data_3OVA
# 
_entry.id   3OVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OVA         
NDB   NA0760       
RCSB  RCSB061617   
WWPDB D_1000061617 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OUY . unspecified 
PDB 3OV7 . unspecified 
PDB 3OVB . unspecified 
PDB 3OVS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OVA 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, B.C.'    1 
'Xiong, Y.'    2 
'Steitz, T.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            330 
_citation.page_first                937 
_citation.page_last                 940 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21071662 
_citation.pdbx_database_id_DOI      10.1126/science.1194985 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, B.'      1 
primary 'Xiong, Y.'    2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           3OVA 
_cell.length_a           57.942 
_cell.length_b           57.942 
_cell.length_c           427.945 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OVA 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CCA-Adding Enzyme'                             51208.762 1   '2.7.7.25, 2.7.7.21' ? ? ? 
2 polymer     syn 'RNA (34-MER)'                                  10837.447 1   ?                    ? ? ? 
3 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   1   ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'                                   96.063    1   ?                    ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                 24.305    1   ?                    ? ? ? 
6 non-polymer syn 1,2-ETHANEDIOL                                  62.068    3   ?                    ? ? ? 
7 water       nat water                                           18.015    219 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
2 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;VEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLEI
GKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYG
AEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLC
REFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKA
SEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGK
NVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;VEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLEI
GKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYG
AEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLC
REFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKA
SEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGK
NVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
2 polyribonucleotide no no GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLU n 
1 3   GLU n 
1 4   ILE n 
1 5   LEU n 
1 6   GLU n 
1 7   LYS n 
1 8   ALA n 
1 9   LEU n 
1 10  GLU n 
1 11  LEU n 
1 12  VAL n 
1 13  ILE n 
1 14  PRO n 
1 15  ASP n 
1 16  GLU n 
1 17  GLU n 
1 18  GLU n 
1 19  VAL n 
1 20  ARG n 
1 21  LYS n 
1 22  GLY n 
1 23  ARG n 
1 24  GLU n 
1 25  ALA n 
1 26  GLU n 
1 27  GLU n 
1 28  GLU n 
1 29  LEU n 
1 30  ARG n 
1 31  ARG n 
1 32  ARG n 
1 33  LEU n 
1 34  ASP n 
1 35  GLU n 
1 36  LEU n 
1 37  GLY n 
1 38  VAL n 
1 39  GLU n 
1 40  TYR n 
1 41  VAL n 
1 42  PHE n 
1 43  VAL n 
1 44  GLY n 
1 45  SER n 
1 46  TYR n 
1 47  ALA n 
1 48  ARG n 
1 49  ASN n 
1 50  THR n 
1 51  TRP n 
1 52  LEU n 
1 53  LYS n 
1 54  GLY n 
1 55  SER n 
1 56  LEU n 
1 57  GLU n 
1 58  ILE n 
1 59  ASP n 
1 60  VAL n 
1 61  PHE n 
1 62  LEU n 
1 63  LEU n 
1 64  PHE n 
1 65  PRO n 
1 66  GLU n 
1 67  GLU n 
1 68  PHE n 
1 69  SER n 
1 70  LYS n 
1 71  GLU n 
1 72  GLU n 
1 73  LEU n 
1 74  ARG n 
1 75  GLU n 
1 76  ARG n 
1 77  GLY n 
1 78  LEU n 
1 79  GLU n 
1 80  ILE n 
1 81  GLY n 
1 82  LYS n 
1 83  ALA n 
1 84  VAL n 
1 85  LEU n 
1 86  ASP n 
1 87  SER n 
1 88  TYR n 
1 89  GLU n 
1 90  ILE n 
1 91  ARG n 
1 92  TYR n 
1 93  ALA n 
1 94  GLU n 
1 95  HIS n 
1 96  PRO n 
1 97  TYR n 
1 98  VAL n 
1 99  HIS n 
1 100 GLY n 
1 101 VAL n 
1 102 VAL n 
1 103 LYS n 
1 104 GLY n 
1 105 VAL n 
1 106 GLU n 
1 107 VAL n 
1 108 ASP n 
1 109 VAL n 
1 110 VAL n 
1 111 PRO n 
1 112 CYS n 
1 113 TYR n 
1 114 LYS n 
1 115 LEU n 
1 116 LYS n 
1 117 GLU n 
1 118 PRO n 
1 119 LYS n 
1 120 ASN n 
1 121 ILE n 
1 122 LYS n 
1 123 SER n 
1 124 ALA n 
1 125 VAL n 
1 126 ASP n 
1 127 ARG n 
1 128 THR n 
1 129 PRO n 
1 130 PHE n 
1 131 HIS n 
1 132 HIS n 
1 133 LYS n 
1 134 TRP n 
1 135 LEU n 
1 136 GLU n 
1 137 GLY n 
1 138 ARG n 
1 139 ILE n 
1 140 LYS n 
1 141 GLY n 
1 142 LYS n 
1 143 GLU n 
1 144 ASN n 
1 145 GLU n 
1 146 VAL n 
1 147 ARG n 
1 148 LEU n 
1 149 LEU n 
1 150 LYS n 
1 151 GLY n 
1 152 PHE n 
1 153 LEU n 
1 154 LYS n 
1 155 ALA n 
1 156 ASN n 
1 157 GLY n 
1 158 ILE n 
1 159 TYR n 
1 160 GLY n 
1 161 ALA n 
1 162 GLU n 
1 163 TYR n 
1 164 LYS n 
1 165 VAL n 
1 166 ARG n 
1 167 GLY n 
1 168 PHE n 
1 169 SER n 
1 170 GLY n 
1 171 TYR n 
1 172 LEU n 
1 173 CYS n 
1 174 GLU n 
1 175 LEU n 
1 176 LEU n 
1 177 ILE n 
1 178 VAL n 
1 179 PHE n 
1 180 TYR n 
1 181 GLY n 
1 182 SER n 
1 183 PHE n 
1 184 LEU n 
1 185 GLU n 
1 186 THR n 
1 187 VAL n 
1 188 LYS n 
1 189 ASN n 
1 190 ALA n 
1 191 ARG n 
1 192 ARG n 
1 193 TRP n 
1 194 THR n 
1 195 ARG n 
1 196 ARG n 
1 197 THR n 
1 198 VAL n 
1 199 ILE n 
1 200 ASP n 
1 201 VAL n 
1 202 ALA n 
1 203 LYS n 
1 204 GLY n 
1 205 GLU n 
1 206 VAL n 
1 207 ARG n 
1 208 LYS n 
1 209 GLY n 
1 210 GLU n 
1 211 GLU n 
1 212 PHE n 
1 213 PHE n 
1 214 VAL n 
1 215 VAL n 
1 216 ASP n 
1 217 PRO n 
1 218 VAL n 
1 219 ASP n 
1 220 GLU n 
1 221 LYS n 
1 222 ARG n 
1 223 ASN n 
1 224 VAL n 
1 225 ALA n 
1 226 ALA n 
1 227 ASN n 
1 228 LEU n 
1 229 SER n 
1 230 LEU n 
1 231 ASP n 
1 232 ASN n 
1 233 LEU n 
1 234 ALA n 
1 235 ARG n 
1 236 PHE n 
1 237 VAL n 
1 238 HIS n 
1 239 LEU n 
1 240 CYS n 
1 241 ARG n 
1 242 GLU n 
1 243 PHE n 
1 244 MET n 
1 245 GLU n 
1 246 ALA n 
1 247 PRO n 
1 248 SER n 
1 249 LEU n 
1 250 GLY n 
1 251 PHE n 
1 252 PHE n 
1 253 LYS n 
1 254 PRO n 
1 255 LYS n 
1 256 HIS n 
1 257 PRO n 
1 258 LEU n 
1 259 GLU n 
1 260 ILE n 
1 261 GLU n 
1 262 PRO n 
1 263 GLU n 
1 264 ARG n 
1 265 LEU n 
1 266 ARG n 
1 267 LYS n 
1 268 ILE n 
1 269 VAL n 
1 270 GLU n 
1 271 GLU n 
1 272 ARG n 
1 273 GLY n 
1 274 THR n 
1 275 ALA n 
1 276 VAL n 
1 277 PHE n 
1 278 ALA n 
1 279 VAL n 
1 280 LYS n 
1 281 PHE n 
1 282 ARG n 
1 283 LYS n 
1 284 PRO n 
1 285 ASP n 
1 286 ILE n 
1 287 VAL n 
1 288 ASP n 
1 289 ASP n 
1 290 ASN n 
1 291 LEU n 
1 292 TYR n 
1 293 PRO n 
1 294 GLN n 
1 295 LEU n 
1 296 GLU n 
1 297 ARG n 
1 298 ALA n 
1 299 SER n 
1 300 ARG n 
1 301 LYS n 
1 302 ILE n 
1 303 PHE n 
1 304 GLU n 
1 305 PHE n 
1 306 LEU n 
1 307 GLU n 
1 308 ARG n 
1 309 GLU n 
1 310 ASN n 
1 311 PHE n 
1 312 MET n 
1 313 PRO n 
1 314 LEU n 
1 315 ARG n 
1 316 SER n 
1 317 ALA n 
1 318 PHE n 
1 319 LYS n 
1 320 ALA n 
1 321 SER n 
1 322 GLU n 
1 323 GLU n 
1 324 PHE n 
1 325 CYS n 
1 326 TYR n 
1 327 LEU n 
1 328 LEU n 
1 329 PHE n 
1 330 GLU n 
1 331 CYS n 
1 332 GLN n 
1 333 ILE n 
1 334 LYS n 
1 335 GLU n 
1 336 ILE n 
1 337 SER n 
1 338 ARG n 
1 339 VAL n 
1 340 PHE n 
1 341 ARG n 
1 342 ARG n 
1 343 MET n 
1 344 GLY n 
1 345 PRO n 
1 346 GLN n 
1 347 PHE n 
1 348 GLU n 
1 349 ASP n 
1 350 GLU n 
1 351 ARG n 
1 352 ASN n 
1 353 VAL n 
1 354 LYS n 
1 355 LYS n 
1 356 PHE n 
1 357 LEU n 
1 358 SER n 
1 359 ARG n 
1 360 ASN n 
1 361 ARG n 
1 362 ALA n 
1 363 PHE n 
1 364 ARG n 
1 365 PRO n 
1 366 PHE n 
1 367 ILE n 
1 368 GLU n 
1 369 ASN n 
1 370 GLY n 
1 371 ARG n 
1 372 TRP n 
1 373 TRP n 
1 374 ALA n 
1 375 PHE n 
1 376 GLU n 
1 377 MET n 
1 378 ARG n 
1 379 LYS n 
1 380 PHE n 
1 381 THR n 
1 382 THR n 
1 383 PRO n 
1 384 GLU n 
1 385 GLU n 
1 386 GLY n 
1 387 VAL n 
1 388 ARG n 
1 389 SER n 
1 390 TYR n 
1 391 ALA n 
1 392 SER n 
1 393 THR n 
1 394 HIS n 
1 395 TRP n 
1 396 HIS n 
1 397 THR n 
1 398 LEU n 
1 399 GLY n 
1 400 LYS n 
1 401 ASN n 
1 402 VAL n 
1 403 GLY n 
1 404 GLU n 
1 405 SER n 
1 406 ILE n 
1 407 ARG n 
1 408 GLU n 
1 409 TYR n 
1 410 PHE n 
1 411 GLU n 
1 412 ILE n 
1 413 ILE n 
1 414 SER n 
1 415 GLY n 
1 416 GLU n 
1 417 LYS n 
1 418 LEU n 
1 419 PHE n 
1 420 LYS n 
1 421 GLU n 
1 422 PRO n 
1 423 VAL n 
1 424 THR n 
1 425 ALA n 
1 426 GLU n 
1 427 LEU n 
1 428 CYS n 
1 429 GLU n 
1 430 MET n 
1 431 MET n 
1 432 GLY n 
1 433 VAL n 
1 434 LYS n 
1 435 ASP n 
2 1   G   n 
2 2   G   n 
2 3   A   n 
2 4   A   n 
2 5   G   n 
2 6   U   n 
2 7   A   n 
2 8   G   n 
2 9   A   n 
2 10  U   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  A   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  A   n 
2 23  U   n 
2 24  U   n 
2 25  U   n 
2 26  A   n 
2 27  C   n 
2 28  U   n 
2 29  U   n 
2 30  C   n 
2 31  C   n 
2 32  A   n 
2 33  C   n 
2 34  C   n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Archaeoglobus fulgidus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      2234 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemistry synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCA_ARCFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          O28126 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3OVA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 435 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O28126 
_struct_ref_seq.db_align_beg                  3 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  437 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       437 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                  'ETHYLENE GLYCOL'                               
'C2 H6 O2'          62.068  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                   ?                                               
'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ?                                               
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_percent_sol   57.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 0.2 M tri-lithium citrate, 80 mM ammonium sulfate, 50 mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-07-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3OVA 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.980 
_reflns.number_obs                   46253 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.11800 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.300 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.98 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   77.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3OVA 
_refine.ls_number_reflns_obs                     43725 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.00 
_refine.ls_d_res_high                            1.98 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2326 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               31.451 
_refine.aniso_B[1][1]                            0.01000 
_refine.aniso_B[2][2]                            0.01000 
_refine.aniso_B[3][3]                            -0.02000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.158 
_refine.overall_SU_ML                            0.120 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.275 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3570 
_refine_hist.pdbx_number_atoms_nucleic_acid   720 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             219 
_refine_hist.number_atoms_total               4558 
_refine_hist.d_res_high                       1.98 
_refine_hist.d_res_low                        48.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 4499 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.279  2.184  ? 6217 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.458  5.000  ? 428  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.627 22.760 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.506 15.000 ? 679  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.781 15.000 ? 40   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.084  0.200  ? 684  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 3150 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.194  0.200  ? 2030 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.297  0.200  ? 3031 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.149  0.200  ? 245  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.183  0.200  ? 88   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.171  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.535  1.500  ? 2211 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.896  2.000  ? 3452 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.332  3.000  ? 2797 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.188  4.500  ? 2765 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.98 
_refine_ls_shell.d_res_low                        2.03 
_refine_ls_shell.number_reflns_R_work             2753 
_refine_ls_shell.R_factor_R_work                  0.2930 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3290 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             122 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3OVA 
_struct.title                     'How the CCA-adding Enzyme Selects Adenine over Cytosine in Position 76 of tRNA' 
_struct.pdbx_descriptor           PROTEIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OVA 
_struct_keywords.pdbx_keywords   Transferase/RNA 
_struct_keywords.text            'Protein-RNA, Rossmann Fold, CCA-adding, tRNA, nucleotidyltransfer, Transferase-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 1   ? ILE A 13  ? VAL A 3   ILE A 15  1 ? 13 
HELX_P HELX_P2  2  ASP A 15  ? GLY A 37  ? ASP A 17  GLY A 39  1 ? 23 
HELX_P HELX_P3  3  GLY A 44  ? ASN A 49  ? GLY A 46  ASN A 51  1 ? 6  
HELX_P HELX_P4  4  SER A 69  ? LEU A 85  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  ARG A 127 ? GLY A 137 ? ARG A 129 GLY A 139 1 ? 11 
HELX_P HELX_P6  6  LYS A 142 ? ASN A 156 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER A 169 ? GLY A 181 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER A 182 ? ARG A 191 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER A 229 ? ALA A 246 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER A 248 ? LYS A 253 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU A 261 ? GLY A 273 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL A 287 ? GLU A 309 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP A 349 ? ARG A 359 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR A 382 ? HIS A 394 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP A 395 ? LEU A 398 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY A 399 ? TYR A 409 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLY A 415 ? LYS A 420 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL A 423 ? GLY A 432 ? VAL A 425 GLY A 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 57 O   ? ? ? 1_555 E MG .  MG ? ? A GLU 59  A MG 601 1_555 ? ? ? ? ? ? ?                    2.719 ? 
metalc2  metalc ? ? C APC .  O3G ? ? ? 1_555 E MG .  MG ? ? A APC 501 A MG 601 1_555 ? ? ? ? ? ? ?                    2.873 ? 
metalc3  metalc ? ? C APC .  O1A ? ? ? 1_555 E MG .  MG ? ? A APC 501 A MG 601 1_555 ? ? ? ? ? ? ?                    2.978 ? 
hydrog1  hydrog ? ? B G   1  N1  ? ? ? 1_555 B C  31 N3 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? B G   1  N2  ? ? ? 1_555 B C  31 O2 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? B G   1  O6  ? ? ? 1_555 B C  31 N4 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? B G   2  N1  ? ? ? 1_555 B C  30 N3 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? B G   2  N2  ? ? ? 1_555 B C  30 O2 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? B G   2  O6  ? ? ? 1_555 B C  30 N4 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? B A   3  N1  ? ? ? 1_555 B U  29 N3 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? B A   3  N6  ? ? ? 1_555 B U  29 O4 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? B A   4  N1  ? ? ? 1_555 B U  28 N3 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? B A   4  N6  ? ? ? 1_555 B U  28 O4 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? B G   5  N1  ? ? ? 1_555 B C  27 N3 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? B G   5  N2  ? ? ? 1_555 B C  27 O2 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? B G   5  O6  ? ? ? 1_555 B C  27 N4 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? B U   6  N3  ? ? ? 1_555 B A  26 N1 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? B U   6  O4  ? ? ? 1_555 B A  26 N6 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16 hydrog ? ? B A   7  N1  ? ? ? 1_555 B U  25 N3 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog17 hydrog ? ? B G   8  N1  ? ? ? 1_555 B U  24 O2 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog18 hydrog ? ? B G   8  O6  ? ? ? 1_555 B U  24 N3 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog19 hydrog ? ? B A   9  N1  ? ? ? 1_555 B U  23 N3 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? B A   9  N6  ? ? ? 1_555 B U  23 O4 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? B U   10 N3  ? ? ? 1_555 B A  22 N1 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? B U   10 O4  ? ? ? 1_555 B A  22 N6 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? B G   11 N1  ? ? ? 1_555 B C  21 N3 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? B G   11 N2  ? ? ? 1_555 B C  21 O2 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? B G   11 O6  ? ? ? 1_555 B C  21 N4 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? B G   12 N1  ? ? ? 1_555 B C  20 N3 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? B G   12 N2  ? ? ? 1_555 B C  20 O2 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog28 hydrog ? ? B G   12 O6  ? ? ? 1_555 B C  20 N4 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? B U   13 N3  ? ? ? 1_555 B A  17 N7 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog30 hydrog ? ? B U   13 O2  ? ? ? 1_555 B A  17 N6 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 40  ? VAL A 43  ? TYR A 42  VAL A 45  
A 2 GLU A 57  ? PHE A 64  ? GLU A 59  PHE A 66  
A 3 VAL A 105 ? TYR A 113 ? VAL A 107 TYR A 115 
A 4 VAL A 98  ? VAL A 102 ? VAL A 100 VAL A 104 
A 5 SER A 87  ? GLU A 89  ? SER A 89  GLU A 91  
B 1 GLU A 205 ? LYS A 208 ? GLU A 207 LYS A 210 
B 2 THR A 197 ? ASP A 200 ? THR A 199 ASP A 202 
B 3 PHE A 213 ? ASP A 216 ? PHE A 215 ASP A 218 
B 4 ASP A 219 ? ASN A 223 ? ASP A 221 ASN A 225 
C 1 PRO A 313 ? ALA A 320 ? PRO A 315 ALA A 322 
C 2 PHE A 324 ? CYS A 331 ? PHE A 326 CYS A 333 
C 3 ALA A 275 ? ARG A 282 ? ALA A 277 ARG A 284 
C 4 GLU A 411 ? SER A 414 ? GLU A 413 SER A 416 
D 1 VAL A 339 ? GLN A 346 ? VAL A 341 GLN A 348 
D 2 ARG A 371 ? MET A 377 ? ARG A 373 MET A 379 
D 3 PHE A 366 ? GLU A 368 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 41  ? N VAL A 43  O PHE A 61  ? O PHE A 63  
A 2 3 N PHE A 64  ? N PHE A 66  O CYS A 112 ? O CYS A 114 
A 3 4 O VAL A 109 ? O VAL A 111 N VAL A 98  ? N VAL A 100 
A 4 5 O HIS A 99  ? O HIS A 101 N GLU A 89  ? N GLU A 91  
B 1 2 O GLU A 205 ? O GLU A 207 N ASP A 200 ? N ASP A 202 
B 2 3 N ILE A 199 ? N ILE A 201 O PHE A 213 ? O PHE A 215 
B 3 4 N ASP A 216 ? N ASP A 218 O ARG A 222 ? O ARG A 224 
C 1 2 N ALA A 317 ? N ALA A 319 O LEU A 328 ? O LEU A 330 
C 2 3 O CYS A 325 ? O CYS A 327 N PHE A 281 ? N PHE A 283 
C 3 4 N LYS A 280 ? N LYS A 282 O GLU A 411 ? O GLU A 413 
D 1 2 N ARG A 342 ? N ARG A 344 O ALA A 374 ? O ALA A 376 
D 2 3 O ARG A 371 ? O ARG A 373 N GLU A 368 ? N GLU A 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE APC A 501' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 503' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 601'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 701' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 702' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 703' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 HOH I .   ? HOH A 1   . ? 1_555 ? 
