOM   1115 C  CA    . TRP A 1 136 ? -53.448 48.155  20.475  1.00 31.83  ? 136 TRP A CA    1 
ATOM   1116 C  C     . TRP A 1 136 ? -52.038 48.686  20.695  1.00 32.69  ? 136 TRP A C     1 
ATOM   1117 O  O     . TRP A 1 136 ? -51.365 48.313  21.657  1.00 36.85  ? 136 TRP A O     1 
ATOM   1118 C  CB    . TRP A 1 136 ? -53.376 46.925  19.558  1.00 29.82  ? 136 TRP A CB    1 
ATOM   1119 C  CG    . TRP A 1 136 ? -52.778 45.757  20.275  1.00 33.16  ? 136 TRP A CG    1 
ATOM   1120 C  CD1   . TRP A 1 136 ? -53.435 44.859  21.039  1.00 36.61  ? 136 TRP A CD1   1 
ATOM   1121 C  CD2   . TRP A 1 136 ? -51.395 45.402  20.342  1.00 33.70  ? 136 TRP A CD2   1 
ATOM   1122 N  NE1   . TRP A 1 136 ? -52.563 43.947  21.569  1.00 40.72  ? 136 TRP A NE1   1 
ATOM   1123 C  CE2   . TRP A 1 136 ? -51.299 44.262  21.164  1.00 37.83  ? 136 TRP A CE2   1 
ATOM   1124 C  CE3   . TRP A 1 136 ? -50.228 45.935  19.783  1.00 32.02  ? 136 TRP A CE3   1 
ATOM   1125 C  CZ2   . TRP A 1 136 ? -50.094 43.634  21.438  1.00 41.35  ? 136 TRP A CZ2   1 
ATOM   1126 C  CZ3   . TRP A 1 136 ? -49.017 45.311  20.062  1.00 35.21  ? 136 TRP A CZ3   1 
ATOM   1127 C  CH2   . TRP A 1 136 ? -48.964 44.172  20.887  1.00 40.32  ? 136 TRP A CH2   1 
ATOM   1128 N  N     . LEU A 1 137 ? -51.605 49.552  19.788  1.00 29.53  ? 137 LEU A N     1 
ATOM   1129 C  CA    . LEU A 1 137 ? -50.240 50.075  19.757  1.00 30.63  ? 137 LEU A CA    1 
ATOM   1130 C  C     . LEU A 1 137 ? -50.053 51.305  20.650  1.00 33.28  ? 137 LEU A C     1 
ATOM   1131 O  O     . LEU A 1 137 ? -49.031 51.458  21.322  1.00 36.47  ? 137 LEU A O     1 
ATOM   1132 C  CB    . LEU A 1 137 ? -49.897 50.443  18.322  1.00 25.95  ? 137 LEU A CB    1 
ATOM   1133 C  CG    . LEU A 1 137 ? -48.640 49.890  17.661  1.00 26.09  ? 137 LEU A CG    1 
ATOM   1134 C  CD1   . LEU A 1 137 ? -48.256 48.455  18.094  1.00 27.21  ? 137 LEU A CD1   1 
ATOM   1135 C  CD2   . LEU A 1 137 ? -48.875 49.984  16.155  1.00 22.23  ? 137 LEU A CD2   1 
ATOM   1136 N  N     . GLU A 1 138 ? -51.064 52.167  20.636  1.00 32.66  ? 138 GLU A N     1 
ATOM   1137 C  CA    . GLU A 1 138 ? -51.111 53.425  21.372  1.00 35.75  ? 138 GLU A CA    1 
ATOM   1138 C  C     . GLU A 1 138 ? -50.389 53.424  22.730  1.00 41.58  ? 138 GLU A C     1 
ATOM   1139 O  O     . GLU A 1 138 ? -49.573 54.311  22.998  1.00 43.78  ? 138 GLU A O     1 
ATOM   1140 C  CB    . GLU A 1 138 ? -52.571 53.770  21.576  1.00 35.67  ? 138 GLU A CB    1 
ATOM   1141 C  CG    . GLU A 1 138 ? -52.903 55.215  21.600  1.00 38.55  ? 138 GLU A CG    1 
ATOM   1142 C  CD    . GLU A 1 138 ? -54.302 55.432  22.148  1.00 44.62  ? 138 GLU A CD    1 
ATOM   1143 O  OE1   . GLU A 1 138 ? -54.875 56.522  21.915  1.00 47.30  ? 138 GLU A OE1   1 
ATOM   1144 O  OE2   . GLU A 1 138 ? -54.833 54.507  22.812  1.00 47.21  ? 138 GLU A OE2   1 
ATOM   1145 N  N     . GLY A 1 139 ? -50.688 52.437  23.577  1.00 44.92  ? 139 GLY A N     1 
ATOM   1146 C  CA    . GLY A 1 139 ? -50.072 52.341  24.900  1.00 50.76  ? 139 GLY A CA    1 
ATOM   1147 C  C     . GLY A 1 139 ? -48.755 51.579  24.941  1.00 52.48  ? 139 GLY A C     1 
ATOM   1148 O  O     . GLY A 1 139 ? -47.930 51.797  25.824  1.00 57.35  ? 139 GLY A O     1 
ATOM   1149 N  N     . ARG A 1 140 ? -48.554 50.684  23.979  1.00 49.08  ? 140 ARG A N     1 
ATOM   1150 C  CA    . ARG A 1 140 ? -47.409 49.767  24.001  1.00 51.31  ? 140 ARG A CA    1 
ATOM   1151 C  C     . ARG A 1 140 ? -46.175 50.262  23.242  1.00 49.98  ? 140 ARG A C     1 
ATOM   1152 O  O     . ARG A 1 140 ? -45.105 49.664  23.340  1.00 53.03  ? 140 ARG A O     1 
ATOM   1153 C  CB    . ARG A 1 140 ? -47.824 48.382  23.492  1.00 49.76  ? 140 ARG A CB    1 
ATOM   1154 C  CG    . ARG A 1 140 ? -48.721 47.641  24.466  1.00 52.42  ? 140 ARG A CG    1 
ATOM   1155 C  CD    . ARG A 1 140 ? -49.205 46.347  23.888  1.00 49.51  ? 140 ARG A CD    1 
ATOM   1156 N  NE    . ARG A 1 140 ? -50.660 46.314  23.841  1.00 46.76  ? 140 ARG A NE    1 
ATOM   1157 C  CZ    . ARG A 1 140 ? -51.426 45.619  24.673  1.00 51.37  ? 140 ARG A CZ    1 
ATOM   1158 N  NH1   . ARG A 1 140 ? -50.873 44.871  25.627  1.00 57.01  ? 140 ARG A NH1   1 
ATOM   1159 N  NH2   . ARG A 1 140 ? -52.751 45.668  24.545  1.00 50.05  ? 140 ARG A NH2   1 
ATOM   1160 N  N     . ILE A 1 141 ? -46.319 51.359  22.508  1.00 46.25  ? 141 ILE A N     1 
ATOM   1161 C  CA    . ILE A 1 141 ? -45.249 51.864  21.659  1.00 44.71  ? 141 ILE A CA    1 
ATOM   1162 C  C     . ILE A 1 141 ? -44.493 53.047  22.268  1.00 48.22  ? 141 ILE A C     1 
ATOM   1163 O  O     . ILE A 1 141 ? -43.421 53.415  21.790  1.00 48.74  ? 141 ILE A O     1 
ATOM   1164 C  CB    . ILE A 1 141 ? -45.804 52.244  20.268  1.00 38.94  ? 141 ILE A CB    1 
ATOM   1165 C  CG1   . ILE A 1 141 ? -44.768 51.971  19.172  1.00 37.61  ? 141 ILE A CG1   1 
ATOM   1166 C  CG2   . ILE A 1 141 ? -46.332 53.699  20.252  1.00 37.51  ? 141 ILE A CG2   1 
ATOM   1167 C  CD1   . ILE A 1 141 ? -44.092 50.612  19.262  1.00 39.89  ? 141 ILE A CD1   1 
ATOM   1168 N  N     . LYS A 1 142 ? -45.057 53.623  23.324  1.00 51.36  ? 142 LYS A N     1 
ATOM   1169 C  CA    . LYS A 1 142 ? -44.532 54.830  23.952  1.00 55.62  ? 142 LYS A CA    1 
ATOM   1170 C  C     . LYS A 1 142 ? -43.070 54.755  24.383  1.00 61.06  ? 142 LYS A C     1 
ATOM   1171 O  O     . LYS A 1 142 ? -42.673 53.878  25.167  1.00 65.37  ? 142 LYS A O     1 
ATOM   1172 C  CB    . LYS A 1 142 ? -45.388 55.216  25.150  1.00 59.42  ? 142 LYS A CB    1 
ATOM   1173 C  CG    . LYS A 1 142 ? -46.585 56.022  24.782  1.00 56.07  ? 142 LYS A CG    1 
ATOM   1174 C  CD    . LYS A 1 142 ? -46.867 57.050  25.842  1.00 62.53  ? 142 LYS A CD    1 
ATOM   1175 C  CE    . LYS A 1 142 ? -47.639 58.201  25.249  1.00 60.69  ? 142 LYS A CE    1 
ATOM   1176 N  NZ    . LYS A 1 142 ? -48.847 57.710  24.524  1.00 55.96  ? 142 LYS A NZ    1 
ATOM   1177 N  N     . GLY A 1 143 ? -42.286 55.698  23.869  1.00 61.46  ? 143 GLY A N     1 
ATOM   1178 C  CA    . GLY A 1 143 ? -40.880 55.822  24.207  1.00 67.16  ? 143 GLY A CA    1 
ATOM   1179 C  C     . GLY A 1 143 ? -40.010 54.945  23.334  1.00 65.94  ? 143 GLY A C     1 
ATOM   1180 O  O     . GLY A 1 143 ? -38.785 54.911  23.515  1.00 70.74  ? 143 GLY A O     1 
ATOM   1181 N  N     . LYS A 1 144 ? -40.637 54.223  22.400  1.00 39.54  ? 144 LYS A N     1 
ATOM   1182 C  CA    . LYS A 1 144 ? -39.923 53.326  21.485  1.00 35.84  ? 144 LYS A CA    1 
ATOM   1183 C  C     . LYS A 1 144 ? -40.051 53.815  20.042  1.00 32.32  ? 144 LYS A C     1 
ATOM   1184 O  O     . LYS A 1 144 ? -39.644 53.132  19.091  1.00 29.56  ? 144 LYS A O     1 
ATOM   1185 C  CB    . LYS A 1 144 ? -40.450 51.890  21.587  1.00 33.88  ? 144 LYS A CB    1 
ATOM   1186 C  CG    . LYS A 1 144 ? -40.808 51.414  22.971  1.00 38.59  ? 144 LYS A CG    1 
ATOM   1187 C  CD    . LYS A 1 144 ? -39.598 50.867  23.719  1.00 44.69  ? 144 LYS A CD    1 
ATOM   1188 C  CE    . LYS A 1 144 ? -39.833 49.409  24.165  1.00 46.36  ? 144 LYS A CE    1 
ATOM   1189 N  NZ    . LYS A 1 144 ? -41.164 49.134  24.823  1.00 48.18  ? 144 LYS A NZ    1 
ATOM   1190 N  N     . GLU A 1 145 ? -40.623 54.999  19.873  1.00 32.74  ? 145 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 145 ? -40.833 55.542  18.538  1.00 29.55  ? 145 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 145 ? -39.539 55.593  17.738  1.00 27.93  ? 145 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 145 ? -39.528 55.329  16.549  1.00 24.84  ? 145 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 145 ? -41.504 56.916  18.604  1.00 31.99  ? 145 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 145 ? -41.623 57.471  19.988  1.00 36.44  ? 145 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 145 ? -42.902 57.048  20.656  1.00 38.09  ? 145 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 145 ? -43.923 56.869  19.947  1.00 35.40  ? 145 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 145 ? -42.889 56.907  21.897  1.00 41.54  ? 145 GLU A OE2   1 
ATOM   1199 N  N     . ASN A 1 146 ? -38.445 55.918  18.403  1.00 30.50  ? 146 ASN A N     1 
ATOM   1200 C  CA    . ASN A 1 146 ? -37.199 56.088  17.692  1.00 30.49  ? 146 ASN A CA    1 
ATOM   1201 C  C     . ASN A 1 146 ? -36.605 54.775  17.276  1.00 27.39  ? 146 ASN A C     1 
ATOM   1202 O  O     . ASN A 1 146 ? -35.893 54.709  16.284  1.00 26.54  ? 146 ASN A O     1 
ATOM   1203 C  CB    . ASN A 1 146 ? -36.210 56.925  18.493  1.00 35.73  ? 146 ASN A CB    1 
ATOM   1204 C  CG    . ASN A 1 146 ? -36.656 58.362  18.624  1.00 38.88  ? 146 ASN A CG    1 
ATOM   1205 O  OD1   . ASN A 1 146 ? -37.303 58.913  17.725  1.00 37.81  ? 146 ASN A OD1   1 
ATOM   1206 N  ND2   . ASN A 1 146 ? -36.341 58.968  19.752  1.00 43.75  ? 146 ASN A ND2   1 
ATOM   1207 N  N     . GLU A 1 147 ? -36.923 53.728  18.027  1.00 26.42  ? 147 GLU A N     1 
ATOM   1208 C  CA    . GLU A 1 147 ? -36.580 52.373  17.637  1.00 23.29  ? 147 GLU A CA    1 
ATOM   1209 C  C     . GLU A 1 147 ? -37.313 52.040  16.353  1.00 19.25  ? 147 GLU A C     1 
ATOM   1210 O  O     . GLU A 1 147 ? -36.723 51.529  15.402  1.00 17.65  ? 147 GLU A O     1 
ATOM   1211 C  CB    . GLU A 1 147 ? -36.932 51.380  18.740  1.00 23.88  ? 147 GLU A CB    1 
ATOM   1212 C  CG    . GLU A 1 147 ? -36.135 51.547  20.029  1.00 27.76  ? 147 GLU A CG    1 
ATOM   1213 C  CD    . GLU A 1 147 ? -34.625 51.523  19.824  1.00 30.33  ? 147 GLU A CD    1 
ATOM   1214 O  OE1   . GLU A 1 147 ? -34.125 50.844  18.886  1.00 28.16  ? 147 GLU A OE1   1 
ATOM   1215 O  OE2   . GLU A 1 147 ? -33.928 52.190  20.621  1.00 35.20  ? 147 GLU A OE2   1 
ATOM   1216 N  N     . VAL A 1 148 ? -38.593 52.369  16.317  1.00 18.28  ? 148 VAL A N     1 
ATOM   1217 C  CA    . VAL A 1 148 ? -39.383 52.167  15.117  1.00 15.86  ? 148 VAL A CA    1 
ATOM   1218 C  C     . VAL A 1 148 ? -38.763 52.913  13.937  1.00 15.72  ? 148 VAL A C     1 
ATOM   1219 O  O     . VAL A 1 148 ? -38.564 52.336  12.861  1.00 13.90  ? 148 VAL A O     1 
ATOM   1220 C  CB    . VAL A 1 148 ? -40.843 52.629  15.314  1.00 16.12  ? 148 VAL A CB    1 
ATOM   1221 C  CG1   . VAL A 1 148 ? -41.655 52.416  14.027  1.00 14.29  ? 148 VAL A CG1   1 
ATOM   1222 C  CG2   . VAL A 1 148 ? -41.485 51.910  16.506  1.00 17.17  ? 148 VAL A CG2   1 
ATOM   1223 N  N     . ARG A 1 149 ? -38.442 54.189  14.149  1.00 18.43  ? 149 ARG A N     1 
ATOM   1224 C  CA    . ARG A 1 149 ? -37.895 55.023  13.088  1.00 18.89  ? 149 ARG A CA    1 
ATOM   1225 C  C     . ARG A 1 149 ? -36.574 54.468  12.567  1.00 19.04  ? 149 ARG A C     1 
ATOM   1226 O  O     . ARG A 1 149 ? -36.319 54.494  11.362  1.00 17.96  ? 149 ARG A O     1 
ATOM   1227 C  CB    . ARG A 1 149 ? -37.734 56.449  13.557  1.00 22.09  ? 149 ARG A CB    1 
ATOM   1228 C  CG    . ARG A 1 149 ? -39.041 57.182  13.765  1.00 22.56  ? 149 ARG A CG    1 
ATOM   1229 C  CD    . ARG A 1 149 ? -38.729 58.636  14.104  1.00 26.36  ? 149 ARG A CD    1 
ATOM   1230 N  NE    . ARG A 1 149 ? -39.898 59.511  14.101  1.00 26.30  ? 149 ARG A NE    1 
ATOM   1231 C  CZ    . ARG A 1 149 ? -40.423 60.044  15.196  1.00 28.89  ? 149 ARG A CZ    1 
ATOM   1232 N  NH1   . ARG A 1 149 ? -39.881 59.766  16.387  1.00 28.77  ? 149 ARG A NH1   1 
ATOM   1233 N  NH2   . ARG A 1 149 ? -41.489 60.847  15.102  1.00 29.94  ? 149 ARG A NH2   1 
ATOM   1234 N  N     . LEU A 1 150 ? -35.754 53.947  13.473  1.00 20.82  ? 150 LEU A N     1 
ATOM   1235 C  CA    . LEU A 1 150 ? -34.505 53.298  13.088  1.00 21.60  ? 150 LEU A CA    1 
ATOM   1236 C  C     . LEU A 1 150 ? -34.742 52.096  12.169  1.00 19.12  ? 150 LEU A C     1 
ATOM   1237 O  O     . LEU A 1 150 ? -34.078 51.948  11.132  1.00 19.23  ? 150 LEU A O     1 
ATOM   1238 C  CB    . LEU A 1 150 ? -33.699 52.870  14.316  1.00 23.62  ? 150 LEU A CB    1 
ATOM   1239 C  CG    . LEU A 1 150 ? -32.860 53.910  15.055  1.00 26.84  ? 150 LEU A CG    1 
ATOM   1240 C  CD1   . LEU A 1 150 ? -32.154 53.191  16.184  1.00 27.75  ? 150 LEU A CD1   1 
ATOM   1241 C  CD2   . LEU A 1 150 ? -31.856 54.665  14.156  1.00 26.67  ? 150 LEU A CD2   1 
ATOM   1242 N  N     . LEU A 1 151 ? -35.687 51.245  12.552  1.00 17.71  ? 151 LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 151 ? -36.011 50.055  11.772  1.00 15.83  ? 151 LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 151 ? -36.640 50.433  10.425  1.00 14.50  ? 151 LEU A C     1 
ATOM   1245 O  O     . LEU A 1 151 ? -36.318 49.833  9.401   1.00 13.42  ? 151 LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 151 ? -36.921 49.126  12.591  1.00 15.05  ? 151 LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 151 ? -37.547 47.869  11.985  1.00 13.22  ? 151 LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 151 ? -36.523 46.975  11.301  1.00 12.48  ? 151 LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 151 ? -38.299 47.111  13.074  1.00 13.41  ? 151 LEU A CD2   1 
ATOM   1250 N  N     . LYS A 1 152 ? -37.508 51.444  10.428  1.00 15.05  ? 152 LYS A N     1 
ATOM   1251 C  CA    . LYS A 1 152 ? -38.086 51.944  9.180   1.00 15.12  ? 152 LYS A CA    1 
ATOM   1252 C  C     . LYS A 1 152 ? -37.037 52.583  8.270   1.00 16.80  ? 152 LYS A C     1 
ATOM   1253 O  O     . LYS A 1 152 ? -37.144 52.483  7.056   1.00 16.72  ? 152 LYS A O     1 
ATOM   1254 C  CB    . LYS A 1 152 ? -39.222 52.920  9.444   1.00 15.57  ? 152 LYS A CB    1 
ATOM   1255 C  CG    . LYS A 1 152 ? -40.502 52.278  9.971   1.00 15.47  ? 152 LYS A CG    1 
ATOM   1256 C  CD    . LYS A 1 152 ? -41.568 53.335  10.257  1.00 16.63  ? 152 LYS A CD    1 
ATOM   1257 C  CE    . LYS A 1 152 ? -42.906 52.696  10.505  1.00 16.09  ? 152 LYS A CE    1 
ATOM   1258 N  NZ    . LYS A 1 152 ? -43.898 53.720  10.912  1.00 18.41  ? 152 LYS A NZ    1 
ATOM   1259 N  N     . GLY A 1 153 ? -36.027 53.237  8.851   1.00 19.45  ? 153 GLY A N     1 
ATOM   1260 C  CA    . GLY A 1 153 ? -34.908 53.803  8.083   1.00 21.53  ? 153 GLY A CA    1 
ATOM   1261 C  C     . GLY A 1 153 ? -34.068 52.723  7.431   1.00 21.28  ? 153 GLY A C     1 
ATOM   1262 O  O     . GLY A 1 153 ? -33.866 52.734  6.207   1.00 21.06  ? 153 GLY A O     1 
ATOM   1263 N  N     . PHE A 1 154 ? -33.600 51.792  8.266   1.00 21.50  ? 154 PHE A N     1 
ATOM   1264 C  CA    . PHE A 1 154 ? -32.884 50.575  7.854   1.00 22.12  ? 154 PHE A CA    1 
ATOM   1265 C  C     . PHE A 1 154 ? -33.570 49.821  6.724   1.00 20.12  ? 154 PHE A C     1 
ATOM   1266 O  O     . PHE A 1 154 ? -32.907 49.263  5.847   1.00 21.03  ? 154 PHE A O     1 
ATOM   1267 C  CB    . PHE A 1 154 ? -32.770 49.626  9.050   1.00 22.72  ? 154 PHE A CB    1 
ATOM   1268 C  CG    . PHE A 1 154 ? -31.741 48.517  8.890   1.00 24.54  ? 154 PHE A CG    1 
ATOM   1269 C  CD1   . PHE A 1 154 ? -30.376 48.774  9.037   1.00 28.34  ? 154 PHE A CD1   1 
ATOM   1270 C  CD2   . PHE A 1 154 ? -32.145 47.207  8.665   1.00 25.05  ? 154 PHE A CD2   1 
ATOM   1271 C  CE1   . PHE A 1 154 ? -29.429 47.757  8.922   1.00 30.05  ? 154 PHE A CE1   1 
ATOM   1272 C  CE2   . PHE A 1 154 ? -31.198 46.167  8.557   1.00 27.50  ? 154 PHE A CE2   1 
ATOM   1273 C  CZ    . PHE A 1 154 ? -29.837 46.453  8.682   1.00 29.39  ? 154 PHE A CZ    1 
ATOM   1274 N  N     . LEU A 1 155 ? -34.896 49.784  6.755   1.00 18.02  ? 155 LEU A N     1 
ATOM   1275 C  CA    . LEU A 1 155 ? -35.632 49.052  5.746   1.00 16.46  ? 155 LEU A CA    1 
ATOM   1276 C  C     . LEU A 1 155 ? -35.699 49.853  4.488   1.00 17.24  ? 155 LEU A C     1 
ATOM   1277 O  O     . LEU A 1 155 ? -35.312 49.375  3.441   1.00 18.05  ? 155 LEU A O     1 
ATOM   1278 C  CB    . LEU A 1 155 ? -37.026 48.682  6.240   1.00 14.81  ? 155 LEU A CB    1 
ATOM   1279 C  CG    . LEU A 1 155 ? -37.003 47.531  7.252   1.00 14.23  ? 155 LEU A CG    1 
ATOM   1280 C  CD1   . LEU A 1 155 ? -38.247 47.556  8.127   1.00 12.44  ? 155 LEU A CD1   1 
ATOM   1281 C  CD2   . LEU A 1 155 ? -36.795 46.179  6.563   1.00 12.89  ? 155 LEU A CD2   1 
ATOM   1282 N  N     . LYS A 1 156 ? -36.173 51.084  4.593   1.00 18.10  ? 156 LYS A N     1 
ATOM   1283 C  CA    . LYS A 1 156 ? -36.311 51.941  3.427   1.00 20.09  ? 156 LYS A CA    1 
ATOM   1284 C  C     . LYS A 1 156 ? -34.984 52.007  2.664   1.00 21.92  ? 156 LYS A C     1 
ATOM   1285 O  O     . LYS A 1 156 ? -34.912 51.655  1.488   1.00 22.31  ? 156 LYS A O     1 
ATOM   1286 C  CB    . LYS A 1 156 ? -36.768 53.339  3.846   1.00 21.54  ? 156 LYS A CB    1 
ATOM   1287 C  CG    . LYS A 1 156 ? -37.625 54.083  2.816   1.00 23.89  ? 156 LYS A CG    1 
ATOM   1288 C  CD    . LYS A 1 156 ? -38.092 55.411  3.423   1.00 28.82  ? 156 LYS A CD    1 
ATOM   1289 C  CE    . LYS A 1 156 ? -39.414 55.890  2.844   1.00 31.22  ? 156 LYS A CE    1 
ATOM   1290 N  NZ    . LYS A 1 156 ? -39.223 56.476  1.484   1.00 35.22  ? 156 LYS A NZ    1 
ATOM   1291 N  N     . ALA A 1 157 ? -33.930 52.423  3.355   1.00 23.13  ? 157 ALA A N     1 
ATOM   1292 C  CA    . ALA A 1 157 ? -32.630 52.514  2.730   1.00 25.22  ? 157 ALA A CA    1 
ATOM   1293 C  C     . ALA A 1 157 ? -32.286 51.223  1.987   1.00 24.40  ? 157 ALA A C     1 
ATOM   1294 O  O     . ALA A 1 157 ? -31.732 51.264  0.899   1.00 26.64  ? 157 ALA A O     1 
ATOM   1295 C  CB    . ALA A 1 157 ? -31.579 52.842  3.761   1.00 27.30  ? 157 ALA A CB    1 
ATOM   1296 N  N     . ASN A 1 158 ? -32.632 50.081  2.557   1.00 21.78  ? 158 ASN A N     1 
ATOM   1297 C  CA    . ASN A 1 158 ? -32.324 48.814  1.914   1.00 21.64  ? 158 ASN A CA    1 
ATOM   1298 C  C     . ASN A 1 158 ? -33.403 48.310  0.964   1.00 20.10  ? 158 ASN A C     1 
ATOM   1299 O  O     . ASN A 1 158 ? -33.452 47.123  0.638   1.00 19.84  ? 158 ASN A O     1 
ATOM   1300 C  CB    . ASN A 1 158 ? -32.007 47.759  2.963   1.00 21.21  ? 158 ASN A CB    1 
ATOM   1301 C  CG    . ASN A 1 158 ? -30.613 47.887  3.498   1.00 24.45  ? 158 ASN A CG    1 
ATOM   1302 O  OD1   . ASN A 1 158 ? -29.646 47.572  2.811   1.00 28.46  ? 158 ASN A OD1   1 
ATOM   1303 N  ND2   . ASN A 1 158 ? -30.495 48.343  4.732   1.00 25.06  ? 158 ASN A ND2   1 
ATOM   1304 N  N     . GLY A 1 159 ? -34.281 49.210  0.542   1.00 19.51  ? 159 GLY A N     1 
ATOM   1305 C  CA    . GLY A 1 159 ? -35.279 48.901  -0.496  1.00 19.36  ? 159 GLY A CA    1 
ATOM   1306 C  C     . GLY A 1 159 ? -36.401 47.931  -0.165  1.00 17.27  ? 159 GLY A C     1 
ATOM   1307 O  O     . GLY A 1 159 ? -37.111 47.478  -1.067  1.00 17.41  ? 159 GLY A O     1 
ATOM   1308 N  N     . ILE A 1 160 ? -36.572 47.625  1.123   1.00 15.57  ? 160 ILE A N     1 
ATOM   1309 C  CA    . ILE A 1 160 ? -37.570 46.639  1.550   1.00 14.14  ? 160 ILE A CA    1 
ATOM   1310 C  C     . ILE A 1 160 ? -38.616 47.147  2.538   1.00 12.99  ? 160 ILE A C     1 
ATOM   1311 O  O     . ILE A 1 160 ? -39.207 46.364  3.266   1.00 12.03  ? 160 ILE A O     1 
ATOM   1312 C  CB    . ILE A 1 160 ? -36.932 45.282  2.041   1.00 14.31  ? 160 ILE A CB    1 
ATOM   1313 C  CG1   . ILE A 1 160 ? -35.799 45.500  3.057   1.00 14.32  ? 160 ILE A CG1   1 
ATOM   1314 C  CG2   . ILE A 1 160 ? -36.454 44.458  0.851   1.00 15.49  ? 160 ILE A CG2   1 
ATOM   1315 C  CD1   . ILE A 1 160 ? -35.228 44.190  3.636   1.00 14.02  ? 160 ILE A CD1   1 
ATOM   1316 N  N     . TYR A 1 161 ? -38.856 48.456  2.540   1.00 13.85  ? 161 TYR A N     1 
ATOM   1317 C  CA    . TYR A 1 161 ? -39.923 49.031  3.354   1.00 13.56  ? 161 TYR A CA    1 
ATOM   1318 C  C     . TYR A 1 161 ? -41.172 49.221  2.516   1.00 14.84  ? 161 TYR A C     1 
ATOM   1319 O  O     . TYR A 1 161 ? -41.104 49.782  1.410   1.00 16.39  ? 161 TYR A O     1 
ATOM   1320 C  CB    . TYR A 1 161 ? -39.504 50.361  3.975   1.00 14.11  ? 161 TYR A CB    1 
ATOM   1321 C  CG    . TYR A 1 161 ? -40.561 50.988  4.867   1.00 14.06  ? 161 TYR A CG    1 
ATOM   1322 C  CD1   . TYR A 1 161 ? -41.022 50.332  5.998   1.00 13.16  ? 161 TYR A CD1   1 
ATOM   1323 C  CD2   . TYR A 1 161 ? -41.080 52.249  4.587   1.00 16.06  ? 161 TYR A CD2   1 
ATOM   1324 C  CE1   . TYR A 1 161 ? -41.985 50.901  6.818   1.00 14.09  ? 161 TYR A CE1   1 
ATOM   1325 C  CE2   . TYR A 1 161 ? -42.048 52.829  5.402   1.00 16.67  ? 161 TYR A CE2   1 
ATOM   1326 C  CZ    . TYR A 1 161 ? -42.499 52.146  6.514   1.00 15.35  ? 161 TYR A CZ    1 
ATOM   1327 O  OH    . TYR A 1 161 ? -43.456 52.708  7.331   1.00 15.82  ? 161 TYR A OH    1 
ATOM   1328 N  N     . GLY A 1 162 ? -42.306 48.762  3.055   1.00 14.72  ? 162 GLY A N     1 
ATOM   1329 C  CA    . GLY A 1 162 ? -43.604 48.820  2.371   1.00 16.17  ? 162 GLY A CA    1 
ATOM   1330 C  C     . GLY A 1 162 ? -44.124 47.437  2.009   1.00 16.77  ? 162 GLY A C     1 
ATOM   1331 O  O     . GLY A 1 162 ? -43.364 46.594  1.543   1.00 17.42  ? 162 GLY A O     1 
ATOM   1332 N  N     . ALA A 1 163 ? -45.417 47.204  2.216   1.00 17.44  ? 163 ALA A N     1 
ATOM   1333 C  CA    . ALA A 1 163 ? -46.043 45.922  1.908   1.00 18.32  ? 163 ALA A CA    1 
ATOM   1334 C  C     . ALA A 1 163 ? -46.650 45.871  0.494   1.00 21.03  ? 163 ALA A C     1 
ATOM   1335 O  O     . ALA A 1 163 ? -47.051 44.807  0.013   1.00 23.28  ? 163 ALA A O     1 
ATOM   1336 C  CB    . ALA A 1 163 ? -47.105 45.592  2.961   1.00 18.46  ? 163 ALA A CB    1 
ATOM   1337 N  N     . GLU A 1 164 ? -46.722 47.010  -0.178  1.00 21.67  ? 164 GLU A N     1 
ATOM   1338 C  CA    . GLU A 1 164 ? -47.340 47.048  -1.496  1.00 24.82  ? 164 GLU A CA    1 
ATOM   1339 C  C     . GLU A 1 164 ? -46.613 46.114  -2.475  1.00 25.29  ? 164 GLU A C     1 
ATOM   1340 O  O     . GLU A 1 164 ? -45.433 45.795  -2.288  1.00 23.21  ? 164 GLU A O     1 
ATOM   1341 C  CB    . GLU A 1 164 ? -47.392 48.482  -2.030  1.00 25.97  ? 164 GLU A CB    1 
ATOM   1342 C  CG    . GLU A 1 164 ? -46.027 49.087  -2.324  1.00 26.81  ? 164 GLU A CG    1 
ATOM   1343 C  CD    . GLU A 1 164 ? -45.474 49.900  -1.169  1.00 28.05  ? 164 GLU A CD    1 
ATOM   1344 O  OE1   . GLU A 1 164 ? -44.759 50.899  -1.433  1.00 29.89  ? 164 GLU A OE1   1 
ATOM   1345 O  OE2   . GLU A 1 164 ? -45.754 49.556  0.002   1.00 27.96  ? 164 GLU A OE2   1 
ATOM   1346 N  N     . TYR A 1 165 ? -47.316 45.690  -3.521  1.00 28.24  ? 165 TYR A N     1 
ATOM   1347 C  CA    . TYR A 1 165 ? -46.732 44.791  -4.510  1.00 29.49  ? 165 TYR A CA    1 
ATOM   1348 C  C     . TYR A 1 165 ? -45.488 45.329  -5.189  1.00 28.78  ? 165 TYR A C     1 
ATOM   1349 O  O     . TYR A 1 165 ? -44.712 44.556  -5.747  1.00 30.32  ? 165 TYR A O     1 
ATOM   1350 C  CB    . TYR A 1 165 ? -47.759 44.368  -5.558  1.00 34.20  ? 165 TYR A CB    1 
ATOM   1351 C  CG    . TYR A 1 165 ? -48.739 43.352  -5.039  1.00 35.62  ? 165 TYR A CG    1 
ATOM   1352 C  CD1   . TYR A 1 165 ? -50.108 43.622  -5.019  1.00 38.53  ? 165 TYR A CD1   1 
ATOM   1353 C  CD2   . TYR A 1 165 ? -48.298 42.133  -4.538  1.00 34.07  ? 165 TYR A CD2   1 
ATOM   1354 C  CE1   . TYR A 1 165 ? -51.015 42.698  -4.524  1.00 40.05  ? 165 TYR A CE1   1 
ATOM   1355 C  CE2   . TYR A 1 165 ? -49.189 41.204  -4.047  1.00 36.60  ? 165 TYR A CE2   1 
ATOM   1356 C  CZ    . TYR A 1 165 ? -50.547 41.490  -4.042  1.00 39.77  ? 165 TYR A CZ    1 
ATOM   1357 O  OH    . TYR A 1 165 ? -51.436 40.558  -3.553  1.00 42.80  ? 165 TYR A OH    1 
ATOM   1358 N  N     . LYS A 1 166 ? -45.283 46.639  -5.151  1.00 27.41  ? 166 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 166 ? -44.103 47.206  -5.795  1.00 27.09  ? 166 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 166 ? -42.860 46.880  -4.990  1.00 23.81  ? 166 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 166 ? -41.783 46.728  -5.545  1.00 24.21  ? 166 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 166 ? -44.239 48.713  -5.991  1.00 27.82  ? 166 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 166 ? -43.293 49.278  -7.030  1.00 29.35  ? 166 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 166 ? -43.064 50.742  -6.788  1.00 30.51  ? 166 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 166 ? -42.441 51.429  -7.986  1.00 34.99  ? 166 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 166 ? -42.614 52.910  -7.851  1.00 37.47  ? 166 LYS A NZ    1 
ATOM   1367 N  N     . VAL A 1 167 ? -43.035 46.749  -3.684  1.00 20.98  ? 167 VAL A N     1 
ATOM   1368 C  CA    . VAL A 1 167 ? -41.936 46.516  -2.774  1.00 18.67  ? 167 VAL A CA    1 
ATOM   1369 C  C     . VAL A 1 167 ? -41.941 45.085  -2.251  1.00 18.91  ? 167 VAL A C     1 
ATOM   1370 O  O     . VAL A 1 167 ? -40.894 44.449  -2.173  1.00 18.72  ? 167 VAL A O     1 
ATOM   1371 C  CB    . VAL A 1 167 ? -42.018 47.475  -1.590  1.00 16.18  ? 167 VAL A CB    1 
ATOM   1372 C  CG1   . VAL A 1 167 ? -40.829 47.299  -0.652  1.00 13.69  ? 167 VAL A CG1   1 
ATOM   1373 C  CG2   . VAL A 1 167 ? -42.105 48.883  -2.094  1.00 17.12  ? 167 VAL A CG2   1 
ATOM   1374 N  N     . ARG A 1 168 ? -43.121 44.582  -1.896  1.00 20.24  ? 168 ARG A N     1 
ATOM   1375 C  CA    . ARG A 1 168 ? -43.256 43.288  -1.203  1.00 20.88  ? 168 ARG A CA    1 
ATOM   1376 C  C     . ARG A 1 168 ? -42.305 43.170  -0.010  1.00 18.74  ? 168 ARG A C     1 
ATOM   1377 O  O     . ARG A 1 168 ? -41.613 42.160  0.151   1.00 19.24  ? 168 ARG A O     1 
ATOM   1378 C  CB    . ARG A 1 168 ? -43.075 42.111  -2.165  1.00 23.31  ? 168 ARG A CB    1 
ATOM   1379 C  CG    . ARG A 1 168 ? -44.250 41.889  -3.050  1.00 27.22  ? 168 ARG A CG    1 
ATOM   1380 C  CD    . ARG A 1 168 ? -43.787 41.170  -4.284  1.00 34.24  ? 168 ARG A CD    1 
ATOM   1381 N  NE    . ARG A 1 168 ? -44.883 40.626  -5.091  1.00 40.12  ? 168 ARG A NE    1 
ATOM   1382 C  CZ    . ARG A 1 168 ? -45.610 39.564  -4.747  1.00 41.63  ? 168 ARG A CZ    1 
ATOM   1383 N  NH1   . ARG A 1 168 ? -45.363 38.950  -3.577  1.00 38.54  ? 168 ARG A NH1   1 
ATOM   1384 N  NH2   . ARG A 1 168 ? -46.588 39.139  -5.560  1.00 42.88  ? 168 ARG A NH2   1 
ATOM   1385 N  N     . GLY A 1 169 ? -42.286 44.214  0.813   1.00 17.22  ? 169 GLY A N     1 
ATOM   1386 C  CA    . GLY A 1 169 ? -41.422 44.277  1.982   1.00 16.12  ? 169 GLY A CA    1 
ATOM   1387 C  C     . GLY A 1 169 ? -42.195 44.489  3.265   1.00 15.58  ? 169 GLY A C     1 
ATOM   1388 O  O     . GLY A 1 169 ? -43.331 44.044  3.389   1.00 16.69  ? 169 GLY A O     1 
ATOM   1389 N  N     . PHE A 1 170 ? -41.587 45.200  4.209   1.00 14.83  ? 170 PHE A N     1 
ATOM   1390 C  CA    . PHE A 1 170 ? -42.108 45.311  5.571   1.00 14.58  ? 170 PHE A CA    1 
ATOM   1391 C  C     . PHE A 1 170 ? -43.032 46.492  5.714   1.00 15.06  ? 170 PHE A C     1 
ATOM   1392 O  O     . PHE A 1 170 ? -42.653 47.623  5.399   1.00 15.44  ? 170 PHE A O     1 
ATOM   1393 C  CB    . PHE A 1 170 ? -40.951 45.435  6.561   1.00 14.09  ? 170 PHE A CB    1 
ATOM   1394 C  CG    . PHE A 1 170 ? -40.119 44.193  6.661   1.00 14.59  ? 170 PHE A CG    1 
ATOM   1395 C  CD1   . PHE A 1 170 ? -39.316 43.793  5.606   1.00 15.01  ? 170 PHE A CD1   1 
ATOM   1396 C  CD2   . PHE A 1 170 ? -40.154 43.412  7.806   1.00 15.29  ? 170 PHE A CD2   1 
ATOM   1397 C  CE1   . PHE A 1 170 ? -38.563 42.633  5.691   1.00 17.44  ? 170 PHE A CE1   1 
ATOM   1398 C  CE2   . PHE A 1 170 ? -39.399 42.246  7.904   1.00 17.13  ? 170 PHE A CE2   1 
ATOM   1399 C  CZ    . PHE A 1 170 ? -38.602 41.856  6.848   1.00 17.41  ? 170 PHE A CZ    1 
ATOM   1400 N  N     . SER A 1 171 ? -44.251 46.233  6.182   1.00 15.76  ? 171 SER A N     1 
ATOM   1401 C  CA    . SER A 1 171 ? -45.217 47.311  6.395   1.00 16.43  ? 171 SER A CA    1 
ATOM   1402 C  C     . SER A 1 171 ? -44.752 48.167  7.570   1.00 15.93  ? 171 SER A C     1 
ATOM   1403 O  O     . SER A 1 171 ? -44.026 47.681  8.436   1.00 15.75  ? 171 SER A O     1 
ATOM   1404 C  CB    . SER A 1 171 ? -46.619 46.742  6.657   1.00 17.70  ? 171 SER A CB    1 
ATOM   1405 O  OG    . SER A 1 171 ? -46.799 46.436  8.029   1.00 17.95  ? 171 SER A OG    1 
ATOM   1406 N  N     . GLY A 1 172 ? -45.156 49.432  7.598   1.00 16.59  ? 172 GLY A N     1 
ATOM   1407 C  CA    . GLY A 1 172 ? -44.925 50.279  8.771   1.00 17.08  ? 172 GLY A CA    1 
ATOM   1408 C  C     . GLY A 1 172 ? -45.412 49.658  10.078  1.00 17.25  ? 172 GLY A C     1 
ATOM   1409 O  O     . GLY A 1 172 ? -44.656 49.572  11.052  1.00 17.20  ? 172 GLY A O     1 
ATOM   1410 N  N     . TYR A 1 173 ? -46.666 49.207  10.087  1.00 17.87  ? 173 TYR A N     1 
ATOM   1411 C  CA    . TYR A 1 173 ? -47.245 48.506  11.228  1.00 18.54  ? 173 TYR A CA    1 
ATOM   1412 C  C     . TYR A 1 173 ? -46.444 47.264  11.627  1.00 17.64  ? 173 TYR A C     1 
ATOM   1413 O  O     . TYR A 1 173 ? -46.238 47.043  12.815  1.00 18.32  ? 173 TYR A O     1 
ATOM   1414 C  CB    . TYR A 1 173 ? -48.701 48.149  10.947  1.00 20.23  ? 173 TYR A CB    1 
ATOM   1415 C  CG    . TYR A 1 173 ? -49.413 47.363  12.034  1.00 21.85  ? 173 TYR A CG    1 
ATOM   1416 C  CD1   . TYR A 1 173 ? -49.816 47.977  13.226  1.00 23.91  ? 173 TYR A CD1   1 
ATOM   1417 C  CD2   . TYR A 1 173 ? -49.720 46.010  11.855  1.00 21.86  ? 173 TYR A CD2   1 
ATOM   1418 C  CE1   . TYR A 1 173 ? -50.490 47.249  14.226  1.00 25.68  ? 173 TYR A CE1   1 
ATOM   1419 C  CE2   . TYR A 1 173 ? -50.391 45.277  12.841  1.00 23.93  ? 173 TYR A CE2   1 
ATOM   1420 C  CZ    . TYR A 1 173 ? -50.773 45.900  14.021  1.00 25.82  ? 173 TYR A CZ    1 
ATOM   1421 O  OH    . TYR A 1 173 ? -51.442 45.179  14.985  1.00 27.69  ? 173 TYR A OH    1 
ATOM   1422 N  N     . LEU A 1 174 ? -45.974 46.470  10.658  1.00 16.46  ? 174 LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 174 ? -45.081 45.343  10.983  1.00 15.95  ? 174 LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 174 ? -43.859 45.811  11.792  1.00 15.99  ? 174 LEU A C     1 
ATOM   1425 O  O     . LEU A 1 174 ? -43.463 45.169  12.770  1.00 16.53  ? 174 LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 174 ? -44.610 44.584  9.730   1.00 15.29  ? 174 LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 174 ? -44.335 43.058  9.811   1.00 15.05  ? 174 LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 174 ? -43.367 42.615  8.740   1.00 14.68  ? 174 LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 174 ? -43.851 42.558  11.152  1.00 13.85  ? 174 LEU A CD2   1 
ATOM   1430 N  N     . CYS A 1 175 ? -43.271 46.930  11.376  1.00 15.62  ? 175 CYS A N     1 
ATOM   1431 C  CA    . CYS A 1 175 ? -42.150 47.506  12.092  1.00 16.40  ? 175 CYS A CA    1 
ATOM   1432 C  C     . CYS A 1 175 ? -42.527 47.801  13.550  1.00 17.94  ? 175 CYS A C     1 
ATOM   1433 O  O     . CYS A 1 175 ? -41.822 47.375  14.476  1.00 19.27  ? 175 CYS A O     1 
ATOM   1434 C  CB    . CYS A 1 175 ? -41.642 48.757  11.379  1.00 16.38  ? 175 CYS A CB    1 
ATOM   1435 S  SG    . CYS A 1 175 ? -40.780 48.386  9.837   1.00 16.81  ? 175 CYS A SG    1 
ATOM   1436 N  N     . GLU A 1 176 ? -43.642 48.496  13.759  1.00 17.97  ? 176 GLU A N     1 
ATOM   1437 C  CA    . GLU A 1 176 ? -44.083 48.792  15.113  1.00 19.61  ? 176 GLU A CA    1 
ATOM   1438 C  C     . GLU A 1 176 ? -44.258 47.524  15.939  1.00 19.59  ? 176 GLU A C     1 
ATOM   1439 O  O     . GLU A 1 176 ? -43.844 47.473  17.102  1.00 21.53  ? 176 GLU A O     1 
ATOM   1440 C  CB    . GLU A 1 176 ? -45.379 49.606  15.107  1.00 21.17  ? 176 GLU A CB    1 
ATOM   1441 C  CG    . GLU A 1 176 ? -45.176 51.118  15.095  1.00 24.03  ? 176 GLU A CG    1 
ATOM   1442 C  CD    . GLU A 1 176 ? -46.162 51.859  14.184  1.00 27.77  ? 176 GLU A CD    1 
ATOM   1443 O  OE1   . GLU A 1 176 ? -46.695 52.906  14.620  1.00 31.23  ? 176 GLU A OE1   1 
ATOM   1444 O  OE2   . GLU A 1 176 ? -46.391 51.416  13.025  1.00 28.07  ? 176 GLU A OE2   1 
ATOM   1445 N  N     . LEU A 1 177 ? -44.851 46.493  15.345  1.00 17.73  ? 177 LEU A N     1 
ATOM   1446 C  CA    . LEU A 1 177 ? -45.094 45.256  16.080  1.00 17.87  ? 177 LEU A CA    1 
ATOM   1447 C  C     . LEU A 1 177 ? -43.795 44.621  16.513  1.00 17.68  ? 177 LEU A C     1 
ATOM   1448 O  O     . LEU A 1 177 ? -43.708 44.072  17.615  1.00 19.57  ? 177 LEU A O     1 
ATOM   1449 C  CB    . LEU A 1 177 ? -45.865 44.245  15.249  1.00 17.41  ? 177 LEU A CB    1 
ATOM   1450 C  CG    . LEU A 1 177 ? -47.308 44.549  14.907  1.00 17.74  ? 177 LEU A CG    1 
ATOM   1451 C  CD1   . LEU A 1 177 ? -47.818 43.428  14.063  1.00 17.18  ? 177 LEU A CD1   1 
ATOM   1452 C  CD2   . LEU A 1 177 ? -48.106 44.683  16.166  1.00 20.43  ? 177 LEU A CD2   1 
ATOM   1453 N  N     . LEU A 1 178 ? -42.793 44.689  15.636  1.00 15.46  ? 178 LEU A N     1 
ATOM   1454 C  CA    . LEU A 1 178 ? -41.513 44.048  15.902  1.00 15.28  ? 178 LEU A CA    1 
ATOM   1455 C  C     . LEU A 1 178 ? -40.809 44.728  17.057  1.00 16.87  ? 178 LEU A C     1 
ATOM   1456 O  O     . LEU A 1 178 ? -40.330 44.048  17.979  1.00 19.17  ? 178 LEU A O     1 
ATOM   1457 C  CB    . LEU A 1 178 ? -40.633 44.024  14.666  1.00 13.31  ? 178 LEU A CB    1 
ATOM   1458 C  CG    . LEU A 1 178 ? -41.125 43.012  13.642  1.00 12.88  ? 178 LEU A CG    1 
ATOM   1459 C  CD1   . LEU A 1 178 ? -40.385 43.236  12.342  1.00 12.85  ? 178 LEU A CD1   1 
ATOM   1460 C  CD2   . LEU A 1 178 ? -41.001 41.553  14.115  1.00 13.60  ? 178 LEU A CD2   1 
ATOM   1461 N  N     . ILE A 1 179 ? -40.777 46.060  17.013  1.00 15.69  ? 179 ILE A N     1 
ATOM   1462 C  CA    . ILE A 1 179 ? -40.207 46.841  18.078  1.00 17.21  ? 179 ILE A CA    1 
ATOM   1463 C  C     . ILE A 1 179 ? -40.919 46.462  19.355  1.00 19.37  ? 179 ILE A C     1 
ATOM   1464 O  O     . ILE A 1 179 ? -40.261 46.181  20.342  1.00 22.14  ? 179 ILE A O     1 
ATOM   1465 C  CB    . ILE A 1 179 ? -40.266 48.360  17.778  1.00 17.48  ? 179 ILE A CB    1 
ATOM   1466 C  CG1   . ILE A 1 179 ? -39.280 48.720  16.651  1.00 16.11  ? 179 ILE A CG1   1 
ATOM   1467 C  CG2   . ILE A 1 179 ? -40.034 49.217  19.049  1.00 20.67  ? 179 ILE A CG2   1 
ATOM   1468 C  CD1   . ILE A 1 179 ? -37.832 48.242  16.866  1.00 16.41  ? 179 ILE A CD1   1 
ATOM   1469 N  N     . VAL A 1 180 ? -42.249 46.384  19.344  1.00 18.94  ? 180 VAL A N     1 
ATOM   1470 C  CA    . VAL A 1 180 ? -42.938 45.928  20.556  1.00 21.40  ? 180 VAL A CA    1 
ATOM   1471 C  C     . VAL A 1 180 ? -42.489 44.532  20.960  1.00 22.77  ? 180 VAL A C     1 
ATOM   1472 O  O     . VAL A 1 180 ? -42.248 44.305  22.124  1.00 26.00  ? 180 VAL A O     1 
ATOM   1473 C  CB    . VAL A 1 180 ? -44.458 46.004  20.457  1.00 21.42  ? 180 VAL A CB    1 
ATOM   1474 C  CG1   . VAL A 1 180 ? -45.128 45.379  21.685  1.00 23.34  ? 180 VAL A CG1   1 
ATOM   1475 C  CG2   . VAL A 1 180 ? -44.879 47.431  20.314  1.00 21.41  ? 180 VAL A CG2   1 
ATOM   1476 N  N     . PHE A 1 181 ? -42.338 43.615  20.004  1.00 21.27  ? 181 PHE A N     1 
ATOM   1477 C  CA    . PHE A 1 181 ? -41.993 42.220  20.318  1.00 23.11  ? 181 PHE A CA    1 
ATOM   1478 C  C     . PHE A 1 181 ? -40.556 42.033  20.798  1.00 25.28  ? 181 PHE A C     1 
ATOM   1479 O  O     . PHE A 1 181 ? -40.264 41.119  21.594  1.00 28.02  ? 181 PHE A O     1 
ATOM   1480 C  CB    . PHE A 1 181 ? -42.271 41.294  19.125  1.00 20.99  ? 181 PHE A CB    1 
ATOM   1481 C  CG    . PHE A 1 181 ? -42.216 39.819  19.464  1.00 23.07  ? 181 PHE A CG    1 
ATOM   1482 C  CD1   . PHE A 1 181 ? -43.219 39.220  20.210  1.00 25.87  ? 181 PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A 1 181 ? -41.160 39.030  19.034  1.00 23.72  ? 181 PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A 1 181 ? -43.168 37.857  20.528  1.00 28.28  ? 181 PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A 1 181 ? -41.105 37.660  19.348  1.00 26.08  ? 181 PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A 1 181 ? -42.112 37.078  20.092  1.00 27.89  ? 181 PHE A CZ    1 
ATOM   1487 N  N     . TYR A 1 182 ? -39.666 42.898  20.315  1.00 24.61  ? 182 TYR A N     1 
ATOM   1488 C  CA    . TYR A 1 182 ? -38.226 42.692  20.484  1.00 26.65  ? 182 TYR A CA    1 
ATOM   1489 C  C     . TYR A 1 182 ? -37.543 43.723  21.385  1.00 29.46  ? 182 TYR A C     1 
ATOM   1490 O  O     . TYR A 1 182 ? -36.388 43.548  21.758  1.00 32.31  ? 182 TYR A O     1 
ATOM   1491 C  CB    . TYR A 1 182 ? -37.517 42.566  19.111  1.00 24.33  ? 182 TYR A CB    1 
ATOM   1492 C  CG    . TYR A 1 182 ? -37.627 41.178  18.479  1.00 23.63  ? 182 TYR A CG    1 
ATOM   1493 C  CD1   . TYR A 1 182 ? -37.124 40.061  19.140  1.00 26.46  ? 182 TYR A CD1   1 
ATOM   1494 C  CD2   . TYR A 1 182 ? -38.222 40.987  17.231  1.00 19.98  ? 182 TYR A CD2   1 
ATOM   1495 C  CE1   . TYR A 1 182 ? -37.212 38.796  18.599  1.00 26.15  ? 182 TYR A CE1   1 
ATOM   1496 C  CE2   . TYR A 1 182 ? -38.312 39.709  16.668  1.00 20.09  ? 182 TYR A CE2   1 
ATOM   1497 C  CZ    . TYR A 1 182 ? -37.803 38.617  17.373  1.00 24.09  ? 182 TYR A CZ    1 
ATOM   1498 O  OH    . TYR A 1 182 ? -37.872 37.326  16.886  1.00 25.23  ? 182 TYR A OH    1 
ATOM   1499 N  N     . GLY A 1 183 ? -38.260 44.778  21.755  1.00 29.71  ? 183 GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 183 ? -37.707 45.810  22.631  1.00 33.06  ? 183 GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 183 ? -37.140 47.021  21.903  1.00 32.23  ? 183 GLY A C     1 
ATOM   1502 O  O     . GLY A 1 183 ? -37.452 48.151  22.249  1.00 33.51  ? 183 GLY A O     1 
ATOM   1503 N  N     . SER A 1 184 ? -36.326 46.784  20.879  1.00 30.88  ? 184 SER A N     1 
ATOM   1504 C  CA    . SER A 1 184 ? -35.548 47.840  20.231  1.00 31.40  ? 184 SER A CA    1 
ATOM   1505 C  C     . SER A 1 184 ? -35.022 47.420  18.862  1.00 29.28  ? 184 SER A C     1 
ATOM   1506 O  O     . SER A 1 184 ? -34.843 46.230  18.599  1.00 28.90  ? 184 SER A O     1 
ATOM   1507 C  CB    . SER A 1 184 ? -34.350 48.199  21.117  1.00 36.06  ? 184 SER A CB    1 
ATOM   1508 O  OG    . SER A 1 184 ? -33.527 47.066  21.358  1.00 37.28  ? 184 SER A OG    1 
ATOM   1509 N  N     . PHE A 1 185 ? -34.732 48.397  18.006  1.00 28.93  ? 185 PHE A N     1 
ATOM   1510 C  CA    . PHE A 1 185 ? -34.104 48.119  16.708  1.00 27.62  ? 185 PHE A CA    1 
ATOM   1511 C  C     . PHE A 1 185 ? -32.990 47.081  16.789  1.00 29.36  ? 185 PHE A C     1 
ATOM   1512 O  O     . PHE A 1 185 ? -33.066 46.050  16.137  1.00 27.49  ? 185 PHE A O     1 
ATOM   1513 C  CB    . PHE A 1 185 ? -33.557 49.394  16.056  1.00 28.42  ? 185 PHE A CB    1 
ATOM   1514 C  CG    . PHE A 1 185 ? -32.734 49.125  14.821  1.00 27.96  ? 185 PHE A CG    1 
ATOM   1515 C  CD1   . PHE A 1 185 ? -31.380 49.396  14.802  1.00 30.89  ? 185 PHE A CD1   1 
ATOM   1516 C  CD2   . PHE A 1 185 ? -33.318 48.570  13.688  1.00 25.22  ? 185 PHE A CD2   1 
ATOM   1517 C  CE1   . PHE A 1 185 ? -30.627 49.137  13.674  1.00 30.57  ? 185 PHE A CE1   1 
ATOM   1518 C  CE2   . PHE A 1 185 ? -32.571 48.316  12.557  1.00 24.82  ? 185 PHE A CE2   1 
ATOM   1519 C  CZ    . PHE A 1 185 ? -31.218 48.597  12.554  1.00 27.42  ? 185 PHE A CZ    1 
ATOM   1520 N  N     . LEU A 1 186 ? -31.961 47.381  17.585  1.00 33.80  ? 186 LEU A N     1 
ATOM   1521 C  CA    . LEU A 1 186 ? -30.818 46.493  17.790  1.00 36.89  ? 186 LEU A CA    1 
ATOM   1522 C  C     . LEU A 1 186 ? -31.275 45.075  18.093  1.00 36.47  ? 186 LEU A C     1 
ATOM   1523 O  O     . LEU A 1 186 ? -30.902 44.139  17.386  1.00 36.14  ? 186 LEU A O     1 
ATOM   1524 C  CB    . LEU A 1 186 ? -29.923 47.001  18.926  1.00 42.07  ? 186 LEU A CB    1 
ATOM   1525 C  CG    . LEU A 1 186 ? -28.593 46.255  19.112  1.00 46.19  ? 186 LEU A CG    1 
ATOM   1526 C  CD1   . LEU A 1 186 ? -27.551 46.732  18.095  1.00 47.79  ? 186 LEU A CD1   1 
ATOM   1527 C  CD2   . LEU A 1 186 ? -28.056 46.394  20.532  1.00 51.13  ? 186 LEU A CD2   1 
ATOM   1528 N  N     . GLU A 1 187 ? -32.105 44.926  19.126  1.00 37.09  ? 187 GLU A N     1 
ATOM   1529 C  CA    . GLU A 1 187 ? -32.629 43.614  19.508  1.00 37.17  ? 187 GLU A CA    1 
ATOM   1530 C  C     . GLU A 1 187 ? -33.463 42.951  18.404  1.00 32.82  ? 187 GLU A C     1 
ATOM   1531 O  O     . GLU A 1 187 ? -33.491 41.727  18.296  1.00 33.20  ? 187 GLU A O     1 
ATOM   1532 C  CB    . GLU A 1 187 ? -33.441 43.706  20.797  1.00 39.00  ? 187 GLU A CB    1 
ATOM   1533 C  CG    . GLU A 1 187 ? -33.412 42.424  21.630  1.00 43.17  ? 187 GLU A CG    1 
ATOM   1534 C  CD    . GLU A 1 187 ? -32.003 42.062  22.141  1.00 50.07  ? 187 GLU A CD    1 
ATOM   1535 O  OE1   . GLU A 1 187 ? -31.767 40.858  22.391  1.00 53.18  ? 187 GLU A OE1   1 
ATOM   1536 O  OE2   . GLU A 1 187 ? -31.132 42.960  22.289  1.00 51.55  ? 187 GLU A OE2   1 
ATOM   1537 N  N     . THR A 1 188 ? -34.133 43.760  17.586  1.00 29.11  ? 188 THR A N     1 
ATOM   1538 C  CA    . THR A 1 188 ? -34.851 43.233  16.438  1.00 25.08  ? 188 THR A CA    1 
ATOM   1539 C  C     . THR A 1 188 ? -33.832 42.684  15.465  1.00 25.05  ? 188 THR A C     1 
ATOM   1540 O  O     . THR A 1 188 ? -33.989 41.588  14.966  1.00 24.76  ? 188 THR A O     1 
ATOM   1541 C  CB    . THR A 1 188 ? -35.733 44.293  15.744  1.00 22.31  ? 188 THR A CB    1 
ATOM   1542 O  OG1   . THR A 1 188 ? -36.744 44.756  16.648  1.00 21.64  ? 188 THR A OG1   1 
ATOM   1543 C  CG2   . THR A 1 188 ? -36.401 43.701  14.533  1.00 18.96  ? 188 THR A CG2   1 
ATOM   1544 N  N     . VAL A 1 189 ? -32.766 43.428  15.223  1.00 26.08  ? 189 VAL A N     1 
ATOM   1545 C  CA    . VAL A 1 189 ? -31.789 43.007  14.227  1.00 26.64  ? 189 VAL A CA    1 
ATOM   1546 C  C     . VAL A 1 189 ? -31.053 41.734  14.675  1.00 29.75  ? 189 VAL A C     1 
ATOM   1547 O  O     . VAL A 1 189 ? -30.866 40.793  13.878  1.00 29.46  ? 189 VAL A O     1 
ATOM   1548 C  CB    . VAL A 1 189 ? -30.824 44.152  13.888  1.00 27.67  ? 189 VAL A CB    1 
ATOM   1549 C  CG1   . VAL A 1 189 ? -29.583 43.640  13.179  1.00 30.08  ? 189 VAL A CG1   1 
ATOM   1550 C  CG2   . VAL A 1 189 ? -31.534 45.156  13.026  1.00 24.85  ? 189 VAL A CG2   1 
ATOM   1551 N  N     . LYS A 1 190 ? -30.671 41.717  15.957  1.00 32.55  ? 190 LYS A N     1 
ATOM   1552 C  CA    . LYS A 1 190 ? -29.935 40.614  16.557  1.00 35.96  ? 190 LYS A CA    1 
ATOM   1553 C  C     . LYS A 1 190 ? -30.732 39.317  16.488  1.00 35.26  ? 190 LYS A C     1 
ATOM   1554 O  O     . LYS A 1 190 ? -30.151 38.224  16.335  1.00 38.08  ? 190 LYS A O     1 
ATOM   1555 C  CB    . LYS A 1 190 ? -29.566 40.933  18.008  1.00 39.41  ? 190 LYS A CB    1 
ATOM   1556 C  CG    . LYS A 1 190 ? -28.203 41.561  18.152  1.00 42.91  ? 190 LYS A CG    1 
ATOM   1557 C  CD    . LYS A 1 190 ? -28.050 42.373  19.429  1.00 47.18  ? 190 LYS A CD    1 
ATOM   1558 C  CE    . LYS A 1 190 ? -27.362 41.588  20.553  1.00 53.67  ? 190 LYS A CE    1 
ATOM   1559 N  NZ    . LYS A 1 190 ? -26.973 42.457  21.711  1.00 57.94  ? 190 LYS A NZ    1 
ATOM   1560 N  N     . ASN A 1 191 ? -32.055 39.434  16.589  1.00 31.83  ? 191 ASN A N     1 
ATOM   1561 C  CA    . ASN A 1 191 ? -32.905 38.262  16.561  1.00 31.12  ? 191 ASN A CA    1 
ATOM   1562 C  C     . ASN A 1 191 ? -33.302 37.893  15.155  1.00 28.27  ? 191 ASN A C     1 
ATOM   1563 O  O     . ASN A 1 191 ? -33.225 36.726  14.770  1.00 29.70  ? 191 ASN A O     1 
ATOM   1564 C  CB    . ASN A 1 191 ? -34.112 38.467  17.447  1.00 30.45  ? 191 ASN A CB    1 
ATOM   1565 C  CG    . ASN A 1 191 ? -33.757 38.381  18.886  1.00 34.99  ? 191 ASN A CG    1 
ATOM   1566 O  OD1   . ASN A 1 191 ? -33.609 37.296  19.426  1.00 39.33  ? 191 ASN A OD1   1 
ATOM   1567 N  ND2   . ASN A 1 191 ? -33.574 39.526  19.522  1.00 37.72  ? 191 ASN A ND2   1 
ATOM   1568 N  N     . ALA A 1 192 ? -33.692 38.902  14.386  1.00 24.72  ? 192 ALA A N     1 
ATOM   1569 C  CA    . ALA A 1 192 ? -34.009 38.740  12.978  1.00 22.37  ? 192 ALA A CA    1 
ATOM   1570 C  C     . ALA A 1 192 ? -33.058 37.768  12.314  1.00 24.12  ? 192 ALA A C     1 
ATOM   1571 O  O     . ALA A 1 192 ? -33.480 36.945  11.532  1.00 24.51  ? 192 ALA A O     1 
ATOM   1572 C  CB    . ALA A 1 192 ? -33.964 40.082  12.272  1.00 20.31  ? 192 ALA A CB    1 
ATOM   1573 N  N     . ARG A 1 193 ? -31.785 37.848  12.669  1.00 26.37  ? 193 ARG A N     1 
ATOM   1574 C  CA    . ARG A 1 193 ? -30.730 37.000  12.106  1.00 29.03  ? 193 ARG A CA    1 
ATOM   1575 C  C     . ARG A 1 193 ? -30.986 35.499  12.102  1.00 30.83  ? 193 ARG A C     1 
ATOM   1576 O  O     . ARG A 1 193 ? -30.439 34.790  11.262  1.00 32.40  ? 193 ARG A O     1 
ATOM   1577 C  CB    . ARG A 1 193 ? -29.396 37.265  12.813  1.00 32.56  ? 193 ARG A CB    1 
ATOM   1578 C  CG    . ARG A 1 193 ? -28.849 38.666  12.588  1.00 31.11  ? 193 ARG A CG    1 
ATOM   1579 C  CD    . ARG A 1 193 ? -27.556 38.888  13.326  1.00 34.66  ? 193 ARG A CD    1 
ATOM   1580 N  NE    . ARG A 1 193 ? -27.550 38.281  14.658  1.00 35.61  ? 193 ARG A NE    1 
ATOM   1581 C  CZ    . ARG A 1 193 ? -26.623 38.513  15.582  1.00 37.45  ? 193 ARG A CZ    1 
ATOM   1582 N  NH1   . ARG A 1 193 ? -25.627 39.358  15.339  1.00 37.23  ? 193 ARG A NH1   1 
ATOM   1583 N  NH2   . ARG A 1 193 ? -26.704 37.902  16.754  1.00 39.44  ? 193 ARG A NH2   1 
ATOM   1584 N  N     . ARG A 1 194 ? -31.788 35.000  13.034  1.00 31.16  ? 194 ARG A N     1 
ATOM   1585 C  CA    . ARG A 1 194 ? -32.060 33.566  13.046  1.00 33.77  ? 194 ARG A CA    1 
ATOM   1586 C  C     . ARG A 1 194 ? -33.499 33.210  12.722  1.00 31.30  ? 194 ARG A C     1 
ATOM   1587 O  O     . ARG A 1 194 ? -33.967 32.133  13.087  1.00 33.78  ? 194 ARG A O     1 
ATOM   1588 C  CB    . ARG A 1 194 ? -31.562 32.880  14.328  1.00 38.00  ? 194 ARG A CB    1 
ATOM   1589 C  CG    . ARG A 1 194 ? -31.559 33.744  15.565  1.00 40.49  ? 194 ARG A CG    1 
ATOM   1590 C  CD    . ARG A 1 194 ? -30.469 33.290  16.555  1.00 50.13  ? 194 ARG A CD    1 
ATOM   1591 N  NE    . ARG A 1 194 ? -30.201 34.320  17.570  1.00 54.41  ? 194 ARG A NE    1 
ATOM   1592 C  CZ    . ARG A 1 194 ? -29.097 35.072  17.625  1.00 57.54  ? 194 ARG A CZ    1 
ATOM   1593 N  NH1   . ARG A 1 194 ? -28.122 34.898  16.730  1.00 59.82  ? 194 ARG A NH1   1 
ATOM   1594 N  NH2   . ARG A 1 194 ? -28.962 36.000  18.578  1.00 57.65  ? 194 ARG A NH2   1 
ATOM   1595 N  N     . TRP A 1 195 ? -34.183 34.103  12.010  1.00 26.99  ? 195 TRP A N     1 
ATOM   1596 C  CA    . TRP A 1 195 ? -35.512 33.815  11.480  1.00 25.47  ? 195 TRP A CA    1 
ATOM   1597 C  C     . TRP A 1 195 ? -35.440 32.779  10.362  1.00 27.20  ? 195 TRP A C     1 
ATOM   1598 O  O     . TRP A 1 195 ? -34.816 33.048  9.347   1.00 27.27  ? 195 TRP A O     1 
ATOM   1599 C  CB    . TRP A 1 195 ? -36.133 35.080  10.890  1.00 21.75  ? 195 TRP A CB    1 
ATOM   1600 C  CG    . TRP A 1 195 ? -36.594 36.101  11.878  1.00 20.28  ? 195 TRP A CG    1 
ATOM   1601 C  CD1   . TRP A 1 195 ? -36.705 35.951  13.226  1.00 22.26  ? 195 TRP A CD1   1 
ATOM   1602 C  CD2   . TRP A 1 195 ? -37.059 37.423  11.586  1.00 16.96  ? 195 TRP A CD2   1 
ATOM   1603 N  NE1   . TRP A 1 195 ? -37.183 37.107  13.799  1.00 20.35  ? 195 TRP A NE1   1 
ATOM   1604 C  CE2   . TRP A 1 195 ? -37.417 38.022  12.811  1.00 17.48  ? 195 TRP A CE2   1 
ATOM   1605 C  CE3   . TRP A 1 195 ? -37.200 38.158  10.411  1.00 15.01  ? 195 TRP A CE3   1 
ATOM   1606 C  CZ2   . TRP A 1 195 ? -37.900 39.328  12.896  1.00 15.73  ? 195 TRP A CZ2   1 
ATOM   1607 C  CZ3   . TRP A 1 195 ? -37.695 39.453  10.494  1.00 14.11  ? 195 TRP A CZ3   1 
ATOM   1608 C  CH2   . TRP A 1 195 ? -38.033 40.027  11.731  1.00 13.61  ? 195 TRP A CH2   1 
ATOM   1609 N  N     . THR A 1 196 ? -36.071 31.615  10.511  1.00 29.14  ? 196 THR A N     1 
ATOM   1610 C  CA    . THR A 1 196 ? -36.215 30.732  9.351   1.00 30.91  ? 196 THR A CA    1 
ATOM   1611 C  C     . THR A 1 196 ? -37.390 31.205  8.511   1.00 28.46  ? 196 THR A C     1 
ATOM   1612 O  O     . THR A 1 196 ? -38.086 32.140  8.879   1.00 25.71  ? 196 THR A O     1 
ATOM   1613 C  CB    . THR A 1 196 ? -36.434 29.226  9.697   1.00 35.58  ? 196 THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 196 ? -37.750 29.022  10.235  1.00 36.32  ? 196 THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 196 ? -35.362 28.678  10.646  1.00 38.40  ? 196 THR A CG2   1 
ATOM   1616 N  N     . ARG A 1 197 ? -37.617 30.543  7.383   1.00 30.46  ? 197 ARG A N     1 
ATOM   1617 C  CA    . ARG A 1 197 ? -38.794 30.810  6.555   1.00 29.34  ? 197 ARG A CA    1 
ATOM   1618 C  C     . ARG A 1 197 ? -40.087 30.274  7.177   1.00 31.36  ? 197 ARG A C     1 
ATOM   1619 O  O     . ARG A 1 197 ? -41.163 30.396  6.573   1.00 31.81  ? 197 ARG A O     1 
ATOM   1620 C  CB    . ARG A 1 197 ? -38.612 30.231  5.152   1.00 31.35  ? 197 ARG A CB    1 
ATOM   1621 C  CG    . ARG A 1 197 ? -38.740 28.721  5.024   1.00 33.65  ? 197 ARG A CG    1 
ATOM   1622 C  CD    . ARG A 1 197 ? -38.296 28.341  3.632   1.00 34.01  ? 197 ARG A CD    1 
ATOM   1623 N  NE    . ARG A 1 197 ? -36.870 28.631  3.449   1.00 33.70  ? 197 ARG A NE    1 
ATOM   1624 C  CZ    . ARG A 1 197 ? -36.242 28.748  2.279   1.00 33.89  ? 197 ARG A CZ    1 
ATOM   1625 N  NH1   . ARG A 1 197 ? -34.939 29.003  2.255   1.00 33.26  ? 197 ARG A NH1   1 
ATOM   1626 N  NH2   . ARG A 1 197 ? -36.907 28.618  1.137   1.00 34.67  ? 197 ARG A NH2   1 
ATOM   1627 N  N     . ARG A 1 198 ? -39.972 29.686  8.369   1.00 33.04  ? 198 ARG A N     1 
ATOM   1628 C  CA    . ARG A 1 198 ? -41.112 29.120  9.075   1.00 35.23  ? 198 ARG A CA    1 
ATOM   1629 C  C     . ARG A 1 198 ? -41.340 29.723  10.462  1.00 33.45  ? 198 ARG A C     1 
ATOM   1630 O  O     . ARG A 1 198 ? -42.204 29.260  11.209  1.00 35.43  ? 198 ARG A O     1 
ATOM   1631 C  CB    . ARG A 1 198 ? -40.951 27.615  9.166   1.00 40.69  ? 198 ARG A CB    1 
ATOM   1632 C  CG    . ARG A 1 198 ? -41.005 26.972  7.820   1.00 44.88  ? 198 ARG A CG    1 
ATOM   1633 C  CD    . ARG A 1 198 ? -40.804 25.493  7.918   1.00 54.90  ? 198 ARG A CD    1 
ATOM   1634 N  NE    . ARG A 1 198 ? -40.658 24.945  6.574   1.00 61.65  ? 198 ARG A NE    1 
ATOM   1635 C  CZ    . ARG A 1 198 ? -40.962 23.700  6.221   1.00 69.18  ? 198 ARG A CZ    1 
ATOM   1636 N  NH1   . ARG A 1 198 ? -41.440 22.830  7.117   1.00 72.78  ? 198 ARG A NH1   1 
ATOM   1637 N  NH2   . ARG A 1 198 ? -40.793 23.337  4.955   1.00 72.44  ? 198 ARG A NH2   1 
ATOM   1638 N  N     . THR A 1 199 ? -40.559 30.755  10.790  1.00 30.20  ? 199 THR A N     1 
ATOM   1639 C  CA    . THR A 1 199 ? -40.724 31.557  12.009  1.00 27.96  ? 199 THR A CA    1 
ATOM   1640 C  C     . THR A 1 199 ? -42.123 32.160  12.094  1.00 26.48  ? 199 THR A C     1 
ATOM   1641 O  O     . THR A 1 199 ? -42.511 32.954  11.247  1.00 23.79  ? 199 THR A O     1 
ATOM   1642 C  CB    . THR A 1 199 ? -39.693 32.710  12.051  1.00 24.88  ? 199 THR A CB    1 
ATOM   1643 O  OG1   . THR A 1 199 ? -38.378 32.170  11.877  1.00 27.39  ? 199 THR A OG1   1 
ATOM   1644 C  CG2   . THR A 1 199 ? -39.748 33.469  13.369  1.00 23.00  ? 199 THR A CG2   1 
ATOM   1645 N  N     . VAL A 1 200 ? -42.874 31.744  13.109  1.00 28.48  ? 200 VAL A N     1 
ATOM   1646 C  CA    . VAL A 1 200 ? -44.142 32.368  13.465  1.00 27.49  ? 200 VAL A CA    1 
ATOM   1647 C  C     . VAL A 1 200 ? -43.937 33.247  14.701  1.00 25.99  ? 200 VAL A C     1 
ATOM   1648 O  O     . VAL A 1 200 ? -43.539 32.755  15.767  1.00 28.19  ? 200 VAL A O     1 
ATOM   1649 C  CB    . VAL A 1 200 ? -45.219 31.300  13.755  1.00 31.80  ? 200 VAL A CB    1 
ATOM   1650 C  CG1   . VAL A 1 200 ? -46.360 31.887  14.585  1.00 32.06  ? 200 VAL A CG1   1 
ATOM   1651 C  CG2   . VAL A 1 200 ? -45.744 30.694  12.458  1.00 33.10  ? 200 VAL A CG2   1 
ATOM   1652 N  N     . ILE A 1 201 ? -44.205 34.540  14.557  1.00 22.56  ? 201 ILE A N     1 
ATOM   1653 C  CA    . ILE A 1 201 ? -44.023 35.489  15.652  1.00 21.44  ? 201 ILE A CA    1 
ATOM   1654 C  C     . ILE A 1 201 ? -45.358 35.991  16.186  1.00 22.71  ? 201 ILE A C     1 
ATOM   1655 O  O     . ILE A 1 201 ? -45.937 36.933  15.628  1.00 21.68  ? 201 ILE A O     1 
ATOM   1656 C  CB    . ILE A 1 201 ? -43.197 36.693  15.197  1.00 17.74  ? 201 ILE A CB    1 
ATOM   1657 C  CG1   . ILE A 1 201 ? -41.799 36.225  14.790  1.00 16.21  ? 201 ILE A CG1   1 
ATOM   1658 C  CG2   . ILE A 1 201 ? -43.180 37.771  16.304  1.00 17.37  ? 201 ILE A CG2   1 
ATOM   1659 C  CD1   . ILE A 1 201 ? -40.951 37.268  14.121  1.00 12.06  ? 201 ILE A CD1   1 
ATOM   1660 N  N     . ASP A 1 202 ? -45.841 35.385  17.269  1.00 25.94  ? 202 ASP A N     1 
ATOM   1661 C  CA    . ASP A 1 202 ? -47.164 35.718  17.809  1.00 27.49  ? 202 ASP A CA    1 
ATOM   1662 C  C     . ASP A 1 202 ? -47.055 36.803  18.871  1.00 27.04  ? 202 ASP A C     1 
ATOM   1663 O  O     . ASP A 1 202 ? -46.909 36.512  20.055  1.00 29.42  ? 202 ASP A O     1 
ATOM   1664 C  CB    . ASP A 1 202 ? -47.833 34.478  18.385  1.00 32.10  ? 202 ASP A CB    1 
ATOM   1665 C  CG    . ASP A 1 202 ? -49.309 34.677  18.653  1.00 35.07  ? 202 ASP A CG    1 
ATOM   1666 O  OD1   . ASP A 1 202 ? -49.788 35.829  18.697  1.00 33.13  ? 202 ASP A OD1   1 
ATOM   1667 O  OD2   . ASP A 1 202 ? -50.003 33.656  18.828  1.00 41.56  ? 202 ASP A OD2   1 
ATOM   1668 N  N     . VAL A 1 203 ? -47.146 38.056  18.429  1.00 24.27  ? 203 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 203 ? -46.881 39.210  19.290  1.00 23.77  ? 203 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 203 ? -47.732 39.166  20.526  1.00 26.81  ? 203 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 203 ? -47.201 39.153  21.627  1.00 29.28  ? 203 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 203 ? -47.147 40.548  18.573  1.00 21.57  ? 203 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 203 ? -46.424 41.692  19.286  1.00 19.91  ? 203 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 203 ? -46.733 40.446  17.087  1.00 19.78  ? 203 VAL A CG2   1 
ATOM   1675 N  N     . ALA A 1 204 ? -49.046 39.130  20.341  1.00 27.35  ? 204 ALA A N     1 
ATOM   1676 C  CA    . ALA A 1 204 ? -49.962 39.094  21.458  1.00 30.61  ? 204 ALA A CA    1 
ATOM   1677 C  C     . ALA A 1 204 ? -49.547 38.053  22.481  1.00 33.48  ? 204 ALA A C     1 
ATOM   1678 O  O     . ALA A 1 204 ? -49.485 38.368  23.647  1.00 36.17  ? 204 ALA A O     1 
ATOM   1679 C  CB    . ALA A 1 204 ? -51.391 38.871  20.990  1.00 32.58  ? 204 ALA A CB    1 
ATOM   1680 N  N     . LYS A 1 205 ? -49.222 36.836  22.052  1.00 33.90  ? 205 LYS A N     1 
ATOM   1681 C  CA    . LYS A 1 205 ? -48.853 35.751  22.975  1.00 37.68  ? 205 LYS A CA    1 
ATOM   1682 C  C     . LYS A 1 205 ? -47.395 35.782  23.471  1.00 37.20  ? 205 LYS A C     1 
ATOM   1683 O  O     . LYS A 1 205 ? -47.000 34.967  24.322  1.00 40.56  ? 205 LYS A O     1 
ATOM   1684 C  CB    . LYS A 1 205 ? -49.085 34.408  22.315  1.00 39.31  ? 205 LYS A CB    1 
ATOM   1685 C  CG    . LYS A 1 205 ? -50.501 33.919  22.278  1.00 43.84  ? 205 LYS A CG    1 
ATOM   1686 C  CD    . LYS A 1 205 ? -50.486 32.402  22.003  1.00 48.96  ? 205 LYS A CD    1 
ATOM   1687 C  CE    . LYS A 1 205 ? -51.648 31.943  21.133  1.00 51.51  ? 205 LYS A CE    1 
ATOM   1688 N  NZ    . LYS A 1 205 ? -52.955 32.152  21.821  1.00 56.71  ? 205 LYS A NZ    1 
ATOM   1689 N  N     . GLY A 1 206 ? -46.603 36.709  22.930  1.00 33.46  ? 206 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 206 ? -45.185 36.842  23.262  1.00 33.25  ? 206 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 206 ? -44.351 35.620  22.909  1.00 34.39  ? 206 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 206 ? -43.335 35.343  23.561  1.00 36.48  ? 206 GLY A O     1 
ATOM   1693 N  N     . GLU A 1 207 ? -44.774 34.909  21.862  1.00 33.52  ? 207 GLU A N     1 
ATOM   1694 C  CA    . GLU A 1 207 ? -44.256 33.588  21.513  1.00 35.81  ? 207 GLU A CA    1 
ATOM   1695 C  C     . GLU A 1 207 ? -43.539 33.572  20.153  1.00 32.30  ? 207 GLU A C     1 
ATOM   1696 O  O     . GLU A 1 207 ? -43.912 34.306  19.231  1.00 29.42  ? 207 GLU A O     1 
ATOM   1697 C  CB    . GLU A 1 207 ? -45.422 32.593  21.494  1.00 38.66  ? 207 GLU A CB    1 
ATOM   1698 C  CG    . GLU A 1 207 ? -45.032 31.118  21.679  1.00 44.14  ? 207 GLU A CG    1 
ATOM   1699 C  CD    . GLU A 1 207 ? -46.243 30.168  21.723  1.00 48.50  ? 207 GLU A CD    1 
ATOM   1700 O  OE1   . GLU A 1 207 ? -47.167 30.313  20.881  1.00 48.35  ? 207 GLU A OE1   1 
ATOM   1701 O  OE2   . GLU A 1 207 ? -46.263 29.264  22.603  1.00 55.62  ? 207 GLU A OE2   1 
ATOM   1702 N  N     . VAL A 1 208 ? -42.507 32.738  20.028  1.00 33.41  ? 208 VAL A N     1 
ATOM   1703 C  CA    . VAL A 1 208 ? -41.936 32.422  18.717  1.00 30.96  ? 208 VAL A CA    1 
ATOM   1704 C  C     . VAL A 1 208 ? -42.082 30.919  18.463  1.00 34.52  ? 208 VAL A C     1 
ATOM   1705 O  O     . VAL A 1 208 ? -41.751 30.091  19.305  1.00 37.95  ? 208 VAL A O     1 
ATOM   1706 C  CB    . VAL A 1 208 ? -40.479 32.903  18.575  1.00 29.53  ? 208 VAL A CB    1 
ATOM   1707 C  CG1   . VAL A 1 208 ? -40.112 33.065  17.113  1.00 25.70  ? 208 VAL A CG1   1 
ATOM   1708 C  CG2   . VAL A 1 208 ? -40.293 34.216  19.287  1.00 28.09  ? 208 VAL A CG2   1 
ATOM   1709 N  N     . ARG A 1 209 ? -42.586 30.589  17.284  1.00 34.01  ? 209 ARG A N     1 
ATOM   1710 C  CA    . ARG A 1 209 ? -43.142 29.273  17.005  1.00 38.51  ? 209 ARG A CA    1 
ATOM   1711 C  C     . ARG A 1 209 ? -42.639 28.843  15.638  1.00 38.35  ? 209 ARG A C     1 
ATOM   1712 O  O     . ARG A 1 209 ? -42.178 29.693  14.851  1.00 34.25  ? 209 ARG A O     1 
ATOM   1713 C  CB    . ARG A 1 209 ? -44.666 29.414  16.926  1.00 39.00  ? 209 ARG A CB    1 
ATOM   1714 C  CG    . ARG A 1 209 ? -45.505 28.427  17.708  1.00 44.04  ? 209 ARG A CG    1 
ATOM   1715 C  CD    . ARG A 1 209 ? -46.820 29.092  18.161  1.00 43.89  ? 209 ARG A CD    1 
ATOM   1716 N  NE    . ARG A 1 209 ? -47.716 29.426  17.047  1.00 43.50  ? 209 ARG A NE    1 
ATOM   1717 C  CZ    . ARG A 1 209 ? -48.625 30.410  17.044  1.00 41.86  ? 209 ARG A CZ    1 
ATOM   1718 N  NH1   . ARG A 1 209 ? -48.784 31.212  18.095  1.00 40.51  ? 209 ARG A NH1   1 
ATOM   1719 N  NH2   . ARG A 1 209 ? -49.378 30.597  15.965  1.00 41.16  ? 209 ARG A NH2   1 
ATOM   1720 N  N     . LYS A 1 210 ? -42.728 27.538  15.349  1.00 42.87  ? 210 LYS A N     1 
ATOM   1721 C  CA    . LYS A 1 210 ? -42.565 27.064  13.970  1.00 43.82  ? 210 LYS A CA    1 
ATOM   1722 C  C     . LYS A 1 210 ? -43.906 26.767  13.297  1.00 45.32  ? 210 LYS A C     1 
ATOM   1723 O  O     . LYS A 1 210 ? -44.682 25.970  13.803  1.00 49.99  ? 210 LYS A O     1 
ATOM   1724 C  CB    . LYS A 1 210 ? -41.616 25.876  13.879  1.00 47.82  ? 210 LYS A CB    1 
ATOM   1725 C  CG    . LYS A 1 210 ? -40.171 26.315  13.859  1.00 48.46  ? 210 LYS A CG    1 
ATOM   1726 C  CD    . LYS A 1 210 ? -39.328 25.527  12.856  1.00 55.55  ? 210 LYS A CD    1 
ATOM   1727 C  CE    . LYS A 1 210 ? -37.971 26.229  12.608  1.00 55.39  ? 210 LYS A CE    1 
ATOM   1728 N  NZ    . LYS A 1 210 ? -37.094 25.468  11.646  1.00 59.27  ? 210 LYS A NZ    1 
ATOM   1729 N  N     . GLY A 1 211 ? -44.181 27.418  12.170  1.00 42.45  ? 211 GLY A N     1 
ATOM   1730 C  CA    . GLY A 1 211 ? -45.391 27.152  11.401  1.00 44.37  ? 211 GLY A CA    1 
ATOM   1731 C  C     . GLY A 1 211 ? -45.084 26.778  9.966   1.00 45.50  ? 211 GLY A C     1 
ATOM   1732 O  O     . GLY A 1 211 ? -43.940 26.516  9.617   1.00 44.96  ? 211 GLY A O     1 
ATOM   1733 N  N     . GLU A 1 212 ? -46.121 26.766  9.134   1.00 47.62  ? 212 GLU A N     1 
ATOM   1734 C  CA    . GLU A 1 212 ? -46.010 26.419  7.716   1.00 49.88  ? 212 GLU A CA    1 
ATOM   1735 C  C     . GLU A 1 212 ? -45.184 27.414  6.942   1.00 45.36  ? 212 GLU A C     1 
ATOM   1736 O  O     . GLU A 1 212 ? -44.535 27.062  5.974   1.00 46.70  ? 212 GLU A O     1 
ATOM   1737 C  CB    . GLU A 1 212 ? -47.396 26.332  7.061   1.00 52.97  ? 212 GLU A CB    1 
ATOM   1738 C  CG    . GLU A 1 212 ? -48.287 25.197  7.566   1.00 61.29  ? 212 GLU A CG    1 
ATOM   1739 C  CD    . GLU A 1 212 ? -47.569 23.830  7.637   1.00 69.43  ? 212 GLU A CD    1 
ATOM   1740 O  OE1   . GLU A 1 212 ? -46.310 23.798  7.703   1.00 68.17  ? 212 GLU A OE1   1 
ATOM   1741 O  OE2   . GLU A 1 212 ? -48.272 22.786  7.644   1.00 76.30  ? 212 GLU A OE2   1 
ATOM   1742 N  N     . GLU A 1 213 ? -45.226 28.666  7.370   1.00 40.98  ? 213 GLU A N     1 
ATOM   1743 C  CA    . GLU A 1 213 ? -44.610 29.752  6.633   1.00 37.12  ? 213 GLU A CA    1 
ATOM   1744 C  C     . GLU A 1 213 ? -44.266 30.806  7.638   1.00 32.51  ? 213 GLU A C     1 
ATOM   1745 O  O     . GLU A 1 213 ? -44.696 30.718  8.791   1.00 32.86  ? 213 GLU A O     1 
ATOM   1746 C  CB    . GLU A 1 213 ? -45.631 30.353  5.694   1.00 37.41  ? 213 GLU A CB    1 
ATOM   1747 C  CG    . GLU A 1 213 ? -46.794 30.931  6.465   1.00 39.33  ? 213 GLU A CG    1 
ATOM   1748 C  CD    . GLU A 1 213 ? -47.981 31.238  5.612   1.00 44.42  ? 213 GLU A CD    1 
ATOM   1749 O  OE1   . GLU A 1 213 ? -47.817 31.377  4.384   1.00 46.83  ? 213 GLU A OE1   1 
ATOM   1750 O  OE2   . GLU A 1 213 ? -49.089 31.339  6.178   1.00 47.95  ? 213 GLU A OE2   1 
ATOM   1751 N  N     . PHE A 1 214 ? -43.515 31.812  7.190   1.00 28.52  ? 214 PHE A N     1 
ATOM   1752 C  CA    . PHE A 1 214 ? -43.270 33.008  7.983   1.00 24.15  ? 214 PHE A CA    1 
ATOM   1753 C  C     . PHE A 1 214 ? -44.635 33.632  8.230   1.00 23.12  ? 214 PHE A C     1 
ATOM   1754 O  O     . PHE A 1 214 ? -45.475 33.635  7.342   1.00 24.99  ? 214 PHE A O     1 
ATOM   1755 C  CB    . PHE A 1 214 ? -42.353 33.971  7.224   1.00 21.37  ? 214 PHE A CB    1 
ATOM   1756 C  CG    . PHE A 1 214 ? -41.792 35.072  8.080   1.00 19.28  ? 214 PHE A CG    1 
ATOM   1757 C  CD1   . PHE A 1 214 ? -40.762 34.815  8.987   1.00 20.09  ? 214 PHE A CD1   1 
ATOM   1758 C  CD2   . PHE A 1 214 ? -42.308 36.363  8.007   1.00 15.24  ? 214 PHE A CD2   1 
ATOM   1759 C  CE1   . PHE A 1 214 ? -40.274 35.841  9.798   1.00 16.91  ? 214 PHE A CE1   1 
ATOM   1760 C  CE2   . PHE A 1 214 ? -41.810 37.373  8.803   1.00 11.56  ? 214 PHE A CE2   1 
ATOM   1761 C  CZ    . PHE A 1 214 ? -40.805 37.117  9.696   1.00 12.87  ? 214 PHE A CZ    1 
ATOM   1762 N  N     . PHE A 1 215 ? -44.878 34.120  9.439   1.00 21.32  ? 215 PHE A N     1 
ATOM   1763 C  CA    . PHE A 1 215 ? -46.210 34.556  9.844   1.00 20.96  ? 215 PHE A CA    1 
ATOM   1764 C  C     . PHE A 1 215 ? -46.075 35.380  11.104  1.00 19.15  ? 215 PHE A C     1 
ATOM   1765 O  O     . PHE A 1 215 ? -45.609 34.889  12.130  1.00 20.27  ? 215 PHE A O     1 
ATOM   1766 C  CB    . PHE A 1 215 ? -47.087 33.339  10.120  1.00 24.68  ? 215 PHE A CB    1 
ATOM   1767 C  CG    . PHE A 1 215 ? -48.560 33.613  10.114  1.00 26.11  ? 215 PHE A CG    1 
ATOM   1768 C  CD1   . PHE A 1 215 ? -49.393 32.946  9.212   1.00 28.17  ? 215 PHE A CD1   1 
ATOM   1769 C  CD2   . PHE A 1 215 ? -49.135 34.501  11.026  1.00 25.92  ? 215 PHE A CD2   1 
ATOM   1770 C  CE1   . PHE A 1 215 ? -50.777 33.168  9.196   1.00 29.34  ? 215 PHE A CE1   1 
ATOM   1771 C  CE2   . PHE A 1 215 ? -50.531 34.731  11.021  1.00 27.87  ? 215 PHE A CE2   1 
ATOM   1772 C  CZ    . PHE A 1 215 ? -51.346 34.057  10.094  1.00 29.72  ? 215 PHE A CZ    1 
ATOM   1773 N  N     . VAL A 1 216 ? -46.453 36.647  11.014  1.00 17.03  ? 216 VAL A N     1 
ATOM   1774 C  CA    . VAL A 1 216 ? -46.554 37.516  12.185  1.00 15.94  ? 216 VAL A CA    1 
ATOM   1775 C  C     . VAL A 1 216 ? -48.038 37.626  12.531  1.00 18.06  ? 216 VAL A C     1 
ATOM   1776 O  O     . VAL A 1 216 ? -48.831 38.125  11.717  1.00 18.69  ? 216 VAL A O     1 
ATOM   1777 C  CB    . VAL A 1 216 ? -45.979 38.905  11.897  1.00 12.63  ? 216 VAL A CB    1 
ATOM   1778 C  CG1   . VAL A 1 216 ? -46.183 39.816  13.079  1.00 12.22  ? 216 VAL A CG1   1 
ATOM   1779 C  CG2   . VAL A 1 216 ? -44.514 38.802  11.548  1.00 10.75  ? 216 VAL A CG2   1 
ATOM   1780 N  N     . VAL A 1 217 ? -48.425 37.137  13.709  1.00 19.92  ? 217 VAL A N     1 
ATOM   1781 C  CA    . VAL A 1 217 ? -49.838 37.143  14.088  1.00 22.26  ? 217 VAL A CA    1 
ATOM   1782 C  C     . VAL A 1 217 ? -50.244 38.543  14.544  1.00 21.32  ? 217 VAL A C     1 
ATOM   1783 O  O     . VAL A 1 217 ? -49.676 39.081  15.506  1.00 20.31  ? 217 VAL A O     1 
ATOM   1784 C  CB    . VAL A 1 217 ? -50.172 36.093  15.169  1.00 25.59  ? 217 VAL A CB    1 
ATOM   1785 C  CG1   . VAL A 1 217 ? -51.637 36.158  15.539  1.00 27.86  ? 217 VAL A CG1   1 
ATOM   1786 C  CG2   . VAL A 1 217 ? -49.839 34.717  14.677  1.00 27.48  ? 217 VAL A CG2   1 
ATOM   1787 N  N     . ASP A 1 218 ? -51.203 39.128  13.823  1.00 21.80  ? 218 ASP A N     1 
ATOM   1788 C  CA    . ASP A 1 218 ? -51.811 40.389  14.208  1.00 22.01  ? 218 ASP A CA    1 
ATOM   1789 C  C     . ASP A 1 218 ? -52.479 40.275  15.579  1.00 25.10  ? 218 ASP A C     1 
ATOM   1790 O  O     . ASP A 1 218 ? -53.401 39.462  15.769  1.00 28.45  ? 218 ASP A O     1 
ATOM   1791 C  CB    . ASP A 1 218 ? -52.840 40.839  13.173  1.00 23.18  ? 218 ASP A CB    1 
ATOM   1792 C  CG    . ASP A 1 218 ? -53.127 42.336  13.234  1.00 22.18  ? 218 ASP A CG    1 
ATOM   1793 O  OD1   . ASP A 1 218 ? -52.853 42.985  14.260  1.00 21.79  ? 218 ASP A OD1   1 
ATOM   1794 O  OD2   . ASP A 1 218 ? -53.631 42.874  12.232  1.00 22.68  ? 218 ASP A OD2   1 
ATOM   1795 N  N     . PRO A 1 219 ? -52.013 41.101  16.542  1.00 24.27  ? 219 PRO A N     1 
ATOM   1796 C  CA    . PRO A 1 219 ? -52.563 41.089  17.900  1.00 27.29  ? 219 PRO A CA    1 
ATOM   1797 C  C     . PRO A 1 219 ? -54.067 41.301  17.861  1.00 30.56  ? 219 PRO A C     1 
ATOM   1798 O  O     . PRO A 1 219 ? -54.800 40.643  18.581  1.00 34.10  ? 219 PRO A O     1 
ATOM   1799 C  CB    . PRO A 1 219 ? -51.878 42.288  18.548  1.00 25.82  ? 219 PRO A CB    1 
ATOM   1800 C  CG    . PRO A 1 219 ? -50.580 42.427  17.797  1.00 21.57  ? 219 PRO A CG    1 
ATOM   1801 C  CD    . PRO A 1 219 ? -50.936 42.102  16.394  1.00 20.47  ? 219 PRO A CD    1 
ATOM   1802 N  N     . VAL A 1 220 ? -54.488 42.190  16.967  1.00 29.50  ? 220 VAL A N     1 
ATOM   1803 C  CA    . VAL A 1 220 ? -55.866 42.609  16.762  1.00 32.62  ? 220 VAL A CA    1 
ATOM   1804 C  C     . VAL A 1 220 ? -56.769 41.560  16.072  1.00 36.04  ? 220 VAL A C     1 
ATOM   1805 O  O     . VAL A 1 220 ? -57.982 41.558  16.251  1.00 40.30  ? 220 VAL A O     1 
ATOM   1806 C  CB    . VAL A 1 220 ? -55.821 43.918  15.957  1.00 30.45  ? 220 VAL A CB    1 
ATOM   1807 C  CG1   . VAL A 1 220 ? -57.020 44.090  15.063  1.00 32.76  ? 220 VAL A CG1   1 
ATOM   1808 C  CG2   . VAL A 1 220 ? -55.632 45.089  16.889  1.00 30.46  ? 220 VAL A CG2   1 
ATOM   1809 N  N     . ASP A 1 221 ? -56.180 40.676  15.277  1.00 35.05  ? 221 ASP A N     1 
ATOM   1810 C  CA    . ASP A 1 221 ? -56.932 39.660  14.539  1.00 38.52  ? 221 ASP A CA    1 
ATOM   1811 C  C     . ASP A 1 221 ? -55.951 38.532  14.295  1.00 37.40  ? 221 ASP A C     1 
ATOM   1812 O  O     . ASP A 1 221 ? -54.941 38.700  13.603  1.00 33.34  ? 221 ASP A O     1 
ATOM   1813 C  CB    . ASP A 1 221 ? -57.502 40.236  13.230  1.00 38.82  ? 221 ASP A CB    1 
ATOM   1814 C  CG    . ASP A 1 221 ? -57.872 39.167  12.194  1.00 42.16  ? 221 ASP A CG    1 
ATOM   1815 O  OD1   . ASP A 1 221 ? -57.909 37.957  12.523  1.00 46.18  ? 221 ASP A OD1   1 
ATOM   1816 O  OD2   . ASP A 1 221 ? -58.150 39.549  11.032  1.00 42.65  ? 221 ASP A OD2   1 
ATOM   1817 N  N     . GLU A 1 222 ? -56.257 37.385  14.894  1.00 41.59  ? 222 GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 222 ? -55.309 36.287  15.008  1.00 41.54  ? 222 GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 222 ? -55.126 35.563  13.700  1.00 41.86  ? 222 GLU A C     1 
ATOM   1820 O  O     . GLU A 1 222 ? -54.034 35.087  13.407  1.00 40.07  ? 222 GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 222 ? -55.735 35.311  16.093  1.00 46.00  ? 222 GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 222 ? -57.161 34.838  15.964  1.00 53.20  ? 222 GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 222 ? -57.395 33.478  16.603  1.00 59.54  ? 222 GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 222 ? -58.471 32.889  16.344  1.00 65.79  ? 222 GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 222 ? -56.513 33.001  17.352  1.00 58.23  ? 222 GLU A OE2   1 
ATOM   1826 N  N     . LYS A 1 223 ? -56.186 35.498  12.904  1.00 45.16  ? 223 LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 223 ? -56.114 34.895  11.584  1.00 46.02  ? 223 LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 223 ? -55.173 35.660  10.652  1.00 40.99  ? 223 LYS A C     1 
ATOM   1829 O  O     . LYS A 1 223 ? -54.673 35.098  9.705   1.00 40.92  ? 223 LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 223 ? -57.506 34.831  10.969  1.00 51.54  ? 223 LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 223 ? -58.625 34.390  11.915  1.00 57.85  ? 223 LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 223 ? -58.740 32.855  12.047  1.00 64.76  ? 223 LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 223 ? -60.033 32.483  12.795  1.00 71.35  ? 223 LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 223 ? -60.114 31.042  13.163  1.00 78.69  ? 223 LYS A NZ    1 
ATOM   1835 N  N     . ARG A 1 224 ? -54.917 36.931  10.949  1.00 37.77  ? 224 ARG A N     1 
ATOM   1836 C  CA    . ARG A 1 224 ? -54.191 37.860  10.066  1.00 34.06  ? 224 ARG A CA    1 
ATOM   1837 C  C     . ARG A 1 224 ? -52.661 37.746  10.107  1.00 30.33  ? 224 ARG A C     1 
ATOM   1838 O  O     . ARG A 1 224 ? -52.044 37.935  11.161  1.00 29.06  ? 224 ARG A O     1 
ATOM   1839 C  CB    . ARG A 1 224 ? -54.561 39.291  10.466  1.00 32.77  ? 224 ARG A CB    1 
ATOM   1840 C  CG    . ARG A 1 224 ? -54.658 40.273  9.331   1.00 32.51  ? 224 ARG A CG    1 
ATOM   1841 C  CD    . ARG A 1 224 ? -53.332 40.822  8.850   1.00 29.63  ? 224 ARG A CD    1 
ATOM   1842 N  NE    . ARG A 1 224 ? -53.335 40.936  7.389   1.00 30.78  ? 224 ARG A NE    1 
ATOM   1843 C  CZ    . ARG A 1 224 ? -52.526 41.730  6.701   1.00 28.91  ? 224 ARG A CZ    1 
ATOM   1844 N  NH1   . ARG A 1 224 ? -51.659 42.496  7.337   1.00 27.18  ? 224 ARG A NH1   1 
ATOM   1845 N  NH2   . ARG A 1 224 ? -52.589 41.768  5.382   1.00 30.44  ? 224 ARG A NH2   1 
ATOM   1846 N  N     . ASN A 1 225 ? -52.037 37.481  8.961   1.00 29.26  ? 225 ASN A N     1 
ATOM   1847 C  CA    . ASN A 1 225 ? -50.573 37.511  8.888   1.00 25.55  ? 225 ASN A CA    1 
ATOM   1848 C  C     . ASN A 1 225 ? -50.098 38.905  8.492   1.00 22.21  ? 225 ASN A C     1 
ATOM   1849 O  O     . ASN A 1 225 ? -50.269 39.343  7.347   1.00 22.19  ? 225 ASN A O     1 
ATOM   1850 C  CB    . ASN A 1 225 ? -50.031 36.462  7.910   1.00 26.65  ? 225 ASN A CB    1 
ATOM   1851 C  CG    . ASN A 1 225 ? -48.500 36.445  7.853   1.00 24.27  ? 225 ASN A CG    1 
ATOM   1852 O  OD1   . ASN A 1 225 ? -47.814 36.999  8.717   1.00 22.84  ? 225 ASN A OD1   1 
ATOM   1853 N  ND2   . ASN A 1 225 ? -47.966 35.812  6.828   1.00 24.71  ? 225 ASN A ND2   1 
ATOM   1854 N  N     . VAL A 1 226 ? -49.487 39.611  9.428   1.00 19.52  ? 226 VAL A N     1 
ATOM   1855 C  CA    . VAL A 1 226 ? -49.098 40.977  9.136   1.00 16.92  ? 226 VAL A CA    1 
ATOM   1856 C  C     . VAL A 1 226 ? -48.058 41.037  8.021   1.00 15.27  ? 226 VAL A C     1 
ATOM   1857 O  O     . VAL A 1 226 ? -47.967 42.042  7.279   1.00 14.59  ? 226 VAL A O     1 
ATOM   1858 C  CB    . VAL A 1 226 ? -48.578 41.699  10.356  1.00 15.14  ? 226 VAL A CB    1 
ATOM   1859 C  CG1   . VAL A 1 226 ? -48.571 43.187  10.079  1.00 13.62  ? 226 VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A 1 226 ? -49.448 41.369  11.562  1.00 17.56  ? 226 VAL A CG2   1 
ATOM   1861 N  N     . ALA A 1 227 ? -47.287 39.962  7.903   1.00 14.78  ? 227 ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 227 ? -46.245 39.913  6.907   1.00 13.59  ? 227 ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 227 ? -46.682 39.013  5.772   1.00 15.92  ? 227 ALA A C     1 
ATOM   1864 O  O     . ALA A 1 227 ? -45.858 38.310  5.186   1.00 17.01  ? 227 ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 227 ? -44.928 39.445  7.514   1.00 12.34  ? 227 ALA A CB    1 
ATOM   1866 N  N     . ALA A 1 228 ? -47.976 39.055  5.450   1.00 17.42  ? 228 ALA A N     1 
ATOM   1867 C  CA    . ALA A 1 228 ? -48.537 38.182  4.427   1.00 20.00  ? 228 ALA A CA    1 
ATOM   1868 C  C     . ALA A 1 228 ? -47.927 38.404  3.065   1.00 19.92  ? 228 ALA A C     1 
ATOM   1869 O  O     . ALA A 1 228 ? -47.787 37.456  2.312   1.00 23.27  ? 228 ALA A O     1 
ATOM   1870 C  CB    . ALA A 1 228 ? -50.028 38.303  4.360   1.00 22.42  ? 228 ALA A CB    1 
ATOM   1871 N  N     . ASN A 1 229 ? -47.541 39.635  2.752   1.00 17.67  ? 229 ASN A N     1 
ATOM   1872 C  CA    . ASN A 1 229 ? -47.051 39.971  1.411   1.00 18.43  ? 229 ASN A CA    1 
ATOM   1873 C  C     . ASN A 1 229 ? -45.533 40.207  1.338   1.00 15.95  ? 229 ASN A C     1 
ATOM   1874 O  O     . ASN A 1 229 ? -45.027 40.718  0.336   1.00 16.20  ? 229 ASN A O     1 
ATOM   1875 C  CB    . ASN A 1 229 ? -47.812 41.186  0.851   1.00 19.28  ? 229 ASN A CB    1 
ATOM   1876 C  CG    . ASN A 1 229 ? -47.725 41.296  -0.673  1.00 22.77  ? 229 ASN A CG    1 
ATOM   1877 O  OD1   . ASN A 1 229 ? -47.442 40.305  -1.363  1.00 27.72  ? 229 ASN A OD1   1 
ATOM   1878 N  ND2   . ASN A 1 229 ? -47.975 42.500  -1.205  1.00 21.47  ? 229 ASN A ND2   1 
ATOM   1879 N  N     . LEU A 1 230 ? -44.826 39.854  2.412   1.00 14.11  ? 230 LEU A N     1 
ATOM   1880 C  CA    . LEU A 1 230 ? -43.373 39.931  2.468   1.00 12.44  ? 230 LEU A CA    1 
ATOM   1881 C  C     . LEU A 1 230 ? -42.813 38.741  1.712   1.00 14.86  ? 230 LEU A C     1 
ATOM   1882 O  O     . LEU A 1 230 ? -42.904 37.608  2.184   1.00 16.24  ? 230 LEU A O     1 
ATOM   1883 C  CB    . LEU A 1 230 ? -42.896 39.857  3.917   1.00 10.61  ? 230 LEU A CB    1 
ATOM   1884 C  CG    . LEU A 1 230 ? -41.504 40.386  4.312   1.00 9.61   ? 230 LEU A CG    1 
ATOM   1885 C  CD1   . LEU A 1 230 ? -40.667 39.312  4.989   1.00 8.48   ? 230 LEU A CD1   1 
ATOM   1886 C  CD2   . LEU A 1 230 ? -40.726 41.042  3.161   1.00 10.13  ? 230 LEU A CD2   1 
ATOM   1887 N  N     . SER A 1 231 ? -42.224 39.001  0.550   1.00 15.96  ? 231 SER A N     1 
ATOM   1888 C  CA    . SER A 1 231 ? -41.678 37.950  -0.297  1.00 19.04  ? 231 SER A CA    1 
ATOM   1889 C  C     . SER A 1 231 ? -40.606 37.151  0.430   1.00 19.17  ? 231 SER A C     1 
ATOM   1890 O  O     . SER A 1 231 ? -39.796 37.715  1.171   1.00 17.07  ? 231 SER A O     1 
ATOM   1891 C  CB    . SER A 1 231 ? -41.082 38.548  -1.561  1.00 20.20  ? 231 SER A CB    1 
ATOM   1892 O  OG    . SER A 1 231 ? -39.774 39.039  -1.311  1.00 19.48  ? 231 SER A OG    1 
ATOM   1893 N  N     . LEU A 1 232 ? -40.603 35.836  0.205   1.00 22.38  ? 232 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1 232 ? -39.621 34.949  0.810   1.00 23.06  ? 232 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1 232 ? -38.234 35.472  0.514   1.00 23.20  ? 232 LEU A C     1 
ATOM   1896 O  O     . LEU A 1 232 ? -37.365 35.422  1.371   1.00 22.60  ? 232 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1 232 ? -39.778 33.537  0.269   1.00 26.89  ? 232 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1 232 ? -38.690 32.501  0.536   1.00 27.43  ? 232 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1 232 ? -38.632 32.145  2.003   1.00 25.63  ? 232 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1 232 ? -38.966 31.279  -0.289  1.00 30.50  ? 232 LEU A CD2   1 
ATOM   1901 N  N     . ASP A 1 233 ? -38.041 36.006  -0.693  1.00 24.87  ? 233 ASP A N     1 
ATOM   1902 C  CA    . ASP A 1 233 ? -36.769 36.647  -1.048  1.00 25.38  ? 233 ASP A CA    1 
ATOM   1903 C  C     . ASP A 1 233 ? -36.411 37.908  -0.257  1.00 22.07  ? 233 ASP A C     1 
ATOM   1904 O  O     . ASP A 1 233 ? -35.255 38.072  0.133   1.00 22.11  ? 233 ASP A O     1 
ATOM   1905 C  CB    . ASP A 1 233 ? -36.647 36.839  -2.550  1.00 27.73  ? 233 ASP A CB    1 
ATOM   1906 C  CG    . ASP A 1 233 ? -36.451 35.520  -3.264  1.00 33.72  ? 233 ASP A CG    1 
ATOM   1907 O  OD1   . ASP A 1 233 ? -35.992 34.567  -2.594  1.00 35.87  ? 233 ASP A OD1   1 
ATOM   1908 O  OD2   . ASP A 1 233 ? -36.760 35.415  -4.474  1.00 38.90  ? 233 ASP A OD2   1 
ATOM   1909 N  N     . ASN A 1 234 ? -37.387 38.765  0.018   1.00 19.92  ? 234 ASN A N     1 
ATOM   1910 C  CA    . ASN A 1 234 ? -37.122 39.930  0.849   1.00 17.74  ? 234 ASN A CA    1 
ATOM   1911 C  C     . ASN A 1 234 ? -36.928 39.584  2.311   1.00 17.10  ? 234 ASN A C     1 
ATOM   1912 O  O     . ASN A 1 234 ? -36.284 40.346  3.055   1.00 16.10  ? 234 ASN A O     1 
ATOM   1913 C  CB    . ASN A 1 234 ? -38.223 40.959  0.717   1.00 16.27  ? 234 ASN A CB    1 
ATOM   1914 C  CG    . ASN A 1 234 ? -38.128 41.736  -0.567  1.00 18.41  ? 234 ASN A CG    1 
ATOM   1915 O  OD1   . ASN A 1 234 ? -39.080 42.417  -0.960  1.00 18.78  ? 234 ASN A OD1   1 
ATOM   1916 N  ND2   . ASN A 1 234 ? -36.969 41.651  -1.236  1.00 19.84  ? 234 ASN A ND2   1 
ATOM   1917 N  N     . LEU A 1 235 ? -37.495 38.448  2.728   1.00 18.06  ? 235 LEU A N     1 
ATOM   1918 C  CA    . LEU A 1 235 ? -37.283 37.961  4.085   1.00 17.81  ? 235 LEU A CA    1 
ATOM   1919 C  C     . LEU A 1 235 ? -35.804 37.622  4.171   1.00 19.80  ? 235 LEU A C     1 
ATOM   1920 O  O     . LEU A 1 235 ? -35.113 38.041  5.110   1.00 19.17  ? 235 LEU A O     1 
ATOM   1921 C  CB    . LEU A 1 235 ? -38.147 36.726  4.383   1.00 19.45  ? 235 LEU A CB    1 
ATOM   1922 C  CG    . LEU A 1 235 ? -37.938 35.960  5.701   1.00 19.81  ? 235 LEU A CG    1 
ATOM   1923 C  CD1   . LEU A 1 235 ? -38.304 36.842  6.875   1.00 17.59  ? 235 LEU A CD1   1 
ATOM   1924 C  CD2   . LEU A 1 235 ? -38.732 34.667  5.749   1.00 21.65  ? 235 LEU A CD2   1 
ATOM   1925 N  N     . ALA A 1 236 ? -35.339 36.888  3.152   1.00 22.26  ? 236 ALA A N     1 
ATOM   1926 C  CA    . ALA A 1 236 ? -33.969 36.426  3.057   1.00 24.64  ? 236 ALA A CA    1 
ATOM   1927 C  C     . ALA A 1 236 ? -33.046 37.632  3.033   1.00 24.14  ? 236 ALA A C     1 
ATOM   1928 O  O     . ALA A 1 236 ? -32.120 37.704  3.853   1.00 25.43  ? 236 ALA A O     1 
ATOM   1929 C  CB    . ALA A 1 236 ? -33.785 35.583  1.824   1.00 27.53  ? 236 ALA A CB    1 
ATOM   1930 N  N     . ARG A 1 237 ? -33.317 38.588  2.131   1.00 22.80  ? 237 ARG A N     1 
ATOM   1931 C  CA    . ARG A 1 237 ? -32.563 39.844  2.068   1.00 22.18  ? 237 ARG A CA    1 
ATOM   1932 C  C     . ARG A 1 237 ? -32.459 40.494  3.447   1.00 20.30  ? 237 ARG A C     1 
ATOM   1933 O  O     . ARG A 1 237 ? -31.370 40.915  3.851   1.00 21.60  ? 237 ARG A O     1 
ATOM   1934 C  CB    . ARG A 1 237 ? -33.161 40.810  1.045   1.00 20.93  ? 237 ARG A CB    1 
ATOM   1935 C  CG    . ARG A 1 237 ? -32.856 40.427  -0.404  1.00 24.97  ? 237 ARG A CG    1 
ATOM   1936 C  CD    . ARG A 1 237 ? -33.687 41.188  -1.476  1.00 25.01  ? 237 ARG A CD    1 
ATOM   1937 N  NE    . ARG A 1 237 ? -33.416 40.651  -2.820  1.00 31.97  ? 237 ARG A NE    1 
ATOM   1938 C  CZ    . ARG A 1 237 ? -34.280 39.981  -3.597  1.00 34.43  ? 237 ARG A CZ    1 
ATOM   1939 N  NH1   . ARG A 1 237 ? -35.536 39.756  -3.226  1.00 33.03  ? 237 ARG A NH1   1 
ATOM   1940 N  NH2   . ARG A 1 237 ? -33.877 39.538  -4.781  1.00 38.13  ? 237 ARG A NH2   1 
ATOM   1941 N  N     . PHE A 1 238 ? -33.569 40.531  4.187   1.00 17.81  ? 238 PHE A N     1 
ATOM   1942 C  CA    . PHE A 1 238 ? -33.557 41.144  5.504   1.00 16.55  ? 238 PHE A CA    1 
ATOM   1943 C  C     . PHE A 1 238 ? -32.667 40.424  6.490   1.00 18.52  ? 238 PHE A C     1 
ATOM   1944 O  O     . PHE A 1 238 ? -31.852 41.067  7.144   1.00 19.77  ? 238 PHE A O     1 
ATOM   1945 C  CB    . PHE A 1 238 ? -34.954 41.307  6.092   1.00 14.73  ? 238 PHE A CB    1 
ATOM   1946 C  CG    . PHE A 1 238 ? -34.968 41.982  7.453   1.00 14.42  ? 238 PHE A CG    1 
ATOM   1947 C  CD1   . PHE A 1 238 ? -34.432 43.259  7.627   1.00 14.75  ? 238 PHE A CD1   1 
ATOM   1948 C  CD2   . PHE A 1 238 ? -35.528 41.345  8.559   1.00 15.11  ? 238 PHE A CD2   1 
ATOM   1949 C  CE1   . PHE A 1 238 ? -34.439 43.886  8.890   1.00 14.59  ? 238 PHE A CE1   1 
ATOM   1950 C  CE2   . PHE A 1 238 ? -35.545 41.971  9.829   1.00 14.46  ? 238 PHE A CE2   1 
ATOM   1951 C  CZ    . PHE A 1 238 ? -35.002 43.237  9.986   1.00 14.18  ? 238 PHE A CZ    1 
ATOM   1952 N  N     . VAL A 1 239 ? -32.800 39.101  6.620   1.00 19.78  ? 239 VAL A N     1 
ATOM   1953 C  CA    . VAL A 1 239 ? -31.957 38.399  7.602   1.00 21.63  ? 239 VAL A CA    1 
ATOM   1954 C  C     . VAL A 1 239 ? -30.491 38.469  7.198   1.00 24.18  ? 239 VAL A C     1 
ATOM   1955 O  O     . VAL A 1 239 ? -29.613 38.496  8.064   1.00 26.38  ? 239 VAL A O     1 
ATOM   1956 C  CB    . VAL A 1 239 ? -32.367 36.940  7.907   1.00 22.87  ? 239 VAL A CB    1 
ATOM   1957 C  CG1   . VAL A 1 239 ? -33.866 36.787  7.971   1.00 20.54  ? 239 VAL A CG1   1 
ATOM   1958 C  CG2   . VAL A 1 239 ? -31.751 35.991  6.921   1.00 26.10  ? 239 VAL A CG2   1 
ATOM   1959 N  N     . HIS A 1 240 ? -30.224 38.529  5.896   1.00 24.23  ? 240 HIS A N     1 
ATOM   1960 C  CA    . HIS A 1 240 ? -28.850 38.698  5.468   1.00 27.12  ? 240 HIS A CA    1 
ATOM   1961 C  C     . HIS A 1 240 ? -28.336 40.073  5.878   1.00 27.10  ? 240 HIS A C     1 
ATOM   1962 O  O     . HIS A 1 240 ? -27.265 40.170  6.475   1.00 29.59  ? 240 HIS A O     1 
ATOM   1963 C  CB    . HIS A 1 240 ? -28.663 38.452  3.971   1.00 28.07  ? 240 HIS A CB    1 
ATOM   1964 C  CG    . HIS A 1 240 ? -27.225 38.331  3.574   1.00 30.98  ? 240 HIS A CG    1 
ATOM   1965 N  ND1   . HIS A 1 240 ? -26.549 39.325  2.899   1.00 29.89  ? 240 HIS A ND1   1 
ATOM   1966 C  CD2   . HIS A 1 240 ? -26.321 37.349  3.802   1.00 34.10  ? 240 HIS A CD2   1 
ATOM   1967 C  CE1   . HIS A 1 240 ? -25.298 38.950  2.708   1.00 34.55  ? 240 HIS A CE1   1 
ATOM   1968 N  NE2   . HIS A 1 240 ? -25.133 37.758  3.248   1.00 36.75  ? 240 HIS A NE2   1 
ATOM   1969 N  N     . LEU A 1 241 ? -29.111 41.120  5.575   1.00 24.82  ? 241 LEU A N     1 
ATOM   1970 C  CA    . LEU A 1 241 ? -28.816 42.475  6.050   1.00 25.17  ? 241 LEU A CA    1 
ATOM   1971 C  C     . LEU A 1 241 ? -28.500 42.527  7.535   1.00 26.46  ? 241 LEU A C     1 
ATOM   1972 O  O     . LEU A 1 241 ? -27.567 43.235  7.940   1.00 29.18  ? 241 LEU A O     1 
ATOM   1973 C  CB    . LEU A 1 241 ? -29.974 43.445  5.798   1.00 22.30  ? 241 LEU A CB    1 
ATOM   1974 C  CG    . LEU A 1 241 ? -29.843 44.515  4.722   1.00 23.20  ? 241 LEU A CG    1 
ATOM   1975 C  CD1   . LEU A 1 241 ? -28.364 44.725  4.371   1.00 27.11  ? 241 LEU A CD1   1 
ATOM   1976 C  CD2   . LEU A 1 241 ? -30.649 44.103  3.498   1.00 22.57  ? 241 LEU A CD2   1 
ATOM   1977 N  N     . CYS A 1 242 ? -29.279 41.803  8.345   1.00 25.01  ? 242 CYS A N     1 
ATOM   1978 C  CA    . CYS A 1 242 ? -29.071 41.823  9.787   1.00 26.48  ? 242 CYS A CA    1 
ATOM   1979 C  C     . CYS A 1 242 ? -27.743 41.177  10.138  1.00 30.38  ? 242 CYS A C     1 
ATOM   1980 O  O     . CYS A 1 242 ? -26.942 41.764  10.850  1.00 32.67  ? 242 CYS A O     1 
ATOM   1981 C  CB    . CYS A 1 242 ? -30.213 41.139  10.522  1.00 25.01  ? 242 CYS A CB    1 
ATOM   1982 S  SG    . CYS A 1 242 ? -31.835 41.895  10.275  1.00 23.41  ? 242 CYS A SG    1 
ATOM   1983 N  N     . ARG A 1 243 ? -27.500 39.983  9.602   1.00 31.60  ? 243 ARG A N     1 
ATOM   1984 C  CA    . ARG A 1 243 ? -26.262 39.275  9.865   1.00 35.97  ? 243 ARG A CA    1 
ATOM   1985 C  C     . ARG A 1 243 ? -25.092 40.131  9.451   1.00 38.71  ? 243 ARG A C     1 
ATOM   1986 O  O     . ARG A 1 243 ? -24.056 40.146  10.111  1.00 42.97  ? 243 ARG A O     1 
ATOM   1987 C  CB    . ARG A 1 243 ? -26.214 37.946  9.122   1.00 37.04  ? 243 ARG A CB    1 
ATOM   1988 C  CG    . ARG A 1 243 ? -27.088 36.864  9.705   1.00 36.00  ? 243 ARG A CG    1 
ATOM   1989 C  CD    . ARG A 1 243 ? -27.165 35.684  8.749   1.00 37.06  ? 243 ARG A CD    1 
ATOM   1990 N  NE    . ARG A 1 243 ? -28.212 34.739  9.130   1.00 36.10  ? 243 ARG A NE    1 
ATOM   1991 C  CZ    . ARG A 1 243 ? -28.487 33.611  8.484   1.00 36.83  ? 243 ARG A CZ    1 
ATOM   1992 N  NH1   . ARG A 1 243 ? -27.800 33.273  7.407   1.00 39.41  ? 243 ARG A NH1   1 
ATOM   1993 N  NH2   . ARG A 1 243 ? -29.456 32.821  8.916   1.00 36.41  ? 243 ARG A NH2   1 
ATOM   1994 N  N     . GLU A 1 244 ? -25.261 40.861  8.361   1.00 37.25  ? 244 GLU A N     1 
ATOM   1995 C  CA    . GLU A 1 244 ? -24.161 41.661  7.851   1.00 40.65  ? 244 GLU A CA    1 
ATOM   1996 C  C     . GLU A 1 244 ? -23.893 42.885  8.690   1.00 41.53  ? 244 GLU A C     1 
ATOM   1997 O  O     . GLU A 1 244 ? -22.735 43.218  8.924   1.00 45.97  ? 244 GLU A O     1 
ATOM   1998 C  CB    . GLU A 1 244 ? -24.345 42.013  6.382   1.00 39.23  ? 244 GLU A CB    1 
ATOM   1999 C  CG    . GLU A 1 244 ? -23.570 41.063  5.499   1.00 43.41  ? 244 GLU A CG    1 
ATOM   2000 C  CD    . GLU A 1 244 ? -23.512 41.515  4.070   1.00 44.77  ? 244 GLU A CD    1 
ATOM   2001 O  OE1   . GLU A 1 244 ? -24.592 41.754  3.498   1.00 43.05  ? 244 GLU A OE1   1 
ATOM   2002 O  OE2   . GLU A 1 244 ? -22.396 41.620  3.511   1.00 48.86  ? 244 GLU A OE2   1 
ATOM   2003 N  N     . PHE A 1 245 ? -24.963 43.524  9.159   1.00 38.24  ? 245 PHE A N     1 
ATOM   2004 C  CA    . PHE A 1 245 ? -24.875 44.716  10.004  1.00 39.20  ? 245 PHE A CA    1 
ATOM   2005 C  C     . PHE A 1 245 ? -24.133 44.455  11.326  1.00 43.59  ? 245 PHE A C     1 
ATOM   2006 O  O     . PHE A 1 245 ? -23.387 45.305  11.806  1.00 47.20  ? 245 PHE A O     1 
ATOM   2007 C  CB    . PHE A 1 245 ? -26.276 45.276  10.264  1.00 34.34  ? 245 PHE A CB    1 
ATOM   2008 C  CG    . PHE A 1 245 ? -26.292 46.514  11.110  1.00 35.45  ? 245 PHE A CG    1 
ATOM   2009 C  CD1   . PHE A 1 245 ? -26.051 47.769  10.544  1.00 37.17  ? 245 PHE A CD1   1 
ATOM   2010 C  CD2   . PHE A 1 245 ? -26.562 46.439  12.473  1.00 35.36  ? 245 PHE A CD2   1 
ATOM   2011 C  CE1   . PHE A 1 245 ? -26.070 48.937  11.334  1.00 38.32  ? 245 PHE A CE1   1 
ATOM   2012 C  CE2   . PHE A 1 245 ? -26.582 47.595  13.263  1.00 36.86  ? 245 PHE A CE2   1 
ATOM   2013 C  CZ    . PHE A 1 245 ? -26.337 48.843  12.693  1.00 38.09  ? 245 PHE A CZ    1 
ATOM   2014 N  N     . MET A 1 246 ? -24.325 43.274  11.897  1.00 44.03  ? 246 MET A N     1 
ATOM   2015 C  CA    . MET A 1 246 ? -23.755 42.958  13.197  1.00 48.40  ? 246 MET A CA    1 
ATOM   2016 C  C     . MET A 1 246 ? -22.329 42.438  13.110  1.00 54.11  ? 246 MET A C     1 
ATOM   2017 O  O     . MET A 1 246 ? -21.649 42.355  14.128  1.00 58.86  ? 246 MET A O     1 
ATOM   2018 C  CB    . MET A 1 246 ? -24.628 41.946  13.917  1.00 46.81  ? 246 MET A CB    1 
ATOM   2019 C  CG    . MET A 1 246 ? -26.045 42.405  14.102  1.00 43.43  ? 246 MET A CG    1 
ATOM   2020 S  SD    . MET A 1 246 ? -26.303 42.952  15.778  1.00 49.40  ? 246 MET A SD    1 
ATOM   2021 C  CE    . MET A 1 246 ? -25.686 44.630  15.733  1.00 51.47  ? 246 MET A CE    1 
ATOM   2022 N  N     . GLU A 1 247 ? -21.878 42.059  11.916  1.00 54.47  ? 247 GLU A N     1 
ATOM   2023 C  CA    . GLU A 1 247 ? -20.465 41.734  11.727  1.00 60.61  ? 247 GLU A CA    1 
ATOM   2024 C  C     . GLU A 1 247 ? -19.703 43.038  11.615  1.00 62.57  ? 247 GLU A C     1 
ATOM   2025 O  O     . GLU A 1 247 ? -18.769 43.285  12.360  1.00 67.87  ? 247 GLU A O     1 
ATOM   2026 C  CB    . GLU A 1 247 ? -20.231 40.877  10.480  1.00 60.62  ? 247 GLU A CB    1 
ATOM   2027 C  CG    . GLU A 1 247 ? -20.624 39.396  10.617  1.00 61.79  ? 247 GLU A CG    1 
ATOM   2028 C  CD    . GLU A 1 247 ? -20.249 38.559  9.374   1.00 63.54  ? 247 GLU A CD    1 
ATOM   2029 O  OE1   . GLU A 1 247 ? -21.108 38.408  8.459   1.00 62.19  ? 247 GLU A OE1   1 
ATOM   2030 O  OE2   . GLU A 1 247 ? -19.093 38.065  9.307   1.00 70.98  ? 247 GLU A OE2   1 
ATOM   2031 N  N     . ALA A 1 248 ? -20.128 43.876  10.683  1.00 58.95  ? 248 ALA A N     1 
ATOM   2032 C  CA    . ALA A 1 248 ? -19.524 45.164  10.483  1.00 61.13  ? 248 ALA A CA    1 
ATOM   2033 C  C     . ALA A 1 248 ? -20.626 46.197  10.409  1.00 56.52  ? 248 ALA A C     1 
ATOM   2034 O  O     . ALA A 1 248 ? -21.191 46.402  9.344   1.00 53.01  ? 248 ALA A O     1 
ATOM   2035 C  CB    . ALA A 1 248 ? -18.717 45.167  9.214   1.00 63.35  ? 248 ALA A CB    1 
ATOM   2036 N  N     . PRO A 1 249 ? -20.949 46.837  11.552  1.00 57.08  ? 249 PRO A N     1 
ATOM   2037 C  CA    . PRO A 1 249 ? -21.865 47.984  11.655  1.00 54.07  ? 249 PRO A CA    1 
ATOM   2038 C  C     . PRO A 1 249 ? -21.339 49.177  10.877  1.00 56.28  ? 249 PRO A C     1 
ATOM   2039 O  O     . PRO A 1 249 ? -20.143 49.332  10.731  1.00 61.54  ? 249 PRO A O     1 
ATOM   2040 C  CB    . PRO A 1 249 ? -21.856 48.317  13.145  1.00 56.56  ? 249 PRO A CB    1 
ATOM   2041 C  CG    . PRO A 1 249 ? -21.377 47.086  13.819  1.00 59.11  ? 249 PRO A CG    1 
ATOM   2042 C  CD    . PRO A 1 249 ? -20.415 46.455  12.870  1.00 61.43  ? 249 PRO A CD    1 
ATOM   2043 N  N     . SER A 1 250 ? -22.236 50.018  10.396  1.00 53.09  ? 250 SER A N     1 
ATOM   2044 C  CA    . SER A 1 250 ? -21.890 51.032  9.427   1.00 55.05  ? 250 SER A CA    1 
ATOM   2045 C  C     . SER A 1 250 ? -23.085 51.958  9.266   1.00 51.75  ? 250 SER A C     1 
ATOM   2046 O  O     . SER A 1 250 ? -24.230 51.503  9.314   1.00 47.30  ? 250 SER A O     1 
ATOM   2047 C  CB    . SER A 1 250 ? -21.576 50.346  8.097   1.00 54.31  ? 250 SER A CB    1 
ATOM   2048 O  OG    . SER A 1 250 ? -21.690 51.237  7.006   1.00 54.79  ? 250 SER A OG    1 
ATOM   2049 N  N     . LEU A 1 251 ? -22.836 53.252  9.079   1.00 54.70  ? 251 LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 251 ? -23.921 54.187  8.776   1.00 52.02  ? 251 LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 251 ? -24.479 53.924  7.372   1.00 48.93  ? 251 LEU A C     1 
ATOM   2052 O  O     . LEU A 1 251 ? -25.560 54.405  7.026   1.00 45.94  ? 251 LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 251 ? -23.452 55.642  8.913   1.00 56.76  ? 251 LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 251 ? -24.515 56.735  9.122   1.00 55.26  ? 251 LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 251 ? -25.281 56.540  10.434  1.00 52.95  ? 251 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 251 ? -23.893 58.125  9.070   1.00 60.89  ? 251 LEU A CD2   1 
ATOM   2057 N  N     . GLY A 1 252 ? -23.734 53.145  6.583   1.00 50.21  ? 252 GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 252 ? -24.096 52.796  5.209   1.00 48.24  ? 252 GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 252 ? -25.453 52.135  5.069   1.00 42.94  ? 252 GLY A C     1 
ATOM   2060 O  O     . GLY A 1 252 ? -26.200 52.445  4.139   1.00 41.36  ? 252 GLY A O     1 
ATOM   2061 N  N     . PHE A 1 253 ? -25.775 51.234  5.995   1.00 40.84  ? 253 PHE A N     1 
ATOM   2062 C  CA    . PHE A 1 253 ? -27.039 50.503  5.989   1.00 36.37  ? 253 PHE A CA    1 
ATOM   2063 C  C     . PHE A 1 253 ? -28.249 51.427  6.090   1.00 34.18  ? 253 PHE A C     1 
ATOM   2064 O  O     . PHE A 1 253 ? -29.366 51.042  5.781   1.00 30.38  ? 253 PHE A O     1 
ATOM   2065 C  CB    . PHE A 1 253 ? -27.061 49.526  7.159   1.00 35.88  ? 253 PHE A CB    1 
ATOM   2066 C  CG    . PHE A 1 253 ? -26.074 48.398  7.033   1.00 39.00  ? 253 PHE A CG    1 
ATOM   2067 C  CD1   . PHE A 1 253 ? -24.718 48.595  7.322   1.00 44.10  ? 253 PHE A CD1   1 
ATOM   2068 C  CD2   . PHE A 1 253 ? -26.499 47.123  6.642   1.00 37.48  ? 253 PHE A CD2   1 
ATOM   2069 C  CE1   . PHE A 1 253 ? -23.797 47.543  7.210   1.00 46.36  ? 253 PHE A CE1   1 
ATOM   2070 C  CE2   . PHE A 1 253 ? -25.580 46.060  6.526   1.00 39.65  ? 253 PHE A CE2   1 
ATOM   2071 C  CZ    . PHE A 1 253 ? -24.231 46.274  6.810   1.00 43.59  ? 253 PHE A CZ    1 
ATOM   2072 N  N     . PHE A 1 254 ? -28.011 52.656  6.531   1.00 37.36  ? 254 PHE A N     1 
ATOM   2073 C  CA    . PHE A 1 254 ? -29.079 53.627  6.757   1.00 36.55  ? 254 PHE A CA    1 
ATOM   2074 C  C     . PHE A 1 254 ? -29.117 54.710  5.696   1.00 38.35  ? 254 PHE A C     1 
ATOM   2075 O  O     . PHE A 1 254 ? -30.050 55.502  5.684   1.00 38.19  ? 254 PHE A O     1 
ATOM   2076 C  CB    . PHE A 1 254 ? -28.983 54.269  8.163   1.00 38.42  ? 254 PHE A CB    1 
ATOM   2077 C  CG    . PHE A 1 254 ? -29.181 53.288  9.297   1.00 36.87  ? 254 PHE A CG    1 
ATOM   2078 C  CD1   . PHE A 1 254 ? -28.101 52.595  9.832   1.00 38.85  ? 254 PHE A CD1   1 
ATOM   2079 C  CD2   . PHE A 1 254 ? -30.444 53.051  9.815   1.00 33.34  ? 254 PHE A CD2   1 
ATOM   2080 C  CE1   . PHE A 1 254 ? -28.280 51.689  10.856  1.00 37.55  ? 254 PHE A CE1   1 
ATOM   2081 C  CE2   . PHE A 1 254 ? -30.630 52.144  10.843  1.00 31.74  ? 254 PHE A CE2   1 
ATOM   2082 C  CZ    . PHE A 1 254 ? -29.547 51.465  11.362  1.00 34.40  ? 254 PHE A CZ    1 
ATOM   2083 N  N     . LYS A 1 255 ? -28.112 54.773  4.831   1.00 41.16  ? 255 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 255 ? -28.183 55.686  3.706   1.00 43.42  ? 255 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 255 ? -28.598 54.845  2.507   1.00 41.50  ? 255 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 255 ? -28.110 53.733  2.355   1.00 41.02  ? 255 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 255 ? -26.834 56.343  3.421   1.00 48.96  ? 255 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 255 ? -26.220 57.239  4.504   1.00 53.72  ? 255 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 255 ? -25.305 58.297  3.831   1.00 61.52  ? 255 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 255 ? -23.868 58.303  4.377   1.00 67.47  ? 255 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 255 ? -23.761 59.044  5.672   1.00 71.93  ? 255 LYS A NZ    1 
ATOM   2092 N  N     . PRO A 1 256 ? -29.496 55.363  1.646   1.00 41.15  ? 256 PRO A N     1 
ATOM   2093 C  CA    . PRO A 1 256 ? -29.940 54.625  0.456   1.00 40.20  ? 256 PRO A CA    1 
ATOM   2094 C  C     . PRO A 1 256 ? -28.893 54.628  -0.661  1.00 44.47  ? 256 PRO A C     1 
ATOM   2095 O  O     . PRO A 1 256 ? -28.077 55.544  -0.737  1.00 48.63  ? 256 PRO A O     1 
ATOM   2096 C  CB    . PRO A 1 256 ? -31.170 55.416  -0.005  1.00 39.27  ? 256 PRO A CB    1 
ATOM   2097 C  CG    . PRO A 1 256 ? -31.450 56.411  1.070   1.00 39.28  ? 256 PRO A CG    1 
ATOM   2098 C  CD    . PRO A 1 256 ? -30.158 56.671  1.737   1.00 42.01  ? 256 PRO A CD    1 
ATOM   2099 N  N     . LYS A 1 257 ? -28.914 53.618  -1.524  1.00 44.39  ? 257 LYS A N     1 
ATOM   2100 C  CA    . LYS A 1 257 ? -27.987 53.585  -2.657  1.00 48.90  ? 257 LYS A CA    1 
ATOM   2101 C  C     . LYS A 1 257 ? -28.729 53.982  -3.937  1.00 49.90  ? 257 LYS A C     1 
ATOM   2102 O  O     . LYS A 1 257 ? -29.950 53.856  -4.024  1.00 47.12  ? 257 LYS A O     1 
ATOM   2103 C  CB    . LYS A 1 257 ? -27.290 52.218  -2.795  1.00 48.95  ? 257 LYS A CB    1 
ATOM   2104 C  CG    . LYS A 1 257 ? -26.802 51.612  -1.454  1.00 48.99  ? 257 LYS A CG    1 
ATOM   2105 C  CD    . LYS A 1 257 ? -25.932 50.341  -1.584  1.00 49.99  ? 257 LYS A CD    1 
ATOM   2106 C  CE    . LYS A 1 257 ? -24.463 50.708  -1.822  1.00 56.17  ? 257 LYS A CE    1 
ATOM   2107 N  NZ    . LYS A 1 257 ? -23.513 49.593  -1.554  1.00 58.51  ? 257 LYS A NZ    1 
ATOM   2108 N  N     . HIS A 1 258 ? -27.988 54.488  -4.916  1.00 54.80  ? 258 HIS A N     1 
ATOM   2109 C  CA    . HIS A 1 258 ? -28.575 54.967  -6.158  1.00 57.04  ? 258 HIS A CA    1 
ATOM   2110 C  C     . HIS A 1 258 ? -27.811 54.388  -7.325  1.00 60.37  ? 258 HIS A C     1 
ATOM   2111 O  O     . HIS A 1 258 ? -26.591 54.283  -7.257  1.00 63.13  ? 258 HIS A O     1 
ATOM   2112 C  CB    . HIS A 1 258 ? -28.578 56.502  -6.207  1.00 60.29  ? 258 HIS A CB    1 
ATOM   2113 C  CG    . HIS A 1 258 ? -29.446 57.129  -5.156  1.00 59.64  ? 258 HIS A CG    1 
ATOM   2114 N  ND1   . HIS A 1 258 ? -28.953 57.989  -4.194  1.00 62.57  ? 258 HIS A ND1   1 
ATOM   2115 C  CD2   . HIS A 1 258 ? -30.771 56.990  -4.892  1.00 57.19  ? 258 HIS A CD2   1 
ATOM   2116 C  CE1   . HIS A 1 258 ? -29.939 58.369  -3.398  1.00 59.90  ? 258 HIS A CE1   1 
ATOM   2117 N  NE2   . HIS A 1 258 ? -31.052 57.777  -3.799  1.00 57.16  ? 258 HIS A NE2   1 
ATOM   2118 N  N     . PRO A 1 259 ? -28.529 53.987  -8.391  1.00 60.68  ? 259 PRO A N     1 
ATOM   2119 C  CA    . PRO A 1 259 ? -27.895 53.469  -9.593  1.00 64.71  ? 259 PRO A CA    1 
ATOM   2120 C  C     . PRO A 1 259 ? -26.947 54.507  -10.157 1.00 70.49  ? 259 PRO A C     1 
ATOM   2121 O  O     . PRO A 1 259 ? -27.259 55.701  -10.131 1.00 71.98  ? 259 PRO A O     1 
ATOM   2122 C  CB    . PRO A 1 259 ? -29.071 53.279  -10.549 1.00 64.35  ? 259 PRO A CB    1 
ATOM   2123 C  CG    . PRO A 1 259 ? -30.241 53.099  -9.669  1.00 59.19  ? 259 PRO A CG    1 
ATOM   2124 C  CD    . PRO A 1 259 ? -29.996 54.002  -8.519  1.00 57.88  ? 259 PRO A CD    1 
ATOM   2125 N  N     . LEU A 1 260 ? -25.786 54.065  -10.629 1.00 68.75  ? 260 LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 260 ? -24.842 54.963  -11.270 1.00 73.95  ? 260 LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 260 ? -25.182 55.052  -12.736 1.00 73.34  ? 260 LEU A C     1 
ATOM   2128 O  O     . LEU A 1 260 ? -25.565 54.048  -13.348 1.00 67.99  ? 260 LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 260 ? -23.414 54.477  -11.073 1.00 74.89  ? 260 LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 260 ? -22.530 55.320  -10.163 1.00 80.73  ? 260 LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 260 ? -23.323 56.021  -9.086  1.00 82.57  ? 260 LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 260 ? -21.430 54.484  -9.559  1.00 79.76  ? 260 LEU A CD2   1 
ATOM   2133 N  N     . GLU A 1 261 ? -25.077 56.261  -13.289 1.00 79.69  ? 261 GLU A N     1 
ATOM   2134 C  CA    . GLU A 1 261 ? -25.295 56.473  -14.724 1.00 80.86  ? 261 GLU A CA    1 
ATOM   2135 C  C     . GLU A 1 261 ? -24.233 55.674  -15.466 1.00 80.16  ? 261 GLU A C     1 
ATOM   2136 O  O     . GLU A 1 261 ? -23.054 56.028  -15.440 1.00 84.87  ? 261 GLU A O     1 
ATOM   2137 C  CB    . GLU A 1 261 ? -25.202 57.962  -15.094 1.00 88.36  ? 261 GLU A CB    1 
ATOM   2138 C  CG    . GLU A 1 261 ? -26.210 58.884  -14.378 1.00 92.06  ? 261 GLU A CG    1 
ATOM   2139 C  CD    . GLU A 1 261 ? -25.582 60.188  -13.835 1.00 102.23 ? 261 GLU A CD    1 
ATOM   2140 O  OE1   . GLU A 1 261 ? -26.308 60.951  -13.147 1.00 105.26 ? 261 GLU A OE1   1 
ATOM   2141 O  OE2   . GLU A 1 261 ? -24.374 60.449  -14.081 1.00 106.57 ? 261 GLU A OE2   1 
ATOM   2142 N  N     . ILE A 1 262 ? -24.652 54.577  -16.092 1.00 75.02  ? 262 ILE A N     1 
ATOM   2143 C  CA    . ILE A 1 262 ? -23.721 53.671  -16.763 1.00 74.23  ? 262 ILE A CA    1 
ATOM   2144 C  C     . ILE A 1 262 ? -23.784 53.815  -18.286 1.00 75.74  ? 262 ILE A C     1 
ATOM   2145 O  O     . ILE A 1 262 ? -24.871 53.794  -18.874 1.00 73.25  ? 262 ILE A O     1 
ATOM   2146 C  CB    . ILE A 1 262 ? -23.922 52.205  -16.300 1.00 68.02  ? 262 ILE A CB    1 
ATOM   2147 C  CG1   . ILE A 1 262 ? -23.333 51.218  -17.314 1.00 66.23  ? 262 ILE A CG1   1 
ATOM   2148 C  CG2   . ILE A 1 262 ? -25.400 51.924  -16.041 1.00 63.93  ? 262 ILE A CG2   1 
ATOM   2149 C  CD1   . ILE A 1 262 ? -22.537 50.100  -16.683 1.00 64.98  ? 262 ILE A CD1   1 
ATOM   2150 N  N     . GLU A 1 263 ? -22.603 53.978  -18.897 1.00 80.57  ? 263 GLU A N     1 
ATOM   2151 C  CA    . GLU A 1 263 ? -22.433 54.162  -20.352 1.00 83.65  ? 263 GLU A CA    1 
ATOM   2152 C  C     . GLU A 1 263 ? -22.996 52.971  -21.131 1.00 78.45  ? 263 GLU A C     1 
ATOM   2153 O  O     . GLU A 1 263 ? -22.721 51.814  -20.783 1.00 74.57  ? 263 GLU A O     1 
ATOM   2154 C  CB    . GLU A 1 263 ? -20.951 54.346  -20.743 1.00 88.94  ? 263 GLU A CB    1 
ATOM   2155 C  CG    . GLU A 1 263 ? -20.076 55.133  -19.762 1.00 94.41  ? 263 GLU A CG    1 
ATOM   2156 C  CD    . GLU A 1 263 ? -19.457 54.264  -18.654 1.00 91.68  ? 263 GLU A CD    1 
ATOM   2157 O  OE1   . GLU A 1 263 ? -18.209 54.155  -18.605 1.00 95.03  ? 263 GLU A OE1   1 
ATOM   2158 O  OE2   . GLU A 1 263 ? -20.213 53.701  -17.825 1.00 85.68  ? 263 GLU A OE2   1 
ATOM   2159 N  N     . PRO A 1 264 ? -23.761 53.244  -22.207 1.00 79.17  ? 264 PRO A N     1 
ATOM   2160 C  CA    . PRO A 1 264 ? -24.245 52.153  -23.065 1.00 74.94  ? 264 PRO A CA    1 
ATOM   2161 C  C     . PRO A 1 264 ? -23.066 51.364  -23.659 1.00 75.85  ? 264 PRO A C     1 
ATOM   2162 O  O     . PRO A 1 264 ? -23.246 50.253  -24.171 1.00 72.12  ? 264 PRO A O     1 
ATOM   2163 C  CB    . PRO A 1 264 ? -25.028 52.888  -24.164 1.00 77.75  ? 264 PRO A CB    1 
ATOM   2164 C  CG    . PRO A 1 264 ? -24.488 54.312  -24.142 1.00 85.02  ? 264 PRO A CG    1 
ATOM   2165 C  CD    . PRO A 1 264 ? -24.180 54.571  -22.702 1.00 84.44  ? 264 PRO A CD    1 
ATOM   2166 N  N     . GLU A 1 265 ? -21.873 51.958  -23.563 1.00 81.11  ? 265 GLU A N     1 
ATOM   2167 C  CA    . GLU A 1 265 ? -20.635 51.358  -24.039 1.00 83.04  ? 265 GLU A CA    1 
ATOM   2168 C  C     . GLU A 1 265 ? -20.046 50.363  -23.051 1.00 79.33  ? 265 GLU A C     1 
ATOM   2169 O  O     . GLU A 1 265 ? -19.677 49.255  -23.446 1.00 77.22  ? 265 GLU A O     1 
ATOM   2170 C  CB    . GLU A 1 265 ? -19.601 52.435  -24.373 1.00 91.13  ? 265 GLU A CB    1 
ATOM   2171 C  CG    . GLU A 1 265 ? -18.499 51.952  -25.308 1.00 94.64  ? 265 GLU A CG    1 
ATOM   2172 C  CD    . GLU A 1 265 ? -18.981 51.727  -26.739 1.00 95.72  ? 265 GLU A CD    1 
ATOM   2173 O  OE1   . GLU A 1 265 ? -20.120 51.235  -26.940 1.00 90.60  ? 265 GLU A OE1   1 
ATOM   2174 O  OE2   . GLU A 1 265 ? -18.207 52.036  -27.673 1.00 102.43 ? 265 GLU A OE2   1 
ATOM   2175 N  N     . ARG A 1 266 ? -19.952 50.750  -21.777 1.00 78.85  ? 266 ARG A N     1 
ATOM   2176 C  CA    . ARG A 1 266 ? -19.442 49.828  -20.766 1.00 75.72  ? 266 ARG A CA    1 
ATOM   2177 C  C     . ARG A 1 266 ? -20.308 48.575  -20.666 1.00 68.41  ? 266 ARG A C     1 
ATOM   2178 O  O     . ARG A 1 266 ? -19.780 47.469  -20.562 1.00 66.67  ? 266 ARG A O     1 
ATOM   2179 C  CB    . ARG A 1 266 ? -19.278 50.480  -19.390 1.00 77.45  ? 266 ARG A CB    1 
ATOM   2180 C  CG    . ARG A 1 266 ? -18.308 49.715  -18.468 1.00 78.35  ? 266 ARG A CG    1 
ATOM   2181 C  CD    . ARG A 1 266 ? -18.612 49.958  -16.990 1.00 80.43  ? 266 ARG A CD    1 
ATOM   2182 N  NE    . ARG A 1 266 ? -18.031 48.938  -16.105 1.00 80.90  ? 266 ARG A NE    1 
ATOM   2183 C  CZ    . ARG A 1 266 ? -18.348 48.772  -14.814 1.00 80.43  ? 266 ARG A CZ    1 
ATOM   2184 N  NH1   . ARG A 1 266 ? -19.246 49.561  -14.218 1.00 80.01  ? 266 ARG A NH1   1 
ATOM   2185 N  NH2   . ARG A 1 266 ? -17.764 47.805  -14.109 1.00 79.47  ? 266 ARG A NH2   1 
ATOM   2186 N  N     . LEU A 1 267 ? -21.627 48.721  -20.719 1.00 64.41  ? 267 LEU A N     1 
ATOM   2187 C  CA    . LEU A 1 267 ? -22.445 47.527  -20.559 1.00 58.05  ? 267 LEU A CA    1 
ATOM   2188 C  C     . LEU A 1 267 ? -22.642 46.756  -21.860 1.00 56.21  ? 267 LEU A C     1 
ATOM   2189 O  O     . LEU A 1 267 ? -23.088 45.614  -21.841 1.00 52.26  ? 267 LEU A O     1 
ATOM   2190 C  CB    . LEU A 1 267 ? -23.744 47.780  -19.768 1.00 55.04  ? 267 LEU A CB    1 
ATOM   2191 C  CG    . LEU A 1 267 ? -25.082 48.110  -20.416 1.00 53.61  ? 267 LEU A CG    1 
ATOM   2192 C  CD1   . LEU A 1 267 ? -26.185 47.983  -19.387 1.00 49.94  ? 267 LEU A CD1   1 
ATOM   2193 C  CD2   . LEU A 1 267 ? -25.077 49.499  -21.009 1.00 58.40  ? 267 LEU A CD2   1 
ATOM   2194 N  N     . ARG A 1 268 ? -22.270 47.360  -22.983 1.00 59.62  ? 268 ARG A N     1 
ATOM   2195 C  CA    . ARG A 1 268 ? -22.108 46.584  -24.213 1.00 59.33  ? 268 ARG A CA    1 
ATOM   2196 C  C     . ARG A 1 268 ? -21.023 45.540  -23.954 1.00 58.49  ? 268 ARG A C     1 
ATOM   2197 O  O     . ARG A 1 268 ? -21.237 44.347  -24.177 1.00 55.32  ? 268 ARG A O     1 
ATOM   2198 C  CB    . ARG A 1 268 ? -21.704 47.480  -25.391 1.00 65.13  ? 268 ARG A CB    1 
ATOM   2199 C  CG    . ARG A 1 268 ? -21.728 46.785  -26.766 1.00 66.37  ? 268 ARG A CG    1 
ATOM   2200 C  CD    . ARG A 1 268 ? -20.724 47.405  -27.746 1.00 73.28  ? 268 ARG A CD    1 
ATOM   2201 N  NE    . ARG A 1 268 ? -19.381 46.839  -27.599 1.00 75.55  ? 268 ARG A NE    1 
ATOM   2202 C  CZ    . ARG A 1 268 ? -18.361 47.432  -26.976 1.00 79.03  ? 268 ARG A CZ    1 
ATOM   2203 N  NH1   . ARG A 1 268 ? -17.183 46.820  -26.897 1.00 80.19  ? 268 ARG A NH1   1 
ATOM   2204 N  NH2   . ARG A 1 268 ? -18.505 48.633  -26.431 1.00 81.12  ? 268 ARG A NH2   1 
ATOM   2205 N  N     . LYS A 1 269 ? -19.878 46.016  -23.456 1.00 61.14  ? 269 LYS A N     1 
ATOM   2206 C  CA    . LYS A 1 269 ? -18.715 45.190  -23.147 1.00 61.39  ? 269 LYS A CA    1 
ATOM   2207 C  C     . LYS A 1 269 ? -19.020 44.144  -22.089 1.00 55.58  ? 269 LYS A C     1 
ATOM   2208 O  O     . LYS A 1 269 ? -18.548 43.018  -22.182 1.00 54.58  ? 269 LYS A O     1 
ATOM   2209 C  CB    . LYS A 1 269 ? -17.541 46.053  -22.680 1.00 66.29  ? 269 LYS A CB    1 
ATOM   2210 C  CG    . LYS A 1 269 ? -17.115 47.124  -23.668 1.00 73.21  ? 269 LYS A CG    1 
ATOM   2211 C  CD    . LYS A 1 269 ? -15.857 47.893  -23.217 1.00 79.82  ? 269 LYS A CD    1 
ATOM   2212 C  CE    . LYS A 1 269 ? -16.167 49.094  -22.285 1.00 83.57  ? 269 LYS A CE    1 
ATOM   2213 N  NZ    . LYS A 1 269 ? -16.268 50.404  -23.015 1.00 89.51  ? 269 LYS A NZ    1 
ATOM   2214 N  N     . ILE A 1 270 ? -19.804 44.520  -21.085 1.00 52.18  ? 270 ILE A N     1 
ATOM   2215 C  CA    . ILE A 1 270 ? -20.176 43.600  -20.013 1.00 47.58  ? 270 ILE A CA    1 
ATOM   2216 C  C     . ILE A 1 270 ? -21.026 42.467  -20.556 1.00 43.63  ? 270 ILE A C     1 
ATOM   2217 O  O     . ILE A 1 270 ? -20.794 41.297  -20.235 1.00 41.83  ? 270 ILE A O     1 
ATOM   2218 C  CB    . ILE A 1 270 ? -20.948 44.307  -18.884 1.00 46.02  ? 270 ILE A CB    1 
ATOM   2219 C  CG1   . ILE A 1 270 ? -20.010 45.187  -18.063 1.00 49.65  ? 270 ILE A CG1   1 
ATOM   2220 C  CG2   . ILE A 1 270 ? -21.608 43.293  -17.982 1.00 41.81  ? 270 ILE A CG2   1 
ATOM   2221 C  CD1   . ILE A 1 270 ? -20.729 46.123  -17.133 1.00 49.51  ? 270 ILE A CD1   1 
ATOM   2222 N  N     . VAL A 1 271 ? -22.008 42.821  -21.382 1.00 42.43  ? 271 VAL A N     1 
ATOM   2223 C  CA    . VAL A 1 271 ? -22.900 41.824  -21.956 1.00 39.31  ? 271 VAL A CA    1 
ATOM   2224 C  C     . VAL A 1 271 ? -22.146 40.879  -22.866 1.00 41.04  ? 271 VAL A C     1 
ATOM   2225 O  O     . VAL A 1 271 ? -22.360 39.680  -22.796 1.00 39.76  ? 271 VAL A O     1 
ATOM   2226 C  CB    . VAL A 1 271 ? -24.086 42.436  -22.713 1.00 38.25  ? 271 VAL A CB    1 
ATOM   2227 C  CG1   . VAL A 1 271 ? -24.782 41.383  -23.560 1.00 35.34  ? 271 VAL A CG1   1 
ATOM   2228 C  CG2   . VAL A 1 271 ? -25.058 43.040  -21.734 1.00 36.13  ? 271 VAL A CG2   1 
ATOM   2229 N  N     . GLU A 1 272 ? -21.271 41.404  -23.718 1.00 44.95  ? 272 GLU A N     1 
ATOM   2230 C  CA    . GLU A 1 272 ? -20.549 40.531  -24.626 1.00 47.05  ? 272 GLU A CA    1 
ATOM   2231 C  C     . GLU A 1 272 ? -19.542 39.677  -23.881 1.00 47.25  ? 272 GLU A C     1 
ATOM   2232 O  O     . GLU A 1 272 ? -19.373 38.517  -24.219 1.00 47.13  ? 272 GLU A O     1 
ATOM   2233 C  CB    . GLU A 1 272 ? -19.937 41.271  -25.819 1.00 51.66  ? 272 GLU A CB    1 
ATOM   2234 C  CG    . GLU A 1 272 ? -18.987 42.405  -25.503 1.00 56.30  ? 272 GLU A CG    1 
ATOM   2235 C  CD    . GLU A 1 272 ? -18.152 42.809  -26.722 1.00 62.45  ? 272 GLU A CD    1 
ATOM   2236 O  OE1   . GLU A 1 272 ? -18.402 43.896  -27.299 1.00 66.79  ? 272 GLU A OE1   1 
ATOM   2237 O  OE2   . GLU A 1 272 ? -17.249 42.029  -27.110 1.00 65.34  ? 272 GLU A OE2   1 
ATOM   2238 N  N     . GLU A 1 273 ? -18.911 40.235  -22.850 1.00 48.24  ? 273 GLU A N     1 
ATOM   2239 C  CA    . GLU A 1 273 ? -18.052 39.457  -21.950 1.00 48.69  ? 273 GLU A CA    1 
ATOM   2240 C  C     . GLU A 1 273 ? -18.803 38.226  -21.422 1.00 44.69  ? 273 GLU A C     1 
ATOM   2241 O  O     . GLU A 1 273 ? -18.274 37.117  -21.473 1.00 45.71  ? 273 GLU A O     1 
ATOM   2242 C  CB    . GLU A 1 273 ? -17.578 40.311  -20.773 1.00 50.12  ? 273 GLU A CB    1 
ATOM   2243 C  CG    . GLU A 1 273 ? -16.315 39.812  -20.090 1.00 54.64  ? 273 GLU A CG    1 
ATOM   2244 C  CD    . GLU A 1 273 ? -15.091 40.660  -20.436 1.00 63.17  ? 273 GLU A CD    1 
ATOM   2245 O  OE1   . GLU A 1 273 ? -15.106 41.872  -20.115 1.00 65.86  ? 273 GLU A OE1   1 
ATOM   2246 O  OE2   . GLU A 1 273 ? -14.110 40.126  -21.017 1.00 67.06  ? 273 GLU A OE2   1 
ATOM   2247 N  N     . ARG A 1 274 ? -20.028 38.433  -20.923 1.00 40.58  ? 274 ARG A N     1 
ATOM   2248 C  CA    . ARG A 1 274 ? -20.902 37.352  -20.460 1.00 36.77  ? 274 ARG A CA    1 
ATOM   2249 C  C     . ARG A 1 274 ? -21.330 36.449  -21.604 1.00 36.43  ? 274 ARG A C     1 
ATOM   2250 O  O     . ARG A 1 274 ? -21.557 35.253  -21.414 1.00 35.78  ? 274 ARG A O     1 
ATOM   2251 C  CB    . ARG A 1 274 ? -22.169 37.926  -19.867 1.00 33.79  ? 274 ARG A CB    1 
ATOM   2252 C  CG    . ARG A 1 274 ? -21.997 38.768  -18.636 1.00 34.26  ? 274 ARG A CG    1 
ATOM   2253 C  CD    . ARG A 1 274 ? -23.357 39.089  -18.059 1.00 30.40  ? 274 ARG A CD    1 
ATOM   2254 N  NE    . ARG A 1 274 ? -23.382 38.783  -16.642 1.00 30.49  ? 274 ARG A NE    1 
ATOM   2255 C  CZ    . ARG A 1 274 ? -24.403 38.214  -16.013 1.00 29.54  ? 274 ARG A CZ    1 
ATOM   2256 N  NH1   . ARG A 1 274 ? -25.493 37.872  -16.675 1.00 26.86  ? 274 ARG A NH1   1 
ATOM   2257 N  NH2   . ARG A 1 274 ? -24.329 37.979  -14.711 1.00 31.27  ? 274 ARG A NH2   1 
ATOM   2258 N  N     . GLY A 1 275 ? -21.467 37.050  -22.785 1.00 37.43  ? 275 GLY A N     1 
ATOM   2259 C  CA    . GLY A 1 275 ? -21.904 36.373  -23.998 1.00 37.54  ? 275 GLY A CA    1 
ATOM   2260 C  C     . GLY A 1 275 ? -23.312 35.827  -23.923 1.00 34.55  ? 275 GLY A C     1 
ATOM   2261 O  O     . GLY A 1 275 ? -23.563 34.704  -24.342 1.00 35.14  ? 275 GLY A O     1 
ATOM   2262 N  N     . THR A 1 276 ? -24.242 36.606  -23.394 1.00 31.90  ? 276 THR A N     1 
ATOM   2263 C  CA    . THR A 1 276 ? -25.605 36.118  -23.270 1.00 29.19  ? 276 THR A CA    1 
ATOM   2264 C  C     . THR A 1 276 ? -26.500 36.877  -24.222 1.00 29.11  ? 276 THR A C     1 
ATOM   2265 O  O     . THR A 1 276 ? -26.137 37.964  -24.693 1.00 31.11  ? 276 THR A O     1 
ATOM   2266 C  CB    . THR A 1 276 ? -26.162 36.292  -21.843 1.00 26.84  ? 276 THR A CB    1 
ATOM   2267 O  OG1   . THR A 1 276 ? -26.040 37.659  -21.436 1.00 27.25  ? 276 THR A OG1   1 
ATOM   2268 C  CG2   . THR A 1 276 ? -25.436 35.417  -20.851 1.00 26.88  ? 276 THR A CG2   1 
ATOM   2269 N  N     . ALA A 1 277 ? -27.665 36.299  -24.510 1.00 27.43  ? 277 ALA A N     1 
ATOM   2270 C  CA    . ALA A 1 277 ? -28.746 37.023  -25.164 1.00 26.60  ? 277 ALA A CA    1 
ATOM   2271 C  C     . ALA A 1 277 ? -29.446 37.840  -24.096 1.00 24.48  ? 277 ALA A C     1 
ATOM   2272 O  O     . ALA A 1 277 ? -30.036 37.284  -23.163 1.00 22.89  ? 277 ALA A O     1 
ATOM   2273 C  CB    . ALA A 1 277 ? -29.727 36.063  -25.811 1.00 26.04  ? 277 ALA A CB    1 
ATOM   2274 N  N     . VAL A 1 278 ? -29.358 39.158  -24.206 1.00 24.91  ? 278 VAL A N     1 
ATOM   2275 C  CA    . VAL A 1 278 ? -30.200 40.014  -23.383 1.00 22.89  ? 278 VAL A CA    1 
ATOM   2276 C  C     . VAL A 1 278 ? -31.053 40.933  -24.256 1.00 23.52  ? 278 VAL A C     1 
ATOM   2277 O  O     . VAL A 1 278 ? -30.560 41.604  -25.158 1.00 26.16  ? 278 VAL A O     1 
ATOM   2278 C  CB    . VAL A 1 278 ? -29.414 40.767  -22.269 1.00 23.04  ? 278 VAL A CB    1 
ATOM   2279 C  CG1   . VAL A 1 278 ? -28.127 41.270  -22.776 1.00 25.77  ? 278 VAL A CG1   1 
ATOM   2280 C  CG2   . VAL A 1 278 ? -30.222 41.915  -21.727 1.00 22.54  ? 278 VAL A CG2   1 
ATOM   2281 N  N     . PHE A 1 279 ? -32.347 40.921  -23.976 1.00 21.51  ? 279 PHE A N     1 
ATOM   2282 C  CA    . PHE A 1 279 ? -33.329 41.686  -24.708 1.00 21.92  ? 279 PHE A CA    1 
ATOM   2283 C  C     . PHE A 1 279 ? -34.463 41.963  -23.746 1.00 20.17  ? 279 PHE A C     1 
ATOM   2284 O  O     . PHE A 1 279 ? -34.557 41.333  -22.685 1.00 18.80  ? 279 PHE A O     1 
ATOM   2285 C  CB    . PHE A 1 279 ? -33.858 40.858  -25.877 1.00 22.35  ? 279 PHE A CB    1 
ATOM   2286 C  CG    . PHE A 1 279 ? -34.468 39.538  -25.458 1.00 20.07  ? 279 PHE A CG    1 
ATOM   2287 C  CD1   . PHE A 1 279 ? -35.815 39.456  -25.108 1.00 17.53  ? 279 PHE A CD1   1 
ATOM   2288 C  CD2   . PHE A 1 279 ? -33.691 38.383  -25.407 1.00 19.76  ? 279 PHE A CD2   1 
ATOM   2289 C  CE1   . PHE A 1 279 ? -36.374 38.255  -24.721 1.00 15.78  ? 279 PHE A CE1   1 
ATOM   2290 C  CE2   . PHE A 1 279 ? -34.240 37.171  -25.008 1.00 17.85  ? 279 PHE A CE2   1 
ATOM   2291 C  CZ    . PHE A 1 279 ? -35.582 37.106  -24.666 1.00 17.26  ? 279 PHE A CZ    1 
ATOM   2292 N  N     . ALA A 1 280 ? -35.333 42.889  -24.125 1.00 20.97  ? 280 ALA A N     1 
ATOM   2293 C  CA    . ALA A 1 280 ? -36.538 43.198  -23.350 1.00 19.44  ? 280 ALA A CA    1 
ATOM   2294 C  C     . ALA A 1 280 ? -37.745 43.118  -24.260 1.00 19.59  ? 280 ALA A C     1 
ATOM   2295 O  O     . ALA A 1 280 ? -37.604 43.177  -25.493 1.00 21.41  ? 280 ALA A O     1 
ATOM   2296 C  CB    . ALA A 1 280 ? -36.445 44.598  -22.744 1.00 20.84  ? 280 ALA A CB    1 
ATOM   2297 N  N     . VAL A 1 281 ? -38.932 42.979  -23.675 1.00 17.59  ? 281 VAL A N     1 
ATOM   2298 C  CA    . VAL A 1 281 ? -40.124 43.307  -24.453 1.00 18.28  ? 281 VAL A CA    1 
ATOM   2299 C  C     . VAL A 1 281 ? -40.665 44.667  -24.026 1.00 18.78  ? 281 VAL A C     1 
ATOM   2300 O  O     . VAL A 1 281 ? -40.895 44.908  -22.834 1.00 17.90  ? 281 VAL A O     1 
ATOM   2301 C  CB    . VAL A 1 281 ? -41.192 42.154  -24.579 1.00 17.34  ? 281 VAL A CB    1 
ATOM   2302 C  CG1   . VAL A 1 281 ? -40.897 41.034  -23.641 1.00 16.16  ? 281 VAL A CG1   1 
ATOM   2303 C  CG2   . VAL A 1 281 ? -42.619 42.680  -24.386 1.00 17.44  ? 281 VAL A CG2   1 
ATOM   2304 N  N     . LYS A 1 282 ? -40.806 45.556  -25.011 1.00 20.17  ? 282 LYS A N     1 
ATOM   2305 C  CA    . LYS A 1 282 ? -41.248 46.910  -24.762 1.00 21.47  ? 282 LYS A CA    1 
ATOM   2306 C  C     . LYS A 1 282 ? -42.685 47.072  -25.196 1.00 22.35  ? 282 LYS A C     1 
ATOM   2307 O  O     . LYS A 1 282 ? -43.032 46.784  -26.350 1.00 23.99  ? 282 LYS A O     1 
ATOM   2308 C  CB    . LYS A 1 282 ? -40.388 47.914  -25.512 1.00 24.30  ? 282 LYS A CB    1 
ATOM   2309 C  CG    . LYS A 1 282 ? -40.708 49.313  -25.107 1.00 27.31  ? 282 LYS A CG    1 
ATOM   2310 C  CD    . LYS A 1 282 ? -40.384 50.296  -26.200 1.00 33.33  ? 282 LYS A CD    1 
ATOM   2311 C  CE    . LYS A 1 282 ? -40.246 51.712  -25.640 1.00 35.93  ? 282 LYS A CE    1 
ATOM   2312 N  NZ    . LYS A 1 282 ? -39.307 52.489  -26.489 1.00 40.73  ? 282 LYS A NZ    1 
ATOM   2313 N  N     . PHE A 1 283 ? -43.512 47.551  -24.271 1.00 21.50  ? 283 PHE A N     1 
ATOM   2314 C  CA    . PHE A 1 283 ? -44.910 47.837  -24.549 1.00 22.18  ? 283 PHE A CA    1 
ATOM   2315 C  C     . PHE A 1 283 ? -45.455 49.032  -23.722 1.00 24.06  ? 283 PHE A C     1 
ATOM   2316 O  O     . PHE A 1 283 ? -44.889 49.412  -22.689 1.00 23.52  ? 283 PHE A O     1 
ATOM   2317 C  CB    . PHE A 1 283 ? -45.735 46.574  -24.322 1.00 19.66  ? 283 PHE A CB    1 
ATOM   2318 C  CG    . PHE A 1 283 ? -45.794 46.146  -22.895 1.00 16.93  ? 283 PHE A CG    1 
ATOM   2319 C  CD1   . PHE A 1 283 ? -46.840 46.559  -22.081 1.00 16.70  ? 283 PHE A CD1   1 
ATOM   2320 C  CD2   . PHE A 1 283 ? -44.806 45.336  -22.360 1.00 14.80  ? 283 PHE A CD2   1 
ATOM   2321 C  CE1   . PHE A 1 283 ? -46.894 46.187  -20.765 1.00 15.38  ? 283 PHE A CE1   1 
ATOM   2322 C  CE2   . PHE A 1 283 ? -44.856 44.942  -21.031 1.00 12.56  ? 283 PHE A CE2   1 
ATOM   2323 C  CZ    . PHE A 1 283 ? -45.905 45.366  -20.237 1.00 13.87  ? 283 PHE A CZ    1 
ATOM   2324 N  N     . ARG A 1 284 ? -46.567 49.603  -24.179 1.00 26.45  ? 284 ARG A N     1 
ATOM   2325 C  CA    . ARG A 1 284 ? -47.142 50.801  -23.583 1.00 28.98  ? 284 ARG A CA    1 
ATOM   2326 C  C     . ARG A 1 284 ? -47.776 50.525  -22.221 1.00 26.89  ? 284 ARG A C     1 
ATOM   2327 O  O     . ARG A 1 284 ? -48.474 49.546  -22.054 1.00 25.15  ? 284 ARG A O     1 
ATOM   2328 C  CB    . ARG A 1 284 ? -48.155 51.391  -24.551 1.00 32.73  ? 284 ARG A CB    1 
ATOM   2329 C  CG    . ARG A 1 284 ? -48.276 52.872  -24.425 1.00 39.64  ? 284 ARG A CG    1 
ATOM   2330 C  CD    . ARG A 1 284 ? -48.504 53.567  -25.768 1.00 47.87  ? 284 ARG A CD    1 
ATOM   2331 N  NE    . ARG A 1 284 ? -48.079 54.968  -25.668 1.00 55.09  ? 284 ARG A NE    1 
ATOM   2332 C  CZ    . ARG A 1 284 ? -47.260 55.577  -26.521 1.00 59.24  ? 284 ARG A CZ    1 
ATOM   2333 N  NH1   . ARG A 1 284 ? -46.793 54.935  -27.592 1.00 59.22  ? 284 ARG A NH1   1 
ATOM   2334 N  NH2   . ARG A 1 284 ? -46.932 56.845  -26.317 1.00 63.80  ? 284 ARG A NH2   1 
ATOM   2335 N  N     . LYS A 1 285 ? -47.525 51.387  -21.242 1.00 27.85  ? 285 LYS A N     1 
ATOM   2336 C  CA    . LYS A 1 285 ? -47.947 51.124  -19.860 1.00 26.52  ? 285 LYS A CA    1 
ATOM   2337 C  C     . LYS A 1 285 ? -49.445 51.293  -19.704 1.00 28.00  ? 285 LYS A C     1 
ATOM   2338 O  O     . LYS A 1 285 ? -49.956 52.385  -19.913 1.00 31.61  ? 285 LYS A O     1 
ATOM   2339 C  CB    . LYS A 1 285 ? -47.212 52.054  -18.884 1.00 28.28  ? 285 LYS A CB    1 
ATOM   2340 C  CG    . LYS A 1 285 ? -47.695 52.002  -17.437 1.00 28.85  ? 285 LYS A CG    1 
ATOM   2341 C  CD    . LYS A 1 285 ? -47.253 53.219  -16.645 1.00 32.73  ? 285 LYS A CD    1 
ATOM   2342 C  CE    . LYS A 1 285 ? -47.904 53.204  -15.262 1.00 35.90  ? 285 LYS A CE    1 
ATOM   2343 N  NZ    . LYS A 1 285 ? -48.427 54.539  -14.784 1.00 40.60  ? 285 LYS A NZ    1 
ATOM   2344 N  N     . PRO A 1 286 ? -50.158 50.215  -19.340 1.00 26.09  ? 286 PRO A N     1 
ATOM   2345 C  CA    . PRO A 1 286 ? -51.608 50.364  -19.108 1.00 28.13  ? 286 PRO A CA    1 
ATOM   2346 C  C     . PRO A 1 286 ? -51.892 51.347  -17.966 1.00 30.50  ? 286 PRO A C     1 
ATOM   2347 O  O     . PRO A 1 286 ? -51.225 51.281  -16.927 1.00 29.44  ? 286 PRO A O     1 
ATOM   2348 C  CB    . PRO A 1 286 ? -52.077 48.932  -18.777 1.00 26.03  ? 286 PRO A CB    1 
ATOM   2349 C  CG    . PRO A 1 286 ? -50.844 48.143  -18.505 1.00 22.76  ? 286 PRO A CG    1 
ATOM   2350 C  CD    . PRO A 1 286 ? -49.685 48.831  -19.144 1.00 22.75  ? 286 PRO A CD    1 
ATOM   2351 N  N     . ASP A 1 287 ? -52.838 52.268  -18.171 1.00 33.91  ? 287 ASP A N     1 
ATOM   2352 C  CA    . ASP A 1 287 ? -53.051 53.361  -17.216 1.00 37.36  ? 287 ASP A CA    1 
ATOM   2353 C  C     . ASP A 1 287 ? -53.872 52.885  -16.024 1.00 37.92  ? 287 ASP A C     1 
ATOM   2354 O  O     . ASP A 1 287 ? -55.067 53.175  -15.900 1.00 41.15  ? 287 ASP A O     1 
ATOM   2355 C  CB    . ASP A 1 287 ? -53.677 54.594  -17.876 1.00 41.73  ? 287 ASP A CB    1 
ATOM   2356 C  CG    . ASP A 1 287 ? -53.976 55.724  -16.874 1.00 47.42  ? 287 ASP A CG    1 
ATOM   2357 O  OD1   . ASP A 1 287 ? -53.485 55.667  -15.715 1.00 47.54  ? 287 ASP A OD1   1 
ATOM   2358 O  OD2   . ASP A 1 287 ? -54.717 56.672  -17.242 1.00 52.34  ? 287 ASP A OD2   1 
ATOM   2359 N  N     . ILE A 1 288 ? -53.204 52.149  -15.146 1.00 35.21  ? 288 ILE A N     1 
ATOM   2360 C  CA    . ILE A 1 288 ? -53.824 51.564  -13.980 1.00 35.42  ? 288 ILE A CA    1 
ATOM   2361 C  C     . ILE A 1 288 ? -52.920 51.791  -12.764 1.00 36.18  ? 288 ILE A C     1 
ATOM   2362 O  O     . ILE A 1 288 ? -51.710 52.006  -12.910 1.00 34.72  ? 288 ILE A O     1 
ATOM   2363 C  CB    . ILE A 1 288 ? -54.077 50.055  -14.206 1.00 32.36  ? 288 ILE A CB    1 
ATOM   2364 C  CG1   . ILE A 1 288 ? -52.759 49.298  -14.389 1.00 27.33  ? 288 ILE A CG1   1 
ATOM   2365 C  CG2   . ILE A 1 288 ? -54.998 49.837  -15.408 1.00 32.31  ? 288 ILE A CG2   1 
ATOM   2366 C  CD1   . ILE A 1 288 ? -52.903 47.798  -14.356 1.00 23.40  ? 288 ILE A CD1   1 
ATOM   2367 N  N     . VAL A 1 289 ? -53.485 51.730  -11.561 1.00 38.77  ? 289 VAL A N     1 
ATOM   2368 C  CA    . VAL A 1 289 ? -52.671 51.947  -10.366 1.00 39.97  ? 289 VAL A CA    1 
ATOM   2369 C  C     . VAL A 1 289 ? -51.496 50.984  -10.249 1.00 36.52  ? 289 VAL A C     1 
ATOM   2370 O  O     . VAL A 1 289 ? -51.441 49.943  -10.912 1.00 33.03  ? 289 VAL A O     1 
ATOM   2371 C  CB    . VAL A 1 289 ? -53.485 51.864  -9.090  1.00 43.48  ? 289 VAL A CB    1 
ATOM   2372 C  CG1   . VAL A 1 289 ? -54.518 52.980  -9.055  1.00 47.60  ? 289 VAL A CG1   1 
ATOM   2373 C  CG2   . VAL A 1 289 ? -54.121 50.484  -8.964  1.00 42.79  ? 289 VAL A CG2   1 
ATOM   2374 N  N     . ASP A 1 290 ? -50.560 51.347  -9.380  1.00 38.22  ? 290 ASP A N     1 
ATOM   2375 C  CA    . ASP A 1 290 ? -49.332 50.586  -9.189  1.00 35.82  ? 290 ASP A CA    1 
ATOM   2376 C  C     . ASP A 1 290 ? -49.617 49.168  -8.736  1.00 34.12  ? 290 ASP A C     1 
ATOM   2377 O  O     . ASP A 1 290 ? -49.111 48.204  -9.308  1.00 30.53  ? 290 ASP A O     1 
ATOM   2378 C  CB    . ASP A 1 290 ? -48.427 51.300  -8.185  1.00 38.75  ? 290 ASP A CB    1 
ATOM   2379 C  CG    . ASP A 1 290 ? -47.338 52.096  -8.857  1.00 39.82  ? 290 ASP A CG    1 
ATOM   2380 O  OD1   . ASP A 1 290 ? -47.464 52.360  -10.071 1.00 41.02  ? 290 ASP A OD1   1 
ATOM   2381 O  OD2   . ASP A 1 290 ? -46.338 52.430  -8.184  1.00 43.28  ? 290 ASP A OD2   1 
ATOM   2382 N  N     . ASP A 1 291 ? -50.475 49.062  -7.730  1.00 37.27  ? 291 ASP A N     1 
ATOM   2383 C  CA    . ASP A 1 291 ? -50.787 47.806  -7.088  1.00 37.24  ? 291 ASP A CA    1 
ATOM   2384 C  C     . ASP A 1 291 ? -51.535 46.850  -7.992  1.00 35.64  ? 291 ASP A C     1 
ATOM   2385 O  O     . ASP A 1 291 ? -51.715 45.682  -7.653  1.00 36.02  ? 291 ASP A O     1 
ATOM   2386 C  CB    . ASP A 1 291 ? -51.562 48.104  -5.838  1.00 41.90  ? 291 ASP A CB    1 
ATOM   2387 C  CG    . ASP A 1 291 ? -50.841 49.085  -4.970  1.00 44.62  ? 291 ASP A CG    1 
ATOM   2388 O  OD1   . ASP A 1 291 ? -51.306 50.235  -4.887  1.00 46.43  ? 291 ASP A OD1   1 
ATOM   2389 O  OD2   . ASP A 1 291 ? -49.773 48.721  -4.423  1.00 45.10  ? 291 ASP A OD2   1 
ATOM   2390 N  N     . ASN A 1 292 ? -51.938 47.337  -9.161  1.00 34.49  ? 292 ASN A N     1 
ATOM   2391 C  CA    . ASN A 1 292 ? -52.514 46.482  -10.174 1.00 32.52  ? 292 ASN A CA    1 
ATOM   2392 C  C     . ASN A 1 292 ? -51.542 46.132  -11.284 1.00 28.68  ? 292 ASN A C     1 
ATOM   2393 O  O     . ASN A 1 292 ? -51.572 45.012  -11.803 1.00 27.15  ? 292 ASN A O     1 
ATOM   2394 C  CB    . ASN A 1 292 ? -53.756 47.120  -10.747 1.00 34.64  ? 292 ASN A CB    1 
ATOM   2395 C  CG    . ASN A 1 292 ? -55.003 46.495  -10.218 1.00 38.05  ? 292 ASN A CG    1 
ATOM   2396 O  OD1   . ASN A 1 292 ? -55.484 46.839  -9.147  1.00 41.47  ? 292 ASN A OD1   1 
ATOM   2397 N  ND2   . ASN A 1 292 ? -55.541 45.553  -10.973 1.00 38.66  ? 292 ASN A ND2   1 
ATOM   2398 N  N     . LEU A 1 293 ? -50.684 47.086  -11.647 1.00 27.61  ? 293 LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 293 ? -49.687 46.880  -12.702 1.00 24.18  ? 293 LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 293 ? -48.700 45.773  -12.322 1.00 22.62  ? 293 LEU A C     1 
ATOM   2401 O  O     . LEU A 1 293 ? -48.453 44.842  -13.098 1.00 20.25  ? 293 LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 293 ? -48.909 48.176  -12.942 1.00 24.46  ? 293 LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 293 ? -48.491 48.644  -14.336 1.00 22.34  ? 293 LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 293 ? -47.399 49.655  -14.238 1.00 23.89  ? 293 LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 293 ? -48.033 47.520  -15.192 1.00 19.38  ? 293 LEU A CD2   1 
ATOM   2406 N  N     . TYR A 1 294 ? -48.154 45.885  -11.112 1.00 24.24  ? 294 TYR A N     1 
ATOM   2407 C  CA    . TYR A 1 294 ? -46.996 45.103  -10.707 1.00 23.08  ? 294 TYR A CA    1 
ATOM   2408 C  C     . TYR A 1 294 ? -47.192 43.592  -10.640 1.00 22.59  ? 294 TYR A C     1 
ATOM   2409 O  O     . TYR A 1 294 ? -46.311 42.842  -11.077 1.00 20.72  ? 294 TYR A O     1 
ATOM   2410 C  CB    . TYR A 1 294 ? -46.365 45.676  -9.438  1.00 25.15  ? 294 TYR A CB    1 
ATOM   2411 C  CG    . TYR A 1 294 ? -45.496 46.851  -9.782  1.00 25.41  ? 294 TYR A CG    1 
ATOM   2412 C  CD1   . TYR A 1 294 ? -45.961 48.152  -9.643  1.00 28.54  ? 294 TYR A CD1   1 
ATOM   2413 C  CD2   . TYR A 1 294 ? -44.220 46.658  -10.313 1.00 23.80  ? 294 TYR A CD2   1 
ATOM   2414 C  CE1   . TYR A 1 294 ? -45.162 49.241  -9.991  1.00 29.86  ? 294 TYR A CE1   1 
ATOM   2415 C  CE2   . TYR A 1 294 ? -43.413 47.729  -10.662 1.00 24.20  ? 294 TYR A CE2   1 
ATOM   2416 C  CZ    . TYR A 1 294 ? -43.891 49.019  -10.503 1.00 27.65  ? 294 TYR A CZ    1 
ATOM   2417 O  OH    . TYR A 1 294 ? -43.090 50.083  -10.852 1.00 29.11  ? 294 TYR A OH    1 
ATOM   2418 N  N     . PRO A 1 295 ? -48.336 43.131  -10.110 1.00 24.78  ? 295 PRO A N     1 
ATOM   2419 C  CA    . PRO A 1 295 ? -48.532 41.683  -10.176 1.00 24.70  ? 295 PRO A CA    1 
ATOM   2420 C  C     . PRO A 1 295 ? -48.632 41.187  -11.632 1.00 22.49  ? 295 PRO A C     1 
ATOM   2421 O  O     . PRO A 1 295 ? -48.058 40.152  -11.972 1.00 21.43  ? 295 PRO A O     1 
ATOM   2422 C  CB    . PRO A 1 295 ? -49.838 41.459  -9.406  1.00 28.16  ? 295 PRO A CB    1 
ATOM   2423 C  CG    . PRO A 1 295 ? -50.057 42.721  -8.622  1.00 30.76  ? 295 PRO A CG    1 
ATOM   2424 C  CD    . PRO A 1 295 ? -49.444 43.817  -9.429  1.00 27.96  ? 295 PRO A CD    1 
ATOM   2425 N  N     . GLN A 1 296 ? -49.322 41.934  -12.487 1.00 22.19  ? 296 GLN A N     1 
ATOM   2426 C  CA    . GLN A 1 296 ? -49.424 41.553  -13.885 1.00 20.75  ? 296 GLN A CA    1 
ATOM   2427 C  C     . GLN A 1 296 ? -48.083 41.669  -14.572 1.00 18.53  ? 296 GLN A C     1 
ATOM   2428 O  O     . GLN A 1 296 ? -47.779 40.902  -15.488 1.00 17.68  ? 296 GLN A O     1 
ATOM   2429 C  CB    . GLN A 1 296 ? -50.436 42.418  -14.624 1.00 21.75  ? 296 GLN A CB    1 
ATOM   2430 C  CG    . GLN A 1 296 ? -51.787 42.510  -13.954 1.00 24.48  ? 296 GLN A CG    1 
ATOM   2431 C  CD    . GLN A 1 296 ? -52.751 43.345  -14.742 1.00 24.83  ? 296 GLN A CD    1 
ATOM   2432 O  OE1   . GLN A 1 296 ? -52.645 43.438  -15.971 1.00 23.28  ? 296 GLN A OE1   1 
ATOM   2433 N  NE2   . GLN A 1 296 ? -53.705 43.965  -14.046 1.00 26.55  ? 296 GLN A NE2   1 
ATOM   2434 N  N     . LEU A 1 297 ? -47.278 42.639  -14.153 1.00 18.65  ? 297 LEU A N     1 
ATOM   2435 C  CA    . LEU A 1 297 ? -45.922 42.720  -14.675 1.00 16.86  ? 297 LEU A CA    1 
ATOM   2436 C  C     . LEU A 1 297 ? -45.133 41.510  -14.215 1.00 16.14  ? 297 LEU A C     1 
ATOM   2437 O  O     . LEU A 1 297 ? -44.415 40.931  -15.001 1.00 14.84  ? 297 LEU A O     1 
ATOM   2438 C  CB    . LEU A 1 297 ? -45.217 44.022  -14.285 1.00 17.18  ? 297 LEU A CB    1 
ATOM   2439 C  CG    . LEU A 1 297 ? -45.451 45.282  -15.125 1.00 17.16  ? 297 LEU A CG    1 
ATOM   2440 C  CD1   . LEU A 1 297 ? -44.423 46.310  -14.717 1.00 17.69  ? 297 LEU A CD1   1 
ATOM   2441 C  CD2   . LEU A 1 297 ? -45.396 45.059  -16.632 1.00 13.95  ? 297 LEU A CD2   1 
ATOM   2442 N  N     . GLU A 1 298 ? -45.292 41.108  -12.959 1.00 18.02  ? 298 GLU A N     1 
ATOM   2443 C  CA    . GLU A 1 298 ? -44.595 39.927  -12.492 1.00 18.84  ? 298 GLU A CA    1 
ATOM   2444 C  C     . GLU A 1 298 ? -45.078 38.745  -13.276 1.00 18.36  ? 298 GLU A C     1 
ATOM   2445 O  O     . GLU A 1 298 ? -44.294 37.926  -13.691 1.00 17.61  ? 298 GLU A O     1 
ATOM   2446 C  CB    . GLU A 1 298 ? -44.816 39.672  -11.016 1.00 21.60  ? 298 GLU A CB    1 
ATOM   2447 C  CG    . GLU A 1 298 ? -43.762 40.247  -10.123 1.00 26.02  ? 298 GLU A CG    1 
ATOM   2448 C  CD    . GLU A 1 298 ? -44.295 40.420  -8.705  1.00 37.41  ? 298 GLU A CD    1 
ATOM   2449 O  OE1   . GLU A 1 298 ? -44.607 39.372  -8.084  1.00 42.38  ? 298 GLU A OE1   1 
ATOM   2450 O  OE2   . GLU A 1 298 ? -44.437 41.587  -8.216  1.00 41.13  ? 298 GLU A OE2   1 
ATOM   2451 N  N     . ARG A 1 299 ? -46.377 38.667  -13.494 1.00 19.87  ? 299 ARG A N     1 
ATOM   2452 C  CA    . ARG A 1 299 ? -46.948 37.535  -14.189 1.00 20.78  ? 299 ARG A CA    1 
ATOM   2453 C  C     . ARG A 1 299 ? -46.389 37.417  -15.606 1.00 19.34  ? 299 ARG A C     1 
ATOM   2454 O  O     . ARG A 1 299 ? -45.911 36.348  -16.020 1.00 19.47  ? 299 ARG A O     1 
ATOM   2455 C  CB    . ARG A 1 299 ? -48.455 37.672  -14.242 1.00 22.57  ? 299 ARG A CB    1 
ATOM   2456 C  CG    . ARG A 1 299 ? -49.081 36.549  -14.980 1.00 23.81  ? 299 ARG A CG    1 
ATOM   2457 C  CD    . ARG A 1 299 ? -50.541 36.460  -14.685 1.00 26.51  ? 299 ARG A CD    1 
ATOM   2458 N  NE    . ARG A 1 299 ? -50.883 35.068  -14.454 1.00 27.87  ? 299 ARG A NE    1 
ATOM   2459 C  CZ    . ARG A 1 299 ? -51.136 34.198  -15.420 1.00 28.39  ? 299 ARG A CZ    1 
ATOM   2460 N  NH1   . ARG A 1 299 ? -51.098 34.581  -16.685 1.00 25.04  ? 299 ARG A NH1   1 
ATOM   2461 N  NH2   . ARG A 1 299 ? -51.427 32.942  -15.112 1.00 32.58  ? 299 ARG A NH2   1 
ATOM   2462 N  N     . ALA A 1 300 ? -46.454 38.521  -16.347 1.00 18.53  ? 300 ALA A N     1 
ATOM   2463 C  CA    . ALA A 1 300 ? -45.921 38.564  -17.698 1.00 17.60  ? 300 ALA A CA    1 
ATOM   2464 C  C     . ALA A 1 300 ? -44.508 37.956  -17.756 1.00 16.58  ? 300 ALA A C     1 
ATOM   2465 O  O     . ALA A 1 300 ? -44.230 37.089  -18.596 1.00 16.56  ? 300 ALA A O     1 
ATOM   2466 C  CB    . ALA A 1 300 ? -45.918 39.986  -18.201 1.00 17.08  ? 300 ALA A CB    1 
ATOM   2467 N  N     . SER A 1 301 ? -43.647 38.404  -16.840 1.00 15.91  ? 301 SER A N     1 
ATOM   2468 C  CA    . SER A 1 301 ? -42.280 37.924  -16.715 1.00 15.23  ? 301 SER A CA    1 
ATOM   2469 C  C     . SER A 1 301 ? -42.169 36.416  -16.513 1.00 16.42  ? 301 SER A C     1 
ATOM   2470 O  O     . SER A 1 301 ? -41.428 35.740  -17.226 1.00 16.24  ? 301 SER A O     1 
ATOM   2471 C  CB    . SER A 1 301 ? -41.596 38.621  -15.552 1.00 15.07  ? 301 SER A CB    1 
ATOM   2472 O  OG    . SER A 1 301 ? -41.296 39.944  -15.898 1.00 14.79  ? 301 SER A OG    1 
ATOM   2473 N  N     . ARG A 1 302 ? -42.895 35.892  -15.538 1.00 18.22  ? 302 ARG A N     1 
ATOM   2474 C  CA    . ARG A 1 302 ? -42.825 34.483  -15.232 1.00 20.58  ? 302 ARG A CA    1 
ATOM   2475 C  C     . ARG A 1 302 ? -43.204 33.667  -16.456 1.00 21.40  ? 302 ARG A C     1 
ATOM   2476 O  O     . ARG A 1 302 ? -42.567 32.659  -16.767 1.00 22.36  ? 302 ARG A O     1 
ATOM   2477 C  CB    . ARG A 1 302 ? -43.768 34.145  -14.092 1.00 23.24  ? 302 ARG A CB    1 
ATOM   2478 C  CG    . ARG A 1 302 ? -43.531 32.790  -13.516 1.00 27.02  ? 302 ARG A CG    1 
ATOM   2479 C  CD    . ARG A 1 302 ? -44.538 32.485  -12.431 1.00 32.97  ? 302 ARG A CD    1 
ATOM   2480 N  NE    . ARG A 1 302 ? -45.769 31.964  -13.004 1.00 36.78  ? 302 ARG A NE    1 
ATOM   2481 C  CZ    . ARG A 1 302 ? -46.948 32.577  -12.943 1.00 40.05  ? 302 ARG A CZ    1 
ATOM   2482 N  NH1   . ARG A 1 302 ? -47.076 33.752  -12.312 1.00 40.02  ? 302 ARG A NH1   1 
ATOM   2483 N  NH2   . ARG A 1 302 ? -48.007 32.006  -13.512 1.00 42.00  ? 302 ARG A NH2   1 
ATOM   2484 N  N     . LYS A 1 303 ? -44.232 34.122  -17.158 1.00 21.48  ? 303 LYS A N     1 
ATOM   2485 C  CA    . LYS A 1 303 ? -44.826 33.329  -18.215 1.00 23.06  ? 303 LYS A CA    1 
ATOM   2486 C  C     . LYS A 1 303 ? -43.901 33.200  -19.416 1.00 22.00  ? 303 LYS A C     1 
ATOM   2487 O  O     . LYS A 1 303 ? -43.764 32.115  -20.002 1.00 23.75  ? 303 LYS A O     1 
ATOM   2488 C  CB    . LYS A 1 303 ? -46.169 33.927  -18.607 1.00 23.93  ? 303 LYS A CB    1 
ATOM   2489 C  CG    . LYS A 1 303 ? -47.201 33.856  -17.495 1.00 26.34  ? 303 LYS A CG    1 
ATOM   2490 C  CD    . LYS A 1 303 ? -47.454 32.416  -17.075 1.00 29.77  ? 303 LYS A CD    1 
ATOM   2491 C  CE    . LYS A 1 303 ? -48.352 31.711  -18.061 1.00 32.85  ? 303 LYS A CE    1 
ATOM   2492 N  NZ    . LYS A 1 303 ? -48.827 30.437  -17.486 1.00 37.76  ? 303 LYS A NZ    1 
ATOM   2493 N  N     . ILE A 1 304 ? -43.265 34.311  -19.771 1.00 19.52  ? 304 ILE A N     1 
ATOM   2494 C  CA    . ILE A 1 304 ? -42.277 34.306  -20.835 1.00 18.66  ? 304 ILE A CA    1 
ATOM   2495 C  C     . ILE A 1 304 ? -41.028 33.565  -20.361 1.00 18.78  ? 304 ILE A C     1 
ATOM   2496 O  O     . ILE A 1 304 ? -40.533 32.691  -21.065 1.00 20.29  ? 304 ILE A O     1 
ATOM   2497 C  CB    . ILE A 1 304 ? -41.950 35.720  -21.319 1.00 16.96  ? 304 ILE A CB    1 
ATOM   2498 C  CG1   . ILE A 1 304 ? -43.224 36.397  -21.803 1.00 17.34  ? 304 ILE A CG1   1 
ATOM   2499 C  CG2   . ILE A 1 304 ? -40.935 35.683  -22.438 1.00 16.06  ? 304 ILE A CG2   1 
ATOM   2500 C  CD1   . ILE A 1 304 ? -43.191 37.893  -21.650 1.00 17.90  ? 304 ILE A CD1   1 
ATOM   2501 N  N     . PHE A 1 305 ? -40.545 33.883  -19.161 1.00 17.85  ? 305 PHE A N     1 
ATOM   2502 C  CA    . PHE A 1 305 ? -39.423 33.147  -18.566 1.00 17.92  ? 305 PHE A CA    1 
ATOM   2503 C  C     . PHE A 1 305 ? -39.620 31.638  -18.650 1.00 20.11  ? 305 PHE A C     1 
ATOM   2504 O  O     . PHE A 1 305 ? -38.713 30.908  -19.028 1.00 20.77  ? 305 PHE A O     1 
ATOM   2505 C  CB    . PHE A 1 305 ? -39.232 33.553  -17.114 1.00 17.60  ? 305 PHE A CB    1 
ATOM   2506 C  CG    . PHE A 1 305 ? -37.996 33.002  -16.487 1.00 18.05  ? 305 PHE A CG    1 
ATOM   2507 C  CD1   . PHE A 1 305 ? -36.812 33.732  -16.505 1.00 16.94  ? 305 PHE A CD1   1 
ATOM   2508 C  CD2   . PHE A 1 305 ? -38.013 31.751  -15.860 1.00 21.10  ? 305 PHE A CD2   1 
ATOM   2509 C  CE1   . PHE A 1 305 ? -35.651 33.224  -15.903 1.00 18.65  ? 305 PHE A CE1   1 
ATOM   2510 C  CE2   . PHE A 1 305 ? -36.864 31.229  -15.265 1.00 21.99  ? 305 PHE A CE2   1 
ATOM   2511 C  CZ    . PHE A 1 305 ? -35.677 31.976  -15.278 1.00 20.35  ? 305 PHE A CZ    1 
ATOM   2512 N  N     . GLU A 1 306 ? -40.809 31.169  -18.305 1.00 21.94  ? 306 GLU A N     1 
ATOM   2513 C  CA    . GLU A 1 306 ? -41.100 29.740  -18.416 1.00 25.27  ? 306 GLU A CA    1 
ATOM   2514 C  C     . GLU A 1 306 ? -41.171 29.298  -19.863 1.00 25.70  ? 306 GLU A C     1 
ATOM   2515 O  O     . GLU A 1 306 ? -40.674 28.238  -20.200 1.00 27.96  ? 306 GLU A O     1 
ATOM   2516 C  CB    . GLU A 1 306 ? -42.371 29.357  -17.668 1.00 27.75  ? 306 GLU A CB    1 
ATOM   2517 C  CG    . GLU A 1 306 ? -42.175 29.266  -16.166 1.00 29.87  ? 306 GLU A CG    1 
ATOM   2518 C  CD    . GLU A 1 306 ? -43.458 29.531  -15.410 1.00 33.45  ? 306 GLU A CD    1 
ATOM   2519 O  OE1   . GLU A 1 306 ? -44.510 29.664  -16.077 1.00 35.61  ? 306 GLU A OE1   1 
ATOM   2520 O  OE2   . GLU A 1 306 ? -43.424 29.601  -14.158 1.00 35.20  ? 306 GLU A OE2   1 
ATOM   2521 N  N     . PHE A 1 307 ? -41.760 30.117  -20.724 1.00 24.16  ? 307 PHE A N     1 
ATOM   2522 C  CA    . PHE A 1 307 ? -41.766 29.790  -22.140 1.00 25.20  ? 307 PHE A CA    1 
ATOM   2523 C  C     . PHE A 1 307 ? -40.330 29.604  -22.611 1.00 24.67  ? 307 PHE A C     1 
ATOM   2524 O  O     . PHE A 1 307 ? -40.029 28.699  -23.382 1.00 27.25  ? 307 PHE A O     1 
ATOM   2525 C  CB    . PHE A 1 307 ? -42.465 30.872  -22.968 1.00 23.94  ? 307 PHE A CB    1 
ATOM   2526 C  CG    . PHE A 1 307 ? -42.011 30.913  -24.392 1.00 24.41  ? 307 PHE A CG    1 
ATOM   2527 C  CD1   . PHE A 1 307 ? -42.500 30.000  -25.314 1.00 26.64  ? 307 PHE A CD1   1 
ATOM   2528 C  CD2   . PHE A 1 307 ? -41.056 31.841  -24.803 1.00 23.13  ? 307 PHE A CD2   1 
ATOM   2529 C  CE1   . PHE A 1 307 ? -42.073 30.019  -26.629 1.00 28.06  ? 307 PHE A CE1   1 
ATOM   2530 C  CE2   . PHE A 1 307 ? -40.618 31.865  -26.132 1.00 24.61  ? 307 PHE A CE2   1 
ATOM   2531 C  CZ    . PHE A 1 307 ? -41.133 30.950  -27.045 1.00 26.78  ? 307 PHE A CZ    1 
ATOM   2532 N  N     . LEU A 1 308 ? -39.445 30.469  -22.133 1.00 22.03  ? 308 LEU A N     1 
ATOM   2533 C  CA    . LEU A 1 308 ? -38.064 30.452  -22.569 1.00 21.31  ? 308 LEU A CA    1 
ATOM   2534 C  C     . LEU A 1 308 ? -37.367 29.205  -22.100 1.00 23.28  ? 308 LEU A C     1 
ATOM   2535 O  O     . LEU A 1 308 ? -36.485 28.711  -22.785 1.00 24.41  ? 308 LEU A O     1 
ATOM   2536 C  CB    . LEU A 1 308 ? -37.312 31.697  -22.092 1.00 18.49  ? 308 LEU A CB    1 
ATOM   2537 C  CG    . LEU A 1 308 ? -37.470 32.939  -22.976 1.00 17.08  ? 308 LEU A CG    1 
ATOM   2538 C  CD1   . LEU A 1 308 ? -36.936 34.165  -22.247 1.00 15.81  ? 308 LEU A CD1   1 
ATOM   2539 C  CD2   . LEU A 1 308 ? -36.794 32.783  -24.328 1.00 16.77  ? 308 LEU A CD2   1 
ATOM   2540 N  N     . GLU A 1 309 ? -37.768 28.688  -20.944 1.00 24.27  ? 309 GLU A N     1 
ATOM   2541 C  CA    . GLU A 1 309 ? -37.058 27.552  -20.388 1.00 27.21  ? 309 GLU A CA    1 
ATOM   2542 C  C     . GLU A 1 309 ? -37.511 26.219  -20.949 1.00 29.84  ? 309 GLU A C     1 
ATOM   2543 O  O     . GLU A 1 309 ? -36.685 25.340  -21.177 1.00 32.28  ? 309 GLU A O     1 
ATOM   2544 C  CB    . GLU A 1 309 ? -36.964 27.586  -18.854 1.00 26.96  ? 309 GLU A CB    1 
ATOM   2545 C  CG    . GLU A 1 309 ? -38.197 27.255  -18.041 1.00 31.05  ? 309 GLU A CG    1 
ATOM   2546 C  CD    . GLU A 1 309 ? -37.999 27.608  -16.542 1.00 31.69  ? 309 GLU A CD    1 
ATOM   2547 O  OE1   . GLU A 1 309 ? -38.999 27.996  -15.856 1.00 35.73  ? 309 GLU A OE1   1 
ATOM   2548 O  OE2   . GLU A 1 309 ? -36.838 27.500  -16.057 1.00 34.30  ? 309 GLU A OE2   1 
ATOM   2549 N  N     . ARG A 1 310 ? -38.797 26.077  -21.228 1.00 29.90  ? 310 ARG A N     1 
ATOM   2550 C  CA    . ARG A 1 310 ? -39.238 24.873  -21.912 1.00 33.19  ? 310 ARG A CA    1 
ATOM   2551 C  C     . ARG A 1 310 ? -38.851 24.897  -23.397 1.00 33.24  ? 310 ARG A C     1 
ATOM   2552 O  O     . ARG A 1 310 ? -38.905 23.876  -24.078 1.00 37.58  ? 310 ARG A O     1 
ATOM   2553 C  CB    . ARG A 1 310 ? -40.722 24.593  -21.692 1.00 35.08  ? 310 ARG A CB    1 
ATOM   2554 C  CG    . ARG A 1 310 ? -41.663 25.489  -22.442 1.00 33.44  ? 310 ARG A CG    1 
ATOM   2555 C  CD    . ARG A 1 310 ? -43.057 25.404  -21.840 1.00 35.96  ? 310 ARG A CD    1 
ATOM   2556 N  NE    . ARG A 1 310 ? -43.991 26.279  -22.545 1.00 35.50  ? 310 ARG A NE    1 
ATOM   2557 C  CZ    . ARG A 1 310 ? -44.436 27.441  -22.079 1.00 32.50  ? 310 ARG A CZ    1 
ATOM   2558 N  NH1   . ARG A 1 310 ? -44.043 27.876  -20.891 1.00 31.73  ? 310 ARG A NH1   1 
ATOM   2559 N  NH2   . ARG A 1 310 ? -45.284 28.160  -22.795 1.00 31.43  ? 310 ARG A NH2   1 
ATOM   2560 N  N     . GLU A 1 311 ? -38.422 26.050  -23.891 1.00 29.07  ? 311 GLU A N     1 
ATOM   2561 C  CA    . GLU A 1 311 ? -37.880 26.109  -25.237 1.00 29.17  ? 311 GLU A CA    1 
ATOM   2562 C  C     . GLU A 1 311 ? -36.353 26.026  -25.276 1.00 28.45  ? 311 GLU A C     1 
ATOM   2563 O  O     . GLU A 1 311 ? -35.747 26.304  -26.316 1.00 29.04  ? 311 GLU A O     1 
ATOM   2564 C  CB    . GLU A 1 311 ? -38.391 27.335  -25.981 1.00 27.02  ? 311 GLU A CB    1 
ATOM   2565 C  CG    . GLU A 1 311 ? -39.842 27.217  -26.404 1.00 30.06  ? 311 GLU A CG    1 
ATOM   2566 C  CD    . GLU A 1 311 ? -40.133 26.016  -27.331 1.00 37.05  ? 311 GLU A CD    1 
ATOM   2567 O  OE1   . GLU A 1 311 ? -41.286 25.540  -27.300 1.00 39.73  ? 311 GLU A OE1   1 
ATOM   2568 O  OE2   . GLU A 1 311 ? -39.239 25.558  -28.096 1.00 39.28  ? 311 GLU A OE2   1 
ATOM   2569 N  N     . ASN A 1 312 ? -35.739 25.663  -24.145 1.00 27.26  ? 312 ASN A N     1 
ATOM   2570 C  CA    . ASN A 1 312 ? -34.300 25.358  -24.068 1.00 27.19  ? 312 ASN A CA    1 
ATOM   2571 C  C     . ASN A 1 312 ? -33.329 26.511  -24.275 1.00 24.62  ? 312 ASN A C     1 
ATOM   2572 O  O     . ASN A 1 312 ? -32.120 26.317  -24.326 1.00 25.61  ? 312 ASN A O     1 
ATOM   2573 C  CB    . ASN A 1 312 ? -33.958 24.194  -24.993 1.00 31.22  ? 312 ASN A CB    1 
ATOM   2574 C  CG    . ASN A 1 312 ? -34.677 22.939  -24.602 1.00 33.51  ? 312 ASN A CG    1 
ATOM   2575 O  OD1   . ASN A 1 312 ? -35.667 22.546  -25.224 1.00 34.03  ? 312 ASN A OD1   1 
ATOM   2576 N  ND2   . ASN A 1 312 ? -34.222 22.329  -23.525 1.00 33.19  ? 312 ASN A ND2   1 
ATOM   2577 N  N     . PHE A 1 313 ? -33.863 27.720  -24.356 1.00 22.24  ? 313 PHE A N     1 
ATOM   2578 C  CA    . PHE A 1 313 ? -33.056 28.926  -24.423 1.00 20.13  ? 313 PHE A CA    1 
ATOM   2579 C  C     . PHE A 1 313 ? -32.395 29.299  -23.108 1.00 18.91  ? 313 PHE A C     1 
ATOM   2580 O  O     . PHE A 1 313 ? -31.733 30.332  -23.011 1.00 17.50  ? 313 PHE A O     1 
ATOM   2581 C  CB    . PHE A 1 313 ? -33.913 30.074  -24.888 1.00 18.06  ? 313 PHE A CB    1 
ATOM   2582 C  CG    . PHE A 1 313 ? -34.275 29.994  -26.317 1.00 19.54  ? 313 PHE A CG    1 
ATOM   2583 C  CD1   . PHE A 1 313 ? -33.278 29.987  -27.292 1.00 20.00  ? 313 PHE A CD1   1 
ATOM   2584 C  CD2   . PHE A 1 313 ? -35.611 29.952  -26.698 1.00 19.64  ? 313 PHE A CD2   1 
ATOM   2585 C  CE1   . PHE A 1 313 ? -33.594 29.928  -28.622 1.00 22.38  ? 313 PHE A CE1   1 
ATOM   2586 C  CE2   . PHE A 1 313 ? -35.951 29.896  -28.022 1.00 22.62  ? 313 PHE A CE2   1 
ATOM   2587 C  CZ    . PHE A 1 313 ? -34.932 29.880  -29.000 1.00 24.75  ? 313 PHE A CZ    1 
ATOM   2588 N  N     . MET A 1 314 ? -32.606 28.471  -22.094 1.00 20.28  ? 314 MET A N     1 
ATOM   2589 C  CA    . MET A 1 314 ? -31.801 28.502  -20.887 1.00 20.91  ? 314 MET A CA    1 
ATOM   2590 C  C     . MET A 1 314 ? -31.746 29.894  -20.247 1.00 18.11  ? 314 MET A C     1 
ATOM   2591 O  O     . MET A 1 314 ? -30.673 30.479  -20.138 1.00 18.28  ? 314 MET A O     1 
ATOM   2592 C  CB    . MET A 1 314 ? -30.386 27.996  -21.222 1.00 22.67  ? 314 MET A CB    1 
ATOM   2593 C  CG    . MET A 1 314 ? -29.775 27.079  -20.168 1.00 25.50  ? 314 MET A CG    1 
ATOM   2594 S  SD    . MET A 1 314 ? -28.566 25.931  -20.859 1.00 29.75  ? 314 MET A SD    1 
ATOM   2595 C  CE    . MET A 1 314 ? -29.633 24.869  -21.852 1.00 31.76  ? 314 MET A CE    1 
ATOM   2596 N  N     . PRO A 1 315 ? -32.893 30.423  -19.802 1.00 16.64  ? 315 PRO A N     1 
ATOM   2597 C  CA    . PRO A 1 315 ? -32.906 31.785  -19.291 1.00 14.87  ? 315 PRO A CA    1 
ATOM   2598 C  C     . PRO A 1 315 ? -32.163 31.895  -17.949 1.00 15.72  ? 315 PRO A C     1 
ATOM   2599 O  O     . PRO A 1 315 ? -32.048 30.900  -17.238 1.00 17.97  ? 315 PRO A O     1 
ATOM   2600 C  CB    . PRO A 1 315 ? -34.390 32.061  -19.109 1.00 13.65  ? 315 PRO A CB    1 
ATOM   2601 C  CG    . PRO A 1 315 ? -34.979 30.751  -18.875 1.00 15.27  ? 315 PRO A CG    1 
ATOM   2602 C  CD    . PRO A 1 315 ? -34.218 29.797  -19.709 1.00 17.45  ? 315 PRO A CD    1 
ATOM   2603 N  N     . LEU A 1 316 ? -31.649 33.075  -17.609 1.00 14.80  ? 316 LEU A N     1 
ATOM   2604 C  CA    . LEU A 1 316 ? -30.911 33.220  -16.363 1.00 15.90  ? 316 LEU A CA    1 
ATOM   2605 C  C     . LEU A 1 316 ? -31.758 33.908  -15.300 1.00 15.69  ? 316 LEU A C     1 
ATOM   2606 O  O     . LEU A 1 316 ? -32.199 33.279  -14.339 1.00 16.83  ? 316 LEU A O     1 
ATOM   2607 C  CB    . LEU A 1 316 ? -29.599 33.981  -16.582 1.00 16.10  ? 316 LEU A CB    1 
ATOM   2608 C  CG    . LEU A 1 316 ? -28.524 33.352  -17.465 1.00 17.81  ? 316 LEU A CG    1 
ATOM   2609 C  CD1   . LEU A 1 316 ? -27.440 34.363  -17.814 1.00 17.46  ? 316 LEU A CD1   1 
ATOM   2610 C  CD2   . LEU A 1 316 ? -27.933 32.136  -16.782 1.00 19.60  ? 316 LEU A CD2   1 
ATOM   2611 N  N     . ARG A 1 317 ? -31.959 35.208  -15.475 1.00 14.93  ? 317 ARG A N     1 
ATOM   2612 C  CA    . ARG A 1 317 ? -32.797 35.998  -14.596 1.00 15.16  ? 317 ARG A CA    1 
ATOM   2613 C  C     . ARG A 1 317 ? -33.716 36.857  -15.442 1.00 14.45  ? 317 ARG A C     1 
ATOM   2614 O  O     . ARG A 1 317 ? -33.445 37.097  -16.628 1.00 14.61  ? 317 ARG A O     1 
ATOM   2615 C  CB    . ARG A 1 317 ? -31.937 36.867  -13.692 1.00 15.71  ? 317 ARG A CB    1 
ATOM   2616 C  CG    . ARG A 1 317 ? -31.308 36.088  -12.565 1.00 18.33  ? 317 ARG A CG    1 
ATOM   2617 C  CD    . ARG A 1 317 ? -30.657 36.985  -11.534 1.00 19.68  ? 317 ARG A CD    1 
ATOM   2618 N  NE    . ARG A 1 317 ? -31.575 37.485  -10.506 1.00 19.66  ? 317 ARG A NE    1 
ATOM   2619 C  CZ    . ARG A 1 317 ? -31.295 38.531  -9.725  1.00 21.04  ? 317 ARG A CZ    1 
ATOM   2620 N  NH1   . ARG A 1 317 ? -30.142 39.168  -9.872  1.00 22.52  ? 317 ARG A NH1   1 
ATOM   2621 N  NH2   . ARG A 1 317 ? -32.153 38.956  -8.810  1.00 20.97  ? 317 ARG A NH2   1 
ATOM   2622 N  N     . SER A 1 318 ? -34.809 37.312  -14.841 1.00 14.56  ? 318 SER A N     1 
ATOM   2623 C  CA    . SER A 1 318 ? -35.752 38.209  -15.510 1.00 13.61  ? 318 SER A CA    1 
ATOM   2624 C  C     . SER A 1 318 ? -36.007 39.412  -14.630 1.00 13.62  ? 318 SER A C     1 
ATOM   2625 O  O     . SER A 1 318 ? -35.910 39.315  -13.413 1.00 14.87  ? 318 SER A O     1 
ATOM   2626 C  CB    . SER A 1 318 ? -37.067 37.473  -15.783 1.00 13.94  ? 318 SER A CB    1 
ATOM   2627 O  OG    . SER A 1 318 ? -37.422 36.619  -14.693 1.00 16.07  ? 318 SER A OG    1 
ATOM   2628 N  N     . ALA A 1 319 ? -36.338 40.542  -15.234 1.00 13.18  ? 319 ALA A N     1 
ATOM   2629 C  CA    . ALA A 1 319 ? -36.653 41.760  -14.476 1.00 14.09  ? 319 ALA A CA    1 
ATOM   2630 C  C     . ALA A 1 319 ? -37.595 42.615  -15.276 1.00 14.17  ? 319 ALA A C     1 
ATOM   2631 O  O     . ALA A 1 319 ? -37.777 42.398  -16.473 1.00 13.84  ? 319 ALA A O     1 
ATOM   2632 C  CB    . ALA A 1 319 ? -35.394 42.541  -14.136 1.00 14.58  ? 319 ALA A CB    1 
ATOM   2633 N  N     . PHE A 1 320 ? -38.196 43.598  -14.628 1.00 15.64  ? 320 PHE A N     1 
ATOM   2634 C  CA    . PHE A 1 320 ? -39.049 44.521  -15.355 1.00 16.37  ? 320 PHE A CA    1 
ATOM   2635 C  C     . PHE A 1 320 ? -38.912 45.968  -14.892 1.00 18.74  ? 320 PHE A C     1 
ATOM   2636 O  O     . PHE A 1 320 ? -38.349 46.218  -13.838 1.00 20.12  ? 320 PHE A O     1 
ATOM   2637 C  CB    . PHE A 1 320 ? -40.499 44.050  -15.289 1.00 16.04  ? 320 PHE A CB    1 
ATOM   2638 C  CG    . PHE A 1 320 ? -40.997 43.781  -13.902 1.00 16.34  ? 320 PHE A CG    1 
ATOM   2639 C  CD1   . PHE A 1 320 ? -41.330 44.823  -13.052 1.00 16.95  ? 320 PHE A CD1   1 
ATOM   2640 C  CD2   . PHE A 1 320 ? -41.187 42.475  -13.468 1.00 16.41  ? 320 PHE A CD2   1 
ATOM   2641 C  CE1   . PHE A 1 320 ? -41.826 44.572  -11.787 1.00 18.39  ? 320 PHE A CE1   1 
ATOM   2642 C  CE2   . PHE A 1 320 ? -41.672 42.209  -12.187 1.00 18.06  ? 320 PHE A CE2   1 
ATOM   2643 C  CZ    . PHE A 1 320 ? -41.998 43.264  -11.347 1.00 18.78  ? 320 PHE A CZ    1 
ATOM   2644 N  N     . LYS A 1 321 ? -39.423 46.902  -15.699 1.00 19.95  ? 321 LYS A N     1 
ATOM   2645 C  CA    . LYS A 1 321 ? -39.425 48.343  -15.402 1.00 22.83  ? 321 LYS A CA    1 
ATOM   2646 C  C     . LYS A 1 321 ? -40.708 48.973  -15.906 1.00 23.96  ? 321 LYS A C     1 
ATOM   2647 O  O     . LYS A 1 321 ? -41.217 48.583  -16.960 1.00 23.15  ? 321 LYS A O     1 
ATOM   2648 C  CB    . LYS A 1 321 ? -38.266 49.040  -16.117 1.00 24.28  ? 321 LYS A CB    1 
ATOM   2649 C  CG    . LYS A 1 321 ? -37.588 50.125  -15.314 1.00 27.68  ? 321 LYS A CG    1 
ATOM   2650 C  CD    . LYS A 1 321 ? -38.098 51.519  -15.542 1.00 32.83  ? 321 LYS A CD    1 
ATOM   2651 C  CE    . LYS A 1 321 ? -37.226 52.507  -14.738 1.00 38.08  ? 321 LYS A CE    1 
ATOM   2652 N  NZ    . LYS A 1 321 ? -37.822 53.874  -14.638 1.00 42.81  ? 321 LYS A NZ    1 
ATOM   2653 N  N     . ALA A 1 322 ? -41.217 49.965  -15.182 1.00 26.42  ? 322 ALA A N     1 
ATOM   2654 C  CA    . ALA A 1 322 ? -42.364 50.726  -15.644 1.00 27.84  ? 322 ALA A CA    1 
ATOM   2655 C  C     . ALA A 1 322 ? -41.999 52.182  -15.605 1.00 31.92  ? 322 ALA A C     1 
ATOM   2656 O  O     . ALA A 1 322 ? -41.874 52.743  -14.529 1.00 34.34  ? 322 ALA A O     1 
ATOM   2657 C  CB    . ALA A 1 322 ? -43.562 50.457  -14.778 1.00 27.52  ? 322 ALA A CB    1 
ATOM   2658 N  N     . SER A 1 323 ? -41.807 52.783  -16.777 1.00 33.81  ? 323 SER A N     1 
ATOM   2659 C  CA    . SER A 1 323 ? -41.520 54.215  -16.901 1.00 38.78  ? 323 SER A CA    1 
ATOM   2660 C  C     . SER A 1 323 ? -42.811 55.007  -16.881 1.00 41.83  ? 323 SER A C     1 
ATOM   2661 O  O     . SER A 1 323 ? -43.844 54.495  -16.461 1.00 39.95  ? 323 SER A O     1 
ATOM   2662 C  CB    . SER A 1 323 ? -40.751 54.505  -18.199 1.00 40.24  ? 323 SER A CB    1 
ATOM   2663 O  OG    . SER A 1 323 ? -41.574 54.398  -19.364 1.00 40.46  ? 323 SER A OG    1 
ATOM   2664 N  N     . GLU A 1 324 ? -42.752 56.252  -17.348 1.00 47.32  ? 324 GLU A N     1 
ATOM   2665 C  CA    . GLU A 1 324 ? -43.947 57.074  -17.487 1.00 51.74  ? 324 GLU A CA    1 
ATOM   2666 C  C     . GLU A 1 324 ? -45.004 56.386  -18.349 1.00 49.21  ? 324 GLU A C     1 
ATOM   2667 O  O     . GLU A 1 324 ? -46.124 56.162  -17.900 1.00 48.33  ? 324 GLU A O     1 
ATOM   2668 C  CB    . GLU A 1 324 ? -43.606 58.429  -18.098 1.00 57.92  ? 324 GLU A CB    1 
ATOM   2669 C  CG    . GLU A 1 324 ? -44.342 59.625  -17.457 1.00 67.09  ? 324 GLU A CG    1 
ATOM   2670 C  CD    . GLU A 1 324 ? -45.857 59.408  -17.267 1.00 70.73  ? 324 GLU A CD    1 
ATOM   2671 O  OE1   . GLU A 1 324 ? -46.291 59.185  -16.104 1.00 71.14  ? 324 GLU A OE1   1 
ATOM   2672 O  OE2   . GLU A 1 324 ? -46.610 59.464  -18.276 1.00 73.00  ? 324 GLU A OE2   1 
ATOM   2673 N  N     . GLU A 1 325 ? -44.622 56.028  -19.575 1.00 48.58  ? 325 GLU A N     1 
ATOM   2674 C  CA    . GLU A 1 325 ? -45.571 55.566  -20.603 1.00 48.14  ? 325 GLU A CA    1 
ATOM   2675 C  C     . GLU A 1 325 ? -45.244 54.189  -21.188 1.00 42.81  ? 325 GLU A C     1 
ATOM   2676 O  O     . GLU A 1 325 ? -45.956 53.696  -22.061 1.00 41.92  ? 325 GLU A O     1 
ATOM   2677 C  CB    . GLU A 1 325 ? -45.669 56.601  -21.723 1.00 53.34  ? 325 GLU A CB    1 
ATOM   2678 C  CG    . GLU A 1 325 ? -44.322 57.248  -22.028 1.00 59.85  ? 325 GLU A CG    1 
ATOM   2679 C  CD    . GLU A 1 325 ? -44.277 57.963  -23.372 1.00 69.76  ? 325 GLU A CD    1 
ATOM   2680 O  OE1   . GLU A 1 325 ? -45.320 58.010  -24.070 1.00 73.28  ? 325 GLU A OE1   1 
ATOM   2681 O  OE2   . GLU A 1 325 ? -43.185 58.474  -23.735 1.00 74.62  ? 325 GLU A OE2   1 
ATOM   2682 N  N     . PHE A 1 326 ? -44.177 53.570  -20.698 1.00 39.60  ? 326 PHE A N     1 
ATOM   2683 C  CA    . PHE A 1 326 ? -43.809 52.238  -21.147 1.00 35.40  ? 326 PHE A CA    1 
ATOM   2684 C  C     . PHE A 1 326 ? -43.467 51.307  -19.998 1.00 31.70  ? 326 PHE A C     1 
ATOM   2685 O  O     . PHE A 1 326 ? -43.007 51.744  -18.947 1.00 32.24  ? 326 PHE A O     1 
ATOM   2686 C  CB    . PHE A 1 326 ? -42.618 52.304  -22.103 1.00 36.52  ? 326 PHE A CB    1 
ATOM   2687 C  CG    . PHE A 1 326 ? -42.905 53.030  -23.382 1.00 40.58  ? 326 PHE A CG    1 
ATOM   2688 C  CD1   . PHE A 1 326 ? -42.646 54.392  -23.496 1.00 45.49  ? 326 PHE A CD1   1 
ATOM   2689 C  CD2   . PHE A 1 326 ? -43.435 52.358  -24.469 1.00 40.13  ? 326 PHE A CD2   1 
ATOM   2690 C  CE1   . PHE A 1 326 ? -42.912 55.067  -24.666 1.00 48.62  ? 326 PHE A CE1   1 
ATOM   2691 C  CE2   . PHE A 1 326 ? -43.704 53.033  -25.647 1.00 44.08  ? 326 PHE A CE2   1 
ATOM   2692 C  CZ    . PHE A 1 326 ? -43.440 54.389  -25.743 1.00 48.36  ? 326 PHE A CZ    1 
ATOM   2693 N  N     . CYS A 1 327 ? -43.699 50.018  -20.220 1.00 28.32  ? 327 CYS A N     1 
ATOM   2694 C  CA    . CYS A 1 327 ? -43.214 48.963  -19.346 1.00 25.29  ? 327 CYS A CA    1 
ATOM   2695 C  C     . CYS A 1 327 ? -42.273 48.108  -20.146 1.00 22.99  ? 327 CYS A C     1 
ATOM   2696 O  O     . CYS A 1 327 ? -42.517 47.857  -21.325 1.00 23.54  ? 327 CYS A O     1 
ATOM   2697 C  CB    . CYS A 1 327 ? -44.358 48.073  -18.881 1.00 24.11  ? 327 CYS A CB    1 
ATOM   2698 S  SG    . CYS A 1 327 ? -45.549 48.845  -17.783 1.00 28.99  ? 327 CYS A SG    1 
ATOM   2699 N  N     . TYR A 1 328 ? -41.204 47.643  -19.514 1.00 21.05  ? 328 TYR A N     1 
ATOM   2700 C  CA    . TYR A 1 328 ? -40.282 46.729  -20.174 1.00 18.91  ? 328 TYR A CA    1 
ATOM   2701 C  C     . TYR A 1 328 ? -40.225 45.399  -19.437 1.00 16.31  ? 328 TYR A C     1 
ATOM   2702 O  O     . TYR A 1 328 ? -40.401 45.338  -18.222 1.00 15.99  ? 328 TYR A O     1 
ATOM   2703 C  CB    . TYR A 1 328 ? -38.903 47.356  -20.268 1.00 20.25  ? 328 TYR A CB    1 
ATOM   2704 C  CG    . TYR A 1 328 ? -38.902 48.766  -20.832 1.00 23.78  ? 328 TYR A CG    1 
ATOM   2705 C  CD1   . TYR A 1 328 ? -39.490 49.828  -20.129 1.00 25.64  ? 328 TYR A CD1   1 
ATOM   2706 C  CD2   . TYR A 1 328 ? -38.281 49.049  -22.051 1.00 25.49  ? 328 TYR A CD2   1 
ATOM   2707 C  CE1   . TYR A 1 328 ? -39.480 51.123  -20.627 1.00 29.20  ? 328 TYR A CE1   1 
ATOM   2708 C  CE2   . TYR A 1 328 ? -38.255 50.343  -22.561 1.00 29.79  ? 328 TYR A CE2   1 
ATOM   2709 C  CZ    . TYR A 1 328 ? -38.861 51.377  -21.844 1.00 32.27  ? 328 TYR A CZ    1 
ATOM   2710 O  OH    . TYR A 1 328 ? -38.853 52.664  -22.352 1.00 37.60  ? 328 TYR A OH    1 
ATOM   2711 N  N     . LEU A 1 329 ? -40.026 44.321  -20.182 1.00 15.10  ? 329 LEU A N     1 
ATOM   2712 C  CA    . LEU A 1 329 ? -39.815 43.003  -19.571 1.00 13.21  ? 329 LEU A CA    1 
ATOM   2713 C  C     . LEU A 1 329 ? -38.459 42.521  -20.036 1.00 13.27  ? 329 LEU A C     1 
ATOM   2714 O  O     . LEU A 1 329 ? -38.272 42.189  -21.220 1.00 13.85  ? 329 LEU A O     1 
ATOM   2715 C  CB    . LEU A 1 329 ? -40.918 42.010  -19.948 1.00 12.03  ? 329 LEU A CB    1 
ATOM   2716 C  CG    . LEU A 1 329 ? -42.345 42.342  -19.501 1.00 11.98  ? 329 LEU A CG    1 
ATOM   2717 C  CD1   . LEU A 1 329 ? -43.318 41.587  -20.352 1.00 11.29  ? 329 LEU A CD1   1 
ATOM   2718 C  CD2   . LEU A 1 329 ? -42.605 42.071  -18.018 1.00 10.01  ? 329 LEU A CD2   1 
ATOM   2719 N  N     . LEU A 1 330 ? -37.507 42.528  -19.108 1.00 13.17  ? 330 LEU A N     1 
ATOM   2720 C  CA    . LEU A 1 330 ? -36.117 42.242  -19.420 1.00 13.53  ? 330 LEU A CA    1 
ATOM   2721 C  C     . LEU A 1 330 ? -35.855 40.772  -19.196 1.00 12.47  ? 330 LEU A C     1 
ATOM   2722 O  O     . LEU A 1 330 ? -36.442 40.169  -18.299 1.00 12.25  ? 330 LEU A O     1 
ATOM   2723 C  CB    . LEU A 1 330 ? -35.223 43.088  -18.531 1.00 14.68  ? 330 LEU A CB    1 
ATOM   2724 C  CG    . LEU A 1 330 ? -35.568 44.569  -18.699 1.00 17.09  ? 330 LEU A CG    1 
ATOM   2725 C  CD1   . LEU A 1 330 ? -35.685 45.271  -17.364 1.00 18.85  ? 330 LEU A CD1   1 
ATOM   2726 C  CD2   . LEU A 1 330 ? -34.571 45.260  -19.587 1.00 19.46  ? 330 LEU A CD2   1 
ATOM   2727 N  N     . PHE A 1 331 ? -35.017 40.185  -20.045 1.00 12.58  ? 331 PHE A N     1 
ATOM   2728 C  CA    . PHE A 1 331 ? -34.591 38.800  -19.879 1.00 12.22  ? 331 PHE A CA    1 
ATOM   2729 C  C     . PHE A 1 331 ? -33.148 38.645  -20.353 1.00 13.64  ? 331 PHE A C     1 
ATOM   2730 O  O     . PHE A 1 331 ? -32.679 39.394  -21.226 1.00 14.48  ? 331 PHE A O     1 
ATOM   2731 C  CB    . PHE A 1 331 ? -35.477 37.818  -20.668 1.00 11.89  ? 331 PHE A CB    1 
ATOM   2732 C  CG    . PHE A 1 331 ? -36.944 37.959  -20.412 1.00 10.70  ? 331 PHE A CG    1 
ATOM   2733 C  CD1   . PHE A 1 331 ? -37.555 37.232  -19.413 1.00 11.44  ? 331 PHE A CD1   1 
ATOM   2734 C  CD2   . PHE A 1 331 ? -37.716 38.807  -21.184 1.00 9.99   ? 331 PHE A CD2   1 
ATOM   2735 C  CE1   . PHE A 1 331 ? -38.912 37.361  -19.172 1.00 11.38  ? 331 PHE A CE1   1 
ATOM   2736 C  CE2   . PHE A 1 331 ? -39.059 38.938  -20.958 1.00 9.89   ? 331 PHE A CE2   1 
ATOM   2737 C  CZ    . PHE A 1 331 ? -39.664 38.216  -19.949 1.00 11.03  ? 331 PHE A CZ    1 
ATOM   2738 N  N     . GLU A 1 332 ? -32.464 37.656  -19.774 1.00 14.16  ? 332 GLU A N     1 
ATOM   2739 C  CA    . GLU A 1 332 ? -31.141 37.227  -20.204 1.00 15.59  ? 332 GLU A CA    1 
ATOM   2740 C  C     . GLU A 1 332 ? -31.072 35.707  -20.429 1.00 16.77  ? 332 GLU A C     1 
ATOM   2741 O  O     . GLU A 1 332 ? -31.445 34.911  -19.556 1.00 16.92  ? 332 GLU A O     1 
ATOM   2742 C  CB    . GLU A 1 332 ? -30.110 37.624  -19.168 1.00 15.85  ? 332 GLU A CB    1 
ATOM   2743 C  CG    . GLU A 1 332 ? -28.705 37.540  -19.701 1.00 17.66  ? 332 GLU A CG    1 
ATOM   2744 C  CD    . GLU A 1 332 ? -27.666 37.787  -18.642 1.00 18.47  ? 332 GLU A CD    1 
ATOM   2745 O  OE1   . GLU A 1 332 ? -28.024 37.754  -17.444 1.00 17.82  ? 332 GLU A OE1   1 
ATOM   2746 O  OE2   . GLU A 1 332 ? -26.489 38.013  -19.004 1.00 19.95  ? 332 GLU A OE2   1 
ATOM   2747 N  N     . CYS A 1 333 ? -30.558 35.306  -21.587 1.00 18.33  ? 333 CYS A N     1 
ATOM   2748 C  CA    . CYS A 1 333 ? -30.467 33.896  -21.924 1.00 19.78  ? 333 CYS A CA    1 
ATOM   2749 C  C     . CYS A 1 333 ? -29.059 33.406  -22.136 1.00 20.82  ? 333 CYS A C     1 
ATOM   2750 O  O     . CYS A 1 333 ? -28.220 34.104  -22.686 1.00 21.63  ? 333 CYS A O     1 
ATOM   2751 C  CB    . CYS A 1 333 ? -31.289 33.617  -23.172 1.00 20.82  ? 333 CYS A CB    1 
ATOM   2752 S  SG    . CYS A 1 333 ? -33.047 33.604  -22.821 1.00 23.51  ? 333 CYS A SG    1 
ATOM   2753 N  N     . GLN A 1 334 ? -28.820 32.177  -21.709 1.00 21.54  ? 334 GLN A N     1 
ATOM   2754 C  CA    . GLN A 1 334 ? -27.548 31.516  -21.940 1.00 23.23  ? 334 GLN A CA    1 
ATOM   2755 C  C     . GLN A 1 334 ? -27.385 31.146  -23.396 1.00 25.13  ? 334 GLN A C     1 
ATOM   2756 O  O     . GLN A 1 334 ? -26.272 31.169  -23.919 1.00 27.47  ? 334 GLN A O     1 
ATOM   2757 C  CB    . GLN A 1 334 ? -27.433 30.256  -21.098 1.00 24.35  ? 334 GLN A CB    1 
ATOM   2758 C  CG    . GLN A 1 334 ? -27.119 30.510  -19.647 1.00 23.41  ? 334 GLN A CG    1 
ATOM   2759 C  CD    . GLN A 1 334 ? -26.593 29.274  -18.979 1.00 25.56  ? 334 GLN A CD    1 
ATOM   2760 O  OE1   . GLN A 1 334 ? -27.354 28.488  -18.449 1.00 27.57  ? 334 GLN A OE1   1 
ATOM   2761 N  NE2   . GLN A 1 334 ? -25.293 29.072  -19.037 1.00 26.51  ? 334 GLN A NE2   1 
ATOM   2762 N  N     . ILE A 1 335 ? -28.491 30.787  -24.048 1.00 24.68  ? 335 ILE A N     1 
ATOM   2763 C  CA    . ILE A 1 335 ? -28.442 30.356  -25.434 1.00 26.53  ? 335 ILE A CA    1 
ATOM   2764 C  C     . ILE A 1 335 ? -28.883 31.507  -26.323 1.00 26.14  ? 335 ILE A C     1 
ATOM   2765 O  O     . ILE A 1 335 ? -29.998 31.995  -26.189 1.00 25.12  ? 335 ILE A O     1 
ATOM   2766 C  CB    . ILE A 1 335 ? -29.311 29.110  -25.669 1.00 27.55  ? 335 ILE A CB    1 
ATOM   2767 C  CG1   . ILE A 1 335 ? -28.510 27.826  -25.469 1.00 29.60  ? 335 ILE A CG1   1 
ATOM   2768 C  CG2   . ILE A 1 335 ? -29.761 29.062  -27.104 1.00 30.22  ? 335 ILE A CG2   1 
ATOM   2769 C  CD1   . ILE A 1 335 ? -27.911 27.628  -24.131 1.00 29.52  ? 335 ILE A CD1   1 
ATOM   2770 N  N     . LYS A 1 336 ? -28.003 31.963  -27.208 1.00 27.96  ? 336 LYS A N     1 
ATOM   2771 C  CA    . LYS A 1 336 ? -28.350 33.012  -28.164 1.00 28.29  ? 336 LYS A CA    1 
ATOM   2772 C  C     . LYS A 1 336 ? -29.007 32.418  -29.409 1.00 30.92  ? 336 LYS A C     1 
ATOM   2773 O  O     . LYS A 1 336 ? -29.751 33.089  -30.133 1.00 31.42  ? 336 LYS A O     1 
ATOM   2774 C  CB    . LYS A 1 336 ? -27.101 33.798  -28.557 1.00 30.09  ? 336 LYS A CB    1 
ATOM   2775 C  CG    . LYS A 1 336 ? -26.759 34.906  -27.586 1.00 28.24  ? 336 LYS A CG    1 
ATOM   2776 C  CD    . LYS A 1 336 ? -25.280 35.187  -27.515 1.00 30.69  ? 336 LYS A CD    1 
ATOM   2777 C  CE    . LYS A 1 336 ? -24.799 35.830  -28.786 1.00 34.94  ? 336 LYS A CE    1 
ATOM   2778 N  NZ    . LYS A 1 336 ? -23.347 36.071  -28.678 1.00 39.11  ? 336 LYS A NZ    1 
ATOM   2779 N  N     . GLU A 1 337 ? -28.732 31.146  -29.653 1.00 33.11  ? 337 GLU A N     1 
ATOM   2780 C  CA    . GLU A 1 337 ? -29.143 30.518  -30.879 1.00 36.29  ? 337 GLU A CA    1 
ATOM   2781 C  C     . GLU A 1 337 ? -29.152 29.024  -30.689 1.00 38.01  ? 337 GLU A C     1 
ATOM   2782 O  O     . GLU A 1 337 ? -28.228 28.447  -30.125 1.00 38.71  ? 337 GLU A O     1 
ATOM   2783 C  CB    . GLU A 1 337 ? -28.165 30.883  -31.970 1.00 39.76  ? 337 GLU A CB    1 
ATOM   2784 C  CG    . GLU A 1 337 ? -28.663 30.642  -33.361 1.00 44.68  ? 337 GLU A CG    1 
ATOM   2785 C  CD    . GLU A 1 337 ? -27.527 30.680  -34.350 1.00 51.59  ? 337 GLU A CD    1 
ATOM   2786 O  OE1   . GLU A 1 337 ? -26.414 31.095  -33.941 1.00 52.09  ? 337 GLU A OE1   1 
ATOM   2787 O  OE2   . GLU A 1 337 ? -27.732 30.280  -35.521 1.00 57.32  ? 337 GLU A OE2   1 
ATOM   2788 N  N     . ILE A 1 338 ? -30.211 28.398  -31.165 1.00 39.32  ? 338 ILE A N     1 
ATOM   2789 C  CA    . ILE A 1 338 ? -30.350 26.970  -31.054 1.00 41.82  ? 338 ILE A CA    1 
ATOM   2790 C  C     . ILE A 1 338 ? -30.509 26.401  -32.466 1.00 47.08  ? 338 ILE A C     1 
ATOM   2791 O  O     . ILE A 1 338 ? -30.873 27.119  -33.393 1.00 47.76  ? 338 ILE A O     1 
ATOM   2792 C  CB    . ILE A 1 338 ? -31.503 26.594  -30.069 1.00 39.26  ? 338 ILE A CB    1 
ATOM   2793 C  CG1   . ILE A 1 338 ? -31.349 25.147  -29.593 1.00 41.96  ? 338 ILE A CG1   1 
ATOM   2794 C  CG2   . ILE A 1 338 ? -32.876 26.868  -30.684 1.00 38.37  ? 338 ILE A CG2   1 
ATOM   2795 C  CD1   . ILE A 1 338 ? -31.929 24.863  -28.237 1.00 39.41  ? 338 ILE A CD1   1 
ATOM   2796 N  N     . SER A 1 339 ? -30.199 25.123  -32.637 1.00 51.67  ? 339 SER A N     1 
ATOM   2797 C  CA    . SER A 1 339 ? -30.295 24.503  -33.941 1.00 57.96  ? 339 SER A CA    1 
ATOM   2798 C  C     . SER A 1 339 ? -31.745 24.407  -34.386 1.00 59.63  ? 339 SER A C     1 
ATOM   2799 O  O     . SER A 1 339 ? -32.654 24.432  -33.567 1.00 56.85  ? 339 SER A O     1 
ATOM   2800 C  CB    . SER A 1 339 ? -29.685 23.126  -33.895 1.00 61.86  ? 339 SER A CB    1 
ATOM   2801 O  OG    . SER A 1 339 ? -30.382 22.350  -32.956 1.00 61.46  ? 339 SER A OG    1 
ATOM   2802 N  N     . ARG A 1 340 ? -31.947 24.301  -35.693 1.00 24.93  ? 340 ARG A N     1 
ATOM   2803 C  CA    . ARG A 1 340 ? -33.271 24.222  -36.277 1.00 30.83  ? 340 ARG A CA    1 
ATOM   2804 C  C     . ARG A 1 340 ? -33.894 22.893  -35.890 1.00 29.62  ? 340 ARG A C     1 
ATOM   2805 O  O     . ARG A 1 340 ? -35.078 22.823  -35.573 1.00 32.72  ? 340 ARG A O     1 
ATOM   2806 C  CB    . ARG A 1 340 ? -33.184 24.328  -37.801 1.00 35.58  ? 340 ARG A CB    1 
ATOM   2807 C  CG    . ARG A 1 340 ? -34.400 24.939  -38.470 1.00 45.12  ? 340 ARG A CG    1 
ATOM   2808 C  CD    . ARG A 1 340 ? -34.054 26.306  -39.017 1.00 53.99  ? 340 ARG A CD    1 
ATOM   2809 N  NE    . ARG A 1 340 ? -35.147 27.260  -38.839 1.00 63.42  ? 340 ARG A NE    1 
ATOM   2810 C  CZ    . ARG A 1 340 ? -35.013 28.584  -38.953 1.00 70.51  ? 340 ARG A CZ    1 
ATOM   2811 N  NH1   . ARG A 1 340 ? -33.823 29.105  -39.254 1.00 70.96  ? 340 ARG A NH1   1 
ATOM   2812 N  NH2   . ARG A 1 340 ? -36.062 29.395  -38.765 1.00 76.78  ? 340 ARG A NH2   1 
ATOM   2813 N  N     . VAL A 1 341 ? -33.080 21.844  -35.899 1.00 26.47  ? 341 VAL A N     1 
ATOM   2814 C  CA    . VAL A 1 341 ? -33.567 20.489  -35.685 1.00 26.40  ? 341 VAL A CA    1 
ATOM   2815 C  C     . VAL A 1 341 ? -33.483 20.094  -34.224 1.00 23.78  ? 341 VAL A C     1 
ATOM   2816 O  O     . VAL A 1 341 ? -32.537 20.467  -33.533 1.00 20.96  ? 341 VAL A O     1 
ATOM   2817 C  CB    . VAL A 1 341 ? -32.781 19.468  -36.542 1.00 25.06  ? 341 VAL A CB    1 
ATOM   2818 C  CG1   . VAL A 1 341 ? -31.302 19.607  -36.303 1.00 22.38  ? 341 VAL A CG1   1 
ATOM   2819 C  CG2   . VAL A 1 341 ? -33.207 18.050  -36.229 1.00 24.39  ? 341 VAL A CG2   1 
ATOM   2820 N  N     . PHE A 1 342 ? -34.478 19.339  -33.765 1.00 26.27  ? 342 PHE A N     1 
ATOM   2821 C  CA    . PHE A 1 342 ? -34.443 18.735  -32.435 1.00 25.58  ? 342 PHE A CA    1 
ATOM   2822 C  C     . PHE A 1 342 ? -35.016 17.309  -32.435 1.00 27.53  ? 342 PHE A C     1 
ATOM   2823 O  O     . PHE A 1 342 ? -35.511 16.835  -33.453 1.00 29.38  ? 342 PHE A O     1 
ATOM   2824 C  CB    . PHE A 1 342 ? -35.157 19.633  -31.420 1.00 27.82  ? 342 PHE A CB    1 
ATOM   2825 C  CG    . PHE A 1 342 ? -36.640 19.656  -31.580 1.00 33.19  ? 342 PHE A CG    1 
ATOM   2826 C  CD1   . PHE A 1 342 ? -37.449 18.885  -30.754 1.00 36.10  ? 342 PHE A CD1   1 
ATOM   2827 C  CD2   . PHE A 1 342 ? -37.235 20.446  -32.558 1.00 36.79  ? 342 PHE A CD2   1 
ATOM   2828 C  CE1   . PHE A 1 342 ? -38.827 18.902  -30.891 1.00 42.64  ? 342 PHE A CE1   1 
ATOM   2829 C  CE2   . PHE A 1 342 ? -38.612 20.471  -32.713 1.00 43.09  ? 342 PHE A CE2   1 
ATOM   2830 C  CZ    . PHE A 1 342 ? -39.413 19.696  -31.875 1.00 46.32  ? 342 PHE A CZ    1 
ATOM   2831 N  N     . ARG A 1 343 ? -34.933 16.641  -31.285 1.00 28.37  ? 343 ARG A N     1 
ATOM   2832 C  CA    . ARG A 1 343 ? -35.378 15.256  -31.135 1.00 31.54  ? 343 ARG A CA    1 
ATOM   2833 C  C     . ARG A 1 343 ? -36.778 15.208  -30.581 1.00 38.01  ? 343 ARG A C     1 
ATOM   2834 O  O     . ARG A 1 343 ? -37.165 16.055  -29.782 1.00 40.39  ? 343 ARG A O     1 
ATOM   2835 C  CB    . ARG A 1 343 ? -34.469 14.481  -30.173 1.00 29.92  ? 343 ARG A CB    1 
ATOM   2836 C  CG    . ARG A 1 343 ? -33.111 14.047  -30.739 1.00 25.85  ? 343 ARG A CG    1 
ATOM   2837 C  CD    . ARG A 1 343 ? -32.154 13.647  -29.615 1.00 24.86  ? 343 ARG A CD    1 
ATOM   2838 N  NE    . ARG A 1 343 ? -32.639 12.479  -28.886 1.00 29.43  ? 343 ARG A NE    1 
ATOM   2839 C  CZ    . ARG A 1 343 ? -32.138 11.251  -29.010 1.00 30.36  ? 343 ARG A CZ    1 
ATOM   2840 N  NH1   . ARG A 1 343 ? -31.114 11.020  -29.823 1.00 27.38  ? 343 ARG A NH1   1 
ATOM   2841 N  NH2   . ARG A 1 343 ? -32.659 10.251  -28.312 1.00 34.74  ? 343 ARG A NH2   1 
ATOM   2842 N  N     . ARG A 1 344 ? -37.533 14.205  -31.001 1.00 42.25  ? 344 ARG A N     1 
ATOM   2843 C  CA    . ARG A 1 344 ? -38.838 13.953  -30.426 1.00 49.83  ? 344 ARG A CA    1 
ATOM   2844 C  C     . ARG A 1 344 ? -38.921 12.479  -30.049 1.00 52.53  ? 344 ARG A C     1 
ATOM   2845 O  O     . ARG A 1 344 ? -38.530 11.601  -30.832 1.00 51.09  ? 344 ARG A O     1 
ATOM   2846 C  CB    . ARG A 1 344 ? -39.953 14.357  -31.396 1.00 54.45  ? 344 ARG A CB    1 
ATOM   2847 C  CG    . ARG A 1 344 ? -41.365 14.221  -30.824 1.00 64.00  ? 344 ARG A CG    1 
ATOM   2848 C  CD    . ARG A 1 344 ? -42.367 15.066  -31.593 1.00 69.92  ? 344 ARG A CD    1 
ATOM   2849 N  NE    . ARG A 1 344 ? -42.433 16.432  -31.076 1.00 71.59  ? 344 ARG A NE    1 
ATOM   2850 C  CZ    . ARG A 1 344 ? -43.089 17.438  -31.659 1.00 76.70  ? 344 ARG A CZ    1 
ATOM   2851 N  NH1   . ARG A 1 344 ? -43.736 17.252  -32.806 1.00 81.51  ? 344 ARG A NH1   1 
ATOM   2852 N  NH2   . ARG A 1 344 ? -43.097 18.642  -31.099 1.00 77.21  ? 344 ARG A NH2   1 
ATOM   2853 N  N     . MET A 1 345 ? -39.407 12.216  -28.839 1.00 57.45  ? 345 MET A N     1 
ATOM   2854 C  CA    . MET A 1 345 ? -39.520 10.851  -28.343 1.00 61.30  ? 345 MET A CA    1 
ATOM   2855 C  C     . MET A 1 345 ? -40.590 10.108  -29.118 1.00 66.41  ? 345 MET A C     1 
ATOM   2856 O  O     . MET A 1 345 ? -41.615 10.684  -29.448 1.00 70.71  ? 345 MET A O     1 
ATOM   2857 C  CB    . MET A 1 345 ? -39.850 10.842  -26.853 1.00 67.03  ? 345 MET A CB    1 
ATOM   2858 C  CG    . MET A 1 345 ? -40.084 9.459   -26.296 1.00 72.79  ? 345 MET A CG    1 
ATOM   2859 S  SD    . MET A 1 345 ? -39.860 9.397   -24.524 1.00 79.02  ? 345 MET A SD    1 
ATOM   2860 C  CE    . MET A 1 345 ? -41.498 9.862   -23.928 1.00 89.42  ? 345 MET A CE    1 
ATOM   2861 N  N     . GLY A 1 346 ? -40.338 8.838   -29.413 1.00 66.72  ? 346 GLY A N     1 
ATOM   2862 C  CA    . GLY A 1 346 ? -41.304 8.008   -30.111 1.00 72.40  ? 346 GLY A CA    1 
ATOM   2863 C  C     . GLY A 1 346 ? -41.700 6.791   -29.305 1.00 79.39  ? 346 GLY A C     1 
ATOM   2864 O  O     . GLY A 1 346 ? -41.173 6.572   -28.216 1.00 79.65  ? 346 GLY A O     1 
ATOM   2865 N  N     . PRO A 1 347 ? -42.652 6.000   -29.829 1.00 86.26  ? 347 PRO A N     1 
ATOM   2866 C  CA    . PRO A 1 347 ? -43.091 4.758   -29.193 1.00 94.42  ? 347 PRO A CA    1 
ATOM   2867 C  C     . PRO A 1 347 ? -42.031 3.665   -29.210 1.00 91.36  ? 347 PRO A C     1 
ATOM   2868 O  O     . PRO A 1 347 ? -41.180 3.624   -30.102 1.00 83.98  ? 347 PRO A O     1 
ATOM   2869 C  CB    . PRO A 1 347 ? -44.291 4.327   -30.046 1.00 101.78 ? 347 PRO A CB    1 
ATOM   2870 C  CG    . PRO A 1 347 ? -44.080 4.979   -31.368 1.00 95.72  ? 347 PRO A CG    1 
ATOM   2871 C  CD    . PRO A 1 347 ? -43.397 6.277   -31.071 1.00 87.89  ? 347 PRO A CD    1 
ATOM   2872 N  N     . GLN A 1 348 ? -42.108 2.785   -28.219 1.00 98.16  ? 348 GLN A N     1 
ATOM   2873 C  CA    . GLN A 1 348 ? -41.232 1.624   -28.122 1.00 98.29  ? 348 GLN A CA    1 
ATOM   2874 C  C     . GLN A 1 348 ? -41.473 0.677   -29.294 1.00 99.86  ? 348 GLN A C     1 
ATOM   2875 O  O     . GLN A 1 348 ? -42.604 0.536   -29.753 1.00 106.04 ? 348 GLN A O     1 
ATOM   2876 C  CB    . GLN A 1 348 ? -41.446 0.927   -26.782 1.00 107.46 ? 348 GLN A CB    1 
ATOM   2877 C  CG    . GLN A 1 348 ? -41.393 1.905   -25.602 1.00 108.74 ? 348 GLN A CG    1 
ATOM   2878 C  CD    . GLN A 1 348 ? -41.084 1.228   -24.282 1.00 117.08 ? 348 GLN A CD    1 
ATOM   2879 O  OE1   . GLN A 1 348 ? -41.624 0.162   -23.978 1.00 127.01 ? 348 GLN A OE1   1 
ATOM   2880 N  NE2   . GLN A 1 348 ? -40.211 1.848   -23.485 1.00 113.71 ? 348 GLN A NE2   1 
ATOM   2881 N  N     . PHE A 1 349 ? -40.408 0.040   -29.773 1.00 95.38  ? 349 PHE A N     1 
ATOM   2882 C  CA    . PHE A 1 349 ? -40.413 -0.622  -31.087 1.00 95.13  ? 349 PHE A CA    1 
ATOM   2883 C  C     . PHE A 1 349 ? -41.478 -1.685  -31.255 1.00 105.29 ? 349 PHE A C     1 
ATOM   2884 O  O     . PHE A 1 349 ? -41.916 -1.954  -32.374 1.00 106.79 ? 349 PHE A O     1 
ATOM   2885 C  CB    . PHE A 1 349 ? -39.036 -1.217  -31.409 1.00 90.24  ? 349 PHE A CB    1 
ATOM   2886 C  CG    . PHE A 1 349 ? -38.644 -2.374  -30.527 1.00 96.19  ? 349 PHE A CG    1 
ATOM   2887 C  CD1   . PHE A 1 349 ? -38.914 -3.687  -30.913 1.00 102.90 ? 349 PHE A CD1   1 
ATOM   2888 C  CD2   . PHE A 1 349 ? -37.990 -2.153  -29.315 1.00 96.31  ? 349 PHE A CD2   1 
ATOM   2889 C  CE1   . PHE A 1 349 ? -38.551 -4.765  -30.105 1.00 109.07 ? 349 PHE A CE1   1 
ATOM   2890 C  CE2   . PHE A 1 349 ? -37.621 -3.221  -28.501 1.00 102.87 ? 349 PHE A CE2   1 
ATOM   2891 C  CZ    . PHE A 1 349 ? -37.904 -4.532  -28.897 1.00 109.30 ? 349 PHE A CZ    1 
ATOM   2892 N  N     . GLU A 1 350 ? -41.870 -2.285  -30.131 1.00 113.29 ? 350 GLU A N     1 
ATOM   2893 C  CA    . GLU A 1 350 ? -42.809 -3.410  -30.076 1.00 124.55 ? 350 GLU A CA    1 
ATOM   2894 C  C     . GLU A 1 350 ? -44.250 -2.967  -30.311 1.00 131.12 ? 350 GLU A C     1 
ATOM   2895 O  O     . GLU A 1 350 ? -45.024 -3.670  -30.967 1.00 138.21 ? 350 GLU A O     1 
ATOM   2896 C  CB    . GLU A 1 350 ? -42.697 -4.095  -28.711 1.00 131.94 ? 350 GLU A CB    1 
ATOM   2897 C  CG    . GLU A 1 350 ? -41.269 -4.472  -28.333 1.00 126.88 ? 350 GLU A CG    1 
ATOM   2898 C  CD    . GLU A 1 350 ? -40.936 -4.212  -26.877 1.00 129.57 ? 350 GLU A CD    1 
ATOM   2899 O  OE1   . GLU A 1 350 ? -39.845 -3.672  -26.600 1.00 120.99 ? 350 GLU A OE1   1 
ATOM   2900 O  OE2   . GLU A 1 350 ? -41.762 -4.549  -26.005 1.00 141.15 ? 350 GLU A OE2   1 
ATOM   2901 N  N     . ASP A 1 351 ? -44.589 -1.797  -29.765 1.00 129.48 ? 351 ASP A N     1 
ATOM   2902 C  CA    . ASP A 1 351 ? -45.915 -1.186  -29.872 1.00 135.94 ? 351 ASP A CA    1 
ATOM   2903 C  C     . ASP A 1 351 ? -46.244 -0.804  -31.321 1.00 133.24 ? 351 ASP A C     1 
ATOM   2904 O  O     . ASP A 1 351 ? -46.210 0.375   -31.695 1.00 127.31 ? 351 ASP A O     1 
ATOM   2905 C  CB    . ASP A 1 351 ? -45.977 0.039   -28.958 1.00 133.63 ? 351 ASP A CB    1 
ATOM   2906 C  CG    . ASP A 1 351 ? -47.384 0.513   -28.716 1.00 142.89 ? 351 ASP A CG    1 
ATOM   2907 O  OD1   . ASP A 1 351 ? -47.791 0.560   -27.541 1.00 149.95 ? 351 ASP A OD1   1 
ATOM   2908 O  OD2   . ASP A 1 351 ? -48.085 0.840   -29.693 1.00 143.63 ? 351 ASP A OD2   1 
ATOM   2909 N  N     . GLU A 1 352 ? -46.591 -1.819  -32.113 1.00 138.84 ? 352 GLU A N     1 
ATOM   2910 C  CA    . GLU A 1 352 ? -46.679 -1.713  -33.568 1.00 136.74 ? 352 GLU A CA    1 
ATOM   2911 C  C     . GLU A 1 352 ? -47.595 -0.603  -34.078 1.00 139.06 ? 352 GLU A C     1 
ATOM   2912 O  O     . GLU A 1 352 ? -47.188 0.195   -34.929 1.00 132.03 ? 352 GLU A O     1 
ATOM   2913 C  CB    . GLU A 1 352 ? -47.111 -3.043  -34.170 1.00 145.08 ? 352 GLU A CB    1 
ATOM   2914 C  CG    . GLU A 1 352 ? -46.751 -3.152  -35.629 1.00 141.59 ? 352 GLU A CG    1 
ATOM   2915 C  CD    . GLU A 1 352 ? -47.829 -3.807  -36.448 1.00 152.73 ? 352 GLU A CD    1 
ATOM   2916 O  OE1   . GLU A 1 352 ? -49.017 -3.676  -36.082 1.00 162.29 ? 352 GLU A OE1   1 
ATOM   2917 O  OE2   . GLU A 1 352 ? -47.486 -4.443  -37.467 1.00 152.81 ? 352 GLU A OE2   1 
ATOM   2918 N  N     . ARG A 1 353 ? -48.822 -0.567  -33.554 1.00 149.91 ? 353 ARG A N     1 
ATOM   2919 C  CA    . ARG A 1 353 ? -49.844 0.397   -33.983 1.00 154.97 ? 353 ARG A CA    1 
ATOM   2920 C  C     . ARG A 1 353 ? -49.418 1.866   -33.819 1.00 146.16 ? 353 ARG A C     1 
ATOM   2921 O  O     . ARG A 1 353 ? -49.807 2.719   -34.622 1.00 146.34 ? 353 ARG A O     1 
ATOM   2922 C  CB    . ARG A 1 353 ? -51.182 0.119   -33.276 1.00 169.16 ? 353 ARG A CB    1 
ATOM   2923 C  CG    . ARG A 1 353 ? -52.353 1.014   -33.717 1.00 177.21 ? 353 ARG A CG    1 
ATOM   2924 C  CD    . ARG A 1 353 ? -53.703 0.419   -33.320 1.00 193.65 ? 353 ARG A CD    1 
ATOM   2925 N  NE    . ARG A 1 353 ? -54.727 1.432   -33.032 1.00 202.34 ? 353 ARG A NE    1 
ATOM   2926 C  CZ    . ARG A 1 353 ? -55.590 1.934   -33.917 1.00 209.28 ? 353 ARG A CZ    1 
ATOM   2927 N  NH1   . ARG A 1 353 ? -55.578 1.533   -35.182 1.00 209.99 ? 353 ARG A NH1   1 
ATOM   2928 N  NH2   . ARG A 1 353 ? -56.478 2.842   -33.534 1.00 216.68 ? 353 ARG A NH2   1 
ATOM   2929 N  N     . ASN A 1 354 ? -48.618 2.154   -32.794 1.00 139.43 ? 354 ASN A N     1 
ATOM   2930 C  CA    . ASN A 1 354 ? -48.132 3.519   -32.565 1.00 131.32 ? 354 ASN A CA    1 
ATOM   2931 C  C     . ASN A 1 354 ? -46.881 3.863   -33.364 1.00 119.29 ? 354 ASN A C     1 
ATOM   2932 O  O     . ASN A 1 354 ? -46.651 5.031   -33.681 1.00 114.04 ? 354 ASN A O     1 
ATOM   2933 C  CB    . ASN A 1 354 ? -47.901 3.782   -31.079 1.00 130.93 ? 354 ASN A CB    1 
ATOM   2934 C  CG    . ASN A 1 354 ? -49.191 3.862   -30.297 1.00 143.11 ? 354 ASN A CG    1 
ATOM   2935 O  OD1   . ASN A 1 354 ? -50.240 3.412   -30.755 1.00 152.57 ? 354 ASN A OD1   1 
ATOM   2936 N  ND2   . ASN A 1 354 ? -49.121 4.436   -29.105 1.00 143.76 ? 354 ASN A ND2   1 
ATOM   2937 N  N     . VAL A 1 355 ? -46.081 2.844   -33.675 1.00 115.89 ? 355 VAL A N     1 
ATOM   2938 C  CA    . VAL A 1 355 ? -44.951 2.993   -34.586 1.00 106.57 ? 355 VAL A CA    1 
ATOM   2939 C  C     . VAL A 1 355 ? -45.477 3.344   -35.982 1.00 109.39 ? 355 VAL A C     1 
ATOM   2940 O  O     . VAL A 1 355 ? -44.933 4.238   -36.639 1.00 103.36 ? 355 VAL A O     1 
ATOM   2941 C  CB    . VAL A 1 355 ? -44.067 1.719   -34.624 1.00 104.48 ? 355 VAL A CB    1 
ATOM   2942 C  CG1   . VAL A 1 355 ? -43.002 1.820   -35.704 1.00 96.85  ? 355 VAL A CG1   1 
ATOM   2943 C  CG2   . VAL A 1 355 ? -43.406 1.483   -33.275 1.00 101.97 ? 355 VAL A CG2   1 
ATOM   2944 N  N     . LYS A 1 356 ? -46.539 2.645   -36.410 1.00 119.48 ? 356 LYS A N     1 
ATOM   2945 C  CA    . LYS A 1 356 ? -47.283 2.952   -37.644 1.00 125.21 ? 356 LYS A CA    1 
ATOM   2946 C  C     . LYS A 1 356 ? -47.626 4.440   -37.730 1.00 124.51 ? 356 LYS A C     1 
ATOM   2947 O  O     . LYS A 1 356 ? -47.339 5.102   -38.735 1.00 122.08 ? 356 LYS A O     1 
ATOM   2948 C  CB    . LYS A 1 356 ? -48.581 2.139   -37.693 1.00 138.12 ? 356 LYS A CB    1 
ATOM   2949 C  CG    . LYS A 1 356 ? -48.565 0.885   -38.572 1.00 142.39 ? 356 LYS A CG    1 
ATOM   2950 C  CD    . LYS A 1 356 ? -49.420 -0.259  -37.974 1.00 152.66 ? 356 LYS A CD    1 
ATOM   2951 C  CE    . LYS A 1 356 ? -50.890 0.126   -37.685 1.00 164.07 ? 356 LYS A CE    1 
ATOM   2952 N  NZ    . LYS A 1 356 ? -51.870 -0.370  -38.696 1.00 175.15 ? 356 LYS A NZ    1 
ATOM   2953 N  N     . LYS A 1 357 ? -48.234 4.949   -36.659 1.00 127.62 ? 357 LYS A N     1 
ATOM   2954 C  CA    . LYS A 1 357 ? -48.643 6.347   -36.551 1.00 128.28 ? 357 LYS A CA    1 
ATOM   2955 C  C     . LYS A 1 357 ? -47.457 7.302   -36.498 1.00 116.67 ? 357 LYS A C     1 
ATOM   2956 O  O     . LYS A 1 357 ? -47.549 8.436   -36.962 1.00 116.07 ? 357 LYS A O     1 
ATOM   2957 C  CB    . LYS A 1 357 ? -49.511 6.555   -35.305 1.00 134.82 ? 357 LYS A CB    1 
ATOM   2958 C  CG    . LYS A 1 357 ? -50.919 5.972   -35.402 1.00 149.25 ? 357 LYS A CG    1 
ATOM   2959 C  CD    . LYS A 1 357 ? -51.786 6.360   -34.206 1.00 156.66 ? 357 LYS A CD    1 
ATOM   2960 C  CE    . LYS A 1 357 ? -52.147 7.843   -34.212 1.00 157.41 ? 357 LYS A CE    1 
ATOM   2961 N  NZ    . LYS A 1 357 ? -53.108 8.185   -33.127 1.00 166.78 ? 357 LYS A NZ    1 
ATOM   2962 N  N     . PHE A 1 358 ? -46.351 6.838   -35.927 1.00 108.62 ? 358 PHE A N     1 
ATOM   2963 C  CA    . PHE A 1 358 ? -45.193 7.694   -35.690 1.00 98.63  ? 358 PHE A CA    1 
ATOM   2964 C  C     . PHE A 1 358 ? -44.415 8.046   -36.961 1.00 94.03  ? 358 PHE A C     1 
ATOM   2965 O  O     . PHE A 1 358 ? -43.971 9.186   -37.112 1.00 89.78  ? 358 PHE A O     1 
ATOM   2966 C  CB    . PHE A 1 358 ? -44.265 7.079   -34.640 1.00 92.86  ? 358 PHE A CB    1 
ATOM   2967 C  CG    . PHE A 1 358 ? -43.223 8.028   -34.121 1.00 83.85  ? 358 PHE A CG    1 
ATOM   2968 C  CD1   . PHE A 1 358 ? -43.562 9.025   -33.209 1.00 84.40  ? 358 PHE A CD1   1 
ATOM   2969 C  CD2   . PHE A 1 358 ? -41.897 7.919   -34.534 1.00 75.57  ? 358 PHE A CD2   1 
ATOM   2970 C  CE1   . PHE A 1 358 ? -42.597 9.904   -32.725 1.00 76.67  ? 358 PHE A CE1   1 
ATOM   2971 C  CE2   . PHE A 1 358 ? -40.922 8.792   -34.053 1.00 67.89  ? 358 PHE A CE2   1 
ATOM   2972 C  CZ    . PHE A 1 358 ? -41.274 9.786   -33.148 1.00 68.92  ? 358 PHE A CZ    1 
ATOM   2973 N  N     . LEU A 1 359 ? -44.242 7.082   -37.865 1.00 95.98  ? 359 LEU A N     1 
ATOM   2974 C  CA    . LEU A 1 359 ? -43.610 7.367   -39.164 1.00 93.83  ? 359 LEU A CA    1 
ATOM   2975 C  C     . LEU A 1 359 ? -44.620 7.810   -40.224 1.00 102.42 ? 359 LEU A C     1 
ATOM   2976 O  O     . LEU A 1 359 ? -44.237 8.207   -41.326 1.00 102.56 ? 359 LEU A O     1 
ATOM   2977 C  CB    . LEU A 1 359 ? -42.745 6.204   -39.678 1.00 91.45  ? 359 LEU A CB    1 
ATOM   2978 C  CG    . LEU A 1 359 ? -42.885 4.772   -39.154 1.00 94.34  ? 359 LEU A CG    1 
ATOM   2979 C  CD1   . LEU A 1 359 ? -42.752 3.734   -40.285 1.00 98.35  ? 359 LEU A CD1   1 
ATOM   2980 C  CD2   . LEU A 1 359 ? -41.858 4.535   -38.048 1.00 86.58  ? 359 LEU A CD2   1 
ATOM   2981 N  N     . SER A 1 360 ? -45.904 7.738   -39.882 1.00 110.74 ? 360 SER A N     1 
ATOM   2982 C  CA    . SER A 1 360 ? -46.963 8.251   -40.739 1.00 120.39 ? 360 SER A CA    1 
ATOM   2983 C  C     . SER A 1 360 ? -46.658 9.679   -41.195 1.00 118.05 ? 360 SER A C     1 
ATOM   2984 O  O     . SER A 1 360 ? -46.896 10.032  -42.350 1.00 123.54 ? 360 SER A O     1 
ATOM   2985 C  CB    . SER A 1 360 ? -48.306 8.185   -39.998 1.00 129.52 ? 360 SER A CB    1 
ATOM   2986 O  OG    . SER A 1 360 ? -49.169 9.268   -40.327 1.00 136.43 ? 360 SER A OG    1 
ATOM   2987 N  N     . ARG A 1 361 ? -46.100 10.475  -40.285 1.00 110.54 ? 361 ARG A N     1 
ATOM   2988 C  CA    . ARG A 1 361 ? -45.888 11.914  -40.498 1.00 109.10 ? 361 ARG A CA    1 
ATOM   2989 C  C     . ARG A 1 361 ? -44.847 12.186  -41.580 1.00 105.12 ? 361 ARG A C     1 
ATOM   2990 O  O     . ARG A 1 361 ? -43.946 11.371  -41.801 1.00 100.10 ? 361 ARG A O     1 
ATOM   2991 C  CB    . ARG A 1 361 ? -45.475 12.610  -39.192 1.00 102.11 ? 361 ARG A CB    1 
ATOM   2992 C  CG    . ARG A 1 361 ? -45.922 11.912  -37.896 1.00 103.31 ? 361 ARG A CG    1 
ATOM   2993 C  CD    . ARG A 1 361 ? -47.438 11.914  -37.713 1.00 115.91 ? 361 ARG A CD    1 
ATOM   2994 N  NE    . ARG A 1 361 ? -47.949 13.181  -37.198 1.00 119.08 ? 361 ARG A NE    1 
ATOM   2995 C  CZ    . ARG A 1 361 ? -49.202 13.600  -37.342 1.00 130.36 ? 361 ARG A CZ    1 
ATOM   2996 N  NH1   . ARG A 1 361 ? -49.566 14.766  -36.826 1.00 133.26 ? 361 ARG A NH1   1 
ATOM   2997 N  NH2   . ARG A 1 361 ? -50.091 12.867  -38.009 1.00 139.18 ? 361 ARG A NH2   1 
ATOM   2998 N  N     . ASN A 1 362 ? -44.985 13.326  -42.257 1.00 108.60 ? 362 ASN A N     1 
ATOM   2999 C  CA    . ASN A 1 362 ? -44.032 13.723  -43.292 1.00 106.36 ? 362 ASN A CA    1 
ATOM   3000 C  C     . ASN A 1 362 ? -42.856 14.468  -42.667 1.00 96.06  ? 362 ASN A C     1 
ATOM   3001 O  O     . ASN A 1 362 ? -43.024 15.563  -42.126 1.00 95.68  ? 362 ASN A O     1 
ATOM   3002 C  CB    . ASN A 1 362 ? -44.714 14.576  -44.372 1.00 116.69 ? 362 ASN A CB    1 
ATOM   3003 C  CG    . ASN A 1 362 ? -43.993 14.516  -45.719 1.00 118.97 ? 362 ASN A CG    1 
ATOM   3004 O  OD1   . ASN A 1 362 ? -44.464 15.084  -46.705 1.00 128.20 ? 362 ASN A OD1   1 
ATOM   3005 N  ND2   . ASN A 1 362 ? -42.856 13.820  -45.768 1.00 111.16 ? 362 ASN A ND2   1 
ATOM   3006 N  N     . ARG A 1 363 ? -41.672 13.862  -42.728 1.00 88.46  ? 363 ARG A N     1 
ATOM   3007 C  CA    . ARG A 1 363 ? -40.487 14.434  -42.093 1.00 78.89  ? 363 ARG A CA    1 
ATOM   3008 C  C     . ARG A 1 363 ? -39.308 14.544  -43.042 1.00 77.13  ? 363 ARG A C     1 
ATOM   3009 O  O     . ARG A 1 363 ? -39.106 13.683  -43.893 1.00 79.78  ? 363 ARG A O     1 
ATOM   3010 C  CB    . ARG A 1 363 ? -40.087 13.620  -40.867 1.00 71.54  ? 363 ARG A CB    1 
ATOM   3011 C  CG    . ARG A 1 363 ? -41.057 13.739  -39.722 1.00 72.13  ? 363 ARG A CG    1 
ATOM   3012 C  CD    . ARG A 1 363 ? -40.450 13.204  -38.450 1.00 64.35  ? 363 ARG A CD    1 
ATOM   3013 N  NE    . ARG A 1 363 ? -41.451 13.002  -37.407 1.00 66.70  ? 363 ARG A NE    1 
ATOM   3014 C  CZ    . ARG A 1 363 ? -42.208 11.914  -37.288 1.00 71.72  ? 363 ARG A CZ    1 
ATOM   3015 N  NH1   . ARG A 1 363 ? -42.101 10.909  -38.157 1.00 73.62  ? 363 ARG A NH1   1 
ATOM   3016 N  NH2   . ARG A 1 363 ? -43.084 11.832  -36.297 1.00 75.95  ? 363 ARG A NH2   1 
ATOM   3017 N  N     . ALA A 1 364 ? -38.533 15.612  -42.875 1.00 73.48  ? 364 ALA A N     1 
ATOM   3018 C  CA    . ALA A 1 364 ? -37.337 15.859  -43.683 1.00 72.51  ? 364 ALA A CA    1 
ATOM   3019 C  C     . ALA A 1 364 ? -36.285 14.754  -43.538 1.00 66.80  ? 364 ALA A C     1 
ATOM   3020 O  O     . ALA A 1 364 ? -35.652 14.367  -44.522 1.00 69.53  ? 364 ALA A O     1 
ATOM   3021 C  CB    . ALA A 1 364 ? -36.734 17.233  -43.353 1.00 69.71  ? 364 ALA A CB    1 
ATOM   3022 N  N     . PHE A 1 365 ? -36.119 14.249  -42.316 1.00 60.20  ? 365 PHE A N     1 
ATOM   3023 C  CA    . PHE A 1 365 ? -35.135 13.207  -42.007 1.00 55.25  ? 365 PHE A CA    1 
ATOM   3024 C  C     . PHE A 1 365 ? -35.814 11.907  -41.570 1.00 56.45  ? 365 PHE A C     1 
ATOM   3025 O  O     . PHE A 1 365 ? -36.946 11.926  -41.078 1.00 59.06  ? 365 PHE A O     1 
ATOM   3026 C  CB    . PHE A 1 365 ? -34.166 13.700  -40.931 1.00 47.40  ? 365 PHE A CB    1 
ATOM   3027 C  CG    . PHE A 1 365 ? -33.422 14.947  -41.320 1.00 46.30  ? 365 PHE A CG    1 
ATOM   3028 C  CD1   . PHE A 1 365 ? -33.915 16.199  -40.987 1.00 46.20  ? 365 PHE A CD1   1 
ATOM   3029 C  CD2   . PHE A 1 365 ? -32.235 14.869  -42.029 1.00 45.41  ? 365 PHE A CD2   1 
ATOM   3030 C  CE1   . PHE A 1 365 ? -33.235 17.350  -41.350 1.00 46.03  ? 365 PHE A CE1   1 
ATOM   3031 C  CE2   . PHE A 1 365 ? -31.550 16.013  -42.392 1.00 45.67  ? 365 PHE A CE2   1 
ATOM   3032 C  CZ    . PHE A 1 365 ? -32.054 17.258  -42.053 1.00 46.38  ? 365 PHE A CZ    1 
ATOM   3033 N  N     . ARG A 1 366 ? -35.146 10.774  -41.770 1.00 55.72  ? 366 ARG A N     1 
ATOM   3034 C  CA    . ARG A 1 366 ? -35.727 9.502   -41.338 1.00 57.52  ? 366 ARG A CA    1 
ATOM   3035 C  C     . ARG A 1 366 ? -35.560 9.269   -39.832 1.00 52.19  ? 366 ARG A C     1 
ATOM   3036 O  O     . ARG A 1 366 ? -34.493 9.529   -39.284 1.00 47.20  ? 366 ARG A O     1 
ATOM   3037 C  CB    . ARG A 1 366 ? -35.243 8.300   -42.176 1.00 59.94  ? 366 ARG A CB    1 
ATOM   3038 C  CG    . ARG A 1 366 ? -33.857 8.422   -42.791 1.00 59.00  ? 366 ARG A CG    1 
ATOM   3039 C  CD    . ARG A 1 366 ? -33.500 7.204   -43.652 1.00 63.34  ? 366 ARG A CD    1 
ATOM   3040 N  NE    . ARG A 1 366 ? -33.513 5.964   -42.872 1.00 65.66  ? 366 ARG A NE    1 
ATOM   3041 C  CZ    . ARG A 1 366 ? -34.264 4.892   -43.137 1.00 71.96  ? 366 ARG A CZ    1 
ATOM   3042 N  NH1   . ARG A 1 366 ? -35.073 4.864   -44.197 1.00 79.22  ? 366 ARG A NH1   1 
ATOM   3043 N  NH2   . ARG A 1 366 ? -34.189 3.824   -42.347 1.00 71.67  ? 366 ARG A NH2   1 
ATOM   3044 N  N     . PRO A 1 367 ? -36.638 8.817   -39.155 1.00 54.78  ? 367 PRO A N     1 
ATOM   3045 C  CA    . PRO A 1 367 ? -36.581 8.484   -37.727 1.00 51.69  ? 367 PRO A CA    1 
ATOM   3046 C  C     . PRO A 1 367 ? -35.703 7.265   -37.472 1.00 49.49  ? 367 PRO A C     1 
ATOM   3047 O  O     . PRO A 1 367 ? -35.594 6.397   -38.334 1.00 52.07  ? 367 PRO A O     1 
ATOM   3048 C  CB    . PRO A 1 367 ? -38.040 8.162   -37.380 1.00 57.69  ? 367 PRO A CB    1 
ATOM   3049 C  CG    . PRO A 1 367 ? -38.854 8.773   -38.496 1.00 62.82  ? 367 PRO A CG    1 
ATOM   3050 C  CD    . PRO A 1 367 ? -37.993 8.609   -39.700 1.00 61.96  ? 367 PRO A CD    1 
ATOM   3051 N  N     . PHE A 1 368 ? -35.095 7.211   -36.293 1.00 45.50  ? 368 PHE A N     1 
ATOM   3052 C  CA    . PHE A 1 368 ? -34.154 6.159   -35.949 1.00 43.95  ? 368 PHE A CA    1 
ATOM   3053 C  C     . PHE A 1 368 ? -34.581 5.337   -34.728 1.00 46.35  ? 368 PHE A C     1 
ATOM   3054 O  O     . PHE A 1 368 ? -35.623 5.581   -34.139 1.00 49.06  ? 368 PHE A O     1 
ATOM   3055 C  CB    . PHE A 1 368 ? -32.754 6.757   -35.753 1.00 38.97  ? 368 PHE A CB    1 
ATOM   3056 C  CG    . PHE A 1 368 ? -32.663 7.771   -34.642 1.00 36.57  ? 368 PHE A CG    1 
ATOM   3057 C  CD1   . PHE A 1 368 ? -32.897 9.126   -34.892 1.00 35.09  ? 368 PHE A CD1   1 
ATOM   3058 C  CD2   . PHE A 1 368 ? -32.326 7.379   -33.347 1.00 36.86  ? 368 PHE A CD2   1 
ATOM   3059 C  CE1   . PHE A 1 368 ? -32.811 10.068  -33.871 1.00 32.19  ? 368 PHE A CE1   1 
ATOM   3060 C  CE2   . PHE A 1 368 ? -32.238 8.318   -32.316 1.00 35.13  ? 368 PHE A CE2   1 
ATOM   3061 C  CZ    . PHE A 1 368 ? -32.478 9.666   -32.585 1.00 32.64  ? 368 PHE A CZ    1 
ATOM   3062 N  N     . ILE A 1 369 ? -33.766 4.354   -34.366 1.00 46.49  ? 369 ILE A N     1 
ATOM   3063 C  CA    . ILE A 1 369 ? -33.994 3.537   -33.179 1.00 50.11  ? 369 ILE A CA    1 
ATOM   3064 C  C     . ILE A 1 369 ? -32.852 3.745   -32.178 1.00 47.70  ? 369 ILE A C     1 
ATOM   3065 O  O     . ILE A 1 369 ? -31.688 3.821   -32.562 1.00 44.75  ? 369 ILE A O     1 
ATOM   3066 C  CB    . ILE A 1 369 ? -34.152 2.041   -33.560 1.00 55.09  ? 369 ILE A CB    1 
ATOM   3067 C  CG1   . ILE A 1 369 ? -35.446 1.830   -34.358 1.00 58.75  ? 369 ILE A CG1   1 
ATOM   3068 C  CG2   . ILE A 1 369 ? -34.127 1.147   -32.322 1.00 59.50  ? 369 ILE A CG2   1 
ATOM   3069 C  CD1   . ILE A 1 369 ? -35.585 0.461   -34.957 1.00 63.27  ? 369 ILE A CD1   1 
ATOM   3070 N  N     . GLU A 1 370 ? -33.190 3.849   -30.896 1.00 50.45  ? 370 GLU A N     1 
ATOM   3071 C  CA    . GLU A 1 370 ? -32.210 4.108   -29.834 1.00 49.76  ? 370 GLU A CA    1 
ATOM   3072 C  C     . GLU A 1 370 ? -32.746 3.598   -28.500 1.00 56.07  ? 370 GLU A C     1 
ATOM   3073 O  O     . GLU A 1 370 ? -33.901 3.857   -28.142 1.00 59.42  ? 370 GLU A O     1 
ATOM   3074 C  CB    . GLU A 1 370 ? -31.874 5.606   -29.764 1.00 44.46  ? 370 GLU A CB    1 
ATOM   3075 C  CG    . GLU A 1 370 ? -31.455 6.126   -28.388 1.00 46.15  ? 370 GLU A CG    1 
ATOM   3076 C  CD    . GLU A 1 370 ? -30.932 7.559   -28.417 1.00 41.23  ? 370 GLU A CD    1 
ATOM   3077 O  OE1   . GLU A 1 370 ? -30.532 8.027   -29.513 1.00 37.88  ? 370 GLU A OE1   1 
ATOM   3078 O  OE2   . GLU A 1 370 ? -30.913 8.211   -27.339 1.00 42.91  ? 370 GLU A OE2   1 
ATOM   3079 N  N     . ASN A 1 371 ? -31.901 2.870   -27.771 1.00 59.13  ? 371 ASN A N     1 
ATOM   3080 C  CA    . ASN A 1 371 ? -32.285 2.228   -26.503 1.00 67.01  ? 371 ASN A CA    1 
ATOM   3081 C  C     . ASN A 1 371 ? -33.699 1.653   -26.576 1.00 72.40  ? 371 ASN A C     1 
ATOM   3082 O  O     . ASN A 1 371 ? -34.492 1.802   -25.645 1.00 77.89  ? 371 ASN A O     1 
ATOM   3083 C  CB    . ASN A 1 371 ? -32.143 3.198   -25.315 1.00 67.85  ? 371 ASN A CB    1 
ATOM   3084 C  CG    . ASN A 1 371 ? -30.707 3.707   -25.122 1.00 64.63  ? 371 ASN A CG    1 
ATOM   3085 O  OD1   . ASN A 1 371 ? -30.000 4.017   -26.082 1.00 59.13  ? 371 ASN A OD1   1 
ATOM   3086 N  ND2   . ASN A 1 371 ? -30.285 3.808   -23.867 1.00 70.13  ? 371 ASN A ND2   1 
ATOM   3087 N  N     . GLY A 1 372 ? -34.003 1.023   -27.711 1.00 71.41  ? 372 GLY A N     1 
ATOM   3088 C  CA    . GLY A 1 372 ? -35.283 0.356   -27.942 1.00 77.31  ? 372 GLY A CA    1 
ATOM   3089 C  C     . GLY A 1 372 ? -36.480 1.283   -27.948 1.00 77.47  ? 372 GLY A C     1 
ATOM   3090 O  O     . GLY A 1 372 ? -37.532 0.966   -27.380 1.00 85.18  ? 372 GLY A O     1 
ATOM   3091 N  N     . ARG A 1 373 ? -36.311 2.432   -28.593 1.00 69.79  ? 373 ARG A N     1 
ATOM   3092 C  CA    . ARG A 1 373 ? -37.370 3.415   -28.722 1.00 69.57  ? 373 ARG A CA    1 
ATOM   3093 C  C     . ARG A 1 373 ? -37.213 4.116   -30.064 1.00 62.72  ? 373 ARG A C     1 
ATOM   3094 O  O     . ARG A 1 373 ? -36.099 4.383   -30.501 1.00 56.33  ? 373 ARG A O     1 
ATOM   3095 C  CB    . ARG A 1 373 ? -37.290 4.419   -27.569 1.00 69.39  ? 373 ARG A CB    1 
ATOM   3096 C  CG    . ARG A 1 373 ? -38.519 5.301   -27.409 1.00 72.80  ? 373 ARG A CG    1 
ATOM   3097 C  CD    . ARG A 1 373 ? -38.414 6.253   -26.215 1.00 73.01  ? 373 ARG A CD    1 
ATOM   3098 N  NE    . ARG A 1 373 ? -38.803 5.627   -24.950 1.00 81.35  ? 373 ARG A NE    1 
ATOM   3099 C  CZ    . ARG A 1 373 ? -40.048 5.569   -24.488 1.00 89.02  ? 373 ARG A CZ    1 
ATOM   3100 N  NH1   . ARG A 1 373 ? -41.045 6.091   -25.182 1.00 89.55  ? 373 ARG A NH1   1 
ATOM   3101 N  NH2   . ARG A 1 373 ? -40.299 4.982   -23.331 1.00 98.01  ? 373 ARG A NH2   1 
ATOM   3102 N  N     . TRP A 1 374 ? -38.325 4.382   -30.736 1.00 65.13  ? 374 TRP A N     1 
ATOM   3103 C  CA    . TRP A 1 374 ? -38.276 5.201   -31.938 1.00 60.37  ? 374 TRP A CA    1 
ATOM   3104 C  C     . TRP A 1 374 ? -38.121 6.661   -31.536 1.00 56.03  ? 374 TRP A C     1 
ATOM   3105 O  O     . TRP A 1 374 ? -38.563 7.064   -30.462 1.00 58.83  ? 374 TRP A O     1 
ATOM   3106 C  CB    . TRP A 1 374 ? -39.510 4.979   -32.814 1.00 66.13  ? 374 TRP A CB    1 
ATOM   3107 C  CG    . TRP A 1 374 ? -39.386 3.749   -33.636 1.00 68.90  ? 374 TRP A CG    1 
ATOM   3108 C  CD1   . TRP A 1 374 ? -39.732 2.475   -33.271 1.00 75.61  ? 374 TRP A CD1   1 
ATOM   3109 C  CD2   . TRP A 1 374 ? -38.845 3.654   -34.960 1.00 66.83  ? 374 TRP A CD2   1 
ATOM   3110 N  NE1   . TRP A 1 374 ? -39.449 1.591   -34.292 1.00 76.44  ? 374 TRP A NE1   1 
ATOM   3111 C  CE2   . TRP A 1 374 ? -38.900 2.285   -35.339 1.00 71.04  ? 374 TRP A CE2   1 
ATOM   3112 C  CE3   . TRP A 1 374 ? -38.320 4.590   -35.866 1.00 61.84  ? 374 TRP A CE3   1 
ATOM   3113 C  CZ2   . TRP A 1 374 ? -38.451 1.829   -36.584 1.00 69.87  ? 374 TRP A CZ2   1 
ATOM   3114 C  CZ3   . TRP A 1 374 ? -37.869 4.136   -37.107 1.00 61.91  ? 374 TRP A CZ3   1 
ATOM   3115 C  CH2   . TRP A 1 374 ? -37.938 2.761   -37.452 1.00 65.83  ? 374 TRP A CH2   1 
ATOM   3116 N  N     . TRP A 1 375 ? -37.449 7.430   -32.386 1.00 49.84  ? 375 TRP A N     1 
ATOM   3117 C  CA    . TRP A 1 375 ? -37.198 8.846   -32.160 1.00 45.42  ? 375 TRP A CA    1 
ATOM   3118 C  C     . TRP A 1 375 ? -37.200 9.540   -33.517 1.00 43.11  ? 375 TRP A C     1 
ATOM   3119 O  O     . TRP A 1 375 ? -36.807 8.934   -34.520 1.00 42.37  ? 375 TRP A O     1 
ATOM   3120 C  CB    . TRP A 1 375 ? -35.826 9.048   -31.515 1.00 40.42  ? 375 TRP A CB    1 
ATOM   3121 C  CG    . TRP A 1 375 ? -35.658 8.520   -30.106 1.00 43.39  ? 375 TRP A CG    1 
ATOM   3122 C  CD1   . TRP A 1 375 ? -35.357 7.232   -29.734 1.00 46.03  ? 375 TRP A CD1   1 
ATOM   3123 C  CD2   . TRP A 1 375 ? -35.727 9.279   -28.886 1.00 44.56  ? 375 TRP A CD2   1 
ATOM   3124 N  NE1   . TRP A 1 375 ? -35.255 7.143   -28.358 1.00 49.28  ? 375 TRP A NE1   1 
ATOM   3125 C  CE2   . TRP A 1 375 ? -35.477 8.383   -27.817 1.00 48.31  ? 375 TRP A CE2   1 
ATOM   3126 C  CE3   . TRP A 1 375 ? -35.982 10.624  -28.593 1.00 43.35  ? 375 TRP A CE3   1 
ATOM   3127 C  CZ2   . TRP A 1 375 ? -35.479 8.794   -26.483 1.00 50.57  ? 375 TRP A CZ2   1 
ATOM   3128 C  CZ3   . TRP A 1 375 ? -35.982 11.026  -27.264 1.00 45.63  ? 375 TRP A CZ3   1 
ATOM   3129 C  CH2   . TRP A 1 375 ? -35.734 10.114  -26.229 1.00 49.29  ? 375 TRP A CH2   1 
ATOM   3130 N  N     . ALA A 1 376 ? -37.621 10.807  -33.557 1.00 42.26  ? 376 ALA A N     1 
ATOM   3131 C  CA    . ALA A 1 376 ? -37.597 11.572  -34.809 1.00 40.94  ? 376 ALA A CA    1 
ATOM   3132 C  C     . ALA A 1 376 ? -36.739 12.820  -34.705 1.00 35.90  ? 376 ALA A C     1 
ATOM   3133 O  O     . ALA A 1 376 ? -36.416 13.255  -33.599 1.00 33.72  ? 376 ALA A O     1 
ATOM   3134 C  CB    . ALA A 1 376 ? -38.995 11.938  -35.218 1.00 47.35  ? 376 ALA A CB    1 
ATOM   3135 N  N     . PHE A 1 377 ? -36.349 13.366  -35.861 1.00 34.95  ? 377 PHE A N     1 
ATOM   3136 C  CA    . PHE A 1 377 ? -35.833 14.743  -35.965 1.00 32.51  ? 377 PHE A CA    1 
ATOM   3137 C  C     . PHE A 1 377 ? -36.910 15.710  -36.527 1.00 37.69  ? 377 PHE A C     1 
ATOM   3138 O  O     . PHE A 1 377 ? -37.461 15.486  -37.619 1.00 42.01  ? 377 PHE A O     1 
ATOM   3139 C  CB    . PHE A 1 377 ? -34.620 14.816  -36.890 1.00 29.85  ? 377 PHE A CB    1 
ATOM   3140 C  CG    . PHE A 1 377 ? -33.407 14.052  -36.420 1.00 25.61  ? 377 PHE A CG    1 
ATOM   3141 C  CD1   . PHE A 1 377 ? -33.076 12.821  -36.999 1.00 27.54  ? 377 PHE A CD1   1 
ATOM   3142 C  CD2   . PHE A 1 377 ? -32.555 14.582  -35.469 1.00 21.04  ? 377 PHE A CD2   1 
ATOM   3143 C  CE1   . PHE A 1 377 ? -31.932 12.121  -36.614 1.00 23.12  ? 377 PHE A CE1   1 
ATOM   3144 C  CE2   . PHE A 1 377 ? -31.425 13.894  -35.073 1.00 18.02  ? 377 PHE A CE2   1 
ATOM   3145 C  CZ    . PHE A 1 377 ? -31.113 12.660  -35.650 1.00 20.08  ? 377 PHE A CZ    1 
ATOM   3146 N  N     . GLU A 1 378 ? -37.196 16.792  -35.803 1.00 37.83  ? 378 GLU A N     1 
ATOM   3147 C  CA    . GLU A 1 378 ? -38.124 17.818  -36.313 1.00 43.43  ? 378 GLU A CA    1 
ATOM   3148 C  C     . GLU A 1 378 ? -37.598 19.254  -36.215 1.00 41.47  ? 378 GLU A C     1 
ATOM   3149 O  O     . GLU A 1 378 ? -36.654 19.525  -35.469 1.00 36.30  ? 378 GLU A O     1 
ATOM   3150 C  CB    . GLU A 1 378 ? -39.496 17.677  -35.660 1.00 49.13  ? 378 GLU A CB    1 
ATOM   3151 C  CG    . GLU A 1 378 ? -40.350 16.609  -36.339 1.00 56.04  ? 378 GLU A CG    1 
ATOM   3152 C  CD    . GLU A 1 378 ? -41.286 15.906  -35.378 1.00 61.88  ? 378 GLU A CD    1 
ATOM   3153 O  OE1   . GLU A 1 378 ? -41.439 14.669  -35.498 1.00 63.25  ? 378 GLU A OE1   1 
ATOM   3154 O  OE2   . GLU A 1 378 ? -41.862 16.585  -34.497 1.00 65.33  ? 378 GLU A OE2   1 
ATOM   3155 N  N     . MET A 1 379 ? -38.201 20.159  -36.988 1.00 46.26  ? 379 MET A N     1 
ATOM   3156 C  CA    . MET A 1 379 ? -37.734 21.554  -37.062 1.00 45.81  ? 379 MET A CA    1 
ATOM   3157 C  C     . MET A 1 379 ? -38.410 22.459  -36.040 1.00 46.67  ? 379 MET A C     1 
ATOM   3158 O  O     . MET A 1 379 ? -39.553 22.238  -35.662 1.00 51.16  ? 379 MET A O     1 
ATOM   3159 C  CB    . MET A 1 379 ? -37.969 22.150  -38.456 1.00 52.95  ? 379 MET A CB    1 
ATOM   3160 C  CG    . MET A 1 379 ? -37.619 21.247  -39.628 1.00 55.05  ? 379 MET A CG    1 
ATOM   3161 S  SD    . MET A 1 379 ? -35.846 21.084  -39.861 1.00 52.33  ? 379 MET A SD    1 
ATOM   3162 C  CE    . MET A 1 379 ? -35.883 20.716  -41.625 1.00 57.61  ? 379 MET A CE    1 
ATOM   3163 N  N     . ARG A 1 380 ? -37.694 23.489  -35.611 1.00 42.85  ? 380 ARG A N     1 
ATOM   3164 C  CA    . ARG A 1 380 ? -38.259 24.524  -34.751 1.00 44.16  ? 380 ARG A CA    1 
ATOM   3165 C  C     . ARG A 1 380 ? -38.687 25.696  -35.606 1.00 50.11  ? 380 ARG A C     1 
ATOM   3166 O  O     . ARG A 1 380 ? -38.012 26.027  -36.584 1.00 50.21  ? 380 ARG A O     1 
ATOM   3167 C  CB    . ARG A 1 380 ? -37.216 25.035  -33.765 1.00 38.53  ? 380 ARG A CB    1 
ATOM   3168 C  CG    . ARG A 1 380 ? -36.727 24.051  -32.770 1.00 30.68  ? 380 ARG A CG    1 
ATOM   3169 C  CD    . ARG A 1 380 ? -35.739 24.753  -31.914 1.00 24.30  ? 380 ARG A CD    1 
ATOM   3170 N  NE    . ARG A 1 380 ? -35.543 24.063  -30.657 1.00 20.70  ? 380 ARG A NE    1 
ATOM   3171 C  CZ    . ARG A 1 380 ? -34.514 23.272  -30.388 1.00 16.52  ? 380 ARG A CZ    1 
ATOM   3172 N  NH1   . ARG A 1 380 ? -33.567 23.056  -31.283 1.00 11.52  ? 380 ARG A NH1   1 
ATOM   3173 N  NH2   . ARG A 1 380 ? -34.434 22.696  -29.203 1.00 18.78  ? 380 ARG A NH2   1 
ATOM   3174 N  N     . LYS A 1 381 ? -39.782 26.345  -35.229 1.00 55.59  ? 381 LYS A N     1 
ATOM   3175 C  CA    . LYS A 1 381 ? -40.228 27.507  -35.977 1.00 62.73  ? 381 LYS A CA    1 
ATOM   3176 C  C     . LYS A 1 381 ? -39.408 28.751  -35.637 1.00 60.85  ? 381 LYS A C     1 
ATOM   3177 O  O     . LYS A 1 381 ? -39.479 29.753  -36.343 1.00 66.93  ? 381 LYS A O     1 
ATOM   3178 C  CB    . LYS A 1 381 ? -41.740 27.727  -35.836 1.00 71.62  ? 381 LYS A CB    1 
ATOM   3179 C  CG    . LYS A 1 381 ? -42.548 26.986  -36.906 1.00 77.71  ? 381 LYS A CG    1 
ATOM   3180 C  CD    . LYS A 1 381 ? -44.079 27.131  -36.759 1.00 88.08  ? 381 LYS A CD    1 
ATOM   3181 C  CE    . LYS A 1 381 ? -44.728 25.965  -35.988 1.00 88.04  ? 381 LYS A CE    1 
ATOM   3182 N  NZ    . LYS A 1 381 ? -44.371 24.597  -36.518 1.00 83.73  ? 381 LYS A NZ    1 
ATOM   3183 N  N     . PHE A 1 382 ? -38.615 28.672  -34.574 1.00 53.51  ? 382 PHE A N     1 
ATOM   3184 C  CA    . PHE A 1 382 ? -37.669 29.736  -34.211 1.00 51.32  ? 382 PHE A CA    1 
ATOM   3185 C  C     . PHE A 1 382 ? -36.379 29.160  -33.628 1.00 42.55  ? 382 PHE A C     1 
ATOM   3186 O  O     . PHE A 1 382 ? -36.357 28.042  -33.094 1.00 38.09  ? 382 PHE A O     1 
ATOM   3187 C  CB    . PHE A 1 382 ? -38.288 30.739  -33.219 1.00 55.48  ? 382 PHE A CB    1 
ATOM   3188 C  CG    . PHE A 1 382 ? -39.045 30.090  -32.103 1.00 55.32  ? 382 PHE A CG    1 
ATOM   3189 C  CD1   . PHE A 1 382 ? -38.398 29.251  -31.191 1.00 49.41  ? 382 PHE A CD1   1 
ATOM   3190 C  CD2   . PHE A 1 382 ? -40.410 30.292  -31.973 1.00 62.88  ? 382 PHE A CD2   1 
ATOM   3191 C  CE1   . PHE A 1 382 ? -39.099 28.630  -30.164 1.00 50.66  ? 382 PHE A CE1   1 
ATOM   3192 C  CE2   . PHE A 1 382 ? -41.127 29.686  -30.950 1.00 64.40  ? 382 PHE A CE2   1 
ATOM   3193 C  CZ    . PHE A 1 382 ? -40.474 28.856  -30.039 1.00 58.40  ? 382 PHE A CZ    1 
ATOM   3194 N  N     . THR A 1 383 ? -35.310 29.944  -33.714 1.00 40.78  ? 383 THR A N     1 
ATOM   3195 C  CA    . THR A 1 383 ? -33.999 29.494  -33.283 1.00 33.73  ? 383 THR A CA    1 
ATOM   3196 C  C     . THR A 1 383 ? -33.288 30.469  -32.372 1.00 32.95  ? 383 THR A C     1 
ATOM   3197 O  O     . THR A 1 383 ? -32.185 30.175  -31.927 1.00 28.68  ? 383 THR A O     1 
ATOM   3198 C  CB    . THR A 1 383 ? -33.090 29.233  -34.466 1.00 32.71  ? 383 THR A CB    1 
ATOM   3199 O  OG1   . THR A 1 383 ? -33.100 30.384  -35.310 1.00 39.43  ? 383 THR A OG1   1 
ATOM   3200 C  CG2   . THR A 1 383 ? -33.557 28.002  -35.252 1.00 32.35  ? 383 THR A CG2   1 
ATOM   3201 N  N     . THR A 1 384 ? -33.890 31.625  -32.100 1.00 33.65  ? 384 THR A N     1 
ATOM   3202 C  CA    . THR A 1 384 ? -33.314 32.563  -31.135 1.00 30.30  ? 384 THR A CA    1 
ATOM   3203 C  C     . THR A 1 384 ? -34.366 32.971  -30.122 1.00 26.85  ? 384 THR A C     1 
ATOM   3204 O  O     . THR A 1 384 ? -35.549 32.851  -30.401 1.00 27.01  ? 384 THR A O     1 
ATOM   3205 C  CB    . THR A 1 384 ? -32.751 33.816  -31.796 1.00 31.27  ? 384 THR A CB    1 
ATOM   3206 O  OG1   . THR A 1 384 ? -33.814 34.519  -32.428 1.00 32.87  ? 384 THR A OG1   1 
ATOM   3207 C  CG2   . THR A 1 384 ? -31.698 33.472  -32.829 1.00 35.15  ? 384 THR A CG2   1 
ATOM   3208 N  N     . PRO A 1 385 ? -33.942 33.444  -28.928 1.00 24.30  ? 385 PRO A N     1 
ATOM   3209 C  CA    . PRO A 1 385 ? -34.949 33.696  -27.898 1.00 21.64  ? 385 PRO A CA    1 
ATOM   3210 C  C     . PRO A 1 385 ? -35.864 34.838  -28.297 1.00 21.53  ? 385 PRO A C     1 
ATOM   3211 O  O     . PRO A 1 385 ? -37.067 34.762  -28.071 1.00 21.11  ? 385 PRO A O     1 
ATOM   3212 C  CB    . PRO A 1 385 ? -34.114 34.076  -26.668 1.00 19.45  ? 385 PRO A CB    1 
ATOM   3213 C  CG    . PRO A 1 385 ? -32.719 33.623  -26.970 1.00 20.73  ? 385 PRO A CG    1 
ATOM   3214 C  CD    . PRO A 1 385 ? -32.583 33.761  -28.443 1.00 23.69  ? 385 PRO A CD    1 
ATOM   3215 N  N     . GLU A 1 386 ? -35.302 35.875  -28.916 1.00 22.70  ? 386 GLU A N     1 
ATOM   3216 C  CA    . GLU A 1 386 ? -36.082 37.033  -29.341 1.00 22.97  ? 386 GLU A CA    1 
ATOM   3217 C  C     . GLU A 1 386 ? -37.172 36.605  -30.300 1.00 24.57  ? 386 GLU A C     1 
ATOM   3218 O  O     . GLU A 1 386 ? -38.317 37.051  -30.178 1.00 23.95  ? 386 GLU A O     1 
ATOM   3219 C  CB    . GLU A 1 386 ? -35.191 38.083  -29.987 1.00 25.05  ? 386 GLU A CB    1 
ATOM   3220 C  CG    . GLU A 1 386 ? -34.211 38.706  -29.032 1.00 25.58  ? 386 GLU A CG    1 
ATOM   3221 C  CD    . GLU A 1 386 ? -32.861 38.017  -29.040 1.00 29.79  ? 386 GLU A CD    1 
ATOM   3222 O  OE1   . GLU A 1 386 ? -32.778 36.826  -29.441 1.00 31.85  ? 386 GLU A OE1   1 
ATOM   3223 O  OE2   . GLU A 1 386 ? -31.871 38.680  -28.645 1.00 31.87  ? 386 GLU A OE2   1 
ATOM   3224 N  N     . GLU A 1 387 ? -36.808 35.728  -31.236 1.00 26.76  ? 387 GLU A N     1 
ATOM   3225 C  CA    . GLU A 1 387 ? -37.756 35.157  -32.182 1.00 29.41  ? 387 GLU A CA    1 
ATOM   3226 C  C     . GLU A 1 387 ? -38.831 34.386  -31.437 1.00 27.39  ? 387 GLU A C     1 
ATOM   3227 O  O     . GLU A 1 387 ? -39.998 34.481  -31.776 1.00 28.70  ? 387 GLU A O     1 
ATOM   3228 C  CB    . GLU A 1 387 ? -37.062 34.225  -33.167 1.00 32.62  ? 387 GLU A CB    1 
ATOM   3229 C  CG    . GLU A 1 387 ? -36.121 34.892  -34.170 1.00 36.68  ? 387 GLU A CG    1 
ATOM   3230 C  CD    . GLU A 1 387 ? -35.537 33.883  -35.176 1.00 41.33  ? 387 GLU A CD    1 
ATOM   3231 O  OE1   . GLU A 1 387 ? -35.741 32.665  -34.968 1.00 44.37  ? 387 GLU A OE1   1 
ATOM   3232 O  OE2   . GLU A 1 387 ? -34.891 34.296  -36.174 1.00 45.58  ? 387 GLU A OE2   1 
ATOM   3233 N  N     . GLY A 1 388 ? -38.431 33.635  -30.418 1.00 25.14  ? 388 GLY A N     1 
ATOM   3234 C  CA    . GLY A 1 388 ? -39.359 32.867  -29.601 1.00 23.96  ? 388 GLY A CA    1 
ATOM   3235 C  C     . GLY A 1 388 ? -40.410 33.711  -28.894 1.00 21.69  ? 388 GLY A C     1 
ATOM   3236 O  O     . GLY A 1 388 ? -41.617 33.509  -29.095 1.00 23.20  ? 388 GLY A O     1 
ATOM   3237 N  N     . VAL A 1 389 ? -39.974 34.657  -28.066 1.00 18.26  ? 389 VAL A N     1 
ATOM   3238 C  CA    . VAL A 1 389 ? -40.932 35.493  -27.357 1.00 16.09  ? 389 VAL A CA    1 
ATOM   3239 C  C     . VAL A 1 389 ? -41.729 36.386  -28.312 1.00 17.60  ? 389 VAL A C     1 
ATOM   3240 O  O     . VAL A 1 389 ? -42.865 36.730  -28.017 1.00 17.43  ? 389 VAL A O     1 
ATOM   3241 C  CB    . VAL A 1 389 ? -40.301 36.302  -26.201 1.00 13.39  ? 389 VAL A CB    1 
ATOM   3242 C  CG1   . VAL A 1 389 ? -39.027 35.636  -25.717 1.00 12.93  ? 389 VAL A CG1   1 
ATOM   3243 C  CG2   . VAL A 1 389 ? -40.071 37.739  -26.573 1.00 12.92  ? 389 VAL A CG2   1 
ATOM   3244 N  N     . ARG A 1 390 ? -41.149 36.743  -29.460 1.00 19.35  ? 390 ARG A N     1 
ATOM   3245 C  CA    . ARG A 1 390 ? -41.906 37.475  -30.482 1.00 21.35  ? 390 ARG A CA    1 
ATOM   3246 C  C     . ARG A 1 390 ? -43.149 36.666  -30.856 1.00 23.18  ? 390 ARG A C     1 
ATOM   3247 O  O     . ARG A 1 390 ? -44.255 37.213  -30.961 1.00 23.78  ? 390 ARG A O     1 
ATOM   3248 C  CB    . ARG A 1 390 ? -41.058 37.768  -31.722 1.00 23.79  ? 390 ARG A CB    1 
ATOM   3249 C  CG    . ARG A 1 390 ? -41.722 38.699  -32.708 1.00 25.03  ? 390 ARG A CG    1 
ATOM   3250 C  CD    . ARG A 1 390 ? -41.599 38.143  -34.091 1.00 28.83  ? 390 ARG A CD    1 
ATOM   3251 N  NE    . ARG A 1 390 ? -40.365 38.510  -34.782 1.00 30.91  ? 390 ARG A NE    1 
ATOM   3252 C  CZ    . ARG A 1 390 ? -39.644 37.672  -35.530 1.00 33.82  ? 390 ARG A CZ    1 
ATOM   3253 N  NH1   . ARG A 1 390 ? -39.988 36.398  -35.662 1.00 34.21  ? 390 ARG A NH1   1 
ATOM   3254 N  NH2   . ARG A 1 390 ? -38.552 38.098  -36.134 1.00 37.06  ? 390 ARG A NH2   1 
ATOM   3255 N  N     . SER A 1 391 ? -42.948 35.362  -31.021 1.00 24.06  ? 391 SER A N     1 
ATOM   3256 C  CA    . SER A 1 391 ? -44.018 34.436  -31.325 1.00 26.72  ? 391 SER A CA    1 
ATOM   3257 C  C     . SER A 1 391 ? -44.895 34.191  -30.103 1.00 25.08  ? 391 SER A C     1 
ATOM   3258 O  O     . SER A 1 391 ? -46.119 34.314  -30.172 1.00 26.50  ? 391 SER A O     1 
ATOM   3259 C  CB    . SER A 1 391 ? -43.433 33.116  -31.821 1.00 29.12  ? 391 SER A CB    1 
ATOM   3260 O  OG    . SER A 1 391 ? -44.402 32.086  -31.880 1.00 32.19  ? 391 SER A OG    1 
ATOM   3261 N  N     . TYR A 1 392 ? -44.278 33.837  -28.985 1.00 22.72  ? 392 TYR A N     1 
ATOM   3262 C  CA    . TYR A 1 392 ? -45.043 33.563  -27.774 1.00 21.90  ? 392 TYR A CA    1 
ATOM   3263 C  C     . TYR A 1 392 ? -45.999 34.706  -27.474 1.00 20.71  ? 392 TYR A C     1 
ATOM   3264 O  O     . TYR A 1 392 ? -47.207 34.520  -27.496 1.00 22.61  ? 392 TYR A O     1 
ATOM   3265 C  CB    . TYR A 1 392 ? -44.115 33.341  -26.586 1.00 20.10  ? 392 TYR A CB    1 
ATOM   3266 C  CG    . TYR A 1 392 ? -44.841 33.032  -25.310 1.00 20.01  ? 392 TYR A CG    1 
ATOM   3267 C  CD1   . TYR A 1 392 ? -45.405 31.780  -25.099 1.00 23.03  ? 392 TYR A CD1   1 
ATOM   3268 C  CD2   . TYR A 1 392 ? -44.958 33.987  -24.308 1.00 18.38  ? 392 TYR A CD2   1 
ATOM   3269 C  CE1   . TYR A 1 392 ? -46.072 31.476  -23.916 1.00 24.34  ? 392 TYR A CE1   1 
ATOM   3270 C  CE2   . TYR A 1 392 ? -45.621 33.703  -23.112 1.00 19.32  ? 392 TYR A CE2   1 
ATOM   3271 C  CZ    . TYR A 1 392 ? -46.174 32.442  -22.923 1.00 22.44  ? 392 TYR A CZ    1 
ATOM   3272 O  OH    . TYR A 1 392 ? -46.832 32.141  -21.746 1.00 23.83  ? 392 TYR A OH    1 
ATOM   3273 N  N     . ALA A 1 393 ? -45.432 35.886  -27.220 1.00 18.06  ? 393 ALA A N     1 
ATOM   3274 C  CA    . ALA A 1 393 ? -46.183 37.104  -26.949 1.00 16.71  ? 393 ALA A CA    1 
ATOM   3275 C  C     . ALA A 1 393 ? -47.232 37.446  -27.998 1.00 19.16  ? 393 ALA A C     1 
ATOM   3276 O  O     . ALA A 1 393 ? -48.316 37.861  -27.631 1.00 20.18  ? 393 ALA A O     1 
ATOM   3277 C  CB    . ALA A 1 393 ? -45.254 38.270  -26.735 1.00 14.81  ? 393 ALA A CB    1 
ATOM   3278 N  N     . SER A 1 394 ? -46.946 37.281  -29.285 1.00 20.88  ? 394 SER A N     1 
ATOM   3279 C  CA    . SER A 1 394 ? -48.000 37.523  -30.287 1.00 24.19  ? 394 SER A CA    1 
ATOM   3280 C  C     . SER A 1 394 ? -49.240 36.646  -30.129 1.00 25.99  ? 394 SER A C     1 
ATOM   3281 O  O     . SER A 1 394 ? -50.358 37.139  -30.214 1.00 27.22  ? 394 SER A O     1 
ATOM   3282 C  CB    . SER A 1 394 ? -47.478 37.407  -31.706 1.00 26.73  ? 394 SER A CB    1 
ATOM   3283 O  OG    . SER A 1 394 ? -46.618 38.480  -31.994 1.00 26.62  ? 394 SER A OG    1 
ATOM   3284 N  N     . THR A 1 395 ? -49.048 35.357  -29.884 1.00 26.69  ? 395 THR A N     1 
ATOM   3285 C  CA    . THR A 1 395 ? -50.183 34.449  -29.765 1.00 29.96  ? 395 THR A CA    1 
ATOM   3286 C  C     . THR A 1 395 ? -50.697 34.291  -28.320 1.00 28.79  ? 395 THR A C     1 
ATOM   3287 O  O     . THR A 1 395 ? -51.859 33.955  -28.113 1.00 31.44  ? 395 THR A O     1 
ATOM   3288 C  CB    . THR A 1 395 ? -49.864 33.066  -30.348 1.00 32.49  ? 395 THR A CB    1 
ATOM   3289 O  OG1   . THR A 1 395 ? -49.156 32.298  -29.372 1.00 31.70  ? 395 THR A OG1   1 
ATOM   3290 C  CG2   . THR A 1 395 ? -49.011 33.171  -31.620 1.00 34.15  ? 395 THR A CG2   1 
ATOM   3291 N  N     . HIS A 1 396 ? -49.848 34.542  -27.327 1.00 25.77  ? 396 HIS A N     1 
ATOM   3292 C  CA    . HIS A 1 396 ? -50.214 34.289  -25.930 1.00 25.40  ? 396 HIS A CA    1 
ATOM   3293 C  C     . HIS A 1 396 ? -50.409 35.524  -25.049 1.00 23.34  ? 396 HIS A C     1 
ATOM   3294 O  O     . HIS A 1 396 ? -50.475 35.415  -23.819 1.00 22.72  ? 396 HIS A O     1 
ATOM   3295 C  CB    . HIS A 1 396 ? -49.201 33.346  -25.280 1.00 24.66  ? 396 HIS A CB    1 
ATOM   3296 C  CG    . HIS A 1 396 ? -49.252 31.949  -25.815 1.00 29.14  ? 396 HIS A CG    1 
ATOM   3297 N  ND1   . HIS A 1 396 ? -50.241 31.055  -25.465 1.00 34.05  ? 396 HIS A ND1   1 
ATOM   3298 C  CD2   . HIS A 1 396 ? -48.440 31.294  -26.677 1.00 30.27  ? 396 HIS A CD2   1 
ATOM   3299 C  CE1   . HIS A 1 396 ? -50.037 29.909  -26.091 1.00 37.12  ? 396 HIS A CE1   1 
ATOM   3300 N  NE2   . HIS A 1 396 ? -48.951 30.029  -26.833 1.00 35.31  ? 396 HIS A NE2   1 
ATOM   3301 N  N     . TRP A 1 397 ? -50.513 36.691  -25.674 1.00 22.85  ? 397 TRP A N     1 
ATOM   3302 C  CA    . TRP A 1 397 ? -50.804 37.936  -24.976 1.00 21.48  ? 397 TRP A CA    1 
ATOM   3303 C  C     . TRP A 1 397 ? -51.877 37.779  -23.868 1.00 22.73  ? 397 TRP A C     1 
ATOM   3304 O  O     . TRP A 1 397 ? -51.760 38.355  -22.779 1.00 21.07  ? 397 TRP A O     1 
ATOM   3305 C  CB    . TRP A 1 397 ? -51.244 38.988  -25.994 1.00 22.66  ? 397 TRP A CB    1 
ATOM   3306 C  CG    . TRP A 1 397 ? -52.514 38.619  -26.691 1.00 25.93  ? 397 TRP A CG    1 
ATOM   3307 C  CD1   . TRP A 1 397 ? -52.639 37.882  -27.828 1.00 28.06  ? 397 TRP A CD1   1 
ATOM   3308 C  CD2   . TRP A 1 397 ? -53.848 38.948  -26.281 1.00 28.28  ? 397 TRP A CD2   1 
ATOM   3309 N  NE1   . TRP A 1 397 ? -53.965 37.738  -28.159 1.00 30.77  ? 397 TRP A NE1   1 
ATOM   3310 C  CE2   . TRP A 1 397 ? -54.727 38.384  -27.226 1.00 30.74  ? 397 TRP A CE2   1 
ATOM   3311 C  CE3   . TRP A 1 397 ? -54.386 39.666  -25.203 1.00 28.11  ? 397 TRP A CE3   1 
ATOM   3312 C  CZ2   . TRP A 1 397 ? -56.110 38.511  -27.127 1.00 33.94  ? 397 TRP A CZ2   1 
ATOM   3313 C  CZ3   . TRP A 1 397 ? -55.770 39.792  -25.112 1.00 30.39  ? 397 TRP A CZ3   1 
ATOM   3314 C  CH2   . TRP A 1 397 ? -56.610 39.219  -26.069 1.00 33.21  ? 397 TRP A CH2   1 
ATOM   3315 N  N     . HIS A 1 398 ? -52.912 36.991  -24.143 1.00 25.87  ? 398 HIS A N     1 
ATOM   3316 C  CA    . HIS A 1 398 ? -53.989 36.826  -23.185 1.00 28.04  ? 398 HIS A CA    1 
ATOM   3317 C  C     . HIS A 1 398 ? -53.449 36.402  -21.820 1.00 27.18  ? 398 HIS A C     1 
ATOM   3318 O  O     . HIS A 1 398 ? -53.904 36.904  -20.776 1.00 27.92  ? 398 HIS A O     1 
ATOM   3319 C  CB    . HIS A 1 398 ? -55.040 35.825  -23.669 1.00 31.52  ? 398 HIS A CB    1 
ATOM   3320 C  CG    . HIS A 1 398 ? -56.275 35.815  -22.824 0.50 34.69  ? 398 HIS A CG    1 
ATOM   3321 N  ND1   . HIS A 1 398 ? -56.291 35.327  -21.534 0.50 35.08  ? 398 HIS A ND1   1 
ATOM   3322 C  CD2   . HIS A 1 398 ? -57.530 36.260  -23.072 0.50 38.23  ? 398 HIS A CD2   1 
ATOM   3323 C  CE1   . HIS A 1 398 ? -57.503 35.462  -21.028 0.50 38.42  ? 398 HIS A CE1   1 
ATOM   3324 N  NE2   . HIS A 1 398 ? -58.275 36.024  -21.941 0.50 40.52  ? 398 HIS A NE2   1 
ATOM   3325 N  N     . THR A 1 399 ? -52.473 35.496  -21.816 1.00 26.17  ? 399 THR A N     1 
ATOM   3326 C  CA    . THR A 1 399 ? -52.049 34.893  -20.564 1.00 25.90  ? 399 THR A CA    1 
ATOM   3327 C  C     . THR A 1 399 ? -51.139 35.792  -19.718 1.00 22.90  ? 399 THR A C     1 
ATOM   3328 O  O     . THR A 1 399 ? -50.622 35.370  -18.687 1.00 22.87  ? 399 THR A O     1 
ATOM   3329 C  CB    . THR A 1 399 ? -51.446 33.477  -20.780 1.00 26.99  ? 399 THR A CB    1 
ATOM   3330 O  OG1   . THR A 1 399 ? -51.710 32.675  -19.627 1.00 29.85  ? 399 THR A OG1   1 
ATOM   3331 C  CG2   . THR A 1 399 ? -49.938 33.512  -21.035 1.00 23.78  ? 399 THR A CG2   1 
ATOM   3332 N  N     . LEU A 1 400 ? -50.977 37.044  -20.129 1.00 21.03  ? 400 LEU A N     1 
ATOM   3333 C  CA    . LEU A 1 400 ? -50.003 37.914  -19.491 1.00 18.51  ? 400 LEU A CA    1 
ATOM   3334 C  C     . LEU A 1 400 ? -50.626 38.994  -18.586 1.00 19.54  ? 400 LEU A C     1 
ATOM   3335 O  O     . LEU A 1 400 ? -50.188 40.144  -18.588 1.00 18.41  ? 400 LEU A O     1 
ATOM   3336 C  CB    . LEU A 1 400 ? -49.085 38.517  -20.558 1.00 16.43  ? 400 LEU A CB    1 
ATOM   3337 C  CG    . LEU A 1 400 ? -48.521 37.521  -21.581 1.00 16.18  ? 400 LEU A CG    1 
ATOM   3338 C  CD1   . LEU A 1 400 ? -47.572 38.168  -22.576 1.00 13.76  ? 400 LEU A CD1   1 
ATOM   3339 C  CD2   . LEU A 1 400 ? -47.826 36.372  -20.894 1.00 16.14  ? 400 LEU A CD2   1 
ATOM   3340 N  N     . GLY A 1 401 ? -51.636 38.620  -17.798 1.00 22.14  ? 401 GLY A N     1 
ATOM   3341 C  CA    . GLY A 1 401 ? -52.378 39.602  -16.999 1.00 23.68  ? 401 GLY A CA    1 
ATOM   3342 C  C     . GLY A 1 401 ? -53.380 40.385  -17.844 1.00 25.44  ? 401 GLY A C     1 
ATOM   3343 O  O     . GLY A 1 401 ? -53.126 40.685  -19.023 1.00 24.33  ? 401 GLY A O     1 
ATOM   3344 N  N     . LYS A 1 402 ? -54.520 40.731  -17.244 1.00 28.28  ? 402 LYS A N     1 
ATOM   3345 C  CA    . LYS A 1 402 ? -55.621 41.336  -17.996 1.00 30.58  ? 402 LYS A CA    1 
ATOM   3346 C  C     . LYS A 1 402 ? -55.220 42.605  -18.754 1.00 29.57  ? 402 LYS A C     1 
ATOM   3347 O  O     . LYS A 1 402 ? -55.617 42.809  -19.904 1.00 30.63  ? 402 LYS A O     1 
ATOM   3348 C  CB    . LYS A 1 402 ? -56.825 41.632  -17.097 1.00 33.89  ? 402 LYS A CB    1 
ATOM   3349 C  CG    . LYS A 1 402 ? -58.053 42.045  -17.903 1.00 36.97  ? 402 LYS A CG    1 
ATOM   3350 C  CD    . LYS A 1 402 ? -59.166 42.633  -17.047 1.00 42.63  ? 402 LYS A CD    1 
ATOM   3351 C  CE    . LYS A 1 402 ? -60.134 43.479  -17.901 1.00 46.48  ? 402 LYS A CE    1 
ATOM   3352 N  NZ    . LYS A 1 402 ? -60.455 42.896  -19.260 1.00 46.48  ? 402 LYS A NZ    1 
ATOM   3353 N  N     . ASN A 1 403 ? -54.432 43.451  -18.108 1.00 27.91  ? 403 ASN A N     1 
ATOM   3354 C  CA    . ASN A 1 403 ? -54.150 44.743  -18.662 1.00 27.59  ? 403 ASN A CA    1 
ATOM   3355 C  C     . ASN A 1 403 ? -52.876 44.785  -19.467 1.00 25.49  ? 403 ASN A C     1 
ATOM   3356 O  O     . ASN A 1 403 ? -52.865 45.348  -20.566 1.00 26.66  ? 403 ASN A O     1 
ATOM   3357 C  CB    . ASN A 1 403 ? -54.148 45.786  -17.562 1.00 28.83  ? 403 ASN A CB    1 
ATOM   3358 C  CG    . ASN A 1 403 ? -55.498 45.946  -16.938 1.00 30.80  ? 403 ASN A CG    1 
ATOM   3359 O  OD1   . ASN A 1 403 ? -56.451 46.325  -17.611 1.00 32.47  ? 403 ASN A OD1   1 
ATOM   3360 N  ND2   . ASN A 1 403 ? -55.599 45.639  -15.654 1.00 29.61  ? 403 ASN A ND2   1 
ATOM   3361 N  N     . VAL A 1 404 ? -51.792 44.210  -18.964 1.00 23.11  ? 404 VAL A N     1 
ATOM   3362 C  CA    . VAL A 1 404 ? -50.609 44.211  -19.812 1.00 21.53  ? 404 VAL A CA    1 
ATOM   3363 C  C     . VAL A 1 404 ? -50.841 43.296  -21.026 1.00 22.16  ? 404 VAL A C     1 
ATOM   3364 O  O     . VAL A 1 404 ? -50.586 43.702  -22.170 1.00 22.71  ? 404 VAL A O     1 
ATOM   3365 C  CB    . VAL A 1 404 ? -49.252 43.996  -19.063 1.00 19.12  ? 404 VAL A CB    1 
ATOM   3366 C  CG1   . VAL A 1 404 ? -49.326 44.499  -17.620 1.00 19.58  ? 404 VAL A CG1   1 
ATOM   3367 C  CG2   . VAL A 1 404 ? -48.752 42.575  -19.165 1.00 17.16  ? 404 VAL A CG2   1 
ATOM   3368 N  N     . GLY A 1 405 ? -51.387 42.102  -20.784 1.00 22.84  ? 405 GLY A N     1 
ATOM   3369 C  CA    . GLY A 1 405 ? -51.720 41.177  -21.865 1.00 24.42  ? 405 GLY A CA    1 
ATOM   3370 C  C     . GLY A 1 405 ? -52.483 41.849  -22.995 1.00 27.25  ? 405 GLY A C     1 
ATOM   3371 O  O     . GLY A 1 405 ? -52.310 41.510  -24.169 1.00 27.34  ? 405 GLY A O     1 
ATOM   3372 N  N     . GLU A 1 406 ? -53.326 42.813  -22.632 1.00 29.69  ? 406 GLU A N     1 
ATOM   3373 C  CA    . GLU A 1 406 ? -54.076 43.585  -23.609 1.00 33.18  ? 406 GLU A CA    1 
ATOM   3374 C  C     . GLU A 1 406 ? -53.224 44.666  -24.255 1.00 32.89  ? 406 GLU A C     1 
ATOM   3375 O  O     . GLU A 1 406 ? -53.385 44.946  -25.438 1.00 35.16  ? 406 GLU A O     1 
ATOM   3376 C  CB    . GLU A 1 406 ? -55.322 44.194  -22.984 1.00 35.77  ? 406 GLU A CB    1 
ATOM   3377 C  CG    . GLU A 1 406 ? -56.578 43.393  -23.244 1.00 41.53  ? 406 GLU A CG    1 
ATOM   3378 C  CD    . GLU A 1 406 ? -57.560 43.415  -22.060 1.00 47.98  ? 406 GLU A CD    1 
ATOM   3379 O  OE1   . GLU A 1 406 ? -57.954 42.312  -21.614 1.00 51.01  ? 406 GLU A OE1   1 
ATOM   3380 O  OE2   . GLU A 1 406 ? -57.937 44.512  -21.564 1.00 50.19  ? 406 GLU A OE2   1 
ATOM   3381 N  N     . SER A 1 407 ? -52.323 45.281  -23.499 1.00 30.99  ? 407 SER A N     1 
ATOM   3382 C  CA    . SER A 1 407 ? -51.502 46.333  -24.081 1.00 31.47  ? 407 SER A CA    1 
ATOM   3383 C  C     . SER A 1 407 ? -50.459 45.751  -25.022 1.00 30.42  ? 407 SER A C     1 
ATOM   3384 O  O     . SER A 1 407 ? -50.065 46.388  -26.015 1.00 31.63  ? 407 SER A O     1 
ATOM   3385 C  CB    . SER A 1 407 ? -50.811 47.154  -23.008 1.00 30.66  ? 407 SER A CB    1 
ATOM   3386 O  OG    . SER A 1 407 ? -49.802 47.934  -23.617 1.00 31.34  ? 407 SER A OG    1 
ATOM   3387 N  N     . ILE A 1 408 ? -50.008 44.544  -24.675 1.00 28.24  ? 408 ILE A N     1 
ATOM   3388 C  CA    . ILE A 1 408 ? -49.049 43.790  -25.472 1.00 27.24  ? 408 ILE A CA    1 
ATOM   3389 C  C     . ILE A 1 408 ? -49.707 43.398  -26.770 1.00 29.91  ? 408 ILE A C     1 
ATOM   3390 O  O     . ILE A 1 408 ? -49.047 43.364  -27.809 1.00 31.12  ? 408 ILE A O     1 
ATOM   3391 C  CB    . ILE A 1 408 ? -48.537 42.544  -24.718 1.00 24.72  ? 408 ILE A CB    1 
ATOM   3392 C  CG1   . ILE A 1 408 ? -47.415 42.945  -23.749 1.00 22.65  ? 408 ILE A CG1   1 
ATOM   3393 C  CG2   . ILE A 1 408 ? -48.055 41.464  -25.690 1.00 24.23  ? 408 ILE A CG2   1 
ATOM   3394 C  CD1   . ILE A 1 408 ? -47.048 41.884  -22.730 1.00 19.80  ? 408 ILE A CD1   1 
ATOM   3395 N  N     . ARG A 1 409 ? -51.010 43.127  -26.709 1.00 31.76  ? 409 ARG A N     1 
ATOM   3396 C  CA    . ARG A 1 409 ? -51.788 42.775  -27.893 1.00 35.14  ? 409 ARG A CA    1 
ATOM   3397 C  C     . ARG A 1 409 ? -51.805 43.941  -28.875 1.00 37.62  ? 409 ARG A C     1 
ATOM   3398 O  O     . ARG A 1 409 ? -51.435 43.784  -30.041 1.00 39.57  ? 409 ARG A O     1 
ATOM   3399 C  CB    . ARG A 1 409 ? -53.211 42.397  -27.506 1.00 37.15  ? 409 ARG A CB    1 
ATOM   3400 C  CG    . ARG A 1 409 ? -54.016 41.790  -28.622 1.00 42.25  ? 409 ARG A CG    1 
ATOM   3401 C  CD    . ARG A 1 409 ? -55.508 41.929  -28.381 1.00 48.61  ? 409 ARG A CD    1 
ATOM   3402 N  NE    . ARG A 1 409 ? -56.219 40.949  -29.203 1.00 56.23  ? 409 ARG A NE    1 
ATOM   3403 C  CZ    . ARG A 1 409 ? -57.542 40.886  -29.380 1.00 61.61  ? 409 ARG A CZ    1 
ATOM   3404 N  NH1   . ARG A 1 409 ? -58.059 39.933  -30.157 1.00 64.86  ? 409 ARG A NH1   1 
ATOM   3405 N  NH2   . ARG A 1 409 ? -58.353 41.765  -28.797 1.00 63.41  ? 409 ARG A NH2   1 
ATOM   3406 N  N     . GLU A 1 410 ? -52.200 45.114  -28.385 1.00 38.07  ? 410 GLU A N     1 
ATOM   3407 C  CA    . GLU A 1 410 ? -52.250 46.321  -29.199 1.00 40.80  ? 410 GLU A CA    1 
ATOM   3408 C  C     . GLU A 1 410 ? -50.894 46.697  -29.781 1.00 39.96  ? 410 GLU A C     1 
ATOM   3409 O  O     . GLU A 1 410 ? -50.817 47.231  -30.884 1.00 43.29  ? 410 GLU A O     1 
ATOM   3410 C  CB    . GLU A 1 410 ? -52.802 47.474  -28.384 1.00 41.99  ? 410 GLU A CB    1 
ATOM   3411 C  CG    . GLU A 1 410 ? -54.294 47.402  -28.207 1.00 46.26  ? 410 GLU A CG    1 
ATOM   3412 C  CD    . GLU A 1 410 ? -54.716 47.786  -26.804 1.00 48.66  ? 410 GLU A CD    1 
ATOM   3413 O  OE1   . GLU A 1 410 ? -55.647 47.132  -26.259 1.00 49.95  ? 410 GLU A OE1   1 
ATOM   3414 O  OE2   . GLU A 1 410 ? -54.100 48.728  -26.245 1.00 48.78  ? 410 GLU A OE2   1 
ATOM   3415 N  N     . TYR A 1 411 ? -49.829 46.429  -29.035 1.00 35.84  ? 411 TYR A N     1 
ATOM   3416 C  CA    . TYR A 1 411 ? -48.475 46.677  -29.515 1.00 35.12  ? 411 TYR A CA    1 
ATOM   3417 C  C     . TYR A 1 411 ? -47.442 46.243  -28.512 1.00 31.20  ? 411 TYR A C     1 
ATOM   3418 O  O     . TYR A 1 411 ? -47.567 46.542  -27.314 1.00 29.88  ? 411 TYR A O     1 
ATOM   3419 C  CB    . TYR A 1 411 ? -48.252 48.155  -29.818 1.00 38.11  ? 411 TYR A CB    1 
ATOM   3420 C  CG    . TYR A 1 411 ? -46.857 48.641  -29.495 1.00 36.89  ? 411 TYR A CG    1 
ATOM   3421 C  CD1   . TYR A 1 411 ? -46.592 49.301  -28.304 1.00 35.43  ? 411 TYR A CD1   1 
ATOM   3422 C  CD2   . TYR A 1 411 ? -45.806 48.442  -30.385 1.00 37.69  ? 411 TYR A CD2   1 
ATOM   3423 C  CE1   . TYR A 1 411 ? -45.319 49.753  -28.011 1.00 35.95  ? 411 TYR A CE1   1 
ATOM   3424 C  CE2   . TYR A 1 411 ? -44.537 48.891  -30.104 1.00 37.54  ? 411 TYR A CE2   1 
ATOM   3425 C  CZ    . TYR A 1 411 ? -44.294 49.545  -28.917 1.00 36.79  ? 411 TYR A CZ    1 
ATOM   3426 O  OH    . TYR A 1 411 ? -43.021 49.986  -28.629 1.00 37.33  ? 411 TYR A OH    1 
ATOM   3427 N  N     . PHE A 1 412 ? -46.424 45.555  -29.023 1.00 29.62  ? 412 PHE A N     1 
ATOM   3428 C  CA    . PHE A 1 412 ? -45.192 45.294  -28.295 1.00 26.25  ? 412 PHE A CA    1 
ATOM   3429 C  C     . PHE A 1 412 ? -44.069 45.177  -29.314 1.00 27.90  ? 412 PHE A C     1 
ATOM   3430 O  O     . PHE A 1 412 ? -44.329 44.953  -30.493 1.00 30.71  ? 412 PHE A O     1 
ATOM   3431 C  CB    . PHE A 1 412 ? -45.294 43.997  -27.509 1.00 22.32  ? 412 PHE A CB    1 
ATOM   3432 C  CG    . PHE A 1 412 ? -44.976 42.776  -28.319 1.00 21.07  ? 412 PHE A CG    1 
ATOM   3433 C  CD1   . PHE A 1 412 ? -43.677 42.319  -28.422 1.00 18.48  ? 412 PHE A CD1   1 
ATOM   3434 C  CD2   . PHE A 1 412 ? -45.980 42.087  -28.979 1.00 21.66  ? 412 PHE A CD2   1 
ATOM   3435 C  CE1   . PHE A 1 412 ? -43.383 41.203  -29.164 1.00 18.79  ? 412 PHE A CE1   1 
ATOM   3436 C  CE2   . PHE A 1 412 ? -45.697 40.967  -29.719 1.00 21.33  ? 412 PHE A CE2   1 
ATOM   3437 C  CZ    . PHE A 1 412 ? -44.389 40.525  -29.817 1.00 21.36  ? 412 PHE A CZ    1 
ATOM   3438 N  N     . GLU A 1 413 ? -42.830 45.317  -28.858 1.00 26.76  ? 413 GLU A N     1 
ATOM   3439 C  CA    . GLU A 1 413 ? -41.652 45.037  -29.687 1.00 27.95  ? 413 GLU A CA    1 
ATOM   3440 C  C     . GLU A 1 413 ? -40.523 44.400  -28.853 1.00 25.04  ? 413 GLU A C     1 
ATOM   3441 O  O     . GLU A 1 413 ? -40.580 44.396  -27.618 1.00 22.79  ? 413 GLU A O     1 
ATOM   3442 C  CB    . GLU A 1 413 ? -41.171 46.312  -30.384 1.00 31.28  ? 413 GLU A CB    1 
ATOM   3443 C  CG    . GLU A 1 413 ? -40.730 47.411  -29.450 1.00 31.19  ? 413 GLU A CG    1 
ATOM   3444 C  CD    . GLU A 1 413 ? -40.176 48.614  -30.195 1.00 37.28  ? 413 GLU A CD    1 
ATOM   3445 O  OE1   . GLU A 1 413 ? -39.195 48.454  -30.959 1.00 40.50  ? 413 GLU A OE1   1 
ATOM   3446 O  OE2   . GLU A 1 413 ? -40.711 49.734  -30.014 1.00 40.49  ? 413 GLU A OE2   1 
ATOM   3447 N  N     . ILE A 1 414 ? -39.509 43.854  -29.516 1.00 25.76  ? 414 ILE A N     1 
ATOM   3448 C  CA    . ILE A 1 414 ? -38.306 43.427  -28.812 1.00 24.01  ? 414 ILE A CA    1 
ATOM   3449 C  C     . ILE A 1 414 ? -37.162 44.393  -29.089 1.00 26.98  ? 414 ILE A C     1 
ATOM   3450 O  O     . ILE A 1 414 ? -36.911 44.750  -30.238 1.00 30.31  ? 414 ILE A O     1 
ATOM   3451 C  CB    . ILE A 1 414 ? -37.904 41.977  -29.160 1.00 22.92  ? 414 ILE A CB    1 
ATOM   3452 C  CG1   . ILE A 1 414 ? -38.777 40.993  -28.394 1.00 20.04  ? 414 ILE A CG1   1 
ATOM   3453 C  CG2   . ILE A 1 414 ? -36.483 41.697  -28.760 1.00 22.09  ? 414 ILE A CG2   1 
ATOM   3454 C  CD1   . ILE A 1 414 ? -39.965 40.505  -29.160 1.00 20.74  ? 414 ILE A CD1   1 
ATOM   3455 N  N     . ILE A 1 415 ? -36.503 44.852  -28.030 1.00 26.66  ? 415 ILE A N     1 
ATOM   3456 C  CA    . ILE A 1 415 ? -35.250 45.557  -28.197 1.00 30.35  ? 415 ILE A CA    1 
ATOM   3457 C  C     . ILE A 1 415 ? -34.151 44.729  -27.569 1.00 29.62  ? 415 ILE A C     1 
ATOM   3458 O  O     . ILE A 1 415 ? -34.339 44.156  -26.497 1.00 26.53  ? 415 ILE A O     1 
ATOM   3459 C  CB    . ILE A 1 415 ? -35.201 46.961  -27.553 1.00 31.96  ? 415 ILE A CB    1 
ATOM   3460 C  CG1   . ILE A 1 415 ? -36.582 47.547  -27.252 1.00 30.76  ? 415 ILE A CG1   1 
ATOM   3461 C  CG2   . ILE A 1 415 ? -34.371 47.874  -28.437 1.00 37.26  ? 415 ILE A CG2   1 
ATOM   3462 C  CD1   . ILE A 1 415 ? -37.272 48.122  -28.436 1.00 33.79  ? 415 ILE A CD1   1 
ATOM   3463 N  N     . SER A 1 416 ? -33.007 44.673  -28.249 1.00 33.63  ? 416 SER A N     1 
ATOM   3464 C  CA    . SER A 1 416 ? -31.826 43.961  -27.757 1.00 34.01  ? 416 SER A CA    1 
ATOM   3465 C  C     . SER A 1 416 ? -30.564 44.740  -28.078 1.00 38.76  ? 416 SER A C     1 
ATOM   3466 O  O     . SER A 1 416 ? -30.548 45.568  -28.996 1.00 42.44  ? 416 SER A O     1 
ATOM   3467 C  CB    . SER A 1 416 ? -31.736 42.553  -28.340 1.00 32.84  ? 416 SER A CB    1 
ATOM   3468 O  OG    . SER A 1 416 ? -31.711 42.613  -29.744 1.00 36.47  ? 416 SER A OG    1 
ATOM   3469 N  N     . GLY A 1 417 ? -29.523 44.481  -27.287 1.00 39.54  ? 417 GLY A N     1 
ATOM   3470 C  CA    . GLY A 1 417 ? -28.219 45.115  -27.465 1.00 45.12  ? 417 GLY A CA    1 
ATOM   3471 C  C     . GLY A 1 417 ? -28.228 46.629  -27.405 1.00 49.40  ? 417 GLY A C     1 
ATOM   3472 O  O     . GLY A 1 417 ? -29.095 47.234  -26.789 1.00 48.10  ? 417 GLY A O     1 
ATOM   3473 N  N     . GLU A 1 418 ? -27.257 47.242  -28.065 1.00 55.51  ? 418 GLU A N     1 
ATOM   3474 C  CA    . GLU A 1 418 ? -27.048 48.693  -27.969 1.00 61.35  ? 418 GLU A CA    1 
ATOM   3475 C  C     . GLU A 1 418 ? -28.326 49.553  -28.056 1.00 61.64  ? 418 GLU A C     1 
ATOM   3476 O  O     . GLU A 1 418 ? -28.440 50.563  -27.351 1.00 63.25  ? 418 GLU A O     1 
ATOM   3477 C  CB    . GLU A 1 418 ? -25.988 49.151  -28.984 1.00 67.59  ? 418 GLU A CB    1 
ATOM   3478 C  CG    . GLU A 1 418 ? -24.690 48.321  -28.941 1.00 68.91  ? 418 GLU A CG    1 
ATOM   3479 C  CD    . GLU A 1 418 ? -23.886 48.388  -30.242 1.00 75.12  ? 418 GLU A CD    1 