2  AC1 22 HOH I .   ? HOH A 2   . ? 1_555 ? 
3  AC1 22 GLY A 44  ? GLY A 46  . ? 1_555 ? 
4  AC1 22 SER A 45  ? SER A 47  . ? 1_555 ? 
5  AC1 22 ARG A 48  ? ARG A 50  . ? 1_555 ? 
6  AC1 22 GLU A 57  ? GLU A 59  . ? 1_555 ? 
7  AC1 22 ASP A 59  ? ASP A 61  . ? 1_555 ? 
8  AC1 22 THR A 128 ? THR A 130 . ? 1_555 ? 
9  AC1 22 HIS A 131 ? HIS A 133 . ? 1_555 ? 
10 AC1 22 LYS A 150 ? LYS A 152 . ? 1_555 ? 
11 AC1 22 TYR A 159 ? TYR A 161 . ? 1_555 ? 
12 AC1 22 ARG A 222 ? ARG A 224 . ? 1_555 ? 
13 AC1 22 HOH I .   ? HOH A 448 . ? 1_555 ? 
14 AC1 22 HOH I .   ? HOH A 519 . ? 1_555 ? 
15 AC1 22 HOH I .   ? HOH A 543 . ? 1_555 ? 
16 AC1 22 HOH I .   ? HOH A 561 . ? 1_555 ? 
17 AC1 22 HOH I .   ? HOH A 567 . ? 1_555 ? 
18 AC1 22 HOH I .   ? HOH A 572 . ? 1_555 ? 
19 AC1 22 MG  E .   ? MG  A 601 . ? 1_555 ? 
20 AC1 22 A   B 32  ? A   C 32  . ? 1_555 ? 
21 AC1 22 C   B 33  ? C   C 33  . ? 1_555 ? 
22 AC1 22 C   B 34  ? C   C 34  . ? 1_555 ? 
23 AC2 3  ARG A 297 ? ARG A 299 . ? 1_555 ? 
24 AC2 3  ARG A 300 ? ARG A 302 . ? 1_555 ? 
25 AC2 3  LYS A 301 ? LYS A 303 . ? 1_555 ? 
26 AC3 4  SER A 45  ? SER A 47  . ? 1_555 ? 
27 AC3 4  GLU A 57  ? GLU A 59  . ? 1_555 ? 
28 AC3 4  ASP A 59  ? ASP A 61  . ? 1_555 ? 
29 AC3 4  APC C .   ? APC A 501 . ? 1_555 ? 
30 AC4 5  VAL A 38  ? VAL A 40  . ? 1_555 ? 
31 AC4 5  GLU A 39  ? GLU A 41  . ? 1_555 ? 
32 AC4 5  LEU A 62  ? LEU A 64  . ? 1_555 ? 
33 AC4 5  LEU A 63  ? LEU A 65  . ? 1_555 ? 
34 AC4 5  PHE A 64  ? PHE A 66  . ? 1_555 ? 
35 AC5 5  ARG A 138 ? ARG A 140 . ? 1_555 ? 
36 AC5 5  ILE A 406 ? ILE A 408 . ? 1_455 ? 
37 AC5 5  ARG A 407 ? ARG A 409 . ? 1_455 ? 
38 AC5 5  TYR A 409 ? TYR A 411 . ? 1_455 ? 
39 AC5 5  PHE A 410 ? PHE A 412 . ? 1_455 ? 
40 AC6 5  ILE A 121 ? ILE A 123 . ? 1_555 ? 
41 AC6 5  LYS A 122 ? LYS A 124 . ? 1_555 ? 
42 AC6 5  SER A 123 ? SER A 125 . ? 1_555 ? 
43 AC6 5  ALA A 124 ? ALA A 126 . ? 1_555 ? 
44 AC6 5  HOH I .   ? HOH A 545 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OVA 
_atom_sites.fract_transf_matrix[1][1]   0.017259 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017259 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002337 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 1   ? 2.117  10.612  -8.079  1.00 54.11  ? 3   VAL A N     1 
ATOM   2    C  CA    . VAL A 1 1   ? 2.636  9.848   -9.247  1.00 52.71  ? 3   VAL A CA    1 
ATOM   3    C  C     . VAL A 1 1   ? 1.983  10.330  -10.538 1.00 52.78  ? 3   VAL A C     1 
ATOM   4    O  O     . VAL A 1 1   ? 2.665  10.511  -11.547 1.00 52.20  ? 3   VAL A O     1 
ATOM   5    C  CB    . VAL A 1 1   ? 2.408  8.318   -9.120  1.00 51.59  ? 3   VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 1   ? 3.276  7.575   -10.117 1.00 50.20  ? 3   VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 1   ? 2.708  7.825   -7.718  1.00 52.27  ? 3   VAL A CG2   1 
ATOM   8    N  N     . GLU A 1 2   ? 0.666  10.536  -10.495 1.00 53.69  ? 4   GLU A N     1 
ATOM   9    C  CA    . GLU A 1 2   ? -0.104 11.001  -11.658 1.00 53.90  ? 4   GLU A CA    1 
ATOM   10   C  C     . GLU A 1 2   ? 0.404  12.326  -12.226 1.00 54.07  ? 4   GLU A C     1 
ATOM   11   O  O     . GLU A 1 2   ? 0.368  12.535  -13.440 1.00 53.78  ? 4   GLU A O     1 
ATOM   12   C  CB    . GLU A 1 2   ? -1.596 11.086  -11.323 1.00 55.32  ? 4   GLU A CB    1 
ATOM   13   C  CG    . GLU A 1 2   ? -2.353 9.795   -11.621 1.00 55.89  ? 4   GLU A CG    1 
ATOM   14   C  CD    . GLU A 1 2   ? -3.436 9.485   -10.597 1.00 59.39  ? 4   GLU A CD    1 
ATOM   15   O  OE1   . GLU A 1 2   ? -4.413 10.269  -10.476 1.00 61.51  ? 4   GLU A OE1   1 
ATOM   16   O  OE2   . GLU A 1 2   ? -3.309 8.439   -9.917  1.00 59.45  ? 4   GLU A OE2   1 
ATOM   17   N  N     . GLU A 1 3   ? 0.894  13.197  -11.346 1.00 54.32  ? 5   GLU A N     1 
ATOM   18   C  CA    . GLU A 1 3   ? 1.455  14.494  -11.742 1.00 54.56  ? 5   GLU A CA    1 
ATOM   19   C  C     . GLU A 1 3   ? 2.805  14.329  -12.438 1.00 52.47  ? 5   GLU A C     1 
ATOM   20   O  O     . GLU A 1 3   ? 3.111  15.053  -13.389 1.00 52.67  ? 5   GLU A O     1 
ATOM   21   C  CB    . GLU A 1 3   ? 1.620  15.420  -10.525 1.00 56.33  ? 5   GLU A CB    1 
ATOM   22   C  CG    . GLU A 1 3   ? 0.544  15.295  -9.438  1.00 58.19  ? 5   GLU A CG    1 
ATOM   23   C  CD    . GLU A 1 3   ? -0.782 15.939  -9.818  1.00 60.47  ? 5   GLU A CD    1 
ATOM   24   O  OE1   . GLU A 1 3   ? -1.499 15.385  -10.687 1.00 59.76  ? 5   GLU A OE1   1 
ATOM   25   O  OE2   . GLU A 1 3   ? -1.114 16.992  -9.227  1.00 62.18  ? 5   GLU A OE2   1 
ATOM   26   N  N     . ILE A 1 4   ? 3.603  13.384  -11.944 1.00 50.23  ? 6   ILE A N     1 
ATOM   27   C  CA    . ILE A 1 4   ? 4.931  13.083  -12.487 1.00 48.25  ? 6   ILE A CA    1 
ATOM   28   C  C     . ILE A 1 4   ? 4.835  12.508  -13.905 1.00 46.39  ? 6   ILE A C     1 
ATOM   29   O  O     . ILE A 1 4   ? 5.594  12.903  -14.796 1.00 46.01  ? 6   ILE A O     1 
ATOM   30   C  CB    . ILE A 1 4   ? 5.723  12.099  -11.559 1.00 47.40  ? 6   ILE A CB    1 
ATOM   31   C  CG1   . ILE A 1 4   ? 5.879  12.678  -10.141 1.00 48.90  ? 6   ILE A CG1   1 
ATOM   32   C  CG2   . ILE A 1 4   ? 7.082  11.706  -12.172 1.00 45.78  ? 6   ILE A CG2   1 
ATOM   33   C  CD1   . ILE A 1 4   ? 6.722  13.942  -10.049 1.00 49.83  ? 6   ILE A CD1   1 
ATOM   34   N  N     . LEU A 1 5   ? 3.894  11.583  -14.097 1.00 44.90  ? 7   LEU A N     1 
ATOM   35   C  CA    . LEU A 1 5   ? 3.667  10.944  -15.394 1.00 43.07  ? 7   LEU A CA    1 
ATOM   36   C  C     . LEU A 1 5   ? 3.171  11.943  -16.439 1.00 43.50  ? 7   LEU A C     1 
ATOM   37   O  O     . LEU A 1 5   ? 3.471  11.799  -17.625 1.00 42.42  ? 7   LEU A O     1 
ATOM   38   C  CB    . LEU A 1 5   ? 2.707  9.760   -15.255 1.00 42.36  ? 7   LEU A CB    1 
ATOM   39   C  CG    . LEU A 1 5   ? 3.147  8.647   -14.292 1.00 41.49  ? 7   LEU A CG    1 
ATOM   40   C  CD1   . LEU A 1 5   ? 2.093  7.552   -14.179 1.00 41.37  ? 7   LEU A CD1   1 
ATOM   41   C  CD2   . LEU A 1 5   ? 4.485  8.059   -14.702 1.00 40.49  ? 7   LEU A CD2   1 
ATOM   42   N  N     . GLU A 1 6   ? 2.435  12.962  -15.988 1.00 44.55  ? 8   GLU A N     1 
ATOM   43   C  CA    . GLU A 1 6   ? 2.047  14.086  -16.847 1.00 45.43  ? 8   GLU A CA    1 
ATOM   44   C  C     . GLU A 1 6   ? 3.272  14.850  -17.339 1.00 44.97  ? 8   GLU A C     1 
ATOM   45   O  O     . GLU A 1 6   ? 3.402  15.100  -18.536 1.00 45.00  ? 8   GLU A O     1 
ATOM   46   C  CB    . GLU A 1 6   ? 1.078  15.043  -16.138 1.00 47.31  ? 8   GLU A CB    1 
ATOM   47   C  CG    . GLU A 1 6   ? -0.232 14.417  -15.643 1.00 49.17  ? 8   GLU A CG    1 
ATOM   48   C  CD    . GLU A 1 6   ? -1.159 13.940  -16.762 1.00 50.94  ? 8   GLU A CD    1 
ATOM   49   O  OE1   . GLU A 1 6   ? -0.826 12.938  -17.437 1.00 50.12  ? 8   GLU A OE1   1 
ATOM   50   O  OE2   . GLU A 1 6   ? -2.240 14.549  -16.939 1.00 52.84  ? 8   GLU A OE2   1 
ATOM   51   N  N     . LYS A 1 7   ? 4.168  15.208  -16.417 1.00 44.68  ? 9   LYS A N     1 
ATOM   52   C  CA    . LYS A 1 7   ? 5.424  15.882  -16.768 1.00 44.52  ? 9   LYS A CA    1 
ATOM   53   C  C     . LYS A 1 7   ? 6.306  15.006  -17.656 1.00 42.39  ? 9   LYS A C     1 
ATOM   54   O  O     . LYS A 1 7   ? 6.928  15.497  -18.603 1.00 42.15  ? 9   LYS A O     1 
ATOM   55   C  CB    . LYS A 1 7   ? 6.212  16.288  -15.520 1.00 45.10  ? 9   LYS A CB    1 
ATOM   56   C  CG    . LYS A 1 7   ? 5.538  17.314  -14.632 1.00 47.60  ? 9   LYS A CG    1 
ATOM   57   C  CD    . LYS A 1 7   ? 6.515  17.819  -13.576 1.00 49.73  ? 9   LYS A CD    1 
ATOM   58   C  CE    . LYS A 1 7   ? 5.820  18.169  -12.261 1.00 51.54  ? 9   LYS A CE    1 
ATOM   59   N  NZ    . LYS A 1 7   ? 5.013  19.412  -12.350 1.00 53.75  ? 9   LYS A NZ    1 
ATOM   60   N  N     . ALA A 1 8   ? 6.354  13.712  -17.332 1.00 40.58  ? 10  ALA A N     1 
ATOM   61   C  CA    . ALA A 1 8   ? 7.173  12.734  -18.062 1.00 38.87  ? 10  ALA A CA    1 
ATOM   62   C  C     . ALA A 1 8   ? 6.742  12.555  -19.526 1.00 38.19  ? 10  ALA A C     1 
ATOM   63   O  O     . ALA A 1 8   ? 7.591  12.332  -20.397 1.00 37.52  ? 10  ALA A O     1 
ATOM   64   C  CB    . ALA A 1 8   ? 7.193  11.388  -17.325 1.00 37.46  ? 10  ALA A CB    1 
ATOM   65   N  N     . LEU A 1 9   ? 5.437  12.672  -19.787 1.00 38.23  ? 11  LEU A N     1 
ATOM   66   C  CA    . LEU A 1 9   ? 4.895  12.660  -21.154 1.00 38.06  ? 11  LEU A CA    1 
ATOM   67   C  C     . LEU A 1 9   ? 5.580  13.658  -22.081 1.00 38.57  ? 11  LEU A C     1 
ATOM   68   O  O     . LEU A 1 9   ? 5.739  13.396  -23.274 1.00 38.27  ? 11  LEU A O     1 
ATOM   69   C  CB    . LEU A 1 9   ? 3.390  12.932  -21.156 1.00 38.86  ? 11  LEU A CB    1 
ATOM   70   C  CG    . LEU A 1 9   ? 2.446  11.852  -20.623 1.00 38.68  ? 11  LEU A CG    1 
ATOM   71   C  CD1   . LEU A 1 9   ? 1.034  12.401  -20.567 1.00 40.40  ? 11  LEU A CD1   1 
ATOM   72   C  CD2   . LEU A 1 9   ? 2.498  10.566  -21.452 1.00 37.65  ? 11  LEU A CD2   1 
ATOM   73   N  N     . GLU A 1 10  ? 5.993  14.794  -21.527 1.00 39.20  ? 12  GLU A N     1 
ATOM   74   C  CA    . GLU A 1 10  ? 6.672  15.831  -22.302 1.00 39.96  ? 12  GLU A CA    1 
ATOM   75   C  C     . GLU A 1 10  ? 8.079  15.401  -22.733 1.00 38.51  ? 12  GLU A C     1 
ATOM   76   O  O     . GLU A 1 10  ? 8.661  15.976  -23.657 1.00 38.83  ? 12  GLU A O     1 
ATOM   77   C  CB    . GLU A 1 10  ? 6.723  17.142  -21.513 1.00 41.88  ? 12  GLU A CB    1 
ATOM   78   C  CG    . GLU A 1 10  ? 5.396  17.503  -20.831 1.00 43.94  ? 12  GLU A CG    1 
ATOM   79   C  CD    . GLU A 1 10  ? 5.295  18.973  -20.449 1.00 47.27  ? 12  GLU A CD    1 
ATOM   80   O  OE1   . GLU A 1 10  ? 6.147  19.769  -20.902 1.00 49.67  ? 12  GLU A OE1   1 
ATOM   81   O  OE2   . GLU A 1 10  ? 4.357  19.336  -19.700 1.00 48.43  ? 12  GLU A OE2   1 
ATOM   82   N  N     . LEU A 1 11  ? 8.612  14.377  -22.073 1.00 36.65  ? 13  LEU A N     1 
ATOM   83   C  CA    . LEU A 1 11  ? 9.939  13.867  -22.400 1.00 35.29  ? 13  LEU A CA    1 
ATOM   84   C  C     . LEU A 1 11  ? 9.885  12.706  -23.396 1.00 33.80  ? 13  LEU A C     1 
ATOM   85   O  O     . LEU A 1 11  ? 10.864 12.452  -24.106 1.00 33.34  ? 13  LEU A O     1 
ATOM   86   C  CB    . LEU A 1 11  ? 10.685 13.439  -21.129 1.00 34.71  ? 13  LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 11  ? 10.744 14.361  -19.910 1.00 35.60  ? 13  LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 11  ? 11.539 13.687  -18.805 1.00 34.52  ? 13  LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 11  ? 11.333 15.732  -20.240 1.00 36.96  ? 13  LEU A CD2   1 
ATOM   90   N  N     . VAL A 1 12  ? 8.748  12.009  -23.444 1.00 32.97  ? 14  VAL A N     1 
ATOM   91   C  CA    . VAL A 1 12  ? 8.629  10.777  -24.235 1.00 31.57  ? 14  VAL A CA    1 
ATOM   92   C  C     . VAL A 1 12  ? 7.800  10.915  -25.525 1.00 32.17  ? 14  VAL A C     1 
ATOM   93   O  O     . VAL A 1 12  ? 7.942  10.100  -26.445 1.00 31.27  ? 14  VAL A O     1 
ATOM   94   C  CB    . VAL A 1 12  ? 8.122  9.557   -23.388 1.00 30.71  ? 14  VAL A CB    1 
ATOM   95   C  CG1   . VAL A 1 12  ? 9.122  9.197   -22.275 1.00 29.62  ? 14  VAL A CG1   1 
ATOM   96   C  CG2   . VAL A 1 12  ? 6.723  9.797   -22.822 1.00 30.26  ? 14  VAL A CG2   1 
ATOM   97   N  N     . ILE A 1 13  ? 6.945  11.933  -25.590 1.00 33.28  ? 15  ILE A N     1 
ATOM   98   C  CA    . ILE A 1 13  ? 6.082  12.133  -26.757 1.00 34.26  ? 15  ILE A CA    1 
ATOM   99   C  C     . ILE A 1 13  ? 6.731  13.107  -27.740 1.00 35.39  ? 15  ILE A C     1 
ATOM   100  O  O     . ILE A 1 13  ? 7.122  14.207  -27.353 1.00 36.45  ? 15  ILE A O     1 
ATOM   101  C  CB    . ILE A 1 13  ? 4.654  12.619  -26.362 1.00 35.18  ? 15  ILE A CB    1 
ATOM   102  C  CG1   . ILE A 1 13  ? 3.982  11.602  -25.436 1.00 34.39  ? 15  ILE A CG1   1 
ATOM   103  C  CG2   . ILE A 1 13  ? 3.788  12.887  -27.613 1.00 35.38  ? 15  ILE A CG2   1 
ATOM   104  C  CD1   . ILE A 1 13  ? 2.750  12.127  -24.759 1.00 37.11  ? 15  ILE A CD1   1 
ATOM   105  N  N     . PRO A 1 14  ? 6.878  12.689  -29.009 1.00 34.77  ? 16  PRO A N     1 
ATOM   106  C  CA    . PRO A 1 14  ? 7.383  13.586  -30.048 1.00 35.69  ? 16  PRO A CA    1 
ATOM   107  C  C     . PRO A 1 14  ? 6.394  14.724  -30.307 1.00 37.64  ? 16  PRO A C     1 
ATOM   108  O  O     . PRO A 1 14  ? 5.180  14.486  -30.351 1.00 37.91  ? 16  PRO A O     1 
ATOM   109  C  CB    . PRO A 1 14  ? 7.493  12.680  -31.285 1.00 34.25  ? 16  PRO A CB    1 
ATOM   110  C  CG    . PRO A 1 14  ? 7.423  11.289  -30.769 1.00 33.54  ? 16  PRO A CG    1 
ATOM   111  C  CD    . PRO A 1 14  ? 6.598  11.338  -29.529 1.00 33.47  ? 16  PRO A CD    1 
ATOM   112  N  N     . ASP A 1 15  ? 6.903  15.948  -30.454 1.00 39.36  ? 17  ASP A N     1 
ATOM   113  C  CA    . ASP A 1 15  ? 6.045  17.094  -30.764 1.00 41.76  ? 17  ASP A CA    1 
ATOM   114  C  C     . ASP A 1 15  ? 5.608  17.053  -32.232 1.00 41.76  ? 17  ASP A C     1 
ATOM   115  O  O     . ASP A 1 15  ? 6.069  16.195  -33.000 1.00 40.59  ? 17  ASP A O     1 
ATOM   116  C  CB    . ASP A 1 15  ? 6.722  18.436  -30.407 1.00 43.43  ? 17  ASP A CB    1 
ATOM   117  C  CG    . ASP A 1 15  ? 8.033  18.675  -31.167 1.00 44.90  ? 17  ASP A CG    1 
ATOM   118  O  OD1   . ASP A 1 15  ? 8.902  19.396  -30.623 1.00 47.14  ? 17  ASP A OD1   1 
ATOM   119  O  OD2   . ASP A 1 15  ? 8.211  18.151  -32.294 1.00 45.55  ? 17  ASP A OD2   1 
ATOM   120  N  N     . GLU A 1 16  ? 4.732  17.983  -32.614 1.00 43.22  ? 18  GLU A N     1 
ATOM   121  C  CA    . GLU A 1 16  ? 4.090  17.961  -33.930 1.00 43.31  ? 18  GLU A CA    1 
ATOM   122  C  C     . GLU A 1 16  ? 5.069  18.077  -35.088 1.00 42.42  ? 18  GLU A C     1 
ATOM   123  O  O     . GLU A 1 16  ? 4.799  17.567  -36.172 1.00 41.62  ? 18  GLU A O     1 
ATOM   124  C  CB    . GLU A 1 16  ? 3.012  19.036  -34.035 1.00 45.43  ? 18  GLU A CB    1 
ATOM   125  C  CG    . GLU A 1 16  ? 1.760  18.737  -33.211 1.00 47.57  ? 18  GLU A CG    1 
ATOM   126  C  CD    . GLU A 1 16  ? 0.922  19.987  -32.934 1.00 51.55  ? 18  GLU A CD    1 
ATOM   127  O  OE1   . GLU A 1 16  ? 1.038  20.976  -33.698 1.00 53.41  ? 18  GLU A OE1   1 
ATOM   128  O  OE2   . GLU A 1 16  ? 0.146  19.976  -31.948 1.00 52.36  ? 18  GLU A OE2   1 
ATOM   129  N  N     . GLU A 1 17  ? 6.196  18.743  -34.844 1.00 42.58  ? 19  GLU A N     1 
ATOM   130  C  CA    . GLU A 1 17  ? 7.222  18.944  -35.863 1.00 42.25  ? 19  GLU A CA    1 
ATOM   131  C  C     . GLU A 1 17  ? 8.001  17.661  -36.142 1.00 40.17  ? 19  GLU A C     1 
ATOM   132  O  O     . GLU A 1 17  ? 8.327  17.375  -37.291 1.00 39.23  ? 19  GLU A O     1 
ATOM   133  C  CB    . GLU A 1 17  ? 8.178  20.066  -35.461 1.00 43.57  ? 19  GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 17  ? 8.863  20.743  -36.637 1.00 45.89  ? 19  GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 17  ? 7.931  21.678  -37.397 1.00 49.61  ? 19  GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 17  ? 7.691  21.433  -38.604 1.00 49.48  ? 19  GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 17  ? 7.432  22.654  -36.783 1.00 51.90  ? 19  GLU A OE2   1 
ATOM   138  N  N     . GLU A 1 18  ? 8.295  16.902  -35.084 1.00 38.95  ? 20  GLU A N     1 
ATOM   139  C  CA    . GLU A 1 18  ? 9.009  15.628  -35.210 1.00 37.23  ? 20  GLU A CA    1 
ATOM   140  C  C     . GLU A 1 18  ? 8.135  14.566  -35.865 1.00 35.70  ? 20  GLU A C     1 
ATOM   141  O  O     . GLU A 1 18  ? 8.610  13.794  -36.698 1.00 35.34  ? 20  GLU A O     1 
ATOM   142  C  CB    . GLU A 1 18  ? 9.514  15.143  -33.846 1.00 36.94  ? 20  GLU A CB    1 
ATOM   143  C  CG    . GLU A 1 18  ? 10.452 13.933  -33.922 1.00 35.78  ? 20  GLU A CG    1 
ATOM   144  C  CD    . GLU A 1 18  ? 10.863 13.419  -32.563 1.00 35.79  ? 20  GLU A CD    1 
ATOM   145  O  OE1   . GLU A 1 18  ? 10.801 14.188  -31.584 1.00 37.28  ? 20  GLU A OE1   1 
ATOM   146  O  OE2   . GLU A 1 18  ? 11.242 12.235  -32.465 1.00 36.39  ? 20  GLU A OE2   1 
ATOM   147  N  N     . VAL A 1 19  ? 6.862  14.530  -35.480 1.00 35.42  ? 21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 19  ? 5.870  13.677  -36.126 1.00 34.47  ? 21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 19  ? 5.776  14.024  -37.624 1.00 34.80  ? 21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 19  ? 5.766  13.130  -38.481 1.00 33.47  ? 21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 19  ? 4.480  13.821  -35.453 1.00 35.15  ? 21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 19  ? 3.418  13.014  -36.204 1.00 34.76  ? 21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 19  ? 4.547  13.409  -33.977 1.00 34.63  ? 21  VAL A CG2   1 
ATOM   154  N  N     . ARG A 1 20  ? 5.726  15.323  -37.920 1.00 35.99  ? 22  ARG A N     1 
ATOM   155  C  CA    . ARG A 1 20  ? 5.666  15.809  -39.296 1.00 36.80  ? 22  ARG A CA    1 
ATOM   156  C  C     . ARG A 1 20  ? 6.857  15.310  -40.106 1.00 35.44  ? 22  ARG A C     1 
ATOM   157  O  O     . ARG A 1 20  ? 6.683  14.812  -41.216 1.00 34.87  ? 22  ARG A O     1 
ATOM   158  C  CB    . ARG A 1 20  ? 5.588  17.335  -39.339 1.00 38.58  ? 22  ARG A CB    1 
ATOM   159  C  CG    . ARG A 1 20  ? 5.014  17.883  -40.647 1.00 42.10  ? 22  ARG A CG    1 
ATOM   160  C  CD    . ARG A 1 20  ? 5.271  19.374  -40.781 1.00 47.45  ? 22  ARG A CD    1 
ATOM   161  N  NE    . ARG A 1 20  ? 6.707  19.658  -40.828 1.00 50.84  ? 22  ARG A NE    1 
ATOM   162  C  CZ    . ARG A 1 20  ? 7.382  19.988  -41.928 1.00 52.66  ? 22  ARG A CZ    1 
ATOM   163  N  NH1   . ARG A 1 20  ? 6.758  20.102  -43.096 1.00 53.67  ? 22  ARG A NH1   1 
ATOM   164  N  NH2   . ARG A 1 20  ? 8.687  20.217  -41.859 1.00 53.50  ? 22  ARG A NH2   1 
ATOM   165  N  N     . LYS A 1 21  ? 8.055  15.421  -39.533 1.00 34.96  ? 23  LYS A N     1 
ATOM   166  C  CA    . LYS A 1 21  ? 9.278  14.908  -40.163 1.00 33.82  ? 23  LYS A CA    1 
ATOM   167  C  C     . LYS A 1 21  ? 9.193  13.423  -40.508 1.00 31.93  ? 23  LYS A C     1 
ATOM   168  O  O     . LYS A 1 21  ? 9.607  13.013  -41.595 1.00 31.09  ? 23  LYS A O     1 
ATOM   169  C  CB    . LYS A 1 21  ? 10.486 15.136  -39.261 1.00 34.20  ? 23  LYS A CB    1 
ATOM   170  C  CG    . LYS A 1 21  ? 11.330 16.337  -39.620 1.00 36.49  ? 23  LYS A CG    1 
ATOM   171  C  CD    . LYS A 1 21  ? 12.607 16.344  -38.775 1.00 38.21  ? 23  LYS A CD    1 
ATOM   172  C  CE    . LYS A 1 21  ? 13.626 15.297  -39.251 1.00 37.94  ? 23  LYS A CE    1 
ATOM   173  N  NZ    . LYS A 1 21  ? 14.830 15.205  -38.352 1.00 38.95  ? 23  LYS A NZ    1 
ATOM   174  N  N     . GLY A 1 22  ? 8.677  12.628  -39.570 1.00 30.49  ? 24  GLY A N     1 
ATOM   175  C  CA    . GLY A 1 22  ? 8.467  11.200  -39.786 1.00 28.72  ? 24  GLY A CA    1 
ATOM   176  C  C     . GLY A 1 22  ? 7.526  10.904  -40.945 1.00 28.16  ? 24  GLY A C     1 
ATOM   177  O  O     . GLY A 1 22  ? 7.859  10.105  -41.823 1.00 26.70  ? 24  GLY A O     1 
ATOM   178  N  N     . ARG A 1 23  ? 6.360  11.554  -40.944 1.00 28.46  ? 25  ARG A N     1 
ATOM   179  C  CA    . ARG A 1 23  ? 5.351  11.376  -42.003 1.00 28.97  ? 25  ARG A CA    1 
ATOM   180  C  C     . ARG A 1 23  ? 5.878  11.722  -43.389 1.00 28.88  ? 25  ARG A C     1 
ATOM   181  O  O     . ARG A 1 23  ? 5.564  11.040  -44.360 1.00 28.70  ? 25  ARG A O     1 
ATOM   182  C  CB    . ARG A 1 23  ? 4.086  12.200  -41.724 1.00 30.09  ? 25  ARG A CB    1 
ATOM   183  C  CG    . ARG A 1 23  ? 3.424  11.937  -40.385 1.00 31.54  ? 25  ARG A CG    1 
ATOM   184  C  CD    . ARG A 1 23  ? 2.657  10.632  -40.367 1.00 32.37  ? 25  ARG A CD    1 
ATOM   185  N  NE    . ARG A 1 23  ? 1.922  10.481  -39.114 1.00 34.16  ? 25  ARG A NE    1 
ATOM   186  C  CZ    . ARG A 1 23  ? 2.262  9.653   -38.124 1.00 34.01  ? 25  ARG A CZ    1 
ATOM   187  N  NH1   . ARG A 1 23  ? 3.339  8.871   -38.227 1.00 32.89  ? 25  ARG A NH1   1 
ATOM   188  N  NH2   . ARG A 1 23  ? 1.520  9.610   -37.022 1.00 32.88  ? 25  ARG A NH2   1 
ATOM   189  N  N     . GLU A 1 24  ? 6.677  12.781  -43.476 1.00 29.45  ? 26  GLU A N     1 
ATOM   190  C  CA    . GLU A 1 24  ? 7.244  13.210  -44.755 1.00 29.82  ? 26  GLU A CA    1 
ATOM   191  C  C     . GLU A 1 24  ? 8.315  12.244  -45.238 1.00 28.25  ? 26  GLU A C     1 
ATOM   192  O  O     . GLU A 1 24  ? 8.445  11.987  -46.442 1.00 28.33  ? 26  GLU A O     1 
ATOM   193  C  CB    . GLU A 1 24  ? 7.841  14.607  -44.633 1.00 31.00  ? 26  GLU A CB    1 
ATOM   194  C  CG    . GLU A 1 24  ? 6.825  15.701  -44.356 1.00 34.08  ? 26  GLU A CG    1 
ATOM   195  C  CD    . GLU A 1 24  ? 7.477  17.060  -44.233 1.00 37.87  ? 26  GLU A CD    1 
ATOM   196  O  OE1   . GLU A 1 24  ? 6.929  18.029  -44.795 1.00 40.57  ? 26  GLU A OE1   1 
ATOM   197  O  OE2   . GLU A 1 24  ? 8.542  17.156  -43.581 1.00 39.16  ? 26  GLU A OE2   1 
ATOM   198  N  N     . ALA A 1 25  ? 9.094  11.725  -44.295 1.00 27.04  ? 27  ALA A N     1 
ATOM   199  C  CA    . ALA A 1 25  ? 10.085 10.702  -44.586 1.00 25.84  ? 27  ALA A CA    1 
ATOM   200  C  C     . ALA A 1 25  ? 9.405  9.400   -45.018 1.00 24.81  ? 27  ALA A C     1 
ATOM   201  O  O     . ALA A 1 25  ? 9.852  8.746   -45.962 1.00 24.17  ? 27  ALA A O     1 
ATOM   202  C  CB    . ALA A 1 25  ? 10.971 10.475  -43.386 1.00 25.34  ? 27  ALA A CB    1 
ATOM   203  N  N     . GLU A 1 26  ? 8.325  9.036   -44.326 1.00 24.53  ? 28  GLU A N     1 
ATOM   204  C  CA    . GLU A 1 26  ? 7.483  7.917   -44.727 1.00 24.51  ? 28  GLU A CA    1 
ATOM   205  C  C     . GLU A 1 26  ? 6.947  8.096   -46.157 1.00 24.54  ? 28  GLU A C     1 
ATOM   206  O  O     . GLU A 1 26  ? 7.041  7.187   -46.983 1.00 24.21  ? 28  GLU A O     1 
ATOM   207  C  CB    . GLU A 1 26  ? 6.311  7.756   -43.754 1.00 24.79  ? 28  GLU A CB    1 
ATOM   208  C  CG    . GLU A 1 26  ? 5.283  6.697   -44.168 1.00 25.34  ? 28  GLU A CG    1 
ATOM   209  C  CD    . GLU A 1 26  ? 3.980  6.775   -43.375 1.00 25.64  ? 28  GLU A CD    1 
ATOM   210  O  OE1   . GLU A 1 26  ? 3.910  7.530   -42.388 1.00 26.28  ? 28  GLU A OE1   1 
ATOM   211  O  OE2   . GLU A 1 26  ? 3.017  6.079   -43.749 1.00 27.60  ? 28  GLU A OE2   1 
ATOM   212  N  N     . GLU A 1 27  ? 6.384  9.263   -46.443 1.00 25.50  ? 29  GLU A N     1 
ATOM   213  C  CA    . GLU A 1 27  ? 5.801  9.521   -47.767 1.00 26.47  ? 29  GLU A CA    1 
ATOM   214  C  C     . GLU A 1 27  ? 6.862  9.421   -48.857 1.00 25.41  ? 29  GLU A C     1 
ATOM   215  O  O     . GLU A 1 27  ? 6.589  8.911   -49.931 1.00 25.13  ? 29  GLU A O     1 
ATOM   216  C  CB    . GLU A 1 27  ? 5.113  10.886  -47.822 1.00 27.76  ? 29  GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 27  ? 4.361  11.146  -49.130 1.00 32.25  ? 29  GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 27  ? 2.957  10.529  -49.157 1.00 37.34  ? 29  GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 27  ? 2.776  9.364   -48.701 1.00 37.15  ? 29  GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 27  ? 2.029  11.224  -49.642 1.00 39.73  ? 29  GLU A OE2   1 
ATOM   221  N  N     . GLU A 1 28  ? 8.076  9.885   -48.563 1.00 25.05  ? 30  GLU A N     1 
ATOM   222  C  CA    . GLU A 1 28  ? 9.161  9.857   -49.544 1.00 25.34  ? 30  GLU A CA    1 