ATOM   3480 O  OE1   . GLU A 1 418 ? -22.668 48.085  -30.200 1.00 79.35  ? 418 GLU A OE1   1 
ATOM   3481 O  OE2   . GLU A 1 418 ? -24.461 48.742  -31.305 1.00 79.44  ? 418 GLU A OE2   1 
ATOM   3482 N  N     . LYS A 1 419 ? -29.279 49.151  -28.901 1.00 60.89  ? 419 LYS A N     1 
ATOM   3483 C  CA    . LYS A 1 419 ? -30.544 49.884  -29.022 1.00 61.45  ? 419 LYS A CA    1 
ATOM   3484 C  C     . LYS A 1 419 ? -31.257 49.917  -27.676 1.00 56.95  ? 419 LYS A C     1 
ATOM   3485 O  O     . LYS A 1 419 ? -31.803 50.949  -27.277 1.00 58.76  ? 419 LYS A O     1 
ATOM   3486 C  CB    . LYS A 1 419 ? -31.461 49.280  -30.098 1.00 61.08  ? 419 LYS A CB    1 
ATOM   3487 C  CG    . LYS A 1 419 ? -32.625 50.221  -30.513 1.00 64.01  ? 419 LYS A CG    1 
ATOM   3488 C  CD    . LYS A 1 419 ? -33.739 49.535  -31.349 1.00 62.60  ? 419 LYS A CD    1 
ATOM   3489 C  CE    . LYS A 1 419 ? -33.309 49.175  -32.779 1.00 66.63  ? 419 LYS A CE    1 
ATOM   3490 N  NZ    . LYS A 1 419 ? -32.910 50.364  -33.592 1.00 73.46  ? 419 LYS A NZ    1 
ATOM   3491 N  N     . LEU A 1 420 ? -31.216 48.779  -26.983 1.00 51.78  ? 420 LEU A N     1 
ATOM   3492 C  CA    . LEU A 1 420 ? -31.850 48.590  -25.675 1.00 47.15  ? 420 LEU A CA    1 
ATOM   3493 C  C     . LEU A 1 420 ? -31.158 49.380  -24.580 1.00 48.20  ? 420 LEU A C     1 
ATOM   3494 O  O     . LEU A 1 420 ? -31.788 49.743  -23.596 1.00 46.68  ? 420 LEU A O     1 
ATOM   3495 C  CB    . LEU A 1 420 ? -31.870 47.092  -25.322 1.00 42.70  ? 420 LEU A CB    1 
ATOM   3496 C  CG    . LEU A 1 420 ? -32.075 46.601  -23.890 1.00 38.87  ? 420 LEU A CG    1 
ATOM   3497 C  CD1   . LEU A 1 420 ? -33.495 46.858  -23.419 1.00 37.38  ? 420 LEU A CD1   1 
ATOM   3498 C  CD2   . LEU A 1 420 ? -31.755 45.134  -23.807 1.00 36.33  ? 420 LEU A CD2   1 
ATOM   3499 N  N     . PHE A 1 421 ? -29.862 49.637  -24.754 1.00 51.25  ? 421 PHE A N     1 
ATOM   3500 C  CA    . PHE A 1 421 ? -29.063 50.321  -23.727 1.00 52.96  ? 421 PHE A CA    1 
ATOM   3501 C  C     . PHE A 1 421 ? -29.387 51.802  -23.606 1.00 56.89  ? 421 PHE A C     1 
ATOM   3502 O  O     . PHE A 1 421 ? -29.182 52.382  -22.543 1.00 57.94  ? 421 PHE A O     1 
ATOM   3503 C  CB    . PHE A 1 421 ? -27.555 50.122  -23.933 1.00 55.49  ? 421 PHE A CB    1 
ATOM   3504 C  CG    . PHE A 1 421 ? -27.124 48.679  -23.972 1.00 52.43  ? 421 PHE A CG    1 
ATOM   3505 C  CD1   . PHE A 1 421 ? -26.191 48.246  -24.911 1.00 55.59  ? 421 PHE A CD1   1 
ATOM   3506 C  CD2   . PHE A 1 421 ? -27.649 47.749  -23.082 1.00 47.27  ? 421 PHE A CD2   1 
ATOM   3507 C  CE1   . PHE A 1 421 ? -25.783 46.900  -24.959 1.00 52.64  ? 421 PHE A CE1   1 
ATOM   3508 C  CE2   . PHE A 1 421 ? -27.248 46.405  -23.128 1.00 44.89  ? 421 PHE A CE2   1 
ATOM   3509 C  CZ    . PHE A 1 421 ? -26.316 45.984  -24.067 1.00 46.77  ? 421 PHE A CZ    1 
ATOM   3510 N  N     . LYS A 1 422 ? -29.897 52.416  -24.673 1.00 59.45  ? 422 LYS A N     1 
ATOM   3511 C  CA    . LYS A 1 422 ? -30.354 53.802  -24.563 1.00 63.70  ? 422 LYS A CA    1 
ATOM   3512 C  C     . LYS A 1 422 ? -31.803 53.928  -24.101 1.00 60.56  ? 422 LYS A C     1 
ATOM   3513 O  O     . LYS A 1 422 ? -32.446 54.958  -24.336 1.00 64.43  ? 422 LYS A O     1 
ATOM   3514 C  CB    . LYS A 1 422 ? -30.073 54.652  -25.826 1.00 70.33  ? 422 LYS A CB    1 
ATOM   3515 C  CG    . LYS A 1 422 ? -29.872 53.901  -27.147 1.00 71.08  ? 422 LYS A CG    1 
ATOM   3516 C  CD    . LYS A 1 422 ? -29.121 54.769  -28.161 1.00 77.88  ? 422 LYS A CD    1 
ATOM   3517 C  CE    . LYS A 1 422 ? -27.636 54.849  -27.821 1.00 81.46  ? 422 LYS A CE    1 
ATOM   3518 N  NZ    . LYS A 1 422 ? -26.911 55.889  -28.627 1.00 90.60  ? 422 LYS A NZ    1 
ATOM   3519 N  N     . GLU A 1 423 ? -32.296 52.884  -23.431 1.00 54.01  ? 423 GLU A N     1 
ATOM   3520 C  CA    . GLU A 1 423 ? -33.631 52.871  -22.834 1.00 50.59  ? 423 GLU A CA    1 
ATOM   3521 C  C     . GLU A 1 423 ? -33.489 52.913  -21.321 1.00 48.96  ? 423 GLU A C     1 
ATOM   3522 O  O     . GLU A 1 423 ? -32.486 52.437  -20.792 1.00 48.26  ? 423 GLU A O     1 
ATOM   3523 C  CB    . GLU A 1 423 ? -34.385 51.613  -23.238 1.00 45.77  ? 423 GLU A CB    1 
ATOM   3524 C  CG    . GLU A 1 423 ? -34.508 51.407  -24.736 1.00 47.24  ? 423 GLU A CG    1 
ATOM   3525 C  CD    . GLU A 1 423 ? -35.752 52.040  -25.325 1.00 48.76  ? 423 GLU A CD    1 
ATOM   3526 O  OE1   . GLU A 1 423 ? -36.651 52.446  -24.549 1.00 47.52  ? 423 GLU A OE1   1 
ATOM   3527 O  OE2   . GLU A 1 423 ? -35.826 52.116  -26.574 1.00 50.61  ? 423 GLU A OE2   1 
ATOM   3528 N  N     . PRO A 1 424 ? -34.493 53.467  -20.609 1.00 48.78  ? 424 PRO A N     1 
ATOM   3529 C  CA    . PRO A 1 424 ? -34.340 53.690  -19.175 1.00 48.38  ? 424 PRO A CA    1 
ATOM   3530 C  C     . PRO A 1 424 ? -34.541 52.416  -18.376 1.00 43.07  ? 424 PRO A C     1 
ATOM   3531 O  O     . PRO A 1 424 ? -35.428 52.360  -17.505 1.00 41.80  ? 424 PRO A O     1 
ATOM   3532 C  CB    . PRO A 1 424 ? -35.442 54.699  -18.871 1.00 50.90  ? 424 PRO A CB    1 
ATOM   3533 C  CG    . PRO A 1 424 ? -36.507 54.361  -19.835 1.00 49.33  ? 424 PRO A CG    1 
ATOM   3534 C  CD    . PRO A 1 424 ? -35.814 53.915  -21.086 1.00 49.48  ? 424 PRO A CD    1 
ATOM   3535 N  N     . VAL A 1 425 ? -33.713 51.412  -18.677 1.00 40.31  ? 425 VAL A N     1 
ATOM   3536 C  CA    . VAL A 1 425 ? -33.794 50.084  -18.052 1.00 35.80  ? 425 VAL A CA    1 
ATOM   3537 C  C     . VAL A 1 425 ? -32.454 49.568  -17.512 1.00 35.77  ? 425 VAL A C     1 
ATOM   3538 O  O     . VAL A 1 425 ? -32.391 48.480  -16.926 1.00 33.29  ? 425 VAL A O     1 
ATOM   3539 C  CB    . VAL A 1 425 ? -34.368 49.039  -19.022 1.00 32.49  ? 425 VAL A CB    1 
ATOM   3540 C  CG1   . VAL A 1 425 ? -35.842 49.237  -19.186 1.00 31.67  ? 425 VAL A CG1   1 
ATOM   3541 C  CG2   . VAL A 1 425 ? -33.668 49.097  -20.367 1.00 34.01  ? 425 VAL A CG2   1 
ATOM   3542 N  N     . THR A 1 426 ? -31.402 50.363  -17.708 1.00 39.23  ? 426 THR A N     1 
ATOM   3543 C  CA    . THR A 1 426 ? -30.022 49.994  -17.384 1.00 39.76  ? 426 THR A CA    1 
ATOM   3544 C  C     . THR A 1 426 ? -29.837 49.594  -15.927 1.00 38.81  ? 426 THR A C     1 
ATOM   3545 O  O     . THR A 1 426 ? -29.112 48.647  -15.622 1.00 37.35  ? 426 THR A O     1 
ATOM   3546 C  CB    . THR A 1 426 ? -29.054 51.150  -17.699 1.00 44.95  ? 426 THR A CB    1 
ATOM   3547 O  OG1   . THR A 1 426 ? -29.313 52.249  -16.811 1.00 48.60  ? 426 THR A OG1   1 
ATOM   3548 C  CG2   . THR A 1 426 ? -29.215 51.614  -19.144 1.00 46.44  ? 426 THR A CG2   1 
ATOM   3549 N  N     . ALA A 1 427 ? -30.493 50.324  -15.034 1.00 40.25  ? 427 ALA A N     1 
ATOM   3550 C  CA    . ALA A 1 427 ? -30.417 50.046  -13.612 1.00 40.41  ? 427 ALA A CA    1 
ATOM   3551 C  C     . ALA A 1 427 ? -30.854 48.611  -13.312 1.00 36.47  ? 427 ALA A C     1 
ATOM   3552 O  O     . ALA A 1 427 ? -30.125 47.872  -12.651 1.00 36.24  ? 427 ALA A O     1 
ATOM   3553 C  CB    . ALA A 1 427 ? -31.240 51.048  -12.836 1.00 42.78  ? 427 ALA A CB    1 
ATOM   3554 N  N     . GLU A 1 428 ? -32.024 48.222  -13.824 1.00 34.25  ? 428 GLU A N     1 
ATOM   3555 C  CA    . GLU A 1 428 ? -32.507 46.830  -13.774 1.00 31.01  ? 428 GLU A CA    1 
ATOM   3556 C  C     . GLU A 1 428 ? -31.497 45.880  -14.380 1.00 30.08  ? 428 GLU A C     1 
ATOM   3557 O  O     . GLU A 1 428 ? -31.160 44.873  -13.761 1.00 29.15  ? 428 GLU A O     1 
ATOM   3558 C  CB    . GLU A 1 428 ? -33.819 46.667  -14.539 1.00 29.00  ? 428 GLU A CB    1 
ATOM   3559 C  CG    . GLU A 1 428 ? -35.049 47.151  -13.818 1.00 30.35  ? 428 GLU A CG    1 
ATOM   3560 C  CD    . GLU A 1 428 ? -35.092 48.666  -13.688 1.00 36.24  ? 428 GLU A CD    1 
ATOM   3561 O  OE1   . GLU A 1 428 ? -34.391 49.379  -14.461 1.00 38.26  ? 428 GLU A OE1   1 
ATOM   3562 O  OE2   . GLU A 1 428 ? -35.837 49.149  -12.803 1.00 38.89  ? 428 GLU A OE2   1 
ATOM   3563 N  N     . LEU A 1 429 ? -31.034 46.202  -15.594 1.00 30.93  ? 429 LEU A N     1 
ATOM   3564 C  CA    . LEU A 1 429 ? -30.014 45.415  -16.300 1.00 30.93  ? 429 LEU A CA    1 
ATOM   3565 C  C     . LEU A 1 429 ? -28.795 45.119  -15.437 1.00 32.28  ? 429 LEU A C     1 
ATOM   3566 O  O     . LEU A 1 429 ? -28.415 43.954  -15.257 1.00 30.63  ? 429 LEU A O     1 
ATOM   3567 C  CB    . LEU A 1 429 ? -29.565 46.146  -17.553 1.00 33.14  ? 429 LEU A CB    1 
ATOM   3568 C  CG    . LEU A 1 429 ? -30.429 45.991  -18.798 1.00 33.19  ? 429 LEU A CG    1 
ATOM   3569 C  CD1   . LEU A 1 429 ? -30.181 47.155  -19.750 1.00 36.83  ? 429 LEU A CD1   1 
ATOM   3570 C  CD2   . LEU A 1 429 ? -30.124 44.671  -19.468 1.00 31.80  ? 429 LEU A CD2   1 
ATOM   3571 N  N     . CYS A 1 430 ? -28.194 46.190  -14.913 1.00 35.44  ? 430 CYS A N     1 
ATOM   3572 C  CA    . CYS A 1 430 ? -27.105 46.085  -13.960 1.00 37.51  ? 430 CYS A CA    1 
ATOM   3573 C  C     . CYS A 1 430 ? -27.485 45.156  -12.825 1.00 35.89  ? 430 CYS A C     1 
ATOM   3574 O  O     . CYS A 1 430 ? -26.787 44.182  -12.568 1.00 35.78  ? 430 CYS A O     1 
ATOM   3575 C  CB    . CYS A 1 430 ? -26.726 47.460  -13.415 1.00 41.39  ? 430 CYS A CB    1 
ATOM   3576 S  SG    . CYS A 1 430 ? -25.659 48.373  -14.538 1.00 45.62  ? 430 CYS A SG    1 
ATOM   3577 N  N     . GLU A 1 431 ? -28.612 45.448  -12.180 1.00 35.23  ? 431 GLU A N     1 
ATOM   3578 C  CA    . GLU A 1 431 ? -29.098 44.686  -11.031 1.00 34.59  ? 431 GLU A CA    1 
ATOM   3579 C  C     . GLU A 1 431 ? -29.295 43.201  -11.370 1.00 31.12  ? 431 GLU A C     1 
ATOM   3580 O  O     . GLU A 1 431 ? -28.869 42.310  -10.630 1.00 31.22  ? 431 GLU A O     1 
ATOM   3581 C  CB    . GLU A 1 431 ? -30.386 45.335  -10.518 1.00 35.13  ? 431 GLU A CB    1 
ATOM   3582 C  CG    . GLU A 1 431 ? -31.378 44.402  -9.824  1.00 37.47  ? 431 GLU A CG    1 
ATOM   3583 C  CD    . GLU A 1 431 ? -31.027 44.142  -8.369  1.00 45.33  ? 431 GLU A CD    1 
ATOM   3584 O  OE1   . GLU A 1 431 ? -31.237 42.990  -7.897  1.00 46.74  ? 431 GLU A OE1   1 
ATOM   3585 O  OE2   . GLU A 1 431 ? -30.536 45.094  -7.700  1.00 50.74  ? 431 GLU A OE2   1 
ATOM   3586 N  N     . MET A 1 432 ? -29.922 42.956  -12.517 1.00 28.23  ? 432 MET A N     1 
ATOM   3587 C  CA    . MET A 1 432 ? -30.263 41.618  -12.978 1.00 25.18  ? 432 MET A CA    1 
ATOM   3588 C  C     . MET A 1 432 ? -29.011 40.771  -13.156 1.00 24.49  ? 432 MET A C     1 
ATOM   3589 O  O     . MET A 1 432 ? -28.991 39.599  -12.771 1.00 24.00  ? 432 MET A O     1 
ATOM   3590 C  CB    . MET A 1 432 ? -31.037 41.728  -14.294 1.00 23.23  ? 432 MET A CB    1 
ATOM   3591 C  CG    . MET A 1 432 ? -31.380 40.408  -14.963 1.00 22.21  ? 432 MET A CG    1 
ATOM   3592 S  SD    . MET A 1 432 ? -32.395 40.595  -16.458 1.00 22.05  ? 432 MET A SD    1 
ATOM   3593 C  CE    . MET A 1 432 ? -31.925 42.241  -17.041 1.00 22.64  ? 432 MET A CE    1 
ATOM   3594 N  N     . MET A 1 433 ? -27.972 41.390  -13.718 1.00 24.51  ? 433 MET A N     1 
ATOM   3595 C  CA    . MET A 1 433 ? -26.736 40.699  -14.096 1.00 23.90  ? 433 MET A CA    1 
ATOM   3596 C  C     . MET A 1 433 ? -25.679 40.662  -13.002 1.00 25.82  ? 433 MET A C     1 
ATOM   3597 O  O     . MET A 1 433 ? -24.610 40.088  -13.195 1.00 26.87  ? 433 MET A O     1 
ATOM   3598 C  CB    . MET A 1 433 ? -26.135 41.324  -15.357 1.00 24.83  ? 433 MET A CB    1 
ATOM   3599 C  CG    . MET A 1 433 ? -27.039 41.257  -16.561 1.00 22.54  ? 433 MET A CG    1 
ATOM   3600 S  SD    . MET A 1 433 ? -26.188 41.688  -18.068 1.00 23.75  ? 433 MET A SD    1 
ATOM   3601 C  CE    . MET A 1 433 ? -26.050 43.462  -17.928 1.00 27.11  ? 433 MET A CE    1 
ATOM   3602 N  N     . GLY A 1 434 ? -25.971 41.273  -11.859 1.00 26.37  ? 434 GLY A N     1 
ATOM   3603 C  CA    . GLY A 1 434 ? -25.047 41.242  -10.719 1.00 28.71  ? 434 GLY A CA    1 
ATOM   3604 C  C     . GLY A 1 434 ? -23.814 42.102  -10.918 1.00 31.02  ? 434 GLY A C     1 
ATOM   3605 O  O     . GLY A 1 434 ? -22.825 41.973  -10.198 1.00 33.52  ? 434 GLY A O     1 
ATOM   3606 N  N     . VAL A 1 435 ? -23.890 42.983  -11.906 1.00 30.59  ? 435 VAL A N     1 
ATOM   3607 C  CA    . VAL A 1 435 ? -22.858 43.957  -12.194 1.00 33.72  ? 435 VAL A CA    1 
ATOM   3608 C  C     . VAL A 1 435 ? -22.380 44.566  -10.891 1.00 37.34  ? 435 VAL A C     1 
ATOM   3609 O  O     . VAL A 1 435 ? -23.186 44.978  -10.067 1.00 37.75  ? 435 VAL A O     1 
ATOM   3610 C  CB    . VAL A 1 435 ? -23.414 45.047  -13.131 1.00 33.66  ? 435 VAL A CB    1 
ATOM   3611 C  CG1   . VAL A 1 435 ? -22.373 46.127  -13.408 1.00 37.63  ? 435 VAL A CG1   1 
ATOM   3612 C  CG2   . VAL A 1 435 ? -23.917 44.415  -14.435 1.00 30.50  ? 435 VAL A CG2   1 
ATOM   3613 N  N     . LYS A 1 436 ? -21.069 44.593  -10.693 1.00 40.93  ? 436 LYS A N     1 
ATOM   3614 C  CA    . LYS A 1 436 ? -20.484 45.200  -9.494  1.00 45.29  ? 436 LYS A CA    1 
ATOM   3615 C  C     . LYS A 1 436 ? -20.355 46.734  -9.581  1.00 49.25  ? 436 LYS A C     1 
ATOM   3616 O  O     . LYS A 1 436 ? -20.415 47.318  -10.660 1.00 49.21  ? 436 LYS A O     1 
ATOM   3617 C  CB    . LYS A 1 436 ? -19.100 44.594  -9.209  1.00 47.93  ? 436 LYS A CB    1 
ATOM   3618 C  CG    . LYS A 1 436 ? -19.071 43.128  -8.807  1.00 44.74  ? 436 LYS A CG    1 
ATOM   3619 C  CD    . LYS A 1 436 ? -17.908 42.898  -7.875  1.00 47.78  ? 436 LYS A CD    1 
ATOM   3620 C  CE    . LYS A 1 436 ? -17.613 41.438  -7.683  1.00 47.35  ? 436 LYS A CE    1 
ATOM   3621 N  NZ    . LYS A 1 436 ? -16.435 40.993  -8.451  1.00 48.37  ? 436 LYS A NZ    1 
ATOM   3622 N  N     . ASP A 1 437 ? -20.174 47.367  -8.428  1.00 53.43  ? 437 ASP A N     1 
ATOM   3623 C  CA    . ASP A 1 437 ? -19.767 48.774  -8.332  1.00 59.07  ? 437 ASP A CA    1 
ATOM   3624 C  C     . ASP A 1 437 ? -20.542 49.768  -9.175  1.00 59.34  ? 437 ASP A C     1 
ATOM   3625 O  O     . ASP A 1 437 ? -19.941 50.681  -9.745  1.00 63.42  ? 437 ASP A O     1 
ATOM   3626 C  CB    . ASP A 1 437 ? -18.289 48.913  -8.667  1.00 62.90  ? 437 ASP A CB    1 
ATOM   3627 C  CG    . ASP A 1 437 ? -17.415 48.260  -7.650  1.00 65.25  ? 437 ASP A CG    1 
ATOM   3628 O  OD1   . ASP A 1 437 ? -16.493 47.524  -8.061  1.00 66.57  ? 437 ASP A OD1   1 
ATOM   3629 O  OD2   . ASP A 1 437 ? -17.660 48.472  -6.444  1.00 66.52  ? 437 ASP A OD2   1 
ATOM   3630 N  N     . CYS A 1 438 ? -21.862 49.608  -9.247  1.00 55.90  ? 438 CYS A N     1 
ATOM   3631 C  CA    . CYS A 1 438 ? -22.689 50.531  -10.014 1.00 56.49  ? 438 CYS A CA    1 
ATOM   3632 C  C     . CYS A 1 438 ? -23.819 51.119  -9.188  1.00 56.62  ? 438 CYS A C     1 
ATOM   3633 O  O     . CYS A 1 438 ? -24.890 51.434  -9.719  1.00 54.52  ? 438 CYS A O     1 
ATOM   3634 C  CB    . CYS A 1 438 ? -23.258 49.824  -11.224 1.00 51.96  ? 438 CYS A CB    1 
ATOM   3635 S  SG    . CYS A 1 438 ? -24.123 48.351  -10.739 1.00 50.14  ? 438 CYS A SG    1 
ATOM   3636 N  N     . CYS A 1 439 ? -23.578 51.243  -7.884  1.00 59.57  ? 439 CYS A N     1 
ATOM   3637 C  CA    . CYS A 1 439 ? -24.468 51.971  -6.998  1.00 61.56  ? 439 CYS A CA    1 
ATOM   3638 C  C     . CYS A 1 439 ? -23.630 52.860  -6.125  1.00 68.19  ? 439 CYS A C     1 
ATOM   3639 O  O     . CYS A 1 439 ? -22.451 52.587  -5.930  1.00 70.17  ? 439 CYS A O     1 
ATOM   3640 C  CB    . CYS A 1 439 ? -25.301 51.024  -6.145  1.00 58.32  ? 439 CYS A CB    1 
ATOM   3641 S  SG    . CYS A 1 439 ? -26.520 50.098  -7.095  1.00 52.02  ? 439 CYS A SG    1 
ATOM   3642 N  N     . CYS A 1 440 ? -24.252 53.913  -5.594  1.00 72.37  ? 440 CYS A N     1 
ATOM   3643 C  CA    . CYS A 1 440 ? -23.546 54.926  -4.821  1.00 79.60  ? 440 CYS A CA    1 
ATOM   3644 C  C     . CYS A 1 440 ? -24.392 55.666  -3.762  1.00 83.23  ? 440 CYS A C     1 
ATOM   3645 O  O     . CYS A 1 440 ? -25.610 55.505  -3.694  1.00 80.05  ? 440 CYS A O     1 
ATOM   3646 C  CB    . CYS A 1 440 ? -22.938 55.926  -5.789  1.00 83.37  ? 440 CYS A CB    1 
ATOM   3647 S  SG    . CYS A 1 440 ? -21.916 57.162  -5.018  1.00 94.32  ? 440 CYS A SG    1 
ATOM   3648 N  N     . MET A 1 441 ? -23.708 56.487  -2.958  1.00 90.50  ? 441 MET A N     1 
ATOM   3649 C  CA    . MET A 1 441 ? -24.277 57.297  -1.864  1.00 95.63  ? 441 MET A CA    1 
ATOM   3650 C  C     . MET A 1 441 ? -25.013 56.443  -0.852  1.00 93.08  ? 441 MET A C     1 
ATOM   3651 O  O     . MET A 1 441 ? -24.645 56.415  0.313   1.00 97.27  ? 441 MET A O     1 
ATOM   3652 C  CB    . MET A 1 441 ? -25.185 58.442  -2.363  1.00 97.75  ? 441 MET A CB    1 
ATOM   3653 C  CG    . MET A 1 441 ? -24.604 59.345  -3.459  1.00 100.86 ? 441 MET A CG    1 
ATOM   3654 S  SD    . MET A 1 441 ? -22.896 59.861  -3.191  1.00 108.89 ? 441 MET A SD    1 
ATOM   3655 C  CE    . MET A 1 441 ? -22.557 60.768  -4.700  1.00 111.12 ? 441 MET A CE    1 
ATOM   3656 N  N     . MET B 1 1   ? -45.355 -9.694  -57.748 1.00 239.59 ? 1   MET B N     1 
ATOM   3657 C  CA    . MET B 1 1   ? -44.843 -11.001 -57.237 1.00 234.46 ? 1   MET B CA    1 
ATOM   3658 C  C     . MET B 1 1   ? -45.343 -11.277 -55.822 1.00 226.73 ? 1   MET B C     1 
ATOM   3659 O  O     . MET B 1 1   ? -45.170 -10.451 -54.923 1.00 217.26 ? 1   MET B O     1 
ATOM   3660 C  CB    . MET B 1 1   ? -43.309 -11.045 -57.263 1.00 225.82 ? 1   MET B CB    1 
ATOM   3661 C  CG    . MET B 1 1   ? -42.687 -10.906 -58.648 1.00 234.29 ? 1   MET B CG    1 
ATOM   3662 S  SD    . MET B 1 1   ? -41.071 -11.705 -58.773 1.00 228.91 ? 1   MET B SD    1 
ATOM   3663 C  CE    . MET B 1 1   ? -41.531 -13.327 -59.385 1.00 239.82 ? 1   MET B CE    1 
ATOM   3664 N  N     . LYS B 1 2   ? -45.953 -12.446 -55.636 1.00 231.64 ? 2   LYS B N     1 
ATOM   3665 C  CA    . LYS B 1 2   ? -46.497 -12.851 -54.338 1.00 226.68 ? 2   LYS B CA    1 
ATOM   3666 C  C     . LYS B 1 2   ? -45.418 -13.150 -53.291 1.00 213.08 ? 2   LYS B C     1 
ATOM   3667 O  O     . LYS B 1 2   ? -44.248 -12.781 -53.456 1.00 205.67 ? 2   LYS B O     1 
ATOM   3668 C  CB    . LYS B 1 2   ? -47.458 -14.043 -54.494 1.00 237.69 ? 2   LYS B CB    1 
ATOM   3669 C  CG    . LYS B 1 2   ? -48.946 -13.667 -54.538 1.00 247.45 ? 2   LYS B CG    1 
ATOM   3670 C  CD    . LYS B 1 2   ? -49.353 -12.989 -55.843 1.00 256.94 ? 2   LYS B CD    1 
ATOM   3671 C  CE    . LYS B 1 2   ? -49.431 -13.980 -56.992 1.00 268.30 ? 2   LYS B CE    1 
ATOM   3672 N  NZ    . LYS B 1 2   ? -49.746 -13.308 -58.279 1.00 278.65 ? 2   LYS B NZ    1 
ATOM   3673 N  N     . VAL B 1 3   ? -45.837 -13.820 -52.219 1.00 210.82 ? 3   VAL B N     1 
ATOM   3674 C  CA    . VAL B 1 3   ? -45.007 -14.060 -51.033 1.00 198.70 ? 3   VAL B CA    1 
ATOM   3675 C  C     . VAL B 1 3   ? -43.795 -14.963 -51.295 1.00 194.89 ? 3   VAL B C     1 
ATOM   3676 O  O     . VAL B 1 3   ? -42.654 -14.552 -51.080 1.00 185.19 ? 3   VAL B O     1 
ATOM   3677 C  CB    . VAL B 1 3   ? -45.871 -14.600 -49.842 1.00 199.90 ? 3   VAL B CB    1 
ATOM   3678 C  CG1   . VAL B 1 3   ? -46.793 -15.767 -50.284 1.00 212.81 ? 3   VAL B CG1   1 
ATOM   3679 C  CG2   . VAL B 1 3   ? -44.994 -14.989 -48.650 1.00 189.02 ? 3   VAL B CG2   1 
ATOM   3680 N  N     . GLU B 1 4   ? -44.056 -16.178 -51.775 1.00 203.24 ? 4   GLU B N     1 
ATOM   3681 C  CA    . GLU B 1 4   ? -43.022 -17.197 -51.956 1.00 201.25 ? 4   GLU B CA    1 
ATOM   3682 C  C     . GLU B 1 4   ? -42.113 -16.915 -53.151 1.00 202.14 ? 4   GLU B C     1 
ATOM   3683 O  O     . GLU B 1 4   ? -41.005 -17.445 -53.231 1.00 198.45 ? 4   GLU B O     1 
ATOM   3684 C  CB    . GLU B 1 4   ? -43.660 -18.580 -52.086 1.00 211.50 ? 4   GLU B CB    1 
ATOM   3685 C  CG    . GLU B 1 4   ? -44.581 -18.936 -50.928 1.00 212.43 ? 4   GLU B CG    1 
ATOM   3686 C  CD    . GLU B 1 4   ? -44.365 -20.371 -50.427 1.00 215.35 ? 4   GLU B CD    1 
ATOM   3687 O  OE1   . GLU B 1 4   ? -43.814 -20.439 -49.150 1.00 206.01 ? 4   GLU B OE1   1 
ATOM   3688 O  OE2   . GLU B 1 4   ? -44.739 -21.410 -51.203 1.00 226.59 ? 4   GLU B OE2   1 
ATOM   3689 N  N     . GLU B 1 5   ? -42.592 -16.068 -54.060 1.00 207.74 ? 5   GLU B N     1 
ATOM   3690 C  CA    . GLU B 1 5   ? -41.870 -15.698 -55.280 1.00 210.83 ? 5   GLU B CA    1 
ATOM   3691 C  C     . GLU B 1 5   ? -40.689 -14.755 -55.051 1.00 199.76 ? 5   GLU B C     1 
ATOM   3692 O  O     . GLU B 1 5   ? -39.964 -14.415 -55.989 1.00 202.54 ? 5   GLU B O     1 
ATOM   3693 C  CB    . GLU B 1 5   ? -42.831 -15.088 -56.296 1.00 222.01 ? 5   GLU B CB    1 
ATOM   3694 C  CG    . GLU B 1 5   ? -43.653 -16.106 -57.041 1.00 235.65 ? 5   GLU B CG    1 
ATOM   3695 C  CD    . GLU B 1 5   ? -44.191 -15.552 -58.332 1.00 247.80 ? 5   GLU B CD    1 
ATOM   3696 O  OE1   . GLU B 1 5   ? -45.111 -14.708 -58.282 1.00 250.77 ? 5   GLU B OE1   1 
ATOM   3697 O  OE2   . GLU B 1 5   ? -43.687 -15.957 -59.398 1.00 255.35 ? 5   GLU B OE2   1 
ATOM   3698 N  N     . ILE B 1 6   ? -40.505 -14.330 -53.807 1.00 188.01 ? 6   ILE B N     1 
ATOM   3699 C  CA    . ILE B 1 6   ? -39.381 -13.476 -53.454 1.00 177.34 ? 6   ILE B CA    1 
ATOM   3700 C  C     . ILE B 1 6   ? -38.232 -14.314 -52.877 1.00 169.90 ? 6   ILE B C     1 
ATOM   3701 O  O     . ILE B 1 6   ? -37.060 -13.951 -53.011 1.00 165.01 ? 6   ILE B O     1 
ATOM   3702 C  CB    . ILE B 1 6   ? -39.816 -12.334 -52.485 1.00 170.12 ? 6   ILE B CB    1 
ATOM   3703 C  CG1   . ILE B 1 6   ? -41.059 -11.593 -53.019 1.00 178.53 ? 6   ILE B CG1   1 
ATOM   3704 C  CG2   . ILE B 1 6   ? -38.660 -11.364 -52.204 1.00 160.74 ? 6   ILE B CG2   1 
ATOM   3705 C  CD1   . ILE B 1 6   ? -40.900 -10.949 -54.406 1.00 186.65 ? 6   ILE B CD1   1 
ATOM   3706 N  N     . LEU B 1 7   ? -38.570 -15.442 -52.253 1.00 169.86 ? 7   LEU B N     1 
ATOM   3707 C  CA    . LEU B 1 7   ? -37.564 -16.372 -51.733 1.00 164.38 ? 7   LEU B CA    1 
ATOM   3708 C  C     . LEU B 1 7   ? -36.882 -17.101 -52.888 1.00 171.37 ? 7   LEU B C     1 
ATOM   3709 O  O     . LEU B 1 7   ? -35.724 -17.510 -52.775 1.00 167.52 ? 7   LEU B O     1 
ATOM   3710 C  CB    . LEU B 1 7   ? -38.186 -17.382 -50.755 1.00 164.62 ? 7   LEU B CB    1 
ATOM   3711 C  CG    . LEU B 1 7   ? -39.225 -16.943 -49.707 1.00 161.75 ? 7   LEU B CG    1 
ATOM   3712 C  CD1   . LEU B 1 7   ? -39.575 -18.097 -48.768 1.00 162.61 ? 7   LEU B CD1   1 
ATOM   3713 C  CD2   . LEU B 1 7   ? -38.767 -15.731 -48.900 1.00 151.04 ? 7   LEU B CD2   1 
ATOM   3714 N  N     . GLU B 1 8   ? -37.617 -17.238 -53.993 1.00 182.21 ? 8   GLU B N     1 
ATOM   3715 C  CA    . GLU B 1 8   ? -37.150 -17.890 -55.222 1.00 191.37 ? 8   GLU B CA    1 
ATOM   3716 C  C     . GLU B 1 8   ? -35.950 -17.158 -55.819 1.00 188.74 ? 8   GLU B C     1 
ATOM   3717 O  O     . GLU B 1 8   ? -34.903 -17.763 -56.057 1.00 189.24 ? 8   GLU B O     1 
ATOM   3718 C  CB    . GLU B 1 8   ? -38.269 -17.929 -56.272 1.00 204.31 ? 8   GLU B CB    1 
ATOM   3719 C  CG    . GLU B 1 8   ? -39.678 -18.095 -55.722 1.00 206.71 ? 8   GLU B CG    1 
ATOM   3720 C  CD    . GLU B 1 8   ? -40.262 -19.481 -55.929 1.00 216.53 ? 8   GLU B CD    1 
ATOM   3721 O  OE1   . GLU B 1 8   ? -39.728 -20.229 -56.789 1.00 223.93 ? 8   GLU B OE1   1 
ATOM   3722 O  OE2   . GLU B 1 8   ? -41.272 -19.821 -55.237 1.00 217.74 ? 8   GLU B OE2   1 
ATOM   3723 N  N     . LYS B 1 9   ? -36.121 -15.859 -56.069 1.00 186.74 ? 9   LYS B N     1 
ATOM   3724 C  CA    . LYS B 1 9   ? -35.065 -15.007 -56.615 1.00 184.86 ? 9   LYS B CA    1 
ATOM   3725 C  C     . LYS B 1 9   ? -33.848 -14.972 -55.689 1.00 173.20 ? 9   LYS B C     1 
ATOM   3726 O  O     . LYS B 1 9   ? -32.710 -15.160 -56.134 1.00 174.39 ? 9   LYS B O     1 
ATOM   3727 C  CB    . LYS B 1 9   ? -35.588 -13.583 -56.841 1.00 184.92 ? 9   LYS B CB    1 
ATOM   3728 C  CG    . LYS B 1 9   ? -36.434 -13.383 -58.097 1.00 198.08 ? 9   LYS B CG    1 
ATOM   3729 C  CD    . LYS B 1 9   ? -36.970 -11.950 -58.165 1.00 197.34 ? 9   LYS B CD    1 
ATOM   3730 C  CE    . LYS B 1 9   ? -37.486 -11.598 -59.553 1.00 210.62 ? 9   LYS B CE    1 
ATOM   3731 N  NZ    . LYS B 1 9   ? -36.387 -11.307 -60.518 1.00 215.37 ? 9   LYS B NZ    1 
ATOM   3732 N  N     . ALA B 1 10  ? -34.112 -14.757 -54.400 1.00 162.68 ? 10  ALA B N     1 
ATOM   3733 C  CA    . ALA B 1 10  ? -33.076 -14.630 -53.371 1.00 151.33 ? 10  ALA B CA    1 
ATOM   3734 C  C     . ALA B 1 10  ? -32.133 -15.833 -53.297 1.00 151.51 ? 10  ALA B C     1 
ATOM   3735 O  O     . ALA B 1 10  ? -30.989 -15.715 -52.843 1.00 145.18 ? 10  ALA B O     1 
ATOM   3736 C  CB    . ALA B 1 10  ? -33.719 -14.376 -52.008 1.00 142.71 ? 10  ALA B CB    1 
ATOM   3737 N  N     . LEU B 1 11  ? -32.620 -16.979 -53.761 1.00 159.29 ? 11  LEU B N     1 
ATOM   3738 C  CA    . LEU B 1 11  ? -31.877 -18.225 -53.694 1.00 160.93 ? 11  LEU B CA    1 
ATOM   3739 C  C     . LEU B 1 11  ? -30.565 -18.184 -54.475 1.00 163.68 ? 11  LEU B C     1 
ATOM   3740 O  O     . LEU B 1 11  ? -29.594 -18.837 -54.096 1.00 161.24 ? 11  LEU B O     1 
ATOM   3741 C  CB    . LEU B 1 11  ? -32.758 -19.377 -54.172 1.00 171.24 ? 11  LEU B CB    1 
ATOM   3742 C  CG    . LEU B 1 11  ? -32.451 -20.799 -53.697 1.00 173.07 ? 11  LEU B CG    1 
ATOM   3743 C  CD1   . LEU B 1 11  ? -31.553 -21.549 -54.693 1.00 182.01 ? 11  LEU B CD1   1 
ATOM   3744 C  CD2   . LEU B 1 11  ? -31.881 -20.822 -52.268 1.00 161.47 ? 11  LEU B CD2   1 
ATOM   3745 N  N     . GLU B 1 12  ? -30.538 -17.410 -55.555 1.00 169.40 ? 12  GLU B N     1 
ATOM   3746 C  CA    . GLU B 1 12  ? -29.330 -17.270 -56.365 1.00 173.75 ? 12  GLU B CA    1 
ATOM   3747 C  C     . GLU B 1 12  ? -28.236 -16.490 -55.654 1.00 163.69 ? 12  GLU B C     1 
ATOM   3748 O  O     . GLU B 1 12  ? -27.054 -16.672 -55.945 1.00 165.73 ? 12  GLU B O     1 
ATOM   3749 C  CB    . GLU B 1 12  ? -29.652 -16.625 -57.715 1.00 184.33 ? 12  GLU B CB    1 
ATOM   3750 C  CG    . GLU B 1 12  ? -29.945 -17.628 -58.827 1.00 198.51 ? 12  GLU B CG    1 
ATOM   3751 C  CD    . GLU B 1 12  ? -31.089 -18.575 -58.491 1.00 200.81 ? 12  GLU B CD    1 
ATOM   3752 O  OE1   . GLU B 1 12  ? -32.140 -18.098 -58.008 1.00 197.41 ? 12  GLU B OE1   1 
ATOM   3753 O  OE2   . GLU B 1 12  ? -30.936 -19.797 -58.708 1.00 206.73 ? 12  GLU B OE2   1 
ATOM   3754 N  N     . LEU B 1 13  ? -28.636 -15.627 -54.722 1.00 153.62 ? 13  LEU B N     1 
ATOM   3755 C  CA    . LEU B 1 13  ? -27.692 -14.810 -53.955 1.00 143.97 ? 13  LEU B CA    1 
ATOM   3756 C  C     . LEU B 1 13  ? -27.245 -15.483 -52.651 1.00 135.18 ? 13  LEU B C     1 
ATOM   3757 O  O     . LEU B 1 13  ? -26.217 -15.110 -52.077 1.00 128.90 ? 13  LEU B O     1 
ATOM   3758 C  CB    . LEU B 1 13  ? -28.273 -13.415 -53.663 1.00 138.72 ? 13  LEU B CB    1 
ATOM   3759 C  CG    . LEU B 1 13  ? -28.673 -12.415 -54.766 1.00 145.51 ? 13  LEU B CG    1 
ATOM   3760 C  CD1   . LEU B 1 13  ? -27.750 -12.460 -55.985 1.00 154.64 ? 13  LEU B CD1   1 
ATOM   3761 C  CD2   . LEU B 1 13  ? -30.123 -12.591 -55.188 1.00 150.81 ? 13  LEU B CD2   1 
ATOM   3762 N  N     . VAL B 1 14  ? -28.010 -16.479 -52.199 1.00 135.62 ? 14  VAL B N     1 
ATOM   3763 C  CA    . VAL B 1 14  ? -27.735 -17.154 -50.921 1.00 128.47 ? 14  VAL B CA    1 
ATOM   3764 C  C     . VAL B 1 14  ? -27.193 -18.585 -51.038 1.00 133.85 ? 14  VAL B C     1 
ATOM   3765 O  O     . VAL B 1 14  ? -26.410 -19.015 -50.190 1.00 128.96 ? 14  VAL B O     1 
ATOM   3766 C  CB    . VAL B 1 14  ? -28.947 -17.092 -49.937 1.00 123.44 ? 14  VAL B CB    1 
ATOM   3767 C  CG1   . VAL B 1 14  ? -29.328 -15.643 -49.647 1.00 117.66 ? 14  VAL B CG1   1 
ATOM   3768 C  CG2   . VAL B 1 14  ? -30.145 -17.858 -50.467 1.00 131.69 ? 14  VAL B CG2   1 
ATOM   3769 N  N     . ILE B 1 15  ? -27.609 -19.314 -52.075 1.00 144.56 ? 15  ILE B N     1 
ATOM   3770 C  CA    . ILE B 1 15  ? -27.113 -20.673 -52.318 1.00 151.54 ? 15  ILE B CA    1 
ATOM   3771 C  C     . ILE B 1 15  ? -25.836 -20.670 -53.158 1.00 156.94 ? 15  ILE B C     1 
ATOM   3772 O  O     . ILE B 1 15  ? -25.767 -19.993 -54.182 1.00 162.05 ? 15  ILE B O     1 
ATOM   3773 C  CB    . ILE B 1 15  ? -28.196 -21.600 -52.939 1.00 161.49 ? 15  ILE B CB    1 
ATOM   3774 C  CG1   . ILE B 1 15  ? -28.706 -22.585 -51.883 1.00 159.42 ? 15  ILE B CG1   1 
ATOM   3775 C  CG2   . ILE B 1 15  ? -27.663 -22.369 -54.164 1.00 173.71 ? 15  ILE B CG2   1 
ATOM   3776 C  CD1   . ILE B 1 15  ? -29.440 -23.793 -52.457 1.00 170.44 ? 15  ILE B CD1   1 
ATOM   3777 N  N     . PRO B 1 16  ? -24.816 -21.422 -52.708 1.00 135.35 ? 16  PRO B N     1 
ATOM   3778 C  CA    . PRO B 1 16  ? -23.510 -21.507 -53.367 1.00 138.04 ? 16  PRO B CA    1 
ATOM   3779 C  C     . PRO B 1 16  ? -23.550 -22.297 -54.673 1.00 149.94 ? 16  PRO B C     1 
ATOM   3780 O  O     . PRO B 1 16  ? -24.079 -23.415 -54.711 1.00 154.73 ? 16  PRO B O     1 
ATOM   3781 C  CB    . PRO B 1 16  ? -22.633 -22.223 -52.326 1.00 131.99 ? 16  PRO B CB    1 
ATOM   3782 C  CG    . PRO B 1 16  ? -23.433 -22.210 -51.043 1.00 125.13 ? 16  PRO B CG    1 
ATOM   3783 C  CD    . PRO B 1 16  ? -24.852 -22.242 -51.487 1.00 130.36 ? 16  PRO B CD    1 
ATOM   3784 N  N     . ASP B 1 17  ? -22.977 -21.713 -55.725 1.00 155.61 ? 17  ASP B N     1 
ATOM   3785 C  CA    . ASP B 1 17  ? -23.013 -22.293 -57.075 1.00 168.35 ? 17  ASP B CA    1 
ATOM   3786 C  C     . ASP B 1 17  ? -22.167 -23.570 -57.222 1.00 172.98 ? 17  ASP B C     1 
ATOM   3787 O  O     . ASP B 1 17  ? -21.528 -24.021 -56.263 1.00 166.14 ? 17  ASP B O     1 
ATOM   3788 C  CB    . ASP B 1 17  ? -22.613 -21.242 -58.127 1.00 173.68 ? 17  ASP B CB    1 
ATOM   3789 C  CG    . ASP B 1 17  ? -21.296 -20.550 -57.801 1.00 168.11 ? 17  ASP B CG    1 
ATOM   3790 O  OD1   . ASP B 1 17  ? -21.222 -19.844 -56.770 1.00 157.62 ? 17  ASP B OD1   1 
ATOM   3791 O  OD2   . ASP B 1 17  ? -20.337 -20.704 -58.588 1.00 174.95 ? 17  ASP B OD2   1 
ATOM   3792 N  N     . GLU B 1 18  ? -22.189 -24.142 -58.427 1.00 185.43 ? 18  GLU B N     1 
ATOM   3793 C  CA    . GLU B 1 18  ? -21.433 -25.352 -58.768 1.00 192.41 ? 18  GLU B CA    1 
ATOM   3794 C  C     . GLU B 1 18  ? -19.966 -25.237 -58.357 1.00 187.67 ? 18  GLU B C     1 
ATOM   3795 O  O     . GLU B 1 18  ? -19.452 -26.071 -57.604 1.00 184.02 ? 18  GLU B O     1 
ATOM   3796 C  CB    . GLU B 1 18  ? -21.514 -25.614 -60.277 1.00 207.42 ? 18  GLU B CB    1 
ATOM   3797 C  CG    . GLU B 1 18  ? -22.921 -25.703 -60.845 1.00 214.26 ? 18  GLU B CG    1 
ATOM   3798 C  CD    . GLU B 1 18  ? -23.567 -27.051 -60.602 1.00 218.45 ? 18  GLU B CD    1 
ATOM   3799 O  OE1   . GLU B 1 18  ? -22.958 -28.085 -60.961 1.00 225.93 ? 18  GLU B OE1   1 
ATOM   3800 O  OE2   . GLU B 1 18  ? -24.692 -27.078 -60.060 1.00 215.10 ? 18  GLU B OE2   1 
ATOM   3801 N  N     . GLU B 1 19  ? -19.316 -24.185 -58.854 1.00 188.43 ? 19  GLU B N     1 
ATOM   3802 C  CA    . GLU B 1 19  ? -17.895 -23.924 -58.642 1.00 185.86 ? 19  GLU B CA    1 
ATOM   3803 C  C     . GLU B 1 19  ? -17.531 -23.882 -57.161 1.00 172.59 ? 19  GLU B C     1 
ATOM   3804 O  O     . GLU B 1 19  ? -16.633 -24.603 -56.720 1.00 171.35 ? 19  GLU B O     1 
ATOM   3805 C  CB    . GLU B 1 19  ? -17.517 -22.590 -59.296 1.00 188.00 ? 19  GLU B CB    1 
ATOM   3806 C  CG    . GLU B 1 19  ? -16.084 -22.508 -59.800 1.00 193.62 ? 19  GLU B CG    1 
ATOM   3807 C  CD    . GLU B 1 19  ? -15.914 -23.112 -61.186 1.00 209.65 ? 19  GLU B CD    1 
ATOM   3808 O  OE1   . GLU B 1 19  ? -14.767 -23.436 -61.557 1.00 215.99 ? 19  GLU B OE1   1 
ATOM   3809 O  OE2   . GLU B 1 19  ? -16.924 -23.263 -61.907 1.00 216.59 ? 19  GLU B OE2   1 
ATOM   3810 N  N     . GLU B 1 20  ? -18.253 -23.046 -56.412 1.00 163.60 ? 20  GLU B N     1 
ATOM   3811 C  CA    . GLU B 1 20  ? -17.938 -22.726 -55.019 1.00 151.50 ? 20  GLU B CA    1 
ATOM   3812 C  C     . GLU B 1 20  ? -17.873 -23.939 -54.096 1.00 148.24 ? 20  GLU B C     1 
ATOM   3813 O  O     . GLU B 1 20  ? -16.953 -24.050 -53.283 1.00 142.54 ? 20  GLU B O     1 
ATOM   3814 C  CB    . GLU B 1 20  ? -18.928 -21.694 -54.466 1.00 144.38 ? 20  GLU B CB    1 
ATOM   3815 C  CG    . GLU B 1 20  ? -18.463 -21.025 -53.169 1.00 133.07 ? 20  GLU B CG    1 
ATOM   3816 C  CD    . GLU B 1 20  ? -19.436 -19.978 -52.641 1.00 127.23 ? 20  GLU B CD    1 
ATOM   3817 O  OE1   . GLU B 1 20  ? -20.084 -19.282 -53.458 1.00 131.89 ? 20  GLU B OE1   1 
ATOM   3818 O  OE2   . GLU B 1 20  ? -19.543 -19.845 -51.401 1.00 118.64 ? 20  GLU B OE2   1 
ATOM   3819 N  N     . VAL B 1 21  ? -18.847 -24.840 -54.228 1.00 152.72 ? 21  VAL B N     1 
ATOM   3820 C  CA    . VAL B 1 21  ? -18.903 -26.064 -53.416 1.00 151.36 ? 21  VAL B CA    1 
ATOM   3821 C  C     . VAL B 1 21  ? -17.800 -27.046 -53.820 1.00 157.81 ? 21  VAL B C     1 
ATOM   3822 O  O     . VAL B 1 21  ? -17.210 -27.714 -52.965 1.00 154.10 ? 21  VAL B O     1 
ATOM   3823 C  CB    . VAL B 1 21  ? -20.297 -26.763 -53.493 1.00 155.74 ? 21  VAL B CB    1 
ATOM   3824 C  CG1   . VAL B 1 21  ? -20.366 -27.953 -52.533 1.00 154.03 ? 21  VAL B CG1   1 
ATOM   3825 C  CG2   . VAL B 1 21  ? -21.428 -25.775 -53.192 1.00 150.99 ? 21  VAL B CG2   1 
ATOM   3826 N  N     . ARG B 1 22  ? -17.526 -27.115 -55.123 1.00 168.22 ? 22  ARG B N     1 
ATOM   3827 C  CA    . ARG B 1 22  ? -16.509 -28.020 -55.660 1.00 176.48 ? 22  ARG B CA    1 
ATOM   3828 C  C     . ARG B 1 22  ? -15.086 -27.637 -55.243 1.00 172.16 ? 22  ARG B C     1 
ATOM   3829 O  O     . ARG B 1 22  ? -14.229 -28.509 -55.089 1.00 175.20 ? 22  ARG B O     1 
ATOM   3830 C  CB    . ARG B 1 22  ? -16.636 -28.148 -57.182 1.00 189.99 ? 22  ARG B CB    1 
ATOM   3831 C  CG    . ARG B 1 22  ? -17.795 -29.044 -57.606 1.00 197.44 ? 22  ARG B CG    1 
ATOM   3832 C  CD    . ARG B 1 22  ? -17.751 -29.417 -59.083 1.00 212.58 ? 22  ARG B CD    1 
ATOM   3833 N  NE    . ARG B 1 22  ? -18.504 -28.484 -59.921 1.00 215.12 ? 22  ARG B NE    1 
ATOM   3834 C  CZ    . ARG B 1 22  ? -17.954 -27.542 -60.682 1.00 218.05 ? 22  ARG B CZ    1 
ATOM   3835 N  NH1   . ARG B 1 22  ? -16.634 -27.396 -60.721 1.00 218.27 ? 22  ARG B NH1   1 
ATOM   3836 N  NH2   . ARG B 1 22  ? -18.727 -26.745 -61.408 1.00 221.32 ? 22  ARG B NH2   1 
ATOM   3837 N  N     . LYS B 1 23  ? -14.847 -26.339 -55.044 1.00 165.66 ? 23  LYS B N     1 
ATOM   3838 C  CA    . LYS B 1 23  ? -13.563 -25.851 -54.529 1.00 160.71 ? 23  LYS B CA    1 
ATOM   3839 C  C     . LYS B 1 23  ? -13.448 -26.138 -53.034 1.00 150.05 ? 23  LYS B C     1 
ATOM   3840 O  O     . LYS B 1 23  ? -12.360 -26.091 -52.459 1.00 146.46 ? 23  LYS B O     1 
ATOM   3841 C  CB    . LYS B 1 23  ? -13.404 -24.350 -54.794 1.00 157.91 ? 23  LYS B CB    1 
ATOM   3842 C  CG    . LYS B 1 23  ? -11.955 -23.881 -54.806 1.00 158.53 ? 23  LYS B CG    1 
ATOM   3843 C  CD    . LYS B 1 23  ? -11.842 -22.387 -55.051 1.00 156.49 ? 23  LYS B CD    1 
ATOM   3844 C  CE    . LYS B 1 23  ? -10.399 -21.990 -55.331 1.00 160.68 ? 23  LYS B CE    1 
ATOM   3845 N  NZ    . LYS B 1 23  ? -10.239 -20.521 -55.504 1.00 159.00 ? 23  LYS B NZ    1 
ATOM   3846 N  N     . GLY B 1 24  ? -14.588 -26.433 -52.419 1.00 145.84 ? 24  GLY B N     1 
ATOM   3847 C  CA    . GLY B 1 24  ? -14.649 -26.754 -51.005 1.00 137.24 ? 24  GLY B CA    1 
ATOM   3848 C  C     . GLY B 1 24  ? -14.281 -28.194 -50.740 1.00 141.45 ? 24  GLY B C     1 
ATOM   3849 O  O     . GLY B 1 24  ? -13.322 -28.467 -50.021 1.00 138.25 ? 24  GLY B O     1 
ATOM   3850 N  N     . ARG B 1 25  ? -15.036 -29.117 -51.329 1.00 149.39 ? 25  ARG B N     1 
ATOM   3851 C  CA    . ARG B 1 25  ? -14.834 -30.545 -51.078 1.00 154.70 ? 25  ARG B CA    1 
ATOM   3852 C  C     . ARG B 1 25  ? -13.391 -31.003 -51.299 1.00 158.91 ? 25  ARG B C     1 
ATOM   3853 O  O     . ARG B 1 25  ? -12.901 -31.852 -50.557 1.00 158.44 ? 25  ARG B O     1 
ATOM   3854 C  CB    . ARG B 1 25  ? -15.808 -31.408 -51.894 1.00 164.64 ? 25  ARG B CB    1 
ATOM   3855 C  CG    . ARG B 1 25  ? -17.265 -31.369 -51.418 1.00 162.15 ? 25  ARG B CG    1 
ATOM   3856 C  CD    . ARG B 1 25  ? -17.446 -31.924 -50.000 1.00 156.69 ? 25  ARG B CD    1 
ATOM   3857 N  NE    . ARG B 1 25  ? -18.858 -32.120 -49.659 1.00 157.36 ? 25  ARG B NE    1 
ATOM   3858 C  CZ    . ARG B 1 25  ? -19.670 -31.178 -49.178 1.00 150.47 ? 25  ARG B CZ    1 
ATOM   3859 N  NH1   . ARG B 1 25  ? -19.231 -29.944 -48.970 1.00 142.50 ? 25  ARG B NH1   1 
ATOM   3860 N  NH2   . ARG B 1 25  ? -20.934 -31.474 -48.906 1.00 152.27 ? 25  ARG B NH2   1 
ATOM   3861 N  N     . GLU B 1 26  ? -12.718 -30.435 -52.303 1.00 163.78 ? 26  GLU B N     1 
ATOM   3862 C  CA    . GLU B 1 26  ? -11.309 -30.764 -52.578 1.00 168.59 ? 26  GLU B CA    1 
ATOM   3863 C  C     . GLU B 1 26  ? -10.352 -30.080 -51.594 1.00 159.18 ? 26  GLU B C     1 
ATOM   3864 O  O     . GLU B 1 26  ? -9.323  -30.651 -51.222 1.00 160.44 ? 26  GLU B O     1 
ATOM   3865 C  CB    . GLU B 1 26  ? -10.924 -30.480 -54.045 1.00 179.40 ? 26  GLU B CB    1 
ATOM   3866 C  CG    . GLU B 1 26  ? -11.013 -29.014 -54.495 1.00 176.29 ? 26  GLU B CG    1 
ATOM   3867 C  CD    . GLU B 1 26  ? -10.714 -28.819 -55.978 1.00 188.52 ? 26  GLU B CD    1 
ATOM   3868 O  OE1   . GLU B 1 26  ? -11.220 -29.605 -56.808 1.00 198.09 ? 26  GLU B OE1   1 
ATOM   3869 O  OE2   . GLU B 1 26  ? -9.979  -27.867 -56.314 1.00 188.43 ? 26  GLU B OE2   1 
ATOM   3870 N  N     . ALA B 1 27  ? -10.710 -28.866 -51.172 1.00 150.25 ? 27  ALA B N     1 
ATOM   3871 C  CA    . ALA B 1 27  ? -9.967  -28.135 -50.143 1.00 140.96 ? 27  ALA B CA    1 
ATOM   3872 C  C     . ALA B 1 27  ? -10.219 -28.741 -48.762 1.00 134.07 ? 27  ALA B C     1 
ATOM   3873 O  O     . ALA B 1 27  ? -9.517  -28.428 -47.797 1.00 127.74 ? 27  ALA B O     1 
ATOM   3874 C  CB    . ALA B 1 27  ? -10.339 -26.667 -50.161 1.00 134.79 ? 27  ALA B CB    1 
ATOM   3875 N  N     . GLU B 1 28  ? -11.229 -29.606 -48.687 1.00 136.25 ? 28  GLU B N     1 
ATOM   3876 C  CA    . GLU B 1 28  ? -11.542 -30.371 -47.486 1.00 132.24 ? 28  GLU B CA    1 
ATOM   3877 C  C     . GLU B 1 28  ? -10.745 -31.687 -47.456 1.00 138.92 ? 28  GLU B C     1 
ATOM   3878 O  O     . GLU B 1 28  ? -10.199 -32.064 -46.412 1.00 135.46 ? 28  GLU B O     1 
ATOM   3879 C  CB    . GLU B 1 28  ? -13.047 -30.649 -47.423 1.00 132.50 ? 28  GLU B CB    1 
ATOM   3880 C  CG    . GLU B 1 28  ? -13.526 -31.296 -46.132 1.00 128.74 ? 28  GLU B CG    1 
ATOM   3881 C  CD    . GLU B 1 28  ? -14.723 -32.211 -46.340 1.00 134.61 ? 28  GLU B CD    1 
ATOM   3882 O  OE1   . GLU B 1 28  ? -15.655 -31.844 -47.095 1.00 136.84 ? 28  GLU B OE1   1 
ATOM   3883 O  OE2   . GLU B 1 28  ? -14.728 -33.305 -45.740 1.00 137.26 ? 28  GLU B OE2   1 
ATOM   3884 N  N     . GLU B 1 29  ? -10.686 -32.374 -48.600 1.00 149.06 ? 29  GLU B N     1 
ATOM   3885 C  CA    . GLU B 1 29  ? -9.921  -33.621 -48.739 1.00 157.04 ? 29  GLU B CA    1 
ATOM   3886 C  C     . GLU B 1 29  ? -8.441  -33.365 -48.495 1.00 155.76 ? 29  GLU B C     1 
ATOM   3887 O  O     . GLU B 1 29  ? -7.751  -34.189 -47.891 1.00 157.52 ? 29  GLU B O     1 
ATOM   3888 C  CB    . GLU B 1 29  ? -10.090 -34.227 -50.135 1.00 169.37 ? 29  GLU B CB    1 
ATOM   3889 C  CG    . GLU B 1 29  ? -11.487 -34.706 -50.476 1.00 173.02 ? 29  GLU B CG    1 
ATOM   3890 C  CD    . GLU B 1 29  ? -11.667 -34.918 -51.969 1.00 184.72 ? 29  GLU B CD    1 
ATOM   3891 O  OE1   . GLU B 1 29  ? -11.061 -35.867 -52.512 1.00 194.87 ? 29  GLU B OE1   1 
ATOM   3892 O  OE2   . GLU B 1 29  ? -12.415 -34.137 -52.600 1.00 184.24 ? 29  GLU B OE2   1 
ATOM   3893 N  N     . GLU B 1 30  ? -7.970  -32.218 -48.982 1.00 153.33 ? 30  GLU B N     1 
ATOM   3894 C  CA    . GLU B 1 30  ? -6.590  -31.778 -48.804 1.00 151.99 ? 30  GLU B CA    1 
ATOM   3895 C  C     . GLU B 1 30  ? -6.276  -31.575 -47.321 1.00 141.95 ? 30  GLU B C     1 
ATOM   3896 O  O     . GLU B 1 30  ? -5.176  -31.894 -46.858 1.00 142.80 ? 30  GLU B O     1 
ATOM   3897 C  CB    . GLU B 1 30  ? -6.359  -30.485 -49.598 1.00 151.79 ? 30  GLU B CB    1 
ATOM   3898 C  CG    . GLU B 1 30  ? -4.938  -29.936 -49.574 1.00 151.79 ? 30  GLU B CG    1 
ATOM   3899 C  CD    . GLU B 1 30  ? -3.893  -30.969 -49.920 1.00 160.53 ? 30  GLU B CD    1 
ATOM   3900 O  OE1   . GLU B 1 30  ? -4.001  -31.606 -50.986 1.00 171.08 ? 30  GLU B OE1   1 
ATOM   3901 O  OE2   . GLU B 1 30  ? -2.958  -31.141 -49.119 1.00 157.88 ? 30  GLU B OE2   1 
ATOM   3902 N  N     . LEU B 1 31  ? -7.265  -31.061 -46.591 1.00 133.09 ? 31  LEU B N     1 
ATOM   3903 C  CA    . LEU B 1 31  ? -7.144  -30.792 -45.162 1.00 123.99 ? 31  LEU B CA    1 
ATOM   3904 C  C     . LEU B 1 31  ? -7.125  -32.034 -44.281 1.00 125.28 ? 31  LEU B C     1 
ATOM   3905 O  O     . LEU B 1 31  ? -6.320  -32.122 -43.349 1.00 122.44 ? 31  LEU B O     1 
ATOM   3906 C  CB    . LEU B 1 31  ? -8.254  -29.846 -44.704 1.00 115.85 ? 31  LEU B CB    1 
ATOM   3907 C  CG    . LEU B 1 31  ? -7.839  -28.432 -44.292 1.00 108.47 ? 31  LEU B CG    1 
ATOM   3908 C  CD1   . LEU B 1 31  ? -6.883  -27.806 -45.293 1.00 112.93 ? 31  LEU B CD1   1 
ATOM   3909 C  CD2   . LEU B 1 31  ? -9.066  -27.563 -44.107 1.00 102.68 ? 31  LEU B CD2   1 
ATOM   3910 N  N     . ARG B 1 32  ? -8.014  -32.986 -44.564 1.00 130.10 ? 32  ARG B N     1 
ATOM   3911 C  CA    . ARG B 1 32  ? -8.019  -34.256 -43.838 1.00 133.12 ? 32  ARG B CA    1 
ATOM   3912 C  C     . ARG B 1 32  ? -6.670  -34.956 -44.008 1.00 139.25 ? 32  ARG B C     1 
ATOM   3913 O  O     . ARG B 1 32  ? -6.167  -35.555 -43.065 1.00 138.87 ? 32  ARG B O     1 
ATOM   3914 C  CB    . ARG B 1 32  ? -9.175  -35.171 -44.280 1.00 139.28 ? 32  ARG B CB    1 
ATOM   3915 C  CG    . ARG B 1 32  ? -10.579 -34.588 -44.069 1.00 134.19 ? 32  ARG B CG    1 
ATOM   3916 C  CD    . ARG B 1 32  ? -11.669 -35.673 -44.021 1.00 140.09 ? 32  ARG B CD    1 
ATOM   3917 N  NE    . ARG B 1 32  ? -12.360 -35.735 -42.726 1.00 134.95 ? 32  ARG B NE    1 
ATOM   3918 C  CZ    . ARG B 1 32  ? -13.460 -35.041 -42.417 1.00 129.40 ? 32  ARG B CZ    1 
ATOM   3919 N  NH1   . ARG B 1 32  ? -14.008 -34.216 -43.300 1.00 127.59 ? 32  ARG B NH1   1 
ATOM   3920 N  NH2   . ARG B 1 32  ? -14.011 -35.162 -41.215 1.00 125.89 ? 32  ARG B NH2   1 
ATOM   3921 N  N     . ARG B 1 33  ? -6.081  -34.835 -45.200 1.00 145.31 ? 33  ARG B N     1 
ATOM   3922 C  CA    . ARG B 1 33  ? -4.815  -35.496 -45.543 1.00 153.03 ? 33  ARG B CA    1 
ATOM   3923 C  C     . ARG B 1 33  ? -3.597  -35.000 -44.762 1.00 148.31 ? 33  ARG B C     1 
ATOM   3924 O  O     . ARG B 1 33  ? -2.750  -35.802 -44.370 1.00 152.71 ? 33  ARG B O     1 
ATOM   3925 C  CB    . ARG B 1 33  ? -4.555  -35.418 -47.050 1.00 162.00 ? 33  ARG B CB    1 
ATOM   3926 C  CG    . ARG B 1 33  ? -5.395  -36.406 -47.839 1.00 171.24 ? 33  ARG B CG    1 
ATOM   3927 C  CD    . ARG B 1 33  ? -5.442  -36.071 -49.317 1.00 179.24 ? 33  ARG B CD    1 
ATOM   3928 N  NE    . ARG B 1 33  ? -6.766  -36.342 -49.874 1.00 182.00 ? 33  ARG B NE    1 
ATOM   3929 C  CZ    . ARG B 1 33  ? -7.032  -36.491 -51.169 1.00 191.79 ? 33  ARG B CZ    1 
ATOM   3930 N  NH1   . ARG B 1 33  ? -6.063  -36.410 -52.073 1.00 200.21 ? 33  ARG B NH1   1 
ATOM   3931 N  NH2   . ARG B 1 33  ? -8.275  -36.732 -51.562 1.00 194.01 ? 33  ARG B NH2   1 
ATOM   3932 N  N     . ARG B 1 34  ? -3.515  -33.689 -44.536 1.00 139.98 ? 34  ARG B N     1 
ATOM   3933 C  CA    . ARG B 1 34  ? -2.435  -33.099 -43.731 1.00 135.01 ? 34  ARG B CA    1 
ATOM   3934 C  C     . ARG B 1 34  ? -2.620  -33.412 -42.239 1.00 128.77 ? 34  ARG B C     1 
ATOM   3935 O  O     . ARG B 1 34  ? -1.679  -33.840 -41.561 1.00 130.05 ? 34  ARG B O     1 
ATOM   3936 C  CB    . ARG B 1 34  ? -2.363  -31.584 -43.950 1.00 128.91 ? 34  ARG B CB    1 
ATOM   3937 C  CG    . ARG B 1 34  ? -2.259  -31.153 -45.409 1.00 134.85 ? 34  ARG B CG    1 
ATOM   3938 C  CD    . ARG B 1 34  ? -2.815  -29.751 -45.587 1.00 127.89 ? 34  ARG B CD    1 
ATOM   3939 N  NE    . ARG B 1 34  ? -2.855  -29.305 -46.980 1.00 133.81 ? 34  ARG B NE    1 
ATOM   3940 C  CZ    . ARG B 1 34  ? -1.956  -28.502 -47.549 1.00 136.68 ? 34  ARG B CZ    1 
ATOM   3941 N  NH1   . ARG B 1 34  ? -0.917  -28.048 -46.861 1.00 133.63 ? 34  ARG B NH1   1 
ATOM   3942 N  NH2   . ARG B 1 34  ? -2.094  -28.154 -48.819 1.00 143.80 ? 34  ARG B NH2   1 
ATOM   3943 N  N     . LEU B 1 35  ? -3.847  -33.202 -41.753 1.00 122.80 ? 35  LEU B N     1 
ATOM   3944 C  CA    . LEU B 1 35  ? -4.238  -33.442 -40.355 1.00 117.48 ? 35  LEU B CA    1 
ATOM   3945 C  C     . LEU B 1 35  ? -4.135  -34.895 -39.907 1.00 123.78 ? 35  LEU B C     1 
ATOM   3946 O  O     . LEU B 1 35  ? -3.638  -35.172 -38.811 1.00 122.43 ? 35  LEU B O     1 
ATOM   3947 C  CB    . LEU B 1 35  ? -5.661  -32.937 -40.108 1.00 111.65 ? 35  LEU B CB    1 
ATOM   3948 C  CG    . LEU B 1 35  ? -5.794  -31.539 -39.520 1.00 102.02 ? 35  LEU B CG    1 
ATOM   3949 C  CD1   . LEU B 1 35  ? -7.139  -30.978 -39.892 1.00 98.66  ? 35  LEU B CD1   1 
ATOM   3950 C  CD2   . LEU B 1 35  ? -5.611  -31.574 -38.007 1.00 97.39  ? 35  LEU B CD2   1 
ATOM   3951 N  N     . ASP B 1 36  ? -4.636  -35.808 -40.744 1.00 131.11 ? 36  ASP B N     1 
ATOM   3952 C  CA    . ASP B 1 36  ? -4.467  -37.241 -40.534 1.00 138.87 ? 36  ASP B CA    1 
ATOM   3953 C  C     . ASP B 1 36  ? -2.985  -37.542 -40.448 1.00 142.93 ? 36  ASP B C     1 
ATOM   3954 O  O     . ASP B 1 36  ? -2.527  -38.145 -39.482 1.00 143.97 ? 36  ASP B O     1 
ATOM   3955 C  CB    . ASP B 1 36  ? -5.091  -38.049 -41.680 1.00 147.55 ? 36  ASP B CB    1 
ATOM   3956 C  CG    . ASP B 1 36  ? -6.608  -38.143 -41.586 1.00 145.68 ? 36  ASP B CG    1 
ATOM   3957 O  OD1   . ASP B 1 36  ? -7.165  -37.929 -40.486 1.00 139.55 ? 36  ASP B OD1   1 
ATOM   3958 O  OD2   . ASP B 1 36  ? -7.245  -38.438 -42.622 1.00 150.99 ? 36  ASP B OD2   1 
ATOM   3959 N  N     . GLU B 1 37  ? -2.242  -37.088 -41.454 1.00 145.83 ? 37  GLU B N     1 
ATOM   3960 C  CA    . GLU B 1 37  ? -0.803  -37.304 -41.530 1.00 150.99 ? 37  GLU B CA    1 
ATOM   3961 C  C     . GLU B 1 37  ? -0.056  -36.771 -40.304 1.00 144.62 ? 37  GLU B C     1 
ATOM   3962 O  O     . GLU B 1 37  ? 1.067   -37.192 -40.033 1.00 149.24 ? 37  GLU B O     1 
ATOM   3963 C  CB    . GLU B 1 37  ? -0.245  -36.673 -42.799 1.00 154.77 ? 37  GLU B CB    1 
ATOM   3964 C  CG    . GLU B 1 37  ? 1.038   -37.306 -43.293 1.00 164.75 ? 37  GLU B CG    1 
ATOM   3965 C  CD    . GLU B 1 37  ? 1.755   -36.440 -44.301 1.00 167.46 ? 37  GLU B CD    1 
ATOM   3966 O  OE1   . GLU B 1 37  ? 1.673   -35.196 -44.190 1.00 159.46 ? 37  GLU B OE1   1 
ATOM   3967 O  OE2   . GLU B 1 37  ? 2.404   -37.006 -45.203 1.00 178.28 ? 37  GLU B OE2   1 
ATOM   3968 N  N     . LEU B 1 38  ? -0.681  -35.851 -39.572 1.00 134.92 ? 38  LEU B N     1 
ATOM   3969 C  CA    . LEU B 1 38  ? -0.121  -35.359 -38.311 1.00 129.22 ? 38  LEU B CA    1 
ATOM   3970 C  C     . LEU B 1 38  ? -0.552  -36.174 -37.085 1.00 129.09 ? 38  LEU B C     1 
ATOM   3971 O  O     . LEU B 1 38  ? 0.099   -36.119 -36.042 1.00 127.50 ? 38  LEU B O     1 
ATOM   3972 C  CB    . LEU B 1 38  ? -0.437  -33.872 -38.109 1.00 119.76 ? 38  LEU B CB    1 
ATOM   3973 C  CG    . LEU B 1 38  ? 0.537   -32.871 -38.743 1.00 119.58 ? 38  LEU B CG    1 
ATOM   3974 C  CD1   . LEU B 1 38  ? -0.022  -31.456 -38.680 1.00 111.57 ? 38  LEU B CD1   1 
ATOM   3975 C  CD2   . LEU B 1 38  ? 1.917   -32.925 -38.091 1.00 121.31 ? 38  LEU B CD2   1 
ATOM   3976 N  N     . GLY B 1 39  ? -1.644  -36.927 -37.217 1.00 131.75 ? 39  GLY B N     1 
ATOM   3977 C  CA    . GLY B 1 39  ? -2.144  -37.793 -36.141 1.00 133.46 ? 39  GLY B CA    1 
ATOM   3978 C  C     . GLY B 1 39  ? -2.800  -37.063 -34.977 1.00 125.63 ? 39  GLY B C     1 
ATOM   3979 O  O     . GLY B 1 39  ? -2.456  -37.303 -33.817 1.00 125.69 ? 39  GLY B O     1 
ATOM   3980 N  N     . VAL B 1 40  ? -3.742  -36.170 -35.289 1.00 119.69 ? 40  VAL B N     1 
ATOM   3981 C  CA    . VAL B 1 40  ? -4.486  -35.419 -34.271 1.00 112.70 ? 40  VAL B CA    1 
ATOM   3982 C  C     . VAL B 1 40  ? -5.966  -35.799 -34.289 1.00 113.67 ? 40  VAL B C     1 
ATOM   3983 O  O     . VAL B 1 40  ? -6.543  -36.050 -35.353 1.00 116.20 ? 40  VAL B O     1 
ATOM   3984 C  CB    . VAL B 1 40  ? -4.374  -33.876 -34.462 1.00 104.63 ? 40  VAL B CB    1 
ATOM   3985 C  CG1   . VAL B 1 40  ? -4.834  -33.142 -33.199 1.00 98.32  ? 40  VAL B CG1   1 
ATOM   3986 C  CG2   . VAL B 1 40  ? -2.951  -33.466 -34.831 1.00 104.97 ? 40  VAL B CG2   1 
ATOM   3987 N  N     . GLU B 1 41  ? -6.567  -35.852 -33.103 1.00 112.44 ? 41  GLU B N     1 
ATOM   3988 C  CA    . GLU B 1 41  ? -8.015  -35.864 -32.992 1.00 112.22 ? 41  GLU B CA    1 
ATOM   3989 C  C     . GLU B 1 41  ? -8.526  -34.470 -33.342 1.00 104.47 ? 41  GLU B C     1 
ATOM   3990 O  O     . GLU B 1 41  ? -8.166  -33.475 -32.697 1.00 98.72  ? 41  GLU B O     1 
ATOM   3991 C  CB    . GLU B 1 41  ? -8.462  -36.270 -31.591 1.00 114.17 ? 41  GLU B CB    1 
ATOM   3992 C  CG    . GLU B 1 41  ? -8.561  -37.770 -31.395 1.00 124.11 ? 41  GLU B CG    1 
ATOM   3993 C  CD    . GLU B 1 41  ? -9.451  -38.156 -30.227 1.00 127.98 ? 41  GLU B CD    1 
ATOM   3994 O  OE1   . GLU B 1 41  ? -9.408  -39.342 -29.823 1.00 135.96 ? 41  GLU B OE1   1 
ATOM   3995 O  OE2   . GLU B 1 41  ? -10.192 -37.279 -29.718 1.00 123.39 ? 41  GLU B OE2   1 
ATOM   3996 N  N     . TYR B 1 42  ? -9.338  -34.411 -34.392 1.00 104.99 ? 42  TYR B N     1 
ATOM   3997 C  CA    . TYR B 1 42  ? -9.913  -33.167 -34.878 1.00 98.76  ? 42  TYR B CA    1 
ATOM   3998 C  C     . TYR B 1 42  ? -11.277 -33.475 -35.453 1.00 101.56 ? 42  TYR B C     1 
ATOM   3999 O  O     . TYR B 1 42  ? -11.527 -34.603 -35.868 1.00 108.74 ? 42  TYR B O     1 
ATOM   4000 C  CB    . TYR B 1 42  ? -9.027  -32.553 -35.960 1.00 96.98  ? 42  TYR B CB    1 
ATOM   4001 C  CG    . TYR B 1 42  ? -9.038  -33.321 -37.257 1.00 103.25 ? 42  TYR B CG    1 
ATOM   4002 C  CD1   . TYR B 1 42  ? -9.871  -32.938 -38.303 1.00 103.37 ? 42  TYR B CD1   1 
ATOM   4003 C  CD2   . TYR B 1 42  ? -8.221  -34.440 -37.435 1.00 110.22 ? 42  TYR B CD2   1 
ATOM   4004 C  CE1   . TYR B 1 42  ? -9.886  -33.646 -39.496 1.00 110.78 ? 42  TYR B CE1   1 
ATOM   4005 C  CE2   . TYR B 1 42  ? -8.229  -35.158 -38.624 1.00 116.97 ? 42  TYR B CE2   1 
ATOM   4006 C  CZ    . TYR B 1 42  ? -9.063  -34.755 -39.650 1.00 117.45 ? 42  TYR B CZ    1 
ATOM   4007 O  OH    . TYR B 1 42  ? -9.079  -35.452 -40.834 1.00 125.21 ? 42  TYR B OH    1 
ATOM   4008 N  N     . VAL B 1 43  ? -12.156 -32.483 -35.488 1.00 96.79  ? 43  VAL B N     1 
ATOM   4009 C  CA    . VAL B 1 43  ? -13.485 -32.690 -36.049 1.00 99.66  ? 43  VAL B CA    1 
ATOM   4010 C  C     . VAL B 1 43  ? -14.036 -31.403 -36.660 1.00 94.33  ? 43  VAL B C     1 
ATOM   4011 O  O     . VAL B 1 43  ? -13.963 -30.331 -36.053 1.00 88.16  ? 43  VAL B O     1 
ATOM   4012 C  CB    . VAL B 1 43  ? -14.464 -33.317 -35.008 1.00 103.19 ? 43  VAL B CB    1 
ATOM   4013 C  CG1   . VAL B 1 43  ? -14.666 -32.384 -33.802 1.00 98.12  ? 43  VAL B CG1   1 
ATOM   4014 C  CG2   . VAL B 1 43  ? -15.797 -33.708 -35.664 1.00 107.68 ? 43  VAL B CG2   1 
ATOM   4015 N  N     . PHE B 1 44  ? -14.572 -31.532 -37.873 1.00 97.40  ? 44  PHE B N     1 
ATOM   4016 C  CA    . PHE B 1 44  ? -15.104 -30.404 -38.628 1.00 93.68  ? 44  PHE B CA    1 
ATOM   4017 C  C     . PHE B 1 44  ? -16.430 -29.928 -38.072 1.00 92.06  ? 44  PHE B C     1 
ATOM   4018 O  O     . PHE B 1 44  ? -17.330 -30.733 -37.797 1.00 96.90  ? 44  PHE B O     1 
ATOM   4019 C  CB    . PHE B 1 44  ? -15.272 -30.772 -40.100 1.00 98.97  ? 44  PHE B CB    1 
ATOM   4020 C  CG    . PHE B 1 44  ? -13.983 -30.837 -40.857 1.00 100.22 ? 44  PHE B CG    1 
ATOM   4021 C  CD1   . PHE B 1 44  ? -13.262 -32.021 -40.926 1.00 105.57 ? 44  PHE B CD1   1 
ATOM   4022 C  CD2   . PHE B 1 44  ? -13.487 -29.712 -41.504 1.00 96.79  ? 44  PHE B CD2   1 
ATOM   4023 C  CE1   . PHE B 1 44  ? -12.068 -32.088 -41.631 1.00 107.74 ? 44  PHE B CE1   1 
ATOM   4024 C  CE2   . PHE B 1 44  ? -12.288 -29.773 -42.213 1.00 99.20  ? 44  PHE B CE2   1 
ATOM   4025 C  CZ    . PHE B 1 44  ? -11.580 -30.965 -42.276 1.00 104.76 ? 44  PHE B CZ    1 
ATOM   4026 N  N     . VAL B 1 45  ? -16.533 -28.611 -37.908 1.00 85.77  ? 45  VAL B N     1 
ATOM   4027 C  CA    . VAL B 1 45  ? -17.746 -27.965 -37.412 1.00 84.15  ? 45  VAL B CA    1 
ATOM   4028 C  C     . VAL B 1 45  ? -18.069 -26.740 -38.258 1.00 80.94  ? 45  VAL B C     1 
ATOM   4029 O  O     . VAL B 1 45  ? -17.407 -26.479 -39.266 1.00 80.86  ? 45  VAL B O     1 
ATOM   4030 C  CB    . VAL B 1 45  ? -17.618 -27.534 -35.929 1.00 80.43  ? 45  VAL B CB    1 
ATOM   4031 C  CG1   . VAL B 1 45  ? -17.710 -28.734 -35.000 1.00 85.19  ? 45  VAL B CG1   1 
ATOM   4032 C  CG2   . VAL B 1 45  ? -16.332 -26.776 -35.708 1.00 75.10  ? 45  VAL B CG2   1 
ATOM   4033 N  N     . GLY B 1 46  ? -19.095 -26.001 -37.846 1.00 79.24  ? 46  GLY B N     1 
ATOM   4034 C  CA    . GLY B 1 46  ? -19.446 -24.744 -38.493 1.00 76.16  ? 46  GLY B CA    1 
ATOM   4035 C  C     . GLY B 1 46  ? -20.264 -24.880 -39.763 1.00 80.36  ? 46  GLY B C     1 
ATOM   4036 O  O     . GLY B 1 46  ? -20.670 -25.978 -40.150 1.00 86.04  ? 46  GLY B O     1 
ATOM   4037 N  N     . SER B 1 47  ? -20.491 -23.741 -40.413 1.00 78.02  ? 47  SER B N     1 
ATOM   4038 C  CA    . SER B 1 47  ? -21.360 -23.653 -41.578 1.00 81.81  ? 47  SER B CA    1 
ATOM   4039 C  C     . SER B 1 47  ? -21.001 -24.642 -42.685 1.00 87.29  ? 47  SER B C     1 
ATOM   4040 O  O     . SER B 1 47  ? -21.890 -25.282 -43.244 1.00 93.10  ? 47  SER B O     1 
ATOM   4041 C  CB    . SER B 1 47  ? -21.384 -22.224 -42.118 1.00 78.75  ? 47  SER B CB    1 
ATOM   4042 O  OG    . SER B 1 47  ? -20.087 -21.786 -42.484 1.00 75.64  ? 47  SER B OG    1 
ATOM   4043 N  N     . TYR B 1 48  ? -19.713 -24.768 -42.999 1.00 86.12  ? 48  TYR B N     1 
ATOM   4044 C  CA    . TYR B 1 48  ? -19.303 -25.685 -44.060 1.00 92.50  ? 48  TYR B CA    1 
ATOM   4045 C  C     . TYR B 1 48  ? -19.616 -27.149 -43.723 1.00 97.40  ? 48  TYR B C     1 
ATOM   4046 O  O     . TYR B 1 48  ? -20.112 -27.892 -44.573 1.00 104.37 ? 48  TYR B O     1 
ATOM   4047 C  CB    . TYR B 1 48  ? -17.826 -25.516 -44.439 1.00 91.55  ? 48  TYR B CB    1 
ATOM   4048 C  CG    . TYR B 1 48  ? -17.376 -26.539 -45.466 1.00 99.44  ? 48  TYR B CG    1 
ATOM   4049 C  CD1   . TYR B 1 48  ? -17.873 -26.512 -46.771 1.00 106.01 ? 48  TYR B CD1   1 
ATOM   4050 C  CD2   . TYR B 1 48  ? -16.480 -27.551 -45.127 1.00 101.61 ? 48  TYR B CD2   1 
ATOM   4051 C  CE1   . TYR B 1 48  ? -17.477 -27.456 -47.717 1.00 114.26 ? 48  TYR B CE1   1 
ATOM   4052 C  CE2   . TYR B 1 48  ? -16.078 -28.505 -46.066 1.00 109.83 ? 48  TYR B CE2   1 
ATOM   4053 C  CZ    . TYR B 1 48  ? -16.580 -28.449 -47.358 1.00 116.10 ? 48  TYR B CZ    1 
ATOM   4054 O  OH    . TYR B 1 48  ? -16.188 -29.383 -48.288 1.00 125.12 ? 48  TYR B OH    1 
ATOM   4055 N  N     . ALA B 1 49  ? -19.340 -27.543 -42.480 1.00 94.33  ? 49  ALA B N     1 
ATOM   4056 C  CA    . ALA B 1 49  ? -19.602 -28.901 -42.002 1.00 99.18  ? 49  ALA B CA    1 
ATOM   4057 C  C     . ALA B 1 49  ? -21.097 -29.227 -41.896 1.00 103.52 ? 49  ALA B C     1 
ATOM   4058 O  O     . ALA B 1 49  ? -21.478 -30.400 -41.812 1.00 109.86 ? 49  ALA B O     1 
ATOM   4059 C  CB    . ALA B 1 49  ? -18.907 -29.137 -40.675 1.00 95.27  ? 49  ALA B CB    1 
ATOM   4060 N  N     . ARG B 1 50  ? -21.936 -28.194 -41.908 1.00 100.82 ? 50  ARG B N     1 
ATOM   4061 C  CA    . ARG B 1 50  ? -23.388 -28.381 -41.868 1.00 105.50 ? 50  ARG B CA    1 
ATOM   4062 C  C     . ARG B 1 50  ? -24.079 -27.973 -43.178 1.00 109.21 ? 50  ARG B C     1 
ATOM   4063 O  O     . ARG B 1 50  ? -25.312 -27.934 -43.251 1.00 112.95 ? 50  ARG B O     1 
ATOM   4064 C  CB    . ARG B 1 50  ? -24.002 -27.658 -40.659 1.00 101.27 ? 50  ARG B CB    1 
ATOM   4065 C  CG    . ARG B 1 50  ? -23.541 -28.215 -39.315 1.00 99.99  ? 50  ARG B CG    1 
ATOM   4066 C  CD    . ARG B 1 50  ? -24.452 -27.825 -38.153 1.00 99.95  ? 50  ARG B CD    1 
ATOM   4067 N  NE    . ARG B 1 50  ? -24.229 -26.458 -37.680 1.00 93.82  ? 50  ARG B NE    1 
ATOM   4068 C  CZ    . ARG B 1 50  ? -23.284 -26.092 -36.813 1.00 89.34  ? 50  ARG B CZ    1 
ATOM   4069 N  NH1   . ARG B 1 50  ? -22.435 -26.978 -36.303 1.00 90.36  ? 50  ARG B NH1   1 
ATOM   4070 N  NH2   . ARG B 1 50  ? -23.183 -24.823 -36.452 1.00 84.33  ? 50  ARG B NH2   1 
ATOM   4071 N  N     . ASN B 1 51  ? -23.276 -27.704 -44.210 1.00 109.16 ? 51  ASN B N     1 
ATOM   4072 C  CA    . ASN B 1 51  ? -23.764 -27.230 -45.513 1.00 113.08 ? 51  ASN B CA    1 
ATOM   4073 C  C     . ASN B 1 51  ? -24.693 -26.035 -45.358 1.00 110.13 ? 51  ASN B C     1 
ATOM   4074 O  O     . ASN B 1 51  ? -25.717 -25.945 -46.039 1.00 115.40 ? 51  ASN B O     1 
ATOM   4075 C  CB    . ASN B 1 51  ? -24.458 -28.355 -46.298 1.00 122.84 ? 51  ASN B CB    1 
ATOM   4076 C  CG    . ASN B 1 51  ? -23.583 -29.580 -46.454 1.00 127.06 ? 51  ASN B CG    1 
ATOM   4077 O  OD1   . ASN B 1 51  ? -22.530 -29.537 -47.096 1.00 126.99 ? 51  ASN B OD1   1 
ATOM   4078 N  ND2   . ASN B 1 51  ? -24.015 -30.687 -45.862 1.00 131.10 ? 51  ASN B ND2   1 
ATOM   4079 N  N     . THR B 1 52  ? -24.327 -25.128 -44.453 1.00 102.43 ? 52  THR B N     1 
ATOM   4080 C  CA    . THR B 1 52  ? -25.189 -24.013 -44.067 1.00 99.59  ? 52  THR B CA    1 
ATOM   4081 C  C     . THR B 1 52  ? -24.501 -22.671 -44.195 1.00 93.63  ? 52  THR B C     1 
ATOM   4082 O  O     . THR B 1 52  ? -24.831 -21.739 -43.462 1.00 89.51  ? 52  THR B O     1 
ATOM   4083 C  CB    . THR B 1 52  ? -25.685 -24.141 -42.605 1.00 97.38  ? 52  THR B CB    1 
ATOM   4084 O  OG1   . THR B 1 52  ? -24.589 -24.477 -41.745 1.00 93.11  ? 52  THR B OG1   1 
ATOM   4085 C  CG2   . THR B 1 52  ? -26.763 -25.193 -42.483 1.00 104.78 ? 52  THR B CG2   1 
ATOM   4086 N  N     . TRP B 1 53  ? -23.537 -22.568 -45.102 1.00 94.16  ? 53  TRP B N     1 
ATOM   4087 C  CA    . TRP B 1 53  ? -22.873 -21.291 -45.314 1.00 89.88  ? 53  TRP B CA    1 
ATOM   4088 C  C     . TRP B 1 53  ? -23.550 -20.555 -46.449 1.00 94.12  ? 53  TRP B C     1 
ATOM   4089 O  O     . TRP B 1 53  ? -24.115 -21.175 -47.360 1.00 100.88 ? 53  TRP B O     1 
ATOM   4090 C  CB    . TRP B 1 53  ? -21.380 -21.457 -45.599 1.00 88.52  ? 53  TRP B CB    1 
ATOM   4091 C  CG    . TRP B 1 53  ? -21.067 -21.930 -46.987 1.00 95.48  ? 53  TRP B CG    1 
ATOM   4092 C  CD1   . TRP B 1 53  ? -20.667 -21.164 -48.046 1.00 97.85  ? 53  TRP B CD1   1 
ATOM   4093 C  CD2   . TRP B 1 53  ? -21.120 -23.278 -47.466 1.00 101.85 ? 53  TRP B CD2   1 
ATOM   4094 N  NE1   . TRP B 1 53  ? -20.469 -21.950 -49.156 1.00 105.44 ? 53  TRP B NE1   1 
ATOM   4095 C  CE2   . TRP B 1 53  ? -20.736 -23.253 -48.827 1.00 108.09 ? 53  TRP B CE2   1 
ATOM   4096 C  CE3   . TRP B 1 53  ? -21.452 -24.506 -46.878 1.00 103.59 ? 53  TRP B CE3   1 
ATOM   4097 C  CZ2   . TRP B 1 53  ? -20.679 -24.409 -49.612 1.00 116.15 ? 53  TRP B CZ2   1 
ATOM   4098 C  CZ3   . TRP B 1 53  ? -21.394 -25.654 -47.660 1.00 111.59 ? 53  TRP B CZ3   1 
ATOM   4099 C  CH2   . TRP B 1 53  ? -21.012 -25.596 -49.013 1.00 117.63 ? 53  TRP B CH2   1 
ATOM   4100 N  N     . LEU B 1 54  ? -23.490 -19.228 -46.370 1.00 90.51  ? 54  LEU B N     1 
ATOM   4101 C  CA    . LEU B 1 54  ? -23.986 -18.354 -47.416 1.00 94.20  ? 54  LEU B CA    1 
ATOM   4102 C  C     . LEU B 1 54  ? -23.039 -18.365 -48.620 1.00 98.04  ? 54  LEU B C     1 
ATOM   4103 O  O     . LEU B 1 54  ? -21.815 -18.349 -48.456 1.00 95.28  ? 54  LEU B O     1 
ATOM   4104 C  CB    . LEU B 1 54  ? -24.117 -16.929 -46.868 1.00 89.51  ? 54  LEU B CB    1 
ATOM   4105 C  CG    . LEU B 1 54  ? -24.933 -15.923 -47.689 1.00 93.58  ? 54  LEU B CG    1 
ATOM   4106 C  CD1   . LEU B 1 54  ? -26.382 -15.963 -47.259 1.00 95.71  ? 54  LEU B CD1   1 
ATOM   4107 C  CD2   . LEU B 1 54  ? -24.392 -14.522 -47.540 1.00 90.10  ? 54  LEU B CD2   1 
ATOM   4108 N  N     . LYS B 1 55  ? -23.610 -18.393 -49.822 1.00 105.19 ? 55  LYS B N     1 
ATOM   4109 C  CA    . LYS B 1 55  ? -22.850 -18.240 -51.063 1.00 110.78 ? 55  LYS B CA    1 
ATOM   4110 C  C     . LYS B 1 55  ? -21.870 -17.059 -51.013 1.00 107.18 ? 55  LYS B C     1 
ATOM   4111 O  O     . LYS B 1 55  ? -22.206 -15.970 -50.521 1.00 103.06 ? 55  LYS B O     1 
ATOM   4112 C  CB    . LYS B 1 55  ? -23.816 -18.051 -52.237 1.00 119.05 ? 55  LYS B CB    1 
ATOM   4113 C  CG    . LYS B 1 55  ? -23.154 -17.857 -53.597 1.00 126.69 ? 55  LYS B CG    1 
ATOM   4114 C  CD    . LYS B 1 55  ? -24.184 -17.540 -54.661 1.00 134.93 ? 55  LYS B CD    1 
ATOM   4115 C  CE    . LYS B 1 55  ? -23.534 -17.196 -55.985 1.00 143.58 ? 55  LYS B CE    1 
ATOM   4116 N  NZ    . LYS B 1 55  ? -23.037 -15.792 -56.005 1.00 141.01 ? 55  LYS B NZ    1 
ATOM   4117 N  N     . GLY B 1 56  ? -20.660 -17.287 -51.523 1.00 109.51 ? 56  GLY B N     1 
ATOM   4118 C  CA    . GLY B 1 56  ? -19.666 -16.229 -51.680 1.00 108.21 ? 56  GLY B CA    1 
ATOM   4119 C  C     . GLY B 1 56  ? -18.700 -16.119 -50.523 1.00 100.34 ? 56  GLY B C     1 
ATOM   4120 O  O     . GLY B 1 56  ? -17.509 -15.906 -50.725 1.00 101.04 ? 56  GLY B O     1 
ATOM   4121 N  N     . SER B 1 57  ? -19.213 -16.258 -49.307 1.00 93.78  ? 57  SER B N     1 
ATOM   4122 C  CA    . SER B 1 57  ? -18.381 -16.166 -48.111 1.00 87.04  ? 57  SER B CA    1 
ATOM   4123 C  C     . SER B 1 57  ? -18.306 -17.494 -47.355 1.00 85.16  ? 57  SER B C     1 
ATOM   4124 O  O     . SER B 1 57  ? -19.057 -17.728 -46.401 1.00 81.64  ? 57  SER B O     1 
ATOM   4125 C  CB    . SER B 1 57  ? -18.867 -15.032 -47.200 1.00 81.52  ? 57  SER B CB    1 
ATOM   4126 O  OG    . SER B 1 57  ? -20.277 -15.058 -47.057 1.00 82.51  ? 57  SER B OG    1 
ATOM   4127 N  N     . LEU B 1 58  ? -17.389 -18.356 -47.794 1.00 88.48  ? 58  LEU B N     1 
ATOM   4128 C  CA    . LEU B 1 58  ? -17.213 -19.692 -47.225 1.00 88.02  ? 58  LEU B CA    1 
ATOM   4129 C  C     . LEU B 1 58  ? -16.072 -19.703 -46.230 1.00 82.80  ? 58  LEU B C     1 
ATOM   4130 O  O     . LEU B 1 58  ? -15.049 -19.059 -46.451 1.00 82.35  ? 58  LEU B O     1 
ATOM   4131 C  CB    . LEU B 1 58  ? -16.944 -20.707 -48.344 1.00 96.19  ? 58  LEU B CB    1 
ATOM   4132 C  CG    . LEU B 1 58  ? -16.411 -22.123 -48.057 1.00 98.20  ? 58  LEU B CG    1 
ATOM   4133 C  CD1   . LEU B 1 58  ? -17.362 -22.944 -47.195 1.00 96.51  ? 58  LEU B CD1   1 
ATOM   4134 C  CD2   . LEU B 1 58  ? -16.118 -22.856 -49.363 1.00 107.54 ? 58  LEU B CD2   1 
ATOM   4135 N  N     . GLU B 1 59  ? -16.254 -20.438 -45.137 1.00 79.70  ? 59  GLU B N     1 
ATOM   4136 C  CA    . GLU B 1 59  ? -15.202 -20.610 -44.139 1.00 75.89  ? 59  GLU B CA    1 
ATOM   4137 C  C     . GLU B 1 59  ? -15.288 -21.980 -43.497 1.00 76.89  ? 59  GLU B C     1 
ATOM   4138 O  O     . GLU B 1 59  ? -16.291 -22.300 -42.859 1.00 76.11  ? 59  GLU B O     1 
ATOM   4139 C  CB    . GLU B 1 59  ? -15.299 -19.527 -43.067 1.00 69.50  ? 59  GLU B CB    1 
ATOM   4140 C  CG    . GLU B 1 59  ? -14.114 -19.486 -42.121 1.00 66.18  ? 59  GLU B CG    1 
ATOM   4141 C  CD    . GLU B 1 59  ? -13.528 -18.091 -41.987 1.00 63.65  ? 59  GLU B CD    1 
ATOM   4142 O  OE1   . GLU B 1 59  ? -13.143 -17.719 -40.858 1.00 59.68  ? 59  GLU B OE1   1 
ATOM   4143 O  OE2   . GLU B 1 59  ? -13.445 -17.369 -43.009 1.00 65.87  ? 59  GLU B OE2   1 
ATOM   4144 N  N     . ILE B 1 60  ? -14.235 -22.781 -43.667 1.00 79.68  ? 60  ILE B N     1 
ATOM   4145 C  CA    . ILE B 1 60  ? -14.195 -24.138 -43.109 1.00 81.68  ? 60  ILE B CA    1 
ATOM   4146 C  C     . ILE B 1 60  ? -13.738 -24.081 -41.657 1.00 76.27  ? 60  ILE B C     1 
ATOM   4147 O  O     . ILE B 1 60  ? -12.728 -23.442 -41.344 1.00 73.34  ? 60  ILE B O     1 
ATOM   4148 C  CB    . ILE B 1 60  ? -13.262 -25.104 -43.908 1.00 88.04  ? 60  ILE B CB    1 
ATOM   4149 C  CG1   . ILE B 1 60  ? -13.539 -25.060 -45.415 1.00 94.77  ? 60  ILE B CG1   1 
ATOM   4150 C  CG2   . ILE B 1 60  ? -13.428 -26.540 -43.428 1.00 91.30  ? 60  ILE B CG2   1 
ATOM   4151 C  CD1   . ILE B 1 60  ? -12.547 -24.223 -46.208 1.00 96.45  ? 60  ILE B CD1   1 
ATOM   4152 N  N     . ASP B 1 61  ? -14.489 -24.739 -40.777 1.00 75.89  ? 61  ASP B N     1 
ATOM   4153 C  CA    . ASP B 1 61  ? -14.143 -24.785 -39.363 1.00 72.28  ? 61  ASP B CA    1 
ATOM   4154 C  C     . ASP B 1 61  ? -13.631 -26.166 -38.968 1.00 75.92  ? 61  ASP B C     1 
ATOM   4155 O  O     . ASP B 1 61  ? -14.338 -27.172 -39.126 1.00 80.77  ? 61  ASP B O     1 
ATOM   4156 C  CB    . ASP B 1 61  ? -15.335 -24.377 -38.493 1.00 69.99  ? 61  ASP B CB    1 
ATOM   4157 C  CG    . ASP B 1 61  ? -15.804 -22.943 -38.756 1.00 67.39  ? 61  ASP B CG    1 
ATOM   4158 O  OD1   . ASP B 1 61  ? -17.019 -22.759 -38.985 1.00 69.30  ? 61  ASP B OD1   1 
ATOM   4159 O  OD2   . ASP B 1 61  ? -14.971 -22.000 -38.731 1.00 64.50  ? 61  ASP B OD2   1 
ATOM   4160 N  N     . VAL B 1 62  ? -12.390 -26.202 -38.473 1.00 74.42  ? 62  VAL B N     1 
ATOM   4161 C  CA    . VAL B 1 62  ? -11.741 -27.430 -37.979 1.00 77.58  ? 62  VAL B CA    1 
ATOM   4162 C  C     . VAL B 1 62  ? -11.414 -27.278 -36.497 1.00 74.00  ? 62  VAL B C     1 
ATOM   4163 O  O     . VAL B 1 62  ? -10.849 -26.264 -36.077 1.00 69.42  ? 62  VAL B O     1 
ATOM   4164 C  CB    . VAL B 1 62  ? -10.399 -27.728 -38.695 1.00 80.44  ? 62  VAL B CB    1 
ATOM   4165 C  CG1   . VAL B 1 62  ? -10.068 -29.207 -38.597 1.00 85.97  ? 62  VAL B CG1   1 
ATOM   4166 C  CG2   . VAL B 1 62  ? -10.425 -27.272 -40.146 1.00 82.82  ? 62  VAL B CG2   1 
ATOM   4167 N  N     . PHE B 1 63  ? -11.748 -28.294 -35.711 1.00 76.77  ? 63  PHE B N     1 
ATOM   4168 C  CA    . PHE B 1 63  ? -11.492 -28.241 -34.277 1.00 74.79  ? 63  PHE B CA    1 
ATOM   4169 C  C     . PHE B 1 63  ? -10.511 -29.289 -33.770 1.00 78.37  ? 63  PHE B C     1 
ATOM   4170 O  O     . PHE B 1 63  ? -10.782 -30.493 -33.800 1.00 83.98  ? 63  PHE B O     1 
ATOM   4171 C  CB    . PHE B 1 63  ? -12.802 -28.290 -33.492 1.00 75.41  ? 63  PHE B CB    1 
ATOM   4172 C  CG    . PHE B 1 63  ? -13.332 -26.938 -33.124 1.00 70.36  ? 63  PHE B CG    1 
ATOM   4173 C  CD1   . PHE B 1 63  ? -13.512 -25.957 -34.094 1.00 66.91  ? 63  PHE B CD1   1 
ATOM   4174 C  CD2   . PHE B 1 63  ? -13.655 -26.645 -31.805 1.00 70.07  ? 63  PHE B CD2   1 
ATOM   4175 C  CE1   . PHE B 1 63  ? -14.001 -24.704 -33.756 1.00 63.41  ? 63  PHE B CE1   1 
ATOM   4176 C  CE2   . PHE B 1 63  ? -14.148 -25.392 -31.451 1.00 66.55  ? 63  PHE B CE2   1 
ATOM   4177 C  CZ    . PHE B 1 63  ? -14.320 -24.417 -32.429 1.00 63.07  ? 63  PHE B CZ    1 
ATOM   4178 N  N     . LEU B 1 64  ? -9.366  -28.809 -33.304 1.00 75.53  ? 64  LEU B N     1 
ATOM   4179 C  CA    . LEU B 1 64  ? -8.389  -29.646 -32.641 1.00 78.52  ? 64  LEU B CA    1 
ATOM   4180 C  C     . LEU B 1 64  ? -8.906  -30.065 -31.272 1.00 79.91  ? 64  LEU B C     1 
ATOM   4181 O  O     . LEU B 1 64  ? -9.205  -29.211 -30.427 1.00 76.40  ? 64  LEU B O     1 
ATOM   4182 C  CB    . LEU B 1 64  ? -7.093  -28.865 -32.458 1.00 75.70  ? 64  LEU B CB    1 
ATOM   4183 C  CG    . LEU B 1 64  ? -6.350  -28.419 -33.712 1.00 75.56  ? 64  LEU B CG    1 
ATOM   4184 C  CD1   . LEU B 1 64  ? -5.547  -27.165 -33.408 1.00 71.06  ? 64  LEU B CD1   1 
ATOM   4185 C  CD2   . LEU B 1 64  ? -5.461  -29.548 -34.209 1.00 81.22  ? 64  LEU B CD2   1 
ATOM   4186 N  N     . LEU B 1 65  ? -9.006  -31.375 -31.056 1.00 85.63  ? 65  LEU B N     1 
ATOM   4187 C  CA    . LEU B 1 65  ? -9.373  -31.907 -29.746 1.00 88.62  ? 65  LEU B CA    1 
ATOM   4188 C  C     . LEU B 1 65  ? -8.135  -32.260 -28.921 1.00 90.45  ? 65  LEU B C     1 
ATOM   4189 O  O     . LEU B 1 65  ? -7.115  -32.689 -29.467 1.00 91.99  ? 65  LEU B O     1 
ATOM   4190 C  CB    . LEU B 1 65  ? -10.309 -33.106 -29.890 1.00 95.18  ? 65  LEU B CB    1 
ATOM   4191 C  CG    . LEU B 1 65  ? -11.607 -32.854 -30.676 1.00 94.76  ? 65  LEU B CG    1 
ATOM   4192 C  CD1   . LEU B 1 65  ? -12.371 -34.150 -30.895 1.00 102.48 ? 65  LEU B CD1   1 
ATOM   4193 C  CD2   . LEU B 1 65  ? -12.502 -31.820 -29.996 1.00 90.87  ? 65  LEU B CD2   1 
ATOM   4194 N  N     . PHE B 1 66  ? -8.231  -32.039 -27.610 1.00 90.86  ? 66  PHE B N     1 
ATOM   4195 C  CA    . PHE B 1 66  ? -7.148  -32.314 -26.656 1.00 93.35  ? 66  PHE B CA    1 
ATOM   4196 C  C     . PHE B 1 66  ? -7.727  -32.879 -25.359 1.00 98.86  ? 66  PHE B C     1 
ATOM   4197 O  O     . PHE B 1 66  ? -8.859  -32.545 -25.001 1.00 98.79  ? 66  PHE B O     1 
ATOM   4198 C  CB    . PHE B 1 66  ? -6.386  -31.031 -26.280 1.00 87.80  ? 66  PHE B CB    1 
ATOM   4199 C  CG    . PHE B 1 66  ? -5.611  -30.398 -27.408 1.00 83.36  ? 66  PHE B CG    1 
ATOM   4200 C  CD1   . PHE B 1 66  ? -4.736  -31.141 -28.191 1.00 86.11  ? 66  PHE B CD1   1 
ATOM   4201 C  CD2   . PHE B 1 66  ? -5.723  -29.031 -27.648 1.00 76.73  ? 66  PHE B CD2   1 
ATOM   4202 C  CE1   . PHE B 1 66  ? -4.015  -30.532 -29.221 1.00 83.24  ? 66  PHE B CE1   1 
ATOM   4203 C  CE2   . PHE B 1 66  ? -5.005  -28.421 -28.670 1.00 73.55  ? 66  PHE B CE2   1 
ATOM   4204 C  CZ    . PHE B 1 66  ? -4.147  -29.173 -29.456 1.00 76.84  ? 66  PHE B CZ    1 
ATOM   4205 N  N     . PRO B 1 67  ? -6.953  -33.722 -24.639 1.00 104.43 ? 67  PRO B N     1 
ATOM   4206 C  CA    . PRO B 1 67  ? -7.293  -34.018 -23.243 1.00 109.82 ? 67  PRO B CA    1 
ATOM   4207 C  C     . PRO B 1 67  ? -7.513  -32.744 -22.415 1.00 105.83 ? 67  PRO B C     1 
ATOM   4208 O  O     . PRO B 1 67  ? -6.997  -31.672 -22.753 1.00 98.97  ? 67  PRO B O     1 
ATOM   4209 C  CB    . PRO B 1 67  ? -6.054  -34.751 -22.726 1.00 114.58 ? 67  PRO B CB    1 
ATOM   4210 C  CG    . PRO B 1 67  ? -5.454  -35.360 -23.919 1.00 114.64 ? 67  PRO B CG    1 
ATOM   4211 C  CD    . PRO B 1 67  ? -5.761  -34.468 -25.083 1.00 107.07 ? 67  PRO B CD    1 
ATOM   4212 N  N     . GLU B 1 68  ? -8.272  -32.886 -21.335 1.00 110.95 ? 68  GLU B N     1 
ATOM   4213 C  CA    . GLU B 1 68  ? -8.558  -31.800 -20.407 1.00 109.40 ? 68  GLU B CA    1 
ATOM   4214 C  C     . GLU B 1 68  ? -7.312  -31.422 -19.590 1.00 109.85 ? 68  GLU B C     1 
ATOM   4215 O  O     . GLU B 1 68  ? -7.217  -30.317 -19.056 1.00 106.94 ? 68  GLU B O     1 
ATOM   4216 C  CB    . GLU B 1 68  ? -9.675  -32.252 -19.473 1.00 117.11 ? 68  GLU B CB    1 
ATOM   4217 C  CG    . GLU B 1 68  ? -10.724 -31.209 -19.156 1.00 115.01 ? 68  GLU B CG    1 
ATOM   4218 C  CD    . GLU B 1 68  ? -11.847 -31.782 -18.313 1.00 123.70 ? 68  GLU B CD    1 
ATOM   4219 O  OE1   . GLU B 1 68  ? -12.244 -31.135 -17.319 1.00 126.37 ? 68  GLU B OE1   1 
ATOM   4220 O  OE2   . GLU B 1 68  ? -12.319 -32.893 -18.636 1.00 128.76 ? 68  GLU B OE2   1 
ATOM   4221 N  N     . GLU B 1 69  ? -6.359  -32.351 -19.520 1.00 113.98 ? 69  GLU B N     1 
ATOM   4222 C  CA    . GLU B 1 69  ? -5.138  -32.218 -18.714 1.00 116.21 ? 69  GLU B CA    1 
ATOM   4223 C  C     . GLU B 1 69  ? -4.224  -31.077 -19.135 1.00 108.79 ? 69  GLU B C     1 
ATOM   4224 O  O     . GLU B 1 69  ? -3.429  -30.587 -18.331 1.00 109.95 ? 69  GLU B O     1 
ATOM   4225 C  CB    . GLU B 1 69  ? -4.346  -33.537 -18.725 1.00 122.51 ? 69  GLU B CB    1 
ATOM   4226 C  CG    . GLU B 1 69  ? -4.905  -34.616 -17.800 1.00 132.51 ? 69  GLU B CG    1 
ATOM   4227 C  CD    . GLU B 1 69  ? -6.393  -34.827 -17.993 1.00 133.73 ? 69  GLU B CD    1 
ATOM   4228 O  OE1   . GLU B 1 69  ? -7.148  -34.685 -17.008 1.00 138.59 ? 69  GLU B OE1   1 
ATOM   4229 O  OE2   . GLU B 1 69  ? -6.809  -35.098 -19.140 1.00 130.35 ? 69  GLU B OE2   1 
ATOM   4230 N  N     . PHE B 1 70  ? -4.337  -30.670 -20.395 1.00 102.06 ? 70  PHE B N     1 
ATOM   4231 C  CA    . PHE B 1 70  ? -3.512  -29.604 -20.949 1.00 95.83  ? 70  PHE B CA    1 
ATOM   4232 C  C     . PHE B 1 70  ? -3.730  -28.291 -20.204 1.00 93.29  ? 70  PHE B C     1 
ATOM   4233 O  O     . PHE B 1 70  ? -4.871  -27.921 -19.900 1.00 93.10  ? 70  PHE B O     1 
ATOM   4234 C  CB    . PHE B 1 70  ? -3.817  -29.423 -22.437 1.00 90.44  ? 70  PHE B CB    1 
ATOM   4235 C  CG    . PHE B 1 70  ? -3.140  -30.429 -23.327 1.00 92.89  ? 70  PHE B CG    1 
ATOM   4236 C  CD1   . PHE B 1 70  ? -3.401  -31.793 -23.197 1.00 99.46  ? 70  PHE B CD1   1 
ATOM   4237 C  CD2   . PHE B 1 70  ? -2.251  -30.009 -24.313 1.00 89.77  ? 70  PHE B CD2   1 
ATOM   4238 C  CE1   . PHE B 1 70  ? -2.775  -32.722 -24.021 1.00 102.37 ? 70  PHE B CE1   1 
ATOM   4239 C  CE2   . PHE B 1 70  ? -1.625  -30.928 -25.147 1.00 92.96  ? 70  PHE B CE2   1 
ATOM   4240 C  CZ    . PHE B 1 70  ? -1.888  -32.290 -25.000 1.00 98.91  ? 70  PHE B CZ    1 
ATOM   4241 N  N     . SER B 1 71  ? -2.633  -27.600 -19.899 1.00 92.11  ? 71  SER B N     1 
ATOM   4242 C  CA    . SER B 1 71  ? -2.704  -26.299 -19.242 1.00 89.97  ? 71  SER B CA    1 
ATOM   4243 C  C     . SER B 1 71  ? -3.304  -25.304 -20.217 1.00 82.90  ? 71  SER B C     1 
ATOM   4244 O  O     . SER B 1 71  ? -3.428  -25.604 -21.407 1.00 79.57  ? 71  SER B O     1 
ATOM   4245 C  CB    . SER B 1 71  ? -1.317  -25.836 -18.769 1.00 91.23  ? 71  SER B CB    1 
ATOM   4246 O  OG    . SER B 1 71  ? -0.400  -25.720 -19.843 1.00 86.95  ? 71  SER B OG    1 
ATOM   4247 N  N     . LYS B 1 72  ? -3.691  -24.134 -19.716 1.00 81.35  ? 72  LYS B N     1 
ATOM   4248 C  CA    . LYS B 1 72  ? -4.193  -23.067 -20.571 1.00 75.12  ? 72  LYS B CA    1 
ATOM   4249 C  C     . LYS B 1 72  ? -3.190  -22.865 -21.716 1.00 70.99  ? 72  LYS B C     1 
ATOM   4250 O  O     . LYS B 1 72  ? -3.564  -22.885 -22.893 1.00 67.15  ? 72  LYS B O     1 
ATOM   4251 C  CB    . LYS B 1 72  ? -4.368  -21.780 -19.753 1.00 75.56  ? 72  LYS B CB    1 
ATOM   4252 C  CG    . LYS B 1 72  ? -5.718  -21.077 -19.916 1.00 73.83  ? 72  LYS B CG    1 
ATOM   4253 C  CD    . LYS B 1 72  ? -5.715  -20.020 -21.021 1.00 68.66  ? 72  LYS B CD    1 
ATOM   4254 C  CE    . LYS B 1 72  ? -7.064  -19.298 -21.074 1.00 68.13  ? 72  LYS B CE    1 
ATOM   4255 N  NZ    . LYS B 1 72  ? -7.221  -18.407 -22.258 1.00 62.11  ? 72  LYS B NZ    1 
ATOM   4256 N  N     . GLU B 1 73  ? -1.915  -22.723 -21.345 1.00 72.69  ? 73  GLU B N     1 
ATOM   4257 C  CA    . GLU B 1 73  ? -0.788  -22.574 -22.279 1.00 70.86  ? 73  GLU B CA    1 
ATOM   4258 C  C     . GLU B 1 73  ? -0.589  -23.753 -23.257 1.00 71.18  ? 73  GLU B C     1 
ATOM   4259 O  O     . GLU B 1 73  ? -0.484  -23.539 -24.464 1.00 68.17  ? 73  GLU B O     1 
ATOM   4260 C  CB    . GLU B 1 73  ? 0.515   -22.286 -21.496 1.00 74.51  ? 73  GLU B CB    1 
ATOM   4261 C  CG    . GLU B 1 73  ? 1.757   -21.954 -22.350 1.00 74.54  ? 73  GLU B CG    1 
ATOM   4262 C  CD    . GLU B 1 73  ? 1.672   -20.600 -23.110 1.00 71.84  ? 73  GLU B CD    1 
ATOM   4263 O  OE1   . GLU B 1 73  ? 0.558   -20.099 -23.416 1.00 67.40  ? 73  GLU B OE1   1 
ATOM   4264 O  OE2   . GLU B 1 73  ? 2.747   -20.040 -23.427 1.00 73.30  ? 73  GLU B OE2   1 
ATOM   4265 N  N     . GLU B 1 74  ? -0.529  -24.981 -22.733 1.00 75.52  ? 74  GLU B N     1 
ATOM   4266 C  CA    . GLU B 1 74  ? -0.297  -26.185 -23.543 1.00 77.04  ? 74  GLU B CA    1 
ATOM   4267 C  C     . GLU B 1 74  ? -1.289  -26.358 -24.689 1.00 73.60  ? 74  GLU B C     1 
ATOM   4268 O  O     . GLU B 1 74  ? -0.905  -26.675 -25.816 1.00 73.06  ? 74  GLU B O     1 
ATOM   4269 C  CB    . GLU B 1 74  ? -0.337  -27.424 -22.663 1.00 83.19  ? 74  GLU B CB    1 
ATOM   4270 C  CG    . GLU B 1 74  ? 0.971   -27.765 -21.987 1.00 87.61  ? 74  GLU B CG    1 
ATOM   4271 C  CD    . GLU B 1 74  ? 0.889   -29.090 -21.260 1.00 93.66  ? 74  GLU B CD    1 
ATOM   4272 O  OE1   . GLU B 1 74  ? -0.121  -29.802 -21.447 1.00 94.54  ? 74  GLU B OE1   1 
ATOM   4273 O  OE2   . GLU B 1 74  ? 1.826   -29.420 -20.503 1.00 98.31  ? 74  GLU B OE2   1 
ATOM   4274 N  N     . LEU B 1 75  ? -2.565  -26.162 -24.375 1.00 72.13  ? 75  LEU B N     1 
ATOM   4275 C  CA    . LEU B 1 75  ? -3.647  -26.119 -25.357 1.00 69.15  ? 75  LEU B CA    1 
ATOM   4276 C  C     . LEU B 1 75  ? -3.311  -25.166 -26.496 1.00 64.64  ? 75  LEU B C     1 
ATOM   4277 O  O     . LEU B 1 75  ? -3.531  -25.476 -27.669 1.00 63.72  ? 75  LEU B O     1 
ATOM   4278 C  CB    . LEU B 1 75  ? -4.938  -25.681 -24.642 1.00 68.60  ? 75  LEU B CB    1 
ATOM   4279 C  CG    . LEU B 1 75  ? -6.223  -25.058 -25.227 1.00 65.14  ? 75  LEU B CG    1 
ATOM   4280 C  CD1   . LEU B 1 75  ? -6.039  -23.588 -25.645 1.00 61.66  ? 75  LEU B CD1   1 
ATOM   4281 C  CD2   . LEU B 1 75  ? -6.845  -25.882 -26.352 1.00 65.66  ? 75  LEU B CD2   1 
ATOM   4282 N  N     . ARG B 1 76  ? -2.759  -24.015 -26.118 1.00 62.74  ? 76  ARG B N     1 
ATOM   4283 C  CA    . ARG B 1 76  ? -2.460  -22.909 -27.022 1.00 59.18  ? 76  ARG B CA    1 
ATOM   4284 C  C     . ARG B 1 76  ? -1.242  -23.186 -27.920 1.00 60.72  ? 76  ARG B C     1 
ATOM   4285 O  O     . ARG B 1 76  ? -1.305  -22.961 -29.132 1.00 59.36  ? 76  ARG B O     1 
ATOM   4286 C  CB    . ARG B 1 76  ? -2.274  -21.636 -26.192 1.00 57.73  ? 76  ARG B CB    1 
ATOM   4287 C  CG    . ARG B 1 76  ? -1.846  -20.433 -26.966 1.00 56.02  ? 76  ARG B CG    1 
ATOM   4288 C  CD    . ARG B 1 76  ? -1.135  -19.467 -26.064 1.00 58.61  ? 76  ARG B CD    1 
ATOM   4289 N  NE    . ARG B 1 76  ? 0.023   -18.906 -26.752 1.00 61.89  ? 76  ARG B NE    1 
ATOM   4290 C  CZ    . ARG B 1 76  ? 1.220   -19.490 -26.809 1.00 66.50  ? 76  ARG B CZ    1 
ATOM   4291 N  NH1   . ARG B 1 76  ? 1.422   -20.651 -26.205 1.00 68.86  ? 76  ARG B NH1   1 
ATOM   4292 N  NH2   . ARG B 1 76  ? 2.223   -18.911 -27.464 1.00 69.10  ? 76  ARG B NH2   1 
ATOM   4293 N  N     . GLU B 1 77  ? -0.156  -23.684 -27.324 1.00 64.36  ? 77  GLU B N     1 
ATOM   4294 C  CA    . GLU B 1 77  ? 1.083   -23.994 -28.051 1.00 67.43  ? 77  GLU B CA    1 
ATOM   4295 C  C     . GLU B 1 77  ? 0.898   -24.972 -29.205 1.00 69.24  ? 77  GLU B C     1 
ATOM   4296 O  O     . GLU B 1 77  ? 1.219   -24.643 -30.349 1.00 69.30  ? 77  GLU B O     1 
ATOM   4297 C  CB    . GLU B 1 77  ? 2.190   -24.509 -27.112 1.00 72.07  ? 77  GLU B CB    1 
ATOM   4298 C  CG    . GLU B 1 77  ? 3.151   -23.441 -26.559 1.00 73.31  ? 77  GLU B CG    1 
ATOM   4299 C  CD    . GLU B 1 77  ? 3.553   -22.351 -27.577 1.00 73.20  ? 77  GLU B CD    1 
ATOM   4300 O  OE1   . GLU B 1 77  ? 3.432   -22.557 -28.807 1.00 73.72  ? 77  GLU B OE1   1 
ATOM   4301 O  OE2   . GLU B 1 77  ? 3.992   -21.265 -27.138 1.00 73.12  ? 77  GLU B OE2   1 
ATOM   4302 N  N     . ARG B 1 78  ? 0.394   -26.168 -28.900 1.00 71.54  ? 78  ARG B N     1 
ATOM   4303 C  CA    . ARG B 1 78  ? 0.138   -27.182 -29.925 1.00 74.39  ? 78  ARG B CA    1 
ATOM   4304 C  C     . ARG B 1 78  ? -0.905  -26.705 -30.934 1.00 70.93  ? 78  ARG B C     1 
ATOM   4305 O  O     . ARG B 1 78  ? -0.761  -26.911 -32.142 1.00 72.49  ? 78  ARG B O     1 
ATOM   4306 C  CB    . ARG B 1 78  ? -0.295  -28.516 -29.293 1.00 78.29  ? 78  ARG B CB    1 
ATOM   4307 C  CG    . ARG B 1 78  ? 0.835   -29.328 -28.638 1.00 84.08  ? 78  ARG B CG    1 
ATOM   4308 C  CD    . ARG B 1 78  ? 2.002   -29.628 -29.596 1.00 88.79  ? 78  ARG B CD    1 
ATOM   4309 N  NE    . ARG B 1 78  ? 1.572   -30.292 -30.832 1.00 91.79  ? 78  ARG B NE    1 
ATOM   4310 C  CZ    . ARG B 1 78  ? 1.840   -31.558 -31.155 1.00 98.77  ? 78  ARG B CZ    1 
ATOM   4311 N  NH1   . ARG B 1 78  ? 2.554   -32.340 -30.346 1.00 103.63 ? 78  ARG B NH1   1 
ATOM   4312 N  NH2   . ARG B 1 78  ? 1.393   -32.044 -32.305 1.00 101.04 ? 78  ARG B NH2   1 
ATOM   4313 N  N     . GLY B 1 79  ? -1.946  -26.055 -30.422 1.00 66.94  ? 79  GLY B N     1 
ATOM   4314 C  CA    . GLY B 1 79  ? -3.004  -25.482 -31.252 1.00 63.99  ? 79  GLY B CA    1 
ATOM   4315 C  C     . GLY B 1 79  ? -2.480  -24.588 -32.358 1.00 62.94  ? 79  GLY B C     1 
ATOM   4316 O  O     . GLY B 1 79  ? -2.862  -24.736 -33.522 1.00 63.97  ? 79  GLY B O     1 
ATOM   4317 N  N     . LEU B 1 80  ? -1.596  -23.666 -31.993 1.00 61.81  ? 80  LEU B N     1 
ATOM   4318 C  CA    . LEU B 1 80  ? -0.979  -22.767 -32.964 1.00 62.14  ? 80  LEU B CA    1 
ATOM   4319 C  C     . LEU B 1 80  ? -0.009  -23.503 -33.888 1.00 67.64  ? 80  LEU B C     1 
ATOM   4320 O  O     . LEU B 1 80  ? -0.033  -23.294 -35.100 1.00 69.39  ? 80  LEU B O     1 
ATOM   4321 C  CB    . LEU B 1 80  ? -0.272  -21.608 -32.251 1.00 60.54  ? 80  LEU B CB    1 
ATOM   4322 C  CG    . LEU B 1 80  ? -1.003  -20.318 -31.834 1.00 55.85  ? 80  LEU B CG    1 
ATOM   4323 C  CD1   . LEU B 1 80  ? -2.535  -20.404 -31.803 1.00 51.96  ? 80  LEU B CD1   1 
ATOM   4324 C  CD2   . LEU B 1 80  ? -0.450  -19.853 -30.483 1.00 55.49  ? 80  LEU B CD2   1 
ATOM   4325 N  N     . GLU B 1 81  ? 0.825   -24.368 -33.307 1.00 71.20  ? 81  GLU B N     1 
ATOM   4326 C  CA    . GLU B 1 81  ? 1.840   -25.120 -34.055 1.00 77.54  ? 81  GLU B CA    1 
ATOM   4327 C  C     . GLU B 1 81  ? 1.229   -26.050 -35.101 1.00 80.45  ? 81  GLU B C     1 
ATOM   4328 O  O     . GLU B 1 81  ? 1.694   -26.095 -36.242 1.00 84.79  ? 81  GLU B O     1 
ATOM   4329 C  CB    . GLU B 1 81  ? 2.735   -25.916 -33.100 1.00 81.01  ? 81  GLU B CB    1 
ATOM   4330 C  CG    . GLU B 1 81  ? 3.620   -26.953 -33.785 1.00 89.01  ? 81  GLU B CG    1 
ATOM   4331 C  CD    . GLU B 1 81  ? 4.018   -28.093 -32.863 1.00 93.68  ? 81  GLU B CD    1 
ATOM   4332 O  OE1   . GLU B 1 81  ? 4.391   -27.813 -31.699 1.00 93.11  ? 81  GLU B OE1   1 
ATOM   4333 O  OE2   . GLU B 1 81  ? 3.963   -29.266 -33.306 1.00 98.29  ? 81  GLU B OE2   1 
ATOM   4334 N  N     . ILE B 1 82  ? 0.199   -26.794 -34.697 1.00 78.91  ? 82  ILE B N     1 
ATOM   4335 C  CA    . ILE B 1 82  ? -0.522  -27.688 -35.605 1.00 81.91  ? 82  ILE B CA    1 
ATOM   4336 C  C     . ILE B 1 82  ? -1.201  -26.868 -36.696 1.00 79.82  ? 82  ILE B C     1 
ATOM   4337 O  O     . ILE B 1 82  ? -1.152  -27.226 -37.874 1.00 84.66  ? 82  ILE B O     1 
ATOM   4338 C  CB    . ILE B 1 82  ? -1.544  -28.588 -34.851 1.00 81.35  ? 82  ILE B CB    1 
ATOM   4339 C  CG1   . ILE B 1 82  ? -0.801  -29.725 -34.117 1.00 86.33  ? 82  ILE B CG1   1 
ATOM   4340 C  CG2   . ILE B 1 82  ? -2.528  -29.220 -35.828 1.00 83.85  ? 82  ILE B CG2   1 
ATOM   4341 C  CD1   . ILE B 1 82  ? -1.609  -30.133 -32.723 1.00 84.47  ? 82  ILE B CD1   1 
ATOM   4342 N  N     . GLY B 1 83  ? -1.812  -25.758 -36.294 1.00 73.38  ? 83  GLY B N     1 
ATOM   4343 C  CA    . GLY B 1 83  ? -2.395  -24.818 -37.230 1.00 71.21  ? 83  GLY B CA    1 
ATOM   4344 C  C     . GLY B 1 83  ? -1.407  -24.399 -38.299 1.00 75.42  ? 83  GLY B C     1 
ATOM   4345 O  O     . GLY B 1 83  ? -1.628  -24.680 -39.475 1.00 79.62  ? 83  GLY B O     1 
ATOM   4346 N  N     . LYS B 1 84  ? -0.315  -23.748 -37.885 1.00 75.26  ? 84  LYS B N     1 
ATOM   4347 C  CA    . LYS B 1 84  ? 0.732   -23.261 -38.802 1.00 80.25  ? 84  LYS B CA    1 
ATOM   4348 C  C     . LYS B 1 84  ? 1.166   -24.349 -39.770 1.00 88.16  ? 84  LYS B C     1 
ATOM   4349 O  O     . LYS B 1 84  ? 1.356   -24.091 -40.965 1.00 93.03  ? 84  LYS B O     1 
ATOM   4350 C  CB    . LYS B 1 84  ? 1.981   -22.792 -38.039 1.00 80.94  ? 84  LYS B CB    1 
ATOM   4351 C  CG    . LYS B 1 84  ? 1.830   -21.572 -37.143 1.00 74.80  ? 84  LYS B CG    1 
ATOM   4352 C  CD    . LYS B 1 84  ? 3.179   -21.201 -36.530 1.00 76.86  ? 84  LYS B CD    1 
ATOM   4353 C  CE    . LYS B 1 84  ? 3.008   -20.439 -35.228 1.00 71.10  ? 84  LYS B CE    1 
ATOM   4354 N  NZ    . LYS B 1 84  ? 4.292   -19.904 -34.701 1.00 73.57  ? 84  LYS B NZ    1 
ATOM   4355 N  N     . ALA B 1 85  ? 1.329   -25.557 -39.220 1.00 90.03  ? 85  ALA B N     1 
ATOM   4356 C  CA    . ALA B 1 85  ? 1.730   -26.756 -39.958 1.00 97.97  ? 85  ALA B CA    1 
ATOM   4357 C  C     . ALA B 1 85  ? 0.746   -27.119 -41.063 1.00 100.55 ? 85  ALA B C     1 
ATOM   4358 O  O     . ALA B 1 85  ? 1.153   -27.457 -42.171 1.00 108.29 ? 85  ALA B O     1 
ATOM   4359 C  CB    . ALA B 1 85  ? 1.896   -27.932 -38.999 1.00 98.69  ? 85  ALA B CB    1 
ATOM   4360 N  N     . VAL B 1 86  ? -0.544  -27.024 -40.753 1.00 94.93  ? 86  VAL B N     1 
ATOM   4361 C  CA    . VAL B 1 86  ? -1.608  -27.485 -41.641 1.00 97.38  ? 86  VAL B CA    1 
ATOM   4362 C  C     . VAL B 1 86  ? -1.959  -26.519 -42.786 1.00 98.54  ? 86  VAL B C     1 
ATOM   4363 O  O     . VAL B 1 86  ? -2.216  -26.960 -43.905 1.00 104.99 ? 86  VAL B O     1 
ATOM   4364 C  CB    . VAL B 1 86  ? -2.861  -27.886 -40.822 1.00 92.13  ? 86  VAL B CB    1 
ATOM   4365 C  CG1   . VAL B 1 86  ? -4.116  -27.880 -41.676 1.00 92.89  ? 86  VAL B CG1   1 
ATOM   4366 C  CG2   . VAL B 1 86  ? -2.652  -29.258 -40.194 1.00 95.40  ? 86  VAL B CG2   1 
ATOM   4367 N  N     . LEU B 1 87  ? -1.959  -25.216 -42.516 1.00 93.33  ? 87  LEU B N     1 
ATOM   4368 C  CA    . LEU B 1 87  ? -2.348  -24.216 -43.526 1.00 94.41  ? 87  LEU B CA    1 
ATOM   4369 C  C     . LEU B 1 87  ? -1.229  -23.878 -44.527 1.00 102.15 ? 87  LEU B C     1 
ATOM   4370 O  O     . LEU B 1 87  ? -0.100  -24.368 -44.395 1.00 106.52 ? 87  LEU B O     1 
ATOM   4371 C  CB    . LEU B 1 87  ? -2.864  -22.946 -42.837 1.00 86.35  ? 87  LEU B CB    1 
ATOM   4372 C  CG    . LEU B 1 87  ? -4.147  -23.113 -42.011 1.00 80.22  ? 87  LEU B CG    1 
ATOM   4373 C  CD1   . LEU B 1 87  ? -4.215  -22.092 -40.892 1.00 73.17  ? 87  LEU B CD1   1 
ATOM   4374 C  CD2   . LEU B 1 87  ? -5.388  -23.030 -42.887 1.00 81.45  ? 87  LEU B CD2   1 
ATOM   4375 N  N     . ASP B 1 88  ? -1.559  -23.061 -45.533 1.00 104.63 ? 88  ASP B N     1 
ATOM   4376 C  CA    . ASP B 1 88  ? -0.566  -22.505 -46.465 1.00 112.32 ? 88  ASP B CA    1 
ATOM   4377 C  C     . ASP B 1 88  ? -0.032  -21.193 -45.900 1.00 107.89 ? 88  ASP B C     1 
ATOM   4378 O  O     . ASP B 1 88  ? 0.818   -21.200 -45.010 1.00 105.74 ? 88  ASP B O     1 
ATOM   4379 C  CB    . ASP B 1 88  ? -1.166  -22.286 -47.859 1.00 118.76 ? 88  ASP B CB    1 
ATOM   4380 C  CG    . ASP B 1 88  ? -1.529  -23.588 -48.557 1.00 125.76 ? 88  ASP B CG    1 
ATOM   4381 O  OD1   . ASP B 1 88  ? -1.794  -24.600 -47.868 1.00 123.30 ? 88  ASP B OD1   1 
ATOM   4382 O  OD2   . ASP B 1 88  ? -1.557  -23.595 -49.808 1.00 134.88 ? 88  ASP B OD2   1 
ATOM   4383 N  N     . SER B 1 89  ? -0.523  -20.068 -46.410 1.00 107.11 ? 89  SER B N     1 
ATOM   4384 C  CA    . SER B 1 89  ? -0.318  -18.797 -45.722 1.00 101.70 ? 89  SER B CA    1 
ATOM   4385 C  C     . SER B 1 89  ? -1.331  -18.733 -44.576 1.00 91.22  ? 89  SER B C     1 
ATOM   4386 O  O     . SER B 1 89  ? -2.458  -19.233 -44.701 1.00 88.92  ? 89  SER B O     1 
ATOM   4387 C  CB    . SER B 1 89  ? -0.452  -17.607 -46.672 1.00 105.61 ? 89  SER B CB    1 
ATOM   4388 O  OG    . SER B 1 89  ? -1.703  -17.617 -47.327 1.00 105.35 ? 89  SER B OG    1 
ATOM   4389 N  N     . TYR B 1 90  ? -0.909  -18.152 -43.455 1.00 85.72  ? 90  TYR B N     1 
ATOM   4390 C  CA    . TYR B 1 90  ? -1.687  -18.176 -42.219 1.00 76.86  ? 90  TYR B CA    1 
ATOM   4391 C  C     . TYR B 1 90  ? -1.549  -16.851 -41.470 1.00 72.60  ? 90  TYR B C     1 
ATOM   4392 O  O     . TYR B 1 90  ? -0.677  -16.040 -41.785 1.00 76.37  ? 90  TYR B O     1 
ATOM   4393 C  CB    . TYR B 1 90  ? -1.235  -19.342 -41.329 1.00 75.69  ? 90  TYR B CB    1 
ATOM   4394 C  CG    . TYR B 1 90  ? 0.119   -19.128 -40.691 1.00 76.92  ? 90  TYR B CG    1 
ATOM   4395 C  CD1   . TYR B 1 90  ? 0.223   -18.617 -39.401 1.00 71.55  ? 90  TYR B CD1   1 
ATOM   4396 C  CD2   . TYR B 1 90  ? 1.296   -19.421 -41.379 1.00 84.47  ? 90  TYR B CD2   1 
ATOM   4397 C  CE1   . TYR B 1 90  ? 1.461   -18.404 -38.807 1.00 73.26  ? 90  TYR B CE1   1 
ATOM   4398 C  CE2   . TYR B 1 90  ? 2.544   -19.211 -40.791 1.00 86.43  ? 90  TYR B CE2   1 
ATOM   4399 C  CZ    . TYR B 1 90  ? 2.613   -18.702 -39.504 1.00 80.58  ? 90  TYR B CZ    1 
ATOM   4400 O  OH    . TYR B 1 90  ? 3.828   -18.488 -38.904 1.00 83.06  ? 90  TYR B OH    1 
ATOM   4401 N  N     . GLU B 1 91  ? -2.399  -16.655 -40.466 1.00 65.66  ? 91  GLU B N     1 
ATOM   4402 C  CA    . GLU B 1 91  ? -2.465  -15.400 -39.723 1.00 61.69  ? 91  GLU B CA    1 
ATOM   4403 C  C     . GLU B 1 91  ? -2.905  -15.630 -38.274 1.00 55.59  ? 91  GLU B C     1 
ATOM   4404 O  O     . GLU B 1 91  ? -3.823  -16.420 -38.006 1.00 53.49  ? 91  GLU B O     1 
ATOM   4405 C  CB    . GLU B 1 91  ? -3.436  -14.447 -40.417 1.00 61.18  ? 91  GLU B CB    1 
ATOM   4406 C  CG    . GLU B 1 91  ? -3.350  -13.020 -39.936 1.00 60.07  ? 91  GLU B CG    1 
ATOM   4407 C  CD    . GLU B 1 91  ? -4.013  -12.056 -40.891 1.00 63.26  ? 91  GLU B CD    1 
ATOM   4408 O  OE1   . GLU B 1 91  ? -4.859  -12.504 -41.696 1.00 64.78  ? 91  GLU B OE1   1 
ATOM   4409 O  OE2   . GLU B 1 91  ? -3.689  -10.848 -40.838 1.00 64.77  ? 91  GLU B OE2   1 
ATOM   4410 N  N     . ILE B 1 92  ? -2.248  -14.951 -37.339 1.00 53.53  ? 92  ILE B N     1 
ATOM   4411 C  CA    . ILE B 1 92  ? -2.702  -14.984 -35.955 1.00 48.32  ? 92  ILE B CA    1 
ATOM   4412 C  C     . ILE B 1 92  ? -2.957  -13.587 -35.416 1.00 45.91  ? 92  ILE B C     1 
ATOM   4413 O  O     . ILE B 1 92  ? -2.086  -12.711 -35.448 1.00 48.44  ? 92  ILE B O     1 
ATOM   4414 C  CB    . ILE B 1 92  ? -1.769  -15.807 -35.022 1.00 49.15  ? 92  ILE B CB    1 
ATOM   4415 C  CG1   . ILE B 1 92  ? -2.025  -17.303 -35.192 1.00 49.63  ? 92  ILE B CG1   1 
ATOM   4416 C  CG2   . ILE B 1 92  ? -2.004  -15.468 -33.561 1.00 45.87  ? 92  ILE B CG2   1 
ATOM   4417 C  CD1   . ILE B 1 92  ? -0.975  -18.003 -35.995 1.00 54.74  ? 92  ILE B CD1   1 
ATOM   4418 N  N     . ARG B 1 93  ? -4.184  -13.398 -34.951 1.00 41.58  ? 93  ARG B N     1 
ATOM   4419 C  CA    . ARG B 1 93  ? -4.622  -12.192 -34.292 1.00 39.03  ? 93  ARG B CA    1 
ATOM   4420 C  C     . ARG B 1 93  ? -5.963  -12.506 -33.650 1.00 35.17  ? 93  ARG B C     1 
ATOM   4421 O  O     . ARG B 1 93  ? -6.980  -12.638 -34.327 1.00 34.27  ? 93  ARG B O     1 
ATOM   4422 C  CB    . ARG B 1 93  ? -4.738  -11.026 -35.287 1.00 41.32  ? 93  ARG B CB    1 
ATOM   4423 C  CG    . ARG B 1 93  ? -3.711  -9.892  -35.093 1.00 44.74  ? 93  ARG B CG    1 
ATOM   4424 C  CD    . ARG B 1 93  ? -4.168  -8.944  -33.992 1.00 43.96  ? 93  ARG B CD    1 
ATOM   4425 N  NE    . ARG B 1 93  ? -3.188  -7.914  -33.669 1.00 48.12  ? 93  ARG B NE    1 
ATOM   4426 C  CZ    . ARG B 1 93  ? -3.126  -6.722  -34.261 1.00 51.93  ? 93  ARG B CZ    1 
ATOM   4427 N  NH1   . ARG B 1 93  ? -3.977  -6.398  -35.229 1.00 52.14  ? 93  ARG B NH1   1 
ATOM   4428 N  NH2   . ARG B 1 93  ? -2.203  -5.851  -33.886 1.00 55.31  ? 93  ARG B NH2   1 
ATOM   4429 N  N     . TYR B 1 94  ? -5.949  -12.649 -32.334 1.00 33.38  ? 94  TYR B N     1 
ATOM   4430 C  CA    . TYR B 1 94  ? -7.155  -12.946 -31.586 1.00 31.06  ? 94  TYR B CA    1 
ATOM   4431 C  C     . TYR B 1 94  ? -7.187  -12.132 -30.289 1.00 30.95  ? 94  TYR B C     1 
ATOM   4432 O  O     . TYR B 1 94  ? -6.181  -11.566 -29.882 1.00 31.85  ? 94  TYR B O     1 
ATOM   4433 C  CB    . TYR B 1 94  ? -7.255  -14.458 -31.326 1.00 31.07  ? 94  TYR B CB    1 
ATOM   4434 C  CG    . TYR B 1 94  ? -6.077  -15.036 -30.575 1.00 32.26  ? 94  TYR B CG    1 
ATOM   4435 C  CD1   . TYR B 1 94  ? -6.045  -15.016 -29.181 1.00 33.00  ? 94  TYR B CD1   1 
ATOM   4436 C  CD2   . TYR B 1 94  ? -4.993  -15.598 -31.250 1.00 33.53  ? 94  TYR B CD2   1 
ATOM   4437 C  CE1   . TYR B 1 94  ? -4.966  -15.530 -28.470 1.00 34.80  ? 94  TYR B CE1   1 
ATOM   4438 C  CE2   . TYR B 1 94  ? -3.901  -16.124 -30.541 1.00 35.42  ? 94  TYR B CE2   1 
ATOM   4439 C  CZ    . TYR B 1 94  ? -3.900  -16.086 -29.147 1.00 35.72  ? 94  TYR B CZ    1 
ATOM   4440 O  OH    . TYR B 1 94  ? -2.852  -16.597 -28.415 1.00 37.52  ? 94  TYR B OH    1 
ATOM   4441 N  N     . ALA B 1 95  ? -8.351  -12.069 -29.653 1.00 30.65  ? 95  ALA B N     1 
ATOM   4442 C  CA    . ALA B 1 95  ? -8.521  -11.270 -28.445 1.00 32.13  ? 95  ALA B CA    1 
ATOM   4443 C  C     . ALA B 1 95  ? -8.413  -12.100 -27.167 1.00 33.97  ? 95  ALA B C     1 
ATOM   4444 O  O     . ALA B 1 95  ? -7.867  -11.628 -26.167 1.00 36.18  ? 95  ALA B O     1 
ATOM   4445 C  CB    . ALA B 1 95  ? -9.837  -10.486 -28.490 1.00 32.12  ? 95  ALA B CB    1 
ATOM   4446 N  N     . GLU B 1 96  ? -8.928  -13.327 -27.190 1.00 34.12  ? 96  GLU B N     1 
ATOM   4447 C  CA    . GLU B 1 96  ? -8.702  -14.257 -26.075 1.00 36.78  ? 96  GLU B CA    1 
ATOM   4448 C  C     . GLU B 1 96  ? -8.339  -15.661 -26.533 1.00 36.65  ? 96  GLU B C     1 
ATOM   4449 O  O     . GLU B 1 96  ? -7.194  -16.056 -26.382 1.00 37.54  ? 96  GLU B O     1 
ATOM   4450 C  CB    . GLU B 1 96  ? -9.872  -14.265 -25.083 1.00 39.56  ? 96  GLU B CB    1 
ATOM   4451 C  CG    . GLU B 1 96  ? -9.627  -15.065 -23.807 1.00 44.10  ? 96  GLU B CG    1 
ATOM   4452 C  CD    . GLU B 1 96  ? -10.086 -16.512 -23.921 1.00 47.41  ? 96  GLU B CD    1 
ATOM   4453 O  OE1   . GLU B 1 96  ? -11.169 -16.744 -24.505 1.00 47.22  ? 96  GLU B OE1   1 
ATOM   4454 O  OE2   . GLU B 1 96  ? -9.373  -17.420 -23.421 1.00 50.44  ? 96  GLU B OE2   1 
ATOM   4455 N  N     . HIS B 1 97  ? -9.298  -16.410 -27.084 1.00 36.44  ? 97  HIS B N     1 
ATOM   4456 C  CA    . HIS B 1 97  ? -9.060  -17.815 -27.438 1.00 37.37  ? 97  HIS B CA    1 
ATOM   4457 C  C     . HIS B 1 97  ? -8.282  -17.986 -28.744 1.00 36.03  ? 97  HIS B C     1 
ATOM   4458 O  O     . HIS B 1 97  ? -8.751  -17.590 -29.811 1.00 34.42  ? 97  HIS B O     1 
ATOM   4459 C  CB    . HIS B 1 97  ? -10.355 -18.632 -27.459 1.00 38.74  ? 97  HIS B CB    1 
ATOM   4460 C  CG    . HIS B 1 97  ? -10.123 -20.112 -27.457 1.00 41.55  ? 97  HIS B CG    1 
ATOM   4461 N  ND1   . HIS B 1 97  ? -10.312 -20.901 -28.573 1.00 41.37  ? 97  HIS B ND1   1 
ATOM   4462 C  CD2   . HIS B 1 97  ? -9.680  -20.943 -26.481 1.00 44.77  ? 97  HIS B CD2   1 
ATOM   4463 C  CE1   . HIS B 1 97  ? -10.009 -22.153 -28.281 1.00 43.73  ? 97  HIS B CE1   1 
ATOM   4464 N  NE2   . HIS B 1 97  ? -9.622  -22.207 -27.019 1.00 45.49  ? 97  HIS B NE2   1 
ATOM   4465 N  N     . PRO B 1 98  ? -7.088  -18.596 -28.653 1.00 37.71  ? 98  PRO B N     1 
ATOM   4466 C  CA    . PRO B 1 98  ? -6.139  -18.742 -29.756 1.00 38.10  ? 98  PRO B CA    1 
ATOM   4467 C  C     . PRO B 1 98  ? -6.615  -19.658 -30.871 1.00 39.16  ? 98  PRO B C     1 
ATOM   4468 O  O     . PRO B 1 98  ? -6.880  -20.836 -30.636 1.00 41.23  ? 98  PRO B O     1 
ATOM   4469 C  CB    . PRO B 1 98  ? -4.898  -19.346 -29.080 1.00 40.42  ? 98  PRO B CB    1 
ATOM   4470 C  CG    . PRO B 1 98  ? -5.416  -20.042 -27.885 1.00 42.12  ? 98  PRO B CG    1 
ATOM   4471 C  CD    . PRO B 1 98  ? -6.577  -19.210 -27.413 1.00 40.49  ? 98  PRO B CD    1 
ATOM   4472 N  N     . TYR B 1 99  ? -6.729  -19.109 -32.074 1.00 38.66  ? 99  TYR B N     1 
ATOM   4473 C  CA    . TYR B 1 99  ? -6.951  -19.916 -33.263 1.00 41.00  ? 99  TYR B CA    1 
ATOM   4474 C  C     . TYR B 1 99  ? -5.950  -19.481 -34.309 1.00 42.87  ? 99  TYR B C     1 
ATOM   4475 O  O     . TYR B 1 99  ? -5.082  -18.648 -34.029 1.00 42.85  ? 99  TYR B O     1 
ATOM   4476 C  CB    . TYR B 1 99  ? -8.378  -19.759 -33.780 1.00 39.93  ? 99  TYR B CB    1 
ATOM   4477 C  CG    . TYR B 1 99  ? -8.740  -18.368 -34.258 1.00 38.20  ? 99  TYR B CG    1 
ATOM   4478 C  CD1   . TYR B 1 99  ? -8.828  -18.080 -35.619 1.00 39.59  ? 99  TYR B CD1   1 
ATOM   4479 C  CD2   . TYR B 1 99  ? -9.015  -17.340 -33.350 1.00 36.35  ? 99  TYR B CD2   1 
ATOM   4480 C  CE1   . TYR B 1 99  ? -9.173  -16.798 -36.067 1.00 38.29  ? 99  TYR B CE1   1 
ATOM   4481 C  CE2   . TYR B 1 99  ? -9.358  -16.058 -33.792 1.00 34.70  ? 99  TYR B CE2   1 
ATOM   4482 C  CZ    . TYR B 1 99  ? -9.437  -15.802 -35.147 1.00 35.55  ? 99  TYR B CZ    1 
ATOM   4483 O  OH    . TYR B 1 99  ? -9.781  -14.550 -35.583 1.00 35.26  ? 99  TYR B OH    1 
ATOM   4484 N  N     . VAL B 1 100 ? -6.053  -20.048 -35.507 1.00 45.93  ? 100 VAL B N     1 
ATOM   4485 C  CA    . VAL B 1 100 ? -5.210  -19.619 -36.625 1.00 48.91  ? 100 VAL B CA    1 
ATOM   4486 C  C     . VAL B 1 100 ? -6.010  -19.566 -37.926 1.00 50.92  ? 100 VAL B C     1 
ATOM   4487 O  O     . VAL B 1 100 ? -6.582  -20.567 -38.357 1.00 52.93  ? 100 VAL B O     1 
ATOM   4488 C  CB    . VAL B 1 100 ? -3.853  -20.408 -36.717 1.00 52.88  ? 100 VAL B CB    1 
ATOM   4489 C  CG1   . VAL B 1 100 ? -4.025  -21.857 -36.338 1.00 54.37  ? 100 VAL B CG1   1 
ATOM   4490 C  CG2   . VAL B 1 100 ? -3.202  -20.263 -38.091 1.00 57.73  ? 100 VAL B CG2   1 
ATOM   4491 N  N     . HIS B 1 101 ? -6.073  -18.368 -38.506 1.00 50.99  ? 101 HIS B N     1 
ATOM   4492 C  CA    . HIS B 1 101 ? -6.792  -18.121 -39.745 1.00 53.63  ? 101 HIS B CA    1 
ATOM   4493 C  C     . HIS B 1 101 ? -5.834  -18.297 -40.907 1.00 59.94  ? 101 HIS B C     1 
ATOM   4494 O  O     . HIS B 1 101 ? -4.675  -17.905 -40.811 1.00 61.50  ? 101 HIS B O     1 
ATOM   4495 C  CB    . HIS B 1 101 ? -7.367  -16.706 -39.749 1.00 51.08  ? 101 HIS B CB    1 
ATOM   4496 C  CG    . HIS B 1 101 ? -8.043  -16.334 -41.032 1.00 54.42  ? 101 HIS B CG    1 
ATOM   4497 N  ND1   . HIS B 1 101 ? -9.373  -16.604 -41.278 1.00 53.88  ? 101 HIS B ND1   1 
ATOM   4498 C  CD2   . HIS B 1 101 ? -7.571  -15.723 -42.145 1.00 59.00  ? 101 HIS B CD2   1 
ATOM   4499 C  CE1   . HIS B 1 101 ? -9.692  -16.171 -42.484 1.00 57.46  ? 101 HIS B CE1   1 
ATOM   4500 N  NE2   . HIS B 1 101 ? -8.617  -15.634 -43.033 1.00 60.76  ? 101 HIS B NE2   1 
ATOM   4501 N  N     . GLY B 1 102 ? -6.318  -18.884 -42.001 1.00 64.55  ? 102 GLY B N     1 
ATOM   4502 C  CA    . GLY B 1 102 ? -5.459  -19.177 -43.146 1.00 72.44  ? 102 GLY B CA    1 
ATOM   4503 C  C     . GLY B 1 102 ? -6.148  -19.418 -44.480 1.00 78.28  ? 102 GLY B C     1 
ATOM   4504 O  O     . GLY B 1 102 ? -7.330  -19.100 -44.654 1.00 76.21  ? 102 GLY B O     1 
ATOM   4505 N  N     . VAL B 1 103 ? -5.382  -19.990 -45.414 1.00 86.33  ? 103 VAL B N     1 
ATOM   4506 C  CA    . VAL B 1 103 ? -5.799  -20.233 -46.799 1.00 93.94  ? 103 VAL B CA    1 
ATOM   4507 C  C     . VAL B 1 103 ? -5.373  -21.642 -47.232 1.00 100.69 ? 103 VAL B C     1 
ATOM   4508 O  O     . VAL B 1 103 ? -4.254  -22.066 -46.937 1.00 102.93 ? 103 VAL B O     1 
ATOM   4509 C  CB    . VAL B 1 103 ? -5.142  -19.201 -47.766 1.00 99.81  ? 103 VAL B CB    1 
ATOM   4510 C  CG1   . VAL B 1 103 ? -5.601  -19.415 -49.215 1.00 108.59 ? 103 VAL B CG1   1 
ATOM   4511 C  CG2   . VAL B 1 103 ? -5.420  -17.768 -47.316 1.00 94.08  ? 103 VAL B CG2   1 
ATOM   4512 N  N     . VAL B 1 104 ? -6.261  -22.363 -47.920 1.00 104.71 ? 104 VAL B N     1 
ATOM   4513 C  CA    . VAL B 1 104 ? -5.901  -23.645 -48.559 1.00 113.17 ? 104 VAL B CA    1 
ATOM   4514 C  C     . VAL B 1 104 ? -6.543  -23.805 -49.945 1.00 121.70 ? 104 VAL B C     1 
ATOM   4515 O  O     . VAL B 1 104 ? -7.733  -23.522 -50.124 1.00 119.47 ? 104 VAL B O     1 
ATOM   4516 C  CB    . VAL B 1 104 ? -6.200  -24.882 -47.658 1.00 110.19 ? 104 VAL B CB    1 
ATOM   4517 C  CG1   . VAL B 1 104 ? -7.691  -25.194 -47.618 1.00 107.71 ? 104 VAL B CG1   1 
ATOM   4518 C  CG2   . VAL B 1 104 ? -5.411  -26.100 -48.140 1.00 118.94 ? 104 VAL B CG2   1 
ATOM   4519 N  N     . LYS B 1 105 ? -5.738  -24.256 -50.911 1.00 132.25 ? 105 LYS B N     1 
ATOM   4520 C  CA    . LYS B 1 105 ? -6.138  -24.374 -52.322 1.00 142.64 ? 105 LYS B CA    1 
ATOM   4521 C  C     . LYS B 1 105 ? -6.661  -23.057 -52.909 1.00 142.52 ? 105 LYS B C     1 
ATOM   4522 O  O     . LYS B 1 105 ? -6.698  -22.879 -54.129 1.00 152.21 ? 105 LYS B O     1 
ATOM   4523 C  CB    . LYS B 1 105 ? -7.156  -25.505 -52.523 1.00 145.12 ? 105 LYS B CB    1 
ATOM   4524 C  CG    . LYS B 1 105 ? -6.550  -26.901 -52.573 1.00 151.63 ? 105 LYS B CG    1 
ATOM   4525 C  CD    . LYS B 1 105 ? -7.599  -27.926 -52.987 1.00 156.03 ? 105 LYS B CD    1 
ATOM   4526 C  CE    . LYS B 1 105 ? -7.018  -29.325 -53.109 1.00 163.67 ? 105 LYS B CE    1 
ATOM   4527 N  NZ    . LYS B 1 105 ? -6.281  -29.530 -54.383 1.00 177.14 ? 105 LYS B NZ    1 
ATOM   4528 N  N     . GLY B 1 106 ? -7.055  -22.143 -52.026 1.00 132.45 ? 106 GLY B N     1 
ATOM   4529 C  CA    . GLY B 1 106 ? -7.593  -20.846 -52.413 1.00 131.61 ? 106 GLY B CA    1 
ATOM   4530 C  C     . GLY B 1 106 ? -8.649  -20.305 -51.463 1.00 121.04 ? 106 GLY B C     1 
ATOM   4531 O  O     . GLY B 1 106 ? -9.022  -19.137 -51.565 1.00 118.79 ? 106 GLY B O     1 
ATOM   4532 N  N     . VAL B 1 107 ? -9.131  -21.143 -50.542 1.00 115.38 ? 107 VAL B N     1 
ATOM   4533 C  CA    . VAL B 1 107 ? -10.218 -20.746 -49.634 1.00 106.72 ? 107 VAL B CA    1 
ATOM   4534 C  C     . VAL B 1 107 ? -9.792  -20.527 -48.184 1.00 97.93  ? 107 VAL B C     1 
ATOM   4535 O  O     . VAL B 1 107 ? -8.811  -21.110 -47.711 1.00 97.89  ? 107 VAL B O     1 
ATOM   4536 C  CB    . VAL B 1 107 ? -11.428 -21.718 -49.671 1.00 107.57 ? 107 VAL B CB    1 
ATOM   4537 C  CG1   . VAL B 1 107 ? -12.198 -21.572 -50.985 1.00 115.28 ? 107 VAL B CG1   1 
ATOM   4538 C  CG2   . VAL B 1 107 ? -10.989 -23.159 -49.429 1.00 110.28 ? 107 VAL B CG2   1 
ATOM   4539 N  N     . GLU B 1 108 ? -10.562 -19.687 -47.494 1.00 91.31  ? 108 GLU B N     1 
ATOM   4540 C  CA    . GLU B 1 108 ? -10.283 -19.287 -46.118 1.00 83.50  ? 108 GLU B CA    1 
ATOM   4541 C  C     . GLU B 1 108 ? -10.588 -20.391 -45.109 1.00 80.32  ? 108 GLU B C     1 
ATOM   4542 O  O     . GLU B 1 108 ? -11.591 -21.103 -45.235 1.00 81.66  ? 108 GLU B O     1 
ATOM   4543 C  CB    . GLU B 1 108 ? -11.081 -18.035 -45.769 1.00 78.66  ? 108 GLU B CB    1 
ATOM   4544 C  CG    . GLU B 1 108 ? -10.680 -16.812 -46.554 1.00 81.54  ? 108 GLU B CG    1 
ATOM   4545 C  CD    . GLU B 1 108 ? -10.884 -15.538 -45.764 1.00 76.68  ? 108 GLU B CD    1 
ATOM   4546 O  OE1   . GLU B 1 108 ? -11.642 -15.556 -44.769 1.00 71.29  ? 108 GLU B OE1   1 
ATOM   4547 O  OE2   . GLU B 1 108 ? -10.283 -14.511 -46.134 1.00 79.12  ? 108 GLU B OE2   1 
ATOM   4548 N  N     . VAL B 1 109 ? -9.721  -20.529 -44.108 1.00 76.95  ? 109 VAL B N     1 
ATOM   4549 C  CA    . VAL B 1 109 ? -9.866  -21.592 -43.106 1.00 74.82  ? 109 VAL B CA    1 
ATOM   4550 C  C     . VAL B 1 109 ? -9.622  -21.087 -41.682 1.00 68.31  ? 109 VAL B C     1 
ATOM   4551 O  O     . VAL B 1 109 ? -8.847  -20.151 -41.462 1.00 66.29  ? 109 VAL B O     1 
ATOM   4552 C  CB    . VAL B 1 109 ? -8.923  -22.803 -43.382 1.00 80.04  ? 109 VAL B CB    1 
ATOM   4553 C  CG1   . VAL B 1 109 ? -9.459  -24.069 -42.725 1.00 80.00  ? 109 VAL B CG1   1 
ATOM   4554 C  CG2   . VAL B 1 109 ? -8.739  -23.034 -44.872 1.00 87.82  ? 109 VAL B CG2   1 
ATOM   4555 N  N     . ASP B 1 110 ? -10.310 -21.714 -40.731 1.00 65.87  ? 110 ASP B N     1 
ATOM   4556 C  CA    . ASP B 1 110 ? -10.081 -21.498 -39.314 1.00 61.31  ? 110 ASP B CA    1 
ATOM   4557 C  C     . ASP B 1 110 ? -9.775  -22.823 -38.662 1.00 63.20  ? 110 ASP B C     1 
ATOM   4558 O  O     . ASP B 1 110 ? -10.489 -23.802 -38.868 1.00 66.35  ? 110 ASP B O     1 
ATOM   4559 C  CB    . ASP B 1 110 ? -11.320 -20.908 -38.645 1.00 57.80  ? 110 ASP B CB    1 
ATOM   4560 C  CG    . ASP B 1 110 ? -11.271 -19.401 -38.542 1.00 54.17  ? 110 ASP B CG    1 
ATOM   4561 O  OD1   . ASP B 1 110 ? -12.187 -18.839 -37.914 1.00 50.48  ? 110 ASP B OD1   1 
ATOM   4562 O  OD2   . ASP B 1 110 ? -10.327 -18.784 -39.085 1.00 55.10  ? 110 ASP B OD2   1 
ATOM   4563 N  N     . VAL B 1 111 ? -8.712  -22.858 -37.875 1.00 62.13  ? 111 VAL B N     1 
ATOM   4564 C  CA    . VAL B 1 111 ? -8.424  -24.038 -37.082 1.00 63.98  ? 111 VAL B CA    1 
ATOM   4565 C  C     . VAL B 1 111 ? -8.251  -23.653 -35.616 1.00 60.61  ? 111 VAL B C     1 
ATOM   4566 O  O     . VAL B 1 111 ? -7.341  -22.907 -35.245 1.00 58.77  ? 111 VAL B O     1 
ATOM   4567 C  CB    . VAL B 1 111 ? -7.261  -24.901 -37.664 1.00 68.79  ? 111 VAL B CB    1 
ATOM   4568 C  CG1   . VAL B 1 111 ? -6.157  -24.037 -38.246 1.00 69.02  ? 111 VAL B CG1   1 
ATOM   4569 C  CG2   . VAL B 1 111 ? -6.712  -25.858 -36.616 1.00 69.98  ? 111 VAL B CG2   1 
ATOM   4570 N  N     . VAL B 1 112 ? -9.171  -24.155 -34.799 1.00 60.80  ? 112 VAL B N     1 
ATOM   4571 C  CA    . VAL B 1 112 ? -9.274  -23.779 -33.396 1.00 58.50  ? 112 VAL B CA    1 
ATOM   4572 C  C     . VAL B 1 112 ? -8.977  -24.977 -32.487 1.00 61.76  ? 112 VAL B C     1 
ATOM   4573 O  O     . VAL B 1 112 ? -9.529  -26.062 -32.672 1.00 65.34  ? 112 VAL B O     1 
ATOM   4574 C  CB    . VAL B 1 112 ? -10.681 -23.209 -33.070 1.00 56.71  ? 112 VAL B CB    1 
ATOM   4575 C  CG1   . VAL B 1 112 ? -10.651 -22.395 -31.787 1.00 54.48  ? 112 VAL B CG1   1 
ATOM   4576 C  CG2   . VAL B 1 112 ? -11.206 -22.355 -34.223 1.00 55.09  ? 112 VAL B CG2   1 
ATOM   4577 N  N     . PRO B 1 113 ? -8.070  -24.790 -31.522 1.00 61.34  ? 113 PRO B N     1 
ATOM   4578 C  CA    . PRO B 1 113 ? -7.914  -25.756 -30.448 1.00 64.91  ? 113 PRO B CA    1 
ATOM   4579 C  C     . PRO B 1 113 ? -9.067  -25.669 -29.446 1.00 65.52  ? 113 PRO B C     1 
ATOM   4580 O  O     . PRO B 1 113 ? -9.716  -24.632 -29.352 1.00 62.37  ? 113 PRO B O     1 
ATOM   4581 C  CB    . PRO B 1 113 ? -6.596  -25.336 -29.793 1.00 64.26  ? 113 PRO B CB    1 
ATOM   4582 C  CG    . PRO B 1 113 ? -6.452  -23.904 -30.093 1.00 59.70  ? 113 PRO B CG    1 
ATOM   4583 C  CD    . PRO B 1 113 ? -7.106  -23.679 -31.419 1.00 58.53  ? 113 PRO B CD    1 
ATOM   4584 N  N     . CYS B 1 114 ? -9.315  -26.765 -28.726 1.00 70.47  ? 114 CYS B N     1 
ATOM   4585 C  CA    . CYS B 1 114 ? -10.345 -26.836 -27.683 1.00 73.07  ? 114 CYS B CA    1 
ATOM   4586 C  C     . CYS B 1 114 ? -10.186 -28.126 -26.874 1.00 79.37  ? 114 CYS B C     1 
ATOM   4587 O  O     . CYS B 1 114 ? -9.434  -29.024 -27.267 1.00 81.90  ? 114 CYS B O     1 
ATOM   4588 C  CB    . CYS B 1 114 ? -11.740 -26.798 -28.303 1.00 73.21  ? 114 CYS B CB    1 
ATOM   4589 S  SG    . CYS B 1 114 ? -12.262 -28.391 -28.967 1.00 80.55  ? 114 CYS B SG    1 
ATOM   4590 N  N     . TYR B 1 115 ? -10.909 -28.223 -25.759 1.00 82.92  ? 115 TYR B N     1 
ATOM   4591 C  CA    . TYR B 1 115 ? -10.858 -29.409 -24.901 1.00 89.89  ? 115 TYR B CA    1 
ATOM   4592 C  C     . TYR B 1 115 ? -12.016 -30.376 -25.151 1.00 95.07  ? 115 TYR B C     1 
ATOM   4593 O  O     . TYR B 1 115 ? -13.168 -29.958 -25.300 1.00 94.64  ? 115 TYR B O     1 
ATOM   4594 C  CB    . TYR B 1 115 ? -10.861 -29.012 -23.425 1.00 92.69  ? 115 TYR B CB    1 
ATOM   4595 C  CG    . TYR B 1 115 ? -9.666  -28.210 -22.958 1.00 89.86  ? 115 TYR B CG    1 
ATOM   4596 C  CD1   . TYR B 1 115 ? -9.808  -26.872 -22.591 1.00 86.34  ? 115 TYR B CD1   1 
ATOM   4597 C  CD2   . TYR B 1 115 ? -8.399  -28.792 -22.859 1.00 91.50  ? 115 TYR B CD2   1 
ATOM   4598 C  CE1   . TYR B 1 115 ? -8.721  -26.128 -22.145 1.00 84.37  ? 115 TYR B CE1   1 
ATOM   4599 C  CE2   . TYR B 1 115 ? -7.299  -28.057 -22.414 1.00 89.11  ? 115 TYR B CE2   1 
ATOM   4600 C  CZ    . TYR B 1 115 ? -7.471  -26.727 -22.057 1.00 85.87  ? 115 TYR B CZ    1 
ATOM   4601 O  OH    . TYR B 1 115 ? -6.397  -25.983 -21.617 1.00 84.80  ? 115 TYR B OH    1 
ATOM   4602 N  N     . LYS B 1 116 ? -11.691 -31.671 -25.175 1.00 100.68 ? 116 LYS B N     1 
ATOM   4603 C  CA    . LYS B 1 116 ? -12.667 -32.765 -25.288 1.00 107.21 ? 116 LYS B CA    1 
ATOM   4604 C  C     . LYS B 1 116 ? -13.408 -32.931 -23.959 1.00 113.39 ? 116 LYS B C     1 
ATOM   4605 O  O     . LYS B 1 116 ? -12.880 -33.518 -23.010 1.00 118.61 ? 116 LYS B O     1 
ATOM   4606 C  CB    . LYS B 1 116 ? -11.950 -34.068 -25.686 1.00 112.03 ? 116 LYS B CB    1 
ATOM   4607 C  CG    . LYS B 1 116 ? -12.846 -35.269 -26.000 1.00 119.54 ? 116 LYS B CG    1 
ATOM   4608 C  CD    . LYS B 1 116 ? -12.010 -36.534 -26.250 1.00 124.90 ? 116 LYS B CD    1 
ATOM   4609 C  CE    . LYS B 1 116 ? -12.893 -37.762 -26.447 1.00 133.03 ? 116 LYS B CE    1 
ATOM   4610 N  NZ    . LYS B 1 116 ? -12.098 -38.985 -26.763 1.00 138.25 ? 116 LYS B NZ    1 
ATOM   4611 N  N     . LEU B 1 117 ? -14.623 -32.388 -23.895 1.00 113.38 ? 117 LEU B N     1 
ATOM   4612 C  CA    . LEU B 1 117 ? -15.443 -32.448 -22.683 1.00 120.07 ? 117 LEU B CA    1 
ATOM   4613 C  C     . LEU B 1 117 ? -16.451 -33.591 -22.741 1.00 128.78 ? 117 LEU B C     1 
ATOM   4614 O  O     . LEU B 1 117 ? -16.847 -34.025 -23.821 1.00 128.20 ? 117 LEU B O     1 
ATOM   4615 C  CB    . LEU B 1 117 ? -16.165 -31.108 -22.446 1.00 116.23 ? 117 LEU B CB    1 
ATOM   4616 C  CG    . LEU B 1 117 ? -15.611 -30.035 -21.488 1.00 113.44 ? 117 LEU B CG    1 
ATOM   4617 C  CD1   . LEU B 1 117 ? -15.986 -30.309 -20.021 1.00 122.23 ? 117 LEU B CD1   1 
ATOM   4618 C  CD2   . LEU B 1 117 ? -14.103 -29.823 -21.638 1.00 107.65 ? 117 LEU B CD2   1 
ATOM   4619 N  N     . LYS B 1 118 ? -16.849 -34.081 -21.572 1.00 137.62 ? 118 LYS B N     1 
ATOM   4620 C  CA    . LYS B 1 118 ? -17.917 -35.071 -21.483 1.00 147.57 ? 118 LYS B CA    1 
ATOM   4621 C  C     . LYS B 1 118 ? -19.269 -34.405 -21.732 1.00 147.47 ? 118 LYS B C     1 
ATOM   4622 O  O     . LYS B 1 118 ? -20.112 -34.936 -22.460 1.00 150.70 ? 118 LYS B O     1 
ATOM   4623 C  CB    . LYS B 1 118 ? -17.899 -35.777 -20.121 1.00 158.47 ? 118 LYS B CB    1 
ATOM   4624 C  CG    . LYS B 1 118 ? -17.693 -34.853 -18.897 1.00 158.79 ? 118 LYS B CG    1 
ATOM   4625 C  CD    . LYS B 1 118 ? -19.003 -34.350 -18.261 1.00 164.23 ? 118 LYS B CD    1 
ATOM   4626 C  CE    . LYS B 1 118 ? -19.867 -35.468 -17.685 1.00 177.31 ? 118 LYS B CE    1 
ATOM   4627 N  NZ    . LYS B 1 118 ? -21.174 -34.940 -17.207 1.00 182.48 ? 118 LYS B NZ    1 
ATOM   4628 N  N     . GLU B 1 119 ? -19.451 -33.238 -21.116 1.00 144.36 ? 119 GLU B N     1 
ATOM   4629 C  CA    . GLU B 1 119 ? -20.649 -32.415 -21.260 1.00 143.88 ? 119 GLU B CA    1 
ATOM   4630 C  C     . GLU B 1 119 ? -20.239 -30.951 -21.288 1.00 134.27 ? 119 GLU B C     1 
ATOM   4631 O  O     . GLU B 1 119 ? -19.254 -30.572 -20.646 1.00 131.85 ? 119 GLU B O     1 
ATOM   4632 C  CB    . GLU B 1 119 ? -21.618 -32.636 -20.094 1.00 155.40 ? 119 GLU B CB    1 
ATOM   4633 C  CG    . GLU B 1 119 ? -22.595 -33.787 -20.278 1.00 165.57 ? 119 GLU B CG    1 
ATOM   4634 C  CD    . GLU B 1 119 ? -23.923 -33.542 -19.579 1.00 174.77 ? 119 GLU B CD    1 
ATOM   4635 O  OE1   . GLU B 1 119 ? -23.921 -33.219 -18.370 1.00 180.31 ? 119 GLU B OE1   1 
ATOM   4636 O  OE2   . GLU B 1 119 ? -24.973 -33.672 -20.243 1.00 177.38 ? 119 GLU B OE2   1 
ATOM   4637 N  N     . PRO B 1 120 ? -20.974 -30.123 -22.050 1.00 129.34 ? 120 PRO B N     1 
ATOM   4638 C  CA    . PRO B 1 120 ? -20.787 -28.669 -22.030 1.00 121.70 ? 120 PRO B CA    1 
ATOM   4639 C  C     . PRO B 1 120 ? -21.320 -28.005 -20.747 1.00 127.07 ? 120 PRO B C     1 
ATOM   4640 O  O     . PRO B 1 120 ? -22.233 -27.177 -20.795 1.00 127.30 ? 120 PRO B O     1 
ATOM   4641 C  CB    . PRO B 1 120 ? -21.558 -28.199 -23.274 1.00 117.18 ? 120 PRO B CB    1 
ATOM   4642 C  CG    . PRO B 1 120 ? -21.843 -29.456 -24.063 1.00 120.94 ? 120 PRO B CG    1 
ATOM   4643 C  CD    . PRO B 1 120 ? -21.986 -30.518 -23.041 1.00 131.04 ? 120 PRO B CD    1 
ATOM   4644 N  N     . LYS B 1 121 ? -20.734 -28.382 -19.613 1.00 132.05 ? 121 LYS B N     1 
ATOM   4645 C  CA    . LYS B 1 121 ? -21.027 -27.790 -18.308 1.00 137.99 ? 121 LYS B CA    1 
ATOM   4646 C  C     . LYS B 1 121 ? -19.702 -27.635 -17.561 1.00 136.15 ? 121 LYS B C     1 
ATOM   4647 O  O     . LYS B 1 121 ? -18.859 -28.543 -17.588 1.00 136.60 ? 121 LYS B O     1 
ATOM   4648 C  CB    . LYS B 1 121 ? -22.003 -28.670 -17.517 1.00 151.32 ? 121 LYS B CB    1 
ATOM   4649 C  CG    . LYS B 1 121 ? -23.422 -28.709 -18.084 1.00 154.71 ? 121 LYS B CG    1 
ATOM   4650 C  CD    . LYS B 1 121 ? -24.334 -29.626 -17.282 1.00 168.86 ? 121 LYS B CD    1 
ATOM   4651 C  CE    . LYS B 1 121 ? -25.775 -29.521 -17.758 1.00 172.42 ? 121 LYS B CE    1 
ATOM   4652 N  NZ    . LYS B 1 121 ? -26.710 -30.193 -16.818 1.00 187.56 ? 121 LYS B NZ    1 
ATOM   4653 N  N     . ASN B 1 122 ? -19.521 -26.494 -16.894 1.00 134.74 ? 122 ASN B N     1 
ATOM   4654 C  CA    . ASN B 1 122 ? -18.202 -26.083 -16.383 1.00 131.11 ? 122 ASN B CA    1 
ATOM   4655 C  C     . ASN B 1 122 ? -17.153 -26.142 -17.492 1.00 120.37 ? 122 ASN B C     1 
ATOM   4656 O  O     . ASN B 1 122 ? -16.058 -26.694 -17.334 1.00 119.71 ? 122 ASN B O     1 
ATOM   4657 C  CB    . ASN B 1 122 ? -17.780 -26.889 -15.146 1.00 141.02 ? 122 ASN B CB    1 
ATOM   4658 C  CG    . ASN B 1 122 ? -18.065 -26.154 -13.846 1.00 148.72 ? 122 ASN B CG    1 
ATOM   4659 O  OD1   . ASN B 1 122 ? -18.122 -24.919 -13.813 1.00 144.72 ? 122 ASN B OD1   1 
ATOM   4660 N  ND2   . ASN B 1 122 ? -18.235 -26.910 -12.765 1.00 160.08 ? 122 ASN B ND2   1 
ATOM   4661 N  N     . ILE B 1 123 ? -17.547 -25.559 -18.620 1.00 112.72 ? 123 ILE B N     1 
ATOM   4662 C  CA    . ILE B 1 123 ? -16.804 -25.529 -19.870 1.00 103.23 ? 123 ILE B CA    1 
ATOM   4663 C  C     . ILE B 1 123 ? -15.415 -24.916 -19.664 1.00 98.08  ? 123 ILE B C     1 
ATOM   4664 O  O     . ILE B 1 123 ? -15.298 -23.767 -19.228 1.00 96.47  ? 123 ILE B O     1 
ATOM   4665 C  CB    . ILE B 1 123 ? -17.633 -24.726 -20.908 1.00 97.83  ? 123 ILE B CB    1 
ATOM   4666 C  CG1   . ILE B 1 123 ? -18.974 -25.425 -21.152 1.00 103.32 ? 123 ILE B CG1   1 
ATOM   4667 C  CG2   . ILE B 1 123 ? -16.888 -24.557 -22.210 1.00 89.13  ? 123 ILE B CG2   1 
ATOM   4668 C  CD1   . ILE B 1 123 ? -20.178 -24.528 -21.021 1.00 104.54 ? 123 ILE B CD1   1 
ATOM   4669 N  N     . LYS B 1 124 ? -14.367 -25.685 -19.965 1.00 96.21  ? 124 LYS B N     1 
ATOM   4670 C  CA    . LYS B 1 124 ? -12.993 -25.248 -19.676 1.00 92.79  ? 124 LYS B CA    1 
ATOM   4671 C  C     . LYS B 1 124 ? -12.534 -24.090 -20.566 1.00 83.82  ? 124 LYS B C     1 
ATOM   4672 O  O     . LYS B 1 124 ? -12.304 -22.982 -20.076 1.00 82.27  ? 124 LYS B O     1 
ATOM   4673 C  CB    . LYS B 1 124 ? -12.002 -26.425 -19.719 1.00 94.75  ? 124 LYS B CB    1 
ATOM   4674 C  CG    . LYS B 1 124 ? -10.613 -26.081 -19.177 1.00 93.69  ? 124 LYS B CG    1 
ATOM   4675 C  CD    . LYS B 1 124 ? -9.785  -27.312 -18.815 1.00 98.58  ? 124 LYS B CD    1 
ATOM   4676 C  CE    . LYS B 1 124 ? -8.381  -26.889 -18.369 1.00 97.36  ? 124 LYS B CE    1 
ATOM   4677 N  NZ    . LYS B 1 124 ? -7.556  -27.994 -17.808 1.00 103.14 ? 124 LYS B NZ    1 
ATOM   4678 N  N     . SER B 1 125 ? -12.408 -24.357 -21.865 1.00 78.75  ? 125 SER B N     1 
ATOM   4679 C  CA    . SER B 1 125 ? -12.018 -23.345 -22.849 1.00 71.08  ? 125 SER B CA    1 
ATOM   4680 C  C     . SER B 1 125 ? -13.202 -22.491 -23.254 1.00 68.98  ? 125 SER B C     1 
ATOM   4681 O  O     . SER B 1 125 ? -14.343 -22.790 -22.903 1.00 73.15  ? 125 SER B O     1 
ATOM   4682 C  CB    . SER B 1 125 ? -11.414 -24.006 -24.090 1.00 68.14  ? 125 SER B CB    1 
ATOM   4683 O  OG    . SER B 1 125 ? -11.695 -23.257 -25.261 1.00 62.72  ? 125 SER B OG    1 
ATOM   4684 N  N     . ALA B 1 126 ? -12.915 -21.435 -24.010 1.00 63.17  ? 126 ALA B N     1 
ATOM   4685 C  CA    . ALA B 1 126 ? -13.934 -20.491 -24.469 1.00 60.98  ? 126 ALA B CA    1 
ATOM   4686 C  C     . ALA B 1 126 ? -14.918 -21.089 -25.495 1.00 60.70  ? 126 ALA B C     1 
ATOM   4687 O  O     . ALA B 1 126 ? -16.125 -20.858 -25.406 1.00 62.88  ? 126 ALA B O     1 
ATOM   4688 C  CB    . ALA B 1 126 ? -13.267 -19.229 -25.022 1.00 55.61  ? 126 ALA B CB    1 
ATOM   4689 N  N     . VAL B 1 127 ? -14.401 -21.872 -26.440 1.00 58.80  ? 127 VAL B N     1 
ATOM   4690 C  CA    . VAL B 1 127 ? -15.176 -22.310 -27.610 1.00 58.23  ? 127 VAL B CA    1 
ATOM   4691 C  C     . VAL B 1 127 ? -15.573 -23.791 -27.574 1.00 63.12  ? 127 VAL B C     1 
ATOM   4692 O  O     . VAL B 1 127 ? -15.953 -24.369 -28.601 1.00 63.61  ? 127 VAL B O     1 
ATOM   4693 C  CB    . VAL B 1 127 ? -14.424 -21.995 -28.946 1.00 53.85  ? 127 VAL B CB    1 
ATOM   4694 C  CG1   . VAL B 1 127 ? -14.094 -20.514 -29.051 1.00 49.01  ? 127 VAL B CG1   1 
ATOM   4695 C  CG2   . VAL B 1 127 ? -13.158 -22.844 -29.085 1.00 54.01  ? 127 VAL B CG2   1 
ATOM   4696 N  N     . ASP B 1 128 ? -15.502 -24.390 -26.386 1.00 67.38  ? 128 ASP B N     1 
ATOM   4697 C  CA    . ASP B 1 128 ? -15.752 -25.825 -26.204 1.00 72.88  ? 128 ASP B CA    1 
ATOM   4698 C  C     . ASP B 1 128 ? -17.124 -26.308 -26.679 1.00 76.89  ? 128 ASP B C     1 
ATOM   4699 O  O     . ASP B 1 128 ? -17.286 -27.489 -26.966 1.00 81.41  ? 128 ASP B O     1 
ATOM   4700 C  CB    . ASP B 1 128 ? -15.558 -26.226 -24.743 1.00 77.82  ? 128 ASP B CB    1 
ATOM   4701 C  CG    . ASP B 1 128 ? -14.116 -26.140 -24.291 1.00 74.99  ? 128 ASP B CG    1 
ATOM   4702 O  OD1   . ASP B 1 128 ? -13.205 -26.243 -25.135 1.00 70.36  ? 128 ASP B OD1   1 
ATOM   4703 O  OD2   . ASP B 1 128 ? -13.893 -25.985 -23.076 1.00 77.18  ? 128 ASP B OD2   1 
ATOM   4704 N  N     . ARG B 1 129 ? -18.102 -25.407 -26.766 1.00 76.14  ? 129 ARG B N     1 
ATOM   4705 C  CA    . ARG B 1 129 ? -19.474 -25.779 -27.131 1.00 80.57  ? 129 ARG B CA    1 
ATOM   4706 C  C     . ARG B 1 129 ? -19.654 -26.133 -28.598 1.00 79.27  ? 129 ARG B C     1 
ATOM   4707 O  O     . ARG B 1 129 ? -20.580 -26.866 -28.945 1.00 84.54  ? 129 ARG B O     1 
ATOM   4708 C  CB    . ARG B 1 129 ? -20.462 -24.671 -26.770 1.00 80.65  ? 129 ARG B CB    1 
ATOM   4709 C  CG    . ARG B 1 129 ? -20.858 -24.637 -25.315 1.00 85.72  ? 129 ARG B CG    1 
ATOM   4710 C  CD    . ARG B 1 129 ? -21.947 -23.614 -25.080 1.00 85.65  ? 129 ARG B CD    1 
ATOM   4711 N  NE    . ARG B 1 129 ? -21.687 -22.860 -23.861 1.00 85.71  ? 129 ARG B NE    1 
ATOM   4712 C  CZ    . ARG B 1 129 ? -21.181 -21.633 -23.830 1.00 79.54  ? 129 ARG B CZ    1 
ATOM   4713 N  NH1   . ARG B 1 129 ? -20.906 -20.992 -24.959 1.00 72.66  ? 129 ARG B NH1   1 
ATOM   4714 N  NH2   . ARG B 1 129 ? -20.973 -21.035 -22.665 1.00 81.34  ? 129 ARG B NH2   1 
ATOM   4715 N  N     . THR B 1 130 ? -18.775 -25.613 -29.449 1.00 73.38  ? 130 THR B N     1 
ATOM   4716 C  CA    . THR B 1 130 ? -18.917 -25.756 -30.899 1.00 72.69  ? 130 THR B CA    1 
ATOM   4717 C  C     . THR B 1 130 ? -19.039 -27.191 -31.450 1.00 78.10  ? 130 THR B C     1 
ATOM   4718 O  O     . THR B 1 130 ? -19.896 -27.434 -32.308 1.00 80.74  ? 130 THR B O     1 
ATOM   4719 C  CB    . THR B 1 130 ? -17.804 -25.026 -31.639 1.00 66.71  ? 130 THR B CB    1 
ATOM   4720 O  OG1   . THR B 1 130 ? -17.771 -23.661 -31.212 1.00 63.26  ? 130 THR B OG1   1 
ATOM   4721 C  CG2   . THR B 1 130 ? -18.054 -25.078 -33.130 1.00 67.05  ? 130 THR B CG2   1 
ATOM   4722 N  N     . PRO B 1 131 ? -18.175 -28.134 -30.995 1.00 80.43  ? 131 PRO B N     1 
ATOM   4723 C  CA    . PRO B 1 131 ? -18.417 -29.518 -31.406 1.00 86.91  ? 131 PRO B CA    1 
ATOM   4724 C  C     . PRO B 1 131 ? -19.769 -30.022 -30.906 1.00 93.72  ? 131 PRO B C     1 
ATOM   4725 O  O     . PRO B 1 131 ? -20.500 -30.671 -31.654 1.00 98.34  ? 131 PRO B O     1 
ATOM   4726 C  CB    . PRO B 1 131 ? -17.268 -30.297 -30.745 1.00 88.34  ? 131 PRO B CB    1 
ATOM   4727 C  CG    . PRO B 1 131 ? -16.776 -29.427 -29.657 1.00 84.29  ? 131 PRO B CG    1 
ATOM   4728 C  CD    . PRO B 1 131 ? -16.966 -28.030 -30.153 1.00 78.11  ? 131 PRO B CD    1 
ATOM   4729 N  N     . PHE B 1 132 ? -20.103 -29.695 -29.661 1.00 95.12  ? 132 PHE B N     1 
ATOM   4730 C  CA    . PHE B 1 132 ? -21.360 -30.123 -29.068 1.00 102.66 ? 132 PHE B CA    1 
ATOM   4731 C  C     . PHE B 1 132 ? -22.580 -29.393 -29.639 1.00 102.55 ? 132 PHE B C     1 
ATOM   4732 O  O     . PHE B 1 132 ? -23.712 -29.847 -29.463 1.00 109.71 ? 132 PHE B O     1 
ATOM   4733 C  CB    . PHE B 1 132 ? -21.280 -30.036 -27.546 1.00 105.50 ? 132 PHE B CB    1 
ATOM   4734 C  CG    . PHE B 1 132 ? -20.447 -31.123 -26.938 1.00 109.73 ? 132 PHE B CG    1 
ATOM   4735 C  CD1   . PHE B 1 132 ? -19.082 -30.949 -26.744 1.00 104.95 ? 132 PHE B CD1   1 
ATOM   4736 C  CD2   . PHE B 1 132 ? -21.024 -32.344 -26.593 1.00 119.50 ? 132 PHE B CD2   1 
ATOM   4737 C  CE1   . PHE B 1 132 ? -18.305 -31.972 -26.197 1.00 109.60 ? 132 PHE B CE1   1 
ATOM   4738 C  CE2   . PHE B 1 132 ? -20.259 -33.370 -26.049 1.00 123.96 ? 132 PHE B CE2   1 
ATOM   4739 C  CZ    . PHE B 1 132 ? -18.898 -33.185 -25.851 1.00 118.71 ? 132 PHE B CZ    1 
ATOM   4740 N  N     . HIS B 1 133 ? -22.342 -28.280 -30.335 1.00 95.28  ? 133 HIS B N     1 
ATOM   4741 C  CA    . HIS B 1 133 ? -23.374 -27.637 -31.140 1.00 95.12  ? 133 HIS B CA    1 
ATOM   4742 C  C     . HIS B 1 133 ? -23.640 -28.483 -32.360 1.00 98.67  ? 133 HIS B C     1 
ATOM   4743 O  O     . HIS B 1 133 ? -24.776 -28.828 -32.654 1.00 104.49 ? 133 HIS B O     1 
ATOM   4744 C  CB    . HIS B 1 133 ? -22.931 -26.260 -31.625 1.00 87.08  ? 133 HIS B CB    1 
ATOM   4745 C  CG    . HIS B 1 133 ? -22.906 -25.216 -30.560 1.00 83.72  ? 133 HIS B CG    1 
ATOM   4746 N  ND1   . HIS B 1 133 ? -22.052 -24.139 -30.608 1.00 76.13  ? 133 HIS B ND1   1 
ATOM   4747 C  CD2   . HIS B 1 133 ? -23.617 -25.087 -29.416 1.00 87.64  ? 133 HIS B CD2   1 
ATOM   4748 C  CE1   . HIS B 1 133 ? -22.243 -23.385 -29.541 1.00 76.83  ? 133 HIS B CE1   1 
ATOM   4749 N  NE2   . HIS B 1 133 ? -23.186 -23.940 -28.801 1.00 83.23  ? 133 HIS B NE2   1 
ATOM   4750 N  N     . HIS B 1 134 ? -22.565 -28.801 -33.067 1.00 96.15  ? 134 HIS B N     1 
ATOM   4751 C  CA    . HIS B 1 134 ? -22.614 -29.609 -34.271 1.00 100.41 ? 134 HIS B CA    1 
ATOM   4752 C  C     . HIS B 1 134 ? -23.300 -30.974 -34.062 1.00 110.10 ? 134 HIS B C     1 
ATOM   4753 O  O     . HIS B 1 134 ? -24.090 -31.413 -34.904 1.00 115.11 ? 134 HIS B O     1 
ATOM   4754 C  CB    . HIS B 1 134 ? -21.190 -29.784 -34.796 1.00 96.79  ? 134 HIS B CB    1 
ATOM   4755 C  CG    . HIS B 1 134 ? -21.110 -30.451 -36.131 1.00 101.25 ? 134 HIS B CG    1 
ATOM   4756 N  ND1   . HIS B 1 134 ? -21.696 -29.924 -37.262 1.00 101.70 ? 134 HIS B ND1   1 
ATOM   4757 C  CD2   . HIS B 1 134 ? -20.501 -31.596 -36.519 1.00 106.75 ? 134 HIS B CD2   1 
ATOM   4758 C  CE1   . HIS B 1 134 ? -21.457 -30.720 -38.288 1.00 106.91 ? 134 HIS B CE1   1 
ATOM   4759 N  NE2   . HIS B 1 134 ? -20.735 -31.743 -37.864 1.00 110.00 ? 134 HIS B NE2   1 
ATOM   4760 N  N     . LYS B 1 135 ? -23.007 -31.621 -32.931 1.00 113.56 ? 135 LYS B N     1 
ATOM   4761 C  CA    . LYS B 1 135 ? -23.548 -32.947 -32.596 1.00 123.56 ? 135 LYS B CA    1 
ATOM   4762 C  C     . LYS B 1 135 ? -25.079 -32.956 -32.440 1.00 130.33 ? 135 LYS B C     1 
ATOM   4763 O  O     . LYS B 1 135 ? -25.714 -33.996 -32.651 1.00 139.13 ? 135 LYS B O     1 
ATOM   4764 C  CB    . LYS B 1 135 ? -22.851 -33.515 -31.336 1.00 125.72 ? 135 LYS B CB    1 
ATOM   4765 C  CG    . LYS B 1 135 ? -23.319 -34.911 -30.854 1.00 136.33 ? 135 LYS B CG    1 
ATOM   4766 C  CD    . LYS B 1 135 ? -22.739 -35.254 -29.472 1.00 138.47 ? 135 LYS B CD    1 
ATOM   4767 C  CE    . LYS B 1 135 ? -23.568 -36.309 -28.721 1.00 149.47 ? 135 LYS B CE    1 
ATOM   4768 N  NZ    . LYS B 1 135 ? -23.248 -37.719 -29.091 1.00 155.57 ? 135 LYS B NZ    1 
ATOM   4769 N  N     . TRP B 1 136 ? -25.662 -31.808 -32.086 1.00 127.01 ? 136 TRP B N     1 
ATOM   4770 C  CA    . TRP B 1 136 ? -27.114 -31.710 -31.863 1.00 133.78 ? 136 TRP B CA    1 
ATOM   4771 C  C     . TRP B 1 136 ? -27.866 -31.152 -33.069 1.00 132.68 ? 136 TRP B C     1 
ATOM   4772 O  O     . TRP B 1 136 ? -29.050 -31.441 -33.272 1.00 139.87 ? 136 TRP B O     1 
ATOM   4773 C  CB    . TRP B 1 136 ? -27.422 -30.858 -30.622 1.00 133.10 ? 136 TRP B CB    1 
ATOM   4774 C  CG    . TRP B 1 136 ? -28.895 -30.789 -30.295 1.00 141.28 ? 136 TRP B CG    1 
ATOM   4775 C  CD1   . TRP B 1 136 ? -29.623 -31.707 -29.589 1.00 152.39 ? 136 TRP B CD1   1 
ATOM   4776 C  CD2   . TRP B 1 136 ? -29.815 -29.756 -30.674 1.00 140.29 ? 136 TRP B CD2   1 
ATOM   4777 N  NE1   . TRP B 1 136 ? -30.938 -31.309 -29.502 1.00 158.17 ? 136 TRP B NE1   1 
ATOM   4778 C  CE2   . TRP B 1 136 ? -31.083 -30.114 -30.158 1.00 151.03 ? 136 TRP B CE2   1 
ATOM   4779 C  CE3   . TRP B 1 136 ? -29.693 -28.562 -31.401 1.00 131.93 ? 136 TRP B CE3   1 
ATOM   4780 C  CZ2   . TRP B 1 136 ? -32.224 -29.316 -30.342 1.00 153.17 ? 136 TRP B CZ2   1 
ATOM   4781 C  CZ3   . TRP B 1 136 ? -30.828 -27.771 -31.587 1.00 134.08 ? 136 TRP B CZ3   1 
ATOM   4782 C  CH2   . TRP B 1 136 ? -32.076 -28.155 -31.060 1.00 144.42 ? 136 TRP B CH2   1 
ATOM   4783 N  N     . LEU B 1 137 ? -27.159 -30.364 -33.869 1.00 124.37 ? 137 LEU B N     1 
ATOM   4784 C  CA    . LEU B 1 137 ? -27.779 -29.546 -34.896 1.00 122.48 ? 137 LEU B CA    1 
ATOM   4785 C  C     . LEU B 1 137 ? -27.648 -30.146 -36.287 1.00 124.52 ? 137 LEU B C     1 
ATOM   4786 O  O     . LEU B 1 137 ? -28.364 -29.743 -37.205 1.00 125.85 ? 137 LEU B O     1 
ATOM   4787 C  CB    . LEU B 1 137 ? -27.142 -28.162 -34.876 1.00 113.03 ? 137 LEU B CB    1 
ATOM   4788 C  CG    . LEU B 1 137 ? -27.931 -26.984 -35.422 1.00 111.53 ? 137 LEU B CG    1 
ATOM   4789 C  CD1   . LEU B 1 137 ? -29.100 -26.641 -34.505 1.00 116.45 ? 137 LEU B CD1   1 
ATOM   4790 C  CD2   . LEU B 1 137 ? -26.988 -25.804 -35.563 1.00 103.06 ? 137 LEU B CD2   1 
ATOM   4791 N  N     . GLU B 1 138 ? -26.723 -31.093 -36.436 1.00 125.34 ? 138 GLU B N     1 
ATOM   4792 C  CA    . GLU B 1 138 ? -26.489 -31.771 -37.710 1.00 128.48 ? 138 GLU B CA    1 
ATOM   4793 C  C     . GLU B 1 138 ? -27.727 -32.532 -38.171 1.00 138.29 ? 138 GLU B C     1 
ATOM   4794 O  O     . GLU B 1 138 ? -28.185 -32.348 -39.299 1.00 140.27 ? 138 GLU B O     1 
ATOM   4795 C  CB    . GLU B 1 138 ? -25.301 -32.722 -37.580 1.00 129.05 ? 138 GLU B CB    1 
ATOM   4796 C  CG    . GLU B 1 138 ? -25.287 -33.860 -38.575 1.00 137.09 ? 138 GLU B CG    1 
ATOM   4797 C  CD    . GLU B 1 138 ? -25.265 -35.208 -37.881 1.00 145.76 ? 138 GLU B CD    1 
ATOM   4798 O  OE1   . GLU B 1 138 ? -24.587 -35.324 -36.833 1.00 143.23 ? 138 GLU B OE1   1 
ATOM   4799 O  OE2   . GLU B 1 138 ? -25.935 -36.149 -38.373 1.00 155.63 ? 138 GLU B OE2   1 
ATOM   4800 N  N     . GLY B 1 139 ? -28.268 -33.368 -37.285 1.00 145.03 ? 139 GLY B N     1 
ATOM   4801 C  CA    . GLY B 1 139 ? -29.388 -34.246 -37.613 1.00 155.88 ? 139 GLY B CA    1 
ATOM   4802 C  C     . GLY B 1 139 ? -30.766 -33.631 -37.441 1.00 159.01 ? 139 GLY B C     1 
ATOM   4803 O  O     . GLY B 1 139 ? -31.782 -34.325 -37.567 1.00 169.02 ? 139 GLY B O     1 
ATOM   4804 N  N     . ARG B 1 140 ? -30.805 -32.335 -37.147 1.00 151.17 ? 140 ARG B N     1 
ATOM   4805 C  CA    . ARG B 1 140 ? -32.068 -31.615 -37.003 1.00 153.75 ? 140 ARG B CA    1 
ATOM   4806 C  C     . ARG B 1 140 ? -32.222 -30.527 -38.066 1.00 148.78 ? 140 ARG B C     1 
ATOM   4807 O  O     . ARG B 1 140 ? -33.247 -29.843 -38.120 1.00 150.78 ? 140 ARG B O     1 
ATOM   4808 C  CB    . ARG B 1 140 ? -32.185 -31.006 -35.603 1.00 151.38 ? 140 ARG B CB    1 
ATOM   4809 C  CG    . ARG B 1 140 ? -32.637 -31.965 -34.513 1.00 159.47 ? 140 ARG B CG    1 
ATOM   4810 C  CD    . ARG B 1 140 ? -32.627 -31.247 -33.174 1.00 155.99 ? 140 ARG B CD    1 
ATOM   4811 N  NE    . ARG B 1 140 ? -33.309 -32.013 -32.111 1.00 165.66 ? 140 ARG B NE    1 
ATOM   4812 C  CZ    . ARG B 1 140 ? -34.587 -31.824 -31.739 1.00 173.73 ? 140 ARG B CZ    1 
ATOM   4813 N  NH1   . ARG B 1 140 ? -35.348 -30.895 -32.340 1.00 171.88 ? 140 ARG B NH1   1 
ATOM   4814 N  NH2   . ARG B 1 140 ? -35.112 -32.572 -30.760 1.00 184.44 ? 140 ARG B NH2   1 
ATOM   4815 N  N     . ILE B 1 141 ? -31.195 -30.371 -38.901 1.00 143.10 ? 141 ILE B N     1 
ATOM   4816 C  CA    . ILE B 1 141 ? -31.193 -29.360 -39.961 1.00 138.92 ? 141 ILE B CA    1 
ATOM   4817 C  C     . ILE B 1 141 ? -31.112 -30.023 -41.336 1.00 143.89 ? 141 ILE B C     1 
ATOM   4818 O  O     . ILE B 1 141 ? -31.325 -29.368 -42.362 1.00 143.39 ? 141 ILE B O     1 
ATOM   4819 C  CB    . ILE B 1 141 ? -30.053 -28.294 -39.767 1.00 127.88 ? 141 ILE B CB    1 
ATOM   4820 C  CG1   . ILE B 1 141 ? -30.428 -26.962 -40.424 1.00 124.69 ? 141 ILE B CG1   1 
ATOM   4821 C  CG2   . ILE B 1 141 ? -28.691 -28.793 -40.272 1.00 124.28 ? 141 ILE B CG2   1 
ATOM   4822 C  CD1   . ILE B 1 141 ? -31.261 -26.038 -39.542 1.00 124.29 ? 141 ILE B CD1   1 
ATOM   4823 N  N     . LYS B 1 142 ? -30.804 -31.322 -41.336 1.00 149.50 ? 142 LYS B N     1 
ATOM   4824 C  CA    . LYS B 1 142 ? -30.728 -32.127 -42.555 1.00 156.22 ? 142 LYS B CA    1 
ATOM   4825 C  C     . LYS B 1 142 ? -31.956 -31.908 -43.444 1.00 162.96 ? 142 LYS B C     1 
ATOM   4826 O  O     . LYS B 1 142 ? -32.955 -32.633 -43.331 1.00 172.25 ? 142 LYS B O     1 
ATOM   4827 C  CB    . LYS B 1 142 ? -30.624 -33.621 -42.215 1.00 163.97 ? 142 LYS B CB    1 
ATOM   4828 C  CG    . LYS B 1 142 ? -29.441 -34.030 -41.363 1.00 159.54 ? 142 LYS B CG    1 
ATOM   4829 C  CD    . LYS B 1 142 ? -28.344 -34.697 -42.172 1.00 160.57 ? 142 LYS B CD    1 
ATOM   4830 C  CE    . LYS B 1 142 ? -27.437 -35.504 -41.257 1.00 160.05 ? 142 LYS B CE    1 
ATOM   4831 N  NZ    . LYS B 1 142 ? -26.198 -35.968 -41.939 1.00 159.66 ? 142 LYS B NZ    1 
ATOM   4832 N  N     . GLY B 1 143 ? -31.886 -30.903 -44.317 1.00 158.91 ? 143 GLY B N     1 
ATOM   4833 C  CA    . GLY B 1 143 ? -32.964 -30.644 -45.264 1.00 165.30 ? 143 GLY B CA    1 
ATOM   4834 C  C     . GLY B 1 143 ? -33.601 -29.276 -45.147 1.00 160.73 ? 143 GLY B C     1 
ATOM   4835 O  O     . GLY B 1 143 ? -34.228 -28.794 -46.104 1.00 164.37 ? 143 GLY B O     1 
ATOM   4836 N  N     . LYS B 1 144 ? -33.458 -28.653 -43.974 1.00 165.57 ? 144 LYS B N     1 
ATOM   4837 C  CA    . LYS B 1 144 ? -33.943 -27.288 -43.779 1.00 157.35 ? 144 LYS B CA    1 
ATOM   4838 C  C     . LYS B 1 144 ? -32.786 -26.296 -43.762 1.00 146.41 ? 144 LYS B C     1 
ATOM   4839 O  O     . LYS B 1 144 ? -32.922 -25.168 -43.286 1.00 138.42 ? 144 LYS B O     1 
ATOM   4840 C  CB    . LYS B 1 144 ? -34.817 -27.185 -42.521 1.00 156.40 ? 144 LYS B CB    1 
ATOM   4841 C  CG    . LYS B 1 144 ? -36.215 -27.797 -42.694 1.00 167.43 ? 144 LYS B CG    1 
ATOM   4842 C  CD    . LYS B 1 144 ? -37.057 -27.024 -43.734 1.00 169.15 ? 144 LYS B CD    1 
ATOM   4843 C  CE    . LYS B 1 144 ? -38.071 -27.924 -44.441 1.00 182.14 ? 144 LYS B CE    1 
ATOM   4844 N  NZ    . LYS B 1 144 ? -39.261 -28.236 -43.591 1.00 188.19 ? 144 LYS B NZ    1 
ATOM   4845 N  N     . GLU B 1 145 ? -31.657 -26.730 -44.318 1.00 147.26 ? 145 GLU B N     1 
ATOM   4846 C  CA    . GLU B 1 145 ? -30.443 -25.920 -44.403 1.00 138.89 ? 145 GLU B CA    1 
ATOM   4847 C  C     . GLU B 1 145 ? -30.559 -24.749 -45.390 1.00 136.21 ? 145 GLU B C     1 
ATOM   4848 O  O     . GLU B 1 145 ? -29.686 -23.882 -45.453 1.00 129.16 ? 145 GLU B O     1 
ATOM   4849 C  CB    . GLU B 1 145 ? -29.227 -26.802 -44.730 1.00 142.53 ? 145 GLU B CB    1 
ATOM   4850 C  CG    . GLU B 1 145 ? -29.221 -27.434 -46.125 1.00 152.36 ? 145 GLU B CG    1 
ATOM   4851 C  CD    . GLU B 1 145 ? -30.008 -28.727 -46.200 1.00 162.55 ? 145 GLU B CD    1 
ATOM   4852 O  OE1   . GLU B 1 145 ? -29.775 -29.617 -45.357 1.00 164.33 ? 145 GLU B OE1   1 
ATOM   4853 O  OE2   . GLU B 1 145 ? -30.851 -28.855 -47.110 1.00 169.43 ? 145 GLU B OE2   1 
ATOM   4854 N  N     . ASN B 1 146 ? -31.638 -24.734 -46.163 1.00 142.76 ? 146 ASN B N     1 
ATOM   4855 C  CA    . ASN B 1 146 ? -31.925 -23.604 -47.034 1.00 141.49 ? 146 ASN B CA    1 
ATOM   4856 C  C     . ASN B 1 146 ? -32.787 -22.543 -46.370 1.00 135.77 ? 146 ASN B C     1 
ATOM   4857 O  O     . ASN B 1 146 ? -33.000 -21.462 -46.928 1.00 133.68 ? 146 ASN B O     1 
ATOM   4858 C  CB    . ASN B 1 146 ? -32.553 -24.069 -48.344 1.00 152.29 ? 146 ASN B CB    1 
ATOM   4859 C  CG    . ASN B 1 146 ? -31.549 -24.134 -49.470 1.00 155.47 ? 146 ASN B CG    1 
ATOM   4860 O  OD1   . ASN B 1 146 ? -30.342 -24.241 -49.239 1.00 151.31 ? 146 ASN B OD1   1 
ATOM   4861 N  ND2   . ASN B 1 146 ? -32.040 -24.062 -50.698 1.00 163.17 ? 146 ASN B ND2   1 
ATOM   4862 N  N     . GLU B 1 147 ? -33.277 -22.854 -45.174 1.00 134.24 ? 147 GLU B N     1 
ATOM   4863 C  CA    . GLU B 1 147 ? -34.074 -21.901 -44.417 1.00 129.40 ? 147 GLU B CA    1 
ATOM   4864 C  C     . GLU B 1 147 ? -33.186 -20.949 -43.628 1.00 118.49 ? 147 GLU B C     1 
ATOM   4865 O  O     . GLU B 1 147 ? -33.554 -19.791 -43.409 1.00 113.52 ? 147 GLU B O     1 
ATOM   4866 C  CB    . GLU B 1 147 ? -35.081 -22.610 -43.511 1.00 134.08 ? 147 GLU B CB    1 
ATOM   4867 C  CG    . GLU B 1 147 ? -36.211 -23.323 -44.258 1.00 145.62 ? 147 GLU B CG    1 
ATOM   4868 C  CD    . GLU B 1 147 ? -37.087 -22.391 -45.092 1.00 147.42 ? 147 GLU B CD    1 
ATOM   4869 O  OE1   . GLU B 1 147 ? -37.176 -21.186 -44.783 1.00 140.13 ? 147 GLU B OE1   1 
ATOM   4870 O  OE2   . GLU B 1 147 ? -37.700 -22.876 -46.063 1.00 157.09 ? 147 GLU B OE2   1 
ATOM   4871 N  N     . VAL B 1 148 ? -32.021 -21.440 -43.209 1.00 115.51 ? 148 VAL B N     1 
ATOM   4872 C  CA    . VAL B 1 148 ? -30.994 -20.569 -42.634 1.00 106.25 ? 148 VAL B CA    1 
ATOM   4873 C  C     . VAL B 1 148 ? -30.399 -19.665 -43.707 1.00 104.26 ? 148 VAL B C     1 
ATOM   4874 O  O     . VAL B 1 148 ? -30.213 -18.469 -43.481 1.00 97.85  ? 148 VAL B O     1 
ATOM   4875 C  CB    . VAL B 1 148 ? -29.852 -21.343 -41.927 1.00 104.53 ? 148 VAL B CB    1 
ATOM   4876 C  CG1   . VAL B 1 148 ? -30.214 -21.624 -40.493 1.00 102.74 ? 148 VAL B CG1   1 
ATOM   4877 C  CG2   . VAL B 1 148 ? -29.520 -22.634 -42.661 1.00 113.23 ? 148 VAL B CG2   1 
ATOM   4878 N  N     . ARG B 1 149 ? -30.122 -20.241 -44.876 1.00 110.85 ? 149 ARG B N     1 
ATOM   4879 C  CA    . ARG B 1 149 ? -29.525 -19.502 -45.984 1.00 111.10 ? 149 ARG B CA    1 
ATOM   4880 C  C     . ARG B 1 149 ? -30.353 -18.289 -46.412 1.00 110.03 ? 149 ARG B C     1 
ATOM   4881 O  O     . ARG B 1 149 ? -29.791 -17.235 -46.710 1.00 106.41 ? 149 ARG B O     1 
ATOM   4882 C  CB    . ARG B 1 149 ? -29.254 -20.420 -47.171 1.00 120.47 ? 149 ARG B CB    1 
ATOM   4883 C  CG    . ARG B 1 149 ? -27.976 -21.212 -47.044 1.00 121.02 ? 149 ARG B CG    1 
ATOM   4884 C  CD    . ARG B 1 149 ? -27.530 -21.706 -48.401 1.00 130.35 ? 149 ARG B CD    1 
ATOM   4885 N  NE    . ARG B 1 149 ? -26.210 -22.319 -48.331 1.00 131.51 ? 149 ARG B NE    1 
ATOM   4886 C  CZ    . ARG B 1 149 ? -25.993 -23.612 -48.124 1.00 136.74 ? 149 ARG B CZ    1 
ATOM   4887 N  NH1   . ARG B 1 149 ? -27.015 -24.447 -47.968 1.00 141.11 ? 149 ARG B NH1   1 
ATOM   4888 N  NH2   . ARG B 1 149 ? -24.750 -24.070 -48.072 1.00 138.31 ? 149 ARG B NH2   1 
ATOM   4889 N  N     . LEU B 1 150 ? -31.679 -18.439 -46.432 1.00 113.98 ? 150 LEU B N     1 
ATOM   4890 C  CA    . LEU B 1 150 ? -32.580 -17.311 -46.679 1.00 113.27 ? 150 LEU B CA    1 
ATOM   4891 C  C     . LEU B 1 150 ? -32.521 -16.278 -45.542 1.00 103.89 ? 150 LEU B C     1 
ATOM   4892 O  O     . LEU B 1 150 ? -32.579 -15.069 -45.786 1.00 101.16 ? 150 LEU B O     1 
ATOM   4893 C  CB    . LEU B 1 150 ? -34.016 -17.796 -46.881 1.00 120.84 ? 150 LEU B CB    1 
ATOM   4894 C  CG    . LEU B 1 150 ? -34.334 -18.529 -48.187 1.00 131.77 ? 150 LEU B CG    1 
ATOM   4895 C  CD1   . LEU B 1 150 ? -35.547 -19.438 -48.015 1.00 139.22 ? 150 LEU B CD1   1 
ATOM   4896 C  CD2   . LEU B 1 150 ? -34.545 -17.549 -49.342 1.00 135.27 ? 150 LEU B CD2   1 
ATOM   4897 N  N     . LEU B 1 151 ? -32.397 -16.762 -44.307 1.00 99.59  ? 151 LEU B N     1 
ATOM   4898 C  CA    . LEU B 1 151 ? -32.350 -15.890 -43.138 1.00 91.42  ? 151 LEU B CA    1 
ATOM   4899 C  C     . LEU B 1 151 ? -31.036 -15.137 -43.091 1.00 84.73  ? 151 LEU B C     1 
ATOM   4900 O  O     . LEU B 1 151 ? -31.004 -13.958 -42.747 1.00 79.75  ? 151 LEU B O     1 
ATOM   4901 C  CB    . LEU B 1 151 ? -32.540 -16.698 -41.850 1.00 90.57  ? 151 LEU B CB    1 
ATOM   4902 C  CG    . LEU B 1 151 ? -32.597 -15.949 -40.514 1.00 83.82  ? 151 LEU B CG    1 
ATOM   4903 C  CD1   . LEU B 1 151 ? -33.674 -14.873 -40.512 1.00 83.65  ? 151 LEU B CD1   1 
ATOM   4904 C  CD2   . LEU B 1 151 ? -32.810 -16.914 -39.363 1.00 85.59  ? 151 LEU B CD2   1 
ATOM   4905 N  N     . LYS B 1 152 ? -29.960 -15.832 -43.446 1.00 85.49  ? 152 LYS B N     1 
ATOM   4906 C  CA    . LYS B 1 152 ? -28.613 -15.269 -43.411 1.00 80.40  ? 152 LYS B CA    1 
ATOM   4907 C  C     . LYS B 1 152 ? -28.453 -14.106 -44.397 1.00 80.58  ? 152 LYS B C     1 
ATOM   4908 O  O     . LYS B 1 152 ? -27.985 -13.035 -44.018 1.00 75.14  ? 152 LYS B O     1 
ATOM   4909 C  CB    . LYS B 1 152 ? -27.554 -16.357 -43.666 1.00 83.28  ? 152 LYS B CB    1 
ATOM   4910 C  CG    . LYS B 1 152 ? -27.272 -17.285 -42.476 1.00 81.28  ? 152 LYS B CG    1 
ATOM   4911 C  CD    . LYS B 1 152 ? -26.028 -18.147 -42.722 1.00 83.66  ? 152 LYS B CD    1 
ATOM   4912 C  CE    . LYS B 1 152 ? -25.537 -18.793 -41.426 1.00 81.25  ? 152 LYS B CE    1 
ATOM   4913 N  NZ    . LYS B 1 152 ? -24.371 -19.712 -41.610 1.00 84.51  ? 152 LYS B NZ    1 
ATOM   4914 N  N     . GLY B 1 153 ? -28.856 -14.315 -45.649 1.00 87.53  ? 153 GLY B N     1 
ATOM   4915 C  CA    . GLY B 1 153 ? -28.753 -13.275 -46.670 1.00 89.53  ? 153 GLY B CA    1 
ATOM   4916 C  C     . GLY B 1 153 ? -29.539 -12.054 -46.248 1.00 85.80  ? 153 GLY B C     1 
ATOM   4917 O  O     . GLY B 1 153 ? -29.068 -10.926 -46.382 1.00 83.32  ? 153 GLY B O     1 
ATOM   4918 N  N     . PHE B 1 154 ? -30.738 -12.312 -45.723 1.00 86.24  ? 154 PHE B N     1 
ATOM   4919 C  CA    . PHE B 1 154 ? -31.657 -11.308 -45.200 1.00 83.51  ? 154 PHE B CA    1 
ATOM   4920 C  C     . PHE B 1 154 ? -30.966 -10.406 -44.188 1.00 75.21  ? 154 PHE B C     1 
ATOM   4921 O  O     . PHE B 1 154 ? -30.950 -9.183  -44.341 1.00 73.81  ? 154 PHE B O     1 
ATOM   4922 C  CB    . PHE B 1 154 ? -32.829 -12.030 -44.541 1.00 85.66  ? 154 PHE B CB    1 
ATOM   4923 C  CG    . PHE B 1 154 ? -33.972 -11.139 -44.163 1.00 86.16  ? 154 PHE B CG    1 
ATOM   4924 C  CD1   . PHE B 1 154 ? -34.832 -10.633 -45.134 1.00 92.40  ? 154 PHE B CD1   1 
ATOM   4925 C  CD2   . PHE B 1 154 ? -34.220 -10.840 -42.827 1.00 81.50  ? 154 PHE B CD2   1 
ATOM   4926 C  CE1   . PHE B 1 154 ? -35.904 -9.817  -44.784 1.00 93.33  ? 154 PHE B CE1   1 
ATOM   4927 C  CE2   . PHE B 1 154 ? -35.293 -10.032 -42.464 1.00 82.61  ? 154 PHE B CE2   1 
ATOM   4928 C  CZ    . PHE B 1 154 ? -36.135 -9.518  -43.446 1.00 88.49  ? 154 PHE B CZ    1 
ATOM   4929 N  N     . LEU B 1 155 ? -30.375 -11.027 -43.171 1.00 70.49  ? 155 LEU B N     1 
ATOM   4930 C  CA    . LEU B 1 155 ? -29.694 -10.319 -42.092 1.00 63.06  ? 155 LEU B CA    1 
ATOM   4931 C  C     . LEU B 1 155 ? -28.370 -9.709  -42.531 1.00 60.80  ? 155 LEU B C     1 
ATOM   4932 O  O     . LEU B 1 155 ? -27.965 -8.670  -42.017 1.00 56.55  ? 155 LEU B O     1 
ATOM   4933 C  CB    . LEU B 1 155 ? -29.459 -11.261 -40.910 1.00 60.38  ? 155 LEU B CB    1 
ATOM   4934 C  CG    . LEU B 1 155 ? -30.681 -11.803 -40.162 1.00 62.48  ? 155 LEU B CG    1 
ATOM   4935 C  CD1   . LEU B 1 155 ? -30.357 -13.105 -39.447 1.00 62.34  ? 155 LEU B CD1   1 
ATOM   4936 C  CD2   . LEU B 1 155 ? -31.225 -10.768 -39.186 1.00 59.50  ? 155 LEU B CD2   1 
ATOM   4937 N  N     . LYS B 1 156 ? -27.696 -10.353 -43.476 1.00 64.57  ? 156 LYS B N     1 
ATOM   4938 C  CA    . LYS B 1 156 ? -26.391 -9.880  -43.924 1.00 64.06  ? 156 LYS B CA    1 
ATOM   4939 C  C     . LYS B 1 156 ? -26.521 -8.727  -44.915 1.00 67.33  ? 156 LYS B C     1 
ATOM   4940 O  O     . LYS B 1 156 ? -25.592 -7.931  -45.070 1.00 66.60  ? 156 LYS B O     1 
ATOM   4941 C  CB    . LYS B 1 156 ? -25.576 -11.018 -44.540 1.00 68.32  ? 156 LYS B CB    1 
ATOM   4942 C  CG    . LYS B 1 156 ? -24.077 -10.952 -44.237 1.00 65.78  ? 156 LYS B CG    1 
ATOM   4943 C  CD    . LYS B 1 156 ? -23.251 -11.810 -45.193 1.00 71.68  ? 156 LYS B CD    1 
ATOM   4944 C  CE    . LYS B 1 156 ? -23.044 -11.111 -46.534 1.00 77.59  ? 156 LYS B CE    1 
ATOM   4945 N  NZ    . LYS B 1 156 ? -22.191 -11.915 -47.451 1.00 84.67  ? 156 LYS B NZ    1 
ATOM   4946 N  N     . ALA B 1 157 ? -27.667 -8.639  -45.586 1.00 71.85  ? 157 ALA B N     1 
ATOM   4947 C  CA    . ALA B 1 157 ? -27.953 -7.498  -46.451 1.00 75.52  ? 157 ALA B CA    1 
ATOM   4948 C  C     . ALA B 1 157 ? -28.368 -6.305  -45.616 1.00 70.62  ? 157 ALA B C     1 
ATOM   4949 O  O     . ALA B 1 157 ? -28.374 -5.176  -46.098 1.00 72.61  ? 157 ALA B O     1 
ATOM   4950 C  CB    . ALA B 1 157 ? -29.032 -7.834  -47.428 1.00 83.14  ? 157 ALA B CB    1 
ATOM   4951 N  N     . ASN B 1 158 ? -28.722 -6.576  -44.363 1.00 65.10  ? 158 ASN B N     1 
ATOM   4952 C  CA    . ASN B 1 158 ? -29.120 -5.550  -43.413 1.00 60.86  ? 158 ASN B CA    1 
ATOM   4953 C  C     . ASN B 1 158 ? -28.054 -5.203  -42.389 1.00 54.52  ? 158 ASN B C     1 
ATOM   4954 O  O     . ASN B 1 158 ? -28.330 -4.511  -41.406 1.00 50.85  ? 158 ASN B O     1 
ATOM   4955 C  CB    . ASN B 1 158 ? -30.390 -5.976  -42.698 1.00 60.72  ? 158 ASN B CB    1 
ATOM   4956 C  CG    . ASN B 1 158 ? -31.623 -5.690  -43.512 1.00 67.61  ? 158 ASN B CG    1 
ATOM   4957 O  OD1   . ASN B 1 158 ? -32.036 -4.529  -43.660 1.00 68.30  ? 158 ASN B OD1   1 
ATOM   4958 N  ND2   . ASN B 1 158 ? -32.231 -6.748  -44.049 1.00 72.74  ? 158 ASN B ND2   1 
ATOM   4959 N  N     . GLY B 1 159 ? -26.838 -5.690  -42.619 1.00 54.07  ? 159 GLY B N     1 
ATOM   4960 C  CA    . GLY B 1 159 ? -25.714 -5.441  -41.719 1.00 49.11  ? 159 GLY B CA    1 
ATOM   4961 C  C     . GLY B 1 159 ? -25.965 -5.781  -40.260 1.00 44.08  ? 159 GLY B C     1 
ATOM   4962 O  O     . GLY B 1 159 ? -25.278 -5.262  -39.387 1.00 40.35  ? 159 GLY B O     1 
ATOM   4963 N  N     . ILE B 1 160 ? -26.954 -6.637  -39.994 1.00 45.16  ? 160 ILE B N     1 
ATOM   4964 C  CA    . ILE B 1 160 ? -27.240 -7.116  -38.632 1.00 42.01  ? 160 ILE B CA    1 
ATOM   4965 C  C     . ILE B 1 160 ? -27.105 -8.636  -38.504 1.00 43.35  ? 160 ILE B C     1 
ATOM   4966 O  O     . ILE B 1 160 ? -27.842 -9.280  -37.748 1.00 43.75  ? 160 ILE B O     1 
ATOM   4967 C  CB    . ILE B 1 160 ? -28.624 -6.619  -38.063 1.00 42.79  ? 160 ILE B CB    1 
ATOM   4968 C  CG1   . ILE B 1 160 ? -29.799 -7.043  -38.966 1.00 48.61  ? 160 ILE B CG1   1 
ATOM   4969 C  CG2   . ILE B 1 160 ? -28.598 -5.119  -37.813 1.00 40.40  ? 160 ILE B CG2   1 
ATOM   4970 C  CD1   . ILE B 1 160 ? -31.170 -7.031  -38.272 1.00 50.15  ? 160 ILE B CD1   1 
ATOM   4971 N  N     . TYR B 1 161 ? -26.161 -9.199  -39.257 1.00 44.85  ? 161 TYR B N     1 
ATOM   4972 C  CA    . TYR B 1 161 ? -25.746 -10.582 -39.078 1.00 46.33  ? 161 TYR B CA    1 
ATOM   4973 C  C     . TYR B 1 161 ? -24.317 -10.585 -38.588 1.00 43.55  ? 161 TYR B C     1 
ATOM   4974 O  O     . TYR B 1 161 ? -23.457 -9.973  -39.209 1.00 43.75  ? 161 TYR B O     1 
ATOM   4975 C  CB    . TYR B 1 161 ? -25.840 -11.362 -40.384 1.00 51.98  ? 161 TYR B CB    1 
ATOM   4976 C  CG    . TYR B 1 161 ? -25.200 -12.732 -40.314 1.00 54.68  ? 161 TYR B CG    1 
ATOM   4977 C  CD1   . TYR B 1 161 ? -25.782 -13.762 -39.563 1.00 55.93  ? 161 TYR B CD1   1 
ATOM   4978 C  CD2   . TYR B 1 161 ? -24.014 -13.007 -41.000 1.00 56.56  ? 161 TYR B CD2   1 
ATOM   4979 C  CE1   . TYR B 1 161 ? -25.196 -15.024 -39.493 1.00 58.21  ? 161 TYR B CE1   1 
ATOM   4980 C  CE2   . TYR B 1 161 ? -23.427 -14.274 -40.943 1.00 59.17  ? 161 TYR B CE2   1 
ATOM   4981 C  CZ    . TYR B 1 161 ? -24.023 -15.270 -40.187 1.00 59.81  ? 161 TYR B CZ    1 
ATOM   4982 O  OH    . TYR B 1 161 ? -23.442 -16.512 -40.123 1.00 63.65  ? 161 TYR B OH    1 
ATOM   4983 N  N     . GLY B 1 162 ? -24.069 -11.275 -37.478 1.00 42.21  ? 162 GLY B N     1 
ATOM   4984 C  CA    . GLY B 1 162 ? -22.739 -11.330 -36.875 1.00 40.33  ? 162 GLY B CA    1 
ATOM   4985 C  C     . GLY B 1 162 ? -22.726 -10.900 -35.416 1.00 36.79  ? 162 GLY B C     1 
ATOM   4986 O  O     . GLY B 1 162 ? -22.999 -9.743  -35.087 1.00 33.98  ? 162 GLY B O     1 
ATOM   4987 N  N     . ALA B 1 163 ? -22.380 -11.834 -34.537 1.00 37.56  ? 163 ALA B N     1 
ATOM   4988 C  CA    . ALA B 1 163 ? -22.402 -11.582 -33.097 1.00 35.38  ? 163 ALA B CA    1 
ATOM   4989 C  C     . ALA B 1 163 ? -21.247 -10.716 -32.582 1.00 32.38  ? 163 ALA B C     1 
ATOM   4990 O  O     . ALA B 1 163 ? -21.262 -10.303 -31.420 1.00 31.05  ? 163 ALA B O     1 
ATOM   4991 C  CB    . ALA B 1 163 ? -22.460 -12.897 -32.335 1.00 38.46  ? 163 ALA B CB    1 
ATOM   4992 N  N     . GLU B 1 164 ? -20.262 -10.433 -33.433 1.00 32.21  ? 164 GLU B N     1 
ATOM   4993 C  CA    . GLU B 1 164 ? -19.079 -9.684  -33.002 1.00 30.46  ? 164 GLU B CA    1 
ATOM   4994 C  C     . GLU B 1 164 ? -19.358 -8.184  -32.790 1.00 27.51  ? 164 GLU B C     1 
ATOM   4995 O  O     . GLU B 1 164 ? -20.199 -7.607  -33.470 1.00 27.29  ? 164 GLU B O     1 
ATOM   4996 C  CB    . GLU B 1 164 ? -17.900 -9.927  -33.951 1.00 32.70  ? 164 GLU B CB    1 
ATOM   4997 C  CG    . GLU B 1 164 ? -17.982 -9.204  -35.281 1.00 33.93  ? 164 GLU B CG    1 
ATOM   4998 C  CD    . GLU B 1 164 ? -18.792 -9.943  -36.320 1.00 36.50  ? 164 GLU B CD    1 
ATOM   4999 O  OE1   . GLU B 1 164 ? -18.520 -9.747  -37.523 1.00 39.39  ? 164 GLU B OE1   1 
ATOM   5000 O  OE2   . GLU B 1 164 ? -19.696 -10.714 -35.948 1.00 36.76  ? 164 GLU B OE2   1 
ATOM   5001 N  N     . TYR B 1 165 ? -18.638 -7.571  -31.850 1.00 26.05  ? 165 TYR B N     1 
ATOM   5002 C  CA    . TYR B 1 165 ? -18.928 -6.211  -31.373 1.00 24.02  ? 165 TYR B CA    1 
ATOM   5003 C  C     . TYR B 1 165 ? -18.960 -5.109  -32.433 1.00 23.69  ? 165 TYR B C     1 
ATOM   5004 O  O     . TYR B 1 165 ? -19.373 -3.982  -32.151 1.00 22.71  ? 165 TYR B O     1 
ATOM   5005 C  CB    . TYR B 1 165 ? -17.964 -5.804  -30.251 1.00 24.13  ? 165 TYR B CB    1 
ATOM   5006 C  CG    . TYR B 1 165 ? -18.256 -6.427  -28.902 1.00 25.24  ? 165 TYR B CG    1 
ATOM   5007 C  CD1   . TYR B 1 165 ? -17.261 -7.115  -28.206 1.00 27.59  ? 165 TYR B CD1   1 
ATOM   5008 C  CD2   . TYR B 1 165 ? -19.526 -6.329  -28.317 1.00 25.50  ? 165 TYR B CD2   1 
ATOM   5009 C  CE1   . TYR B 1 165 ? -17.517 -7.697  -26.955 1.00 29.58  ? 165 TYR B CE1   1 
ATOM   5010 C  CE2   . TYR B 1 165 ? -19.799 -6.914  -27.065 1.00 27.65  ? 165 TYR B CE2   1 
ATOM   5011 C  CZ    . TYR B 1 165 ? -18.784 -7.600  -26.394 1.00 29.43  ? 165 TYR B CZ    1 
ATOM   5012 O  OH    . TYR B 1 165 ? -19.020 -8.178  -25.168 1.00 31.63  ? 165 TYR B OH    1 
ATOM   5013 N  N     . LYS B 1 166 ? -18.517 -5.421  -33.642 1.00 25.26  ? 166 LYS B N     1 
ATOM   5014 C  CA    . LYS B 1 166 ? -18.621 -4.470  -34.731 1.00 26.12  ? 166 LYS B CA    1 
ATOM   5015 C  C     . LYS B 1 166 ? -20.056 -4.484  -35.266 1.00 26.32  ? 166 LYS B C     1 
ATOM   5016 O  O     . LYS B 1 166 ? -20.515 -3.509  -35.860 1.00 27.53  ? 166 LYS B O     1 
ATOM   5017 C  CB    . LYS B 1 166 ? -17.621 -4.820  -35.829 1.00 29.58  ? 166 LYS B CB    1 
ATOM   5018 C  CG    . LYS B 1 166 ? -17.402 -3.748  -36.874 1.00 31.65  ? 166 LYS B CG    1 
ATOM   5019 C  CD    . LYS B 1 166 ? -16.532 -4.291  -37.988 1.00 36.18  ? 166 LYS B CD    1 
ATOM   5020 C  CE    . LYS B 1 166 ? -16.677 -3.495  -39.262 1.00 40.38  ? 166 LYS B CE    1 
ATOM   5021 N  NZ    . LYS B 1 166 ? -16.182 -4.277  -40.430 1.00 46.45  ? 166 LYS B NZ    1 
ATOM   5022 N  N     . VAL B 1 167 ? -20.775 -5.576  -35.020 1.00 25.84  ? 167 VAL B N     1 
ATOM   5023 C  CA    . VAL B 1 167 ? -22.065 -5.812  -35.660 1.00 26.90  ? 167 VAL B CA    1 
ATOM   5024 C  C     . VAL B 1 167 ? -23.208 -5.927  -34.665 1.00 25.54  ? 167 VAL B C     1 
ATOM   5025 O  O     . VAL B 1 167 ? -24.339 -5.575  -34.984 1.00 26.98  ? 167 VAL B O     1 
ATOM   5026 C  CB    . VAL B 1 167 ? -22.034 -7.102  -36.510 1.00 29.92  ? 167 VAL B CB    1 
ATOM   5027 C  CG1   . VAL B 1 167 ? -23.275 -7.206  -37.377 1.00 32.50  ? 167 VAL B CG1   1 
ATOM   5028 C  CG2   . VAL B 1 167 ? -20.774 -7.161  -37.371 1.00 32.31  ? 167 VAL B CG2   1 
ATOM   5029 N  N     . ARG B 1 168 ? -22.913 -6.435  -33.471 1.00 24.17  ? 168 ARG B N     1 
ATOM   5030 C  CA    . ARG B 1 168 ? -23.925 -6.726  -32.429 1.00 24.19  ? 168 ARG B CA    1 
ATOM   5031 C  C     . ARG B 1 168 ? -25.213 -7.348  -32.981 1.00 26.87  ? 168 ARG B C     1 
ATOM   5032 O  O     . ARG B 1 168 ? -26.316 -7.024  -32.552 1.00 27.64  ? 168 ARG B O     1 
ATOM   5033 C  CB    . ARG B 1 168 ? -24.224 -5.482  -31.566 1.00 22.70  ? 168 ARG B CB    1 
ATOM   5034 C  CG    . ARG B 1 168 ? -23.019 -4.947  -30.841 1.00 19.97  ? 168 ARG B CG    1 
ATOM   5035 C  CD    . ARG B 1 168 ? -23.293 -4.579  -29.403 1.00 19.72  ? 168 ARG B CD    1 
ATOM   5036 N  NE    . ARG B 1 168 ? -22.022 -4.177  -28.789 1.00 20.45  ? 168 ARG B NE    1 
ATOM   5037 C  CZ    . ARG B 1 168 ? -21.833 -3.884  -27.501 1.00 20.40  ? 168 ARG B CZ    1 
ATOM   5038 N  NH1   . ARG B 1 168 ? -22.845 -3.936  -26.639 1.00 22.31  ? 168 ARG B NH1   1 
ATOM   5039 N  NH2   . ARG B 1 168 ? -20.620 -3.534  -27.077 1.00 17.52  ? 168 ARG B NH2   1 
ATOM   5040 N  N     . GLY B 1 169 ? -25.049 -8.260  -33.931 1.00 29.17  ? 169 GLY B N     1 
ATOM   5041 C  CA    . GLY B 1 169 ? -26.181 -8.868  -34.625 1.00 32.97  ? 169 GLY B CA    1 
ATOM   5042 C  C     . GLY B 1 169 ? -26.399 -10.341 -34.337 1.00 35.86  ? 169 GLY B C     1 
ATOM   5043 O  O     . GLY B 1 169 ? -26.010 -10.854 -33.294 1.00 35.28  ? 169 GLY B O     1 
ATOM   5044 N  N     . PHE B 1 170 ? -27.028 -11.017 -35.286 1.00 39.97  ? 170 PHE B N     1 
ATOM   5045 C  CA    . PHE B 1 170 ? -27.423 -12.403 -35.117 1.00 44.35  ? 170 PHE B CA    1 
ATOM   5046 C  C     . PHE B 1 170 ? -26.282 -13.351 -35.415 1.00 45.32  ? 170 PHE B C     1 
ATOM   5047 O  O     . PHE B 1 170 ? -25.666 -13.309 -36.479 1.00 45.76  ? 170 PHE B O     1 
ATOM   5048 C  CB    . PHE B 1 170 ? -28.637 -12.716 -35.996 1.00 49.35  ? 170 PHE B CB    1 
ATOM   5049 C  CG    . PHE B 1 170 ? -29.899 -12.040 -35.536 1.00 50.70  ? 170 PHE B CG    1 
ATOM   5050 C  CD1   . PHE B 1 170 ? -30.062 -10.652 -35.684 1.00 48.28  ? 170 PHE B CD1   1 
ATOM   5051 C  CD2   . PHE B 1 170 ? -30.915 -12.779 -34.938 1.00 54.79  ? 170 PHE B CD2   1 
ATOM   5052 C  CE1   . PHE B 1 170 ? -31.218 -10.014 -35.250 1.00 49.59  ? 170 PHE B CE1   1 
ATOM   5053 C  CE2   . PHE B 1 170 ? -32.073 -12.154 -34.496 1.00 57.21  ? 170 PHE B CE2   1 
ATOM   5054 C  CZ    . PHE B 1 170 ? -32.225 -10.765 -34.655 1.00 54.80  ? 170 PHE B CZ    1 
ATOM   5055 N  N     . SER B 1 171 ? -26.000 -14.203 -34.444 1.00 46.70  ? 171 SER B N     1 
ATOM   5056 C  CA    . SER B 1 171 ? -25.008 -15.242 -34.606 1.00 49.25  ? 171 SER B CA    1 
ATOM   5057 C  C     . SER B 1 171 ? -25.465 -16.273 -35.645 1.00 55.08  ? 171 SER B C     1 
ATOM   5058 O  O     . SER B 1 171 ? -26.656 -16.569 -35.740 1.00 58.39  ? 171 SER B O     1 
ATOM   5059 C  CB    . SER B 1 171 ? -24.764 -15.909 -33.259 1.00 50.14  ? 171 SER B CB    1 
ATOM   5060 O  OG    . SER B 1 171 ? -24.008 -17.088 -33.426 1.00 54.81  ? 171 SER B OG    1 
ATOM   5061 N  N     . GLY B 1 172 ? -24.516 -16.801 -36.422 1.00 57.28  ? 172 GLY B N     1 
ATOM   5062 C  CA    . GLY B 1 172 ? -24.790 -17.854 -37.407 1.00 64.07  ? 172 GLY B CA    1 
ATOM   5063 C  C     . GLY B 1 172 ? -25.497 -19.055 -36.797 1.00 69.62  ? 172 GLY B C     1 
ATOM   5064 O  O     . GLY B 1 172 ? -26.496 -19.546 -37.339 1.00 74.42  ? 172 GLY B O     1 
ATOM   5065 N  N     . TYR B 1 173 ? -24.971 -19.525 -35.666 1.00 69.68  ? 173 TYR B N     1 
ATOM   5066 C  CA    . TYR B 1 173 ? -25.622 -20.557 -34.861 1.00 75.17  ? 173 TYR B CA    1 
ATOM   5067 C  C     . TYR B 1 173 ? -27.072 -20.185 -34.490 1.00 76.28  ? 173 TYR B C     1 
ATOM   5068 O  O     . TYR B 1 173 ? -27.979 -20.996 -34.671 1.00 82.69  ? 173 TYR B O     1 
ATOM   5069 C  CB    . TYR B 1 173 ? -24.784 -20.858 -33.604 1.00 74.45  ? 173 TYR B CB    1 
ATOM   5070 C  CG    . TYR B 1 173 ? -25.281 -22.030 -32.770 1.00 81.26  ? 173 TYR B CG    1 
ATOM   5071 C  CD1   . TYR B 1 173 ? -25.275 -23.330 -33.281 1.00 88.82  ? 173 TYR B CD1   1 
ATOM   5072 C  CD2   . TYR B 1 173 ? -25.736 -21.839 -31.467 1.00 81.06  ? 173 TYR B CD2   1 
ATOM   5073 C  CE1   . TYR B 1 173 ? -25.726 -24.406 -32.522 1.00 96.28  ? 173 TYR B CE1   1 
ATOM   5074 C  CE2   . TYR B 1 173 ? -26.187 -22.907 -30.698 1.00 89.15  ? 173 TYR B CE2   1 
ATOM   5075 C  CZ    . TYR B 1 173 ? -26.180 -24.193 -31.232 1.00 96.59  ? 173 TYR B CZ    1 
ATOM   5076 O  OH    . TYR B 1 173 ? -26.624 -25.264 -30.481 1.00 104.47 ? 173 TYR B OH    1 
ATOM   5077 N  N     . LEU B 1 174 ? -27.283 -18.961 -33.993 1.00 71.04  ? 174 LEU B N     1 
ATOM   5078 C  CA    . LEU B 1 174 ? -28.619 -18.486 -33.592 1.00 72.42  ? 174 LEU B CA    1 
ATOM   5079 C  C     . LEU B 1 174 ? -29.638 -18.602 -34.726 1.00 76.61  ? 174 LEU B C     1 
ATOM   5080 O  O     . LEU B 1 174 ? -30.786 -18.993 -34.497 1.00 81.93  ? 174 LEU B O     1 
ATOM   5081 C  CB    . LEU B 1 174 ? -28.562 -17.031 -33.113 1.00 65.89  ? 174 LEU B CB    1 
ATOM   5082 C  CG    . LEU B 1 174 ? -29.570 -16.473 -32.088 1.00 66.72  ? 174 LEU B CG    1 
ATOM   5083 C  CD1   . LEU B 1 174 ? -29.367 -14.977 -31.923 1.00 60.28  ? 174 LEU B CD1   1 
ATOM   5084 C  CD2   . LEU B 1 174 ? -31.039 -16.768 -32.397 1.00 72.62  ? 174 LEU B CD2   1 
ATOM   5085 N  N     . CYS B 1 175 ? -29.212 -18.248 -35.937 1.00 75.00  ? 175 CYS B N     1 
ATOM   5086 C  CA    . CYS B 1 175 ? -30.050 -18.365 -37.123 1.00 79.65  ? 175 CYS B CA    1 
ATOM   5087 C  C     . CYS B 1 175 ? -30.404 -19.820 -37.385 1.00 88.12  ? 175 CYS B C     1 
ATOM   5088 O  O     . CYS B 1 175 ? -31.559 -20.130 -37.703 1.00 94.32  ? 175 CYS B O     1 
ATOM   5089 C  CB    . CYS B 1 175 ? -29.348 -17.768 -38.332 1.00 77.11  ? 175 CYS B CB    1 
ATOM   5090 S  SG    . CYS B 1 175 ? -28.811 -16.083 -38.042 1.00 68.68  ? 175 CYS B SG    1 
ATOM   5091 N  N     . GLU B 1 176 ? -29.421 -20.712 -37.239 1.00 89.28  ? 176 GLU B N     1 
ATOM   5092 C  CA    . GLU B 1 176 ? -29.668 -22.148 -37.367 1.00 97.52  ? 176 GLU B CA    1 
ATOM   5093 C  C     . GLU B 1 176 ? -30.706 -22.607 -36.352 1.00 101.93 ? 176 GLU B C     1 
ATOM   5094 O  O     . GLU B 1 176 ? -31.601 -23.379 -36.686 1.00 109.80 ? 176 GLU B O     1 
ATOM   5095 C  CB    . GLU B 1 176 ? -28.377 -22.949 -37.218 1.00 98.28  ? 176 GLU B CB    1 
ATOM   5096 C  CG    . GLU B 1 176 ? -27.301 -22.607 -38.240 1.00 96.31  ? 176 GLU B CG    1 
ATOM   5097 C  CD    . GLU B 1 176 ? -26.390 -23.785 -38.549 1.00 102.73 ? 176 GLU B CD    1 
ATOM   5098 O  OE1   . GLU B 1 176 ? -26.890 -24.818 -39.045 1.00 111.19 ? 176 GLU B OE1   1 
ATOM   5099 O  OE2   . GLU B 1 176 ? -25.169 -23.678 -38.310 1.00 100.22 ? 176 GLU B OE2   1 
ATOM   5100 N  N     . LEU B 1 177 ? -30.592 -22.097 -35.127 1.00 97.63  ? 177 LEU B N     1 
ATOM   5101 C  CA    . LEU B 1 177 ? -31.542 -22.385 -34.053 1.00 102.28 ? 177 LEU B CA    1 
ATOM   5102 C  C     . LEU B 1 177 ? -32.936 -21.815 -34.289 1.00 104.59 ? 177 LEU B C     1 
ATOM   5103 O  O     . LEU B 1 177 ? -33.907 -22.297 -33.713 1.00 111.75 ? 177 LEU B O     1 
ATOM   5104 C  CB    . LEU B 1 177 ? -31.021 -21.871 -32.709 1.00 97.62  ? 177 LEU B CB    1 
ATOM   5105 C  CG    . LEU B 1 177 ? -29.962 -22.665 -31.940 1.00 98.98  ? 177 LEU B CG    1 
ATOM   5106 C  CD1   . LEU B 1 177 ? -29.749 -22.008 -30.584 1.00 95.77  ? 177 LEU B CD1   1 
ATOM   5107 C  CD2   . LEU B 1 177 ? -30.326 -24.148 -31.773 1.00 108.95 ? 177 LEU B CD2   1 
ATOM   5108 N  N     . LEU B 1 178 ? -33.040 -20.784 -35.118 1.00 99.66  ? 178 LEU B N     1 
ATOM   5109 C  CA    . LEU B 1 178 ? -34.340 -20.182 -35.392 1.00 102.38 ? 178 LEU B CA    1 
ATOM   5110 C  C     . LEU B 1 178 ? -35.103 -20.972 -36.445 1.00 110.52 ? 178 LEU B C     1 
ATOM   5111 O  O     . LEU B 1 178 ? -36.326 -20.881 -36.547 1.00 116.08 ? 178 LEU B O     1 
ATOM   5112 C  CB    . LEU B 1 178 ? -34.195 -18.711 -35.792 1.00 94.94  ? 178 LEU B CB    1 
ATOM   5113 C  CG    . LEU B 1 178 ? -33.773 -17.759 -34.666 1.00 88.45  ? 178 LEU B CG    1 
ATOM   5114 C  CD1   . LEU B 1 178 ? -33.599 -16.335 -35.182 1.00 81.91  ? 178 LEU B CD1   1 
ATOM   5115 C  CD2   . LEU B 1 178 ? -34.757 -17.797 -33.493 1.00 93.36  ? 178 LEU B CD2   1 
ATOM   5116 N  N     . ILE B 1 179 ? -34.371 -21.759 -37.219 1.00 112.01 ? 179 ILE B N     1 
ATOM   5117 C  CA    . ILE B 1 179 ? -34.997 -22.651 -38.174 1.00 120.92 ? 179 ILE B CA    1 
ATOM   5118 C  C     . ILE B 1 179 ? -35.478 -23.913 -37.468 1.00 129.67 ? 179 ILE B C     1 
ATOM   5119 O  O     . ILE B 1 179 ? -36.604 -24.346 -37.691 1.00 138.27 ? 179 ILE B O     1 
ATOM   5120 C  CB    . ILE B 1 179 ? -34.056 -22.968 -39.357 1.00 120.49 ? 179 ILE B CB    1 
ATOM   5121 C  CG1   . ILE B 1 179 ? -33.679 -21.675 -40.100 1.00 113.46 ? 179 ILE B CG1   1 
ATOM   5122 C  CG2   . ILE B 1 179 ? -34.680 -24.000 -40.301 1.00 130.97 ? 179 ILE B CG2   1 
ATOM   5123 C  CD1   . ILE B 1 179 ? -34.836 -20.703 -40.365 1.00 114.03 ? 179 ILE B CD1   1 
ATOM   5124 N  N     . VAL B 1 180 ? -34.644 -24.482 -36.600 1.00 128.35 ? 180 VAL B N     1 
ATOM   5125 C  CA    . VAL B 1 180 ? -35.019 -25.698 -35.869 1.00 137.53 ? 180 VAL B CA    1 
ATOM   5126 C  C     . VAL B 1 180 ? -36.178 -25.437 -34.897 1.00 141.49 ? 180 VAL B C     1 
ATOM   5127 O  O     . VAL B 1 180 ? -36.954 -26.346 -34.582 1.00 151.88 ? 180 VAL B O     1 
ATOM   5128 C  CB    . VAL B 1 180 ? -33.811 -26.363 -35.148 1.00 136.23 ? 180 VAL B CB    1 
ATOM   5129 C  CG1   . VAL B 1 180 ? -34.109 -27.830 -34.817 1.00 147.70 ? 180 VAL B CG1   1 
ATOM   5130 C  CG2   . VAL B 1 180 ? -32.570 -26.291 -36.013 1.00 130.90 ? 180 VAL B CG2   1 
ATOM   5131 N  N     . PHE B 1 181 ? -36.304 -24.192 -34.445 1.00 134.07 ? 181 PHE B N     1 
ATOM   5132 C  CA    . PHE B 1 181 ? -37.452 -23.789 -33.641 1.00 138.25 ? 181 PHE B CA    1 
ATOM   5133 C  C     . PHE B 1 181 ? -38.696 -23.535 -34.503 1.00 143.65 ? 181 PHE B C     1 
ATOM   5134 O  O     . PHE B 1 181 ? -39.784 -23.985 -34.155 1.00 153.47 ? 181 PHE B O     1 
ATOM   5135 C  CB    . PHE B 1 181 ? -37.125 -22.557 -32.784 1.00 129.43 ? 181 PHE B CB    1 
ATOM   5136 C  CG    . PHE B 1 181 ? -38.217 -22.178 -31.806 1.00 134.82 ? 181 PHE B CG    1 
ATOM   5137 C  CD1   . PHE B 1 181 ? -38.187 -22.645 -30.492 1.00 139.62 ? 181 PHE B CD1   1 
ATOM   5138 C  CD2   . PHE B 1 181 ? -39.272 -21.348 -32.194 1.00 136.06 ? 181 PHE B CD2   1 
ATOM   5139 C  CE1   . PHE B 1 181 ? -39.196 -22.296 -29.580 1.00 145.61 ? 181 PHE B CE1   1 
ATOM   5140 C  CE2   . PHE B 1 181 ? -40.284 -20.995 -31.289 1.00 141.78 ? 181 PHE B CE2   1 
ATOM   5141 C  CZ    . PHE B 1 181 ? -40.243 -21.469 -29.980 1.00 146.62 ? 181 PHE B CZ    1 
ATOM   5142 N  N     . TYR B 1 182 ? -38.535 -22.827 -35.622 1.00 138.28 ? 182 TYR B N     1 
ATOM   5143 C  CA    . TYR B 1 182 ? -39.686 -22.349 -36.403 1.00 142.58 ? 182 TYR B CA    1 
ATOM   5144 C  C     . TYR B 1 182 ? -40.062 -23.159 -37.638 1.00 150.21 ? 182 TYR B C     1 
ATOM   5145 O  O     . TYR B 1 182 ? -41.245 -23.261 -37.965 1.00 158.83 ? 182 TYR B O     1 
ATOM   5146 C  CB    . TYR B 1 182 ? -39.508 -20.885 -36.787 1.00 133.66 ? 182 TYR B CB    1 
ATOM   5147 C  CG    . TYR B 1 182 ? -39.760 -19.943 -35.645 1.00 130.01 ? 182 TYR B CG    1 
ATOM   5148 C  CD1   . TYR B 1 182 ? -41.036 -19.798 -35.117 1.00 137.73 ? 182 TYR B CD1   1 
ATOM   5149 C  CD2   . TYR B 1 182 ? -38.728 -19.194 -35.092 1.00 120.09 ? 182 TYR B CD2   1 
ATOM   5150 C  CE1   . TYR B 1 182 ? -41.282 -18.935 -34.066 1.00 135.60 ? 182 TYR B CE1   1 
ATOM   5151 C  CE2   . TYR B 1 182 ? -38.963 -18.320 -34.038 1.00 117.55 ? 182 TYR B CE2   1 
ATOM   5152 C  CZ    . TYR B 1 182 ? -40.247 -18.197 -33.532 1.00 125.41 ? 182 TYR B CZ    1 
ATOM   5153 O  OH    . TYR B 1 182 ? -40.508 -17.340 -32.490 1.00 124.19 ? 182 TYR B OH    1 
ATOM   5154 N  N     . GLY B 1 183 ? -39.068 -23.698 -38.336 1.00 147.90 ? 183 GLY B N     1 
ATOM   5155 C  CA    . GLY B 1 183 ? -39.321 -24.589 -39.471 1.00 156.14 ? 183 GLY B CA    1 
ATOM   5156 C  C     . GLY B 1 183 ? -39.102 -23.980 -40.848 1.00 153.34 ? 183 GLY B C     1 
ATOM   5157 O  O     . GLY B 1 183 ? -38.798 -24.716 -41.825 1.00 158.04 ? 183 GLY B O     1 
ATOM   5158 N  N     . SER B 1 184 ? -39.268 -22.646 -40.931 1.00 146.48 ? 184 SER B N     1 
ATOM   5159 C  CA    . SER B 1 184 ? -39.062 -21.933 -42.188 1.00 144.20 ? 184 SER B CA    1 
ATOM   5160 C  C     . SER B 1 184 ? -38.728 -20.484 -41.919 1.00 134.40 ? 184 SER B C     1 
ATOM   5161 O  O     . SER B 1 184 ? -39.221 -19.903 -40.953 1.00 132.33 ? 184 SER B O     1 
ATOM   5162 C  CB    . SER B 1 184 ? -40.312 -21.996 -43.069 1.00 154.05 ? 184 SER B CB    1 
ATOM   5163 O  OG    . SER B 1 184 ? -41.256 -21.006 -42.690 1.00 153.19 ? 184 SER B OG    1 
ATOM   5164 N  N     . PHE B 1 185 ? -37.906 -19.901 -42.790 1.00 129.60 ? 185 PHE B N     1 
ATOM   5165 C  CA    . PHE B 1 185 ? -37.549 -18.481 -42.730 1.00 121.04 ? 185 PHE B CA    1 
ATOM   5166 C  C     . PHE B 1 185 ? -38.794 -17.590 -42.679 1.00 123.41 ? 185 PHE B C     1 
ATOM   5167 O  O     . PHE B 1 185 ? -38.848 -16.627 -41.913 1.00 117.61 ? 185 PHE B O     1 
ATOM   5168 C  CB    . PHE B 1 185 ? -36.647 -18.120 -43.923 1.00 119.13 ? 185 PHE B CB    1 
ATOM   5169 C  CG    . PHE B 1 185 ? -36.626 -16.649 -44.269 1.00 114.64 ? 185 PHE B CG    1 
ATOM   5170 C  CD1   . PHE B 1 185 ? -37.158 -16.201 -45.471 1.00 120.21 ? 185 PHE B CD1   1 
ATOM   5171 C  CD2   . PHE B 1 185 ? -36.059 -15.716 -43.403 1.00 105.84 ? 185 PHE B CD2   1 
ATOM   5172 C  CE1   . PHE B 1 185 ? -37.136 -14.848 -45.801 1.00 117.42 ? 185 PHE B CE1   1 
ATOM   5173 C  CE2   . PHE B 1 185 ? -36.030 -14.364 -43.727 1.00 102.49 ? 185 PHE B CE2   1 
ATOM   5174 C  CZ    . PHE B 1 185 ? -36.573 -13.927 -44.927 1.00 108.13 ? 185 PHE B CZ    1 
ATOM   5175 N  N     . LEU B 1 186 ? -39.791 -17.936 -43.487 1.00 132.71 ? 186 LEU B N     1 
ATOM   5176 C  CA    . LEU B 1 186 ? -41.035 -17.176 -43.556 1.00 136.98 ? 186 LEU B CA    1 
ATOM   5177 C  C     . LEU B 1 186 ? -41.770 -17.177 -42.209 1.00 137.52 ? 186 LEU B C     1 
ATOM   5178 O  O     . LEU B 1 186 ? -42.145 -16.113 -41.699 1.00 134.39 ? 186 LEU B O     1 
ATOM   5179 C  CB    . LEU B 1 186 ? -41.929 -17.717 -44.682 1.00 148.28 ? 186 LEU B CB    1 
ATOM   5180 C  CG    . LEU B 1 186 ? -43.160 -16.901 -45.090 1.00 154.25 ? 186 LEU B CG    1 
ATOM   5181 C  CD1   . LEU B 1 186 ? -42.765 -15.626 -45.821 1.00 149.07 ? 186 LEU B CD1   1 
ATOM   5182 C  CD2   . LEU B 1 186 ? -44.091 -17.753 -45.951 1.00 167.44 ? 186 LEU B CD2   1 
ATOM   5183 N  N     . GLU B 1 187 ? -41.957 -18.368 -41.637 1.00 142.09 ? 187 GLU B N     1 
ATOM   5184 C  CA    . GLU B 1 187 ? -42.619 -18.512 -40.341 1.00 144.09 ? 187 GLU B CA    1 
ATOM   5185 C  C     . GLU B 1 187 ? -41.829 -17.789 -39.243 1.00 133.41 ? 187 GLU B C     1 
ATOM   5186 O  O     . GLU B 1 187 ? -42.414 -17.190 -38.336 1.00 133.33 ? 187 GLU B O     1 
ATOM   5187 C  CB    . GLU B 1 187 ? -42.817 -19.993 -39.995 1.00 152.06 ? 187 GLU B CB    1 
ATOM   5188 C  CG    . GLU B 1 187 ? -43.833 -20.252 -38.890 1.00 159.40 ? 187 GLU B CG    1 
ATOM   5189 C  CD    . GLU B 1 187 ? -45.266 -20.119 -39.378 1.00 170.86 ? 187 GLU B CD    1 
ATOM   5190 O  OE1   . GLU B 1 187 ? -45.854 -19.012 -39.240 1.00 169.60 ? 187 GLU B OE1   1 
ATOM   5191 O  OE2   . GLU B 1 187 ? -45.804 -21.124 -39.910 1.00 182.11 ? 187 GLU B OE2   1 
ATOM   5192 N  N     . THR B 1 188 ? -40.503 -17.846 -39.348 1.00 124.94 ? 188 THR B N     1 
ATOM   5193 C  CA    . THR B 1 188 ? -39.610 -17.127 -38.446 1.00 115.00 ? 188 THR B CA    1 
ATOM   5194 C  C     . THR B 1 188 ? -39.891 -15.624 -38.535 1.00 110.55 ? 188 THR B C     1 
ATOM   5195 O  O     . THR B 1 188 ? -39.994 -14.935 -37.516 1.00 107.25 ? 188 THR B O     1 
ATOM   5196 C  CB    . THR B 1 188 ? -38.117 -17.392 -38.786 1.00 108.22 ? 188 THR B CB    1 
ATOM   5197 O  OG1   . THR B 1 188 ? -37.918 -18.773 -39.110 1.00 113.58 ? 188 THR B OG1   1 
ATOM   5198 C  CG2   . THR B 1 188 ? -37.217 -17.019 -37.615 1.00 100.38 ? 188 THR B CG2   1 
ATOM   5199 N  N     . VAL B 1 189 ? -40.025 -15.132 -39.763 1.00 111.26 ? 189 VAL B N     1 
ATOM   5200 C  CA    . VAL B 1 189 ? -40.365 -13.738 -40.010 1.00 108.72 ? 189 VAL B CA    1 
ATOM   5201 C  C     . VAL B 1 189 ? -41.750 -13.410 -39.448 1.00 115.07 ? 189 VAL B C     1 
ATOM   5202 O  O     . VAL B 1 189 ? -41.949 -12.344 -38.864 1.00 112.18 ? 189 VAL B O     1 
ATOM   5203 C  CB    . VAL B 1 189 ? -40.284 -13.406 -41.519 1.00 110.65 ? 189 VAL B CB    1 
ATOM   5204 C  CG1   . VAL B 1 189 ? -40.944 -12.074 -41.831 1.00 111.77 ? 189 VAL B CG1   1 
ATOM   5205 C  CG2   . VAL B 1 189 ? -38.841 -13.406 -41.987 1.00 103.52 ? 189 VAL B CG2   1 
ATOM   5206 N  N     . LYS B 1 190 ? -42.695 -14.333 -39.605 1.00 124.51 ? 190 LYS B N     1 
ATOM   5207 C  CA    . LYS B 1 190 ? -44.049 -14.127 -39.089 1.00 132.40 ? 190 LYS B CA    1 
ATOM   5208 C  C     . LYS B 1 190 ? -44.076 -13.826 -37.583 1.00 129.94 ? 190 LYS B C     1 
ATOM   5209 O  O     . LYS B 1 190 ? -44.593 -12.790 -37.172 1.00 130.03 ? 190 LYS B O     1 
ATOM   5210 C  CB    . LYS B 1 190 ? -44.976 -15.299 -39.448 1.00 144.01 ? 190 LYS B CB    1 
ATOM   5211 C  CG    . LYS B 1 190 ? -45.624 -15.170 -40.826 1.00 150.38 ? 190 LYS B CG    1 
ATOM   5212 C  CD    . LYS B 1 190 ? -46.607 -16.295 -41.123 1.00 162.85 ? 190 LYS B CD    1 
ATOM   5213 C  CE    . LYS B 1 190 ? -47.247 -16.095 -42.487 1.00 169.19 ? 190 LYS B CE    1 
ATOM   5214 N  NZ    . LYS B 1 190 ? -47.804 -17.361 -43.014 1.00 180.09 ? 190 LYS B NZ    1 
ATOM   5215 N  N     . ASN B 1 191 ? -43.498 -14.716 -36.775 1.00 128.38 ? 191 ASN B N     1 
ATOM   5216 C  CA    . ASN B 1 191 ? -43.475 -14.548 -35.313 1.00 126.97 ? 191 ASN B CA    1 
ATOM   5217 C  C     . ASN B 1 191 ? -42.634 -13.387 -34.830 1.00 116.54 ? 191 ASN B C     1 
ATOM   5218 O  O     . ASN B 1 191 ? -43.015 -12.702 -33.875 1.00 117.24 ? 191 ASN B O     1 
ATOM   5219 C  CB    . ASN B 1 191 ? -42.989 -15.818 -34.617 1.00 128.52 ? 191 ASN B CB    1 
ATOM   5220 C  CG    . ASN B 1 191 ? -43.966 -16.940 -34.737 1.00 140.46 ? 191 ASN B CG    1 
ATOM   5221 O  OD1   . ASN B 1 191 ? -44.792 -17.154 -33.850 1.00 148.56 ? 191 ASN B OD1   1 
ATOM   5222 N  ND2   . ASN B 1 191 ? -43.900 -17.660 -35.850 1.00 143.09 ? 191 ASN B ND2   1 
ATOM   5223 N  N     . ALA B 1 192 ? -41.490 -13.178 -35.482 1.00 107.66 ? 192 ALA B N     1 
ATOM   5224 C  CA    . ALA B 1 192 ? -40.567 -12.112 -35.100 1.00 97.93  ? 192 ALA B CA    1 
ATOM   5225 C  C     . ALA B 1 192 ? -41.316 -10.846 -34.722 1.00 98.70  ? 192 ALA B C     1 
ATOM   5226 O  O     . ALA B 1 192 ? -40.995 -10.229 -33.718 1.00 94.95  ? 192 ALA B O     1 
ATOM   5227 C  CB    . ALA B 1 192 ? -39.575 -11.830 -36.214 1.00 91.71  ? 192 ALA B CB    1 
ATOM   5228 N  N     . ARG B 1 193 ? -42.329 -10.499 -35.521 1.00 104.38 ? 193 ARG B N     1 
ATOM   5229 C  CA    . ARG B 1 193 ? -43.171 -9.311  -35.324 1.00 107.06 ? 193 ARG B CA    1 
ATOM   5230 C  C     . ARG B 1 193 ? -43.664 -9.101  -33.892 1.00 110.13 ? 193 ARG B C     1 
ATOM   5231 O  O     . ARG B 1 193 ? -43.678 -7.968  -33.402 1.00 107.97 ? 193 ARG B O     1 
ATOM   5232 C  CB    . ARG B 1 193 ? -44.379 -9.353  -36.256 1.00 116.22 ? 193 ARG B CB    1 
ATOM   5233 C  CG    . ARG B 1 193 ? -44.062 -9.246  -37.731 1.00 114.68 ? 193 ARG B CG    1 
ATOM   5234 C  CD    . ARG B 1 193 ? -45.350 -9.255  -38.549 1.00 125.01 ? 193 ARG B CD    1 
ATOM   5235 N  NE    . ARG B 1 193 ? -45.937 -10.593 -38.608 1.00 132.07 ? 193 ARG B NE    1 
ATOM   5236 C  CZ    . ARG B 1 193 ? -46.783 -11.001 -39.545 1.00 140.66 ? 193 ARG B CZ    1 
ATOM   5237 N  NH1   . ARG B 1 193 ? -47.155 -10.175 -40.510 1.00 143.39 ? 193 ARG B NH1   1 
ATOM   5238 N  NH2   . ARG B 1 193 ? -47.255 -12.239 -39.519 1.00 147.82 ? 193 ARG B NH2   1 
ATOM   5239 N  N     . ARG B 1 194 ? -44.081 -10.182 -33.234 1.00 116.06 ? 194 ARG B N     1 
ATOM   5240 C  CA    . ARG B 1 194 ? -44.517 -10.104 -31.839 1.00 120.53 ? 194 ARG B CA    1 
ATOM   5241 C  C     . ARG B 1 194 ? -43.444 -10.587 -30.854 1.00 114.79 ? 194 ARG B C     1 
ATOM   5242 O  O     . ARG B 1 194 ? -43.756 -11.147 -29.801 1.00 120.79 ? 194 ARG B O     1 
ATOM   5243 C  CB    . ARG B 1 194 ? -45.861 -10.815 -31.624 1.00 133.60 ? 194 ARG B CB    1 
ATOM   5244 C  CG    . ARG B 1 194 ? -45.887 -12.283 -32.016 1.00 138.16 ? 194 ARG B CG    1 
ATOM   5245 C  CD    . ARG B 1 194 ? -47.271 -12.887 -31.819 1.00 152.38 ? 194 ARG B CD    1 
ATOM   5246 N  NE    . ARG B 1 194 ? -47.324 -14.257 -32.324 1.00 158.23 ? 194 ARG B NE    1 
ATOM   5247 C  CZ    . ARG B 1 194 ? -47.712 -14.599 -33.551 1.00 162.11 ? 194 ARG B CZ    1 
ATOM   5248 N  NH1   . ARG B 1 194 ? -48.105 -13.673 -34.418 1.00 161.63 ? 194 ARG B NH1   1 
ATOM   5249 N  NH2   . ARG B 1 194 ? -47.714 -15.876 -33.913 1.00 167.52 ? 194 ARG B NH2   1 
ATOM   5250 N  N     . TRP B 1 195 ? -42.182 -10.373 -31.223 1.00 104.15 ? 195 TRP B N     1 
ATOM   5251 C  CA    . TRP B 1 195 ? -41.051 -10.491 -30.305 1.00 97.50  ? 195 TRP B CA    1 
ATOM   5252 C  C     . TRP B 1 195 ? -40.952 -9.207  -29.487 1.00 94.70  ? 195 TRP B C     1 
ATOM   5253 O  O     . TRP B 1 195 ? -41.189 -8.116  -30.001 1.00 93.00  ? 195 TRP B O     1 
ATOM   5254 C  CB    . TRP B 1 195 ? -39.752 -10.687 -31.089 1.00 88.26  ? 195 TRP B CB    1 
ATOM   5255 C  CG    . TRP B 1 195 ? -39.385 -12.111 -31.385 1.00 89.51  ? 195 TRP B CG    1 
ATOM   5256 C  CD1   . TRP B 1 195 ? -40.097 -13.225 -31.069 1.00 97.84  ? 195 TRP B CD1   1 
ATOM   5257 C  CD2   . TRP B 1 195 ? -38.213 -12.569 -32.082 1.00 83.55  ? 195 TRP B CD2   1 
ATOM   5258 N  NE1   . TRP B 1 195 ? -39.441 -14.350 -31.507 1.00 97.18  ? 195 TRP B NE1   1 
ATOM   5259 C  CE2   . TRP B 1 195 ? -38.283 -13.976 -32.135 1.00 88.34  ? 195 TRP B CE2   1 
ATOM   5260 C  CE3   . TRP B 1 195 ? -37.107 -11.924 -32.661 1.00 75.18  ? 195 TRP B CE3   1 
ATOM   5261 C  CZ2   . TRP B 1 195 ? -37.291 -14.757 -32.750 1.00 84.91  ? 195 TRP B CZ2   1 
ATOM   5262 C  CZ3   . TRP B 1 195 ? -36.120 -12.703 -33.269 1.00 71.77  ? 195 TRP B CZ3   1 
ATOM   5263 C  CH2   . TRP B 1 195 ? -36.223 -14.106 -33.307 1.00 76.68  ? 195 TRP B CH2   1 
ATOM   5264 N  N     . THR B 1 196 ? -40.609 -9.340  -28.212 1.00 95.09  ? 196 THR B N     1 
ATOM   5265 C  CA    . THR B 1 196 ? -40.384 -8.183  -27.351 1.00 92.71  ? 196 THR B CA    1 
ATOM   5266 C  C     . THR B 1 196 ? -39.051 -8.333  -26.638 1.00 86.00  ? 196 THR B C     1 
ATOM   5267 O  O     . THR B 1 196 ? -38.489 -9.422  -26.587 1.00 85.21  ? 196 THR B O     1 
ATOM   5268 C  CB    . THR B 1 196 ? -41.493 -8.043  -26.289 1.00 103.07 ? 196 THR B CB    1 
ATOM   5269 O  OG1   . THR B 1 196 ? -41.697 -9.306  -25.645 1.00 109.50 ? 196 THR B OG1   1 
ATOM   5270 C  CG2   . THR B 1 196 ? -42.805 -7.569  -26.921 1.00 109.89 ? 196 THR B CG2   1 
ATOM   5271 N  N     . ARG B 1 197 ? -38.546 -7.244  -26.073 1.00 81.95  ? 197 ARG B N     1 
ATOM   5272 C  CA    . ARG B 1 197 ? -37.329 -7.317  -25.273 1.00 77.01  ? 197 ARG B CA    1 
ATOM   5273 C  C     . ARG B 1 197 ? -37.494 -8.273  -24.079 1.00 83.94  ? 197 ARG B C     1 
ATOM   5274 O  O     . ARG B 1 197 ? -36.523 -8.611  -23.397 1.00 81.43  ? 197 ARG B O     1 
ATOM   5275 C  CB    . ARG B 1 197 ? -36.903 -5.917  -24.815 1.00 73.24  ? 197 ARG B CB    1 
ATOM   5276 C  CG    . ARG B 1 197 ? -37.731 -5.323  -23.704 1.00 80.78  ? 197 ARG B CG    1 
ATOM   5277 C  CD    . ARG B 1 197 ? -37.436 -3.856  -23.563 1.00 78.23  ? 197 ARG B CD    1 
ATOM   5278 N  NE    . ARG B 1 197 ? -38.135 -3.074  -24.580 1.00 78.82  ? 197 ARG B NE    1 
ATOM   5279 C  CZ    . ARG B 1 197 ? -37.899 -1.789  -24.833 1.00 75.94  ? 197 ARG B CZ    1 
ATOM   5280 N  NH1   . ARG B 1 197 ? -38.589 -1.161  -25.781 1.00 76.42  ? 197 ARG B NH1   1 
ATOM   5281 N  NH2   . ARG B 1 197 ? -36.965 -1.135  -24.146 1.00 72.56  ? 197 ARG B NH2   1 
ATOM   5282 N  N     . ARG B 1 198 ? -38.731 -8.710  -23.855 1.00 93.49  ? 198 ARG B N     1 
ATOM   5283 C  CA    . ARG B 1 198 ? -39.072 -9.579  -22.735 1.00 102.51 ? 198 ARG B CA    1 
ATOM   5284 C  C     . ARG B 1 198 ? -39.049 -11.059 -23.125 1.00 105.10 ? 198 ARG B C     1 
ATOM   5285 O  O     . ARG B 1 198 ? -39.195 -11.930 -22.266 1.00 112.67 ? 198 ARG B O     1 
ATOM   5286 C  CB    . ARG B 1 198 ? -40.460 -9.220  -22.176 1.00 113.66 ? 198 ARG B CB    1 
ATOM   5287 C  CG    . ARG B 1 198 ? -40.768 -7.723  -22.026 1.00 113.19 ? 198 ARG B CG    1 
ATOM   5288 C  CD    . ARG B 1 198 ? -39.814 -7.011  -21.063 1.00 110.22 ? 198 ARG B CD    1 
ATOM   5289 N  NE    . ARG B 1 198 ? -40.023 -7.394  -19.666 1.00 119.84 ? 198 ARG B NE    1 
ATOM   5290 C  CZ    . ARG B 1 198 ? -39.277 -6.970  -18.646 1.00 119.14 ? 198 ARG B CZ    1 
ATOM   5291 N  NH1   . ARG B 1 198 ? -38.257 -6.140  -18.852 1.00 108.86 ? 198 ARG B NH1   1 
ATOM   5292 N  NH2   . ARG B 1 198 ? -39.555 -7.378  -17.414 1.00 129.10 ? 198 ARG B NH2   1 
ATOM   5293 N  N     . THR B 1 199 ? -38.859 -11.333 -24.416 1.00 99.69  ? 199 THR B N     1 
ATOM   5294 C  CA    . THR B 1 199 ? -38.935 -12.695 -24.963 1.00 102.81 ? 199 THR B CA    1 
ATOM   5295 C  C     . THR B 1 199 ? -37.826 -13.631 -24.479 1.00 100.87 ? 199 THR B C     1 
ATOM   5296 O  O     . THR B 1 199 ? -36.653 -13.253 -24.417 1.00 92.50  ? 199 THR B O     1 
ATOM   5297 C  CB    . THR B 1 199 ? -38.927 -12.682 -26.509 1.00 97.84  ? 199 THR B CB    1 
ATOM   5298 O  OG1   . THR B 1 199 ? -39.854 -11.698 -26.984 1.00 99.68  ? 199 THR B OG1   1 
ATOM   5299 C  CG2   . THR B 1 199 ? -39.305 -14.051 -27.076 1.00 103.39 ? 199 THR B CG2   1 
ATOM   5300 N  N     . VAL B 1 200 ? -38.229 -14.850 -24.129 1.00 109.56 ? 200 VAL B N     1 
ATOM   5301 C  CA    . VAL B 1 200 ? -37.317 -15.957 -23.857 1.00 109.66 ? 200 VAL B CA    1 
ATOM   5302 C  C     . VAL B 1 200 ? -37.768 -17.150 -24.706 1.00 114.86 ? 200 VAL B C     1 
ATOM   5303 O  O     . VAL B 1 200 ? -38.831 -17.736 -24.468 1.00 125.47 ? 200 VAL B O     1 
ATOM   5304 C  CB    . VAL B 1 200 ? -37.260 -16.314 -22.340 1.00 117.29 ? 200 VAL B CB    1 
ATOM   5305 C  CG1   . VAL B 1 200 ? -36.394 -17.555 -22.090 1.00 118.64 ? 200 VAL B CG1   1 
ATOM   5306 C  CG2   . VAL B 1 200 ? -36.736 -15.123 -21.529 1.00 112.37 ? 200 VAL B CG2   1 
ATOM   5307 N  N     . ILE B 1 201 ? -36.971 -17.470 -25.723 1.00 108.01 ? 201 ILE B N     1 
ATOM   5308 C  CA    . ILE B 1 201 ? -37.227 -18.621 -26.587 1.00 112.78 ? 201 ILE B CA    1 
ATOM   5309 C  C     . ILE B 1 201 ? -36.457 -19.821 -26.043 1.00 116.32 ? 201 ILE B C     1 
ATOM   5310 O  O     . ILE B 1 201 ? -35.232 -19.745 -25.856 1.00 109.66 ? 201 ILE B O     1 
ATOM   5311 C  CB    . ILE B 1 201 ? -36.818 -18.343 -28.061 1.00 104.92 ? 201 ILE B CB    1 
ATOM   5312 C  CG1   . ILE B 1 201 ? -37.737 -17.292 -28.677 1.00 104.01 ? 201 ILE B CG1   1 
ATOM   5313 C  CG2   . ILE B 1 201 ? -36.862 -19.621 -28.903 1.00 109.62 ? 201 ILE B CG2   1 
ATOM   5314 C  CD1   . ILE B 1 201 ? -37.276 -16.806 -30.026 1.00 97.01  ? 201 ILE B CD1   1 
ATOM   5315 N  N     . ASP B 1 202 ? -37.176 -20.913 -25.778 1.00 127.50 ? 202 ASP B N     1 
ATOM   5316 C  CA    . ASP B 1 202 ? -36.551 -22.133 -25.286 1.00 132.64 ? 202 ASP B CA    1 
ATOM   5317 C  C     . ASP B 1 202 ? -36.531 -23.207 -26.365 1.00 135.57 ? 202 ASP B C     1 
ATOM   5318 O  O     . ASP B 1 202 ? -37.522 -23.899 -26.591 1.00 145.52 ? 202 ASP B O     1 
ATOM   5319 C  CB    . ASP B 1 202 ? -37.243 -22.641 -24.016 1.00 144.99 ? 202 ASP B CB    1 
ATOM   5320 C  CG    . ASP B 1 202 ? -36.533 -23.842 -23.402 1.00 150.97 ? 202 ASP B CG    1 
ATOM   5321 O  OD1   . ASP B 1 202 ? -37.138 -24.939 -23.370 1.00 162.49 ? 202 ASP B OD1   1 
ATOM   5322 O  OD2   . ASP B 1 202 ? -35.371 -23.694 -22.963 1.00 144.29 ? 202 ASP B OD2   1 
ATOM   5323 N  N     . VAL B 1 203 ? -35.387 -23.339 -27.025 1.00 127.80 ? 203 VAL B N     1 
ATOM   5324 C  CA    . VAL B 1 203 ? -35.207 -24.333 -28.076 1.00 130.42 ? 203 VAL B CA    1 
ATOM   5325 C  C     . VAL B 1 203 ? -35.307 -25.739 -27.488 1.00 142.05 ? 203 VAL B C     1 
ATOM   5326 O  O     . VAL B 1 203 ? -35.939 -26.623 -28.073 1.00 150.31 ? 203 VAL B O     1 
ATOM   5327 C  CB    . VAL B 1 203 ? -33.847 -24.163 -28.788 1.00 120.63 ? 203 VAL B CB    1 
ATOM   5328 C  CG1   . VAL B 1 203 ? -33.811 -24.994 -30.070 1.00 123.33 ? 203 VAL B CG1   1 
ATOM   5329 C  CG2   . VAL B 1 203 ? -33.568 -22.679 -29.090 1.00 109.58 ? 203 VAL B CG2   1 
ATOM   5330 N  N     . ALA B 1 204 ? -34.690 -25.917 -26.320 1.00 143.35 ? 204 ALA B N     1 
ATOM   5331 C  CA    . ALA B 1 204 ? -34.699 -27.178 -25.585 1.00 154.89 ? 204 ALA B CA    1 
ATOM   5332 C  C     . ALA B 1 204 ? -36.083 -27.851 -25.547 1.00 168.12 ? 204 ALA B C     1 
ATOM   5333 O  O     . ALA B 1 204 ? -36.210 -29.035 -25.875 1.00 176.79 ? 204 ALA B O     1 
ATOM   5334 C  CB    . ALA B 1 204 ? -34.148 -26.966 -24.171 1.00 155.48 ? 204 ALA B CB    1 
ATOM   5335 N  N     . LYS B 1 205 ? -37.115 -27.094 -25.175 1.00 170.23 ? 205 LYS B N     1 
ATOM   5336 C  CA    . LYS B 1 205 ? -38.468 -27.650 -25.061 1.00 183.96 ? 205 LYS B CA    1 
ATOM   5337 C  C     . LYS B 1 205 ? -39.451 -27.099 -26.101 1.00 182.57 ? 205 LYS B C     1 
ATOM   5338 O  O     . LYS B 1 205 ? -40.595 -27.555 -26.181 1.00 193.82 ? 205 LYS B O     1 
ATOM   5339 C  CB    . LYS B 1 205 ? -39.010 -27.465 -23.636 1.00 192.52 ? 205 LYS B CB    1 
ATOM   5340 C  CG    . LYS B 1 205 ? -38.257 -28.273 -22.579 1.00 198.60 ? 205 LYS B CG    1 
ATOM   5341 C  CD    . LYS B 1 205 ? -38.131 -27.508 -21.273 1.00 197.92 ? 205 LYS B CD    1 
ATOM   5342 C  CE    . LYS B 1 205 ? -36.842 -27.904 -20.539 1.00 195.63 ? 205 LYS B CE    1 
ATOM   5343 N  NZ    . LYS B 1 205 ? -36.738 -27.288 -19.149 1.00 197.62 ? 205 LYS B NZ    1 
ATOM   5344 N  N     . GLY B 1 206 ? -38.996 -26.132 -26.897 1.00 169.61 ? 206 GLY B N     1 
ATOM   5345 C  CA    . GLY B 1 206 ? -39.829 -25.513 -27.931 1.00 167.87 ? 206 GLY B CA    1 
ATOM   5346 C  C     . GLY B 1 206 ? -40.988 -24.722 -27.349 1.00 172.59 ? 206 GLY B C     1 
ATOM   5347 O  O     . GLY B 1 206 ? -42.147 -25.014 -27.636 1.00 182.42 ? 206 GLY B O     1 
ATOM   5348 N  N     . GLU B 1 207 ? -40.662 -23.717 -26.538 1.00 166.36 ? 207 GLU B N     1 
ATOM   5349 C  CA    . GLU B 1 207 ? -41.646 -22.943 -25.780 1.00 171.52 ? 207 GLU B CA    1 
ATOM   5350 C  C     . GLU B 1 207 ? -41.232 -21.472 -25.651 1.00 159.98 ? 207 GLU B C     1 
ATOM   5351 O  O     . GLU B 1 207 ? -40.163 -21.164 -25.106 1.00 152.44 ? 207 GLU B O     1 
ATOM   5352 C  CB    . GLU B 1 207 ? -41.824 -23.567 -24.391 1.00 182.64 ? 207 GLU B CB    1 
ATOM   5353 C  CG    . GLU B 1 207 ? -42.554 -22.686 -23.364 1.00 187.28 ? 207 GLU B CG    1 
ATOM   5354 C  CD    . GLU B 1 207 ? -42.648 -23.466 -21.976 1.00 200.01 ? 207 GLU B CD    1 
ATOM   5355 O  OE1   . GLU B 1 207 ? -41.489 -23.626 -21.351 1.00 194.47 ? 207 GLU B OE1   1 
ATOM   5356 O  OE2   . GLU B 1 207 ? -43.898 -23.553 -21.507 1.00 212.82 ? 207 GLU B OE2   1 
ATOM   5357 N  N     . VAL B 1 208 ? -42.081 -20.574 -26.156 1.00 159.50 ? 208 VAL B N     1 
ATOM   5358 C  CA    . VAL B 1 208 ? -41.861 -19.121 -26.043 1.00 150.18 ? 208 VAL B CA    1 
ATOM   5359 C  C     . VAL B 1 208 ? -42.174 -18.696 -24.601 1.00 156.02 ? 208 VAL B C     1 
ATOM   5360 O  O     . VAL B 1 208 ? -42.974 -19.352 -23.925 1.00 168.81 ? 208 VAL B O     1 
ATOM   5361 C  CB    . VAL B 1 208 ? -42.715 -18.333 -27.080 1.00 149.00 ? 208 VAL B CB    1 
ATOM   5362 C  CG1   . VAL B 1 208 ? -42.412 -16.838 -27.035 1.00 139.30 ? 208 VAL B CG1   1 
ATOM   5363 C  CG2   . VAL B 1 208 ? -42.485 -18.876 -28.489 1.00 145.54 ? 208 VAL B CG2   1 
ATOM   5364 N  N     . ARG B 1 209 ? -41.531 -17.628 -24.124 1.00 147.65 ? 209 ARG B N     1 
ATOM   5365 C  CA    . ARG B 1 209 ? -41.631 -17.238 -22.711 1.00 152.97 ? 209 ARG B CA    1 
ATOM   5366 C  C     . ARG B 1 209 ? -41.320 -15.761 -22.493 1.00 144.83 ? 209 ARG B C     1 
ATOM   5367 O  O     . ARG B 1 209 ? -40.460 -15.209 -23.169 1.00 133.14 ? 209 ARG B O     1 
ATOM   5368 C  CB    . ARG B 1 209 ? -40.677 -18.096 -21.870 1.00 154.10 ? 209 ARG B CB    1 
ATOM   5369 C  CG    . ARG B 1 209 ? -41.006 -18.182 -20.385 1.00 164.30 ? 209 ARG B CG    1 
ATOM   5370 C  CD    . ARG B 1 209 ? -40.613 -19.547 -19.830 1.00 170.57 ? 209 ARG B CD    1 
ATOM   5371 N  NE    . ARG B 1 209 ? -39.158 -19.756 -19.822 1.00 159.99 ? 209 ARG B NE    1 
ATOM   5372 C  CZ    . ARG B 1 209 ? -38.582 -20.871 -20.303 1.00 159.14 ? 209 ARG B CZ    1 
ATOM   5373 N  NH1   . ARG B 1 209 ? -39.332 -21.884 -20.859 1.00 168.49 ? 209 ARG B NH1   1 
ATOM   5374 N  NH2   . ARG B 1 209 ? -37.253 -20.972 -20.243 1.00 150.16 ? 209 ARG B NH2   1 
ATOM   5375 N  N     . LYS B 1 210 ? -42.017 -15.129 -21.547 1.00 152.22 ? 210 LYS B N     1 
ATOM   5376 C  CA    . LYS B 1 210 ? -41.722 -13.744 -21.160 1.00 146.26 ? 210 LYS B CA    1 
ATOM   5377 C  C     . LYS B 1 210 ? -40.907 -13.650 -19.856 1.00 146.80 ? 210 LYS B C     1 
ATOM   5378 O  O     . LYS B 1 210 ? -41.413 -13.228 -18.814 1.00 154.99 ? 210 LYS B O     1 
ATOM   5379 C  CB    . LYS B 1 210 ? -42.994 -12.864 -21.114 1.00 153.07 ? 210 LYS B CB    1 
ATOM   5380 C  CG    . LYS B 1 210 ? -44.269 -13.519 -20.501 1.00 169.88 ? 210 LYS B CG    1 
ATOM   5381 C  CD    . LYS B 1 210 ? -44.351 -13.367 -18.956 1.00 179.29 ? 210 LYS B CD    1 
ATOM   5382 C  CE    . LYS B 1 210 ? -46.084 -13.632 -18.584 1.00 198.57 ? 210 LYS B CE    1 
ATOM   5383 N  NZ    . LYS B 1 210 ? -46.478 -12.086 -18.657 1.00 195.74 ? 210 LYS B NZ    1 
ATOM   5384 N  N     . GLY B 1 211 ? -39.633 -14.038 -19.935 1.00 138.81 ? 211 GLY B N     1 
ATOM   5385 C  CA    . GLY B 1 211 ? -38.764 -14.089 -18.759 1.00 139.81 ? 211 GLY B CA    1 
ATOM   5386 C  C     . GLY B 1 211 ? -38.117 -12.764 -18.410 1.00 132.23 ? 211 GLY B C     1 
ATOM   5387 O  O     . GLY B 1 211 ? -38.790 -11.740 -18.332 1.00 133.51 ? 211 GLY B O     1 
ATOM   5388 N  N     . GLU B 1 212 ? -36.806 -12.792 -18.194 1.00 125.23 ? 212 GLU B N     1 
ATOM   5389 C  CA    . GLU B 1 212 ? -36.043 -11.601 -17.812 1.00 118.77 ? 212 GLU B CA    1 
ATOM   5390 C  C     . GLU B 1 212 ? -35.973 -10.582 -18.958 1.00 108.39 ? 212 GLU B C     1 
ATOM   5391 O  O     . GLU B 1 212 ? -36.909 -9.807  -19.169 1.00 110.69 ? 212 GLU B O     1 
ATOM   5392 C  CB    . GLU B 1 212 ? -34.632 -12.006 -17.355 1.00 114.77 ? 212 GLU B CB    1 
ATOM   5393 C  CG    . GLU B 1 212 ? -34.569 -12.671 -15.977 1.00 126.11 ? 212 GLU B CG    1 
ATOM   5394 C  CD    . GLU B 1 212 ? -34.822 -11.688 -14.838 1.00 132.33 ? 212 GLU B CD    1 
ATOM   5395 O  OE1   . GLU B 1 212 ? -35.580 -12.044 -13.906 1.00 144.77 ? 212 GLU B OE1   1 
ATOM   5396 O  OE2   . GLU B 1 212 ? -34.271 -10.561 -14.882 1.00 124.84 ? 212 GLU B OE2   1 
ATOM   5397 N  N     . GLU B 1 213 ? -34.853 -10.586 -19.676 1.00 98.01  ? 213 GLU B N     1 
ATOM   5398 C  CA    . GLU B 1 213 ? -34.709 -9.867  -20.943 1.00 88.89  ? 213 GLU B CA    1 
ATOM   5399 C  C     . GLU B 1 213 ? -34.796 -10.864 -22.121 1.00 86.78  ? 213 GLU B C     1 
ATOM   5400 O  O     . GLU B 1 213 ? -35.259 -11.997 -21.942 1.00 93.68  ? 213 GLU B O     1 
ATOM   5401 C  CB    . GLU B 1 213 ? -33.405 -9.033  -20.970 1.00 79.98  ? 213 GLU B CB    1 
ATOM   5402 C  CG    . GLU B 1 213 ? -32.374 -9.313  -19.832 1.00 81.28  ? 213 GLU B CG    1 
ATOM   5403 C  CD    . GLU B 1 213 ? -31.695 -10.686 -19.921 1.00 81.53  ? 213 GLU B CD    1 
ATOM   5404 O  OE1   . GLU B 1 213 ? -32.054 -11.577 -19.130 1.00 89.68  ? 213 GLU B OE1   1 
ATOM   5405 O  OE2   . GLU B 1 213 ? -30.803 -10.880 -20.772 1.00 74.54  ? 213 GLU B OE2   1 
ATOM   5406 N  N     . PHE B 1 214 ? -34.383 -10.441 -23.317 1.00 78.13  ? 214 PHE B N     1 
ATOM   5407 C  CA    . PHE B 1 214 ? -34.292 -11.345 -24.471 1.00 75.78  ? 214 PHE B CA    1 
ATOM   5408 C  C     . PHE B 1 214 ? -33.271 -12.454 -24.186 1.00 74.78  ? 214 PHE B C     1 
ATOM   5409 O  O     . PHE B 1 214 ? -32.199 -12.185 -23.634 1.00 70.67  ? 214 PHE B O     1 
ATOM   5410 C  CB    . PHE B 1 214 ? -33.909 -10.568 -25.740 1.00 67.91  ? 214 PHE B CB    1 
ATOM   5411 C  CG    . PHE B 1 214 ? -34.211 -11.300 -27.027 1.00 68.18  ? 214 PHE B CG    1 
ATOM   5412 C  CD1   . PHE B 1 214 ? -35.386 -11.051 -27.722 1.00 72.14  ? 214 PHE B CD1   1 
ATOM   5413 C  CD2   . PHE B 1 214 ? -33.318 -12.230 -27.548 1.00 65.60  ? 214 PHE B CD2   1 
ATOM   5414 C  CE1   . PHE B 1 214 ? -35.672 -11.716 -28.914 1.00 72.92  ? 214 PHE B CE1   1 
ATOM   5415 C  CE2   . PHE B 1 214 ? -33.598 -12.902 -28.736 1.00 66.53  ? 214 PHE B CE2   1 
ATOM   5416 C  CZ    . PHE B 1 214 ? -34.774 -12.641 -29.420 1.00 70.34  ? 214 PHE B CZ    1 
ATOM   5417 N  N     . PHE B 1 215 ? -33.606 -13.691 -24.560 1.00 78.85  ? 215 PHE B N     1 
ATOM   5418 C  CA    . PHE B 1 215 ? -32.792 -14.858 -24.217 1.00 79.93  ? 215 PHE B CA    1 
ATOM   5419 C  C     . PHE B 1 215 ? -33.114 -16.042 -25.125 1.00 83.32  ? 215 PHE B C     1 
ATOM   5420 O  O     . PHE B 1 215 ? -34.122 -16.720 -24.935 1.00 92.07  ? 215 PHE B O     1 
ATOM   5421 C  CB    . PHE B 1 215 ? -33.045 -15.245 -22.750 1.00 87.94  ? 215 PHE B CB    1 
ATOM   5422 C  CG    . PHE B 1 215 ? -31.931 -16.040 -22.104 1.00 88.34  ? 215 PHE B CG    1 
ATOM   5423 C  CD1   . PHE B 1 215 ? -31.124 -15.458 -21.128 1.00 85.78  ? 215 PHE B CD1   1 
ATOM   5424 C  CD2   . PHE B 1 215 ? -31.715 -17.379 -22.437 1.00 91.87  ? 215 PHE B CD2   1 
ATOM   5425 C  CE1   . PHE B 1 215 ? -30.105 -16.182 -20.514 1.00 87.16  ? 215 PHE B CE1   1 
ATOM   5426 C  CE2   . PHE B 1 215 ? -30.698 -18.112 -21.828 1.00 92.85  ? 215 PHE B CE2   1 
ATOM   5427 C  CZ    . PHE B 1 215 ? -29.890 -17.513 -20.868 1.00 91.03  ? 215 PHE B CZ    1 
ATOM   5428 N  N     . VAL B 1 216 ? -32.271 -16.297 -26.116 1.00 77.47  ? 216 VAL B N     1 
ATOM   5429 C  CA    . VAL B 1 216 ? -32.374 -17.555 -26.849 1.00 81.69  ? 216 VAL B CA    1 
ATOM   5430 C  C     . VAL B 1 216 ? -31.497 -18.580 -26.132 1.00 84.70  ? 216 VAL B C     1 
ATOM   5431 O  O     . VAL B 1 216 ? -30.267 -18.409 -26.055 1.00 79.14  ? 216 VAL B O     1 
ATOM   5432 C  CB    . VAL B 1 216 ? -31.959 -17.426 -28.333 1.00 75.97  ? 216 VAL B CB    1 
ATOM   5433 C  CG1   . VAL B 1 216 ? -31.911 -18.796 -29.000 1.00 81.24  ? 216 VAL B CG1   1 
ATOM   5434 C  CG2   . VAL B 1 216 ? -32.925 -16.547 -29.076 1.00 75.11  ? 216 VAL B CG2   1 
ATOM   5435 N  N     . VAL B 1 217 ? -32.129 -19.630 -25.600 1.00 94.10  ? 217 VAL B N     1 
ATOM   5436 C  CA    . VAL B 1 217 ? -31.402 -20.673 -24.866 1.00 98.54  ? 217 VAL B CA    1 
ATOM   5437 C  C     . VAL B 1 217 ? -30.662 -21.602 -25.822 1.00 97.47  ? 217 VAL B C     1 
ATOM   5438 O  O     . VAL B 1 217 ? -31.131 -21.861 -26.933 1.00 97.89  ? 217 VAL B O     1 
ATOM   5439 C  CB    . VAL B 1 217 ? -32.310 -21.512 -23.904 1.00 110.83 ? 217 VAL B CB    1 
ATOM   5440 C  CG1   . VAL B 1 217 ? -33.307 -20.619 -23.157 1.00 113.50 ? 217 VAL B CG1   1 
ATOM   5441 C  CG2   . VAL B 1 217 ? -33.021 -22.640 -24.646 1.00 118.24 ? 217 VAL B CG2   1 
ATOM   5442 N  N     . ASP B 1 218 ? -29.501 -22.080 -25.387 1.00 96.70  ? 218 ASP B N     1 
ATOM   5443 C  CA    . ASP B 1 218 ? -28.784 -23.110 -26.116 1.00 98.00  ? 218 ASP B CA    1 
ATOM   5444 C  C     . ASP B 1 218 ? -29.234 -24.474 -25.582 1.00 109.69 ? 218 ASP B C     1 
ATOM   5445 O  O     . ASP B 1 218 ? -29.064 -24.763 -24.398 1.00 114.74 ? 218 ASP B O     1 
ATOM   5446 C  CB    . ASP B 1 218 ? -27.273 -22.923 -25.963 1.00 92.28  ? 218 ASP B CB    1 
ATOM   5447 C  CG    . ASP B 1 218 ? -26.466 -23.721 -26.981 1.00 92.58  ? 218 ASP B CG    1 
ATOM   5448 O  OD1   . ASP B 1 218 ? -27.044 -24.531 -27.741 1.00 98.05  ? 218 ASP B OD1   1 
ATOM   5449 O  OD2   . ASP B 1 218 ? -25.232 -23.538 -27.018 1.00 88.29  ? 218 ASP B OD2   1 
ATOM   5450 N  N     . PRO B 1 219 ? -29.841 -25.309 -26.446 1.00 114.85 ? 219 PRO B N     1 
ATOM   5451 C  CA    . PRO B 1 219 ? -30.225 -26.651 -26.010 1.00 126.82 ? 219 PRO B CA    1 
ATOM   5452 C  C     . PRO B 1 219 ? -29.009 -27.483 -25.608 1.00 129.12 ? 219 PRO B C     1 
ATOM   5453 O  O     . PRO B 1 219 ? -29.162 -28.547 -25.003 1.00 139.65 ? 219 PRO B O     1 
ATOM   5454 C  CB    . PRO B 1 219 ? -30.898 -27.247 -27.251 1.00 130.39 ? 219 PRO B CB    1 
ATOM   5455 C  CG    . PRO B 1 219 ? -30.373 -26.445 -28.386 1.00 119.98 ? 219 PRO B CG    1 
ATOM   5456 C  CD    . PRO B 1 219 ? -30.215 -25.065 -27.849 1.00 111.14 ? 219 PRO B CD    1 
ATOM   5457 N  N     . VAL B 1 220 ? -27.818 -26.981 -25.931 1.00 120.01 ? 220 VAL B N     1 
ATOM   5458 C  CA    . VAL B 1 220 ? -26.555 -27.644 -25.592 1.00 121.70 ? 220 VAL B CA    1 
ATOM   5459 C  C     . VAL B 1 220 ? -26.047 -27.225 -24.200 1.00 121.35 ? 220 VAL B C     1 
ATOM   5460 O  O     . VAL B 1 220 ? -25.602 -28.061 -23.415 1.00 129.09 ? 220 VAL B O     1 
ATOM   5461 C  CB    . VAL B 1 220 ? -25.482 -27.405 -26.685 1.00 114.09 ? 220 VAL B CB    1 
ATOM   5462 C  CG1   . VAL B 1 220 ? -24.229 -28.213 -26.398 1.00 117.77 ? 220 VAL B CG1   1 
ATOM   5463 C  CG2   . VAL B 1 220 ? -26.037 -27.771 -28.064 1.00 114.97 ? 220 VAL B CG2   1 
ATOM   5464 N  N     . ASP B 1 221 ? -26.110 -25.930 -23.916 1.00 113.03 ? 221 ASP B N     1 
ATOM   5465 C  CA    . ASP B 1 221 ? -25.886 -25.401 -22.577 1.00 113.51 ? 221 ASP B CA    1 
ATOM   5466 C  C     . ASP B 1 221 ? -27.053 -24.484 -22.254 1.00 112.15 ? 221 ASP B C     1 
ATOM   5467 O  O     . ASP B 1 221 ? -27.132 -23.351 -22.748 1.00 103.01 ? 221 ASP B O     1 
ATOM   5468 C  CB    . ASP B 1 221 ? -24.563 -24.629 -22.500 1.00 105.17 ? 221 ASP B CB    1 
ATOM   5469 C  CG    . ASP B 1 221 ? -24.462 -23.725 -21.262 1.00 104.05 ? 221 ASP B CG    1 
ATOM   5470 O  OD1   . ASP B 1 221 ? -25.311 -23.813 -20.346 1.00 110.79 ? 221 ASP B OD1   1 
ATOM   5471 O  OD2   . ASP B 1 221 ? -23.515 -22.915 -21.209 1.00 97.01  ? 221 ASP B OD2   1 
ATOM   5472 N  N     . GLU B 1 222 ? -27.958 -24.983 -21.419 1.00 121.98 ? 222 GLU B N     1 
ATOM   5473 C  CA    . GLU B 1 222 ? -29.188 -24.265 -21.082 1.00 123.13 ? 222 GLU B CA    1 
ATOM   5474 C  C     . GLU B 1 222 ? -28.962 -22.833 -20.566 1.00 115.14 ? 222 GLU B C     1 
ATOM   5475 O  O     . GLU B 1 222 ? -29.823 -21.968 -20.728 1.00 112.33 ? 222 GLU B O     1 
ATOM   5476 C  CB    . GLU B 1 222 ? -30.014 -25.072 -20.081 1.00 136.87 ? 222 GLU B CB    1 
ATOM   5477 C  CG    . GLU B 1 222 ? -29.260 -25.457 -18.823 1.00 143.21 ? 222 GLU B CG    1 
ATOM   5478 C  CD    . GLU B 1 222 ? -30.173 -25.588 -17.627 1.00 155.81 ? 222 GLU B CD    1 
ATOM   5479 O  OE1   . GLU B 1 222 ? -29.964 -26.517 -16.816 1.00 166.91 ? 222 GLU B OE1   1 
ATOM   5480 O  OE2   . GLU B 1 222 ? -31.104 -24.762 -17.501 1.00 155.49 ? 222 GLU B OE2   1 
ATOM   5481 N  N     . LYS B 1 223 ? -27.797 -22.592 -19.968 1.00 111.85 ? 223 LYS B N     1 
ATOM   5482 C  CA    . LYS B 1 223 ? -27.506 -21.317 -19.324 1.00 106.13 ? 223 LYS B CA    1 
ATOM   5483 C  C     . LYS B 1 223 ? -26.891 -20.266 -20.266 1.00 93.35  ? 223 LYS B C     1 
ATOM   5484 O  O     . LYS B 1 223 ? -26.747 -19.100 -19.878 1.00 88.34  ? 223 LYS B O     1 
ATOM   5485 C  CB    . LYS B 1 223 ? -26.611 -21.541 -18.104 1.00 110.82 ? 223 LYS B CB    1 
ATOM   5486 C  CG    . LYS B 1 223 ? -26.953 -20.653 -16.912 1.00 113.56 ? 223 LYS B CG    1 
ATOM   5487 C  CD    . LYS B 1 223 ? -27.845 -21.365 -15.905 1.00 126.49 ? 223 LYS B CD    1 
ATOM   5488 C  CE    . LYS B 1 223 ? -27.038 -22.312 -15.041 1.00 134.40 ? 223 LYS B CE    1 
ATOM   5489 N  NZ    . LYS B 1 223 ? -27.827 -22.760 -13.871 1.00 148.61 ? 223 LYS B NZ    1 
ATOM   5490 N  N     . ARG B 1 224 ? -26.532 -20.682 -21.486 1.00 89.03  ? 224 ARG B N     1 
ATOM   5491 C  CA    . ARG B 1 224 ? -26.067 -19.770 -22.543 1.00 78.36  ? 224 ARG B CA    1 
ATOM   5492 C  C     . ARG B 1 224 ? -27.184 -18.917 -23.077 1.00 75.40  ? 224 ARG B C     1 
ATOM   5493 O  O     . ARG B 1 224 ? -28.287 -19.399 -23.323 1.00 80.70  ? 224 ARG B O     1 
ATOM   5494 C  CB    . ARG B 1 224 ? -25.524 -20.533 -23.753 1.00 76.63  ? 224 ARG B CB    1 
ATOM   5495 C  CG    . ARG B 1 224 ? -24.054 -20.377 -24.026 1.00 71.63  ? 224 ARG B CG    1 
ATOM   5496 C  CD    . ARG B 1 224 ? -23.593 -18.926 -24.109 1.00 63.65  ? 224 ARG B CD    1 
ATOM   5497 N  NE    . ARG B 1 224 ? -23.490 -18.416 -25.477 1.00 57.63  ? 224 ARG B NE    1 
ATOM   5498 C  CZ    . ARG B 1 224 ? -22.726 -17.387 -25.846 1.00 50.02  ? 224 ARG B CZ    1 
ATOM   5499 N  NH1   . ARG B 1 224 ? -21.973 -16.756 -24.957 1.00 48.02  ? 224 ARG B NH1   1 
ATOM   5500 N  NH2   . ARG B 1 224 ? -22.701 -16.995 -27.116 1.00 45.22  ? 224 ARG B NH2   1 
ATOM   5501 N  N     . ASN B 1 225 ? -26.889 -17.646 -23.291 1.00 67.72  ? 225 ASN B N     1 
ATOM   5502 C  CA    . ASN B 1 225 ? -27.737 -16.854 -24.143 1.00 63.86  ? 225 ASN B CA    1 
ATOM   5503 C  C     . ASN B 1 225 ? -27.095 -16.816 -25.519 1.00 57.84  ? 225 ASN B C     1 
ATOM   5504 O  O     . ASN B 1 225 ? -26.063 -16.178 -25.712 1.00 51.86  ? 225 ASN B O     1 
ATOM   5505 C  CB    . ASN B 1 225 ? -27.929 -15.453 -23.581 1.00 60.32  ? 225 ASN B CB    1 
ATOM   5506 C  CG    . ASN B 1 225 ? -28.984 -14.675 -24.329 1.00 58.61  ? 225 ASN B CG    1 
ATOM   5507 O  OD1   . ASN B 1 225 ? -29.830 -15.253 -25.014 1.00 62.03  ? 225 ASN B OD1   1 
ATOM   5508 N  ND2   . ASN B 1 225 ? -28.943 -13.355 -24.205 1.00 54.29  ? 225 ASN B ND2   1 
ATOM   5509 N  N     . VAL B 1 226 ? -27.686 -17.532 -26.469 1.00 60.40  ? 226 VAL B N     1 
ATOM   5510 C  CA    . VAL B 1 226 ? -27.172 -17.533 -27.833 1.00 56.19  ? 226 VAL B CA    1 
ATOM   5511 C  C     . VAL B 1 226 ? -27.371 -16.155 -28.457 1.00 50.03  ? 226 VAL B C     1 
ATOM   5512 O  O     . VAL B 1 226 ? -26.677 -15.783 -29.398 1.00 45.78  ? 226 VAL B O     1 
ATOM   5513 C  CB    . VAL B 1 226 ? -27.844 -18.602 -28.693 1.00 61.46  ? 226 VAL B CB    1 
ATOM   5514 C  CG1   . VAL B 1 226 ? -27.118 -18.744 -30.022 1.00 58.38  ? 226 VAL B CG1   1 
ATOM   5515 C  CG2   . VAL B 1 226 ? -27.853 -19.923 -27.964 1.00 69.50  ? 226 VAL B CG2   1 
ATOM   5516 N  N     . ALA B 1 227 ? -28.315 -15.400 -27.909 1.00 50.77  ? 227 ALA B N     1 
ATOM   5517 C  CA    . ALA B 1 227 ? -28.570 -14.041 -28.345 1.00 45.95  ? 227 ALA B CA    1 
ATOM   5518 C  C     . ALA B 1 227 ? -27.847 -13.035 -27.465 1.00 42.00  ? 227 ALA B C     1 
ATOM   5519 O  O     . ALA B 1 227 ? -28.166 -11.845 -27.496 1.00 39.38  ? 227 ALA B O     1 
ATOM   5520 C  CB    . ALA B 1 227 ? -30.059 -13.764 -28.345 1.00 49.85  ? 227 ALA B CB    1 
ATOM   5521 N  N     . ALA B 1 228 ? -26.861 -13.509 -26.707 1.00 42.40  ? 228 ALA B N     1 
ATOM   5522 C  CA    . ALA B 1 228 ? -26.147 -12.681 -25.736 1.00 40.37  ? 228 ALA B CA    1 
ATOM   5523 C  C     . ALA B 1 228 ? -25.718 -11.295 -26.244 1.00 34.77  ? 228 ALA B C     1 
ATOM   5524 O  O     . ALA B 1 228 ? -25.801 -10.305 -25.509 1.00 33.81  ? 228 ALA B O     1 
ATOM   5525 C  CB    . ALA B 1 228 ? -24.959 -13.425 -25.192 1.00 41.09  ? 228 ALA B CB    1 
ATOM   5526 N  N     . ASN B 1 229 ? -25.269 -11.210 -27.491 1.00 32.02  ? 229 ASN B N     1 
ATOM   5527 C  CA    . ASN B 1 229 ? -24.692 -9.960  -27.963 1.00 27.86  ? 229 ASN B CA    1 
ATOM   5528 C  C     . ASN B 1 229 ? -25.569 -9.146  -28.935 1.00 27.01  ? 229 ASN B C     1 
ATOM   5529 O  O     . ASN B 1 229 ? -25.152 -8.085  -29.429 1.00 24.10  ? 229 ASN B O     1 
ATOM   5530 C  CB    . ASN B 1 229 ? -23.287 -10.195 -28.521 1.00 25.74  ? 229 ASN B CB    1 
ATOM   5531 C  CG    . ASN B 1 229 ? -22.386 -8.973  -28.388 1.00 23.28  ? 229 ASN B CG    1 
ATOM   5532 O  OD1   . ASN B 1 229 ? -22.815 -7.885  -27.976 1.00 22.39  ? 229 ASN B OD1   1 
ATOM   5533 N  ND2   . ASN B 1 229 ? -21.123 -9.151  -28.743 1.00 23.68  ? 229 ASN B ND2   1 
ATOM   5534 N  N     . LEU B 1 230 ? -26.781 -9.627  -29.200 1.00 30.39  ? 230 LEU B N     1 
ATOM   5535 C  CA    . LEU B 1 230 ? -27.707 -8.851  -30.003 1.00 30.63  ? 230 LEU B CA    1 
ATOM   5536 C  C     . LEU B 1 230 ? -28.116 -7.640  -29.187 1.00 30.15  ? 230 LEU B C     1 
ATOM   5537 O  O     . LEU B 1 230 ? -28.645 -7.786  -28.088 1.00 33.21  ? 230 LEU B O     1 
ATOM   5538 C  CB    . LEU B 1 230 ? -28.928 -9.692  -30.390 1.00 35.66  ? 230 LEU B CB    1 
ATOM   5539 C  CG    . LEU B 1 230 ? -30.016 -9.045  -31.268 1.00 37.66  ? 230 LEU B CG    1 
ATOM   5540 C  CD1   . LEU B 1 230 ? -29.516 -8.793  -32.681 1.00 35.97  ? 230 LEU B CD1   1 
ATOM   5541 C  CD2   . LEU B 1 230 ? -31.303 -9.880  -31.298 1.00 43.26  ? 230 LEU B CD2   1 
ATOM   5542 N  N     . SER B 1 231 ? -27.842 -6.449  -29.709 1.00 27.57  ? 231 SER B N     1 
ATOM   5543 C  CA    . SER B 1 231 ? -28.264 -5.204  -29.060 1.00 27.99  ? 231 SER B CA    1 
ATOM   5544 C  C     . SER B 1 231 ? -29.785 -5.118  -29.016 1.00 32.57  ? 231 SER B C     1 
ATOM   5545 O  O     . SER B 1 231 ? -30.489 -5.722  -29.848 1.00 34.69  ? 231 SER B O     1 
ATOM   5546 C  CB    . SER B 1 231 ? -27.768 -3.974  -29.822 1.00 25.30  ? 231 SER B CB    1 
ATOM   5547 O  OG    . SER B 1 231 ? -26.952 -4.318  -30.924 1.00 23.86  ? 231 SER B OG    1 
ATOM   5548 N  N     . LEU B 1 232 ? -30.287 -4.340  -28.060 1.00 34.65  ? 232 LEU B N     1 
ATOM   5549 C  CA    . LEU B 1 232 ? -31.715 -4.037  -27.990 1.00 39.49  ? 232 LEU B CA    1 
ATOM   5550 C  C     . LEU B 1 232 ? -32.160 -3.309  -29.259 1.00 39.18  ? 232 LEU B C     1 
ATOM   5551 O  O     . LEU B 1 232 ? -33.219 -3.613  -29.810 1.00 43.32  ? 232 LEU B O     1 
ATOM   5552 C  CB    . LEU B 1 232 ? -32.033 -3.217  -26.733 1.00 42.15  ? 232 LEU B CB    1 
ATOM   5553 C  CG    . LEU B 1 232 ? -33.389 -2.522  -26.596 1.00 47.48  ? 232 LEU B CG    1 
ATOM   5554 C  CD1   . LEU B 1 232 ? -34.526 -3.510  -26.709 1.00 53.60  ? 232 LEU B CD1   1 
ATOM   5555 C  CD2   . LEU B 1 232 ? -33.471 -1.766  -25.281 1.00 50.61  ? 232 LEU B CD2   1 
ATOM   5556 N  N     . ASP B 1 233 ? -31.339 -2.369  -29.725 1.00 35.04  ? 233 ASP B N     1 
ATOM   5557 C  CA    . ASP B 1 233 ? -31.626 -1.647  -30.948 1.00 35.24  ? 233 ASP B CA    1 
ATOM   5558 C  C     . ASP B 1 233 ? -31.561 -2.544  -32.163 1.00 35.16  ? 233 ASP B C     1 
ATOM   5559 O  O     . ASP B 1 233 ? -32.409 -2.459  -33.042 1.00 38.17  ? 233 ASP B O     1 
ATOM   5560 C  CB    . ASP B 1 233 ? -30.650 -0.501  -31.127 1.00 32.23  ? 233 ASP B CB    1 
ATOM   5561 C  CG    . ASP B 1 233 ? -30.985 0.687   -30.270 1.00 34.14  ? 233 ASP B CG    1 
ATOM   5562 O  OD1   . ASP B 1 233 ? -32.093 0.719   -29.687 1.00 38.07  ? 233 ASP B OD1   1 
ATOM   5563 O  OD2   . ASP B 1 233 ? -30.129 1.595   -30.192 1.00 32.51  ? 233 ASP B OD2   1 
ATOM   5564 N  N     . ASN B 1 234 ? -30.547 -3.399  -32.225 1.00 32.44  ? 234 ASN B N     1 
ATOM   5565 C  CA    . ASN B 1 234 ? -30.446 -4.303  -33.357 1.00 33.44  ? 234 ASN B CA    1 
ATOM   5566 C  C     . ASN B 1 234 ? -31.549 -5.342  -33.372 1.00 37.96  ? 234 ASN B C     1 
ATOM   5567 O  O     . ASN B 1 234 ? -31.988 -5.763  -34.444 1.00 40.68  ? 234 ASN B O     1 
ATOM   5568 C  CB    . ASN B 1 234 ? -29.061 -4.926  -33.468 1.00 30.11  ? 234 ASN B CB    1 
ATOM   5569 C  CG    . ASN B 1 234 ? -28.089 -4.036  -34.227 1.00 28.33  ? 234 ASN B CG    1 
ATOM   5570 O  OD1   . ASN B 1 234 ? -26.907 -3.954  -33.888 1.00 26.50  ? 234 ASN B OD1   1 
ATOM   5571 N  ND2   . ASN B 1 234 ? -28.586 -3.356  -35.253 1.00 29.76  ? 234 ASN B ND2   1 
ATOM   5572 N  N     . LEU B 1 235 ? -32.010 -5.743  -32.190 1.00 39.88  ? 235 LEU B N     1 
ATOM   5573 C  CA    . LEU B 1 235 ? -33.217 -6.555  -32.117 1.00 45.84  ? 235 LEU B CA    1 
ATOM   5574 C  C     . LEU B 1 235 ? -34.345 -5.754  -32.758 1.00 49.79  ? 235 LEU B C     1 
ATOM   5575 O  O     . LEU B 1 235 ? -34.979 -6.207  -33.719 1.00 53.32  ? 235 LEU B O     1 
ATOM   5576 C  CB    . LEU B 1 235 ? -33.571 -6.936  -30.668 1.00 48.57  ? 235 LEU B CB    1 
ATOM   5577 C  CG    . LEU B 1 235 ? -34.904 -7.679  -30.436 1.00 55.74  ? 235 LEU B CG    1 
ATOM   5578 C  CD1   . LEU B 1 235 ? -34.953 -9.021  -31.162 1.00 57.41  ? 235 LEU B CD1   1 
ATOM   5579 C  CD2   . LEU B 1 235 ? -35.200 -7.854  -28.950 1.00 59.02  ? 235 LEU B CD2   1 
ATOM   5580 N  N     . ALA B 1 236 ? -34.546 -4.543  -32.238 1.00 49.72  ? 236 ALA B N     1 
ATOM   5581 C  CA    . ALA B 1 236 ? -35.600 -3.637  -32.690 1.00 54.09  ? 236 ALA B CA    1 
ATOM   5582 C  C     . ALA B 1 236 ? -35.623 -3.457  -34.207 1.00 54.79  ? 236 ALA B C     1 
ATOM   5583 O  O     . ALA B 1 236 ? -36.692 -3.305  -34.799 1.00 60.12  ? 236 ALA B O     1 
ATOM   5584 C  CB    . ALA B 1 236 ? -35.475 -2.294  -31.995 1.00 52.87  ? 236 ALA B CB    1 
ATOM   5585 N  N     . ARG B 1 237 ? -34.443 -3.486  -34.827 1.00 50.39  ? 237 ARG B N     1 
ATOM   5586 C  CA    . ARG B 1 237 ? -34.339 -3.349  -36.273 1.00 51.92  ? 237 ARG B CA    1 
ATOM   5587 C  C     . ARG B 1 237 ? -34.829 -4.604  -36.992 1.00 55.40  ? 237 ARG B C     1 
ATOM   5588 O  O     . ARG B 1 237 ? -35.544 -4.504  -37.994 1.00 60.20  ? 237 ARG B O     1 
ATOM   5589 C  CB    . ARG B 1 237 ? -32.920 -2.943  -36.695 1.00 47.04  ? 237 ARG B CB    1 
ATOM   5590 C  CG    . ARG B 1 237 ? -32.668 -1.446  -36.500 1.00 46.78  ? 237 ARG B CG    1 
ATOM   5591 C  CD    . ARG B 1 237 ? -31.194 -1.024  -36.634 1.00 42.65  ? 237 ARG B CD    1 
ATOM   5592 N  NE    . ARG B 1 237 ? -30.914 0.174   -35.829 1.00 41.93  ? 237 ARG B NE    1 
ATOM   5593 C  CZ    . ARG B 1 237 ? -30.164 0.187   -34.726 1.00 38.54  ? 237 ARG B CZ    1 
ATOM   5594 N  NH1   . ARG B 1 237 ? -29.574 -0.924  -34.294 1.00 36.19  ? 237 ARG B NH1   1 
ATOM   5595 N  NH2   . ARG B 1 237 ? -29.989 1.319   -34.056 1.00 38.15  ? 237 ARG B NH2   1 
ATOM   5596 N  N     . PHE B 1 238 ? -34.479 -5.776  -36.463 1.00 53.79  ? 238 PHE B N     1 
ATOM   5597 C  CA    . PHE B 1 238 ? -34.923 -7.033  -37.059 1.00 57.83  ? 238 PHE B CA    1 
ATOM   5598 C  C     . PHE B 1 238 ? -36.442 -7.189  -36.994 1.00 64.66  ? 238 PHE B C     1 
ATOM   5599 O  O     . PHE B 1 238 ? -37.073 -7.565  -37.983 1.00 69.83  ? 238 PHE B O     1 
ATOM   5600 C  CB    . PHE B 1 238 ? -34.223 -8.237  -36.415 1.00 55.87  ? 238 PHE B CB    1 
ATOM   5601 C  CG    . PHE B 1 238 ? -34.744 -9.575  -36.885 1.00 61.11  ? 238 PHE B CG    1 
ATOM   5602 C  CD1   . PHE B 1 238 ? -34.569 -9.983  -38.200 1.00 63.25  ? 238 PHE B CD1   1 
ATOM   5603 C  CD2   . PHE B 1 238 ? -35.415 -10.427 -36.006 1.00 65.25  ? 238 PHE B CD2   1 
ATOM   5604 C  CE1   . PHE B 1 238 ? -35.056 -11.214 -38.632 1.00 69.21  ? 238 PHE B CE1   1 
ATOM   5605 C  CE2   . PHE B 1 238 ? -35.903 -11.664 -36.428 1.00 70.62  ? 238 PHE B CE2   1 
ATOM   5606 C  CZ    . PHE B 1 238 ? -35.722 -12.058 -37.739 1.00 72.71  ? 238 PHE B CZ    1 
ATOM   5607 N  N     . VAL B 1 239 ? -37.024 -6.894  -35.834 1.00 65.48  ? 239 VAL B N     1 
ATOM   5608 C  CA    . VAL B 1 239 ? -38.464 -7.078  -35.634 1.00 72.97  ? 239 VAL B CA    1 
ATOM   5609 C  C     . VAL B 1 239 ? -39.278 -6.067  -36.442 1.00 76.87  ? 239 VAL B C     1 
ATOM   5610 O  O     . VAL B 1 239 ? -40.401 -6.360  -36.866 1.00 84.23  ? 239 VAL B O     1 
ATOM   5611 C  CB    . VAL B 1 239 ? -38.863 -7.099  -34.120 1.00 74.40  ? 239 VAL B CB    1 
ATOM   5612 C  CG1   . VAL B 1 239 ? -38.138 -6.041  -33.357 1.00 68.91  ? 239 VAL B CG1   1 
ATOM   5613 C  CG2   . VAL B 1 239 ? -40.355 -6.918  -33.934 1.00 83.04  ? 239 VAL B CG2   1 
ATOM   5614 N  N     . HIS B 1 240 ? -38.709 -4.888  -36.671 1.00 72.75  ? 240 HIS B N     1 
ATOM   5615 C  CA    . HIS B 1 240 ? -39.367 -3.908  -37.525 1.00 76.94  ? 240 HIS B CA    1 
ATOM   5616 C  C     . HIS B 1 240 ? -39.208 -4.346  -38.971 1.00 79.45  ? 240 HIS B C     1 
ATOM   5617 O  O     . HIS B 1 240 ? -40.139 -4.228  -39.778 1.00 86.26  ? 240 HIS B O     1 
ATOM   5618 C  CB    . HIS B 1 240 ? -38.801 -2.501  -37.309 1.00 72.66  ? 240 HIS B CB    1 
ATOM   5619 C  CG    . HIS B 1 240 ? -39.486 -1.446  -38.120 1.00 76.41  ? 240 HIS B CG    1 
ATOM   5620 N  ND1   . HIS B 1 240 ? -38.822 -0.673  -39.047 1.00 73.75  ? 240 HIS B ND1   1 
ATOM   5621 C  CD2   . HIS B 1 240 ? -40.780 -1.051  -38.159 1.00 83.01  ? 240 HIS B CD2   1 
ATOM   5622 C  CE1   . HIS B 1 240 ? -39.673 0.163   -39.612 1.00 79.84  ? 240 HIS B CE1   1 
ATOM   5623 N  NE2   . HIS B 1 240 ? -40.869 -0.049  -39.094 1.00 85.53  ? 240 HIS B NE2   1 
ATOM   5624 N  N     . LEU B 1 241 ? -38.023 -4.874  -39.269 1.00 74.82  ? 241 LEU B N     1 
ATOM   5625 C  CA    . LEU B 1 241 ? -37.684 -5.391  -40.588 1.00 77.52  ? 241 LEU B CA    1 
ATOM   5626 C  C     . LEU B 1 241 ? -38.693 -6.446  -41.031 1.00 85.18  ? 241 LEU B C     1 
ATOM   5627 O  O     . LEU B 1 241 ? -39.258 -6.349  -42.126 1.00 91.43  ? 241 LEU B O     1 
ATOM   5628 C  CB    . LEU B 1 241 ? -36.288 -6.002  -40.539 1.00 71.46  ? 241 LEU B CB    1 
ATOM   5629 C  CG    . LEU B 1 241 ? -35.232 -5.688  -41.593 1.00 70.29  ? 241 LEU B CG    1 
ATOM   5630 C  CD1   . LEU B 1 241 ? -35.056 -4.190  -41.820 1.00 69.35  ? 241 LEU B CD1   1 
ATOM   5631 C  CD2   . LEU B 1 241 ? -33.937 -6.302  -41.115 1.00 64.36  ? 241 LEU B CD2   1 
ATOM   5632 N  N     . CYS B 1 242 ? -38.930 -7.429  -40.159 1.00 85.75  ? 242 CYS B N     1 
ATOM   5633 C  CA    . CYS B 1 242 ? -39.874 -8.518  -40.419 1.00 93.71  ? 242 CYS B CA    1 
ATOM   5634 C  C     . CYS B 1 242 ? -41.317 -8.052  -40.573 1.00 101.97 ? 242 CYS B C     1 
ATOM   5635 O  O     . CYS B 1 242 ? -42.101 -8.708  -41.258 1.00 109.57 ? 242 CYS B O     1 
ATOM   5636 C  CB    . CYS B 1 242 ? -39.790 -9.568  -39.318 1.00 92.89  ? 242 CYS B CB    1 
ATOM   5637 S  SG    . CYS B 1 242 ? -38.340 -10.628 -39.446 1.00 88.43  ? 242 CYS B SG    1 
ATOM   5638 N  N     . ARG B 1 243 ? -41.658 -6.934  -39.924 1.00 101.37 ? 243 ARG B N     1 
ATOM   5639 C  CA    . ARG B 1 243 ? -42.974 -6.290  -40.073 1.00 109.43 ? 243 ARG B CA    1 
ATOM   5640 C  C     . ARG B 1 243 ? -43.099 -5.641  -41.444 1.00 112.85 ? 243 ARG B C     1 
ATOM   5641 O  O     . ARG B 1 243 ? -44.158 -5.708  -42.073 1.00 121.56 ? 243 ARG B O     1 
ATOM   5642 C  CB    . ARG B 1 243 ? -43.219 -5.241  -38.975 1.00 107.81 ? 243 ARG B CB    1 
ATOM   5643 C  CG    . ARG B 1 243 ? -43.721 -5.805  -37.647 1.00 110.09 ? 243 ARG B CG    1 
ATOM   5644 C  CD    . ARG B 1 243 ? -43.733 -4.749  -36.546 1.00 107.75 ? 243 ARG B CD    1 
ATOM   5645 N  NE    . ARG B 1 243 ? -43.839 -5.337  -35.207 1.00 107.92 ? 243 ARG B NE    1 
ATOM   5646 C  CZ    . ARG B 1 243 ? -43.732 -4.651  -34.071 1.00 105.66 ? 243 ARG B CZ    1 
ATOM   5647 N  NH1   . ARG B 1 243 ? -43.516 -3.342  -34.097 1.00 102.95 ? 243 ARG B NH1   1 
ATOM   5648 N  NH2   . ARG B 1 243 ? -43.837 -5.272  -32.904 1.00 106.74 ? 243 ARG B NH2   1 
ATOM   5649 N  N     . GLU B 1 244 ? -42.012 -5.019  -41.898 1.00 106.88 ? 244 GLU B N     1 
ATOM   5650 C  CA    . GLU B 1 244 ? -41.986 -4.377  -43.205 1.00 110.89 ? 244 GLU B CA    1 
ATOM   5651 C  C     . GLU B 1 244 ? -42.041 -5.401  -44.331 1.00 116.04 ? 244 GLU B C     1 
ATOM   5652 O  O     . GLU B 1 244 ? -42.848 -5.261  -45.252 1.00 124.58 ? 244 GLU B O     1 
ATOM   5653 C  CB    . GLU B 1 244 ? -40.772 -3.461  -43.346 1.00 103.87 ? 244 GLU B CB    1 
ATOM   5654 C  CG    . GLU B 1 244 ? -40.994 -2.069  -42.765 1.00 103.30 ? 244 GLU B CG    1 
ATOM   5655 C  CD    . GLU B 1 244 ? -39.701 -1.264  -42.618 1.00 96.30  ? 244 GLU B CD    1 
ATOM   5656 O  OE1   . GLU B 1 244 ? -39.738 -0.028  -42.820 1.00 98.00  ? 244 GLU B OE1   1 
ATOM   5657 O  OE2   . GLU B 1 244 ? -38.647 -1.860  -42.289 1.00 90.86  ? 244 GLU B OE2   1 
ATOM   5658 N  N     . PHE B 1 245 ? -41.208 -6.435  -44.243 1.00 111.94 ? 245 PHE B N     1 
ATOM   5659 C  CA    . PHE B 1 245 ? -41.221 -7.524  -45.225 1.00 117.41 ? 245 PHE B CA    1 
ATOM   5660 C  C     . PHE B 1 245 ? -42.584 -8.217  -45.355 1.00 126.91 ? 245 PHE B C     1 
ATOM   5661 O  O     . PHE B 1 245 ? -43.039 -8.485  -46.461 1.00 134.68 ? 245 PHE B O     1 
ATOM   5662 C  CB    . PHE B 1 245 ? -40.146 -8.563  -44.902 1.00 111.90 ? 245 PHE B CB    1 
ATOM   5663 C  CG    . PHE B 1 245 ? -39.945 -9.583  -45.987 1.00 117.55 ? 245 PHE B CG    1 
ATOM   5664 C  CD1   . PHE B 1 245 ? -39.138 -9.299  -47.087 1.00 118.60 ? 245 PHE B CD1   1 
ATOM   5665 C  CD2   . PHE B 1 245 ? -40.560 -10.828 -45.912 1.00 123.59 ? 245 PHE B CD2   1 
ATOM   5666 C  CE1   . PHE B 1 245 ? -38.944 -10.242 -48.100 1.00 124.83 ? 245 PHE B CE1   1 
ATOM   5667 C  CE2   . PHE B 1 245 ? -40.374 -11.782 -46.920 1.00 129.77 ? 245 PHE B CE2   1 
ATOM   5668 C  CZ    . PHE B 1 245 ? -39.564 -11.488 -48.016 1.00 129.91 ? 245 PHE B CZ    1 
ATOM   5669 N  N     . MET B 1 246 ? -43.223 -8.509  -44.225 1.00 127.04 ? 246 MET B N     1 
ATOM   5670 C  CA    . MET B 1 246 ? -44.533 -9.156  -44.222 1.00 136.81 ? 246 MET B CA    1 
ATOM   5671 C  C     . MET B 1 246 ? -45.635 -8.312  -44.845 1.00 145.36 ? 246 MET B C     1 
ATOM   5672 O  O     . MET B 1 246 ? -46.552 -8.850  -45.456 1.00 155.38 ? 246 MET B O     1 
ATOM   5673 C  CB    . MET B 1 246 ? -44.934 -9.569  -42.809 1.00 135.88 ? 246 MET B CB    1 
ATOM   5674 C  CG    . MET B 1 246 ? -44.285 -10.863 -42.328 1.00 133.07 ? 246 MET B CG    1 
ATOM   5675 S  SD    . MET B 1 246 ? -45.035 -12.373 -42.984 1.00 144.04 ? 246 MET B SD    1 
ATOM   5676 C  CE    . MET B 1 246 ? -44.233 -12.544 -44.580 1.00 143.52 ? 246 MET B CE    1 
ATOM   5677 N  N     . GLU B 1 247 ? -45.552 -6.994  -44.695 1.00 142.41 ? 247 GLU B N     1 
ATOM   5678 C  CA    . GLU B 1 247 ? -46.590 -6.118  -45.230 1.00 150.95 ? 247 GLU B CA    1 
ATOM   5679 C  C     . GLU B 1 247 ? -46.299 -5.639  -46.651 1.00 154.16 ? 247 GLU B C     1 
ATOM   5680 O  O     . GLU B 1 247 ? -47.223 -5.329  -47.395 1.00 163.93 ? 247 GLU B O     1 
ATOM   5681 C  CB    . GLU B 1 247 ? -46.848 -4.941  -44.289 1.00 148.41 ? 247 GLU B CB    1 
ATOM   5682 C  CG    . GLU B 1 247 ? -47.567 -5.336  -43.001 1.00 150.29 ? 247 GLU B CG    1 
ATOM   5683 C  CD    . GLU B 1 247 ? -47.801 -4.159  -42.066 1.00 148.65 ? 247 GLU B CD    1 
ATOM   5684 O  OE1   . GLU B 1 247 ? -48.981 -3.857  -41.784 1.00 157.62 ? 247 GLU B OE1   1 
ATOM   5685 O  OE2   . GLU B 1 247 ? -46.811 -3.534  -41.617 1.00 139.46 ? 247 GLU B OE2   1 
ATOM   5686 N  N     . ALA B 1 248 ? -45.022 -5.584  -47.024 1.00 147.04 ? 248 ALA B N     1 
ATOM   5687 C  CA    . ALA B 1 248 ? -44.628 -5.205  -48.382 1.00 151.02 ? 248 ALA B CA    1 
ATOM   5688 C  C     . ALA B 1 248 ? -43.329 -5.895  -48.823 1.00 145.98 ? 248 ALA B C     1 
ATOM   5689 O  O     . ALA B 1 248 ? -42.278 -5.252  -48.865 1.00 139.75 ? 248 ALA B O     1 
ATOM   5690 C  CB    . ALA B 1 248 ? -44.502 -3.688  -48.498 1.00 149.99 ? 248 ALA B CB    1 
ATOM   5691 N  N     . PRO B 1 249 ? -43.402 -7.196  -49.185 1.00 149.88 ? 249 PRO B N     1 
ATOM   5692 C  CA    . PRO B 1 249 ? -42.214 -8.025  -49.460 1.00 145.63 ? 249 PRO B CA    1 
ATOM   5693 C  C     . PRO B 1 249 ? -41.511 -7.691  -50.769 1.00 149.26 ? 249 PRO B C     1 
ATOM   5694 O  O     . PRO B 1 249 ? -42.155 -7.557  -51.810 1.00 159.26 ? 249 PRO B O     1 
ATOM   5695 C  CB    . PRO B 1 249 ? -42.768 -9.457  -49.531 1.00 151.47 ? 249 PRO B CB    1 
ATOM   5696 C  CG    . PRO B 1 249 ? -44.222 -9.366  -49.198 1.00 158.57 ? 249 PRO B CG    1 
ATOM   5697 C  CD    . PRO B 1 249 ? -44.649 -7.948  -49.388 1.00 159.73 ? 249 PRO B CD    1 
ATOM   5698 N  N     . SER B 1 250 ? -40.188 -7.581  -50.704 1.00 142.21 ? 250 SER B N     1 
ATOM   5699 C  CA    . SER B 1 250 ? -39.366 -7.223  -51.857 1.00 145.71 ? 250 SER B CA    1 
ATOM   5700 C  C     . SER B 1 250 ? -38.032 -7.980  -51.822 1.00 140.51 ? 250 SER B C     1 
ATOM   5701 O  O     . SER B 1 250 ? -37.635 -8.514  -50.780 1.00 132.58 ? 250 SER B O     1 
ATOM   5702 C  CB    . SER B 1 250 ? -39.132 -5.702  -51.878 1.00 143.76 ? 250 SER B CB    1 
ATOM   5703 O  OG    . SER B 1 250 ? -38.404 -5.288  -53.023 1.00 148.59 ? 250 SER B OG    1 
ATOM   5704 N  N     . LEU B 1 251 ? -37.358 -8.041  -52.968 1.00 146.05 ? 251 LEU B N     1 
ATOM   5705 C  CA    . LEU B 1 251 ? -36.011 -8.605  -53.046 1.00 142.33 ? 251 LEU B CA    1 
ATOM   5706 C  C     . LEU B 1 251 ? -34.981 -7.608  -52.512 1.00 134.11 ? 251 LEU B C     1 
ATOM   5707 O  O     . LEU B 1 251 ? -33.876 -7.994  -52.129 1.00 128.29 ? 251 LEU B O     1 
ATOM   5708 C  CB    . LEU B 1 251 ? -35.676 -9.011  -54.486 1.00 152.66 ? 251 LEU B CB    1 
ATOM   5709 C  CG    . LEU B 1 251 ? -34.423 -9.850  -54.765 1.00 151.97 ? 251 LEU B CG    1 
ATOM   5710 C  CD1   . LEU B 1 251 ? -34.481 -11.198 -54.061 1.00 148.64 ? 251 LEU B CD1   1 
ATOM   5711 C  CD2   . LEU B 1 251 ? -34.239 -10.040 -56.260 1.00 164.25 ? 251 LEU B CD2   1 
ATOM   5712 N  N     . GLY B 1 252 ? -35.361 -6.330  -52.482 1.00 134.36 ? 252 GLY B N     1 
ATOM   5713 C  CA    . GLY B 1 252 ? -34.533 -5.266  -51.911 1.00 127.42 ? 252 GLY B CA    1 
ATOM   5714 C  C     . GLY B 1 252 ? -34.117 -5.550  -50.479 1.00 116.44 ? 252 GLY B C     1 
ATOM   5715 O  O     . GLY B 1 252 ? -33.111 -5.020  -49.998 1.00 110.30 ? 252 GLY B O     1 
ATOM   5716 N  N     . PHE B 1 253 ? -34.895 -6.398  -49.807 1.00 114.99 ? 253 PHE B N     1 
ATOM   5717 C  CA    . PHE B 1 253 ? -34.596 -6.844  -48.449 1.00 106.05 ? 253 PHE B CA    1 
ATOM   5718 C  C     . PHE B 1 253 ? -33.465 -7.861  -48.426 1.00 103.31 ? 253 PHE B C     1 
ATOM   5719 O  O     . PHE B 1 253 ? -33.166 -8.413  -47.376 1.00 97.03  ? 253 PHE B O     1 
ATOM   5720 C  CB    . PHE B 1 253 ? -35.840 -7.461  -47.796 1.00 107.28 ? 253 PHE B CB    1 
ATOM   5721 C  CG    . PHE B 1 253 ? -36.948 -6.473  -47.513 1.00 109.30 ? 253 PHE B CG    1 
ATOM   5722 C  CD1   . PHE B 1 253 ? -37.925 -6.206  -48.470 1.00 118.05 ? 253 PHE B CD1   1 
ATOM   5723 C  CD2   . PHE B 1 253 ? -37.028 -5.830  -46.277 1.00 102.70 ? 253 PHE B CD2   1 
ATOM   5724 C  CE1   . PHE B 1 253 ? -38.955 -5.306  -48.207 1.00 120.48 ? 253 PHE B CE1   1 
ATOM   5725 C  CE2   . PHE B 1 253 ? -38.058 -4.930  -46.007 1.00 105.16 ? 253 PHE B CE2   1 
ATOM   5726 C  CZ    . PHE B 1 253 ? -39.021 -4.669  -46.973 1.00 114.09 ? 253 PHE B CZ    1 
ATOM   5727 N  N     . PHE B 1 254 ? -32.856 -8.114  -49.584 1.00 109.27 ? 254 PHE B N     1 
ATOM   5728 C  CA    . PHE B 1 254 ? -31.754 -9.081  -49.720 1.00 108.93 ? 254 PHE B CA    1 
ATOM   5729 C  C     . PHE B 1 254 ? -30.565 -8.487  -50.473 1.00 111.14 ? 254 PHE B C     1 
ATOM   5730 O  O     . PHE B 1 254 ? -29.459 -9.034  -50.445 1.00 109.47 ? 254 PHE B O     1 
ATOM   5731 C  CB    . PHE B 1 254 ? -32.230 -10.358 -50.423 1.00 116.33 ? 254 PHE B CB    1 
ATOM   5732 C  CG    . PHE B 1 254 ? -33.125 -11.219 -49.581 1.00 114.46 ? 254 PHE B CG    1 
ATOM   5733 C  CD1   . PHE B 1 254 ? -34.496 -11.004 -49.552 1.00 117.84 ? 254 PHE B CD1   1 
ATOM   5734 C  CD2   . PHE B 1 254 ? -32.597 -12.250 -48.820 1.00 110.19 ? 254 PHE B CD2   1 
ATOM   5735 C  CE1   . PHE B 1 254 ? -35.325 -11.802 -48.768 1.00 117.80 ? 254 PHE B CE1   1 
ATOM   5736 C  CE2   . PHE B 1 254 ? -33.419 -13.054 -48.039 1.00 110.08 ? 254 PHE B CE2   1 
ATOM   5737 C  CZ    . PHE B 1 254 ? -34.783 -12.830 -48.011 1.00 114.02 ? 254 PHE B CZ    1 
ATOM   5738 N  N     . LYS B 1 255 ? -30.810 -7.369  -51.151 1.00 116.12 ? 255 LYS B N     1 
ATOM   5739 C  CA    . LYS B 1 255 ? -29.764 -6.619  -51.834 1.00 119.58 ? 255 LYS B CA    1 
ATOM   5740 C  C     . LYS B 1 255 ? -29.009 -5.798  -50.790 1.00 111.15 ? 255 LYS B C     1 
ATOM   5741 O  O     . LYS B 1 255 ? -29.623 -5.039  -50.031 1.00 106.47 ? 255 LYS B O     1 
ATOM   5742 C  CB    . LYS B 1 255 ? -30.356 -5.673  -52.891 1.00 128.31 ? 255 LYS B CB    1 
ATOM   5743 C  CG    . LYS B 1 255 ? -31.512 -6.233  -53.730 1.00 137.12 ? 255 LYS B CG    1 
ATOM   5744 C  CD    . LYS B 1 255 ? -31.088 -6.661  -55.132 1.00 148.03 ? 255 LYS B CD    1 
ATOM   5745 C  CE    . LYS B 1 255 ? -32.313 -6.911  -56.015 1.00 158.04 ? 255 LYS B CE    1 
ATOM   5746 N  NZ    . LYS B 1 255 ? -31.986 -7.438  -57.372 1.00 169.32 ? 255 LYS B NZ    1 
ATOM   5747 N  N     . PRO B 1 256 ? -27.676 -5.967  -50.724 1.00 109.90 ? 256 PRO B N     1 
ATOM   5748 C  CA    . PRO B 1 256 ? -26.869 -5.112  -49.849 1.00 103.34 ? 256 PRO B CA    1 
ATOM   5749 C  C     . PRO B 1 256 ? -26.503 -3.775  -50.525 1.00 108.63 ? 256 PRO B C     1 
ATOM   5750 O  O     . PRO B 1 256 ? -25.491 -3.695  -51.232 1.00 113.73 ? 256 PRO B O     1 
ATOM   5751 C  CB    . PRO B 1 256 ? -25.617 -5.967  -49.571 1.00 100.88 ? 256 PRO B CB    1 
ATOM   5752 C  CG    . PRO B 1 256 ? -25.725 -7.206  -50.478 1.00 107.53 ? 256 PRO B CG    1 
ATOM   5753 C  CD    . PRO B 1 256 ? -26.851 -6.963  -51.434 1.00 114.90 ? 256 PRO B CD    1 
ATOM   5754 N  N     . LYS B 1 257 ? -27.331 -2.746  -50.314 1.00 108.58 ? 257 LYS B N     1 
ATOM   5755 C  CA    . LYS B 1 257 ? -27.101 -1.411  -50.893 1.00 114.18 ? 257 LYS B CA    1 
ATOM   5756 C  C     . LYS B 1 257 ? -25.776 -0.817  -50.437 1.00 111.09 ? 257 LYS B C     1 
ATOM   5757 O  O     . LYS B 1 257 ? -25.410 -0.918  -49.264 1.00 102.35 ? 257 LYS B O     1 
ATOM   5758 C  CB    . LYS B 1 257 ? -28.248 -0.452  -50.563 1.00 113.75 ? 257 LYS B CB    1 
ATOM   5759 C  CG    . LYS B 1 257 ? -29.412 -0.532  -51.533 1.00 122.57 ? 257 LYS B CG    1 
ATOM   5760 C  CD    . LYS B 1 257 ? -30.709 -0.095  -50.873 1.00 120.64 ? 257 LYS B CD    1 
ATOM   5761 C  CE    . LYS B 1 257 ? -31.877 -0.921  -51.394 1.00 126.16 ? 257 LYS B CE    1 
ATOM   5762 N  NZ    . LYS B 1 257 ? -33.052 -0.878  -50.482 1.00 122.35 ? 257 LYS B NZ    1 
ATOM   5763 N  N     . HIS B 1 258 ? -25.066 -0.195  -51.376 1.00 119.37 ? 258 HIS B N     1 
ATOM   5764 C  CA    . HIS B 1 258 ? -23.702 0.278   -51.126 1.00 118.77 ? 258 HIS B CA    1 
ATOM   5765 C  C     . HIS B 1 258 ? -23.640 1.739   -50.659 1.00 117.42 ? 258 HIS B C     1 
ATOM   5766 O  O     . HIS B 1 258 ? -23.929 2.657   -51.446 1.00 125.27 ? 258 HIS B O     1 
ATOM   5767 C  CB    . HIS B 1 258 ? -22.798 -0.004  -52.339 1.00 129.14 ? 258 HIS B CB    1 
ATOM   5768 C  CG    . HIS B 1 258 ? -22.461 -1.459  -52.504 1.00 129.74 ? 258 HIS B CG    1 
ATOM   5769 N  ND1   . HIS B 1 258 ? -23.359 -2.383  -52.999 1.00 132.66 ? 258 HIS B ND1   1 
ATOM   5770 C  CD2   . HIS B 1 258 ? -21.331 -2.153  -52.216 1.00 128.33 ? 258 HIS B CD2   1 
ATOM   5771 C  CE1   . HIS B 1 258 ? -22.795 -3.578  -53.018 1.00 132.46 ? 258 HIS B CE1   1 
ATOM   5772 N  NE2   . HIS B 1 258 ? -21.564 -3.466  -52.549 1.00 129.78 ? 258 HIS B NE2   1 
ATOM   5773 N  N     . PRO B 1 259 ? -23.261 1.942   -49.367 1.00 107.98 ? 259 PRO B N     1 
ATOM   5774 C  CA    . PRO B 1 259 ? -23.291 3.216   -48.644 1.00 105.04 ? 259 PRO B CA    1 
ATOM   5775 C  C     . PRO B 1 259 ? -23.118 4.406   -49.572 1.00 114.52 ? 259 PRO B C     1 
ATOM   5776 O  O     . PRO B 1 259 ? -22.058 4.562   -50.188 1.00 120.72 ? 259 PRO B O     1 
ATOM   5777 C  CB    . PRO B 1 259 ? -22.104 3.091   -47.685 1.00 98.91  ? 259 PRO B CB    1 
ATOM   5778 C  CG    . PRO B 1 259 ? -22.038 1.612   -47.379 1.00 94.00  ? 259 PRO B CG    1 
ATOM   5779 C  CD    . PRO B 1 259 ? -22.733 0.864   -48.503 1.00 100.06 ? 259 PRO B CD    1 
ATOM   5780 N  N     . LEU B 1 260 ? -24.175 5.213   -49.680 1.00 139.26 ? 260 LEU B N     1 
ATOM   5781 C  CA    . LEU B 1 260 ? -24.223 6.359   -50.599 1.00 142.32 ? 260 LEU B CA    1 
ATOM   5782 C  C     . LEU B 1 260 ? -22.977 7.251   -50.540 1.00 138.04 ? 260 LEU B C     1 
ATOM   5783 O  O     . LEU B 1 260 ? -22.455 7.561   -49.459 1.00 129.72 ? 260 LEU B O     1 
ATOM   5784 C  CB    . LEU B 1 260 ? -25.512 7.183   -50.399 1.00 141.46 ? 260 LEU B CB    1 
ATOM   5785 C  CG    . LEU B 1 260 ? -26.669 7.052   -51.410 1.00 150.76 ? 260 LEU B CG    1 
ATOM   5786 C  CD1   . LEU B 1 260 ? -27.047 5.593   -51.717 1.00 156.65 ? 260 LEU B CD1   1 
ATOM   5787 C  CD2   . LEU B 1 260 ? -27.891 7.869   -50.956 1.00 148.44 ? 260 LEU B CD2   1 
ATOM   5788 N  N     . GLU B 1 261 ? -22.513 7.642   -51.726 1.00 144.27 ? 261 GLU B N     1 
ATOM   5789 C  CA    . GLU B 1 261 ? -21.314 8.462   -51.885 1.00 142.33 ? 261 GLU B CA    1 
ATOM   5790 C  C     . GLU B 1 261 ? -21.617 9.960   -51.807 1.00 139.35 ? 261 GLU B C     1 
ATOM   5791 O  O     . GLU B 1 261 ? -20.895 10.773  -52.395 1.00 142.77 ? 261 GLU B O     1 
ATOM   5792 C  CB    . GLU B 1 261 ? -20.638 8.164   -53.227 1.00 152.53 ? 261 GLU B CB    1 
ATOM   5793 C  CG    . GLU B 1 261 ? -20.004 6.802   -53.368 1.00 154.99 ? 261 GLU B CG    1 
ATOM   5794 C  CD    . GLU B 1 261 ? -19.033 6.776   -54.524 1.00 164.24 ? 261 GLU B CD    1 
ATOM   5795 O  OE1   . GLU B 1 261 ? -17.929 7.334   -54.367 1.00 162.37 ? 261 GLU B OE1   1 
ATOM   5796 O  OE2   . GLU B 1 261 ? -19.374 6.216   -55.589 1.00 174.10 ? 261 GLU B OE2   1 
ATOM   5797 N  N     . ILE B 1 262 ? -22.690 10.314  -51.097 1.00 133.24 ? 262 ILE B N     1 
ATOM   5798 C  CA    . ILE B 1 262 ? -23.074 11.706  -50.863 1.00 129.39 ? 262 ILE B CA    1 
ATOM   5799 C  C     . ILE B 1 262 ? -21.845 12.622  -50.842 1.00 127.04 ? 262 ILE B C     1 
ATOM   5800 O  O     . ILE B 1 262 ? -20.909 12.399  -50.064 1.00 121.62 ? 262 ILE B O     1 
ATOM   5801 C  CB    . ILE B 1 262 ? -23.876 11.830  -49.545 1.00 121.19 ? 262 ILE B CB    1 
ATOM   5802 C  CG1   . ILE B 1 262 ? -24.206 13.298  -49.236 1.00 118.79 ? 262 ILE B CG1   1 
ATOM   5803 C  CG2   . ILE B 1 262 ? -23.128 11.138  -48.391 1.00 113.91 ? 262 ILE B CG2   1 
ATOM   5804 C  CD1   . ILE B 1 262 ? -25.240 13.497  -48.133 1.00 112.68 ? 262 ILE B CD1   1 
ATOM   5805 N  N     . GLU B 1 263 ? -21.841 13.631  -51.711 1.00 131.45 ? 263 GLU B N     1 
ATOM   5806 C  CA    . GLU B 1 263 ? -20.675 14.505  -51.860 1.00 131.22 ? 263 GLU B CA    1 
ATOM   5807 C  C     . GLU B 1 263 ? -20.413 15.322  -50.588 1.00 121.27 ? 263 GLU B C     1 
ATOM   5808 O  O     . GLU B 1 263 ? -21.344 15.591  -49.814 1.00 115.65 ? 263 GLU B O     1 
ATOM   5809 C  CB    . GLU B 1 263 ? -20.809 15.444  -53.071 1.00 140.60 ? 263 GLU B CB    1 
ATOM   5810 C  CG    . GLU B 1 263 ? -21.657 14.932  -54.223 1.00 149.92 ? 263 GLU B CG    1 
ATOM   5811 C  CD    . GLU B 1 263 ? -23.105 15.385  -54.112 1.00 149.94 ? 263 GLU B CD    1 
ATOM   5812 O  OE1   . GLU B 1 263 ? -23.506 16.292  -54.878 1.00 156.10 ? 263 GLU B OE1   1 
ATOM   5813 O  OE2   . GLU B 1 263 ? -23.836 14.846  -53.248 1.00 143.70 ? 263 GLU B OE2   1 
ATOM   5814 N  N     . PRO B 1 264 ? -19.143 15.728  -50.375 1.00 119.39 ? 264 PRO B N     1 
ATOM   5815 C  CA    . PRO B 1 264 ? -18.786 16.565  -49.228 1.00 111.45 ? 264 PRO B CA    1 
ATOM   5816 C  C     . PRO B 1 264 ? -19.548 17.892  -49.251 1.00 111.10 ? 264 PRO B C     1 
ATOM   5817 O  O     . PRO B 1 264 ? -19.791 18.493  -48.205 1.00 104.86 ? 264 PRO B O     1 
ATOM   5818 C  CB    . PRO B 1 264 ? -17.291 16.831  -49.430 1.00 114.64 ? 264 PRO B CB    1 
ATOM   5819 C  CG    . PRO B 1 264 ? -16.821 15.804  -50.390 1.00 121.29 ? 264 PRO B CG    1 
ATOM   5820 C  CD    . PRO B 1 264 ? -17.980 15.439  -51.237 1.00 126.14 ? 264 PRO B CD    1 
ATOM   5821 N  N     . GLU B 1 265 ? -19.917 18.337  -50.446 1.00 118.07 ? 265 GLU B N     1 
ATOM   5822 C  CA    . GLU B 1 265 ? -20.661 19.568  -50.603 1.00 118.75 ? 265 GLU B CA    1 
ATOM   5823 C  C     . GLU B 1 265 ? -22.103 19.425  -50.109 1.00 113.60 ? 265 GLU B C     1 
ATOM   5824 O  O     . GLU B 1 265 ? -22.604 20.309  -49.410 1.00 109.79 ? 265 GLU B O     1 
ATOM   5825 C  CB    . GLU B 1 265 ? -20.603 20.048  -52.062 1.00 130.03 ? 265 GLU B CB    1 
ATOM   5826 C  CG    . GLU B 1 265 ? -21.199 21.439  -52.321 1.00 133.62 ? 265 GLU B CG    1 
ATOM   5827 C  CD    . GLU B 1 265 ? -21.021 22.403  -51.153 1.00 127.21 ? 265 GLU B CD    1 
ATOM   5828 O  OE1   . GLU B 1 265 ? -19.874 22.617  -50.699 1.00 125.45 ? 265 GLU B OE1   1 
ATOM   5829 O  OE2   . GLU B 1 265 ? -22.043 22.945  -50.683 1.00 124.60 ? 265 GLU B OE2   1 
ATOM   5830 N  N     . ARG B 1 266 ? -22.750 18.308  -50.446 1.00 113.44 ? 266 ARG B N     1 
ATOM   5831 C  CA    . ARG B 1 266 ? -24.175 18.119  -50.149 1.00 110.21 ? 266 ARG B CA    1 
ATOM   5832 C  C     . ARG B 1 266 ? -24.494 18.207  -48.662 1.00 99.63  ? 266 ARG B C     1 
ATOM   5833 O  O     . ARG B 1 266 ? -25.376 18.962  -48.259 1.00 98.08  ? 266 ARG B O     1 
ATOM   5834 C  CB    . ARG B 1 266 ? -24.710 16.800  -50.731 1.00 113.97 ? 266 ARG B CB    1 
ATOM   5835 C  CG    . ARG B 1 266 ? -26.247 16.716  -50.841 1.00 116.25 ? 266 ARG B CG    1 
ATOM   5836 C  CD    . ARG B 1 266 ? -26.839 17.970  -51.511 1.00 122.98 ? 266 ARG B CD    1 
ATOM   5837 N  NE    . ARG B 1 266 ? -27.938 17.675  -52.441 1.00 131.87 ? 266 ARG B NE    1 
ATOM   5838 C  CZ    . ARG B 1 266 ? -28.282 18.447  -53.476 1.00 140.59 ? 266 ARG B CZ    1 
ATOM   5839 N  NH1   . ARG B 1 266 ? -27.616 19.574  -53.727 1.00 141.89 ? 266 ARG B NH1   1 
ATOM   5840 N  NH2   . ARG B 1 266 ? -29.295 18.093  -54.268 1.00 148.30 ? 266 ARG B NH2   1 
ATOM   5841 N  N     . LEU B 1 267 ? -23.780 17.449  -47.843 1.00 92.43  ? 267 LEU B N     1 
ATOM   5842 C  CA    . LEU B 1 267 ? -24.120 17.425  -46.431 1.00 83.13  ? 267 LEU B CA    1 
ATOM   5843 C  C     . LEU B 1 267 ? -23.583 18.629  -45.644 1.00 78.47  ? 267 LEU B C     1 
ATOM   5844 O  O     . LEU B 1 267 ? -24.137 18.982  -44.602 1.00 73.50  ? 267 LEU B O     1 
ATOM   5845 C  CB    . LEU B 1 267 ? -23.814 16.058  -45.789 1.00 79.09  ? 267 LEU B CB    1 
ATOM   5846 C  CG    . LEU B 1 267 ? -22.458 15.556  -45.295 1.00 75.76  ? 267 LEU B CG    1 
ATOM   5847 C  CD1   . LEU B 1 267 ? -22.623 14.127  -44.828 1.00 73.52  ? 267 LEU B CD1   1 
ATOM   5848 C  CD2   . LEU B 1 267 ? -21.394 15.628  -46.364 1.00 82.33  ? 267 LEU B CD2   1 
ATOM   5849 N  N     . ARG B 1 268 ? -22.553 19.293  -46.170 1.00 80.53  ? 268 ARG B N     1 
ATOM   5850 C  CA    . ARG B 1 268 ? -22.143 20.601  -45.652 1.00 78.00  ? 268 ARG B CA    1 
ATOM   5851 C  C     . ARG B 1 268 ? -23.343 21.529  -45.675 1.00 78.01  ? 268 ARG B C     1 
ATOM   5852 O  O     . ARG B 1 268 ? -23.492 22.386  -44.811 1.00 74.65  ? 268 ARG B O     1 
ATOM   5853 C  CB    . ARG B 1 268 ? -21.032 21.222  -46.501 1.00 84.38  ? 268 ARG B CB    1 
ATOM   5854 C  CG    . ARG B 1 268 ? -20.321 22.407  -45.831 1.00 84.01  ? 268 ARG B CG    1 