ATOM   223  C  C     . GLU A 1 28  ? 9.665  8.437   -49.805 1.00 24.63  ? 30  GLU A C     1 
ATOM   224  O  O     . GLU A 1 28  ? 9.987  8.085   -50.940 1.00 24.70  ? 30  GLU A O     1 
ATOM   225  C  CB    . GLU A 1 28  ? 10.312 10.786  -49.131 1.00 25.58  ? 30  GLU A CB    1 
ATOM   226  C  CG    . GLU A 1 28  ? 11.552 10.755  -50.061 1.00 25.61  ? 30  GLU A CG    1 
ATOM   227  C  CD    . GLU A 1 28  ? 11.277 11.192  -51.510 1.00 25.81  ? 30  GLU A CD    1 
ATOM   228  O  OE1   . GLU A 1 28  ? 10.117 11.457  -51.875 1.00 26.74  ? 30  GLU A OE1   1 
ATOM   229  O  OE2   . GLU A 1 28  ? 12.243 11.281  -52.297 1.00 27.30  ? 30  GLU A OE2   1 
ATOM   230  N  N     . LEU A 1 29  ? 9.742  7.644   -48.740 1.00 23.99  ? 31  LEU A N     1 
ATOM   231  C  CA    . LEU A 1 29  ? 10.094 6.231   -48.815 1.00 23.62  ? 31  LEU A CA    1 
ATOM   232  C  C     . LEU A 1 29  ? 9.117  5.466   -49.699 1.00 23.45  ? 31  LEU A C     1 
ATOM   233  O  O     . LEU A 1 29  ? 9.539  4.783   -50.615 1.00 23.29  ? 31  LEU A O     1 
ATOM   234  C  CB    . LEU A 1 29  ? 10.067 5.654   -47.403 1.00 23.52  ? 31  LEU A CB    1 
ATOM   235  C  CG    . LEU A 1 29  ? 11.204 4.887   -46.740 1.00 23.61  ? 31  LEU A CG    1 
ATOM   236  C  CD1   . LEU A 1 29  ? 12.557 4.984   -47.451 1.00 23.04  ? 31  LEU A CD1   1 
ATOM   237  C  CD2   . LEU A 1 29  ? 11.258 5.361   -45.287 1.00 21.88  ? 31  LEU A CD2   1 
ATOM   238  N  N     . ARG A 1 30  ? 7.819  5.582   -49.418 1.00 23.94  ? 32  ARG A N     1 
ATOM   239  C  CA    . ARG A 1 30  ? 6.773  4.964   -50.252 1.00 25.05  ? 32  ARG A CA    1 
ATOM   240  C  C     . ARG A 1 30  ? 6.958  5.336   -51.722 1.00 24.75  ? 32  ARG A C     1 
ATOM   241  O  O     . ARG A 1 30  ? 6.921  4.472   -52.592 1.00 24.23  ? 32  ARG A O     1 
ATOM   242  C  CB    . ARG A 1 30  ? 5.353  5.361   -49.799 1.00 25.53  ? 32  ARG A CB    1 
ATOM   243  C  CG    . ARG A 1 30  ? 5.091  5.221   -48.308 1.00 27.16  ? 32  ARG A CG    1 
ATOM   244  C  CD    . ARG A 1 30  ? 3.602  5.095   -47.962 1.00 28.61  ? 32  ARG A CD    1 
ATOM   245  N  NE    . ARG A 1 30  ? 3.235  3.684   -47.821 1.00 35.49  ? 32  ARG A NE    1 
ATOM   246  C  CZ    . ARG A 1 30  ? 3.061  3.051   -46.665 1.00 36.90  ? 32  ARG A CZ    1 
ATOM   247  N  NH1   . ARG A 1 30  ? 3.188  3.700   -45.514 1.00 38.66  ? 32  ARG A NH1   1 
ATOM   248  N  NH2   . ARG A 1 30  ? 2.755  1.758   -46.661 1.00 38.10  ? 32  ARG A NH2   1 
ATOM   249  N  N     . ARG A 1 31  ? 7.173  6.626   -51.980 1.00 24.71  ? 33  ARG A N     1 
ATOM   250  C  CA    . ARG A 1 31  ? 7.390  7.128   -53.331 1.00 25.15  ? 33  ARG A CA    1 
ATOM   251  C  C     . ARG A 1 31  ? 8.596  6.481   -54.033 1.00 24.18  ? 33  ARG A C     1 
ATOM   252  O  O     . ARG A 1 31  ? 8.501  6.087   -55.194 1.00 24.54  ? 33  ARG A O     1 
ATOM   253  C  CB    . ARG A 1 31  ? 7.520  8.655   -53.314 1.00 25.87  ? 33  ARG A CB    1 
ATOM   254  C  CG    . ARG A 1 31  ? 6.195  9.381   -53.173 1.00 27.83  ? 33  ARG A CG    1 
ATOM   255  C  CD    . ARG A 1 31  ? 6.404  10.825  -52.736 1.00 28.83  ? 33  ARG A CD    1 
ATOM   256  N  NE    . ARG A 1 31  ? 5.147  11.567  -52.741 1.00 29.80  ? 33  ARG A NE    1 
ATOM   257  C  CZ    . ARG A 1 31  ? 5.040  12.877  -52.538 1.00 31.31  ? 33  ARG A CZ    1 
ATOM   258  N  NH1   . ARG A 1 31  ? 6.124  13.620  -52.321 1.00 29.41  ? 33  ARG A NH1   1 
ATOM   259  N  NH2   . ARG A 1 31  ? 3.843  13.453  -52.575 1.00 32.71  ? 33  ARG A NH2   1 
ATOM   260  N  N     . ARG A 1 32  ? 9.723  6.391   -53.327 1.00 22.89  ? 34  ARG A N     1 
ATOM   261  C  CA    . ARG A 1 32  ? 10.922 5.751   -53.850 1.00 22.61  ? 34  ARG A CA    1 
ATOM   262  C  C     . ARG A 1 32  ? 10.706 4.253   -54.073 1.00 22.22  ? 34  ARG A C     1 
ATOM   263  O  O     . ARG A 1 32  ? 11.139 3.701   -55.093 1.00 21.68  ? 34  ARG A O     1 
ATOM   264  C  CB    . ARG A 1 32  ? 12.097 5.981   -52.897 1.00 22.05  ? 34  ARG A CB    1 
ATOM   265  C  CG    . ARG A 1 32  ? 12.487 7.440   -52.774 1.00 22.75  ? 34  ARG A CG    1 
ATOM   266  C  CD    . ARG A 1 32  ? 13.580 7.601   -51.757 1.00 20.34  ? 34  ARG A CD    1 
ATOM   267  N  NE    . ARG A 1 32  ? 13.899 9.002   -51.529 1.00 20.32  ? 34  ARG A NE    1 
ATOM   268  C  CZ    . ARG A 1 32  ? 14.999 9.417   -50.924 1.00 20.23  ? 34  ARG A CZ    1 
ATOM   269  N  NH1   . ARG A 1 32  ? 15.890 8.529   -50.490 1.00 18.60  ? 34  ARG A NH1   1 
ATOM   270  N  NH2   . ARG A 1 32  ? 15.213 10.715  -50.761 1.00 20.54  ? 34  ARG A NH2   1 
ATOM   271  N  N     . LEU A 1 33  ? 10.020 3.616   -53.119 1.00 22.20  ? 35  LEU A N     1 
ATOM   272  C  CA    . LEU A 1 33  ? 9.725  2.177   -53.172 1.00 22.57  ? 35  LEU A CA    1 
ATOM   273  C  C     . LEU A 1 33  ? 8.689  1.814   -54.253 1.00 23.86  ? 35  LEU A C     1 
ATOM   274  O  O     . LEU A 1 33  ? 8.833  0.801   -54.942 1.00 23.60  ? 35  LEU A O     1 
ATOM   275  C  CB    . LEU A 1 33  ? 9.280  1.665   -51.791 1.00 21.49  ? 35  LEU A CB    1 
ATOM   276  C  CG    . LEU A 1 33  ? 10.331 1.593   -50.666 1.00 21.49  ? 35  LEU A CG    1 
ATOM   277  C  CD1   . LEU A 1 33  ? 9.678  1.568   -49.290 1.00 19.66  ? 35  LEU A CD1   1 
ATOM   278  C  CD2   . LEU A 1 33  ? 11.270 0.402   -50.841 1.00 21.27  ? 35  LEU A CD2   1 
ATOM   279  N  N     . ASP A 1 34  ? 7.656  2.641   -54.400 1.00 25.24  ? 36  ASP A N     1 
ATOM   280  C  CA    . ASP A 1 34  ? 6.642  2.445   -55.458 1.00 26.96  ? 36  ASP A CA    1 
ATOM   281  C  C     . ASP A 1 34  ? 7.215  2.606   -56.855 1.00 27.97  ? 36  ASP A C     1 
ATOM   282  O  O     . ASP A 1 34  ? 6.752  1.974   -57.798 1.00 28.98  ? 36  ASP A O     1 
ATOM   283  C  CB    . ASP A 1 34  ? 5.469  3.408   -55.279 1.00 27.56  ? 36  ASP A CB    1 
ATOM   284  C  CG    . ASP A 1 34  ? 4.707  3.160   -54.006 1.00 27.19  ? 36  ASP A CG    1 
ATOM   285  O  OD1   . ASP A 1 34  ? 4.895  2.083   -53.401 1.00 26.99  ? 36  ASP A OD1   1 
ATOM   286  O  OD2   . ASP A 1 34  ? 3.927  4.048   -53.599 1.00 28.54  ? 36  ASP A OD2   1 
ATOM   287  N  N     . GLU A 1 35  ? 8.218  3.465   -56.988 1.00 28.71  ? 37  GLU A N     1 
ATOM   288  C  CA    . GLU A 1 35  ? 8.871  3.684   -58.271 1.00 30.13  ? 37  GLU A CA    1 
ATOM   289  C  C     . GLU A 1 35  ? 9.623  2.433   -58.703 1.00 29.87  ? 37  GLU A C     1 
ATOM   290  O  O     . GLU A 1 35  ? 9.782  2.171   -59.894 1.00 30.17  ? 37  GLU A O     1 
ATOM   291  C  CB    . GLU A 1 35  ? 9.801  4.899   -58.198 1.00 30.41  ? 37  GLU A CB    1 
ATOM   292  C  CG    . GLU A 1 35  ? 10.528 5.265   -59.496 1.00 33.69  ? 37  GLU A CG    1 
ATOM   293  C  CD    . GLU A 1 35  ? 9.611  5.399   -60.706 1.00 38.11  ? 37  GLU A CD    1 
ATOM   294  O  OE1   . GLU A 1 35  ? 8.440  5.817   -60.557 1.00 40.72  ? 37  GLU A OE1   1 
ATOM   295  O  OE2   . GLU A 1 35  ? 10.081 5.104   -61.823 1.00 40.66  ? 37  GLU A OE2   1 
ATOM   296  N  N     . LEU A 1 36  ? 10.075 1.659   -57.721 1.00 29.42  ? 38  LEU A N     1 
ATOM   297  C  CA    . LEU A 1 36  ? 10.800 0.432   -58.000 1.00 29.13  ? 38  LEU A CA    1 
ATOM   298  C  C     . LEU A 1 36  ? 9.863  -0.764  -58.143 1.00 29.30  ? 38  LEU A C     1 
ATOM   299  O  O     . LEU A 1 36  ? 10.288 -1.827  -58.590 1.00 29.96  ? 38  LEU A O     1 
ATOM   300  C  CB    . LEU A 1 36  ? 11.860 0.182   -56.922 1.00 28.23  ? 38  LEU A CB    1 
ATOM   301  C  CG    . LEU A 1 36  ? 13.019 1.180   -56.850 1.00 28.27  ? 38  LEU A CG    1 
ATOM   302  C  CD1   . LEU A 1 36  ? 13.776 1.009   -55.551 1.00 26.62  ? 38  LEU A CD1   1 
ATOM   303  C  CD2   . LEU A 1 36  ? 13.969 1.077   -58.062 1.00 29.74  ? 38  LEU A CD2   1 
ATOM   304  N  N     . GLY A 1 37  ? 8.594  -0.590  -57.772 1.00 29.49  ? 39  GLY A N     1 
ATOM   305  C  CA    . GLY A 1 37  ? 7.595  -1.659  -57.856 1.00 29.31  ? 39  GLY A CA    1 
ATOM   306  C  C     . GLY A 1 37  ? 7.841  -2.770  -56.850 1.00 28.89  ? 39  GLY A C     1 
ATOM   307  O  O     . GLY A 1 37  ? 7.495  -3.928  -57.089 1.00 28.93  ? 39  GLY A O     1 
ATOM   308  N  N     . VAL A 1 38  ? 8.433  -2.403  -55.716 1.00 27.88  ? 40  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 38  ? 8.837  -3.340  -54.674 1.00 27.48  ? 40  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 38  ? 7.659  -3.659  -53.729 1.00 27.21  ? 40  VAL A C     1 
ATOM   311  O  O     . VAL A 1 38  ? 6.794  -2.809  -53.504 1.00 27.29  ? 40  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 38  ? 10.089 -2.742  -53.930 1.00 26.85  ? 40  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 38  ? 10.238 -3.260  -52.534 1.00 27.69  ? 40  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 38  ? 11.364 -2.983  -54.756 1.00 27.59  ? 40  VAL A CG2   1 
ATOM   315  N  N     . GLU A 1 39  ? 7.604  -4.892  -53.213 1.00 26.74  ? 41  GLU A N     1 
ATOM   316  C  CA    . GLU A 1 39  ? 6.628  -5.248  -52.179 1.00 26.59  ? 41  GLU A CA    1 
ATOM   317  C  C     . GLU A 1 39  ? 7.223  -5.046  -50.778 1.00 25.02  ? 41  GLU A C     1 
ATOM   318  O  O     . GLU A 1 39  ? 8.206  -5.689  -50.409 1.00 24.21  ? 41  GLU A O     1 
ATOM   319  C  CB    . GLU A 1 39  ? 6.117  -6.687  -52.348 1.00 27.16  ? 41  GLU A CB    1 
ATOM   320  C  CG    . GLU A 1 39  ? 4.902  -7.013  -51.460 1.00 28.85  ? 41  GLU A CG    1 
ATOM   321  C  CD    . GLU A 1 39  ? 4.472  -8.472  -51.532 1.00 29.26  ? 41  GLU A CD    1 
ATOM   322  O  OE1   . GLU A 1 39  ? 4.911  -9.203  -52.444 1.00 33.28  ? 41  GLU A OE1   1 
ATOM   323  O  OE2   . GLU A 1 39  ? 3.676  -8.893  -50.677 1.00 32.67  ? 41  GLU A OE2   1 
ATOM   324  N  N     . TYR A 1 40  ? 6.601  -4.165  -50.003 1.00 24.16  ? 42  TYR A N     1 
ATOM   325  C  CA    . TYR A 1 40  ? 7.127  -3.774  -48.697 1.00 23.17  ? 42  TYR A CA    1 
ATOM   326  C  C     . TYR A 1 40  ? 6.012  -3.588  -47.670 1.00 23.03  ? 42  TYR A C     1 
ATOM   327  O  O     . TYR A 1 40  ? 4.840  -3.480  -48.037 1.00 24.01  ? 42  TYR A O     1 
ATOM   328  C  CB    . TYR A 1 40  ? 7.911  -2.472  -48.833 1.00 22.18  ? 42  TYR A CB    1 
ATOM   329  C  CG    . TYR A 1 40  ? 7.084  -1.312  -49.346 1.00 23.04  ? 42  TYR A CG    1 
ATOM   330  C  CD1   . TYR A 1 40  ? 6.421  -0.454  -48.464 1.00 21.93  ? 42  TYR A CD1   1 
ATOM   331  C  CD2   . TYR A 1 40  ? 6.958  -1.077  -50.713 1.00 23.37  ? 42  TYR A CD2   1 
ATOM   332  C  CE1   . TYR A 1 40  ? 5.657  0.599   -48.932 1.00 23.39  ? 42  TYR A CE1   1 
ATOM   333  C  CE2   . TYR A 1 40  ? 6.200  -0.012  -51.194 1.00 24.23  ? 42  TYR A CE2   1 
ATOM   334  C  CZ    . TYR A 1 40  ? 5.554  0.822   -50.294 1.00 23.69  ? 42  TYR A CZ    1 
ATOM   335  O  OH    . TYR A 1 40  ? 4.799  1.867   -50.764 1.00 24.76  ? 42  TYR A OH    1 
ATOM   336  N  N     . VAL A 1 41  ? 6.390  -3.526  -46.397 1.00 22.15  ? 43  VAL A N     1 
ATOM   337  C  CA    . VAL A 1 41  ? 5.468  -3.182  -45.312 1.00 22.17  ? 43  VAL A CA    1 
ATOM   338  C  C     . VAL A 1 41  ? 6.190  -2.352  -44.243 1.00 21.36  ? 43  VAL A C     1 
ATOM   339  O  O     . VAL A 1 41  ? 7.347  -2.628  -43.905 1.00 20.85  ? 43  VAL A O     1 
ATOM   340  C  CB    . VAL A 1 41  ? 4.790  -4.457  -44.698 1.00 22.63  ? 43  VAL A CB    1 
ATOM   341  C  CG1   . VAL A 1 41  ? 5.823  -5.396  -44.055 1.00 20.70  ? 43  VAL A CG1   1 
ATOM   342  C  CG2   . VAL A 1 41  ? 3.693  -4.074  -43.701 1.00 23.60  ? 43  VAL A CG2   1 
ATOM   343  N  N     . PHE A 1 42  ? 5.517  -1.313  -43.741 1.00 21.58  ? 44  PHE A N     1 
ATOM   344  C  CA    . PHE A 1 42  ? 6.034  -0.547  -42.605 1.00 20.61  ? 44  PHE A CA    1 
ATOM   345  C  C     . PHE A 1 42  ? 5.680  -1.278  -41.302 1.00 20.26  ? 44  PHE A C     1 
ATOM   346  O  O     . PHE A 1 42  ? 4.533  -1.668  -41.085 1.00 19.39  ? 44  PHE A O     1 
ATOM   347  C  CB    . PHE A 1 42  ? 5.494  0.889   -42.590 1.00 21.72  ? 44  PHE A CB    1 
ATOM   348  C  CG    . PHE A 1 42  ? 6.100  1.790   -43.654 1.00 22.00  ? 44  PHE A CG    1 
ATOM   349  C  CD1   . PHE A 1 42  ? 5.801  1.603   -45.004 1.00 22.81  ? 44  PHE A CD1   1 
ATOM   350  C  CD2   . PHE A 1 42  ? 6.967  2.813   -43.306 1.00 21.94  ? 44  PHE A CD2   1 
ATOM   351  C  CE1   . PHE A 1 42  ? 6.360  2.423   -45.986 1.00 23.46  ? 44  PHE A CE1   1 
ATOM   352  C  CE2   . PHE A 1 42  ? 7.528  3.642   -44.284 1.00 21.60  ? 44  PHE A CE2   1 
ATOM   353  C  CZ    . PHE A 1 42  ? 7.223  3.449   -45.618 1.00 23.37  ? 44  PHE A CZ    1 
ATOM   354  N  N     . VAL A 1 43  ? 6.679  -1.455  -40.445 1.00 19.28  ? 45  VAL A N     1 
ATOM   355  C  CA    . VAL A 1 43  ? 6.499  -2.172  -39.187 1.00 19.57  ? 45  VAL A CA    1 
ATOM   356  C  C     . VAL A 1 43  ? 7.203  -1.448  -38.042 1.00 19.40  ? 45  VAL A C     1 
ATOM   357  O  O     . VAL A 1 43  ? 7.703  -0.331  -38.226 1.00 19.78  ? 45  VAL A O     1 
ATOM   358  C  CB    . VAL A 1 43  ? 6.984  -3.648  -39.284 1.00 18.73  ? 45  VAL A CB    1 
ATOM   359  C  CG1   . VAL A 1 43  ? 6.131  -4.431  -40.299 1.00 19.50  ? 45  VAL A CG1   1 
ATOM   360  C  CG2   . VAL A 1 43  ? 8.476  -3.706  -39.629 1.00 18.89  ? 45  VAL A CG2   1 
ATOM   361  N  N     . GLY A 1 44  ? 7.242  -2.086  -36.872 1.00 19.43  ? 46  GLY A N     1 
ATOM   362  C  CA    . GLY A 1 44  ? 7.944  -1.527  -35.726 1.00 19.31  ? 46  GLY A CA    1 
ATOM   363  C  C     . GLY A 1 44  ? 7.254  -0.314  -35.120 1.00 19.51  ? 46  GLY A C     1 
ATOM   364  O  O     . GLY A 1 44  ? 6.064  -0.076  -35.371 1.00 19.85  ? 46  GLY A O     1 
ATOM   365  N  N     . SER A 1 45  ? 8.016  0.454   -34.337 1.00 19.54  ? 47  SER A N     1 
ATOM   366  C  CA    . SER A 1 45  ? 7.476  1.579   -33.563 1.00 20.12  ? 47  SER A CA    1 
ATOM   367  C  C     . SER A 1 45  ? 6.947  2.761   -34.379 1.00 20.43  ? 47  SER A C     1 
ATOM   368  O  O     . SER A 1 45  ? 5.977  3.406   -33.956 1.00 21.19  ? 47  SER A O     1 
ATOM   369  C  CB    . SER A 1 45  ? 8.461  2.060   -32.494 1.00 20.58  ? 47  SER A CB    1 
ATOM   370  O  OG    . SER A 1 45  ? 9.677  2.540   -33.051 1.00 20.24  ? 47  SER A OG    1 
ATOM   371  N  N     . TYR A 1 46  ? 7.565  3.059   -35.526 1.00 20.14  ? 48  TYR A N     1 
ATOM   372  C  CA    . TYR A 1 46  ? 7.044  4.131   -36.372 1.00 20.37  ? 48  TYR A CA    1 
ATOM   373  C  C     . TYR A 1 46  ? 5.634  3.810   -36.863 1.00 20.83  ? 48  TYR A C     1 
ATOM   374  O  O     . TYR A 1 46  ? 4.748  4.674   -36.836 1.00 20.53  ? 48  TYR A O     1 
ATOM   375  C  CB    . TYR A 1 46  ? 7.951  4.480   -37.569 1.00 20.40  ? 48  TYR A CB    1 
ATOM   376  C  CG    . TYR A 1 46  ? 7.290  5.543   -38.416 1.00 21.87  ? 48  TYR A CG    1 
ATOM   377  C  CD1   . TYR A 1 46  ? 7.213  6.863   -37.959 1.00 22.96  ? 48  TYR A CD1   1 
ATOM   378  C  CD2   . TYR A 1 46  ? 6.654  5.218   -39.620 1.00 22.49  ? 48  TYR A CD2   1 
ATOM   379  C  CE1   . TYR A 1 46  ? 6.570  7.840   -38.685 1.00 23.77  ? 48  TYR A CE1   1 
ATOM   380  C  CE2   . TYR A 1 46  ? 5.990  6.192   -40.356 1.00 24.31  ? 48  TYR A CE2   1 
ATOM   381  C  CZ    . TYR A 1 46  ? 5.961  7.506   -39.879 1.00 24.40  ? 48  TYR A CZ    1 
ATOM   382  O  OH    . TYR A 1 46  ? 5.320  8.485   -40.585 1.00 24.98  ? 48  TYR A OH    1 
ATOM   383  N  N     . ALA A 1 47  ? 5.439  2.566   -37.306 1.00 20.66  ? 49  ALA A N     1 
ATOM   384  C  CA    . ALA A 1 47  ? 4.154  2.128   -37.832 1.00 21.68  ? 49  ALA A CA    1 
ATOM   385  C  C     . ALA A 1 47  ? 3.067  2.061   -36.755 1.00 22.56  ? 49  ALA A C     1 
ATOM   386  O  O     . ALA A 1 47  ? 1.888  2.199   -37.062 1.00 22.98  ? 49  ALA A O     1 
ATOM   387  C  CB    . ALA A 1 47  ? 4.299  0.785   -38.569 1.00 21.35  ? 49  ALA A CB    1 
ATOM   388  N  N     . ARG A 1 48  ? 3.465  1.873   -35.497 1.00 22.63  ? 50  ARG A N     1 
ATOM   389  C  CA    . ARG A 1 48  ? 2.514  1.862   -34.376 1.00 23.90  ? 50  ARG A CA    1 
ATOM   390  C  C     . ARG A 1 48  ? 2.413  3.185   -33.597 1.00 24.69  ? 50  ARG A C     1 
ATOM   391  O  O     . ARG A 1 48  ? 1.601  3.300   -32.667 1.00 25.18  ? 50  ARG A O     1 
ATOM   392  C  CB    . ARG A 1 48  ? 2.853  0.743   -33.398 1.00 23.45  ? 50  ARG A CB    1 
ATOM   393  C  CG    . ARG A 1 48  ? 2.673  -0.661  -33.921 1.00 24.00  ? 50  ARG A CG    1 
ATOM   394  C  CD    . ARG A 1 48  ? 3.498  -1.621  -33.058 1.00 25.79  ? 50  ARG A CD    1 
ATOM   395  N  NE    . ARG A 1 48  ? 4.023  -2.657  -33.920 1.00 29.20  ? 50  ARG A NE    1 
ATOM   396  C  CZ    . ARG A 1 48  ? 5.204  -3.240  -33.812 1.00 27.95  ? 50  ARG A CZ    1 
ATOM   397  N  NH1   . ARG A 1 48  ? 6.065  -2.934  -32.844 1.00 25.95  ? 50  ARG A NH1   1 
ATOM   398  N  NH2   . ARG A 1 48  ? 5.506  -4.161  -34.704 1.00 30.84  ? 50  ARG A NH2   1 
ATOM   399  N  N     . ASN A 1 49  ? 3.223  4.172   -33.978 1.00 25.07  ? 51  ASN A N     1 
ATOM   400  C  CA    . ASN A 1 49  ? 3.329  5.448   -33.246 1.00 26.00  ? 51  ASN A CA    1 
ATOM   401  C  C     . ASN A 1 49  ? 3.656  5.233   -31.763 1.00 25.48  ? 51  ASN A C     1 
ATOM   402  O  O     . ASN A 1 49  ? 3.062  5.860   -30.866 1.00 25.84  ? 51  ASN A O     1 
ATOM   403  C  CB    . ASN A 1 49  ? 2.072  6.331   -33.425 1.00 27.43  ? 51  ASN A CB    1 
ATOM   404  C  CG    . ASN A 1 49  ? 1.758  6.626   -34.889 1.00 30.83  ? 51  ASN A CG    1 
ATOM   405  O  OD1   . ASN A 1 49  ? 2.533  7.282   -35.596 1.00 34.08  ? 51  ASN A OD1   1 
ATOM   406  N  ND2   . ASN A 1 49  ? 0.601  6.152   -35.346 1.00 34.32  ? 51  ASN A ND2   1 
ATOM   407  N  N     . THR A 1 50  ? 4.604  4.337   -31.516 1.00 24.37  ? 52  THR A N     1 
ATOM   408  C  CA    . THR A 1 50  ? 5.053  4.030   -30.158 1.00 24.33  ? 52  THR A CA    1 
ATOM   409  C  C     . THR A 1 50  ? 6.532  4.375   -29.991 1.00 23.73  ? 52  THR A C     1 
ATOM   410  O  O     . THR A 1 50  ? 7.164  3.929   -29.036 1.00 22.59  ? 52  THR A O     1 
ATOM   411  C  CB    . THR A 1 50  ? 4.837  2.536   -29.785 1.00 23.80  ? 52  THR A CB    1 
ATOM   412  O  OG1   . THR A 1 50  ? 5.438  1.705   -30.778 1.00 23.98  ? 52  THR A OG1   1 
ATOM   413  C  CG2   . THR A 1 50  ? 3.352  2.189   -29.660 1.00 24.11  ? 52  THR A CG2   1 
ATOM   414  N  N     . TRP A 1 51  ? 7.075  5.170   -30.916 1.00 23.68  ? 53  TRP A N     1 
ATOM   415  C  CA    . TRP A 1 51  ? 8.484  5.537   -30.857 1.00 24.14  ? 53  TRP A CA    1 
ATOM   416  C  C     . TRP A 1 51  ? 8.741  6.669   -29.862 1.00 25.56  ? 53  TRP A C     1 
ATOM   417  O  O     . TRP A 1 51  ? 7.893  7.559   -29.671 1.00 26.20  ? 53  TRP A O     1 
ATOM   418  C  CB    . TRP A 1 51  ? 9.048  5.866   -32.244 1.00 24.19  ? 53  TRP A CB    1 
ATOM   419  C  CG    . TRP A 1 51  ? 8.906  7.285   -32.657 1.00 25.68  ? 53  TRP A CG    1 
ATOM   420  C  CD1   . TRP A 1 51  ? 9.743  8.327   -32.338 1.00 27.24  ? 53  TRP A CD1   1 
ATOM   421  C  CD2   . TRP A 1 51  ? 7.879  7.837   -33.477 1.00 26.31  ? 53  TRP A CD2   1 
ATOM   422  N  NE1   . TRP A 1 51  ? 9.292  9.492   -32.903 1.00 27.92  ? 53  TRP A NE1   1 
ATOM   423  C  CE2   . TRP A 1 51  ? 8.147  9.225   -33.604 1.00 27.81  ? 53  TRP A CE2   1 
ATOM   424  C  CE3   . TRP A 1 51  ? 6.747  7.302   -34.106 1.00 25.26  ? 53  TRP A CE3   1 
ATOM   425  C  CZ2   . TRP A 1 51  ? 7.334  10.081  -34.352 1.00 28.00  ? 53  TRP A CZ2   1 
ATOM   426  C  CZ3   . TRP A 1 51  ? 5.944  8.148   -34.844 1.00 26.69  ? 53  TRP A CZ3   1 
ATOM   427  C  CH2   . TRP A 1 51  ? 6.237  9.527   -34.957 1.00 28.08  ? 53  TRP A CH2   1 
ATOM   428  N  N     . LEU A 1 52  ? 9.926  6.624   -29.247 1.00 25.58  ? 54  LEU A N     1 
ATOM   429  C  CA    . LEU A 1 52  ? 10.340 7.590   -28.232 1.00 27.09  ? 54  LEU A CA    1 
ATOM   430  C  C     . LEU A 1 52  ? 10.772 8.907   -28.870 1.00 27.70  ? 54  LEU A C     1 
ATOM   431  O  O     . LEU A 1 52  ? 11.486 8.920   -29.886 1.00 27.48  ? 54  LEU A O     1 
ATOM   432  C  CB    . LEU A 1 52  ? 11.488 6.996   -27.406 1.00 26.89  ? 54  LEU A CB    1 
ATOM   433  C  CG    . LEU A 1 52  ? 11.743 7.360   -25.948 1.00 28.57  ? 54  LEU A CG    1 
ATOM   434  C  CD1   . LEU A 1 52  ? 10.460 7.324   -25.108 1.00 28.24  ? 54  LEU A CD1   1 
ATOM   435  C  CD2   . LEU A 1 52  ? 12.781 6.396   -25.385 1.00 27.31  ? 54  LEU A CD2   1 
ATOM   436  N  N     . LYS A 1 53  ? 10.311 10.008  -28.279 1.00 28.83  ? 55  LYS A N     1 
ATOM   437  C  CA    . LYS A 1 53  ? 10.676 11.361  -28.687 1.00 29.81  ? 55  LYS A CA    1 
ATOM   438  C  C     . LYS A 1 53  ? 12.183 11.487  -28.866 1.00 29.77  ? 55  LYS A C     1 
ATOM   439  O  O     . LYS A 1 53  ? 12.942 11.187  -27.964 1.00 29.78  ? 55  LYS A O     1 
ATOM   440  C  CB    . LYS A 1 53  ? 10.186 12.358  -27.627 1.00 31.03  ? 55  LYS A CB    1 
ATOM   441  C  CG    . LYS A 1 53  ? 10.665 13.782  -27.792 1.00 32.99  ? 55  LYS A CG    1 
ATOM   442  C  CD    . LYS A 1 53  ? 10.379 14.586  -26.522 1.00 35.26  ? 55  LYS A CD    1 
ATOM   443  C  CE    . LYS A 1 53  ? 10.197 16.057  -26.818 1.00 37.49  ? 55  LYS A CE    1 
ATOM   444  N  NZ    . LYS A 1 53  ? 11.394 16.637  -27.459 1.00 38.22  ? 55  LYS A NZ    1 
ATOM   445  N  N     . GLY A 1 54  ? 12.608 11.926  -30.041 1.00 30.45  ? 56  GLY A N     1 
ATOM   446  C  CA    . GLY A 1 54  ? 14.027 12.127  -30.307 1.00 31.09  ? 56  GLY A CA    1 
ATOM   447  C  C     . GLY A 1 54  ? 14.769 10.886  -30.761 1.00 30.41  ? 56  GLY A C     1 
ATOM   448  O  O     . GLY A 1 54  ? 15.955 10.957  -31.073 1.00 30.72  ? 56  GLY A O     1 
ATOM   449  N  N     . SER A 1 55  ? 14.075 9.750   -30.802 1.00 29.85  ? 57  SER A N     1 
ATOM   450  C  CA    . SER A 1 55  ? 14.689 8.472   -31.162 1.00 29.17  ? 57  SER A CA    1 
ATOM   451  C  C     . SER A 1 55  ? 13.944 7.763   -32.294 1.00 28.22  ? 57  SER A C     1 
ATOM   452  O  O     . SER A 1 55  ? 13.705 6.559   -32.218 1.00 28.04  ? 57  SER A O     1 
ATOM   453  C  CB    . SER A 1 55  ? 14.737 7.554   -29.936 1.00 29.01  ? 57  SER A CB    1 
ATOM   454  O  OG    . SER A 1 55  ? 15.564 8.094   -28.917 1.00 30.53  ? 57  SER A OG    1 
ATOM   455  N  N     . LEU A 1 56  ? 13.570 8.506   -33.333 1.00 28.14  ? 58  LEU A N     1 
ATOM   456  C  CA    . LEU A 1 56  ? 12.798 7.931   -34.435 1.00 26.87  ? 58  LEU A CA    1 
ATOM   457  C  C     . LEU A 1 56  ? 13.664 7.121   -35.390 1.00 25.80  ? 58  LEU A C     1 
ATOM   458  O  O     . LEU A 1 56  ? 14.692 7.596   -35.881 1.00 25.97  ? 58  LEU A O     1 
ATOM   459  C  CB    . LEU A 1 56  ? 12.024 9.013   -35.208 1.00 27.45  ? 58  LEU A CB    1 
ATOM   460  C  CG    . LEU A 1 56  ? 11.204 8.599   -36.444 1.00 27.35  ? 58  LEU A CG    1 
ATOM   461  C  CD1   . LEU A 1 56  ? 10.300 7.397   -36.176 1.00 26.71  ? 58  LEU A CD1   1 
ATOM   462  C  CD2   . LEU A 1 56  ? 10.379 9.771   -36.974 1.00 28.55  ? 58  LEU A CD2   1 
ATOM   463  N  N     . GLU A 1 57  ? 13.233 5.890   -35.632 1.00 24.37  ? 59  GLU A N     1 
ATOM   464  C  CA    . GLU A 1 57  ? 13.728 5.090   -36.743 1.00 23.65  ? 59  GLU A CA    1 
ATOM   465  C  C     . GLU A 1 57  ? 12.561 4.389   -37.428 1.00 22.47  ? 59  GLU A C     1 
ATOM   466  O  O     . GLU A 1 57  ? 11.801 3.683   -36.778 1.00 22.46  ? 59  GLU A O     1 
ATOM   467  C  CB    . GLU A 1 57  ? 14.767 4.076   -36.265 1.00 23.26  ? 59  GLU A CB    1 
ATOM   468  C  CG    . GLU A 1 57  ? 15.090 3.003   -37.295 1.00 23.40  ? 59  GLU A CG    1 
ATOM   469  C  CD    . GLU A 1 57  ? 16.084 2.008   -36.775 1.00 22.98  ? 59  GLU A CD    1 
ATOM   470  O  OE1   . GLU A 1 57  ? 15.688 0.851   -36.480 1.00 21.23  ? 59  GLU A OE1   1 
ATOM   471  O  OE2   . GLU A 1 57  ? 17.255 2.407   -36.644 1.00 24.33  ? 59  GLU A OE2   1 
ATOM   472  N  N     . ILE A 1 58  ? 12.439 4.592   -38.738 1.00 21.99  ? 60  ILE A N     1 
ATOM   473  C  CA    . ILE A 1 58  ? 11.420 3.952   -39.576 1.00 20.93  ? 60  ILE A CA    1 
ATOM   474  C  C     . ILE A 1 58  ? 11.908 2.565   -40.023 1.00 20.16  ? 60  ILE A C     1 
ATOM   475  O  O     . ILE A 1 58  ? 13.036 2.421   -40.527 1.00 20.25  ? 60  ILE A O     1 
ATOM   476  C  CB    . ILE A 1 58  ? 11.065 4.860   -40.808 1.00 21.29  ? 60  ILE A CB    1 
ATOM   477  C  CG1   . ILE A 1 58  ? 10.478 6.198   -40.327 1.00 22.36  ? 60  ILE A CG1   1 
ATOM   478  C  CG2   . ILE A 1 58  ? 10.125 4.142   -41.810 1.00 20.47  ? 60  ILE A CG2   1 
ATOM   479  C  CD1   . ILE A 1 58  ? 10.061 7.184   -41.443 1.00 22.63  ? 60  ILE A CD1   1 
ATOM   480  N  N     . ASP A 1 59  ? 11.076 1.545   -39.833 1.00 19.24  ? 61  ASP A N     1 
ATOM   481  C  CA    . ASP A 1 59  ? 11.407 0.204   -40.329 1.00 18.83  ? 61  ASP A CA    1 
ATOM   482  C  C     . ASP A 1 59  ? 10.632 -0.108  -41.608 1.00 18.38  ? 61  ASP A C     1 
ATOM   483  O  O     . ASP A 1 59  ? 9.401  -0.043  -41.632 1.00 18.66  ? 61  ASP A O     1 
ATOM   484  C  CB    . ASP A 1 59  ? 11.143 -0.882  -39.270 1.00 18.45  ? 61  ASP A CB    1 
ATOM   485  C  CG    . ASP A 1 59  ? 11.993 -0.707  -38.029 1.00 19.29  ? 61  ASP A CG    1 
ATOM   486  O  OD1   . ASP A 1 59  ? 11.438 -0.219  -37.018 1.00 20.34  ? 61  ASP A OD1   1 
ATOM   487  O  OD2   . ASP A 1 59  ? 13.206 -1.038  -38.064 1.00 19.25  ? 61  ASP A OD2   1 
ATOM   488  N  N     . VAL A 1 60  ? 11.365 -0.410  -42.677 1.00 18.20  ? 62  VAL A N     1 
ATOM   489  C  CA    . VAL A 1 60  ? 10.748 -0.858  -43.929 1.00 18.32  ? 62  VAL A CA    1 
ATOM   490  C  C     . VAL A 1 60  ? 11.174 -2.294  -44.195 1.00 17.95  ? 62  VAL A C     1 
ATOM   491  O  O     . VAL A 1 60  ? 12.375 -2.599  -44.297 1.00 18.46  ? 62  VAL A O     1 
ATOM   492  C  CB    . VAL A 1 60  ? 11.105 0.054   -45.125 1.00 18.76  ? 62  VAL A CB    1 
ATOM   493  C  CG1   . VAL A 1 60  ? 10.476 -0.479  -46.415 1.00 18.62  ? 62  VAL A CG1   1 
ATOM   494  C  CG2   . VAL A 1 60  ? 10.638 1.469   -44.857 1.00 19.24  ? 62  VAL A CG2   1 
ATOM   495  N  N     . PHE A 1 61  ? 10.184 -3.176  -44.272 1.00 17.41  ? 63  PHE A N     1 
ATOM   496  C  CA    . PHE A 1 61  ? 10.423 -4.596  -44.514 1.00 17.16  ? 63  PHE A CA    1 
ATOM   497  C  C     . PHE A 1 61  ? 10.116 -4.975  -45.950 1.00 17.80  ? 63  PHE A C     1 
ATOM   498  O  O     . PHE A 1 61  ? 9.006  -4.734  -46.438 1.00 18.22  ? 63  PHE A O     1 
ATOM   499  C  CB    . PHE A 1 61  ? 9.609  -5.456  -43.531 1.00 17.25  ? 63  PHE A CB    1 
ATOM   500  C  CG    . PHE A 1 61  ? 10.378 -5.847  -42.312 1.00 16.58  ? 63  PHE A CG    1 
ATOM   501  C  CD1   . PHE A 1 61  ? 11.023 -4.877  -41.537 1.00 16.62  ? 63  PHE A CD1   1 
ATOM   502  C  CD2   . PHE A 1 61  ? 10.481 -7.185  -41.940 1.00 15.97  ? 63  PHE A CD2   1 
ATOM   503  C  CE1   . PHE A 1 61  ? 11.759 -5.238  -40.430 1.00 14.93  ? 63  PHE A CE1   1 
ATOM   504  C  CE2   . PHE A 1 61  ? 11.220 -7.548  -40.833 1.00 16.00  ? 63  PHE A CE2   1 
ATOM   505  C  CZ    . PHE A 1 61  ? 11.856 -6.570  -40.074 1.00 15.21  ? 63  PHE A CZ    1 
ATOM   506  N  N     . LEU A 1 62  ? 11.112 -5.545  -46.629 1.00 17.91  ? 64  LEU A N     1 
ATOM   507  C  CA    . LEU A 1 62  ? 10.947 -6.043  -48.002 1.00 19.15  ? 64  LEU A CA    1 
ATOM   508  C  C     . LEU A 1 62  ? 10.475 -7.503  -47.952 1.00 19.84  ? 64  LEU A C     1 
ATOM   509  O  O     . LEU A 1 62  ? 11.136 -8.357  -47.360 1.00 20.35  ? 64  LEU A O     1 
ATOM   510  C  CB    . LEU A 1 62  ? 12.259 -5.902  -48.791 1.00 19.13  ? 64  LEU A CB    1 
ATOM   511  C  CG    . LEU A 1 62  ? 12.986 -4.552  -48.681 1.00 19.29  ? 64  LEU A CG    1 
ATOM   512  C  CD1   . LEU A 1 62  ? 14.350 -4.576  -49.364 1.00 17.48  ? 64  LEU A CD1   1 
ATOM   513  C  CD2   . LEU A 1 62  ? 12.134 -3.420  -49.254 1.00 20.77  ? 64  LEU A CD2   1 
ATOM   514  N  N     . LEU A 1 63  ? 9.322  -7.781  -48.555 1.00 20.46  ? 65  LEU A N     1 
ATOM   515  C  CA    . LEU A 1 63  ? 8.707  -9.099  -48.432 1.00 21.18  ? 65  LEU A CA    1 
ATOM   516  C  C     . LEU A 1 63  ? 9.058  -10.020 -49.604 1.00 21.60  ? 65  LEU A C     1 
ATOM   517  O  O     . LEU A 1 63  ? 8.571  -9.837  -50.729 1.00 21.78  ? 65  LEU A O     1 
ATOM   518  C  CB    . LEU A 1 63  ? 7.184  -8.969  -48.267 1.00 21.86  ? 65  LEU A CB    1 
ATOM   519  C  CG    . LEU A 1 63  ? 6.669  -8.155  -47.066 1.00 21.41  ? 65  LEU A CG    1 
ATOM   520  C  CD1   . LEU A 1 63  ? 5.156  -7.899  -47.161 1.00 22.36  ? 65  LEU A CD1   1 
ATOM   521  C  CD2   . LEU A 1 63  ? 6.987  -8.878  -45.778 1.00 21.16  ? 65  LEU A CD2   1 
ATOM   522  N  N     . PHE A 1 64  ? 9.908  -11.007 -49.334 1.00 21.04  ? 66  PHE A N     1 
ATOM   523  C  CA    . PHE A 1 64  ? 10.360 -11.933 -50.383 1.00 21.77  ? 66  PHE A CA    1 
ATOM   524  C  C     . PHE A 1 64  ? 9.638  -13.284 -50.336 1.00 21.98  ? 66  PHE A C     1 
ATOM   525  O  O     . PHE A 1 64  ? 9.347  -13.784 -49.246 1.00 21.73  ? 66  PHE A O     1 
ATOM   526  C  CB    . PHE A 1 64  ? 11.885 -12.140 -50.296 1.00 21.64  ? 66  PHE A CB    1 
ATOM   527  C  CG    . PHE A 1 64  ? 12.685 -10.965 -50.782 1.00 20.99  ? 66  PHE A CG    1 
ATOM   528  C  CD1   . PHE A 1 64  ? 12.986 -10.828 -52.141 1.00 23.18  ? 66  PHE A CD1   1 
ATOM   529  C  CD2   . PHE A 1 64  ? 13.122 -9.992  -49.898 1.00 20.20  ? 66  PHE A CD2   1 
ATOM   530  C  CE1   . PHE A 1 64  ? 13.721 -9.735  -52.613 1.00 22.76  ? 66  PHE A CE1   1 
ATOM   531  C  CE2   . PHE A 1 64  ? 13.861 -8.897  -50.351 1.00 22.17  ? 66  PHE A CE2   1 
ATOM   532  C  CZ    . PHE A 1 64  ? 14.166 -8.766  -51.710 1.00 22.45  ? 66  PHE A CZ    1 
ATOM   533  N  N     . PRO A 1 65  ? 9.375  -13.890 -51.519 1.00 22.70  ? 67  PRO A N     1 
ATOM   534  C  CA    . PRO A 1 65  ? 8.782  -15.229 -51.529 1.00 23.82  ? 67  PRO A CA    1 
ATOM   535  C  C     . PRO A 1 65  ? 9.637  -16.225 -50.762 1.00 23.93  ? 67  PRO A C     1 
ATOM   536  O  O     . PRO A 1 65  ? 10.871 -16.189 -50.851 1.00 23.58  ? 67  PRO A O     1 
ATOM   537  C  CB    . PRO A 1 65  ? 8.735  -15.602 -53.023 1.00 24.36  ? 67  PRO A CB    1 
ATOM   538  C  CG    . PRO A 1 65  ? 8.733  -14.272 -53.745 1.00 24.55  ? 67  PRO A CG    1 
ATOM   539  C  CD    . PRO A 1 65  ? 9.613  -13.381 -52.884 1.00 22.79  ? 67  PRO A CD    1 
ATOM   540  N  N     . GLU A 1 66  ? 8.969  -17.112 -50.033 1.00 24.49  ? 68  GLU A N     1 
ATOM   541  C  CA    . GLU A 1 66  ? 9.636  -18.101 -49.190 1.00 25.12  ? 68  GLU A CA    1 
ATOM   542  C  C     . GLU A 1 66  ? 10.693 -18.938 -49.908 1.00 25.09  ? 68  GLU A C     1 
ATOM   543  O  O     . GLU A 1 66  ? 11.658 -19.370 -49.281 1.00 24.93  ? 68  GLU A O     1 
ATOM   544  C  CB    . GLU A 1 66  ? 8.617  -19.038 -48.555 1.00 26.36  ? 68  GLU A CB    1 
ATOM   545  C  CG    . GLU A 1 66  ? 9.142  -19.675 -47.280 1.00 28.77  ? 68  GLU A CG    1 
ATOM   546  C  CD    . GLU A 1 66  ? 8.202  -20.702 -46.692 1.00 32.73  ? 68  GLU A CD    1 
ATOM   547  O  OE1   . GLU A 1 66  ? 6.966  -20.541 -46.818 1.00 33.28  ? 68  GLU A OE1   1 
ATOM   548  O  OE2   . GLU A 1 66  ? 8.715  -21.671 -46.094 1.00 35.53  ? 68  GLU A OE2   1 
ATOM   549  N  N     . GLU A 1 67  ? 10.505 -19.162 -51.210 1.00 25.13  ? 69  GLU A N     1 
ATOM   550  C  CA    . GLU A 1 67  ? 11.394 -20.018 -51.986 1.00 25.17  ? 69  GLU A CA    1 
ATOM   551  C  C     . GLU A 1 67  ? 12.771 -19.418 -52.190 1.00 24.41  ? 69  GLU A C     1 
ATOM   552  O  O     . GLU A 1 67  ? 13.701 -20.148 -52.506 1.00 25.14  ? 69  GLU A O     1 
ATOM   553  C  CB    . GLU A 1 67  ? 10.792 -20.364 -53.358 1.00 26.35  ? 69  GLU A CB    1 
ATOM   554  C  CG    . GLU A 1 67  ? 9.584  -21.268 -53.312 1.00 26.70  ? 69  GLU A CG    1 
ATOM   555  C  CD    . GLU A 1 67  ? 8.302  -20.540 -52.960 1.00 28.44  ? 69  GLU A CD    1 
ATOM   556  O  OE1   . GLU A 1 67  ? 7.286  -21.238 -52.750 1.00 30.71  ? 69  GLU A OE1   1 
ATOM   557  O  OE2   . GLU A 1 67  ? 8.293  -19.283 -52.907 1.00 28.15  ? 69  GLU A OE2   1 
ATOM   558  N  N     . PHE A 1 68  ? 12.901 -18.099 -52.021 1.00 23.14  ? 70  PHE A N     1 
ATOM   559  C  CA    . PHE A 1 68  ? 14.152 -17.407 -52.325 1.00 22.82  ? 70  PHE A CA    1 
ATOM   560  C  C     . PHE A 1 68  ? 15.268 -17.875 -51.395 1.00 22.91  ? 70  PHE A C     1 
ATOM   561  O  O     . PHE A 1 68  ? 15.028 -18.148 -50.214 1.00 22.20  ? 70  PHE A O     1 
ATOM   562  C  CB    . PHE A 1 68  ? 13.975 -15.892 -52.203 1.00 22.20  ? 70  PHE A CB    1 
ATOM   563  C  CG    . PHE A 1 68  ? 13.332 -15.240 -53.406 1.00 23.96  ? 70  PHE A CG    1 
ATOM   564  C  CD1   . PHE A 1 68  ? 12.409 -15.925 -54.197 1.00 24.80  ? 70  PHE A CD1   1 
ATOM   565  C  CD2   . PHE A 1 68  ? 13.636 -13.915 -53.730 1.00 25.25  ? 70  PHE A CD2   1 
ATOM   566  C  CE1   . PHE A 1 68  ? 11.814 -15.315 -55.300 1.00 26.37  ? 70  PHE A CE1   1 
ATOM   567  C  CE2   . PHE A 1 68  ? 13.044 -13.295 -54.834 1.00 25.72  ? 70  PHE A CE2   1 
ATOM   568  C  CZ    . PHE A 1 68  ? 12.130 -13.997 -55.615 1.00 25.74  ? 70  PHE A CZ    1 
ATOM   569  N  N     . SER A 1 69  ? 16.483 -17.981 -51.921 1.00 23.28  ? 71  SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? 17.623 -18.295 -51.073 1.00 23.82  ? 71  SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? 17.959 -17.131 -50.133 1.00 23.77  ? 71  SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? 17.627 -15.966 -50.396 1.00 22.57  ? 71  SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? 18.846 -18.698 -51.903 1.00 24.80  ? 71  SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? 19.446 -17.587 -52.543 1.00 23.26  ? 71  SER A OG    1 
ATOM   575  N  N     . LYS A 1 70  ? 18.605 -17.472 -49.022 1.00 24.57  ? 72  LYS A N     1 
ATOM   576  C  CA    . LYS A 1 70  ? 19.120 -16.505 -48.071 1.00 24.88  ? 72  LYS A CA    1 
ATOM   577  C  C     . LYS A 1 70  ? 20.042 -15.485 -48.773 1.00 24.54  ? 72  LYS A C     1 
ATOM   578  O  O     . LYS A 1 70  ? 20.027 -14.281 -48.466 1.00 23.75  ? 72  LYS A O     1 
ATOM   579  C  CB    . LYS A 1 70  ? 19.819 -17.275 -46.932 1.00 26.16  ? 72  LYS A CB    1 
ATOM   580  C  CG    . LYS A 1 70  ? 21.107 -16.683 -46.387 1.00 29.10  ? 72  LYS A CG    1 
ATOM   581  C  CD    . LYS A 1 70  ? 22.355 -17.412 -46.913 1.00 33.01  ? 72  LYS A CD    1 
ATOM   582  C  CE    . LYS A 1 70  ? 23.675 -16.675 -46.564 1.00 33.30  ? 72  LYS A CE    1 
ATOM   583  N  NZ    . LYS A 1 70  ? 23.783 -15.266 -47.134 1.00 34.05  ? 72  LYS A NZ    1 
ATOM   584  N  N     . GLU A 1 71  ? 20.824 -15.978 -49.731 1.00 25.06  ? 73  GLU A N     1 
ATOM   585  C  CA    . GLU A 1 71  ? 21.725 -15.122 -50.502 1.00 25.38  ? 73  GLU A CA    1 
ATOM   586  C  C     . GLU A 1 71  ? 21.009 -14.132 -51.424 1.00 24.42  ? 73  GLU A C     1 
ATOM   587  O  O     . GLU A 1 71  ? 21.487 -13.011 -51.604 1.00 23.56  ? 73  GLU A O     1 
ATOM   588  C  CB    . GLU A 1 71  ? 22.740 -15.953 -51.279 1.00 26.19  ? 73  GLU A CB    1 
ATOM   589  C  CG    . GLU A 1 71  ? 23.710 -16.742 -50.392 1.00 29.04  ? 73  GLU A CG    1 
ATOM   590  C  CD    . GLU A 1 71  ? 23.246 -18.168 -50.047 1.00 33.30  ? 73  GLU A CD    1 
ATOM   591  O  OE1   . GLU A 1 71  ? 22.089 -18.547 -50.348 1.00 32.30  ? 73  GLU A OE1   1 
ATOM   592  O  OE2   . GLU A 1 71  ? 24.058 -18.918 -49.448 1.00 37.01  ? 73  GLU A OE2   1 
ATOM   593  N  N     . GLU A 1 72  ? 19.871 -14.544 -51.999 1.00 24.81  ? 74  GLU A N     1 
ATOM   594  C  CA    . GLU A 1 72  ? 19.059 -13.629 -52.808 1.00 24.85  ? 74  GLU A CA    1 
ATOM   595  C  C     . GLU A 1 72  ? 18.462 -12.528 -51.950 1.00 23.40  ? 74  GLU A C     1 
ATOM   596  O  O     . GLU A 1 72  ? 18.431 -11.373 -52.365 1.00 22.70  ? 74  GLU A O     1 
ATOM   597  C  CB    . GLU A 1 72  ? 17.936 -14.345 -53.586 1.00 25.34  ? 74  GLU A CB    1 
ATOM   598  C  CG    . GLU A 1 72  ? 18.200 -14.547 -55.080 1.00 29.19  ? 74  GLU A CG    1 
ATOM   599  C  CD    . GLU A 1 72  ? 18.360 -13.261 -55.872 1.00 30.56  ? 74  GLU A CD    1 
ATOM   600  O  OE1   . GLU A 1 72  ? 17.345 -12.591 -56.148 1.00 33.03  ? 74  GLU A OE1   1 
ATOM   601  O  OE2   . GLU A 1 72  ? 19.505 -12.931 -56.236 1.00 31.39  ? 74  GLU A OE2   1 
ATOM   602  N  N     . LEU A 1 73  ? 17.978 -12.883 -50.763 1.00 23.06  ? 75  LEU A N     1 
ATOM   603  C  CA    . LEU A 1 73  ? 17.455 -11.875 -49.840 1.00 23.08  ? 75  LEU A CA    1 
ATOM   604  C  C     . LEU A 1 73  ? 18.466 -10.791 -49.528 1.00 22.83  ? 75  LEU A C     1 
ATOM   605  O  O     . LEU A 1 73  ? 18.117 -9.619  -49.591 1.00 22.72  ? 75  LEU A O     1 
ATOM   606  C  CB    . LEU A 1 73  ? 16.890 -12.482 -48.545 1.00 22.74  ? 75  LEU A CB    1 
ATOM   607  C  CG    . LEU A 1 73  ? 15.364 -12.582 -48.595 1.00 23.48  ? 75  LEU A CG    1 
ATOM   608  C  CD1   . LEU A 1 73  ? 14.950 -13.729 -49.523 1.00 25.55  ? 75  LEU A CD1   1 
ATOM   609  C  CD2   . LEU A 1 73  ? 14.759 -12.738 -47.223 1.00 22.04  ? 75  LEU A CD2   1 
ATOM   610  N  N     . ARG A 1 74  ? 19.712 -11.170 -49.225 1.00 23.85  ? 76  ARG A N     1 
ATOM   611  C  CA    . ARG A 1 74  ? 20.744 -10.152 -48.960 1.00 24.50  ? 76  ARG A CA    1 
ATOM   612  C  C     . ARG A 1 74  ? 21.129 -9.335  -50.175 1.00 24.34  ? 76  ARG A C     1 
ATOM   613  O  O     . ARG A 1 74  ? 21.166 -8.118  -50.078 1.00 23.99  ? 76  ARG A O     1 
ATOM   614  C  CB    . ARG A 1 74  ? 21.996 -10.663 -48.235 1.00 25.30  ? 76  ARG A CB    1 
ATOM   615  C  CG    . ARG A 1 74  ? 22.672 -11.878 -48.750 1.00 29.28  ? 76  ARG A CG    1 
ATOM   616  C  CD    . ARG A 1 74  ? 24.116 -11.914 -48.199 1.00 34.43  ? 76  ARG A CD    1 
ATOM   617  N  NE    . ARG A 1 74  ? 24.859 -10.736 -48.635 1.00 37.54  ? 76  ARG A NE    1 
ATOM   618  C  CZ    . ARG A 1 74  ? 25.441 -10.609 -49.826 1.00 39.90  ? 76  ARG A CZ    1 
ATOM   619  N  NH1   . ARG A 1 74  ? 25.388 -11.601 -50.703 1.00 41.41  ? 76  ARG A NH1   1 
ATOM   620  N  NH2   . ARG A 1 74  ? 26.081 -9.484  -50.143 1.00 40.78  ? 76  ARG A NH2   1 
ATOM   621  N  N     . GLU A 1 75  ? 21.389 -9.993  -51.306 1.00 24.63  ? 77  GLU A N     1 
ATOM   622  C  CA    . GLU A 1 75  ? 21.722 -9.293  -52.549 1.00 24.95  ? 77  GLU A CA    1 
ATOM   623  C  C     . GLU A 1 75  ? 20.617 -8.331  -52.993 1.00 24.37  ? 77  GLU A C     1 
ATOM   624  O  O     . GLU A 1 75  ? 20.857 -7.136  -53.190 1.00 24.17  ? 77  GLU A O     1 
ATOM   625  C  CB    . GLU A 1 75  ? 22.070 -10.292 -53.655 1.00 25.91  ? 77  GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 75  ? 23.466 -10.893 -53.489 1.00 27.07  ? 77  GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 75  ? 23.762 -12.014 -54.470 1.00 28.30  ? 77  GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 75  ? 24.847 -12.626 -54.363 1.00 31.34  ? 77  GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 75  ? 22.914 -12.298 -55.338 1.00 30.79  ? 77  GLU A OE2   1 
ATOM   630  N  N     . ARG A 1 76  ? 19.402 -8.849  -53.119 1.00 24.39  ? 78  ARG A N     1 
ATOM   631  C  CA    . ARG A 1 76  ? 18.264 -8.041  -53.548 1.00 24.59  ? 78  ARG A CA    1 
ATOM   632  C  C     . ARG A 1 76  ? 17.891 -6.974  -52.523 1.00 23.59  ? 78  ARG A C     1 
ATOM   633  O  O     . ARG A 1 76  ? 17.640 -5.828  -52.901 1.00 23.38  ? 78  ARG A O     1 
ATOM   634  C  CB    . ARG A 1 76  ? 17.046 -8.918  -53.880 1.00 24.90  ? 78  ARG A CB    1 
ATOM   635  C  CG    . ARG A 1 76  ? 17.159 -9.669  -55.194 1.00 29.06  ? 78  ARG A CG    1 
ATOM   636  C  CD    . ARG A 1 76  ? 16.503 -8.944  -56.389 1.00 34.50  ? 78  ARG A CD    1 
ATOM   637  N  NE    . ARG A 1 76  ? 16.865 -7.526  -56.501 1.00 37.26  ? 78  ARG A NE    1 
ATOM   638  C  CZ    . ARG A 1 76  ? 15.997 -6.524  -56.657 1.00 38.61  ? 78  ARG A CZ    1 
ATOM   639  N  NH1   . ARG A 1 76  ? 14.690 -6.757  -56.740 1.00 38.64  ? 78  ARG A NH1   1 
ATOM   640  N  NH2   . ARG A 1 76  ? 16.442 -5.277  -56.754 1.00 39.84  ? 78  ARG A NH2   1 
ATOM   641  N  N     . GLY A 1 77  ? 17.860 -7.355  -51.244 1.00 22.36  ? 79  GLY A N     1 
ATOM   642  C  CA    . GLY A 1 77  ? 17.554 -6.419  -50.163 1.00 21.75  ? 79  GLY A CA    1 
ATOM   643  C  C     . GLY A 1 77  ? 18.538 -5.269  -50.042 1.00 22.07  ? 79  GLY A C     1 
ATOM   644  O  O     . GLY A 1 77  ? 18.136 -4.109  -49.900 1.00 22.09  ? 79  GLY A O     1 
ATOM   645  N  N     . LEU A 1 78  ? 19.833 -5.579  -50.084 1.00 22.34  ? 80  LEU A N     1 
ATOM   646  C  CA    . LEU A 1 78  ? 20.858 -4.542  -50.032 1.00 22.82  ? 80  LEU A CA    1 
ATOM   647  C  C     . LEU A 1 78  ? 20.779 -3.613  -51.259 1.00 23.33  ? 80  LEU A C     1 
ATOM   648  O  O     . LEU A 1 78  ? 20.933 -2.401  -51.129 1.00 23.36  ? 80  LEU A O     1 
ATOM   649  C  CB    . LEU A 1 78  ? 22.268 -5.125  -49.818 1.00 22.85  ? 80  LEU A CB    1 
ATOM   650  C  CG    . LEU A 1 78  ? 22.611 -5.983  -48.568 1.00 23.85  ? 80  LEU A CG    1 
ATOM   651  C  CD1   . LEU A 1 78  ? 24.120 -6.192  -48.446 1.00 23.93  ? 80  LEU A CD1   1 
ATOM   652  C  CD2   . LEU A 1 78  ? 22.097 -5.459  -47.245 1.00 24.51  ? 80  LEU A CD2   1 
ATOM   653  N  N     . GLU A 1 79  ? 20.495 -4.191  -52.422 1.00 23.89  ? 81  GLU A N     1 
ATOM   654  C  CA    . GLU A 1 79  ? 20.314 -3.460  -53.678 1.00 25.33  ? 81  GLU A CA    1 
ATOM   655  C  C     . GLU A 1 79  ? 19.173 -2.436  -53.563 1.00 24.09  ? 81  GLU A C     1 
ATOM   656  O  O     . GLU A 1 79  ? 19.352 -1.267  -53.888 1.00 24.03  ? 81  GLU A O     1 
ATOM   657  C  CB    . GLU A 1 79  ? 20.044 -4.455  -54.815 1.00 25.51  ? 81  GLU A CB    1 
ATOM   658  C  CG    . GLU A 1 79  ? 20.247 -3.920  -56.204 1.00 28.80  ? 81  GLU A CG    1 
ATOM   659  C  CD    . GLU A 1 79  ? 19.915 -4.957  -57.279 1.00 30.37  ? 81  GLU A CD    1 
ATOM   660  O  OE1   . GLU A 1 79  ? 20.677 -5.946  -57.417 1.00 35.27  ? 81  GLU A OE1   1 
ATOM   661  O  OE2   . GLU A 1 79  ? 18.885 -4.791  -57.976 1.00 33.99  ? 81  GLU A OE2   1 
ATOM   662  N  N     . ILE A 1 80  ? 18.017 -2.888  -53.076 1.00 23.01  ? 82  ILE A N     1 
ATOM   663  C  CA    . ILE A 1 80  ? 16.863 -2.013  -52.862 1.00 22.43  ? 82  ILE A CA    1 
ATOM   664  C  C     . ILE A 1 80  ? 17.128 -0.938  -51.805 1.00 22.28  ? 82  ILE A C     1 
ATOM   665  O  O     . ILE A 1 80  ? 16.792 0.240   -52.017 1.00 22.57  ? 82  ILE A O     1 
ATOM   666  C  CB    . ILE A 1 80  ? 15.585 -2.815  -52.527 1.00 22.12  ? 82  ILE A CB    1 
ATOM   667  C  CG1   . ILE A 1 80  ? 15.125 -3.620  -53.753 1.00 22.20  ? 82  ILE A CG1   1 
ATOM   668  C  CG2   . ILE A 1 80  ? 14.476 -1.892  -52.029 1.00 21.23  ? 82  ILE A CG2   1 
ATOM   669  C  CD1   . ILE A 1 80  ? 14.374 -4.913  -53.401 1.00 22.04  ? 82  ILE A CD1   1 
ATOM   670  N  N     . GLY A 1 81  ? 17.732 -1.338  -50.682 1.00 21.44  ? 83  GLY A N     1 
ATOM   671  C  CA    . GLY A 1 81  ? 18.051 -0.404  -49.604 1.00 21.28  ? 83  GLY A CA    1 
ATOM   672  C  C     . GLY A 1 81  ? 18.903 0.758   -50.096 1.00 21.77  ? 83  GLY A C     1 
ATOM   673  O  O     . GLY A 1 81  ? 18.604 1.921   -49.824 1.00 21.77  ? 83  GLY A O     1 
ATOM   674  N  N     . LYS A 1 82  ? 19.966 0.441   -50.827 1.00 22.13  ? 84  LYS A N     1 
ATOM   675  C  CA    . LYS A 1 82  ? 20.872 1.459   -51.346 1.00 23.13  ? 84  LYS A CA    1 
ATOM   676  C  C     . LYS A 1 82  ? 20.219 2.443   -52.324 1.00 23.49  ? 84  LYS A C     1 
ATOM   677  O  O     . LYS A 1 82  ? 20.540 3.635   -52.317 1.00 24.00  ? 84  LYS A O     1 
ATOM   678  C  CB    . LYS A 1 82  ? 22.088 0.798   -51.994 1.00 23.80  ? 84  LYS A CB    1 
ATOM   679  C  CG    . LYS A 1 82  ? 22.970 0.079   -50.979 1.00 25.07  ? 84  LYS A CG    1 
ATOM   680  C  CD    . LYS A 1 82  ? 23.609 -1.159  -51.578 1.00 29.48  ? 84  LYS A CD    1 
ATOM   681  C  CE    . LYS A 1 82  ? 24.902 -0.861  -52.294 1.00 31.91  ? 84  LYS A CE    1 
ATOM   682  N  NZ    . LYS A 1 82  ? 25.436 -2.108  -52.921 1.00 33.83  ? 84  LYS A NZ    1 
ATOM   683  N  N     . ALA A 1 83  ? 19.309 1.945   -53.162 1.00 23.01  ? 85  ALA A N     1 
ATOM   684  C  CA    . ALA A 1 83  ? 18.666 2.783   -54.176 1.00 23.62  ? 85  ALA A CA    1 
ATOM   685  C  C     . ALA A 1 83  ? 17.691 3.781   -53.549 1.00 23.57  ? 85  ALA A C     1 
ATOM   686  O  O     . ALA A 1 83  ? 17.345 4.799   -54.159 1.00 24.33  ? 85  ALA A O     1 
ATOM   687  C  CB    . ALA A 1 83  ? 17.941 1.914   -55.207 1.00 23.39  ? 85  ALA A CB    1 
ATOM   688  N  N     . VAL A 1 84  ? 17.277 3.481   -52.324 1.00 22.53  ? 86  VAL A N     1 
ATOM   689  C  CA    . VAL A 1 84  ? 16.138 4.109   -51.676 1.00 22.52  ? 86  VAL A CA    1 
ATOM   690  C  C     . VAL A 1 84  ? 16.491 5.085   -50.513 1.00 22.79  ? 86  VAL A C     1 
ATOM   691  O  O     . VAL A 1 84  ? 15.621 5.784   -49.976 1.00 22.15  ? 86  VAL A O     1 
ATOM   692  C  CB    . VAL A 1 84  ? 15.150 2.966   -51.265 1.00 22.37  ? 86  VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 84  ? 14.917 2.853   -49.754 1.00 21.44  ? 86  VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 84  ? 13.892 2.999   -52.113 1.00 21.82  ? 86  VAL A CG2   1 
ATOM   695  N  N     . LEU A 1 85  ? 17.765 5.145   -50.147 1.00 23.38  ? 87  LEU A N     1 
ATOM   696  C  CA    . LEU A 1 85  ? 18.196 5.983   -49.014 1.00 24.00  ? 87  LEU A CA    1 
ATOM   697  C  C     . LEU A 1 85  ? 19.190 7.055   -49.449 1.00 25.29  ? 87  LEU A C     1 
ATOM   698  O  O     . LEU A 1 85  ? 19.958 6.856   -50.397 1.00 26.08  ? 87  LEU A O     1 
ATOM   699  C  CB    . LEU A 1 85  ? 18.800 5.115   -47.916 1.00 23.65  ? 87  LEU A CB    1 
ATOM   700  C  CG    . LEU A 1 85  ? 18.007 3.898   -47.417 1.00 21.80  ? 87  LEU A CG    1 
ATOM   701  C  CD1   . LEU A 1 85  ? 18.955 2.964   -46.695 1.00 21.84  ? 87  LEU A CD1   1 
ATOM   702  C  CD2   . LEU A 1 85  ? 16.856 4.278   -46.501 1.00 20.46  ? 87  LEU A CD2   1 
ATOM   703  N  N     . ASP A 1 86  ? 19.173 8.196   -48.767 1.00 26.05  ? 88  ASP A N     1 
ATOM   704  C  CA    . ASP A 1 86  ? 20.015 9.337   -49.153 1.00 27.16  ? 88  ASP A CA    1 
ATOM   705  C  C     . ASP A 1 86  ? 21.490 9.023   -48.943 1.00 27.89  ? 88  ASP A C     1 
ATOM   706  O  O     . ASP A 1 86  ? 22.345 9.367   -49.768 1.00 28.26  ? 88  ASP A O     1 
ATOM   707  C  CB    . ASP A 1 86  ? 19.642 10.587  -48.351 1.00 27.61  ? 88  ASP A CB    1 
ATOM   708  C  CG    . ASP A 1 86  ? 18.255 11.105  -48.672 1.00 28.03  ? 88  ASP A CG    1 
ATOM   709  O  OD1   . ASP A 1 86  ? 17.626 10.615  -49.629 1.00 26.74  ? 88  ASP A OD1   1 
ATOM   710  O  OD2   . ASP A 1 86  ? 17.789 12.014  -47.958 1.00 28.89  ? 88  ASP A OD2   1 
ATOM   711  N  N     . SER A 1 87  ? 21.768 8.396   -47.804 1.00 27.78  ? 89  SER A N     1 
ATOM   712  C  CA    . SER A 1 87  ? 23.083 7.884   -47.459 1.00 28.37  ? 89  SER A CA    1 
ATOM   713  C  C     . SER A 1 87  ? 22.801 6.573   -46.735 1.00 27.94  ? 89  SER A C     1 
ATOM   714  O  O     . SER A 1 87  ? 21.660 6.336   -46.299 1.00 27.28  ? 89  SER A O     1 
ATOM   715  C  CB    . SER A 1 87  ? 23.841 8.868   -46.564 1.00 29.29  ? 89  SER A CB    1 