ATOM   5855 C  CD    . ARG B 1 268 ? -20.253 23.640  -46.729 1.00 94.21  ? 268 ARG B CD    1 
ATOM   5856 N  NE    . ARG B 1 268 ? -21.402 24.539  -46.521 1.00 96.25  ? 268 ARG B NE    1 
ATOM   5857 C  CZ    . ARG B 1 268 ? -22.261 24.948  -47.464 1.00 102.19 ? 268 ARG B CZ    1 
ATOM   5858 N  NH1   . ARG B 1 268 ? -23.256 25.763  -47.131 1.00 101.48 ? 268 ARG B NH1   1 
ATOM   5859 N  NH2   . ARG B 1 268 ? -22.134 24.567  -48.736 1.00 108.54 ? 268 ARG B NH2   1 
ATOM   5860 N  N     . LYS B 1 269 ? -24.191 21.347  -46.680 1.00 82.02  ? 269 LYS B N     1 
ATOM   5861 C  CA    . LYS B 1 269 ? -25.406 22.125  -46.821 1.00 83.11  ? 269 LYS B CA    1 
ATOM   5862 C  C     . LYS B 1 269 ? -26.459 21.635  -45.831 1.00 76.96  ? 269 LYS B C     1 
ATOM   5863 O  O     . LYS B 1 269 ? -27.119 22.440  -45.169 1.00 74.89  ? 269 LYS B O     1 
ATOM   5864 C  CB    . LYS B 1 269 ? -25.929 22.015  -48.246 1.00 91.55  ? 269 LYS B CB    1 
ATOM   5865 C  CG    . LYS B 1 269 ? -26.610 23.256  -48.771 1.00 96.81  ? 269 LYS B CG    1 
ATOM   5866 C  CD    . LYS B 1 269 ? -26.899 23.115  -50.259 1.00 106.42 ? 269 LYS B CD    1 
ATOM   5867 C  CE    . LYS B 1 269 ? -25.611 22.918  -51.066 1.00 111.06 ? 269 LYS B CE    1 
ATOM   5868 N  NZ    . LYS B 1 269 ? -25.817 23.010  -52.542 1.00 121.62 ? 269 LYS B NZ    1 
ATOM   5869 N  N     . ILE B 1 270 ? -26.600 20.315  -45.726 1.00 74.12  ? 270 ILE B N     1 
ATOM   5870 C  CA    . ILE B 1 270 ? -27.599 19.708  -44.853 1.00 69.17  ? 270 ILE B CA    1 
ATOM   5871 C  C     . ILE B 1 270 ? -27.277 20.023  -43.412 1.00 61.45  ? 270 ILE B C     1 
ATOM   5872 O  O     . ILE B 1 270 ? -28.159 20.374  -42.637 1.00 59.56  ? 270 ILE B O     1 
ATOM   5873 C  CB    . ILE B 1 270 ? -27.696 18.181  -45.067 1.00 69.69  ? 270 ILE B CB    1 
ATOM   5874 C  CG1   . ILE B 1 270 ? -28.520 17.884  -46.322 1.00 77.54  ? 270 ILE B CG1   1 
ATOM   5875 C  CG2   . ILE B 1 270 ? -28.320 17.482  -43.859 1.00 64.40  ? 270 ILE B CG2   1 
ATOM   5876 C  CD1   . ILE B 1 270 ? -28.366 16.475  -46.858 1.00 80.08  ? 270 ILE B CD1   1 
ATOM   5877 N  N     . VAL B 1 271 ? -26.007 19.912  -43.056 1.00 57.64  ? 271 VAL B N     1 
ATOM   5878 C  CA    . VAL B 1 271 ? -25.587 20.239  -41.707 1.00 51.12  ? 271 VAL B CA    1 
ATOM   5879 C  C     . VAL B 1 271 ? -25.809 21.716  -41.425 1.00 51.72  ? 271 VAL B C     1 
ATOM   5880 O  O     . VAL B 1 271 ? -26.222 22.091  -40.318 1.00 48.40  ? 271 VAL B O     1 
ATOM   5881 C  CB    . VAL B 1 271 ? -24.132 19.859  -41.477 1.00 48.85  ? 271 VAL B CB    1 
ATOM   5882 C  CG1   . VAL B 1 271 ? -23.531 20.642  -40.327 1.00 43.94  ? 271 VAL B CG1   1 
ATOM   5883 C  CG2   . VAL B 1 271 ? -24.044 18.375  -41.238 1.00 46.59  ? 271 VAL B CG2   1 
ATOM   5884 N  N     . GLU B 1 272 ? -25.556 22.557  -42.423 1.00 56.45  ? 272 GLU B N     1 
ATOM   5885 C  CA    . GLU B 1 272 ? -25.787 23.975  -42.235 1.00 57.68  ? 272 GLU B CA    1 
ATOM   5886 C  C     . GLU B 1 272 ? -27.287 24.286  -42.250 1.00 58.62  ? 272 GLU B C     1 
ATOM   5887 O  O     . GLU B 1 272 ? -27.744 25.173  -41.535 1.00 57.49  ? 272 GLU B O     1 
ATOM   5888 C  CB    . GLU B 1 272 ? -24.974 24.814  -43.221 1.00 63.60  ? 272 GLU B CB    1 
ATOM   5889 C  CG    . GLU B 1 272 ? -25.712 25.317  -44.431 1.00 72.34  ? 272 GLU B CG    1 
ATOM   5890 C  CD    . GLU B 1 272 ? -25.528 26.816  -44.614 1.00 79.11  ? 272 GLU B CD    1 
ATOM   5891 O  OE1   . GLU B 1 272 ? -25.060 27.236  -45.703 1.00 87.32  ? 272 GLU B OE1   1 
ATOM   5892 O  OE2   . GLU B 1 272 ? -25.842 27.574  -43.661 1.00 76.59  ? 272 GLU B OE2   1 
ATOM   5893 N  N     . GLU B 1 273 ? -28.047 23.521  -43.030 1.00 61.06  ? 273 GLU B N     1 
ATOM   5894 C  CA    . GLU B 1 273 ? -29.510 23.586  -42.999 1.00 62.47  ? 273 GLU B CA    1 
ATOM   5895 C  C     . GLU B 1 273 ? -30.075 23.191  -41.630 1.00 56.33  ? 273 GLU B C     1 
ATOM   5896 O  O     . GLU B 1 273 ? -31.050 23.769  -41.167 1.00 56.98  ? 273 GLU B O     1 
ATOM   5897 C  CB    . GLU B 1 273 ? -30.122 22.725  -44.115 1.00 67.80  ? 273 GLU B CB    1 
ATOM   5898 C  CG    . GLU B 1 273 ? -31.405 21.997  -43.704 1.00 69.12  ? 273 GLU B CG    1 
ATOM   5899 C  CD    . GLU B 1 273 ? -32.353 21.700  -44.853 1.00 78.61  ? 273 GLU B CD    1 
ATOM   5900 O  OE1   . GLU B 1 273 ? -31.888 21.417  -45.991 1.00 83.27  ? 273 GLU B OE1   1 
ATOM   5901 O  OE2   . GLU B 1 273 ? -33.581 21.738  -44.594 1.00 81.25  ? 273 GLU B OE2   1 
ATOM   5902 N  N     . ARG B 1 274 ? -29.460 22.205  -40.991 1.00 51.05  ? 274 ARG B N     1 
ATOM   5903 C  CA    . ARG B 1 274 ? -29.859 21.784  -39.663 1.00 45.95  ? 274 ARG B CA    1 
ATOM   5904 C  C     . ARG B 1 274 ? -29.391 22.754  -38.586 1.00 42.58  ? 274 ARG B C     1 
ATOM   5905 O  O     . ARG B 1 274 ? -29.920 22.738  -37.475 1.00 40.38  ? 274 ARG B O     1 
ATOM   5906 C  CB    . ARG B 1 274 ? -29.270 20.425  -39.359 1.00 42.96  ? 274 ARG B CB    1 
ATOM   5907 C  CG    . ARG B 1 274 ? -30.084 19.277  -39.811 1.00 44.88  ? 274 ARG B CG    1 
ATOM   5908 C  CD    . ARG B 1 274 ? -29.223 18.061  -39.724 1.00 43.31  ? 274 ARG B CD    1 
ATOM   5909 N  NE    . ARG B 1 274 ? -30.006 16.855  -39.487 1.00 44.97  ? 274 ARG B NE    1 
ATOM   5910 C  CZ    . ARG B 1 274 ? -29.906 16.101  -38.402 1.00 40.39  ? 274 ARG B CZ    1 
ATOM   5911 N  NH1   . ARG B 1 274 ? -29.052 16.432  -37.457 1.00 34.77  ? 274 ARG B NH1   1 
ATOM   5912 N  NH2   . ARG B 1 274 ? -30.658 15.017  -38.268 1.00 42.31  ? 274 ARG B NH2   1 
ATOM   5913 N  N     . GLY B 1 275 ? -28.382 23.568  -38.906 1.00 42.80  ? 275 GLY B N     1 
ATOM   5914 C  CA    . GLY B 1 275 ? -27.837 24.562  -37.977 1.00 40.21  ? 275 GLY B CA    1 
ATOM   5915 C  C     . GLY B 1 275 ? -27.274 24.008  -36.673 1.00 34.95  ? 275 GLY B C     1 
ATOM   5916 O  O     . GLY B 1 275 ? -27.357 24.667  -35.634 1.00 33.82  ? 275 GLY B O     1 
ATOM   5917 N  N     . THR B 1 276 ? -26.698 22.806  -36.729 1.00 32.17  ? 276 THR B N     1 
ATOM   5918 C  CA    . THR B 1 276 ? -26.163 22.124  -35.546 1.00 27.39  ? 276 THR B CA    1 
ATOM   5919 C  C     . THR B 1 276 ? -24.650 22.120  -35.546 1.00 26.18  ? 276 THR B C     1 
ATOM   5920 O  O     . THR B 1 276 ? -24.028 22.225  -36.594 1.00 28.91  ? 276 THR B O     1 
ATOM   5921 C  CB    . THR B 1 276 ? -26.584 20.671  -35.524 1.00 26.17  ? 276 THR B CB    1 
ATOM   5922 O  OG1   . THR B 1 276 ? -26.843 20.251  -36.863 1.00 29.22  ? 276 THR B OG1   1 
ATOM   5923 C  CG2   . THR B 1 276 ? -27.830 20.486  -34.716 1.00 25.85  ? 276 THR B CG2   1 
ATOM   5924 N  N     . ALA B 1 277 ? -24.050 21.987  -34.371 1.00 22.93  ? 277 ALA B N     1 
ATOM   5925 C  CA    . ALA B 1 277 ? -22.611 21.833  -34.286 1.00 22.00  ? 277 ALA B CA    1 
ATOM   5926 C  C     . ALA B 1 277 ? -22.286 20.366  -34.551 1.00 20.56  ? 277 ALA B C     1 
ATOM   5927 O  O     . ALA B 1 277 ? -22.688 19.498  -33.760 1.00 18.36  ? 277 ALA B O     1 
ATOM   5928 C  CB    . ALA B 1 277 ? -22.110 22.263  -32.919 1.00 20.17  ? 277 ALA B CB    1 
ATOM   5929 N  N     . VAL B 1 278 ? -21.595 20.089  -35.667 1.00 22.16  ? 278 VAL B N     1 
ATOM   5930 C  CA    . VAL B 1 278 ? -21.166 18.710  -35.994 1.00 21.51  ? 278 VAL B CA    1 
ATOM   5931 C  C     . VAL B 1 278 ? -19.669 18.559  -36.258 1.00 22.80  ? 278 VAL B C     1 
ATOM   5932 O  O     . VAL B 1 278 ? -19.148 19.005  -37.284 1.00 26.38  ? 278 VAL B O     1 
ATOM   5933 C  CB    . VAL B 1 278 ? -21.999 18.066  -37.118 1.00 23.60  ? 278 VAL B CB    1 
ATOM   5934 C  CG1   . VAL B 1 278 ? -22.441 19.114  -38.083 1.00 27.35  ? 278 VAL B CG1   1 
ATOM   5935 C  CG2   . VAL B 1 278 ? -21.222 16.939  -37.824 1.00 23.69  ? 278 VAL B CG2   1 
ATOM   5936 N  N     . PHE B 1 279 ? -19.002 17.903  -35.308 1.00 20.67  ? 279 PHE B N     1 
ATOM   5937 C  CA    . PHE B 1 279 ? -17.554 17.780  -35.281 1.00 21.81  ? 279 PHE B CA    1 
ATOM   5938 C  C     . PHE B 1 279 ? -17.183 16.350  -34.949 1.00 20.70  ? 279 PHE B C     1 
ATOM   5939 O  O     . PHE B 1 279 ? -18.053 15.557  -34.580 1.00 19.08  ? 279 PHE B O     1 
ATOM   5940 C  CB    . PHE B 1 279 ? -16.968 18.705  -34.218 1.00 21.38  ? 279 PHE B CB    1 
ATOM   5941 C  CG    . PHE B 1 279 ? -17.471 18.430  -32.831 1.00 17.62  ? 279 PHE B CG    1 
ATOM   5942 C  CD1   . PHE B 1 279 ? -16.927 17.407  -32.070 1.00 15.98  ? 279 PHE B CD1   1 
ATOM   5943 C  CD2   . PHE B 1 279 ? -18.480 19.211  -32.282 1.00 17.04  ? 279 PHE B CD2   1 
ATOM   5944 C  CE1   . PHE B 1 279 ? -17.398 17.153  -30.778 1.00 14.94  ? 279 PHE B CE1   1 
ATOM   5945 C  CE2   . PHE B 1 279 ? -18.952 18.975  -30.999 1.00 15.90  ? 279 PHE B CE2   1 
ATOM   5946 C  CZ    . PHE B 1 279 ? -18.410 17.939  -30.241 1.00 14.63  ? 279 PHE B CZ    1 
ATOM   5947 N  N     . ALA B 1 280 ? -15.887 16.047  -35.048 1.00 22.38  ? 280 ALA B N     1 
ATOM   5948 C  CA    . ALA B 1 280 ? -15.346 14.718  -34.774 1.00 22.16  ? 280 ALA B CA    1 
ATOM   5949 C  C     . ALA B 1 280 ? -14.006 14.779  -34.040 1.00 23.06  ? 280 ALA B C     1 
ATOM   5950 O  O     . ALA B 1 280 ? -13.221 15.715  -34.253 1.00 25.66  ? 280 ALA B O     1 
ATOM   5951 C  CB    . ALA B 1 280 ? -15.185 13.945  -36.075 1.00 25.11  ? 280 ALA B CB    1 
ATOM   5952 N  N     . VAL B 1 281 ? -13.741 13.787  -33.186 1.00 21.57  ? 281 VAL B N     1 
ATOM   5953 C  CA    . VAL B 1 281 ? -12.427 13.660  -32.553 1.00 22.96  ? 281 VAL B CA    1 
ATOM   5954 C  C     . VAL B 1 281 ? -11.612 12.685  -33.376 1.00 25.66  ? 281 VAL B C     1 
ATOM   5955 O  O     . VAL B 1 281 ? -11.954 11.505  -33.444 1.00 25.38  ? 281 VAL B O     1 
ATOM   5956 C  CB    . VAL B 1 281 ? -12.501 13.080  -31.135 1.00 21.06  ? 281 VAL B CB    1 
ATOM   5957 C  CG1   . VAL B 1 281 ? -11.127 13.164  -30.475 1.00 23.09  ? 281 VAL B CG1   1 
ATOM   5958 C  CG2   . VAL B 1 281 ? -13.566 13.772  -30.298 1.00 18.33  ? 281 VAL B CG2   1 
ATOM   5959 N  N     . LYS B 1 282 ? -10.538 13.163  -33.994 1.00 29.18  ? 282 LYS B N     1 
ATOM   5960 C  CA    . LYS B 1 282 ? -9.698  12.314  -34.839 1.00 32.49  ? 282 LYS B CA    1 
ATOM   5961 C  C     . LYS B 1 282 ? -8.407  11.944  -34.120 1.00 34.53  ? 282 LYS B C     1 
ATOM   5962 O  O     . LYS B 1 282 ? -7.689  12.821  -33.628 1.00 36.54  ? 282 LYS B O     1 
ATOM   5963 C  CB    . LYS B 1 282 ? -9.383  13.017  -36.162 1.00 36.67  ? 282 LYS B CB    1 
ATOM   5964 C  CG    . LYS B 1 282 ? -8.513  12.227  -37.115 1.00 40.82  ? 282 LYS B CG    1 
ATOM   5965 C  CD    . LYS B 1 282 ? -7.931  13.127  -38.168 1.00 46.22  ? 282 LYS B CD    1 
ATOM   5966 C  CE    . LYS B 1 282 ? -7.205  12.316  -39.212 1.00 52.53  ? 282 LYS B CE    1 
ATOM   5967 N  NZ    . LYS B 1 282 ? -6.474  13.175  -40.182 1.00 60.56  ? 282 LYS B NZ    1 
ATOM   5968 N  N     . PHE B 1 283 ? -8.113  10.650  -34.065 1.00 34.49  ? 283 PHE B N     1 
ATOM   5969 C  CA    . PHE B 1 283 ? -6.906  10.181  -33.416 1.00 36.65  ? 283 PHE B CA    1 
ATOM   5970 C  C     . PHE B 1 283 ? -6.409  8.902   -34.079 1.00 39.19  ? 283 PHE B C     1 
ATOM   5971 O  O     . PHE B 1 283 ? -7.155  8.242   -34.796 1.00 38.63  ? 283 PHE B O     1 
ATOM   5972 C  CB    . PHE B 1 283 ? -7.156  9.984   -31.916 1.00 34.10  ? 283 PHE B CB    1 
ATOM   5973 C  CG    . PHE B 1 283 ? -8.272  9.021   -31.597 1.00 31.48  ? 283 PHE B CG    1 
ATOM   5974 C  CD1   . PHE B 1 283 ? -7.997  7.665   -31.351 1.00 33.77  ? 283 PHE B CD1   1 
ATOM   5975 C  CD2   . PHE B 1 283 ? -9.590  9.455   -31.536 1.00 28.59  ? 283 PHE B CD2   1 
ATOM   5976 C  CE1   . PHE B 1 283 ? -9.021  6.753   -31.060 1.00 31.70  ? 283 PHE B CE1   1 
ATOM   5977 C  CE2   . PHE B 1 283 ? -10.630 8.549   -31.240 1.00 27.69  ? 283 PHE B CE2   1 
ATOM   5978 C  CZ    . PHE B 1 283 ? -10.343 7.193   -31.001 1.00 28.19  ? 283 PHE B CZ    1 
ATOM   5979 N  N     . ARG B 1 284 ? -5.150  8.551   -33.844 1.00 42.67  ? 284 ARG B N     1 
ATOM   5980 C  CA    . ARG B 1 284 ? -4.561  7.365   -34.475 1.00 45.81  ? 284 ARG B CA    1 
ATOM   5981 C  C     . ARG B 1 284 ? -5.181  6.096   -33.910 1.00 42.60  ? 284 ARG B C     1 
ATOM   5982 O  O     . ARG B 1 284 ? -5.412  5.993   -32.711 1.00 40.04  ? 284 ARG B O     1 
ATOM   5983 C  CB    . ARG B 1 284 ? -3.037  7.358   -34.302 1.00 51.31  ? 284 ARG B CB    1 
ATOM   5984 C  CG    . ARG B 1 284 ? -2.301  6.340   -35.155 1.00 57.06  ? 284 ARG B CG    1 
ATOM   5985 C  CD    . ARG B 1 284 ? -0.804  6.600   -35.124 1.00 65.25  ? 284 ARG B CD    1 
ATOM   5986 N  NE    . ARG B 1 284 ? -0.353  7.553   -36.149 1.00 71.50  ? 284 ARG B NE    1 
ATOM   5987 C  CZ    . ARG B 1 284 ? -0.209  8.869   -35.971 1.00 72.42  ? 284 ARG B CZ    1 
ATOM   5988 N  NH1   . ARG B 1 284 ? -0.488  9.438   -34.799 1.00 68.33  ? 284 ARG B NH1   1 
ATOM   5989 N  NH2   . ARG B 1 284 ? 0.219   9.624   -36.975 1.00 77.24  ? 284 ARG B NH2   1 
ATOM   5990 N  N     . LYS B 1 285 ? -5.457  5.142   -34.785 1.00 43.45  ? 285 LYS B N     1 
ATOM   5991 C  CA    . LYS B 1 285 ? -6.164  3.927   -34.408 1.00 41.45  ? 285 LYS B CA    1 
ATOM   5992 C  C     . LYS B 1 285 ? -5.191  2.925   -33.819 1.00 44.12  ? 285 LYS B C     1 
ATOM   5993 O  O     . LYS B 1 285 ? -4.235  2.553   -34.478 1.00 48.89  ? 285 LYS B O     1 
ATOM   5994 C  CB    . LYS B 1 285 ? -6.864  3.363   -35.644 1.00 42.81  ? 285 LYS B CB    1 
ATOM   5995 C  CG    . LYS B 1 285 ? -7.230  1.903   -35.610 1.00 44.17  ? 285 LYS B CG    1 
ATOM   5996 C  CD    . LYS B 1 285 ? -7.223  1.354   -37.040 1.00 49.31  ? 285 LYS B CD    1 
ATOM   5997 C  CE    . LYS B 1 285 ? -7.783  -0.062  -37.144 1.00 51.40  ? 285 LYS B CE    1 
ATOM   5998 N  NZ    . LYS B 1 285 ? -6.991  -1.036  -36.335 1.00 53.87  ? 285 LYS B NZ    1 
ATOM   5999 N  N     . PRO B 1 286 ? -5.413  2.502   -32.566 1.00 42.05  ? 286 PRO B N     1 
ATOM   6000 C  CA    . PRO B 1 286 ? -4.578  1.487   -31.919 1.00 45.57  ? 286 PRO B CA    1 
ATOM   6001 C  C     . PRO B 1 286 ? -4.503  0.165   -32.681 1.00 49.48  ? 286 PRO B C     1 
ATOM   6002 O  O     . PRO B 1 286 ? -5.505  -0.304  -33.221 1.00 48.62  ? 286 PRO B O     1 
ATOM   6003 C  CB    . PRO B 1 286 ? -5.263  1.271   -30.565 1.00 42.61  ? 286 PRO B CB    1 
ATOM   6004 C  CG    . PRO B 1 286 ? -6.583  1.867   -30.697 1.00 38.34  ? 286 PRO B CG    1 
ATOM   6005 C  CD    . PRO B 1 286 ? -6.459  2.984   -31.660 1.00 37.30  ? 286 PRO B CD    1 
ATOM   6006 N  N     . ASP B 1 287 ? -3.316  -0.431  -32.717 1.00 54.64  ? 287 ASP B N     1 
ATOM   6007 C  CA    . ASP B 1 287 ? -3.122  -1.671  -33.445 1.00 59.24  ? 287 ASP B CA    1 
ATOM   6008 C  C     . ASP B 1 287 ? -3.658  -2.838  -32.631 1.00 59.38  ? 287 ASP B C     1 
ATOM   6009 O  O     . ASP B 1 287 ? -2.904  -3.676  -32.150 1.00 63.35  ? 287 ASP B O     1 
ATOM   6010 C  CB    . ASP B 1 287 ? -1.647  -1.876  -33.810 1.00 65.11  ? 287 ASP B CB    1 
ATOM   6011 C  CG    . ASP B 1 287 ? -1.451  -2.964  -34.860 1.00 71.42  ? 287 ASP B CG    1 
ATOM   6012 O  OD1   . ASP B 1 287 ? -2.462  -3.540  -35.318 1.00 71.78  ? 287 ASP B OD1   1 
ATOM   6013 O  OD2   . ASP B 1 287 ? -0.291  -3.258  -35.236 1.00 78.35  ? 287 ASP B OD2   1 
ATOM   6014 N  N     . ILE B 1 288 ? -4.974  -2.879  -32.479 1.00 56.08  ? 288 ILE B N     1 
ATOM   6015 C  CA    . ILE B 1 288 ? -5.655  -3.994  -31.823 1.00 57.22  ? 288 ILE B CA    1 
ATOM   6016 C  C     . ILE B 1 288 ? -6.775  -4.576  -32.697 1.00 57.90  ? 288 ILE B C     1 
ATOM   6017 O  O     . ILE B 1 288 ? -7.397  -3.859  -33.489 1.00 55.81  ? 288 ILE B O     1 
ATOM   6018 C  CB    . ILE B 1 288 ? -6.260  -3.573  -30.459 1.00 53.81  ? 288 ILE B CB    1 
ATOM   6019 C  CG1   . ILE B 1 288 ? -7.016  -2.237  -30.581 1.00 48.38  ? 288 ILE B CG1   1 
ATOM   6020 C  CG2   . ILE B 1 288 ? -5.174  -3.539  -29.384 1.00 55.74  ? 288 ILE B CG2   1 
ATOM   6021 C  CD1   . ILE B 1 288 ? -8.065  -2.016  -29.515 1.00 45.10  ? 288 ILE B CD1   1 
ATOM   6022 N  N     . VAL B 1 289 ? -7.038  -5.870  -32.538 1.00 61.42  ? 289 VAL B N     1 
ATOM   6023 C  CA    . VAL B 1 289 ? -8.160  -6.530  -33.215 1.00 62.97  ? 289 VAL B CA    1 
ATOM   6024 C  C     . VAL B 1 289 ? -9.506  -5.811  -32.991 1.00 58.59  ? 289 VAL B C     1 
ATOM   6025 O  O     . VAL B 1 289 ? -9.660  -5.046  -32.033 1.00 54.93  ? 289 VAL B O     1 
ATOM   6026 C  CB    . VAL B 1 289 ? -8.265  -7.991  -32.768 1.00 67.97  ? 289 VAL B CB    1 
ATOM   6027 C  CG1   . VAL B 1 289 ? -7.637  -8.917  -33.808 1.00 73.80  ? 289 VAL B CG1   1 
ATOM   6028 C  CG2   . VAL B 1 289 ? -7.613  -8.163  -31.400 1.00 68.18  ? 289 VAL B CG2   1 
ATOM   6029 N  N     . ASP B 1 290 ? -10.475 -6.054  -33.873 1.00 59.80  ? 290 ASP B N     1 
ATOM   6030 C  CA    . ASP B 1 290 ? -11.774 -5.370  -33.809 1.00 56.26  ? 290 ASP B CA    1 
ATOM   6031 C  C     . ASP B 1 290 ? -12.497 -5.530  -32.470 1.00 54.58  ? 290 ASP B C     1 
ATOM   6032 O  O     . ASP B 1 290 ? -13.064 -4.569  -31.931 1.00 50.53  ? 290 ASP B O     1 
ATOM   6033 C  CB    . ASP B 1 290 ? -12.690 -5.842  -34.948 1.00 60.01  ? 290 ASP B CB    1 
ATOM   6034 C  CG    . ASP B 1 290 ? -12.428 -5.118  -36.269 1.00 60.59  ? 290 ASP B CG    1 
ATOM   6035 O  OD1   . ASP B 1 290 ? -11.435 -4.347  -36.355 1.00 59.16  ? 290 ASP B OD1   1 
ATOM   6036 O  OD2   . ASP B 1 290 ? -13.230 -5.322  -37.216 1.00 63.27  ? 290 ASP B OD2   1 
ATOM   6037 N  N     . ASP B 1 291 ? -12.460 -6.744  -31.936 1.00 58.54  ? 291 ASP B N     1 
ATOM   6038 C  CA    . ASP B 1 291 ? -13.225 -7.102  -30.752 1.00 59.01  ? 291 ASP B CA    1 
ATOM   6039 C  C     . ASP B 1 291 ? -12.751 -6.393  -29.488 1.00 55.86  ? 291 ASP B C     1 
ATOM   6040 O  O     . ASP B 1 291 ? -13.477 -6.337  -28.497 1.00 55.70  ? 291 ASP B O     1 
ATOM   6041 C  CB    . ASP B 1 291 ? -13.183 -8.613  -30.545 1.00 65.55  ? 291 ASP B CB    1 
ATOM   6042 C  CG    . ASP B 1 291 ? -13.215 -9.369  -31.842 1.00 69.24  ? 291 ASP B CG    1 
ATOM   6043 O  OD1   . ASP B 1 291 ? -12.146 -9.871  -32.243 1.00 71.94  ? 291 ASP B OD1   1 
ATOM   6044 O  OD2   . ASP B 1 291 ? -14.295 -9.442  -32.464 1.00 69.53  ? 291 ASP B OD2   1 
ATOM   6045 N  N     . ASN B 1 292 ? -11.533 -5.872  -29.509 1.00 54.34  ? 292 ASN B N     1 
ATOM   6046 C  CA    . ASN B 1 292 ? -11.071 -5.047  -28.408 1.00 52.19  ? 292 ASN B CA    1 
ATOM   6047 C  C     . ASN B 1 292 ? -11.250 -3.556  -28.736 1.00 47.13  ? 292 ASN B C     1 
ATOM   6048 O  O     . ASN B 1 292 ? -11.198 -2.703  -27.847 1.00 44.66  ? 292 ASN B O     1 
ATOM   6049 C  CB    . ASN B 1 292 ? -9.609  -5.352  -28.079 1.00 54.66  ? 292 ASN B CB    1 
ATOM   6050 C  CG    . ASN B 1 292 ? -9.381  -6.796  -27.638 1.00 61.54  ? 292 ASN B CG    1 
ATOM   6051 O  OD1   . ASN B 1 292 ? -10.188 -7.379  -26.905 1.00 65.38  ? 292 ASN B OD1   1 
ATOM   6052 N  ND2   . ASN B 1 292 ? -8.257  -7.373  -28.068 1.00 65.00  ? 292 ASN B ND2   1 
ATOM   6053 N  N     . LEU B 1 293 ? -11.467 -3.257  -30.016 1.00 46.32  ? 293 LEU B N     1 
ATOM   6054 C  CA    . LEU B 1 293 ? -11.487 -1.883  -30.503 1.00 42.33  ? 293 LEU B CA    1 
ATOM   6055 C  C     . LEU B 1 293 ? -12.873 -1.278  -30.404 1.00 39.79  ? 293 LEU B C     1 
ATOM   6056 O  O     . LEU B 1 293 ? -13.071 -0.247  -29.749 1.00 36.44  ? 293 LEU B O     1 
ATOM   6057 C  CB    . LEU B 1 293 ? -11.023 -1.824  -31.962 1.00 43.66  ? 293 LEU B CB    1 
ATOM   6058 C  CG    . LEU B 1 293 ? -10.300 -0.590  -32.539 1.00 41.57  ? 293 LEU B CG    1 
ATOM   6059 C  CD1   . LEU B 1 293 ? -10.732 -0.353  -33.982 1.00 41.51  ? 293 LEU B CD1   1 
ATOM   6060 C  CD2   . LEU B 1 293 ? -10.419 0.698   -31.709 1.00 36.54  ? 293 LEU B CD2   1 
ATOM   6061 N  N     . TYR B 1 294 ? -13.835 -1.916  -31.061 1.00 41.75  ? 294 TYR B N     1 
ATOM   6062 C  CA    . TYR B 1 294 ? -15.166 -1.342  -31.129 1.00 39.94  ? 294 TYR B CA    1 
ATOM   6063 C  C     . TYR B 1 294 ? -15.820 -1.088  -29.754 1.00 38.49  ? 294 TYR B C     1 
ATOM   6064 O  O     . TYR B 1 294 ? -16.373 -0.008  -29.547 1.00 35.48  ? 294 TYR B O     1 
ATOM   6065 C  CB    . TYR B 1 294 ? -16.053 -2.107  -32.114 1.00 43.63  ? 294 TYR B CB    1 
ATOM   6066 C  CG    . TYR B 1 294 ? -15.621 -1.857  -33.548 1.00 44.75  ? 294 TYR B CG    1 
ATOM   6067 C  CD1   . TYR B 1 294 ? -14.902 -2.820  -34.260 1.00 49.15  ? 294 TYR B CD1   1 
ATOM   6068 C  CD2   . TYR B 1 294 ? -15.898 -0.638  -34.182 1.00 41.64  ? 294 TYR B CD2   1 
ATOM   6069 C  CE1   . TYR B 1 294 ? -14.484 -2.587  -35.572 1.00 50.91  ? 294 TYR B CE1   1 
ATOM   6070 C  CE2   . TYR B 1 294 ? -15.487 -0.395  -35.498 1.00 43.67  ? 294 TYR B CE2   1 
ATOM   6071 C  CZ    . TYR B 1 294 ? -14.779 -1.372  -36.190 1.00 48.25  ? 294 TYR B CZ    1 
ATOM   6072 O  OH    . TYR B 1 294 ? -14.361 -1.142  -37.492 1.00 50.41  ? 294 TYR B OH    1 
ATOM   6073 N  N     . PRO B 1 295 ? -15.714 -2.042  -28.798 1.00 41.18  ? 295 PRO B N     1 
ATOM   6074 C  CA    . PRO B 1 295 ? -16.203 -1.719  -27.459 1.00 40.39  ? 295 PRO B CA    1 
ATOM   6075 C  C     . PRO B 1 295 ? -15.529 -0.481  -26.857 1.00 36.65  ? 295 PRO B C     1 
ATOM   6076 O  O     . PRO B 1 295 ? -16.151 0.237   -26.070 1.00 35.26  ? 295 PRO B O     1 
ATOM   6077 C  CB    . PRO B 1 295 ? -15.840 -2.962  -26.648 1.00 44.80  ? 295 PRO B CB    1 
ATOM   6078 C  CG    . PRO B 1 295 ? -15.804 -4.024  -27.625 1.00 48.17  ? 295 PRO B CG    1 
ATOM   6079 C  CD    . PRO B 1 295 ? -15.191 -3.417  -28.844 1.00 45.57  ? 295 PRO B CD    1 
ATOM   6080 N  N     . GLN B 1 296 ? -14.280 -0.223  -27.229 1.00 35.68  ? 296 GLN B N     1 
ATOM   6081 C  CA    . GLN B 1 296 ? -13.572 0.923   -26.681 1.00 33.61  ? 296 GLN B CA    1 
ATOM   6082 C  C     . GLN B 1 296 ? -13.999 2.224   -27.342 1.00 30.23  ? 296 GLN B C     1 
ATOM   6083 O  O     . GLN B 1 296 ? -13.978 3.287   -26.715 1.00 28.23  ? 296 GLN B O     1 
ATOM   6084 C  CB    . GLN B 1 296 ? -12.075 0.743   -26.819 1.00 34.83  ? 296 GLN B CB    1 
ATOM   6085 C  CG    . GLN B 1 296 ? -11.446 -0.080  -25.730 1.00 38.49  ? 296 GLN B CG    1 
ATOM   6086 C  CD    . GLN B 1 296 ? -9.953  -0.123  -25.893 1.00 40.96  ? 296 GLN B CD    1 
ATOM   6087 O  OE1   . GLN B 1 296 ? -9.340  0.899   -26.204 1.00 40.16  ? 296 GLN B OE1   1 
ATOM   6088 N  NE2   . GLN B 1 296 ? -9.353  -1.303  -25.712 1.00 44.04  ? 296 GLN B NE2   1 
ATOM   6089 N  N     . LEU B 1 297 ? -14.380 2.129   -28.615 1.00 30.31  ? 297 LEU B N     1 
ATOM   6090 C  CA    . LEU B 1 297 ? -14.907 3.269   -29.355 1.00 27.62  ? 297 LEU B CA    1 
ATOM   6091 C  C     . LEU B 1 297 ? -16.314 3.588   -28.904 1.00 26.74  ? 297 LEU B C     1 
ATOM   6092 O  O     . LEU B 1 297 ? -16.706 4.765   -28.893 1.00 24.53  ? 297 LEU B O     1 
ATOM   6093 C  CB    . LEU B 1 297 ? -14.892 3.007   -30.855 1.00 28.76  ? 297 LEU B CB    1 
ATOM   6094 C  CG    . LEU B 1 297 ? -13.510 2.866   -31.497 1.00 30.67  ? 297 LEU B CG    1 
ATOM   6095 C  CD1   . LEU B 1 297 ? -13.631 2.347   -32.907 1.00 34.54  ? 297 LEU B CD1   1 
ATOM   6096 C  CD2   . LEU B 1 297 ? -12.767 4.178   -31.508 1.00 30.06  ? 297 LEU B CD2   1 
ATOM   6097 N  N     . GLU B 1 298 ? -17.067 2.544   -28.542 1.00 29.09  ? 298 GLU B N     1 
ATOM   6098 C  CA    . GLU B 1 298 ? -18.393 2.716   -27.944 1.00 29.74  ? 298 GLU B CA    1 
ATOM   6099 C  C     . GLU B 1 298 ? -18.268 3.538   -26.660 1.00 27.67  ? 298 GLU B C     1 
ATOM   6100 O  O     . GLU B 1 298 ? -18.959 4.560   -26.484 1.00 25.73  ? 298 GLU B O     1 
ATOM   6101 C  CB    . GLU B 1 298 ? -19.059 1.370   -27.647 1.00 33.73  ? 298 GLU B CB    1 
ATOM   6102 C  CG    . GLU B 1 298 ? -19.941 0.817   -28.774 1.00 37.51  ? 298 GLU B CG    1 
ATOM   6103 C  CD    . GLU B 1 298 ? -20.421 -0.648  -28.512 1.00 43.77  ? 298 GLU B CD    1 
ATOM   6104 O  OE1   . GLU B 1 298 ? -21.241 -0.847  -27.568 1.00 48.00  ? 298 GLU B OE1   1 
ATOM   6105 O  OE2   . GLU B 1 298 ? -19.991 -1.587  -29.254 1.00 46.57  ? 298 GLU B OE2   1 
ATOM   6106 N  N     . ARG B 1 299 ? -17.354 3.100   -25.792 1.00 28.32  ? 299 ARG B N     1 
ATOM   6107 C  CA    . ARG B 1 299 ? -17.186 3.692   -24.476 1.00 27.53  ? 299 ARG B CA    1 
ATOM   6108 C  C     . ARG B 1 299 ? -16.704 5.108   -24.600 1.00 24.25  ? 299 ARG B C     1 
ATOM   6109 O  O     . ARG B 1 299 ? -17.288 6.013   -24.019 1.00 23.24  ? 299 ARG B O     1 
ATOM   6110 C  CB    . ARG B 1 299 ? -16.187 2.904   -23.654 1.00 30.18  ? 299 ARG B CB    1 
ATOM   6111 C  CG    . ARG B 1 299 ? -16.173 3.332   -22.222 1.00 30.68  ? 299 ARG B CG    1 
ATOM   6112 C  CD    . ARG B 1 299 ? -14.815 3.150   -21.575 1.00 30.53  ? 299 ARG B CD    1 
ATOM   6113 N  NE    . ARG B 1 299 ? -15.008 2.846   -20.170 1.00 33.67  ? 299 ARG B NE    1 
ATOM   6114 C  CZ    . ARG B 1 299 ? -15.325 3.738   -19.241 1.00 34.25  ? 299 ARG B CZ    1 
ATOM   6115 N  NH1   . ARG B 1 299 ? -15.456 5.021   -19.536 1.00 30.95  ? 299 ARG B NH1   1 
ATOM   6116 N  NH2   . ARG B 1 299 ? -15.498 3.345   -17.996 1.00 40.21  ? 299 ARG B NH2   1 
ATOM   6117 N  N     . ALA B 1 300 ? -15.631 5.284   -25.369 1.00 23.32  ? 300 ALA B N     1 
ATOM   6118 C  CA    . ALA B 1 300 ? -15.048 6.592   -25.616 1.00 21.28  ? 300 ALA B CA    1 
ATOM   6119 C  C     . ALA B 1 300 ? -16.167 7.544   -25.962 1.00 19.34  ? 300 ALA B C     1 
ATOM   6120 O  O     . ALA B 1 300 ? -16.394 8.530   -25.264 1.00 19.00  ? 300 ALA B O     1 
ATOM   6121 C  CB    . ALA B 1 300 ? -14.052 6.518   -26.735 1.00 20.81  ? 300 ALA B CB    1 
ATOM   6122 N  N     . SER B 1 301 ? -16.901 7.204   -27.010 1.00 19.14  ? 301 SER B N     1 
ATOM   6123 C  CA    . SER B 1 301 ? -17.987 8.036   -27.480 1.00 18.25  ? 301 SER B CA    1 
ATOM   6124 C  C     . SER B 1 301 ? -19.109 8.242   -26.456 1.00 18.93  ? 301 SER B C     1 
ATOM   6125 O  O     . SER B 1 301 ? -19.623 9.363   -26.315 1.00 17.95  ? 301 SER B O     1 
ATOM   6126 C  CB    . SER B 1 301 ? -18.564 7.464   -28.767 1.00 19.17  ? 301 SER B CB    1 
ATOM   6127 O  OG    . SER B 1 301 ? -19.602 8.300   -29.253 1.00 19.40  ? 301 SER B OG    1 
ATOM   6128 N  N     . ARG B 1 302 ? -19.503 7.177   -25.755 1.00 21.32  ? 302 ARG B N     1 
ATOM   6129 C  CA    . ARG B 1 302 ? -20.573 7.308   -24.769 1.00 22.82  ? 302 ARG B CA    1 
ATOM   6130 C  C     . ARG B 1 302 ? -20.204 8.387   -23.768 1.00 22.34  ? 302 ARG B C     1 
ATOM   6131 O  O     . ARG B 1 302 ? -21.005 9.287   -23.471 1.00 22.25  ? 302 ARG B O     1 
ATOM   6132 C  CB    . ARG B 1 302 ? -20.828 6.005   -24.024 1.00 26.62  ? 302 ARG B CB    1 
ATOM   6133 C  CG    . ARG B 1 302 ? -22.147 6.027   -23.259 1.00 29.70  ? 302 ARG B CG    1 
ATOM   6134 C  CD    . ARG B 1 302 ? -22.337 4.789   -22.401 1.00 35.16  ? 302 ARG B CD    1 
ATOM   6135 N  NE    . ARG B 1 302 ? -22.000 5.043   -21.004 1.00 36.31  ? 302 ARG B NE    1 
ATOM   6136 C  CZ    . ARG B 1 302 ? -20.869 4.667   -20.422 1.00 37.43  ? 302 ARG B CZ    1 
ATOM   6137 N  NH1   . ARG B 1 302 ? -19.939 4.003   -21.101 1.00 35.77  ? 302 ARG B NH1   1 
ATOM   6138 N  NH2   . ARG B 1 302 ? -20.672 4.954   -19.145 1.00 40.76  ? 302 ARG B NH2   1 
ATOM   6139 N  N     . LYS B 1 303 ? -18.967 8.288   -23.281 1.00 22.48  ? 303 LYS B N     1 
ATOM   6140 C  CA    . LYS B 1 303 ? -18.456 9.151   -22.235 1.00 22.70  ? 303 LYS B CA    1 
ATOM   6141 C  C     . LYS B 1 303 ? -18.453 10.583  -22.672 1.00 20.03  ? 303 LYS B C     1 
ATOM   6142 O  O     . LYS B 1 303 ? -18.902 11.453  -21.930 1.00 20.94  ? 303 LYS B O     1 
ATOM   6143 C  CB    . LYS B 1 303 ? -17.066 8.704   -21.802 1.00 24.01  ? 303 LYS B CB    1 
ATOM   6144 C  CG    . LYS B 1 303 ? -17.113 7.462   -20.942 1.00 27.22  ? 303 LYS B CG    1 
ATOM   6145 C  CD    . LYS B 1 303 ? -17.914 7.682   -19.671 1.00 30.15  ? 303 LYS B CD    1 
ATOM   6146 C  CE    . LYS B 1 303 ? -17.060 8.278   -18.568 1.00 32.77  ? 303 LYS B CE    1 
ATOM   6147 N  NZ    . LYS B 1 303 ? -17.761 8.241   -17.253 1.00 37.10  ? 303 LYS B NZ    1 
ATOM   6148 N  N     . ILE B 1 304 ? -17.983 10.827  -23.887 1.00 17.46  ? 304 ILE B N     1 
ATOM   6149 C  CA    . ILE B 1 304 ? -17.968 12.189  -24.399 1.00 15.82  ? 304 ILE B CA    1 
ATOM   6150 C  C     . ILE B 1 304 ? -19.387 12.703  -24.603 1.00 15.27  ? 304 ILE B C     1 
ATOM   6151 O  O     . ILE B 1 304 ? -19.654 13.857  -24.286 1.00 15.27  ? 304 ILE B O     1 
ATOM   6152 C  CB    . ILE B 1 304 ? -17.113 12.351  -25.669 1.00 14.28  ? 304 ILE B CB    1 
ATOM   6153 C  CG1   . ILE B 1 304 ? -15.656 12.088  -25.339 1.00 15.11  ? 304 ILE B CG1   1 
ATOM   6154 C  CG2   . ILE B 1 304 ? -17.236 13.768  -26.224 1.00 13.30  ? 304 ILE B CG2   1 
ATOM   6155 C  CD1   . ILE B 1 304 ? -14.822 11.820  -26.539 1.00 16.18  ? 304 ILE B CD1   1 
ATOM   6156 N  N     . PHE B 1 305 ? -20.289 11.849  -25.099 1.00 15.50  ? 305 PHE B N     1 
ATOM   6157 C  CA    . PHE B 1 305 ? -21.682 12.250  -25.293 1.00 16.08  ? 305 PHE B CA    1 
ATOM   6158 C  C     . PHE B 1 305 ? -22.319 12.679  -23.966 1.00 19.07  ? 305 PHE B C     1 
ATOM   6159 O  O     . PHE B 1 305 ? -23.028 13.696  -23.876 1.00 19.29  ? 305 PHE B O     1 
ATOM   6160 C  CB    . PHE B 1 305 ? -22.500 11.141  -25.943 1.00 16.18  ? 305 PHE B CB    1 
ATOM   6161 C  CG    . PHE B 1 305 ? -23.881 11.581  -26.369 1.00 16.15  ? 305 PHE B CG    1 
ATOM   6162 C  CD1   . PHE B 1 305 ? -24.129 11.978  -27.674 1.00 14.30  ? 305 PHE B CD1   1 
ATOM   6163 C  CD2   . PHE B 1 305 ? -24.938 11.605  -25.460 1.00 17.57  ? 305 PHE B CD2   1 
ATOM   6164 C  CE1   . PHE B 1 305 ? -25.414 12.386  -28.060 1.00 14.77  ? 305 PHE B CE1   1 
ATOM   6165 C  CE2   . PHE B 1 305 ? -26.209 12.018  -25.844 1.00 16.40  ? 305 PHE B CE2   1 
ATOM   6166 C  CZ    . PHE B 1 305 ? -26.445 12.397  -27.140 1.00 16.03  ? 305 PHE B CZ    1 
ATOM   6167 N  N     . GLU B 1 306 ? -22.042 11.904  -22.930 1.00 22.46  ? 306 GLU B N     1 
ATOM   6168 C  CA    . GLU B 1 306 ? -22.529 12.213  -21.595 1.00 26.41  ? 306 GLU B CA    1 
ATOM   6169 C  C     . GLU B 1 306 ? -21.898 13.479  -21.023 1.00 26.38  ? 306 GLU B C     1 
ATOM   6170 O  O     . GLU B 1 306 ? -22.529 14.189  -20.252 1.00 28.51  ? 306 GLU B O     1 
ATOM   6171 C  CB    . GLU B 1 306 ? -22.284 11.029  -20.673 1.00 29.85  ? 306 GLU B CB    1 
ATOM   6172 C  CG    . GLU B 1 306 ? -23.035 9.791   -21.076 1.00 32.72  ? 306 GLU B CG    1 
ATOM   6173 C  CD    . GLU B 1 306 ? -22.838 8.680   -20.080 1.00 40.58  ? 306 GLU B CD    1 
ATOM   6174 O  OE1   . GLU B 1 306 ? -21.938 8.813   -19.216 1.00 42.71  ? 306 GLU B OE1   1 
ATOM   6175 O  OE2   . GLU B 1 306 ? -23.582 7.673   -20.154 1.00 45.48  ? 306 GLU B OE2   1 
ATOM   6176 N  N     . PHE B 1 307 ? -20.653 13.750  -21.393 1.00 25.14  ? 307 PHE B N     1 
ATOM   6177 C  CA    . PHE B 1 307 ? -20.028 15.015  -21.046 1.00 26.42  ? 307 PHE B CA    1 
ATOM   6178 C  C     . PHE B 1 307 ? -20.852 16.131  -21.675 1.00 25.38  ? 307 PHE B C     1 
ATOM   6179 O  O     . PHE B 1 307 ? -21.374 17.008  -20.978 1.00 27.72  ? 307 PHE B O     1 
ATOM   6180 C  CB    . PHE B 1 307 ? -18.572 15.047  -21.524 1.00 25.66  ? 307 PHE B CB    1 
ATOM   6181 C  CG    . PHE B 1 307 ? -17.993 16.431  -21.647 1.00 26.94  ? 307 PHE B CG    1 
ATOM   6182 C  CD1   . PHE B 1 307 ? -17.515 17.106  -20.524 1.00 30.26  ? 307 PHE B CD1   1 
ATOM   6183 C  CD2   . PHE B 1 307 ? -17.910 17.058  -22.896 1.00 25.64  ? 307 PHE B CD2   1 
ATOM   6184 C  CE1   . PHE B 1 307 ? -16.968 18.394  -20.634 1.00 31.41  ? 307 PHE B CE1   1 
ATOM   6185 C  CE2   . PHE B 1 307 ? -17.361 18.355  -23.018 1.00 27.89  ? 307 PHE B CE2   1 
ATOM   6186 C  CZ    . PHE B 1 307 ? -16.892 19.023  -21.883 1.00 29.70  ? 307 PHE B CZ    1 
ATOM   6187 N  N     . LEU B 1 308 ? -20.996 16.053  -22.992 1.00 22.73  ? 308 LEU B N     1 
ATOM   6188 C  CA    . LEU B 1 308 ? -21.748 17.014  -23.764 1.00 21.87  ? 308 LEU B CA    1 
ATOM   6189 C  C     . LEU B 1 308 ? -23.096 17.353  -23.163 1.00 24.01  ? 308 LEU B C     1 
ATOM   6190 O  O     . LEU B 1 308 ? -23.408 18.543  -23.003 1.00 25.11  ? 308 LEU B O     1 
ATOM   6191 C  CB    . LEU B 1 308 ? -21.915 16.525  -25.195 1.00 19.75  ? 308 LEU B CB    1 
ATOM   6192 C  CG    . LEU B 1 308 ? -20.655 16.663  -26.053 1.00 18.32  ? 308 LEU B CG    1 
ATOM   6193 C  CD1   . LEU B 1 308 ? -20.618 15.557  -27.101 1.00 16.31  ? 308 LEU B CD1   1 
ATOM   6194 C  CD2   . LEU B 1 308 ? -20.557 18.058  -26.687 1.00 16.60  ? 308 LEU B CD2   1 
ATOM   6195 N  N     . GLU B 1 309 ? -23.893 16.335  -22.820 1.00 25.49  ? 309 GLU B N     1 
ATOM   6196 C  CA    . GLU B 1 309 ? -25.219 16.626  -22.260 1.00 28.63  ? 309 GLU B CA    1 
ATOM   6197 C  C     . GLU B 1 309 ? -25.082 17.379  -20.963 1.00 31.04  ? 309 GLU B C     1 
ATOM   6198 O  O     . GLU B 1 309 ? -25.615 18.490  -20.848 1.00 32.41  ? 309 GLU B O     1 
ATOM   6199 C  CB    . GLU B 1 309 ? -26.167 15.416  -22.157 1.00 30.33  ? 309 GLU B CB    1 
ATOM   6200 C  CG    . GLU B 1 309 ? -25.706 14.230  -21.331 1.00 33.89  ? 309 GLU B CG    1 
ATOM   6201 C  CD    . GLU B 1 309 ? -26.499 12.942  -21.634 1.00 35.81  ? 309 GLU B CD    1 
ATOM   6202 O  OE1   . GLU B 1 309 ? -26.445 11.984  -20.816 1.00 40.36  ? 309 GLU B OE1   1 
ATOM   6203 O  OE2   . GLU B 1 309 ? -27.173 12.885  -22.691 1.00 36.51  ? 309 GLU B OE2   1 
ATOM   6204 N  N     . ARG B 1 310 ? -24.308 16.834  -20.028 1.00 32.22  ? 310 ARG B N     1 
ATOM   6205 C  CA    . ARG B 1 310 ? -24.151 17.486  -18.736 1.00 35.89  ? 310 ARG B CA    1 
ATOM   6206 C  C     . ARG B 1 310 ? -23.536 18.878  -18.851 1.00 34.96  ? 310 ARG B C     1 
ATOM   6207 O  O     . ARG B 1 310 ? -23.655 19.676  -17.931 1.00 38.40  ? 310 ARG B O     1 
ATOM   6208 C  CB    . ARG B 1 310 ? -23.415 16.595  -17.723 1.00 38.56  ? 310 ARG B CB    1 
ATOM   6209 C  CG    . ARG B 1 310 ? -21.905 16.771  -17.639 1.00 38.59  ? 310 ARG B CG    1 
ATOM   6210 C  CD    . ARG B 1 310 ? -21.276 15.906  -16.533 1.00 42.20  ? 310 ARG B CD    1 
ATOM   6211 N  NE    . ARG B 1 310 ? -19.831 15.794  -16.731 1.00 43.22  ? 310 ARG B NE    1 
ATOM   6212 C  CZ    . ARG B 1 310 ? -19.237 14.865  -17.488 1.00 41.91  ? 310 ARG B CZ    1 
ATOM   6213 N  NH1   . ARG B 1 310 ? -19.967 13.944  -18.109 1.00 39.71  ? 310 ARG B NH1   1 
ATOM   6214 N  NH2   . ARG B 1 310 ? -17.907 14.851  -17.627 1.00 41.96  ? 310 ARG B NH2   1 
ATOM   6215 N  N     . GLU B 1 311 ? -22.915 19.181  -19.986 1.00 31.10  ? 311 GLU B N     1 
ATOM   6216 C  CA    . GLU B 1 311 ? -22.352 20.506  -20.193 1.00 31.74  ? 311 GLU B CA    1 
ATOM   6217 C  C     . GLU B 1 311 ? -23.281 21.483  -20.914 1.00 31.56  ? 311 GLU B C     1 
ATOM   6218 O  O     . GLU B 1 311 ? -22.893 22.626  -21.224 1.00 32.30  ? 311 GLU B O     1 
ATOM   6219 C  CB    . GLU B 1 311 ? -21.011 20.424  -20.898 1.00 29.70  ? 311 GLU B CB    1 
ATOM   6220 C  CG    . GLU B 1 311 ? -19.867 20.027  -19.993 1.00 33.12  ? 311 GLU B CG    1 
ATOM   6221 C  CD    . GLU B 1 311 ? -19.801 20.825  -18.696 1.00 39.26  ? 311 GLU B CD    1 
ATOM   6222 O  OE1   . GLU B 1 311 ? -20.854 21.063  -18.086 1.00 42.56  ? 311 GLU B OE1   1 
ATOM   6223 O  OE2   . GLU B 1 311 ? -18.691 21.186  -18.257 1.00 43.14  ? 311 GLU B OE2   1 
ATOM   6224 N  N     . ASN B 1 312 ? -24.511 21.024  -21.155 1.00 31.21  ? 312 ASN B N     1 
ATOM   6225 C  CA    . ASN B 1 312 ? -25.588 21.821  -21.777 1.00 30.85  ? 312 ASN B CA    1 
ATOM   6226 C  C     . ASN B 1 312 ? -25.390 22.192  -23.241 1.00 27.74  ? 312 ASN B C     1 
ATOM   6227 O  O     . ASN B 1 312 ? -25.823 23.261  -23.698 1.00 28.20  ? 312 ASN B O     1 
ATOM   6228 C  CB    . ASN B 1 312 ? -25.960 23.029  -20.920 1.00 34.33  ? 312 ASN B CB    1 
ATOM   6229 C  CG    . ASN B 1 312 ? -26.847 22.647  -19.782 1.00 37.56  ? 312 ASN B CG    1 
ATOM   6230 O  OD1   . ASN B 1 312 ? -26.397 22.534  -18.652 1.00 40.42  ? 312 ASN B OD1   1 
ATOM   6231 N  ND2   . ASN B 1 312 ? -28.114 22.396  -20.077 1.00 38.68  ? 312 ASN B ND2   1 
ATOM   6232 N  N     . PHE B 1 313 ? -24.761 21.278  -23.973 1.00 24.72  ? 313 PHE B N     1 
ATOM   6233 C  CA    . PHE B 1 313 ? -24.590 21.453  -25.406 1.00 22.66  ? 313 PHE B CA    1 
ATOM   6234 C  C     . PHE B 1 313 ? -25.688 20.758  -26.200 1.00 22.13  ? 313 PHE B C     1 
ATOM   6235 O  O     . PHE B 1 313 ? -25.804 20.942  -27.420 1.00 21.79  ? 313 PHE B O     1 
ATOM   6236 C  CB    . PHE B 1 313 ? -23.177 21.062  -25.841 1.00 20.67  ? 313 PHE B CB    1 
ATOM   6237 C  CG    . PHE B 1 313 ? -22.138 22.067  -25.420 1.00 21.86  ? 313 PHE B CG    1 
ATOM   6238 C  CD1   . PHE B 1 313 ? -22.123 23.351  -25.985 1.00 22.16  ? 313 PHE B CD1   1 
ATOM   6239 C  CD2   . PHE B 1 313 ? -21.202 21.754  -24.434 1.00 21.51  ? 313 PHE B CD2   1 
ATOM   6240 C  CE1   . PHE B 1 313 ? -21.182 24.293  -25.594 1.00 23.49  ? 313 PHE B CE1   1 
ATOM   6241 C  CE2   . PHE B 1 313 ? -20.259 22.694  -24.033 1.00 23.20  ? 313 PHE B CE2   1 
ATOM   6242 C  CZ    . PHE B 1 313 ? -20.245 23.962  -24.618 1.00 25.39  ? 313 PHE B CZ    1 
ATOM   6243 N  N     . MET B 1 314 ? -26.505 19.989  -25.481 1.00 22.91  ? 314 MET B N     1 
ATOM   6244 C  CA    . MET B 1 314 ? -27.649 19.289  -26.053 1.00 23.46  ? 314 MET B CA    1 
ATOM   6245 C  C     . MET B 1 314 ? -27.301 18.435  -27.282 1.00 21.01  ? 314 MET B C     1 
ATOM   6246 O  O     . MET B 1 314 ? -27.691 18.763  -28.406 1.00 21.36  ? 314 MET B O     1 
ATOM   6247 C  CB    . MET B 1 314 ? -28.766 20.278  -26.355 1.00 25.23  ? 314 MET B CB    1 
ATOM   6248 C  CG    . MET B 1 314 ? -29.605 20.569  -25.158 1.00 28.46  ? 314 MET B CG    1 
ATOM   6249 S  SD    . MET B 1 314 ? -30.828 21.800  -25.574 1.00 32.50  ? 314 MET B SD    1 
ATOM   6250 C  CE    . MET B 1 314 ? -29.977 23.319  -25.150 1.00 31.51  ? 314 MET B CE    1 
ATOM   6251 N  N     . PRO B 1 315 ? -26.578 17.325  -27.064 1.00 19.28  ? 315 PRO B N     1 
ATOM   6252 C  CA    . PRO B 1 315 ? -26.133 16.532  -28.188 1.00 17.80  ? 315 PRO B CA    1 
ATOM   6253 C  C     . PRO B 1 315 ? -27.318 15.774  -28.724 1.00 19.47  ? 315 PRO B C     1 
ATOM   6254 O  O     . PRO B 1 315 ? -28.249 15.514  -27.972 1.00 21.60  ? 315 PRO B O     1 
ATOM   6255 C  CB    . PRO B 1 315 ? -25.131 15.578  -27.560 1.00 16.70  ? 315 PRO B CB    1 
ATOM   6256 C  CG    . PRO B 1 315 ? -25.573 15.437  -26.174 1.00 18.40  ? 315 PRO B CG    1 
ATOM   6257 C  CD    . PRO B 1 315 ? -26.177 16.731  -25.780 1.00 19.74  ? 315 PRO B CD    1 
ATOM   6258 N  N     . LEU B 1 316 ? -27.305 15.474  -30.016 1.00 19.31  ? 316 LEU B N     1 
ATOM   6259 C  CA    . LEU B 1 316 ? -28.368 14.703  -30.620 1.00 21.86  ? 316 LEU B CA    1 
ATOM   6260 C  C     . LEU B 1 316 ? -28.008 13.230  -30.662 1.00 22.84  ? 316 LEU B C     1 
ATOM   6261 O  O     . LEU B 1 316 ? -28.719 12.387  -30.121 1.00 25.03  ? 316 LEU B O     1 
ATOM   6262 C  CB    . LEU B 1 316 ? -28.655 15.187  -32.038 1.00 22.77  ? 316 LEU B CB    1 
ATOM   6263 C  CG    . LEU B 1 316 ? -29.715 16.253  -32.293 1.00 23.64  ? 316 LEU B CG    1 
ATOM   6264 C  CD1   . LEU B 1 316 ? -30.421 16.651  -31.021 1.00 22.97  ? 316 LEU B CD1   1 
ATOM   6265 C  CD2   . LEU B 1 316 ? -29.122 17.446  -33.016 1.00 22.52  ? 316 LEU B CD2   1 
ATOM   6266 N  N     . ARG B 1 317 ? -26.901 12.938  -31.334 1.00 21.96  ? 317 ARG B N     1 
ATOM   6267 C  CA    . ARG B 1 317 ? -26.447 11.578  -31.576 1.00 23.40  ? 317 ARG B CA    1 
ATOM   6268 C  C     . ARG B 1 317 ? -24.935 11.552  -31.636 1.00 21.35  ? 317 ARG B C     1 
ATOM   6269 O  O     . ARG B 1 317 ? -24.280 12.600  -31.670 1.00 19.66  ? 317 ARG B O     1 
ATOM   6270 C  CB    . ARG B 1 317 ? -26.985 11.040  -32.902 1.00 26.17  ? 317 ARG B CB    1 
ATOM   6271 C  CG    . ARG B 1 317 ? -28.454 10.734  -32.912 1.00 30.70  ? 317 ARG B CG    1 
ATOM   6272 C  CD    . ARG B 1 317 ? -28.824 9.963   -34.161 1.00 35.88  ? 317 ARG B CD    1 
ATOM   6273 N  NE    . ARG B 1 317 ? -28.906 8.524   -33.926 1.00 39.37  ? 317 ARG B NE    1 
ATOM   6274 C  CZ    . ARG B 1 317 ? -29.207 7.632   -34.864 1.00 43.87  ? 317 ARG B CZ    1 
ATOM   6275 N  NH1   . ARG B 1 317 ? -29.440 8.020   -36.110 1.00 46.14  ? 317 ARG B NH1   1 
ATOM   6276 N  NH2   . ARG B 1 317 ? -29.277 6.347   -34.557 1.00 46.96  ? 317 ARG B NH2   1 
ATOM   6277 N  N     . SER B 1 318 ? -24.395 10.336  -31.654 1.00 22.56  ? 318 SER B N     1 
ATOM   6278 C  CA    . SER B 1 318 ? -22.982 10.109  -31.887 1.00 21.34  ? 318 SER B CA    1 
ATOM   6279 C  C     . SER B 1 318 ? -22.804 8.901   -32.783 1.00 23.81  ? 318 SER B C     1 
ATOM   6280 O  O     . SER B 1 318 ? -23.767 8.233   -33.145 1.00 26.35  ? 318 SER B O     1 
ATOM   6281 C  CB    . SER B 1 318 ? -22.259 9.889   -30.576 1.00 19.90  ? 318 SER B CB    1 
ATOM   6282 O  OG    . SER B 1 318 ? -22.861 8.824   -29.892 1.00 21.78  ? 318 SER B OG    1 
ATOM   6283 N  N     . ALA B 1 319 ? -21.554 8.641   -33.136 1.00 23.81  ? 319 ALA B N     1 
ATOM   6284 C  CA    . ALA B 1 319 ? -21.185 7.593   -34.070 1.00 26.70  ? 319 ALA B CA    1 
ATOM   6285 C  C     . ALA B 1 319 ? -19.672 7.536   -34.038 1.00 25.90  ? 319 ALA B C     1 
ATOM   6286 O  O     . ALA B 1 319 ? -19.041 8.387   -33.428 1.00 23.89  ? 319 ALA B O     1 
ATOM   6287 C  CB    . ALA B 1 319 ? -21.674 7.941   -35.467 1.00 29.00  ? 319 ALA B CB    1 
ATOM   6288 N  N     . PHE B 1 320 ? -19.087 6.534   -34.678 1.00 28.52  ? 320 PHE B N     1 
ATOM   6289 C  CA    . PHE B 1 320 ? -17.632 6.436   -34.770 1.00 28.29  ? 320 PHE B CA    1 
ATOM   6290 C  C     . PHE B 1 320 ? -17.209 5.684   -36.015 1.00 31.72  ? 320 PHE B C     1 
ATOM   6291 O  O     . PHE B 1 320 ? -18.014 5.011   -36.646 1.00 34.45  ? 320 PHE B O     1 
ATOM   6292 C  CB    . PHE B 1 320 ? -17.043 5.770   -33.526 1.00 27.78  ? 320 PHE B CB    1 
ATOM   6293 C  CG    . PHE B 1 320 ? -17.775 4.529   -33.093 1.00 29.90  ? 320 PHE B CG    1 
ATOM   6294 C  CD1   . PHE B 1 320 ? -17.612 3.330   -33.780 1.00 32.93  ? 320 PHE B CD1   1 
ATOM   6295 C  CD2   . PHE B 1 320 ? -18.616 4.562   -31.985 1.00 28.74  ? 320 PHE B CD2   1 
ATOM   6296 C  CE1   . PHE B 1 320 ? -18.287 2.182   -33.374 1.00 36.19  ? 320 PHE B CE1   1 
ATOM   6297 C  CE2   . PHE B 1 320 ? -19.290 3.416   -31.572 1.00 32.18  ? 320 PHE B CE2   1 
ATOM   6298 C  CZ    . PHE B 1 320 ? -19.127 2.224   -32.267 1.00 35.03  ? 320 PHE B CZ    1 
ATOM   6299 N  N     . LYS B 1 321 ? -15.935 5.801   -36.362 1.00 32.40  ? 321 LYS B N     1 
ATOM   6300 C  CA    . LYS B 1 321 ? -15.422 5.214   -37.593 1.00 36.42  ? 321 LYS B CA    1 
ATOM   6301 C  C     . LYS B 1 321 ? -13.985 4.764   -37.402 1.00 37.56  ? 321 LYS B C     1 
ATOM   6302 O  O     . LYS B 1 321 ? -13.150 5.506   -36.863 1.00 35.80  ? 321 LYS B O     1 
ATOM   6303 C  CB    . LYS B 1 321 ? -15.497 6.219   -38.741 1.00 38.08  ? 321 LYS B CB    1 
ATOM   6304 C  CG    . LYS B 1 321 ? -16.083 5.664   -40.011 1.00 42.36  ? 321 LYS B CG    1 
ATOM   6305 C  CD    . LYS B 1 321 ? -15.060 5.014   -40.915 1.00 46.65  ? 321 LYS B CD    1 
ATOM   6306 C  CE    . LYS B 1 321 ? -15.730 4.634   -42.217 1.00 52.65  ? 321 LYS B CE    1 
ATOM   6307 N  NZ    . LYS B 1 321 ? -15.077 3.475   -42.860 1.00 59.49  ? 321 LYS B NZ    1 
ATOM   6308 N  N     . ALA B 1 322 ? -13.702 3.543   -37.836 1.00 40.79  ? 322 ALA B N     1 
ATOM   6309 C  CA    . ALA B 1 322 ? -12.346 3.064   -37.801 1.00 42.75  ? 322 ALA B CA    1 
ATOM   6310 C  C     . ALA B 1 322 ? -11.826 2.916   -39.231 1.00 48.02  ? 322 ALA B C     1 
ATOM   6311 O  O     . ALA B 1 322 ? -12.441 2.236   -40.050 1.00 51.44  ? 322 ALA B O     1 
ATOM   6312 C  CB    . ALA B 1 322 ? -12.288 1.769   -37.044 1.00 43.48  ? 322 ALA B CB    1 
ATOM   6313 N  N     . SER B 1 323 ? -10.719 3.584   -39.542 1.00 49.48  ? 323 SER B N     1 
ATOM   6314 C  CA    . SER B 1 323 ? -10.124 3.484   -40.876 1.00 55.96  ? 323 SER B CA    1 
ATOM   6315 C  C     . SER B 1 323 ? -8.755  2.795   -40.835 1.00 59.55  ? 323 SER B C     1 
ATOM   6316 O  O     . SER B 1 323 ? -8.387  2.217   -39.812 1.00 57.36  ? 323 SER B O     1 
ATOM   6317 C  CB    . SER B 1 323 ? -10.077 4.859   -41.582 1.00 57.13  ? 323 SER B CB    1 
ATOM   6318 O  OG    . SER B 1 323 ? -9.135  5.756   -41.012 1.00 56.28  ? 323 SER B OG    1 
ATOM   6319 N  N     . GLU B 1 324 ? -8.025  2.835   -41.950 1.00 65.75  ? 324 GLU B N     1 
ATOM   6320 C  CA    . GLU B 1 324 ? -6.632  2.387   -41.982 1.00 70.37  ? 324 GLU B CA    1 
ATOM   6321 C  C     . GLU B 1 324 ? -5.876  2.741   -40.703 1.00 66.58  ? 324 GLU B C     1 
ATOM   6322 O  O     . GLU B 1 324 ? -5.685  1.892   -39.838 1.00 65.06  ? 324 GLU B O     1 
ATOM   6323 C  CB    . GLU B 1 324 ? -5.901  2.981   -43.192 1.00 77.30  ? 324 GLU B CB    1 
ATOM   6324 C  CG    . GLU B 1 324 ? -5.957  2.130   -44.468 1.00 85.89  ? 324 GLU B CG    1 
ATOM   6325 C  CD    . GLU B 1 324 ? -5.157  0.839   -44.350 1.00 90.75  ? 324 GLU B CD    1 
ATOM   6326 O  OE1   . GLU B 1 324 ? -5.505  -0.012  -43.497 1.00 87.47  ? 324 GLU B OE1   1 
ATOM   6327 O  OE2   . GLU B 1 324 ? -4.180  0.677   -45.112 1.00 98.06  ? 324 GLU B OE2   1 
ATOM   6328 N  N     . GLU B 1 325 ? -5.480  4.004   -40.577 1.00 65.80  ? 325 GLU B N     1 
ATOM   6329 C  CA    . GLU B 1 325 ? -4.655  4.459   -39.454 1.00 63.81  ? 325 GLU B CA    1 
ATOM   6330 C  C     . GLU B 1 325 ? -5.360  5.374   -38.442 1.00 56.71  ? 325 GLU B C     1 
ATOM   6331 O  O     . GLU B 1 325 ? -4.766  5.762   -37.435 1.00 55.16  ? 325 GLU B O     1 
ATOM   6332 C  CB    . GLU B 1 325 ? -3.364  5.121   -39.971 1.00 69.99  ? 325 GLU B CB    1 
ATOM   6333 C  CG    . GLU B 1 325 ? -3.566  6.226   -41.035 1.00 73.51  ? 325 GLU B CG    1 
ATOM   6334 C  CD    . GLU B 1 325 ? -2.266  6.936   -41.441 1.00 79.85  ? 325 GLU B CD    1 
ATOM   6335 O  OE1   . GLU B 1 325 ? -2.256  7.586   -42.509 1.00 84.92  ? 325 GLU B OE1   1 
ATOM   6336 O  OE2   . GLU B 1 325 ? -1.257  6.851   -40.701 1.00 82.00  ? 325 GLU B OE2   1 
ATOM   6337 N  N     . PHE B 1 326 ? -6.624  5.692   -38.693 1.00 52.93  ? 326 PHE B N     1 
ATOM   6338 C  CA    . PHE B 1 326 ? -7.329  6.658   -37.863 1.00 47.40  ? 326 PHE B CA    1 
ATOM   6339 C  C     . PHE B 1 326 ? -8.662  6.192   -37.288 1.00 42.78  ? 326 PHE B C     1 
ATOM   6340 O  O     . PHE B 1 326 ? -9.312  5.304   -37.837 1.00 44.11  ? 326 PHE B O     1 
ATOM   6341 C  CB    . PHE B 1 326 ? -7.512  7.967   -38.638 1.00 48.43  ? 326 PHE B CB    1 
ATOM   6342 C  CG    . PHE B 1 326 ? -6.253  8.750   -38.769 1.00 52.02  ? 326 PHE B CG    1 
ATOM   6343 C  CD1   . PHE B 1 326 ? -5.574  8.791   -39.969 1.00 58.60  ? 326 PHE B CD1   1 
ATOM   6344 C  CD2   . PHE B 1 326 ? -5.717  9.411   -37.673 1.00 49.78  ? 326 PHE B CD2   1 
ATOM   6345 C  CE1   . PHE B 1 326 ? -4.391  9.502   -40.085 1.00 63.25  ? 326 PHE B CE1   1 
ATOM   6346 C  CE2   . PHE B 1 326 ? -4.539  10.120  -37.780 1.00 54.35  ? 326 PHE B CE2   1 
ATOM   6347 C  CZ    . PHE B 1 326 ? -3.875  10.170  -38.987 1.00 61.28  ? 326 PHE B CZ    1 
ATOM   6348 N  N     . CYS B 1 327 ? -9.050  6.797   -36.168 1.00 38.42  ? 327 CYS B N     1 
ATOM   6349 C  CA    . CYS B 1 327 ? -10.373 6.612   -35.585 1.00 34.35  ? 327 CYS B CA    1 
ATOM   6350 C  C     . CYS B 1 327 ? -11.054 7.954   -35.427 1.00 31.45  ? 327 CYS B C     1 
ATOM   6351 O  O     . CYS B 1 327 ? -10.398 8.982   -35.188 1.00 31.55  ? 327 CYS B O     1 
ATOM   6352 C  CB    . CYS B 1 327 ? -10.292 5.913   -34.235 1.00 32.41  ? 327 CYS B CB    1 
ATOM   6353 S  SG    . CYS B 1 327 ? -10.028 4.133   -34.364 1.00 37.59  ? 327 CYS B SG    1 
ATOM   6354 N  N     . TYR B 1 328 ? -12.376 7.929   -35.557 1.00 29.35  ? 328 TYR B N     1 
ATOM   6355 C  CA    . TYR B 1 328 ? -13.185 9.130   -35.562 1.00 27.12  ? 328 TYR B CA    1 
ATOM   6356 C  C     . TYR B 1 328 ? -14.359 8.988   -34.609 1.00 24.00  ? 328 TYR B C     1 
ATOM   6357 O  O     . TYR B 1 328 ? -15.201 8.116   -34.788 1.00 24.40  ? 328 TYR B O     1 
ATOM   6358 C  CB    . TYR B 1 328 ? -13.712 9.395   -36.972 1.00 29.37  ? 328 TYR B CB    1 
ATOM   6359 C  CG    . TYR B 1 328 ? -12.649 9.581   -38.033 1.00 33.71  ? 328 TYR B CG    1 
ATOM   6360 C  CD1   . TYR B 1 328 ? -12.162 8.489   -38.760 1.00 37.79  ? 328 TYR B CD1   1 
ATOM   6361 C  CD2   . TYR B 1 328 ? -12.142 10.850  -38.330 1.00 34.40  ? 328 TYR B CD2   1 
ATOM   6362 C  CE1   . TYR B 1 328 ? -11.182 8.654   -39.752 1.00 42.88  ? 328 TYR B CE1   1 
ATOM   6363 C  CE2   . TYR B 1 328 ? -11.168 11.029  -39.315 1.00 39.89  ? 328 TYR B CE2   1 
ATOM   6364 C  CZ    . TYR B 1 328 ? -10.692 9.928   -40.027 1.00 44.36  ? 328 TYR B CZ    1 
ATOM   6365 O  OH    . TYR B 1 328 ? -9.734  10.093  -41.008 1.00 50.04  ? 328 TYR B OH    1 
ATOM   6366 N  N     . LEU B 1 329 ? -14.422 9.836   -33.591 1.00 21.78  ? 329 LEU B N     1 
ATOM   6367 C  CA    . LEU B 1 329 ? -15.632 9.908   -32.784 1.00 19.64  ? 329 LEU B CA    1 
ATOM   6368 C  C     . LEU B 1 329 ? -16.452 11.130  -33.223 1.00 19.53  ? 329 LEU B C     1 
ATOM   6369 O  O     . LEU B 1 329 ? -16.012 12.277  -33.071 1.00 19.81  ? 329 LEU B O     1 
ATOM   6370 C  CB    . LEU B 1 329 ? -15.307 9.935   -31.288 1.00 17.85  ? 329 LEU B CB    1 
ATOM   6371 C  CG    . LEU B 1 329 ? -14.357 8.874   -30.724 1.00 18.47  ? 329 LEU B CG    1 
ATOM   6372 C  CD1   . LEU B 1 329 ? -13.910 9.246   -29.314 1.00 15.78  ? 329 LEU B CD1   1 
ATOM   6373 C  CD2   . LEU B 1 329 ? -14.968 7.452   -30.768 1.00 18.90  ? 329 LEU B CD2   1 
ATOM   6374 N  N     . LEU B 1 330 ? -17.630 10.865  -33.786 1.00 20.18  ? 330 LEU B N     1 
ATOM   6375 C  CA    . LEU B 1 330 ? -18.514 11.895  -34.331 1.00 20.57  ? 330 LEU B CA    1 
ATOM   6376 C  C     . LEU B 1 330 ? -19.616 12.283  -33.373 1.00 19.12  ? 330 LEU B C     1 
ATOM   6377 O  O     . LEU B 1 330 ? -20.176 11.436  -32.663 1.00 18.93  ? 330 LEU B O     1 
ATOM   6378 C  CB    . LEU B 1 330 ? -19.168 11.402  -35.607 1.00 23.07  ? 330 LEU B CB    1 
ATOM   6379 C  CG    . LEU B 1 330 ? -18.147 10.891  -36.599 1.00 26.52  ? 330 LEU B CG    1 
ATOM   6380 C  CD1   . LEU B 1 330 ? -18.638 9.578   -37.197 1.00 29.93  ? 330 LEU B CD1   1 
ATOM   6381 C  CD2   . LEU B 1 330 ? -17.879 11.953  -37.647 1.00 29.08  ? 330 LEU B CD2   1 
ATOM   6382 N  N     . PHE B 1 331 ? -19.934 13.575  -33.374 1.00 18.96  ? 331 PHE B N     1 
ATOM   6383 C  CA    . PHE B 1 331 ? -21.014 14.114  -32.555 1.00 17.97  ? 331 PHE B CA    1 
ATOM   6384 C  C     . PHE B 1 331 ? -21.768 15.205  -33.298 1.00 19.10  ? 331 PHE B C     1 
ATOM   6385 O  O     . PHE B 1 331 ? -21.192 15.911  -34.143 1.00 20.19  ? 331 PHE B O     1 
ATOM   6386 C  CB    . PHE B 1 331 ? -20.458 14.659  -31.236 1.00 16.40  ? 331 PHE B CB    1 
ATOM   6387 C  CG    . PHE B 1 331 ? -19.694 13.640  -30.446 1.00 16.36  ? 331 PHE B CG    1 
ATOM   6388 C  CD1   . PHE B 1 331 ? -20.356 12.798  -29.547 1.00 16.09  ? 331 PHE B CD1   1 
ATOM   6389 C  CD2   . PHE B 1 331 ? -18.314 13.488  -30.628 1.00 16.35  ? 331 PHE B CD2   1 
ATOM   6390 C  CE1   . PHE B 1 331 ? -19.654 11.846  -28.817 1.00 15.87  ? 331 PHE B CE1   1 
ATOM   6391 C  CE2   . PHE B 1 331 ? -17.605 12.530  -29.916 1.00 16.04  ? 331 PHE B CE2   1 
ATOM   6392 C  CZ    . PHE B 1 331 ? -18.274 11.707  -29.008 1.00 16.28  ? 331 PHE B CZ    1 
ATOM   6393 N  N     . GLU B 1 332 ? -23.058 15.325  -32.982 1.00 19.30  ? 332 GLU B N     1 
ATOM   6394 C  CA    . GLU B 1 332 ? -23.849 16.478  -33.398 1.00 20.24  ? 332 GLU B CA    1 
ATOM   6395 C  C     . GLU B 1 332 ? -24.595 17.119  -32.231 1.00 19.09  ? 332 GLU B C     1 
ATOM   6396 O  O     . GLU B 1 332 ? -25.238 16.427  -31.438 1.00 18.65  ? 332 GLU B O     1 
ATOM   6397 C  CB    . GLU B 1 332 ? -24.827 16.094  -34.491 1.00 23.18  ? 332 GLU B CB    1 
ATOM   6398 C  CG    . GLU B 1 332 ? -25.550 17.295  -35.080 1.00 25.24  ? 332 GLU B CG    1 
ATOM   6399 C  CD    . GLU B 1 332 ? -26.702 16.872  -35.926 1.00 28.74  ? 332 GLU B CD    1 
ATOM   6400 O  OE1   . GLU B 1 332 ? -27.048 15.668  -35.869 1.00 30.77  ? 332 GLU B OE1   1 
ATOM   6401 O  OE2   . GLU B 1 332 ? -27.255 17.725  -36.648 1.00 30.38  ? 332 GLU B OE2   1 
ATOM   6402 N  N     . CYS B 1 333 ? -24.511 18.446  -32.152 1.00 19.05  ? 333 CYS B N     1 
ATOM   6403 C  CA    . CYS B 1 333 ? -25.023 19.191  -30.998 1.00 18.91  ? 333 CYS B CA    1 
ATOM   6404 C  C     . CYS B 1 333 ? -25.937 20.328  -31.365 1.00 20.25  ? 333 CYS B C     1 
ATOM   6405 O  O     . CYS B 1 333 ? -25.682 21.074  -32.308 1.00 21.76  ? 333 CYS B O     1 
ATOM   6406 C  CB    . CYS B 1 333 ? -23.878 19.730  -30.155 1.00 17.88  ? 333 CYS B CB    1 
ATOM   6407 S  SG    . CYS B 1 333 ? -23.122 18.412  -29.221 1.00 19.00  ? 333 CYS B SG    1 
ATOM   6408 N  N     . GLN B 1 334 ? -27.006 20.460  -30.600 1.00 20.39  ? 334 GLN B N     1 
ATOM   6409 C  CA    . GLN B 1 334 ? -27.974 21.490  -30.864 1.00 22.10  ? 334 GLN B CA    1 
ATOM   6410 C  C     . GLN B 1 334 ? -27.360 22.864  -30.626 1.00 22.07  ? 334 GLN B C     1 
ATOM   6411 O  O     . GLN B 1 334 ? -27.712 23.819  -31.317 1.00 24.40  ? 334 GLN B O     1 
ATOM   6412 C  CB    . GLN B 1 334 ? -29.228 21.274  -30.018 1.00 23.59  ? 334 GLN B CB    1 
ATOM   6413 C  CG    . GLN B 1 334 ? -30.018 20.027  -30.392 1.00 24.57  ? 334 GLN B CG    1 
ATOM   6414 C  CD    . GLN B 1 334 ? -31.414 19.990  -29.782 1.00 28.38  ? 334 GLN B CD    1 
ATOM   6415 O  OE1   . GLN B 1 334 ? -31.896 18.935  -29.372 1.00 32.14  ? 334 GLN B OE1   1 
ATOM   6416 N  NE2   . GLN B 1 334 ? -32.071 21.140  -29.721 1.00 31.61  ? 334 GLN B NE2   1 
ATOM   6417 N  N     . ILE B 1 335 ? -26.419 22.948  -29.681 1.00 19.96  ? 335 ILE B N     1 
ATOM   6418 C  CA    . ILE B 1 335 ? -25.813 24.228  -29.292 1.00 20.51  ? 335 ILE B CA    1 
ATOM   6419 C  C     . ILE B 1 335 ? -24.410 24.405  -29.867 1.00 19.98  ? 335 ILE B C     1 
ATOM   6420 O  O     . ILE B 1 335 ? -23.508 23.628  -29.548 1.00 18.71  ? 335 ILE B O     1 
ATOM   6421 C  CB    . ILE B 1 335 ? -25.718 24.392  -27.754 1.00 20.82  ? 335 ILE B CB    1 
ATOM   6422 C  CG1   . ILE B 1 335 ? -27.076 24.189  -27.069 1.00 21.66  ? 335 ILE B CG1   1 
ATOM   6423 C  CG2   . ILE B 1 335 ? -25.104 25.737  -27.399 1.00 22.62  ? 335 ILE B CG2   1 
ATOM   6424 C  CD1   . ILE B 1 335 ? -28.185 25.038  -27.618 1.00 24.29  ? 335 ILE B CD1   1 
ATOM   6425 N  N     . LYS B 1 336 ? -24.227 25.437  -30.693 1.00 21.50  ? 336 LYS B N     1 
ATOM   6426 C  CA    . LYS B 1 336 ? -22.930 25.719  -31.309 1.00 21.58  ? 336 LYS B CA    1 
ATOM   6427 C  C     . LYS B 1 336 ? -22.074 26.552  -30.398 1.00 22.64  ? 336 LYS B C     1 
ATOM   6428 O  O     . LYS B 1 336 ? -20.849 26.494  -30.459 1.00 23.66  ? 336 LYS B O     1 
ATOM   6429 C  CB    . LYS B 1 336 ? -23.100 26.411  -32.653 1.00 24.29  ? 336 LYS B CB    1 
ATOM   6430 C  CG    . LYS B 1 336 ? -23.767 25.505  -33.661 1.00 24.35  ? 336 LYS B CG    1 
ATOM   6431 C  CD    . LYS B 1 336 ? -23.459 25.863  -35.068 1.00 28.15  ? 336 LYS B CD    1 
ATOM   6432 C  CE    . LYS B 1 336 ? -24.500 26.803  -35.604 1.00 33.99  ? 336 LYS B CE    1 
ATOM   6433 N  NZ    . LYS B 1 336 ? -24.252 26.993  -37.065 1.00 41.11  ? 336 LYS B NZ    1 
ATOM   6434 N  N     . GLU B 1 337 ? -22.733 27.306  -29.532 1.00 23.15  ? 337 GLU B N     1 
ATOM   6435 C  CA    . GLU B 1 337 ? -22.057 28.217  -28.645 1.00 25.17  ? 337 GLU B CA    1 
ATOM   6436 C  C     . GLU B 1 337 ? -22.987 28.597  -27.504 1.00 25.63  ? 337 GLU B C     1 
ATOM   6437 O  O     . GLU B 1 337 ? -24.125 29.014  -27.725 1.00 26.67  ? 337 GLU B O     1 
ATOM   6438 C  CB    . GLU B 1 337 ? -21.654 29.441  -29.428 1.00 29.25  ? 337 GLU B CB    1 
ATOM   6439 C  CG    . GLU B 1 337 ? -21.223 30.594  -28.609 1.00 34.38  ? 337 GLU B CG    1 
ATOM   6440 C  CD    . GLU B 1 337 ? -20.659 31.679  -29.475 1.00 41.02  ? 337 GLU B CD    1 
ATOM   6441 O  OE1   . GLU B 1 337 ? -21.392 32.197  -30.351 1.00 43.15  ? 337 GLU B OE1   1 
ATOM   6442 O  OE2   . GLU B 1 337 ? -19.468 32.000  -29.286 1.00 45.02  ? 337 GLU B OE2   1 
ATOM   6443 N  N     . ILE B 1 338 ? -22.491 28.444  -26.284 1.00 25.34  ? 338 ILE B N     1 
ATOM   6444 C  CA    . ILE B 1 338 ? -23.237 28.768  -25.083 1.00 26.59  ? 338 ILE B CA    1 
ATOM   6445 C  C     . ILE B 1 338 ? -22.593 29.981  -24.396 1.00 31.31  ? 338 ILE B C     1 
ATOM   6446 O  O     . ILE B 1 338 ? -21.391 30.228  -24.544 1.00 32.93  ? 338 ILE B O     1 
ATOM   6447 C  CB    . ILE B 1 338 ? -23.305 27.529  -24.137 1.00 24.60  ? 338 ILE B CB    1 
ATOM   6448 C  CG1   . ILE B 1 338 ? -24.304 27.748  -23.000 1.00 26.59  ? 338 ILE B CG1   1 
ATOM   6449 C  CG2   . ILE B 1 338 ? -21.909 27.120  -23.617 1.00 24.26  ? 338 ILE B CG2   1 
ATOM   6450 C  CD1   . ILE B 1 338 ? -24.764 26.475  -22.376 1.00 24.82  ? 338 ILE B CD1   1 
ATOM   6451 N  N     . SER B 1 339 ? -23.386 30.743  -23.652 1.00 34.06  ? 339 SER B N     1 
ATOM   6452 C  CA    . SER B 1 339 ? -22.868 31.926  -22.990 1.00 39.02  ? 339 SER B CA    1 
ATOM   6453 C  C     . SER B 1 339 ? -21.764 31.547  -22.015 1.00 40.41  ? 339 SER B C     1 
ATOM   6454 O  O     . SER B 1 339 ? -21.618 30.373  -21.637 1.00 36.62  ? 339 SER B O     1 
ATOM   6455 C  CB    . SER B 1 339 ? -23.977 32.664  -22.262 1.00 42.32  ? 339 SER B CB    1 
ATOM   6456 O  OG    . SER B 1 339 ? -24.466 31.893  -21.183 1.00 42.40  ? 339 SER B OG    1 
ATOM   6457 N  N     . ARG B 1 340 ? -20.993 32.560  -21.618 1.00 29.80  ? 340 ARG B N     1 
ATOM   6458 C  CA    . ARG B 1 340 ? -19.829 32.369  -20.775 1.00 31.08  ? 340 ARG B CA    1 
ATOM   6459 C  C     . ARG B 1 340 ? -20.246 32.293  -19.325 1.00 27.98  ? 340 ARG B C     1 
ATOM   6460 O  O     . ARG B 1 340 ? -19.687 31.514  -18.570 1.00 29.23  ? 340 ARG B O     1 
ATOM   6461 C  CB    . ARG B 1 340 ? -18.821 33.486  -21.003 1.00 33.50  ? 340 ARG B CB    1 
ATOM   6462 C  CG    . ARG B 1 340 ? -17.577 33.387  -20.129 1.00 38.10  ? 340 ARG B CG    1 
ATOM   6463 C  CD    . ARG B 1 340 ? -16.299 33.474  -20.951 1.00 44.46  ? 340 ARG B CD    1 
ATOM   6464 N  NE    . ARG B 1 340 ? -15.774 32.150  -21.268 1.00 48.66  ? 340 ARG B NE    1 
ATOM   6465 C  CZ    . ARG B 1 340 ? -14.957 31.889  -22.284 1.00 55.32  ? 340 ARG B CZ    1 
ATOM   6466 N  NH1   . ARG B 1 340 ? -14.587 32.859  -23.114 1.00 57.35  ? 340 ARG B NH1   1 
ATOM   6467 N  NH2   . ARG B 1 340 ? -14.521 30.648  -22.484 1.00 59.66  ? 340 ARG B NH2   1 
ATOM   6468 N  N     . VAL B 1 341 ? -21.243 33.090  -18.947 1.00 24.62  ? 341 VAL B N     1 
ATOM   6469 C  CA    . VAL B 1 341 ? -21.798 33.051  -17.590 1.00 21.83  ? 341 VAL B CA    1 
ATOM   6470 C  C     . VAL B 1 341 ? -22.857 31.950  -17.439 1.00 20.95  ? 341 VAL B C     1 
ATOM   6471 O  O     . VAL B 1 341 ? -23.646 31.706  -18.361 1.00 21.01  ? 341 VAL B O     1 
ATOM   6472 C  CB    . VAL B 1 341 ? -22.344 34.441  -17.128 1.00 19.30  ? 341 VAL B CB    1 
ATOM   6473 C  CG1   . VAL B 1 341 ? -23.638 34.786  -17.796 1.00 17.91  ? 341 VAL B CG1   1 
ATOM   6474 C  CG2   . VAL B 1 341 ? -22.569 34.439  -15.674 1.00 18.08  ? 341 VAL B CG2   1 
ATOM   6475 N  N     . PHE B 1 342 ? -22.834 31.272  -16.291 1.00 20.78  ? 342 PHE B N     1 
ATOM   6476 C  CA    . PHE B 1 342 ? -23.878 30.321  -15.919 1.00 20.92  ? 342 PHE B CA    1 
ATOM   6477 C  C     . PHE B 1 342 ? -24.289 30.485  -14.446 1.00 19.92  ? 342 PHE B C     1 
ATOM   6478 O  O     . PHE B 1 342 ? -23.760 31.353  -13.756 1.00 19.27  ? 342 PHE B O     1 
ATOM   6479 C  CB    . PHE B 1 342 ? -23.451 28.888  -16.238 1.00 23.76  ? 342 PHE B CB    1 
ATOM   6480 C  CG    . PHE B 1 342 ? -22.366 28.367  -15.366 1.00 25.24  ? 342 PHE B CG    1 
ATOM   6481 C  CD1   . PHE B 1 342 ? -22.659 27.783  -14.140 1.00 24.38  ? 342 PHE B CD1   1 
ATOM   6482 C  CD2   . PHE B 1 342 ? -21.042 28.430  -15.779 1.00 27.73  ? 342 PHE B CD2   1 
ATOM   6483 C  CE1   . PHE B 1 342 ? -21.649 27.298  -13.336 1.00 27.35  ? 342 PHE B CE1   1 
ATOM   6484 C  CE2   . PHE B 1 342 ? -20.018 27.942  -14.976 1.00 29.63  ? 342 PHE B CE2   1 
ATOM   6485 C  CZ    . PHE B 1 342 ? -20.324 27.374  -13.757 1.00 30.33  ? 342 PHE B CZ    1 
ATOM   6486 N  N     . ARG B 1 343 ? -25.236 29.674  -13.971 1.00 20.92  ? 343 ARG B N     1 
ATOM   6487 C  CA    . ARG B 1 343 ? -25.703 29.775  -12.586 1.00 20.28  ? 343 ARG B CA    1 
ATOM   6488 C  C     . ARG B 1 343 ? -25.190 28.607  -11.755 1.00 23.76  ? 343 ARG B C     1 
ATOM   6489 O  O     . ARG B 1 343 ? -25.312 27.444  -12.167 1.00 27.31  ? 343 ARG B O     1 
ATOM   6490 C  CB    . ARG B 1 343 ? -27.232 29.769  -12.514 1.00 19.61  ? 343 ARG B CB    1 
ATOM   6491 C  CG    . ARG B 1 343 ? -27.965 30.865  -13.265 1.00 17.66  ? 343 ARG B CG    1 
ATOM   6492 C  CD    . ARG B 1 343 ? -29.438 30.477  -13.512 1.00 20.06  ? 343 ARG B CD    1 
ATOM   6493 N  NE    . ARG B 1 343 ? -30.181 30.217  -12.272 1.00 21.53  ? 343 ARG B NE    1 
ATOM   6494 C  CZ    . ARG B 1 343 ? -31.044 31.056  -11.689 1.00 20.72  ? 343 ARG B CZ    1 
ATOM   6495 N  NH1   . ARG B 1 343 ? -31.325 32.249  -12.218 1.00 18.71  ? 343 ARG B NH1   1 
ATOM   6496 N  NH2   . ARG B 1 343 ? -31.640 30.692  -10.561 1.00 20.52  ? 343 ARG B NH2   1 
ATOM   6497 N  N     . ARG B 1 344 ? -24.623 28.911  -10.588 1.00 23.88  ? 344 ARG B N     1 
ATOM   6498 C  CA    . ARG B 1 344 ? -24.318 27.886  -9.594  1.00 27.22  ? 344 ARG B CA    1 
ATOM   6499 C  C     . ARG B 1 344 ? -25.295 28.041  -8.442  1.00 26.06  ? 344 ARG B C     1 
ATOM   6500 O  O     . ARG B 1 344 ? -25.625 29.163  -8.028  1.00 23.36  ? 344 ARG B O     1 
ATOM   6501 C  CB    . ARG B 1 344 ? -22.892 28.017  -9.091  1.00 29.41  ? 344 ARG B CB    1 
ATOM   6502 C  CG    . ARG B 1 344 ? -22.412 26.846  -8.234  1.00 36.17  ? 344 ARG B CG    1 
ATOM   6503 C  CD    . ARG B 1 344 ? -20.892 26.790  -8.153  1.00 42.70  ? 344 ARG B CD    1 
ATOM   6504 N  NE    . ARG B 1 344 ? -20.298 26.798  -9.489  1.00 46.60  ? 344 ARG B NE    1 
ATOM   6505 C  CZ    . ARG B 1 344 ? -19.036 27.128  -9.755  1.00 51.66  ? 344 ARG B CZ    1 
ATOM   6506 N  NH1   . ARG B 1 344 ? -18.210 27.479  -8.772  1.00 55.78  ? 344 ARG B NH1   1 
ATOM   6507 N  NH2   . ARG B 1 344 ? -18.594 27.107  -11.008 1.00 52.45  ? 344 ARG B NH2   1 
ATOM   6508 N  N     . MET B 1 345 ? -25.776 26.918  -7.927  1.00 28.89  ? 345 MET B N     1 
ATOM   6509 C  CA    . MET B 1 345 ? -26.765 26.957  -6.867  1.00 28.33  ? 345 MET B CA    1 
ATOM   6510 C  C     . MET B 1 345 ? -26.092 27.155  -5.519  1.00 28.96  ? 345 MET B C     1 
ATOM   6511 O  O     . MET B 1 345 ? -25.125 26.467  -5.202  1.00 32.73  ? 345 MET B O     1 
ATOM   6512 C  CB    . MET B 1 345 ? -27.573 25.676  -6.883  1.00 32.11  ? 345 MET B CB    1 
ATOM   6513 C  CG    . MET B 1 345 ? -28.674 25.623  -5.870  1.00 32.89  ? 345 MET B CG    1 
ATOM   6514 S  SD    . MET B 1 345 ? -29.289 23.950  -5.878  1.00 40.01  ? 345 MET B SD    1 
ATOM   6515 C  CE    . MET B 1 345 ? -28.009 23.073  -4.966  1.00 44.73  ? 345 MET B CE    1 
ATOM   6516 N  N     . GLY B 1 346 ? -26.591 28.107  -4.736  1.00 26.15  ? 346 GLY B N     1 
ATOM   6517 C  CA    . GLY B 1 346 ? -26.071 28.333  -3.386  1.00 26.95  ? 346 GLY B CA    1 
ATOM   6518 C  C     . GLY B 1 346 ? -26.899 27.621  -2.329  1.00 29.23  ? 346 GLY B C     1 
ATOM   6519 O  O     . GLY B 1 346 ? -27.737 26.788  -2.671  1.00 31.82  ? 346 GLY B O     1 
ATOM   6520 N  N     . PRO B 1 347 ? -26.662 27.925  -1.038  1.00 29.48  ? 347 PRO B N     1 
ATOM   6521 C  CA    . PRO B 1 347 ? -27.499 27.359  0.009   1.00 31.71  ? 347 PRO B CA    1 
ATOM   6522 C  C     . PRO B 1 347 ? -28.632 28.313  0.449   1.00 28.80  ? 347 PRO B C     1 
ATOM   6523 O  O     . PRO B 1 347 ? -28.547 29.532  0.223   1.00 24.75  ? 347 PRO B O     1 
ATOM   6524 C  CB    . PRO B 1 347 ? -26.510 27.177  1.149   1.00 34.95  ? 347 PRO B CB    1 
ATOM   6525 C  CG    . PRO B 1 347 ? -25.501 28.329  0.955   1.00 31.90  ? 347 PRO B CG    1 
ATOM   6526 C  CD    . PRO B 1 347 ? -25.591 28.774  -0.478  1.00 28.58  ? 347 PRO B CD    1 
ATOM   6527 N  N     . GLN B 1 348 ? -29.664 27.750  1.089   1.00 30.93  ? 348 GLN B N     1 
ATOM   6528 C  CA    . GLN B 1 348 ? -30.774 28.523  1.642   1.00 29.15  ? 348 GLN B CA    1 
ATOM   6529 C  C     . GLN B 1 348 ? -30.258 29.577  2.614   1.00 26.86  ? 348 GLN B C     1 
ATOM   6530 O  O     . GLN B 1 348 ? -29.418 29.271  3.452   1.00 28.85  ? 348 GLN B O     1 
ATOM   6531 C  CB    . GLN B 1 348 ? -31.728 27.598  2.376   1.00 33.51  ? 348 GLN B CB    1 
ATOM   6532 C  CG    . GLN B 1 348 ? -32.356 26.509  1.520   1.00 37.46  ? 348 GLN B CG    1 
ATOM   6533 C  CD    . GLN B 1 348 ? -33.101 25.452  2.359   1.00 44.40  ? 348 GLN B CD    1 
ATOM   6534 O  OE1   . GLN B 1 348 ? -33.727 25.761  3.393   1.00 47.20  ? 348 GLN B OE1   1 
ATOM   6535 N  NE2   . GLN B 1 348 ? -33.032 24.200  1.916   1.00 49.79  ? 348 GLN B NE2   1 
ATOM   6536 N  N     . PHE B 1 349 ? -30.769 30.806  2.514   1.00 23.25  ? 349 PHE B N     1 
ATOM   6537 C  CA    . PHE B 1 349 ? -30.344 31.910  3.392   1.00 21.49  ? 349 PHE B CA    1 
ATOM   6538 C  C     . PHE B 1 349 ? -30.165 31.583  4.888   1.00 24.65  ? 349 PHE B C     1 
ATOM   6539 O  O     . PHE B 1 349 ? -29.292 32.148  5.544   1.00 24.49  ? 349 PHE B O     1 
ATOM   6540 C  CB    . PHE B 1 349 ? -31.277 33.111  3.237   1.00 19.25  ? 349 PHE B CB    1 
ATOM   6541 C  CG    . PHE B 1 349 ? -32.647 32.942  3.886   1.00 21.47  ? 349 PHE B CG    1 
ATOM   6542 C  CD1   . PHE B 1 349 ? -32.896 33.446  5.162   1.00 20.88  ? 349 PHE B CD1   1 
ATOM   6543 C  CD2   . PHE B 1 349 ? -33.697 32.322  3.201   1.00 23.11  ? 349 PHE B CD2   1 
ATOM   6544 C  CE1   . PHE B 1 349 ? -34.139 33.317  5.753   1.00 22.29  ? 349 PHE B CE1   1 
ATOM   6545 C  CE2   . PHE B 1 349 ? -34.958 32.195  3.791   1.00 25.23  ? 349 PHE B CE2   1 
ATOM   6546 C  CZ    . PHE B 1 349 ? -35.167 32.696  5.071   1.00 26.15  ? 349 PHE B CZ    1 
ATOM   6547 N  N     . GLU B 1 350 ? -30.988 30.677  5.417   1.00 27.95  ? 350 GLU B N     1 
ATOM   6548 C  CA    . GLU B 1 350 ? -30.967 30.349  6.842   1.00 31.76  ? 350 GLU B CA    1 
ATOM   6549 C  C     . GLU B 1 350 ? -29.593 29.854  7.280   1.00 34.26  ? 350 GLU B C     1 
ATOM   6550 O  O     . GLU B 1 350 ? -29.120 30.204  8.368   1.00 36.47  ? 350 GLU B O     1 
ATOM   6551 C  CB    . GLU B 1 350 ? -32.030 29.300  7.196   1.00 35.87  ? 350 GLU B CB    1 
ATOM   6552 C  CG    . GLU B 1 350 ? -33.462 29.784  7.092   1.00 36.05  ? 350 GLU B CG    1 
ATOM   6553 C  CD    . GLU B 1 350 ? -34.112 29.507  5.732   1.00 36.49  ? 350 GLU B CD    1 
ATOM   6554 O  OE1   . GLU B 1 350 ? -35.334 29.255  5.715   1.00 40.48  ? 350 GLU B OE1   1 
ATOM   6555 O  OE2   . GLU B 1 350 ? -33.429 29.536  4.682   1.00 32.93  ? 350 GLU B OE2   1 
ATOM   6556 N  N     . ASP B 1 351 ? -28.958 29.044  6.430   1.00 34.79  ? 351 ASP B N     1 
ATOM   6557 C  CA    . ASP B 1 351 ? -27.666 28.449  6.738   1.00 37.78  ? 351 ASP B CA    1 
ATOM   6558 C  C     . ASP B 1 351 ? -26.506 29.454  6.699   1.00 35.84  ? 351 ASP B C     1 
ATOM   6559 O  O     . ASP B 1 351 ? -25.768 29.536  5.722   1.00 34.27  ? 351 ASP B O     1 
ATOM   6560 C  CB    . ASP B 1 351 ? -27.396 27.268  5.816   1.00 39.67  ? 351 ASP B CB    1 
ATOM   6561 C  CG    . ASP B 1 351 ? -26.220 26.454  6.271   1.00 46.18  ? 351 ASP B CG    1 
ATOM   6562 O  OD1   . ASP B 1 351 ? -25.543 25.864  5.415   1.00 48.22  ? 351 ASP B OD1   1 
ATOM   6563 O  OD2   . ASP B 1 351 ? -25.956 26.406  7.497   1.00 51.74  ? 351 ASP B OD2   1 
ATOM   6564 N  N     . GLU B 1 352 ? -26.340 30.194  7.790   1.00 36.85  ? 352 GLU B N     1 
ATOM   6565 C  CA    . GLU B 1 352 ? -25.360 31.279  7.868   1.00 36.55  ? 352 GLU B CA    1 
ATOM   6566 C  C     . GLU B 1 352 ? -23.941 30.849  7.475   1.00 39.74  ? 352 GLU B C     1 
ATOM   6567 O  O     . GLU B 1 352 ? -23.240 31.573  6.759   1.00 37.96  ? 352 GLU B O     1 
ATOM   6568 C  CB    . GLU B 1 352 ? -25.378 31.915  9.259   1.00 37.98  ? 352 GLU B CB    1 
ATOM   6569 C  CG    . GLU B 1 352 ? -24.469 33.108  9.400   1.00 38.96  ? 352 GLU B CG    1 
ATOM   6570 C  CD    . GLU B 1 352 ? -24.644 33.862  10.725  1.00 42.04  ? 352 GLU B CD    1 
ATOM   6571 O  OE1   . GLU B 1 352 ? -24.943 33.224  11.759  1.00 47.22  ? 352 GLU B OE1   1 
ATOM   6572 O  OE2   . GLU B 1 352 ? -24.472 35.110  10.735  1.00 43.40  ? 352 GLU B OE2   1 
ATOM   6573 N  N     . ARG B 1 353 ? -23.532 29.660  7.920   1.00 45.36  ? 353 ARG B N     1 
ATOM   6574 C  CA    . ARG B 1 353 ? -22.146 29.239  7.766   1.00 50.12  ? 353 ARG B CA    1 
ATOM   6575 C  C     . ARG B 1 353 ? -21.831 28.867  6.335   1.00 47.87  ? 353 ARG B C     1 
ATOM   6576 O  O     . ARG B 1 353 ? -20.725 29.094  5.872   1.00 49.95  ? 353 ARG B O     1 
ATOM   6577 C  CB    . ARG B 1 353 ? -21.798 28.091  8.702   1.00 57.95  ? 353 ARG B CB    1 
ATOM   6578 C  CG    . ARG B 1 353 ? -20.410 28.239  9.294   1.00 66.95  ? 353 ARG B CG    1 
ATOM   6579 C  CD    . ARG B 1 353 ? -19.801 26.907  9.766   1.00 80.43  ? 353 ARG B CD    1 
ATOM   6580 N  NE    . ARG B 1 353 ? -19.313 25.998  8.706   1.00 86.73  ? 353 ARG B NE    1 
ATOM   6581 C  CZ    . ARG B 1 353 ? -18.966 26.342  7.457   1.00 85.16  ? 353 ARG B CZ    1 
ATOM   6582 N  NH1   . ARG B 1 353 ? -19.035 27.602  7.045   1.00 80.28  ? 353 ARG B NH1   1 
ATOM   6583 N  NH2   . ARG B 1 353 ? -18.536 25.416  6.603   1.00 89.12  ? 353 ARG B NH2   1 
ATOM   6584 N  N     . ASN B 1 354 ? -22.797 28.306  5.627   1.00 44.41  ? 354 ASN B N     1 
ATOM   6585 C  CA    . ASN B 1 354 ? -22.539 27.902  4.260   1.00 42.74  ? 354 ASN B CA    1 
ATOM   6586 C  C     . ASN B 1 354 ? -22.760 29.035  3.318   1.00 36.54  ? 354 ASN B C     1 
ATOM   6587 O  O     . ASN B 1 354 ? -22.133 29.103  2.270   1.00 36.26  ? 354 ASN B O     1 
ATOM   6588 C  CB    . ASN B 1 354 ? -23.385 26.711  3.860   1.00 43.69  ? 354 ASN B CB    1 
ATOM   6589 C  CG    . ASN B 1 354 ? -22.715 25.388  4.184   1.00 50.85  ? 354 ASN B CG    1 
ATOM   6590 O  OD1   . ASN B 1 354 ? -22.060 25.226  5.220   1.00 53.38  ? 354 ASN B OD1   1 
ATOM   6591 N  ND2   . ASN B 1 354 ? -22.881 24.430  3.289   1.00 53.53  ? 354 ASN B ND2   1 
ATOM   6592 N  N     . VAL B 1 355 ? -23.649 29.939  3.697   1.00 32.52  ? 355 VAL B N     1 
ATOM   6593 C  CA    . VAL B 1 355 ? -23.827 31.165  2.946   1.00 27.53  ? 355 VAL B CA    1 
ATOM   6594 C  C     . VAL B 1 355 ? -22.537 31.985  2.979   1.00 28.97  ? 355 VAL B C     1 
ATOM   6595 O  O     . VAL B 1 355 ? -22.101 32.472  1.947   1.00 27.50  ? 355 VAL B O     1 
ATOM   6596 C  CB    . VAL B 1 355 ? -25.026 31.967  3.469   1.00 24.48  ? 355 VAL B CB    1 
ATOM   6597 C  CG1   . VAL B 1 355 ? -25.025 33.397  2.912   1.00 21.33  ? 355 VAL B CG1   1 
ATOM   6598 C  CG2   . VAL B 1 355 ? -26.323 31.250  3.106   1.00 23.78  ? 355 VAL B CG2   1 
ATOM   6599 N  N     . LYS B 1 356 ? -21.915 32.095  4.155   1.00 32.73  ? 356 LYS B N     1 
ATOM   6600 C  CA    . LYS B 1 356 ? -20.701 32.890  4.328   1.00 35.54  ? 356 LYS B CA    1 
ATOM   6601 C  C     . LYS B 1 356 ? -19.535 32.421  3.453   1.00 39.16  ? 356 LYS B C     1 
ATOM   6602 O  O     . LYS B 1 356 ? -18.794 33.252  2.912   1.00 39.61  ? 356 LYS B O     1 
ATOM   6603 C  CB    . LYS B 1 356 ? -20.283 32.909  5.794   1.00 40.11  ? 356 LYS B CB    1 
ATOM   6604 C  CG    . LYS B 1 356 ? -19.397 34.085  6.148   1.00 43.29  ? 356 LYS B CG    1 
ATOM   6605 C  CD    . LYS B 1 356 ? -19.111 34.154  7.641   1.00 49.80  ? 356 LYS B CD    1 
ATOM   6606 C  CE    . LYS B 1 356 ? -18.017 35.180  7.917   1.00 56.05  ? 356 LYS B CE    1 
ATOM   6607 N  NZ    . LYS B 1 356 ? -17.352 35.011  9.250   1.00 65.01  ? 356 LYS B NZ    1 
ATOM   6608 N  N     . LYS B 1 357 ? -19.381 31.098  3.333   1.00 42.52  ? 357 LYS B N     1 
ATOM   6609 C  CA    . LYS B 1 357 ? -18.338 30.477  2.516   1.00 46.95  ? 357 LYS B CA    1 
ATOM   6610 C  C     . LYS B 1 357 ? -18.648 30.623  1.034   1.00 42.61  ? 357 LYS B C     1 
ATOM   6611 O  O     . LYS B 1 357 ? -17.754 30.862  0.229   1.00 44.72  ? 357 LYS B O     1 
ATOM   6612 C  CB    . LYS B 1 357 ? -18.209 28.995  2.843   1.00 51.88  ? 357 LYS B CB    1 
ATOM   6613 C  CG    . LYS B 1 357 ? -17.358 28.686  4.067   1.00 60.71  ? 357 LYS B CG    1 
ATOM   6614 C  CD    . LYS B 1 357 ? -16.904 27.206  4.129   1.00 67.72  ? 357 LYS B CD    1 
ATOM   6615 C  CE    . LYS B 1 357 ? -16.126 26.797  2.872   1.00 71.27  ? 357 LYS B CE    1 
ATOM   6616 N  NZ    . LYS B 1 357 ? -14.948 25.945  3.193   1.00 82.82  ? 357 LYS B NZ    1 
ATOM   6617 N  N     . PHE B 1 358 ? -19.921 30.467  0.683   1.00 37.44  ? 358 PHE B N     1 
ATOM   6618 C  CA    . PHE B 1 358 ? -20.365 30.560  -0.689  1.00 33.45  ? 358 PHE B CA    1 
ATOM   6619 C  C     . PHE B 1 358 ? -20.174 31.988  -1.192  1.00 30.83  ? 358 PHE B C     1 
ATOM   6620 O  O     . PHE B 1 358 ? -19.812 32.193  -2.345  1.00 30.76  ? 358 PHE B O     1 
ATOM   6621 C  CB    . PHE B 1 358 ? -21.828 30.129  -0.770  1.00 29.68  ? 358 PHE B CB    1 
ATOM   6622 C  CG    . PHE B 1 358 ? -22.429 30.201  -2.152  1.00 26.16  ? 358 PHE B CG    1 
ATOM   6623 C  CD1   . PHE B 1 358 ? -22.202 29.196  -3.079  1.00 26.93  ? 358 PHE B CD1   1 
ATOM   6624 C  CD2   . PHE B 1 358 ? -23.264 31.266  -2.513  1.00 22.16  ? 358 PHE B CD2   1 
ATOM   6625 C  CE1   . PHE B 1 358 ? -22.778 29.253  -4.349  1.00 24.05  ? 358 PHE B CE1   1 
ATOM   6626 C  CE2   . PHE B 1 358 ? -23.848 31.325  -3.797  1.00 18.91  ? 358 PHE B CE2   1 
ATOM   6627 C  CZ    . PHE B 1 358 ? -23.602 30.317  -4.707  1.00 19.76  ? 358 PHE B CZ    1 
ATOM   6628 N  N     . LEU B 1 359 ? -20.400 32.974  -0.328  1.00 29.96  ? 359 LEU B N     1 
ATOM   6629 C  CA    . LEU B 1 359 ? -20.214 34.386  -0.701  1.00 28.25  ? 359 LEU B CA    1 
ATOM   6630 C  C     . LEU B 1 359 ? -18.739 34.811  -0.720  1.00 33.86  ? 359 LEU B C     1 
ATOM   6631 O  O     . LEU B 1 359 ? -18.381 35.790  -1.391  1.00 34.05  ? 359 LEU B O     1 
ATOM   6632 C  CB    . LEU B 1 359 ? -21.029 35.321  0.204   1.00 25.32  ? 359 LEU B CB    1 
ATOM   6633 C  CG    . LEU B 1 359 ? -22.536 35.325  -0.026  1.00 19.71  ? 359 LEU B CG    1 
ATOM   6634 C  CD1   . LEU B 1 359 ? -23.215 36.431  0.729   1.00 18.22  ? 359 LEU B CD1   1 
ATOM   6635 C  CD2   . LEU B 1 359 ? -22.823 35.481  -1.480  1.00 17.04  ? 359 LEU B CD2   1 
ATOM   6636 N  N     . SER B 1 360 ? -17.891 34.074  0.001   1.00 39.33  ? 360 SER B N     1 
ATOM   6637 C  CA    . SER B 1 360 ? -16.476 34.416  0.118   1.00 45.75  ? 360 SER B CA    1 
ATOM   6638 C  C     . SER B 1 360 ? -15.675 34.075  -1.137  1.00 48.39  ? 360 SER B C     1 
ATOM   6639 O  O     . SER B 1 360 ? -14.551 34.546  -1.294  1.00 53.86  ? 360 SER B O     1 
ATOM   6640 C  CB    . SER B 1 360 ? -15.859 33.706  1.315   1.00 51.91  ? 360 SER B CB    1 
ATOM   6641 O  OG    . SER B 1 360 ? -15.618 32.343  1.017   1.00 54.16  ? 360 SER B OG    1 
ATOM   6642 N  N     . ARG B 1 361 ? -16.247 33.250  -2.014  1.00 45.31  ? 361 ARG B N     1 
ATOM   6643 C  CA    . ARG B 1 361 ? -15.570 32.815  -3.231  1.00 47.72  ? 361 ARG B CA    1 
ATOM   6644 C  C     . ARG B 1 361 ? -15.526 33.965  -4.208  1.00 45.15  ? 361 ARG B C     1 
ATOM   6645 O  O     . ARG B 1 361 ? -16.558 34.560  -4.479  1.00 39.52  ? 361 ARG B O     1 
ATOM   6646 C  CB    . ARG B 1 361 ? -16.312 31.631  -3.866  1.00 45.22  ? 361 ARG B CB    1 
ATOM   6647 C  CG    . ARG B 1 361 ? -16.346 30.336  -3.022  1.00 50.50  ? 361 ARG B CG    1 
ATOM   6648 C  CD    . ARG B 1 361 ? -14.938 29.780  -2.659  1.00 61.85  ? 361 ARG B CD    1 
ATOM   6649 N  NE    . ARG B 1 361 ? -14.121 29.476  -3.844  1.00 66.68  ? 361 ARG B NE    1 
ATOM   6650 C  CZ    . ARG B 1 361 ? -12.789 29.428  -3.851  1.00 74.28  ? 361 ARG B CZ    1 
ATOM   6651 N  NH1   . ARG B 1 361 ? -12.134 29.150  -4.974  1.00 75.73  ? 361 ARG B NH1   1 
ATOM   6652 N  NH2   . ARG B 1 361 ? -12.111 29.669  -2.733  1.00 80.38  ? 361 ARG B NH2   1 
ATOM   6653 N  N     . ASN B 1 362 ? -14.343 34.272  -4.735  1.00 50.44  ? 362 ASN B N     1 
ATOM   6654 C  CA    . ASN B 1 362 ? -14.166 35.366  -5.698  1.00 49.70  ? 362 ASN B CA    1 
ATOM   6655 C  C     . ASN B 1 362 ? -14.858 35.148  -7.043  1.00 45.39  ? 362 ASN B C     1 
ATOM   6656 O  O     . ASN B 1 362 ? -14.573 34.180  -7.758  1.00 47.25  ? 362 ASN B O     1 
ATOM   6657 C  CB    . ASN B 1 362 ? -12.684 35.604  -5.951  1.00 57.78  ? 362 ASN B CB    1 
ATOM   6658 C  CG    . ASN B 1 362 ? -12.003 36.261  -4.797  1.00 62.69  ? 362 ASN B CG    1 
ATOM   6659 O  OD1   . ASN B 1 362 ? -11.243 35.634  -4.074  1.00 69.22  ? 362 ASN B OD1   1 
ATOM   6660 N  ND2   . ASN B 1 362 ? -12.269 37.532  -4.609  1.00 61.65  ? 362 ASN B ND2   1 
ATOM   6661 N  N     . ARG B 1 363 ? -15.755 36.059  -7.396  1.00 40.71  ? 363 ARG B N     1 
ATOM   6662 C  CA    . ARG B 1 363 ? -16.450 35.991  -8.666  1.00 37.25  ? 363 ARG B CA    1 
ATOM   6663 C  C     . ARG B 1 363 ? -16.459 37.344  -9.317  1.00 37.84  ? 363 ARG B C     1 
ATOM   6664 O  O     . ARG B 1 363 ? -15.980 38.313  -8.740  1.00 41.17  ? 363 ARG B O     1 
ATOM   6665 C  CB    . ARG B 1 363 ? -17.872 35.533  -8.441  1.00 31.54  ? 363 ARG B CB    1 
ATOM   6666 C  CG    . ARG B 1 363 ? -17.967 34.071  -8.110  1.00 32.02  ? 363 ARG B CG    1 
ATOM   6667 C  CD    . ARG B 1 363 ? -19.379 33.695  -7.783  1.00 27.10  ? 363 ARG B CD    1 
ATOM   6668 N  NE    . ARG B 1 363 ? -19.386 32.464  -7.016  1.00 29.27  ? 363 ARG B NE    1 
ATOM   6669 C  CZ    . ARG B 1 363 ? -19.607 32.409  -5.709  1.00 30.18  ? 363 ARG B CZ    1 
ATOM   6670 N  NH1   . ARG B 1 363 ? -19.863 33.526  -5.028  1.00 27.57  ? 363 ARG B NH1   1 
ATOM   6671 N  NH2   . ARG B 1 363 ? -19.581 31.232  -5.091  1.00 32.99  ? 363 ARG B NH2   1 
ATOM   6672 N  N     . ALA B 1 364 ? -17.007 37.421  -10.520 1.00 36.31  ? 364 ALA B N     1 
ATOM   6673 C  CA    . ALA B 1 364 ? -17.060 38.694  -11.246 1.00 37.75  ? 364 ALA B CA    1 
ATOM   6674 C  C     . ALA B 1 364 ? -18.351 39.484  -11.031 1.00 34.00  ? 364 ALA B C     1 
ATOM   6675 O  O     . ALA B 1 364 ? -18.392 40.686  -11.294 1.00 35.62  ? 364 ALA B O     1 
ATOM   6676 C  CB    . ALA B 1 364 ? -16.847 38.458  -12.711 1.00 38.86  ? 364 ALA B CB    1 
ATOM   6677 N  N     . PHE B 1 365 ? -19.397 38.807  -10.563 1.00 30.19  ? 365 PHE B N     1 
ATOM   6678 C  CA    . PHE B 1 365 ? -20.719 39.411  -10.426 1.00 27.26  ? 365 PHE B CA    1 
ATOM   6679 C  C     . PHE B 1 365 ? -21.294 39.102  -9.052  1.00 25.53  ? 365 PHE B C     1 
ATOM   6680 O  O     . PHE B 1 365 ? -21.106 37.997  -8.546  1.00 25.59  ? 365 PHE B O     1 
ATOM   6681 C  CB    . PHE B 1 365 ? -21.668 38.912  -11.536 1.00 24.83  ? 365 PHE B CB    1 
ATOM   6682 C  CG    . PHE B 1 365 ? -21.191 39.226  -12.935 1.00 27.27  ? 365 PHE B CG    1 
ATOM   6683 C  CD1   . PHE B 1 365 ? -20.430 38.309  -13.650 1.00 29.53  ? 365 PHE B CD1   1 
ATOM   6684 C  CD2   . PHE B 1 365 ? -21.491 40.444  -13.533 1.00 28.10  ? 365 PHE B CD2   1 
ATOM   6685 C  CE1   . PHE B 1 365 ? -19.976 38.611  -14.940 1.00 31.34  ? 365 PHE B CE1   1 
ATOM   6686 C  CE2   . PHE B 1 365 ? -21.042 40.750  -14.818 1.00 29.82  ? 365 PHE B CE2   1 
ATOM   6687 C  CZ    . PHE B 1 365 ? -20.288 39.834  -15.519 1.00 31.22  ? 365 PHE B CZ    1 
ATOM   6688 N  N     . ARG B 1 366 ? -21.988 40.075  -8.460  1.00 24.93  ? 366 ARG B N     1 
ATOM   6689 C  CA    . ARG B 1 366 ? -22.639 39.912  -7.163  1.00 23.99  ? 366 ARG B CA    1 
ATOM   6690 C  C     . ARG B 1 366 ? -23.554 38.704  -7.235  1.00 20.70  ? 366 ARG B C     1 
ATOM   6691 O  O     . ARG B 1 366 ? -24.287 38.570  -8.207  1.00 19.92  ? 366 ARG B O     1 
ATOM   6692 C  CB    . ARG B 1 366 ? -23.480 41.149  -6.815  1.00 23.92  ? 366 ARG B CB    1 
ATOM   6693 C  CG    . ARG B 1 366 ? -22.730 42.505  -6.809  1.00 28.92  ? 366 ARG B CG    1 
ATOM   6694 C  CD    . ARG B 1 366 ? -23.651 43.723  -7.094  1.00 30.48  ? 366 ARG B CD    1 
ATOM   6695 N  NE    . ARG B 1 366 ? -24.756 43.871  -6.138  1.00 35.26  ? 366 ARG B NE    1 
ATOM   6696 C  CZ    . ARG B 1 366 ? -24.669 44.489  -4.957  1.00 39.78  ? 366 ARG B CZ    1 
ATOM   6697 N  NH1   . ARG B 1 366 ? -23.520 45.039  -4.570  1.00 45.28  ? 366 ARG B NH1   1 
ATOM   6698 N  NH2   . ARG B 1 366 ? -25.728 44.559  -4.149  1.00 39.85  ? 366 ARG B NH2   1 
ATOM   6699 N  N     . PRO B 1 367 ? -23.501 37.808  -6.230  1.00 20.28  ? 367 PRO B N     1 
ATOM   6700 C  CA    . PRO B 1 367 ? -24.478 36.722  -6.078  1.00 18.30  ? 367 PRO B CA    1 
ATOM   6701 C  C     . PRO B 1 367 ? -25.873 37.266  -5.752  1.00 16.23  ? 367 PRO B C     1 
ATOM   6702 O  O     . PRO B 1 367 ? -26.002 38.412  -5.332  1.00 17.16  ? 367 PRO B O     1 
ATOM   6703 C  CB    . PRO B 1 367 ? -23.945 35.945  -4.866  1.00 19.67  ? 367 PRO B CB    1 
ATOM   6704 C  CG    . PRO B 1 367 ? -22.539 36.301  -4.773  1.00 22.43  ? 367 PRO B CG    1 
ATOM   6705 C  CD    . PRO B 1 367 ? -22.486 37.740  -5.172  1.00 22.95  ? 367 PRO B CD    1 
ATOM   6706 N  N     . PHE B 1 368 ? -26.909 36.465  -5.929  1.00 14.45  ? 368 PHE B N     1 
ATOM   6707 C  CA    . PHE B 1 368 ? -28.254 36.964  -5.679  1.00 13.56  ? 368 PHE B CA    1 
ATOM   6708 C  C     . PHE B 1 368 ? -29.094 35.939  -4.928  1.00 13.89  ? 368 PHE B C     1 
ATOM   6709 O  O     . PHE B 1 368 ? -28.714 34.769  -4.835  1.00 15.07  ? 368 PHE B O     1 
ATOM   6710 C  CB    . PHE B 1 368 ? -28.926 37.366  -6.997  1.00 13.00  ? 368 PHE B CB    1 
ATOM   6711 C  CG    . PHE B 1 368 ? -28.978 36.259  -8.028  1.00 12.78  ? 368 PHE B CG    1 
ATOM   6712 C  CD1   . PHE B 1 368 ? -27.891 35.980  -8.833  1.00 11.95  ? 368 PHE B CD1   1 
ATOM   6713 C  CD2   . PHE B 1 368 ? -30.124 35.513  -8.211  1.00 13.10  ? 368 PHE B CD2   1 
ATOM   6714 C  CE1   . PHE B 1 368 ? -27.949 34.975  -9.787  1.00 10.67  ? 368 PHE B CE1   1 
ATOM   6715 C  CE2   . PHE B 1 368 ? -30.171 34.518  -9.168  1.00 12.82  ? 368 PHE B CE2   1 
ATOM   6716 C  CZ    . PHE B 1 368 ? -29.081 34.251  -9.947  1.00 11.45  ? 368 PHE B CZ    1 
ATOM   6717 N  N     . ILE B 1 369 ? -30.223 36.371  -4.382  1.00 13.64  ? 369 ILE B N     1 
ATOM   6718 C  CA    . ILE B 1 369 ? -31.160 35.431  -3.831  1.00 14.62  ? 369 ILE B CA    1 
ATOM   6719 C  C     . ILE B 1 369 ? -32.304 35.255  -4.811  1.00 16.06  ? 369 ILE B C     1 
ATOM   6720 O  O     . ILE B 1 369 ? -32.793 36.219  -5.423  1.00 16.67  ? 369 ILE B O     1 
ATOM   6721 C  CB    . ILE B 1 369 ? -31.730 35.888  -2.504  1.00 15.54  ? 369 ILE B CB    1 
ATOM   6722 C  CG1   . ILE B 1 369 ? -30.670 36.615  -1.685  1.00 16.06  ? 369 ILE B CG1   1 
ATOM   6723 C  CG2   . ILE B 1 369 ? -32.274 34.704  -1.715  1.00 16.99  ? 369 ILE B CG2   1 
ATOM   6724 C  CD1   . ILE B 1 369 ? -31.260 37.668  -0.741  1.00 18.34  ? 369 ILE B CD1   1 
ATOM   6725 N  N     . GLU B 1 370 ? -32.721 34.003  -4.960  1.00 17.33  ? 370 GLU B N     1 
ATOM   6726 C  CA    . GLU B 1 370 ? -33.907 33.665  -5.709  1.00 19.15  ? 370 GLU B CA    1 
ATOM   6727 C  C     . GLU B 1 370 ? -34.608 32.490  -5.020  1.00 21.86  ? 370 GLU B C     1 
ATOM   6728 O  O     . GLU B 1 370 ? -33.976 31.481  -4.713  1.00 22.03  ? 370 GLU B O     1 
ATOM   6729 C  CB    . GLU B 1 370 ? -33.505 33.313  -7.128  1.00 18.89  ? 370 GLU B CB    1 
ATOM   6730 C  CG    . GLU B 1 370 ? -34.649 33.089  -8.080  1.00 21.60  ? 370 GLU B CG    1 
ATOM   6731 C  CD    . GLU B 1 370 ? -34.159 32.504  -9.388  1.00 22.44  ? 370 GLU B CD    1 
ATOM   6732 O  OE1   . GLU B 1 370 ? -33.345 33.164  -10.091 1.00 19.01  ? 370 GLU B OE1   1 
ATOM   6733 O  OE2   . GLU B 1 370 ? -34.585 31.370  -9.703  1.00 26.25  ? 370 GLU B OE2   1 
ATOM   6734 N  N     . ASN B 1 371 ? -35.908 32.646  -4.764  1.00 24.46  ? 371 ASN B N     1 
ATOM   6735 C  CA    . ASN B 1 371 ? -36.744 31.604  -4.165  1.00 28.11  ? 371 ASN B CA    1 
ATOM   6736 C  C     . ASN B 1 371 ? -36.210 30.998  -2.887  1.00 27.36  ? 371 ASN B C     1 
ATOM   6737 O  O     . ASN B 1 371 ? -36.358 29.801  -2.650  1.00 30.96  ? 371 ASN B O     1 
ATOM   6738 C  CB    . ASN B 1 371 ? -36.993 30.483  -5.162  1.00 31.26  ? 371 ASN B CB    1 
ATOM   6739 C  CG    . ASN B 1 371 ? -38.030 30.837  -6.165  1.00 35.38  ? 371 ASN B CG    1 
ATOM   6740 O  OD1   . ASN B 1 371 ? -39.173 31.095  -5.811  1.00 41.24  ? 371 ASN B OD1   1 
ATOM   6741 N  ND2   . ASN B 1 371 ? -37.650 30.848  -7.438  1.00 35.94  ? 371 ASN B ND2   1 
ATOM   6742 N  N     . GLY B 1 372 ? -35.582 31.812  -2.060  1.00 23.60  ? 372 GLY B N     1 
ATOM   6743 C  CA    . GLY B 1 372 ? -35.158 31.341  -0.760  1.00 23.42  ? 372 GLY B CA    1 
ATOM   6744 C  C     . GLY B 1 372 ? -33.671 31.150  -0.645  1.00 20.40  ? 372 GLY B C     1 
ATOM   6745 O  O     . GLY B 1 372 ? -33.111 31.278  0.455   1.00 20.15  ? 372 GLY B O     1 
ATOM   6746 N  N     . ARG B 1 373 ? -33.021 30.862  -1.772  1.00 18.51  ? 373 ARG B N     1 
ATOM   6747 C  CA    . ARG B 1 373 ? -31.607 30.506  -1.733  1.00 17.06  ? 373 ARG B CA    1 
ATOM   6748 C  C     . ARG B 1 373 ? -30.695 31.356  -2.580  1.00 13.59  ? 373 ARG B C     1 
ATOM   6749 O  O     . ARG B 1 373 ? -31.126 32.026  -3.503  1.00 12.39  ? 373 ARG B O     1 
ATOM   6750 C  CB    . ARG B 1 373 ? -31.394 29.027  -2.050  1.00 20.19  ? 373 ARG B CB    1 
ATOM   6751 C  CG    . ARG B 1 373 ? -31.385 28.673  -3.505  1.00 20.56  ? 373 ARG B CG    1 
ATOM   6752 C  CD    . ARG B 1 373 ? -30.907 27.232  -3.717  1.00 25.63  ? 373 ARG B CD    1 
ATOM   6753 N  NE    . ARG B 1 373 ? -31.690 26.280  -2.931  1.00 29.44  ? 373 ARG B NE    1 
ATOM   6754 C  CZ    . ARG B 1 373 ? -31.178 25.411  -2.073  1.00 32.13  ? 373 ARG B CZ    1 
ATOM   6755 N  NH1   . ARG B 1 373 ? -29.868 25.337  -1.905  1.00 31.81  ? 373 ARG B NH1   1 
ATOM   6756 N  NH2   . ARG B 1 373 ? -31.983 24.597  -1.404  1.00 37.69  ? 373 ARG B NH2   1 
ATOM   6757 N  N     . TRP B 1 374 ? -29.416 31.299  -2.245  1.00 13.24  ? 374 TRP B N     1 
ATOM   6758 C  CA    . TRP B 1 374 ? -28.402 32.039  -2.944  1.00 11.02  ? 374 TRP B CA    1 
ATOM   6759 C  C     . TRP B 1 374 ? -28.098 31.395  -4.289  1.00 11.80  ? 374 TRP B C     1 
ATOM   6760 O  O     . TRP B 1 374 ? -28.291 30.184  -4.468  1.00 14.47  ? 374 TRP B O     1 
ATOM   6761 C  CB    . TRP B 1 374 ? -27.164 32.157  -2.065  1.00 11.47  ? 374 TRP B CB    1 
ATOM   6762 C  CG    . TRP B 1 374 ? -27.395 33.128  -0.970  1.00 10.28  ? 374 TRP B CG    1 
ATOM   6763 C  CD1   . TRP B 1 374 ? -27.844 32.853  0.274   1.00 11.85  ? 374 TRP B CD1   1 
ATOM   6764 C  CD2   . TRP B 1 374 ? -27.238 34.549  -1.033  1.00 8.53   ? 374 TRP B CD2   1 
ATOM   6765 N  NE1   . TRP B 1 374 ? -27.955 34.002  1.008   1.00 10.76  ? 374 TRP B NE1   1 
ATOM   6766 C  CE2   . TRP B 1 374 ? -27.595 35.062  0.220   1.00 9.04   ? 374 TRP B CE2   1 
ATOM   6767 C  CE3   . TRP B 1 374 ? -26.817 35.437  -2.027  1.00 8.05   ? 374 TRP B CE3   1 
ATOM   6768 C  CZ2   . TRP B 1 374 ? -27.547 36.426  0.511   1.00 8.77   ? 374 TRP B CZ2   1 
ATOM   6769 C  CZ3   . TRP B 1 374 ? -26.764 36.794  -1.730  1.00 7.93   ? 374 TRP B CZ3   1 
ATOM   6770 C  CH2   . TRP B 1 374 ? -27.124 37.270  -0.472  1.00 7.77   ? 374 TRP B CH2   1 
ATOM   6771 N  N     . TRP B 1 375 ? -27.683 32.227  -5.244  1.00 10.11  ? 375 TRP B N     1 
ATOM   6772 C  CA    . TRP B 1 375 ? -27.200 31.769  -6.537  1.00 10.53  ? 375 TRP B CA    1 
ATOM   6773 C  C     . TRP B 1 375 ? -26.037 32.654  -6.960  1.00 10.09  ? 375 TRP B C     1 
ATOM   6774 O  O     . TRP B 1 375 ? -25.900 33.794  -6.524  1.00 8.59   ? 375 TRP B O     1 
ATOM   6775 C  CB    . TRP B 1 375 ? -28.303 31.825  -7.593  1.00 9.95   ? 375 TRP B CB    1 
ATOM   6776 C  CG    . TRP B 1 375 ? -29.459 30.929  -7.309  1.00 11.97  ? 375 TRP B CG    1 
ATOM   6777 C  CD1   . TRP B 1 375 ? -30.505 31.179  -6.459  1.00 11.76  ? 375 TRP B CD1   1 
ATOM   6778 C  CD2   . TRP B 1 375 ? -29.704 29.636  -7.875  1.00 15.50  ? 375 TRP B CD2   1 
ATOM   6779 N  NE1   . TRP B 1 375 ? -31.372 30.119  -6.452  1.00 14.77  ? 375 TRP B NE1   1 
ATOM   6780 C  CE2   . TRP B 1 375 ? -30.908 29.155  -7.311  1.00 17.19  ? 375 TRP B CE2   1 
ATOM   6781 C  CE3   . TRP B 1 375 ? -29.024 28.829  -8.807  1.00 17.42  ? 375 TRP B CE3   1 
ATOM   6782 C  CZ2   . TRP B 1 375 ? -31.447 27.895  -7.649  1.00 20.49  ? 375 TRP B CZ2   1 
ATOM   6783 C  CZ3   . TRP B 1 375 ? -29.567 27.575  -9.140  1.00 19.16  ? 375 TRP B CZ3   1 
ATOM   6784 C  CH2   . TRP B 1 375 ? -30.759 27.128  -8.561  1.00 21.26  ? 375 TRP B CH2   1 
ATOM   6785 N  N     . ALA B 1 376 ? -25.207 32.106  -7.832  1.00 12.10  ? 376 ALA B N     1 
ATOM   6786 C  CA    . ALA B 1 376 ? -24.017 32.772  -8.309  1.00 13.15  ? 376 ALA B CA    1 
ATOM   6787 C  C     . ALA B 1 376 ? -23.816 32.568  -9.812  1.00 13.85  ? 376 ALA B C     1 
ATOM   6788 O  O     . ALA B 1 376 ? -24.000 31.476  -10.350 1.00 14.76  ? 376 ALA B O     1 
ATOM   6789 C  CB    . ALA B 1 376 ? -22.806 32.276  -7.547  1.00 16.11  ? 376 ALA B CB    1 
ATOM   6790 N  N     . PHE B 1 377 ? -23.443 33.656  -10.467 1.00 13.86  ? 377 PHE B N     1 
ATOM   6791 C  CA    . PHE B 1 377 ? -22.999 33.640  -11.831 1.00 15.49  ? 377 PHE B CA    1 
ATOM   6792 C  C     . PHE B 1 377 ? -21.545 33.205  -11.859 1.00 19.17  ? 377 PHE B C     1 
ATOM   6793 O  O     . PHE B 1 377 ? -20.737 33.708  -11.090 1.00 20.67  ? 377 PHE B O     1 
ATOM   6794 C  CB    . PHE B 1 377 ? -23.073 35.051  -12.375 1.00 14.95  ? 377 PHE B CB    1 
ATOM   6795 C  CG    . PHE B 1 377 ? -24.470 35.621  -12.453 1.00 13.98  ? 377 PHE B CG    1 
ATOM   6796 C  CD1   . PHE B 1 377 ? -24.772 36.833  -11.821 1.00 12.83  ? 377 PHE B CD1   1 
ATOM   6797 C  CD2   . PHE B 1 377 ? -25.468 34.982  -13.194 1.00 13.19  ? 377 PHE B CD2   1 
ATOM   6798 C  CE1   . PHE B 1 377 ? -26.034 37.383  -11.917 1.00 10.75  ? 377 PHE B CE1   1 
ATOM   6799 C  CE2   . PHE B 1 377 ? -26.727 35.535  -13.294 1.00 11.86  ? 377 PHE B CE2   1 
ATOM   6800 C  CZ    . PHE B 1 377 ? -27.008 36.740  -12.652 1.00 11.28  ? 377 PHE B CZ    1 
ATOM   6801 N  N     . GLU B 1 378 ? -21.204 32.273  -12.743 1.00 21.82  ? 378 GLU B N     1 
ATOM   6802 C  CA    . GLU B 1 378 ? -19.820 31.815  -12.871 1.00 26.69  ? 378 GLU B CA    1 
ATOM   6803 C  C     . GLU B 1 378 ? -19.464 31.746  -14.329 1.00 28.15  ? 378 GLU B C     1 
ATOM   6804 O  O     . GLU B 1 378 ? -20.342 31.539  -15.151 1.00 26.27  ? 378 GLU B O     1 
ATOM   6805 C  CB    . GLU B 1 378 ? -19.635 30.433  -12.255 1.00 29.54  ? 378 GLU B CB    1 
ATOM   6806 C  CG    . GLU B 1 378 ? -18.523 30.364  -11.215 1.00 34.90  ? 378 GLU B CG    1 
ATOM   6807 C  CD    . GLU B 1 378 ? -19.075 30.507  -9.816  1.00 35.54  ? 378 GLU B CD    1 
ATOM   6808 O  OE1   . GLU B 1 378 ? -18.339 30.306  -8.833  1.00 40.45  ? 378 GLU B OE1   1 
ATOM   6809 O  OE2   . GLU B 1 378 ? -20.275 30.816  -9.692  1.00 33.60  ? 378 GLU B OE2   1 
ATOM   6810 N  N     . MET B 1 379 ? -18.179 31.918  -14.640 1.00 32.42  ? 379 MET B N     1 
ATOM   6811 C  CA    . MET B 1 379 ? -17.699 31.933  -16.019 1.00 35.23  ? 379 MET B CA    1 
ATOM   6812 C  C     . MET B 1 379 ? -17.198 30.548  -16.418 1.00 38.79  ? 379 MET B C     1 
ATOM   6813 O  O     . MET B 1 379 ? -16.347 29.980  -15.752 1.00 43.08  ? 379 MET B O     1 
ATOM   6814 C  CB    . MET B 1 379 ? -16.594 32.989  -16.226 1.00 38.89  ? 379 MET B CB    1 
ATOM   6815 C  CG    . MET B 1 379 ? -16.938 34.421  -15.768 1.00 38.99  ? 379 MET B CG    1 
ATOM   6816 S  SD    . MET B 1 379 ? -18.236 35.266  -16.734 1.00 42.39  ? 379 MET B SD    1 
ATOM   6817 C  CE    . MET B 1 379 ? -17.285 36.316  -17.849 1.00 44.08  ? 379 MET B CE    1 
ATOM   6818 N  N     . ARG B 1 380 ? -17.743 30.003  -17.499 1.00 38.11  ? 380 ARG B N     1 
ATOM   6819 C  CA    . ARG B 1 380 ? -17.285 28.740  -18.048 1.00 42.31  ? 380 ARG B CA    1 
ATOM   6820 C  C     . ARG B 1 380 ? -15.840 28.864  -18.513 1.00 48.44  ? 380 ARG B C     1 
ATOM   6821 O  O     . ARG B 1 380 ? -15.341 29.969  -18.755 1.00 48.57  ? 380 ARG B O     1 
ATOM   6822 C  CB    . ARG B 1 380 ? -18.132 28.355  -19.259 1.00 41.03  ? 380 ARG B CB    1 
ATOM   6823 C  CG    . ARG B 1 380 ? -19.489 27.801  -18.961 1.00 36.91  ? 380 ARG B CG    1 
ATOM   6824 C  CD    . ARG B 1 380 ? -20.240 27.534  -20.254 1.00 35.45  ? 380 ARG B CD    1 
ATOM   6825 N  NE    . ARG B 1 380 ? -21.481 26.817  -19.998 1.00 34.31  ? 380 ARG B NE    1 
ATOM   6826 C  CZ    . ARG B 1 380 ? -22.601 27.394  -19.577 1.00 31.18  ? 380 ARG B CZ    1 
ATOM   6827 N  NH1   . ARG B 1 380 ? -22.639 28.702  -19.383 1.00 29.40  ? 380 ARG B NH1   1 
ATOM   6828 N  NH2   . ARG B 1 380 ? -23.682 26.668  -19.345 1.00 31.04  ? 380 ARG B NH2   1 
ATOM   6829 N  N     . LYS B 1 381 ? -15.173 27.722  -18.664 1.00 54.35  ? 381 LYS B N     1 
ATOM   6830 C  CA    . LYS B 1 381 ? -13.834 27.706  -19.234 1.00 61.19  ? 381 LYS B CA    1 
ATOM   6831 C  C     . LYS B 1 381 ? -13.826 27.683  -20.770 1.00 62.24  ? 381 LYS B C     1 
ATOM   6832 O  O     . LYS B 1 381 ? -12.884 28.153  -21.394 1.00 66.68  ? 381 LYS B O     1 
ATOM   6833 C  CB    . LYS B 1 381 ? -13.008 26.577  -18.624 1.00 68.13  ? 381 LYS B CB    1 
ATOM   6834 C  CG    . LYS B 1 381 ? -11.979 27.083  -17.613 1.00 73.37  ? 381 LYS B CG    1 
ATOM   6835 C  CD    . LYS B 1 381 ? -11.915 26.255  -16.338 1.00 77.64  ? 381 LYS B CD    1 
ATOM   6836 C  CE    . LYS B 1 381 ? -12.955 26.730  -15.334 1.00 72.05  ? 381 LYS B CE    1 
ATOM   6837 N  NZ    . LYS B 1 381 ? -12.479 26.543  -13.934 1.00 76.96  ? 381 LYS B NZ    1 
ATOM   6838 N  N     . PHE B 1 382 ? -14.896 27.171  -21.364 1.00 59.01  ? 382 PHE B N     1 
ATOM   6839 C  CA    . PHE B 1 382 ? -15.023 27.037  -22.814 1.00 60.39  ? 382 PHE B CA    1 
ATOM   6840 C  C     . PHE B 1 382 ? -16.432 27.432  -23.202 1.00 54.72  ? 382 PHE B C     1 
ATOM   6841 O  O     . PHE B 1 382 ? -17.341 27.284  -22.395 1.00 51.04  ? 382 PHE B O     1 
ATOM   6842 C  CB    . PHE B 1 382 ? -14.802 25.580  -23.201 1.00 65.27  ? 382 PHE B CB    1 
ATOM   6843 C  CG    . PHE B 1 382 ? -15.325 24.604  -22.183 1.00 65.00  ? 382 PHE B CG    1 
ATOM   6844 C  CD1   . PHE B 1 382 ? -16.694 24.334  -22.082 1.00 60.23  ? 382 PHE B CD1   1 
ATOM   6845 C  CD2   . PHE B 1 382 ? -14.452 23.960  -21.306 1.00 69.59  ? 382 PHE B CD2   1 
ATOM   6846 C  CE1   . PHE B 1 382 ? -17.180 23.435  -21.120 1.00 60.09  ? 382 PHE B CE1   1 
ATOM   6847 C  CE2   . PHE B 1 382 ? -14.930 23.055  -20.349 1.00 69.43  ? 382 PHE B CE2   1 
ATOM   6848 C  CZ    . PHE B 1 382 ? -16.294 22.794  -20.257 1.00 64.68  ? 382 PHE B CZ    1 
ATOM   6849 N  N     . THR B 1 383 ? -16.635 27.935  -24.415 1.00 55.04  ? 383 THR B N     1 
ATOM   6850 C  CA    . THR B 1 383 ? -17.986 28.345  -24.822 1.00 50.96  ? 383 THR B CA    1 
ATOM   6851 C  C     . THR B 1 383 ? -18.554 27.574  -26.008 1.00 53.79  ? 383 THR B C     1 
ATOM   6852 O  O     . THR B 1 383 ? -19.673 27.845  -26.438 1.00 51.70  ? 383 THR B O     1 
ATOM   6853 C  CB    . THR B 1 383 ? -18.066 29.826  -25.175 1.00 48.61  ? 383 THR B CB    1 
ATOM   6854 O  OG1   . THR B 1 383 ? -17.209 30.089  -26.291 1.00 52.90  ? 383 THR B OG1   1 
ATOM   6855 C  CG2   . THR B 1 383 ? -17.684 30.693  -23.992 1.00 46.35  ? 383 THR B CG2   1 
ATOM   6856 N  N     . THR B 1 384 ? -17.792 26.631  -26.548 1.00 28.32  ? 384 THR B N     1 
ATOM   6857 C  CA    . THR B 1 384 ? -18.240 25.871  -27.706 1.00 25.92  ? 384 THR B CA    1 
ATOM   6858 C  C     . THR B 1 384 ? -18.060 24.392  -27.416 1.00 23.36  ? 384 THR B C     1 
ATOM   6859 O  O     . THR B 1 384 ? -17.164 24.023  -26.669 1.00 24.24  ? 384 THR B O     1 
ATOM   6860 C  CB    . THR B 1 384 ? -17.437 26.248  -28.960 1.00 28.05  ? 384 THR B CB    1 
ATOM   6861 O  OG1   . THR B 1 384 ? -16.045 26.128  -28.672 1.00 30.26  ? 384 THR B OG1   1 
ATOM   6862 C  CG2   . THR B 1 384 ? -17.717 27.688  -29.374 1.00 32.19  ? 384 THR B CG2   1 
ATOM   6863 N  N     . PRO B 1 385 ? -18.893 23.527  -28.018 1.00 21.19  ? 385 PRO B N     1 
ATOM   6864 C  CA    . PRO B 1 385 ? -18.750 22.109  -27.709 1.00 19.35  ? 385 PRO B CA    1 
ATOM   6865 C  C     . PRO B 1 385 ? -17.400 21.567  -28.160 1.00 20.89  ? 385 PRO B C     1 
ATOM   6866 O  O     . PRO B 1 385 ? -16.907 20.571  -27.603 1.00 20.39  ? 385 PRO B O     1 
ATOM   6867 C  CB    . PRO B 1 385 ? -19.881 21.457  -28.500 1.00 16.97  ? 385 PRO B CB    1 
ATOM   6868 C  CG    . PRO B 1 385 ? -20.226 22.411  -29.540 1.00 18.38  ? 385 PRO B CG    1 
ATOM   6869 C  CD    . PRO B 1 385 ? -19.962 23.769  -28.999 1.00 20.71  ? 385 PRO B CD    1 
ATOM   6870 N  N     . GLU B 1 386 ? -16.802 22.224  -29.153 1.00 23.80  ? 386 GLU B N     1 
ATOM   6871 C  CA    . GLU B 1 386 ? -15.487 21.825  -29.630 1.00 26.11  ? 386 GLU B CA    1 
ATOM   6872 C  C     . GLU B 1 386 ? -14.423 22.136  -28.581 1.00 28.70  ? 386 GLU B C     1 
ATOM   6873 O  O     . GLU B 1 386 ? -13.669 21.240  -28.204 1.00 28.65  ? 386 GLU B O     1 
ATOM   6874 C  CB    . GLU B 1 386 ? -15.157 22.467  -30.981 1.00 29.26  ? 386 GLU B CB    1 
ATOM   6875 C  CG    . GLU B 1 386 ? -15.816 21.794  -32.184 1.00 29.44  ? 386 GLU B CG    1 
ATOM   6876 C  CD    . GLU B 1 386 ? -17.153 22.417  -32.578 1.00 32.33  ? 386 GLU B CD    1 
ATOM   6877 O  OE1   . GLU B 1 386 ? -17.771 23.150  -31.761 1.00 33.95  ? 386 GLU B OE1   1 
ATOM   6878 O  OE2   . GLU B 1 386 ? -17.589 22.172  -33.726 1.00 34.07  ? 386 GLU B OE2   1 
ATOM   6879 N  N     . GLU B 1 387 ? -14.377 23.385  -28.099 1.00 31.59  ? 387 GLU B N     1 
ATOM   6880 C  CA    . GLU B 1 387 ? -13.483 23.760  -27.003 1.00 35.17  ? 387 GLU B CA    1 
ATOM   6881 C  C     . GLU B 1 387 ? -13.741 22.767  -25.889 1.00 32.57  ? 387 GLU B C     1 
ATOM   6882 O  O     . GLU B 1 387 ? -12.816 22.272  -25.245 1.00 34.13  ? 387 GLU B O     1 
ATOM   6883 C  CB    . GLU B 1 387 ? -13.809 25.157  -26.484 1.00 38.46  ? 387 GLU B CB    1 
ATOM   6884 C  CG    . GLU B 1 387 ? -13.076 26.324  -27.130 1.00 44.69  ? 387 GLU B CG    1 
ATOM   6885 C  CD    . GLU B 1 387 ? -13.437 27.682  -26.478 1.00 48.35  ? 387 GLU B CD    1 
ATOM   6886 O  OE1   . GLU B 1 387 ? -12.920 27.988  -25.374 1.00 52.88  ? 387 GLU B OE1   1 
ATOM   6887 O  OE2   . GLU B 1 387 ? -14.223 28.454  -27.078 1.00 49.35  ? 387 GLU B OE2   1 
ATOM   6888 N  N     . GLY B 1 388 ? -15.028 22.491  -25.690 1.00 29.51  ? 388 GLY B N     1 
ATOM   6889 C  CA    . GLY B 1 388 ? -15.526 21.508  -24.737 1.00 27.80  ? 388 GLY B CA    1 
ATOM   6890 C  C     . GLY B 1 388 ? -14.799 20.182  -24.772 1.00 26.93  ? 388 GLY B C     1 
ATOM   6891 O  O     . GLY B 1 388 ? -14.035 19.876  -23.844 1.00 29.33  ? 388 GLY B O     1 
ATOM   6892 N  N     . VAL B 1 389 ? -15.002 19.397  -25.832 1.00 24.02  ? 389 VAL B N     1 
ATOM   6893 C  CA    . VAL B 1 389 ? -14.409 18.062  -25.844 1.00 23.23  ? 389 VAL B CA    1 
ATOM   6894 C  C     . VAL B 1 389 ? -12.878 18.071  -25.903 1.00 26.11  ? 389 VAL B C     1 
ATOM   6895 O  O     . VAL B 1 389 ? -12.250 17.138  -25.398 1.00 26.77  ? 389 VAL B O     1 
ATOM   6896 C  CB    . VAL B 1 389 ? -15.045 17.088  -26.872 1.00 20.44  ? 389 VAL B CB    1 
ATOM   6897 C  CG1   . VAL B 1 389 ? -16.477 17.472  -27.158 1.00 18.96  ? 389 VAL B CG1   1 
ATOM   6898 C  CG2   . VAL B 1 389 ? -14.220 16.987  -28.144 1.00 21.62  ? 389 VAL B CG2   1 
ATOM   6899 N  N     . ARG B 1 390 ? -12.281 19.125  -26.473 1.00 28.57  ? 390 ARG B N     1 
ATOM   6900 C  CA    . ARG B 1 390 ? -10.815 19.278  -26.449 1.00 32.79  ? 390 ARG B CA    1 
ATOM   6901 C  C     . ARG B 1 390 ? -10.358 19.231  -25.010 1.00 34.61  ? 390 ARG B C     1 
ATOM   6902 O  O     . ARG B 1 390 ? -9.413  18.517  -24.668 1.00 36.20  ? 390 ARG B O     1 
ATOM   6903 C  CB    . ARG B 1 390 ? -10.354 20.595  -27.087 1.00 36.37  ? 390 ARG B CB    1 
ATOM   6904 C  CG    . ARG B 1 390 ? -8.836  20.668  -27.373 1.00 42.05  ? 390 ARG B CG    1 
ATOM   6905 C  CD    . ARG B 1 390 ? -8.414  21.949  -28.104 1.00 47.44  ? 390 ARG B CD    1 
ATOM   6906 N  NE    . ARG B 1 390 ? -9.188  22.192  -29.331 1.00 51.50  ? 390 ARG B NE    1 
ATOM   6907 C  CZ    . ARG B 1 390 ? -10.095 23.172  -29.496 1.00 54.61  ? 390 ARG B CZ    1 
ATOM   6908 N  NH1   . ARG B 1 390 ? -10.370 24.053  -28.522 1.00 57.11  ? 390 ARG B NH1   1 
ATOM   6909 N  NH2   . ARG B 1 390 ? -10.738 23.286  -30.658 1.00 54.35  ? 390 ARG B NH2   1 
ATOM   6910 N  N     . SER B 1 391 ? -11.065 19.982  -24.171 1.00 34.58  ? 391 SER B N     1 
ATOM   6911 C  CA    . SER B 1 391 ? -10.745 20.063  -22.764 1.00 37.28  ? 391 SER B CA    1 
ATOM   6912 C  C     . SER B 1 391 ? -11.005 18.740  -22.054 1.00 34.82  ? 391 SER B C     1 
ATOM   6913 O  O     . SER B 1 391 ? -10.198 18.310  -21.226 1.00 37.71  ? 391 SER B O     1 
ATOM   6914 C  CB    . SER B 1 391 ? -11.521 21.207  -22.112 1.00 38.78  ? 391 SER B CB    1 
ATOM   6915 O  OG    . SER B 1 391 ? -11.005 21.500  -20.823 1.00 44.35  ? 391 SER B OG    1 
ATOM   6916 N  N     . TYR B 1 392 ? -12.115 18.096  -22.402 1.00 29.94  ? 392 TYR B N     1 
ATOM   6917 C  CA    . TYR B 1 392 ? -12.514 16.831  -21.773 1.00 28.66  ? 392 TYR B CA    1 
ATOM   6918 C  C     . TYR B 1 392 ? -11.576 15.667  -22.135 1.00 29.06  ? 392 TYR B C     1 
ATOM   6919 O  O     . TYR B 1 392 ? -11.039 14.973  -21.254 1.00 31.12  ? 392 TYR B O     1 
ATOM   6920 C  CB    . TYR B 1 392 ? -13.970 16.490  -22.115 1.00 24.39  ? 392 TYR B CB    1 
ATOM   6921 C  CG    . TYR B 1 392 ? -14.425 15.193  -21.509 1.00 23.90  ? 392 TYR B CG    1 
ATOM   6922 C  CD1   . TYR B 1 392 ? -14.787 15.116  -20.167 1.00 25.97  ? 392 TYR B CD1   1 
ATOM   6923 C  CD2   . TYR B 1 392 ? -14.476 14.023  -22.277 1.00 21.58  ? 392 TYR B CD2   1 
ATOM   6924 C  CE1   . TYR B 1 392 ? -15.188 13.912  -19.612 1.00 27.31  ? 392 TYR B CE1   1 
ATOM   6925 C  CE2   . TYR B 1 392 ? -14.881 12.815  -21.730 1.00 20.65  ? 392 TYR B CE2   1 
ATOM   6926 C  CZ    . TYR B 1 392 ? -15.231 12.763  -20.402 1.00 24.37  ? 392 TYR B CZ    1 
ATOM   6927 O  OH    . TYR B 1 392 ? -15.634 11.564  -19.865 1.00 26.63  ? 392 TYR B OH    1 
ATOM   6928 N  N     . ALA B 1 393 ? -11.379 15.478  -23.439 1.00 27.33  ? 393 ALA B N     1 
ATOM   6929 C  CA    . ALA B 1 393 ? -10.490 14.448  -23.964 1.00 28.09  ? 393 ALA B CA    1 
ATOM   6930 C  C     . ALA B 1 393 ? -9.072  14.614  -23.429 1.00 33.01  ? 393 ALA B C     1 
ATOM   6931 O  O     . ALA B 1 393 ? -8.384  13.626  -23.141 1.00 35.06  ? 393 ALA B O     1 
ATOM   6932 C  CB    . ALA B 1 393 ? -10.485 14.496  -25.453 1.00 26.15  ? 393 ALA B CB    1 
ATOM   6933 N  N     . SER B 1 394 ? -8.640  15.864  -23.306 1.00 35.79  ? 394 SER B N     1 
ATOM   6934 C  CA    . SER B 1 394 ? -7.342  16.170  -22.742 1.00 41.48  ? 394 SER B CA    1 
ATOM   6935 C  C     . SER B 1 394 ? -7.195  15.611  -21.344 1.00 43.85  ? 394 SER B C     1 
ATOM   6936 O  O     . SER B 1 394 ? -6.173  15.019  -21.018 1.00 47.64  ? 394 SER B O     1 
ATOM   6937 C  CB    . SER B 1 394 ? -7.109  17.680  -22.704 1.00 44.95  ? 394 SER B CB    1 
ATOM   6938 O  OG    . SER B 1 394 ? -6.481  18.122  -23.897 1.00 47.33  ? 394 SER B OG    1 
ATOM   6939 N  N     . THR B 1 395 ? -8.221  15.786  -20.521 1.00 42.57  ? 395 THR B N     1 
ATOM   6940 C  CA    . THR B 1 395 ? -8.086  15.518  -19.091 1.00 46.14  ? 395 THR B CA    1 
ATOM   6941 C  C     . THR B 1 395 ? -8.561  14.129  -18.718 1.00 44.58  ? 395 THR B C     1 
ATOM   6942 O  O     . THR B 1 395 ? -8.105  13.556  -17.728 1.00 48.38  ? 395 THR B O     1 
ATOM   6943 C  CB    . THR B 1 395 ? -8.836  16.572  -18.251 1.00 47.54  ? 395 THR B CB    1 
ATOM   6944 O  OG1   . THR B 1 395 ? -10.203 16.625  -18.666 1.00 41.97  ? 395 THR B OG1   1 
ATOM   6945 C  CG2   . THR B 1 395 ? -8.207  17.947  -18.449 1.00 50.72  ? 395 THR B CG2   1 
ATOM   6946 N  N     . HIS B 1 396 ? -9.468  13.589  -19.525 1.00 39.50  ? 396 HIS B N     1 
ATOM   6947 C  CA    . HIS B 1 396 ? -10.146 12.355  -19.182 1.00 38.46  ? 396 HIS B CA    1 
ATOM   6948 C  C     . HIS B 1 396 ? -9.811  11.240  -20.146 1.00 36.62  ? 396 HIS B C     1 
ATOM   6949 O  O     . HIS B 1 396 ? -10.561 10.268  -20.249 1.00 35.16  ? 396 HIS B O     1 
ATOM   6950 C  CB    . HIS B 1 396 ? -11.660 12.583  -19.135 1.00 35.57  ? 396 HIS B CB    1 
ATOM   6951 C  CG    . HIS B 1 396 ? -12.109 13.399  -17.965 1.00 38.36  ? 396 HIS B CG    1 
ATOM   6952 N  ND1   . HIS B 1 396 ? -12.934 12.898  -16.984 1.00 40.47  ? 396 HIS B ND1   1 
ATOM   6953 C  CD2   . HIS B 1 396 ? -11.834 14.675  -17.608 1.00 40.82  ? 396 HIS B CD2   1 
ATOM   6954 C  CE1   . HIS B 1 396 ? -13.148 13.829  -16.074 1.00 43.82  ? 396 HIS B CE1   1 
ATOM   6955 N  NE2   . HIS B 1 396 ? -12.497 14.920  -16.433 1.00 44.09  ? 396 HIS B NE2   1 
ATOM   6956 N  N     . TRP B 1 397 ? -8.679  11.374  -20.838 1.00 37.76  ? 397 TRP B N     1 
ATOM   6957 C  CA    . TRP B 1 397 ? -8.231  10.375  -21.825 1.00 36.95  ? 397 TRP B CA    1 
ATOM   6958 C  C     . TRP B 1 397 ? -8.324  8.924   -21.309 1.00 38.49  ? 397 TRP B C     1 
ATOM   6959 O  O     . TRP B 1 397 ? -8.670  8.020   -22.063 1.00 36.49  ? 397 TRP B O     1 
ATOM   6960 C  CB    . TRP B 1 397 ? -6.805  10.684  -22.300 1.00 39.73  ? 397 TRP B CB    1 
ATOM   6961 C  CG    . TRP B 1 397 ? -5.827  10.751  -21.166 1.00 44.94  ? 397 TRP B CG    1 
ATOM   6962 C  CD1   . TRP B 1 397 ? -5.441  11.864  -20.491 1.00 47.70  ? 397 TRP B CD1   1 
ATOM   6963 C  CD2   . TRP B 1 397 ? -5.147  9.651   -20.550 1.00 47.97  ? 397 TRP B CD2   1 
ATOM   6964 N  NE1   . TRP B 1 397 ? -4.550  11.536  -19.502 1.00 52.96  ? 397 TRP B NE1   1 
ATOM   6965 C  CE2   . TRP B 1 397 ? -4.352  10.184  -19.511 1.00 53.15  ? 397 TRP B CE2   1 
ATOM   6966 C  CE3   . TRP B 1 397 ? -5.122  8.269   -20.783 1.00 47.19  ? 397 TRP B CE3   1 
ATOM   6967 C  CZ2   . TRP B 1 397 ? -3.537  9.390   -18.701 1.00 58.74  ? 397 TRP B CZ2   1 
ATOM   6968 C  CZ3   . TRP B 1 397 ? -4.318  7.474   -19.976 1.00 52.75  ? 397 TRP B CZ3   1 
ATOM   6969 C  CH2   . TRP B 1 397 ? -3.531  8.039   -18.946 1.00 58.28  ? 397 TRP B CH2   1 
ATOM   6970 N  N     . HIS B 1 398 ? -8.040  8.737   -20.016 1.00 42.87  ? 398 HIS B N     1 
ATOM   6971 C  CA    . HIS B 1 398 ? -7.973  7.424   -19.360 1.00 45.97  ? 398 HIS B CA    1 
ATOM   6972 C  C     . HIS B 1 398 ? -9.316  6.734   -19.227 1.00 44.07  ? 398 HIS B C     1 
ATOM   6973 O  O     . HIS B 1 398 ? -9.390  5.505   -19.192 1.00 45.75  ? 398 HIS B O     1 
ATOM   6974 C  CB    . HIS B 1 398 ? -7.355  7.556   -17.973 1.00 51.75  ? 398 HIS B CB    1 
ATOM   6975 C  CG    . HIS B 1 398 ? -7.933  8.674   -17.160 1.00 53.60  ? 398 HIS B CG    1 
ATOM   6976 N  ND1   . HIS B 1 398 ? -7.382  9.938   -17.128 1.00 55.22  ? 398 HIS B ND1   1 
ATOM   6977 C  CD2   . HIS B 1 398 ? -9.016  8.719   -16.351 1.00 54.59  ? 398 HIS B CD2   1 
ATOM   6978 C  CE1   . HIS B 1 398 ? -8.095  10.709  -16.328 1.00 56.30  ? 398 HIS B CE1   1 
ATOM   6979 N  NE2   . HIS B 1 398 ? -9.092  9.992   -15.842 1.00 56.16  ? 398 HIS B NE2   1 
ATOM   6980 N  N     . THR B 1 399 ? -10.381 7.516   -19.141 1.00 41.42  ? 399 THR B N     1 
ATOM   6981 C  CA    . THR B 1 399 ? -11.701 6.925   -19.002 1.00 40.36  ? 399 THR B CA    1 
ATOM   6982 C  C     . THR B 1 399 ? -12.292 6.517   -20.371 1.00 35.96  ? 399 THR B C     1 
ATOM   6983 O  O     . THR B 1 399 ? -13.371 5.915   -20.443 1.00 35.31  ? 399 THR B O     1 
ATOM   6984 C  CB    . THR B 1 399 ? -12.652 7.841   -18.171 1.00 40.89  ? 399 THR B CB    1 
ATOM   6985 O  OG1   . THR B 1 399 ? -13.773 7.071   -17.716 1.00 42.71  ? 399 THR B OG1   1 
ATOM   6986 C  CG2   . THR B 1 399 ? -13.133 9.061   -18.978 1.00 36.28  ? 399 THR B CG2   1 
ATOM   6987 N  N     . LEU B 1 400 ? -11.556 6.821   -21.443 1.00 33.48  ? 400 LEU B N     1 
ATOM   6988 C  CA    . LEU B 1 400 ? -12.052 6.650   -22.811 1.00 29.66  ? 400 LEU B CA    1 
ATOM   6989 C  C     . LEU B 1 400 ? -11.629 5.335   -23.437 1.00 30.84  ? 400 LEU B C     1 
ATOM   6990 O  O     . LEU B 1 400 ? -11.272 5.307   -24.604 1.00 29.55  ? 400 LEU B O     1 
ATOM   6991 C  CB    . LEU B 1 400 ? -11.590 7.813   -23.698 1.00 27.30  ? 400 LEU B CB    1 
ATOM   6992 C  CG    . LEU B 1 400 ? -11.865 9.241   -23.215 1.00 26.33  ? 400 LEU B CG    1 
ATOM   6993 C  CD1   . LEU B 1 400 ? -11.438 10.224  -24.276 1.00 25.27  ? 400 LEU B CD1   1 
ATOM   6994 C  CD2   . LEU B 1 400 ? -13.335 9.462   -22.836 1.00 24.44  ? 400 LEU B CD2   1 
ATOM   6995 N  N     . GLY B 1 401 ? -11.681 4.250   -22.664 1.00 34.04  ? 401 GLY B N     1 
ATOM   6996 C  CA    . GLY B 1 401 ? -11.247 2.939   -23.136 1.00 35.96  ? 401 GLY B CA    1 
ATOM   6997 C  C     . GLY B 1 401 ? -9.743  2.787   -23.005 1.00 38.70  ? 401 GLY B C     1 
ATOM   6998 O  O     . GLY B 1 401 ? -8.993  3.742   -23.213 1.00 38.16  ? 401 GLY B O     1 
ATOM   6999 N  N     . LYS B 1 402 ? -9.305  1.580   -22.664 1.00 42.24  ? 402 LYS B N     1 
ATOM   7000 C  CA    . LYS B 1 402 ? -7.903  1.294   -22.402 1.00 45.51  ? 402 LYS B CA    1 
ATOM   7001 C  C     . LYS B 1 402 ? -6.954  1.828   -23.472 1.00 44.53  ? 402 LYS B C     1 
ATOM   7002 O  O     . LYS B 1 402 ? -5.996  2.526   -23.160 1.00 46.08  ? 402 LYS B O     1 
ATOM   7003 C  CB    . LYS B 1 402 ? -7.713  -0.214  -22.219 1.00 49.57  ? 402 LYS B CB    1 
ATOM   7004 C  CG    . LYS B 1 402 ? -6.290  -0.708  -22.404 1.00 52.99  ? 402 LYS B CG    1 
ATOM   7005 C  CD    . LYS B 1 402 ? -5.387  -0.346  -21.244 1.00 56.40  ? 402 LYS B CD    1 
ATOM   7006 C  CE    . LYS B 1 402 ? -3.947  -0.513  -21.667 1.00 60.92  ? 402 LYS B CE    1 
ATOM   7007 N  NZ    . LYS B 1 402 ? -3.019  -0.736  -20.521 1.00 68.34  ? 402 LYS B NZ    1 
ATOM   7008 N  N     . ASN B 1 403 ? -7.226  1.502   -24.729 1.00 43.09  ? 403 ASN B N     1 
ATOM   7009 C  CA    . ASN B 1 403 ? -6.295  1.795   -25.813 1.00 43.88  ? 403 ASN B CA    1 
ATOM   7010 C  C     . ASN B 1 403 ? -6.578  3.076   -26.543 1.00 41.11  ? 403 ASN B C     1 
ATOM   7011 O  O     . ASN B 1 403 ? -5.647  3.839   -26.804 1.00 42.79  ? 403 ASN B O     1 
ATOM   7012 C  CB    . ASN B 1 403 ? -6.239  0.644   -26.800 1.00 45.32  ? 403 ASN B CB    1 
ATOM   7013 C  CG    . ASN B 1 403 ? -5.692  -0.606  -26.173 1.00 49.51  ? 403 ASN B CG    1 
ATOM   7014 O  OD1   . ASN B 1 403 ? -4.592  -0.607  -25.617 1.00 51.75  ? 403 ASN B OD1   1 
ATOM   7015 N  ND2   . ASN B 1 403 ? -6.461  -1.679  -26.243 1.00 50.86  ? 403 ASN B ND2   1 
ATOM   7016 N  N     . VAL B 1 404 ? -7.848  3.315   -26.878 1.00 38.01  ? 404 VAL B N     1 
ATOM   7017 C  CA    . VAL B 1 404 ? -8.245  4.588   -27.479 1.00 35.56  ? 404 VAL B CA    1 
ATOM   7018 C  C     . VAL B 1 404 ? -7.840  5.714   -26.567 1.00 35.95  ? 404 VAL B C     1 
ATOM   7019 O  O     . VAL B 1 404 ? -7.429  6.767   -27.034 1.00 35.92  ? 404 VAL B O     1 
ATOM   7020 C  CB    . VAL B 1 404 ? -9.751  4.688   -27.766 1.00 32.27  ? 404 VAL B CB    1 
ATOM   7021 C  CG1   . VAL B 1 404 ? -10.065 4.096   -29.118 1.00 32.67  ? 404 VAL B CG1   1 
ATOM   7022 C  CG2   . VAL B 1 404 ? -10.540 3.970   -26.707 1.00 33.34  ? 404 VAL B CG2   1 
ATOM   7023 N  N     . GLY B 1 405 ? -7.932  5.467   -25.264 1.00 37.74  ? 405 GLY B N     1 
ATOM   7024 C  CA    . GLY B 1 405 ? -7.498  6.424   -24.252 1.00 40.16  ? 405 GLY B CA    1 
ATOM   7025 C  C     . GLY B 1 405 ? -6.018  6.759   -24.318 1.00 44.57  ? 405 GLY B C     1 
ATOM   7026 O  O     . GLY B 1 405 ? -5.636  7.939   -24.284 1.00 45.55  ? 405 GLY B O     1 
ATOM   7027 N  N     . GLU B 1 406 ? -5.183  5.725   -24.408 1.00 47.92  ? 406 GLU B N     1 
ATOM   7028 C  CA    . GLU B 1 406 ? -3.752  5.923   -24.586 1.00 52.88  ? 406 GLU B CA    1 
ATOM   7029 C  C     . GLU B 1 406 ? -3.518  6.771   -25.831 1.00 51.35  ? 406 GLU B C     1 
ATOM   7030 O  O     . GLU B 1 406 ? -2.710  7.699   -25.815 1.00 54.26  ? 406 GLU B O     1 
ATOM   7031 C  CB    . GLU B 1 406 ? -3.029  4.584   -24.751 1.00 56.26  ? 406 GLU B CB    1 
ATOM   7032 C  CG    . GLU B 1 406 ? -2.966  3.683   -23.519 1.00 60.21  ? 406 GLU B CG    1 
ATOM   7033 C  CD    . GLU B 1 406 ? -2.404  2.287   -23.852 1.00 64.08  ? 406 GLU B CD    1 
ATOM   7034 O  OE1   . GLU B 1 406 ? -1.643  1.731   -23.018 1.00 71.43  ? 406 GLU B OE1   1 
ATOM   7035 O  OE2   . GLU B 1 406 ? -2.709  1.744   -24.952 1.00 64.75  ? 406 GLU B OE2   1 
ATOM   7036 N  N     . SER B 1 407 ? -4.244  6.443   -26.899 1.00 47.74  ? 407 SER B N     1 
ATOM   7037 C  CA    . SER B 1 407 ? -4.078  7.090   -28.198 1.00 47.10  ? 407 SER B CA    1 
ATOM   7038 C  C     . SER B 1 407 ? -4.459  8.566   -28.151 1.00 45.14  ? 407 SER B C     1 
ATOM   7039 O  O     . SER B 1 407 ? -3.701  9.414   -28.625 1.00 48.07  ? 407 SER B O     1 
ATOM   7040 C  CB    . SER B 1 407 ? -4.881  6.354   -29.279 1.00 44.85  ? 407 SER B CB    1 
ATOM   7041 O  OG    . SER B 1 407 ? -4.587  6.879   -30.560 1.00 45.79  ? 407 SER B OG    1 