ATOM   716  O  OG    . SER A 1 87  ? 23.106 9.173   -45.394 1.00 28.52  ? 89  SER A OG    1 
ATOM   717  N  N     . TYR A 1 88  ? 23.802 5.706   -46.634 1.00 27.87  ? 90  TYR A N     1 
ATOM   718  C  CA    . TYR A 1 88  ? 23.574 4.390   -46.055 1.00 27.61  ? 90  TYR A CA    1 
ATOM   719  C  C     . TYR A 1 88  ? 24.823 3.775   -45.435 1.00 28.04  ? 90  TYR A C     1 
ATOM   720  O  O     . TYR A 1 88  ? 25.956 4.135   -45.783 1.00 28.54  ? 90  TYR A O     1 
ATOM   721  C  CB    . TYR A 1 88  ? 22.953 3.434   -47.097 1.00 27.49  ? 90  TYR A CB    1 
ATOM   722  C  CG    . TYR A 1 88  ? 23.894 3.044   -48.227 1.00 28.31  ? 90  TYR A CG    1 
ATOM   723  C  CD1   . TYR A 1 88  ? 24.769 1.968   -48.086 1.00 28.62  ? 90  TYR A CD1   1 
ATOM   724  C  CD2   . TYR A 1 88  ? 23.909 3.754   -49.431 1.00 28.84  ? 90  TYR A CD2   1 
ATOM   725  C  CE1   . TYR A 1 88  ? 25.646 1.606   -49.111 1.00 30.06  ? 90  TYR A CE1   1 
ATOM   726  C  CE2   . TYR A 1 88  ? 24.774 3.400   -50.467 1.00 30.55  ? 90  TYR A CE2   1 
ATOM   727  C  CZ    . TYR A 1 88  ? 25.644 2.324   -50.296 1.00 30.35  ? 90  TYR A CZ    1 
ATOM   728  O  OH    . TYR A 1 88  ? 26.501 1.947   -51.304 1.00 31.61  ? 90  TYR A OH    1 
ATOM   729  N  N     . GLU A 1 89  ? 24.597 2.851   -44.504 1.00 27.86  ? 91  GLU A N     1 
ATOM   730  C  CA    . GLU A 1 89  ? 25.648 2.021   -43.940 1.00 28.63  ? 91  GLU A CA    1 
ATOM   731  C  C     . GLU A 1 89  ? 25.183 0.597   -44.014 1.00 27.46  ? 91  GLU A C     1 
ATOM   732  O  O     . GLU A 1 89  ? 24.021 0.306   -43.707 1.00 26.64  ? 91  GLU A O     1 
ATOM   733  C  CB    . GLU A 1 89  ? 25.845 2.297   -42.455 1.00 29.01  ? 91  GLU A CB    1 
ATOM   734  C  CG    . GLU A 1 89  ? 26.346 3.649   -42.052 1.00 33.18  ? 91  GLU A CG    1 
ATOM   735  C  CD    . GLU A 1 89  ? 26.419 3.750   -40.537 1.00 36.34  ? 91  GLU A CD    1 
ATOM   736  O  OE1   . GLU A 1 89  ? 25.743 4.627   -39.949 1.00 38.51  ? 91  GLU A OE1   1 
ATOM   737  O  OE2   . GLU A 1 89  ? 27.127 2.917   -39.930 1.00 37.77  ? 91  GLU A OE2   1 
ATOM   738  N  N     . ILE A 1 90  ? 26.092 -0.305  -44.361 1.00 27.44  ? 92  ILE A N     1 
ATOM   739  C  CA    . ILE A 1 90  ? 25.796 -1.727  -44.248 1.00 27.25  ? 92  ILE A CA    1 
ATOM   740  C  C     . ILE A 1 90  ? 26.750 -2.391  -43.253 1.00 27.57  ? 92  ILE A C     1 
ATOM   741  O  O     . ILE A 1 90  ? 27.952 -2.557  -43.526 1.00 28.17  ? 92  ILE A O     1 
ATOM   742  C  CB    . ILE A 1 90  ? 25.744 -2.443  -45.625 1.00 27.38  ? 92  ILE A CB    1 
ATOM   743  C  CG1   . ILE A 1 90  ? 24.629 -1.831  -46.485 1.00 27.52  ? 92  ILE A CG1   1 
ATOM   744  C  CG2   . ILE A 1 90  ? 25.484 -3.943  -45.437 1.00 27.22  ? 92  ILE A CG2   1 
ATOM   745  C  CD1   . ILE A 1 90  ? 24.863 -1.899  -47.992 1.00 28.39  ? 92  ILE A CD1   1 
ATOM   746  N  N     . ARG A 1 91  ? 26.200 -2.748  -42.091 1.00 26.72  ? 93  ARG A N     1 
ATOM   747  C  CA    . ARG A 1 91  ? 26.971 -3.363  -41.014 1.00 27.71  ? 93  ARG A CA    1 
ATOM   748  C  C     . ARG A 1 91  ? 26.016 -4.186  -40.166 1.00 26.06  ? 93  ARG A C     1 
ATOM   749  O  O     . ARG A 1 91  ? 25.065 -3.661  -39.595 1.00 25.68  ? 93  ARG A O     1 
ATOM   750  C  CB    . ARG A 1 91  ? 27.698 -2.294  -40.175 1.00 28.23  ? 93  ARG A CB    1 
ATOM   751  C  CG    . ARG A 1 91  ? 29.066 -2.734  -39.635 1.00 31.34  ? 93  ARG A CG    1 
ATOM   752  C  CD    . ARG A 1 91  ? 29.908 -1.554  -39.159 1.00 32.12  ? 93  ARG A CD    1 
ATOM   753  N  NE    . ARG A 1 91  ? 30.832 -1.879  -38.061 1.00 37.95  ? 93  ARG A NE    1 
ATOM   754  C  CZ    . ARG A 1 91  ? 32.019 -2.480  -38.194 1.00 41.01  ? 93  ARG A CZ    1 
ATOM   755  N  NH1   . ARG A 1 91  ? 32.470 -2.878  -39.384 1.00 42.18  ? 93  ARG A NH1   1 
ATOM   756  N  NH2   . ARG A 1 91  ? 32.761 -2.702  -37.119 1.00 42.86  ? 93  ARG A NH2   1 
ATOM   757  N  N     . TYR A 1 92  ? 26.248 -5.492  -40.124 1.00 25.17  ? 94  TYR A N     1 
ATOM   758  C  CA    . TYR A 1 92  ? 25.356 -6.409  -39.407 1.00 23.58  ? 94  TYR A CA    1 
ATOM   759  C  C     . TYR A 1 92  ? 26.127 -7.655  -39.017 1.00 22.89  ? 94  TYR A C     1 
ATOM   760  O  O     . TYR A 1 92  ? 27.198 -7.905  -39.566 1.00 23.53  ? 94  TYR A O     1 
ATOM   761  C  CB    . TYR A 1 92  ? 24.136 -6.763  -40.266 1.00 22.97  ? 94  TYR A CB    1 
ATOM   762  C  CG    . TYR A 1 92  ? 24.459 -7.363  -41.616 1.00 23.02  ? 94  TYR A CG    1 
ATOM   763  C  CD1   . TYR A 1 92  ? 24.606 -8.739  -41.769 1.00 22.19  ? 94  TYR A CD1   1 
ATOM   764  C  CD2   . TYR A 1 92  ? 24.598 -6.552  -42.749 1.00 22.57  ? 94  TYR A CD2   1 
ATOM   765  C  CE1   . TYR A 1 92  ? 24.912 -9.297  -42.999 1.00 23.02  ? 94  TYR A CE1   1 
ATOM   766  C  CE2   . TYR A 1 92  ? 24.904 -7.107  -43.997 1.00 22.50  ? 94  TYR A CE2   1 
ATOM   767  C  CZ    . TYR A 1 92  ? 25.057 -8.478  -44.112 1.00 23.74  ? 94  TYR A CZ    1 
ATOM   768  O  OH    . TYR A 1 92  ? 25.341 -9.042  -45.342 1.00 24.80  ? 94  TYR A OH    1 
ATOM   769  N  N     . ALA A 1 93  ? 25.581 -8.420  -38.074 1.00 21.55  ? 95  ALA A N     1 
ATOM   770  C  CA    . ALA A 1 93  ? 26.216 -9.647  -37.571 1.00 21.23  ? 95  ALA A CA    1 
ATOM   771  C  C     . ALA A 1 93  ? 25.831 -10.892 -38.369 1.00 20.85  ? 95  ALA A C     1 
ATOM   772  O  O     . ALA A 1 93  ? 26.680 -11.723 -38.653 1.00 21.57  ? 95  ALA A O     1 
ATOM   773  C  CB    . ALA A 1 93  ? 25.880 -9.863  -36.093 1.00 21.11  ? 95  ALA A CB    1 
ATOM   774  N  N     . GLU A 1 94  ? 24.551 -11.023 -38.709 1.00 19.90  ? 96  GLU A N     1 
ATOM   775  C  CA    . GLU A 1 94  ? 24.058 -12.211 -39.413 1.00 20.12  ? 96  GLU A CA    1 
ATOM   776  C  C     . GLU A 1 94  ? 22.982 -11.868 -40.431 1.00 19.60  ? 96  GLU A C     1 
ATOM   777  O  O     . GLU A 1 94  ? 23.150 -12.116 -41.624 1.00 18.88  ? 96  GLU A O     1 
ATOM   778  C  CB    . GLU A 1 94  ? 23.543 -13.254 -38.409 1.00 20.44  ? 96  GLU A CB    1 
ATOM   779  C  CG    . GLU A 1 94  ? 23.032 -14.548 -39.023 1.00 20.49  ? 96  GLU A CG    1 
ATOM   780  C  CD    . GLU A 1 94  ? 21.552 -14.504 -39.366 1.00 20.44  ? 96  GLU A CD    1 
ATOM   781  O  OE1   . GLU A 1 94  ? 21.215 -14.694 -40.546 1.00 23.00  ? 96  GLU A OE1   1 
ATOM   782  O  OE2   . GLU A 1 94  ? 20.716 -14.283 -38.468 1.00 21.84  ? 96  GLU A OE2   1 
ATOM   783  N  N     . HIS A 1 95  ? 21.880 -11.295 -39.957 1.00 19.03  ? 97  HIS A N     1 
ATOM   784  C  CA    . HIS A 1 95  ? 20.785 -10.962 -40.852 1.00 19.20  ? 97  HIS A CA    1 
ATOM   785  C  C     . HIS A 1 95  ? 21.000 -9.627  -41.548 1.00 19.08  ? 97  HIS A C     1 
ATOM   786  O  O     . HIS A 1 95  ? 21.132 -8.583  -40.885 1.00 18.82  ? 97  HIS A O     1 
ATOM   787  C  CB    . HIS A 1 95  ? 19.421 -10.986 -40.154 1.00 18.58  ? 97  HIS A CB    1 
ATOM   788  C  CG    . HIS A 1 95  ? 18.288 -10.769 -41.103 1.00 19.42  ? 97  HIS A CG    1 
ATOM   789  N  ND1   . HIS A 1 95  ? 17.837 -9.510  -41.446 1.00 19.81  ? 97  HIS A ND1   1 
ATOM   790  C  CD2   . HIS A 1 95  ? 17.571 -11.642 -41.845 1.00 18.98  ? 97  HIS A CD2   1 
ATOM   791  C  CE1   . HIS A 1 95  ? 16.856 -9.624  -42.326 1.00 18.79  ? 97  HIS A CE1   1 
ATOM   792  N  NE2   . HIS A 1 95  ? 16.674 -10.908 -42.583 1.00 20.48  ? 97  HIS A NE2   1 
ATOM   793  N  N     . PRO A 1 96  ? 21.024 -9.661  -42.890 1.00 19.30  ? 98  PRO A N     1 
ATOM   794  C  CA    . PRO A 1 96  ? 21.342 -8.497  -43.710 1.00 19.59  ? 98  PRO A CA    1 
ATOM   795  C  C     . PRO A 1 96  ? 20.263 -7.432  -43.672 1.00 19.19  ? 98  PRO A C     1 
ATOM   796  O  O     . PRO A 1 96  ? 19.064 -7.733  -43.559 1.00 19.10  ? 98  PRO A O     1 
ATOM   797  C  CB    . PRO A 1 96  ? 21.470 -9.090  -45.115 1.00 20.27  ? 98  PRO A CB    1 
ATOM   798  C  CG    . PRO A 1 96  ? 20.560 -10.295 -45.068 1.00 20.84  ? 98  PRO A CG    1 
ATOM   799  C  CD    . PRO A 1 96  ? 20.776 -10.861 -43.713 1.00 19.13  ? 98  PRO A CD    1 
ATOM   800  N  N     . TYR A 1 97  ? 20.712 -6.184  -43.717 1.00 19.21  ? 99  TYR A N     1 
ATOM   801  C  CA    . TYR A 1 97  ? 19.833 -5.015  -43.801 1.00 18.61  ? 99  TYR A CA    1 
ATOM   802  C  C     . TYR A 1 97  ? 20.674 -3.787  -44.127 1.00 18.95  ? 99  TYR A C     1 
ATOM   803  O  O     . TYR A 1 97  ? 21.914 -3.813  -44.027 1.00 19.29  ? 99  TYR A O     1 
ATOM   804  C  CB    . TYR A 1 97  ? 19.033 -4.803  -42.503 1.00 17.86  ? 99  TYR A CB    1 
ATOM   805  C  CG    . TYR A 1 97  ? 19.855 -4.381  -41.297 1.00 17.37  ? 99  TYR A CG    1 
ATOM   806  C  CD1   . TYR A 1 97  ? 19.946 -3.028  -40.915 1.00 17.27  ? 99  TYR A CD1   1 
ATOM   807  C  CD2   . TYR A 1 97  ? 20.524 -5.327  -40.529 1.00 15.92  ? 99  TYR A CD2   1 
ATOM   808  C  CE1   . TYR A 1 97  ? 20.697 -2.642  -39.822 1.00 14.63  ? 99  TYR A CE1   1 
ATOM   809  C  CE2   . TYR A 1 97  ? 21.275 -4.958  -39.432 1.00 14.39  ? 99  TYR A CE2   1 
ATOM   810  C  CZ    . TYR A 1 97  ? 21.364 -3.620  -39.077 1.00 16.99  ? 99  TYR A CZ    1 
ATOM   811  O  OH    . TYR A 1 97  ? 22.118 -3.283  -37.971 1.00 16.51  ? 99  TYR A OH    1 
ATOM   812  N  N     . VAL A 1 98  ? 19.993 -2.720  -44.526 1.00 19.09  ? 100 VAL A N     1 
ATOM   813  C  CA    . VAL A 1 98  ? 20.638 -1.452  -44.833 1.00 19.43  ? 100 VAL A CA    1 
ATOM   814  C  C     . VAL A 1 98  ? 20.092 -0.367  -43.903 1.00 19.96  ? 100 VAL A C     1 
ATOM   815  O  O     . VAL A 1 98  ? 18.869 -0.178  -43.774 1.00 19.14  ? 100 VAL A O     1 
ATOM   816  C  CB    . VAL A 1 98  ? 20.423 -1.060  -46.314 1.00 19.72  ? 100 VAL A CB    1 
ATOM   817  C  CG1   . VAL A 1 98  ? 21.191 0.217   -46.690 1.00 19.58  ? 100 VAL A CG1   1 
ATOM   818  C  CG2   . VAL A 1 98  ? 20.853 -2.192  -47.225 1.00 18.95  ? 100 VAL A CG2   1 
ATOM   819  N  N     . HIS A 1 99  ? 21.008 0.329   -43.244 1.00 20.37  ? 101 HIS A N     1 
ATOM   820  C  CA    . HIS A 1 99  ? 20.645 1.482   -42.449 1.00 21.18  ? 101 HIS A CA    1 
ATOM   821  C  C     . HIS A 1 99  ? 20.941 2.735   -43.241 1.00 22.00  ? 101 HIS A C     1 
ATOM   822  O  O     . HIS A 1 99  ? 21.985 2.838   -43.888 1.00 22.38  ? 101 HIS A O     1 
ATOM   823  C  CB    . HIS A 1 99  ? 21.428 1.526   -41.133 1.00 21.57  ? 101 HIS A CB    1 
ATOM   824  C  CG    . HIS A 1 99  ? 20.964 2.612   -40.214 1.00 22.89  ? 101 HIS A CG    1 
ATOM   825  N  ND1   . HIS A 1 99  ? 19.805 2.508   -39.477 1.00 24.31  ? 101 HIS A ND1   1 
ATOM   826  C  CD2   . HIS A 1 99  ? 21.467 3.844   -39.957 1.00 25.18  ? 101 HIS A CD2   1 
ATOM   827  C  CE1   . HIS A 1 99  ? 19.627 3.619   -38.782 1.00 25.47  ? 101 HIS A CE1   1 
ATOM   828  N  NE2   . HIS A 1 99  ? 20.620 4.447   -39.058 1.00 26.84  ? 101 HIS A NE2   1 
ATOM   829  N  N     . GLY A 1 100 ? 20.041 3.703   -43.170 1.00 22.01  ? 102 GLY A N     1 
ATOM   830  C  CA    . GLY A 1 100 ? 20.273 4.951   -43.860 1.00 22.81  ? 102 GLY A CA    1 
ATOM   831  C  C     . GLY A 1 100 ? 19.420 6.075   -43.355 1.00 23.01  ? 102 GLY A C     1 
ATOM   832  O  O     . GLY A 1 100 ? 18.918 6.035   -42.233 1.00 22.94  ? 102 GLY A O     1 
ATOM   833  N  N     . VAL A 1 101 ? 19.261 7.079   -44.210 1.00 23.54  ? 103 VAL A N     1 
ATOM   834  C  CA    . VAL A 1 101 ? 18.563 8.307   -43.878 1.00 23.94  ? 103 VAL A CA    1 
ATOM   835  C  C     . VAL A 1 101 ? 17.718 8.729   -45.074 1.00 23.91  ? 103 VAL A C     1 
ATOM   836  O  O     . VAL A 1 101 ? 18.184 8.709   -46.214 1.00 23.64  ? 103 VAL A O     1 
ATOM   837  C  CB    . VAL A 1 101 ? 19.565 9.445   -43.510 1.00 25.15  ? 103 VAL A CB    1 
ATOM   838  C  CG1   . VAL A 1 101 ? 18.834 10.720  -43.132 1.00 26.15  ? 103 VAL A CG1   1 
ATOM   839  C  CG2   . VAL A 1 101 ? 20.492 9.016   -42.359 1.00 25.33  ? 103 VAL A CG2   1 
ATOM   840  N  N     . VAL A 1 102 ? 16.462 9.068   -44.814 1.00 23.43  ? 104 VAL A N     1 
ATOM   841  C  CA    . VAL A 1 102 ? 15.608 9.705   -45.816 1.00 23.53  ? 104 VAL A CA    1 
ATOM   842  C  C     . VAL A 1 102 ? 15.025 10.961  -45.179 1.00 24.07  ? 104 VAL A C     1 
ATOM   843  O  O     . VAL A 1 102 ? 14.385 10.894  -44.130 1.00 23.48  ? 104 VAL A O     1 
ATOM   844  C  CB    . VAL A 1 102 ? 14.467 8.786   -46.297 1.00 23.02  ? 104 VAL A CB    1 
ATOM   845  C  CG1   . VAL A 1 102 ? 13.604 9.496   -47.328 1.00 23.33  ? 104 VAL A CG1   1 
ATOM   846  C  CG2   . VAL A 1 102 ? 15.016 7.498   -46.877 1.00 22.72  ? 104 VAL A CG2   1 
ATOM   847  N  N     . LYS A 1 103 ? 15.288 12.102  -45.800 1.00 24.63  ? 105 LYS A N     1 
ATOM   848  C  CA    . LYS A 1 103 ? 14.778 13.401  -45.335 1.00 25.64  ? 105 LYS A CA    1 
ATOM   849  C  C     . LYS A 1 103 ? 15.041 13.644  -43.838 1.00 25.41  ? 105 LYS A C     1 
ATOM   850  O  O     . LYS A 1 103 ? 14.132 13.995  -43.071 1.00 25.36  ? 105 LYS A O     1 
ATOM   851  C  CB    . LYS A 1 103 ? 13.297 13.574  -45.714 1.00 25.27  ? 105 LYS A CB    1 
ATOM   852  C  CG    . LYS A 1 103 ? 13.054 13.553  -47.223 1.00 26.64  ? 105 LYS A CG    1 
ATOM   853  C  CD    . LYS A 1 103 ? 11.625 13.898  -47.581 1.00 26.67  ? 105 LYS A CD    1 
ATOM   854  C  CE    . LYS A 1 103 ? 11.368 15.376  -47.414 1.00 28.66  ? 105 LYS A CE    1 
ATOM   855  N  NZ    . LYS A 1 103 ? 9.976  15.667  -47.782 1.00 29.95  ? 105 LYS A NZ    1 
ATOM   856  N  N     . GLY A 1 104 ? 16.293 13.417  -43.441 1.00 25.23  ? 106 GLY A N     1 
ATOM   857  C  CA    . GLY A 1 104 ? 16.737 13.604  -42.062 1.00 25.75  ? 106 GLY A CA    1 
ATOM   858  C  C     . GLY A 1 104 ? 16.355 12.530  -41.052 1.00 25.05  ? 106 GLY A C     1 
ATOM   859  O  O     . GLY A 1 104 ? 16.784 12.584  -39.898 1.00 25.06  ? 106 GLY A O     1 
ATOM   860  N  N     . VAL A 1 105 ? 15.549 11.558  -41.469 1.00 24.82  ? 107 VAL A N     1 
ATOM   861  C  CA    . VAL A 1 105 ? 15.102 10.487  -40.566 1.00 24.16  ? 107 VAL A CA    1 
ATOM   862  C  C     . VAL A 1 105 ? 15.844 9.160   -40.811 1.00 23.53  ? 107 VAL A C     1 
ATOM   863  O  O     . VAL A 1 105 ? 16.025 8.729   -41.961 1.00 23.15  ? 107 VAL A O     1 
ATOM   864  C  CB    . VAL A 1 105 ? 13.543 10.292  -40.627 1.00 23.60  ? 107 VAL A CB    1 
ATOM   865  C  CG1   . VAL A 1 105 ? 13.141 9.735   -41.946 1.00 25.39  ? 107 VAL A CG1   1 
ATOM   866  C  CG2   . VAL A 1 105 ? 13.055 9.344   -39.562 1.00 22.96  ? 107 VAL A CG2   1 
ATOM   867  N  N     . GLU A 1 106 ? 16.254 8.520   -39.713 1.00 23.18  ? 108 GLU A N     1 
ATOM   868  C  CA    . GLU A 1 106 ? 16.857 7.174   -39.722 1.00 22.68  ? 108 GLU A CA    1 
ATOM   869  C  C     . GLU A 1 106 ? 15.892 6.110   -40.211 1.00 20.89  ? 108 GLU A C     1 
ATOM   870  O  O     . GLU A 1 106 ? 14.720 6.110   -39.835 1.00 20.13  ? 108 GLU A O     1 
ATOM   871  C  CB    . GLU A 1 106 ? 17.250 6.778   -38.300 1.00 23.61  ? 108 GLU A CB    1 
ATOM   872  C  CG    . GLU A 1 106 ? 17.996 7.838   -37.552 1.00 27.42  ? 108 GLU A CG    1 
ATOM   873  C  CD    . GLU A 1 106 ? 19.451 7.653   -37.727 1.00 32.77  ? 108 GLU A CD    1 
ATOM   874  O  OE1   . GLU A 1 106 ? 20.012 6.811   -36.998 1.00 35.05  ? 108 GLU A OE1   1 
ATOM   875  O  OE2   . GLU A 1 106 ? 20.024 8.322   -38.608 1.00 36.66  ? 108 GLU A OE2   1 
ATOM   876  N  N     . VAL A 1 107 ? 16.409 5.183   -41.012 1.00 19.93  ? 109 VAL A N     1 
ATOM   877  C  CA    . VAL A 1 107 ? 15.609 4.127   -41.630 1.00 19.07  ? 109 VAL A CA    1 
ATOM   878  C  C     . VAL A 1 107 ? 16.417 2.829   -41.622 1.00 18.43  ? 109 VAL A C     1 
ATOM   879  O  O     . VAL A 1 107 ? 17.606 2.842   -41.912 1.00 18.93  ? 109 VAL A O     1 
ATOM   880  C  CB    . VAL A 1 107 ? 15.245 4.486   -43.123 1.00 19.62  ? 109 VAL A CB    1 
ATOM   881  C  CG1   . VAL A 1 107 ? 14.307 3.449   -43.762 1.00 17.32  ? 109 VAL A CG1   1 
ATOM   882  C  CG2   . VAL A 1 107 ? 14.641 5.898   -43.235 1.00 19.86  ? 109 VAL A CG2   1 
ATOM   883  N  N     . ASP A 1 108 ? 15.772 1.716   -41.285 1.00 18.04  ? 110 ASP A N     1 
ATOM   884  C  CA    . ASP A 1 108 ? 16.304 0.391   -41.599 1.00 17.48  ? 110 ASP A CA    1 
ATOM   885  C  C     . ASP A 1 108 ? 15.479 -0.226  -42.708 1.00 17.15  ? 110 ASP A C     1 
ATOM   886  O  O     . ASP A 1 108 ? 14.253 -0.290  -42.610 1.00 17.55  ? 110 ASP A O     1 
ATOM   887  C  CB    . ASP A 1 108 ? 16.261 -0.538  -40.382 1.00 17.33  ? 110 ASP A CB    1 
ATOM   888  C  CG    . ASP A 1 108 ? 17.505 -0.450  -39.528 1.00 17.65  ? 110 ASP A CG    1 
ATOM   889  O  OD1   . ASP A 1 108 ? 18.517 0.138   -39.973 1.00 19.38  ? 110 ASP A OD1   1 
ATOM   890  O  OD2   . ASP A 1 108 ? 17.466 -0.967  -38.397 1.00 17.34  ? 110 ASP A OD2   1 
ATOM   891  N  N     . VAL A 1 109 ? 16.151 -0.680  -43.764 1.00 17.35  ? 111 VAL A N     1 
ATOM   892  C  CA    . VAL A 1 109 ? 15.498 -1.410  -44.837 1.00 17.21  ? 111 VAL A CA    1 
ATOM   893  C  C     . VAL A 1 109 ? 15.933 -2.855  -44.743 1.00 17.01  ? 111 VAL A C     1 
ATOM   894  O  O     . VAL A 1 109 ? 17.119 -3.173  -44.919 1.00 17.22  ? 111 VAL A O     1 
ATOM   895  C  CB    . VAL A 1 109 ? 15.832 -0.858  -46.254 1.00 17.59  ? 111 VAL A CB    1 
ATOM   896  C  CG1   . VAL A 1 109 ? 14.965 -1.557  -47.283 1.00 17.16  ? 111 VAL A CG1   1 
ATOM   897  C  CG2   . VAL A 1 109 ? 15.627 0.665   -46.339 1.00 17.79  ? 111 VAL A CG2   1 
ATOM   898  N  N     . VAL A 1 110 ? 14.962 -3.718  -44.462 1.00 17.09  ? 112 VAL A N     1 
ATOM   899  C  CA    . VAL A 1 110 ? 15.218 -5.089  -44.031 1.00 17.28  ? 112 VAL A CA    1 
ATOM   900  C  C     . VAL A 1 110 ? 14.480 -6.122  -44.912 1.00 18.13  ? 112 VAL A C     1 
ATOM   901  O  O     . VAL A 1 110 ? 13.253 -6.092  -45.028 1.00 18.14  ? 112 VAL A O     1 
ATOM   902  C  CB    . VAL A 1 110 ? 14.797 -5.292  -42.543 1.00 17.17  ? 112 VAL A CB    1 
ATOM   903  C  CG1   . VAL A 1 110 ? 15.189 -6.687  -42.042 1.00 15.45  ? 112 VAL A CG1   1 
ATOM   904  C  CG2   . VAL A 1 110 ? 15.384 -4.203  -41.619 1.00 17.42  ? 112 VAL A CG2   1 
ATOM   905  N  N     . PRO A 1 111 ? 15.228 -7.060  -45.507 1.00 18.90  ? 113 PRO A N     1 
ATOM   906  C  CA    . PRO A 1 111 ? 14.603 -8.129  -46.284 1.00 19.33  ? 113 PRO A CA    1 
ATOM   907  C  C     . PRO A 1 111 ? 14.094 -9.241  -45.362 1.00 19.96  ? 113 PRO A C     1 
ATOM   908  O  O     . PRO A 1 111 ? 14.774 -9.624  -44.401 1.00 19.54  ? 113 PRO A O     1 
ATOM   909  C  CB    . PRO A 1 111 ? 15.744 -8.627  -47.172 1.00 19.32  ? 113 PRO A CB    1 
ATOM   910  C  CG    . PRO A 1 111 ? 16.986 -8.353  -46.390 1.00 19.70  ? 113 PRO A CG    1 
ATOM   911  C  CD    . PRO A 1 111 ? 16.699 -7.182  -45.469 1.00 19.22  ? 113 PRO A CD    1 
ATOM   912  N  N     . CYS A 1 112 ? 12.892 -9.736  -45.631 1.00 20.67  ? 114 CYS A N     1 
ATOM   913  C  CA    . CYS A 1 112 ? 12.337 -10.835 -44.846 1.00 21.93  ? 114 CYS A CA    1 
ATOM   914  C  C     . CYS A 1 112 ? 11.456 -11.719 -45.724 1.00 21.95  ? 114 CYS A C     1 
ATOM   915  O  O     . CYS A 1 112 ? 10.995 -11.285 -46.789 1.00 21.52  ? 114 CYS A O     1 
ATOM   916  C  CB    . CYS A 1 112 ? 11.557 -10.310 -43.639 1.00 21.79  ? 114 CYS A CB    1 
ATOM   917  S  SG    . CYS A 1 112 ? 9.802  -9.993  -43.920 1.00 29.43  ? 114 CYS A SG    1 
ATOM   918  N  N     . TYR A 1 113 ? 11.224 -12.952 -45.275 1.00 22.25  ? 115 TYR A N     1 
ATOM   919  C  CA    . TYR A 1 113 ? 10.354 -13.873 -46.001 1.00 22.54  ? 115 TYR A CA    1 
ATOM   920  C  C     . TYR A 1 113 ? 8.876  -13.613 -45.717 1.00 23.45  ? 115 TYR A C     1 
ATOM   921  O  O     . TYR A 1 113 ? 8.472  -13.350 -44.578 1.00 23.05  ? 115 TYR A O     1 
ATOM   922  C  CB    . TYR A 1 113 ? 10.710 -15.330 -45.683 1.00 22.12  ? 115 TYR A CB    1 
ATOM   923  C  CG    . TYR A 1 113 ? 12.043 -15.734 -46.237 1.00 21.04  ? 115 TYR A CG    1 
ATOM   924  C  CD1   . TYR A 1 113 ? 13.165 -15.835 -45.411 1.00 20.46  ? 115 TYR A CD1   1 
ATOM   925  C  CD2   . TYR A 1 113 ? 12.200 -16.001 -47.590 1.00 22.44  ? 115 TYR A CD2   1 
ATOM   926  C  CE1   . TYR A 1 113 ? 14.404 -16.201 -45.919 1.00 19.16  ? 115 TYR A CE1   1 
ATOM   927  C  CE2   . TYR A 1 113 ? 13.442 -16.369 -48.110 1.00 22.26  ? 115 TYR A CE2   1 
ATOM   928  C  CZ    . TYR A 1 113 ? 14.538 -16.465 -47.268 1.00 21.35  ? 115 TYR A CZ    1 
ATOM   929  O  OH    . TYR A 1 113 ? 15.769 -16.822 -47.784 1.00 20.28  ? 115 TYR A OH    1 
ATOM   930  N  N     . LYS A 1 114 ? 8.081  -13.674 -46.774 1.00 24.98  ? 116 LYS A N     1 
ATOM   931  C  CA    . LYS A 1 114 ? 6.652  -13.499 -46.671 1.00 26.42  ? 116 LYS A CA    1 
ATOM   932  C  C     . LYS A 1 114 ? 6.052  -14.857 -46.328 1.00 27.57  ? 116 LYS A C     1 
ATOM   933  O  O     . LYS A 1 114 ? 5.710  -15.627 -47.210 1.00 28.72  ? 116 LYS A O     1 
ATOM   934  C  CB    . LYS A 1 114 ? 6.099  -12.950 -47.988 1.00 26.66  ? 116 LYS A CB    1 
ATOM   935  C  CG    . LYS A 1 114 ? 4.654  -12.493 -47.910 1.00 28.63  ? 116 LYS A CG    1 
ATOM   936  C  CD    . LYS A 1 114 ? 4.149  -12.057 -49.274 1.00 30.39  ? 116 LYS A CD    1 
ATOM   937  C  CE    . LYS A 1 114 ? 2.682  -11.666 -49.179 1.00 33.27  ? 116 LYS A CE    1 
ATOM   938  N  NZ    . LYS A 1 114 ? 2.172  -11.108 -50.459 1.00 33.89  ? 116 LYS A NZ    1 
ATOM   939  N  N     . LEU A 1 115 ? 5.952  -15.156 -45.041 1.00 28.26  ? 117 LEU A N     1 
ATOM   940  C  CA    . LEU A 1 115 ? 5.431  -16.443 -44.608 1.00 30.46  ? 117 LEU A CA    1 
ATOM   941  C  C     . LEU A 1 115 ? 3.936  -16.360 -44.321 1.00 32.42  ? 117 LEU A C     1 
ATOM   942  O  O     . LEU A 1 115 ? 3.403  -15.280 -44.041 1.00 32.05  ? 117 LEU A O     1 
ATOM   943  C  CB    . LEU A 1 115 ? 6.163  -16.936 -43.355 1.00 29.81  ? 117 LEU A CB    1 
ATOM   944  C  CG    . LEU A 1 115 ? 7.693  -16.931 -43.279 1.00 28.47  ? 117 LEU A CG    1 
ATOM   945  C  CD1   . LEU A 1 115 ? 8.137  -17.304 -41.877 1.00 27.91  ? 117 LEU A CD1   1 
ATOM   946  C  CD2   . LEU A 1 115 ? 8.321  -17.881 -44.293 1.00 28.93  ? 117 LEU A CD2   1 
ATOM   947  N  N     . LYS A 1 116 ? 3.257  -17.497 -44.432 1.00 35.32  ? 118 LYS A N     1 
ATOM   948  C  CA    . LYS A 1 116 ? 2.032  -17.716 -43.664 1.00 38.03  ? 118 LYS A CA    1 
ATOM   949  C  C     . LYS A 1 116 ? 2.496  -18.449 -42.409 1.00 38.89  ? 118 LYS A C     1 
ATOM   950  O  O     . LYS A 1 116 ? 3.314  -19.379 -42.498 1.00 39.98  ? 118 LYS A O     1 
ATOM   951  C  CB    . LYS A 1 116 ? 0.983  -18.523 -44.449 1.00 39.60  ? 118 LYS A CB    1 
ATOM   952  C  CG    . LYS A 1 116 ? 1.500  -19.768 -45.171 1.00 42.40  ? 118 LYS A CG    1 
ATOM   953  C  CD    . LYS A 1 116 ? 1.256  -21.055 -44.381 1.00 45.86  ? 118 LYS A CD    1 
ATOM   954  C  CE    . LYS A 1 116 ? -0.017 -21.761 -44.837 1.00 48.89  ? 118 LYS A CE    1 
ATOM   955  N  NZ    . LYS A 1 116 ? -0.244 -23.034 -44.081 1.00 51.66  ? 118 LYS A NZ    1 
ATOM   956  N  N     . GLU A 1 117 ? 2.013  -18.025 -41.247 1.00 39.37  ? 119 GLU A N     1 
ATOM   957  C  CA    . GLU A 1 117 ? 2.442  -18.595 -39.960 1.00 39.78  ? 119 GLU A CA    1 
ATOM   958  C  C     . GLU A 1 117 ? 3.895  -18.220 -39.655 1.00 38.66  ? 119 GLU A C     1 
ATOM   959  O  O     . GLU A 1 117 ? 4.800  -18.528 -40.438 1.00 38.15  ? 119 GLU A O     1 
ATOM   960  C  CB    . GLU A 1 117 ? 2.298  -20.134 -39.911 1.00 41.35  ? 119 GLU A CB    1 
ATOM   961  C  CG    . GLU A 1 117 ? 1.009  -20.732 -40.497 1.00 44.83  ? 119 GLU A CG    1 
ATOM   962  C  CD    . GLU A 1 117 ? -0.176 -20.674 -39.546 1.00 48.50  ? 119 GLU A CD    1 
ATOM   963  O  OE1   . GLU A 1 117 ? 0.046  -20.536 -38.319 1.00 49.87  ? 119 GLU A OE1   1 
ATOM   964  O  OE2   . GLU A 1 117 ? -1.332 -20.775 -40.026 1.00 49.66  ? 119 GLU A OE2   1 
ATOM   965  N  N     . PRO A 1 118 ? 4.130  -17.575 -38.498 1.00 38.07  ? 120 PRO A N     1 
ATOM   966  C  CA    . PRO A 1 118 ? 5.487  -17.309 -38.039 1.00 37.36  ? 120 PRO A CA    1 
ATOM   967  C  C     . PRO A 1 118 ? 6.062  -18.535 -37.330 1.00 38.29  ? 120 PRO A C     1 
ATOM   968  O  O     . PRO A 1 118 ? 6.662  -18.415 -36.255 1.00 38.00  ? 120 PRO A O     1 
ATOM   969  C  CB    . PRO A 1 118 ? 5.315  -16.136 -37.069 1.00 36.64  ? 120 PRO A CB    1 
ATOM   970  C  CG    . PRO A 1 118 ? 3.836  -15.992 -36.838 1.00 37.12  ? 120 PRO A CG    1 
ATOM   971  C  CD    . PRO A 1 118 ? 3.118  -17.074 -37.554 1.00 38.26  ? 120 PRO A CD    1 
ATOM   972  N  N     . LYS A 1 119 ? 5.853  -19.702 -37.941 1.00 39.34  ? 121 LYS A N     1 
ATOM   973  C  CA    . LYS A 1 119 ? 6.395  -20.979 -37.478 1.00 40.36  ? 121 LYS A CA    1 
ATOM   974  C  C     . LYS A 1 119 ? 7.461  -21.465 -38.447 1.00 39.92  ? 121 LYS A C     1 
ATOM   975  O  O     . LYS A 1 119 ? 7.334  -21.287 -39.666 1.00 40.18  ? 121 LYS A O     1 
ATOM   976  C  CB    . LYS A 1 119 ? 5.291  -22.040 -37.358 1.00 41.72  ? 121 LYS A CB    1 
ATOM   977  C  CG    . LYS A 1 119 ? 4.022  -21.576 -36.646 1.00 43.99  ? 121 LYS A CG    1 
ATOM   978  C  CD    . LYS A 1 119 ? 4.291  -21.127 -35.202 1.00 46.76  ? 121 LYS A CD    1 
ATOM   979  C  CE    . LYS A 1 119 ? 3.353  -19.989 -34.808 1.00 47.64  ? 121 LYS A CE    1 
ATOM   980  N  NZ    . LYS A 1 119 ? 3.421  -19.671 -33.360 1.00 48.57  ? 121 LYS A NZ    1 
ATOM   981  N  N     . ASN A 1 120 ? 8.496  -22.096 -37.897 1.00 39.30  ? 122 ASN A N     1 
ATOM   982  C  CA    . ASN A 1 120 ? 9.674  -22.519 -38.654 1.00 38.51  ? 122 ASN A CA    1 
ATOM   983  C  C     . ASN A 1 120 ? 10.178 -21.375 -39.525 1.00 36.32  ? 122 ASN A C     1 
ATOM   984  O  O     . ASN A 1 120 ? 10.368 -21.535 -40.734 1.00 36.97  ? 122 ASN A O     1 
ATOM   985  C  CB    . ASN A 1 120 ? 9.391  -23.760 -39.518 1.00 40.22  ? 122 ASN A CB    1 
ATOM   986  C  CG    . ASN A 1 120 ? 8.425  -24.733 -38.864 1.00 42.24  ? 122 ASN A CG    1 
ATOM   987  O  OD1   . ASN A 1 120 ? 8.445  -24.932 -37.648 1.00 43.49  ? 122 ASN A OD1   1 
ATOM   988  N  ND2   . ASN A 1 120 ? 7.566  -25.344 -39.678 1.00 43.72  ? 122 ASN A ND2   1 
ATOM   989  N  N     . ILE A 1 121 ? 10.385 -20.218 -38.901 1.00 33.67  ? 123 ILE A N     1 
ATOM   990  C  CA    . ILE A 1 121 ? 10.823 -19.015 -39.609 1.00 30.68  ? 123 ILE A CA    1 
ATOM   991  C  C     . ILE A 1 121 ? 12.089 -19.314 -40.430 1.00 29.65  ? 123 ILE A C     1 
ATOM   992  O  O     . ILE A 1 121 ? 12.888 -20.176 -40.057 1.00 29.88  ? 123 ILE A O     1 
ATOM   993  C  CB    . ILE A 1 121 ? 10.973 -17.797 -38.651 1.00 29.98  ? 123 ILE A CB    1 
ATOM   994  C  CG1   . ILE A 1 121 ? 12.119 -17.987 -37.642 1.00 29.55  ? 123 ILE A CG1   1 
ATOM   995  C  CG2   . ILE A 1 121 ? 9.638  -17.525 -37.936 1.00 29.85  ? 123 ILE A CG2   1 
ATOM   996  C  CD1   . ILE A 1 121 ? 12.482 -16.713 -36.862 1.00 28.64  ? 123 ILE A CD1   1 
ATOM   997  N  N     . LYS A 1 122 ? 12.238 -18.641 -41.568 1.00 27.34  ? 124 LYS A N     1 
ATOM   998  C  CA    . LYS A 1 122 ? 13.368 -18.913 -42.461 1.00 26.54  ? 124 LYS A CA    1 
ATOM   999  C  C     . LYS A 1 122 ? 14.525 -17.940 -42.217 1.00 24.72  ? 124 LYS A C     1 
ATOM   1000 O  O     . LYS A 1 122 ? 15.676 -18.372 -42.140 1.00 25.44  ? 124 LYS A O     1 
ATOM   1001 C  CB    . LYS A 1 122 ? 12.917 -18.939 -43.929 1.00 26.45  ? 124 LYS A CB    1 
ATOM   1002 C  CG    . LYS A 1 122 ? 13.963 -19.448 -44.908 1.00 28.07  ? 124 LYS A CG    1 
ATOM   1003 C  CD    . LYS A 1 122 ? 13.298 -20.101 -46.109 1.00 29.70  ? 124 LYS A CD    1 
ATOM   1004 C  CE    . LYS A 1 122 ? 14.069 -19.875 -47.407 1.00 32.55  ? 124 LYS A CE    1 
ATOM   1005 N  NZ    . LYS A 1 122 ? 15.427 -20.452 -47.408 1.00 34.35  ? 124 LYS A NZ    1 
ATOM   1006 N  N     . SER A 1 123 ? 14.215 -16.646 -42.090 1.00 22.63  ? 125 SER A N     1 
ATOM   1007 C  CA    . SER A 1 123 ? 15.177 -15.646 -41.600 1.00 20.94  ? 125 SER A CA    1 
ATOM   1008 C  C     . SER A 1 123 ? 14.896 -15.299 -40.143 1.00 20.31  ? 125 SER A C     1 
ATOM   1009 O  O     . SER A 1 123 ? 13.788 -15.508 -39.650 1.00 19.49  ? 125 SER A O     1 
ATOM   1010 C  CB    . SER A 1 123 ? 15.177 -14.365 -42.457 1.00 19.93  ? 125 SER A CB    1 
ATOM   1011 O  OG    . SER A 1 123 ? 14.126 -13.477 -42.118 1.00 19.14  ? 125 SER A OG    1 
ATOM   1012 N  N     . ALA A 1 124 ? 15.911 -14.758 -39.471 1.00 19.69  ? 126 ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 124 ? 15.792 -14.296 -38.093 1.00 19.56  ? 126 ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 124 ? 14.682 -13.258 -37.846 1.00 18.88  ? 126 ALA A C     1 
ATOM   1015 O  O     . ALA A 1 124 ? 14.164 -13.161 -36.738 1.00 18.92  ? 126 ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 124 ? 17.143 -13.762 -37.606 1.00 19.71  ? 126 ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 125 ? 14.311 -12.498 -38.874 1.00 18.56  ? 127 VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 125 ? 13.364 -11.400 -38.705 1.00 17.75  ? 127 VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 125 ? 11.902 -11.725 -39.097 1.00 18.29  ? 127 VAL A C     1 
ATOM   1020 O  O     . VAL A 1 125 ? 11.023 -10.871 -38.984 1.00 17.96  ? 127 VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 125 ? 13.862 -10.105 -39.417 1.00 17.47  ? 127 VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 125 ? 15.317 -9.787  -39.023 1.00 16.70  ? 127 VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 125 ? 13.724 -10.199 -40.945 1.00 16.46  ? 127 VAL A CG2   1 
ATOM   1024 N  N     . ASP A 1 126 ? 11.641 -12.960 -39.515 1.00 19.06  ? 128 ASP A N     1 
ATOM   1025 C  CA    . ASP A 1 126 ? 10.326 -13.336 -40.077 1.00 19.63  ? 128 ASP A CA    1 
ATOM   1026 C  C     . ASP A 1 126 ? 9.105  -13.130 -39.179 1.00 20.61  ? 128 ASP A C     1 
ATOM   1027 O  O     . ASP A 1 126 ? 7.981  -13.024 -39.693 1.00 21.71  ? 128 ASP A O     1 
ATOM   1028 C  CB    . ASP A 1 126 ? 10.329 -14.779 -40.605 1.00 20.42  ? 128 ASP A CB    1 
ATOM   1029 C  CG    . ASP A 1 126 ? 11.234 -14.971 -41.813 1.00 19.38  ? 128 ASP A CG    1 
ATOM   1030 O  OD1   . ASP A 1 126 ? 11.585 -13.986 -42.473 1.00 19.08  ? 128 ASP A OD1   1 
ATOM   1031 O  OD2   . ASP A 1 126 ? 11.592 -16.127 -42.102 1.00 21.23  ? 128 ASP A OD2   1 
ATOM   1032 N  N     . ARG A 1 127 ? 9.300  -13.067 -37.859 1.00 20.54  ? 129 ARG A N     1 
ATOM   1033 C  CA    . ARG A 1 127 ? 8.168  -12.808 -36.936 1.00 21.27  ? 129 ARG A CA    1 
ATOM   1034 C  C     . ARG A 1 127 ? 7.667  -11.350 -36.988 1.00 20.20  ? 129 ARG A C     1 
ATOM   1035 O  O     . ARG A 1 127 ? 6.505  -11.074 -36.687 1.00 20.02  ? 129 ARG A O     1 
ATOM   1036 C  CB    . ARG A 1 127 ? 8.526  -13.169 -35.487 1.00 20.85  ? 129 ARG A CB    1 
ATOM   1037 C  CG    . ARG A 1 127 ? 8.495  -14.665 -35.165 1.00 23.16  ? 129 ARG A CG    1 
ATOM   1038 C  CD    . ARG A 1 127 ? 8.966  -14.952 -33.723 1.00 23.52  ? 129 ARG A CD    1 
ATOM   1039 N  NE    . ARG A 1 127 ? 10.395 -14.683 -33.641 1.00 28.00  ? 129 ARG A NE    1 
ATOM   1040 C  CZ    . ARG A 1 127 ? 11.351 -15.582 -33.424 1.00 27.28  ? 129 ARG A CZ    1 
ATOM   1041 N  NH1   . ARG A 1 127 ? 11.074 -16.852 -33.190 1.00 27.22  ? 129 ARG A NH1   1 
ATOM   1042 N  NH2   . ARG A 1 127 ? 12.606 -15.183 -33.419 1.00 27.89  ? 129 ARG A NH2   1 
ATOM   1043 N  N     . THR A 1 128 ? 8.552  -10.434 -37.367 1.00 19.12  ? 130 THR A N     1 
ATOM   1044 C  CA    . THR A 1 128 ? 8.299  -8.990  -37.227 1.00 18.53  ? 130 THR A CA    1 
ATOM   1045 C  C     . THR A 1 128 ? 6.997  -8.461  -37.874 1.00 18.60  ? 130 THR A C     1 
ATOM   1046 O  O     . THR A 1 128 ? 6.268  -7.699  -37.229 1.00 18.42  ? 130 THR A O     1 
ATOM   1047 C  CB    . THR A 1 128 ? 9.542  -8.157  -37.645 1.00 18.06  ? 130 THR A CB    1 
ATOM   1048 O  OG1   . THR A 1 128 ? 10.646 -8.534  -36.818 1.00 17.67  ? 130 THR A OG1   1 
ATOM   1049 C  CG2   . THR A 1 128 ? 9.284  -6.672  -37.495 1.00 16.54  ? 130 THR A CG2   1 
ATOM   1050 N  N     . PRO A 1 129 ? 6.713  -8.837  -39.143 1.00 18.49  ? 131 PRO A N     1 
ATOM   1051 C  CA    . PRO A 1 129 ? 5.403  -8.469  -39.705 1.00 18.67  ? 131 PRO A CA    1 
ATOM   1052 C  C     . PRO A 1 129 ? 4.209  -8.999  -38.906 1.00 18.28  ? 131 PRO A C     1 
ATOM   1053 O  O     . PRO A 1 129 ? 3.177  -8.341  -38.870 1.00 18.56  ? 131 PRO A O     1 
ATOM   1054 C  CB    . PRO A 1 129 ? 5.433  -9.099  -41.104 1.00 18.94  ? 131 PRO A CB    1 
ATOM   1055 C  CG    . PRO A 1 129 ? 6.868  -9.142  -41.454 1.00 18.25  ? 131 PRO A CG    1 
ATOM   1056 C  CD    . PRO A 1 129 ? 7.548  -9.524  -40.152 1.00 18.64  ? 131 PRO A CD    1 
ATOM   1057 N  N     . PHE A 1 130 ? 4.352  -10.173 -38.291 1.00 18.07  ? 132 PHE A N     1 
ATOM   1058 C  CA    . PHE A 1 130 ? 3.296  -10.768 -37.461 1.00 18.17  ? 132 PHE A CA    1 
ATOM   1059 C  C     . PHE A 1 130 ? 3.144  -10.054 -36.115 1.00 17.93  ? 132 PHE A C     1 
ATOM   1060 O  O     . PHE A 1 130 ? 2.028  -9.906  -35.614 1.00 18.34  ? 132 PHE A O     1 
ATOM   1061 C  CB    . PHE A 1 130 ? 3.542  -12.272 -37.263 1.00 18.83  ? 132 PHE A CB    1 
ATOM   1062 C  CG    . PHE A 1 130 ? 3.454  -13.073 -38.537 1.00 19.88  ? 132 PHE A CG    1 
ATOM   1063 C  CD1   . PHE A 1 130 ? 4.596  -13.363 -39.273 1.00 20.91  ? 132 PHE A CD1   1 
ATOM   1064 C  CD2   . PHE A 1 130 ? 2.223  -13.524 -39.005 1.00 21.78  ? 132 PHE A CD2   1 
ATOM   1065 C  CE1   . PHE A 1 130 ? 4.515  -14.101 -40.456 1.00 20.73  ? 132 PHE A CE1   1 
ATOM   1066 C  CE2   . PHE A 1 130 ? 2.135  -14.261 -40.187 1.00 23.65  ? 132 PHE A CE2   1 
ATOM   1067 C  CZ    . PHE A 1 130 ? 3.293  -14.548 -40.910 1.00 21.86  ? 132 PHE A CZ    1 
ATOM   1068 N  N     . HIS A 1 131 ? 4.259  -9.616  -35.532 1.00 17.41  ? 133 HIS A N     1 
ATOM   1069 C  CA    . HIS A 1 131 ? 4.236  -8.741  -34.345 1.00 17.40  ? 133 HIS A CA    1 
ATOM   1070 C  C     . HIS A 1 131 ? 3.361  -7.518  -34.598 1.00 17.99  ? 133 HIS A C     1 
ATOM   1071 O  O     . HIS A 1 131 ? 2.507  -7.149  -33.763 1.00 18.09  ? 133 HIS A O     1 
ATOM   1072 C  CB    . HIS A 1 131 ? 5.629  -8.230  -34.026 1.00 16.81  ? 133 HIS A CB    1 
ATOM   1073 C  CG    . HIS A 1 131 ? 6.568  -9.278  -33.526 1.00 16.73  ? 133 HIS A CG    1 
ATOM   1074 N  ND1   . HIS A 1 131 ? 7.923  -9.060  -33.426 1.00 16.97  ? 133 HIS A ND1   1 
ATOM   1075 C  CD2   . HIS A 1 131 ? 6.356  -10.546 -33.104 1.00 16.62  ? 133 HIS A CD2   1 
ATOM   1076 C  CE1   . HIS A 1 131 ? 8.506  -10.148 -32.955 1.00 18.48  ? 133 HIS A CE1   1 
ATOM   1077 N  NE2   . HIS A 1 131 ? 7.574  -11.056 -32.730 1.00 17.67  ? 133 HIS A NE2   1 
ATOM   1078 N  N     . HIS A 1 132 ? 3.598  -6.879  -35.742 1.00 17.63  ? 134 HIS A N     1 
ATOM   1079 C  CA    . HIS A 1 132 ? 2.838  -5.699  -36.132 1.00 17.78  ? 134 HIS A CA    1 
ATOM   1080 C  C     . HIS A 1 132 ? 1.336  -5.966  -36.299 1.00 18.85  ? 134 HIS A C     1 
ATOM   1081 O  O     . HIS A 1 132 ? 0.512  -5.213  -35.782 1.00 18.83  ? 134 HIS A O     1 
ATOM   1082 C  CB    . HIS A 1 132 ? 3.408  -5.066  -37.401 1.00 17.75  ? 134 HIS A CB    1 
ATOM   1083 C  CG    . HIS A 1 132 ? 2.728  -3.786  -37.764 1.00 18.27  ? 134 HIS A CG    1 
ATOM   1084 N  ND1   . HIS A 1 132 ? 2.869  -2.640  -37.014 1.00 18.99  ? 134 HIS A ND1   1 
ATOM   1085 C  CD2   . HIS A 1 132 ? 1.859  -3.484  -38.755 1.00 18.92  ? 134 HIS A CD2   1 
ATOM   1086 C  CE1   . HIS A 1 132 ? 2.118  -1.683  -37.529 1.00 20.35  ? 134 HIS A CE1   1 
ATOM   1087 N  NE2   . HIS A 1 132 ? 1.506  -2.166  -38.595 1.00 20.69  ? 134 HIS A NE2   1 
ATOM   1088 N  N     . LYS A 1 133 ? 0.974  -7.025  -37.017 1.00 19.47  ? 135 LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 133 ? -0.446 -7.363  -37.174 1.00 21.36  ? 135 LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 133 ? -1.099 -7.628  -35.818 1.00 21.46  ? 135 LYS A C     1 
ATOM   1091 O  O     . LYS A 1 133 ? -2.227 -7.174  -35.572 1.00 21.79  ? 135 LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 133 ? -0.633 -8.557  -38.113 1.00 21.98  ? 135 LYS A CB    1 
ATOM   1093 C  CG    . LYS A 1 133 ? -0.364 -8.235  -39.572 1.00 25.15  ? 135 LYS A CG    1 
ATOM   1094 C  CD    . LYS A 1 133 ? -1.500 -7.437  -40.207 1.00 30.55  ? 135 LYS A CD    1 
ATOM   1095 C  CE    . LYS A 1 133 ? -1.173 -7.064  -41.647 1.00 33.89  ? 135 LYS A CE    1 
ATOM   1096 N  NZ    . LYS A 1 133 ? -1.085 -8.259  -42.543 1.00 35.75  ? 135 LYS A NZ    1 
ATOM   1097 N  N     . TRP A 1 134 ? -0.369 -8.329  -34.936 1.00 21.00  ? 136 TRP A N     1 
ATOM   1098 C  CA    . TRP A 1 134 ? -0.862 -8.673  -33.594 1.00 21.52  ? 136 TRP A CA    1 
ATOM   1099 C  C     . TRP A 1 134 ? -1.079 -7.419  -32.731 1.00 21.94  ? 136 TRP A C     1 
ATOM   1100 O  O     . TRP A 1 134 ? -2.115 -7.269  -32.072 1.00 22.36  ? 136 TRP A O     1 
ATOM   1101 C  CB    . TRP A 1 134 ? 0.065  -9.681  -32.887 1.00 20.77  ? 136 TRP A CB    1 
ATOM   1102 C  CG    . TRP A 1 134 ? -0.618 -10.323 -31.697 1.00 21.86  ? 136 TRP A CG    1 
ATOM   1103 C  CD1   . TRP A 1 134 ? -1.430 -11.420 -31.716 1.00 21.93  ? 136 TRP A CD1   1 
ATOM   1104 C  CD2   . TRP A 1 134 ? -0.595 -9.867  -30.338 1.00 20.94  ? 136 TRP A CD2   1 
ATOM   1105 N  NE1   . TRP A 1 134 ? -1.900 -11.689 -30.453 1.00 22.43  ? 136 TRP A NE1   1 
ATOM   1106 C  CE2   . TRP A 1 134 ? -1.410 -10.747 -29.588 1.00 21.78  ? 136 TRP A CE2   1 
ATOM   1107 C  CE3   . TRP A 1 134 ? 0.028  -8.795  -29.681 1.00 20.89  ? 136 TRP A CE3   1 
ATOM   1108 C  CZ2   . TRP A 1 134 ? -1.602 -10.604 -28.216 1.00 21.78  ? 136 TRP A CZ2   1 
ATOM   1109 C  CZ3   . TRP A 1 134 ? -0.166 -8.646  -28.319 1.00 21.10  ? 136 TRP A CZ3   1 
ATOM   1110 C  CH2   . TRP A 1 134 ? -0.970 -9.553  -27.597 1.00 22.72  ? 136 TRP A CH2   1 
ATOM   1111 N  N     . LEU A 1 135 ? -0.111 -6.509  -32.783 1.00 21.56  ? 137 LEU A N     1 
ATOM   1112 C  CA    . LEU A 1 135 ? -0.113 -5.297  -31.967 1.00 22.58  ? 137 LEU A CA    1 
ATOM   1113 C  C     . LEU A 1 135 ? -1.028 -4.207  -32.501 1.00 23.70  ? 137 LEU A C     1 
ATOM   1114 O  O     . LEU A 1 135 ? -1.551 -3.391  -31.726 1.00 24.07  ? 137 LEU A O     1 
ATOM   1115 C  CB    . LEU A 1 135 ? 1.312  -4.753  -31.858 1.00 21.12  ? 137 LEU A CB    1 
ATOM   1116 C  CG    . LEU A 1 135 ? 2.095  -4.691  -30.535 1.00 23.31  ? 137 LEU A CG    1 
ATOM   1117 C  CD1   . LEU A 1 135 ? 1.544  -5.520  -29.349 1.00 23.23  ? 137 LEU A CD1   1 
ATOM   1118 C  CD2   . LEU A 1 135 ? 3.572  -4.963  -30.778 1.00 20.20  ? 137 LEU A CD2   1 
ATOM   1119 N  N     . GLU A 1 136 ? -1.201 -4.208  -33.823 1.00 24.35  ? 138 GLU A N     1 
ATOM   1120 C  CA    . GLU A 1 136 ? -1.956 -3.207  -34.577 1.00 26.35  ? 138 GLU A CA    1 
ATOM   1121 C  C     . GLU A 1 136 ? -3.226 -2.732  -33.881 1.00 26.87  ? 138 GLU A C     1 
ATOM   1122 O  O     . GLU A 1 136 ? -3.368 -1.545  -33.581 1.00 27.00  ? 138 GLU A O     1 
ATOM   1123 C  CB    . GLU A 1 136 ? -2.299 -3.772  -35.964 1.00 26.53  ? 138 GLU A CB    1 
ATOM   1124 C  CG    . GLU A 1 136 ? -2.492 -2.730  -37.044 1.00 28.88  ? 138 GLU A CG    1 
ATOM   1125 C  CD    . GLU A 1 136 ? -2.594 -3.330  -38.445 1.00 29.04  ? 138 GLU A CD    1 
ATOM   1126 O  OE1   . GLU A 1 136 ? -2.488 -2.548  -39.412 1.00 34.30  ? 138 GLU A OE1   1 
ATOM   1127 O  OE2   . GLU A 1 136 ? -2.781 -4.566  -38.592 1.00 31.62  ? 138 GLU A OE2   1 
ATOM   1128 N  N     . GLY A 1 137 ? -4.138 -3.663  -33.623 1.00 27.20  ? 139 GLY A N     1 
ATOM   1129 C  CA    . GLY A 1 137 ? -5.450 -3.319  -33.086 1.00 28.57  ? 139 GLY A CA    1 
ATOM   1130 C  C     . GLY A 1 137 ? -5.552 -3.533  -31.593 1.00 28.81  ? 139 GLY A C     1 
ATOM   1131 O  O     . GLY A 1 137 ? -6.646 -3.524  -31.038 1.00 30.18  ? 139 GLY A O     1 
ATOM   1132 N  N     . ARG A 1 138 ? -4.407 -3.732  -30.947 1.00 28.04  ? 140 ARG A N     1 
ATOM   1133 C  CA    . ARG A 1 138 ? -4.353 -3.936  -29.510 1.00 28.51  ? 140 ARG A CA    1 
ATOM   1134 C  C     . ARG A 1 138 ? -3.637 -2.785  -28.802 1.00 28.45  ? 140 ARG A C     1 
ATOM   1135 O  O     . ARG A 1 138 ? -4.002 -2.438  -27.677 1.00 28.90  ? 140 ARG A O     1 
ATOM   1136 C  CB    . ARG A 1 138 ? -3.726 -5.299  -29.164 1.00 27.96  ? 140 ARG A CB    1 
ATOM   1137 C  CG    . ARG A 1 138 ? -4.570 -6.487  -29.596 1.00 28.23  ? 140 ARG A CG    1 
ATOM   1138 C  CD    . ARG A 1 138 ? -3.928 -7.842  -29.292 1.00 28.82  ? 140 ARG A CD    1 
ATOM   1139 N  NE    . ARG A 1 138 ? -4.439 -8.869  -30.206 1.00 32.02  ? 140 ARG A NE    1 
ATOM   1140 C  CZ    . ARG A 1 138 ? -5.076 -9.976  -29.835 1.00 33.03  ? 140 ARG A CZ    1 
ATOM   1141 N  NH1   . ARG A 1 138 ? -5.274 -10.235 -28.557 1.00 36.98  ? 140 ARG A NH1   1 
ATOM   1142 N  NH2   . ARG A 1 138 ? -5.505 -10.841 -30.741 1.00 32.80  ? 140 ARG A NH2   1 
ATOM   1143 N  N     . ILE A 1 139 ? -2.647 -2.181  -29.466 1.00 27.97  ? 141 ILE A N     1 
ATOM   1144 C  CA    . ILE A 1 139 ? -1.861 -1.091  -28.861 1.00 28.41  ? 141 ILE A CA    1 
ATOM   1145 C  C     . ILE A 1 139 ? -2.531 0.292   -28.991 1.00 29.98  ? 141 ILE A C     1 
ATOM   1146 O  O     . ILE A 1 139 ? -2.153 1.243   -28.304 1.00 30.30  ? 141 ILE A O     1 
ATOM   1147 C  CB    . ILE A 1 139 ? -0.381 -1.071  -29.397 1.00 27.23  ? 141 ILE A CB    1 
ATOM   1148 C  CG1   . ILE A 1 139 ? 0.590  -0.491  -28.354 1.00 26.14  ? 141 ILE A CG1   1 
ATOM   1149 C  CG2   . ILE A 1 139 ? -0.282 -0.323  -30.752 1.00 26.18  ? 141 ILE A CG2   1 
ATOM   1150 C  CD1   . ILE A 1 139 ? 0.866  -1.383  -27.141 1.00 24.81  ? 141 ILE A CD1   1 
ATOM   1151 N  N     . LYS A 1 140 ? -3.537 0.391   -29.860 1.00 31.50  ? 142 LYS A N     1 
ATOM   1152 C  CA    . LYS A 1 140 ? -4.190 1.664   -30.189 1.00 32.91  ? 142 LYS A CA    1 
ATOM   1153 C  C     . LYS A 1 140 ? -4.772 2.352   -28.947 1.00 33.40  ? 142 LYS A C     1 
ATOM   1154 O  O     . LYS A 1 140 ? -5.546 1.753   -28.197 1.00 33.53  ? 142 LYS A O     1 
ATOM   1155 C  CB    . LYS A 1 140 ? -5.304 1.417   -31.205 1.00 34.34  ? 142 LYS A CB    1 
ATOM   1156 C  CG    . LYS A 1 140 ? -5.286 2.300   -32.428 1.00 36.70  ? 142 LYS A CG    1 
ATOM   1157 C  CD    . LYS A 1 140 ? -4.712 1.555   -33.621 1.00 39.47  ? 142 LYS A CD    1 
ATOM   1158 C  CE    . LYS A 1 140 ? -5.531 1.784   -34.895 1.00 42.04  ? 142 LYS A CE    1 
ATOM   1159 N  NZ    . LYS A 1 140 ? -5.655 3.226   -35.291 1.00 45.33  ? 142 LYS A NZ    1 
ATOM   1160 N  N     . GLY A 1 141 ? -4.380 3.609   -28.733 1.00 33.20  ? 143 GLY A N     1 
ATOM   1161 C  CA    . GLY A 1 141 ? -4.794 4.371   -27.558 1.00 33.23  ? 143 GLY A CA    1 
ATOM   1162 C  C     . GLY A 1 141 ? -3.854 4.288   -26.366 1.00 32.77  ? 143 GLY A C     1 
ATOM   1163 O  O     . GLY A 1 141 ? -3.979 5.076   -25.426 1.00 33.29  ? 143 GLY A O     1 
ATOM   1164 N  N     . LYS A 1 142 ? -2.920 3.331   -26.398 1.00 29.59  ? 144 LYS A N     1 
ATOM   1165 C  CA    . LYS A 1 142 ? -1.974 3.097   -25.294 1.00 28.93  ? 144 LYS A CA    1 
ATOM   1166 C  C     . LYS A 1 142 ? -0.544 3.466   -25.657 1.00 27.88  ? 144 LYS A C     1 
ATOM   1167 O  O     . LYS A 1 142 ? 0.405  3.075   -24.972 1.00 26.49  ? 144 LYS A O     1 
ATOM   1168 C  CB    . LYS A 1 142 ? -2.032 1.640   -24.827 1.00 28.50  ? 144 LYS A CB    1 
ATOM   1169 C  CG    . LYS A 1 142 ? -3.334 1.278   -24.156 1.00 30.83  ? 144 LYS A CG    1 
ATOM   1170 C  CD    . LYS A 1 142 ? -3.291 -0.130  -23.604 1.00 33.95  ? 144 LYS A CD    1 
ATOM   1171 C  CE    . LYS A 1 142 ? -4.690 -0.704  -23.491 1.00 36.82  ? 144 LYS A CE    1 
ATOM   1172 N  NZ    . LYS A 1 142 ? -5.277 -0.928  -24.859 1.00 39.85  ? 144 LYS A NZ    1 
ATOM   1173 N  N     . GLU A 1 143 ? -0.421 4.242   -26.732 1.00 28.11  ? 145 GLU A N     1 
ATOM   1174 C  CA    . GLU A 1 143 ? 0.849  4.674   -27.326 1.00 27.81  ? 145 GLU A CA    1 
ATOM   1175 C  C     . GLU A 1 143 ? 1.778  5.366   -26.339 1.00 27.16  ? 145 GLU A C     1 
ATOM   1176 O  O     . GLU A 1 143 ? 2.974  5.094   -26.294 1.00 26.46  ? 145 GLU A O     1 
ATOM   1177 C  CB    . GLU A 1 143 ? 0.556  5.666   -28.467 1.00 29.34  ? 145 GLU A CB    1 
ATOM   1178 C  CG    . GLU A 1 143 ? -0.916 5.651   -28.995 1.00 31.39  ? 145 GLU A CG    1 
ATOM   1179 C  CD    . GLU A 1 143 ? -1.133 4.523   -29.959 1.00 31.60  ? 145 GLU A CD    1 
ATOM   1180 O  OE1   . GLU A 1 143 ? -2.208 4.443   -30.584 1.00 29.83  ? 145 GLU A OE1   1 
ATOM   1181 O  OE2   . GLU A 1 143 ? -0.193 3.707   -30.087 1.00 33.40  ? 145 GLU A OE2   1 
ATOM   1182 N  N     . ASN A 1 144 ? 1.217  6.287   -25.568 1.00 27.46  ? 146 ASN A N     1 
ATOM   1183 C  CA    . ASN A 1 144 ? 1.995  7.069   -24.626 1.00 26.86  ? 146 ASN A CA    1 
ATOM   1184 C  C     . ASN A 1 144 ? 2.394  6.300   -23.386 1.00 25.63  ? 146 ASN A C     1 
ATOM   1185 O  O     . ASN A 1 144 ? 3.354  6.669   -22.722 1.00 25.61  ? 146 ASN A O     1 
ATOM   1186 C  CB    . ASN A 1 144 ? 1.250  8.348   -24.270 1.00 28.62  ? 146 ASN A CB    1 
ATOM   1187 C  CG    . ASN A 1 144 ? 1.034  9.242   -25.479 1.00 29.64  ? 146 ASN A CG    1 
ATOM   1188 O  OD1   . ASN A 1 144 ? 1.771  9.168   -26.466 1.00 31.60  ? 146 ASN A OD1   1 
ATOM   1189 N  ND2   . ASN A 1 144 ? 0.025  10.086  -25.412 1.00 31.82  ? 146 ASN A ND2   1 
ATOM   1190 N  N     . GLU A 1 145 ? 1.663  5.225   -23.090 1.00 24.50  ? 147 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 145 ? 2.023  4.313   -22.005 1.00 23.17  ? 147 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 145 ? 3.287  3.568   -22.393 1.00 21.44  ? 147 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 145 ? 4.195  3.395   -21.574 1.00 20.60  ? 147 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 145 ? 0.898  3.322   -21.720 1.00 22.61  ? 147 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 145 ? -0.434 3.958   -21.316 1.00 25.22  ? 147 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 145 ? -0.364 4.784   -20.030 1.00 26.66  ? 147 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 145 ? 0.415  4.445   -19.114 1.00 26.52  ? 147 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 145 ? -1.114 5.778   -19.935 1.00 29.86  ? 147 GLU A OE2   1 
ATOM   1199 N  N     . VAL A 1 146 ? 3.332  3.124   -23.647 1.00 20.97  ? 148 VAL A N     1 
ATOM   1200 C  CA    . VAL A 1 146 ? 4.511  2.435   -24.182 1.00 19.50  ? 148 VAL A CA    1 
ATOM   1201 C  C     . VAL A 1 146 ? 5.702  3.388   -24.130 1.00 19.41  ? 148 VAL A C     1 
ATOM   1202 O  O     . VAL A 1 146 ? 6.799  3.006   -23.701 1.00 18.53  ? 148 VAL A O     1 
ATOM   1203 C  CB    . VAL A 1 146 ? 4.293  1.938   -25.630 1.00 19.70  ? 148 VAL A CB    1 
ATOM   1204 C  CG1   . VAL A 1 146 ? 5.553  1.227   -26.154 1.00 19.03  ? 148 VAL A CG1   1 
ATOM   1205 C  CG2   . VAL A 1 146 ? 3.104  0.998   -25.709 1.00 19.32  ? 148 VAL A CG2   1 
ATOM   1206 N  N     . ARG A 1 147 ? 5.465  4.634   -24.561 1.00 19.81  ? 149 ARG A N     1 
ATOM   1207 C  CA    . ARG A 1 147 ? 6.503  5.664   -24.598 1.00 19.92  ? 149 ARG A CA    1 