ATOM   7042 N  N     . ILE B 1 408 ? -5.628  8.861   -27.578 1.00 40.62  ? 408 ILE B N     1 
ATOM   7043 C  CA    . ILE B 1 408 ? -6.081  10.234  -27.371 1.00 38.69  ? 408 ILE B CA    1 
ATOM   7044 C  C     . ILE B 1 408 ? -5.071  10.975  -26.505 1.00 42.50  ? 408 ILE B C     1 
ATOM   7045 O  O     . ILE B 1 408 ? -4.822  12.161  -26.707 1.00 43.73  ? 408 ILE B O     1 
ATOM   7046 C  CB    . ILE B 1 408 ? -7.464  10.284  -26.665 1.00 34.93  ? 408 ILE B CB    1 
ATOM   7047 C  CG1   . ILE B 1 408 ? -8.494  9.401   -27.390 1.00 31.43  ? 408 ILE B CG1   1 
ATOM   7048 C  CG2   . ILE B 1 408 ? -7.943  11.742  -26.467 1.00 32.99  ? 408 ILE B CG2   1 
ATOM   7049 C  CD1   . ILE B 1 408 ? -9.623  10.129  -28.057 1.00 27.59  ? 408 ILE B CD1   1 
ATOM   7050 N  N     . ARG B 1 409 ? -4.486  10.272  -25.543 1.00 44.81  ? 409 ARG B N     1 
ATOM   7051 C  CA    . ARG B 1 409 ? -3.509  10.892  -24.671 1.00 49.70  ? 409 ARG B CA    1 
ATOM   7052 C  C     . ARG B 1 409 ? -2.300  11.419  -25.457 1.00 54.28  ? 409 ARG B C     1 
ATOM   7053 O  O     . ARG B 1 409 ? -1.867  12.544  -25.227 1.00 57.33  ? 409 ARG B O     1 
ATOM   7054 C  CB    . ARG B 1 409 ? -3.074  9.938   -23.571 1.00 52.39  ? 409 ARG B CB    1 
ATOM   7055 C  CG    . ARG B 1 409 ? -2.411  10.636  -22.407 1.00 57.52  ? 409 ARG B CG    1 
ATOM   7056 C  CD    . ARG B 1 409 ? -1.279  9.803   -21.837 1.00 63.61  ? 409 ARG B CD    1 
ATOM   7057 N  NE    . ARG B 1 409 ? -0.868  10.291  -20.525 1.00 68.83  ? 409 ARG B NE    1 
ATOM   7058 C  CZ    . ARG B 1 409 ? 0.129   9.776   -19.816 1.00 75.21  ? 409 ARG B CZ    1 
ATOM   7059 N  NH1   . ARG B 1 409 ? 0.428   10.289  -18.629 1.00 80.52  ? 409 ARG B NH1   1 
ATOM   7060 N  NH2   . ARG B 1 409 ? 0.827   8.752   -20.290 1.00 76.64  ? 409 ARG B NH2   1 
ATOM   7061 N  N     . GLU B 1 410 ? -1.778  10.620  -26.387 1.00 55.51  ? 410 GLU B N     1 
ATOM   7062 C  CA    . GLU B 1 410 ? -0.692  11.056  -27.262 1.00 60.67  ? 410 GLU B CA    1 
ATOM   7063 C  C     . GLU B 1 410 ? -1.111  12.241  -28.096 1.00 59.78  ? 410 GLU B C     1 
ATOM   7064 O  O     . GLU B 1 410 ? -0.475  13.291  -28.057 1.00 64.11  ? 410 GLU B O     1 
ATOM   7065 C  CB    . GLU B 1 410 ? -0.271  9.942   -28.210 1.00 61.92  ? 410 GLU B CB    1 
ATOM   7066 C  CG    . GLU B 1 410 ? 0.780   9.008   -27.660 1.00 67.95  ? 410 GLU B CG    1 
ATOM   7067 C  CD    . GLU B 1 410 ? 0.478   7.555   -27.989 1.00 68.00  ? 410 GLU B CD    1 
ATOM   7068 O  OE1   . GLU B 1 410 ? 0.724   6.681   -27.120 1.00 70.50  ? 410 GLU B OE1   1 
ATOM   7069 O  OE2   . GLU B 1 410 ? -0.024  7.288   -29.108 1.00 65.88  ? 410 GLU B OE2   1 
ATOM   7070 N  N     . TYR B 1 411 ? -2.192  12.068  -28.850 1.00 55.07  ? 411 TYR B N     1 
ATOM   7071 C  CA    . TYR B 1 411 ? -2.600  13.047  -29.847 1.00 54.89  ? 411 TYR B CA    1 
ATOM   7072 C  C     . TYR B 1 411 ? -4.015  12.846  -30.327 1.00 48.96  ? 411 TYR B C     1 
ATOM   7073 O  O     . TYR B 1 411 ? -4.487  11.714  -30.457 1.00 46.34  ? 411 TYR B O     1 
ATOM   7074 C  CB    . TYR B 1 411 ? -1.692  12.966  -31.069 1.00 60.35  ? 411 TYR B CB    1 
ATOM   7075 C  CG    . TYR B 1 411 ? -2.010  13.997  -32.116 1.00 61.90  ? 411 TYR B CG    1 
ATOM   7076 C  CD1   . TYR B 1 411 ? -2.736  13.661  -33.260 1.00 59.48  ? 411 TYR B CD1   1 
ATOM   7077 C  CD2   . TYR B 1 411 ? -1.594  15.321  -31.952 1.00 66.97  ? 411 TYR B CD2   1 
ATOM   7078 C  CE1   . TYR B 1 411 ? -3.029  14.615  -34.226 1.00 62.47  ? 411 TYR B CE1   1 
ATOM   7079 C  CE2   . TYR B 1 411 ? -1.877  16.288  -32.905 1.00 69.24  ? 411 TYR B CE2   1 
ATOM   7080 C  CZ    . TYR B 1 411 ? -2.593  15.934  -34.045 1.00 66.97  ? 411 TYR B CZ    1 
ATOM   7081 O  OH    . TYR B 1 411 ? -2.866  16.913  -34.985 1.00 69.18  ? 411 TYR B OH    1 
ATOM   7082 N  N     . PHE B 1 412 ? -4.666  13.968  -30.616 1.00 47.60  ? 412 PHE B N     1 
ATOM   7083 C  CA    . PHE B 1 412 ? -5.960  13.999  -31.277 1.00 43.20  ? 412 PHE B CA    1 
ATOM   7084 C  C     . PHE B 1 412 ? -6.177  15.402  -31.798 1.00 45.07  ? 412 PHE B C     1 
ATOM   7085 O  O     . PHE B 1 412 ? -5.589  16.363  -31.298 1.00 48.27  ? 412 PHE B O     1 
ATOM   7086 C  CB    . PHE B 1 412 ? -7.086  13.636  -30.310 1.00 37.63  ? 412 PHE B CB    1 
ATOM   7087 C  CG    . PHE B 1 412 ? -7.267  14.628  -29.198 1.00 37.05  ? 412 PHE B CG    1 
ATOM   7088 C  CD1   . PHE B 1 412 ? -8.246  15.605  -29.273 1.00 34.53  ? 412 PHE B CD1   1 
ATOM   7089 C  CD2   . PHE B 1 412 ? -6.448  14.601  -28.087 1.00 38.74  ? 412 PHE B CD2   1 
ATOM   7090 C  CE1   . PHE B 1 412 ? -8.411  16.521  -28.256 1.00 33.86  ? 412 PHE B CE1   1 
ATOM   7091 C  CE2   . PHE B 1 412 ? -6.612  15.517  -27.070 1.00 38.89  ? 412 PHE B CE2   1 
ATOM   7092 C  CZ    . PHE B 1 412 ? -7.594  16.475  -27.154 1.00 37.13  ? 412 PHE B CZ    1 
ATOM   7093 N  N     . GLU B 1 413 ? -7.018  15.516  -32.810 1.00 44.03  ? 413 GLU B N     1 
ATOM   7094 C  CA    . GLU B 1 413 ? -7.498  16.812  -33.241 1.00 45.67  ? 413 GLU B CA    1 
ATOM   7095 C  C     . GLU B 1 413 ? -9.006  16.775  -33.260 1.00 40.97  ? 413 GLU B C     1 
ATOM   7096 O  O     . GLU B 1 413 ? -9.609  15.710  -33.385 1.00 38.36  ? 413 GLU B O     1 
ATOM   7097 C  CB    . GLU B 1 413 ? -6.929  17.206  -34.597 1.00 50.56  ? 413 GLU B CB    1 
ATOM   7098 C  CG    . GLU B 1 413 ? -6.188  16.092  -35.307 1.00 53.80  ? 413 GLU B CG    1 
ATOM   7099 C  CD    . GLU B 1 413 ? -5.510  16.550  -36.590 1.00 60.88  ? 413 GLU B CD    1 
ATOM   7100 O  OE1   . GLU B 1 413 ? -4.702  17.513  -36.553 1.00 66.40  ? 413 GLU B OE1   1 
ATOM   7101 O  OE2   . GLU B 1 413 ? -5.785  15.931  -37.642 1.00 63.58  ? 413 GLU B OE2   1 
ATOM   7102 N  N     . ILE B 1 414 ? -9.610  17.938  -33.063 1.00 41.05  ? 414 ILE B N     1 
ATOM   7103 C  CA    . ILE B 1 414 ? -11.042 18.080  -33.162 1.00 37.64  ? 414 ILE B CA    1 
ATOM   7104 C  C     . ILE B 1 414 ? -11.276 18.675  -34.525 1.00 40.86  ? 414 ILE B C     1 
ATOM   7105 O  O     . ILE B 1 414 ? -10.815 19.773  -34.807 1.00 44.84  ? 414 ILE B O     1 
ATOM   7106 C  CB    . ILE B 1 414 ? -11.614 18.968  -32.033 1.00 35.77  ? 414 ILE B CB    1 
ATOM   7107 C  CG1   . ILE B 1 414 ? -11.927 18.120  -30.809 1.00 32.03  ? 414 ILE B CG1   1 
ATOM   7108 C  CG2   . ILE B 1 414 ? -12.916 19.601  -32.443 1.00 34.51  ? 414 ILE B CG2   1 
ATOM   7109 C  CD1   . ILE B 1 414 ? -10.844 18.074  -29.822 1.00 33.78  ? 414 ILE B CD1   1 
ATOM   7110 N  N     . ILE B 1 415 ? -11.958 17.931  -35.381 1.00 40.52  ? 415 ILE B N     1 
ATOM   7111 C  CA    . ILE B 1 415 ? -12.200 18.380  -36.739 1.00 45.20  ? 415 ILE B CA    1 
ATOM   7112 C  C     . ILE B 1 415 ? -13.671 18.760  -36.920 1.00 43.64  ? 415 ILE B C     1 
ATOM   7113 O  O     . ILE B 1 415 ? -14.564 18.038  -36.488 1.00 39.76  ? 415 ILE B O     1 
ATOM   7114 C  CB    . ILE B 1 415 ? -11.727 17.326  -37.776 1.00 47.83  ? 415 ILE B CB    1 
ATOM   7115 C  CG1   . ILE B 1 415 ? -10.222 17.424  -37.988 1.00 53.10  ? 415 ILE B CG1   1 
ATOM   7116 C  CG2   . ILE B 1 415 ? -12.348 17.552  -39.117 1.00 51.53  ? 415 ILE B CG2   1 
ATOM   7117 C  CD1   . ILE B 1 415 ? -9.426  16.468  -37.161 1.00 53.16  ? 415 ILE B CD1   1 
ATOM   7118 N  N     . SER B 1 416 ? -13.912 19.913  -37.535 1.00 47.91  ? 416 SER B N     1 
ATOM   7119 C  CA    . SER B 1 416 ? -15.268 20.373  -37.799 1.00 47.93  ? 416 SER B CA    1 
ATOM   7120 C  C     . SER B 1 416 ? -15.277 21.304  -38.998 1.00 54.11  ? 416 SER B C     1 
ATOM   7121 O  O     . SER B 1 416 ? -14.220 21.590  -39.567 1.00 59.20  ? 416 SER B O     1 
ATOM   7122 C  CB    . SER B 1 416 ? -15.832 21.107  -36.586 1.00 44.97  ? 416 SER B CB    1 
ATOM   7123 O  OG    . SER B 1 416 ? -15.534 22.492  -36.659 1.00 48.85  ? 416 SER B OG    1 
ATOM   7124 N  N     . GLY B 1 417 ? -16.470 21.783  -39.358 1.00 54.77  ? 417 GLY B N     1 
ATOM   7125 C  CA    . GLY B 1 417 ? -16.649 22.689  -40.488 1.00 61.28  ? 417 GLY B CA    1 
ATOM   7126 C  C     . GLY B 1 417 ? -16.158 22.062  -41.779 1.00 66.83  ? 417 GLY B C     1 
ATOM   7127 O  O     . GLY B 1 417 ? -16.305 20.849  -41.993 1.00 65.18  ? 417 GLY B O     1 
ATOM   7128 N  N     . GLU B 1 418 ? -15.535 22.886  -42.620 1.00 74.12  ? 418 GLU B N     1 
ATOM   7129 C  CA    . GLU B 1 418 ? -15.080 22.461  -43.945 1.00 80.81  ? 418 GLU B CA    1 
ATOM   7130 C  C     . GLU B 1 418 ? -14.112 21.259  -43.936 1.00 80.32  ? 418 GLU B C     1 
ATOM   7131 O  O     . GLU B 1 418 ? -14.220 20.385  -44.793 1.00 82.70  ? 418 GLU B O     1 
ATOM   7132 C  CB    . GLU B 1 418 ? -14.489 23.657  -44.705 1.00 89.25  ? 418 GLU B CB    1 
ATOM   7133 C  CG    . GLU B 1 418 ? -14.077 23.381  -46.171 1.00 98.80  ? 418 GLU B CG    1 
ATOM   7134 C  CD    . GLU B 1 418 ? -15.247 23.354  -47.164 1.00 102.94 ? 418 GLU B CD    1 
ATOM   7135 O  OE1   . GLU B 1 418 ? -16.430 23.432  -46.741 1.00 99.19  ? 418 GLU B OE1   1 
ATOM   7136 O  OE2   . GLU B 1 418 ? -14.971 23.254  -48.382 1.00 110.15 ? 418 GLU B OE2   1 
ATOM   7137 N  N     . LYS B 1 419 ? -13.192 21.201  -42.971 1.00 77.89  ? 419 LYS B N     1 
ATOM   7138 C  CA    . LYS B 1 419 ? -12.163 20.142  -42.952 1.00 78.41  ? 419 LYS B CA    1 
ATOM   7139 C  C     . LYS B 1 419 ? -12.742 18.739  -42.741 1.00 72.69  ? 419 LYS B C     1 
ATOM   7140 O  O     . LYS B 1 419 ? -12.165 17.739  -43.199 1.00 74.59  ? 419 LYS B O     1 
ATOM   7141 C  CB    . LYS B 1 419 ? -11.080 20.413  -41.894 1.00 77.29  ? 419 LYS B CB    1 
ATOM   7142 C  CG    . LYS B 1 419 ? -9.713  19.769  -42.250 1.00 82.84  ? 419 LYS B CG    1 
ATOM   7143 C  CD    . LYS B 1 419 ? -8.886  19.229  -41.039 1.00 79.34  ? 419 LYS B CD    1 
ATOM   7144 C  CE    . LYS B 1 419 ? -8.519  20.311  -39.992 1.00 80.85  ? 419 LYS B CE    1 
ATOM   7145 N  NZ    . LYS B 1 419 ? -7.911  21.564  -40.565 1.00 89.01  ? 419 LYS B NZ    1 
ATOM   7146 N  N     . LEU B 1 420 ? -13.880 18.680  -42.053 1.00 66.13  ? 420 LEU B N     1 
ATOM   7147 C  CA    . LEU B 1 420 ? -14.486 17.414  -41.666 1.00 60.82  ? 420 LEU B CA    1 
ATOM   7148 C  C     . LEU B 1 420 ? -14.985 16.599  -42.856 1.00 64.15  ? 420 LEU B C     1 
ATOM   7149 O  O     . LEU B 1 420 ? -14.758 15.383  -42.931 1.00 63.70  ? 420 LEU B O     1 
ATOM   7150 C  CB    . LEU B 1 420 ? -15.628 17.663  -40.684 1.00 54.89  ? 420 LEU B CB    1 
ATOM   7151 C  CG    . LEU B 1 420 ? -16.408 16.434  -40.233 1.00 49.87  ? 420 LEU B CG    1 
ATOM   7152 C  CD1   . LEU B 1 420 ? -15.599 15.628  -39.254 1.00 46.73  ? 420 LEU B CD1   1 
ATOM   7153 C  CD2   . LEU B 1 420 ? -17.701 16.862  -39.608 1.00 46.33  ? 420 LEU B CD2   1 
ATOM   7154 N  N     . PHE B 1 421 ? -15.648 17.287  -43.783 1.00 67.77  ? 421 PHE B N     1 
ATOM   7155 C  CA    . PHE B 1 421 ? -16.384 16.637  -44.863 1.00 71.11  ? 421 PHE B CA    1 
ATOM   7156 C  C     . PHE B 1 421 ? -15.502 15.946  -45.900 1.00 77.17  ? 421 PHE B C     1 
ATOM   7157 O  O     . PHE B 1 421 ? -15.952 15.031  -46.595 1.00 79.85  ? 421 PHE B O     1 
ATOM   7158 C  CB    . PHE B 1 421 ? -17.356 17.623  -45.509 1.00 74.14  ? 421 PHE B CB    1 
ATOM   7159 C  CG    . PHE B 1 421 ? -18.300 18.252  -44.528 1.00 68.72  ? 421 PHE B CG    1 
ATOM   7160 C  CD1   . PHE B 1 421 ? -18.197 19.597  -44.210 1.00 68.88  ? 421 PHE B CD1   1 
ATOM   7161 C  CD2   . PHE B 1 421 ? -19.274 17.484  -43.887 1.00 64.84  ? 421 PHE B CD2   1 
ATOM   7162 C  CE1   . PHE B 1 421 ? -19.062 20.181  -43.286 1.00 64.30  ? 421 PHE B CE1   1 
ATOM   7163 C  CE2   . PHE B 1 421 ? -20.146 18.056  -42.957 1.00 60.01  ? 421 PHE B CE2   1 
ATOM   7164 C  CZ    . PHE B 1 421 ? -20.038 19.411  -42.661 1.00 59.81  ? 421 PHE B CZ    1 
ATOM   7165 N  N     . LYS B 1 422 ? -14.245 16.371  -45.992 1.00 79.90  ? 422 LYS B N     1 
ATOM   7166 C  CA    . LYS B 1 422 ? -13.296 15.708  -46.877 1.00 85.66  ? 422 LYS B CA    1 
ATOM   7167 C  C     . LYS B 1 422 ? -12.571 14.565  -46.150 1.00 81.63  ? 422 LYS B C     1 
ATOM   7168 O  O     . LYS B 1 422 ? -11.470 14.176  -46.532 1.00 86.16  ? 422 LYS B O     1 
ATOM   7169 C  CB    . LYS B 1 422 ? -12.329 16.706  -47.566 1.00 93.17  ? 422 LYS B CB    1 
ATOM   7170 C  CG    . LYS B 1 422 ? -11.772 17.832  -46.680 1.00 90.94  ? 422 LYS B CG    1 
ATOM   7171 C  CD    . LYS B 1 422 ? -10.296 18.188  -46.988 1.00 97.66  ? 422 LYS B CD    1 
ATOM   7172 C  CE    . LYS B 1 422 ? -10.120 19.246  -48.081 1.00 106.60 ? 422 LYS B CE    1 
ATOM   7173 N  NZ    . LYS B 1 422 ? -9.550  18.695  -49.343 1.00 114.84 ? 422 LYS B NZ    1 
ATOM   7174 N  N     . GLU B 1 423 ? -13.208 14.017  -45.117 1.00 73.83  ? 423 GLU B N     1 
ATOM   7175 C  CA    . GLU B 1 423 ? -12.700 12.812  -44.443 1.00 70.53  ? 423 GLU B CA    1 
ATOM   7176 C  C     . GLU B 1 423 ? -13.658 11.604  -44.534 1.00 68.41  ? 423 GLU B C     1 
ATOM   7177 O  O     . GLU B 1 423 ? -14.846 11.782  -44.784 1.00 67.86  ? 423 GLU B O     1 
ATOM   7178 C  CB    . GLU B 1 423 ? -12.279 13.127  -43.003 1.00 64.67  ? 423 GLU B CB    1 
ATOM   7179 C  CG    . GLU B 1 423 ? -10.941 13.873  -42.949 1.00 69.07  ? 423 GLU B CG    1 
ATOM   7180 C  CD    . GLU B 1 423 ? -10.022 13.391  -41.838 1.00 67.23  ? 423 GLU B CD    1 
ATOM   7181 O  OE1   . GLU B 1 423 ? -9.057  12.649  -42.126 1.00 70.15  ? 423 GLU B OE1   1 
ATOM   7182 O  OE2   . GLU B 1 423 ? -10.268 13.754  -40.670 1.00 64.10  ? 423 GLU B OE2   1 
ATOM   7183 N  N     . PRO B 1 424 ? -13.141 10.373  -44.339 1.00 68.00  ? 424 PRO B N     1 
ATOM   7184 C  CA    . PRO B 1 424 ? -13.908 9.170   -44.695 1.00 68.94  ? 424 PRO B CA    1 
ATOM   7185 C  C     . PRO B 1 424 ? -15.067 8.829   -43.742 1.00 63.00  ? 424 PRO B C     1 
ATOM   7186 O  O     . PRO B 1 424 ? -15.318 7.653   -43.465 1.00 62.67  ? 424 PRO B O     1 
ATOM   7187 C  CB    . PRO B 1 424 ? -12.848 8.067   -44.646 1.00 70.77  ? 424 PRO B CB    1 
ATOM   7188 C  CG    . PRO B 1 424 ? -11.897 8.530   -43.605 1.00 66.92  ? 424 PRO B CG    1 
ATOM   7189 C  CD    . PRO B 1 424 ? -11.826 10.025  -43.762 1.00 67.50  ? 424 PRO B CD    1 
ATOM   7190 N  N     . VAL B 1 425 ? -15.784 9.842   -43.275 1.00 59.15  ? 425 VAL B N     1 
ATOM   7191 C  CA    . VAL B 1 425 ? -16.809 9.645   -42.256 1.00 53.61  ? 425 VAL B CA    1 
ATOM   7192 C  C     . VAL B 1 425 ? -18.221 10.006  -42.714 1.00 54.63  ? 425 VAL B C     1 
ATOM   7193 O  O     . VAL B 1 425 ? -19.147 10.025  -41.900 1.00 50.92  ? 425 VAL B O     1 
ATOM   7194 C  CB    . VAL B 1 425 ? -16.476 10.471  -41.008 1.00 48.35  ? 425 VAL B CB    1 
ATOM   7195 C  CG1   . VAL B 1 425 ? -15.252 9.900   -40.317 1.00 46.83  ? 425 VAL B CG1   1 
ATOM   7196 C  CG2   . VAL B 1 425 ? -16.268 11.952  -41.376 1.00 49.20  ? 425 VAL B CG2   1 
ATOM   7197 N  N     . THR B 1 426 ? -18.377 10.284  -44.011 1.00 60.30  ? 426 THR B N     1 
ATOM   7198 C  CA    . THR B 1 426 ? -19.639 10.775  -44.587 1.00 62.44  ? 426 THR B CA    1 
ATOM   7199 C  C     . THR B 1 426 ? -20.777 9.769   -44.456 1.00 62.76  ? 426 THR B C     1 
ATOM   7200 O  O     . THR B 1 426 ? -21.851 10.112  -43.956 1.00 60.60  ? 426 THR B O     1 
ATOM   7201 C  CB    . THR B 1 426 ? -19.487 11.147  -46.071 1.00 69.88  ? 426 THR B CB    1 
ATOM   7202 O  OG1   . THR B 1 426 ? -18.846 10.066  -46.744 1.00 75.13  ? 426 THR B OG1   1 
ATOM   7203 C  CG2   . THR B 1 426 ? -18.652 12.409  -46.246 1.00 70.21  ? 426 THR B CG2   1 
ATOM   7204 N  N     . ALA B 1 427 ? -20.538 8.538   -44.906 1.00 66.11  ? 427 ALA B N     1 
ATOM   7205 C  CA    . ALA B 1 427 ? -21.468 7.431   -44.699 1.00 67.21  ? 427 ALA B CA    1 
ATOM   7206 C  C     . ALA B 1 427 ? -22.065 7.441   -43.290 1.00 61.11  ? 427 ALA B C     1 
ATOM   7207 O  O     . ALA B 1 427 ? -23.276 7.303   -43.123 1.00 61.65  ? 427 ALA B O     1 
ATOM   7208 C  CB    . ALA B 1 427 ? -20.773 6.095   -44.974 1.00 70.46  ? 427 ALA B CB    1 
ATOM   7209 N  N     . GLU B 1 428 ? -21.207 7.624   -42.286 1.00 56.19  ? 428 GLU B N     1 
ATOM   7210 C  CA    . GLU B 1 428 ? -21.624 7.617   -40.885 1.00 51.55  ? 428 GLU B CA    1 
ATOM   7211 C  C     . GLU B 1 428 ? -22.394 8.853   -40.470 1.00 48.82  ? 428 GLU B C     1 
ATOM   7212 O  O     . GLU B 1 428 ? -23.226 8.773   -39.574 1.00 46.88  ? 428 GLU B O     1 
ATOM   7213 C  CB    . GLU B 1 428 ? -20.435 7.415   -39.950 1.00 47.81  ? 428 GLU B CB    1 
ATOM   7214 C  CG    . GLU B 1 428 ? -20.010 5.964   -39.795 1.00 51.72  ? 428 GLU B CG    1 
ATOM   7215 C  CD    . GLU B 1 428 ? -19.259 5.426   -41.010 1.00 59.80  ? 428 GLU B CD    1 
ATOM   7216 O  OE1   . GLU B 1 428 ? -18.817 6.236   -41.864 1.00 62.96  ? 428 GLU B OE1   1 
ATOM   7217 O  OE2   . GLU B 1 428 ? -19.101 4.186   -41.106 1.00 63.73  ? 428 GLU B OE2   1 
ATOM   7218 N  N     . LEU B 1 429 ? -22.113 9.991   -41.101 1.00 49.61  ? 429 LEU B N     1 
ATOM   7219 C  CA    . LEU B 1 429 ? -22.857 11.216  -40.819 1.00 48.00  ? 429 LEU B CA    1 
ATOM   7220 C  C     . LEU B 1 429 ? -24.294 11.102  -41.323 1.00 51.51  ? 429 LEU B C     1 
ATOM   7221 O  O     . LEU B 1 429 ? -25.225 11.421  -40.590 1.00 49.77  ? 429 LEU B O     1 
ATOM   7222 C  CB    . LEU B 1 429 ? -22.165 12.446  -41.413 1.00 49.10  ? 429 LEU B CB    1 
ATOM   7223 C  CG    . LEU B 1 429 ? -20.811 12.913  -40.838 1.00 47.28  ? 429 LEU B CG    1 
ATOM   7224 C  CD1   . LEU B 1 429 ? -20.150 13.992  -41.724 1.00 50.20  ? 429 LEU B CD1   1 
ATOM   7225 C  CD2   . LEU B 1 429 ? -20.920 13.411  -39.394 1.00 42.49  ? 429 LEU B CD2   1 
ATOM   7226 N  N     . CYS B 1 430 ? -24.469 10.630  -42.560 1.00 57.23  ? 430 CYS B N     1 
ATOM   7227 C  CA    . CYS B 1 430 ? -25.799 10.400  -43.129 1.00 61.78  ? 430 CYS B CA    1 
ATOM   7228 C  C     . CYS B 1 430 ? -26.646 9.583   -42.190 1.00 60.47  ? 430 CYS B C     1 
ATOM   7229 O  O     . CYS B 1 430 ? -27.680 10.041  -41.726 1.00 60.04  ? 430 CYS B O     1 
ATOM   7230 C  CB    . CYS B 1 430 ? -25.708 9.663   -44.459 1.00 68.80  ? 430 CYS B CB    1 
ATOM   7231 S  SG    . CYS B 1 430 ? -25.304 10.724  -45.816 1.00 74.04  ? 430 CYS B SG    1 
ATOM   7232 N  N     . GLU B 1 431 ? -26.181 8.372   -41.912 1.00 60.75  ? 431 GLU B N     1 
ATOM   7233 C  CA    . GLU B 1 431 ? -26.862 7.445   -41.026 1.00 60.81  ? 431 GLU B CA    1 
ATOM   7234 C  C     . GLU B 1 431 ? -27.275 8.148   -39.741 1.00 55.70  ? 431 GLU B C     1 
ATOM   7235 O  O     . GLU B 1 431 ? -28.449 8.137   -39.358 1.00 57.17  ? 431 GLU B O     1 
ATOM   7236 C  CB    . GLU B 1 431 ? -25.952 6.246   -40.724 1.00 60.53  ? 431 GLU B CB    1 
ATOM   7237 C  CG    . GLU B 1 431 ? -26.672 5.049   -40.134 1.00 64.27  ? 431 GLU B CG    1 
ATOM   7238 C  CD    . GLU B 1 431 ? -27.932 4.690   -40.915 1.00 73.20  ? 431 GLU B CD    1 
ATOM   7239 O  OE1   . GLU B 1 431 ? -29.030 4.711   -40.314 1.00 75.25  ? 431 GLU B OE1   1 
ATOM   7240 O  OE2   . GLU B 1 431 ? -27.831 4.414   -42.133 1.00 78.68  ? 431 GLU B OE2   1 
ATOM   7241 N  N     . MET B 1 432 ? -26.294 8.783   -39.110 1.00 50.44  ? 432 MET B N     1 
ATOM   7242 C  CA    . MET B 1 432 ? -26.463 9.498   -37.859 1.00 46.27  ? 432 MET B CA    1 
ATOM   7243 C  C     . MET B 1 432 ? -27.493 10.627  -37.968 1.00 46.59  ? 432 MET B C     1 
ATOM   7244 O  O     . MET B 1 432 ? -28.293 10.829  -37.053 1.00 45.98  ? 432 MET B O     1 
ATOM   7245 C  CB    . MET B 1 432 ? -25.103 10.040  -37.422 1.00 41.62  ? 432 MET B CB    1 
ATOM   7246 C  CG    . MET B 1 432 ? -25.096 10.883  -36.174 1.00 38.22  ? 432 MET B CG    1 
ATOM   7247 S  SD    . MET B 1 432 ? -23.426 11.478  -35.801 1.00 35.99  ? 432 MET B SD    1 
ATOM   7248 C  CE    . MET B 1 432 ? -23.091 12.468  -37.259 1.00 39.12  ? 432 MET B CE    1 
ATOM   7249 N  N     . MET B 1 433 ? -27.490 11.343  -39.091 1.00 48.44  ? 433 MET B N     1 
ATOM   7250 C  CA    . MET B 1 433 ? -28.350 12.513  -39.246 1.00 48.75  ? 433 MET B CA    1 
ATOM   7251 C  C     . MET B 1 433 ? -29.698 12.208  -39.870 1.00 54.03  ? 433 MET B C     1 
ATOM   7252 O  O     . MET B 1 433 ? -30.496 13.115  -40.073 1.00 55.55  ? 433 MET B O     1 
ATOM   7253 C  CB    . MET B 1 433 ? -27.646 13.600  -40.052 1.00 49.01  ? 433 MET B CB    1 
ATOM   7254 C  CG    . MET B 1 433 ? -26.402 14.155  -39.382 1.00 44.19  ? 433 MET B CG    1 
ATOM   7255 S  SD    . MET B 1 433 ? -25.806 15.657  -40.162 1.00 45.44  ? 433 MET B SD    1 
ATOM   7256 C  CE    . MET B 1 433 ? -25.649 15.136  -41.871 1.00 51.85  ? 433 MET B CE    1 
ATOM   7257 N  N     . GLY B 1 434 ? -29.942 10.939  -40.176 1.00 57.40  ? 434 GLY B N     1 
ATOM   7258 C  CA    . GLY B 1 434 ? -31.221 10.494  -40.737 1.00 63.76  ? 434 GLY B CA    1 
ATOM   7259 C  C     . GLY B 1 434 ? -31.540 11.029  -42.123 1.00 68.99  ? 434 GLY B C     1 
ATOM   7260 O  O     . GLY B 1 434 ? -32.700 11.293  -42.451 1.00 73.41  ? 434 GLY B O     1 
ATOM   7261 N  N     . VAL B 1 435 ? -30.504 11.169  -42.939 1.00 69.17  ? 435 VAL B N     1 
ATOM   7262 C  CA    . VAL B 1 435 ? -30.626 11.724  -44.281 1.00 74.84  ? 435 VAL B CA    1 
ATOM   7263 C  C     . VAL B 1 435 ? -31.348 10.774  -45.249 1.00 83.38  ? 435 VAL B C     1 
ATOM   7264 O  O     . VAL B 1 435 ? -31.265 9.545   -45.124 1.00 84.80  ? 435 VAL B O     1 
ATOM   7265 C  CB    . VAL B 1 435 ? -29.233 12.099  -44.842 1.00 73.44  ? 435 VAL B CB    1 
ATOM   7266 C  CG1   . VAL B 1 435 ? -29.353 12.843  -46.160 1.00 79.45  ? 435 VAL B CG1   1 
ATOM   7267 C  CG2   . VAL B 1 435 ? -28.456 12.933  -43.829 1.00 65.94  ? 435 VAL B CG2   1 
ATOM   7268 N  N     . LYS B 1 436 ? -32.079 11.370  -46.189 1.00 89.75  ? 436 LYS B N     1 
ATOM   7269 C  CA    . LYS B 1 436 ? -32.682 10.665  -47.309 1.00 99.25  ? 436 LYS B CA    1 
ATOM   7270 C  C     . LYS B 1 436 ? -32.196 11.398  -48.556 1.00 104.16 ? 436 LYS B C     1 
ATOM   7271 O  O     . LYS B 1 436 ? -32.879 12.305  -49.043 1.00 108.25 ? 436 LYS B O     1 
ATOM   7272 C  CB    . LYS B 1 436 ? -34.213 10.742  -47.246 1.00 103.94 ? 436 LYS B CB    1 
ATOM   7273 C  CG    . LYS B 1 436 ? -34.819 11.027  -45.880 1.00 97.63  ? 436 LYS B CG    1 
ATOM   7274 C  CD    . LYS B 1 436 ? -36.324 11.148  -46.011 1.00 103.87 ? 436 LYS B CD    1 
ATOM   7275 C  CE    . LYS B 1 436 ? -37.023 11.130  -44.665 1.00 100.20 ? 436 LYS B CE    1 
ATOM   7276 N  NZ    . LYS B 1 436 ? -38.498 10.926  -44.809 1.00 107.88 ? 436 LYS B NZ    1 
ATOM   7277 N  N     . ASP B 1 437 ? -31.026 11.002  -49.066 1.00 104.78 ? 437 ASP B N     1 
ATOM   7278 C  CA    . ASP B 1 437 ? -30.291 11.731  -50.136 1.00 108.87 ? 437 ASP B CA    1 
ATOM   7279 C  C     . ASP B 1 437 ? -29.573 12.977  -49.570 1.00 101.97 ? 437 ASP B C     1 
ATOM   7280 O  O     . ASP B 1 437 ? -29.379 13.993  -50.257 1.00 104.91 ? 437 ASP B O     1 
ATOM   7281 C  CB    . ASP B 1 437 ? -31.187 12.118  -51.339 1.00 118.87 ? 437 ASP B CB    1 
ATOM   7282 C  CG    . ASP B 1 437 ? -32.231 11.066  -51.673 1.00 125.88 ? 437 ASP B CG    1 
ATOM   7283 O  OD1   . ASP B 1 437 ? -31.971 9.855   -51.478 1.00 125.94 ? 437 ASP B OD1   1 
ATOM   7284 O  OD2   . ASP B 1 437 ? -33.324 11.469  -52.126 1.00 132.33 ? 437 ASP B OD2   1 
ATOM   7285 O  OP3   . G   C 2 1   ? -60.822 44.366  -10.945 1.00 66.65  ? 1   G   C OP3   1 
ATOM   7286 P  P     . G   C 2 1   ? -60.478 43.654  -13.363 0.00 75.23  ? 1   G   C P     1 
ATOM   7287 O  OP1   . G   C 2 1   ? -61.086 42.782  -14.394 0.00 77.64  ? 1   G   C OP1   1 
ATOM   7288 O  OP2   . G   C 2 1   ? -61.316 44.110  -12.229 0.00 76.67  ? 1   G   C OP2   1 
ATOM   7289 O  "O5'" . G   C 2 1   ? -59.074 42.126  -12.893 1.00 60.11  ? 1   G   C "O5'" 1 
ATOM   7290 C  "C5'" . G   C 2 1   ? -57.916 42.547  -13.597 1.00 57.17  ? 1   G   C "C5'" 1 
ATOM   7291 C  "C4'" . G   C 2 1   ? -56.769 42.848  -12.648 1.00 51.07  ? 1   G   C "C4'" 1 
ATOM   7292 O  "O4'" . G   C 2 1   ? -57.251 43.386  -11.396 1.00 50.55  ? 1   G   C "O4'" 1 
ATOM   7293 C  "C3'" . G   C 2 1   ? -55.988 41.635  -12.199 1.00 43.46  ? 1   G   C "C3'" 1 
ATOM   7294 O  "O3'" . G   C 2 1   ? -55.112 41.214  -13.201 1.00 41.30  ? 1   G   C "O3'" 1 
ATOM   7295 C  "C2'" . G   C 2 1   ? -55.245 42.167  -10.995 1.00 41.11  ? 1   G   C "C2'" 1 
ATOM   7296 O  "O2'" . G   C 2 1   ? -54.194 43.022  -11.395 1.00 42.92  ? 1   G   C "O2'" 1 
ATOM   7297 C  "C1'" . G   C 2 1   ? -56.359 42.991  -10.359 1.00 44.69  ? 1   G   C "C1'" 1 
ATOM   7298 N  N9    . G   C 2 1   ? -57.118 42.430  -9.231  1.00 43.76  ? 1   G   C N9    1 
ATOM   7299 C  C8    . G   C 2 1   ? -58.471 42.179  -9.226  1.00 46.89  ? 1   G   C C8    1 
ATOM   7300 N  N7    . G   C 2 1   ? -58.903 41.707  -8.092  1.00 46.34  ? 1   G   C N7    1 
ATOM   7301 C  C5    . G   C 2 1   ? -57.772 41.653  -7.280  1.00 41.58  ? 1   G   C C5    1 
ATOM   7302 C  C6    . G   C 2 1   ? -57.619 41.233  -5.931  1.00 39.02  ? 1   G   C C6    1 
ATOM   7303 O  O6    . G   C 2 1   ? -58.466 40.796  -5.150  1.00 40.70  ? 1   G   C O6    1 
ATOM   7304 N  N1    . G   C 2 1   ? -56.321 41.332  -5.466  1.00 34.81  ? 1   G   C N1    1 
ATOM   7305 C  C2    . G   C 2 1   ? -55.279 41.778  -6.210  1.00 33.86  ? 1   G   C C2    1 
ATOM   7306 N  N2    . G   C 2 1   ? -54.111 41.789  -5.567  1.00 31.62  ? 1   G   C N2    1 
ATOM   7307 N  N3    . G   C 2 1   ? -55.390 42.177  -7.474  1.00 36.75  ? 1   G   C N3    1 
ATOM   7308 C  C4    . G   C 2 1   ? -56.663 42.100  -7.958  1.00 40.26  ? 1   G   C C4    1 
ATOM   7309 P  P     . G   C 2 2   ? -55.131 39.638  -13.411 1.00 39.36  ? 2   G   C P     1 
ATOM   7310 O  OP1   . G   C 2 2   ? -54.424 39.202  -14.646 1.00 38.33  ? 2   G   C OP1   1 
ATOM   7311 O  OP2   . G   C 2 2   ? -56.546 39.257  -13.180 1.00 41.98  ? 2   G   C OP2   1 
ATOM   7312 O  "O5'" . G   C 2 2   ? -54.251 39.147  -12.176 1.00 32.79  ? 2   G   C "O5'" 1 
ATOM   7313 C  "C5'" . G   C 2 2   ? -52.871 39.424  -12.144 1.00 28.65  ? 2   G   C "C5'" 1 
ATOM   7314 C  "C4'" . G   C 2 2   ? -52.328 39.126  -10.765 1.00 25.10  ? 2   G   C "C4'" 1 
ATOM   7315 O  "O4'" . G   C 2 2   ? -52.944 39.956  -9.733  1.00 25.18  ? 2   G   C "O4'" 1 
ATOM   7316 C  "C3'" . G   C 2 2   ? -52.548 37.701  -10.298 1.00 22.57  ? 2   G   C "C3'" 1 
ATOM   7317 O  "O3'" . G   C 2 2   ? -51.597 36.890  -10.952 1.00 22.74  ? 2   G   C "O3'" 1 
ATOM   7318 C  "C2'" . G   C 2 2   ? -52.221 37.906  -8.827  1.00 21.03  ? 2   G   C "C2'" 1 
ATOM   7319 O  "O2'" . G   C 2 2   ? -50.815 37.928  -8.628  1.00 19.59  ? 2   G   C "O2'" 1 
ATOM   7320 C  "C1'" . G   C 2 2   ? -52.932 39.242  -8.509  1.00 20.75  ? 2   G   C "C1'" 1 
ATOM   7321 N  N9    . G   C 2 2   ? -54.312 38.990  -8.052  1.00 21.65  ? 2   G   C N9    1 
ATOM   7322 C  C8    . G   C 2 2   ? -55.466 39.074  -8.806  1.00 23.63  ? 2   G   C C8    1 
ATOM   7323 N  N7    . G   C 2 2   ? -56.547 38.761  -8.153  1.00 24.78  ? 2   G   C N7    1 
ATOM   7324 C  C5    . G   C 2 2   ? -56.083 38.418  -6.890  1.00 22.74  ? 2   G   C C5    1 
ATOM   7325 C  C6    . G   C 2 2   ? -56.799 37.990  -5.751  1.00 24.69  ? 2   G   C C6    1 
ATOM   7326 O  O6    . G   C 2 2   ? -58.019 37.826  -5.642  1.00 29.08  ? 2   G   C O6    1 
ATOM   7327 N  N1    . G   C 2 2   ? -55.990 37.758  -4.653  1.00 21.83  ? 2   G   C N1    1 
ATOM   7328 C  C2    . G   C 2 2   ? -54.640 37.921  -4.668  1.00 19.35  ? 2   G   C C2    1 
ATOM   7329 N  N2    . G   C 2 2   ? -54.045 37.653  -3.505  1.00 19.37  ? 2   G   C N2    1 
ATOM   7330 N  N3    . G   C 2 2   ? -53.931 38.317  -5.722  1.00 17.83  ? 2   G   C N3    1 
ATOM   7331 C  C4    . G   C 2 2   ? -54.718 38.555  -6.800  1.00 20.15  ? 2   G   C C4    1 
ATOM   7332 P  P     . A   C 2 3   ? -51.766 35.295  -11.098 1.00 23.51  ? 3   A   C P     1 
ATOM   7333 O  OP1   . A   C 2 3   ? -50.552 34.753  -11.801 1.00 20.63  ? 3   A   C OP1   1 
ATOM   7334 O  OP2   . A   C 2 3   ? -53.137 35.058  -11.607 1.00 23.65  ? 3   A   C OP2   1 
ATOM   7335 O  "O5'" . A   C 2 3   ? -51.721 34.770  -9.582  1.00 22.73  ? 3   A   C "O5'" 1 
ATOM   7336 C  "C5'" . A   C 2 3   ? -50.459 34.488  -8.972  1.00 22.43  ? 3   A   C "C5'" 1 
ATOM   7337 C  "C4'" . A   C 2 3   ? -50.663 34.245  -7.502  1.00 24.33  ? 3   A   C "C4'" 1 
ATOM   7338 O  "O4'" . A   C 2 3   ? -51.517 35.282  -6.966  1.00 26.48  ? 3   A   C "O4'" 1 
ATOM   7339 C  "C3'" . A   C 2 3   ? -51.462 32.993  -7.236  1.00 27.42  ? 3   A   C "C3'" 1 
ATOM   7340 O  "O3'" . A   C 2 3   ? -50.565 31.935  -7.201  1.00 31.28  ? 3   A   C "O3'" 1 
ATOM   7341 C  "C2'" . A   C 2 3   ? -51.994 33.260  -5.849  1.00 27.70  ? 3   A   C "C2'" 1 
ATOM   7342 O  "O2'" . A   C 2 3   ? -50.958 33.061  -4.926  1.00 28.79  ? 3   A   C "O2'" 1 
ATOM   7343 C  "C1'" . A   C 2 3   ? -52.348 34.744  -5.939  1.00 25.54  ? 3   A   C "C1'" 1 
ATOM   7344 N  N9    . A   C 2 3   ? -53.776 34.890  -6.218  1.00 25.64  ? 3   A   C N9    1 
ATOM   7345 C  C8    . A   C 2 3   ? -54.404 35.312  -7.360  1.00 26.36  ? 3   A   C C8    1 
ATOM   7346 N  N7    . A   C 2 3   ? -55.720 35.301  -7.274  1.00 28.57  ? 3   A   C N7    1 
ATOM   7347 C  C5    . A   C 2 3   ? -55.946 34.826  -5.999  1.00 28.80  ? 3   A   C C5    1 
ATOM   7348 C  C6    . A   C 2 3   ? -57.116 34.566  -5.277  1.00 33.25  ? 3   A   C C6    1 
ATOM   7349 N  N6    . A   C 2 3   ? -58.321 34.763  -5.791  1.00 37.26  ? 3   A   C N6    1 
ATOM   7350 N  N1    . A   C 2 3   ? -57.015 34.105  -4.011  1.00 34.43  ? 3   A   C N1    1 
ATOM   7351 C  C2    . A   C 2 3   ? -55.791 33.912  -3.501  1.00 32.37  ? 3   A   C C2    1 
ATOM   7352 N  N3    . A   C 2 3   ? -54.609 34.119  -4.091  1.00 28.80  ? 3   A   C N3    1 
ATOM   7353 C  C4    . A   C 2 3   ? -54.766 34.575  -5.340  1.00 26.78  ? 3   A   C C4    1 
ATOM   7354 P  P     . A   C 2 4   ? -50.982 30.478  -7.724  1.00 34.83  ? 4   A   C P     1 
ATOM   7355 O  OP1   . A   C 2 4   ? -49.700 29.720  -7.701  1.00 35.14  ? 4   A   C OP1   1 
ATOM   7356 O  OP2   . A   C 2 4   ? -51.811 30.590  -8.965  1.00 32.78  ? 4   A   C OP2   1 
ATOM   7357 O  "O5'" . A   C 2 4   ? -51.881 29.923  -6.526  1.00 38.34  ? 4   A   C "O5'" 1 
ATOM   7358 C  "C5'" . A   C 2 4   ? -51.260 29.571  -5.292  1.00 41.40  ? 4   A   C "C5'" 1 
ATOM   7359 C  "C4'" . A   C 2 4   ? -52.348 29.369  -4.269  1.00 46.57  ? 4   A   C "C4'" 1 
ATOM   7360 O  "O4'" . A   C 2 4   ? -53.219 30.535  -4.172  1.00 45.80  ? 4   A   C "O4'" 1 
ATOM   7361 C  "C3'" . A   C 2 4   ? -53.313 28.276  -4.654  1.00 50.87  ? 4   A   C "C3'" 1 
ATOM   7362 O  "O3'" . A   C 2 4   ? -52.682 27.066  -4.395  1.00 57.14  ? 4   A   C "O3'" 1 
ATOM   7363 C  "C2'" . A   C 2 4   ? -54.421 28.559  -3.663  1.00 53.26  ? 4   A   C "C2'" 1 
ATOM   7364 O  "O2'" . A   C 2 4   ? -54.074 28.109  -2.373  1.00 55.41  ? 4   A   C "O2'" 1 
ATOM   7365 C  "C1'" . A   C 2 4   ? -54.470 30.088  -3.690  1.00 49.25  ? 4   A   C "C1'" 1 
ATOM   7366 N  N9    . A   C 2 4   ? -55.539 30.600  -4.541  1.00 48.87  ? 4   A   C N9    1 
ATOM   7367 C  C8    . A   C 2 4   ? -55.434 31.212  -5.763  1.00 46.43  ? 4   A   C C8    1 
ATOM   7368 N  N7    . A   C 2 4   ? -56.589 31.566  -6.290  1.00 47.92  ? 4   A   C N7    1 
ATOM   7369 C  C5    . A   C 2 4   ? -57.514 31.157  -5.347  1.00 51.85  ? 4   A   C C5    1 
ATOM   7370 C  C6    . A   C 2 4   ? -58.925 31.237  -5.294  1.00 56.83  ? 4   A   C C6    1 
ATOM   7371 N  N6    . A   C 2 4   ? -59.678 31.786  -6.257  1.00 57.53  ? 4   A   C N6    1 
ATOM   7372 N  N1    . A   C 2 4   ? -59.538 30.723  -4.194  1.00 61.56  ? 4   A   C N1    1 
ATOM   7373 C  C2    . A   C 2 4   ? -58.793 30.169  -3.214  1.00 61.23  ? 4   A   C C2    1 
ATOM   7374 N  N3    . A   C 2 4   ? -57.465 30.038  -3.158  1.00 56.86  ? 4   A   C N3    1 
ATOM   7375 C  C4    . A   C 2 4   ? -56.884 30.556  -4.262  1.00 52.42  ? 4   A   C C4    1 
ATOM   7376 P  P     . G   C 2 5   ? -52.888 25.769  -5.315  1.00 62.15  ? 5   G   C P     1 
ATOM   7377 O  OP1   . G   C 2 5   ? -51.839 24.822  -4.872  1.00 65.00  ? 5   G   C OP1   1 
ATOM   7378 O  OP2   . G   C 2 5   ? -52.997 26.134  -6.748  1.00 56.95  ? 5   G   C OP2   1 
ATOM   7379 O  "O5'" . G   C 2 5   ? -54.305 25.214  -4.820  1.00 69.61  ? 5   G   C "O5'" 1 
ATOM   7380 C  "C5'" . G   C 2 5   ? -54.433 24.636  -3.515  1.00 78.18  ? 5   G   C "C5'" 1 
ATOM   7381 C  "C4'" . G   C 2 5   ? -55.870 24.713  -3.045  1.00 84.96  ? 5   G   C "C4'" 1 
ATOM   7382 O  "O4'" . G   C 2 5   ? -56.334 26.079  -3.177  1.00 81.71  ? 5   G   C "O4'" 1 
ATOM   7383 C  "C3'" . G   C 2 5   ? -56.885 23.984  -3.904  1.00 90.20  ? 5   G   C "C3'" 1 
ATOM   7384 O  "O3'" . G   C 2 5   ? -56.852 22.586  -3.678  1.00 100.51 ? 5   G   C "O3'" 1 
ATOM   7385 C  "C2'" . G   C 2 5   ? -58.180 24.628  -3.426  1.00 91.66  ? 5   G   C "C2'" 1 
ATOM   7386 O  "O2'" . G   C 2 5   ? -58.637 24.150  -2.183  1.00 97.88  ? 5   G   C "O2'" 1 
ATOM   7387 C  "C1'" . G   C 2 5   ? -57.745 26.083  -3.292  1.00 84.40  ? 5   G   C "C1'" 1 
ATOM   7388 N  N9    . G   C 2 5   ? -58.183 26.826  -4.468  1.00 80.44  ? 5   G   C N9    1 
ATOM   7389 C  C8    . G   C 2 5   ? -57.439 27.294  -5.522  1.00 74.44  ? 5   G   C C8    1 
ATOM   7390 N  N7    . G   C 2 5   ? -58.167 27.904  -6.415  1.00 73.71  ? 5   G   C N7    1 
ATOM   7391 C  C5    . G   C 2 5   ? -59.467 27.826  -5.927  1.00 79.15  ? 5   G   C C5    1 
ATOM   7392 C  C6    . G   C 2 5   ? -60.698 28.301  -6.454  1.00 82.52  ? 5   G   C C6    1 
ATOM   7393 O  O6    . G   C 2 5   ? -60.878 28.917  -7.515  1.00 80.88  ? 5   G   C O6    1 
ATOM   7394 N  N1    . G   C 2 5   ? -61.791 28.000  -5.622  1.00 89.14  ? 5   G   C N1    1 
ATOM   7395 C  C2    . G   C 2 5   ? -61.705 27.319  -4.420  1.00 92.48  ? 5   G   C C2    1 
ATOM   7396 N  N2    . G   C 2 5   ? -62.838 27.106  -3.726  1.00 99.29  ? 5   G   C N2    1 
ATOM   7397 N  N3    . G   C 2 5   ? -60.557 26.873  -3.927  1.00 89.96  ? 5   G   C N3    1 
ATOM   7398 C  C4    . G   C 2 5   ? -59.490 27.158  -4.727  1.00 83.32  ? 5   G   C C4    1 
ATOM   7399 P  P     . U   C 2 6   ? -57.360 21.604  -4.837  1.00 106.12 ? 6   U   C P     1 
ATOM   7400 O  OP1   . U   C 2 6   ? -56.923 20.241  -4.472  1.00 113.22 ? 6   U   C OP1   1 
ATOM   7401 O  OP2   . U   C 2 6   ? -57.000 22.149  -6.169  1.00 99.16  ? 6   U   C OP2   1 
ATOM   7402 O  "O5'" . U   C 2 6   ? -58.946 21.714  -4.693  1.00 112.67 ? 6   U   C "O5'" 1 
ATOM   7403 C  "C5'" . U   C 2 6   ? -59.651 21.144  -3.592  1.00 123.29 ? 6   U   C "C5'" 1 
ATOM   7404 C  "C4'" . U   C 2 6   ? -61.135 21.289  -3.864  1.00 129.81 ? 6   U   C "C4'" 1 
ATOM   7405 O  "O4'" . U   C 2 6   ? -61.380 22.707  -4.069  1.00 124.11 ? 6   U   C "O4'" 1 
ATOM   7406 C  "C3'" . U   C 2 6   ? -61.639 20.656  -5.162  1.00 132.73 ? 6   U   C "C3'" 1 
ATOM   7407 O  "O3'" . U   C 2 6   ? -61.934 19.258  -5.075  1.00 143.22 ? 6   U   C "O3'" 1 
ATOM   7408 C  "C2'" . U   C 2 6   ? -62.870 21.504  -5.464  1.00 133.56 ? 6   U   C "C2'" 1 
ATOM   7409 O  "O2'" . U   C 2 6   ? -63.996 21.147  -4.686  1.00 142.83 ? 6   U   C "O2'" 1 
ATOM   7410 C  "C1'" . U   C 2 6   ? -62.350 22.889  -5.084  1.00 125.42 ? 6   U   C "C1'" 1 
ATOM   7411 N  N1    . U   C 2 6   ? -61.779 23.636  -6.258  1.00 117.05 ? 6   U   C N1    1 
ATOM   7412 C  C2    . U   C 2 6   ? -62.562 24.614  -6.835  1.00 116.13 ? 6   U   C C2    1 
ATOM   7413 O  O2    . U   C 2 6   ? -63.671 24.903  -6.432  1.00 121.69 ? 6   U   C O2    1 
ATOM   7414 N  N3    . U   C 2 6   ? -62.001 25.255  -7.911  1.00 109.80 ? 6   U   C N3    1 
ATOM   7415 C  C4    . U   C 2 6   ? -60.755 25.013  -8.465  1.00 104.33 ? 6   U   C C4    1 
ATOM   7416 O  O4    . U   C 2 6   ? -60.390 25.674  -9.433  1.00 99.78  ? 6   U   C O4    1 
ATOM   7417 C  C5    . U   C 2 6   ? -59.992 23.970  -7.819  1.00 105.43 ? 6   U   C C5    1 
ATOM   7418 C  C6    . U   C 2 6   ? -60.522 23.338  -6.765  1.00 111.63 ? 6   U   C C6    1 
ATOM   7419 P  P     . A   C 2 7   ? -61.695 18.337  -6.375  1.00 145.17 ? 7   A   C P     1 
ATOM   7420 O  OP1   . A   C 2 7   ? -61.574 16.943  -5.900  1.00 154.13 ? 7   A   C OP1   1 
ATOM   7421 O  OP2   . A   C 2 7   ? -60.616 18.932  -7.208  1.00 134.17 ? 7   A   C OP2   1 
ATOM   7422 O  "O5'" . A   C 2 7   ? -63.057 18.470  -7.205  1.00 149.84 ? 7   A   C "O5'" 1 
ATOM   7423 C  "C5'" . A   C 2 7   ? -64.325 18.194  -6.610  1.00 161.07 ? 7   A   C "C5'" 1 
ATOM   7424 C  "C4'" . A   C 2 7   ? -65.443 18.797  -7.441  1.00 163.49 ? 7   A   C "C4'" 1 
ATOM   7425 O  "O4'" . A   C 2 7   ? -65.444 20.249  -7.321  1.00 156.92 ? 7   A   C "O4'" 1 
ATOM   7426 C  "C3'" . A   C 2 7   ? -65.337 18.598  -8.949  1.00 161.17 ? 7   A   C "C3'" 1 
ATOM   7427 O  "O3'" . A   C 2 7   ? -65.634 17.272  -9.391  1.00 169.60 ? 7   A   C "O3'" 1 
ATOM   7428 C  "C2'" . A   C 2 7   ? -66.356 19.642  -9.400  1.00 161.88 ? 7   A   C "C2'" 1 
ATOM   7429 O  "O2'" . A   C 2 7   ? -67.696 19.307  -9.093  1.00 172.76 ? 7   A   C "O2'" 1 
ATOM   7430 C  "C1'" . A   C 2 7   ? -65.882 20.820  -8.550  1.00 154.88 ? 7   A   C "C1'" 1 
ATOM   7431 N  N9    . A   C 2 7   ? -64.820 21.574  -9.241  1.00 144.27 ? 7   A   C N9    1 
ATOM   7432 C  C8    . A   C 2 7   ? -63.457 21.441  -9.132  1.00 137.04 ? 7   A   C C8    1 
ATOM   7433 N  N7    . A   C 2 7   ? -62.769 22.253  -9.904  1.00 128.60 ? 7   A   C N7    1 
ATOM   7434 C  C5    . A   C 2 7   ? -63.749 22.963  -10.576 1.00 130.63 ? 7   A   C C5    1 
ATOM   7435 C  C6    . A   C 2 7   ? -63.695 23.987  -11.544 1.00 126.08 ? 7   A   C C6    1 
ATOM   7436 N  N6    . A   C 2 7   ? -62.551 24.485  -12.015 1.00 118.41 ? 7   A   C N6    1 
ATOM   7437 N  N1    . A   C 2 7   ? -64.858 24.484  -12.021 1.00 131.07 ? 7   A   C N1    1 
ATOM   7438 C  C2    . A   C 2 7   ? -66.012 23.993  -11.552 1.00 139.92 ? 7   A   C C2    1 
ATOM   7439 N  N3    . A   C 2 7   ? -66.192 23.037  -10.639 1.00 145.16 ? 7   A   C N3    1 
ATOM   7440 C  C4    . A   C 2 7   ? -65.015 22.557  -10.187 1.00 140.17 ? 7   A   C C4    1 
ATOM   7441 P  P     . G   C 2 8   ? -65.010 16.703  -10.764 1.00 166.43 ? 8   G   C P     1 
ATOM   7442 O  OP1   . G   C 2 8   ? -66.143 16.233  -11.591 1.00 174.56 ? 8   G   C OP1   1 
ATOM   7443 O  OP2   . G   C 2 8   ? -63.933 15.747  -10.423 1.00 166.08 ? 8   G   C OP2   1 
ATOM   7444 O  "O5'" . G   C 2 8   ? -64.314 17.971  -11.462 1.00 154.77 ? 8   G   C "O5'" 1 
ATOM   7445 C  "C5'" . G   C 2 8   ? -64.362 18.166  -12.876 1.00 151.86 ? 8   G   C "C5'" 1 
ATOM   7446 C  "C4'" . G   C 2 8   ? -65.652 18.854  -13.296 1.00 156.37 ? 8   G   C "C4'" 1 
ATOM   7447 O  "O4'" . G   C 2 8   ? -65.728 20.188  -12.723 1.00 151.68 ? 8   G   C "O4'" 1 
ATOM   7448 C  "C3'" . G   C 2 8   ? -65.780 19.058  -14.798 1.00 154.72 ? 8   G   C "C3'" 1 
ATOM   7449 O  "O3'" . G   C 2 8   ? -66.424 17.950  -15.394 1.00 163.95 ? 8   G   C "O3'" 1 
ATOM   7450 C  "C2'" . G   C 2 8   ? -66.580 20.351  -14.922 1.00 154.55 ? 8   G   C "C2'" 1 
ATOM   7451 O  "O2'" . G   C 2 8   ? -67.978 20.201  -14.801 1.00 164.58 ? 8   G   C "O2'" 1 
ATOM   7452 C  "C1'" . G   C 2 8   ? -66.002 21.128  -13.745 1.00 148.84 ? 8   G   C "C1'" 1 
ATOM   7453 N  N9    . G   C 2 8   ? -64.774 21.829  -14.130 1.00 138.59 ? 8   G   C N9    1 
ATOM   7454 C  C8    . G   C 2 8   ? -63.477 21.587  -13.727 1.00 131.84 ? 8   G   C C8    1 
ATOM   7455 N  N7    . G   C 2 8   ? -62.604 22.387  -14.271 1.00 123.88 ? 8   G   C N7    1 
ATOM   7456 C  C5    . G   C 2 8   ? -63.369 23.209  -15.090 1.00 125.59 ? 8   G   C C5    1 
ATOM   7457 C  C6    . G   C 2 8   ? -62.984 24.278  -15.937 1.00 120.71 ? 8   G   C C6    1 
ATOM   7458 O  O6    . G   C 2 8   ? -61.842 24.723  -16.134 1.00 113.42 ? 8   G   C O6    1 
ATOM   7459 N  N1    . G   C 2 8   ? -64.088 24.836  -16.599 1.00 126.19 ? 8   G   C N1    1 
ATOM   7460 C  C2    . G   C 2 8   ? -65.403 24.427  -16.462 1.00 135.00 ? 8   G   C C2    1 
ATOM   7461 N  N2    . G   C 2 8   ? -66.340 25.081  -17.168 1.00 139.88 ? 8   G   C N2    1 
ATOM   7462 N  N3    . G   C 2 8   ? -65.768 23.430  -15.670 1.00 139.59 ? 8   G   C N3    1 
ATOM   7463 C  C4    . G   C 2 8   ? -64.706 22.874  -15.020 1.00 134.62 ? 8   G   C C4    1 
ATOM   7464 P  P     . A   C 2 9   ? -65.672 17.184  -16.584 1.00 161.92 ? 9   A   C P     1 
ATOM   7465 O  OP1   . A   C 2 9   ? -66.321 15.866  -16.794 1.00 171.72 ? 9   A   C OP1   1 
ATOM   7466 O  OP2   . A   C 2 9   ? -64.215 17.271  -16.318 1.00 152.51 ? 9   A   C OP2   1 
ATOM   7467 O  "O5'" . A   C 2 9   ? -65.961 18.112  -17.849 1.00 158.38 ? 9   A   C "O5'" 1 
ATOM   7468 C  "C5'" . A   C 2 9   ? -67.271 18.553  -18.168 1.00 164.80 ? 9   A   C "C5'" 1 
ATOM   7469 C  "C4'" . A   C 2 9   ? -67.134 19.674  -19.168 1.00 159.15 ? 9   A   C "C4'" 1 
ATOM   7470 O  "O4'" . A   C 2 9   ? -66.749 20.893  -18.481 1.00 152.42 ? 9   A   C "O4'" 1 
ATOM   7471 C  "C3'" . A   C 2 9   ? -66.017 19.452  -20.173 1.00 151.71 ? 9   A   C "C3'" 1 
ATOM   7472 O  "O3'" . A   C 2 9   ? -66.380 18.536  -21.222 1.00 157.03 ? 9   A   C "O3'" 1 
ATOM   7473 C  "C2'" . A   C 2 9   ? -65.795 20.883  -20.645 1.00 146.41 ? 9   A   C "C2'" 1 
ATOM   7474 O  "O2'" . A   C 2 9   ? -66.684 21.285  -21.662 1.00 152.60 ? 9   A   C "O2'" 1 
ATOM   7475 C  "C1'" . A   C 2 9   ? -65.962 21.679  -19.352 1.00 145.00 ? 9   A   C "C1'" 1 
ATOM   7476 N  N9    . A   C 2 9   ? -64.613 21.847  -18.837 1.00 135.46 ? 9   A   C N9    1 
ATOM   7477 C  C8    . A   C 2 9   ? -63.956 21.112  -17.888 1.00 133.29 ? 9   A   C C8    1 
ATOM   7478 N  N7    . A   C 2 9   ? -62.721 21.501  -17.689 1.00 124.92 ? 9   A   C N7    1 
ATOM   7479 C  C5    . A   C 2 9   ? -62.550 22.550  -18.582 1.00 121.58 ? 9   A   C C5    1 
ATOM   7480 C  C6    . A   C 2 9   ? -61.459 23.408  -18.879 1.00 114.17 ? 9   A   C C6    1 
ATOM   7481 N  N6    . A   C 2 9   ? -60.262 23.345  -18.274 1.00 107.68 ? 9   A   C N6    1 
ATOM   7482 N  N1    . A   C 2 9   ? -61.655 24.349  -19.837 1.00 114.10 ? 9   A   C N1    1 
ATOM   7483 C  C2    . A   C 2 9   ? -62.846 24.438  -20.457 1.00 120.65 ? 9   A   C C2    1 
ATOM   7484 N  N3    . A   C 2 9   ? -63.931 23.693  -20.260 1.00 127.86 ? 9   A   C N3    1 
ATOM   7485 C  C4    . A   C 2 9   ? -63.712 22.767  -19.303 1.00 127.86 ? 9   A   C C4    1 
ATOM   7486 P  P     . U   C 2 10  ? -65.385 18.258  -22.454 1.00 151.26 ? 10  U   C P     1 
ATOM   7487 O  OP1   . U   C 2 10  ? -65.783 17.003  -23.123 1.00 157.97 ? 10  U   C OP1   1 
ATOM   7488 O  OP2   . U   C 2 10  ? -63.985 18.382  -21.990 1.00 142.23 ? 10  U   C OP2   1 
ATOM   7489 O  "O5'" . U   C 2 10  ? -65.699 19.521  -23.396 1.00 150.25 ? 10  U   C "O5'" 1 
ATOM   7490 C  "C5'" . U   C 2 10  ? -64.963 19.745  -24.586 1.00 144.93 ? 10  U   C "C5'" 1 
ATOM   7491 C  "C4'" . U   C 2 10  ? -64.793 21.216  -24.913 1.00 140.56 ? 10  U   C "C4'" 1 
ATOM   7492 O  "O4'" . U   C 2 10  ? -64.626 22.021  -23.721 1.00 136.50 ? 10  U   C "O4'" 1 
ATOM   7493 C  "C3'" . U   C 2 10  ? -63.495 21.469  -25.652 1.00 132.79 ? 10  U   C "C3'" 1 
ATOM   7494 O  "O3'" . U   C 2 10  ? -63.630 21.185  -27.005 1.00 136.76 ? 10  U   C "O3'" 1 
ATOM   7495 C  "C2'" . U   C 2 10  ? -63.185 22.926  -25.357 1.00 128.19 ? 10  U   C "C2'" 1 
ATOM   7496 O  "O2'" . U   C 2 10  ? -63.991 23.849  -26.061 1.00 133.44 ? 10  U   C "O2'" 1 
ATOM   7497 C  "C1'" . U   C 2 10  ? -63.501 22.892  -23.865 1.00 127.73 ? 10  U   C "C1'" 1 
ATOM   7498 N  N1    . U   C 2 10  ? -62.311 22.420  -23.028 1.00 120.09 ? 10  U   C N1    1 
ATOM   7499 C  C2    . U   C 2 10  ? -61.166 23.204  -22.935 1.00 112.06 ? 10  U   C C2    1 
ATOM   7500 O  O2    . U   C 2 10  ? -61.026 24.288  -23.476 1.00 110.60 ? 10  U   C O2    1 
ATOM   7501 N  N3    . U   C 2 10  ? -60.169 22.669  -22.158 1.00 106.63 ? 10  U   C N3    1 
ATOM   7502 C  C4    . U   C 2 10  ? -60.190 21.464  -21.481 1.00 108.78 ? 10  U   C C4    1 
ATOM   7503 O  O4    . U   C 2 10  ? -59.219 21.123  -20.823 1.00 104.93 ? 10  U   C O4    1 
ATOM   7504 C  C5    . U   C 2 10  ? -61.397 20.699  -21.620 1.00 116.66 ? 10  U   C C5    1 
ATOM   7505 C  C6    . U   C 2 10  ? -62.381 21.199  -22.370 1.00 121.90 ? 10  U   C C6    1 
ATOM   7506 P  P     . G   C 2 11  ? -62.692 20.018  -27.546 1.00 134.10 ? 11  G   C P     1 
ATOM   7507 O  OP1   . G   C 2 11  ? -63.494 19.282  -28.553 1.00 141.98 ? 11  G   C OP1   1 
ATOM   7508 O  OP2   . G   C 2 11  ? -62.123 19.278  -26.392 1.00 130.38 ? 11  G   C OP2   1 
ATOM   7509 O  "O5'" . G   C 2 11  ? -61.503 20.845  -28.237 1.00 126.51 ? 11  G   C "O5'" 1 
ATOM   7510 C  "C5'" . G   C 2 11  ? -61.826 21.924  -29.107 1.00 129.31 ? 11  G   C "C5'" 1 
ATOM   7511 C  "C4'" . G   C 2 11  ? -60.822 23.049  -28.999 1.00 123.05 ? 11  G   C "C4'" 1 
ATOM   7512 O  "O4'" . G   C 2 11  ? -60.688 23.487  -27.624 1.00 119.95 ? 11  G   C "O4'" 1 
ATOM   7513 C  "C3'" . G   C 2 11  ? -59.402 22.670  -29.370 1.00 116.44 ? 11  G   C "C3'" 1 
ATOM   7514 O  "O3'" . G   C 2 11  ? -59.235 22.642  -30.762 1.00 118.72 ? 11  G   C "O3'" 1 
ATOM   7515 C  "C2'" . G   C 2 11  ? -58.618 23.807  -28.736 1.00 111.18 ? 11  G   C "C2'" 1 
ATOM   7516 O  "O2'" . G   C 2 11  ? -58.693 25.027  -29.452 1.00 113.07 ? 11  G   C "O2'" 1 
ATOM   7517 C  "C1'" . G   C 2 11  ? -59.343 23.900  -27.396 1.00 112.26 ? 11  G   C "C1'" 1 
ATOM   7518 N  N9    . G   C 2 11  ? -58.704 23.061  -26.375 1.00 107.97 ? 11  G   C N9    1 
ATOM   7519 C  C8    . G   C 2 11  ? -59.261 21.989  -25.719 1.00 110.82 ? 11  G   C C8    1 
ATOM   7520 N  N7    . G   C 2 11  ? -58.457 21.426  -24.862 1.00 106.99 ? 11  G   C N7    1 
ATOM   7521 C  C5    . G   C 2 11  ? -57.287 22.162  -24.953 1.00 100.81 ? 11  G   C C5    1 
ATOM   7522 C  C6    . G   C 2 11  ? -56.062 22.016  -24.255 1.00 95.63  ? 11  G   C C6    1 
ATOM   7523 O  O6    . G   C 2 11  ? -55.770 21.169  -23.403 1.00 95.32  ? 11  G   C O6    1 
ATOM   7524 N  N1    . G   C 2 11  ? -55.120 22.978  -24.634 1.00 91.56  ? 11  G   C N1    1 
ATOM   7525 C  C2    . G   C 2 11  ? -55.336 23.956  -25.580 1.00 92.59  ? 11  G   C C2    1 
ATOM   7526 N  N2    . G   C 2 11  ? -54.322 24.796  -25.825 1.00 89.02  ? 11  G   C N2    1 
ATOM   7527 N  N3    . G   C 2 11  ? -56.485 24.104  -26.236 1.00 97.86  ? 11  G   C N3    1 
ATOM   7528 C  C4    . G   C 2 11  ? -57.419 23.175  -25.879 1.00 101.56 ? 11  G   C C4    1 
ATOM   7529 P  P     . G   C 2 12  ? -58.545 21.364  -31.435 1.00 117.85 ? 12  G   C P     1 
ATOM   7530 O  OP1   . G   C 2 12  ? -59.250 21.110  -32.708 1.00 124.64 ? 12  G   C OP1   1 
ATOM   7531 O  OP2   . G   C 2 12  ? -58.486 20.279  -30.428 1.00 116.63 ? 12  G   C OP2   1 
ATOM   7532 O  "O5'" . G   C 2 12  ? -57.037 21.813  -31.758 1.00 110.35 ? 12  G   C "O5'" 1 
ATOM   7533 C  "C5'" . G   C 2 12  ? -56.631 23.169  -31.958 1.00 107.50 ? 12  G   C "C5'" 1 
ATOM   7534 C  "C4'" . G   C 2 12  ? -55.340 23.414  -31.204 1.00 100.08 ? 12  G   C "C4'" 1 
ATOM   7535 O  "O4'" . G   C 2 12  ? -55.604 23.311  -29.784 1.00 97.61  ? 12  G   C "O4'" 1 
ATOM   7536 C  "C3'" . G   C 2 12  ? -54.262 22.354  -31.372 1.00 96.74  ? 12  G   C "C3'" 1 
ATOM   7537 O  "O3'" . G   C 2 12  ? -53.520 22.462  -32.585 1.00 97.98  ? 12  G   C "O3'" 1 
ATOM   7538 C  "C2'" . G   C 2 12  ? -53.377 22.607  -30.158 1.00 90.60  ? 12  G   C "C2'" 1 
ATOM   7539 O  "O2'" . G   C 2 12  ? -52.414 23.618  -30.392 1.00 87.96  ? 12  G   C "O2'" 1 
ATOM   7540 C  "C1'" . G   C 2 12  ? -54.401 22.996  -29.092 1.00 91.02  ? 12  G   C "C1'" 1 
ATOM   7541 N  N9    . G   C 2 12  ? -54.608 21.918  -28.110 1.00 90.51  ? 12  G   C N9    1 
ATOM   7542 C  C8    . G   C 2 12  ? -55.711 21.098  -27.962 1.00 94.76  ? 12  G   C C8    1 
ATOM   7543 N  N7    . G   C 2 12  ? -55.597 20.221  -27.000 1.00 94.05  ? 12  G   C N7    1 
ATOM   7544 C  C5    . G   C 2 12  ? -54.333 20.468  -26.478 1.00 88.95  ? 12  G   C C5    1 
ATOM   7545 C  C6    . G   C 2 12  ? -53.646 19.837  -25.415 1.00 87.23  ? 12  G   C C6    1 
ATOM   7546 O  O6    . G   C 2 12  ? -54.046 18.905  -24.712 1.00 90.12  ? 12  G   C O6    1 
ATOM   7547 N  N1    . G   C 2 12  ? -52.381 20.384  -25.194 1.00 82.69  ? 12  G   C N1    1 
ATOM   7548 C  C2    . G   C 2 12  ? -51.839 21.419  -25.919 1.00 80.26  ? 12  G   C C2    1 
ATOM   7549 N  N2    . G   C 2 12  ? -50.610 21.826  -25.576 1.00 76.77  ? 12  G   C N2    1 
ATOM   7550 N  N3    . G   C 2 12  ? -52.474 22.023  -26.915 1.00 82.23  ? 12  G   C N3    1 
ATOM   7551 C  C4    . G   C 2 12  ? -53.711 21.502  -27.144 1.00 86.45  ? 12  G   C C4    1 
ATOM   7552 P  P     . U   C 2 13  ? -52.778 21.148  -33.141 1.00 97.49  ? 13  U   C P     1 
ATOM   7553 O  OP1   . U   C 2 13  ? -52.122 21.514  -34.420 1.00 98.44  ? 13  U   C OP1   1 
ATOM   7554 O  OP2   . U   C 2 13  ? -53.771 20.044  -33.116 1.00 100.57 ? 13  U   C OP2   1 
ATOM   7555 O  "O5'" . U   C 2 13  ? -51.647 20.816  -32.043 1.00 91.84  ? 13  U   C "O5'" 1 
ATOM   7556 C  "C5'" . U   C 2 13  ? -50.347 21.413  -32.068 1.00 88.62  ? 13  U   C "C5'" 1 
ATOM   7557 C  "C4'" . U   C 2 13  ? -49.474 20.821  -30.977 1.00 85.86  ? 13  U   C "C4'" 1 
ATOM   7558 O  "O4'" . U   C 2 13  ? -50.143 20.901  -29.692 1.00 85.86  ? 13  U   C "O4'" 1 
ATOM   7559 C  "C3'" . U   C 2 13  ? -49.209 19.333  -31.105 1.00 86.86  ? 13  U   C "C3'" 1 
ATOM   7560 O  "O3'" . U   C 2 13  ? -48.208 19.061  -32.076 1.00 86.59  ? 13  U   C "O3'" 1 
ATOM   7561 C  "C2'" . U   C 2 13  ? -48.801 18.957  -29.679 1.00 85.02  ? 13  U   C "C2'" 1 
ATOM   7562 O  "O2'" . U   C 2 13  ? -47.487 19.324  -29.317 1.00 82.66  ? 13  U   C "O2'" 1 
ATOM   7563 C  "C1'" . U   C 2 13  ? -49.796 19.783  -28.877 1.00 85.18  ? 13  U   C "C1'" 1 
ATOM   7564 N  N1    . U   C 2 13  ? -51.006 18.974  -28.479 1.00 88.35  ? 13  U   C N1    1 
ATOM   7565 C  C2    . U   C 2 13  ? -50.913 18.086  -27.415 1.00 88.79  ? 13  U   C C2    1 
ATOM   7566 O  O2    . U   C 2 13  ? -49.900 17.917  -26.763 1.00 87.13  ? 13  U   C O2    1 
ATOM   7567 N  N3    . U   C 2 13  ? -52.062 17.388  -27.131 1.00 92.82  ? 13  U   C N3    1 
ATOM   7568 C  C4    . U   C 2 13  ? -53.272 17.490  -27.799 1.00 96.75  ? 13  U   C C4    1 
ATOM   7569 O  O4    . U   C 2 13  ? -54.222 16.805  -27.441 1.00 101.30 ? 13  U   C O4    1 
ATOM   7570 C  C5    . U   C 2 13  ? -53.301 18.427  -28.896 1.00 95.81  ? 13  U   C C5    1 
ATOM   7571 C  C6    . U   C 2 13  ? -52.190 19.115  -29.187 1.00 91.80  ? 13  U   C C6    1 
ATOM   7572 P  P     . U   C 2 14  ? -48.431 17.845  -33.091 1.00 88.94  ? 14  U   C P     1 
ATOM   7573 O  OP1   . U   C 2 14  ? -47.466 18.011  -34.202 1.00 88.67  ? 14  U   C OP1   1 
ATOM   7574 O  OP2   . U   C 2 14  ? -49.884 17.731  -33.351 1.00 91.68  ? 14  U   C OP2   1 
ATOM   7575 O  "O5'" . U   C 2 14  ? -48.027 16.560  -32.231 1.00 89.65  ? 14  U   C "O5'" 1 
ATOM   7576 C  "C5'" . U   C 2 14  ? -46.764 16.469  -31.585 1.00 88.20  ? 14  U   C "C5'" 1 
ATOM   7577 C  "C4'" . U   C 2 14  ? -46.801 15.371  -30.544 1.00 90.33  ? 14  U   C "C4'" 1 
ATOM   7578 O  "O4'" . U   C 2 14  ? -47.746 15.719  -29.504 1.00 89.98  ? 14  U   C "O4'" 1 
ATOM   7579 C  "C3'" . U   C 2 14  ? -47.331 14.038  -31.039 1.00 94.86  ? 14  U   C "C3'" 1 
ATOM   7580 O  "O3'" . U   C 2 14  ? -46.367 13.318  -31.800 1.00 96.02  ? 14  U   C "O3'" 1 
ATOM   7581 C  "C2'" . U   C 2 14  ? -47.680 13.371  -29.716 1.00 97.07  ? 14  U   C "C2'" 1 
ATOM   7582 O  "O2'" . U   C 2 14  ? -46.548 12.908  -29.001 1.00 97.39  ? 14  U   C "O2'" 1 
ATOM   7583 C  "C1'" . U   C 2 14  ? -48.345 14.542  -28.994 1.00 94.28  ? 14  U   C "C1'" 1 
ATOM   7584 N  N1    . U   C 2 14  ? -49.843 14.596  -29.174 1.00 97.08  ? 14  U   C N1    1 
ATOM   7585 C  C2    . U   C 2 14  ? -50.648 13.748  -28.422 1.00 101.48 ? 14  U   C C2    1 
ATOM   7586 O  O2    . U   C 2 14  ? -50.218 12.944  -27.616 1.00 103.74 ? 14  U   C O2    1 
ATOM   7587 N  N3    . U   C 2 14  ? -52.000 13.858  -28.642 1.00 104.22 ? 14  U   C N3    1 
ATOM   7588 C  C4    . U   C 2 14  ? -52.623 14.721  -29.522 1.00 103.64 ? 14  U   C C4    1 
ATOM   7589 O  O4    . U   C 2 14  ? -53.846 14.703  -29.608 1.00 107.67 ? 14  U   C O4    1 
ATOM   7590 C  C5    . U   C 2 14  ? -51.730 15.577  -30.272 1.00 99.67  ? 14  U   C C5    1 
ATOM   7591 C  C6    . U   C 2 14  ? -50.406 15.486  -30.077 1.00 96.36  ? 14  U   C C6    1 
ATOM   7592 P  P     . C   C 2 15  ? -46.825 12.707  -33.204 1.00 98.84  ? 15  C   C P     1 
ATOM   7593 O  OP1   . C   C 2 15  ? -45.605 12.476  -34.012 1.00 98.86  ? 15  C   C OP1   1 
ATOM   7594 O  OP2   . C   C 2 15  ? -47.936 13.523  -33.752 1.00 98.62  ? 15  C   C OP2   1 
ATOM   7595 O  "O5'" . C   C 2 15  ? -47.438 11.305  -32.752 1.00 103.68 ? 15  C   C "O5'" 1 
ATOM   7596 C  "C5'" . C   C 2 15  ? -47.995 10.387  -33.688 1.00 107.74 ? 15  C   C "C5'" 1 
ATOM   7597 C  "C4'" . C   C 2 15  ? -48.505 9.164   -32.946 1.00 113.06 ? 15  C   C "C4'" 1 
ATOM   7598 O  "O4'" . C   C 2 15  ? -47.406 8.366   -32.430 1.00 114.68 ? 15  C   C "O4'" 1 
ATOM   7599 C  "C3'" . C   C 2 15  ? -49.292 9.453   -31.680 1.00 113.65 ? 15  C   C "C3'" 1 
ATOM   7600 O  "O3'" . C   C 2 15  ? -50.596 9.905   -31.985 1.00 114.81 ? 15  C   C "O3'" 1 
ATOM   7601 C  "C2'" . C   C 2 15  ? -49.285 8.086   -31.007 1.00 119.58 ? 15  C   C "C2'" 1 
ATOM   7602 O  "O2'" . C   C 2 15  ? -50.226 7.180   -31.551 1.00 125.63 ? 15  C   C "O2'" 1 
ATOM   7603 C  "C1'" . C   C 2 15  ? -47.871 7.607   -31.319 1.00 119.23 ? 15  C   C "C1'" 1 
ATOM   7604 N  N1    . C   C 2 15  ? -46.939 7.670   -30.129 1.00 118.64 ? 15  C   C N1    1 
ATOM   7605 C  C2    . C   C 2 15  ? -46.008 8.713   -29.922 1.00 113.62 ? 15  C   C C2    1 
ATOM   7606 O  O2    . C   C 2 15  ? -45.909 9.652   -30.722 1.00 109.49 ? 15  C   C O2    1 
ATOM   7607 N  N3    . C   C 2 15  ? -45.212 8.674   -28.816 1.00 114.32 ? 15  C   C N3    1 
ATOM   7608 C  C4    . C   C 2 15  ? -45.308 7.665   -27.939 1.00 120.19 ? 15  C   C C4    1 
ATOM   7609 N  N4    . C   C 2 15  ? -44.499 7.674   -26.871 1.00 121.23 ? 15  C   C N4    1 
ATOM   7610 C  C5    . C   C 2 15  ? -46.246 6.601   -28.125 1.00 125.79 ? 15  C   C C5    1 
ATOM   7611 C  C6    . C   C 2 15  ? -47.021 6.651   -29.217 1.00 124.58 ? 15  C   C C6    1 
ATOM   7612 P  P     . A   C 2 16  ? -51.275 11.054  -31.105 1.00 112.38 ? 16  A   C P     1 
ATOM   7613 O  OP1   . A   C 2 16  ? -52.654 11.172  -31.612 1.00 116.24 ? 16  A   C OP1   1 
ATOM   7614 O  OP2   . A   C 2 16  ? -50.396 12.243  -31.086 1.00 105.94 ? 16  A   C OP2   1 
ATOM   7615 O  "O5'" . A   C 2 16  ? -51.321 10.459  -29.624 1.00 116.03 ? 16  A   C "O5'" 1 
ATOM   7616 C  "C5'" . A   C 2 16  ? -52.295 9.466   -29.293 1.00 124.58 ? 16  A   C "C5'" 1 
ATOM   7617 C  "C4'" . A   C 2 16  ? -52.000 8.842   -27.944 1.00 128.71 ? 16  A   C "C4'" 1 
ATOM   7618 O  "O4'" . A   C 2 16  ? -50.645 8.328   -27.929 1.00 127.93 ? 16  A   C "O4'" 1 
ATOM   7619 C  "C3'" . A   C 2 16  ? -52.029 9.815   -26.778 1.00 126.52 ? 16  A   C "C3'" 1 
ATOM   7620 O  "O3'" . A   C 2 16  ? -53.370 10.037  -26.339 1.00 131.82 ? 16  A   C "O3'" 1 
ATOM   7621 C  "C2'" . A   C 2 16  ? -51.145 9.101   -25.753 1.00 128.13 ? 16  A   C "C2'" 1 
ATOM   7622 O  "O2'" . A   C 2 16  ? -51.804 8.080   -25.027 1.00 136.15 ? 16  A   C "O2'" 1 
ATOM   7623 C  "C1'" . A   C 2 16  ? -50.064 8.498   -26.648 1.00 126.73 ? 16  A   C "C1'" 1 
ATOM   7624 N  N9    . A   C 2 16  ? -48.885 9.360   -26.727 1.00 120.04 ? 16  A   C N9    1 
ATOM   7625 C  C8    . A   C 2 16  ? -48.671 10.395  -27.593 1.00 114.18 ? 16  A   C C8    1 
ATOM   7626 N  N7    . A   C 2 16  ? -47.521 11.001  -27.418 1.00 110.43 ? 16  A   C N7    1 
ATOM   7627 C  C5    . A   C 2 16  ? -46.934 10.324  -26.362 1.00 113.65 ? 16  A   C C5    1 
ATOM   7628 C  C6    . A   C 2 16  ? -45.698 10.478  -25.684 1.00 112.94 ? 16  A   C C6    1 
ATOM   7629 N  N6    . A   C 2 16  ? -44.792 11.410  -25.994 1.00 108.33 ? 16  A   C N6    1 
ATOM   7630 N  N1    . A   C 2 16  ? -45.421 9.624   -24.670 1.00 118.26 ? 16  A   C N1    1 
ATOM   7631 C  C2    . A   C 2 16  ? -46.324 8.684   -24.351 1.00 123.80 ? 16  A   C C2    1 
ATOM   7632 N  N3    . A   C 2 16  ? -47.513 8.446   -24.916 1.00 124.99 ? 16  A   C N3    1 
ATOM   7633 C  C4    . A   C 2 16  ? -47.765 9.305   -25.923 1.00 119.60 ? 16  A   C C4    1 
ATOM   7634 P  P     . A   C 2 17  ? -53.845 11.468  -25.786 1.00 128.84 ? 17  A   C P     1 
ATOM   7635 O  OP1   . A   C 2 17  ? -54.887 11.983  -26.697 1.00 129.86 ? 17  A   C OP1   1 
ATOM   7636 O  OP2   . A   C 2 17  ? -52.675 12.320  -25.482 1.00 122.43 ? 17  A   C OP2   1 
ATOM   7637 O  "O5'" . A   C 2 17  ? -54.497 11.055  -24.389 1.00 135.68 ? 17  A   C "O5'" 1 
ATOM   7638 C  "C5'" . A   C 2 17  ? -53.671 10.604  -23.313 1.00 138.64 ? 17  A   C "C5'" 1 
ATOM   7639 C  "C4'" . A   C 2 17  ? -53.563 11.654  -22.218 1.00 136.29 ? 17  A   C "C4'" 1 
ATOM   7640 O  "O4'" . A   C 2 17  ? -52.441 12.531  -22.480 1.00 129.31 ? 17  A   C "O4'" 1 
ATOM   7641 C  "C3'" . A   C 2 17  ? -54.774 12.570  -22.055 1.00 137.07 ? 17  A   C "C3'" 1 
ATOM   7642 O  "O3'" . A   C 2 17  ? -55.068 12.694  -20.668 1.00 140.36 ? 17  A   C "O3'" 1 
ATOM   7643 C  "C2'" . A   C 2 17  ? -54.311 13.888  -22.672 1.00 129.41 ? 17  A   C "C2'" 1 
ATOM   7644 O  "O2'" . A   C 2 17  ? -54.972 15.009  -22.127 1.00 127.61 ? 17  A   C "O2'" 1 
ATOM   7645 C  "C1'" . A   C 2 17  ? -52.847 13.868  -22.256 1.00 126.03 ? 17  A   C "C1'" 1 
ATOM   7646 N  N9    . A   C 2 17  ? -51.947 14.755  -22.999 1.00 120.16 ? 17  A   C N9    1 
ATOM   7647 C  C8    . A   C 2 17  ? -52.186 15.398  -24.189 1.00 117.79 ? 17  A   C C8    1 
ATOM   7648 N  N7    . A   C 2 17  ? -51.178 16.122  -24.617 1.00 113.08 ? 17  A   C N7    1 
ATOM   7649 C  C5    . A   C 2 17  ? -50.204 15.943  -23.642 1.00 112.33 ? 17  A   C C5    1 
ATOM   7650 C  C6    . A   C 2 17  ? -48.887 16.444  -23.495 1.00 108.58 ? 17  A   C C6    1 
ATOM   7651 N  N6    . A   C 2 17  ? -48.318 17.266  -24.387 1.00 105.02 ? 17  A   C N6    1 
ATOM   7652 N  N1    . A   C 2 17  ? -48.182 16.070  -22.395 1.00 109.67 ? 17  A   C N1    1 
ATOM   7653 C  C2    . A   C 2 17  ? -48.747 15.246  -21.499 1.00 114.00 ? 17  A   C C2    1 
ATOM   7654 N  N3    . A   C 2 17  ? -49.971 14.715  -21.533 1.00 117.95 ? 17  A   C N3    1 
ATOM   7655 C  C4    . A   C 2 17  ? -50.658 15.102  -22.634 1.00 116.73 ? 17  A   C C4    1 
ATOM   7656 P  P     . G   C 2 18  ? -56.517 12.325  -20.103 1.00 148.74 ? 18  G   C P     1 
ATOM   7657 O  OP1   . G   C 2 18  ? -56.337 11.622  -18.809 1.00 153.62 ? 18  G   C OP1   1 
ATOM   7658 O  OP2   . G   C 2 18  ? -57.297 11.689  -21.189 1.00 153.62 ? 18  G   C OP2   1 
ATOM   7659 O  "O5'" . G   C 2 18  ? -57.127 13.782  -19.858 1.00 145.13 ? 18  G   C "O5'" 1 
ATOM   7660 C  "C5'" . G   C 2 18  ? -58.005 14.045  -18.772 1.00 149.91 ? 18  G   C "C5'" 1 
ATOM   7661 C  "C4'" . G   C 2 18  ? -57.263 14.480  -17.520 1.00 147.23 ? 18  G   C "C4'" 1 
ATOM   7662 O  "O4'" . G   C 2 18  ? -57.276 13.398  -16.561 1.00 154.89 ? 18  G   C "O4'" 1 
ATOM   7663 C  "C3'" . G   C 2 18  ? -55.770 14.766  -17.629 1.00 140.38 ? 18  G   C "C3'" 1 
ATOM   7664 O  "O3'" . G   C 2 18  ? -55.519 16.013  -18.286 1.00 132.79 ? 18  G   C "O3'" 1 
ATOM   7665 C  "C2'" . G   C 2 18  ? -55.402 14.782  -16.147 1.00 142.03 ? 18  G   C "C2'" 1 
ATOM   7666 O  "O2'" . G   C 2 18  ? -55.714 16.016  -15.520 1.00 138.24 ? 18  G   C "O2'" 1 
ATOM   7667 C  "C1'" . G   C 2 18  ? -56.277 13.659  -15.590 1.00 152.19 ? 18  G   C "C1'" 1 
ATOM   7668 N  N9    . G   C 2 18  ? -55.550 12.426  -15.260 1.00 157.48 ? 18  G   C N9    1 
ATOM   7669 C  C8    . G   C 2 18  ? -54.692 11.709  -16.067 1.00 156.95 ? 18  G   C C8    1 
ATOM   7670 N  N7    . G   C 2 18  ? -54.192 10.650  -15.491 1.00 163.18 ? 18  G   C N7    1 
ATOM   7671 C  C5    . G   C 2 18  ? -54.749 10.659  -14.215 1.00 168.45 ? 18  G   C C5    1 
ATOM   7672 C  C6    . G   C 2 18  ? -54.582 9.759   -13.127 1.00 177.10 ? 18  G   C C6    1 
ATOM   7673 O  O6    . G   C 2 18  ? -53.881 8.737   -13.077 1.00 182.37 ? 18  G   C O6    1 
ATOM   7674 N  N1    . G   C 2 18  ? -55.332 10.131  -12.006 1.00 180.34 ? 18  G   C N1    1 
ATOM   7675 C  C2    . G   C 2 18  ? -56.147 11.239  -11.939 1.00 175.63 ? 18  G   C C2    1 
ATOM   7676 N  N2    . G   C 2 18  ? -56.789 11.437  -10.779 1.00 180.19 ? 18  G   C N2    1 
ATOM   7677 N  N3    . G   C 2 18  ? -56.312 12.090  -12.947 1.00 167.97 ? 18  G   C N3    1 
ATOM   7678 C  C4    . G   C 2 18  ? -55.588 11.747  -14.054 1.00 164.80 ? 18  G   C C4    1 
ATOM   7679 P  P     . U   C 2 19  ? -54.028 16.569  -18.513 1.00 125.35 ? 19  U   C P     1 
ATOM   7680 O  OP1   . U   C 2 19  ? -54.126 17.719  -19.439 1.00 120.27 ? 19  U   C OP1   1 
ATOM   7681 O  OP2   . U   C 2 19  ? -53.149 15.420  -18.861 1.00 127.09 ? 19  U   C OP2   1 
ATOM   7682 O  "O5'" . U   C 2 19  ? -53.628 17.121  -17.055 1.00 122.78 ? 19  U   C "O5'" 1 
ATOM   7683 C  "C5'" . U   C 2 19  ? -52.481 17.947  -16.846 1.00 115.65 ? 19  U   C "C5'" 1 
ATOM   7684 C  "C4'" . U   C 2 19  ? -51.322 17.213  -16.179 1.00 116.06 ? 19  U   C "C4'" 1 
ATOM   7685 O  "O4'" . U   C 2 19  ? -51.526 15.776  -16.123 1.00 122.86 ? 19  U   C "O4'" 1 
ATOM   7686 C  "C3'" . U   C 2 19  ? -49.989 17.416  -16.889 1.00 111.15 ? 19  U   C "C3'" 1 
ATOM   7687 O  "O3'" . U   C 2 19  ? -49.049 17.935  -15.971 1.00 107.40 ? 19  U   C "O3'" 1 
ATOM   7688 C  "C2'" . U   C 2 19  ? -49.560 16.040  -17.385 1.00 115.67 ? 19  U   C "C2'" 1 
ATOM   7689 O  "O2'" . U   C 2 19  ? -48.172 15.830  -17.221 1.00 115.58 ? 19  U   C "O2'" 1 
ATOM   7690 C  "C1'" . U   C 2 19  ? -50.333 15.103  -16.469 1.00 123.11 ? 19  U   C "C1'" 1 
ATOM   7691 N  N1    . U   C 2 19  ? -50.684 13.790  -17.103 1.00 128.85 ? 19  U   C N1    1 
ATOM   7692 C  C2    . U   C 2 19  ? -51.247 12.791  -16.325 1.00 136.79 ? 19  U   C C2    1 
ATOM   7693 O  O2    . U   C 2 19  ? -51.483 12.914  -15.134 1.00 139.35 ? 19  U   C O2    1 
ATOM   7694 N  N3    . U   C 2 19  ? -51.530 11.621  -16.999 1.00 142.47 ? 19  U   C N3    1 
ATOM   7695 C  C4    . U   C 2 19  ? -51.311 11.351  -18.345 1.00 140.31 ? 19  U   C C4    1 
ATOM   7696 O  O4    . U   C 2 19  ? -51.617 10.254  -18.807 1.00 145.66 ? 19  U   C O4    1 
ATOM   7697 C  C5    . U   C 2 19  ? -50.720 12.440  -19.089 1.00 132.11 ? 19  U   C C5    1 
ATOM   7698 C  C6    . U   C 2 19  ? -50.438 13.589  -18.454 1.00 127.05 ? 19  U   C C6    1 
ATOM   7699 P  P     . C   C 2 20  ? -48.499 19.424  -16.170 1.00 99.75  ? 20  C   C P     1 
ATOM   7700 O  OP1   . C   C 2 20  ? -47.326 19.552  -15.276 1.00 100.80 ? 20  C   C OP1   1 
ATOM   7701 O  OP2   . C   C 2 20  ? -49.641 20.359  -15.987 1.00 98.23  ? 20  C   C OP2   1 
ATOM   7702 O  "O5'" . C   C 2 20  ? -48.036 19.463  -17.715 1.00 93.53  ? 20  C   C "O5'" 1 
ATOM   7703 C  "C5'" . C   C 2 20  ? -46.674 19.348  -18.137 1.00 87.33  ? 20  C   C "C5'" 1 
ATOM   7704 C  "C4'" . C   C 2 20  ? -46.469 19.938  -19.524 1.00 80.79  ? 20  C   C "C4'" 1 
ATOM   7705 O  "O4'" . C   C 2 20  ? -46.947 18.995  -20.522 1.00 82.44  ? 20  C   C "O4'" 1 
ATOM   7706 C  "C3'" . C   C 2 20  ? -47.228 21.228  -19.821 1.00 75.23  ? 20  C   C "C3'" 1 
ATOM   7707 O  "O3'" . C   C 2 20  ? -46.510 22.385  -19.443 1.00 69.65  ? 20  C   C "O3'" 1 
ATOM   7708 C  "C2'" . C   C 2 20  ? -47.422 21.187  -21.331 1.00 75.32  ? 20  C   C "C2'" 1 
ATOM   7709 O  "O2'" . C   C 2 20  ? -46.357 21.739  -22.074 1.00 73.28  ? 20  C   C "O2'" 1 
ATOM   7710 C  "C1'" . C   C 2 20  ? -47.561 19.692  -21.605 1.00 79.69  ? 20  C   C "C1'" 1 
ATOM   7711 N  N1    . C   C 2 20  ? -49.019 19.317  -21.780 1.00 81.84  ? 20  C   C N1    1 
ATOM   7712 C  C2    . C   C 2 20  ? -49.726 19.750  -22.921 1.00 81.03  ? 20  C   C C2    1 
ATOM   7713 O  O2    . C   C 2 20  ? -49.165 20.424  -23.792 1.00 79.07  ? 20  C   C O2    1 
ATOM   7714 N  N3    . C   C 2 20  ? -51.032 19.411  -23.050 1.00 84.20  ? 20  C   C N3    1 
ATOM   7715 C  C4    . C   C 2 20  ? -51.636 18.681  -22.108 1.00 87.67  ? 20  C   C C4    1 
ATOM   7716 N  N4    . C   C 2 20  ? -52.923 18.380  -22.298 1.00 91.56  ? 20  C   C N4    1 
ATOM   7717 C  C5    . C   C 2 20  ? -50.950 18.230  -20.935 1.00 88.02  ? 20  C   C C5    1 
ATOM   7718 C  C6    . C   C 2 20  ? -49.659 18.574  -20.816 1.00 85.26  ? 20  C   C C6    1 
ATOM   7719 P  P     . C   C 2 21  ? -47.342 23.718  -19.117 1.00 65.59  ? 21  C   C P     1 
ATOM   7720 O  OP1   . C   C 2 21  ? -46.443 24.702  -18.486 1.00 64.35  ? 21  C   C OP1   1 
ATOM   7721 O  OP2   . C   C 2 21  ? -48.554 23.301  -18.387 1.00 68.10  ? 21  C   C OP2   1 
ATOM   7722 O  "O5'" . C   C 2 21  ? -47.799 24.256  -20.545 1.00 62.63  ? 21  C   C "O5'" 1 
ATOM   7723 C  "C5'" . C   C 2 21  ? -46.890 24.938  -21.374 1.00 59.19  ? 21  C   C "C5'" 1 
ATOM   7724 C  "C4'" . C   C 2 21  ? -47.632 25.481  -22.565 1.00 58.44  ? 21  C   C "C4'" 1 
ATOM   7725 O  "O4'" . C   C 2 21  ? -48.245 24.374  -23.259 1.00 58.42  ? 21  C   C "O4'" 1 
ATOM   7726 C  "C3'" . C   C 2 21  ? -48.779 26.406  -22.190 1.00 59.01  ? 21  C   C "C3'" 1 
ATOM   7727 O  "O3'" . C   C 2 21  ? -48.294 27.737  -22.101 1.00 60.22  ? 21  C   C "O3'" 1 
ATOM   7728 C  "C2'" . C   C 2 21  ? -49.727 26.229  -23.366 1.00 59.96  ? 21  C   C "C2'" 1 
ATOM   7729 O  "O2'" . C   C 2 21  ? -49.425 27.090  -24.457 1.00 60.26  ? 21  C   C "O2'" 1 
ATOM   7730 C  "C1'" . C   C 2 21  ? -49.526 24.752  -23.718 1.00 59.11  ? 21  C   C "C1'" 1 
ATOM   7731 N  N1    . C   C 2 21  ? -50.565 23.863  -23.111 1.00 60.01  ? 21  C   C N1    1 
ATOM   7732 C  C2    . C   C 2 21  ? -51.826 23.812  -23.700 1.00 63.27  ? 21  C   C C2    1 
ATOM   7733 O  O2    . C   C 2 21  ? -52.036 24.491  -24.710 1.00 64.41  ? 21  C   C O2    1 
ATOM   7734 N  N3    . C   C 2 21  ? -52.785 23.010  -23.158 1.00 66.44  ? 21  C   C N3    1 
ATOM   7735 C  C4    . C   C 2 21  ? -52.534 22.280  -22.069 1.00 65.78  ? 21  C   C C4    1 
ATOM   7736 N  N4    . C   C 2 21  ? -53.524 21.516  -21.592 1.00 68.94  ? 21  C   C N4    1 
ATOM   7737 C  C5    . C   C 2 21  ? -51.250 22.322  -21.438 1.00 62.66  ? 21  C   C C5    1 
ATOM   7738 C  C6    . C   C 2 21  ? -50.317 23.114  -21.991 1.00 60.10  ? 21  C   C C6    1 
ATOM   7739 P  P     . A   C 2 22  ? -48.927 28.804  -21.099 1.00 60.03  ? 22  A   C P     1 
ATOM   7740 O  OP1   . A   C 2 22  ? -47.928 29.883  -20.939 1.00 59.16  ? 22  A   C OP1   1 
ATOM   7741 O  OP2   . A   C 2 22  ? -49.456 28.060  -19.928 1.00 59.66  ? 22  A   C OP2   1 
ATOM   7742 O  "O5'" . A   C 2 22  ? -50.146 29.389  -21.947 1.00 64.06  ? 22  A   C "O5'" 1 
ATOM   7743 C  "C5'" . A   C 2 22  ? -51.488 29.211  -21.512 1.00 67.20  ? 22  A   C "C5'" 1 
ATOM   7744 C  "C4'" . A   C 2 22  ? -52.447 29.287  -22.683 1.00 71.87  ? 22  A   C "C4'" 1 
ATOM   7745 O  "O4'" . A   C 2 22  ? -52.502 28.009  -23.365 1.00 72.98  ? 22  A   C "O4'" 1 
ATOM   7746 C  "C3'" . A   C 2 22  ? -53.881 29.575  -22.289 1.00 75.41  ? 22  A   C "C3'" 1 
ATOM   7747 O  "O3'" . A   C 2 22  ? -54.106 30.964  -22.291 1.00 77.45  ? 22  A   C "O3'" 1 
ATOM   7748 C  "C2'" . A   C 2 22  ? -54.655 28.891  -23.402 1.00 79.45  ? 22  A   C "C2'" 1 
ATOM   7749 O  "O2'" . A   C 2 22  ? -54.625 29.643  -24.594 1.00 83.06  ? 22  A   C "O2'" 1 
ATOM   7750 C  "C1'" . A   C 2 22  ? -53.842 27.622  -23.589 1.00 77.23  ? 22  A   C "C1'" 1 
ATOM   7751 N  N9    . A   C 2 22  ? -54.227 26.535  -22.684 1.00 77.33  ? 22  A   C N9    1 
ATOM   7752 C  C8    . A   C 2 22  ? -53.501 26.010  -21.655 1.00 74.56  ? 22  A   C C8    1 
ATOM   7753 N  N7    . A   C 2 22  ? -54.112 25.045  -21.021 1.00 76.42  ? 22  A   C N7    1 
ATOM   7754 C  C5    . A   C 2 22  ? -55.323 24.921  -21.673 1.00 80.68  ? 22  A   C C5    1 
ATOM   7755 C  C6    . A   C 2 22  ? -56.438 24.072  -21.487 1.00 85.42  ? 22  A   C C6    1 
ATOM   7756 N  N6    . A   C 2 22  ? -56.506 23.140  -20.537 1.00 86.49  ? 22  A   C N6    1 
ATOM   7757 N  N1    . A   C 2 22  ? -57.503 24.213  -22.312 1.00 90.30  ? 22  A   C N1    1 
ATOM   7758 C  C2    . A   C 2 22  ? -57.459 25.150  -23.270 1.00 90.28  ? 22  A   C C2    1 
ATOM   7759 N  N3    . A   C 2 22  ? -56.461 25.998  -23.540 1.00 86.96  ? 22  A   C N3    1 
ATOM   7760 C  C4    . A   C 2 22  ? -55.413 25.835  -22.701 1.00 81.63  ? 22  A   C C4    1 
ATOM   7761 P  P     . U   C 2 23  ? -55.031 31.568  -21.146 1.00 78.81  ? 23  U   C P     1 
ATOM   7762 O  OP1   . U   C 2 23  ? -54.992 33.043  -21.237 1.00 80.80  ? 23  U   C OP1   1 
ATOM   7763 O  OP2   . U   C 2 23  ? -54.667 30.890  -19.883 1.00 75.69  ? 23  U   C OP2   1 
ATOM   7764 O  "O5'" . U   C 2 23  ? -56.478 31.059  -21.550 1.00 84.48  ? 23  U   C "O5'" 1 
ATOM   7765 C  "C5'" . U   C 2 23  ? -57.096 31.582  -22.706 1.00 91.48  ? 23  U   C "C5'" 1 
ATOM   7766 C  "C4'" . U   C 2 23  ? -58.369 30.813  -22.984 1.00 97.68  ? 23  U   C "C4'" 1 
ATOM   7767 O  "O4'" . U   C 2 23  ? -58.087 29.389  -23.054 1.00 95.90  ? 23  U   C "O4'" 1 
ATOM   7768 C  "C3'" . U   C 2 23  ? -59.425 30.905  -21.890 1.00 100.47 ? 23  U   C "C3'" 1 
ATOM   7769 O  "O3'" . U   C 2 23  ? -60.112 32.162  -21.908 1.00 104.96 ? 23  U   C "O3'" 1 
ATOM   7770 C  "C2'" . U   C 2 23  ? -60.305 29.731  -22.298 1.00 104.67 ? 23  U   C "C2'" 1 
ATOM   7771 O  "O2'" . U   C 2 23  ? -61.138 30.013  -23.408 1.00 111.09 ? 23  U   C "O2'" 1 
ATOM   7772 C  "C1'" . U   C 2 23  ? -59.253 28.685  -22.666 1.00 99.98  ? 23  U   C "C1'" 1 
ATOM   7773 N  N1    . U   C 2 23  ? -58.942 27.743  -21.542 1.00 96.82  ? 23  U   C N1    1 
ATOM   7774 C  C2    . U   C 2 23  ? -59.851 26.739  -21.250 1.00 101.26 ? 23  U   C C2    1 
ATOM   7775 O  O2    . U   C 2 23  ? -60.900 26.570  -21.858 1.00 107.32 ? 23  U   C O2    1 
ATOM   7776 N  N3    . U   C 2 23  ? -59.485 25.920  -20.207 1.00 99.03  ? 23  U   C N3    1 
ATOM   7777 C  C4    . U   C 2 23  ? -58.336 25.999  -19.444 1.00 93.28  ? 23  U   C C4    1 
ATOM   7778 O  O4    . U   C 2 23  ? -58.161 25.185  -18.547 1.00 93.18  ? 23  U   C O4    1 
ATOM   7779 C  C5    . U   C 2 23  ? -57.438 27.068  -19.805 1.00 89.18  ? 23  U   C C5    1 
ATOM   7780 C  C6    . U   C 2 23  ? -57.768 27.881  -20.819 1.00 90.93  ? 23  U   C C6    1 
ATOM   7781 P  P     . U   C 2 24  ? -60.444 32.926  -20.537 1.00 104.51 ? 24  U   C P     1 
ATOM   7782 O  OP1   . U   C 2 24  ? -60.753 34.328  -20.878 1.00 108.29 ? 24  U   C OP1   1 
ATOM   7783 O  OP2   . U   C 2 24  ? -59.394 32.626  -19.536 1.00 97.41  ? 24  U   C OP2   1 
ATOM   7784 O  "O5'" . U   C 2 24  ? -61.776 32.202  -20.055 1.00 109.37 ? 24  U   C "O5'" 1 
ATOM   7785 C  "C5'" . U   C 2 24  ? -62.890 32.158  -20.927 1.00 117.86 ? 24  U   C "C5'" 1 
ATOM   7786 C  "C4'" . U   C 2 24  ? -63.792 30.993  -20.578 1.00 122.13 ? 24  U   C "C4'" 1 
ATOM   7787 O  "O4'" . U   C 2 24  ? -63.059 29.753  -20.708 1.00 117.55 ? 24  U   C "O4'" 1 
ATOM   7788 C  "C3'" . U   C 2 24  ? -64.254 30.961  -19.132 1.00 122.61 ? 24  U   C "C3'" 1 
ATOM   7789 O  "O3'" . U   C 2 24  ? -65.327 31.858  -18.883 1.00 129.19 ? 24  U   C "O3'" 1 
ATOM   7790 C  "C2'" . U   C 2 24  ? -64.641 29.498  -18.963 1.00 124.57 ? 24  U   C "C2'" 1 
ATOM   7791 O  "O2'" . U   C 2 24  ? -65.884 29.171  -19.555 1.00 133.66 ? 24  U   C "O2'" 1 
ATOM   7792 C  "C1'" . U   C 2 24  ? -63.497 28.834  -19.722 1.00 118.58 ? 24  U   C "C1'" 1 
ATOM   7793 N  N1    . U   C 2 24  ? -62.337 28.399  -18.855 1.00 111.18 ? 24  U   C N1    1 
ATOM   7794 C  C2    . U   C 2 24  ? -62.455 27.202  -18.165 1.00 112.03 ? 24  U   C C2    1 
ATOM   7795 O  O2    . U   C 2 24  ? -63.446 26.492  -18.218 1.00 118.15 ? 24  U   C O2    1 
ATOM   7796 N  N3    . U   C 2 24  ? -61.365 26.859  -17.404 1.00 105.66 ? 24  U   C N3    1 
ATOM   7797 C  C4    . U   C 2 24  ? -60.196 27.578  -17.271 1.00 99.10  ? 24  U   C C4    1 
ATOM   7798 O  O4    . U   C 2 24  ? -59.314 27.132  -16.556 1.00 95.50  ? 24  U   C O4    1 
ATOM   7799 C  C5    . U   C 2 24  ? -60.133 28.810  -18.018 1.00 98.55  ? 24  U   C C5    1 
ATOM   7800 C  C6    . U   C 2 24  ? -61.185 29.168  -18.765 1.00 104.42 ? 24  U   C C6    1 
ATOM   7801 P  P     . U   C 2 25  ? -65.423 32.434  -17.395 1.00 127.79 ? 25  U   C P     1 
ATOM   7802 O  OP1   . U   C 2 25  ? -65.893 33.836  -17.468 1.00 132.15 ? 25  U   C OP1   1 
ATOM   7803 O  OP2   . U   C 2 25  ? -64.168 32.119  -16.668 1.00 118.35 ? 25  U   C OP2   1 
ATOM   7804 O  "O5'" . U   C 2 25  ? -66.570 31.516  -16.773 1.00 133.70 ? 25  U   C "O5'" 1 
ATOM   7805 C  "C5'" . U   C 2 25  ? -67.811 31.335  -17.445 1.00 142.32 ? 25  U   C "C5'" 1 
ATOM   7806 C  "C4'" . U   C 2 25  ? -68.554 30.178  -16.810 1.00 146.46 ? 25  U   C "C4'" 1 
ATOM   7807 O  "O4'" . U   C 2 25  ? -67.840 28.942  -17.075 1.00 141.88 ? 25  U   C "O4'" 1 
ATOM   7808 C  "C3'" . U   C 2 25  ? -68.597 30.195  -15.289 1.00 144.80 ? 25  U   C "C3'" 1 
ATOM   7809 O  "O3'" . U   C 2 25  ? -69.521 31.137  -14.754 1.00 151.44 ? 25  U   C "O3'" 1 
ATOM   7810 C  "C2'" . U   C 2 25  ? -68.974 28.747  -15.024 1.00 147.88 ? 25  U   C "C2'" 1 
ATOM   7811 O  "O2'" . U   C 2 25  ? -70.312 28.459  -15.382 1.00 158.52 ? 25  U   C "O2'" 1 
ATOM   7812 C  "C1'" . U   C 2 25  ? -67.976 28.067  -15.965 1.00 141.62 ? 25  U   C "C1'" 1 
ATOM   7813 N  N1    . U   C 2 25  ? -66.624 27.798  -15.335 1.00 131.33 ? 25  U   C N1    1 
ATOM   7814 C  C2    . U   C 2 25  ? -66.511 26.875  -14.302 1.00 131.52 ? 25  U   C C2    1 
ATOM   7815 O  O2    . U   C 2 25  ? -67.439 26.237  -13.840 1.00 139.23 ? 25  U   C O2    1 
ATOM   7816 N  N3    . U   C 2 25  ? -65.248 26.710  -13.796 1.00 123.42 ? 25  U   C N3    1 
ATOM   7817 C  C4    . U   C 2 25  ? -64.099 27.353  -14.205 1.00 115.61 ? 25  U   C C4    1 
ATOM   7818 O  O4    . U   C 2 25  ? -63.043 27.085  -13.646 1.00 110.16 ? 25  U   C O4    1 
ATOM   7819 C  C5    . U   C 2 25  ? -64.281 28.296  -15.282 1.00 115.71 ? 25  U   C C5    1 
ATOM   7820 C  C6    . U   C 2 25  ? -65.507 28.477  -15.790 1.00 123.05 ? 25  U   C C6    1 
ATOM   7821 P  P     . A   C 2 26  ? -69.153 31.872  -13.370 1.00 147.69 ? 26  A   C P     1 
ATOM   7822 O  OP1   . A   C 2 26  ? -70.125 32.967  -13.160 1.00 154.59 ? 26  A   C OP1   1 
ATOM   7823 O  OP2   . A   C 2 26  ? -67.701 32.178  -13.353 1.00 136.46 ? 26  A   C OP2   1 
ATOM   7824 O  "O5'" . A   C 2 26  ? -69.458 30.747  -12.277 1.00 149.73 ? 26  A   C "O5'" 1 
ATOM   7825 C  "C5'" . A   C 2 26  ? -70.761 30.170  -12.150 1.00 160.04 ? 26  A   C "C5'" 1 
ATOM   7826 C  "C4'" . A   C 2 26  ? -70.723 29.009  -11.175 1.00 161.00 ? 26  A   C "C4'" 1 
ATOM   7827 O  "O4'" . A   C 2 26  ? -69.901 27.923  -11.699 1.00 157.15 ? 26  A   C "O4'" 1 
ATOM   7828 C  "C3'" . A   C 2 26  ? -70.080 29.345  -9.835  1.00 154.88 ? 26  A   C "C3'" 1 
ATOM   7829 O  "O3'" . A   C 2 26  ? -70.989 30.014  -8.956  1.00 159.46 ? 26  A   C "O3'" 1 
ATOM   7830 C  "C2'" . A   C 2 26  ? -69.658 27.955  -9.366  1.00 155.30 ? 26  A   C "C2'" 1 
ATOM   7831 O  "O2'" . A   C 2 26  ? -70.748 27.166  -8.915  1.00 165.97 ? 26  A   C "O2'" 1 
ATOM   7832 C  "C1'" . A   C 2 26  ? -69.060 27.417  -10.668 1.00 152.12 ? 26  A   C "C1'" 1 
ATOM   7833 N  N9    . A   C 2 26  ? -67.664 27.841  -10.889 1.00 141.52 ? 26  A   C N9    1 
ATOM   7834 C  C8    . A   C 2 26  ? -67.214 28.802  -11.763 1.00 136.81 ? 26  A   C C8    1 
ATOM   7835 N  N7    . A   C 2 26  ? -65.916 28.994  -11.765 1.00 128.00 ? 26  A   C N7    1 
ATOM   7836 C  C5    . A   C 2 26  ? -65.466 28.095  -10.818 1.00 126.79 ? 26  A   C C5    1 
ATOM   7837 C  C6    . A   C 2 26  ? -64.169 27.805  -10.348 1.00 119.77 ? 26  A   C C6    1 
ATOM   7838 N  N6    . A   C 2 26  ? -63.082 28.433  -10.804 1.00 112.63 ? 26  A   C N6    1 
ATOM   7839 N  N1    . A   C 2 26  ? -64.041 26.853  -9.395  1.00 121.76 ? 26  A   C N1    1 
ATOM   7840 C  C2    . A   C 2 26  ? -65.148 26.234  -8.949  1.00 130.21 ? 26  A   C C2    1 
ATOM   7841 N  N3    . A   C 2 26  ? -66.424 26.421  -9.312  1.00 137.27 ? 26  A   C N3    1 
ATOM   7842 C  C4    . A   C 2 26  ? -66.521 27.375  -10.263 1.00 135.16 ? 26  A   C C4    1 
ATOM   7843 P  P     . C   C 2 27  ? -70.503 31.233  -8.016  1.00 152.69 ? 27  C   C P     1 
ATOM   7844 O  OP1   . C   C 2 27  ? -71.727 31.941  -7.588  1.00 160.97 ? 27  C   C OP1   1 
ATOM   7845 O  OP2   . C   C 2 27  ? -69.424 32.008  -8.680  1.00 143.81 ? 27  C   C OP2   1 
ATOM   7846 O  "O5'" . C   C 2 27  ? -69.850 30.495  -6.751  1.00 147.75 ? 27  C   C "O5'" 1 
ATOM   7847 C  "C5'" . C   C 2 27  ? -70.532 29.426  -6.083  1.00 153.05 ? 27  C   C "C5'" 1 
ATOM   7848 C  "C4'" . C   C 2 27  ? -69.584 28.575  -5.254  1.00 147.05 ? 27  C   C "C4'" 1 
ATOM   7849 O  "O4'" . C   C 2 27  ? -68.679 27.838  -6.116  1.00 141.05 ? 27  C   C "O4'" 1 
ATOM   7850 C  "C3'" . C   C 2 27  ? -68.647 29.353  -4.341  1.00 138.46 ? 27  C   C "C3'" 1 
ATOM   7851 O  "O3'" . C   C 2 27  ? -69.292 29.750  -3.134  1.00 142.76 ? 27  C   C "O3'" 1 
ATOM   7852 C  "C2'" . C   C 2 27  ? -67.530 28.334  -4.144  1.00 133.50 ? 27  C   C "C2'" 1 
ATOM   7853 O  "O2'" . C   C 2 27  ? -67.917 27.240  -3.332  1.00 140.80 ? 27  C   C "O2'" 1 
ATOM   7854 C  "C1'" . C   C 2 27  ? -67.365 27.874  -5.585  1.00 131.01 ? 27  C   C "C1'" 1 
ATOM   7855 N  N1    . C   C 2 27  ? -66.453 28.720  -6.461  1.00 121.53 ? 27  C   C N1    1 
ATOM   7856 C  C2    . C   C 2 27  ? -65.057 28.558  -6.365  1.00 113.81 ? 27  C   C C2    1 
ATOM   7857 O  O2    . C   C 2 27  ? -64.596 27.742  -5.559  1.00 114.37 ? 27  C   C O2    1 
ATOM   7858 N  N3    . C   C 2 27  ? -64.236 29.300  -7.160  1.00 106.43 ? 27  C   C N3    1 
ATOM   7859 C  C4    . C   C 2 27  ? -64.749 30.179  -8.023  1.00 107.03 ? 27  C   C C4    1 
ATOM   7860 N  N4    . C   C 2 27  ? -63.895 30.877  -8.774  1.00 100.89 ? 27  C   C N4    1 
ATOM   7861 C  C5    . C   C 2 27  ? -66.162 30.365  -8.146  1.00 115.00 ? 27  C   C C5    1 
ATOM   7862 C  C6    . C   C 2 27  ? -66.959 29.624  -7.361  1.00 121.64 ? 27  C   C C6    1 
ATOM   7863 P  P     . U   C 2 28  ? -68.772 31.058  -2.356  1.00 136.78 ? 28  U   C P     1 
ATOM   7864 O  OP1   . U   C 2 28  ? -69.809 31.459  -1.366  1.00 143.69 ? 28  U   C OP1   1 
ATOM   7865 O  OP2   . U   C 2 28  ? -68.260 32.049  -3.340  1.00 129.99 ? 28  U   C OP2   1 
ATOM   7866 O  "O5'" . U   C 2 28  ? -67.501 30.484  -1.569  1.00 129.33 ? 28  U   C "O5'" 1 
ATOM   7867 C  "C5'" . U   C 2 28  ? -67.642 29.582  -0.461  1.00 131.04 ? 28  U   C "C5'" 1 
ATOM   7868 C  "C4'" . U   C 2 28  ? -66.279 29.299  0.141   1.00 121.74 ? 28  U   C "C4'" 1 
ATOM   7869 O  "O4'" . U   C 2 28  ? -65.507 28.511  -0.810  1.00 117.40 ? 28  U   C "O4'" 1 
ATOM   7870 C  "C3'" . U   C 2 28  ? -65.359 30.501  0.347   1.00 110.93 ? 28  U   C "C3'" 1 
ATOM   7871 O  "O3'" . U   C 2 28  ? -65.698 31.396  1.426   1.00 109.56 ? 28  U   C "O3'" 1 
ATOM   7872 C  "C2'" . U   C 2 28  ? -64.048 29.743  0.506   1.00 106.47 ? 28  U   C "C2'" 1 
ATOM   7873 O  "O2'" . U   C 2 28  ? -64.045 28.901  1.645   1.00 111.50 ? 28  U   C "O2'" 1 
ATOM   7874 C  "C1'" . U   C 2 28  ? -64.147 28.923  -0.781  1.00 106.98 ? 28  U   C "C1'" 1 
ATOM   7875 N  N1    . U   C 2 28  ? -63.738 29.703  -2.040  1.00 99.88  ? 28  U   C N1    1 
ATOM   7876 C  C2    . U   C 2 28  ? -62.388 29.776  -2.376  1.00 92.79  ? 28  U   C C2    1 
ATOM   7877 O  O2    . U   C 2 28  ? -61.492 29.235  -1.742  1.00 91.05  ? 28  U   C O2    1 
ATOM   7878 N  N3    . U   C 2 28  ? -62.106 30.509  -3.509  1.00 87.62  ? 28  U   C N3    1 
ATOM   7879 C  C4    . U   C 2 28  ? -62.998 31.180  -4.330  1.00 89.29  ? 28  U   C C4    1 
ATOM   7880 O  O4    . U   C 2 28  ? -62.573 31.796  -5.305  1.00 85.05  ? 28  U   C O4    1 
ATOM   7881 C  C5    . U   C 2 28  ? -64.379 31.075  -3.921  1.00 96.53  ? 28  U   C C5    1 
ATOM   7882 C  C6    . U   C 2 28  ? -64.682 30.361  -2.825  1.00 101.03 ? 28  U   C C6    1 
ATOM   7883 P  P     . U   C 2 29  ? -65.114 32.904  1.381   1.00 100.94 ? 29  U   C P     1 
ATOM   7884 O  OP1   . U   C 2 29  ? -65.980 33.858  2.110   1.00 103.24 ? 29  U   C OP1   1 
ATOM   7885 O  OP2   . U   C 2 29  ? -64.682 33.231  -0.004  1.00 96.02  ? 29  U   C OP2   1 
ATOM   7886 O  "O5'" . U   C 2 29  ? -63.812 32.696  2.251   1.00 93.67  ? 29  U   C "O5'" 1 
ATOM   7887 C  "C5'" . U   C 2 29  ? -62.673 33.223  1.717   1.00 82.32  ? 29  U   C "C5'" 1 
ATOM   7888 C  "C4'" . U   C 2 29  ? -61.482 32.382  2.058   1.00 77.22  ? 29  U   C "C4'" 1 
ATOM   7889 O  "O4'" . U   C 2 29  ? -61.192 31.438  0.998   1.00 76.89  ? 29  U   C "O4'" 1 
ATOM   7890 C  "C3'" . U   C 2 29  ? -60.332 33.345  2.056   1.00 69.29  ? 29  U   C "C3'" 1 
ATOM   7891 O  "O3'" . U   C 2 29  ? -60.178 33.754  3.382   1.00 67.67  ? 29  U   C "O3'" 1 
ATOM   7892 C  "C2'" . U   C 2 29  ? -59.191 32.545  1.438   1.00 66.54  ? 29  U   C "C2'" 1 
ATOM   7893 O  "O2'" . U   C 2 29  ? -58.564 31.709  2.378   1.00 69.19  ? 29  U   C "O2'" 1 
ATOM   7894 C  "C1'" . U   C 2 29  ? -59.958 31.762  0.364   1.00 68.91  ? 29  U   C "C1'" 1 
ATOM   7895 N  N1    . U   C 2 29  ? -60.191 32.566  -0.933  1.00 65.19  ? 29  U   C N1    1 
ATOM   7896 C  C2    . U   C 2 29  ? -59.097 32.995  -1.676  1.00 59.30  ? 29  U   C C2    1 
ATOM   7897 O  O2    . U   C 2 29  ? -57.935 32.762  -1.377  1.00 56.17  ? 29  U   C O2    1 
ATOM   7898 N  N3    . U   C 2 29  ? -59.411 33.718  -2.810  1.00 57.51  ? 29  U   C N3    1 
ATOM   7899 C  C4    . U   C 2 29  ? -60.669 34.068  -3.271  1.00 61.04  ? 29  U   C C4    1 
ATOM   7900 O  O4    . U   C 2 29  ? -60.768 34.727  -4.296  1.00 59.88  ? 29  U   C O4    1 
ATOM   7901 C  C5    . U   C 2 29  ? -61.760 33.603  -2.453  1.00 66.42  ? 29  U   C C5    1 
ATOM   7902 C  C6    . U   C 2 29  ? -61.481 32.892  -1.352  1.00 68.20  ? 29  U   C C6    1 
ATOM   7903 P  P     . C   C 2 30  ? -60.345 35.312  3.712   1.00 62.97  ? 30  C   C P     1 
ATOM   7904 O  OP1   . C   C 2 30  ? -60.511 35.384  5.176   1.00 66.52  ? 30  C   C OP1   1 
ATOM   7905 O  OP2   . C   C 2 30  ? -61.333 35.972  2.833   1.00 62.93  ? 30  C   C OP2   1 
ATOM   7906 O  "O5'" . C   C 2 30  ? -58.897 35.841  3.286   1.00 54.50  ? 30  C   C "O5'" 1 
ATOM   7907 C  "C5'" . C   C 2 30  ? -57.778 35.135  3.788   1.00 50.65  ? 30  C   C "C5'" 1 
ATOM   7908 C  "C4'" . C   C 2 30  ? -56.549 35.277  2.916   1.00 43.98  ? 30  C   C "C4'" 1 
ATOM   7909 O  "O4'" . C   C 2 30  ? -56.699 34.625  1.619   1.00 42.30  ? 30  C   C "O4'" 1 
ATOM   7910 C  "C3'" . C   C 2 30  ? -56.144 36.716  2.627   1.00 38.73  ? 30  C   C "C3'" 1 
ATOM   7911 O  "O3'" . C   C 2 30  ? -55.490 37.295  3.761   1.00 35.80  ? 30  C   C "O3'" 1 
ATOM   7912 C  "C2'" . C   C 2 30  ? -55.243 36.487  1.409   1.00 36.24  ? 30  C   C "C2'" 1 
ATOM   7913 O  "O2'" . C   C 2 30  ? -53.980 35.902  1.670   1.00 37.41  ? 30  C   C "O2'" 1 
ATOM   7914 C  "C1'" . C   C 2 30  ? -56.048 35.443  0.650   1.00 37.14  ? 30  C   C "C1'" 1 
ATOM   7915 N  N1    . C   C 2 30  ? -57.004 36.017  -0.380  1.00 36.04  ? 30  C   C N1    1 
ATOM   7916 C  C2    . C   C 2 30  ? -56.484 36.522  -1.585  1.00 32.77  ? 30  C   C C2    1 
ATOM   7917 O  O2    . C   C 2 30  ? -55.260 36.513  -1.765  1.00 30.80  ? 30  C   C O2    1 
ATOM   7918 N  N3    . C   C 2 30  ? -57.317 37.019  -2.529  1.00 32.18  ? 30  C   C N3    1 
ATOM   7919 C  C4    . C   C 2 30  ? -58.616 37.015  -2.298  1.00 37.01  ? 30  C   C C4    1 
ATOM   7920 N  N4    . C   C 2 30  ? -59.406 37.495  -3.255  1.00 40.21  ? 30  C   C N4    1 
ATOM   7921 C  C5    . C   C 2 30  ? -59.173 36.506  -1.086  1.00 40.11  ? 30  C   C C5    1 
ATOM   7922 C  C6    . C   C 2 30  ? -58.348 36.018  -0.161  1.00 38.50  ? 30  C   C C6    1 
ATOM   7923 P  P     . C   C 2 31  ? -55.358 38.885  3.896   1.00 33.96  ? 31  C   C P     1 
ATOM   7924 O  OP1   . C   C 2 31  ? -54.666 39.238  5.159   1.00 33.96  ? 31  C   C OP1   1 
ATOM   7925 O  OP2   . C   C 2 31  ? -56.640 39.506  3.541   1.00 34.84  ? 31  C   C OP2   1 
ATOM   7926 O  "O5'" . C   C 2 31  ? -54.413 39.255  2.679   1.00 30.38  ? 31  C   C "O5'" 1 
ATOM   7927 C  "C5'" . C   C 2 31  ? -53.056 38.878  2.710   1.00 27.97  ? 31  C   C "C5'" 1 
ATOM   7928 C  "C4'" . C   C 2 31  ? -52.373 39.431  1.485   1.00 24.26  ? 31  C   C "C4'" 1 
ATOM   7929 O  "O4'" . C   C 2 31  ? -53.025 38.891  0.321   1.00 22.50  ? 31  C   C "O4'" 1 
ATOM   7930 C  "C3'" . C   C 2 31  ? -52.501 40.936  1.343   1.00 23.33  ? 31  C   C "C3'" 1 
ATOM   7931 O  "O3'" . C   C 2 31  ? -51.452 41.580  2.020   1.00 23.58  ? 31  C   C "O3'" 1 
ATOM   7932 C  "C2'" . C   C 2 31  ? -52.421 41.153  -0.153  1.00 21.65  ? 31  C   C "C2'" 1 
ATOM   7933 O  "O2'" . C   C 2 31  ? -51.087 41.111  -0.607  1.00 22.31  ? 31  C   C "O2'" 1 
ATOM   7934 C  "C1'" . C   C 2 31  ? -53.104 39.900  -0.670  1.00 20.79  ? 31  C   C "C1'" 1 
ATOM   7935 N  N1    . C   C 2 31  ? -54.531 40.035  -1.080  1.00 21.66  ? 31  C   C N1    1 
ATOM   7936 C  C2    . C   C 2 31  ? -54.849 40.569  -2.345  1.00 21.59  ? 31  C   C C2    1 
ATOM   7937 O  O2    . C   C 2 31  ? -53.945 40.970  -3.106  1.00 19.37  ? 31  C   C O2    1 
ATOM   7938 N  N3    . C   C 2 31  ? -56.171 40.643  -2.682  1.00 23.68  ? 31  C   C N3    1 
ATOM   7939 C  C4    . C   C 2 31  ? -57.109 40.215  -1.833  1.00 25.31  ? 31  C   C C4    1 
ATOM   7940 N  N4    . C   C 2 31  ? -58.371 40.301  -2.217  1.00 28.86  ? 31  C   C N4    1 
ATOM   7941 C  C5    . C   C 2 31  ? -56.804 39.672  -0.555  1.00 24.84  ? 31  C   C C5    1 
ATOM   7942 C  C6    . C   C 2 31  ? -55.512 39.597  -0.228  1.00 22.93  ? 31  C   C C6    1 
ATOM   7943 P  P     . A   C 2 32  ? -51.821 43.039  2.502   1.00 27.64  ? 32  A   C P     1 
ATOM   7944 O  OP1   . A   C 2 32  ? -51.001 43.343  3.685   1.00 28.00  ? 32  A   C OP1   1 
ATOM   7945 O  OP2   . A   C 2 32  ? -53.295 43.103  2.619   1.00 29.98  ? 32  A   C OP2   1 
ATOM   7946 O  "O5'" . A   C 2 32  ? -51.551 44.002  1.253   1.00 26.71  ? 32  A   C "O5'" 1 
ATOM   7947 C  "C5'" . A   C 2 32  ? -50.342 44.046  0.552   1.00 25.24  ? 32  A   C "C5'" 1 
ATOM   7948 C  "C4'" . A   C 2 32  ? -50.614 44.778  -0.737  1.00 26.11  ? 32  A   C "C4'" 1 
ATOM   7949 O  "O4'" . A   C 2 32  ? -51.553 44.054  -1.564  1.00 26.98  ? 32  A   C "O4'" 1 
ATOM   7950 C  "C3'" . A   C 2 32  ? -51.344 46.084  -0.586  1.00 27.95  ? 32  A   C "C3'" 1 
ATOM   7951 O  "O3'" . A   C 2 32  ? -50.389 47.013  -0.153  1.00 29.17  ? 32  A   C "O3'" 1 
ATOM   7952 C  "C2'" . A   C 2 32  ? -51.763 46.329  -2.030  1.00 30.04  ? 32  A   C "C2'" 1 
ATOM   7953 O  "O2'" . A   C 2 32  ? -50.650 46.536  -2.879  1.00 32.26  ? 32  A   C "O2'" 1 
ATOM   7954 C  "C1'" . A   C 2 32  ? -52.221 44.956  -2.430  1.00 27.54  ? 32  A   C "C1'" 1 
ATOM   7955 N  N9    . A   C 2 32  ? -53.637 44.633  -2.407  1.00 28.40  ? 32  A   C N9    1 
ATOM   7956 C  C8    . A   C 2 32  ? -54.354 44.109  -1.361  1.00 27.83  ? 32  A   C C8    1 
ATOM   7957 N  N7    . A   C 2 32  ? -55.611 43.869  -1.645  1.00 28.88  ? 32  A   C N7    1 
ATOM   7958 C  C5    . A   C 2 32  ? -55.711 44.248  -2.975  1.00 30.61  ? 32  A   C C5    1 
ATOM   7959 C  C6    . A   C 2 32  ? -56.791 44.238  -3.883  1.00 34.00  ? 32  A   C C6    1 
ATOM   7960 N  N6    . A   C 2 32  ? -58.010 43.813  -3.525  1.00 35.12  ? 32  A   C N6    1 
ATOM   7961 N  N1    . A   C 2 32  ? -56.561 44.688  -5.161  1.00 36.36  ? 32  A   C N1    1 
ATOM   7962 C  C2    . A   C 2 32  ? -55.325 45.120  -5.493  1.00 33.76  ? 32  A   C C2    1 
ATOM   7963 N  N3    . A   C 2 32  ? -54.239 45.168  -4.715  1.00 30.13  ? 32  A   C N3    1 
ATOM   7964 C  C4    . A   C 2 32  ? -54.500 44.716  -3.469  1.00 29.73  ? 32  A   C C4    1 
ATOM   7965 P  P     . C   C 2 33  ? -50.829 48.217  0.787   1.00 30.86  ? 33  C   C P     1 
ATOM   7966 O  OP1   . C   C 2 33  ? -49.658 49.049  1.132   1.00 33.49  ? 33  C   C OP1   1 
ATOM   7967 O  OP2   . C   C 2 33  ? -51.678 47.629  1.864   1.00 29.96  ? 33  C   C OP2   1 
ATOM   7968 O  "O5'" . C   C 2 33  ? -51.733 49.062  -0.196  1.00 33.26  ? 33  C   C "O5'" 1 
ATOM   7969 C  "C5'" . C   C 2 33  ? -51.165 49.622  -1.317  1.00 35.84  ? 33  C   C "C5'" 1 
ATOM   7970 C  "C4'" . C   C 2 33  ? -52.289 50.345  -2.004  1.00 41.01  ? 33  C   C "C4'" 1 
ATOM   7971 O  "O4'" . C   C 2 33  ? -53.176 49.346  -2.571  1.00 40.60  ? 33  C   C "O4'" 1 
ATOM   7972 C  "C3'" . C   C 2 33  ? -53.176 51.246  -1.154  1.00 41.32  ? 33  C   C "C3'" 1 
ATOM   7973 O  "O3'" . C   C 2 33  ? -52.591 52.519  -1.019  1.00 42.16  ? 33  C   C "O3'" 1 
ATOM   7974 C  "C2'" . C   C 2 33  ? -54.404 51.318  -2.039  1.00 45.47  ? 33  C   C "C2'" 1 
ATOM   7975 O  "O2'" . C   C 2 33  ? -54.207 52.237  -3.086  1.00 48.99  ? 33  C   C "O2'" 1 
ATOM   7976 C  "C1'" . C   C 2 33  ? -54.484 49.906  -2.623  1.00 45.03  ? 33  C   C "C1'" 1 
ATOM   7977 N  N1    . C   C 2 33  ? -55.395 48.973  -1.883  1.00 44.90  ? 33  C   C N1    1 
ATOM   7978 C  C2    . C   C 2 33  ? -56.778 49.198  -1.817  1.00 49.23  ? 33  C   C C2    1 
ATOM   7979 O  O2    . C   C 2 33  ? -57.242 50.198  -2.393  1.00 52.83  ? 33  C   C O2    1 
ATOM   7980 N  N3    . C   C 2 33  ? -57.548 48.289  -1.126  1.00 47.87  ? 33  C   C N3    1 
ATOM   7981 C  C4    . C   C 2 33  ? -57.001 47.217  -0.535  1.00 41.43  ? 33  C   C C4    1 
ATOM   7982 N  N4    . C   C 2 33  ? -57.759 46.351  0.140   1.00 40.31  ? 33  C   C N4    1 
ATOM   7983 C  C5    . C   C 2 33  ? -55.609 46.983  -0.607  1.00 39.06  ? 33  C   C C5    1 
ATOM   7984 C  C6    . C   C 2 33  ? -54.863 47.864  -1.280  1.00 41.11  ? 33  C   C C6    1 
ATOM   7985 P  P     . C   C 2 34  ? -52.132 52.996  0.441   1.00 44.29  ? 34  C   C P     1 
ATOM   7986 O  OP1   . C   C 2 34  ? -51.637 54.414  0.455   1.00 48.71  ? 34  C   C OP1   1 
ATOM   7987 O  OP2   . C   C 2 34  ? -51.319 51.866  0.954   1.00 38.29  ? 34  C   C OP2   1 
ATOM   7988 O  "O5'" . C   C 2 34  ? -53.479 53.087  1.308   1.00 42.69  ? 34  C   C "O5'" 1 
ATOM   7989 C  "C5'" . C   C 2 34  ? -53.994 54.370  1.626   1.00 45.95  ? 34  C   C "C5'" 1 
ATOM   7990 C  "C4'" . C   C 2 34  ? -54.437 54.447  3.065   1.00 45.33  ? 34  C   C "C4'" 1 
ATOM   7991 O  "O4'" . C   C 2 34  ? -55.439 53.435  3.308   1.00 43.38  ? 34  C   C "O4'" 1 
ATOM   7992 C  "C3'" . C   C 2 34  ? -53.356 54.094  4.053   1.00 42.85  ? 34  C   C "C3'" 1 
ATOM   7993 O  "O3'" . C   C 2 34  ? -52.563 55.221  4.330   1.00 47.98  ? 34  C   C "O3'" 1 
ATOM   7994 C  "C2'" . C   C 2 34  ? -54.185 53.658  5.249   1.00 41.19  ? 34  C   C "C2'" 1 
ATOM   7995 O  "O2'" . C   C 2 34  ? -54.778 54.748  5.889   1.00 46.20  ? 34  C   C "O2'" 1 
ATOM   7996 C  "C1'" . C   C 2 34  ? -55.299 52.869  4.592   1.00 40.45  ? 34  C   C "C1'" 1 
ATOM   7997 N  N1    . C   C 2 34  ? -55.053 51.383  4.484   1.00 35.54  ? 34  C   C N1    1 
ATOM   7998 C  C2    . C   C 2 34  ? -55.287 50.546  5.595   1.00 34.18  ? 34  C   C C2    1 
ATOM   7999 O  O2    . C   C 2 34  ? -55.703 51.024  6.657   1.00 36.73  ? 34  C   C O2    1 
ATOM   8000 N  N3    . C   C 2 34  ? -55.082 49.210  5.493   1.00 32.08  ? 34  C   C N3    1 
ATOM   8001 C  C4    . C   C 2 34  ? -54.652 48.708  4.331   1.00 31.09  ? 34  C   C C4    1 
ATOM   8002 N  N4    . C   C 2 34  ? -54.446 47.380  4.253   1.00 27.51  ? 34  C   C N4    1 
ATOM   8003 C  C5    . C   C 2 34  ? -54.404 49.555  3.191   1.00 32.24  ? 34  C   C C5    1 
ATOM   8004 C  C6    . C   C 2 34  ? -54.611 50.865  3.309   1.00 33.15  ? 34  C   C C6    1 
ATOM   8005 O  OP3   . G   D 2 1   ? -5.759  -6.787  -19.901 1.00 46.65  ? 1   G   D OP3   1 
ATOM   8006 P  P     . G   D 2 1   ? -6.118  -6.006  -20.448 0.00 84.05  ? 1   G   D P     1 
ATOM   8007 O  OP1   . G   D 2 1   ? -4.884  -5.391  -20.997 0.00 88.94  ? 1   G   D OP1   1 
ATOM   8008 O  OP2   . G   D 2 1   ? -6.523  -5.634  -19.071 0.00 85.03  ? 1   G   D OP2   1 
ATOM   8009 O  "O5'" . G   D 2 1   ? -7.689  -4.926  -21.756 1.00 55.21  ? 1   G   D "O5'" 1 
ATOM   8010 C  "C5'" . G   D 2 1   ? -7.607  -4.040  -22.851 1.00 54.14  ? 1   G   D "C5'" 1 
ATOM   8011 C  "C4'" . G   D 2 1   ? -8.902  -4.082  -23.627 1.00 49.30  ? 1   G   D "C4'" 1 
ATOM   8012 O  "O4'" . G   D 2 1   ? -9.151  -5.432  -24.064 1.00 48.54  ? 1   G   D "O4'" 1 
ATOM   8013 C  "C3'" . G   D 2 1   ? -10.154 -3.772  -22.838 1.00 46.32  ? 1   G   D "C3'" 1 
ATOM   8014 O  "O3'" . G   D 2 1   ? -10.325 -2.380  -22.746 1.00 47.24  ? 1   G   D "O3'" 1 
ATOM   8015 C  "C2'" . G   D 2 1   ? -11.222 -4.389  -23.732 1.00 43.32  ? 1   G   D "C2'" 1 
ATOM   8016 O  "O2'" . G   D 2 1   ? -11.518 -3.620  -24.881 1.00 43.49  ? 1   G   D "O2'" 1 
ATOM   8017 C  "C1'" . G   D 2 1   ? -10.541 -5.667  -24.163 1.00 44.57  ? 1   G   D "C1'" 1 
ATOM   8018 N  N9    . G   D 2 1   ? -10.894 -6.811  -23.334 1.00 45.04  ? 1   G   D N9    1 
ATOM   8019 C  C8    . G   D 2 1   ? -10.101 -7.407  -22.385 1.00 49.14  ? 1   G   D C8    1 
ATOM   8020 N  N7    . G   D 2 1   ? -10.661 -8.421  -21.794 1.00 50.26  ? 1   G   D N7    1 
ATOM   8021 C  C5    . G   D 2 1   ? -11.905 -8.504  -22.392 1.00 46.88  ? 1   G   D C5    1 
ATOM   8022 C  C6    . G   D 2 1   ? -12.953 -9.418  -22.150 1.00 47.65  ? 1   G   D C6    1 
ATOM   8023 O  O6    . G   D 2 1   ? -12.947 -10.339 -21.333 1.00 51.90  ? 1   G   D O6    1 
ATOM   8024 N  N1    . G   D 2 1   ? -14.072 -9.187  -22.954 1.00 44.36  ? 1   G   D N1    1 
ATOM   8025 C  C2    . G   D 2 1   ? -14.156 -8.175  -23.879 1.00 41.47  ? 1   G   D C2    1 
ATOM   8026 N  N2    . G   D 2 1   ? -15.304 -8.106  -24.553 1.00 40.64  ? 1   G   D N2    1 
ATOM   8027 N  N3    . G   D 2 1   ? -13.179 -7.298  -24.127 1.00 41.38  ? 1   G   D N3    1 
ATOM   8028 C  C4    . G   D 2 1   ? -12.076 -7.523  -23.347 1.00 43.94  ? 1   G   D C4    1 
ATOM   8029 P  P     . G   D 2 2   ? -11.203 -1.785  -21.559 1.00 46.55  ? 2   G   D P     1 
ATOM   8030 O  OP1   . G   D 2 2   ? -11.072 -0.312  -21.637 1.00 46.31  ? 2   G   D OP1   1 
ATOM   8031 O  OP2   . G   D 2 2   ? -10.834 -2.505  -20.315 1.00 48.89  ? 2   G   D OP2   1 
ATOM   8032 O  "O5'" . G   D 2 2   ? -12.693 -2.268  -21.889 1.00 43.80  ? 2   G   D "O5'" 1 
ATOM   8033 C  "C5'" . G   D 2 2   ? -13.501 -1.600  -22.843 1.00 44.25  ? 2   G   D "C5'" 1 
ATOM   8034 C  "C4'" . G   D 2 2   ? -14.830 -2.321  -23.006 1.00 44.62  ? 2   G   D "C4'" 1 
ATOM   8035 O  "O4'" . G   D 2 2   ? -14.614 -3.719  -23.308 1.00 45.01  ? 2   G   D "O4'" 1 
ATOM   8036 C  "C3'" . G   D 2 2   ? -15.703 -2.356  -21.765 1.00 46.12  ? 2   G   D "C3'" 1 
ATOM   8037 O  "O3'" . G   D 2 2   ? -16.383 -1.104  -21.649 1.00 47.94  ? 2   G   D "O3'" 1 
ATOM   8038 C  "C2'" . G   D 2 2   ? -16.601 -3.562  -22.056 1.00 46.16  ? 2   G   D "C2'" 1 
ATOM   8039 O  "O2'" . G   D 2 2   ? -17.682 -3.336  -22.930 1.00 46.47  ? 2   G   D "O2'" 1 
ATOM   8040 C  "C1'" . G   D 2 2   ? -15.645 -4.508  -22.758 1.00 45.20  ? 2   G   D "C1'" 1 
ATOM   8041 N  N9    . G   D 2 2   ? -15.103 -5.500  -21.837 1.00 47.05  ? 2   G   D N9    1 
ATOM   8042 C  C8    . G   D 2 2   ? -13.853 -5.587  -21.267 1.00 48.61  ? 2   G   D C8    1 
ATOM   8043 N  N7    . G   D 2 2   ? -13.700 -6.610  -20.463 1.00 51.51  ? 2   G   D N7    1 
ATOM   8044 C  C5    . G   D 2 2   ? -14.936 -7.237  -20.500 1.00 52.31  ? 2   G   D C5    1 
ATOM   8045 C  C6    . G   D 2 2   ? -15.397 -8.404  -19.842 1.00 56.91  ? 2   G   D C6    1 
ATOM   8046 O  O6    . G   D 2 2   ? -14.799 -9.158  -19.061 1.00 60.87  ? 2   G   D O6    1 
ATOM   8047 N  N1    . G   D 2 2   ? -16.728 -8.668  -20.176 1.00 57.98  ? 2   G   D N1    1 
ATOM   8048 C  C2    . G   D 2 2   ? -17.511 -7.914  -21.026 1.00 54.22  ? 2   G   D C2    1 
ATOM   8049 N  N2    . G   D 2 2   ? -18.763 -8.324  -21.213 1.00 57.09  ? 2   G   D N2    1 
ATOM   8050 N  N3    . G   D 2 2   ? -17.096 -6.833  -21.652 1.00 50.14  ? 2   G   D N3    1 
ATOM   8051 C  C4    . G   D 2 2   ? -15.805 -6.562  -21.341 1.00 49.53  ? 2   G   D C4    1 
ATOM   8052 P  P     . A   D 2 3   ? -17.005 -0.591  -20.266 1.00 50.26  ? 3   A   D P     1 
ATOM   8053 O  OP1   . A   D 2 3   ? -17.671 0.709   -20.538 1.00 49.65  ? 3   A   D OP1   1 
ATOM   8054 O  OP2   . A   D 2 3   ? -15.969 -0.672  -19.214 1.00 50.69  ? 3   A   D OP2   1 
ATOM   8055 O  "O5'" . A   D 2 3   ? -18.095 -1.731  -19.959 1.00 54.41  ? 3   A   D "O5'" 1 
ATOM   8056 C  "C5'" . A   D 2 3   ? -19.399 -1.650  -20.533 1.00 59.00  ? 3   A   D "C5'" 1 
ATOM   8057 C  "C4'" . A   D 2 3   ? -20.167 -2.925  -20.280 1.00 64.72  ? 3   A   D "C4'" 1 
ATOM   8058 O  "O4'" . A   D 2 3   ? -19.301 -4.057  -20.504 1.00 64.44  ? 3   A   D "O4'" 1 
ATOM   8059 C  "C3'" . A   D 2 3   ? -20.581 -3.160  -18.840 1.00 70.48  ? 3   A   D "C3'" 1 
ATOM   8060 O  "O3'" . A   D 2 3   ? -21.682 -2.353  -18.464 1.00 76.15  ? 3   A   D "O3'" 1 
ATOM   8061 C  "C2'" . A   D 2 3   ? -20.944 -4.636  -18.893 1.00 73.51  ? 3   A   D "C2'" 1 
ATOM   8062 O  "O2'" . A   D 2 3   ? -22.195 -4.875  -19.506 1.00 75.91  ? 3   A   D "O2'" 1 
ATOM   8063 C  "C1'" . A   D 2 3   ? -19.783 -5.155  -19.743 1.00 69.41  ? 3   A   D "C1'" 1 
ATOM   8064 N  N9    . A   D 2 3   ? -18.699 -5.669  -18.907 1.00 70.30  ? 3   A   D N9    1 
ATOM   8065 C  C8    . A   D 2 3   ? -17.466 -5.107  -18.700 1.00 67.72  ? 3   A   D C8    1 
ATOM   8066 N  N7    . A   D 2 3   ? -16.696 -5.789  -17.882 1.00 70.52  ? 3   A   D N7    1 
ATOM   8067 C  C5    . A   D 2 3   ? -17.484 -6.866  -17.522 1.00 75.34  ? 3   A   D C5    1 
ATOM   8068 C  C6    . A   D 2 3   ? -17.256 -7.966  -16.674 1.00 81.80  ? 3   A   D C6    1 
ATOM   8069 N  N6    . A   D 2 3   ? -16.109 -8.153  -16.016 1.00 84.20  ? 3   A   D N6    1 
ATOM   8070 N  N1    . A   D 2 3   ? -18.254 -8.868  -16.531 1.00 87.27  ? 3   A   D N1    1 
ATOM   8071 C  C2    . A   D 2 3   ? -19.405 -8.684  -17.191 1.00 85.93  ? 3   A   D C2    1 
ATOM   8072 N  N3    . A   D 2 3   ? -19.730 -7.695  -18.018 1.00 80.33  ? 3   A   D N3    1 
ATOM   8073 C  C4    . A   D 2 3   ? -18.722 -6.812  -18.141 1.00 75.21  ? 3   A   D C4    1 
ATOM   8074 P  P     . A   D 2 4   ? -21.761 -1.770  -16.973 1.00 80.12  ? 4   A   D P     1 
ATOM   8075 O  OP1   . A   D 2 4   ? -22.592 -0.551  -17.049 1.00 81.16  ? 4   A   D OP1   1 
ATOM   8076 O  OP2   . A   D 2 4   ? -20.391 -1.702  -16.405 1.00 76.84  ? 4   A   D OP2   1 
ATOM   8077 O  "O5'" . A   D 2 4   ? -22.551 -2.904  -16.167 1.00 88.92  ? 4   A   D "O5'" 1 
ATOM   8078 C  "C5'" . A   D 2 4   ? -23.896 -3.238  -16.474 1.00 96.81  ? 4   A   D "C5'" 1 
ATOM   8079 C  "C4'" . A   D 2 4   ? -24.210 -4.600  -15.886 1.00 105.94 ? 4   A   D "C4'" 1 
ATOM   8080 O  "O4'" . A   D 2 4   ? -23.271 -5.585  -16.395 1.00 103.02 ? 4   A   D "O4'" 1 
ATOM   8081 C  "C3'" . A   D 2 4   ? -23.999 -4.733  -14.385 1.00 112.61 ? 4   A   D "C3'" 1 
ATOM   8082 O  "O3'" . A   D 2 4   ? -25.007 -4.125  -13.597 1.00 120.87 ? 4   A   D "O3'" 1 
ATOM   8083 C  "C2'" . A   D 2 4   ? -23.986 -6.250  -14.252 1.00 118.54 ? 4   A   D "C2'" 1 
ATOM   8084 O  "O2'" . A   D 2 4   ? -25.247 -6.855  -14.467 1.00 126.23 ? 4   A   D "O2'" 1 
ATOM   8085 C  "C1'" . A   D 2 4   ? -23.012 -6.556  -15.384 1.00 109.56 ? 4   A   D "C1'" 1 
ATOM   8086 N  N9    . A   D 2 4   ? -21.609 -6.515  -14.934 1.00 105.77 ? 4   A   D N9    1 
ATOM   8087 C  C8    . A   D 2 4   ? -20.648 -5.591  -15.247 1.00 98.03  ? 4   A   D C8    1 
ATOM   8088 N  N7    . A   D 2 4   ? -19.481 -5.818  -14.688 1.00 97.92  ? 4   A   D N7    1 
ATOM   8089 C  C5    . A   D 2 4   ? -19.679 -6.969  -13.949 1.00 106.00 ? 4   A   D C5    1 
ATOM   8090 C  C6    . A   D 2 4   ? -18.828 -7.738  -13.119 1.00 111.63 ? 4   A   D C6    1 
ATOM   8091 N  N6    . A   D 2 4   ? -17.547 -7.444  -12.885 1.00 109.50 ? 4   A   D N6    1 
ATOM   8092 N  N1    . A   D 2 4   ? -19.346 -8.836  -12.523 1.00 121.49 ? 4   A   D N1    1 
ATOM   8093 C  C2    . A   D 2 4   ? -20.634 -9.146  -12.744 1.00 125.37 ? 4   A   D C2    1 
ATOM   8094 N  N3    . A   D 2 4   ? -21.526 -8.503  -13.505 1.00 120.93 ? 4   A   D N3    1 
ATOM   8095 C  C4    . A   D 2 4   ? -20.986 -7.412  -14.087 1.00 111.05 ? 4   A   D C4    1 
ATOM   8096 P  P     . G   D 2 5   ? -24.590 -3.462  -12.198 1.00 124.25 ? 5   G   D P     1 
ATOM   8097 O  OP1   . G   D 2 5   ? -25.836 -2.982  -11.560 1.00 133.14 ? 5   G   D OP1   1 
ATOM   8098 O  OP2   . G   D 2 5   ? -23.475 -2.520  -12.430 1.00 114.37 ? 5   G   D OP2   1 
ATOM   8099 O  "O5'" . G   D 2 5   ? -24.004 -4.687  -11.353 1.00 132.14 ? 5   G   D "O5'" 1 
ATOM   8100 C  "C5'" . G   D 2 5   ? -24.877 -5.621  -10.733 1.00 146.57 ? 5   G   D "C5'" 1 
ATOM   8101 C  "C4'" . G   D 2 5   ? -24.087 -6.587  -9.880  1.00 154.33 ? 5   G   D "C4'" 1 
ATOM   8102 O  "O4'" . G   D 2 5   ? -22.958 -7.075  -10.641 1.00 146.38 ? 5   G   D "O4'" 1 
ATOM   8103 C  "C3'" . G   D 2 5   ? -23.438 -5.999  -8.635  1.00 158.34 ? 5   G   D "C3'" 1 
ATOM   8104 O  "O3'" . G   D 2 5   ? -24.373 -5.853  -7.566  1.00 171.55 ? 5   G   D "O3'" 1 
ATOM   8105 C  "C2'" . G   D 2 5   ? -22.395 -7.071  -8.338  1.00 162.02 ? 5   G   D "C2'" 1 
ATOM   8106 O  "O2'" . G   D 2 5   ? -22.923 -8.243  -7.729  1.00 175.90 ? 5   G   D "O2'" 1 
ATOM   8107 C  "C1'" . G   D 2 5   ? -21.895 -7.365  -9.747  1.00 150.93 ? 5   G   D "C1'" 1 
ATOM   8108 N  N9    . G   D 2 5   ? -20.703 -6.595  -10.107 1.00 140.70 ? 5   G   D N9    1 
ATOM   8109 C  C8    . G   D 2 5   ? -20.627 -5.506  -10.946 1.00 130.31 ? 5   G   D C8    1 
ATOM   8110 N  N7    . G   D 2 5   ? -19.417 -5.034  -11.082 1.00 124.30 ? 5   G   D N7    1 
ATOM   8111 C  C5    . G   D 2 5   ? -18.635 -5.858  -10.279 1.00 131.08 ? 5   G   D C5    1 
ATOM   8112 C  C6    . G   D 2 5   ? -17.237 -5.836  -10.024 1.00 130.38 ? 5   G   D C6    1 
ATOM   8113 O  O6    . G   D 2 5   ? -16.390 -5.051  -10.476 1.00 123.32 ? 5   G   D O6    1 
ATOM   8114 N  N1    . G   D 2 5   ? -16.845 -6.853  -9.150  1.00 140.74 ? 5   G   D N1    1 
ATOM   8115 C  C2    . G   D 2 5   ? -17.704 -7.773  -8.590  1.00 150.76 ? 5   G   D C2    1 
ATOM   8116 N  N2    . G   D 2 5   ? -17.161 -8.682  -7.770  1.00 161.67 ? 5   G   D N2    1 
ATOM   8117 N  N3    . G   D 2 5   ? -19.012 -7.807  -8.823  1.00 151.60 ? 5   G   D N3    1 
ATOM   8118 C  C4    . G   D 2 5   ? -19.412 -6.825  -9.674  1.00 141.34 ? 5   G   D C4    1 
ATOM   8119 P  P     . U   D 2 6   ? -24.015 -4.991  -6.258  1.00 176.52 ? 6   U   D P     1 
ATOM   8120 O  OP1   . U   D 2 6   ? -25.264 -4.826  -5.483  1.00 188.76 ? 6   U   D OP1   1 
ATOM   8121 O  OP2   . U   D 2 6   ? -23.259 -3.786  -6.679  1.00 163.05 ? 6   U   D OP2   1 
ATOM   8122 O  "O5'" . U   D 2 6   ? -23.019 -5.943  -5.437  1.00 184.46 ? 6   U   D "O5'" 1 
ATOM   8123 C  "C5'" . U   D 2 6   ? -23.492 -6.920  -4.513  1.00 201.33 ? 6   U   D "C5'" 1 
ATOM   8124 C  "C4'" . U   D 2 6   ? -22.335 -7.677  -3.885  1.00 207.74 ? 6   U   D "C4'" 1 
ATOM   8125 O  "O4'" . U   D 2 6   ? -21.402 -8.115  -4.915  1.00 197.23 ? 6   U   D "O4'" 1 
ATOM   8126 C  "C3'" . U   D 2 6   ? -21.432 -6.874  -2.958  1.00 208.41 ? 6   U   D "C3'" 1 
ATOM   8127 O  "O3'" . U   D 2 6   ? -21.992 -6.627  -1.679  1.00 222.27 ? 6   U   D "O3'" 1 
ATOM   8128 C  "C2'" . U   D 2 6   ? -20.231 -7.811  -2.905  1.00 211.54 ? 6   U   D "C2'" 1 
ATOM   8129 O  "O2'" . U   D 2 6   ? -20.472 -9.005  -2.182  1.00 228.50 ? 6   U   D "O2'" 1 
ATOM   8130 C  "C1'" . U   D 2 6   ? -20.076 -8.079  -4.401  1.00 197.77 ? 6   U   D "C1'" 1 
ATOM   8131 N  N1    . U   D 2 6   ? -19.251 -7.006  -5.086  1.00 182.39 ? 6   U   D N1    1 
ATOM   8132 C  C2    . U   D 2 6   ? -17.881 -6.931  -4.856  1.00 181.47 ? 6   U   D C2    1 
ATOM   8133 O  O2    . U   D 2 6   ? -17.257 -7.695  -4.134  1.00 192.04 ? 6   U   D O2    1 
ATOM   8134 N  N3    . U   D 2 6   ? -17.244 -5.906  -5.521  1.00 168.83 ? 6   U   D N3    1 
ATOM   8135 C  C4    . U   D 2 6   ? -17.811 -4.967  -6.369  1.00 157.24 ? 6   U   D C4    1 
ATOM   8136 O  O4    . U   D 2 6   ? -17.103 -4.114  -6.890  1.00 148.03 ? 6   U   D O4    1 
ATOM   8137 C  C5    . U   D 2 6   ? -19.233 -5.099  -6.558  1.00 158.90 ? 6   U   D C5    1 
ATOM   8138 C  C6    . U   D 2 6   ? -19.874 -6.088  -5.922  1.00 171.13 ? 6   U   D C6    1 
ATOM   8139 P  P     . A   D 2 7   ? -21.596 -5.280  -0.898  1.00 219.92 ? 7   A   D P     1 
ATOM   8140 O  OP1   . A   D 2 7   ? -22.413 -5.245  0.333   1.00 236.48 ? 7   A   D OP1   1 
ATOM   8141 O  OP2   . A   D 2 7   ? -21.661 -4.135  -1.835  1.00 202.83 ? 7   A   D OP2   1 
ATOM   8142 O  "O5'" . A   D 2 7   ? -20.060 -5.513  -0.504  1.00 221.09 ? 7   A   D "O5'" 1 
ATOM   8143 C  "C5'" . A   D 2 7   ? -19.678 -6.175  0.714   1.00 238.44 ? 7   A   D "C5'" 1 
ATOM   8144 C  "C4'" . A   D 2 7   ? -18.177 -6.073  0.939   1.00 237.10 ? 7   A   D "C4'" 1 
ATOM   8145 O  "O4'" . A   D 2 7   ? -17.484 -6.548  -0.252  1.00 226.11 ? 7   A   D "O4'" 1 
ATOM   8146 C  "C3'" . A   D 2 7   ? -17.594 -4.668  1.113   1.00 228.08 ? 7   A   D "C3'" 1 
ATOM   8147 O  "O3'" . A   D 2 7   ? -17.791 -4.057  2.400   1.00 237.98 ? 7   A   D "O3'" 1 
ATOM   8148 C  "C2'" . A   D 2 7   ? -16.129 -4.965  0.793   1.00 225.46 ? 7   A   D "C2'" 1 
ATOM   8149 O  "O2'" . A   D 2 7   ? -15.488 -5.803  1.737   1.00 241.94 ? 7   A   D "O2'" 1 
ATOM   8150 C  "C1'" . A   D 2 7   ? -16.350 -5.725  -0.508  1.00 216.59 ? 7   A   D "C1'" 1 
ATOM   8151 N  N9    . A   D 2 7   ? -16.560 -4.818  -1.651  1.00 198.93 ? 7   A   D N9    1 
ATOM   8152 C  C8    . A   D 2 7   ? -17.739 -4.270  -2.091  1.00 192.30 ? 7   A   D C8    1 
ATOM   8153 N  N7    . A   D 2 7   ? -17.620 -3.482  -3.131  1.00 177.66 ? 7   A   D N7    1 
ATOM   8154 C  C5    . A   D 2 7   ? -16.264 -3.506  -3.396  1.00 174.19 ? 7   A   D C5    1 
ATOM   8155 C  C6    . A   D 2 7   ? -15.485 -2.874  -4.385  1.00 162.16 ? 7   A   D C6    1 
ATOM   8156 N  N6    . A   D 2 7   ? -16.014 -2.064  -5.307  1.00 150.90 ? 7   A   D N6    1 
ATOM   8157 N  N1    . A   D 2 7   ? -14.149 -3.097  -4.385  1.00 163.74 ? 7   A   D N1    1 
ATOM   8158 C  C2    . A   D 2 7   ? -13.630 -3.901  -3.447  1.00 176.59 ? 7   A   D C2    1 
ATOM   8159 N  N3    . A   D 2 7   ? -14.265 -4.554  -2.470  1.00 188.97 ? 7   A   D N3    1 
ATOM   8160 C  C4    . A   D 2 7   ? -15.591 -4.315  -2.496  1.00 187.00 ? 7   A   D C4    1 
ATOM   8161 P  P     . G   D 2 8   ? -18.157 -2.490  2.546   1.00 228.28 ? 8   G   D P     1 
ATOM   8162 O  OP1   . G   D 2 8   ? -17.768 -2.128  3.928   1.00 241.49 ? 8   G   D OP1   1 
ATOM   8163 O  OP2   . G   D 2 8   ? -19.554 -2.288  2.104   1.00 224.44 ? 8   G   D OP2   1 
ATOM   8164 O  "O5'" . G   D 2 8   ? -17.251 -1.691  1.490   1.00 209.08 ? 8   G   D "O5'" 1 
ATOM   8165 C  "C5'" . G   D 2 8   ? -16.577 -0.486  1.863   1.00 203.43 ? 8   G   D "C5'" 1 
ATOM   8166 C  "C4'" . G   D 2 8   ? -15.133 -0.810  2.207   1.00 207.92 ? 8   G   D "C4'" 1 
ATOM   8167 O  "O4'" . G   D 2 8   ? -14.724 -1.983  1.444   1.00 206.76 ? 8   G   D "O4'" 1 
ATOM   8168 C  "C3'" . G   D 2 8   ? -14.092 0.251   1.856   1.00 197.73 ? 8   G   D "C3'" 1 
ATOM   8169 O  "O3'" . G   D 2 8   ? -13.913 1.222   2.904   1.00 202.11 ? 8   G   D "O3'" 1 
ATOM   8170 C  "C2'" . G   D 2 8   ? -12.869 -0.640  1.601   1.00 201.81 ? 8   G   D "C2'" 1 
ATOM   8171 O  "O2'" . G   D 2 8   ? -12.306 -1.210  2.767   1.00 218.40 ? 8   G   D "O2'" 1 
ATOM   8172 C  "C1'" . G   D 2 8   ? -13.523 -1.717  0.748   1.00 198.61 ? 8   G   D "C1'" 1 
ATOM   8173 N  N9    . G   D 2 8   ? -13.823 -1.241  -0.608  1.00 182.03 ? 8   G   D N9    1 
ATOM   8174 C  C8    . G   D 2 8   ? -15.065 -1.025  -1.170  1.00 174.51 ? 8   G   D C8    1 
ATOM   8175 N  N7    . G   D 2 8   ? -15.019 -0.578  -2.392  1.00 161.29 ? 8   G   D N7    1 
ATOM   8176 C  C5    . G   D 2 8   ? -13.659 -0.492  -2.670  1.00 159.59 ? 8   G   D C5    1 
ATOM   8177 C  C6    . G   D 2 8   ? -12.990 -0.076  -3.851  1.00 148.81 ? 8   G   D C6    1 
ATOM   8178 O  O6    . G   D 2 8   ? -13.490 0.311   -4.918  1.00 138.07 ? 8   G   D O6    1 
ATOM   8179 N  N1    . G   D 2 8   ? -11.600 -0.140  -3.716  1.00 152.86 ? 8   G   D N1    1 
ATOM   8180 C  C2    . G   D 2 8   ? -10.937 -0.554  -2.583  1.00 165.67 ? 8   G   D C2    1 
ATOM   8181 N  N2    . G   D 2 8   ? -9.600  -0.544  -2.640  1.00 169.30 ? 8   G   D N2    1 
ATOM   8182 N  N3    . G   D 2 8   ? -11.549 -0.948  -1.472  1.00 176.08 ? 8   G   D N3    1 
ATOM   8183 C  C4    . G   D 2 8   ? -12.907 -0.894  -1.583  1.00 172.29 ? 8   G   D C4    1 
ATOM   8184 P  P     . A   D 2 9   ? -13.031 2.548   2.680   1.00 192.54 ? 9   A   D P     1 
ATOM   8185 O  OP1   . A   D 2 9   ? -12.884 3.225   3.991   1.00 202.09 ? 9   A   D OP1   1 
ATOM   8186 O  OP2   . A   D 2 9   ? -13.597 3.276   1.516   1.00 175.96 ? 9   A   D OP2   1 
ATOM   8187 O  "O5'" . A   D 2 9   ? -11.613 1.938   2.237   1.00 193.30 ? 9   A   D "O5'" 1 
ATOM   8188 C  "C5'" . A   D 2 9   ? -10.372 2.286   2.846   1.00 199.09 ? 9   A   D "C5'" 1 
ATOM   8189 C  "C4'" . A   D 2 9   ? -9.403  2.771   1.783   1.00 187.93 ? 9   A   D "C4'" 1 
ATOM   8190 O  "O4'" . A   D 2 9   ? -9.428  1.905   0.612   1.00 180.36 ? 9   A   D "O4'" 1 
ATOM   8191 C  "C3'" . A   D 2 9   ? -9.765  4.122   1.186   1.00 173.68 ? 9   A   D "C3'" 1 
ATOM   8192 O  "O3'" . A   D 2 9   ? -9.441  5.213   2.009   1.00 176.71 ? 9   A   D "O3'" 1 
ATOM   8193 C  "C2'" . A   D 2 9   ? -8.958  4.100   -0.100  1.00 165.20 ? 9   A   D "C2'" 1 
ATOM   8194 O  "O2'" . A   D 2 9   ? -7.577  4.334   0.088   1.00 171.80 ? 9   A   D "O2'" 1 
ATOM   8195 C  "C1'" . A   D 2 9   ? -9.291  2.688   -0.569  1.00 165.62 ? 9   A   D "C1'" 1 
ATOM   8196 N  N9    . A   D 2 9   ? -10.541 2.737   -1.330  1.00 154.28 ? 9   A   D N9    1 
ATOM   8197 C  C8    . A   D 2 9   ? -11.776 2.288   -0.951  1.00 155.96 ? 9   A   D C8    1 
ATOM   8198 N  N7    . A   D 2 9   ? -12.717 2.492   -1.839  1.00 145.42 ? 9   A   D N7    1 
ATOM   8199 C  C5    . A   D 2 9   ? -12.060 3.130   -2.871  1.00 135.97 ? 9   A   D C5    1 
ATOM   8200 C  C6    . A   D 2 9   ? -12.498 3.619   -4.117  1.00 124.54 ? 9   A   D C6    1 
ATOM   8201 N  N6    . A   D 2 9   ? -13.763 3.528   -4.537  1.00 119.78 ? 9   A   D N6    1 
ATOM   8202 N  N1    . A   D 2 9   ? -11.582 4.210   -4.918  1.00 119.62 ? 9   A   D N1    1 
ATOM   8203 C  C2    . A   D 2 9   ? -10.312 4.305   -4.496  1.00 125.62 ? 9   A   D C2    1 
ATOM   8204 N  N3    . A   D 2 9   ? -9.786  3.880   -3.350  1.00 136.50 ? 9   A   D N3    1 
ATOM   8205 C  C4    . A   D 2 9   ? -10.720 3.297   -2.574  1.00 141.28 ? 9   A   D C4    1 
ATOM   8206 P  P     . U   D 2 10  ? -10.618 6.265   2.259   1.00 169.97 ? 10  U   D P     1 
ATOM   8207 O  OP1   . U   D 2 10  ? -11.060 6.079   3.660   1.00 182.78 ? 10  U   D OP1   1 
ATOM   8208 O  OP2   . U   D 2 10  ? -11.609 6.139   1.157   1.00 157.76 ? 10  U   D OP2   1 
ATOM   8209 O  "O5'" . U   D 2 10  ? -9.877  7.683   2.133   1.00 164.43 ? 10  U   D "O5'" 1 
ATOM   8210 C  "C5'" . U   D 2 10  ? -9.873  8.407   0.912   1.00 149.28 ? 10  U   D "C5'" 1 
ATOM   8211 C  "C4'" . U   D 2 10  ? -8.582  8.189   0.141   1.00 147.76 ? 10  U   D "C4'" 1 
ATOM   8212 O  "O4'" . U   D 2 10  ? -8.618  6.925   -0.570  1.00 145.85 ? 10  U   D "O4'" 1 
ATOM   8213 C  "C3'" . U   D 2 10  ? -8.356  9.203   -0.966  1.00 137.25 ? 10  U   D "C3'" 1 
ATOM   8214 O  "O3'" . U   D 2 10  ? -7.624  10.291  -0.472  1.00 140.22 ? 10  U   D "O3'" 1 
ATOM   8215 C  "C2'" . U   D 2 10  ? -7.613  8.411   -2.034  1.00 135.60 ? 10  U   D "C2'" 1 
ATOM   8216 O  "O2'" . U   D 2 10  ? -6.267  8.138   -1.695  1.00 146.77 ? 10  U   D "O2'" 1 
ATOM   8217 C  "C1'" . U   D 2 10  ? -8.430  7.131   -1.966  1.00 134.80 ? 10  U   D "C1'" 1 
ATOM   8218 N  N1    . U   D 2 10  ? -9.775  7.165   -2.661  1.00 123.68 ? 10  U   D N1    1 
ATOM   8219 C  C2    . U   D 2 10  ? -9.924  7.675   -3.946  1.00 113.26 ? 10  U   D C2    1 
ATOM   8220 O  O2    . U   D 2 10  ? -9.025  8.135   -4.632  1.00 111.75 ? 10  U   D O2    1 
ATOM   8221 N  N3    . U   D 2 10  ? -11.211 7.625   -4.418  1.00 106.00 ? 10  U   D N3    1 
ATOM   8222 C  C4    . U   D 2 10  ? -12.331 7.137   -3.768  1.00 108.26 ? 10  U   D C4    1 
ATOM   8223 O  O4    . U   D 2 10  ? -13.417 7.159   -4.326  1.00 102.84 ? 10  U   D O4    1 
ATOM   8224 C  C5    . U   D 2 10  ? -12.106 6.625   -2.447  1.00 118.81 ? 10  U   D C5    1 
ATOM   8225 C  C6    . U   D 2 10  ? -10.864 6.662   -1.965  1.00 125.90 ? 10  U   D C6    1 
ATOM   8226 P  P     . G   D 2 11  ? -8.450  11.639  -0.285  1.00 133.52 ? 11  G   D P     1 
ATOM   8227 O  OP1   . G   D 2 11  ? -8.000  12.260  0.982   1.00 143.52 ? 11  G   D OP1   1 
ATOM   8228 O  OP2   . G   D 2 11  ? -9.887  11.331  -0.493  1.00 126.84 ? 11  G   D OP2   1 