ATOM   1208 C  C     . ARG A 1 147 ? 7.052  5.987   -23.202 1.00 19.90  ? 149 ARG A C     1 
ATOM   1209 O  O     . ARG A 1 147 ? 8.258  6.164   -23.043 1.00 19.93  ? 149 ARG A O     1 
ATOM   1210 C  CB    . ARG A 1 147 ? 5.992  6.917   -25.312 1.00 20.98  ? 149 ARG A CB    1 
ATOM   1211 C  CG    . ARG A 1 147 ? 5.763  6.685   -26.803 1.00 20.43  ? 149 ARG A CG    1 
ATOM   1212 C  CD    . ARG A 1 147 ? 4.962  7.792   -27.456 1.00 21.24  ? 149 ARG A CD    1 
ATOM   1213 N  NE    . ARG A 1 147 ? 5.300  7.865   -28.875 1.00 21.09  ? 149 ARG A NE    1 
ATOM   1214 C  CZ    . ARG A 1 147 ? 4.497  8.309   -29.835 1.00 22.84  ? 149 ARG A CZ    1 
ATOM   1215 N  NH1   . ARG A 1 147 ? 3.264  8.715   -29.551 1.00 22.42  ? 149 ARG A NH1   1 
ATOM   1216 N  NH2   . ARG A 1 147 ? 4.931  8.326   -31.094 1.00 23.09  ? 149 ARG A NH2   1 
ATOM   1217 N  N     . LEU A 1 148 ? 6.171  6.029   -22.202 1.00 19.86  ? 150 LEU A N     1 
ATOM   1218 C  CA    . LEU A 1 148 ? 6.579  6.128   -20.791 1.00 20.40  ? 150 LEU A CA    1 
ATOM   1219 C  C     . LEU A 1 148 ? 7.470  4.970   -20.346 1.00 19.16  ? 150 LEU A C     1 
ATOM   1220 O  O     . LEU A 1 148 ? 8.493  5.195   -19.699 1.00 19.91  ? 150 LEU A O     1 
ATOM   1221 C  CB    . LEU A 1 148 ? 5.361  6.242   -19.860 1.00 20.94  ? 150 LEU A CB    1 
ATOM   1222 C  CG    . LEU A 1 148 ? 4.654  7.591   -19.712 1.00 22.79  ? 150 LEU A CG    1 
ATOM   1223 C  CD1   . LEU A 1 148 ? 3.310  7.436   -18.987 1.00 23.52  ? 150 LEU A CD1   1 
ATOM   1224 C  CD2   . LEU A 1 148 ? 5.518  8.633   -19.002 1.00 24.30  ? 150 LEU A CD2   1 
ATOM   1225 N  N     . LEU A 1 149 ? 7.107  3.737   -20.705 1.00 18.36  ? 151 LEU A N     1 
ATOM   1226 C  CA    . LEU A 1 149 ? 7.907  2.576   -20.321 1.00 17.07  ? 151 LEU A CA    1 
ATOM   1227 C  C     . LEU A 1 149 ? 9.282  2.592   -20.991 1.00 17.11  ? 151 LEU A C     1 
ATOM   1228 O  O     . LEU A 1 149 ? 10.295 2.355   -20.323 1.00 16.42  ? 151 LEU A O     1 
ATOM   1229 C  CB    . LEU A 1 149 ? 7.183  1.259   -20.611 1.00 16.74  ? 151 LEU A CB    1 
ATOM   1230 C  CG    . LEU A 1 149 ? 7.815  -0.029  -20.057 1.00 15.75  ? 151 LEU A CG    1 
ATOM   1231 C  CD1   . LEU A 1 149 ? 8.025  0.005   -18.502 1.00 14.48  ? 151 LEU A CD1   1 
ATOM   1232 C  CD2   . LEU A 1 149 ? 6.947  -1.216  -20.461 1.00 15.77  ? 151 LEU A CD2   1 
ATOM   1233 N  N     . LYS A 1 150 ? 9.301  2.902   -22.291 1.00 16.84  ? 152 LYS A N     1 
ATOM   1234 C  CA    . LYS A 1 150 ? 10.539 2.988   -23.068 1.00 16.70  ? 152 LYS A CA    1 
ATOM   1235 C  C     . LYS A 1 150 ? 11.473 4.050   -22.493 1.00 17.55  ? 152 LYS A C     1 
ATOM   1236 O  O     . LYS A 1 150 ? 12.684 3.811   -22.364 1.00 18.18  ? 152 LYS A O     1 
ATOM   1237 C  CB    . LYS A 1 150 ? 10.254 3.289   -24.561 1.00 16.45  ? 152 LYS A CB    1 
ATOM   1238 C  CG    . LYS A 1 150 ? 9.599  2.162   -25.370 1.00 15.46  ? 152 LYS A CG    1 
ATOM   1239 C  CD    . LYS A 1 150 ? 9.490  2.531   -26.861 1.00 15.34  ? 152 LYS A CD    1 
ATOM   1240 C  CE    . LYS A 1 150 ? 9.027  1.343   -27.712 1.00 14.04  ? 152 LYS A CE    1 
ATOM   1241 N  NZ    . LYS A 1 150 ? 8.890  1.723   -29.158 1.00 13.47  ? 152 LYS A NZ    1 
ATOM   1242 N  N     . GLY A 1 151 ? 10.906 5.216   -22.171 1.00 18.43  ? 153 GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 151 ? 11.644 6.350   -21.626 1.00 19.40  ? 153 GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 151 ? 12.204 6.078   -20.243 1.00 20.02  ? 153 GLY A C     1 
ATOM   1245 O  O     . GLY A 1 151 ? 13.334 6.442   -19.944 1.00 20.65  ? 153 GLY A O     1 
ATOM   1246 N  N     . PHE A 1 152 ? 11.400 5.437   -19.403 1.00 20.41  ? 154 PHE A N     1 
ATOM   1247 C  CA    . PHE A 1 152 ? 11.816 4.981   -18.075 1.00 20.58  ? 154 PHE A CA    1 
ATOM   1248 C  C     . PHE A 1 152 ? 12.992 4.009   -18.182 1.00 20.26  ? 154 PHE A C     1 
ATOM   1249 O  O     . PHE A 1 152 ? 14.002 4.161   -17.486 1.00 20.60  ? 154 PHE A O     1 
ATOM   1250 C  CB    . PHE A 1 152 ? 10.626 4.299   -17.404 1.00 19.96  ? 154 PHE A CB    1 
ATOM   1251 C  CG    . PHE A 1 152 ? 10.850 3.929   -15.975 1.00 20.99  ? 154 PHE A CG    1 
ATOM   1252 C  CD1   . PHE A 1 152 ? 10.817 4.899   -14.971 1.00 21.47  ? 154 PHE A CD1   1 
ATOM   1253 C  CD2   . PHE A 1 152 ? 11.041 2.603   -15.615 1.00 20.72  ? 154 PHE A CD2   1 
ATOM   1254 C  CE1   . PHE A 1 152 ? 11.000 4.550   -13.634 1.00 21.51  ? 154 PHE A CE1   1 
ATOM   1255 C  CE2   . PHE A 1 152 ? 11.229 2.250   -14.276 1.00 21.28  ? 154 PHE A CE2   1 
ATOM   1256 C  CZ    . PHE A 1 152 ? 11.206 3.229   -13.290 1.00 21.02  ? 154 PHE A CZ    1 
ATOM   1257 N  N     . LEU A 1 153 ? 12.863 3.014   -19.061 1.00 19.92  ? 155 LEU A N     1 
ATOM   1258 C  CA    . LEU A 1 153 ? 13.920 2.011   -19.241 1.00 19.85  ? 155 LEU A CA    1 
ATOM   1259 C  C     . LEU A 1 153 ? 15.208 2.612   -19.824 1.00 20.32  ? 155 LEU A C     1 
ATOM   1260 O  O     . LEU A 1 153 ? 16.322 2.276   -19.402 1.00 20.62  ? 155 LEU A O     1 
ATOM   1261 C  CB    . LEU A 1 153 ? 13.421 0.850   -20.116 1.00 19.14  ? 155 LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1 153 ? 12.439 -0.119  -19.445 1.00 18.82  ? 155 LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1 153 ? 11.649 -0.893  -20.507 1.00 19.01  ? 155 LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1 153 ? 13.173 -1.080  -18.518 1.00 16.92  ? 155 LEU A CD2   1 
ATOM   1265 N  N     . LYS A 1 154 ? 15.043 3.516   -20.781 1.00 20.63  ? 156 LYS A N     1 
ATOM   1266 C  CA    . LYS A 1 154 ? 16.163 4.142   -21.473 1.00 21.34  ? 156 LYS A CA    1 
ATOM   1267 C  C     . LYS A 1 154 ? 16.970 5.024   -20.523 1.00 21.82  ? 156 LYS A C     1 
ATOM   1268 O  O     . LYS A 1 154 ? 18.202 5.001   -20.541 1.00 21.46  ? 156 LYS A O     1 
ATOM   1269 C  CB    . LYS A 1 154 ? 15.653 4.954   -22.664 1.00 21.73  ? 156 LYS A CB    1 
ATOM   1270 C  CG    . LYS A 1 154 ? 16.737 5.598   -23.497 1.00 25.09  ? 156 LYS A CG    1 
ATOM   1271 C  CD    . LYS A 1 154 ? 16.776 5.070   -24.901 1.00 28.31  ? 156 LYS A CD    1 
ATOM   1272 C  CE    . LYS A 1 154 ? 17.633 5.975   -25.774 1.00 31.81  ? 156 LYS A CE    1 
ATOM   1273 N  NZ    . LYS A 1 154 ? 16.831 7.045   -26.440 1.00 34.74  ? 156 LYS A NZ    1 
ATOM   1274 N  N     . ALA A 1 155 ? 16.262 5.791   -19.692 1.00 22.16  ? 157 ALA A N     1 
ATOM   1275 C  CA    . ALA A 1 155 ? 16.890 6.684   -18.724 1.00 23.54  ? 157 ALA A CA    1 
ATOM   1276 C  C     . ALA A 1 155 ? 17.704 5.922   -17.682 1.00 23.41  ? 157 ALA A C     1 
ATOM   1277 O  O     . ALA A 1 155 ? 18.608 6.481   -17.060 1.00 25.26  ? 157 ALA A O     1 
ATOM   1278 C  CB    . ALA A 1 155 ? 15.837 7.560   -18.045 1.00 23.81  ? 157 ALA A CB    1 
ATOM   1279 N  N     . ASN A 1 156 ? 17.389 4.645   -17.507 1.00 22.29  ? 158 ASN A N     1 
ATOM   1280 C  CA    . ASN A 1 156 ? 18.087 3.800   -16.553 1.00 22.38  ? 158 ASN A CA    1 
ATOM   1281 C  C     . ASN A 1 156 ? 18.971 2.704   -17.169 1.00 22.09  ? 158 ASN A C     1 
ATOM   1282 O  O     . ASN A 1 156 ? 19.294 1.730   -16.498 1.00 22.37  ? 158 ASN A O     1 
ATOM   1283 C  CB    . ASN A 1 156 ? 17.082 3.213   -15.560 1.00 22.29  ? 158 ASN A CB    1 
ATOM   1284 C  CG    . ASN A 1 156 ? 16.500 4.269   -14.658 1.00 23.54  ? 158 ASN A CG    1 
ATOM   1285 O  OD1   . ASN A 1 156 ? 17.168 4.743   -13.745 1.00 24.32  ? 158 ASN A OD1   1 
ATOM   1286 N  ND2   . ASN A 1 156 ? 15.256 4.666   -14.925 1.00 23.95  ? 158 ASN A ND2   1 
ATOM   1287 N  N     . GLY A 1 157 ? 19.337 2.868   -18.437 1.00 21.37  ? 159 GLY A N     1 
ATOM   1288 C  CA    . GLY A 1 157 ? 20.350 2.044   -19.086 1.00 21.97  ? 159 GLY A CA    1 
ATOM   1289 C  C     . GLY A 1 157 ? 19.992 0.596   -19.390 1.00 21.19  ? 159 GLY A C     1 
ATOM   1290 O  O     . GLY A 1 157 ? 20.884 -0.223  -19.638 1.00 20.94  ? 159 GLY A O     1 
ATOM   1291 N  N     . ILE A 1 158 ? 18.695 0.274   -19.374 1.00 20.83  ? 160 ILE A N     1 
ATOM   1292 C  CA    . ILE A 1 158 ? 18.249 -1.110  -19.592 1.00 20.68  ? 160 ILE A CA    1 
ATOM   1293 C  C     . ILE A 1 158 ? 17.199 -1.251  -20.705 1.00 20.16  ? 160 ILE A C     1 
ATOM   1294 O  O     . ILE A 1 158 ? 16.427 -2.228  -20.735 1.00 19.47  ? 160 ILE A O     1 
ATOM   1295 C  CB    . ILE A 1 158 ? 17.786 -1.800  -18.272 1.00 20.77  ? 160 ILE A CB    1 
ATOM   1296 C  CG1   . ILE A 1 158 ? 16.693 -0.987  -17.566 1.00 21.30  ? 160 ILE A CG1   1 
ATOM   1297 C  CG2   . ILE A 1 158 ? 18.969 -2.008  -17.349 1.00 21.81  ? 160 ILE A CG2   1 
ATOM   1298 C  CD1   . ILE A 1 158 ? 16.001 -1.715  -16.438 1.00 20.95  ? 160 ILE A CD1   1 
ATOM   1299 N  N     . TYR A 1 159 ? 17.196 -0.275  -21.621 1.00 20.14  ? 161 TYR A N     1 
ATOM   1300 C  CA    . TYR A 1 159 ? 16.380 -0.336  -22.829 1.00 19.59  ? 161 TYR A CA    1 
ATOM   1301 C  C     . TYR A 1 159 ? 17.155 -0.909  -24.019 1.00 19.35  ? 161 TYR A C     1 
ATOM   1302 O  O     . TYR A 1 159 ? 18.237 -0.431  -24.370 1.00 20.57  ? 161 TYR A O     1 
ATOM   1303 C  CB    . TYR A 1 159 ? 15.793 1.035   -23.189 1.00 19.98  ? 161 TYR A CB    1 
ATOM   1304 C  CG    . TYR A 1 159 ? 14.819 0.960   -24.356 1.00 19.87  ? 161 TYR A CG    1 
ATOM   1305 C  CD1   . TYR A 1 159 ? 13.607 0.280   -24.234 1.00 19.71  ? 161 TYR A CD1   1 
ATOM   1306 C  CD2   . TYR A 1 159 ? 15.123 1.558   -25.591 1.00 20.80  ? 161 TYR A CD2   1 
ATOM   1307 C  CE1   . TYR A 1 159 ? 12.706 0.189   -25.318 1.00 19.66  ? 161 TYR A CE1   1 
ATOM   1308 C  CE2   . TYR A 1 159 ? 14.237 1.472   -26.679 1.00 21.01  ? 161 TYR A CE2   1 
ATOM   1309 C  CZ    . TYR A 1 159 ? 13.030 0.785   -26.532 1.00 20.42  ? 161 TYR A CZ    1 
ATOM   1310 O  OH    . TYR A 1 159 ? 12.164 0.701   -27.595 1.00 20.44  ? 161 TYR A OH    1 
ATOM   1311 N  N     . GLY A 1 160 ? 16.581 -1.919  -24.659 1.00 18.33  ? 162 GLY A N     1 
ATOM   1312 C  CA    . GLY A 1 160 ? 17.233 -2.557  -25.787 1.00 17.08  ? 162 GLY A CA    1 
ATOM   1313 C  C     . GLY A 1 160 ? 17.670 -3.959  -25.438 1.00 17.03  ? 162 GLY A C     1 
ATOM   1314 O  O     . GLY A 1 160 ? 18.282 -4.182  -24.380 1.00 16.26  ? 162 GLY A O     1 
ATOM   1315 N  N     . ALA A 1 161 ? 17.356 -4.898  -26.333 1.00 16.34  ? 163 ALA A N     1 
ATOM   1316 C  CA    . ALA A 1 161 ? 17.714 -6.310  -26.167 1.00 16.13  ? 163 ALA A CA    1 
ATOM   1317 C  C     . ALA A 1 161 ? 19.089 -6.674  -26.755 1.00 16.60  ? 163 ALA A C     1 
ATOM   1318 O  O     . ALA A 1 161 ? 19.539 -7.819  -26.626 1.00 16.49  ? 163 ALA A O     1 
ATOM   1319 C  CB    . ALA A 1 161 ? 16.642 -7.193  -26.771 1.00 15.83  ? 163 ALA A CB    1 
ATOM   1320 N  N     . GLU A 1 162 ? 19.752 -5.712  -27.390 1.00 16.47  ? 164 GLU A N     1 
ATOM   1321 C  CA    . GLU A 1 162 ? 21.054 -5.980  -28.005 1.00 17.53  ? 164 GLU A CA    1 
ATOM   1322 C  C     . GLU A 1 162 ? 22.083 -6.330  -26.919 1.00 18.03  ? 164 GLU A C     1 
ATOM   1323 O  O     . GLU A 1 162 ? 21.906 -5.931  -25.766 1.00 17.97  ? 164 GLU A O     1 
ATOM   1324 C  CB    . GLU A 1 162 ? 21.507 -4.814  -28.899 1.00 17.85  ? 164 GLU A CB    1 
ATOM   1325 C  CG    . GLU A 1 162 ? 21.844 -3.503  -28.176 1.00 18.64  ? 164 GLU A CG    1 
ATOM   1326 C  CD    . GLU A 1 162 ? 20.642 -2.597  -27.989 1.00 20.94  ? 164 GLU A CD    1 
ATOM   1327 O  OE1   . GLU A 1 162 ? 20.838 -1.367  -27.876 1.00 22.51  ? 164 GLU A OE1   1 
ATOM   1328 O  OE2   . GLU A 1 162 ? 19.501 -3.097  -27.964 1.00 19.87  ? 164 GLU A OE2   1 
ATOM   1329 N  N     . TYR A 1 163 ? 23.121 -7.096  -27.279 1.00 19.06  ? 165 TYR A N     1 
ATOM   1330 C  CA    . TYR A 1 163 ? 24.142 -7.554  -26.320 1.00 19.59  ? 165 TYR A CA    1 
ATOM   1331 C  C     . TYR A 1 163 ? 24.792 -6.469  -25.490 1.00 19.99  ? 165 TYR A C     1 
ATOM   1332 O  O     . TYR A 1 163 ? 25.093 -6.692  -24.312 1.00 19.68  ? 165 TYR A O     1 
ATOM   1333 C  CB    . TYR A 1 163 ? 25.222 -8.444  -26.963 1.00 20.91  ? 165 TYR A CB    1 
ATOM   1334 C  CG    . TYR A 1 163 ? 24.745 -9.858  -27.084 1.00 21.41  ? 165 TYR A CG    1 
ATOM   1335 C  CD1   . TYR A 1 163 ? 24.596 -10.463 -28.329 1.00 22.34  ? 165 TYR A CD1   1 
ATOM   1336 C  CD2   . TYR A 1 163 ? 24.401 -10.585 -25.946 1.00 21.06  ? 165 TYR A CD2   1 
ATOM   1337 C  CE1   . TYR A 1 163 ? 24.126 -11.768 -28.437 1.00 22.06  ? 165 TYR A CE1   1 
ATOM   1338 C  CE2   . TYR A 1 163 ? 23.925 -11.873 -26.039 1.00 21.71  ? 165 TYR A CE2   1 
ATOM   1339 C  CZ    . TYR A 1 163 ? 23.777 -12.462 -27.282 1.00 23.05  ? 165 TYR A CZ    1 
ATOM   1340 O  OH    . TYR A 1 163 ? 23.281 -13.748 -27.354 1.00 22.33  ? 165 TYR A OH    1 
ATOM   1341 N  N     . LYS A 1 164 ? 25.001 -5.302  -26.092 1.00 20.24  ? 166 LYS A N     1 
ATOM   1342 C  CA    . LYS A 1 164 ? 25.569 -4.179  -25.357 1.00 21.24  ? 166 LYS A CA    1 
ATOM   1343 C  C     . LYS A 1 164 ? 24.754 -3.818  -24.120 1.00 20.71  ? 166 LYS A C     1 
ATOM   1344 O  O     . LYS A 1 164 ? 25.323 -3.399  -23.124 1.00 21.33  ? 166 LYS A O     1 
ATOM   1345 C  CB    . LYS A 1 164 ? 25.739 -2.954  -26.254 1.00 21.52  ? 166 LYS A CB    1 
ATOM   1346 C  CG    . LYS A 1 164 ? 26.564 -1.838  -25.612 1.00 22.32  ? 166 LYS A CG    1 
ATOM   1347 C  CD    . LYS A 1 164 ? 26.865 -0.711  -26.594 1.00 23.68  ? 166 LYS A CD    1 
ATOM   1348 C  CE    . LYS A 1 164 ? 27.534 0.453   -25.867 1.00 25.67  ? 166 LYS A CE    1 
ATOM   1349 N  NZ    . LYS A 1 164 ? 27.654 1.605   -26.786 1.00 30.28  ? 166 LYS A NZ    1 
ATOM   1350 N  N     . VAL A 1 165 ? 23.430 -3.976  -24.197 1.00 19.28  ? 167 VAL A N     1 
ATOM   1351 C  CA    . VAL A 1 165 ? 22.533 -3.584  -23.120 1.00 19.23  ? 167 VAL A CA    1 
ATOM   1352 C  C     . VAL A 1 165 ? 21.988 -4.787  -22.342 1.00 19.29  ? 167 VAL A C     1 
ATOM   1353 O  O     . VAL A 1 165 ? 21.868 -4.720  -21.118 1.00 19.53  ? 167 VAL A O     1 
ATOM   1354 C  CB    . VAL A 1 165 ? 21.320 -2.755  -23.648 1.00 18.69  ? 167 VAL A CB    1 
ATOM   1355 C  CG1   . VAL A 1 165 ? 20.372 -2.381  -22.496 1.00 16.91  ? 167 VAL A CG1   1 
ATOM   1356 C  CG2   . VAL A 1 165 ? 21.789 -1.503  -24.385 1.00 18.82  ? 167 VAL A CG2   1 
ATOM   1357 N  N     . ARG A 1 166 ? 21.648 -5.866  -23.053 1.00 19.68  ? 168 ARG A N     1 
ATOM   1358 C  CA    . ARG A 1 166 ? 20.969 -7.038  -22.460 1.00 19.99  ? 168 ARG A CA    1 
ATOM   1359 C  C     . ARG A 1 166 ? 19.714 -6.643  -21.646 1.00 19.48  ? 168 ARG A C     1 
ATOM   1360 O  O     . ARG A 1 166 ? 19.512 -7.088  -20.505 1.00 18.81  ? 168 ARG A O     1 
ATOM   1361 C  CB    . ARG A 1 166 ? 21.945 -7.856  -21.594 1.00 20.38  ? 168 ARG A CB    1 
ATOM   1362 C  CG    . ARG A 1 166 ? 23.029 -8.618  -22.376 1.00 21.39  ? 168 ARG A CG    1 
ATOM   1363 C  CD    . ARG A 1 166 ? 23.786 -9.553  -21.417 1.00 23.50  ? 168 ARG A CD    1 
ATOM   1364 N  NE    . ARG A 1 166 ? 24.813 -10.379 -22.064 1.00 28.54  ? 168 ARG A NE    1 
ATOM   1365 C  CZ    . ARG A 1 166 ? 24.604 -11.605 -22.545 1.00 29.61  ? 168 ARG A CZ    1 
ATOM   1366 N  NH1   . ARG A 1 166 ? 23.390 -12.151 -22.472 1.00 29.55  ? 168 ARG A NH1   1 
ATOM   1367 N  NH2   . ARG A 1 166 ? 25.601 -12.279 -23.114 1.00 27.75  ? 168 ARG A NH2   1 
ATOM   1368 N  N     . GLY A 1 167 ? 18.878 -5.797  -22.236 1.00 19.20  ? 169 GLY A N     1 
ATOM   1369 C  CA    . GLY A 1 167 ? 17.719 -5.248  -21.536 1.00 18.65  ? 169 GLY A CA    1 
ATOM   1370 C  C     . GLY A 1 167 ? 16.395 -5.599  -22.179 1.00 18.29  ? 169 GLY A C     1 
ATOM   1371 O  O     . GLY A 1 167 ? 16.225 -6.710  -22.705 1.00 18.42  ? 169 GLY A O     1 
ATOM   1372 N  N     . PHE A 1 168 ? 15.471 -4.636  -22.137 1.00 17.88  ? 170 PHE A N     1 
ATOM   1373 C  CA    . PHE A 1 168 ? 14.094 -4.762  -22.632 1.00 17.90  ? 170 PHE A CA    1 
ATOM   1374 C  C     . PHE A 1 168 ? 13.957 -4.186  -24.053 1.00 18.14  ? 170 PHE A C     1 
ATOM   1375 O  O     . PHE A 1 168 ? 14.218 -2.995  -24.280 1.00 18.38  ? 170 PHE A O     1 
ATOM   1376 C  CB    . PHE A 1 168 ? 13.136 -3.962  -21.723 1.00 17.85  ? 170 PHE A CB    1 
ATOM   1377 C  CG    . PHE A 1 168 ? 13.007 -4.496  -20.300 1.00 18.12  ? 170 PHE A CG    1 
ATOM   1378 C  CD1   . PHE A 1 168 ? 14.068 -4.394  -19.385 1.00 17.75  ? 170 PHE A CD1   1 
ATOM   1379 C  CD2   . PHE A 1 168 ? 11.797 -5.033  -19.861 1.00 17.34  ? 170 PHE A CD2   1 
ATOM   1380 C  CE1   . PHE A 1 168 ? 13.943 -4.867  -18.069 1.00 17.72  ? 170 PHE A CE1   1 
ATOM   1381 C  CE2   . PHE A 1 168 ? 11.657 -5.526  -18.538 1.00 17.86  ? 170 PHE A CE2   1 
ATOM   1382 C  CZ    . PHE A 1 168 ? 12.735 -5.446  -17.648 1.00 18.22  ? 170 PHE A CZ    1 
ATOM   1383 N  N     . SER A 1 169 ? 13.524 -5.015  -25.002 1.00 17.82  ? 171 SER A N     1 
ATOM   1384 C  CA    . SER A 1 169 ? 13.265 -4.529  -26.355 1.00 17.87  ? 171 SER A CA    1 
ATOM   1385 C  C     . SER A 1 169 ? 12.011 -3.660  -26.397 1.00 17.70  ? 171 SER A C     1 
ATOM   1386 O  O     . SER A 1 169 ? 11.192 -3.685  -25.475 1.00 17.34  ? 171 SER A O     1 
ATOM   1387 C  CB    . SER A 1 169 ? 13.127 -5.694  -27.343 1.00 18.37  ? 171 SER A CB    1 
ATOM   1388 O  OG    . SER A 1 169 ? 12.000 -6.505  -27.050 1.00 17.23  ? 171 SER A OG    1 
ATOM   1389 N  N     . GLY A 1 170 ? 11.879 -2.880  -27.464 1.00 17.29  ? 172 GLY A N     1 
ATOM   1390 C  CA    . GLY A 1 170 ? 10.698 -2.084  -27.691 1.00 17.20  ? 172 GLY A CA    1 
ATOM   1391 C  C     . GLY A 1 170 ? 9.449  -2.937  -27.785 1.00 16.40  ? 172 GLY A C     1 
ATOM   1392 O  O     . GLY A 1 170 ? 8.426  -2.593  -27.213 1.00 15.97  ? 172 GLY A O     1 
ATOM   1393 N  N     . TYR A 1 171 ? 9.550  -4.064  -28.486 1.00 16.68  ? 173 TYR A N     1 
ATOM   1394 C  CA    . TYR A 1 171 ? 8.444  -5.016  -28.614 1.00 16.74  ? 173 TYR A CA    1 
ATOM   1395 C  C     . TYR A 1 171 ? 7.994  -5.613  -27.273 1.00 16.98  ? 173 TYR A C     1 
ATOM   1396 O  O     . TYR A 1 171 ? 6.784  -5.764  -27.018 1.00 17.19  ? 173 TYR A O     1 
ATOM   1397 C  CB    . TYR A 1 171 ? 8.828  -6.123  -29.592 1.00 16.92  ? 173 TYR A CB    1 
ATOM   1398 C  CG    . TYR A 1 171 ? 7.754  -7.175  -29.802 1.00 17.58  ? 173 TYR A CG    1 
ATOM   1399 C  CD1   . TYR A 1 171 ? 6.481  -6.824  -30.270 1.00 17.14  ? 173 TYR A CD1   1 
ATOM   1400 C  CD2   . TYR A 1 171 ? 8.025  -8.532  -29.572 1.00 17.06  ? 173 TYR A CD2   1 
ATOM   1401 C  CE1   . TYR A 1 171 ? 5.505  -7.795  -30.480 1.00 19.20  ? 173 TYR A CE1   1 
ATOM   1402 C  CE2   . TYR A 1 171 ? 7.057  -9.506  -29.785 1.00 16.73  ? 173 TYR A CE2   1 
ATOM   1403 C  CZ    . TYR A 1 171 ? 5.798  -9.136  -30.233 1.00 18.96  ? 173 TYR A CZ    1 
ATOM   1404 O  OH    . TYR A 1 171 ? 4.831  -10.100 -30.453 1.00 18.23  ? 173 TYR A OH    1 
ATOM   1405 N  N     . LEU A 1 172 ? 8.962  -5.958  -26.428 1.00 16.40  ? 174 LEU A N     1 
ATOM   1406 C  CA    . LEU A 1 172 ? 8.669  -6.395  -25.076 1.00 17.15  ? 174 LEU A CA    1 
ATOM   1407 C  C     . LEU A 1 172 ? 7.861  -5.330  -24.300 1.00 17.12  ? 174 LEU A C     1 
ATOM   1408 O  O     . LEU A 1 172 ? 6.897  -5.667  -23.610 1.00 17.20  ? 174 LEU A O     1 
ATOM   1409 C  CB    . LEU A 1 172 ? 9.959  -6.765  -24.322 1.00 16.83  ? 174 LEU A CB    1 
ATOM   1410 C  CG    . LEU A 1 172 ? 9.783  -7.181  -22.846 1.00 17.42  ? 174 LEU A CG    1 
ATOM   1411 C  CD1   . LEU A 1 172 ? 8.811  -8.343  -22.705 1.00 17.50  ? 174 LEU A CD1   1 
ATOM   1412 C  CD2   . LEU A 1 172 ? 11.114 -7.551  -22.226 1.00 17.87  ? 174 LEU A CD2   1 
ATOM   1413 N  N     . CYS A 1 173 ? 8.258  -4.062  -24.424 1.00 17.10  ? 175 CYS A N     1 
ATOM   1414 C  CA    . CYS A 1 173 ? 7.534  -2.956  -23.789 1.00 17.68  ? 175 CYS A CA    1 
ATOM   1415 C  C     . CYS A 1 173 ? 6.082  -2.897  -24.252 1.00 17.92  ? 175 CYS A C     1 
ATOM   1416 O  O     . CYS A 1 173 ? 5.172  -2.686  -23.446 1.00 18.26  ? 175 CYS A O     1 
ATOM   1417 C  CB    . CYS A 1 173 ? 8.210  -1.618  -24.079 1.00 17.98  ? 175 CYS A CB    1 
ATOM   1418 S  SG    . CYS A 1 173 ? 9.831  -1.441  -23.335 1.00 19.30  ? 175 CYS A SG    1 
ATOM   1419 N  N     . GLU A 1 174 ? 5.874  -3.082  -25.554 1.00 17.72  ? 176 GLU A N     1 
ATOM   1420 C  CA    . GLU A 1 174 ? 4.522  -3.083  -26.108 1.00 17.75  ? 176 GLU A CA    1 
ATOM   1421 C  C     . GLU A 1 174 ? 3.685  -4.243  -25.563 1.00 17.01  ? 176 GLU A C     1 
ATOM   1422 O  O     . GLU A 1 174 ? 2.512  -4.071  -25.221 1.00 17.17  ? 176 GLU A O     1 
ATOM   1423 C  CB    . GLU A 1 174 ? 4.568  -3.090  -27.636 1.00 17.08  ? 176 GLU A CB    1 
ATOM   1424 C  CG    . GLU A 1 174 ? 4.893  -1.719  -28.187 1.00 19.20  ? 176 GLU A CG    1 
ATOM   1425 C  CD    . GLU A 1 174 ? 5.216  -1.722  -29.660 1.00 20.00  ? 176 GLU A CD    1 
ATOM   1426 O  OE1   . GLU A 1 174 ? 4.633  -0.900  -30.396 1.00 19.77  ? 176 GLU A OE1   1 
ATOM   1427 O  OE2   . GLU A 1 174 ? 6.069  -2.523  -30.079 1.00 21.02  ? 176 GLU A OE2   1 
ATOM   1428 N  N     . LEU A 1 175 ? 4.295  -5.419  -25.484 1.00 16.43  ? 177 LEU A N     1 
ATOM   1429 C  CA    . LEU A 1 175 ? 3.620  -6.588  -24.926 1.00 16.83  ? 177 LEU A CA    1 
ATOM   1430 C  C     . LEU A 1 175 ? 3.209  -6.389  -23.466 1.00 16.97  ? 177 LEU A C     1 
ATOM   1431 O  O     . LEU A 1 175 ? 2.111  -6.792  -23.063 1.00 17.41  ? 177 LEU A O     1 
ATOM   1432 C  CB    . LEU A 1 175 ? 4.487  -7.848  -25.069 1.00 15.55  ? 177 LEU A CB    1 
ATOM   1433 C  CG    . LEU A 1 175 ? 4.723  -8.389  -26.482 1.00 15.59  ? 177 LEU A CG    1 
ATOM   1434 C  CD1   . LEU A 1 175 ? 5.506  -9.689  -26.346 1.00 14.58  ? 177 LEU A CD1   1 
ATOM   1435 C  CD2   . LEU A 1 175 ? 3.393  -8.612  -27.223 1.00 14.41  ? 177 LEU A CD2   1 
ATOM   1436 N  N     . LEU A 1 176 ? 4.093  -5.767  -22.689 1.00 17.74  ? 178 LEU A N     1 
ATOM   1437 C  CA    . LEU A 1 176 ? 3.815  -5.451  -21.274 1.00 18.39  ? 178 LEU A CA    1 
ATOM   1438 C  C     . LEU A 1 176 ? 2.672  -4.463  -21.101 1.00 19.21  ? 178 LEU A C     1 
ATOM   1439 O  O     . LEU A 1 176 ? 1.865  -4.605  -20.190 1.00 19.86  ? 178 LEU A O     1 
ATOM   1440 C  CB    . LEU A 1 176 ? 5.063  -4.932  -20.565 1.00 18.63  ? 178 LEU A CB    1 
ATOM   1441 C  CG    . LEU A 1 176 ? 6.234  -5.911  -20.396 1.00 18.14  ? 178 LEU A CG    1 
ATOM   1442 C  CD1   . LEU A 1 176 ? 7.487  -5.173  -19.952 1.00 17.94  ? 178 LEU A CD1   1 
ATOM   1443 C  CD2   . LEU A 1 176 ? 5.878  -7.062  -19.434 1.00 17.71  ? 178 LEU A CD2   1 
ATOM   1444 N  N     . ILE A 1 177 ? 2.615  -3.461  -21.964 1.00 19.27  ? 179 ILE A N     1 
ATOM   1445 C  CA    . ILE A 1 177 ? 1.498  -2.523  -21.962 1.00 20.32  ? 179 ILE A CA    1 
ATOM   1446 C  C     . ILE A 1 177 ? 0.167  -3.206  -22.308 1.00 20.72  ? 179 ILE A C     1 
ATOM   1447 O  O     . ILE A 1 177 ? -0.849 -2.937  -21.672 1.00 21.50  ? 179 ILE A O     1 
ATOM   1448 C  CB    . ILE A 1 177 ? 1.783  -1.273  -22.859 1.00 20.58  ? 179 ILE A CB    1 
ATOM   1449 C  CG1   . ILE A 1 177 ? 3.024  -0.514  -22.349 1.00 20.37  ? 179 ILE A CG1   1 
ATOM   1450 C  CG2   . ILE A 1 177 ? 0.560  -0.347  -22.943 1.00 20.22  ? 179 ILE A CG2   1 
ATOM   1451 C  CD1   . ILE A 1 177 ? 2.988  -0.115  -20.870 1.00 21.34  ? 179 ILE A CD1   1 
ATOM   1452 N  N     . VAL A 1 178 ? 0.173  -4.100  -23.294 1.00 20.89  ? 180 VAL A N     1 
ATOM   1453 C  CA    . VAL A 1 178 ? -1.020 -4.896  -23.601 1.00 21.70  ? 180 VAL A CA    1 