ATOM   8229 O  "O5'" . G   D 2 11  ? -8.004  12.556  -1.516  1.00 124.91 ? 11  G   D "O5'" 1 
ATOM   8230 C  "C5'" . G   D 2 11  ? -6.749  12.393  -2.158  1.00 126.63 ? 11  G   D "C5'" 1 
ATOM   8231 C  "C4'" . G   D 2 11  ? -6.951  12.714  -3.620  1.00 116.40 ? 11  G   D "C4'" 1 
ATOM   8232 O  "O4'" . G   D 2 11  ? -7.641  11.608  -4.256  1.00 110.59 ? 11  G   D "O4'" 1 
ATOM   8233 C  "C3'" . G   D 2 11  ? -7.901  13.873  -3.875  1.00 108.58 ? 11  G   D "C3'" 1 
ATOM   8234 O  "O3'" . G   D 2 11  ? -7.280  15.122  -3.725  1.00 111.26 ? 11  G   D "O3'" 1 
ATOM   8235 C  "C2'" . G   D 2 11  ? -8.309  13.622  -5.318  1.00 100.68 ? 11  G   D "C2'" 1 
ATOM   8236 O  "O2'" . G   D 2 11  ? -7.328  14.037  -6.253  1.00 103.51 ? 11  G   D "O2'" 1 
ATOM   8237 C  "C1'" . G   D 2 11  ? -8.486  12.106  -5.286  1.00 99.31  ? 11  G   D "C1'" 1 
ATOM   8238 N  N9    . G   D 2 11  ? -9.878  11.751  -5.016  1.00 94.04  ? 11  G   D N9    1 
ATOM   8239 C  C8    . G   D 2 11  ? -10.386 11.169  -3.880  1.00 97.81  ? 11  G   D C8    1 
ATOM   8240 N  N7    . G   D 2 11  ? -11.672 10.988  -3.940  1.00 93.64  ? 11  G   D N7    1 
ATOM   8241 C  C5    . G   D 2 11  ? -12.040 11.480  -5.190  1.00 86.00  ? 11  G   D C5    1 
ATOM   8242 C  C6    . G   D 2 11  ? -13.305 11.552  -5.829  1.00 80.55  ? 11  G   D C6    1 
ATOM   8243 O  O6    . G   D 2 11  ? -14.403 11.184  -5.393  1.00 81.39  ? 11  G   D O6    1 
ATOM   8244 N  N1    . G   D 2 11  ? -13.244 12.122  -7.097  1.00 75.01  ? 11  G   D N1    1 
ATOM   8245 C  C2    . G   D 2 11  ? -12.097 12.573  -7.679  1.00 75.63  ? 11  G   D C2    1 
ATOM   8246 N  N2    . G   D 2 11  ? -12.225 13.092  -8.898  1.00 72.48  ? 11  G   D N2    1 
ATOM   8247 N  N3    . G   D 2 11  ? -10.907 12.514  -7.106  1.00 81.33  ? 11  G   D N3    1 
ATOM   8248 C  C4    . G   D 2 11  ? -10.946 11.959  -5.863  1.00 86.06  ? 11  G   D C4    1 
ATOM   8249 P  P     . G   D 2 12  ? -8.219  16.358  -3.355  1.00 106.80 ? 12  G   D P     1 
ATOM   8250 O  OP1   . G   D 2 12  ? -7.322  17.469  -2.977  1.00 113.65 ? 12  G   D OP1   1 
ATOM   8251 O  OP2   . G   D 2 12  ? -9.265  15.892  -2.412  1.00 105.94 ? 12  G   D OP2   1 
ATOM   8252 O  "O5'" . G   D 2 12  ? -8.945  16.713  -4.734  1.00 96.98  ? 12  G   D "O5'" 1 
ATOM   8253 C  "C5'" . G   D 2 12  ? -8.234  17.286  -5.820  1.00 95.52  ? 12  G   D "C5'" 1 
ATOM   8254 C  "C4'" . G   D 2 12  ? -9.137  17.316  -7.035  1.00 87.01  ? 12  G   D "C4'" 1 
ATOM   8255 O  "O4'" . G   D 2 12  ? -9.803  16.040  -7.212  1.00 81.98  ? 12  G   D "O4'" 1 
ATOM   8256 C  "C3'" . G   D 2 12  ? -10.308 18.271  -6.919  1.00 82.57  ? 12  G   D "C3'" 1 
ATOM   8257 O  "O3'" . G   D 2 12  ? -9.918  19.594  -7.171  1.00 85.95  ? 12  G   D "O3'" 1 
ATOM   8258 C  "C2'" . G   D 2 12  ? -11.233 17.743  -8.004  1.00 76.00  ? 12  G   D "C2'" 1 
ATOM   8259 O  "O2'" . G   D 2 12  ? -10.803 18.063  -9.313  1.00 75.87  ? 12  G   D "O2'" 1 
ATOM   8260 C  "C1'" . G   D 2 12  ? -11.105 16.254  -7.743  1.00 74.65  ? 12  G   D "C1'" 1 
ATOM   8261 N  N9    . G   D 2 12  ? -12.121 15.767  -6.814  1.00 72.68  ? 12  G   D N9    1 
ATOM   8262 C  C8    . G   D 2 12  ? -11.932 15.356  -5.519  1.00 77.01  ? 12  G   D C8    1 
ATOM   8263 N  N7    . G   D 2 12  ? -13.023 14.969  -4.924  1.00 75.98  ? 12  G   D N7    1 
ATOM   8264 C  C5    . G   D 2 12  ? -13.997 15.131  -5.886  1.00 70.59  ? 12  G   D C5    1 
ATOM   8265 C  C6    . G   D 2 12  ? -15.383 14.868  -5.814  1.00 69.50  ? 12  G   D C6    1 
ATOM   8266 O  O6    . G   D 2 12  ? -16.016 14.431  -4.849  1.00 72.45  ? 12  G   D O6    1 
ATOM   8267 N  N1    . G   D 2 12  ? -16.039 15.168  -7.016  1.00 66.10  ? 12  G   D N1    1 
ATOM   8268 C  C2    . G   D 2 12  ? -15.422 15.670  -8.150  1.00 63.74  ? 12  G   D C2    1 
ATOM   8269 N  N2    . G   D 2 12  ? -16.213 15.907  -9.209  1.00 61.03  ? 12  G   D N2    1 
ATOM   8270 N  N3    . G   D 2 12  ? -14.111 15.912  -8.223  1.00 65.23  ? 12  G   D N3    1 
ATOM   8271 C  C4    . G   D 2 12  ? -13.464 15.623  -7.059  1.00 68.49  ? 12  G   D C4    1 
ATOM   8272 P  P     . U   D 2 13  ? -10.676 20.743  -6.369  1.00 86.36  ? 13  U   D P     1 
ATOM   8273 O  OP1   . U   D 2 13  ? -10.000 22.011  -6.713  1.00 91.39  ? 13  U   D OP1   1 
ATOM   8274 O  OP2   . U   D 2 13  ? -10.791 20.304  -4.962  1.00 87.85  ? 13  U   D OP2   1 
ATOM   8275 O  "O5'" . U   D 2 13  ? -12.159 20.764  -6.967  1.00 79.97  ? 13  U   D "O5'" 1 
ATOM   8276 C  "C5'" . U   D 2 13  ? -12.388 21.077  -8.333  1.00 78.39  ? 13  U   D "C5'" 1 
ATOM   8277 C  "C4'" . U   D 2 13  ? -13.837 20.810  -8.659  1.00 73.84  ? 13  U   D "C4'" 1 
ATOM   8278 O  "O4'" . U   D 2 13  ? -14.198 19.434  -8.348  1.00 71.51  ? 13  U   D "O4'" 1 
ATOM   8279 C  "C3'" . U   D 2 13  ? -14.785 21.612  -7.789  1.00 73.61  ? 13  U   D "C3'" 1 
ATOM   8280 O  "O3'" . U   D 2 13  ? -14.852 22.956  -8.212  1.00 74.50  ? 13  U   D "O3'" 1 
ATOM   8281 C  "C2'" . U   D 2 13  ? -16.076 20.851  -8.047  1.00 71.54  ? 13  U   D "C2'" 1 
ATOM   8282 O  "O2'" . U   D 2 13  ? -16.655 21.217  -9.289  1.00 71.47  ? 13  U   D "O2'" 1 
ATOM   8283 C  "C1'" . U   D 2 13  ? -15.581 19.385  -8.001  1.00 70.01  ? 13  U   D "C1'" 1 
ATOM   8284 N  N1    . U   D 2 13  ? -15.817 18.738  -6.629  1.00 70.70  ? 13  U   D N1    1 
ATOM   8285 C  C2    . U   D 2 13  ? -17.078 18.239  -6.264  1.00 70.46  ? 13  U   D C2    1 
ATOM   8286 O  O2    . U   D 2 13  ? -18.070 18.242  -6.974  1.00 69.36  ? 13  U   D O2    1 
ATOM   8287 N  N3    . U   D 2 13  ? -17.164 17.708  -4.994  1.00 73.33  ? 13  U   D N3    1 
ATOM   8288 C  C4    . U   D 2 13  ? -16.142 17.626  -4.062  1.00 76.68  ? 13  U   D C4    1 
ATOM   8289 O  O4    . U   D 2 13  ? -16.360 17.123  -2.969  1.00 80.58  ? 13  U   D O4    1 
ATOM   8290 C  C5    . U   D 2 13  ? -14.874 18.161  -4.497  1.00 76.76  ? 13  U   D C5    1 
ATOM   8291 C  C6    . U   D 2 13  ? -14.763 18.688  -5.728  1.00 73.73  ? 13  U   D C6    1 
ATOM   8292 P  P     . U   D 2 14  ? -14.753 24.142  -7.139  1.00 76.94  ? 14  U   D P     1 
ATOM   8293 O  OP1   . U   D 2 14  ? -14.702 25.434  -7.862  1.00 80.96  ? 14  U   D OP1   1 
ATOM   8294 O  OP2   . U   D 2 14  ? -13.723 23.789  -6.136  1.00 78.47  ? 14  U   D OP2   1 
ATOM   8295 O  "O5'" . U   D 2 14  ? -16.167 24.100  -6.419  1.00 74.09  ? 14  U   D "O5'" 1 
ATOM   8296 C  "C5'" . U   D 2 14  ? -17.369 24.278  -7.164  1.00 71.02  ? 14  U   D "C5'" 1 
ATOM   8297 C  "C4'" . U   D 2 14  ? -18.507 23.713  -6.340  1.00 67.76  ? 14  U   D "C4'" 1 
ATOM   8298 O  "O4'" . U   D 2 14  ? -18.347 22.274  -6.161  1.00 64.36  ? 14  U   D "O4'" 1 
ATOM   8299 C  "C3'" . U   D 2 14  ? -18.507 24.281  -4.932  1.00 68.00  ? 14  U   D "C3'" 1 
ATOM   8300 O  "O3'" . U   D 2 14  ? -19.090 25.585  -4.918  1.00 69.76  ? 14  U   D "O3'" 1 
ATOM   8301 C  "C2'" . U   D 2 14  ? -19.290 23.206  -4.190  1.00 67.75  ? 14  U   D "C2'" 1 
ATOM   8302 O  "O2'" . U   D 2 14  ? -20.691 23.288  -4.304  1.00 68.99  ? 14  U   D "O2'" 1 
ATOM   8303 C  "C1'" . U   D 2 14  ? -18.769 21.929  -4.857  1.00 65.08  ? 14  U   D "C1'" 1 
ATOM   8304 N  N1    . U   D 2 14  ? -17.658 21.470  -4.011  1.00 65.67  ? 14  U   D N1    1 
ATOM   8305 C  C2    . U   D 2 14  ? -17.976 20.735  -2.887  1.00 68.28  ? 14  U   D C2    1 
ATOM   8306 O  O2    . U   D 2 14  ? -19.114 20.408  -2.587  1.00 69.15  ? 14  U   D O2    1 
ATOM   8307 N  N3    . U   D 2 14  ? -16.886 20.392  -2.121  1.00 71.43  ? 14  U   D N3    1 
ATOM   8308 C  C4    . U   D 2 14  ? -15.556 20.703  -2.358  1.00 71.18  ? 14  U   D C4    1 
ATOM   8309 O  O4    . U   D 2 14  ? -14.696 20.310  -1.583  1.00 74.95  ? 14  U   D O4    1 
ATOM   8310 C  C5    . U   D 2 14  ? -15.308 21.483  -3.542  1.00 68.28  ? 14  U   D C5    1 
ATOM   8311 C  C6    . U   D 2 14  ? -16.352 21.831  -4.300  1.00 66.00  ? 14  U   D C6    1 
ATOM   8312 P  P     . C   D 2 15  ? -18.384 26.785  -4.128  1.00 71.31  ? 15  C   D P     1 
ATOM   8313 O  OP1   . C   D 2 15  ? -19.176 28.000  -4.406  1.00 73.78  ? 15  C   D OP1   1 
ATOM   8314 O  OP2   . C   D 2 15  ? -16.934 26.761  -4.433  1.00 71.30  ? 15  C   D OP2   1 
ATOM   8315 O  "O5'" . C   D 2 15  ? -18.572 26.333  -2.597  1.00 72.91  ? 15  C   D "O5'" 1 
ATOM   8316 C  "C5'" . C   D 2 15  ? -18.405 27.226  -1.503  1.00 76.05  ? 15  C   D "C5'" 1 
ATOM   8317 C  "C4'" . C   D 2 15  ? -19.102 26.740  -0.240  1.00 78.71  ? 15  C   D "C4'" 1 
ATOM   8318 O  "O4'" . C   D 2 15  ? -20.491 27.140  -0.274  1.00 79.14  ? 15  C   D "O4'" 1 
ATOM   8319 C  "C3'" . C   D 2 15  ? -19.209 25.241  -0.015  1.00 79.50  ? 15  C   D "C3'" 1 
ATOM   8320 O  "O3'" . C   D 2 15  ? -18.022 24.693  0.533   1.00 84.80  ? 15  C   D "O3'" 1 
ATOM   8321 C  "C2'" . C   D 2 15  ? -20.340 25.168  1.004   1.00 82.81  ? 15  C   D "C2'" 1 
ATOM   8322 O  "O2'" . C   D 2 15  ? -19.943 25.501  2.319   1.00 87.50  ? 15  C   D "O2'" 1 
ATOM   8323 C  "C1'" . C   D 2 15  ? -21.280 26.248  0.503   1.00 80.88  ? 15  C   D "C1'" 1 
ATOM   8324 N  N1    . C   D 2 15  ? -22.485 25.733  -0.263  1.00 79.63  ? 15  C   D N1    1 
ATOM   8325 C  C2    . C   D 2 15  ? -22.511 25.700  -1.675  1.00 75.46  ? 15  C   D C2    1 
ATOM   8326 O  O2    . C   D 2 15  ? -21.543 26.085  -2.336  1.00 72.81  ? 15  C   D O2    1 
ATOM   8327 N  N3    . C   D 2 15  ? -23.613 25.245  -2.314  1.00 76.16  ? 15  C   D N3    1 
ATOM   8328 C  C4    . C   D 2 15  ? -24.664 24.832  -1.613  1.00 82.30  ? 15  C   D C4    1 
ATOM   8329 N  N4    . C   D 2 15  ? -25.715 24.397  -2.318  1.00 85.11  ? 15  C   D N4    1 
ATOM   8330 C  C5    . C   D 2 15  ? -24.673 24.844  -0.175  1.00 85.91  ? 15  C   D C5    1 
ATOM   8331 C  C6    . C   D 2 15  ? -23.577 25.300  0.447   1.00 83.69  ? 15  C   D C6    1 
ATOM   8332 P  P     . A   D 2 16  ? -17.515 23.283  -0.013  1.00 85.90  ? 16  A   D P     1 
ATOM   8333 O  OP1   . A   D 2 16  ? -16.301 22.896  0.726   1.00 89.58  ? 16  A   D OP1   1 
ATOM   8334 O  OP2   . A   D 2 16  ? -17.445 23.396  -1.484  1.00 81.12  ? 16  A   D OP2   1 
ATOM   8335 O  "O5'" . A   D 2 16  ? -18.695 22.284  0.402   1.00 91.52  ? 16  A   D "O5'" 1 
ATOM   8336 C  "C5'" . A   D 2 16  ? -18.845 21.880  1.766   1.00 102.97 ? 16  A   D "C5'" 1 
ATOM   8337 C  "C4'" . A   D 2 16  ? -20.111 21.069  1.998   1.00 110.39 ? 16  A   D "C4'" 1 
ATOM   8338 O  "O4'" . A   D 2 16  ? -21.263 21.838  1.576   1.00 109.93 ? 16  A   D "O4'" 1 
ATOM   8339 C  "C3'" . A   D 2 16  ? -20.227 19.755  1.227   1.00 110.93 ? 16  A   D "C3'" 1 
ATOM   8340 O  "O3'" . A   D 2 16  ? -19.642 18.675  1.926   1.00 119.64 ? 16  A   D "O3'" 1 
ATOM   8341 C  "C2'" . A   D 2 16  ? -21.731 19.538  1.119   1.00 113.14 ? 16  A   D "C2'" 1 
ATOM   8342 O  "O2'" . A   D 2 16  ? -22.282 18.905  2.264   1.00 121.56 ? 16  A   D "O2'" 1 
ATOM   8343 C  "C1'" . A   D 2 16  ? -22.220 20.976  0.980   1.00 110.93 ? 16  A   D "C1'" 1 
ATOM   8344 N  N9    . A   D 2 16  ? -22.403 21.374  -0.410  1.00 104.95 ? 16  A   D N9    1 
ATOM   8345 C  C8    . A   D 2 16  ? -21.522 22.041  -1.212  1.00 99.80  ? 16  A   D C8    1 
ATOM   8346 N  N7    . A   D 2 16  ? -21.981 22.267  -2.417  1.00 97.04  ? 16  A   D N7    1 
ATOM   8347 C  C5    . A   D 2 16  ? -23.245 21.711  -2.408  1.00 100.52 ? 16  A   D C5    1 
ATOM   8348 C  C6    . A   D 2 16  ? -24.262 21.615  -3.385  1.00 101.72 ? 16  A   D C6    1 
ATOM   8349 N  N6    . A   D 2 16  ? -24.146 22.099  -4.625  1.00 99.21  ? 16  A   D N6    1 
ATOM   8350 N  N1    . A   D 2 16  ? -25.415 20.998  -3.046  1.00 106.92 ? 16  A   D N1    1 
ATOM   8351 C  C2    . A   D 2 16  ? -25.533 20.509  -1.806  1.00 111.59 ? 16  A   D C2    1 
ATOM   8352 N  N3    . A   D 2 16  ? -24.649 20.535  -0.805  1.00 111.57 ? 16  A   D N3    1 
ATOM   8353 C  C4    . A   D 2 16  ? -23.518 21.155  -1.175  1.00 105.45 ? 16  A   D C4    1 
ATOM   8354 P  P     . A   D 2 17  ? -18.358 17.951  1.319   1.00 119.64 ? 17  A   D P     1 
ATOM   8355 O  OP1   . A   D 2 17  ? -17.791 17.096  2.378   1.00 127.89 ? 17  A   D OP1   1 
ATOM   8356 O  OP2   . A   D 2 17  ? -17.530 18.979  0.650   1.00 114.32 ? 17  A   D OP2   1 
ATOM   8357 O  "O5'" . A   D 2 17  ? -18.949 16.969  0.231   1.00 119.89 ? 17  A   D "O5'" 1 
ATOM   8358 C  "C5'" . A   D 2 17  ? -19.350 17.474  -1.007  1.00 122.00 ? 17  A   D "C5'" 1 
ATOM   8359 C  "C4'" . A   D 2 17  ? -20.398 16.519  -1.509  1.00 127.89 ? 17  A   D "C4'" 1 
ATOM   8360 O  "O4'" . A   D 2 17  ? -21.504 17.199  -2.149  1.00 128.84 ? 17  A   D "O4'" 1 
ATOM   8361 C  "C3'" . A   D 2 17  ? -19.841 15.483  -2.494  1.00 126.08 ? 17  A   D "C3'" 1 
ATOM   8362 O  "O3'" . A   D 2 17  ? -20.025 14.125  -1.962  1.00 132.38 ? 17  A   D "O3'" 1 
ATOM   8363 C  "C2'" . A   D 2 17  ? -20.586 15.859  -3.794  1.00 122.38 ? 17  A   D "C2'" 1 
ATOM   8364 O  "O2'" . A   D 2 17  ? -20.840 14.825  -4.721  1.00 120.11 ? 17  A   D "O2'" 1 
ATOM   8365 C  "C1'" . A   D 2 17  ? -21.895 16.294  -3.153  1.00 128.97 ? 17  A   D "C1'" 1 
ATOM   8366 N  N9    . A   D 2 17  ? -22.888 16.955  -3.976  1.00 129.20 ? 17  A   D N9    1 
ATOM   8367 C  C8    . A   D 2 17  ? -22.768 17.503  -5.224  1.00 125.05 ? 17  A   D C8    1 
ATOM   8368 N  N7    . A   D 2 17  ? -23.893 18.026  -5.652  1.00 127.92 ? 17  A   D N7    1 
ATOM   8369 C  C5    . A   D 2 17  ? -24.793 17.802  -4.617  1.00 134.22 ? 17  A   D C5    1 
ATOM   8370 C  C6    . A   D 2 17  ? -26.163 18.106  -4.439  1.00 141.01 ? 17  A   D C6    1 
ATOM   8371 N  N6    . A   D 2 17  ? -26.897 18.746  -5.362  1.00 142.14 ? 17  A   D N6    1 
ATOM   8372 N  N1    . A   D 2 17  ? -26.749 17.725  -3.270  1.00 148.11 ? 17  A   D N1    1 
ATOM   8373 C  C2    . A   D 2 17  ? -26.022 17.082  -2.338  1.00 148.34 ? 17  A   D C2    1 
ATOM   8374 N  N3    . A   D 2 17  ? -24.732 16.748  -2.397  1.00 142.40 ? 17  A   D N3    1 
ATOM   8375 C  C4    . A   D 2 17  ? -24.183 17.140  -3.569  1.00 135.31 ? 17  A   D C4    1 
ATOM   8376 P  P     . G   D 2 18  ? -20.561 13.726  -0.479  1.00 143.41 ? 18  G   D P     1 
ATOM   8377 O  OP1   . G   D 2 18  ? -21.938 13.228  -0.678  1.00 147.25 ? 18  G   D OP1   1 
ATOM   8378 O  OP2   . G   D 2 18  ? -20.345 14.791  0.529   1.00 146.15 ? 18  G   D OP2   1 
ATOM   8379 O  "O5'" . G   D 2 18  ? -19.621 12.499  -0.054  1.00 147.61 ? 18  G   D "O5'" 1 
ATOM   8380 C  "C5'" . G   D 2 18  ? -19.189 11.537  -1.015  1.00 144.66 ? 18  G   D "C5'" 1 
ATOM   8381 C  "C4'" . G   D 2 18  ? -19.634 10.123  -0.667  1.00 152.30 ? 18  G   D "C4'" 1 
ATOM   8382 O  "O4'" . G   D 2 18  ? -19.871 10.020  0.756   1.00 163.46 ? 18  G   D "O4'" 1 
ATOM   8383 C  "C3'" . G   D 2 18  ? -20.925 9.653   -1.332  1.00 152.25 ? 18  G   D "C3'" 1 
ATOM   8384 O  "O3'" . G   D 2 18  ? -20.637 9.029   -2.586  1.00 145.48 ? 18  G   D "O3'" 1 
ATOM   8385 C  "C2'" . G   D 2 18  ? -21.506 8.662   -0.325  1.00 164.01 ? 18  G   D "C2'" 1 
ATOM   8386 O  "O2'" . G   D 2 18  ? -21.001 7.348   -0.470  1.00 165.49 ? 18  G   D "O2'" 1 
ATOM   8387 C  "C1'" . G   D 2 18  ? -21.026 9.238   1.001   1.00 171.46 ? 18  G   D "C1'" 1 
ATOM   8388 N  N9    . G   D 2 18  ? -22.014 10.060  1.702   1.00 176.92 ? 18  G   D N9    1 
ATOM   8389 C  C8    . G   D 2 18  ? -22.130 11.430  1.676   1.00 172.29 ? 18  G   D C8    1 
ATOM   8390 N  N7    . G   D 2 18  ? -23.102 11.888  2.414   1.00 179.55 ? 18  G   D N7    1 
ATOM   8391 C  C5    . G   D 2 18  ? -23.672 10.747  2.978   1.00 190.54 ? 18  G   D C5    1 
ATOM   8392 C  C6    . G   D 2 18  ? -24.772 10.600  3.879   1.00 203.21 ? 18  G   D C6    1 
ATOM   8393 O  O6    . G   D 2 18  ? -25.489 11.487  4.374   1.00 206.90 ? 18  G   D O6    1 
ATOM   8394 N  N1    . G   D 2 18  ? -25.020 9.258   4.203   1.00 213.07 ? 18  G   D N1    1 
ATOM   8395 C  C2    . G   D 2 18  ? -24.296 8.186   3.719   1.00 210.44 ? 18  G   D C2    1 
ATOM   8396 N  N2    . G   D 2 18  ? -24.674 6.967   4.135   1.00 222.01 ? 18  G   D N2    1 
ATOM   8397 N  N3    . G   D 2 18  ? -23.267 8.311   2.877   1.00 198.39 ? 18  G   D N3    1 
ATOM   8398 C  C4    . G   D 2 18  ? -23.008 9.611   2.548   1.00 189.06 ? 18  G   D C4    1 
ATOM   8399 P  P     . U   D 2 19  ? -21.138 9.658   -3.979  1.00 137.13 ? 19  U   D P     1 
ATOM   8400 O  OP1   . U   D 2 19  ? -20.472 8.899   -5.069  1.00 131.33 ? 19  U   D OP1   1 
ATOM   8401 O  OP2   . U   D 2 19  ? -20.979 11.135  -3.910  1.00 134.10 ? 19  U   D OP2   1 
ATOM   8402 O  "O5'" . U   D 2 19  ? -22.713 9.332   -3.979  1.00 141.23 ? 19  U   D "O5'" 1 
ATOM   8403 C  "C5'" . U   D 2 19  ? -23.378 8.857   -5.157  1.00 136.15 ? 19  U   D "C5'" 1 
ATOM   8404 C  "C4'" . U   D 2 19  ? -24.564 9.737   -5.526  1.00 135.44 ? 19  U   D "C4'" 1 
ATOM   8405 O  "O4'" . U   D 2 19  ? -25.353 10.019  -4.347  1.00 144.22 ? 19  U   D "O4'" 1 
ATOM   8406 C  "C3'" . U   D 2 19  ? -24.230 11.094  -6.152  1.00 127.27 ? 19  U   D "C3'" 1 
ATOM   8407 O  "O3'" . U   D 2 19  ? -25.025 11.274  -7.340  1.00 123.64 ? 19  U   D "O3'" 1 
ATOM   8408 C  "C2'" . U   D 2 19  ? -24.534 12.101  -5.039  1.00 131.79 ? 19  U   D "C2'" 1 
ATOM   8409 O  "O2'" . U   D 2 19  ? -24.929 13.376  -5.512  1.00 128.91 ? 19  U   D "O2'" 1 
ATOM   8410 C  "C1'" . U   D 2 19  ? -25.686 11.388  -4.341  1.00 143.00 ? 19  U   D "C1'" 1 
ATOM   8411 N  N1    . U   D 2 19  ? -25.927 11.764  -2.922  1.00 151.21 ? 19  U   D N1    1 
ATOM   8412 C  C2    . U   D 2 19  ? -27.129 12.381  -2.608  1.00 158.58 ? 19  U   D C2    1 
ATOM   8413 O  O2    . U   D 2 19  ? -27.992 12.641  -3.435  1.00 159.12 ? 19  U   D O2    1 
ATOM   8414 N  N3    . U   D 2 19  ? -27.280 12.691  -1.274  1.00 166.09 ? 19  U   D N3    1 
ATOM   8415 C  C4    . U   D 2 19  ? -26.372 12.442  -0.255  1.00 167.35 ? 19  U   D C4    1 
ATOM   8416 O  O4    . U   D 2 19  ? -26.658 12.780  0.889   1.00 175.30 ? 19  U   D O4    1 
ATOM   8417 C  C5    . U   D 2 19  ? -25.145 11.788  -0.656  1.00 160.35 ? 19  U   D C5    1 
ATOM   8418 C  C6    . U   D 2 19  ? -24.974 11.478  -1.950  1.00 152.54 ? 19  U   D C6    1 
ATOM   8419 P  P     . C   D 2 20  ? -24.497 10.776  -8.784  1.00 115.10 ? 20  C   D P     1 
ATOM   8420 O  OP1   . C   D 2 20  ? -25.686 10.513  -9.630  1.00 118.70 ? 20  C   D OP1   1 
ATOM   8421 O  OP2   . C   D 2 20  ? -23.466 9.719   -8.614  1.00 111.71 ? 20  C   D OP2   1 
ATOM   8422 O  "O5'" . C   D 2 20  ? -23.746 12.077  -9.330  1.00 106.22 ? 20  C   D "O5'" 1 
ATOM   8423 C  "C5'" . C   D 2 20  ? -24.232 12.803  -10.446 1.00 100.83 ? 20  C   D "C5'" 1 
ATOM   8424 C  "C4'" . C   D 2 20  ? -23.201 13.840  -10.823 1.00 92.96  ? 20  C   D "C4'" 1 
ATOM   8425 O  "O4'" . C   D 2 20  ? -22.828 14.574  -9.634  1.00 93.16  ? 20  C   D "O4'" 1 
ATOM   8426 C  "C3'" . C   D 2 20  ? -21.866 13.286  -11.286 1.00 85.26  ? 20  C   D "C3'" 1 
ATOM   8427 O  "O3'" . C   D 2 20  ? -21.912 12.835  -12.617 1.00 80.44  ? 20  C   D "O3'" 1 
ATOM   8428 C  "C2'" . C   D 2 20  ? -20.987 14.511  -11.107 1.00 84.52  ? 20  C   D "C2'" 1 
ATOM   8429 O  "O2'" . C   D 2 20  ? -21.224 15.524  -12.064 1.00 85.35  ? 20  C   D "O2'" 1 
ATOM   8430 C  "C1'" . C   D 2 20  ? -21.464 14.953  -9.727  1.00 88.63  ? 20  C   D "C1'" 1 
ATOM   8431 N  N1    . C   D 2 20  ? -20.631 14.382  -8.594  1.00 88.94  ? 20  C   D N1    1 
ATOM   8432 C  C2    . C   D 2 20  ? -19.471 15.075  -8.186  1.00 88.35  ? 20  C   D C2    1 
ATOM   8433 O  O2    . C   D 2 20  ? -19.151 16.140  -8.747  1.00 86.84  ? 20  C   D O2    1 
ATOM   8434 N  N3    . C   D 2 20  ? -18.722 14.549  -7.170  1.00 89.92  ? 20  C   D N3    1 
ATOM   8435 C  C4    . C   D 2 20  ? -19.073 13.407  -6.573  1.00 91.61  ? 20  C   D C4    1 
ATOM   8436 N  N4    . C   D 2 20  ? -18.292 12.969  -5.590  1.00 94.40  ? 20  C   D N4    1 
ATOM   8437 C  C5    . C   D 2 20  ? -20.241 12.685  -6.967  1.00 92.97  ? 20  C   D C5    1 
ATOM   8438 C  C6    . C   D 2 20  ? -20.977 13.205  -7.967  1.00 91.43  ? 20  C   D C6    1 
ATOM   8439 P  P     . C   D 2 21  ? -21.045 11.553  -13.030 1.00 74.79  ? 21  C   D P     1 
ATOM   8440 O  OP1   . C   D 2 21  ? -21.559 11.025  -14.311 1.00 75.56  ? 21  C   D OP1   1 
ATOM   8441 O  OP2   . C   D 2 21  ? -20.954 10.637  -11.875 1.00 75.24  ? 21  C   D OP2   1 
ATOM   8442 O  "O5'" . C   D 2 21  ? -19.604 12.193  -13.286 1.00 70.26  ? 21  C   D "O5'" 1 
ATOM   8443 C  "C5'" . C   D 2 21  ? -19.398 13.211  -14.250 1.00 67.36  ? 21  C   D "C5'" 1 
ATOM   8444 C  "C4'" . C   D 2 21  ? -18.014 13.790  -14.057 1.00 65.12  ? 21  C   D "C4'" 1 
ATOM   8445 O  "O4'" . C   D 2 21  ? -17.872 14.335  -12.719 1.00 64.85  ? 21  C   D "O4'" 1 
ATOM   8446 C  "C3'" . C   D 2 21  ? -16.905 12.759  -14.155 1.00 62.55  ? 21  C   D "C3'" 1 
ATOM   8447 O  "O3'" . C   D 2 21  ? -16.517 12.580  -15.481 1.00 61.06  ? 21  C   D "O3'" 1 
ATOM   8448 C  "C2'" . C   D 2 21  ? -15.786 13.391  -13.348 1.00 64.14  ? 21  C   D "C2'" 1 
ATOM   8449 O  "O2'" . C   D 2 21  ? -15.049 14.331  -14.097 1.00 66.93  ? 21  C   D "O2'" 1 
ATOM   8450 C  "C1'" . C   D 2 21  ? -16.565 14.074  -12.226 1.00 64.70  ? 21  C   D "C1'" 1 
ATOM   8451 N  N1    . C   D 2 21  ? -16.645 13.266  -10.955 1.00 65.18  ? 21  C   D N1    1 
ATOM   8452 C  C2    . C   D 2 21  ? -15.496 12.952  -10.194 1.00 66.89  ? 21  C   D C2    1 
ATOM   8453 O  O2    . C   D 2 21  ? -14.379 13.337  -10.558 1.00 67.95  ? 21  C   D O2    1 
ATOM   8454 N  N3    . C   D 2 21  ? -15.627 12.229  -9.048  1.00 69.02  ? 21  C   D N3    1 
ATOM   8455 C  C4    . C   D 2 21  ? -16.834 11.821  -8.651  1.00 69.99  ? 21  C   D C4    1 
ATOM   8456 N  N4    . C   D 2 21  ? -16.930 11.116  -7.522  1.00 73.67  ? 21  C   D N4    1 
ATOM   8457 C  C5    . C   D 2 21  ? -18.006 12.118  -9.409  1.00 68.78  ? 21  C   D C5    1 
ATOM   8458 C  C6    . C   D 2 21  ? -17.868 12.834  -10.531 1.00 66.15  ? 21  C   D C6    1 
ATOM   8459 P  P     . A   D 2 22  ? -16.488 11.090  -16.033 1.00 59.64  ? 22  A   D P     1 
ATOM   8460 O  OP1   . A   D 2 22  ? -16.724 11.173  -17.496 1.00 59.75  ? 22  A   D OP1   1 
ATOM   8461 O  OP2   . A   D 2 22  ? -17.349 10.245  -15.165 1.00 59.40  ? 22  A   D OP2   1 
ATOM   8462 O  "O5'" . A   D 2 22  ? -14.983 10.618  -15.761 1.00 59.70  ? 22  A   D "O5'" 1 
ATOM   8463 C  "C5'" . A   D 2 22  ? -14.635 9.645   -14.762 1.00 58.18  ? 22  A   D "C5'" 1 
ATOM   8464 C  "C4'" . A   D 2 22  ? -13.337 10.080  -14.096 1.00 60.18  ? 22  A   D "C4'" 1 
ATOM   8465 O  "O4'" . A   D 2 22  ? -13.640 10.871  -12.920 1.00 60.86  ? 22  A   D "O4'" 1 
ATOM   8466 C  "C3'" . A   D 2 22  ? -12.424 8.988   -13.564 1.00 61.49  ? 22  A   D "C3'" 1 
ATOM   8467 O  "O3'" . A   D 2 22  ? -11.583 8.479   -14.578 1.00 63.94  ? 22  A   D "O3'" 1 
ATOM   8468 C  "C2'" . A   D 2 22  ? -11.622 9.719   -12.491 1.00 64.05  ? 22  A   D "C2'" 1 
ATOM   8469 O  "O2'" . A   D 2 22  ? -10.547 10.496  -12.982 1.00 66.36  ? 22  A   D "O2'" 1 
ATOM   8470 C  "C1'" . A   D 2 22  ? -12.707 10.598  -11.892 1.00 61.15  ? 22  A   D "C1'" 1 
ATOM   8471 N  N9    . A   D 2 22  ? -13.408 9.932   -10.802 1.00 61.21  ? 22  A   D N9    1 
ATOM   8472 C  C8    . A   D 2 22  ? -14.720 9.534   -10.750 1.00 59.03  ? 22  A   D C8    1 
ATOM   8473 N  N7    . A   D 2 22  ? -15.050 8.956   -9.617  1.00 62.08  ? 22  A   D N7    1 
ATOM   8474 C  C5    . A   D 2 22  ? -13.874 8.979   -8.876  1.00 66.04  ? 22  A   D C5    1 
ATOM   8475 C  C6    . A   D 2 22  ? -13.537 8.531   -7.580  1.00 71.42  ? 22  A   D C6    1 
ATOM   8476 N  N6    . A   D 2 22  ? -14.386 7.936   -6.750  1.00 74.71  ? 22  A   D N6    1 
ATOM   8477 N  N1    . A   D 2 22  ? -12.275 8.719   -7.157  1.00 75.79  ? 22  A   D N1    1 
ATOM   8478 C  C2    . A   D 2 22  ? -11.393 9.312   -7.972  1.00 74.40  ? 22  A   D C2    1 
ATOM   8479 N  N3    . A   D 2 22  ? -11.576 9.783   -9.203  1.00 68.99  ? 22  A   D N3    1 
ATOM   8480 C  C4    . A   D 2 22  ? -12.851 9.581   -9.596  1.00 65.52  ? 22  A   D C4    1 
ATOM   8481 P  P     . U   D 2 23  ? -11.371 6.899   -14.607 1.00 64.95  ? 23  U   D P     1 
ATOM   8482 O  OP1   . U   D 2 23  ? -10.635 6.503   -15.831 1.00 65.33  ? 23  U   D OP1   1 
ATOM   8483 O  OP2   . U   D 2 23  ? -12.694 6.289   -14.324 1.00 61.92  ? 23  U   D OP2   1 
ATOM   8484 O  "O5'" . U   D 2 23  ? -10.422 6.689   -13.332 1.00 71.26  ? 23  U   D "O5'" 1 
ATOM   8485 C  "C5'" . U   D 2 23  ? -9.122  7.295   -13.231 1.00 77.67  ? 23  U   D "C5'" 1 
ATOM   8486 C  "C4'" . U   D 2 23  ? -8.531  7.110   -11.839 1.00 84.62  ? 23  U   D "C4'" 1 
ATOM   8487 O  "O4'" . U   D 2 23  ? -9.419  7.624   -10.817 1.00 83.54  ? 23  U   D "O4'" 1 
ATOM   8488 C  "C3'" . U   D 2 23  ? -8.325  5.666   -11.412 1.00 88.56  ? 23  U   D "C3'" 1 
ATOM   8489 O  "O3'" . U   D 2 23  ? -7.110  5.166   -11.950 1.00 94.56  ? 23  U   D "O3'" 1 
ATOM   8490 C  "C2'" . U   D 2 23  ? -8.266  5.779   -9.892  1.00 93.54  ? 23  U   D "C2'" 1 
ATOM   8491 O  "O2'" . U   D 2 23  ? -7.009  6.192   -9.397  1.00 101.47 ? 23  U   D "O2'" 1 
ATOM   8492 C  "C1'" . U   D 2 23  ? -9.287  6.869   -9.624  1.00 88.49  ? 23  U   D "C1'" 1 
ATOM   8493 N  N1    . U   D 2 23  ? -10.605 6.309   -9.179  1.00 86.03  ? 23  U   D N1    1 
ATOM   8494 C  C2    . U   D 2 23  ? -10.748 5.892   -7.860  1.00 91.64  ? 23  U   D C2    1 
ATOM   8495 O  O2    . U   D 2 23  ? -9.857  5.957   -7.027  1.00 98.29  ? 23  U   D O2    1 
ATOM   8496 N  N3    . U   D 2 23  ? -11.997 5.397   -7.551  1.00 90.38  ? 23  U   D N3    1 
ATOM   8497 C  C4    . U   D 2 23  ? -13.084 5.281   -8.407  1.00 84.39  ? 23  U   D C4    1 
ATOM   8498 O  O4    . U   D 2 23  ? -14.135 4.817   -7.992  1.00 85.97  ? 23  U   D O4    1 
ATOM   8499 C  C5    . U   D 2 23  ? -12.864 5.731   -9.757  1.00 78.32  ? 23  U   D C5    1 
ATOM   8500 C  C6    . U   D 2 23  ? -11.656 6.215   -10.083 1.00 79.62  ? 23  U   D C6    1 
ATOM   8501 P  P     . U   D 2 24  ? -6.992  3.636   -12.393 1.00 95.70  ? 24  U   D P     1 
ATOM   8502 O  OP1   . U   D 2 24  ? -5.660  3.509   -13.033 1.00 101.04 ? 24  U   D OP1   1 
ATOM   8503 O  OP2   . U   D 2 24  ? -8.239  3.271   -13.114 1.00 87.28  ? 24  U   D OP2   1 
ATOM   8504 O  "O5'" . U   D 2 24  ? -6.983  2.825   -11.005 1.00 102.34 ? 24  U   D "O5'" 1 
ATOM   8505 C  "C5'" . U   D 2 24  ? -5.909  2.979   -10.067 1.00 111.60 ? 24  U   D "C5'" 1 
ATOM   8506 C  "C4'" . U   D 2 24  ? -6.244  2.438   -8.682  1.00 117.28 ? 24  U   D "C4'" 1 
ATOM   8507 O  "O4'" . U   D 2 24  ? -7.330  3.172   -8.051  1.00 112.69 ? 24  U   D "O4'" 1 
ATOM   8508 C  "C3'" . U   D 2 24  ? -6.738  1.001   -8.603  1.00 118.52 ? 24  U   D "C3'" 1 
ATOM   8509 O  "O3'" . U   D 2 24  ? -5.691  0.076   -8.917  1.00 126.57 ? 24  U   D "O3'" 1 
ATOM   8510 C  "C2'" . U   D 2 24  ? -7.185  1.017   -7.141  1.00 124.20 ? 24  U   D "C2'" 1 
ATOM   8511 O  "O2'" . U   D 2 24  ? -6.120  1.074   -6.200  1.00 134.82 ? 24  U   D "O2'" 1 
ATOM   8512 C  "C1'" . U   D 2 24  ? -7.998  2.311   -7.141  1.00 115.74 ? 24  U   D "C1'" 1 
ATOM   8513 N  N1    . U   D 2 24  ? -9.440  2.100   -7.553  1.00 107.31 ? 24  U   D N1    1 
ATOM   8514 C  C2    . U   D 2 24  ? -10.354 1.580   -6.646  1.00 110.67 ? 24  U   D C2    1 
ATOM   8515 O  O2    . U   D 2 24  ? -10.075 1.274   -5.506  1.00 120.31 ? 24  U   D O2    1 
ATOM   8516 N  N3    . U   D 2 24  ? -11.634 1.420   -7.116  1.00 104.43 ? 24  U   D N3    1 
ATOM   8517 C  C4    . U   D 2 24  ? -12.090 1.720   -8.388  1.00 95.64  ? 24  U   D C4    1 
ATOM   8518 O  O4    . U   D 2 24  ? -13.263 1.524   -8.677  1.00 92.67  ? 24  U   D O4    1 
ATOM   8519 C  C5    . U   D 2 24  ? -11.097 2.257   -9.283  1.00 92.04  ? 24  U   D C5    1 
ATOM   8520 C  C6    . U   D 2 24  ? -9.841  2.421   -8.841  1.00 98.04  ? 24  U   D C6    1 
ATOM   8521 P  P     . U   D 2 25  ? -5.856  -1.514  -8.776  1.00 132.03 ? 25  U   D P     1 
ATOM   8522 O  OP1   . U   D 2 25  ? -4.683  -2.149  -9.418  1.00 136.64 ? 25  U   D OP1   1 
ATOM   8523 O  OP2   . U   D 2 25  ? -7.226  -1.879  -9.212  1.00 123.30 ? 25  U   D OP2   1 
ATOM   8524 O  "O5'" . U   D 2 25  ? -5.732  -1.691  -7.190  1.00 144.75 ? 25  U   D "O5'" 1 
ATOM   8525 C  "C5'" . U   D 2 25  ? -4.783  -2.538  -6.561  1.00 158.64 ? 25  U   D "C5'" 1 
ATOM   8526 C  "C4'" . U   D 2 25  ? -5.534  -3.296  -5.493  1.00 166.75 ? 25  U   D "C4'" 1 
ATOM   8527 O  "O4'" . U   D 2 25  ? -6.582  -2.451  -4.941  1.00 161.89 ? 25  U   D "O4'" 1 
ATOM   8528 C  "C3'" . U   D 2 25  ? -6.271  -4.504  -6.035  1.00 164.54 ? 25  U   D "C3'" 1 
ATOM   8529 O  "O3'" . U   D 2 25  ? -5.385  -5.610  -6.077  1.00 175.81 ? 25  U   D "O3'" 1 
ATOM   8530 C  "C2'" . U   D 2 25  ? -7.372  -4.671  -4.995  1.00 168.66 ? 25  U   D "C2'" 1 
ATOM   8531 O  "O2'" . U   D 2 25  ? -6.961  -5.375  -3.844  1.00 184.79 ? 25  U   D "O2'" 1 
ATOM   8532 C  "C1'" . U   D 2 25  ? -7.718  -3.236  -4.621  1.00 163.43 ? 25  U   D "C1'" 1 
ATOM   8533 N  N1    . U   D 2 25  ? -8.948  -2.773  -5.349  1.00 150.72 ? 25  U   D N1    1 
ATOM   8534 C  C2    . U   D 2 25  ? -10.210 -3.077  -4.850  1.00 151.95 ? 25  U   D C2    1 
ATOM   8535 O  O2    . U   D 2 25  ? -10.402 -3.706  -3.825  1.00 163.36 ? 25  U   D O2    1 
ATOM   8536 N  N3    . U   D 2 25  ? -11.263 -2.613  -5.608  1.00 140.55 ? 25  U   D N3    1 
ATOM   8537 C  C4    . U   D 2 25  ? -11.178 -1.893  -6.791  1.00 128.96 ? 25  U   D C4    1 
ATOM   8538 O  O4    . U   D 2 25  ? -12.193 -1.536  -7.370  1.00 121.66 ? 25  U   D O4    1 
ATOM   8539 C  C5    . U   D 2 25  ? -9.844  -1.620  -7.256  1.00 128.63 ? 25  U   D C5    1 
ATOM   8540 C  C6    . U   D 2 25  ? -8.811  -2.063  -6.530  1.00 139.51 ? 25  U   D C6    1 
ATOM   8541 P  P     . A   D 2 26  ? -5.630  -6.867  -7.039  1.00 174.08 ? 26  A   D P     1 
ATOM   8542 O  OP1   . A   D 2 26  ? -4.451  -7.754  -6.893  1.00 186.42 ? 26  A   D OP1   1 
ATOM   8543 O  OP2   . A   D 2 26  ? -6.018  -6.375  -8.379  1.00 158.92 ? 26  A   D OP2   1 
ATOM   8544 O  "O5'" . A   D 2 26  ? -6.917  -7.588  -6.412  1.00 178.30 ? 26  A   D "O5'" 1 
ATOM   8545 C  "C5'" . A   D 2 26  ? -6.798  -8.761  -5.605  1.00 194.69 ? 26  A   D "C5'" 1 
ATOM   8546 C  "C4'" . A   D 2 26  ? -7.844  -8.798  -4.500  1.00 202.86 ? 26  A   D "C4'" 1 
ATOM   8547 O  "O4'" . A   D 2 26  ? -8.386  -7.477  -4.240  1.00 195.82 ? 26  A   D "O4'" 1 
ATOM   8548 C  "C3'" . A   D 2 26  ? -9.071  -9.642  -4.792  1.00 201.68 ? 26  A   D "C3'" 1 
ATOM   8549 O  "O3'" . A   D 2 26  ? -8.797  -10.981 -4.456  1.00 217.31 ? 26  A   D "O3'" 1 
ATOM   8550 C  "C2'" . A   D 2 26  ? -10.110 -9.030  -3.859  1.00 203.76 ? 26  A   D "C2'" 1 
ATOM   8551 O  "O2'" . A   D 2 26  ? -9.979  -9.439  -2.514  1.00 220.85 ? 26  A   D "O2'" 1 
ATOM   8552 C  "C1'" . A   D 2 26  ? -9.774  -7.548  -3.969  1.00 194.48 ? 26  A   D "C1'" 1 
ATOM   8553 N  N9    . A   D 2 26  ? -10.524 -6.857  -5.023  1.00 178.50 ? 26  A   D N9    1 
ATOM   8554 C  C8    . A   D 2 26  ? -10.019 -6.210  -6.121  1.00 166.53 ? 26  A   D C8    1 
ATOM   8555 N  N7    . A   D 2 26  ? -10.929 -5.685  -6.903  1.00 154.79 ? 26  A   D N7    1 
ATOM   8556 C  C5    . A   D 2 26  ? -12.119 -6.014  -6.281  1.00 159.14 ? 26  A   D C5    1 
ATOM   8557 C  C6    . A   D 2 26  ? -13.465 -5.751  -6.607  1.00 153.21 ? 26  A   D C6    1 
ATOM   8558 N  N6    . A   D 2 26  ? -13.836 -5.066  -7.689  1.00 140.97 ? 26  A   D N6    1 
ATOM   8559 N  N1    . A   D 2 26  ? -14.420 -6.224  -5.773  1.00 162.32 ? 26  A   D N1    1 
ATOM   8560 C  C2    . A   D 2 26  ? -14.056 -6.919  -4.681  1.00 176.19 ? 26  A   D C2    1 
ATOM   8561 N  N3    . A   D 2 26  ? -12.825 -7.223  -4.269  1.00 183.00 ? 26  A   D N3    1 
ATOM   8562 C  C4    . A   D 2 26  ? -11.894 -6.739  -5.120  1.00 173.81 ? 26  A   D C4    1 
ATOM   8563 P  P     . C   D 2 27  ? -8.487  -12.059 -5.594  1.00 215.76 ? 27  C   D P     1 
ATOM   8564 O  OP1   . C   D 2 27  ? -7.506  -13.023 -5.033  1.00 231.57 ? 27  C   D OP1   1 
ATOM   8565 O  OP2   . C   D 2 27  ? -8.205  -11.324 -6.858  1.00 199.02 ? 27  C   D OP2   1 
ATOM   8566 O  "O5'" . C   D 2 27  ? -9.896  -12.806 -5.772  1.00 215.66 ? 27  C   D "O5'" 1 
ATOM   8567 C  "C5'" . C   D 2 27  ? -10.526 -13.554 -4.715  1.00 231.93 ? 27  C   D "C5'" 1 
ATOM   8568 C  "C4'" . C   D 2 27  ? -12.025 -13.287 -4.693  1.00 228.35 ? 27  C   D "C4'" 1 
ATOM   8569 O  "O4'" . C   D 2 27  ? -12.233 -11.849 -4.599  1.00 219.19 ? 27  C   D "O4'" 1 
ATOM   8570 C  "C3'" . C   D 2 27  ? -12.824 -13.638 -5.952  1.00 216.76 ? 27  C   D "C3'" 1 
ATOM   8571 O  "O3'" . C   D 2 27  ? -13.133 -15.031 -6.106  1.00 225.36 ? 27  C   D "O3'" 1 
ATOM   8572 C  "C2'" . C   D 2 27  ? -14.070 -12.776 -5.753  1.00 211.94 ? 27  C   D "C2'" 1 
ATOM   8573 O  "O2'" . C   D 2 27  ? -14.944 -13.254 -4.745  1.00 226.08 ? 27  C   D "O2'" 1 
ATOM   8574 C  "C1'" . C   D 2 27  ? -13.409 -11.477 -5.306  1.00 207.86 ? 27  C   D "C1'" 1 
ATOM   8575 N  N1    . C   D 2 27  ? -13.116 -10.533 -6.457  1.00 190.45 ? 27  C   D N1    1 
ATOM   8576 C  C2    . C   D 2 27  ? -14.106 -9.607  -6.827  1.00 180.65 ? 27  C   D C2    1 
ATOM   8577 O  O2    . C   D 2 27  ? -15.176 -9.581  -6.202  1.00 186.00 ? 27  C   D O2    1 
ATOM   8578 N  N3    . C   D 2 27  ? -13.863 -8.756  -7.862  1.00 166.85 ? 27  C   D N3    1 
ATOM   8579 C  C4    . C   D 2 27  ? -12.696 -8.806  -8.515  1.00 162.77 ? 27  C   D C4    1 
ATOM   8580 N  N4    . C   D 2 27  ? -12.516 -7.948  -9.521  1.00 150.60 ? 27  C   D N4    1 
ATOM   8581 C  C5    . C   D 2 27  ? -11.672 -9.743  -8.166  1.00 172.39 ? 27  C   D C5    1 
ATOM   8582 C  C6    . C   D 2 27  ? -11.924 -10.576 -7.144  1.00 185.86 ? 27  C   D C6    1 
ATOM   8583 P  P     . U   D 2 28  ? -13.192 -15.678 -7.582  1.00 214.37 ? 28  U   D P     1 
ATOM   8584 O  OP1   . U   D 2 28  ? -13.187 -17.154 -7.404  1.00 227.19 ? 28  U   D OP1   1 
ATOM   8585 O  OP2   . U   D 2 28  ? -12.174 -15.016 -8.438  1.00 201.79 ? 28  U   D OP2   1 
ATOM   8586 O  "O5'" . U   D 2 28  ? -14.612 -15.216 -8.160  1.00 203.86 ? 28  U   D "O5'" 1 
ATOM   8587 C  "C5'" . U   D 2 28  ? -15.823 -15.687 -7.583  1.00 212.30 ? 28  U   D "C5'" 1 
ATOM   8588 C  "C4'" . U   D 2 28  ? -16.999 -14.858 -8.061  1.00 201.59 ? 28  U   D "C4'" 1 
ATOM   8589 O  "O4'" . U   D 2 28  ? -16.796 -13.447 -7.771  1.00 194.63 ? 28  U   D "O4'" 1 
ATOM   8590 C  "C3'" . U   D 2 28  ? -17.216 -14.813 -9.565  1.00 186.11 ? 28  U   D "C3'" 1 
ATOM   8591 O  "O3'" . U   D 2 28  ? -17.641 -16.057 -10.116 1.00 187.14 ? 28  U   D "O3'" 1 
ATOM   8592 C  "C2'" . U   D 2 28  ? -18.244 -13.686 -9.618  1.00 180.97 ? 28  U   D "C2'" 1 
ATOM   8593 O  "O2'" . U   D 2 28  ? -19.518 -14.029 -9.105  1.00 191.82 ? 28  U   D "O2'" 1 
ATOM   8594 C  "C1'" . U   D 2 28  ? -17.554 -12.680 -8.698  1.00 181.95 ? 28  U   D "C1'" 1 
ATOM   8595 N  N1    . U   D 2 28  ? -16.694 -11.724 -9.474  1.00 168.21 ? 28  U   D N1    1 
ATOM   8596 C  C2    . U   D 2 28  ? -17.302 -10.646 -10.101 1.00 158.02 ? 28  U   D C2    1 
ATOM   8597 O  O2    . U   D 2 28  ? -18.500 -10.428 -10.037 1.00 159.49 ? 28  U   D O2    1 
ATOM   8598 N  N3    . U   D 2 28  ? -16.452 -9.813  -10.800 1.00 147.24 ? 28  U   D N3    1 
ATOM   8599 C  C4    . U   D 2 28  ? -15.080 -9.957  -10.939 1.00 145.99 ? 28  U   D C4    1 
ATOM   8600 O  O4    . U   D 2 28  ? -14.443 -9.142  -11.596 1.00 137.16 ? 28  U   D O4    1 
ATOM   8601 C  C5    . U   D 2 28  ? -14.520 -11.108 -10.269 1.00 157.47 ? 28  U   D C5    1 
ATOM   8602 C  C6    . U   D 2 28  ? -15.326 -11.930 -9.578  1.00 167.68 ? 28  U   D C6    1 
ATOM   8603 P  P     . U   D 2 29  ? -16.619 -16.845 -11.066 1.00 179.77 ? 29  U   D P     1 
ATOM   8604 O  OP1   . U   D 2 29  ? -16.189 -18.057 -10.341 1.00 195.20 ? 29  U   D OP1   1 
ATOM   8605 O  OP2   . U   D 2 29  ? -15.597 -15.894 -11.565 1.00 168.07 ? 29  U   D OP2   1 
ATOM   8606 O  "O5'" . U   D 2 29  ? -17.527 -17.299 -12.296 1.00 171.55 ? 29  U   D "O5'" 1 
ATOM   8607 C  "C5'" . U   D 2 29  ? -17.787 -16.387 -13.345 1.00 155.00 ? 29  U   D "C5'" 1 
ATOM   8608 C  "C4'" . U   D 2 29  ? -19.207 -15.862 -13.254 1.00 153.97 ? 29  U   D "C4'" 1 
ATOM   8609 O  "O4'" . U   D 2 29  ? -19.269 -14.699 -12.392 1.00 153.65 ? 29  U   D "O4'" 1 
ATOM   8610 C  "C3'" . U   D 2 29  ? -19.755 -15.390 -14.586 1.00 141.33 ? 29  U   D "C3'" 1 
ATOM   8611 O  "O3'" . U   D 2 29  ? -20.498 -16.439 -15.159 1.00 143.18 ? 29  U   D "O3'" 1 
ATOM   8612 C  "C2'" . U   D 2 29  ? -20.636 -14.206 -14.216 1.00 140.71 ? 29  U   D "C2'" 1 
ATOM   8613 O  "O2'" . U   D 2 29  ? -21.908 -14.597 -13.742 1.00 151.13 ? 29  U   D "O2'" 1 
ATOM   8614 C  "C1'" . U   D 2 29  ? -19.818 -13.592 -13.087 1.00 143.21 ? 29  U   D "C1'" 1 
ATOM   8615 N  N1    . U   D 2 29  ? -18.698 -12.657 -13.507 1.00 132.33 ? 29  U   D N1    1 
ATOM   8616 C  C2    . U   D 2 29  ? -18.926 -11.586 -14.367 1.00 121.51 ? 29  U   D C2    1 
ATOM   8617 O  O2    . U   D 2 29  ? -20.009 -11.310 -14.859 1.00 119.76 ? 29  U   D O2    1 
ATOM   8618 N  N3    . U   D 2 29  ? -17.806 -10.830 -14.646 1.00 113.99 ? 29  U   D N3    1 
ATOM   8619 C  C4    . U   D 2 29  ? -16.515 -11.018 -14.166 1.00 116.13 ? 29  U   D C4    1 
ATOM   8620 O  O4    . U   D 2 29  ? -15.610 -10.258 -14.494 1.00 109.93 ? 29  U   D O4    1 
ATOM   8621 C  C5    . U   D 2 29  ? -16.357 -12.144 -13.282 1.00 127.36 ? 29  U   D C5    1 
ATOM   8622 C  C6    . U   D 2 29  ? -17.428 -12.893 -12.995 1.00 134.81 ? 29  U   D C6    1 
ATOM   8623 P  P     . C   D 2 30  ? -19.969 -17.077 -16.520 1.00 133.04 ? 30  C   D P     1 
ATOM   8624 O  OP1   . C   D 2 30  ? -20.648 -18.381 -16.674 1.00 141.72 ? 30  C   D OP1   1 
ATOM   8625 O  OP2   . C   D 2 30  ? -18.491 -16.994 -16.528 1.00 128.25 ? 30  C   D OP2   1 
ATOM   8626 O  "O5'" . C   D 2 30  ? -20.503 -16.049 -17.627 1.00 120.78 ? 30  C   D "O5'" 1 
ATOM   8627 C  "C5'" . C   D 2 30  ? -21.865 -15.603 -17.628 1.00 120.91 ? 30  C   D "C5'" 1 
ATOM   8628 C  "C4'" . C   D 2 30  ? -22.007 -14.331 -18.435 1.00 108.50 ? 30  C   D "C4'" 1 
ATOM   8629 O  "O4'" . C   D 2 30  ? -21.401 -13.243 -17.698 1.00 105.08 ? 30  C   D "O4'" 1 
ATOM   8630 C  "C3'" . C   D 2 30  ? -21.261 -14.362 -19.759 1.00 97.39  ? 30  C   D "C3'" 1 
ATOM   8631 O  "O3'" . C   D 2 30  ? -22.079 -14.944 -20.761 1.00 95.41  ? 30  C   D "O3'" 1 
ATOM   8632 C  "C2'" . C   D 2 30  ? -20.939 -12.888 -19.999 1.00 90.16  ? 30  C   D "C2'" 1 
ATOM   8633 O  "O2'" . C   D 2 30  ? -21.992 -12.118 -20.550 1.00 89.26  ? 30  C   D "O2'" 1 
ATOM   8634 C  "C1'" . C   D 2 30  ? -20.653 -12.414 -18.576 1.00 94.57  ? 30  C   D "C1'" 1 
ATOM   8635 N  N1    . C   D 2 30  ? -19.182 -12.418 -18.222 1.00 92.16  ? 30  C   D N1    1 
ATOM   8636 C  C2    . C   D 2 30  ? -18.322 -11.477 -18.822 1.00 83.34  ? 30  C   D C2    1 
ATOM   8637 O  O2    . C   D 2 30  ? -18.784 -10.665 -19.629 1.00 78.43  ? 30  C   D O2    1 
ATOM   8638 N  N3    . C   D 2 30  ? -17.000 -11.480 -18.502 1.00 82.28  ? 30  C   D N3    1 
ATOM   8639 C  C4    . C   D 2 30  ? -16.535 -12.378 -17.621 1.00 90.05  ? 30  C   D C4    1 
ATOM   8640 N  N4    . C   D 2 30  ? -15.228 -12.354 -17.332 1.00 90.31  ? 30  C   D N4    1 
ATOM   8641 C  C5    . C   D 2 30  ? -17.387 -13.349 -16.995 1.00 98.85  ? 30  C   D C5    1 
ATOM   8642 C  C6    . C   D 2 30  ? -18.688 -13.333 -17.323 1.00 99.63  ? 30  C   D C6    1 
ATOM   8643 P  P     . C   D 2 31  ? -21.443 -15.794 -21.960 1.00 88.60  ? 31  C   D P     1 
ATOM   8644 O  OP1   . C   D 2 31  ? -22.532 -16.595 -22.544 1.00 93.96  ? 31  C   D OP1   1 
ATOM   8645 O  OP2   . C   D 2 31  ? -20.218 -16.474 -21.490 1.00 88.74  ? 31  C   D OP2   1 
ATOM   8646 O  "O5'" . C   D 2 31  ? -21.040 -14.669 -23.016 1.00 78.16  ? 31  C   D "O5'" 1 
ATOM   8647 C  "C5'" . C   D 2 31  ? -22.069 -13.799 -23.448 1.00 77.09  ? 31  C   D "C5'" 1 
ATOM   8648 C  "C4'" . C   D 2 31  ? -21.528 -12.556 -24.115 1.00 69.51  ? 31  C   D "C4'" 1 
ATOM   8649 O  "O4'" . C   D 2 31  ? -20.831 -11.694 -23.175 1.00 66.90  ? 31  C   D "O4'" 1 
ATOM   8650 C  "C3'" . C   D 2 31  ? -20.538 -12.830 -25.236 1.00 63.11  ? 31  C   D "C3'" 1 
ATOM   8651 O  "O3'" . C   D 2 31  ? -21.276 -13.147 -26.401 1.00 62.64  ? 31  C   D "O3'" 1 
ATOM   8652 C  "C2'" . C   D 2 31  ? -19.839 -11.479 -25.327 1.00 58.33  ? 31  C   D "C2'" 1 
ATOM   8653 O  "O2'" . C   D 2 31  ? -20.576 -10.528 -26.076 1.00 57.87  ? 31  C   D "O2'" 1 
ATOM   8654 C  "C1'" . C   D 2 31  ? -19.760 -11.073 -23.853 1.00 60.55  ? 31  C   D "C1'" 1 
ATOM   8655 N  N1    . C   D 2 31  ? -18.482 -11.488 -23.199 1.00 60.79  ? 31  C   D N1    1 
ATOM   8656 C  C2    . C   D 2 31  ? -17.378 -10.612 -23.193 1.00 57.76  ? 31  C   D C2    1 
ATOM   8657 O  O2    . C   D 2 31  ? -17.466 -9.489  -23.728 1.00 54.60  ? 31  C   D O2    1 
ATOM   8658 N  N3    . C   D 2 31  ? -16.226 -11.022 -22.590 1.00 57.79  ? 31  C   D N3    1 
ATOM   8659 C  C4    . C   D 2 31  ? -16.161 -12.218 -22.025 1.00 61.28  ? 31  C   D C4    1 
ATOM   8660 N  N4    . C   D 2 31  ? -15.022 -12.559 -21.447 1.00 64.06  ? 31  C   D N4    1 
ATOM   8661 C  C5    . C   D 2 31  ? -17.257 -13.118 -22.019 1.00 66.53  ? 31  C   D C5    1 
ATOM   8662 C  C6    . C   D 2 31  ? -18.384 -12.719 -22.610 1.00 65.59  ? 31  C   D C6    1 
ATOM   8663 P  P     . A   D 2 32  ? -20.745 -14.192 -27.474 1.00 59.80  ? 32  A   D P     1 
ATOM   8664 O  OP1   . A   D 2 32  ? -21.855 -14.451 -28.411 1.00 63.07  ? 32  A   D OP1   1 
ATOM   8665 O  OP2   . A   D 2 32  ? -20.112 -15.318 -26.748 1.00 61.33  ? 32  A   D OP2   1 
ATOM   8666 O  "O5'" . A   D 2 32  ? -19.603 -13.364 -28.236 1.00 53.89  ? 32  A   D "O5'" 1 
ATOM   8667 C  "C5'" . A   D 2 32  ? -19.924 -12.184 -28.989 1.00 53.00  ? 32  A   D "C5'" 1 
ATOM   8668 C  "C4'" . A   D 2 32  ? -18.729 -11.308 -29.362 1.00 48.45  ? 32  A   D "C4'" 1 
ATOM   8669 O  "O4'" . A   D 2 32  ? -18.078 -10.732 -28.196 1.00 46.24  ? 32  A   D "O4'" 1 
ATOM   8670 C  "C3'" . A   D 2 32  ? -17.576 -12.014 -30.049 1.00 47.16  ? 32  A   D "C3'" 1 
ATOM   8671 O  "O3'" . A   D 2 32  ? -17.891 -12.350 -31.392 1.00 49.60  ? 32  A   D "O3'" 1 
ATOM   8672 C  "C2'" . A   D 2 32  ? -16.509 -10.940 -29.918 1.00 44.38  ? 32  A   D "C2'" 1 
ATOM   8673 O  "O2'" . A   D 2 32  ? -16.834 -9.821  -30.711 1.00 44.72  ? 32  A   D "O2'" 1 
ATOM   8674 C  "C1'" . A   D 2 32  ? -16.684 -10.582 -28.447 1.00 43.81  ? 32  A   D "C1'" 1 
ATOM   8675 N  N9    . A   D 2 32  ? -15.874 -11.276 -27.421 1.00 43.91  ? 32  A   D N9    1 
ATOM   8676 C  C8    . A   D 2 32  ? -16.130 -12.475 -26.792 1.00 47.04  ? 32  A   D C8    1 
ATOM   8677 N  N7    . A   D 2 32  ? -15.239 -12.846 -25.893 1.00 48.17  ? 32  A   D N7    1 
ATOM   8678 C  C5    . A   D 2 32  ? -14.318 -11.801 -25.916 1.00 46.51  ? 32  A   D C5    1 
ATOM   8679 C  C6    . A   D 2 32  ? -13.111 -11.550 -25.196 1.00 47.35  ? 32  A   D C6    1 
ATOM   8680 N  N6    . A   D 2 32  ? -12.611 -12.386 -24.278 1.00 51.07  ? 32  A   D N6    1 
ATOM   8681 N  N1    . A   D 2 32  ? -12.422 -10.406 -25.445 1.00 45.44  ? 32  A   D N1    1 
ATOM   8682 C  C2    . A   D 2 32  ? -12.909 -9.575  -26.375 1.00 43.34  ? 32  A   D C2    1 
ATOM   8683 N  N3    . A   D 2 32  ? -14.024 -9.699  -27.112 1.00 42.42  ? 32  A   D N3    1 
ATOM   8684 C  C4    . A   D 2 32  ? -14.699 -10.833 -26.843 1.00 43.57  ? 32  A   D C4    1 
ATOM   8685 P  P     . C   D 2 33  ? -17.621 -13.857 -31.875 1.00 51.22  ? 33  C   D P     1 
ATOM   8686 O  OP1   . C   D 2 33  ? -18.458 -14.116 -33.070 1.00 54.20  ? 33  C   D OP1   1 
ATOM   8687 O  OP2   . C   D 2 33  ? -17.759 -14.747 -30.699 1.00 51.52  ? 33  C   D OP2   1 
ATOM   8688 O  "O5'" . C   D 2 33  ? -16.064 -13.842 -32.266 1.00 48.96  ? 33  C   D "O5'" 1 
ATOM   8689 C  "C5'" . C   D 2 33  ? -15.478 -12.910 -33.175 1.00 50.19  ? 33  C   D "C5'" 1 
ATOM   8690 C  "C4'" . C   D 2 33  ? -13.974 -12.845 -32.972 1.00 50.38  ? 33  C   D "C4'" 1 
ATOM   8691 O  "O4'" . C   D 2 33  ? -13.664 -12.496 -31.603 1.00 48.88  ? 33  C   D "O4'" 1 
ATOM   8692 C  "C3'" . C   D 2 33  ? -13.248 -14.169 -33.104 1.00 51.90  ? 33  C   D "C3'" 1 
ATOM   8693 O  "O3'" . C   D 2 33  ? -13.062 -14.471 -34.455 1.00 55.02  ? 33  C   D "O3'" 1 
ATOM   8694 C  "C2'" . C   D 2 33  ? -11.937 -13.910 -32.372 1.00 52.00  ? 33  C   D "C2'" 1 
ATOM   8695 O  "O2'" . C   D 2 33  ? -10.992 -13.186 -33.133 1.00 55.04  ? 33  C   D "O2'" 1 
ATOM   8696 C  "C1'" . C   D 2 33  ? -12.427 -13.067 -31.205 1.00 49.80  ? 33  C   D "C1'" 1 
ATOM   8697 N  N1    . C   D 2 33  ? -12.651 -13.884 -29.988 1.00 50.10  ? 33  C   D N1    1 
ATOM   8698 C  C2    . C   D 2 33  ? -11.561 -14.351 -29.225 1.00 52.43  ? 33  C   D C2    1 
ATOM   8699 O  O2    . C   D 2 33  ? -10.396 -14.080 -29.549 1.00 53.42  ? 33  C   D O2    1 
ATOM   8700 N  N3    . C   D 2 33  ? -11.830 -15.101 -28.123 1.00 54.36  ? 33  C   D N3    1 
ATOM   8701 C  C4    . C   D 2 33  ? -13.097 -15.374 -27.781 1.00 53.73  ? 33  C   D C4    1 
ATOM   8702 N  N4    . C   D 2 33  ? -13.301 -16.106 -26.691 1.00 57.36  ? 33  C   D N4    1 
ATOM   8703 C  C5    . C   D 2 33  ? -14.215 -14.915 -28.532 1.00 51.37  ? 33  C   D C5    1 
ATOM   8704 C  C6    . C   D 2 33  ? -13.940 -14.182 -29.615 1.00 49.88  ? 33  C   D C6    1 
ATOM   8705 P  P     . C   D 2 34  ? -13.777 -15.770 -35.031 1.00 56.51  ? 34  C   D P     1 
ATOM   8706 O  OP1   . C   D 2 34  ? -13.600 -15.694 -36.500 1.00 59.69  ? 34  C   D OP1   1 
ATOM   8707 O  OP2   . C   D 2 34  ? -15.124 -15.912 -34.439 1.00 56.02  ? 34  C   D OP2   1 
ATOM   8708 O  "O5'" . C   D 2 34  ? -12.895 -16.950 -34.410 1.00 57.90  ? 34  C   D "O5'" 1 
ATOM   8709 C  "C5'" . C   D 2 34  ? -12.520 -18.091 -35.178 1.00 60.92  ? 34  C   D "C5'" 1 
ATOM   8710 C  "C4'" . C   D 2 34  ? -13.352 -19.302 -34.808 1.00 62.44  ? 34  C   D "C4'" 1 
ATOM   8711 O  "O4'" . C   D 2 34  ? -13.685 -19.247 -33.403 1.00 62.30  ? 34  C   D "O4'" 1 
ATOM   8712 C  "C3'" . C   D 2 34  ? -14.703 -19.407 -35.500 1.00 63.72  ? 34  C   D "C3'" 1 
ATOM   8713 O  "O3'" . C   D 2 34  ? -14.548 -20.008 -36.791 1.00 66.00  ? 34  C   D "O3'" 1 
ATOM   8714 C  "C2'" . C   D 2 34  ? -15.499 -20.278 -34.523 1.00 64.94  ? 34  C   D "C2'" 1 
ATOM   8715 O  "O2'" . C   D 2 34  ? -15.432 -21.653 -34.806 1.00 67.49  ? 34  C   D "O2'" 1 
ATOM   8716 C  "C1'" . C   D 2 34  ? -14.805 -20.081 -33.180 1.00 64.43  ? 34  C   D "C1'" 1 
ATOM   8717 N  N1    . C   D 2 34  ? -15.710 -19.493 -32.139 1.00 64.97  ? 34  C   D N1    1 
ATOM   8718 C  C2    . C   D 2 34  ? -16.578 -20.336 -31.409 1.00 68.73  ? 34  C   D C2    1 
ATOM   8719 O  O2    . C   D 2 34  ? -16.578 -21.556 -31.625 1.00 70.82  ? 34  C   D O2    1 
ATOM   8720 N  N3    . C   D 2 34  ? -17.396 -19.772 -30.473 1.00 70.18  ? 34  C   D N3    1 
ATOM   8721 C  C4    . C   D 2 34  ? -17.368 -18.441 -30.265 1.00 66.96  ? 34  C   D C4    1 
ATOM   8722 N  N4    . C   D 2 34  ? -18.182 -17.921 -29.339 1.00 68.34  ? 34  C   D N4    1 
ATOM   8723 C  C5    . C   D 2 34  ? -16.498 -17.575 -30.999 1.00 62.74  ? 34  C   D C5    1 
ATOM   8724 C  C6    . C   D 2 34  ? -15.698 -18.137 -31.915 1.00 62.44  ? 34  C   D C6    1 
HETATM 8725 P  PG    . ATP E 3 .   ? -45.666 55.216  7.514   1.00 27.00  ? 501 ATP A PG    1 
HETATM 8726 O  O1G   . ATP E 3 .   ? -44.424 55.488  8.329   1.00 27.83  ? 501 ATP A O1G   1 
HETATM 8727 O  O2G   . ATP E 3 .   ? -45.330 54.439  6.262   1.00 27.23  ? 501 ATP A O2G   1 
HETATM 8728 O  O3G   . ATP E 3 .   ? -46.527 56.437  7.296   1.00 27.12  ? 501 ATP A O3G   1 
HETATM 8729 P  PB    . ATP E 3 .   ? -48.185 54.024  8.331   1.00 26.64  ? 501 ATP A PB    1 
HETATM 8730 O  O1B   . ATP E 3 .   ? -48.535 52.789  9.121   1.00 25.37  ? 501 ATP A O1B   1 
HETATM 8731 O  O2B   . ATP E 3 .   ? -48.835 55.321  8.717   1.00 27.02  ? 501 ATP A O2B   1 
HETATM 8732 O  O3B   . ATP E 3 .   ? -46.569 54.218  8.438   1.00 26.92  ? 501 ATP A O3B   1 
HETATM 8733 P  PA    . ATP E 3 .   ? -50.070 53.781  6.146   1.00 24.44  ? 501 ATP A PA    1 
HETATM 8734 O  O1A   . ATP E 3 .   ? -50.674 55.170  6.126   1.00 24.47  ? 501 ATP A O1A   1 
HETATM 8735 O  O2A   . ATP E 3 .   ? -50.056 52.969  4.878   1.00 22.47  ? 501 ATP A O2A   1 
HETATM 8736 O  O3A   . ATP E 3 .   ? -48.557 53.791  6.760   1.00 24.90  ? 501 ATP A O3A   1 
HETATM 8737 O  "O5'" . ATP E 3 .   ? -50.941 52.940  7.200   1.00 23.98  ? 501 ATP A "O5'" 1 
HETATM 8738 C  "C5'" . ATP E 3 .   ? -51.720 53.561  8.204   1.00 22.73  ? 501 ATP A "C5'" 1 
HETATM 8739 C  "C4'" . ATP E 3 .   ? -52.178 52.432  9.102   1.00 23.86  ? 501 ATP A "C4'" 1 
HETATM 8740 O  "O4'" . ATP E 3 .   ? -53.021 51.557  8.369   1.00 23.81  ? 501 ATP A "O4'" 1 
HETATM 8741 C  "C3'" . ATP E 3 .   ? -51.057 51.524  9.562   1.00 24.40  ? 501 ATP A "C3'" 1 
HETATM 8742 O  "O3'" . ATP E 3 .   ? -50.398 52.018  10.729  1.00 23.34  ? 501 ATP A "O3'" 1 
HETATM 8743 C  "C2'" . ATP E 3 .   ? -51.764 50.203  9.784   1.00 25.17  ? 501 ATP A "C2'" 1 
HETATM 8744 O  "O2'" . ATP E 3 .   ? -52.608 50.199  10.927  1.00 27.51  ? 501 ATP A "O2'" 1 
HETATM 8745 C  "C1'" . ATP E 3 .   ? -52.759 50.196  8.678   1.00 26.31  ? 501 ATP A "C1'" 1 
HETATM 8746 N  N9    . ATP E 3 .   ? -52.197 49.478  7.513   1.00 27.93  ? 501 ATP A N9    1 
HETATM 8747 C  C8    . ATP E 3 .   ? -51.939 49.997  6.299   1.00 28.36  ? 501 ATP A C8    1 
HETATM 8748 N  N7    . ATP E 3 .   ? -51.458 49.041  5.467   1.00 27.95  ? 501 ATP A N7    1 
HETATM 8749 C  C5    . ATP E 3 .   ? -51.406 47.897  6.147   1.00 26.57  ? 501 ATP A C5    1 
HETATM 8750 C  C6    . ATP E 3 .   ? -50.988 46.520  5.859   1.00 27.69  ? 501 ATP A C6    1 
HETATM 8751 N  N6    . ATP E 3 .   ? -50.522 46.170  4.626   1.00 28.01  ? 501 ATP A N6    1 
HETATM 8752 N  N1    . ATP E 3 .   ? -51.096 45.620  6.871   1.00 28.59  ? 501 ATP A N1    1 
HETATM 8753 C  C2    . ATP E 3 .   ? -51.570 45.929  8.099   1.00 28.20  ? 501 ATP A C2    1 
HETATM 8754 N  N3    . ATP E 3 .   ? -51.950 47.176  8.416   1.00 28.47  ? 501 ATP A N3    1 
HETATM 8755 C  C4    . ATP E 3 .   ? -51.890 48.178  7.497   1.00 27.75  ? 501 ATP A C4    1 
HETATM 8756 S  S     . SO4 F 4 .   ? -50.366 29.729  -14.687 1.00 86.66  ? 601 SO4 A S     1 
HETATM 8757 O  O1    . SO4 F 4 .   ? -51.423 28.760  -14.386 1.00 86.17  ? 601 SO4 A O1    1 
HETATM 8758 O  O2    . SO4 F 4 .   ? -50.598 30.335  -15.990 1.00 86.61  ? 601 SO4 A O2    1 
HETATM 8759 O  O3    . SO4 F 4 .   ? -50.392 30.807  -13.701 1.00 87.12  ? 601 SO4 A O3    1 
HETATM 8760 O  O4    . SO4 F 4 .   ? -49.068 29.054  -14.685 1.00 86.48  ? 601 SO4 A O4    1 
HETATM 8761 MN MN    . MN  G 5 .   ? -49.084 57.405  6.899   1.00 49.43  ? 701 MN  A MN    1 
HETATM 8762 P  PG    . ATP H 3 .   ? -20.972 -18.868 -41.230 1.00 70.59  ? 502 ATP B PG    1 
HETATM 8763 O  O1G   . ATP H 3 .   ? -21.835 -19.236 -42.406 1.00 71.76  ? 502 ATP B O1G   1 
HETATM 8764 O  O2G   . ATP H 3 .   ? -21.062 -17.392 -40.958 1.00 70.58  ? 502 ATP B O2G   1 
HETATM 8765 O  O3G   . ATP H 3 .   ? -19.581 -19.456 -41.287 1.00 70.66  ? 502 ATP B O3G   1 
HETATM 8766 P  PB    . ATP H 3 .   ? -20.782 -20.215 -38.700 1.00 73.10  ? 502 ATP B PB    1 
HETATM 8767 O  O1B   . ATP H 3 .   ? -21.688 -20.195 -37.481 1.00 71.91  ? 502 ATP B O1B   1 
HETATM 8768 O  O2B   . ATP H 3 .   ? -20.181 -21.517 -39.183 1.00 72.59  ? 502 ATP B O2B   1 
HETATM 8769 O  O3B   . ATP H 3 .   ? -21.635 -19.584 -39.937 1.00 71.48  ? 502 ATP B O3B   1 
HETATM 8770 P  PA    . ATP H 3 .   ? -18.255 -19.391 -37.439 1.00 73.30  ? 502 ATP B PA    1 
HETATM 8771 O  O1A   . ATP H 3 .   ? -17.184 -20.029 -38.297 1.00 73.36  ? 502 ATP B O1A   1 
HETATM 8772 O  O2A   . ATP H 3 .   ? -17.898 -18.105 -36.742 1.00 73.03  ? 502 ATP B O2A   1 
HETATM 8773 O  O3A   . ATP H 3 .   ? -19.553 -19.177 -38.410 1.00 73.55  ? 502 ATP B O3A   1 
HETATM 8774 O  "O5'" . ATP H 3 .   ? -18.749 -20.367 -36.256 1.00 73.13  ? 502 ATP B "O5'" 1 
HETATM 8775 C  "C5'" . ATP H 3 .   ? -18.402 -21.750 -36.284 1.00 73.86  ? 502 ATP B "C5'" 1 
HETATM 8776 C  "C4'" . ATP H 3 .   ? -19.218 -22.531 -35.271 1.00 74.11  ? 502 ATP B "C4'" 1 
HETATM 8777 O  "O4'" . ATP H 3 .   ? -18.818 -22.169 -33.949 1.00 74.47  ? 502 ATP B "O4'" 1 
HETATM 8778 C  "C3'" . ATP H 3 .   ? -20.705 -22.236 -35.366 1.00 74.44  ? 502 ATP B "C3'" 1 
HETATM 8779 O  "O3'" . ATP H 3 .   ? -21.375 -23.191 -36.185 1.00 74.10  ? 502 ATP B "O3'" 1 
HETATM 8780 C  "C2'" . ATP H 3 .   ? -21.192 -22.266 -33.932 1.00 74.98  ? 502 ATP B "C2'" 1 
HETATM 8781 O  "O2'" . ATP H 3 .   ? -21.663 -23.563 -33.544 1.00 75.10  ? 502 ATP B "O2'" 1 
HETATM 8782 C  "C1'" . ATP H 3 .   ? -19.957 -21.892 -33.127 1.00 75.39  ? 502 ATP B "C1'" 1 
HETATM 8783 N  N9    . ATP H 3 .   ? -20.004 -20.444 -32.768 1.00 75.76  ? 502 ATP B N9    1 
HETATM 8784 C  C8    . ATP H 3 .   ? -19.274 -19.453 -33.323 1.00 75.67  ? 502 ATP B C8    1 
HETATM 8785 N  N7    . ATP H 3 .   ? -19.559 -18.252 -32.762 1.00 75.39  ? 502 ATP B N7    1 
HETATM 8786 C  C5    . ATP H 3 .   ? -20.500 -18.464 -31.825 1.00 75.61  ? 502 ATP B C5    1 
HETATM 8787 C  C6    . ATP H 3 .   ? -21.259 -17.634 -30.853 1.00 75.80  ? 502 ATP B C6    1 
HETATM 8788 N  N6    . ATP H 3 .   ? -21.053 -16.295 -30.775 1.00 75.89  ? 502 ATP B N6    1 
HETATM 8789 N  N1    . ATP H 3 .   ? -22.161 -18.254 -30.047 1.00 75.83  ? 502 ATP B N1    1 
HETATM 8790 C  C2    . ATP H 3 .   ? -22.379 -19.586 -30.109 1.00 75.69  ? 502 ATP B C2    1 
HETATM 8791 N  N3    . ATP H 3 .   ? -21.728 -20.396 -30.968 1.00 75.92  ? 502 ATP B N3    1 
HETATM 8792 C  C4    . ATP H 3 .   ? -20.793 -19.908 -31.831 1.00 75.79  ? 502 ATP B C4    1 
HETATM 8793 S  S     . SO4 I 4 .   ? -18.718 4.769   -16.490 1.00 70.51  ? 603 SO4 B S     1 
HETATM 8794 O  O1    . SO4 I 4 .   ? -19.248 3.446   -16.144 1.00 70.99  ? 603 SO4 B O1    1 
HETATM 8795 O  O2    . SO4 I 4 .   ? -17.426 4.959   -15.841 1.00 70.85  ? 603 SO4 B O2    1 
HETATM 8796 O  O3    . SO4 I 4 .   ? -18.513 4.891   -17.928 1.00 69.92  ? 603 SO4 B O3    1 
HETATM 8797 O  O4    . SO4 I 4 .   ? -19.647 5.795   -16.025 1.00 70.71  ? 603 SO4 B O4    1 
HETATM 8798 C  C1    . EDO J 6 .   ? -22.879 47.995  -6.212  1.00 43.77  ? 801 EDO B C1    1 
HETATM 8799 O  O1    . EDO J 6 .   ? -22.318 46.686  -6.358  1.00 43.75  ? 801 EDO B O1    1 
HETATM 8800 C  C2    . EDO J 6 .   ? -24.338 47.867  -5.808  1.00 44.25  ? 801 EDO B C2    1 
HETATM 8801 O  O2    . EDO J 6 .   ? -24.468 47.963  -4.381  1.00 44.64  ? 801 EDO B O2    1 
HETATM 8802 O  O     . HOH K 7 .   ? -58.301 61.379  17.149  1.00 13.71  ? 442 HOH A O     1 
HETATM 8803 O  O     . HOH K 7 .   ? -70.837 65.475  5.694   1.00 12.19  ? 443 HOH A O     1 
HETATM 8804 O  O     . HOH K 7 .   ? -69.183 59.367  9.961   1.00 27.00  ? 444 HOH A O     1 
HETATM 8805 O  O     . HOH K 7 .   ? -55.330 46.446  25.269  1.00 26.53  ? 445 HOH A O     1 
HETATM 8806 O  O     . HOH K 7 .   ? -43.041 63.074  16.658  1.00 34.57  ? 446 HOH A O     1 
HETATM 8807 O  O     . HOH K 7 .   ? -56.892 51.410  -11.978 1.00 15.05  ? 447 HOH A O     1 
HETATM 8808 O  O     . HOH K 7 .   ? -34.027 41.954  -11.100 1.00 27.93  ? 448 HOH A O     1 
HETATM 8809 O  O     . HOH K 7 .   ? -50.056 53.993  -8.643  1.00 21.69  ? 449 HOH A O     1 
HETATM 8810 O  O     . HOH K 7 .   ? -71.955 56.063  17.041  1.00 27.90  ? 450 HOH A O     1 
HETATM 8811 O  O     . HOH K 7 .   ? -39.529 53.171  -9.273  1.00 34.29  ? 451 HOH A O     1 
HETATM 8812 O  O     . HOH K 7 .   ? -72.329 46.227  0.722   1.00 29.91  ? 452 HOH A O     1 
HETATM 8813 O  O     . HOH K 7 .   ? -48.204 44.071  26.570  1.00 12.34  ? 453 HOH A O     1 
HETATM 8814 O  O     . HOH K 7 .   ? -58.704 62.028  -9.020  1.00 35.17  ? 454 HOH A O     1 
HETATM 8815 O  O     . HOH K 7 .   ? -24.730 41.114  0.956   1.00 29.37  ? 455 HOH A O     1 
HETATM 8816 O  O     . HOH K 7 .   ? -62.484 42.466  3.362   1.00 27.78  ? 456 HOH A O     1 
HETATM 8817 O  O     . HOH K 7 .   ? -50.389 38.481  17.620  1.00 19.61  ? 457 HOH A O     1 
HETATM 8818 O  O     . HOH K 7 .   ? -35.842 35.670  -12.700 1.00 23.15  ? 458 HOH A O     1 
HETATM 8819 O  O     . HOH K 7 .   ? -42.922 34.668  -1.909  1.00 10.78  ? 459 HOH A O     1 
HETATM 8820 O  O     . HOH K 7 .   ? -49.105 51.987  -4.210  1.00 13.43  ? 460 HOH A O     1 
HETATM 8821 O  O     . HOH K 7 .   ? -42.111 33.196  3.522   1.00 19.74  ? 461 HOH A O     1 
HETATM 8822 O  O     . HOH K 7 .   ? -61.051 54.411  -9.067  1.00 18.21  ? 462 HOH A O     1 
HETATM 8823 O  O     . HOH K 7 .   ? -62.296 51.059  -8.834  1.00 9.85   ? 463 HOH A O     1 
HETATM 8824 O  O     . HOH K 7 .   ? -48.265 50.392  8.121   1.00 26.28  ? 464 HOH A O     1 
HETATM 8825 O  O     . HOH K 7 .   ? -49.991 30.637  12.999  1.00 37.50  ? 465 HOH A O     1 
HETATM 8826 O  O     . HOH K 7 .   ? -36.440 18.960  -25.021 1.00 16.13  ? 466 HOH A O     1 
HETATM 8827 O  O     . HOH K 7 .   ? -33.738 25.666  -20.733 1.00 21.23  ? 467 HOH A O     1 
HETATM 8828 O  O     . HOH K 7 .   ? -34.856 19.393  -27.040 1.00 22.95  ? 468 HOH A O     1 
HETATM 8829 O  O     . HOH K 7 .   ? -33.910 55.859  5.544   1.00 31.05  ? 469 HOH A O     1 
HETATM 8830 O  O     . HOH K 7 .   ? -33.659 36.049  -9.016  1.00 23.38  ? 470 HOH A O     1 
HETATM 8831 O  O     . HOH K 7 .   ? -57.542 46.737  19.914  1.00 30.46  ? 471 HOH A O     1 
HETATM 8832 O  O     . HOH K 7 .   ? -63.662 50.189  15.922  1.00 33.91  ? 472 HOH A O     1 
HETATM 8833 O  O     . HOH K 7 .   ? -58.726 68.707  -6.706  1.00 42.15  ? 473 HOH A O     1 
HETATM 8834 O  O     . HOH K 7 .   ? -45.927 70.045  -0.140  1.00 32.55  ? 474 HOH A O     1 
HETATM 8835 O  O     . HOH K 7 .   ? -16.706 35.550  -23.001 1.00 19.83  ? 475 HOH A O     1 
HETATM 8836 O  O     . HOH K 7 .   ? -64.379 50.396  14.136  1.00 60.84  ? 476 HOH A O     1 
HETATM 8837 O  O     . HOH K 7 .   ? -28.234 3.760   -22.394 1.00 40.87  ? 477 HOH A O     1 
HETATM 8838 O  O     . HOH K 7 .   ? -39.881 55.720  -21.313 1.00 36.04  ? 478 HOH A O     1 
HETATM 8839 O  O     . HOH L 7 .   ? -30.742 39.182  -4.372  1.00 12.33  ? 442 HOH B O     1 
HETATM 8840 O  O     . HOH L 7 .   ? -35.091 24.303  -2.083  1.00 26.85  ? 443 HOH B O     1 
HETATM 8841 O  O     . HOH L 7 .   ? -13.720 30.263  -24.781 1.00 27.38  ? 444 HOH B O     1 
HETATM 8842 O  O     . HOH L 7 .   ? -23.956 -20.876 -38.528 1.00 31.62  ? 445 HOH B O     1 
HETATM 8843 O  O     . HOH L 7 .   ? -19.299 24.222  -16.427 1.00 14.33  ? 446 HOH B O     1 
HETATM 8844 O  O     . HOH L 7 .   ? -27.865 -3.462  -25.841 1.00 30.61  ? 447 HOH B O     1 
HETATM 8845 O  O     . HOH L 7 .   ? -17.086 25.268  -17.715 1.00 26.77  ? 448 HOH B O     1 
HETATM 8846 O  O     . HOH L 7 .   ? -49.849 -12.795 -41.704 1.00 41.69  ? 449 HOH B O     1 
HETATM 8847 O  O     . HOH M 7 .   ? -48.771 41.961  4.166   1.00 17.76  ? 35  HOH C O     1 
HETATM 8848 O  O     . HOH M 7 .   ? -53.501 36.304  6.073   1.00 32.48  ? 36  HOH C O     1 
HETATM 8849 O  O     . HOH M 7 .   ? -54.114 32.959  -24.479 1.00 22.89  ? 45  HOH C O     1 
HETATM 8850 O  O     . HOH M 7 .   ? -58.704 38.363  -10.075 1.00 32.86  ? 47  HOH C O     1 
HETATM 8851 O  O     . HOH M 7 .   ? -59.785 44.246  -7.034  1.00 51.79  ? 48  HOH C O     1 
HETATM 8852 O  O     . HOH M 7 .   ? -56.606 43.013  1.304   1.00 17.50  ? 49  HOH C O     1 
HETATM 8853 O  O     . HOH N 7 .   ? -16.849 -15.638 -24.205 1.00 47.41  ? 46  HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 1.0594 1.6844 1.4806 -0.1602 -0.1210 -0.0812 1   MET A N     
2    C CA    . MET A 1   ? 1.0964 1.7067 1.4826 -0.1800 -0.1469 -0.1004 1   MET A CA    
3    C C     . MET A 1   ? 1.0599 1.6485 1.3925 -0.1511 -0.1624 -0.0944 1   MET A C     
4    O O     . MET A 1   ? 1.0061 1.5730 1.3219 -0.1206 -0.1488 -0.0780 1   MET A O     
5    C CB    . MET A 1   ? 1.0994 1.6440 1.4545 -0.2065 -0.1303 -0.1157 1   MET A CB    
6    C CG    . MET A 1   ? 1.1335 1.6817 1.5333 -0.2332 -0.1068 -0.1181 1   MET A CG    
7    S SD    . MET A 1   ? 1.1682 1.6392 1.5307 -0.2665 -0.0921 -0.1379 1   MET A SD    
8    C CE    . MET A 1   ? 1.2670 1.7759 1.6472 -0.3056 -0.1262 -0.1651 1   MET A CE    
9    N N     . LYS A 2   ? 1.0949 1.6881 1.3996 -0.1617 -0.1901 -0.1079 2   LYS A N     
10   C CA    . LYS A 2   ? 1.0677 1.6294 1.3129 -0.1391 -0.2014 -0.1038 2   LYS A CA    
11   C C     . LYS A 2   ? 1.0028 1.4863 1.1995 -0.1328 -0.1761 -0.1031 2   LYS A C     
12   O O     . LYS A 2   ? 1.0012 1.4481 1.1936 -0.1543 -0.1592 -0.1146 2   LYS A O     
13   C CB    . LYS A 2   ? 1.1374 1.7115 1.3550 -0.1559 -0.2325 -0.1215 2   LYS A CB    
14   C CG    . LYS A 2   ? 1.1642 1.7824 1.3732 -0.1318 -0.2613 -0.1101 2   LYS A CG    
15   C CD    . LYS A 2   ? 1.1755 1.8719 1.4513 -0.1206 -0.2717 -0.0959 2   LYS A CD    
16   C CE    . LYS A 2   ? 1.2406 1.9955 1.5681 -0.1553 -0.2894 -0.1130 2   LYS A CE    
17   N NZ    . LYS A 2   ? 1.2338 2.0537 1.6386 -0.1496 -0.2832 -0.0993 2   LYS A NZ    
18   N N     . VAL A 3   ? 0.9522 1.4111 1.1140 -0.1033 -0.1737 -0.0889 3   VAL A N     
19   C CA    . VAL A 3   ? 0.8846 1.2770 1.0052 -0.0945 -0.1515 -0.0858 3   VAL A CA    
20   C C     . VAL A 3   ? 0.8959 1.2430 0.9756 -0.1149 -0.1501 -0.1041 3   VAL A C     
21   O O     . VAL A 3   ? 0.8624 1.1624 0.9272 -0.1189 -0.1284 -0.1062 3   VAL A O     
22   C CB    . VAL A 3   ? 0.8527 1.2289 0.9426 -0.0628 -0.1527 -0.0689 3   VAL A CB    
23   C CG1   . VAL A 3   ? 0.7894 1.1190 0.8668 -0.0507 -0.1267 -0.0603 3   VAL A CG1   
24   C CG2   . VAL A 3   ? 0.8765 1.3051 0.9960 -0.0418 -0.1668 -0.0540 3   VAL A CG2   
25   N N     . GLU A 4   ? 0.9465 1.3080 1.0067 -0.1263 -0.1734 -0.1171 4   GLU A N     
26   C CA    . GLU A 4   ? 0.9704 1.2885 0.9878 -0.1443 -0.1725 -0.1365 4   GLU A CA    
27   C C     . GLU A 4   ? 0.9741 1.2720 1.0108 -0.1733 -0.1578 -0.1522 4   GLU A C     
28   O O     . GLU A 4   ? 0.9706 1.2139 0.9755 -0.1798 -0.1418 -0.1610 4   GLU A O     
29   C CB    . GLU A 4   ? 1.0530 1.3955 1.0459 -0.1522 -0.2023 -0.1493 4   GLU A CB    
30   C CG    . GLU A 4   ? 1.0768 1.4392 1.0455 -0.1241 -0.2188 -0.1331 4   GLU A CG    
31   C CD    . GLU A 4   ? 1.1960 1.6184 1.1748 -0.1305 -0.2536 -0.1392 4   GLU A CD    
32   O OE1   . GLU A 4   ? 1.2654 1.6821 1.1964 -0.1313 -0.2714 -0.1482 4   GLU A OE1   
33   O OE2   . GLU A 4   ? 1.2117 1.6895 1.2470 -0.1345 -0.2632 -0.1350 4   GLU A OE2   
34   N N     . GLU A 5   ? 0.9801 1.3217 1.0701 -0.1899 -0.1620 -0.1546 5   GLU A N     
35   C CA    . GLU A 5   ? 0.9923 1.3155 1.1047 -0.2194 -0.1466 -0.1678 5   GLU A CA    
36   C C     . GLU A 5   ? 0.9141 1.2036 1.0358 -0.2092 -0.1145 -0.1533 5   GLU A C     
37   O O     . GLU A 5   ? 0.9265 1.1716 1.0404 -0.2249 -0.0954 -0.1611 5   GLU A O     
38   C CB    . GLU A 5   ? 1.0476 1.4326 1.2183 -0.2428 -0.1606 -0.1742 5   GLU A CB    
39   C CG    . GLU A 5   ? 1.1252 1.5623 1.2975 -0.2487 -0.1970 -0.1841 5   GLU A CG    
40   C CD    . GLU A 5   ? 1.1926 1.7042 1.4347 -0.2659 -0.2105 -0.1845 5   GLU A CD    
41   O OE1   . GLU A 5   ? 1.1565 1.6935 1.4444 -0.2546 -0.1937 -0.1663 5   GLU A OE1   
42   O OE2   . GLU A 5   ? 1.2775 1.8235 1.5286 -0.2908 -0.2378 -0.2034 5   GLU A OE2   
43   N N     . ILE A 6   ? 0.8350 1.1444 0.9718 -0.1825 -0.1087 -0.1323 6   ILE A N     
44   C CA    . ILE A 6   ? 0.7628 1.0414 0.9014 -0.1692 -0.0808 -0.1181 6   ILE A CA    
45   C C     . ILE A 6   ? 0.7268 0.9413 0.8141 -0.1614 -0.0685 -0.1198 6   ILE A C     
46   O O     . ILE A 6   ? 0.7117 0.8890 0.7945 -0.1634 -0.0461 -0.1167 6   ILE A O     
47   C CB    . ILE A 6   ? 0.7137 1.0204 0.8678 -0.1396 -0.0795 -0.0979 6   ILE A CB    
48   C CG1   . ILE A 6   ? 0.7380 1.1105 0.9487 -0.1433 -0.0871 -0.0935 6   ILE A CG1   
49   C CG2   . ILE A 6   ? 0.6653 0.9343 0.8096 -0.1248 -0.0529 -0.0855 6   ILE A CG2   
50   C CD1   . ILE A 6   ? 0.7483 1.1273 0.9978 -0.1515 -0.0625 -0.0874 6   ILE A CD1   
51   N N     . LEU A 7   ? 0.7167 0.9207 0.7661 -0.1515 -0.0826 -0.1233 7   LEU A N     
52   C CA    . LEU A 7   ? 0.6867 0.8367 0.6903 -0.1431 -0.0717 -0.1245 7   LEU A CA    
53   C C     . LEU A 7   ? 0.7395 0.8505 0.7235 -0.1653 -0.0649 -0.1434 7   LEU A C     
54   O O     . LEU A 7   ? 0.7229 0.7879 0.6875 -0.1612 -0.0456 -0.1417 7   LEU A O     
55   C CB    . LEU A 7   ? 0.6692 0.8219 0.6402 -0.1243 -0.0859 -0.1197 7   LEU A CB    
56   C CG    . LEU A 7   ? 0.5980 0.7677 0.5781 -0.0985 -0.0857 -0.0994 7   LEU A CG    
57   C CD1   . LEU A 7   ? 0.6019 0.7793 0.5545 -0.0834 -0.1013 -0.0942 7   LEU A CD1   
58   C CD2   . LEU A 7   ? 0.5256 0.6591 0.4974 -0.0866 -0.0644 -0.0894 7   LEU A CD2   
59   N N     . GLU A 8   ? 0.8081 0.9362 0.7968 -0.1885 -0.0809 -0.1617 8   GLU A N     
60   C CA    . GLU A 8   ? 0.8763 0.9628 0.8481 -0.2121 -0.0728 -0.1818 8   GLU A CA    
61   C C     . GLU A 8   ? 0.8669 0.9278 0.8633 -0.2225 -0.0476 -0.1775 8   GLU A C     
62   O O     . GLU A 8   ? 0.8812 0.8877 0.8533 -0.2245 -0.0290 -0.1819 8   GLU A O     
63   C CB    . GLU A 8   ? 0.9662 1.0781 0.9422 -0.2392 -0.0962 -0.2045 8   GLU A CB    
64   C CG    . GLU A 8   ? 1.0427 1.1449 0.9676 -0.2347 -0.1139 -0.2177 8   GLU A CG    
65   C CD    . GLU A 8   ? 1.1081 1.1413 0.9821 -0.2316 -0.0955 -0.2277 8   GLU A CD    
66   O OE1   . GLU A 8   ? 1.1014 1.0939 0.9794 -0.2299 -0.0696 -0.2223 8   GLU A OE1   
67   O OE2   . GLU A 8   ? 1.1671 1.1875 0.9959 -0.2291 -0.1062 -0.2402 8   GLU A OE2   
68   N N     . LYS A 9   ? 0.8463 0.9463 0.8899 -0.2271 -0.0456 -0.1674 9   LYS A N     
69   C CA    . LYS A 9   ? 0.8440 0.9236 0.9107 -0.2347 -0.0202 -0.1594 9   LYS A CA    
70   C C     . LYS A 9   ? 0.7790 0.8237 0.8243 -0.2076 0.0001  -0.1409 9   LYS A C     
71   O O     . LYS A 9   ? 0.7969 0.8022 0.8386 -0.2109 0.0225  -0.1367 9   LYS A O     
72   C CB    . LYS A 9   ? 0.8461 0.9807 0.9689 -0.2441 -0.0214 -0.1518 9   LYS A CB    
73   C CG    . LYS A 9   ? 0.9437 1.1028 1.0985 -0.2812 -0.0325 -0.1709 9   LYS A CG    
74   C CD    . LYS A 9   ? 0.9783 1.1671 1.1891 -0.2954 -0.0168 -0.1612 9   LYS A CD    
75   C CE    . LYS A 9   ? 0.9653 1.2350 1.2231 -0.2876 -0.0340 -0.1522 9   LYS A CE    
76   N NZ    . LYS A 9   ? 1.0503 1.3655 1.3300 -0.3135 -0.0641 -0.1720 9   LYS A NZ    
77   N N     . ALA A 10  ? 0.7125 0.7710 0.7432 -0.1813 -0.0081 -0.1297 10  ALA A N     
78   C CA    . ALA A 10  ? 0.6520 0.6821 0.6627 -0.1568 0.0070  -0.1138 10  ALA A CA    
79   C C     . ALA A 10  ? 0.6648 0.6424 0.6362 -0.1532 0.0160  -0.1194 10  ALA A C     
80   O O     . ALA A 10  ? 0.6405 0.5880 0.5997 -0.1395 0.0324  -0.1083 10  ALA A O     
81   C CB    . ALA A 10  ? 0.5945 0.6526 0.6024 -0.1329 -0.0048 -0.1019 10  ALA A CB    
82   N N     . LEU A 11  ? 0.7103 0.6785 0.6613 -0.1643 0.0051  -0.1367 11  LEU A N     
83   C CA    . LEU A 11  ? 0.7325 0.6519 0.6458 -0.1595 0.0150  -0.1434 11  LEU A CA    
84   C C     . LEU A 11  ? 0.7776 0.6516 0.6911 -0.1696 0.0375  -0.1454 11  LEU A C     
85   O O     . LEU A 11  ? 0.7753 0.6100 0.6657 -0.1554 0.0526  -0.1400 11  LEU A O     
86   C CB    . LEU A 11  ? 0.7847 0.7027 0.6713 -0.1689 -0.0008 -0.1630 11  LEU A CB    
87   C CG    . LEU A 11  ? 0.7445 0.6883 0.6124 -0.1514 -0.0175 -0.1581 11  LEU A CG    
88   C CD1   . LEU A 11  ? 0.8006 0.7496 0.6430 -0.1636 -0.0352 -0.1778 11  LEU A CD1   
89   C CD2   . LEU A 11  ? 0.6960 0.6150 0.5401 -0.1269 -0.0051 -0.1453 11  LEU A CD2   
90   N N     . GLU A 12  ? 0.8233 0.7034 0.7644 -0.1932 0.0409  -0.1513 12  GLU A N     
91   C CA    . GLU A 12  ? 0.8769 0.7116 0.8199 -0.2024 0.0650  -0.1494 12  GLU A CA    
92   C C     . GLU A 12  ? 0.8264 0.6525 0.7735 -0.1805 0.0825  -0.1248 12  GLU A C     
93   O O     . GLU A 12  ? 0.8625 0.6454 0.8017 -0.1793 0.1038  -0.1184 12  GLU A O     
94   C CB    . GLU A 12  ? 0.9457 0.7895 0.9207 -0.2357 0.0659  -0.1607 12  GLU A CB    
95   C CG    . GLU A 12  ? 1.0657 0.8735 1.0233 -0.2612 0.0641  -0.1869 12  GLU A CG    
96   C CD    . GLU A 12  ? 1.1210 0.9641 1.0714 -0.2717 0.0347  -0.2068 12  GLU A CD    
97   O OE1   . GLU A 12  ? 1.1396 1.0386 1.1255 -0.2852 0.0174  -0.2084 12  GLU A OE1   
98   O OE2   . GLU A 12  ? 1.1378 0.9544 1.0470 -0.2652 0.0294  -0.2199 12  GLU A OE2   
99   N N     . LEU A 13  ? 0.7544 0.6195 0.7112 -0.1626 0.0735  -0.1112 13  LEU A N     
100  C CA    . LEU A 13  ? 0.7109 0.5701 0.6666 -0.1415 0.0867  -0.0901 13  LEU A CA    
101  C C     . LEU A 13  ? 0.6766 0.5156 0.6025 -0.1169 0.0871  -0.0830 13  LEU A C     
102  O O     . LEU A 13  ? 0.6663 0.4904 0.5853 -0.1004 0.0988  -0.0675 13  LEU A O     
103  C CB    . LEU A 13  ? 0.6603 0.5675 0.6406 -0.1344 0.0791  -0.0796 13  LEU A CB    
104  C CG    . LEU A 13  ? 0.6880 0.6171 0.7030 -0.1491 0.0884  -0.0752 13  LEU A CG    
105  C CD1   . LEU A 13  ? 0.7629 0.6513 0.7788 -0.1641 0.1112  -0.0737 13  LEU A CD1   
106  C CD2   . LEU A 13  ? 0.7084 0.6820 0.7531 -0.1678 0.0713  -0.0879 13  LEU A CD2   
107  N N     . VAL A 14  ? 0.6696 0.5109 0.5783 -0.1139 0.0743  -0.0935 14  VAL A N     
108  C CA    . VAL A 14  ? 0.6254 0.4606 0.5134 -0.0905 0.0728  -0.0851 14  VAL A CA    
109  C C     . VAL A 14  ? 0.6635 0.4628 0.5247 -0.0872 0.0794  -0.0942 14  VAL A C     
110  O O     . VAL A 14  ? 0.6430 0.4356 0.4911 -0.0681 0.0823  -0.0859 14  VAL A O     
111  C CB    . VAL A 14  ? 0.5659 0.4418 0.4577 -0.0806 0.0541  -0.0814 14  VAL A CB    
112  C CG1   . VAL A 14  ? 0.5343 0.4432 0.4514 -0.0811 0.0495  -0.0732 14  VAL A CG1   
113  C CG2   . VAL A 14  ? 0.5841 0.4728 0.4665 -0.0897 0.0392  -0.0961 14  VAL A CG2   
114  N N     . ILE A 15  ? 0.7275 0.5042 0.5815 -0.1059 0.0825  -0.1116 15  ILE A N     
115  C CA    . ILE A 15  ? 0.7768 0.5151 0.6018 -0.1020 0.0911  -0.1222 15  ILE A CA    
116  C C     . ILE A 15  ? 0.8297 0.5180 0.6487 -0.0996 0.1144  -0.1184 15  ILE A C     
117  O O     . ILE A 15  ? 0.8808 0.5502 0.7095 -0.1187 0.1221  -0.1242 15  ILE A O     
118  C CB    . ILE A 15  ? 0.8358 0.5718 0.6467 -0.1226 0.0801  -0.1468 15  ILE A CB    
119  C CG1   . ILE A 15  ? 0.7968 0.5790 0.6072 -0.1202 0.0575  -0.1482 15  ILE A CG1   
120  C CG2   . ILE A 15  ? 0.8943 0.5825 0.6710 -0.1183 0.0931  -0.1597 15  ILE A CG2   
121  C CD1   . ILE A 15  ? 0.8651 0.6555 0.6652 -0.1422 0.0419  -0.1710 15  ILE A CD1   
122  N N     . PRO A 16  ? 0.6862 0.7992 0.9545 -0.0703 -0.1287 -0.0783 16  PRO A N     
123  C CA    . PRO A 16  ? 0.6978 0.7887 0.9912 -0.0865 -0.1173 -0.0720 16  PRO A CA    
124  C C     . PRO A 16  ? 0.7610 0.8445 1.0977 -0.1032 -0.1422 -0.0946 16  PRO A C     
125  O O     . PRO A 16  ? 0.7874 0.8650 1.1007 -0.0981 -0.1685 -0.1210 16  PRO A O     
126  C CB    . PRO A 16  ? 0.6647 0.7159 0.8920 -0.0763 -0.1088 -0.0745 16  PRO A CB    
127  C CG    . PRO A 16  ? 0.6419 0.6928 0.8116 -0.0574 -0.1197 -0.0856 16  PRO A CG    
128  C CD    . PRO A 16  ? 0.6404 0.7308 0.8355 -0.0520 -0.1225 -0.0785 16  PRO A CD    
129  N N     . ASP A 17  ? 0.7972 0.8822 1.1980 -0.1228 -0.1347 -0.0842 17  ASP A N     
130  C CA    . ASP A 17  ? 0.8700 0.9420 1.3179 -0.1406 -0.1589 -0.1083 17  ASP A CA    
131  C C     . ASP A 17  ? 0.8845 0.9060 1.3074 -0.1427 -0.1566 -0.1185 17  ASP A C     
132  O O     . ASP A 17  ? 0.8365 0.8384 1.2147 -0.1323 -0.1347 -0.1020 17  ASP A O     
133  C CB    . ASP A 17  ? 0.9173 1.0169 1.4601 -0.1630 -0.1540 -0.0927 17  ASP A CB    
134  C CG    . ASP A 17  ? 0.8899 0.9960 1.4513 -0.1666 -0.1162 -0.0510 17  ASP A CG    
135  O OD1   . ASP A 17  ? 0.8512 0.9264 1.3669 -0.1587 -0.0981 -0.0387 17  ASP A OD1   
136  O OD2   . ASP A 17  ? 0.9090 1.0547 1.5323 -0.1767 -0.1046 -0.0301 17  ASP A OD2   
137  N N     . GLU A 18  ? 0.9602 0.9617 1.4147 -0.1556 -0.1801 -0.1473 18  GLU A N     
138  C CA    . GLU A 18  ? 0.9909 0.9430 1.4208 -0.1547 -0.1815 -0.1646 18  GLU A CA    
139  C C     . GLU A 18  ? 0.9858 0.9125 1.4459 -0.1635 -0.1548 -0.1361 18  GLU A C     
140  O O     . GLU A 18  ? 0.9894 0.8770 1.4205 -0.1572 -0.1497 -0.1434 18  GLU A O     
141  C CB    . GLU A 18  ? 1.0823 1.0194 1.5349 -0.1638 -0.2162 -0.2090 18  GLU A CB    
142  C CG    . GLU A 18  ? 1.1044 1.0393 1.4798 -0.1441 -0.2377 -0.2416 18  GLU A CG    
143  C CD    . GLU A 18  ? 1.1226 1.0153 1.4339 -0.1295 -0.2280 -0.2534 18  GLU A CD    
144  O OE1   . GLU A 18  ? 1.0676 0.9492 1.3510 -0.1212 -0.1990 -0.2250 18  GLU A OE1   
145  O OE2   . GLU A 18  ? 1.1975 1.0707 1.4865 -0.1255 -0.2500 -0.2928 18  GLU A OE2   
146  N N     . GLU A 19  ? 0.9848 0.9363 1.5028 -0.1764 -0.1372 -0.1024 19  GLU A N     
147  C CA    . GLU A 19  ? 0.9744 0.9125 1.5087 -0.1799 -0.1069 -0.0642 19  GLU A CA    
148  C C     . GLU A 19  ? 0.8989 0.8274 1.3532 -0.1576 -0.0886 -0.0512 19  GLU A C     
149  O O     . GLU A 19  ? 0.8994 0.7933 1.3369 -0.1532 -0.0792 -0.0457 19  GLU A O     
150  C CB    . GLU A 19  ? 0.9782 0.9592 1.5672 -0.1908 -0.0877 -0.0272 19  GLU A CB    
151  C CG    . GLU A 19  ? 0.9863 0.9606 1.5889 -0.1930 -0.0555 0.0171  19  GLU A CG    
152  C CD    . GLU A 19  ? 1.0813 1.0230 1.7559 -0.2139 -0.0563 0.0239  19  GLU A CD    
153  O OE1   . GLU A 19  ? 1.0971 0.9920 1.7517 -0.2093 -0.0597 0.0135  19  GLU A OE1   
154  O OE2   . GLU A 19  ? 1.1268 1.0897 1.8818 -0.2347 -0.0535 0.0390  19  GLU A OE2   
155  N N     . GLU A 20  ? 0.8395 0.7993 1.2496 -0.1435 -0.0852 -0.0476 20  GLU A N     
156  C CA    . GLU A 20  ? 0.7684 0.7286 1.1119 -0.1243 -0.0673 -0.0328 20  GLU A CA    
157  C C     . GLU A 20  ? 0.7379 0.6688 1.0169 -0.1097 -0.0786 -0.0596 20  GLU A C     
158  O O     . GLU A 20  ? 0.7010 0.6154 0.9395 -0.0986 -0.0647 -0.0499 20  GLU A O     
159  C CB    . GLU A 20  ? 0.7248 0.7285 1.0556 -0.1158 -0.0606 -0.0214 20  GLU A CB    
160  C CG    . GLU A 20  ? 0.7079 0.7305 1.0287 -0.1093 -0.0314 0.0140  20  GLU A CG    
161  C CD    . GLU A 20  ? 0.6650 0.7170 0.9451 -0.0925 -0.0259 0.0151  20  GLU A CD    
162  O OE1   . GLU A 20  ? 0.6964 0.7694 0.9859 -0.0907 -0.0405 0.0000  20  GLU A OE1   
163  O OE2   . GLU A 20  ? 0.6474 0.7010 0.8880 -0.0804 -0.0084 0.0303  20  GLU A OE2   
164  N N     . VAL A 21  ? 0.7599 0.6878 1.0300 -0.1092 -0.1036 -0.0926 21  VAL A N     
165  C CA    . VAL A 21  ? 0.7513 0.6549 0.9606 -0.0952 -0.1133 -0.1180 21  VAL A CA    
166  C C     . VAL A 21  ? 0.7823 0.6454 0.9967 -0.0973 -0.1089 -0.1254 21  VAL A C     
167  O O     . VAL A 21  ? 0.7539 0.5996 0.9230 -0.0842 -0.0978 -0.1235 21  VAL A O     
168  C CB    . VAL A 21  ? 0.7959 0.7065 0.9954 -0.0940 -0.1428 -0.1523 21  VAL A CB    
169  C CG1   . VAL A 21  ? 0.7956 0.6860 0.9251 -0.0771 -0.1480 -0.1733 21  VAL A CG1   
170  C CG2   . VAL A 21  ? 0.7737 0.7251 0.9794 -0.0918 -0.1498 -0.1448 21  VAL A CG2   
171  N N     . ARG A 22  ? 0.8420 0.6906 1.1166 -0.1138 -0.1180 -0.1339 22  ARG A N     
172  C CA    . ARG A 22  ? 0.8826 0.6902 1.1746 -0.1163 -0.1139 -0.1397 22  ARG A CA    
173  C C     . ARG A 22  ? 0.8286 0.6290 1.1067 -0.1087 -0.0870 -0.1047 22  ARG A C     
174  O O     . ARG A 22  ? 0.8233 0.5981 1.0705 -0.0968 -0.0810 -0.1108 22  ARG A O     
175  C CB    . ARG A 22  ? 0.9643 0.7601 1.3391 -0.1384 -0.1230 -0.1425 22  ARG A CB    
176  C CG    . ARG A 22  ? 1.0600 0.8196 1.4491 -0.1418 -0.1449 -0.1857 22  ARG A CG    
177  C CD    . ARG A 22  ? 1.1759 0.9210 1.6564 -0.1657 -0.1522 -0.1846 22  ARG A CD    
178  N NE    . ARG A 22  ? 1.2379 1.0122 1.7604 -0.1814 -0.1751 -0.2011 22  ARG A NE    
179  C CZ    . ARG A 22  ? 1.2375 1.0464 1.8144 -0.1969 -0.1681 -0.1714 22  ARG A CZ    
180  N NH1   . ARG A 22  ? 1.2092 1.0283 1.7999 -0.1983 -0.1377 -0.1227 22  ARG A NH1   
181  N NH2   . ARG A 22  ? 1.2726 1.1093 1.8903 -0.2101 -0.1916 -0.1906 22  ARG A NH2   
182  N N     . LYS A 23  ? 0.7928 0.6194 1.0947 -0.1146 -0.0713 -0.0686 23  LYS A N     
183  C CA    . LYS A 23  ? 0.7525 0.5800 1.0437 -0.1079 -0.0473 -0.0322 23  LYS A CA    
184  C C     . LYS A 23  ? 0.6819 0.5122 0.9009 -0.0879 -0.0413 -0.0358 23  LYS A C     
185  O O     . LYS A 23  ? 0.6695 0.4888 0.8720 -0.0792 -0.0280 -0.0191 23  LYS A O     
186  C CB    . LYS A 23  ? 0.7421 0.6067 1.0630 -0.1160 -0.0331 0.0020  23  LYS A CB    
187  C CG    . LYS A 23  ? 0.7611 0.6245 1.1115 -0.1198 -0.0114 0.0439  23  LYS A CG    
188  C CD    . LYS A 23  ? 0.7493 0.6591 1.1097 -0.1223 0.0046  0.0737  23  LYS A CD    
189  C CE    . LYS A 23  ? 0.8200 0.7362 1.2313 -0.1329 0.0246  0.1167  23  LYS A CE    
190  N NZ    . LYS A 23  ? 0.8106 0.7246 1.1883 -0.1194 0.0433  0.1487  23  LYS A NZ    
191  N N     . GLY A 24  ? 0.6420 0.4874 0.8223 -0.0810 -0.0520 -0.0564 24  GLY A N     
192  C CA    . GLY A 24  ? 0.5786 0.4256 0.6965 -0.0642 -0.0472 -0.0607 24  GLY A CA    
193  C C     . GLY A 24  ? 0.5938 0.4119 0.6819 -0.0552 -0.0533 -0.0867 24  GLY A C     
194  O O     . GLY A 24  ? 0.5644 0.3748 0.6220 -0.0440 -0.0422 -0.0808 24  GLY A O     
195  N N     . ARG A 25  ? 0.6469 0.4519 0.7437 -0.0594 -0.0711 -0.1169 25  ARG A N     
196  C CA    . ARG A 25  ? 0.6835 0.4617 0.7534 -0.0498 -0.0760 -0.1450 25  ARG A CA    
197  C C     . ARG A 25  ? 0.6941 0.4452 0.7835 -0.0471 -0.0628 -0.1358 25  ARG A C     
198  O O     . ARG A 25  ? 0.6768 0.4193 0.7328 -0.0334 -0.0529 -0.1379 25  ARG A O     
199  C CB    . ARG A 25  ? 0.7620 0.5306 0.8454 -0.0559 -0.0996 -0.1814 25  ARG A CB    
200  C CG    . ARG A 25  ? 0.7834 0.5793 0.8451 -0.0557 -0.1171 -0.1939 25  ARG A CG    
201  C CD    . ARG A 25  ? 0.8128 0.6133 0.8033 -0.0376 -0.1169 -0.2055 25  ARG A CD    
202  N NE    . ARG A 25  ? 0.8389 0.6676 0.8075 -0.0350 -0.1307 -0.2070 25  ARG A NE    
203  C CZ    . ARG A 25  ? 0.7870 0.6385 0.7433 -0.0316 -0.1219 -0.1814 25  ARG A CZ    
204  N NH1   . ARG A 25  ? 0.7292 0.5811 0.6901 -0.0312 -0.1001 -0.1540 25  ARG A NH1   
205  N NH2   . ARG A 25  ? 0.7880 0.6623 0.7276 -0.0274 -0.1362 -0.1843 25  ARG A NH2   
206  N N     . GLU A 26  ? 0.7243 0.4629 0.8711 -0.0596 -0.0619 -0.1231 26  GLU A N     
207  C CA    . GLU A 26  ? 0.7479 0.4590 0.9175 -0.0557 -0.0507 -0.1117 26  GLU A CA    
208  C C     . GLU A 26  ? 0.6818 0.4076 0.8360 -0.0478 -0.0318 -0.0748 26  GLU A C     
209  O O     . GLU A 26  ? 0.6952 0.4031 0.8569 -0.0397 -0.0227 -0.0647 26  GLU A O     
210  C CB    . GLU A 26  ? 0.8209 0.5073 1.0598 -0.0709 -0.0562 -0.1100 26  GLU A CB    
211  C CG    . GLU A 26  ? 0.8338 0.5415 1.1169 -0.0896 -0.0584 -0.0894 26  GLU A CG    
212  C CD    . GLU A 26  ? 0.9271 0.6073 1.2856 -0.1071 -0.0662 -0.0929 26  GLU A CD    
213  O OE1   . GLU A 26  ? 1.0085 0.6531 1.3802 -0.1057 -0.0782 -0.1264 26  GLU A OE1   
214  O OE2   . GLU A 26  ? 0.9513 0.6457 1.3581 -0.1223 -0.0597 -0.0624 26  GLU A OE2   
215  N N     . ALA A 27  ? 0.6173 0.3765 0.7501 -0.0488 -0.0272 -0.0569 27  ALA A N     
216  C CA    . ALA A 27  ? 0.5526 0.3293 0.6596 -0.0392 -0.0126 -0.0299 27  ALA A CA    
217  C C     . ALA A 27  ? 0.5157 0.2924 0.5739 -0.0253 -0.0116 -0.0469 27  ALA A C     
218  O O     . ALA A 27  ? 0.4937 0.2716 0.5387 -0.0156 -0.0021 -0.0345 27  ALA A O     
219  C CB    . ALA A 27  ? 0.5098 0.3204 0.6119 -0.0438 -0.0082 -0.0096 27  ALA A CB    
220  N N     . GLU A 28  ? 0.5208 0.2983 0.5542 -0.0243 -0.0218 -0.0740 28  GLU A N     
221  C CA    . GLU A 28  ? 0.5065 0.2849 0.4934 -0.0118 -0.0193 -0.0890 28  GLU A CA    
222  C C     . GLU A 28  ? 0.5533 0.3065 0.5422 -0.0026 -0.0150 -0.1036 28  GLU A C     
223  O O     . GLU A 28  ? 0.5306 0.2869 0.4999 0.0083  -0.0041 -0.0983 28  GLU A O     
224  C CB    . GLU A 28  ? 0.5115 0.2983 0.4713 -0.0123 -0.0317 -0.1105 28  GLU A CB    
225  C CG    . GLU A 28  ? 0.5281 0.3102 0.4425 0.0003  -0.0305 -0.1303 28  GLU A CG    
226  C CD    . GLU A 28  ? 0.5483 0.3410 0.4342 0.0008  -0.0444 -0.1469 28  GLU A CD    
227  O OE1   . GLU A 28  ? 0.5717 0.3690 0.4804 -0.0087 -0.0594 -0.1537 28  GLU A OE1   
228  O OE2   . GLU A 28  ? 0.5563 0.3544 0.3988 0.0111  -0.0406 -0.1513 28  GLU A OE2   
229  N N     . GLU A 29  ? 0.6222 0.3512 0.6395 -0.0068 -0.0237 -0.1227 29  GLU A N     
230  C CA    . GLU A 29  ? 0.6813 0.3837 0.7060 0.0033  -0.0198 -0.1399 29  GLU A CA    
231  C C     . GLU A 29  ? 0.6623 0.3601 0.7090 0.0095  -0.0064 -0.1135 29  GLU A C     
232  O O     . GLU A 29  ? 0.6764 0.3678 0.7126 0.0233  0.0024  -0.1202 29  GLU A O     
233  C CB    . GLU A 29  ? 0.7716 0.4456 0.8317 -0.0038 -0.0333 -0.1658 29  GLU A CB    
234  C CG    . GLU A 29  ? 0.8716 0.5387 0.8990 0.0025  -0.0448 -0.2088 29  GLU A CG    
235  C CD    . GLU A 29  ? 0.9218 0.5922 0.9016 0.0220  -0.0319 -0.2208 29  GLU A CD    
236  O OE1   . GLU A 29  ? 0.9760 0.6258 0.9693 0.0330  -0.0231 -0.2300 29  GLU A OE1   
237  O OE2   . GLU A 29  ? 0.8993 0.5933 0.8313 0.0267  -0.0296 -0.2197 29  GLU A OE2   
238  N N     . GLU A 30  ? 0.6391 0.3428 0.7166 0.0005  -0.0046 -0.0825 30  GLU A N     
239  C CA    . GLU A 30  ? 0.6284 0.3298 0.7261 0.0073  0.0056  -0.0545 30  GLU A CA    
240  C C     . GLU A 30  ? 0.5714 0.2992 0.6333 0.0176  0.0140  -0.0427 30  GLU A C     
241  O O     . GLU A 30  ? 0.5780 0.3028 0.6438 0.0297  0.0208  -0.0375 30  GLU A O     
242  C CB    . GLU A 30  ? 0.6337 0.3390 0.7671 -0.0040 0.0065  -0.0212 30  GLU A CB    
243  C CG    . GLU A 30  ? 0.6391 0.3405 0.7942 0.0044  0.0151  0.0105  30  GLU A CG    
244  C CD    . GLU A 30  ? 0.6984 0.3653 0.8806 0.0149  0.0155  -0.0026 30  GLU A CD    
245  O OE1   . GLU A 30  ? 0.7451 0.3848 0.9426 0.0113  0.0086  -0.0336 30  GLU A OE1   
246  O OE2   . GLU A 30  ? 0.7005 0.3682 0.8893 0.0278  0.0217  0.0162  30  GLU A OE2   
247  N N     . LEU A 31  ? 0.5206 0.2740 0.5523 0.0126  0.0127  -0.0395 31  LEU A N     
248  C CA    . LEU A 31  ? 0.4670 0.2455 0.4688 0.0192  0.0187  -0.0293 31  LEU A CA    
249  C C     . LEU A 31  ? 0.4751 0.2492 0.4571 0.0304  0.0239  -0.0491 31  LEU A C     
250  O O     . LEU A 31  ? 0.4634 0.2474 0.4451 0.0392  0.0308  -0.0398 31  LEU A O     
251  C CB    . LEU A 31  ? 0.4253 0.2245 0.4029 0.0116  0.0148  -0.0290 31  LEU A CB    
252  C CG    . LEU A 31  ? 0.3805 0.2073 0.3385 0.0124  0.0178  -0.0124 31  LEU A CG    
253  C CD1   . LEU A 31  ? 0.3688 0.2061 0.3411 0.0161  0.0219  0.0130  31  LEU A CD1   
254  C CD2   . LEU A 31  ? 0.3667 0.2064 0.3201 0.0035  0.0129  -0.0114 31  LEU A CD2   
255  N N     . ARG A 32  ? 0.5039 0.2653 0.4709 0.0307  0.0205  -0.0762 32  ARG A N     
256  C CA    . ARG A 32  ? 0.5292 0.2861 0.4764 0.0427  0.0281  -0.0963 32  ARG A CA    
257  C C     . ARG A 32  ? 0.5628 0.3039 0.5371 0.0542  0.0352  -0.0997 32  ARG A C     
258  O O     . ARG A 32  ? 0.5599 0.3113 0.5273 0.0650  0.0461  -0.0997 32  ARG A O     
259  C CB    . ARG A 32  ? 0.5723 0.3198 0.4946 0.0423  0.0215  -0.1254 32  ARG A CB    
260  C CG    . ARG A 32  ? 0.5643 0.3317 0.4473 0.0398  0.0203  -0.1241 32  ARG A CG    
261  C CD    . ARG A 32  ? 0.6518 0.4128 0.5087 0.0401  0.0103  -0.1502 32  ARG A CD    
262  N NE    . ARG A 32  ? 0.6748 0.4542 0.4919 0.0417  0.0118  -0.1455 32  ARG A NE    
263  C CZ    . ARG A 32  ? 0.7182 0.5032 0.5157 0.0377  -0.0014 -0.1527 32  ARG A CZ    
264  N NH1   . ARG A 32  ? 0.7673 0.5433 0.5832 0.0304  -0.0177 -0.1671 32  ARG A NH1   
265  N NH2   . ARG A 32  ? 0.7183 0.5178 0.4819 0.0408  0.0011  -0.1444 32  ARG A NH2   
266  N N     . ARG A 33  ? 0.6012 0.3176 0.6109 0.0521  0.0297  -0.1018 33  ARG A N     
267  C CA    . ARG A 33  ? 0.6482 0.3461 0.6887 0.0648  0.0359  -0.1044 33  ARG A CA    
268  C C     . ARG A 33  ? 0.6039 0.3211 0.6575 0.0716  0.0428  -0.0745 33  ARG A C     
269  O O     . ARG A 33  ? 0.6274 0.3443 0.6941 0.0860  0.0511  -0.0770 33  ARG A O     
270  C CB    . ARG A 33  ? 0.7130 0.3779 0.7969 0.0597  0.0279  -0.1065 33  ARG A CB    
271  C CG    . ARG A 33  ? 0.7996 0.4394 0.8815 0.0571  0.0194  -0.1446 33  ARG A CG    
272  C CD    . ARG A 33  ? 0.9301 0.5328 1.0667 0.0537  0.0129  -0.1467 33  ARG A CD    
273  N NE    . ARG A 33  ? 1.0175 0.6038 1.1622 0.0396  -0.0021 -0.1710 33  ARG A NE    
274  C CZ    . ARG A 33  ? 1.0204 0.6149 1.1798 0.0207  -0.0109 -0.1543 33  ARG A CZ    
275  N NH1   . ARG A 33  ? 0.9547 0.5723 1.1177 0.0147  -0.0049 -0.1133 33  ARG A NH1   
276  N NH2   . ARG A 33  ? 1.0850 0.6668 1.2564 0.0085  -0.0262 -0.1801 33  ARG A NH2   
277  N N     . ARG A 34  ? 0.5464 0.2829 0.5969 0.0621  0.0386  -0.0478 34  ARG A N     
278  C CA    . ARG A 34  ? 0.5127 0.2702 0.5734 0.0678  0.0410  -0.0195 34  ARG A CA    
279  C C     . ARG A 34  ? 0.4720 0.2564 0.5087 0.0732  0.0470  -0.0239 34  ARG A C     
280  O O     . ARG A 34  ? 0.4802 0.2753 0.5332 0.0846  0.0516  -0.0171 34  ARG A O     
281  C CB    . ARG A 34  ? 0.4811 0.2524 0.5412 0.0570  0.0349  0.0075  34  ARG A CB    
282  C CG    . ARG A 34  ? 0.5106 0.2588 0.6047 0.0521  0.0317  0.0215  34  ARG A CG    
283  C CD    . ARG A 34  ? 0.4730 0.2403 0.5645 0.0436  0.0297  0.0510  34  ARG A CD    
284  N NE    . ARG A 34  ? 0.4939 0.2401 0.6227 0.0373  0.0292  0.0689  34  ARG A NE    
285  C CZ    . ARG A 34  ? 0.4751 0.2338 0.6078 0.0274  0.0299  0.0934  34  ARG A CZ    
286  N NH1   . ARG A 34  ? 0.4225 0.2141 0.5218 0.0243  0.0304  0.0990  34  ARG A NH1   
287  N NH2   . ARG A 34  ? 0.5346 0.2731 0.7074 0.0208  0.0313  0.1121  34  ARG A NH2   
288  N N     . LEU A 35  ? 0.4296 0.2251 0.4325 0.0648  0.0466  -0.0339 35  LEU A N     
289  C CA    . LEU A 35  ? 0.3952 0.2139 0.3770 0.0667  0.0527  -0.0367 35  LEU A CA    
290  C C     . LEU A 35  ? 0.4344 0.2499 0.4170 0.0784  0.0650  -0.0547 35  LEU A C     
291  O O     . LEU A 35  ? 0.4315 0.2672 0.4209 0.0843  0.0727  -0.0499 35  LEU A O     
292  C CB    . LEU A 35  ? 0.3569 0.1822 0.3052 0.0561  0.0495  -0.0420 35  LEU A CB    
293  C CG    . LEU A 35  ? 0.3071 0.1459 0.2502 0.0466  0.0409  -0.0252 35  LEU A CG    
294  C CD1   . LEU A 35  ? 0.2655 0.1021 0.1833 0.0381  0.0368  -0.0346 35  LEU A CD1   
295  C CD2   . LEU A 35  ? 0.2662 0.1300 0.2091 0.0481  0.0413  -0.0132 35  LEU A CD2   
296  N N     . ASP A 36  ? 0.4815 0.2737 0.4589 0.0821  0.0669  -0.0766 36  ASP A N     
297  C CA    . ASP A 36  ? 0.5305 0.3197 0.5073 0.0961  0.0803  -0.0957 36  ASP A CA    
298  C C     . ASP A 36  ? 0.5548 0.3461 0.5726 0.1090  0.0857  -0.0871 36  ASP A C     
299  O O     . ASP A 36  ? 0.5669 0.3769 0.5914 0.1189  0.0983  -0.0882 36  ASP A O     
300  C CB    . ASP A 36  ? 0.5893 0.3515 0.5533 0.0989  0.0782  -0.1245 36  ASP A CB    
301  C CG    . ASP A 36  ? 0.5793 0.3438 0.5016 0.0893  0.0724  -0.1344 36  ASP A CG    
302  O OD1   . ASP A 36  ? 0.5336 0.3202 0.4334 0.0845  0.0762  -0.1221 36  ASP A OD1   
303  O OD2   . ASP A 36  ? 0.6349 0.3788 0.5502 0.0867  0.0627  -0.1546 36  ASP A OD2   
304  N N     . GLU A 37  ? 0.5728 0.3461 0.6210 0.1092  0.0764  -0.0765 37  GLU A N     
305  C CA    . GLU A 37  ? 0.6022 0.3760 0.6916 0.1229  0.0789  -0.0644 37  GLU A CA    
306  C C     . GLU A 37  ? 0.5617 0.3734 0.6566 0.1246  0.0808  -0.0446 37  GLU A C     
307  O O     . GLU A 37  ? 0.5855 0.4101 0.7090 0.1386  0.0874  -0.0415 37  GLU A O     
308  C CB    . GLU A 37  ? 0.6194 0.3714 0.7367 0.1195  0.0672  -0.0461 37  GLU A CB    
309  C CG    . GLU A 37  ? 0.6581 0.4114 0.8175 0.1340  0.0670  -0.0266 37  GLU A CG    
310  C CD    . GLU A 37  ? 0.7103 0.4416 0.8958 0.1304  0.0571  -0.0032 37  GLU A CD    
311  O OE1   . GLU A 37  ? 0.7048 0.4213 0.8785 0.1150  0.0512  -0.0030 37  GLU A OE1   
312  O OE2   . GLU A 37  ? 0.7759 0.5060 0.9969 0.1435  0.0555  0.0170  37  GLU A OE2   
313  N N     . LEU A 38  ? 0.5114 0.3414 0.5811 0.1106  0.0744  -0.0336 38  LEU A N     
314  C CA    . LEU A 38  ? 0.4825 0.3475 0.5566 0.1091  0.0725  -0.0181 38  LEU A CA    
315  C C     . LEU A 38  ? 0.4820 0.3666 0.5443 0.1089  0.0856  -0.0301 38  LEU A C     
316  O O     . LEU A 38  ? 0.4661 0.3796 0.5381 0.1062  0.0844  -0.0204 38  LEU A O     
317  C CB    . LEU A 38  ? 0.4330 0.3069 0.4869 0.0953  0.0597  -0.0034 38  LEU A CB    
318  C CG    . LEU A 38  ? 0.4429 0.3213 0.5149 0.0980  0.0476  0.0210  38  LEU A CG    
319  C CD1   . LEU A 38  ? 0.4065 0.2855 0.4535 0.0852  0.0389  0.0310  38  LEU A CD1   
320  C CD2   . LEU A 38  ? 0.4478 0.3592 0.5392 0.1053  0.0431  0.0326  38  LEU A CD2   
321  N N     . GLY A 39  ? 0.5153 0.3850 0.5570 0.1113  0.0975  -0.0509 39  GLY A N     
322  C CA    . GLY A 39  ? 0.5256 0.4124 0.5524 0.1121  0.1137  -0.0598 39  GLY A CA    
323  C C     . GLY A 39  ? 0.4824 0.3907 0.4964 0.0985  0.1110  -0.0480 39  GLY A C     
324  O O     . GLY A 39  ? 0.4849 0.4180 0.5153 0.0993  0.1212  -0.0434 39  GLY A O     
325  N N     . VAL A 40  ? 0.4536 0.3529 0.4433 0.0860  0.0979  -0.0436 40  VAL A N     
326  C CA    . VAL A 40  ? 0.4243 0.3398 0.4036 0.0738  0.0941  -0.0347 40  VAL A CA    
327  C C     . VAL A 40  ? 0.4278 0.3316 0.3675 0.0668  0.0974  -0.0415 40  VAL A C     
328  O O     . VAL A 40  ? 0.4465 0.3298 0.3636 0.0678  0.0941  -0.0516 40  VAL A O     
329  C CB    . VAL A 40  ? 0.3862 0.3088 0.3727 0.0668  0.0756  -0.0218 40  VAL A CB    
330  C CG1   . VAL A 40  ? 0.3935 0.3403 0.4175 0.0723  0.0711  -0.0118 40  VAL A CG1   
331  C CG2   . VAL A 40  ? 0.3778 0.2794 0.3540 0.0663  0.0656  -0.0208 40  VAL A CG2   
332  N N     . GLU A 41  ? 0.4216 0.3386 0.3566 0.0599  0.1030  -0.0356 41  GLU A N     
333  C CA    . GLU A 41  ? 0.4294 0.3369 0.3290 0.0540  0.1051  -0.0370 41  GLU A CA    
334  C C     . GLU A 41  ? 0.3900 0.2871 0.2752 0.0461  0.0873  -0.0355 41  GLU A C     
335  O O     . GLU A 41  ? 0.3708 0.2773 0.2705 0.0399  0.0773  -0.0281 41  GLU A O     
336  C CB    . GLU A 41  ? 0.4344 0.3570 0.3427 0.0477  0.1151  -0.0268 41  GLU A CB    
337  C CG    . GLU A 41  ? 0.5220 0.4505 0.4218 0.0542  0.1379  -0.0267 41  GLU A CG    
338  C CD    . GLU A 41  ? 0.5945 0.5151 0.4598 0.0500  0.1438  -0.0203 41  GLU A CD    
339  O OE1   . GLU A 41  ? 0.6189 0.5229 0.4453 0.0532  0.1373  -0.0277 41  GLU A OE1   
340  O OE2   . GLU A 41  ? 0.6275 0.5593 0.5083 0.0435  0.1544  -0.0067 41  GLU A OE2   
341  N N     . TYR A 42  ? 0.3918 0.2722 0.2493 0.0469  0.0829  -0.0438 42  TYR A N     
342  C CA    . TYR A 42  ? 0.3575 0.2315 0.2049 0.0401  0.0678  -0.0422 42  TYR A CA    
343  C C     . TYR A 42  ? 0.3736 0.2364 0.1880 0.0400  0.0656  -0.0491 42  TYR A C     
344  O O     . TYR A 42  ? 0.4180 0.2762 0.2134 0.0464  0.0744  -0.0570 42  TYR A O     
345  C CB    . TYR A 42  ? 0.3496 0.2179 0.2132 0.0407  0.0584  -0.0429 42  TYR A CB    
346  C CG    . TYR A 42  ? 0.3812 0.2328 0.2420 0.0465  0.0600  -0.0563 42  TYR A CG    
347  C CD1   . TYR A 42  ? 0.3870 0.2258 0.2283 0.0439  0.0524  -0.0669 42  TYR A CD1   
348  C CD2   . TYR A 42  ? 0.4118 0.2607 0.2927 0.0552  0.0676  -0.0603 42  TYR A CD2   
349  C CE1   . TYR A 42  ? 0.4480 0.2704 0.2888 0.0486  0.0513  -0.0837 42  TYR A CE1   
350  C CE2   . TYR A 42  ? 0.4628 0.2930 0.3431 0.0614  0.0684  -0.0767 42  TYR A CE2   
351  C CZ    . TYR A 42  ? 0.4755 0.2917 0.3353 0.0575  0.0596  -0.0896 42  TYR A CZ    
352  O OH    . TYR A 42  ? 0.5092 0.3059 0.3708 0.0629  0.0576  -0.1100 42  TYR A OH    
353  N N     . VAL A 43  ? 0.3468 0.2076 0.1537 0.0343  0.0537  -0.0467 43  VAL A N     
354  C CA    . VAL A 43  ? 0.3657 0.2190 0.1446 0.0350  0.0482  -0.0523 43  VAL A CA    
355  C C     . VAL A 43  ? 0.3470 0.2007 0.1323 0.0296  0.0338  -0.0519 43  VAL A C     
356  O O     . VAL A 43  ? 0.3194 0.1814 0.1191 0.0256  0.0310  -0.0433 43  VAL A O     
357  C CB    . VAL A 43  ? 0.3760 0.2314 0.1354 0.0360  0.0552  -0.0437 43  VAL A CB    
358  C CG1   . VAL A 43  ? 0.3383 0.2000 0.1160 0.0299  0.0544  -0.0322 43  VAL A CG1   
359  C CG2   . VAL A 43  ? 0.4026 0.2525 0.1331 0.0386  0.0466  -0.0468 43  VAL A CG2   
360  N N     . PHE A 44  ? 0.3690 0.2162 0.1457 0.0299  0.0248  -0.0624 44  PHE A N     
361  C CA    . PHE A 44  ? 0.3535 0.2047 0.1388 0.0246  0.0123  -0.0616 44  PHE A CA    
362  C C     . PHE A 44  ? 0.3509 0.2073 0.1189 0.0260  0.0081  -0.0564 44  PHE A C     
363  O O     . PHE A 44  ? 0.3884 0.2410 0.1305 0.0312  0.0074  -0.0593 44  PHE A O     
364  C CB    . PHE A 44  ? 0.3858 0.2296 0.1755 0.0230  0.0025  -0.0759 44  PHE A CB    
365  C CG    . PHE A 44  ? 0.4114 0.2472 0.2283 0.0206  0.0049  -0.0780 44  PHE A CG    
366  C CD1   . PHE A 44  ? 0.4500 0.2758 0.2655 0.0267  0.0140  -0.0849 44  PHE A CD1   
367  C CD2   . PHE A 44  ? 0.4174 0.2563 0.2639 0.0131  -0.0003 -0.0709 44  PHE A CD2   
368  C CE1   . PHE A 44  ? 0.4589 0.2751 0.3033 0.0262  0.0158  -0.0851 44  PHE A CE1   
369  C CE2   . PHE A 44  ? 0.4283 0.2575 0.3025 0.0113  0.0025  -0.0683 44  PHE A CE2   
370  C CZ    . PHE A 44  ? 0.4405 0.2569 0.3141 0.0182  0.0096  -0.0756 44  PHE A CZ    
371  N N     . VAL A 45  ? 0.3178 0.1831 0.0992 0.0231  0.0059  -0.0481 45  VAL A N     
372  C CA    . VAL A 45  ? 0.3167 0.1854 0.0891 0.0256  0.0012  -0.0436 45  VAL A CA    
373  C C     . VAL A 45  ? 0.3069 0.1872 0.0954 0.0234  -0.0086 -0.0448 45  VAL A C     
374  O O     . VAL A 45  ? 0.3186 0.2027 0.1235 0.0187  -0.0114 -0.0481 45  VAL A O     
375  C CB    . VAL A 45  ? 0.2986 0.1677 0.0753 0.0258  0.0084  -0.0355 45  VAL A CB    
376  C CG1   . VAL A 45  ? 0.3073 0.1683 0.0737 0.0270  0.0191  -0.0320 45  VAL A CG1   
377  C CG2   . VAL A 45  ? 0.2538 0.1332 0.0512 0.0222  0.0100  -0.0342 45  VAL A CG2   
378  N N     . GLY A 46  ? 0.2960 0.1821 0.0842 0.0270  -0.0127 -0.0411 46  GLY A N     
379  C CA    . GLY A 46  ? 0.2755 0.1776 0.0836 0.0261  -0.0184 -0.0411 46  GLY A CA    
380  C C     . GLY A 46  ? 0.2934 0.2027 0.1089 0.0246  -0.0304 -0.0470 46  GLY A C     
381  O O     . GLY A 46  ? 0.3223 0.2229 0.1228 0.0251  -0.0368 -0.0541 46  GLY A O     
382  N N     . SER A 47  ? 0.2784 0.2063 0.1185 0.0232  -0.0334 -0.0454 47  SER A N     
383  C CA    . SER A 47  ? 0.2963 0.2369 0.1536 0.0211  -0.0465 -0.0507 47  SER A CA    
384  C C     . SER A 47  ? 0.3160 0.2501 0.1816 0.0123  -0.0529 -0.0599 47  SER A C     
385  O O     . SER A 47  ? 0.3484 0.2873 0.2183 0.0115  -0.0684 -0.0698 47  SER A O     
386  C CB    . SER A 47  ? 0.2874 0.2531 0.1770 0.0200  -0.0435 -0.0451 47  SER A CB    
387  O OG    . SER A 47  ? 0.2767 0.2476 0.1839 0.0122  -0.0323 -0.0386 47  SER A OG    
388  N N     . TYR A 48  ? 0.2990 0.2226 0.1697 0.0065  -0.0429 -0.0578 48  TYR A N     
389  C CA    . TYR A 48  ? 0.3198 0.2331 0.2042 -0.0013 -0.0484 -0.0676 48  TYR A CA    
390  C C     . TYR A 48  ? 0.3545 0.2512 0.2059 0.0042  -0.0553 -0.0822 48  TYR A C     
391  O O     . TYR A 48  ? 0.4011 0.2952 0.2552 0.0019  -0.0694 -0.0981 48  TYR A O     
392  C CB    . TYR A 48  ? 0.3019 0.2066 0.2018 -0.0067 -0.0360 -0.0594 48  TYR A CB    
393  C CG    . TYR A 48  ? 0.3269 0.2147 0.2427 -0.0132 -0.0419 -0.0716 48  TYR A CG    
394  C CD1   . TYR A 48  ? 0.3610 0.2542 0.3164 -0.0239 -0.0506 -0.0749 48  TYR A CD1   
395  C CD2   . TYR A 48  ? 0.3277 0.1945 0.2229 -0.0085 -0.0387 -0.0812 48  TYR A CD2   
396  C CE1   . TYR A 48  ? 0.3902 0.2641 0.3642 -0.0302 -0.0577 -0.0893 48  TYR A CE1   
397  C CE2   . TYR A 48  ? 0.3675 0.2166 0.2776 -0.0124 -0.0444 -0.0963 48  TYR A CE2   
398  C CZ    . TYR A 48  ? 0.4102 0.2609 0.3596 -0.0235 -0.0547 -0.1011 48  TYR A CZ    
399  O OH    . TYR A 48  ? 0.4753 0.3044 0.4436 -0.0278 -0.0616 -0.1189 48  TYR A OH    
400  N N     . ALA A 49  ? 0.3419 0.2294 0.1627 0.0118  -0.0453 -0.0773 49  ALA A N     
401  C CA    . ALA A 49  ? 0.3804 0.2551 0.1661 0.0188  -0.0465 -0.0872 49  ALA A CA    
402  C C     . ALA A 49  ? 0.4186 0.3004 0.1811 0.0258  -0.0605 -0.0914 49  ALA A C     
403  O O     . ALA A 49  ? 0.4671 0.3427 0.1994 0.0319  -0.0654 -0.1020 49  ALA A O     
404  C CB    . ALA A 49  ? 0.3639 0.2306 0.1312 0.0236  -0.0302 -0.0772 49  ALA A CB    
405  N N     . ARG A 50  ? 0.4101 0.3066 0.1853 0.0268  -0.0670 -0.0828 50  ARG A N     
406  C CA    . ARG A 50  ? 0.4582 0.3635 0.2154 0.0349  -0.0830 -0.0853 50  ARG A CA    
407  C C     . ARG A 50  ? 0.4857 0.4097 0.2747 0.0297  -0.1022 -0.0951 50  ARG A C     
408  O O     . ARG A 50  ? 0.5218 0.4585 0.3032 0.0368  -0.1187 -0.0968 50  ARG A O     
409  C CB    . ARG A 50  ? 0.4430 0.3495 0.1887 0.0437  -0.0776 -0.0679 50  ARG A CB    
410  C CG    . ARG A 50  ? 0.4254 0.3149 0.1475 0.0467  -0.0597 -0.0579 50  ARG A CG    
411  C CD    . ARG A 50  ? 0.4269 0.3139 0.1435 0.0546  -0.0564 -0.0417 50  ARG A CD    
412  N NE    . ARG A 50  ? 0.3668 0.2599 0.1149 0.0516  -0.0517 -0.0376 50  ARG A NE    
413  C CZ    . ARG A 50  ? 0.3208 0.2074 0.0784 0.0470  -0.0376 -0.0345 50  ARG A CZ    
414  N NH1   . ARG A 50  ? 0.3200 0.1947 0.0640 0.0438  -0.0267 -0.0335 50  ARG A NH1   
415  N NH2   . ARG A 50  ? 0.2868 0.1816 0.0677 0.0465  -0.0348 -0.0336 50  ARG A NH2   
416  N N     . ASN A 51  ? 0.4793 0.4060 0.3066 0.0174  -0.1001 -0.0999 51  ASN A N     
417  C CA    . ASN A 51  ? 0.5081 0.4542 0.3784 0.0088  -0.1152 -0.1072 51  ASN A CA    
418  C C     . ASN A 51  ? 0.4966 0.4676 0.3852 0.0138  -0.1201 -0.0964 51  ASN A C     
419  O O     . ASN A 51  ? 0.5384 0.5285 0.4463 0.0134  -0.1397 -0.1045 51  ASN A O     
420  C CB    . ASN A 51  ? 0.5755 0.5208 0.4399 0.0074  -0.1380 -0.1308 51  ASN A CB    
421  C CG    . ASN A 51  ? 0.6268 0.5469 0.4762 0.0042  -0.1333 -0.1458 51  ASN A CG    
422  O OD1   . ASN A 51  ? 0.6453 0.5550 0.5255 -0.0062 -0.1227 -0.1443 51  ASN A OD1   
423  N ND2   . ASN A 51  ? 0.6890 0.5996 0.4901 0.0147  -0.1401 -0.1592 51  ASN A ND2   
424  N N     . THR A 52  ? 0.4494 0.4209 0.3338 0.0194  -0.1036 -0.0802 52  THR A N     
425  C CA    . THR A 52  ? 0.4400 0.4340 0.3450 0.0261  -0.1051 -0.0712 52  THR A CA    
426  C C     . THR A 52  ? 0.4069 0.4161 0.3483 0.0197  -0.0885 -0.0616 52  THR A C     
427  O O     . THR A 52  ? 0.3908 0.4126 0.3391 0.0281  -0.0805 -0.0534 52  THR A O     
428  C CB    . THR A 52  ? 0.4381 0.4222 0.3092 0.0415  -0.1026 -0.0621 52  THR A CB    
429  O OG1   . THR A 52  ? 0.3984 0.3664 0.2564 0.0419  -0.0825 -0.0541 52  THR A OG1   
430  C CG2   . THR A 52  ? 0.4721 0.4420 0.3022 0.0484  -0.1145 -0.0664 52  THR A CG2   
431  N N     . TRP A 53  ? 0.4022 0.4100 0.3661 0.0062  -0.0828 -0.0625 53  TRP A N     
432  C CA    . TRP A 53  ? 0.3810 0.4050 0.3760 0.0005  -0.0656 -0.0497 53  TRP A CA    
433  C C     . TRP A 53  ? 0.4012 0.4574 0.4479 -0.0061 -0.0710 -0.0479 53  TRP A C     
434  O O     . TRP A 53  ? 0.4366 0.4970 0.5011 -0.0118 -0.0900 -0.0595 53  TRP A O     
435  C CB    . TRP A 53  ? 0.3751 0.3809 0.3689 -0.0089 -0.0539 -0.0451 53  TRP A CB    
436  C CG    . TRP A 53  ? 0.4092 0.4133 0.4396 -0.0238 -0.0596 -0.0485 53  TRP A CG    
437  C CD1   . TRP A 53  ? 0.4375 0.4607 0.5157 -0.0347 -0.0519 -0.0363 53  TRP A CD1   
438  C CD2   . TRP A 53  ? 0.4434 0.4237 0.4678 -0.0294 -0.0726 -0.0648 53  TRP A CD2   
439  N NE1   . TRP A 53  ? 0.4796 0.4896 0.5873 -0.0484 -0.0609 -0.0439 53  TRP A NE1   
440  C CE2   . TRP A 53  ? 0.4805 0.4636 0.5548 -0.0447 -0.0744 -0.0638 53  TRP A CE2   
441  C CE3   . TRP A 53  ? 0.4568 0.4146 0.4393 -0.0224 -0.0819 -0.0805 53  TRP A CE3   
442  C CZ2   . TRP A 53  ? 0.5168 0.4779 0.6015 -0.0530 -0.0875 -0.0819 53  TRP A CZ2   
443  C CZ3   . TRP A 53  ? 0.5046 0.4442 0.4918 -0.0289 -0.0934 -0.0986 53  TRP A CZ3   
444  C CH2   . TRP A 53  ? 0.5362 0.4759 0.5748 -0.0440 -0.0973 -0.1011 53  TRP A CH2   
445  N N     . LEU A 54  ? 0.3900 0.4715 0.4612 -0.0047 -0.0547 -0.0346 54  LEU A N     
446  C CA    . LEU A 54  ? 0.4170 0.5350 0.5449 -0.0115 -0.0555 -0.0297 54  LEU A CA    
447  C C     . LEU A 54  ? 0.4375 0.5585 0.6060 -0.0301 -0.0490 -0.0213 54  LEU A C     
448  O O     . LEU A 54  ? 0.4273 0.5294 0.5819 -0.0347 -0.0356 -0.0121 54  LEU A O     
449  C CB    . LEU A 54  ? 0.4088 0.5579 0.5488 -0.0004 -0.0384 -0.0189 54  LEU A CB    
450  C CG    . LEU A 54  ? 0.4130 0.5626 0.5271 0.0189  -0.0434 -0.0258 54  LEU A CG    
451  C CD1   . LEU A 54  ? 0.4144 0.5499 0.4896 0.0288  -0.0252 -0.0219 54  LEU A CD1   
452  C CD2   . LEU A 54  ? 0.4298 0.6206 0.5877 0.0260  -0.0432 -0.0238 54  LEU A CD2   
453  N N     . LYS A 55  ? 0.4738 0.6196 0.6971 -0.0407 -0.0593 -0.0235 55  LYS A N     
454  C CA    . LYS A 55  ? 0.5060 0.6602 0.7833 -0.0598 -0.0518 -0.0120 55  LYS A CA    
455  C C     . LYS A 55  ? 0.4959 0.6609 0.7723 -0.0583 -0.0206 0.0142  55  LYS A C     
456  O O     . LYS A 55  ? 0.4831 0.6745 0.7507 -0.0453 -0.0058 0.0227  55  LYS A O     
457  C CB    . LYS A 55  ? 0.5452 0.7381 0.8886 -0.0684 -0.0630 -0.0145 55  LYS A CB    
458  C CG    . LYS A 55  ? 0.5930 0.7890 1.0012 -0.0920 -0.0642 -0.0090 55  LYS A CG    
459  C CD    . LYS A 55  ? 0.6362 0.8787 1.1163 -0.1002 -0.0726 -0.0090 55  LYS A CD    
460  C CE    . LYS A 55  ? 0.6955 0.9404 1.2498 -0.1265 -0.0746 -0.0035 55  LYS A CE    
461  N NZ    . LYS A 55  ? 0.7077 0.9340 1.2584 -0.1331 -0.0454 0.0234  55  LYS A NZ    
462  N N     . GLY A 56  ? 0.5091 0.6526 0.7914 -0.0696 -0.0115 0.0259  56  GLY A N     
463  C CA    . GLY A 56  ? 0.5167 0.6710 0.7986 -0.0689 0.0165  0.0541  56  GLY A CA    
464  C C     . GLY A 56  ? 0.4812 0.6290 0.6996 -0.0505 0.0284  0.0566  56  GLY A C     
465  O O     . GLY A 56  ? 0.4947 0.6614 0.7064 -0.0453 0.0504  0.0774  56  GLY A O     
466  N N     . SER A 57  ? 0.4503 0.5720 0.6223 -0.0408 0.0138  0.0359  57  SER A N     
467  C CA    . SER A 57  ? 0.4195 0.5341 0.5373 -0.0249 0.0221  0.0349  57  SER A CA    
468  C C     . SER A 57  ? 0.4003 0.4740 0.4791 -0.0238 0.0117  0.0232  57  SER A C     
469  O O     . SER A 57  ? 0.3771 0.4395 0.4158 -0.0121 0.0078  0.0120  57  SER A O     
470  C CB    . SER A 57  ? 0.4071 0.5388 0.5124 -0.0106 0.0178  0.0222  57  SER A CB    
471  O OG    . SER A 57  ? 0.4092 0.5622 0.4972 0.0021  0.0361  0.0301  57  SER A OG    
472  N N     . LEU A 58  ? 0.4178 0.4695 0.5121 -0.0356 0.0081  0.0260  58  LEU A N     
473  C CA    . LEU A 58  ? 0.4024 0.4178 0.4661 -0.0342 -0.0010 0.0132  58  LEU A CA    
474  C C     . LEU A 58  ? 0.3855 0.3917 0.4146 -0.0258 0.0107  0.0230  58  LEU A C     
475  O O     . LEU A 58  ? 0.4017 0.4162 0.4411 -0.0276 0.0239  0.0436  58  LEU A O     
476  C CB    . LEU A 58  ? 0.4328 0.4270 0.5284 -0.0479 -0.0094 0.0091  58  LEU A CB    
477  C CG    . LEU A 58  ? 0.4331 0.3908 0.5043 -0.0461 -0.0148 -0.0024 58  LEU A CG    
478  C CD1   . LEU A 58  ? 0.4132 0.3581 0.4480 -0.0384 -0.0290 -0.0268 58  LEU A CD1   
479  C CD2   . LEU A 58  ? 0.4837 0.4214 0.5956 -0.0592 -0.0193 -0.0035 58  LEU A CD2   
480  N N     . GLU A 59  ? 0.3599 0.3510 0.3496 -0.0166 0.0055  0.0096  59  GLU A N     
481  C CA    . GLU A 59  ? 0.3514 0.3312 0.3127 -0.0101 0.0119  0.0141  59  GLU A CA    
482  C C     . GLU A 59  ? 0.3318 0.2851 0.2684 -0.0072 0.0033  -0.0022 59  GLU A C     
483  O O     . GLU A 59  ? 0.3285 0.2800 0.2473 -0.0023 -0.0033 -0.0143 59  GLU A O     
484  C CB    . GLU A 59  ? 0.3373 0.3371 0.2768 0.0003  0.0198  0.0180  59  GLU A CB    
485  C CG    . GLU A 59  ? 0.3554 0.3466 0.2681 0.0065  0.0230  0.0200  59  GLU A CG    
486  C CD    . GLU A 59  ? 0.3427 0.3456 0.2303 0.0169  0.0245  0.0126  59  GLU A CD    
487  O OE1   . GLU A 59  ? 0.3361 0.3233 0.2069 0.0200  0.0181  -0.0009 59  GLU A OE1   
488  O OE2   . GLU A 59  ? 0.4016 0.4295 0.2876 0.0221  0.0326  0.0201  59  GLU A OE2   
489  N N     . ILE A 60  ? 0.3323 0.2664 0.2691 -0.0090 0.0045  -0.0009 60  ILE A N     
490  C CA    . ILE A 60  ? 0.3167 0.2291 0.2318 -0.0052 -0.0001 -0.0153 60  ILE A CA    
491  C C     . ILE A 60  ? 0.2880 0.2024 0.1783 0.0026  0.0054  -0.0129 60  ILE A C     
492  O O     . ILE A 60  ? 0.2841 0.2092 0.1762 0.0048  0.0116  -0.0005 60  ILE A O     
493  C CB    . ILE A 60  ? 0.3414 0.2327 0.2710 -0.0086 -0.0004 -0.0175 60  ILE A CB    
494  C CG1   . ILE A 60  ? 0.3833 0.2685 0.3410 -0.0179 -0.0091 -0.0257 60  ILE A CG1   
495  C CG2   . ILE A 60  ? 0.3450 0.2191 0.2500 -0.0022 -0.0009 -0.0314 60  ILE A CG2   
496  C CD1   . ILE A 60  ? 0.4150 0.2768 0.3979 -0.0222 -0.0093 -0.0276 60  ILE A CD1   
497  N N     . ASP A 61  ? 0.2759 0.1811 0.1441 0.0067  0.0027  -0.0241 61  ASP A N     
498  C CA    . ASP A 61  ? 0.2486 0.1540 0.1003 0.0120  0.0071  -0.0232 61  ASP A CA    
499  C C     . ASP A 61  ? 0.2513 0.1414 0.0960 0.0138  0.0103  -0.0281 61  ASP A C     
500  O O     . ASP A 61  ? 0.2658 0.1451 0.0966 0.0152  0.0089  -0.0371 61  ASP A O     
501  C CB    . ASP A 61  ? 0.2400 0.1481 0.0770 0.0154  0.0043  -0.0282 61  ASP A CB    
502  C CG    . ASP A 61  ? 0.2349 0.1611 0.0783 0.0171  0.0040  -0.0247 61  ASP A CG    
503  O OD1   . ASP A 61  ? 0.2589 0.1901 0.1061 0.0177  -0.0007 -0.0275 61  ASP A OD1   
504  O OD2   . ASP A 61  ? 0.2259 0.1638 0.0703 0.0191  0.0082  -0.0197 61  ASP A OD2   
505  N N     . VAL A 62  ? 0.2387 0.1308 0.0920 0.0152  0.0149  -0.0214 62  VAL A N     
506  C CA    . VAL A 62  ? 0.2380 0.1208 0.0895 0.0185  0.0200  -0.0254 62  VAL A CA    
507  C C     . VAL A 62  ? 0.2228 0.1146 0.0699 0.0203  0.0226  -0.0233 62  VAL A C     
508  O O     . VAL A 62  ? 0.2134 0.1190 0.0674 0.0209  0.0204  -0.0169 62  VAL A O     
509  C CB    . VAL A 62  ? 0.2494 0.1278 0.1206 0.0204  0.0226  -0.0200 62  VAL A CB    
510  C CG1   . VAL A 62  ? 0.2557 0.1274 0.1273 0.0257  0.0293  -0.0260 62  VAL A CG1   
511  C CG2   . VAL A 62  ? 0.2765 0.1425 0.1597 0.0169  0.0193  -0.0229 62  VAL A CG2   
512  N N     . PHE A 63  ? 0.2266 0.1117 0.0630 0.0212  0.0271  -0.0286 63  PHE A N     
513  C CA    . PHE A 63  ? 0.2226 0.1144 0.0636 0.0208  0.0304  -0.0265 63  PHE A CA    
514  C C     . PHE A 63  ? 0.2395 0.1327 0.0930 0.0234  0.0386  -0.0259 63  PHE A C     
515  O O     . PHE A 63  ? 0.2677 0.1515 0.1145 0.0266  0.0455  -0.0300 63  PHE A O     
516  C CB    . PHE A 63  ? 0.2262 0.1110 0.0535 0.0195  0.0319  -0.0279 63  PHE A CB    
517  C CG    . PHE A 63  ? 0.2110 0.1002 0.0386 0.0180  0.0247  -0.0284 63  PHE A CG    
518  C CD1   . PHE A 63  ? 0.1798 0.0753 0.0050 0.0190  0.0179  -0.0295 63  PHE A CD1   
519  C CD2   . PHE A 63  ? 0.2125 0.0996 0.0461 0.0158  0.0256  -0.0284 63  PHE A CD2   
520  C CE1   . PHE A 63  ? 0.1947 0.0959 0.0196 0.0201  0.0131  -0.0324 63  PHE A CE1   
521  C CE2   . PHE A 63  ? 0.2184 0.1069 0.0537 0.0160  0.0186  -0.0328 63  PHE A CE2   
522  C CZ    . PHE A 63  ? 0.2028 0.0991 0.0317 0.0194  0.0126  -0.0357 63  PHE A CZ    
523  N N     . LEU A 64  ? 0.2343 0.1414 0.1065 0.0230  0.0372  -0.0222 64  LEU A N     
524  C CA    . LEU A 64  ? 0.2517 0.1662 0.1437 0.0258  0.0446  -0.0207 64  LEU A CA    
525  C C     . LEU A 64  ? 0.2666 0.1866 0.1671 0.0209  0.0496  -0.0204 64  LEU A C     
526  O O     . LEU A 64  ? 0.2620 0.1884 0.1684 0.0159  0.0412  -0.0214 64  LEU A O     
527  C CB    . LEU A 64  ? 0.2473 0.1775 0.1601 0.0290  0.0371  -0.0154 64  LEU A CB    
528  C CG    . LEU A 64  ? 0.2448 0.1719 0.1540 0.0324  0.0309  -0.0098 64  LEU A CG    
529  C CD1   . LEU A 64  ? 0.2339 0.1812 0.1574 0.0361  0.0217  -0.0011 64  LEU A CD1   
530  C CD2   . LEU A 64  ? 0.2484 0.1592 0.1619 0.0372  0.0378  -0.0113 64  LEU A CD2   
531  N N     . LEU A 65  ? 0.2929 0.2108 0.1959 0.0226  0.0639  -0.0193 65  LEU A N     
532  C CA    . LEU A 65  ? 0.3129 0.2347 0.2272 0.0168  0.0726  -0.0147 65  LEU A CA    
533  C C     . LEU A 65  ? 0.3232 0.2659 0.2764 0.0157  0.0768  -0.0122 65  LEU A C     
534  O O     . LEU A 65  ? 0.3488 0.2985 0.3119 0.0222  0.0891  -0.0112 65  LEU A O     
535  C CB    . LEU A 65  ? 0.3427 0.2534 0.2337 0.0199  0.0882  -0.0115 65  LEU A CB    
536  C CG    . LEU A 65  ? 0.3499 0.2432 0.2048 0.0217  0.0810  -0.0146 65  LEU A CG    
537  C CD1   . LEU A 65  ? 0.3957 0.2819 0.2237 0.0301  0.0909  -0.0187 65  LEU A CD1   
538  C CD2   . LEU A 65  ? 0.3564 0.2415 0.2052 0.0160  0.0788  -0.0076 65  LEU A CD2   
539  N N     . PHE A 66  ? 0.3125 0.2664 0.2894 0.0082  0.0657  -0.0133 66  PHE A N     
540  C CA    . PHE A 66  ? 0.3205 0.2984 0.3409 0.0054  0.0656  -0.0122 66  PHE A CA    
541  C C     . PHE A 66  ? 0.3477 0.3281 0.3926 -0.0045 0.0781  -0.0062 66  PHE A C     
542  O O     . PHE A 66  ? 0.3504 0.3119 0.3774 -0.0095 0.0821  -0.0028 66  PHE A O     
543  C CB    . PHE A 66  ? 0.3084 0.3007 0.3419 0.0036  0.0432  -0.0191 66  PHE A CB    
544  C CG    . PHE A 66  ? 0.2943 0.2904 0.3127 0.0138  0.0336  -0.0188 66  PHE A CG    
545  C CD1   . PHE A 66  ? 0.3224 0.3327 0.3612 0.0224  0.0364  -0.0139 66  PHE A CD1   
546  C CD2   . PHE A 66  ? 0.2707 0.2570 0.2583 0.0155  0.0229  -0.0214 66  PHE A CD2   
547  C CE1   . PHE A 66  ? 0.3083 0.3191 0.3367 0.0320  0.0280  -0.0098 66  PHE A CE1   
548  C CE2   . PHE A 66  ? 0.2596 0.2497 0.2366 0.0239  0.0161  -0.0167 66  PHE A CE2   
549  C CZ    . PHE A 66  ? 0.2847 0.2853 0.2821 0.0318  0.0183  -0.0099 66  PHE A CZ    
550  N N     . PRO A 67  ? 0.3706 0.3749 0.4597 -0.0068 0.0853  -0.0026 67  PRO A N     
551  C CA    . PRO A 67  ? 0.4090 0.4187 0.5309 -0.0180 0.0992  0.0061  67  PRO A CA    
552  C C     . PRO A 67  ? 0.4195 0.4226 0.5600 -0.0317 0.0828  0.0004  67  PRO A C     
553  O O     . PRO A 67  ? 0.4059 0.4180 0.5554 -0.0328 0.0596  -0.0129 67  PRO A O     
554  C CB    . PRO A 67  ? 0.4268 0.4701 0.5993 -0.0167 0.1057  0.0084  67  PRO A CB    
555  C CG    . PRO A 67  ? 0.3992 0.4462 0.5523 -0.0006 0.1039  0.0042  67  PRO A CG    
556  C CD    . PRO A 67  ? 0.3674 0.3961 0.4828 0.0015  0.0824  -0.0042 67  PRO A CD    
557  N N     . GLU A 68  ? 0.4549 0.4420 0.6004 -0.0409 0.0946  0.0104  68  GLU A N     
558  C CA    . GLU A 68  ? 0.4805 0.4558 0.6482 -0.0536 0.0798  0.0035  68  GLU A CA    
559  C C     . GLU A 68  ? 0.4970 0.4979 0.7229 -0.0639 0.0634  -0.0086 68  GLU A C     
560  O O     . GLU A 68  ? 0.5049 0.4993 0.7416 -0.0706 0.0419  -0.0248 68  GLU A O     
561  C CB    . GLU A 68  ? 0.5233 0.4770 0.6974 -0.0622 0.0977  0.0211  68  GLU A CB    
562  C CG    . GLU A 68  ? 0.5677 0.4989 0.7553 -0.0719 0.0809  0.0117  68  GLU A CG    
563  C CD    . GLU A 68  ? 0.6733 0.5864 0.8911 -0.0841 0.0969  0.0312  68  GLU A CD    
564  O OE1   . GLU A 68  ? 0.7154 0.6248 0.9851 -0.0987 0.0861  0.0235  68  GLU A OE1   
565  O OE2   . GLU A 68  ? 0.7101 0.6125 0.9000 -0.0787 0.1195  0.0543  68  GLU A OE2   
566  N N     . GLU A 69  ? 0.5093 0.5407 0.7731 -0.0641 0.0726  -0.0027 69  GLU A N     
567  C CA    . GLU A 69  ? 0.5349 0.5963 0.8618 -0.0742 0.0569  -0.0128 69  GLU A CA    
568  C C     . GLU A 69  ? 0.5079 0.5834 0.8239 -0.0674 0.0251  -0.0340 69  GLU A C     
569  O O     . GLU A 69  ? 0.5367 0.6275 0.8915 -0.0768 0.0029  -0.0497 69  GLU A O     
570  C CB    . GLU A 69  ? 0.5604 0.6554 0.9332 -0.0738 0.0759  0.0000  69  GLU A CB    
571  C CG    . GLU A 69  ? 0.6263 0.7190 1.0321 -0.0854 0.1060  0.0212  69  GLU A CG    
572  C CD    . GLU A 69  ? 0.6503 0.7343 1.0120 -0.0724 0.1383  0.0399  69  GLU A CD    
573  O OE1   . GLU A 69  ? 0.6193 0.6759 0.9147 -0.0611 0.1372  0.0379  69  GLU A OE1   
574  O OE2   . GLU A 69  ? 0.6975 0.8049 1.0928 -0.0730 0.1648  0.0555  69  GLU A OE2   
575  N N     . PHE A 70  ? 0.4615 0.5321 0.7254 -0.0511 0.0231  -0.0339 70  PHE A N     
576  C CA    . PHE A 70  ? 0.4434 0.5265 0.6868 -0.0418 -0.0034 -0.0480 70  PHE A CA    
577  C C     . PHE A 70  ? 0.4659 0.5417 0.7041 -0.0484 -0.0276 -0.0682 70  PHE A C     
578  O O     . PHE A 70  ? 0.4609 0.5071 0.6805 -0.0537 -0.0235 -0.0712 70  PHE A O     
579  C CB    . PHE A 70  ? 0.3946 0.4621 0.5795 -0.0265 0.0021  -0.0418 70  PHE A CB    
580  C CG    . PHE A 70  ? 0.3704 0.4539 0.5600 -0.0144 0.0114  -0.0311 70  PHE A CG    
581  C CD1   . PHE A 70  ? 0.3778 0.4802 0.6119 -0.0160 0.0272  -0.0228 70  PHE A CD1   
582  C CD2   . PHE A 70  ? 0.3342 0.4128 0.4864 -0.0006 0.0060  -0.0285 70  PHE A CD2   
583  C CE1   . PHE A 70  ? 0.3767 0.4923 0.6166 -0.0023 0.0364  -0.0151 70  PHE A CE1   
584  C CE2   . PHE A 70  ? 0.3299 0.4182 0.4898 0.0115  0.0143  -0.0194 70  PHE A CE2   
585  C CZ    . PHE A 70  ? 0.3597 0.4661 0.5629 0.0116  0.0291  -0.0140 70  PHE A CZ    
586  N N     . SER A 71  ? 0.4985 0.6027 0.7522 -0.0462 -0.0536 -0.0829 71  SER A N     
587  C CA    . SER A 71  ? 0.5397 0.6423 0.7836 -0.0489 -0.0793 -0.1070 71  SER A CA    
588  C C     . SER A 71  ? 0.5202 0.6034 0.6966 -0.0360 -0.0798 -0.1082 71  SER A C     
589  O O     . SER A 71  ? 0.4819 0.5557 0.6260 -0.0266 -0.0634 -0.0907 71  SER A O     
590  C CB    . SER A 71  ? 0.5764 0.7197 0.8480 -0.0469 -0.1083 -0.1221 71  SER A CB    
591  O OG    . SER A 71  ? 0.5603 0.7200 0.7897 -0.0288 -0.1178 -0.1172 71  SER A OG    
592  N N     . LYS A 72  ? 0.5594 0.6369 0.7178 -0.0359 -0.0978 -0.1303 72  LYS A N     
593  C CA    . LYS A 72  ? 0.5528 0.6204 0.6520 -0.0229 -0.0994 -0.1329 72  LYS A CA    
594  C C     . LYS A 72  ? 0.5512 0.6478 0.6241 -0.0081 -0.1084 -0.1247 72  LYS A C     
595  O O     . LYS A 72  ? 0.5210 0.6106 0.5522 0.0026  -0.0988 -0.1115 72  LYS A O     
596  C CB    . LYS A 72  ? 0.5978 0.6557 0.6889 -0.0249 -0.1158 -0.1614 72  LYS A CB    
597  C CG    . LYS A 72  ? 0.6477 0.7260 0.6945 -0.0102 -0.1346 -0.1776 72  LYS A CG    
598  C CD    . LYS A 72  ? 0.7413 0.8555 0.8092 -0.0102 -0.1639 -0.1987 72  LYS A CD    
599  C CE    . LYS A 72  ? 0.8108 0.9307 0.8507 -0.0030 -0.1852 -0.2325 72  LYS A CE    
600  N NZ    . LYS A 72  ? 0.8056 0.9269 0.7808 0.0145  -0.1773 -0.2261 72  LYS A NZ    
601  N N     . GLU A 73  ? 0.5885 0.7183 0.6905 -0.0077 -0.1269 -0.1305 73  GLU A N     
602  C CA    . GLU A 73  ? 0.6014 0.7604 0.6822 0.0075  -0.1382 -0.1207 73  GLU A CA    
603  C C     . GLU A 73  ? 0.5531 0.7084 0.6352 0.0140  -0.1182 -0.0915 73  GLU A C     
604  O O     . GLU A 73  ? 0.5438 0.7028 0.5921 0.0272  -0.1166 -0.0766 73  GLU A O     
605  C CB    . GLU A 73  ? 0.6661 0.8640 0.7800 0.0070  -0.1671 -0.1365 73  GLU A CB    
606  C CG    . GLU A 73  ? 0.7227 0.9558 0.8190 0.0244  -0.1823 -0.1235 73  GLU A CG    
607  C CD    . GLU A 73  ? 0.7681 1.0005 0.7969 0.0404  -0.1831 -0.1167 73  GLU A CD    
608  O OE1   . GLU A 73  ? 0.7837 0.9971 0.7787 0.0390  -0.1792 -0.1308 73  GLU A OE1   
609  O OE2   . GLU A 73  ? 0.7865 1.0384 0.7991 0.0549  -0.1866 -0.0951 73  GLU A OE2   
610  N N     . GLU A 74  ? 0.5298 0.6774 0.6522 0.0051  -0.1020 -0.0836 74  GLU A N     
611  C CA    . GLU A 74  ? 0.4972 0.6411 0.6243 0.0122  -0.0829 -0.0610 74  GLU A CA    
612  C C     . GLU A 74  ? 0.4575 0.5672 0.5420 0.0153  -0.0628 -0.0508 74  GLU A C     
613  O O     . GLU A 74  ? 0.4412 0.5464 0.5093 0.0257  -0.0547 -0.0355 74  GLU A O     
614  C CB    . GLU A 74  ? 0.4961 0.6450 0.6764 0.0029  -0.0693 -0.0574 74  GLU A CB    
615  C CG    . GLU A 74  ? 0.5364 0.7240 0.7689 0.0000  -0.0888 -0.0653 74  GLU A CG    
616  C CD    . GLU A 74  ? 0.5453 0.7404 0.8364 -0.0114 -0.0726 -0.0613 74  GLU A CD    
617  O OE1   . GLU A 74  ? 0.5300 0.6995 0.8222 -0.0228 -0.0534 -0.0601 74  GLU A OE1   
618  O OE2   . GLU A 74  ? 0.5901 0.8191 0.9279 -0.0082 -0.0787 -0.0577 74  GLU A OE2   
619  N N     . LEU A 75  ? 0.4468 0.5325 0.5180 0.0061  -0.0563 -0.0600 75  LEU A N     
620  C CA    . LEU A 75  ? 0.4141 0.4699 0.4468 0.0078  -0.0415 -0.0542 75  LEU A CA    
621  C C     . LEU A 75  ? 0.4131 0.4731 0.4067 0.0191  -0.0488 -0.0497 75  LEU A C     
622  O O     . LEU A 75  ? 0.3880 0.4344 0.3618 0.0244  -0.0371 -0.0369 75  LEU A O     
623  C CB    . LEU A 75  ? 0.4143 0.4504 0.4449 -0.0023 -0.0405 -0.0670 75  LEU A CB    
624  C CG    . LEU A 75  ? 0.3908 0.3952 0.3961 -0.0043 -0.0256 -0.0632 75  LEU A CG    
625  C CD1   . LEU A 75  ? 0.3835 0.3827 0.3477 0.0041  -0.0298 -0.0653 75  LEU A CD1   
626  C CD2   . LEU A 75  ? 0.3697 0.3604 0.3760 -0.0045 -0.0043 -0.0476 75  LEU A CD2   
627  N N     . ARG A 76  ? 0.4508 0.5314 0.4350 0.0228  -0.0683 -0.0607 76  ARG A N     
628  C CA    . ARG A 76  ? 0.4690 0.5612 0.4170 0.0347  -0.0748 -0.0538 76  ARG A CA    
629  C C     . ARG A 76  ? 0.4736 0.5766 0.4282 0.0441  -0.0726 -0.0316 76  ARG A C     
630  O O     . ARG A 76  ? 0.4543 0.5424 0.3926 0.0484  -0.0600 -0.0156 76  ARG A O     
631  C CB    . ARG A 76  ? 0.5209 0.6392 0.4589 0.0384  -0.0977 -0.0719 76  ARG A CB    
632  C CG    . ARG A 76  ? 0.5497 0.6732 0.4413 0.0478  -0.1001 -0.0744 76  ARG A CG    
633  C CD    . ARG A 76  ? 0.6478 0.8052 0.5255 0.0560  -0.1242 -0.0897 76  ARG A CD    
634  N NE    . ARG A 76  ? 0.7078 0.8904 0.5712 0.0692  -0.1297 -0.0666 76  ARG A NE    
635  C CZ    . ARG A 76  ? 0.7516 0.9546 0.6420 0.0722  -0.1420 -0.0584 76  ARG A CZ    
636  N NH1   . ARG A 76  ? 0.7513 0.9561 0.6869 0.0617  -0.1497 -0.0726 76  ARG A NH1   
637  N NH2   . ARG A 76  ? 0.7925 1.0158 0.6680 0.0861  -0.1463 -0.0338 76  ARG A NH2   
638  N N     . GLU A 77  ? 0.5023 0.6305 0.4861 0.0469  -0.0855 -0.0314 77  GLU A N     
639  C CA    . GLU A 77  ? 0.5211 0.6637 0.5162 0.0587  -0.0876 -0.0107 77  GLU A CA    
640  C C     . GLU A 77  ? 0.4844 0.6012 0.4862 0.0605  -0.0663 0.0058  77  GLU A C     
641  O O     . GLU A 77  ? 0.4968 0.6110 0.4875 0.0706  -0.0640 0.0248  77  GLU A O     
642  C CB    . GLU A 77  ? 0.5526 0.7233 0.5917 0.0590  -0.1013 -0.0155 77  GLU A CB    
643  C CG    . GLU A 77  ? 0.6374 0.8416 0.6734 0.0614  -0.1290 -0.0301 77  GLU A CG    
644  C CD    . GLU A 77  ? 0.7250 0.9632 0.8069 0.0660  -0.1450 -0.0279 77  GLU A CD    
645  O OE1   . GLU A 77  ? 0.7896 1.0595 0.8780 0.0667  -0.1714 -0.0435 77  GLU A OE1   
646  O OE2   . GLU A 77  ? 0.7195 0.9539 0.8323 0.0697  -0.1317 -0.0121 77  GLU A OE2   
647  N N     . ARG A 78  ? 0.4486 0.5466 0.4692 0.0514  -0.0509 -0.0014 78  ARG A N     
648  C CA    . ARG A 78  ? 0.4202 0.4940 0.4449 0.0538  -0.0314 0.0085  78  ARG A CA    
649  C C     . ARG A 78  ? 0.3932 0.4407 0.3815 0.0514  -0.0227 0.0106  78  ARG A C     
650  O O     . ARG A 78  ? 0.3962 0.4300 0.3782 0.0572  -0.0163 0.0229  78  ARG A O     
651  C CB    . ARG A 78  ? 0.4076 0.4747 0.4595 0.0469  -0.0168 0.0007  78  ARG A CB    
652  C CG    . ARG A 78  ? 0.4263 0.5229 0.5243 0.0484  -0.0226 -0.0004 78  ARG A CG    
653  C CD    . ARG A 78  ? 0.4309 0.5320 0.5560 0.0610  -0.0140 0.0108  78  ARG A CD    
654  N NE    . ARG A 78  ? 0.4237 0.5057 0.5273 0.0717  -0.0114 0.0230  78  ARG A NE    
655  C CZ    . ARG A 78  ? 0.4219 0.4795 0.5254 0.0768  0.0061  0.0249  78  ARG A CZ    
656  N NH1   . ARG A 78  ? 0.4003 0.4523 0.5177 0.0744  0.0240  0.0163  78  ARG A NH1   
657  N NH2   . ARG A 78  ? 0.4509 0.4900 0.5410 0.0845  0.0059  0.0354  78  ARG A NH2   
658  N N     . GLY A 79  ? 0.3715 0.4123 0.3405 0.0429  -0.0235 -0.0017 79  GLY A N     
659  C CA    . GLY A 79  ? 0.3472 0.3686 0.2857 0.0410  -0.0170 -0.0005 79  GLY A CA    
660  C C     . GLY A 79  ? 0.3586 0.3842 0.2841 0.0493  -0.0193 0.0161  79  GLY A C     
661  O O     . GLY A 79  ? 0.3447 0.3519 0.2703 0.0503  -0.0096 0.0255  79  GLY A O     
662  N N     . LEU A 80  ? 0.3889 0.4396 0.3044 0.0553  -0.0327 0.0199  80  LEU A N     
663  C CA    . LEU A 80  ? 0.4135 0.4731 0.3133 0.0639  -0.0344 0.0400  80  LEU A CA    
664  C C     . LEU A 80  ? 0.4294 0.4833 0.3520 0.0712  -0.0312 0.0599  80  LEU A C     
665  O O     . LEU A 80  ? 0.4439 0.4881 0.3619 0.0744  -0.0249 0.0788  80  LEU A O     
666  C CB    . LEU A 80  ? 0.4577 0.5501 0.3372 0.0715  -0.0503 0.0393  80  LEU A CB    
667  C CG    . LEU A 80  ? 0.4584 0.5614 0.3095 0.0694  -0.0557 0.0203  80  LEU A CG    
668  C CD1   . LEU A 80  ? 0.4303 0.5097 0.2705 0.0618  -0.0411 0.0146  80  LEU A CD1   
669  C CD2   . LEU A 80  ? 0.4613 0.5740 0.3259 0.0648  -0.0694 -0.0046 80  LEU A CD2   
670  N N     . GLU A 81  ? 0.4287 0.4883 0.3803 0.0738  -0.0348 0.0560  81  GLU A N     
671  C CA    . GLU A 81  ? 0.4476 0.4995 0.4265 0.0827  -0.0308 0.0720  81  GLU A CA    
672  C C     . GLU A 81  ? 0.4188 0.4352 0.4017 0.0789  -0.0145 0.0733  81  GLU A C     
673  O O     . GLU A 81  ? 0.4423 0.4462 0.4285 0.0836  -0.0113 0.0914  81  GLU A O     
674  C CB    . GLU A 81  ? 0.4556 0.5214 0.4693 0.0861  -0.0345 0.0643  81  GLU A CB    
675  C CG    . GLU A 81  ? 0.5294 0.6319 0.5518 0.0954  -0.0544 0.0715  81  GLU A CG    
676  C CD    . GLU A 81  ? 0.5991 0.7172 0.6668 0.1025  -0.0575 0.0716  81  GLU A CD    
677  O OE1   . GLU A 81  ? 0.5949 0.6933 0.6867 0.1055  -0.0423 0.0730  81  GLU A OE1   
678  O OE2   . GLU A 81  ? 0.6574 0.8101 0.7375 0.1061  -0.0761 0.0689  81  GLU A OE2   
679  N N     . ILE A 82  ? 0.3731 0.3737 0.3562 0.0703  -0.0049 0.0542  82  ILE A N     
680  C CA    . ILE A 82  ? 0.3530 0.3225 0.3361 0.0667  0.0079  0.0495  82  ILE A CA    
681  C C     . ILE A 82  ? 0.3486 0.3072 0.3121 0.0618  0.0086  0.0575  82  ILE A C     
682  O O     . ILE A 82  ? 0.3716 0.3096 0.3452 0.0625  0.0135  0.0655  82  ILE A O     
683  C CB    . ILE A 82  ? 0.3220 0.2827 0.2990 0.0592  0.0162  0.0292  82  ILE A CB    
684  C CG1   . ILE A 82  ? 0.3279 0.3044 0.3296 0.0630  0.0180  0.0239  82  ILE A CG1   
685  C CG2   . ILE A 82  ? 0.3201 0.2513 0.2936 0.0576  0.0270  0.0215  82  ILE A CG2   
686  C CD1   . ILE A 82  ? 0.3041 0.2824 0.3000 0.0543  0.0240  0.0100  82  ILE A CD1   
687  N N     . GLY A 83  ? 0.3282 0.3013 0.2679 0.0569  0.0038  0.0547  83  GLY A N     
688  C CA    . GLY A 83  ? 0.3187 0.2876 0.2420 0.0523  0.0063  0.0616  83  GLY A CA    
689  C C     . GLY A 83  ? 0.3530 0.3244 0.2848 0.0582  0.0063  0.0875  83  GLY A C     
690  O O     . GLY A 83  ? 0.3644 0.3172 0.3060 0.0541  0.0129  0.0957  83  GLY A O     
691  N N     . LYS A 84  ? 0.3789 0.3739 0.3087 0.0677  -0.0020 0.1011  84  LYS A N     
692  C CA    . LYS A 84  ? 0.4245 0.4232 0.3636 0.0762  -0.0024 0.1312  84  LYS A CA    
693  C C     . LYS A 84  ? 0.4357 0.4037 0.4097 0.0778  0.0036  0.1377  84  LYS A C     
694  O O     . LYS A 84  ? 0.4723 0.4264 0.4596 0.0780  0.0088  0.1590  84  LYS A O     
695  C CB    . LYS A 84  ? 0.4591 0.4895 0.3913 0.0886  -0.0156 0.1420  84  LYS A CB    
696  C CG    . LYS A 84  ? 0.4742 0.5369 0.3695 0.0908  -0.0231 0.1401  84  LYS A CG    
697  C CD    . LYS A 84  ? 0.5166 0.6089 0.4098 0.1004  -0.0408 0.1349  84  LYS A CD    
698  C CE    . LYS A 84  ? 0.5972 0.7246 0.4566 0.1115  -0.0506 0.1502  84  LYS A CE    
699  N NZ    . LYS A 84  ? 0.6362 0.7955 0.4957 0.1217  -0.0722 0.1444  84  LYS A NZ    
700  N N     . ALA A 85  ? 0.4122 0.3698 0.4026 0.0791  0.0039  0.1185  85  ALA A N     
701  C CA    . ALA A 85  ? 0.4344 0.3665 0.4583 0.0851  0.0087  0.1204  85  ALA A CA    
702  C C     . ALA A 85  ? 0.4363 0.3345 0.4682 0.0760  0.0175  0.1127  85  ALA A C     
703  O O     . ALA A 85  ? 0.4736 0.3455 0.5344 0.0801  0.0211  0.1164  85  ALA A O     
704  C CB    . ALA A 85  ? 0.4089 0.3447 0.4448 0.0893  0.0095  0.0996  85  ALA A CB    
705  N N     . VAL A 86  ? 0.3991 0.2984 0.4079 0.0641  0.0195  0.1010  86  VAL A N     
706  C CA    . VAL A 86  ? 0.3897 0.2620 0.4025 0.0548  0.0246  0.0832  86  VAL A CA    
707  C C     . VAL A 86  ? 0.4021 0.2690 0.4176 0.0448  0.0263  0.0959  86  VAL A C     
708  O O     . VAL A 86  ? 0.4011 0.2456 0.4277 0.0366  0.0279  0.0829  86  VAL A O     
709  C CB    . VAL A 86  ? 0.3416 0.2188 0.3304 0.0504  0.0255  0.0560  86  VAL A CB    
710  C CG1   . VAL A 86  ? 0.3135 0.1877 0.2843 0.0391  0.0256  0.0460  86  VAL A CG1   
711  C CG2   . VAL A 86  ? 0.3557 0.2166 0.3555 0.0560  0.0304  0.0371  86  VAL A CG2   
712  N N     . LEU A 87  ? 0.4164 0.3059 0.4234 0.0462  0.0259  0.1212  87  LEU A N     
713  C CA    . LEU A 87  ? 0.4368 0.3312 0.4446 0.0370  0.0304  0.1356  87  LEU A CA    
714  C C     . LEU A 87  ? 0.5127 0.4028 0.5461 0.0389  0.0351  0.1718  87  LEU A C     
715  O O     . LEU A 87  ? 0.5496 0.4510 0.5815 0.0507  0.0330  0.1934  87  LEU A O     
716  C CB    . LEU A 87  ? 0.3971 0.3243 0.3694 0.0367  0.0298  0.1334  87  LEU A CB    
717  C CG    . LEU A 87  ? 0.3259 0.2528 0.2782 0.0329  0.0263  0.1012  87  LEU A CG    
718  C CD1   . LEU A 87  ? 0.2744 0.2303 0.1956 0.0350  0.0243  0.0970  87  LEU A CD1   
719  C CD2   . LEU A 87  ? 0.2863 0.1925 0.2501 0.0221  0.0280  0.0853  87  LEU A CD2   
720  N N     . ASP A 88  ? 0.5513 0.4261 0.6111 0.0274  0.0408  0.1800  88  ASP A N     
721  C CA    . ASP A 88  ? 0.6379 0.5063 0.7278 0.0273  0.0475  0.2185  88  ASP A CA    
722  C C     . ASP A 88  ? 0.6669 0.5731 0.7291 0.0364  0.0518  0.2511  88  ASP A C     
723  O O     . ASP A 88  ? 0.7347 0.6414 0.8091 0.0447  0.0546  0.2864  88  ASP A O     
724  C CB    . ASP A 88  ? 0.6686 0.5227 0.7931 0.0103  0.0537  0.2226  88  ASP A CB    
725  C CG    . ASP A 88  ? 0.6834 0.4982 0.8392 0.0019  0.0474  0.1918  88  ASP A CG    
726  O OD1   . ASP A 88  ? 0.6901 0.4847 0.8460 0.0109  0.0415  0.1735  88  ASP A OD1   
727  O OD2   . ASP A 88  ? 0.7052 0.5117 0.8866 -0.0133 0.0480  0.1848  88  ASP A OD2   
728  N N     . SER A 89  ? 0.6292 0.5666 0.6538 0.0358  0.0523  0.2392  89  SER A N     
729  C CA    . SER A 89  ? 0.6538 0.6310 0.6414 0.0464  0.0544  0.2593  89  SER A CA    
730  C C     . SER A 89  ? 0.5966 0.5947 0.5488 0.0452  0.0509  0.2276  89  SER A C     
731  O O     . SER A 89  ? 0.5531 0.5370 0.5140 0.0346  0.0506  0.2016  89  SER A O     
732  C CB    . SER A 89  ? 0.7149 0.7067 0.7123 0.0433  0.0692  0.2977  89  SER A CB    
733  O OG    . SER A 89  ? 0.6979 0.6909 0.7076 0.0289  0.0771  0.2853  89  SER A OG    
734  N N     . TYR A 90  ? 0.6066 0.6378 0.5197 0.0568  0.0471  0.2294  90  TYR A N     
735  C CA    . TYR A 90  ? 0.5602 0.6053 0.4432 0.0579  0.0399  0.1956  90  TYR A CA    
736  C C     . TYR A 90  ? 0.5903 0.6753 0.4328 0.0677  0.0413  0.1996  90  TYR A C     
737  O O     . TYR A 90  ? 0.6576 0.7636 0.4909 0.0741  0.0500  0.2308  90  TYR A O     
738  C CB    . TYR A 90  ? 0.5316 0.5663 0.4140 0.0623  0.0260  0.1747  90  TYR A CB    
739  C CG    . TYR A 90  ? 0.5759 0.6283 0.4490 0.0763  0.0167  0.1919  90  TYR A CG    
740  C CD1   . TYR A 90  ? 0.5894 0.6746 0.4280 0.0859  0.0066  0.1831  90  TYR A CD1   
741  C CD2   . TYR A 90  ? 0.6165 0.6527 0.5178 0.0810  0.0161  0.2153  90  TYR A CD2   
742  C CE1   . TYR A 90  ? 0.6449 0.7502 0.4752 0.0995  -0.0055 0.1979  90  TYR A CE1   
743  C CE2   . TYR A 90  ? 0.6615 0.7165 0.5565 0.0958  0.0056  0.2329  90  TYR A CE2   
744  C CZ    . TYR A 90  ? 0.6715 0.7627 0.5301 0.1048  -0.0059 0.2242  90  TYR A CZ    
745  O OH    . TYR A 90  ? 0.7175 0.8309 0.5697 0.1199  -0.0195 0.2402  90  TYR A OH    
746  N N     . GLU A 91  ? 0.5523 0.6469 0.3709 0.0697  0.0330  0.1676  91  GLU A N     
747  C CA    . GLU A 91  ? 0.5774 0.7069 0.3570 0.0793  0.0329  0.1602  91  GLU A CA    
748  C C     . GLU A 91  ? 0.5316 0.6597 0.2972 0.0800  0.0187  0.1215  91  GLU A C     
749  O O     . GLU A 91  ? 0.4762 0.5800 0.2586 0.0701  0.0179  0.0998  91  GLU A O     
750  C CB    . GLU A 91  ? 0.5840 0.7233 0.3645 0.0748  0.0494  0.1642  91  GLU A CB    
751  C CG    . GLU A 91  ? 0.6715 0.8511 0.4140 0.0875  0.0566  0.1690  91  GLU A CG    
752  C CD    . GLU A 91  ? 0.7398 0.9316 0.4943 0.0828  0.0772  0.1817  91  GLU A CD    
753  O OE1   . GLU A 91  ? 0.6977 0.8704 0.4795 0.0712  0.0794  0.1655  91  GLU A OE1   
754  O OE2   . GLU A 91  ? 0.8309 1.0540 0.5684 0.0913  0.0914  0.2094  91  GLU A OE2   
755  N N     . ILE A 92  ? 0.5543 0.7080 0.2906 0.0915  0.0069  0.1135  92  ILE A N     
756  C CA    . ILE A 92  ? 0.5169 0.6682 0.2475 0.0908  -0.0078 0.0776  92  ILE A CA    
757  C C     . ILE A 92  ? 0.5611 0.7394 0.2558 0.1001  -0.0108 0.0570  92  ILE A C     
758  O O     . ILE A 92  ? 0.6297 0.8391 0.2937 0.1132  -0.0175 0.0618  92  ILE A O     
759  C CB    . ILE A 92  ? 0.5121 0.6622 0.2550 0.0927  -0.0246 0.0755  92  ILE A CB    
760  C CG1   . ILE A 92  ? 0.4498 0.5682 0.2307 0.0836  -0.0194 0.0870  92  ILE A CG1   
761  C CG2   . ILE A 92  ? 0.4875 0.6386 0.2289 0.0905  -0.0396 0.0397  92  ILE A CG2   
762  C CD1   . ILE A 92  ? 0.4334 0.5542 0.2318 0.0886  -0.0309 0.0959  92  ILE A CD1   
763  N N     . ARG A 93  ? 0.5297 0.6959 0.2278 0.0949  -0.0057 0.0338  93  ARG A N     
764  C CA    . ARG A 93  ? 0.5645 0.7491 0.2353 0.1037  -0.0082 0.0073  93  ARG A CA    
765  C C     . ARG A 93  ? 0.5089 0.6644 0.2007 0.0943  -0.0114 -0.0208 93  ARG A C     
766  O O     . ARG A 93  ? 0.4615 0.5940 0.1766 0.0847  -0.0016 -0.0139 93  ARG A O     
767  C CB    . ARG A 93  ? 0.6007 0.8071 0.2539 0.1111  0.0111  0.0209  93  ARG A CB    
768  C CG    . ARG A 93  ? 0.7129 0.9569 0.3324 0.1251  0.0158  0.0450  93  ARG A CG    
769  C CD    . ARG A 93  ? 0.8262 1.0986 0.4040 0.1405  0.0003  0.0185  93  ARG A CD    
770  N NE    . ARG A 93  ? 0.9126 1.2196 0.4524 0.1560  0.0137  0.0148  93  ARG A NE    
771  C CZ    . ARG A 93  ? 1.0157 1.3517 0.5126 0.1723  0.0026  -0.0101 93  ARG A CZ    
772  N NH1   . ARG A 93  ? 1.0344 1.3683 0.5257 0.1732  -0.0244 -0.0335 93  ARG A NH1   
773  N NH2   . ARG A 93  ? 1.0952 1.4644 0.5560 0.1882  0.0181  -0.0134 93  ARG A NH2   
774  N N     . TYR A 94  ? 0.5190 0.6747 0.2042 0.0969  -0.0262 -0.0518 94  TYR A N     
775  C CA    . TYR A 94  ? 0.4772 0.6048 0.1826 0.0893  -0.0283 -0.0761 94  TYR A CA    
776  C C     . TYR A 94  ? 0.5256 0.6616 0.2172 0.0965  -0.0421 -0.1106 94  TYR A C     
777  O O     . TYR A 94  ? 0.5819 0.7418 0.2544 0.1039  -0.0553 -0.1179 94  TYR A O     
778  C CB    . TYR A 94  ? 0.4245 0.5237 0.1621 0.0755  -0.0333 -0.0724 94  TYR A CB    
779  C CG    . TYR A 94  ? 0.4440 0.5529 0.1875 0.0746  -0.0482 -0.0725 94  TYR A CG    
780  C CD1   . TYR A 94  ? 0.4695 0.5762 0.2237 0.0718  -0.0644 -0.0991 94  TYR A CD1   
781  C CD2   . TYR A 94  ? 0.4390 0.5590 0.1830 0.0764  -0.0470 -0.0457 94  TYR A CD2   
782  C CE1   . TYR A 94  ? 0.5017 0.6218 0.2674 0.0706  -0.0797 -0.0997 94  TYR A CE1   
783  C CE2   . TYR A 94  ? 0.4637 0.5953 0.2171 0.0773  -0.0616 -0.0450 94  TYR A CE2   
784  C CZ    . TYR A 94  ? 0.4907 0.6246 0.2553 0.0742  -0.0783 -0.0723 94  TYR A CZ    
785  O OH    . TYR A 94  ? 0.5067 0.6565 0.2865 0.0747  -0.0945 -0.0724 94  TYR A OH    
786  N N     . ALA A 95  ? 0.5123 0.6283 0.2149 0.0952  -0.0407 -0.1326 95  ALA A N     
787  C CA    . ALA A 95  ? 0.5589 0.6791 0.2515 0.1031  -0.0529 -0.1690 95  ALA A CA    
788  C C     . ALA A 95  ? 0.5556 0.6568 0.2753 0.0920  -0.0715 -0.1870 95  ALA A C     
789  O O     . ALA A 95  ? 0.6163 0.7304 0.3279 0.0967  -0.0888 -0.2135 95  ALA A O     
790  C CB    . ALA A 95  ? 0.5629 0.6690 0.2600 0.1082  -0.0429 -0.1835 95  ALA A CB    
791  N N     . GLU A 96  ? 0.4899 0.5630 0.2426 0.0774  -0.0680 -0.1730 96  GLU A N     
792  C CA    . GLU A 96  ? 0.4851 0.5415 0.2701 0.0654  -0.0819 -0.1864 96  GLU A CA    
793  C C     . GLU A 96  ? 0.4289 0.4722 0.2388 0.0528  -0.0754 -0.1599 96  GLU A C     
794  O O     . GLU A 96  ? 0.4298 0.4839 0.2543 0.0478  -0.0850 -0.1567 96  GLU A O     
795  C CB    . GLU A 96  ? 0.5022 0.5296 0.3073 0.0626  -0.0846 -0.2117 96  GLU A CB    
796  C CG    . GLU A 96  ? 0.4935 0.5015 0.3394 0.0485  -0.0973 -0.2251 96  GLU A CG    
797  C CD    . GLU A 96  ? 0.4172 0.3978 0.2927 0.0348  -0.0848 -0.2004 96  GLU A CD    
798  O OE1   . GLU A 96  ? 0.3628 0.3223 0.2363 0.0360  -0.0712 -0.1894 96  GLU A OE1   
799  O OE2   . GLU A 96  ? 0.4160 0.3989 0.3166 0.0239  -0.0886 -0.1921 96  GLU A OE2   
800  N N     . HIS A 97  ? 0.3887 0.4113 0.2039 0.0489  -0.0596 -0.1423 97  HIS A N     
801  C CA    . HIS A 97  ? 0.3588 0.3696 0.1930 0.0392  -0.0524 -0.1205 97  HIS A CA    
802  C C     . HIS A 97  ? 0.3429 0.3701 0.1640 0.0429  -0.0459 -0.0960 97  HIS A C     
803  O O     . HIS A 97  ? 0.3289 0.3575 0.1341 0.0474  -0.0355 -0.0838 97  HIS A O     
804  C CB    . HIS A 97  ? 0.3290 0.3091 0.1751 0.0332  -0.0410 -0.1141 97  HIS A CB    
805  C CG    . HIS A 97  ? 0.3098 0.2779 0.1742 0.0240  -0.0339 -0.0972 97  HIS A CG    
806  N ND1   . HIS A 97  ? 0.2833 0.2517 0.1395 0.0247  -0.0241 -0.0776 97  HIS A ND1   
807  C CD2   . HIS A 97  ? 0.3243 0.2819 0.2161 0.0146  -0.0346 -0.0977 97  HIS A CD2   
808  C CE1   . HIS A 97  ? 0.2892 0.2476 0.1628 0.0179  -0.0188 -0.0691 97  HIS A CE1   
809  N NE2   . HIS A 97  ? 0.3022 0.2556 0.1976 0.0116  -0.0237 -0.0792 97  HIS A NE2   
810  N N     . PRO A 98  ? 0.3503 0.3883 0.1843 0.0404  -0.0518 -0.0878 98  PRO A N     
811  C CA    . PRO A 98  ? 0.3493 0.4018 0.1750 0.0456  -0.0480 -0.0649 98  PRO A CA    
812  C C     . PRO A 98  ? 0.3087 0.3409 0.1406 0.0414  -0.0326 -0.0460 98  PRO A C     
813  O O     . PRO A 98  ? 0.2802 0.2908 0.1286 0.0338  -0.0267 -0.0477 98  PRO A O     
814  C CB    . PRO A 98  ? 0.3637 0.4294 0.2109 0.0440  -0.0596 -0.0646 98  PRO A CB    
815  C CG    . PRO A 98  ? 0.3506 0.3984 0.2264 0.0329  -0.0603 -0.0789 98  PRO A CG    
816  C CD    . PRO A 98  ? 0.3624 0.3993 0.2265 0.0325  -0.0618 -0.0981 98  PRO A CD    
817  N N     . TYR A 99  ? 0.3118 0.3524 0.1303 0.0468  -0.0263 -0.0284 99  TYR A N     
818  C CA    . TYR A 99  ? 0.2875 0.3111 0.1141 0.0433  -0.0144 -0.0119 99  TYR A CA    
819  C C     . TYR A 99  ? 0.3120 0.3505 0.1312 0.0495  -0.0112 0.0099  99  TYR A C     
820  O O     . TYR A 99  ? 0.3532 0.4165 0.1550 0.0575  -0.0166 0.0130  99  TYR A O     
821  C CB    . TYR A 99  ? 0.2619 0.2685 0.0848 0.0390  -0.0066 -0.0181 99  TYR A CB    
822  C CG    . TYR A 99  ? 0.2723 0.2934 0.0782 0.0444  -0.0038 -0.0194 99  TYR A CG    
823  C CD1   . TYR A 99  ? 0.2672 0.2910 0.0737 0.0441  0.0055  -0.0043 99  TYR A CD1   
824  C CD2   . TYR A 99  ? 0.2975 0.3305 0.0902 0.0499  -0.0099 -0.0372 99  TYR A CD2   
825  C CE1   . TYR A 99  ? 0.2973 0.3392 0.0920 0.0496  0.0110  -0.0042 99  TYR A CE1   
826  C CE2   . TYR A 99  ? 0.3179 0.3670 0.0945 0.0572  -0.0050 -0.0401 99  TYR A CE2   
827  C CZ    . TYR A 99  ? 0.3224 0.3777 0.1002 0.0573  0.0066  -0.0223 99  TYR A CZ    
828  O OH    . TYR A 99  ? 0.3389 0.4145 0.1047 0.0651  0.0140  -0.0240 99  TYR A OH    
829  N N     . VAL A 100 ? 0.2990 0.3224 0.1314 0.0462  -0.0027 0.0250  100 VAL A N     
830  C CA    . VAL A 100 ? 0.3274 0.3602 0.1597 0.0503  0.0022  0.0493  100 VAL A CA    
831  C C     . VAL A 100 ? 0.3179 0.3383 0.1572 0.0439  0.0128  0.0549  100 VAL A C     
832  O O     . VAL A 100 ? 0.2892 0.2868 0.1414 0.0368  0.0148  0.0458  100 VAL A O     
833  C CB    . VAL A 100 ? 0.3382 0.3651 0.1897 0.0533  -0.0001 0.0647  100 VAL A CB    
834  C CG1   . VAL A 100 ? 0.3166 0.3179 0.1882 0.0474  0.0018  0.0529  100 VAL A CG1   
835  C CG2   . VAL A 100 ? 0.3629 0.3882 0.2233 0.0551  0.0075  0.0925  100 VAL A CG2   
836  N N     . HIS A 101 ? 0.3510 0.3902 0.1812 0.0469  0.0193  0.0691  101 HIS A N     
837  C CA    . HIS A 101 ? 0.3515 0.3859 0.1955 0.0403  0.0295  0.0778  101 HIS A CA    
838  C C     . HIS A 101 ? 0.3789 0.4089 0.2437 0.0386  0.0355  0.1063  101 HIS A C     
839  O O     . HIS A 101 ? 0.4175 0.4612 0.2745 0.0465  0.0350  0.1253  101 HIS A O     
840  C CB    . HIS A 101 ? 0.3725 0.4334 0.1990 0.0450  0.0357  0.0763  101 HIS A CB    
841  C CG    . HIS A 101 ? 0.4058 0.4706 0.2520 0.0386  0.0472  0.0887  101 HIS A CG    
842  N ND1   . HIS A 101 ? 0.3965 0.4413 0.2653 0.0287  0.0460  0.0784  101 HIS A ND1   
843  C CD2   . HIS A 101 ? 0.4623 0.5517 0.3109 0.0407  0.0600  0.1108  101 HIS A CD2   
844  C CE1   . HIS A 101 ? 0.4225 0.4793 0.3118 0.0238  0.0557  0.0921  101 HIS A CE1   
845  N NE2   . HIS A 101 ? 0.4598 0.5437 0.3388 0.0305  0.0661  0.1131  101 HIS A NE2   
846  N N     . GLY A 102 ? 0.3619 0.3716 0.2545 0.0287  0.0397  0.1093  102 GLY A N     
847  C CA    . GLY A 102 ? 0.3939 0.3927 0.3128 0.0262  0.0442  0.1342  102 GLY A CA    
848  C C     . GLY A 102 ? 0.3972 0.3762 0.3504 0.0135  0.0478  0.1338  102 GLY A C     
849  O O     . GLY A 102 ? 0.3737 0.3550 0.3283 0.0073  0.0473  0.1176  102 GLY A O     
850  N N     . VAL A 103 ? 0.4301 0.3894 0.4138 0.0102  0.0498  0.1513  103 VAL A N     
851  C CA    . VAL A 103 ? 0.4491 0.3884 0.4725 -0.0030 0.0516  0.1517  103 VAL A CA    
852  C C     . VAL A 103 ? 0.4708 0.3726 0.5202 -0.0044 0.0457  0.1453  103 VAL A C     
853  O O     . VAL A 103 ? 0.5020 0.3963 0.5560 0.0038  0.0466  0.1622  103 VAL A O     
854  C CB    . VAL A 103 ? 0.4930 0.4507 0.5387 -0.0082 0.0645  0.1849  103 VAL A CB    
855  C CG1   . VAL A 103 ? 0.5531 0.4832 0.6526 -0.0211 0.0661  0.1959  103 VAL A CG1   
856  C CG2   . VAL A 103 ? 0.4690 0.4562 0.5048 -0.0114 0.0697  0.1782  103 VAL A CG2   
857  N N     . VAL A 104 ? 0.4638 0.3435 0.5282 -0.0127 0.0389  0.1189  104 VAL A N     
858  C CA    . VAL A 104 ? 0.5021 0.3451 0.5969 -0.0152 0.0342  0.1093  104 VAL A CA    
859  C C     . VAL A 104 ? 0.5443 0.3753 0.6806 -0.0309 0.0324  0.1068  104 VAL A C     
860  O O     . VAL A 104 ? 0.5262 0.3714 0.6585 -0.0386 0.0287  0.0925  104 VAL A O     
861  C CB    . VAL A 104 ? 0.4696 0.2968 0.5429 -0.0098 0.0262  0.0744  104 VAL A CB    
862  C CG1   . VAL A 104 ? 0.5076 0.2981 0.6118 -0.0123 0.0214  0.0582  104 VAL A CG1   
863  C CG2   . VAL A 104 ? 0.4580 0.2949 0.5040 0.0038  0.0279  0.0777  104 VAL A CG2   
864  N N     . LYS A 105 ? 0.6079 0.4129 0.7883 -0.0356 0.0341  0.1207  105 LYS A N     
865  C CA    . LYS A 105 ? 0.6615 0.4520 0.8933 -0.0527 0.0316  0.1199  105 LYS A CA    
866  C C     . LYS A 105 ? 0.6463 0.4718 0.8811 -0.0632 0.0355  0.1277  105 LYS A C     
867  O O     . LYS A 105 ? 0.6412 0.4679 0.8883 -0.0733 0.0257  0.1029  105 LYS A O     
868  C CB    . LYS A 105 ? 0.6802 0.4378 0.9244 -0.0566 0.0168  0.0780  105 LYS A CB    
869  C CG    . LYS A 105 ? 0.7062 0.4312 0.9484 -0.0440 0.0149  0.0665  105 LYS A CG    
870  C CD    . LYS A 105 ? 0.7853 0.4691 1.0716 -0.0513 0.0051  0.0415  105 LYS A CD    
871  C CE    . LYS A 105 ? 0.8399 0.4921 1.1344 -0.0366 0.0075  0.0396  105 LYS A CE    
872  N NZ    . LYS A 105 ? 0.9519 0.5587 1.3031 -0.0431 0.0006  0.0244  105 LYS A NZ    
873  N N     . GLY A 106 ? 0.6452 0.5017 0.8663 -0.0587 0.0495  0.1612  106 GLY A N     
874  C CA    . GLY A 106 ? 0.6512 0.5442 0.8793 -0.0662 0.0579  0.1740  106 GLY A CA    
875  C C     . GLY A 106 ? 0.5976 0.5143 0.7902 -0.0629 0.0514  0.1464  106 GLY A C     
876  O O     . GLY A 106 ? 0.5995 0.5466 0.8035 -0.0684 0.0574  0.1530  106 GLY A O     
877  N N     . VAL A 107 ? 0.5566 0.4608 0.7097 -0.0534 0.0403  0.1175  107 VAL A N     
878  C CA    . VAL A 107 ? 0.5126 0.4357 0.6318 -0.0489 0.0342  0.0944  107 VAL A CA    
879  C C     . VAL A 107 ? 0.4770 0.4114 0.5444 -0.0335 0.0371  0.0932  107 VAL A C     
880  O O     . VAL A 107 ? 0.4741 0.3925 0.5263 -0.0259 0.0362  0.0939  107 VAL A O     
881  C CB    . VAL A 107 ? 0.5066 0.4109 0.6303 -0.0544 0.0169  0.0586  107 VAL A CB    
882  C CG1   . VAL A 107 ? 0.5568 0.4269 0.7180 -0.0633 0.0096  0.0506  107 VAL A CG1   
883  C CG2   . VAL A 107 ? 0.4525 0.3521 0.5257 -0.0425 0.0098  0.0350  107 VAL A CG2   
884  N N     . GLU A 108 ? 0.4631 0.4259 0.5085 -0.0289 0.0401  0.0904  108 GLU A N     
885  C CA    . GLU A 108 ? 0.4407 0.4175 0.4422 -0.0156 0.0425  0.0884  108 GLU A CA    
886  C C     . GLU A 108 ? 0.3994 0.3580 0.3733 -0.0103 0.0319  0.0627  108 GLU A C     
887  O O     . GLU A 108 ? 0.3858 0.3340 0.3608 -0.0139 0.0233  0.0427  108 GLU A O     
888  C CB    . GLU A 108 ? 0.4393 0.4503 0.4303 -0.0114 0.0496  0.0912  108 GLU A CB    
889  C CG    . GLU A 108 ? 0.5063 0.5442 0.4981 -0.0076 0.0650  0.1209  108 GLU A CG    
890  C CD    . GLU A 108 ? 0.5604 0.6339 0.5537 -0.0049 0.0752  0.1239  108 GLU A CD    
891  O OE1   . GLU A 108 ? 0.6072 0.7075 0.5743 0.0062  0.0856  0.1345  108 GLU A OE1   
892  O OE2   . GLU A 108 ? 0.5661 0.6429 0.5866 -0.0126 0.0722  0.1141  108 GLU A OE2   
893  N N     . VAL A 109 ? 0.3871 0.3447 0.3372 -0.0014 0.0326  0.0651  109 VAL A N     
894  C CA    . VAL A 109 ? 0.3541 0.2969 0.2823 0.0034  0.0258  0.0455  109 VAL A CA    
895  C C     . VAL A 109 ? 0.3354 0.2952 0.2350 0.0123  0.0261  0.0434  109 VAL A C     
896  O O     . VAL A 109 ? 0.3559 0.3349 0.2490 0.0175  0.0302  0.0584  109 VAL A O     
897  C CB    . VAL A 109 ? 0.3665 0.2864 0.3054 0.0043  0.0245  0.0466  109 VAL A CB    
898  C CG1   . VAL A 109 ? 0.3367 0.2418 0.2587 0.0076  0.0200  0.0253  109 VAL A CG1   
899  C CG2   . VAL A 109 ? 0.3941 0.2963 0.3673 -0.0041 0.0244  0.0513  109 VAL A CG2   
900  N N     . ASP A 110 ? 0.3037 0.2568 0.1869 0.0142  0.0212  0.0249  110 ASP A N     
901  C CA    . ASP A 110 ? 0.2896 0.2510 0.1534 0.0206  0.0192  0.0191  110 ASP A CA    
902  C C     . ASP A 110 ? 0.2749 0.2187 0.1387 0.0207  0.0167  0.0109  110 ASP A C     
903  O O     . ASP A 110 ? 0.2714 0.1992 0.1332 0.0181  0.0158  -0.0001 110 ASP A O     
904  C CB    . ASP A 110 ? 0.2793 0.2482 0.1298 0.0229  0.0174  0.0065  110 ASP A CB    
905  C CG    . ASP A 110 ? 0.3286 0.3234 0.1721 0.0282  0.0211  0.0121  110 ASP A CG    
906  O OD1   . ASP A 110 ? 0.3622 0.3637 0.1993 0.0314  0.0208  0.0016  110 ASP A OD1   
907  O OD2   . ASP A 110 ? 0.3907 0.4002 0.2343 0.0307  0.0250  0.0277  110 ASP A OD2   
908  N N     . VAL A 111 ? 0.2784 0.2275 0.1448 0.0248  0.0160  0.0175  111 VAL A N     
909  C CA    . VAL A 111 ? 0.2650 0.2040 0.1347 0.0258  0.0153  0.0097  111 VAL A CA    
910  C C     . VAL A 111 ? 0.2597 0.2119 0.1210 0.0279  0.0108  0.0022  111 VAL A C     
911  O O     . VAL A 111 ? 0.2717 0.2433 0.1285 0.0320  0.0059  0.0065  111 VAL A O     
912  C CB    . VAL A 111 ? 0.2776 0.2083 0.1658 0.0288  0.0174  0.0185  111 VAL A CB    
913  C CG1   . VAL A 111 ? 0.2980 0.2330 0.1961 0.0297  0.0182  0.0366  111 VAL A CG1   
914  C CG2   . VAL A 111 ? 0.2716 0.2122 0.1662 0.0339  0.0151  0.0183  111 VAL A CG2   
915  N N     . VAL A 112 ? 0.2463 0.1877 0.1051 0.0249  0.0120  -0.0093 112 VAL A N     
916  C CA    . VAL A 112 ? 0.2534 0.2015 0.1090 0.0243  0.0077  -0.0184 112 VAL A CA    
917  C C     . VAL A 112 ? 0.2608 0.2045 0.1302 0.0221  0.0101  -0.0217 112 VAL A C     
918  O O     . VAL A 112 ? 0.2680 0.1976 0.1384 0.0206  0.0179  -0.0215 112 VAL A O     
919  C CB    . VAL A 112 ? 0.2459 0.1846 0.0902 0.0225  0.0082  -0.0261 112 VAL A CB    
920  C CG1   . VAL A 112 ? 0.2639 0.2049 0.1097 0.0219  0.0032  -0.0367 112 VAL A CG1   
921  C CG2   . VAL A 112 ? 0.2376 0.1844 0.0738 0.0249  0.0079  -0.0224 112 VAL A CG2   
922  N N     . PRO A 113 ? 0.2752 0.2336 0.1561 0.0220  0.0035  -0.0255 113 PRO A N     
923  C CA    . PRO A 113 ? 0.2808 0.2377 0.1818 0.0183  0.0074  -0.0277 113 PRO A CA    
924  C C     . PRO A 113 ? 0.2831 0.2294 0.1851 0.0121  0.0082  -0.0358 113 PRO A C     
925  O O     . PRO A 113 ? 0.2852 0.2317 0.1780 0.0121  0.0007  -0.0437 113 PRO A O     
926  C CB    . PRO A 113 ? 0.3006 0.2813 0.2192 0.0206  -0.0032 -0.0283 113 PRO A CB    
927  C CG    . PRO A 113 ? 0.3084 0.3015 0.2079 0.0247  -0.0144 -0.0315 113 PRO A CG    
928  C CD    . PRO A 113 ? 0.2941 0.2733 0.1710 0.0255  -0.0079 -0.0288 113 PRO A CD    
929  N N     . CYS A 114 ? 0.2862 0.2232 0.1998 0.0079  0.0185  -0.0328 114 CYS A N     
930  C CA    . CYS A 114 ? 0.3025 0.2280 0.2236 0.0014  0.0207  -0.0355 114 CYS A CA    
931  C C     . CYS A 114 ? 0.3199 0.2472 0.2655 -0.0037 0.0327  -0.0287 114 CYS A C     
932  O O     . CYS A 114 ? 0.3207 0.2580 0.2738 -0.0003 0.0397  -0.0239 114 CYS A O     
933  C CB    . CYS A 114 ? 0.2973 0.2026 0.1931 0.0033  0.0253  -0.0326 114 CYS A CB    
934  S SG    . CYS A 114 ? 0.3110 0.2046 0.1944 0.0049  0.0423  -0.0211 114 CYS A SG    
935  N N     . TYR A 115 ? 0.3410 0.2579 0.3008 -0.0110 0.0366  -0.0269 115 TYR A N     
936  C CA    . TYR A 115 ? 0.3662 0.2852 0.3510 -0.0169 0.0521  -0.0162 115 TYR A CA    
937  C C     . TYR A 115 ? 0.3813 0.2849 0.3408 -0.0133 0.0702  -0.0023 115 TYR A C     
938  O O     . TYR A 115 ? 0.3857 0.2706 0.3205 -0.0112 0.0689  0.0005  115 TYR A O     
939  C CB    . TYR A 115 ? 0.3942 0.3103 0.4154 -0.0284 0.0475  -0.0190 115 TYR A CB    
940  C CG    . TYR A 115 ? 0.3947 0.3290 0.4428 -0.0322 0.0282  -0.0355 115 TYR A CG    
941  C CD1   . TYR A 115 ? 0.4006 0.3302 0.4352 -0.0300 0.0103  -0.0516 115 TYR A CD1   
942  C CD2   . TYR A 115 ? 0.4112 0.3704 0.4983 -0.0368 0.0275  -0.0358 115 TYR A CD2   
943  C CE1   . TYR A 115 ? 0.3993 0.3484 0.4528 -0.0318 -0.0089 -0.0689 115 TYR A CE1   
944  C CE2   . TYR A 115 ? 0.4145 0.3936 0.5248 -0.0394 0.0064  -0.0520 115 TYR A CE2   
945  C CZ    . TYR A 115 ? 0.4090 0.3826 0.4993 -0.0367 -0.0121 -0.0690 115 TYR A CZ    
946  O OH    . TYR A 115 ? 0.4410 0.4368 0.5483 -0.0375 -0.0343 -0.0869 115 TYR A OH    
947  N N     . LYS A 116 ? 0.3996 0.3134 0.3653 -0.0111 0.0869  0.0059  116 LYS A N     
948  C CA    . LYS A 116 ? 0.4377 0.3421 0.3784 -0.0067 0.1058  0.0189  116 LYS A CA    
949  C C     . LYS A 116 ? 0.4892 0.3869 0.4506 -0.0157 0.1175  0.0349  116 LYS A C     
950  O O     . LYS A 116 ? 0.5121 0.4245 0.5153 -0.0236 0.1273  0.0411  116 LYS A O     
951  C CB    . LYS A 116 ? 0.4498 0.3698 0.3897 0.0010  0.1209  0.0194  116 LYS A CB    
952  C CG    . LYS A 116 ? 0.4922 0.4086 0.4031 0.0080  0.1426  0.0304  116 LYS A CG    
953  C CD    . LYS A 116 ? 0.4925 0.4118 0.3778 0.0209  0.1455  0.0185  116 LYS A CD    
954  C CE    . LYS A 116 ? 0.5581 0.4792 0.4123 0.0307  0.1677  0.0245  116 LYS A CE    
955  N NZ    . LYS A 116 ? 0.5764 0.5190 0.4545 0.0367  0.1869  0.0231  116 LYS A NZ    
956  N N     . LEU A 117 ? 0.5152 0.3913 0.4519 -0.0145 0.1165  0.0432  117 LEU A N     
957  C CA    . LEU A 117 ? 0.5736 0.4371 0.5314 -0.0229 0.1264  0.0617  117 LEU A CA    
958  C C     . LEU A 117 ? 0.6357 0.4916 0.5582 -0.0155 0.1457  0.0841  117 LEU A C     
959  O O     . LEU A 117 ? 0.6323 0.4873 0.5073 -0.0033 0.1450  0.0806  117 LEU A O     
960  C CB    . LEU A 117 ? 0.5606 0.4034 0.5289 -0.0275 0.1078  0.0547  117 LEU A CB    
961  C CG    . LEU A 117 ? 0.5136 0.3641 0.5056 -0.0320 0.0863  0.0300  117 LEU A CG    
962  C CD1   . LEU A 117 ? 0.5193 0.3484 0.5166 -0.0335 0.0708  0.0213  117 LEU A CD1   
963  C CD2   . LEU A 117 ? 0.5152 0.3857 0.5580 -0.0432 0.0880  0.0262  117 LEU A CD2   
964  N N     . LYS A 118 ? 0.7062 0.5582 0.6528 -0.0229 0.1631  0.1075  118 LYS A N     
965  C CA    . LYS A 118 ? 0.7804 0.6247 0.6901 -0.0148 0.1810  0.1331  118 LYS A CA    
966  C C     . LYS A 118 ? 0.8053 0.6207 0.7017 -0.0131 0.1684  0.1425  118 LYS A C     
967  O O     . LYS A 118 ? 0.8321 0.6397 0.6798 -0.0006 0.1690  0.1532  118 LYS A O     
968  C CB    . LYS A 118 ? 0.8504 0.7083 0.7882 -0.0213 0.2110  0.1595  118 LYS A CB    
969  C CG    . LYS A 118 ? 0.8900 0.7451 0.9006 -0.0408 0.2139  0.1686  118 LYS A CG    
970  C CD    . LYS A 118 ? 0.9957 0.8235 1.0188 -0.0469 0.2212  0.1988  118 LYS A CD    
971  C CE    . LYS A 118 ? 1.0850 0.9139 1.0647 -0.0361 0.2488  0.2350  118 LYS A CE    
972  N NZ    . LYS A 118 ? 1.1302 0.9897 1.1237 -0.0378 0.2820  0.2535  118 LYS A NZ    
973  N N     . GLU A 119 ? 0.8060 0.6066 0.7469 -0.0244 0.1553  0.1361  119 GLU A N     
974  C CA    . GLU A 119 ? 0.8321 0.6041 0.7690 -0.0218 0.1410  0.1396  119 GLU A CA    
975  C C     . GLU A 119 ? 0.7740 0.5419 0.7262 -0.0237 0.1152  0.1075  119 GLU A C     
976  O O     . GLU A 119 ? 0.7547 0.5324 0.7465 -0.0345 0.1094  0.0906  119 GLU A O     
977  C CB    . GLU A 119 ? 0.9126 0.6639 0.8926 -0.0326 0.1526  0.1660  119 GLU A CB    
978  C CG    . GLU A 119 ? 1.0070 0.7601 0.9691 -0.0292 0.1805  0.2055  119 GLU A CG    
979  C CD    . GLU A 119 ? 1.0656 0.8071 0.9665 -0.0110 0.1786  0.2226  119 GLU A CD    
980  O OE1   . GLU A 119 ? 1.0185 0.7620 0.8813 0.0005  0.1591  0.2009  119 GLU A OE1   
981  O OE2   . GLU A 119 ? 1.1631 0.8955 1.0554 -0.0082 0.1967  0.2598  119 GLU A OE2   
982  N N     . PRO A 120 ? 0.7565 0.5133 0.6775 -0.0124 0.0998  0.0991  120 PRO A N     
983  C CA    . PRO A 120 ? 0.7172 0.4689 0.6528 -0.0125 0.0784  0.0721  120 PRO A CA    
984  C C     . PRO A 120 ? 0.7648 0.4899 0.7423 -0.0188 0.0719  0.0717  120 PRO A C     
985  O O     . PRO A 120 ? 0.7447 0.4651 0.7320 -0.0168 0.0551  0.0476  120 PRO A O     
986  C CB    . PRO A 120 ? 0.6899 0.4420 0.5809 0.0024  0.0679  0.0673  120 PRO A CB    
987  C CG    . PRO A 120 ? 0.7407 0.4868 0.6006 0.0101  0.0795  0.0946  120 PRO A CG    
988  C CD    . PRO A 120 ? 0.7769 0.5295 0.6474 0.0021  0.1013  0.1137  120 PRO A CD    
989  N N     . LYS A 121 ? 0.8362 0.5439 0.8387 -0.0258 0.0860  0.0981  121 LYS A N     
990  C CA    . LYS A 121 ? 0.8899 0.5708 0.9464 -0.0361 0.0815  0.0969  121 LYS A CA    
991  C C     . LYS A 121 ? 0.8672 0.5645 0.9679 -0.0517 0.0765  0.0740  121 LYS A C     
992  O O     . LYS A 121 ? 0.8603 0.5797 0.9718 -0.0601 0.0903  0.0836  121 LYS A O     
993  C CB    . LYS A 121 ? 0.9786 0.6386 1.0543 -0.0411 0.1009  0.1366  121 LYS A CB    
994  C CG    . LYS A 121 ? 1.0283 0.6774 1.0559 -0.0246 0.1076  0.1659  121 LYS A CG    
995  C CD    . LYS A 121 ? 1.0891 0.7030 1.1281 -0.0158 0.0939  0.1673  121 LYS A CD    
996  C CE    . LYS A 121 ? 1.1726 0.7707 1.1828 -0.0040 0.1075  0.2143  121 LYS A CE    
997  N NZ    . LYS A 121 ? 1.1953 0.7630 1.2102 0.0105  0.0885  0.2097  121 LYS A NZ    
998  N N     . ASN A 122 ? 0.8581 0.5469 0.9838 -0.0541 0.0564  0.0430  122 ASN A N     
999  C CA    . ASN A 122 ? 0.8283 0.5390 0.9835 -0.0645 0.0440  0.0134  122 ASN A CA    
1000 C C     . ASN A 122 ? 0.7491 0.4965 0.8670 -0.0582 0.0427  0.0037  122 ASN A C     
1001 O O     . ASN A 122 ? 0.7358 0.4969 0.8275 -0.0546 0.0586  0.0240  122 ASN A O     
1002 C CB    . ASN A 122 ? 0.8816 0.5924 1.0990 -0.0845 0.0521  0.0226  122 ASN A CB    
1003 C CG    . ASN A 122 ? 0.9692 0.6403 1.2337 -0.0930 0.0513  0.0299  122 ASN A CG    
1004 O OD1   . ASN A 122 ? 0.9984 0.6478 1.2707 -0.0884 0.0332  0.0052  122 ASN A OD1   
1005 N ND2   . ASN A 122 ? 1.0234 0.6846 1.3216 -0.1047 0.0722  0.0645  122 ASN A ND2   
1006 N N     . ILE A 123 ? 0.7041 0.4671 0.8198 -0.0559 0.0240  -0.0275 123 ILE A N     
1007 C CA    . ILE A 123 ? 0.6206 0.4107 0.6941 -0.0455 0.0201  -0.0362 123 ILE A CA    
1008 C C     . ILE A 123 ? 0.5946 0.4101 0.6855 -0.0498 0.0041  -0.0620 123 ILE A C     
1009 O O     . ILE A 123 ? 0.6219 0.4319 0.7296 -0.0511 -0.0123 -0.0862 123 ILE A O     
1010 C CB    . ILE A 123 ? 0.6034 0.3824 0.6356 -0.0302 0.0141  -0.0417 123 ILE A CB    
1011 C CG1   . ILE A 123 ? 0.5893 0.3650 0.5856 -0.0225 0.0283  -0.0165 123 ILE A CG1   
1012 C CG2   . ILE A 123 ? 0.5628 0.3643 0.5713 -0.0219 0.0004  -0.0651 123 ILE A CG2   
1013 C CD1   . ILE A 123 ? 0.5656 0.3422 0.5242 -0.0083 0.0211  -0.0230 123 ILE A CD1   
1014 N N     . LYS A 124 ? 0.5501 0.3937 0.6377 -0.0506 0.0080  -0.0578 124 LYS A N     
1015 C CA    . LYS A 124 ? 0.5358 0.4064 0.6389 -0.0528 -0.0091 -0.0795 124 LYS A CA    
1016 C C     . LYS A 124 ? 0.5043 0.3843 0.5669 -0.0395 -0.0229 -0.0972 124 LYS A C     
1017 O O     . LYS A 124 ? 0.5351 0.4154 0.6029 -0.0382 -0.0398 -0.1214 124 LYS A O     
1018 C CB    . LYS A 124 ? 0.5161 0.4151 0.6343 -0.0562 -0.0017 -0.0688 124 LYS A CB    
1019 C CG    . LYS A 124 ? 0.5602 0.4708 0.7397 -0.0716 -0.0050 -0.0722 124 LYS A CG    
1020 C CD    . LYS A 124 ? 0.5367 0.4856 0.7329 -0.0710 -0.0118 -0.0763 124 LYS A CD    
1021 C CE    . LYS A 124 ? 0.5858 0.5500 0.8511 -0.0875 -0.0153 -0.0792 124 LYS A CE    
1022 N NZ    . LYS A 124 ? 0.5797 0.5841 0.8660 -0.0854 -0.0219 -0.0810 124 LYS A NZ    
1023 N N     . SER A 125 ? 0.4512 0.3392 0.4746 -0.0294 -0.0152 -0.0857 125 SER A N     
1024 C CA    . SER A 125 ? 0.4239 0.3231 0.4117 -0.0174 -0.0249 -0.0975 125 SER A CA    
1025 C C     . SER A 125 ? 0.4266 0.3036 0.3955 -0.0106 -0.0239 -0.1011 125 SER A C     
1026 O O     . SER A 125 ? 0.4466 0.2984 0.4301 -0.0147 -0.0179 -0.0945 125 SER A O     
1027 C CB    . SER A 125 ? 0.3782 0.2936 0.3403 -0.0108 -0.0177 -0.0835 125 SER A CB    
1028 O OG    . SER A 125 ? 0.3567 0.2557 0.2965 -0.0070 -0.0049 -0.0689 125 SER A OG    
1029 N N     . ALA A 126 ? 0.4070 0.2946 0.3459 0.0005  -0.0289 -0.1097 126 ALA A N     
1030 C CA    . ALA A 126 ? 0.4056 0.2771 0.3300 0.0088  -0.0273 -0.1129 126 ALA A CA    
1031 C C     . ALA A 126 ? 0.3676 0.2352 0.2693 0.0133  -0.0158 -0.0926 126 ALA A C     
1032 O O     . ALA A 126 ? 0.3766 0.2314 0.2703 0.0199  -0.0141 -0.0913 126 ALA A O     
1033 C CB    . ALA A 126 ? 0.4217 0.3088 0.3298 0.0191  -0.0371 -0.1345 126 ALA A CB    
1034 N N     . VAL A 127 ? 0.3321 0.2106 0.2260 0.0104  -0.0093 -0.0785 127 VAL A N     
1035 C CA    . VAL A 127 ? 0.3026 0.1788 0.1753 0.0145  -0.0013 -0.0639 127 VAL A CA    
1036 C C     . VAL A 127 ? 0.3059 0.1682 0.1802 0.0099  0.0092  -0.0476 127 VAL A C     
1037 O O     . VAL A 127 ? 0.2933 0.1546 0.1490 0.0130  0.0144  -0.0381 127 VAL A O     
1038 C CB    . VAL A 127 ? 0.2716 0.1694 0.1298 0.0178  -0.0016 -0.0618 127 VAL A CB    
1039 C CG1   . VAL A 127 ? 0.2836 0.1995 0.1377 0.0230  -0.0100 -0.0752 127 VAL A CG1   
1040 C CG2   . VAL A 127 ? 0.2564 0.1618 0.1230 0.0128  0.0021  -0.0546 127 VAL A CG2   
1041 N N     . ASP A 128 ? 0.3276 0.1801 0.2250 0.0025  0.0124  -0.0450 128 ASP A N     
1042 C CA    . ASP A 128 ? 0.3408 0.1852 0.2410 -0.0018 0.0257  -0.0278 128 ASP A CA    
1043 C C     . ASP A 128 ? 0.3538 0.1812 0.2318 0.0038  0.0320  -0.0135 128 ASP A C     
1044 O O     . ASP A 128 ? 0.3791 0.2030 0.2500 0.0029  0.0442  0.0015  128 ASP A O     
1045 C CB    . ASP A 128 ? 0.3785 0.2178 0.3157 -0.0122 0.0288  -0.0262 128 ASP A CB    
1046 C CG    . ASP A 128 ? 0.3898 0.2517 0.3499 -0.0180 0.0249  -0.0350 128 ASP A CG    
1047 O OD1   . ASP A 128 ? 0.3828 0.2620 0.3282 -0.0134 0.0252  -0.0353 128 ASP A OD1   
1048 O OD2   . ASP A 128 ? 0.4188 0.2811 0.4152 -0.0272 0.0205  -0.0413 128 ASP A OD2   
1049 N N     . ARG A 129 ? 0.3457 0.1653 0.2124 0.0110  0.0240  -0.0177 129 ARG A N     
1050 C CA    . ARG A 129 ? 0.3543 0.1600 0.2021 0.0177  0.0266  -0.0036 129 ARG A CA    
1051 C C     . ARG A 129 ? 0.3261 0.1439 0.1453 0.0237  0.0247  -0.0039 129 ARG A C     
1052 O O     . ARG A 129 ? 0.3462 0.1588 0.1441 0.0291  0.0265  0.0071  129 ARG A O     
1053 C CB    . ARG A 129 ? 0.3753 0.1676 0.2305 0.0242  0.0177  -0.0080 129 ARG A CB    
1054 C CG    . ARG A 129 ? 0.3940 0.1662 0.2801 0.0196  0.0178  -0.0083 129 ARG A CG    
1055 C CD    . ARG A 129 ? 0.3974 0.1553 0.2879 0.0298  0.0094  -0.0130 129 ARG A CD    
1056 N NE    . ARG A 129 ? 0.4320 0.1704 0.3567 0.0263  0.0056  -0.0232 129 ARG A NE    
1057 C CZ    . ARG A 129 ? 0.4259 0.1712 0.3646 0.0261  -0.0032 -0.0498 129 ARG A CZ    
1058 N NH1   . ARG A 129 ? 0.3749 0.1476 0.2952 0.0295  -0.0074 -0.0648 129 ARG A NH1   
1059 N NH2   . ARG A 129 ? 0.4924 0.2166 0.4638 0.0228  -0.0080 -0.0614 129 ARG A NH2   
1060 N N     . THR A 130 ? 0.2858 0.1202 0.1055 0.0229  0.0200  -0.0163 130 THR A N     
1061 C CA    . THR A 130 ? 0.2704 0.1152 0.0723 0.0271  0.0160  -0.0188 130 THR A CA    
1062 C C     . THR A 130 ? 0.2846 0.1276 0.0665 0.0278  0.0222  -0.0120 130 THR A C     
1063 O O     . THR A 130 ? 0.2992 0.1420 0.0630 0.0331  0.0169  -0.0111 130 THR A O     
1064 C CB    . THR A 130 ? 0.2360 0.0977 0.0459 0.0252  0.0124  -0.0288 130 THR A CB    
1065 O OG1   . THR A 130 ? 0.2553 0.1210 0.0759 0.0277  0.0068  -0.0370 130 THR A OG1   
1066 C CG2   . THR A 130 ? 0.2213 0.0916 0.0212 0.0272  0.0090  -0.0299 130 THR A CG2   
1067 N N     . PRO A 131 ? 0.2891 0.1329 0.0750 0.0237  0.0327  -0.0089 131 PRO A N     
1068 C CA    . PRO A 131 ? 0.3087 0.1517 0.0715 0.0274  0.0390  -0.0057 131 PRO A CA    
1069 C C     . PRO A 131 ? 0.3579 0.1904 0.0996 0.0326  0.0431  0.0079  131 PRO A C     
1070 O O     . PRO A 131 ? 0.3893 0.2226 0.1020 0.0390  0.0426  0.0080  131 PRO A O     
1071 C CB    . PRO A 131 ? 0.3049 0.1544 0.0806 0.0236  0.0507  -0.0062 131 PRO A CB    
1072 C CG    . PRO A 131 ? 0.2936 0.1452 0.0991 0.0169  0.0512  -0.0046 131 PRO A CG    
1073 C CD    . PRO A 131 ? 0.2836 0.1317 0.0941 0.0170  0.0387  -0.0094 131 PRO A CD    
1074 N N     . PHE A 132 ? 0.3693 0.1916 0.1252 0.0305  0.0458  0.0190  132 PHE A N     
1075 C CA    . PHE A 132 ? 0.4207 0.2307 0.1594 0.0365  0.0484  0.0368  132 PHE A CA    
1076 C C     . PHE A 132 ? 0.4300 0.2385 0.1531 0.0454  0.0326  0.0350  132 PHE A C     
1077 O O     . PHE A 132 ? 0.4788 0.2840 0.1746 0.0539  0.0312  0.0473  132 PHE A O     
1078 C CB    . PHE A 132 ? 0.4370 0.2325 0.2035 0.0314  0.0540  0.0493  132 PHE A CB    
1079 C CG    . PHE A 132 ? 0.4438 0.2415 0.2302 0.0225  0.0703  0.0566  132 PHE A CG    
1080 C CD1   . PHE A 132 ? 0.4144 0.2166 0.2376 0.0126  0.0686  0.0447  132 PHE A CD1   
1081 C CD2   . PHE A 132 ? 0.4769 0.2755 0.2462 0.0246  0.0875  0.0755  132 PHE A CD2   
1082 C CE1   . PHE A 132 ? 0.4281 0.2362 0.2770 0.0038  0.0823  0.0511  132 PHE A CE1   
1083 C CE2   . PHE A 132 ? 0.4931 0.2979 0.2870 0.0161  0.1047  0.0834  132 PHE A CE2   
1084 C CZ    . PHE A 132 ? 0.4711 0.2810 0.3082 0.0051  0.1014  0.0711  132 PHE A CZ    
1085 N N     . HIS A 133 ? 0.3880 0.2014 0.1294 0.0443  0.0210  0.0210  133 HIS A N     
1086 C CA    . HIS A 133 ? 0.3937 0.2112 0.1291 0.0524  0.0064  0.0176  133 HIS A CA    
1087 C C     . HIS A 133 ? 0.4073 0.2355 0.1155 0.0563  0.0005  0.0135  133 HIS A C     
1088 O O     . HIS A 133 ? 0.4510 0.2793 0.1386 0.0652  -0.0079 0.0206  133 HIS A O     
1089 C CB    . HIS A 133 ? 0.3478 0.1761 0.1064 0.0500  -0.0008 0.0019  133 HIS A CB    
1090 C CG    . HIS A 133 ? 0.3520 0.1711 0.1350 0.0498  0.0000  0.0002  133 HIS A CG    
1091 N ND1   . HIS A 133 ? 0.3001 0.1294 0.1010 0.0470  -0.0018 -0.0145 133 HIS A ND1   
1092 C CD2   . HIS A 133 ? 0.3853 0.1849 0.1779 0.0524  0.0022  0.0104  133 HIS A CD2   
1093 C CE1   . HIS A 133 ? 0.3308 0.1478 0.1497 0.0485  -0.0020 -0.0173 133 HIS A CE1   
1094 N NE2   . HIS A 133 ? 0.3689 0.1658 0.1866 0.0509  0.0004  -0.0023 133 HIS A NE2   
1095 N N     . HIS A 134 ? 0.3768 0.2136 0.0862 0.0501  0.0036  0.0011  134 HIS A N     
1096 C CA    . HIS A 134 ? 0.3885 0.2335 0.0792 0.0522  -0.0033 -0.0090 134 HIS A CA    
1097 C C     . HIS A 134 ? 0.4538 0.2947 0.1079 0.0599  0.0003  -0.0006 134 HIS A C     
1098 O O     . HIS A 134 ? 0.4965 0.3428 0.1282 0.0674  -0.0126 -0.0033 134 HIS A O     
1099 C CB    . HIS A 134 ? 0.3584 0.2072 0.0599 0.0449  0.0029  -0.0207 134 HIS A CB    
1100 C CG    . HIS A 134 ? 0.3823 0.2354 0.0693 0.0465  -0.0042 -0.0343 134 HIS A CG    
1101 N ND1   . HIS A 134 ? 0.3845 0.2459 0.0842 0.0443  -0.0191 -0.0451 134 HIS A ND1   
1102 C CD2   . HIS A 134 ? 0.4372 0.2874 0.0990 0.0505  0.0008  -0.0404 134 HIS A CD2   
1103 C CE1   . HIS A 134 ? 0.4446 0.3058 0.1306 0.0454  -0.0248 -0.0588 134 HIS A CE1   
1104 N NE2   . HIS A 134 ? 0.4912 0.3454 0.1513 0.0503  -0.0130 -0.0577 134 HIS A NE2   
1105 N N     . LYS A 135 ? 0.4691 0.3031 0.1175 0.0587  0.0179  0.0102  135 LYS A N     
1106 C CA    . LYS A 135 ? 0.5395 0.3721 0.1507 0.0670  0.0265  0.0222  135 LYS A CA    
1107 C C     . LYS A 135 ? 0.5828 0.4117 0.1747 0.0770  0.0162  0.0388  135 LYS A C     
1108 O O     . LYS A 135 ? 0.6451 0.4799 0.1976 0.0874  0.0104  0.0409  135 LYS A O     
1109 C CB    . LYS A 135 ? 0.5482 0.3763 0.1695 0.0621  0.0497  0.0353  135 LYS A CB    
1110 C CG    . LYS A 135 ? 0.6373 0.4688 0.2227 0.0699  0.0663  0.0478  135 LYS A CG    
1111 C CD    . LYS A 135 ? 0.6442 0.4715 0.2532 0.0631  0.0892  0.0686  135 LYS A CD    
1112 C CE    . LYS A 135 ? 0.7333 0.5560 0.3163 0.0706  0.1014  0.0989  135 LYS A CE    
1113 N NZ    . LYS A 135 ? 0.8099 0.6462 0.3484 0.0809  0.1170  0.1012  135 LYS A NZ    
1114 N N     . TRP A 136 ? 0.5574 0.3773 0.1768 0.0753  0.0123  0.0488  136 TRP A N     
1115 C CA    . TRP A 136 ? 0.5950 0.4098 0.2046 0.0861  0.0011  0.0652  136 TRP A CA    
1116 C C     . TRP A 136 ? 0.6041 0.4337 0.2041 0.0935  -0.0223 0.0517  136 TRP A C     
1117 O O     . TRP A 136 ? 0.6646 0.4978 0.2378 0.1058  -0.0334 0.0629  136 TRP A O     
1118 C CB    . TRP A 136 ? 0.5620 0.3614 0.2098 0.0834  0.0024  0.0746  136 TRP A CB    
1119 C CG    . TRP A 136 ? 0.6110 0.3993 0.2494 0.0958  -0.0032 0.0986  136 TRP A CG    
1120 C CD1   . TRP A 136 ? 0.6634 0.4365 0.2910 0.0991  0.0100  0.1272  136 TRP A CD1   
1121 C CD2   . TRP A 136 ? 0.6155 0.4088 0.2561 0.1075  -0.0232 0.0987  136 TRP A CD2   
1122 N NE1   . TRP A 136 ? 0.7202 0.4855 0.3414 0.1128  -0.0009 0.1467  136 TRP A NE1   
1123 C CE2   . TRP A 136 ? 0.6766 0.4550 0.3057 0.1189  -0.0223 0.1286  136 TRP A CE2   
1124 C CE3   . TRP A 136 ? 0.5836 0.3942 0.2386 0.1096  -0.0410 0.0782  136 TRP A CE3   
1125 C CZ2   . TRP A 136 ? 0.7202 0.4999 0.3512 0.1338  -0.0402 0.1377  136 TRP A CZ2   
1126 C CZ3   . TRP A 136 ? 0.6213 0.4362 0.2805 0.1235  -0.0581 0.0859  136 TRP A CZ3   
1127 C CH2   . TRP A 136 ? 0.6954 0.4946 0.3420 0.1363  -0.0585 0.1149  136 TRP A CH2   
1128 N N     . LEU A 137 ? 0.5527 0.3924 0.1769 0.0857  -0.0298 0.0293  137 LEU A N     
1129 C CA    . LEU A 137 ? 0.5590 0.4152 0.1896 0.0890  -0.0512 0.0154  137 LEU A CA    
1130 C C     . LEU A 137 ? 0.5978 0.4659 0.2009 0.0900  -0.0610 -0.0008 137 LEU A C     
1131 O O     . LEU A 137 ? 0.6378 0.5190 0.2288 0.0976  -0.0811 -0.0059 137 LEU A O     
1132 C CB    . LEU A 137 ? 0.4836 0.3462 0.1562 0.0794  -0.0516 0.0018  137 LEU A CB    
1133 C CG    . LEU A 137 ? 0.4721 0.3451 0.1740 0.0840  -0.0636 0.0010  137 LEU A CG    
1134 C CD1   . LEU A 137 ? 0.4906 0.3541 0.1892 0.0971  -0.0677 0.0198  137 LEU A CD1   
1135 C CD2   . LEU A 137 ? 0.4119 0.2862 0.1466 0.0751  -0.0535 -0.0069 137 LEU A CD2   
1136 N N     . GLU A 138 ? 0.5938 0.4574 0.1898 0.0830  -0.0478 -0.0107 138 GLU A N     
1137 C CA    . GLU A 138 ? 0.6382 0.5082 0.2119 0.0833  -0.0538 -0.0308 138 GLU A CA    
1138 C C     . GLU A 138 ? 0.7223 0.6026 0.2550 0.0961  -0.0718 -0.0338 138 GLU A C     
1139 O O     . GLU A 138 ? 0.7457 0.6374 0.2802 0.0953  -0.0915 -0.0556 138 GLU A O     
1140 C CB    . GLU A 138 ? 0.6452 0.5060 0.2041 0.0814  -0.0313 -0.0300 138 GLU A CB    
1141 C CG    . GLU A 138 ? 0.6808 0.5423 0.2417 0.0769  -0.0310 -0.0545 138 GLU A CG    
1142 C CD    . GLU A 138 ? 0.7669 0.6232 0.3051 0.0806  -0.0088 -0.0526 138 GLU A CD    
1143 O OE1   . GLU A 138 ? 0.7980 0.6513 0.3479 0.0767  -0.0028 -0.0697 138 GLU A OE1   
1144 O OE2   . GLU A 138 ? 0.8089 0.6645 0.3205 0.0879  0.0038  -0.0323 138 GLU A OE2   
1145 N N     . GLY A 139 ? 0.7774 0.6545 0.2747 0.1079  -0.0658 -0.0112 139 GLY A N     
1146 C CA    . GLY A 139 ? 0.8630 0.7520 0.3137 0.1229  -0.0828 -0.0101 139 GLY A CA    
1147 C C     . GLY A 139 ? 0.8778 0.7769 0.3394 0.1307  -0.1060 0.0000  139 GLY A C     
1148 O O     . GLY A 139 ? 0.9427 0.8582 0.3779 0.1410  -0.1294 -0.0080 139 GLY A O     
1149 N N     . ARG A 140 ? 0.8241 0.7148 0.3258 0.1269  -0.1007 0.0157  140 ARG A N     
1150 C CA    . ARG A 140 ? 0.8453 0.7436 0.3607 0.1373  -0.1189 0.0294  140 ARG A CA    
1151 C C     . ARG A 140 ? 0.8071 0.7237 0.3681 0.1316  -0.1387 0.0095  140 ARG A C     
1152 O O     . ARG A 140 ? 0.8369 0.7661 0.4119 0.1415  -0.1567 0.0167  140 ARG A O     
1153 C CB    . ARG A 140 ? 0.8264 0.7041 0.3600 0.1397  -0.1024 0.0578  140 ARG A CB    
1154 C CG    . ARG A 140 ? 0.8788 0.7425 0.3704 0.1486  -0.0871 0.0864  140 ARG A CG    
1155 C CD    . ARG A 140 ? 0.8407 0.6803 0.3602 0.1474  -0.0705 0.1118  140 ARG A CD    
1156 N NE    . ARG A 140 ? 0.8126 0.6372 0.3268 0.1376  -0.0428 0.1202  140 ARG A NE    
1157 C CZ    . ARG A 140 ? 0.8836 0.6971 0.3711 0.1434  -0.0265 0.1500  140 ARG A CZ    
1158 N NH1   . ARG A 140 ? 0.9646 0.7780 0.4235 0.1602  -0.0355 0.1766  140 ARG A NH1   
1159 N NH2   . ARG A 140 ? 0.8685 0.6729 0.3603 0.1327  -0.0007 0.1554  140 ARG A NH2   
1160 N N     . ILE A 141 ? 0.7506 0.6700 0.3369 0.1163  -0.1347 -0.0136 141 ILE A N     
1161 C CA    . ILE A 141 ? 0.7088 0.6459 0.3442 0.1084  -0.1477 -0.0290 141 ILE A CA    
1162 C C     . ILE A 141 ? 0.7466 0.7036 0.3819 0.1051  -0.1712 -0.0539 141 ILE A C     
1163 O O     . ILE A 141 ? 0.7323 0.7092 0.4103 0.0997  -0.1858 -0.0645 141 ILE A O     
1164 C CB    . ILE A 141 ? 0.6266 0.5548 0.2982 0.0934  -0.1275 -0.0341 141 ILE A CB    
1165 C CG1   . ILE A 141 ? 0.5876 0.5315 0.3097 0.0911  -0.1317 -0.0345 141 ILE A CG1   
1166 C CG2   . ILE A 141 ? 0.6098 0.5357 0.2799 0.0808  -0.1240 -0.0549 141 ILE A CG2   
1167 C CD1   . ILE A 141 ? 0.6134 0.5605 0.3417 0.1061  -0.1383 -0.0176 141 ILE A CD1   
1168 N N     . LYS A 142 ? 0.8033 0.7557 0.3926 0.1085  -0.1743 -0.0642 142 LYS A N     
1169 C CA    . LYS A 142 ? 0.8537 0.8200 0.4397 0.1046  -0.1965 -0.0937 142 LYS A CA    
1170 C C     . LYS A 142 ? 0.9075 0.9024 0.5104 0.1104  -0.2297 -0.1009 142 LYS A C     
1171 O O     . LYS A 142 ? 0.9685 0.9733 0.5418 0.1273  -0.2431 -0.0860 142 LYS A O     
1172 C CB    . LYS A 142 ? 0.9254 0.8833 0.4489 0.1131  -0.1941 -0.1027 142 LYS A CB    
1173 C CG    . LYS A 142 ? 0.8900 0.8277 0.4125 0.1031  -0.1702 -0.1132 142 LYS A CG    
1174 C CD    . LYS A 142 ? 0.9847 0.9228 0.4684 0.1073  -0.1797 -0.1419 142 LYS A CD    
1175 C CE    . LYS A 142 ? 0.9589 0.8800 0.4670 0.0942  -0.1642 -0.1609 142 LYS A CE    
1176 N NZ    . LYS A 142 ? 0.9033 0.8077 0.4154 0.0915  -0.1311 -0.1378 142 LYS A NZ    
1177 N N     . GLY A 143 ? 0.8908 0.8998 0.5444 0.0963  -0.2429 -0.1223 143 GLY A N     
1178 C CA    . GLY A 143 ? 0.9429 0.9835 0.6255 0.0981  -0.2757 -0.1335 143 GLY A CA    
1179 C C     . GLY A 143 ? 0.9055 0.9628 0.6373 0.1003  -0.2745 -0.1138 143 GLY A C     
1180 O O     . GLY A 143 ? 0.9450 1.0329 0.7098 0.1030  -0.3003 -0.1193 143 GLY A O     
1181 N N     . LYS A 144 ? 0.6664 0.5271 0.3088 -0.0218 0.0346  -0.1104 144 LYS A N     
1182 C CA    . LYS A 144 ? 0.5987 0.4874 0.2758 -0.0242 0.0196  -0.0985 144 LYS A CA    
1183 C C     . LYS A 144 ? 0.5446 0.4273 0.2559 -0.0250 0.0270  -0.0947 144 LYS A C     
1184 O O     . LYS A 144 ? 0.4940 0.3955 0.2338 -0.0246 0.0191  -0.0843 144 LYS A O     
1185 C CB    . LYS A 144 ? 0.5659 0.4733 0.2482 -0.0125 0.0178  -0.0782 144 LYS A CB    
1186 C CG    . LYS A 144 ? 0.6381 0.5447 0.2833 -0.0065 0.0193  -0.0759 144 LYS A CG    
1187 C CD    . LYS A 144 ? 0.7148 0.6400 0.3432 -0.0114 -0.0028 -0.0790 144 LYS A CD    
1188 C CE    . LYS A 144 ? 0.7332 0.6725 0.3557 -0.0003 -0.0061 -0.0584 144 LYS A CE    
1189 N NZ    . LYS A 144 ? 0.7678 0.6932 0.3695 0.0099  0.0139  -0.0480 144 LYS A NZ    
1190 N N     . GLU A 145 ? 0.5614 0.4157 0.2670 -0.0243 0.0432  -0.1026 145 GLU A N     
1191 C CA    . GLU A 145 ? 0.5149 0.3603 0.2476 -0.0224 0.0517  -0.0970 145 GLU A CA    
1192 C C     . GLU A 145 ? 0.4831 0.3404 0.2376 -0.0356 0.0395  -0.1000 145 GLU A C     
1193 O O     . GLU A 145 ? 0.4327 0.2984 0.2125 -0.0320 0.0401  -0.0887 145 GLU A O     
1194 C CB    . GLU A 145 ? 0.5626 0.3710 0.2819 -0.0190 0.0713  -0.1058 145 GLU A CB    
1195 C CG    . GLU A 145 ? 0.6388 0.4261 0.3195 -0.0214 0.0768  -0.1225 145 GLU A CG    
1196 C CD    . GLU A 145 ? 0.6642 0.4524 0.3307 -0.0044 0.0898  -0.1135 145 GLU A CD    
1197 O OE1   . GLU A 145 ? 0.6207 0.4148 0.3097 0.0096  0.1008  -0.0975 145 GLU A OE1   
1198 O OE2   . GLU A 145 ? 0.7202 0.5051 0.3531 -0.0051 0.0891  -0.1223 145 GLU A OE2   
1199 N N     . ASN A 146 ? 0.5182 0.3782 0.2626 -0.0509 0.0284  -0.1153 146 ASN A N     
1200 C CA    . ASN A 146 ? 0.5052 0.3788 0.2744 -0.0648 0.0192  -0.1186 146 ASN A CA    
1201 C C     . ASN A 146 ? 0.4463 0.3574 0.2372 -0.0606 0.0048  -0.1057 146 ASN A C     
1202 O O     . ASN A 146 ? 0.4223 0.3459 0.2401 -0.0647 0.0030  -0.1012 146 ASN A O     
1203 C CB    . ASN A 146 ? 0.5776 0.4453 0.3345 -0.0851 0.0111  -0.1402 146 ASN A CB    
1204 C CG    . ASN A 146 ? 0.6388 0.4609 0.3777 -0.0911 0.0282  -0.1542 146 ASN A CG    
1205 O OD1   . ASN A 146 ? 0.6299 0.4286 0.3782 -0.0833 0.0457  -0.1461 146 ASN A OD1   
1206 N ND2   . ASN A 146 ? 0.7148 0.5222 0.4252 -0.1037 0.0233  -0.1751 146 ASN A ND2   
1207 N N     . GLU A 147 ? 0.4334 0.3594 0.2112 -0.0512 -0.0032 -0.0990 147 GLU A N     
1208 C CA    . GLU A 147 ? 0.3785 0.3327 0.1738 -0.0432 -0.0137 -0.0846 147 GLU A CA    
1209 C C     . GLU A 147 ? 0.3229 0.2714 0.1371 -0.0332 -0.0034 -0.0712 147 GLU A C     
1210 O O     . GLU A 147 ? 0.2903 0.2534 0.1269 -0.0320 -0.0073 -0.0646 147 GLU A O     
1211 C CB    . GLU A 147 ? 0.3903 0.3535 0.1637 -0.0344 -0.0209 -0.0783 147 GLU A CB    
1212 C CG    . GLU A 147 ? 0.4436 0.4172 0.1940 -0.0423 -0.0352 -0.0902 147 GLU A CG    
1213 C CD    . GLU A 147 ? 0.4590 0.4617 0.2319 -0.0527 -0.0523 -0.0956 147 GLU A CD    
1214 O OE1   . GLU A 147 ? 0.4151 0.4364 0.2185 -0.0481 -0.0551 -0.0848 147 GLU A OE1   
1215 O OE2   . GLU A 147 ? 0.5231 0.5312 0.2833 -0.0658 -0.0630 -0.1115 147 GLU A OE2   
1216 N N     . VAL A 148 ? 0.3204 0.2490 0.1251 -0.0257 0.0100  -0.0677 148 VAL A N     
1217 C CA    . VAL A 148 ? 0.2855 0.2103 0.1066 -0.0168 0.0179  -0.0561 148 VAL A CA    
1218 C C     . VAL A 148 ? 0.2801 0.1996 0.1175 -0.0220 0.0218  -0.0579 148 VAL A C     
1219 O O     . VAL A 148 ? 0.2484 0.1779 0.1018 -0.0180 0.0194  -0.0495 148 VAL A O     
1220 C CB    . VAL A 148 ? 0.2976 0.2055 0.1096 -0.0080 0.0321  -0.0527 148 VAL A CB    
1221 C CG1   . VAL A 148 ? 0.2675 0.1772 0.0984 0.0010  0.0366  -0.0405 148 VAL A CG1   
1222 C CG2   . VAL A 148 ? 0.3146 0.2276 0.1102 -0.0032 0.0319  -0.0495 148 VAL A CG2   
1223 N N     . ARG A 149 ? 0.3228 0.2237 0.1537 -0.0312 0.0288  -0.0691 149 ARG A N     
1224 C CA    . ARG A 149 ? 0.3275 0.2183 0.1720 -0.0370 0.0360  -0.0696 149 ARG A CA    
1225 C C     . ARG A 149 ? 0.3143 0.2304 0.1789 -0.0445 0.0263  -0.0686 149 ARG A C     
1226 O O     . ARG A 149 ? 0.2955 0.2128 0.1743 -0.0422 0.0316  -0.0610 149 ARG A O     
1227 C CB    . ARG A 149 ? 0.3814 0.2436 0.2143 -0.0480 0.0457  -0.0830 149 ARG A CB    
1228 C CG    . ARG A 149 ? 0.4029 0.2353 0.2190 -0.0369 0.0607  -0.0820 149 ARG A CG    
1229 C CD    . ARG A 149 ? 0.4667 0.2639 0.2709 -0.0485 0.0720  -0.0965 149 ARG A CD    
1230 N NE    . ARG A 149 ? 0.4819 0.2451 0.2723 -0.0355 0.0901  -0.0943 149 ARG A NE    
1231 C CZ    . ARG A 149 ? 0.5304 0.2712 0.2963 -0.0338 0.0975  -0.1061 149 ARG A CZ    
1232 N NH1   . ARG A 149 ? 0.5317 0.2808 0.2807 -0.0454 0.0864  -0.1212 149 ARG A NH1   
1233 N NH2   . ARG A 149 ? 0.5567 0.2673 0.3133 -0.0187 0.1162  -0.1024 149 ARG A NH2   
1234 N N     . LEU A 150 ? 0.3294 0.2672 0.1945 -0.0515 0.0125  -0.0753 150 LEU A N     
1235 C CA    . LEU A 150 ? 0.3217 0.2897 0.2093 -0.0554 0.0028  -0.0730 150 LEU A CA    
1236 C C     . LEU A 150 ? 0.2835 0.2628 0.1803 -0.0404 0.0019  -0.0588 150 LEU A C     
1237 O O     . LEU A 150 ? 0.2757 0.2646 0.1903 -0.0396 0.0052  -0.0541 150 LEU A O     
1238 C CB    . LEU A 150 ? 0.3399 0.3325 0.2250 -0.0620 -0.0141 -0.0807 150 LEU A CB    
1239 C CG    . LEU A 150 ? 0.3802 0.3744 0.2653 -0.0821 -0.0192 -0.0977 150 LEU A CG    
1240 C CD1   . LEU A 150 ? 0.3825 0.4081 0.2638 -0.0835 -0.0397 -0.1015 150 LEU A CD1   
1241 C CD2   . LEU A 150 ? 0.3662 0.3665 0.2806 -0.0966 -0.0129 -0.1007 150 LEU A CD2   
1242 N N     . LEU A 151 ? 0.2710 0.2474 0.1545 -0.0292 -0.0015 -0.0526 151 LEU A N     
1243 C CA    . LEU A 151 ? 0.2434 0.2256 0.1325 -0.0169 -0.0032 -0.0414 151 LEU A CA    
1244 C C     . LEU A 151 ? 0.2307 0.1978 0.1225 -0.0121 0.0075  -0.0360 151 LEU A C     
1245 O O     . LEU A 151 ? 0.2124 0.1852 0.1122 -0.0065 0.0077  -0.0308 151 LEU A O     
1246 C CB    . LEU A 151 ? 0.2387 0.2190 0.1140 -0.0094 -0.0081 -0.0362 151 LEU A CB    
1247 C CG    . LEU A 151 ? 0.2151 0.1945 0.0929 0.0007  -0.0097 -0.0260 151 LEU A CG    
1248 C CD1   . LEU A 151 ? 0.1973 0.1893 0.0875 0.0054  -0.0149 -0.0230 151 LEU A CD1   
1249 C CD2   . LEU A 151 ? 0.2224 0.1998 0.0874 0.0041  -0.0128 -0.0213 151 LEU A CD2   
1250 N N     . LYS A 152 ? 0.2472 0.1946 0.1301 -0.0129 0.0167  -0.0373 152 LYS A N     
1251 C CA    . LYS A 152 ? 0.2524 0.1863 0.1360 -0.0069 0.0260  -0.0309 152 LYS A CA    
1252 C C     . LYS A 152 ? 0.2710 0.2036 0.1637 -0.0124 0.0330  -0.0313 152 LYS A C     
1253 O O     . LYS A 152 ? 0.2710 0.2005 0.1638 -0.0055 0.0374  -0.0239 152 LYS A O     
1254 C CB    . LYS A 152 ? 0.2680 0.1819 0.1416 -0.0037 0.0351  -0.0306 152 LYS A CB    
1255 C CG    . LYS A 152 ? 0.2671 0.1846 0.1362 0.0045  0.0321  -0.0261 152 LYS A CG    
1256 C CD    . LYS A 152 ? 0.2898 0.1899 0.1521 0.0099  0.0436  -0.0253 152 LYS A CD    
1257 C CE    . LYS A 152 ? 0.2788 0.1884 0.1440 0.0189  0.0424  -0.0180 152 LYS A CE    
1258 N NZ    . LYS A 152 ? 0.3144 0.2100 0.1751 0.0264  0.0554  -0.0171 152 LYS A NZ    
1259 N N     . GLY A 153 ? 0.3011 0.2369 0.2010 -0.0257 0.0341  -0.0399 153 GLY A N     
1260 C CA    . GLY A 153 ? 0.3216 0.2606 0.2358 -0.0340 0.0419  -0.0399 153 GLY A CA    
1261 C C     . GLY A 153 ? 0.3055 0.2695 0.2334 -0.0288 0.0373  -0.0350 153 GLY A C     
1262 O O     . GLY A 153 ? 0.3031 0.2642 0.2329 -0.0235 0.0465  -0.0278 153 GLY A O     
1263 N N     . PHE A 154 ? 0.2985 0.2854 0.2330 -0.0287 0.0240  -0.0384 154 PHE A N     
1264 C CA    . PHE A 154 ? 0.2949 0.3044 0.2410 -0.0200 0.0187  -0.0338 154 PHE A CA    
1265 C C     . PHE A 154 ? 0.2775 0.2752 0.2118 -0.0055 0.0224  -0.0259 154 PHE A C     
1266 O O     . PHE A 154 ? 0.2838 0.2904 0.2250 0.0013  0.0266  -0.0223 154 PHE A O     
1267 C CB    . PHE A 154 ? 0.2972 0.3233 0.2427 -0.0172 0.0034  -0.0358 154 PHE A CB    
1268 C CG    . PHE A 154 ? 0.3060 0.3582 0.2680 -0.0088 -0.0022 -0.0318 154 PHE A CG    
1269 C CD1   . PHE A 154 ? 0.3356 0.4175 0.3236 -0.0159 -0.0039 -0.0344 154 PHE A CD1   
1270 C CD2   . PHE A 154 ? 0.3171 0.3645 0.2703 0.0060  -0.0060 -0.0256 154 PHE A CD2   
1271 C CE1   . PHE A 154 ? 0.3422 0.4511 0.3482 -0.0052 -0.0082 -0.0294 154 PHE A CE1   
1272 C CE2   . PHE A 154 ? 0.3367 0.4042 0.3038 0.0165  -0.0096 -0.0215 154 PHE A CE2   
1273 C CZ    . PHE A 154 ? 0.3410 0.4406 0.3350 0.0125  -0.0104 -0.0228 154 PHE A CZ    
1274 N N     . LEU A 155 ? 0.2629 0.2420 0.1797 -0.0006 0.0208  -0.0240 155 LEU A N     
1275 C CA    . LEU A 155 ? 0.2501 0.2197 0.1554 0.0107  0.0207  -0.0185 155 LEU A CA    
1276 C C     . LEU A 155 ? 0.2661 0.2237 0.1651 0.0130  0.0323  -0.0142 155 LEU A C     
1277 O O     . LEU A 155 ? 0.2775 0.2358 0.1724 0.0200  0.0361  -0.0114 155 LEU A O     
1278 C CB    . LEU A 155 ? 0.2360 0.1964 0.1304 0.0138  0.0138  -0.0172 155 LEU A CB    
1279 C CG    . LEU A 155 ? 0.2250 0.1943 0.1213 0.0148  0.0035  -0.0181 155 LEU A CG    
1280 C CD1   . LEU A 155 ? 0.2068 0.1697 0.0963 0.0134  0.0007  -0.0170 155 LEU A CD1   
1281 C CD2   . LEU A 155 ? 0.2086 0.1780 0.1034 0.0231  -0.0006 -0.0160 155 LEU A CD2   
1282 N N     . LYS A 156 ? 0.2829 0.2267 0.1782 0.0083  0.0393  -0.0133 156 LYS A N     
1283 C CA    . LYS A 156 ? 0.3162 0.2448 0.2024 0.0121  0.0514  -0.0064 156 LYS A CA    
1284 C C     . LYS A 156 ? 0.3339 0.2703 0.2286 0.0096  0.0617  -0.0047 156 LYS A C     
1285 O O     . LYS A 156 ? 0.3436 0.2772 0.2268 0.0190  0.0666  0.0008  156 LYS A O     
1286 C CB    . LYS A 156 ? 0.3414 0.2513 0.2255 0.0067  0.0598  -0.0059 156 LYS A CB    
1287 C CG    . LYS A 156 ? 0.3832 0.2731 0.2514 0.0171  0.0681  0.0045  156 LYS A CG    
1288 C CD    . LYS A 156 ? 0.4534 0.3213 0.3202 0.0135  0.0773  0.0044  156 LYS A CD    
1289 C CE    . LYS A 156 ? 0.4932 0.3468 0.3462 0.0287  0.0795  0.0150  156 LYS A CE    
1290 N NZ    . LYS A 156 ? 0.5528 0.3923 0.3932 0.0364  0.0907  0.0274  156 LYS A NZ    
1291 N N     . ALA A 157 ? 0.3384 0.2868 0.2535 -0.0033 0.0649  -0.0099 157 ALA A N     
1292 C CA    . ALA A 157 ? 0.3552 0.3171 0.2858 -0.0072 0.0759  -0.0078 157 ALA A CA    
1293 C C     . ALA A 157 ? 0.3415 0.3166 0.2689 0.0064  0.0739  -0.0053 157 ALA A C     
1294 O O     . ALA A 157 ? 0.3708 0.3458 0.2955 0.0115  0.0872  0.0004  157 ALA A O     
1295 C CB    . ALA A 157 ? 0.3654 0.3482 0.3236 -0.0235 0.0733  -0.0156 157 ALA A CB    
1296 N N     . ASN A 158 ? 0.3066 0.2893 0.2316 0.0128  0.0591  -0.0094 158 ASN A N     
1297 C CA    . ASN A 158 ? 0.3045 0.2934 0.2244 0.0259  0.0577  -0.0087 158 ASN A CA    
1298 C C     . ASN A 158 ? 0.3022 0.2694 0.1920 0.0372  0.0551  -0.0068 158 ASN A C     
1299 O O     . ASN A 158 ? 0.3027 0.2679 0.1831 0.0469  0.0499  -0.0093 158 ASN A O     
1300 C CB    . ASN A 158 ? 0.2891 0.2949 0.2219 0.0278  0.0444  -0.0129 158 ASN A CB    
1301 C CG    . ASN A 158 ? 0.3098 0.3457 0.2733 0.0220  0.0465  -0.0139 158 ASN A CG    
1302 O OD1   . ASN A 158 ? 0.3519 0.4021 0.3275 0.0285  0.0564  -0.0111 158 ASN A OD1   
1303 N ND2   . ASN A 158 ? 0.3093 0.3571 0.2857 0.0102  0.0372  -0.0180 158 ASN A ND2   
1304 N N     . GLY A 159 ? 0.3054 0.2558 0.1801 0.0361  0.0580  -0.0027 159 GLY A N     
1305 C CA    . GLY A 159 ? 0.3183 0.2525 0.1647 0.0463  0.0545  -0.0002 159 GLY A CA    
1306 C C     . GLY A 159 ? 0.2957 0.2264 0.1339 0.0490  0.0373  -0.0047 159 GLY A C     
1307 O O     . GLY A 159 ? 0.3080 0.2291 0.1245 0.0561  0.0319  -0.0050 159 GLY A O     
1308 N N     . ILE A 160 ? 0.2661 0.2048 0.1207 0.0424  0.0288  -0.0082 160 ILE A N     
1309 C CA    . ILE A 160 ? 0.2501 0.1861 0.1011 0.0429  0.0148  -0.0113 160 ILE A CA    
1310 C C     . ILE A 160 ? 0.2326 0.1701 0.0910 0.0369  0.0094  -0.0096 160 ILE A C     
1311 O O     . ILE A 160 ? 0.2183 0.1578 0.0810 0.0346  0.0006  -0.0113 160 ILE A O     
1312 C CB    . ILE A 160 ? 0.2490 0.1887 0.1062 0.0449  0.0099  -0.0159 160 ILE A CB    
1313 C CG1   . ILE A 160 ? 0.2368 0.1929 0.1146 0.0411  0.0134  -0.0157 160 ILE A CG1   
1314 C CG2   . ILE A 160 ? 0.2721 0.2026 0.1137 0.0544  0.0132  -0.0190 160 ILE A CG2   
1315 C CD1   . ILE A 160 ? 0.2293 0.1899 0.1135 0.0462  0.0078  -0.0171 160 ILE A CD1   
1316 N N     . TYR A 161 ? 0.2442 0.1787 0.1033 0.0353  0.0167  -0.0056 161 TYR A N     
1317 C CA    . TYR A 161 ? 0.2391 0.1730 0.1031 0.0328  0.0145  -0.0037 161 TYR A CA    
1318 C C     . TYR A 161 ? 0.2592 0.1902 0.1144 0.0399  0.0104  0.0019  161 TYR A C     
1319 O O     . TYR A 161 ? 0.2852 0.2094 0.1280 0.0463  0.0151  0.0067  161 TYR A O     
1320 C CB    . TYR A 161 ? 0.2460 0.1746 0.1156 0.0275  0.0253  -0.0037 161 TYR A CB    
1321 C CG    . TYR A 161 ? 0.2458 0.1705 0.1178 0.0271  0.0260  -0.0028 161 TYR A CG    
1322 C CD1   . TYR A 161 ? 0.2301 0.1627 0.1073 0.0240  0.0194  -0.0059 161 TYR A CD1   
1323 C CD2   . TYR A 161 ? 0.2770 0.1884 0.1448 0.0313  0.0355  0.0022  161 TYR A CD2   
1324 C CE1   . TYR A 161 ? 0.2424 0.1720 0.1209 0.0251  0.0230  -0.0049 161 TYR A CE1   
1325 C CE2   . TYR A 161 ? 0.2855 0.1924 0.1555 0.0337  0.0386  0.0030  161 TYR A CE2   
1326 C CZ    . TYR A 161 ? 0.2635 0.1807 0.1390 0.0304  0.0327  -0.0010 161 TYR A CZ    
1327 O OH    . TYR A 161 ? 0.2702 0.1838 0.1471 0.0340  0.0385  -0.0001 161 TYR A OH    
1328 N N     . GLY A 162 ? 0.2529 0.1911 0.1152 0.0391  0.0019  0.0023  162 GLY A N     
1329 C CA    . GLY A 162 ? 0.2700 0.2138 0.1306 0.0449  -0.0054 0.0076  162 GLY A CA    
1330 C C     . GLY A 162 ? 0.2755 0.2259 0.1358 0.0417  -0.0197 0.0034  162 GLY A C     
1331 O O     . GLY A 162 ? 0.2895 0.2327 0.1394 0.0404  -0.0223 -0.0026 162 GLY A O     
1332 N N     . ALA A 163 ? 0.2753 0.2389 0.1483 0.0402  -0.0279 0.0061  163 ALA A N     
1333 C CA    . ALA A 163 ? 0.2835 0.2530 0.1596 0.0335  -0.0420 0.0014  163 ALA A CA    
1334 C C     . ALA A 163 ? 0.3201 0.2951 0.1839 0.0379  -0.0545 0.0011  163 ALA A C     
1335 O O     . ALA A 163 ? 0.3491 0.3252 0.2102 0.0310  -0.0678 -0.0059 163 ALA A O     
1336 C CB    . ALA A 163 ? 0.2721 0.2563 0.1728 0.0265  -0.0438 0.0045  163 ALA A CB    
1337 N N     . GLU A 164 ? 0.3307 0.3075 0.1850 0.0491  -0.0508 0.0085  164 GLU A N     
1338 C CA    . GLU A 164 ? 0.3732 0.3576 0.2124 0.0554  -0.0640 0.0101  164 GLU A CA    
1339 C C     . GLU A 164 ? 0.3940 0.3624 0.2047 0.0533  -0.0702 -0.0007 164 GLU A C     
1340 O O     . GLU A 164 ? 0.3766 0.3271 0.1781 0.0519  -0.0595 -0.0059 164 GLU A O     
1341 C CB    . GLU A 164 ? 0.3912 0.3749 0.2205 0.0706  -0.0559 0.0226  164 GLU A CB    
1342 C CG    . GLU A 164 ? 0.4171 0.3766 0.2251 0.0754  -0.0390 0.0238  164 GLU A CG    
1343 C CD    . GLU A 164 ? 0.4305 0.3813 0.2541 0.0731  -0.0212 0.0266  164 GLU A CD    
1344 O OE1   . GLU A 164 ? 0.4625 0.3979 0.2753 0.0787  -0.0067 0.0324  164 GLU A OE1   
1345 O OE2   . GLU A 164 ? 0.4197 0.3779 0.2648 0.0651  -0.0215 0.0228  164 GLU A OE2   
1346 N N     . TYR A 165 ? 0.4335 0.4095 0.2300 0.0538  -0.0876 -0.0045 165 TYR A N     
1347 C CA    . TYR A 165 ? 0.4662 0.4239 0.2303 0.0526  -0.0937 -0.0168 165 TYR A CA    
1348 C C     . TYR A 165 ? 0.4739 0.4117 0.2078 0.0644  -0.0777 -0.0143 165 TYR A C     
1349 O O     . TYR A 165 ? 0.5077 0.4267 0.2174 0.0645  -0.0755 -0.0247 165 TYR A O     
1350 C CB    . TYR A 165 ? 0.5264 0.4966 0.2763 0.0508  -0.1172 -0.0222 165 TYR A CB    
1351 C CG    . TYR A 165 ? 0.5307 0.5146 0.3079 0.0333  -0.1333 -0.0306 165 TYR A CG    
1352 C CD1   . TYR A 165 ? 0.5476 0.5658 0.3507 0.0301  -0.1492 -0.0245 165 TYR A CD1   
1353 C CD2   . TYR A 165 ? 0.5170 0.4804 0.2971 0.0204  -0.1311 -0.0431 165 TYR A CD2   
1354 C CE1   . TYR A 165 ? 0.5518 0.5851 0.3849 0.0117  -0.1622 -0.0313 165 TYR A CE1   
1355 C CE2   . TYR A 165 ? 0.5375 0.5098 0.3432 0.0027  -0.1435 -0.0495 165 TYR A CE2   
1356 C CZ    . TYR A 165 ? 0.5565 0.5647 0.3898 -0.0029 -0.1587 -0.0438 165 TYR A CZ    
1357 O OH    . TYR A 165 ? 0.5814 0.6006 0.4443 -0.0228 -0.1695 -0.0495 165 TYR A OH    
1358 N N     . LYS A 166 ? 0.4552 0.3954 0.1908 0.0744  -0.0648 -0.0005 166 LYS A N     
1359 C CA    . LYS A 166 ? 0.4655 0.3879 0.1760 0.0838  -0.0473 0.0036  166 LYS A CA    
1360 C C     . LYS A 166 ? 0.4230 0.3349 0.1467 0.0778  -0.0315 -0.0016 166 LYS A C     
1361 O O     . LYS A 166 ? 0.4385 0.3375 0.1439 0.0821  -0.0197 -0.0041 166 LYS A O     
1362 C CB    . LYS A 166 ? 0.4750 0.3984 0.1836 0.0949  -0.0366 0.0207  166 LYS A CB    
1363 C CG    . LYS A 166 ? 0.5113 0.4171 0.1870 0.1054  -0.0211 0.0272  166 LYS A CG    
1364 C CD    . LYS A 166 ? 0.5256 0.4244 0.2093 0.1113  -0.0029 0.0431  166 LYS A CD    
1365 C CE    . LYS A 166 ? 0.5996 0.4818 0.2480 0.1234  0.0115  0.0543  166 LYS A CE    
1366 N NZ    . LYS A 166 ? 0.6322 0.5051 0.2863 0.1307  0.0255  0.0722  166 LYS A NZ    
1367 N N     . VAL A 167 ? 0.3739 0.2938 0.1295 0.0686  -0.0316 -0.0026 167 VAL A N     
1368 C CA    . VAL A 167 ? 0.3410 0.2563 0.1120 0.0634  -0.0196 -0.0061 167 VAL A CA    
1369 C C     . VAL A 167 ? 0.3425 0.2553 0.1208 0.0558  -0.0285 -0.0168 167 VAL A C     
1370 O O     . VAL A 167 ? 0.3439 0.2481 0.1195 0.0567  -0.0215 -0.0221 167 VAL A O     
1371 C CB    . VAL A 167 ? 0.2986 0.2213 0.0950 0.0595  -0.0118 0.0008  167 VAL A CB    
1372 C CG1   . VAL A 167 ? 0.2625 0.1841 0.0735 0.0538  -0.0019 -0.0029 167 VAL A CG1   
1373 C CG2   . VAL A 167 ? 0.3143 0.2333 0.1031 0.0671  -0.0022 0.0118  167 VAL A CG2   
1374 N N     . ARG A 168 ? 0.3530 0.2737 0.1424 0.0488  -0.0427 -0.0188 168 ARG A N     
1375 C CA    . ARG A 168 ? 0.3591 0.2749 0.1593 0.0396  -0.0494 -0.0265 168 ARG A CA    
1376 C C     . ARG A 168 ? 0.3273 0.2413 0.1433 0.0382  -0.0383 -0.0248 168 ARG A C     
1377 O O     . ARG A 168 ? 0.3388 0.2406 0.1515 0.0382  -0.0368 -0.0304 168 ARG A O     
1378 C CB    . ARG A 168 ? 0.4040 0.3016 0.1800 0.0397  -0.0566 -0.0385 168 ARG A CB    
1379 C CG    . ARG A 168 ? 0.4559 0.3580 0.2205 0.0357  -0.0739 -0.0432 168 ARG A CG    
1380 C CD    . ARG A 168 ? 0.5642 0.4447 0.2922 0.0403  -0.0770 -0.0554 168 ARG A CD    
1381 N NE    . ARG A 168 ? 0.6428 0.5243 0.3572 0.0328  -0.0978 -0.0648 168 ARG A NE    
1382 C CZ    . ARG A 168 ? 0.6592 0.5363 0.3862 0.0177  -0.1104 -0.0740 168 ARG A CZ    
1383 N NH1   . ARG A 168 ? 0.6145 0.4839 0.3658 0.0107  -0.1027 -0.0726 168 ARG A NH1   
1384 N NH2   . ARG A 168 ? 0.6777 0.5586 0.3930 0.0090  -0.1311 -0.0839 168 ARG A NH2   
1385 N N     . GLY A 169 ? 0.2991 0.2245 0.1306 0.0378  -0.0310 -0.0171 169 GLY A N     
1386 C CA    . GLY A 169 ? 0.2801 0.2076 0.1248 0.0358  -0.0228 -0.0158 169 GLY A CA    
1387 C C     . GLY A 169 ? 0.2644 0.2010 0.1264 0.0296  -0.0240 -0.0117 169 GLY A C     
1388 O O     . GLY A 169 ? 0.2752 0.2156 0.1436 0.0251  -0.0316 -0.0108 169 GLY A O     
1389 N N     . PHE A 170 ? 0.2510 0.1920 0.1204 0.0287  -0.0161 -0.0096 170 PHE A N     
1390 C CA    . PHE A 170 ? 0.2423 0.1892 0.1224 0.0239  -0.0153 -0.0069 170 PHE A CA    
1391 C C     . PHE A 170 ? 0.2453 0.1971 0.1299 0.0249  -0.0108 -0.0029 170 PHE A C     
1392 O O     . PHE A 170 ? 0.2525 0.2008 0.1332 0.0280  -0.0035 -0.0023 170 PHE A O     
1393 C CB    . PHE A 170 ? 0.2349 0.1838 0.1167 0.0225  -0.0110 -0.0086 170 PHE A CB    
1394 C CG    . PHE A 170 ? 0.2425 0.1889 0.1230 0.0244  -0.0151 -0.0100 170 PHE A CG    
1395 C CD1   . PHE A 170 ? 0.2509 0.1929 0.1265 0.0297  -0.0145 -0.0130 170 PHE A CD1   
1396 C CD2   . PHE A 170 ? 0.2507 0.1973 0.1331 0.0228  -0.0180 -0.0073 170 PHE A CD2   
1397 C CE1   . PHE A 170 ? 0.2834 0.2211 0.1583 0.0344  -0.0165 -0.0138 170 PHE A CE1   
1398 C CE2   . PHE A 170 ? 0.2761 0.2177 0.1569 0.0273  -0.0211 -0.0066 170 PHE A CE2   
1399 C CZ    . PHE A 170 ? 0.2821 0.2191 0.1603 0.0336  -0.0202 -0.0102 170 PHE A CZ    
1400 N N     . SER A 171 ? 0.2486 0.2077 0.1427 0.0228  -0.0135 0.0007  171 SER A N     
1401 C CA    . SER A 171 ? 0.2524 0.2181 0.1537 0.0266  -0.0077 0.0056  171 SER A CA    
1402 C C     . SER A 171 ? 0.2491 0.2090 0.1471 0.0261  0.0032  0.0040  171 SER A C     
1403 O O     . SER A 171 ? 0.2490 0.2064 0.1429 0.0213  0.0031  0.0005  171 SER A O     
1404 C CB    . SER A 171 ? 0.2582 0.2384 0.1757 0.0241  -0.0121 0.0104  171 SER A CB    
1405 O OG    . SER A 171 ? 0.2593 0.2410 0.1817 0.0198  -0.0060 0.0119  171 SER A OG    
1406 N N     . GLY A 172 ? 0.2588 0.2149 0.1567 0.0317  0.0122  0.0062  172 GLY A N     
1407 C CA    . GLY A 172 ? 0.2698 0.2169 0.1620 0.0306  0.0230  0.0025  172 GLY A CA    
1408 C C     . GLY A 172 ? 0.2693 0.2230 0.1632 0.0273  0.0243  0.0026  172 GLY A C     
1409 O O     . GLY A 172 ? 0.2740 0.2225 0.1570 0.0222  0.0254  -0.0029 172 GLY A O     
1410 N N     . TYR A 173 ? 0.2680 0.2352 0.1757 0.0300  0.0240  0.0098  173 TYR A N     
1411 C CA    . TYR A 173 ? 0.2729 0.2474 0.1840 0.0268  0.0274  0.0128  173 TYR A CA    
1412 C C     . TYR A 173 ? 0.2648 0.2367 0.1687 0.0190  0.0193  0.0113  173 TYR A C     
1413 O O     . TYR A 173 ? 0.2782 0.2468 0.1711 0.0171  0.0238  0.0112  173 TYR A O     
1414 C CB    . TYR A 173 ? 0.2801 0.2741 0.2145 0.0288  0.0275  0.0218  173 TYR A CB    
1415 C CG    . TYR A 173 ? 0.2949 0.2982 0.2370 0.0243  0.0336  0.0274  173 TYR A CG    
1416 C CD1   . TYR A 173 ? 0.3239 0.3254 0.2592 0.0294  0.0495  0.0288  173 TYR A CD1   
1417 C CD2   . TYR A 173 ? 0.2881 0.2994 0.2429 0.0149  0.0252  0.0316  173 TYR A CD2   
1418 C CE1   . TYR A 173 ? 0.3417 0.3517 0.2822 0.0259  0.0578  0.0360  173 TYR A CE1   
1419 C CE2   . TYR A 173 ? 0.3096 0.3276 0.2722 0.0098  0.0332  0.0390  173 TYR A CE2   
1420 C CZ    . TYR A 173 ? 0.3356 0.3543 0.2911 0.0157  0.0499  0.0421  173 TYR A CZ    
1421 O OH    . TYR A 173 ? 0.3551 0.3803 0.3167 0.0112  0.0603  0.0511  173 TYR A OH    
1422 N N     . LEU A 174 ? 0.2490 0.2205 0.1560 0.0161  0.0082  0.0103  174 LEU A N     
1423 C CA    . LEU A 174 ? 0.2471 0.2125 0.1464 0.0120  0.0018  0.0092  174 LEU A CA    
1424 C C     . LEU A 174 ? 0.2546 0.2147 0.1384 0.0126  0.0036  0.0040  174 LEU A C     
1425 O O     . LEU A 174 ? 0.2646 0.2237 0.1397 0.0115  0.0024  0.0060  174 LEU A O     
1426 C CB    . LEU A 174 ? 0.2394 0.2009 0.1405 0.0113  -0.0081 0.0067  174 LEU A CB    
1427 C CG    . LEU A 174 ? 0.2395 0.1930 0.1395 0.0080  -0.0141 0.0083  174 LEU A CG    
1428 C CD1   . LEU A 174 ? 0.2397 0.1848 0.1335 0.0110  -0.0203 0.0027  174 LEU A CD1   
1429 C CD2   . LEU A 174 ? 0.2283 0.1780 0.1199 0.0081  -0.0112 0.0125  174 LEU A CD2   
1430 N N     . CYS A 175 ? 0.2518 0.2092 0.1325 0.0139  0.0059  -0.0021 175 CYS A N     
1431 C CA    . CYS A 175 ? 0.2661 0.2212 0.1358 0.0113  0.0064  -0.0090 175 CYS A CA    
1432 C C     . CYS A 175 ? 0.2906 0.2437 0.1471 0.0104  0.0120  -0.0099 175 CYS A C     
1433 O O     . CYS A 175 ? 0.3104 0.2664 0.1555 0.0086  0.0071  -0.0114 175 CYS A O     
1434 C CB    . CYS A 175 ? 0.2674 0.2167 0.1382 0.0104  0.0108  -0.0148 175 CYS A CB    
1435 S SG    . CYS A 175 ? 0.2692 0.2211 0.1484 0.0117  0.0058  -0.0142 175 CYS A SG    
1436 N N     . GLU A 176 ? 0.2923 0.2415 0.1490 0.0134  0.0224  -0.0085 176 GLU A N     
1437 C CA    . GLU A 176 ? 0.3196 0.2649 0.1605 0.0144  0.0308  -0.0097 176 GLU A CA    
1438 C C     . GLU A 176 ? 0.3191 0.2706 0.1544 0.0140  0.0280  -0.0016 176 GLU A C     
1439 O O     . GLU A 176 ? 0.3517 0.3007 0.1655 0.0134  0.0281  -0.0039 176 GLU A O     
1440 C CB    . GLU A 176 ? 0.3386 0.2808 0.1850 0.0208  0.0449  -0.0071 176 GLU A CB    
1441 C CG    . GLU A 176 ? 0.3836 0.3091 0.2203 0.0227  0.0535  -0.0167 176 GLU A CG    
1442 C CD    . GLU A 176 ? 0.4259 0.3501 0.2790 0.0317  0.0621  -0.0111 176 GLU A CD    
1443 O OE1   . GLU A 176 ? 0.4768 0.3876 0.3221 0.0385  0.0763  -0.0141 176 GLU A OE1   
1444 O OE2   . GLU A 176 ? 0.4197 0.3554 0.2914 0.0332  0.0546  -0.0039 176 GLU A OE2   
1445 N N     . LEU A 177 ? 0.2878 0.2457 0.1403 0.0138  0.0252  0.0078  177 LEU A N     
1446 C CA    . LEU A 177 ? 0.2905 0.2496 0.1390 0.0127  0.0250  0.0174  177 LEU A CA    
1447 C C     . LEU A 177 ? 0.2940 0.2502 0.1274 0.0129  0.0146  0.0165  177 LEU A C     
1448 O O     . LEU A 177 ? 0.3245 0.2785 0.1406 0.0146  0.0160  0.0225  177 LEU A O     
1449 C CB    . LEU A 177 ? 0.2758 0.2388 0.1470 0.0095  0.0225  0.0254  177 LEU A CB    
1450 C CG    . LEU A 177 ? 0.2693 0.2430 0.1617 0.0089  0.0307  0.0300  177 LEU A CG    
1451 C CD1   . LEU A 177 ? 0.2541 0.2315 0.1673 0.0022  0.0234  0.0350  177 LEU A CD1   
1452 C CD2   . LEU A 177 ? 0.3044 0.2813 0.1906 0.0107  0.0458  0.0366  177 LEU A CD2   
1453 N N     . LEU A 178 ? 0.2632 0.2209 0.1033 0.0125  0.0048  0.0103  178 LEU A N     
1454 C CA    . LEU A 178 ? 0.2625 0.2229 0.0953 0.0146  -0.0056 0.0104  178 LEU A CA    
1455 C C     . LEU A 178 ? 0.2878 0.2530 0.1001 0.0143  -0.0081 0.0045  178 LEU A C     
1456 O O     . LEU A 178 ? 0.3211 0.2892 0.1182 0.0180  -0.0136 0.0101  178 LEU A O     
1457 C CB    . LEU A 178 ? 0.2316 0.1953 0.0789 0.0151  -0.0126 0.0054  178 LEU A CB    
1458 C CG    . LEU A 178 ? 0.2244 0.1807 0.0843 0.0162  -0.0134 0.0106  178 LEU A CG    
1459 C CD1   . LEU A 178 ? 0.2201 0.1783 0.0897 0.0176  -0.0170 0.0042  178 LEU A CD1   
1460 C CD2   . LEU A 178 ? 0.2377 0.1860 0.0930 0.0199  -0.0164 0.0202  178 LEU A CD2   
1461 N N     . ILE A 179 ? 0.2740 0.2383 0.0839 0.0100  -0.0042 -0.0068 179 ILE A N     
1462 C CA    . ILE A 179 ? 0.3000 0.2655 0.0884 0.0068  -0.0066 -0.0163 179 ILE A CA    
1463 C C     . ILE A 179 ? 0.3374 0.2978 0.1009 0.0108  -0.0007 -0.0099 179 ILE A C     
1464 O O     . ILE A 179 ? 0.3777 0.3435 0.1199 0.0122  -0.0089 -0.0099 179 ILE A O     
1465 C CB    . ILE A 179 ? 0.3061 0.2628 0.0951 0.0008  0.0003  -0.0297 179 ILE A CB    
1466 C CG1   . ILE A 179 ? 0.2797 0.2427 0.0898 -0.0041 -0.0057 -0.0350 179 ILE A CG1   
1467 C CG2   . ILE A 179 ? 0.3584 0.3085 0.1183 -0.0036 0.0010  -0.0418 179 ILE A CG2   
1468 C CD1   . ILE A 179 ? 0.2757 0.2578 0.0899 -0.0068 -0.0208 -0.0371 179 ILE A CD1   
1469 N N     . VAL A 180 ? 0.3333 0.2860 0.1002 0.0135  0.0134  -0.0028 180 VAL A N     
1470 C CA    . VAL A 180 ? 0.3735 0.3221 0.1176 0.0176  0.0222  0.0058  180 VAL A CA    
1471 C C     . VAL A 180 ? 0.3918 0.3438 0.1297 0.0213  0.0140  0.0192  180 VAL A C     
1472 O O     . VAL A 180 ? 0.4429 0.3937 0.1511 0.0250  0.0129  0.0228  180 VAL A O     
1473 C CB    . VAL A 180 ? 0.3710 0.3162 0.1266 0.0196  0.0401  0.0131  180 VAL A CB    
1474 C CG1   . VAL A 180 ? 0.4035 0.3457 0.1376 0.0237  0.0516  0.0249  180 VAL A CG1   
1475 C CG2   . VAL A 180 ? 0.3730 0.3123 0.1281 0.0201  0.0500  0.0012  180 VAL A CG2   
1476 N N     . PHE A 181 ? 0.3641 0.3176 0.1263 0.0213  0.0082  0.0264  181 PHE A N     
1477 C CA    . PHE A 181 ? 0.3902 0.3404 0.1475 0.0263  0.0030  0.0406  181 PHE A CA    
1478 C C     . PHE A 181 ? 0.4195 0.3790 0.1622 0.0318  -0.0128 0.0391  181 PHE A C     
1479 O O     . PHE A 181 ? 0.4610 0.4178 0.1858 0.0394  -0.0160 0.0519  181 PHE A O     
1480 C CB    . PHE A 181 ? 0.3560 0.3002 0.1415 0.0245  0.0023  0.0464  181 PHE A CB    
1481 C CG    . PHE A 181 ? 0.3881 0.3200 0.1685 0.0292  0.0021  0.0623  181 PHE A CG    
1482 C CD1   . PHE A 181 ? 0.4297 0.3511 0.2020 0.0277  0.0150  0.0760  181 PHE A CD1   
1483 C CD2   . PHE A 181 ? 0.3958 0.3251 0.1803 0.0358  -0.0089 0.0647  181 PHE A CD2   
1484 C CE1   . PHE A 181 ? 0.4679 0.3725 0.2343 0.0315  0.0167  0.0921  181 PHE A CE1   
1485 C CE2   . PHE A 181 ? 0.4336 0.3457 0.2117 0.0419  -0.0075 0.0803  181 PHE A CE2   
1486 C CZ    . PHE A 181 ? 0.4645 0.3623 0.2329 0.0390  0.0052  0.0942  181 PHE A CZ    
1487 N N     . TYR A 182 ? 0.4038 0.3756 0.1555 0.0283  -0.0223 0.0247  182 TYR A N     
1488 C CA    . TYR A 182 ? 0.4245 0.4128 0.1753 0.0324  -0.0389 0.0229  182 TYR A CA    
1489 C C     . TYR A 182 ? 0.4624 0.4640 0.1930 0.0278  -0.0479 0.0100  182 TYR A C     
1490 O O     . TYR A 182 ? 0.4928 0.5138 0.2211 0.0309  -0.0636 0.0093  182 TYR A O     
1491 C CB    . TYR A 182 ? 0.3819 0.3777 0.1649 0.0321  -0.0440 0.0190  182 TYR A CB    
1492 C CG    . TYR A 182 ? 0.3726 0.3574 0.1676 0.0403  -0.0423 0.0321  182 TYR A CG    
1493 C CD1   . TYR A 182 ? 0.4123 0.3965 0.1965 0.0518  -0.0482 0.0458  182 TYR A CD1   
1494 C CD2   . TYR A 182 ? 0.3240 0.2968 0.1385 0.0370  -0.0352 0.0305  182 TYR A CD2   
1495 C CE1   . TYR A 182 ? 0.4111 0.3787 0.2038 0.0594  -0.0452 0.0569  182 TYR A CE1   
1496 C CE2   . TYR A 182 ? 0.3278 0.2859 0.1498 0.0430  -0.0340 0.0396  182 TYR A CE2   
1497 C CZ    . TYR A 182 ? 0.3837 0.3370 0.1948 0.0540  -0.0380 0.0526  182 TYR A CZ    
1498 O OH    . TYR A 182 ? 0.4035 0.3357 0.2193 0.0604  -0.0353 0.0616  182 TYR A OH    
1499 N N     . GLY A 183 ? 0.4739 0.4653 0.1898 0.0207  -0.0382 -0.0006 183 GLY A N     
1500 C CA    . GLY A 183 ? 0.5223 0.5196 0.2143 0.0142  -0.0456 -0.0162 183 GLY A CA    
1501 C C     . GLY A 183 ? 0.5040 0.5053 0.2154 0.0020  -0.0483 -0.0343 183 GLY A C     
1502 O O     . GLY A 183 ? 0.5297 0.5181 0.2256 -0.0057 -0.0418 -0.0487 183 GLY A O     
1503 N N     . SER A 184 ? 0.4710 0.4870 0.2154 0.0007  -0.0556 -0.0332 184 SER A N     
1504 C CA    . SER A 184 ? 0.4684 0.4920 0.2328 -0.0116 -0.0590 -0.0482 184 SER A CA    
1505 C C     . SER A 184 ? 0.4257 0.4599 0.2271 -0.0095 -0.0590 -0.0422 184 SER A C     
1506 O O     . SER A 184 ? 0.4151 0.4573 0.2256 0.0016  -0.0627 -0.0289 184 SER A O     
1507 C CB    . SER A 184 ? 0.5228 0.5692 0.2780 -0.0193 -0.0775 -0.0591 184 SER A CB    
1508 O OG    . SER A 184 ? 0.5270 0.6000 0.2894 -0.0090 -0.0927 -0.0469 184 SER A OG    
1509 N N     . PHE A 185 ? 0.4158 0.4477 0.2359 -0.0196 -0.0537 -0.0520 185 PHE A N     
1510 C CA    . PHE A 185 ? 0.3848 0.4277 0.2368 -0.0179 -0.0524 -0.0476 185 PHE A CA    
1511 C C     . PHE A 185 ? 0.3921 0.4644 0.2591 -0.0100 -0.0659 -0.0400 185 PHE A C     
1512 O O     . PHE A 185 ? 0.3655 0.4368 0.2420 0.0020  -0.0634 -0.0286 185 PHE A O     
1513 C CB    . PHE A 185 ? 0.3897 0.4322 0.2581 -0.0321 -0.0473 -0.0594 185 PHE A CB    
1514 C CG    . PHE A 185 ? 0.3683 0.4262 0.2678 -0.0303 -0.0452 -0.0545 185 PHE A CG    
1515 C CD1   . PHE A 185 ? 0.3880 0.4750 0.3109 -0.0390 -0.0531 -0.0597 185 PHE A CD1   
1516 C CD2   . PHE A 185 ? 0.3360 0.3813 0.2410 -0.0199 -0.0354 -0.0450 185 PHE A CD2   
1517 C CE1   . PHE A 185 ? 0.3692 0.4716 0.3208 -0.0359 -0.0480 -0.0543 185 PHE A CE1   
1518 C CE2   . PHE A 185 ? 0.3195 0.3764 0.2473 -0.0168 -0.0316 -0.0411 185 PHE A CE2   
1519 C CZ    . PHE A 185 ? 0.3350 0.4205 0.2864 -0.0240 -0.0365 -0.0451 185 PHE A CZ    
1520 N N     . LEU A 186 ? 0.4390 0.5372 0.3080 -0.0167 -0.0803 -0.0470 186 LEU A N     
1521 C CA    . LEU A 186 ? 0.4612 0.5938 0.3468 -0.0077 -0.0950 -0.0393 186 LEU A CA    
1522 C C     . LEU A 186 ? 0.4633 0.5878 0.3344 0.0117  -0.0961 -0.0224 186 LEU A C     
1523 O O     . LEU A 186 ? 0.4511 0.5815 0.3406 0.0245  -0.0944 -0.0119 186 LEU A O     
1524 C CB    . LEU A 186 ? 0.5187 0.6802 0.3995 -0.0175 -0.1139 -0.0492 186 LEU A CB    
1525 C CG    . LEU A 186 ? 0.5475 0.7544 0.4532 -0.0086 -0.1313 -0.0417 186 LEU A CG    
1526 C CD1   . LEU A 186 ? 0.5434 0.7773 0.4950 -0.0176 -0.1288 -0.0465 186 LEU A CD1   
1527 C CD2   . LEU A 186 ? 0.6080 0.8401 0.4945 -0.0123 -0.1538 -0.0471 186 LEU A CD2   
1528 N N     . GLU A 187 ? 0.4882 0.5958 0.3251 0.0140  -0.0967 -0.0198 187 GLU A N     
1529 C CA    . GLU A 187 ? 0.4989 0.5939 0.3196 0.0303  -0.0953 -0.0025 187 GLU A CA    
1530 C C     . GLU A 187 ? 0.4490 0.5181 0.2801 0.0359  -0.0801 0.0053  187 GLU A C     
1531 O O     . GLU A 187 ? 0.4560 0.5179 0.2876 0.0493  -0.0795 0.0191  187 GLU A O     
1532 C CB    . GLU A 187 ? 0.5402 0.6205 0.3211 0.0299  -0.0949 -0.0012 187 GLU A CB    
1533 C CG    . GLU A 187 ? 0.5997 0.6798 0.3608 0.0466  -0.1007 0.0175  187 GLU A CG    
1534 C CD    . GLU A 187 ? 0.6728 0.7893 0.4402 0.0553  -0.1219 0.0215  187 GLU A CD    
1535 O OE1   . GLU A 187 ? 0.7134 0.8305 0.4769 0.0731  -0.1255 0.0399  187 GLU A OE1   
1536 O OE2   . GLU A 187 ? 0.6786 0.8234 0.4565 0.0445  -0.1349 0.0071  187 GLU A OE2   
1537 N N     . THR A 188 ? 0.4044 0.4586 0.2429 0.0258  -0.0684 -0.0036 188 THR A N     
1538 C CA    . THR A 188 ? 0.3565 0.3907 0.2056 0.0294  -0.0571 0.0014  188 THR A CA    
1539 C C     . THR A 188 ? 0.3438 0.3908 0.2170 0.0368  -0.0596 0.0037  188 THR A C     
1540 O O     . THR A 188 ? 0.3435 0.3780 0.2191 0.0470  -0.0566 0.0122  188 THR A O     
1541 C CB    . THR A 188 ? 0.3255 0.3450 0.1771 0.0190  -0.0457 -0.0074 188 THR A CB    
1542 O OG1   . THR A 188 ? 0.3282 0.3354 0.1585 0.0149  -0.0406 -0.0087 188 THR A OG1   
1543 C CG2   . THR A 188 ? 0.2849 0.2887 0.1466 0.0229  -0.0379 -0.0027 188 THR A CG2   
1544 N N     . VAL A 189 ? 0.3429 0.4142 0.2340 0.0314  -0.0641 -0.0043 189 VAL A N     
1545 C CA    . VAL A 189 ? 0.3366 0.4225 0.2531 0.0389  -0.0630 -0.0022 189 VAL A CA    
1546 C C     . VAL A 189 ? 0.3704 0.4694 0.2904 0.0563  -0.0715 0.0097  189 VAL A C     
1547 O O     . VAL A 189 ? 0.3671 0.4572 0.2952 0.0692  -0.0658 0.0161  189 VAL A O     
1548 C CB    . VAL A 189 ? 0.3336 0.4450 0.2727 0.0271  -0.0637 -0.0124 189 VAL A CB    
1549 C CG1   . VAL A 189 ? 0.3458 0.4831 0.3139 0.0369  -0.0637 -0.0082 189 VAL A CG1   
1550 C CG2   . VAL A 189 ? 0.3056 0.3959 0.2428 0.0157  -0.0507 -0.0200 189 VAL A CG2   
1551 N N     . LYS A 190 ? 0.4030 0.5205 0.3135 0.0576  -0.0848 0.0126  190 LYS A N     
1552 C CA    . LYS A 190 ? 0.4405 0.5735 0.3522 0.0758  -0.0949 0.0259  190 LYS A CA    
1553 C C     . LYS A 190 ? 0.4496 0.5466 0.3436 0.0895  -0.0871 0.0391  190 LYS A C     
1554 O O     . LYS A 190 ? 0.4827 0.5803 0.3841 0.1081  -0.0879 0.0506  190 LYS A O     
1555 C CB    . LYS A 190 ? 0.4814 0.6382 0.3779 0.0734  -0.1119 0.0262  190 LYS A CB    
1556 C CG    . LYS A 190 ? 0.5004 0.7056 0.4245 0.0687  -0.1260 0.0192  190 LYS A CG    
1557 C CD    . LYS A 190 ? 0.5544 0.7784 0.4596 0.0561  -0.1424 0.0104  190 LYS A CD    
1558 C CE    . LYS A 190 ? 0.6309 0.8825 0.5258 0.0726  -0.1621 0.0233  190 LYS A CE    
1559 N NZ    . LYS A 190 ? 0.6815 0.9596 0.5604 0.0589  -0.1819 0.0114  190 LYS A NZ    
1560 N N     . ASN A 191 ? 0.4237 0.4891 0.2965 0.0804  -0.0786 0.0377  191 ASN A N     
1561 C CA    . ASN A 191 ? 0.4313 0.4618 0.2894 0.0886  -0.0707 0.0493  191 ASN A CA    
1562 C C     . ASN A 191 ? 0.3989 0.4065 0.2686 0.0880  -0.0595 0.0451  191 ASN A C     
1563 O O     . ASN A 191 ? 0.4237 0.4112 0.2934 0.1002  -0.0556 0.0530  191 ASN A O     
1564 C CB    . ASN A 191 ? 0.4373 0.4500 0.2698 0.0796  -0.0669 0.0518  191 ASN A CB    
1565 C CG    . ASN A 191 ? 0.4972 0.5237 0.3085 0.0857  -0.0771 0.0602  191 ASN A CG    
1566 O OD1   . ASN A 191 ? 0.5591 0.5764 0.3588 0.1001  -0.0788 0.0762  191 ASN A OD1   
1567 N ND2   . ASN A 191 ? 0.5275 0.5746 0.3311 0.0755  -0.0841 0.0494  191 ASN A ND2   
1568 N N     . ALA A 192 ? 0.3509 0.3599 0.2283 0.0744  -0.0545 0.0324  192 ALA A N     
1569 C CA    . ALA A 192 ? 0.3242 0.3159 0.2098 0.0732  -0.0458 0.0266  192 ALA A CA    
1570 C C     . ALA A 192 ? 0.3435 0.3338 0.2392 0.0894  -0.0443 0.0304  192 ALA A C     
1571 O O     . ALA A 192 ? 0.3595 0.3217 0.2502 0.0935  -0.0378 0.0303  192 ALA A O     
1572 C CB    . ALA A 192 ? 0.2904 0.2952 0.1862 0.0614  -0.0427 0.0145  192 ALA A CB    
1573 N N     . ARG A 193 ? 0.3567 0.3781 0.2671 0.0988  -0.0504 0.0334  193 ARG A N     
1574 C CA    . ARG A 193 ? 0.3839 0.4109 0.3084 0.1176  -0.0478 0.0381  193 ARG A CA    
1575 C C     . ARG A 193 ? 0.4228 0.4147 0.3339 0.1332  -0.0436 0.0481  193 ARG A C     
1576 O O     . ARG A 193 ? 0.4440 0.4255 0.3616 0.1475  -0.0362 0.0481  193 ARG A O     
1577 C CB    . ARG A 193 ? 0.4065 0.4795 0.3514 0.1257  -0.0582 0.0428  193 ARG A CB    
1578 C CG    . ARG A 193 ? 0.3696 0.4777 0.3348 0.1104  -0.0602 0.0317  193 ARG A CG    
1579 C CD    . ARG A 193 ? 0.3903 0.5475 0.3790 0.1156  -0.0730 0.0354  193 ARG A CD    
1580 N NE    . ARG A 193 ? 0.4059 0.5680 0.3791 0.1249  -0.0869 0.0466  193 ARG A NE    
1581 C CZ    . ARG A 193 ? 0.4106 0.6161 0.3964 0.1276  -0.1033 0.0500  193 ARG A CZ    
1582 N NH1   . ARG A 193 ? 0.3821 0.6316 0.4009 0.1189  -0.1080 0.0420  193 ARG A NH1   
1583 N NH2   . ARG A 193 ? 0.4428 0.6482 0.4077 0.1382  -0.1153 0.0617  193 ARG A NH2   
1584 N N     . ARG A 194 ? 0.4403 0.4115 0.3320 0.1312  -0.0465 0.0568  194 ARG A N     
1585 C CA    . ARG A 194 ? 0.4907 0.4227 0.3695 0.1442  -0.0409 0.0671  194 ARG A CA    
1586 C C     . ARG A 194 ? 0.4786 0.3692 0.3414 0.1294  -0.0339 0.0634  194 ARG A C     
1587 O O     . ARG A 194 ? 0.5258 0.3823 0.3755 0.1339  -0.0299 0.0735  194 ARG A O     
1588 C CB    . ARG A 194 ? 0.5449 0.4829 0.4162 0.1604  -0.0478 0.0855  194 ARG A CB    
1589 C CG    . ARG A 194 ? 0.5677 0.5379 0.4330 0.1525  -0.0596 0.0887  194 ARG A CG    
1590 C CD    . ARG A 194 ? 0.6807 0.6771 0.5470 0.1735  -0.0709 0.1044  194 ARG A CD    
1591 N NE    . ARG A 194 ? 0.7227 0.7590 0.5855 0.1647  -0.0853 0.1019  194 ARG A NE    
1592 C CZ    . ARG A 194 ? 0.7385 0.8238 0.6238 0.1652  -0.0972 0.0957  194 ARG A CZ    
1593 N NH1   . ARG A 194 ? 0.7510 0.8551 0.6667 0.1763  -0.0948 0.0935  194 ARG A NH1   
1594 N NH2   . ARG A 194 ? 0.7325 0.8479 0.6101 0.1541  -0.1108 0.0909  194 ARG A NH2   
1595 N N     . TRP A 195 ? 0.4218 0.3160 0.2877 0.1119  -0.0322 0.0498  195 TRP A N     
1596 C CA    . TRP A 195 ? 0.4163 0.2784 0.2732 0.0975  -0.0273 0.0444  195 TRP A CA    
1597 C C     . TRP A 195 ? 0.4512 0.2786 0.3037 0.1044  -0.0211 0.0388  195 TRP A C     
1598 O O     . TRP A 195 ? 0.4479 0.2826 0.3055 0.1099  -0.0188 0.0291  195 TRP A O     
1599 C CB    . TRP A 195 ? 0.3617 0.2404 0.2242 0.0812  -0.0281 0.0321  195 TRP A CB    
1600 C CG    . TRP A 195 ? 0.3358 0.2367 0.1981 0.0709  -0.0314 0.0344  195 TRP A CG    
1601 C CD1   . TRP A 195 ? 0.3625 0.2673 0.2161 0.0723  -0.0336 0.0455  195 TRP A CD1   
1602 C CD2   . TRP A 195 ? 0.2864 0.2043 0.1537 0.0587  -0.0314 0.0253  195 TRP A CD2   
1603 N NE1   . TRP A 195 ? 0.3327 0.2560 0.1847 0.0616  -0.0346 0.0420  195 TRP A NE1   
1604 C CE2   . TRP A 195 ? 0.2907 0.2211 0.1523 0.0533  -0.0330 0.0298  195 TRP A CE2   
1605 C CE3   . TRP A 195 ? 0.2585 0.1801 0.1318 0.0533  -0.0294 0.0146  195 TRP A CE3   
1606 C CZ2   . TRP A 195 ? 0.2635 0.2076 0.1268 0.0430  -0.0317 0.0229  195 TRP A CZ2   
1607 C CZ3   . TRP A 195 ? 0.2415 0.1775 0.1173 0.0434  -0.0287 0.0100  195 TRP A CZ3   
1608 C CH2   . TRP A 195 ? 0.2331 0.1792 0.1049 0.0385  -0.0294 0.0136  195 TRP A CH2   
1609 N N     . THR A 196 ? 0.4927 0.2804 0.3342 0.1034  -0.0172 0.0441  196 THR A N     
1610 C CA    . THR A 196 ? 0.5305 0.2797 0.3640 0.1047  -0.0117 0.0339  196 THR A CA    
1611 C C     . THR A 196 ? 0.5015 0.2461 0.3338 0.0829  -0.0143 0.0198  196 THR A C     
1612 O O     . THR A 196 ? 0.4559 0.2255 0.2955 0.0692  -0.0185 0.0203  196 THR A O     
1613 C CB    . THR A 196 ? 0.6101 0.3103 0.4316 0.1104  -0.0056 0.0429  196 THR A CB    
1614 O OG1   . THR A 196 ? 0.6254 0.3098 0.4448 0.0900  -0.0057 0.0472  196 THR A OG1   
1615 C CG2   . THR A 196 ? 0.6447 0.3483 0.4659 0.1347  -0.0037 0.0610  196 THR A CG2   
1616 N N     . ARG A 197 ? 0.5411 0.2534 0.3628 0.0808  -0.0120 0.0071  197 ARG A N     
1617 C CA    . ARG A 197 ? 0.5298 0.2362 0.3489 0.0602  -0.0172 -0.0062 197 ARG A CA    
1618 C C     . ARG A 197 ? 0.5596 0.2487 0.3831 0.0409  -0.0188 -0.0009 197 ARG A C     
1619 O O     . ARG A 197 ? 0.5651 0.2524 0.3912 0.0223  -0.0246 -0.0108 197 ARG A O     
1620 C CB    . ARG A 197 ? 0.5710 0.2472 0.3728 0.0635  -0.0157 -0.0232 197 ARG A CB    
1621 C CG    . ARG A 197 ? 0.6232 0.2445 0.4108 0.0644  -0.0108 -0.0263 197 ARG A CG    
1622 C CD    . ARG A 197 ? 0.6437 0.2391 0.4096 0.0724  -0.0079 -0.0447 197 ARG A CD    
1623 N NE    . ARG A 197 ? 0.6340 0.2466 0.4000 0.0983  0.0008  -0.0414 197 ARG A NE    
1624 C CZ    . ARG A 197 ? 0.6429 0.2514 0.3935 0.1097  0.0061  -0.0544 197 ARG A CZ    
1625 N NH1   . ARG A 197 ? 0.6255 0.2551 0.3833 0.1327  0.0157  -0.0484 197 ARG A NH1   
1626 N NH2   . ARG A 197 ? 0.6678 0.2535 0.3960 0.0981  0.0018  -0.0731 197 ARG A NH2   
1627 N N     . ARG A 198 ? 0.5838 0.2626 0.4088 0.0457  -0.0137 0.0155  198 ARG A N     
1628 C CA    . ARG A 198 ? 0.6157 0.2773 0.4457 0.0284  -0.0114 0.0239  198 ARG A CA    
1629 C C     . ARG A 198 ? 0.5809 0.2714 0.4186 0.0278  -0.0093 0.0412  198 ARG A C     
1630 O O     . ARG A 198 ? 0.6088 0.2872 0.4503 0.0158  -0.0042 0.0519  198 ARG A O     
1631 C CB    . ARG A 198 ? 0.7067 0.3145 0.5249 0.0328  -0.0038 0.0285  198 ARG A CB    
1632 C CG    . ARG A 198 ? 0.7751 0.3479 0.5823 0.0285  -0.0055 0.0086  198 ARG A CG    
1633 C CD    . ARG A 198 ? 0.9264 0.4395 0.7200 0.0338  0.0038  0.0121  198 ARG A CD    
1634 N NE    . ARG A 198 ? 1.0291 0.5070 0.8062 0.0334  0.0028  -0.0100 198 ARG A NE    
1635 C CZ    . ARG A 198 ? 1.1489 0.5669 0.9127 0.0259  0.0079  -0.0177 198 ARG A CZ    
1636 N NH1   . ARG A 198 ? 1.2043 0.5891 0.9718 0.0175  0.0158  -0.0028 198 ARG A NH1   
1637 N NH2   . ARG A 198 ? 1.2064 0.5953 0.9507 0.0263  0.0061  -0.0406 198 ARG A NH2   
1638 N N     . THR A 199 ? 0.5268 0.2545 0.3660 0.0399  -0.0125 0.0431  199 THR A N     
1639 C CA    . THR A 199 ? 0.4874 0.2454 0.3294 0.0392  -0.0120 0.0548  199 THR A CA    
1640 C C     . THR A 199 ? 0.4601 0.2323 0.3138 0.0188  -0.0112 0.0526  199 THR A C     
1641 O O     . THR A 199 ? 0.4171 0.2069 0.2798 0.0113  -0.0162 0.0401  199 THR A O     
1642 C CB    . THR A 199 ? 0.4355 0.2309 0.2790 0.0508  -0.0175 0.0508  199 THR A CB    
1643 O OG1   . THR A 199 ? 0.4709 0.2600 0.3098 0.0702  -0.0181 0.0527  199 THR A OG1   
1644 C CG2   . THR A 199 ? 0.4040 0.2254 0.2445 0.0509  -0.0176 0.0607  199 THR A CG2   
1645 N N     . VAL A 200 ? 0.4880 0.2523 0.3418 0.0116  -0.0039 0.0665  200 VAL A N     
1646 C CA    . VAL A 200 ? 0.4643 0.2486 0.3316 -0.0043 -0.0001 0.0684  200 VAL A CA    
1647 C C     . VAL A 200 ? 0.4399 0.2497 0.2980 0.0036  0.0037  0.0778  200 VAL A C     
1648 O O     . VAL A 200 ? 0.4766 0.2761 0.3185 0.0125  0.0088  0.0924  200 VAL A O     
1649 C CB    . VAL A 200 ? 0.5246 0.2834 0.4002 -0.0201 0.0085  0.0776  200 VAL A CB    
1650 C CG1   . VAL A 200 ? 0.5156 0.2988 0.4039 -0.0312 0.0172  0.0865  200 VAL A CG1   
1651 C CG2   . VAL A 200 ? 0.5431 0.2834 0.4312 -0.0347 0.0024  0.0633  200 VAL A CG2   
1652 N N     . ILE A 201 ? 0.3839 0.2241 0.2492 0.0010  0.0013  0.0695  201 ILE A N     
1653 C CA    . ILE A 201 ? 0.3664 0.2280 0.2202 0.0073  0.0046  0.0741  201 ILE A CA    
1654 C C     . ILE A 201 ? 0.3749 0.2496 0.2382 -0.0032 0.0150  0.0787  201 ILE A C     
1655 O O     . ILE A 201 ? 0.3506 0.2445 0.2286 -0.0083 0.0141  0.0695  201 ILE A O     
1656 C CB    . ILE A 201 ? 0.3127 0.1960 0.1654 0.0138  -0.0036 0.0610  201 ILE A CB    
1657 C CG1   . ILE A 201 ? 0.2977 0.1741 0.1440 0.0257  -0.0118 0.0584  201 ILE A CG1   
1658 C CG2   . ILE A 201 ? 0.3059 0.2081 0.1460 0.0166  0.0001  0.0623  201 ILE A CG2   
1659 C CD1   . ILE A 201 ? 0.2371 0.1333 0.0877 0.0297  -0.0185 0.0457  201 ILE A CD1   
1660 N N     . ASP A 202 ? 0.4220 0.2870 0.2768 -0.0047 0.0264  0.0941  202 ASP A N     
1661 C CA    . ASP A 202 ? 0.4334 0.3112 0.3000 -0.0143 0.0400  0.1007  202 ASP A CA    
1662 C C     . ASP A 202 ? 0.4288 0.3235 0.2750 -0.0054 0.0464  0.1017  202 ASP A C     
1663 O O     . ASP A 202 ? 0.4697 0.3568 0.2914 0.0006  0.0546  0.1141  202 ASP A O     
1664 C CB    . ASP A 202 ? 0.4978 0.3547 0.3671 -0.0225 0.0523  0.1178  202 ASP A CB    
1665 C CG    . ASP A 202 ? 0.5218 0.3954 0.4152 -0.0357 0.0669  0.1241  202 ASP A CG    
1666 O OD1   . ASP A 202 ? 0.4854 0.3865 0.3867 -0.0340 0.0699  0.1180  202 ASP A OD1   
1667 O OD2   . ASP A 202 ? 0.6047 0.4633 0.5110 -0.0479 0.0767  0.1361  202 ASP A OD2   
1668 N N     . VAL A 203 ? 0.3845 0.2994 0.2383 -0.0044 0.0430  0.0884  203 VAL A N     
1669 C CA    . VAL A 203 ? 0.3817 0.3078 0.2135 0.0039  0.0472  0.0841  203 VAL A CA    
1670 C C     . VAL A 203 ? 0.4241 0.3509 0.2436 0.0042  0.0655  0.0967  203 VAL A C     
1671 O O     . VAL A 203 ? 0.4687 0.3891 0.2546 0.0122  0.0681  0.1019  203 VAL A O     
1672 C CB    . VAL A 203 ? 0.3437 0.2863 0.1896 0.0035  0.0454  0.0698  203 VAL A CB    
1673 C CG1   . VAL A 203 ? 0.3308 0.2763 0.1495 0.0114  0.0449  0.0606  203 VAL A CG1   
1674 C CG2   . VAL A 203 ? 0.3144 0.2571 0.1799 0.0004  0.0311  0.0603  203 VAL A CG2   
1675 N N     . ALA A 204 ? 0.4186 0.3554 0.2653 -0.0040 0.0781  0.1021  204 ALA A N     
1676 C CA    . ALA A 204 ? 0.4610 0.4014 0.3007 -0.0037 0.0994  0.1152  204 ALA A CA    
1677 C C     . ALA A 204 ? 0.5141 0.4337 0.3242 -0.0007 0.1049  0.1313  204 ALA A C     
1678 O O     . ALA A 204 ? 0.5600 0.4774 0.3368 0.0078  0.1156  0.1368  204 ALA A O     
1679 C CB    . ALA A 204 ? 0.4660 0.4229 0.3489 -0.0154 0.1107  0.1216  204 ALA A CB    
1680 N N     . LYS A 205 ? 0.5229 0.4244 0.3408 -0.0060 0.0976  0.1385  205 LYS A N     
1681 C CA    . LYS A 205 ? 0.5879 0.4654 0.3783 -0.0016 0.1037  0.1570  205 LYS A CA    
1682 C C     . LYS A 205 ? 0.5980 0.4665 0.3489 0.0142  0.0892  0.1552  205 LYS A C     
1683 O O     . LYS A 205 ? 0.6561 0.5063 0.3787 0.0220  0.0928  0.1719  205 LYS A O     
1684 C CB    . LYS A 205 ? 0.6078 0.4640 0.4219 -0.0130 0.1030  0.1655  205 LYS A CB    
1685 C CG    . LYS A 205 ? 0.6532 0.5125 0.5000 -0.0302 0.1207  0.1760  205 LYS A CG    
1686 C CD    . LYS A 205 ? 0.7265 0.5520 0.5818 -0.0402 0.1217  0.1876  205 LYS A CD    
1687 C CE    . LYS A 205 ? 0.7406 0.5719 0.6446 -0.0638 0.1251  0.1849  205 LYS A CE    
1688 N NZ    . LYS A 205 ? 0.7923 0.6456 0.7169 -0.0738 0.1480  0.1977  205 LYS A NZ    
1689 N N     . GLY A 206 ? 0.5460 0.4287 0.2966 0.0188  0.0727  0.1362  206 GLY A N     
1690 C CA    . GLY A 206 ? 0.5528 0.4355 0.2752 0.0315  0.0562  0.1319  206 GLY A CA    
1691 C C     . GLY A 206 ? 0.5729 0.4374 0.2964 0.0372  0.0460  0.1407  206 GLY A C     
1692 O O     . GLY A 206 ? 0.6090 0.4715 0.3055 0.0505  0.0368  0.1472  206 GLY A O     
1693 N N     . GLU A 207 ? 0.5559 0.4077 0.3101 0.0279  0.0471  0.1404  207 GLU A N     
1694 C CA    . GLU A 207 ? 0.5931 0.4183 0.3491 0.0320  0.0432  0.1501  207 GLU A CA    
1695 C C     . GLU A 207 ? 0.5416 0.3675 0.3183 0.0325  0.0285  0.1340  207 GLU A C     
1696 O O     . GLU A 207 ? 0.4929 0.3336 0.2915 0.0231  0.0250  0.1180  207 GLU A O     
1697 C CB    . GLU A 207 ? 0.6322 0.4338 0.4030 0.0186  0.0596  0.1635  207 GLU A CB    
1698 C CG    . GLU A 207 ? 0.7179 0.4814 0.4778 0.0246  0.0629  0.1809  207 GLU A CG    
1699 C CD    . GLU A 207 ? 0.7763 0.5143 0.5522 0.0073  0.0810  0.1942  207 GLU A CD    
1700 O OE1   . GLU A 207 ? 0.7606 0.5064 0.5702 -0.0118 0.0827  0.1829  207 GLU A OE1   
1701 O OE2   . GLU A 207 ? 0.8825 0.5932 0.6378 0.0125  0.0934  0.2168  207 GLU A OE2   
1702 N N     . VAL A 208 ? 0.5638 0.3735 0.3322 0.0454  0.0210  0.1395  208 VAL A N     
1703 C CA    . VAL A 208 ? 0.5292 0.3312 0.3158 0.0465  0.0120  0.1271  208 VAL A CA    
1704 C C     . VAL A 208 ? 0.5880 0.3482 0.3754 0.0468  0.0187  0.1381  208 VAL A C     
1705 O O     . VAL A 208 ? 0.6446 0.3846 0.4128 0.0583  0.0234  0.1568  208 VAL A O     
1706 C CB    . VAL A 208 ? 0.5058 0.3287 0.2875 0.0624  -0.0023 0.1197  208 VAL A CB    
1707 C CG1   . VAL A 208 ? 0.4497 0.2745 0.2523 0.0601  -0.0086 0.1025  208 VAL A CG1   
1708 C CG2   . VAL A 208 ? 0.4796 0.3361 0.2515 0.0623  -0.0072 0.1137  208 VAL A CG2   
1709 N N     . ARG A 209 ? 0.5797 0.3251 0.3874 0.0341  0.0187  0.1261  209 ARG A N     
1710 C CA    . ARG A 209 ? 0.6496 0.3523 0.4614 0.0255  0.0273  0.1329  209 ARG A CA    
1711 C C     . ARG A 209 ? 0.6510 0.3355 0.4706 0.0271  0.0198  0.1165  209 ARG A C     
1712 O O     . ARG A 209 ? 0.5882 0.2984 0.4146 0.0300  0.0098  0.1001  209 ARG A O     
1713 C CB    . ARG A 209 ? 0.6477 0.3548 0.4794 0.0005  0.0355  0.1313  209 ARG A CB    
1714 C CG    . ARG A 209 ? 0.7215 0.3996 0.5520 -0.0099 0.0516  0.1507  209 ARG A CG    
1715 C CD    . ARG A 209 ? 0.7044 0.4107 0.5526 -0.0274 0.0612  0.1538  209 ARG A CD    
1716 N NE    . ARG A 209 ? 0.6834 0.4055 0.5641 -0.0476 0.0552  0.1361  209 ARG A NE    
1717 C CZ    . ARG A 209 ? 0.6429 0.4035 0.5440 -0.0573 0.0568  0.1314  209 ARG A CZ    
1718 N NH1   . ARG A 209 ? 0.6211 0.4060 0.5122 -0.0496 0.0660  0.1409  209 ARG A NH1   
1719 N NH2   . ARG A 209 ? 0.6197 0.3943 0.5501 -0.0737 0.0489  0.1166  209 ARG A NH2   
1720 N N     . LYS A 210 ? 0.7249 0.3625 0.5414 0.0251  0.0260  0.1208  210 LYS A N     
1721 C CA    . LYS A 210 ? 0.7430 0.3569 0.5652 0.0215  0.0211  0.1022  210 LYS A CA    
1722 C C     . LYS A 210 ? 0.7609 0.3609 0.6003 -0.0074 0.0224  0.0915  210 LYS A C     
1723 O O     . LYS A 210 ? 0.8278 0.4008 0.6709 -0.0211 0.0325  0.1030  210 LYS A O     
1724 C CB    . LYS A 210 ? 0.8139 0.3831 0.6198 0.0407  0.0255  0.1086  210 LYS A CB    
1725 C CG    . LYS A 210 ? 0.8167 0.4095 0.6151 0.0683  0.0186  0.1083  210 LYS A CG    
1726 C CD    . LYS A 210 ? 0.9196 0.4793 0.7119 0.0832  0.0195  0.0984  210 LYS A CD    
1727 C CE    . LYS A 210 ? 0.9041 0.5018 0.6987 0.1067  0.0121  0.0942  210 LYS A CE    
1728 N NZ    . LYS A 210 ? 0.9652 0.5328 0.7541 0.1247  0.0161  0.0856  210 LYS A NZ    
1729 N N     . GLY A 211 ? 0.7139 0.3342 0.5647 -0.0170 0.0118  0.0706  211 GLY A N     
1730 C CA    . GLY A 211 ? 0.7350 0.3475 0.6032 -0.0439 0.0086  0.0581  211 GLY A CA    
1731 C C     . GLY A 211 ? 0.7596 0.3491 0.6200 -0.0451 -0.0005 0.0357  211 GLY A C     
1732 O O     . GLY A 211 ? 0.7651 0.3364 0.6067 -0.0244 -0.0003 0.0319  211 GLY A O     
1733 N N     . GLU A 212 ? 0.7805 0.3733 0.6554 -0.0689 -0.0086 0.0209  212 GLU A N     
1734 C CA    . GLU A 212 ? 0.8202 0.3910 0.6839 -0.0734 -0.0189 -0.0028 212 GLU A CA    
1735 C C     . GLU A 212 ? 0.7576 0.3565 0.6093 -0.0551 -0.0268 -0.0136 212 GLU A C     
1736 O O     . GLU A 212 ? 0.7896 0.3639 0.6210 -0.0463 -0.0296 -0.0285 212 GLU A O     
1737 C CB    . GLU A 212 ? 0.8498 0.4289 0.7339 -0.1045 -0.0294 -0.0157 212 GLU A CB    
1738 C CG    . GLU A 212 ? 0.9615 0.5069 0.8603 -0.1290 -0.0219 -0.0093 212 GLU A CG    
1739 C CD    . GLU A 212 ? 1.0963 0.5714 0.9704 -0.1218 -0.0110 -0.0086 212 GLU A CD    
1740 O OE1   . GLU A 212 ? 1.0936 0.5534 0.9430 -0.0927 -0.0056 -0.0051 212 GLU A OE1   
1741 O OE2   . GLU A 212 ? 1.1941 0.6294 1.0756 -0.1453 -0.0071 -0.0108 212 GLU A OE2   
1742 N N     . GLU A 213 ? 0.6816 0.3302 0.5452 -0.0497 -0.0286 -0.0060 213 GLU A N     
1743 C CA    . GLU A 213 ? 0.6252 0.3035 0.4818 -0.0365 -0.0353 -0.0152 213 GLU A CA    
1744 C C     . GLU A 213 ? 0.5515 0.2676 0.4163 -0.0254 -0.0308 -0.0007 213 GLU A C     
1745 O O     . GLU A 213 ? 0.5508 0.2721 0.4255 -0.0299 -0.0240 0.0143  213 GLU A O     
1746 C CB    . GLU A 213 ? 0.6174 0.3196 0.4843 -0.0530 -0.0479 -0.0281 213 GLU A CB    
1747 C CG    . GLU A 213 ? 0.6208 0.3576 0.5161 -0.0674 -0.0479 -0.0170 213 GLU A CG    
1748 C CD    . GLU A 213 ? 0.6725 0.4313 0.5839 -0.0857 -0.0612 -0.0277 213 GLU A CD    
1749 O OE1   . GLU A 213 ? 0.7089 0.4651 0.6052 -0.0840 -0.0723 -0.0436 213 GLU A OE1   
1750 O OE2   . GLU A 213 ? 0.7005 0.4815 0.6398 -0.1011 -0.0603 -0.0195 213 GLU A OE2   
1751 N N     . PHE A 214 ? 0.4946 0.2354 0.3538 -0.0121 -0.0336 -0.0056 214 PHE A N     
1752 C CA    . PHE A 214 ? 0.4243 0.2022 0.2911 -0.0050 -0.0313 0.0037  214 PHE A CA    
1753 C C     . PHE A 214 ? 0.3970 0.1992 0.2825 -0.0212 -0.0334 0.0062  214 PHE A C     
1754 O O     . PHE A 214 ? 0.4173 0.2223 0.3099 -0.0333 -0.0410 -0.0032 214 PHE A O     
1755 C CB    . PHE A 214 ? 0.3851 0.1818 0.2451 0.0075  -0.0339 -0.0043 214 PHE A CB    
1756 C CG    . PHE A 214 ? 0.3470 0.1738 0.2119 0.0156  -0.0308 0.0037  214 PHE A CG    
1757 C CD1   . PHE A 214 ? 0.3587 0.1853 0.2193 0.0283  -0.0269 0.0127  214 PHE A CD1   
1758 C CD2   . PHE A 214 ? 0.2837 0.1385 0.1569 0.0107  -0.0324 0.0021  214 PHE A CD2   
1759 C CE1   . PHE A 214 ? 0.3081 0.1627 0.1719 0.0329  -0.0263 0.0176  214 PHE A CE1   
1760 C CE2   . PHE A 214 ? 0.2289 0.1060 0.1042 0.0161  -0.0292 0.0070  214 PHE A CE2   
1761 C CZ    . PHE A 214 ? 0.2471 0.1245 0.1174 0.0257  -0.0270 0.0136  214 PHE A CZ    
1762 N N     . PHE A 215 ? 0.3657 0.1858 0.2586 -0.0207 -0.0268 0.0190  215 PHE A N     
1763 C CA    . PHE A 215 ? 0.3475 0.1890 0.2601 -0.0342 -0.0248 0.0240  215 PHE A CA    
1764 C C     . PHE A 215 ? 0.3185 0.1798 0.2294 -0.0267 -0.0162 0.0351  215 PHE A C     
1765 O O     . PHE A 215 ? 0.3404 0.1896 0.2402 -0.0209 -0.0094 0.0457  215 PHE A O     
1766 C CB    . PHE A 215 ? 0.3981 0.2185 0.3213 -0.0502 -0.0213 0.0294  215 PHE A CB    
1767 C CG    . PHE A 215 ? 0.3988 0.2436 0.3498 -0.0674 -0.0215 0.0313  215 PHE A CG    
1768 C CD1   . PHE A 215 ? 0.4221 0.2604 0.3880 -0.0855 -0.0304 0.0221  215 PHE A CD1   
1769 C CD2   . PHE A 215 ? 0.3823 0.2572 0.3454 -0.0658 -0.0127 0.0417  215 PHE A CD2   
1770 C CE1   . PHE A 215 ? 0.4164 0.2841 0.4144 -0.1021 -0.0320 0.0245  215 PHE A CE1   
1771 C CE2   . PHE A 215 ? 0.3878 0.2895 0.3816 -0.0800 -0.0112 0.0449  215 PHE A CE2   
1772 C CZ    . PHE A 215 ? 0.4048 0.3056 0.4187 -0.0984 -0.0217 0.0368  215 PHE A CZ    
1773 N N     . VAL A 216 ? 0.2795 0.1692 0.1983 -0.0256 -0.0165 0.0323  216 VAL A N     
1774 C CA    . VAL A 216 ? 0.2608 0.1677 0.1771 -0.0206 -0.0075 0.0403  216 VAL A CA    
1775 C C     . VAL A 216 ? 0.2751 0.1979 0.2132 -0.0316 -0.0004 0.0469  216 VAL A C     
1776 O O     . VAL A 216 ? 0.2709 0.2117 0.2276 -0.0367 -0.0052 0.0416  216 VAL A O     
1777 C CB    . VAL A 216 ? 0.2152 0.1389 0.1257 -0.0115 -0.0098 0.0326  216 VAL A CB    
1778 C CG1   . VAL A 216 ? 0.2073 0.1442 0.1128 -0.0078 -0.0001 0.0379  216 VAL A CG1   
1779 C CG2   . VAL A 216 ? 0.2000 0.1135 0.0950 -0.0019 -0.0154 0.0270  216 VAL A CG2   
1780 N N     . VAL A 217 ? 0.3007 0.2189 0.2375 -0.0344 0.0112  0.0596  217 VAL A N     
1781 C CA    . VAL A 217 ? 0.3163 0.2518 0.2777 -0.0452 0.0209  0.0677  217 VAL A CA    
1782 C C     . VAL A 217 ? 0.2948 0.2565 0.2587 -0.0371 0.0288  0.0679  217 VAL A C     
1783 O O     . VAL A 217 ? 0.2909 0.2496 0.2313 -0.0267 0.0363  0.0704  217 VAL A O     
1784 C CB    . VAL A 217 ? 0.3647 0.2841 0.3236 -0.0516 0.0341  0.0831  217 VAL A CB    
1785 C CG1   . VAL A 217 ? 0.3758 0.3179 0.3649 -0.0633 0.0465  0.0922  217 VAL A CG1   
1786 C CG2   . VAL A 217 ? 0.3999 0.2875 0.3569 -0.0597 0.0279  0.0827  217 VAL A CG2   
1787 N N     . ASP A 218 ? 0.2836 0.2701 0.2745 -0.0410 0.0262  0.0646  218 ASP A N     
1788 C CA    . ASP A 218 ? 0.2759 0.2862 0.2742 -0.0326 0.0362  0.0663  218 ASP A CA    
1789 C C     . ASP A 218 ? 0.3129 0.3285 0.3124 -0.0330 0.0565  0.0794  218 ASP A C     
1790 O O     . ASP A 218 ? 0.3444 0.3681 0.3684 -0.0452 0.0631  0.0891  218 ASP A O     
1791 C CB    . ASP A 218 ? 0.2702 0.3086 0.3018 -0.0359 0.0293  0.0638  218 ASP A CB    
1792 C CG    . ASP A 218 ? 0.2512 0.3074 0.2843 -0.0214 0.0364  0.0628  218 ASP A CG    
1793 O OD1   . ASP A 218 ? 0.2551 0.3044 0.2686 -0.0119 0.0506  0.0646  218 ASP A OD1   
1794 O OD2   . ASP A 218 ? 0.2449 0.3200 0.2967 -0.0189 0.0275  0.0598  218 ASP A OD2   
1795 N N     . PRO A 219 ? 0.3134 0.3237 0.2852 -0.0204 0.0671  0.0793  219 PRO A N     
1796 C CA    . PRO A 219 ? 0.3536 0.3663 0.3172 -0.0180 0.0880  0.0909  219 PRO A CA    
1797 C C     . PRO A 219 ? 0.3717 0.4147 0.3747 -0.0218 0.1011  0.0989  219 PRO A C     
1798 O O     . PRO A 219 ? 0.4109 0.4595 0.4254 -0.0286 0.1163  0.1122  219 PRO A O     
1799 C CB    . PRO A 219 ? 0.3486 0.3541 0.2782 -0.0035 0.0927  0.0827  219 PRO A CB    
1800 C CG    . PRO A 219 ? 0.3047 0.2961 0.2187 -0.0017 0.0730  0.0703  219 PRO A CG    
1801 C CD    . PRO A 219 ? 0.2771 0.2781 0.2226 -0.0091 0.0601  0.0673  219 PRO A CD    
1802 N N     . VAL A 220 ? 0.3441 0.4076 0.3690 -0.0170 0.0946  0.0919  220 VAL A N     
1803 C CA    . VAL A 220 ? 0.3578 0.4571 0.4244 -0.0165 0.1039  0.0986  220 VAL A CA    
1804 C C     . VAL A 220 ? 0.3789 0.5002 0.4905 -0.0353 0.0957  0.1048  220 VAL A C     
1805 O O     . VAL A 220 ? 0.4089 0.5630 0.5594 -0.0390 0.1073  0.1148  220 VAL A O     
1806 C CB    . VAL A 220 ? 0.3263 0.4352 0.3954 -0.0026 0.0967  0.0894  220 VAL A CB    
1807 C CG1   . VAL A 220 ? 0.3263 0.4743 0.4442 -0.0042 0.0915  0.0939  220 VAL A CG1   
1808 C CG2   . VAL A 220 ? 0.3392 0.4376 0.3805 0.0146  0.1148  0.0870  220 VAL A CG2   
1809 N N     . ASP A 221 ? 0.3736 0.4773 0.4810 -0.0474 0.0761  0.0981  221 ASP A N     
1810 C CA    . ASP A 221 ? 0.3999 0.5183 0.5452 -0.0678 0.0653  0.0999  221 ASP A CA    
1811 C C     . ASP A 221 ? 0.4076 0.4863 0.5273 -0.0778 0.0537  0.0942  221 ASP A C     
1812 O O     . ASP A 221 ? 0.3714 0.4303 0.4651 -0.0711 0.0386  0.0823  221 ASP A O     
1813 C CB    . ASP A 221 ? 0.3837 0.5334 0.5581 -0.0671 0.0471  0.0925  221 ASP A CB    
1814 C CG    . ASP A 221 ? 0.4161 0.5708 0.6152 -0.0890 0.0268  0.0868  221 ASP A CG    
1815 O OD1   . ASP A 221 ? 0.4717 0.6082 0.6746 -0.1071 0.0297  0.0900  221 ASP A OD1   
1816 O OD2   . ASP A 221 ? 0.4106 0.5861 0.6237 -0.0881 0.0077  0.0789  221 ASP A OD2   
1817 N N     . GLU A 222 ? 0.4621 0.5283 0.5897 -0.0929 0.0632  0.1041  222 GLU A N     
1818 C CA    . GLU A 222 ? 0.4857 0.5080 0.5844 -0.0982 0.0590  0.1031  222 GLU A CA    
1819 C C     . GLU A 222 ? 0.4916 0.5011 0.5978 -0.1111 0.0370  0.0899  222 GLU A C     
1820 O O     . GLU A 222 ? 0.4908 0.4655 0.5663 -0.1066 0.0284  0.0827  222 GLU A O     
1821 C CB    . GLU A 222 ? 0.5454 0.5542 0.6481 -0.1091 0.0788  0.1203  222 GLU A CB    
1822 C CG    . GLU A 222 ? 0.6099 0.6471 0.7645 -0.1308 0.0852  0.1278  222 GLU A CG    
1823 C CD    . GLU A 222 ? 0.6979 0.7076 0.8567 -0.1487 0.0989  0.1416  222 GLU A CD    
1824 O OE1   . GLU A 222 ? 0.7558 0.7840 0.9601 -0.1720 0.1012  0.1457  222 GLU A OE1   
1825 O OE2   . GLU A 222 ? 0.7080 0.6784 0.8261 -0.1399 0.1071  0.1489  222 GLU A OE2   
1826 N N     . LYS A 223 ? 0.5099 0.5492 0.6566 -0.1261 0.0276  0.0861  223 LYS A N     
1827 C CA    . LYS A 223 ? 0.5225 0.5522 0.6740 -0.1390 0.0048  0.0708  223 LYS A CA    
1828 C C     . LYS A 223 ? 0.4705 0.4941 0.5926 -0.1217 -0.0112 0.0566  223 LYS A C     
1829 O O     . LYS A 223 ? 0.4821 0.4830 0.5897 -0.1266 -0.0268 0.0435  223 LYS A O     
1830 C CB    . LYS A 223 ? 0.5614 0.6333 0.7637 -0.1579 -0.0042 0.0698  223 LYS A CB    
1831 C CG    . LYS A 223 ? 0.6207 0.7142 0.8631 -0.1738 0.0151  0.0864  223 LYS A CG    
1832 C CD    . LYS A 223 ? 0.7177 0.7764 0.9665 -0.2001 0.0178  0.0879  223 LYS A CD    
1833 C CE    . LYS A 223 ? 0.7742 0.8636 1.0732 -0.2198 0.0361  0.1045  223 LYS A CE    
1834 N NZ    . LYS A 223 ? 0.8792 0.9287 1.1819 -0.2444 0.0453  0.1102  223 LYS A NZ    
1835 N N     . ARG A 224 ? 0.4275 0.4682 0.5393 -0.1016 -0.0053 0.0592  224 ARG A N     
1836 C CA    . ARG A 224 ? 0.3875 0.4288 0.4778 -0.0857 -0.0176 0.0482  224 ARG A CA    
1837 C C     . ARG A 224 ? 0.3669 0.3705 0.4149 -0.0742 -0.0183 0.0421  224 ARG A C     
1838 O O     . ARG A 224 ? 0.3611 0.3526 0.3906 -0.0649 -0.0052 0.0489  224 ARG A O     
1839 C CB    . ARG A 224 ? 0.3589 0.4296 0.4566 -0.0696 -0.0079 0.0543  224 ARG A CB    
1840 C CG    . ARG A 224 ? 0.3485 0.4383 0.4483 -0.0596 -0.0214 0.0474  224 ARG A CG    
1841 C CD    . ARG A 224 ? 0.3332 0.3977 0.3948 -0.0458 -0.0262 0.0385  224 ARG A CD    
1842 N NE    . ARG A 224 ? 0.3469 0.4167 0.4060 -0.0455 -0.0451 0.0293  224 ARG A NE    
1843 C CZ    . ARG A 224 ? 0.3346 0.3948 0.3691 -0.0320 -0.0491 0.0239  224 ARG A CZ    
1844 N NH1   . ARG A 224 ? 0.3239 0.3701 0.3386 -0.0198 -0.0366 0.0255  224 ARG A NH1   
1845 N NH2   . ARG A 224 ? 0.3544 0.4190 0.3833 -0.0315 -0.0655 0.0170  224 ARG A NH2   
1846 N N     . ASN A 225 ? 0.3639 0.3516 0.3962 -0.0739 -0.0336 0.0294  225 ASN A N     
1847 C CA    . ASN A 225 ? 0.3378 0.2974 0.3353 -0.0609 -0.0336 0.0239  225 ASN A CA    
1848 C C     . ASN A 225 ? 0.2944