ATOM   1454 C  C     . VAL A 1 178 ? -1.413 -5.795  -22.407 1.00 21.84  ? 180 VAL A C     1 
ATOM   1455 O  O     . VAL A 1 178 ? -2.610 -5.954  -22.085 1.00 22.70  ? 180 VAL A O     1 
ATOM   1456 C  CB    . VAL A 1 178 ? -0.839 -5.745  -24.884 1.00 22.07  ? 180 VAL A CB    1 
ATOM   1457 C  CG1   . VAL A 1 178 ? -2.025 -6.708  -25.084 1.00 22.17  ? 180 VAL A CG1   1 
ATOM   1458 C  CG2   . VAL A 1 178 ? -0.643 -4.835  -26.132 1.00 21.57  ? 180 VAL A CG2   1 
ATOM   1459 N  N     . PHE A 1 179 ? -0.411 -6.360  -21.748 1.00 21.17  ? 181 PHE A N     1 
ATOM   1460 C  CA    . PHE A 1 179 ? -0.649 -7.247  -20.611 1.00 21.49  ? 181 PHE A CA    1 
ATOM   1461 C  C     . PHE A 1 179 ? -1.237 -6.495  -19.410 1.00 22.43  ? 181 PHE A C     1 
ATOM   1462 O  O     . PHE A 1 179 ? -2.268 -6.905  -18.884 1.00 22.96  ? 181 PHE A O     1 
ATOM   1463 C  CB    . PHE A 1 179 ? 0.615  -8.015  -20.211 1.00 20.96  ? 181 PHE A CB    1 
ATOM   1464 C  CG    . PHE A 1 179 ? 0.345  -9.178  -19.298 1.00 21.19  ? 181 PHE A CG    1 
ATOM   1465 C  CD1   . PHE A 1 179 ? -0.131 -10.380 -19.812 1.00 21.71  ? 181 PHE A CD1   1 
ATOM   1466 C  CD2   . PHE A 1 179 ? 0.540  -9.067  -17.929 1.00 21.42  ? 181 PHE A CD2   1 
ATOM   1467 C  CE1   . PHE A 1 179 ? -0.402 -11.458 -18.974 1.00 23.35  ? 181 PHE A CE1   1 
ATOM   1468 C  CE2   . PHE A 1 179 ? 0.275  -10.138 -17.078 1.00 23.05  ? 181 PHE A CE2   1 
ATOM   1469 C  CZ    . PHE A 1 179 ? -0.196 -11.341 -17.606 1.00 23.39  ? 181 PHE A CZ    1 
ATOM   1470 N  N     . TYR A 1 180 ? -0.602 -5.390  -19.014 1.00 22.32  ? 182 TYR A N     1 
ATOM   1471 C  CA    . TYR A 1 180 ? -0.956 -4.677  -17.778 1.00 23.09  ? 182 TYR A CA    1 
ATOM   1472 C  C     . TYR A 1 180 ? -1.920 -3.506  -17.951 1.00 23.69  ? 182 TYR A C     1 
ATOM   1473 O  O     . TYR A 1 180 ? -2.608 -3.132  -17.003 1.00 24.22  ? 182 TYR A O     1 
ATOM   1474 C  CB    . TYR A 1 180 ? 0.306  -4.221  -17.032 1.00 22.75  ? 182 TYR A CB    1 
ATOM   1475 C  CG    . TYR A 1 180 ? 1.098  -5.363  -16.450 1.00 23.15  ? 182 TYR A CG    1 
ATOM   1476 C  CD1   . TYR A 1 180 ? 0.566  -6.162  -15.425 1.00 23.72  ? 182 TYR A CD1   1 
ATOM   1477 C  CD2   . TYR A 1 180 ? 2.375  -5.659  -16.919 1.00 22.30  ? 182 TYR A CD2   1 
ATOM   1478 C  CE1   . TYR A 1 180 ? 1.283  -7.233  -14.896 1.00 23.23  ? 182 TYR A CE1   1 
ATOM   1479 C  CE2   . TYR A 1 180 ? 3.110  -6.719  -16.386 1.00 23.34  ? 182 TYR A CE2   1 
ATOM   1480 C  CZ    . TYR A 1 180 ? 2.559  -7.503  -15.375 1.00 23.18  ? 182 TYR A CZ    1 
ATOM   1481 O  OH    . TYR A 1 180 ? 3.284  -8.559  -14.857 1.00 24.67  ? 182 TYR A OH    1 
ATOM   1482 N  N     . GLY A 1 181 ? -1.951 -2.923  -19.150 1.00 23.54  ? 183 GLY A N     1 
ATOM   1483 C  CA    . GLY A 1 181 ? -2.893 -1.862  -19.484 1.00 24.17  ? 183 GLY A CA    1 
ATOM   1484 C  C     . GLY A 1 181 ? -2.295 -0.469  -19.546 1.00 24.24  ? 183 GLY A C     1 
ATOM   1485 O  O     . GLY A 1 181 ? -2.828 0.398   -20.239 1.00 24.91  ? 183 GLY A O     1 
ATOM   1486 N  N     . SER A 1 182 ? -1.196 -0.250  -18.817 1.00 23.49  ? 184 SER A N     1 
ATOM   1487 C  CA    . SER A 1 182 ? -0.608 1.087   -18.645 1.00 23.12  ? 184 SER A CA    1 
ATOM   1488 C  C     . SER A 1 182 ? 0.788  0.962   -18.050 1.00 22.31  ? 184 SER A C     1 
ATOM   1489 O  O     . SER A 1 182 ? 1.144  -0.104  -17.564 1.00 21.87  ? 184 SER A O     1 
ATOM   1490 C  CB    . SER A 1 182 ? -1.473 1.943   -17.711 1.00 24.14  ? 184 SER A CB    1 
ATOM   1491 O  OG    . SER A 1 182 ? -1.354 1.501   -16.372 1.00 22.52  ? 184 SER A OG    1 
ATOM   1492 N  N     . PHE A 1 183 ? 1.560  2.052   -18.087 1.00 22.16  ? 185 PHE A N     1 
ATOM   1493 C  CA    . PHE A 1 183 ? 2.913  2.088   -17.504 1.00 21.97  ? 185 PHE A CA    1 
ATOM   1494 C  C     . PHE A 1 183 ? 2.860  1.846   -15.996 1.00 22.65  ? 185 PHE A C     1 
ATOM   1495 O  O     . PHE A 1 183 ? 3.636  1.066   -15.446 1.00 21.83  ? 185 PHE A O     1 
ATOM   1496 C  CB    . PHE A 1 183 ? 3.579  3.436   -17.802 1.00 22.05  ? 185 PHE A CB    1 
ATOM   1497 C  CG    . PHE A 1 183 ? 4.826  3.701   -17.003 1.00 22.49  ? 185 PHE A CG    1 
ATOM   1498 C  CD1   . PHE A 1 183 ? 4.783  4.519   -15.865 1.00 23.91  ? 185 PHE A CD1   1 
ATOM   1499 C  CD2   . PHE A 1 183 ? 6.048  3.164   -17.397 1.00 21.58  ? 185 PHE A CD2   1 
ATOM   1500 C  CE1   . PHE A 1 183 ? 5.935  4.765   -15.126 1.00 23.96  ? 185 PHE A CE1   1 
ATOM   1501 C  CE2   . PHE A 1 183 ? 7.208  3.405   -16.668 1.00 20.57  ? 185 PHE A CE2   1 
ATOM   1502 C  CZ    . PHE A 1 183 ? 7.157  4.214   -15.533 1.00 21.37  ? 185 PHE A CZ    1 
ATOM   1503 N  N     . LEU A 1 184 ? 1.917  2.517   -15.345 1.00 23.91  ? 186 LEU A N     1 
ATOM   1504 C  CA    . LEU A 1 184 ? 1.793  2.487   -13.895 1.00 24.80  ? 186 LEU A CA    1 
ATOM   1505 C  C     . LEU A 1 184 ? 1.479  1.081   -13.392 1.00 24.72  ? 186 LEU A C     1 
ATOM   1506 O  O     . LEU A 1 184 ? 2.109  0.592   -12.449 1.00 24.91  ? 186 LEU A O     1 
ATOM   1507 C  CB    . LEU A 1 184 ? 0.726  3.501   -13.441 1.00 25.67  ? 186 LEU A CB    1 
ATOM   1508 C  CG    . LEU A 1 184 ? 0.616  3.800   -11.943 1.00 26.74  ? 186 LEU A CG    1 
ATOM   1509 C  CD1   . LEU A 1 184 ? 1.894  4.424   -11.384 1.00 26.75  ? 186 LEU A CD1   1 
ATOM   1510 C  CD2   . LEU A 1 184 ? -0.591 4.686   -11.658 1.00 28.17  ? 186 LEU A CD2   1 
ATOM   1511 N  N     . GLU A 1 185 ? 0.511  0.432   -14.026 1.00 25.09  ? 187 GLU A N     1 
ATOM   1512 C  CA    . GLU A 1 185 ? 0.193  -0.964  -13.725 1.00 25.44  ? 187 GLU A CA    1 
ATOM   1513 C  C     . GLU A 1 185 ? 1.356  -1.913  -13.969 1.00 24.02  ? 187 GLU A C     1 
ATOM   1514 O  O     . GLU A 1 185 ? 1.561  -2.847  -13.198 1.00 23.85  ? 187 GLU A O     1 
ATOM   1515 C  CB    . GLU A 1 185 ? -1.029 -1.428  -14.510 1.00 26.12  ? 187 GLU A CB    1 
ATOM   1516 C  CG    . GLU A 1 185 ? -2.325 -1.020  -13.864 1.00 29.64  ? 187 GLU A CG    1 
ATOM   1517 C  CD    . GLU A 1 185 ? -2.549 -1.687  -12.516 1.00 33.21  ? 187 GLU A CD    1 
ATOM   1518 O  OE1   . GLU A 1 185 ? -2.732 -2.929  -12.472 1.00 34.34  ? 187 GLU A OE1   1 
ATOM   1519 O  OE2   . GLU A 1 185 ? -2.551 -0.957  -11.504 1.00 34.30  ? 187 GLU A OE2   1 
ATOM   1520 N  N     . THR A 1 186 ? 2.110  -1.676  -15.039 1.00 23.38  ? 188 THR A N     1 
ATOM   1521 C  CA    . THR A 1 186 ? 3.291  -2.477  -15.330 1.00 22.18  ? 188 THR A CA    1 
ATOM   1522 C  C     . THR A 1 186 ? 4.272  -2.325  -14.178 1.00 22.47  ? 188 THR A C     1 
ATOM   1523 O  O     . THR A 1 186 ? 4.748  -3.323  -13.629 1.00 22.16  ? 188 THR A O     1 
ATOM   1524 C  CB    . THR A 1 186 ? 3.971  -2.056  -16.650 1.00 21.81  ? 188 THR A CB    1 
ATOM   1525 O  OG1   . THR A 1 186 ? 3.025  -2.149  -17.723 1.00 20.59  ? 188 THR A OG1   1 
ATOM   1526 C  CG2   . THR A 1 186 ? 5.184  -2.940  -16.942 1.00 20.20  ? 188 THR A CG2   1 
ATOM   1527 N  N     . VAL A 1 187 ? 4.556  -1.074  -13.818 1.00 22.51  ? 189 VAL A N     1 
ATOM   1528 C  CA    . VAL A 1 187 ? 5.514  -0.767  -12.760 1.00 23.13  ? 189 VAL A CA    1 
ATOM   1529 C  C     . VAL A 1 187 ? 5.082  -1.330  -11.400 1.00 23.45  ? 189 VAL A C     1 
ATOM   1530 O  O     . VAL A 1 187 ? 5.900  -1.891  -10.685 1.00 23.57  ? 189 VAL A O     1 
ATOM   1531 C  CB    . VAL A 1 187 ? 5.818  0.746   -12.728 1.00 23.78  ? 189 VAL A CB    1 
ATOM   1532 C  CG1   . VAL A 1 187 ? 6.495  1.155   -11.434 1.00 25.59  ? 189 VAL A CG1   1 
ATOM   1533 C  CG2   . VAL A 1 187 ? 6.685  1.135   -13.953 1.00 23.00  ? 189 VAL A CG2   1 
ATOM   1534 N  N     . LYS A 1 188 ? 3.798  -1.211  -11.069 1.00 23.87  ? 190 LYS A N     1 
ATOM   1535 C  CA    . LYS A 1 188 ? 3.247  -1.762  -9.824  1.00 24.86  ? 190 LYS A CA    1 
ATOM   1536 C  C     . LYS A 1 188 ? 3.398  -3.287  -9.732  1.00 24.12  ? 190 LYS A C     1 
ATOM   1537 O  O     . LYS A 1 188 ? 3.814  -3.817  -8.703  1.00 24.29  ? 190 LYS A O     1 
ATOM   1538 C  CB    . LYS A 1 188 ? 1.771  -1.352  -9.653  1.00 26.19  ? 190 LYS A CB    1 
ATOM   1539 C  CG    . LYS A 1 188 ? 1.589  0.055   -9.070  1.00 28.18  ? 190 LYS A CG    1 
ATOM   1540 C  CD    . LYS A 1 188 ? 0.376  0.777   -9.623  1.00 32.50  ? 190 LYS A CD    1 
ATOM   1541 C  CE    . LYS A 1 188 ? -0.847 0.630   -8.734  1.00 36.30  ? 190 LYS A CE    1 
ATOM   1542 N  NZ    . LYS A 1 188 ? -1.776 1.797   -8.905  1.00 38.72  ? 190 LYS A NZ    1 
ATOM   1543 N  N     . ASN A 1 189 ? 3.070  -3.981  -10.815 1.00 23.13  ? 191 ASN A N     1 
ATOM   1544 C  CA    . ASN A 1 189 ? 3.158  -5.440  -10.841 1.00 22.66  ? 191 ASN A CA    1 
ATOM   1545 C  C     . ASN A 1 189 ? 4.590  -5.983  -10.943 1.00 22.05  ? 191 ASN A C     1 
ATOM   1546 O  O     . ASN A 1 189 ? 4.905  -7.007  -10.344 1.00 21.84  ? 191 ASN A O     1 
ATOM   1547 C  CB    . ASN A 1 189 ? 2.259  -5.995  -11.945 1.00 22.66  ? 191 ASN A CB    1 
ATOM   1548 C  CG    . ASN A 1 189 ? 0.785  -5.945  -11.565 1.00 23.47  ? 191 ASN A CG    1 
ATOM   1549 O  OD1   . ASN A 1 189 ? 0.295  -6.802  -10.832 1.00 23.89  ? 191 ASN A OD1   1 
ATOM   1550 N  ND2   . ASN A 1 189 ? 0.083  -4.927  -12.044 1.00 22.11  ? 191 ASN A ND2   1 
ATOM   1551 N  N     . ALA A 1 190 ? 5.452  -5.276  -11.672 1.00 21.46  ? 192 ALA A N     1 
ATOM   1552 C  CA    . ALA A 1 190 ? 6.861  -5.676  -11.830 1.00 21.67  ? 192 ALA A CA    1 
ATOM   1553 C  C     . ALA A 1 190 ? 7.616  -5.735  -10.499 1.00 22.56  ? 192 ALA A C     1 
ATOM   1554 O  O     . ALA A 1 190 ? 8.604  -6.467  -10.370 1.00 22.45  ? 192 ALA A O     1 
ATOM   1555 C  CB    . ALA A 1 190 ? 7.574  -4.757  -12.810 1.00 21.03  ? 192 ALA A CB    1 
ATOM   1556 N  N     . ARG A 1 191 ? 7.135  -4.982  -9.509  1.00 23.80  ? 193 ARG A N     1 
ATOM   1557 C  CA    . ARG A 1 191 ? 7.681  -5.035  -8.151  1.00 25.18  ? 193 ARG A CA    1 
ATOM   1558 C  C     . ARG A 1 191 ? 7.649  -6.449  -7.572  1.00 25.92  ? 193 ARG A C     1 
ATOM   1559 O  O     . ARG A 1 191 ? 8.444  -6.782  -6.685  1.00 26.77  ? 193 ARG A O     1 
ATOM   1560 C  CB    . ARG A 1 191 ? 6.896  -4.101  -7.226  1.00 25.86  ? 193 ARG A CB    1 
ATOM   1561 C  CG    . ARG A 1 191 ? 7.080  -2.625  -7.514  1.00 25.56  ? 193 ARG A CG    1 
ATOM   1562 C  CD    . ARG A 1 191 ? 6.352  -1.765  -6.476  1.00 27.51  ? 193 ARG A CD    1 
ATOM   1563 N  NE    . ARG A 1 191 ? 4.898  -1.946  -6.549  1.00 29.24  ? 193 ARG A NE    1 
ATOM   1564 C  CZ    . ARG A 1 191 ? 4.007  -1.286  -5.815  1.00 31.05  ? 193 ARG A CZ    1 
ATOM   1565 N  NH1   . ARG A 1 191 ? 4.396  -0.359  -4.940  1.00 32.11  ? 193 ARG A NH1   1 
ATOM   1566 N  NH2   . ARG A 1 191 ? 2.716  -1.543  -5.968  1.00 30.57  ? 193 ARG A NH2   1 
ATOM   1567 N  N     . ARG A 1 192 ? 6.717  -7.271  -8.064  1.00 26.53  ? 194 ARG A N     1 
ATOM   1568 C  CA    . ARG A 1 192 ? 6.533  -8.639  -7.561  1.00 27.21  ? 194 ARG A CA    1 
ATOM   1569 C  C     . ARG A 1 192 ? 7.012  -9.718  -8.547  1.00 25.84  ? 194 ARG A C     1 
ATOM   1570 O  O     . ARG A 1 192 ? 6.765  -10.905 -8.342  1.00 26.08  ? 194 ARG A O     1 
ATOM   1571 C  CB    . ARG A 1 192 ? 5.074  -8.863  -7.148  1.00 27.72  ? 194 ARG A CB    1 
ATOM   1572 C  CG    . ARG A 1 192 ? 4.679  -8.103  -5.866  1.00 30.71  ? 194 ARG A CG    1 
ATOM   1573 C  CD    . ARG A 1 192 ? 3.185  -8.269  -5.530  1.00 32.23  ? 194 ARG A CD    1 
ATOM   1574 N  NE    . ARG A 1 192 ? 2.394  -8.462  -6.745  1.00 39.09  ? 194 ARG A NE    1 
ATOM   1575 C  CZ    . ARG A 1 192 ? 1.783  -7.494  -7.429  1.00 41.09  ? 194 ARG A CZ    1 
ATOM   1576 N  NH1   . ARG A 1 192 ? 1.834  -6.225  -7.019  1.00 42.24  ? 194 ARG A NH1   1 
ATOM   1577 N  NH2   . ARG A 1 192 ? 1.103  -7.809  -8.527  1.00 41.78  ? 194 ARG A NH2   1 
ATOM   1578 N  N     . TRP A 1 193 ? 7.700  -9.304  -9.611  1.00 24.75  ? 195 TRP A N     1 
ATOM   1579 C  CA    . TRP A 1 193 ? 8.336  -10.252 -10.521 1.00 23.92  ? 195 TRP A CA    1 
ATOM   1580 C  C     . TRP A 1 193 ? 9.489  -10.968 -9.838  1.00 24.11  ? 195 TRP A C     1 
ATOM   1581 O  O     . TRP A 1 193 ? 10.198 -10.393 -9.018  1.00 24.55  ? 195 TRP A O     1 
ATOM   1582 C  CB    . TRP A 1 193 ? 8.901  -9.564  -11.758 1.00 22.79  ? 195 TRP A CB    1 
ATOM   1583 C  CG    . TRP A 1 193 ? 7.919  -9.028  -12.764 1.00 22.00  ? 195 TRP A CG    1 
ATOM   1584 C  CD1   . TRP A 1 193 ? 6.561  -9.189  -12.785 1.00 21.70  ? 195 TRP A CD1   1 
ATOM   1585 C  CD2   . TRP A 1 193 ? 8.251  -8.273  -13.936 1.00 21.61  ? 195 TRP A CD2   1 
ATOM   1586 N  NE1   . TRP A 1 193 ? 6.027  -8.553  -13.880 1.00 21.18  ? 195 TRP A NE1   1 
ATOM   1587 C  CE2   . TRP A 1 193 ? 7.043  -7.988  -14.607 1.00 21.18  ? 195 TRP A CE2   1 
ATOM   1588 C  CE3   . TRP A 1 193 ? 9.456  -7.795  -14.474 1.00 20.97  ? 195 TRP A CE3   1 
ATOM   1589 C  CZ2   . TRP A 1 193 ? 7.005  -7.245  -15.793 1.00 21.00  ? 195 TRP A CZ2   1 
ATOM   1590 C  CZ3   . TRP A 1 193 ? 9.417  -7.059  -15.656 1.00 20.00  ? 195 TRP A CZ3   1 
ATOM   1591 C  CH2   . TRP A 1 193 ? 8.199  -6.790  -16.299 1.00 20.81  ? 195 TRP A CH2   1 
ATOM   1592 N  N     . THR A 1 194 ? 9.668  -12.231 -10.195 1.00 24.01  ? 196 THR A N     1 
ATOM   1593 C  CA    . THR A 1 194 ? 10.778 -13.032 -9.710  1.00 24.21  ? 196 THR A CA    1 
ATOM   1594 C  C     . THR A 1 194 ? 11.582 -13.493 -10.926 1.00 23.93  ? 196 THR A C     1 
ATOM   1595 O  O     . THR A 1 194 ? 11.177 -13.261 -12.072 1.00 23.27  ? 196 THR A O     1 
ATOM   1596 C  CB    . THR A 1 194 ? 10.288 -14.264 -8.897  1.00 25.12  ? 196 THR A CB    1 
ATOM   1597 O  OG1   . THR A 1 194 ? 9.814  -15.288 -9.777  1.00 24.48  ? 196 THR A OG1   1 
ATOM   1598 C  CG2   . THR A 1 194 ? 9.165  -13.889 -7.936  1.00 25.23  ? 196 THR A CG2   1 
ATOM   1599 N  N     . ARG A 1 195 ? 12.700 -14.168 -10.665 1.00 24.07  ? 197 ARG A N     1 
ATOM   1600 C  CA    . ARG A 1 195 ? 13.525 -14.754 -11.711 1.00 23.49  ? 197 ARG A CA    1 
ATOM   1601 C  C     . ARG A 1 195 ? 12.860 -15.958 -12.380 1.00 23.80  ? 197 ARG A C     1 
ATOM   1602 O  O     . ARG A 1 195 ? 13.423 -16.533 -13.304 1.00 23.67  ? 197 ARG A O     1 
ATOM   1603 C  CB    . ARG A 1 195 ? 14.913 -15.126 -11.159 1.00 24.00  ? 197 ARG A CB    1 
ATOM   1604 C  CG    . ARG A 1 195 ? 14.956 -16.339 -10.212 1.00 24.37  ? 197 ARG A CG    1 
ATOM   1605 C  CD    . ARG A 1 195 ? 16.258 -16.395 -9.454  1.00 25.30  ? 197 ARG A CD    1 
ATOM   1606 N  NE    . ARG A 1 195 ? 16.427 -15.253 -8.549  1.00 23.46  ? 197 ARG A NE    1 
ATOM   1607 C  CZ    . ARG A 1 195 ? 17.584 -14.893 -7.997  1.00 24.66  ? 197 ARG A CZ    1 
ATOM   1608 N  NH1   . ARG A 1 195 ? 18.692 -15.571 -8.272  1.00 23.72  ? 197 ARG A NH1   1 
ATOM   1609 N  NH2   . ARG A 1 195 ? 17.643 -13.835 -7.193  1.00 23.59  ? 197 ARG A NH2   1 
ATOM   1610 N  N     . ARG A 1 196 ? 11.665 -16.322 -11.912 1.00 24.10  ? 198 ARG A N     1 
ATOM   1611 C  CA    . ARG A 1 196 ? 10.904 -17.455 -12.468 1.00 25.10  ? 198 ARG A CA    1 
ATOM   1612 C  C     . ARG A 1 196 ? 9.529  -17.041 -13.029 1.00 23.62  ? 198 ARG A C     1 
ATOM   1613 O  O     . ARG A 1 196 ? 8.716  -17.886 -13.365 1.00 23.65  ? 198 ARG A O     1 
ATOM   1614 C  CB    . ARG A 1 196 ? 10.715 -18.560 -11.422 1.00 26.24  ? 198 ARG A CB    1 
ATOM   1615 C  CG    . ARG A 1 196 ? 11.858 -18.732 -10.418 1.00 31.37  ? 198 ARG A CG    1 
ATOM   1616 C  CD    . ARG A 1 196 ? 13.045 -19.469 -10.992 1.00 37.03  ? 198 ARG A CD    1 
ATOM   1617 N  NE    . ARG A 1 196 ? 12.992 -20.903 -10.702 1.00 42.15  ? 198 ARG A NE    1 
ATOM   1618 C  CZ    . ARG A 1 196 ? 13.978 -21.761 -10.970 1.00 44.54  ? 198 ARG A CZ    1 
ATOM   1619 N  NH1   . ARG A 1 196 ? 15.103 -21.329 -11.538 1.00 44.45  ? 198 ARG A NH1   1 
ATOM   1620 N  NH2   . ARG A 1 196 ? 13.843 -23.051 -10.674 1.00 45.37  ? 198 ARG A NH2   1 
ATOM   1621 N  N     . THR A 1 197 ? 9.293  -15.737 -13.129 1.00 22.43  ? 199 THR A N     1 
ATOM   1622 C  CA    . THR A 1 197 ? 8.043  -15.193 -13.655 1.00 21.67  ? 199 THR A CA    1 
ATOM   1623 C  C     . THR A 1 197 ? 7.871  -15.477 -15.154 1.00 21.44  ? 199 THR A C     1 
ATOM   1624 O  O     . THR A 1 197 ? 8.743  -15.143 -15.973 1.00 21.27  ? 199 THR A O     1 
ATOM   1625 C  CB    . THR A 1 197 ? 7.946  -13.677 -13.354 1.00 21.00  ? 199 THR A CB    1 
ATOM   1626 O  OG1   . THR A 1 197 ? 7.908  -13.501 -11.933 1.00 22.47  ? 199 THR A OG1   1 
ATOM   1627 C  CG2   . THR A 1 197 ? 6.691  -13.055 -13.957 1.00 19.60  ? 199 THR A CG2   1 
ATOM   1628 N  N     . VAL A 1 198 ? 6.758  -16.123 -15.499 1.00 21.40  ? 200 VAL A N     1 
ATOM   1629 C  CA    . VAL A 1 198 ? 6.392  -16.312 -16.898 1.00 20.67  ? 200 VAL A CA    1 
ATOM   1630 C  C     . VAL A 1 198 ? 5.172  -15.438 -17.193 1.00 20.53  ? 200 VAL A C     1 
ATOM   1631 O  O     . VAL A 1 198 ? 4.127  -15.577 -16.558 1.00 20.50  ? 200 VAL A O     1 
ATOM   1632 C  CB    . VAL A 1 198 ? 6.105  -17.808 -17.256 1.00 21.76  ? 200 VAL A CB    1 
ATOM   1633 C  CG1   . VAL A 1 198 ? 5.671  -17.952 -18.714 1.00 20.81  ? 200 VAL A CG1   1 
ATOM   1634 C  CG2   . VAL A 1 198 ? 7.319  -18.704 -16.972 1.00 21.62  ? 200 VAL A CG2   1 
ATOM   1635 N  N     . ILE A 1 199 ? 5.322  -14.521 -18.145 1.00 19.74  ? 201 ILE A N     1 
ATOM   1636 C  CA    . ILE A 1 199 ? 4.207  -13.678 -18.618 1.00 19.50  ? 201 ILE A CA    1 
ATOM   1637 C  C     . ILE A 1 199 ? 3.767  -14.141 -20.012 1.00 20.03  ? 201 ILE A C     1 
ATOM   1638 O  O     . ILE A 1 199 ? 4.554  -14.106 -20.965 1.00 19.28  ? 201 ILE A O     1 
ATOM   1639 C  CB    . ILE A 1 199 ? 4.586  -12.170 -18.658 1.00 18.63  ? 201 ILE A CB    1 
ATOM   1640 C  CG1   . ILE A 1 199 ? 5.013  -11.682 -17.264 1.00 17.86  ? 201 ILE A CG1   1 
ATOM   1641 C  CG2   . ILE A 1 199 ? 3.415  -11.329 -19.214 1.00 18.76  ? 201 ILE A CG2   1 
ATOM   1642 C  CD1   . ILE A 1 199 ? 5.644  -10.296 -17.275 1.00 17.98  ? 201 ILE A CD1   1 
ATOM   1643 N  N     . ASP A 1 200 ? 2.510  -14.575 -20.116 1.00 20.69  ? 202 ASP A N     1 
ATOM   1644 C  CA    . ASP A 1 200 ? 1.953  -15.108 -21.363 1.00 21.32  ? 202 ASP A CA    1 
ATOM   1645 C  C     . ASP A 1 200 ? 0.782  -14.227 -21.809 1.00 22.00  ? 202 ASP A C     1 
ATOM   1646 O  O     . ASP A 1 200 ? -0.382 -14.487 -21.451 1.00 21.66  ? 202 ASP A O     1 
ATOM   1647 C  CB    . ASP A 1 200 ? 1.518  -16.570 -21.137 1.00 22.32  ? 202 ASP A CB    1 
ATOM   1648 C  CG    . ASP A 1 200 ? 1.160  -17.306 -22.425 1.00 22.72  ? 202 ASP A CG    1 
ATOM   1649 O  OD1   . ASP A 1 200 ? 0.955  -16.668 -23.476 1.00 22.57  ? 202 ASP A OD1   1 
ATOM   1650 O  OD2   . ASP A 1 200 ? 1.067  -18.557 -22.371 1.00 24.39  ? 202 ASP A OD2   1 
ATOM   1651 N  N     . VAL A 1 201 ? 1.105  -13.177 -22.580 1.00 21.58  ? 203 VAL A N     1 
ATOM   1652 C  CA    . VAL A 1 201 ? 0.122  -12.183 -23.026 1.00 22.31  ? 203 VAL A CA    1 
ATOM   1653 C  C     . VAL A 1 201 ? -1.062 -12.823 -23.771 1.00 22.85  ? 203 VAL A C     1 
ATOM   1654 O  O     . VAL A 1 201 ? -2.214 -12.525 -23.464 1.00 22.73  ? 203 VAL A O     1 
ATOM   1655 C  CB    . VAL A 1 201 ? 0.756  -11.045 -23.898 1.00 22.12  ? 203 VAL A CB    1 
ATOM   1656 C  CG1   . VAL A 1 201 ? -0.083 -9.770  -23.795 1.00 23.83  ? 203 VAL A CG1   1 
ATOM   1657 C  CG2   . VAL A 1 201 ? 2.185  -10.725 -23.446 1.00 24.27  ? 203 VAL A CG2   1 
ATOM   1658 N  N     . ALA A 1 202 ? -0.780 -13.707 -24.731 1.00 22.92  ? 204 ALA A N     1 
ATOM   1659 C  CA    . ALA A 1 202 ? -1.844 -14.370 -25.505 1.00 23.90  ? 204 ALA A CA    1 
ATOM   1660 C  C     . ALA A 1 202 ? -2.871 -15.111 -24.641 1.00 24.61  ? 204 ALA A C     1 
ATOM   1661 O  O     . ALA A 1 202 ? -4.054 -15.182 -25.002 1.00 25.74  ? 204 ALA A O     1 
ATOM   1662 C  CB    . ALA A 1 202 ? -1.246 -15.329 -26.546 1.00 24.20  ? 204 ALA A CB    1 
ATOM   1663 N  N     . LYS A 1 203 ? -2.418 -15.662 -23.513 1.00 24.16  ? 205 LYS A N     1 
ATOM   1664 C  CA    . LYS A 1 203 ? -3.278 -16.419 -22.611 1.00 24.78  ? 205 LYS A CA    1 
ATOM   1665 C  C     . LYS A 1 203 ? -3.794 -15.587 -21.440 1.00 24.09  ? 205 LYS A C     1 
ATOM   1666 O  O     . LYS A 1 203 ? -4.600 -16.062 -20.647 1.00 24.20  ? 205 LYS A O     1 
ATOM   1667 C  CB    . LYS A 1 203 ? -2.557 -17.663 -22.088 1.00 25.48  ? 205 LYS A CB    1 
ATOM   1668 C  CG    . LYS A 1 203 ? -2.424 -18.769 -23.126 1.00 28.39  ? 205 LYS A CG    1 
ATOM   1669 C  CD    . LYS A 1 203 ? -2.040 -20.096 -22.488 1.00 31.71  ? 205 LYS A CD    1 
ATOM   1670 C  CE    . LYS A 1 203 ? -1.885 -21.164 -23.564 1.00 35.50  ? 205 LYS A CE    1 
ATOM   1671 N  NZ    . LYS A 1 203 ? -2.145 -22.548 -23.038 1.00 39.47  ? 205 LYS A NZ    1 
ATOM   1672 N  N     . GLY A 1 204 ? -3.326 -14.349 -21.345 1.00 23.12  ? 206 GLY A N     1 
ATOM   1673 C  CA    . GLY A 1 204 ? -3.719 -13.438 -20.274 1.00 23.79  ? 206 GLY A CA    1 
ATOM   1674 C  C     . GLY A 1 204 ? -3.306 -13.904 -18.889 1.00 24.38  ? 206 GLY A C     1 
ATOM   1675 O  O     . GLY A 1 204 ? -4.036 -13.706 -17.915 1.00 24.77  ? 206 GLY A O     1 
ATOM   1676 N  N     . GLU A 1 205 ? -2.111 -14.479 -18.795 1.00 24.26  ? 207 GLU A N     1 
ATOM   1677 C  CA    . GLU A 1 205 ? -1.732 -15.272 -17.633 1.00 25.95  ? 207 GLU A CA    1 
ATOM   1678 C  C     . GLU A 1 205 ? -0.289 -15.050 -17.183 1.00 25.71  ? 207 GLU A C     1 
ATOM   1679 O  O     . GLU A 1 205 ? 0.603  -14.845 -18.007 1.00 24.31  ? 207 GLU A O     1 
ATOM   1680 C  CB    . GLU A 1 205 ? -1.965 -16.750 -17.959 1.00 26.63  ? 207 GLU A CB    1 
ATOM   1681 C  CG    . GLU A 1 205 ? -1.315 -17.728 -17.037 1.00 28.51  ? 207 GLU A CG    1 
ATOM   1682 C  CD    . GLU A 1 205 ? -1.748 -19.138 -17.322 1.00 31.80  ? 207 GLU A CD    1 
ATOM   1683 O  OE1   . GLU A 1 205 ? -0.934 -19.906 -17.876 1.00 32.82  ? 207 GLU A OE1   1 
ATOM   1684 O  OE2   . GLU A 1 205 ? -2.907 -19.470 -17.001 1.00 33.30  ? 207 GLU A OE2   1 
ATOM   1685 N  N     . VAL A 1 206 ? -0.091 -15.089 -15.866 1.00 26.95  ? 208 VAL A N     1 
ATOM   1686 C  CA    . VAL A 1 206 ? 1.242  -15.128 -15.254 1.00 27.81  ? 208 VAL A CA    1 
ATOM   1687 C  C     . VAL A 1 206 ? 1.371  -16.447 -14.504 1.00 28.77  ? 208 VAL A C     1 
ATOM   1688 O  O     . VAL A 1 206 ? 0.507  -16.801 -13.702 1.00 29.93  ? 208 VAL A O     1 
ATOM   1689 C  CB    . VAL A 1 206 ? 1.507  -13.944 -14.264 1.00 27.45  ? 208 VAL A CB    1 
ATOM   1690 C  CG1   . VAL A 1 206 ? 2.863  -14.094 -13.564 1.00 27.71  ? 208 VAL A CG1   1 
ATOM   1691 C  CG2   . VAL A 1 206 ? 1.463  -12.620 -14.976 1.00 27.83  ? 208 VAL A CG2   1 
ATOM   1692 N  N     . ARG A 1 207 ? 2.444  -17.177 -14.788 1.00 29.39  ? 209 ARG A N     1 
ATOM   1693 C  CA    . ARG A 1 207 ? 2.743  -18.420 -14.085 1.00 30.90  ? 209 ARG A CA    1 
ATOM   1694 C  C     . ARG A 1 207 ? 4.208  -18.448 -13.639 1.00 30.94  ? 209 ARG A C     1 
ATOM   1695 O  O     . ARG A 1 207 ? 4.917  -17.447 -13.736 1.00 29.89  ? 209 ARG A O     1 
ATOM   1696 C  CB    . ARG A 1 207 ? 2.373  -19.647 -14.938 1.00 31.36  ? 209 ARG A CB    1 
ATOM   1697 C  CG    . ARG A 1 207 ? 2.961  -19.662 -16.328 1.00 31.51  ? 209 ARG A CG    1 
ATOM   1698 C  CD    . ARG A 1 207 ? 2.508  -20.869 -17.146 1.00 32.36  ? 209 ARG A CD    1 
ATOM   1699 N  NE    . ARG A 1 207 ? 3.067  -20.817 -18.502 1.00 33.59  ? 209 ARG A NE    1 
ATOM   1700 C  CZ    . ARG A 1 207 ? 2.462  -20.253 -19.552 1.00 34.85  ? 209 ARG A CZ    1 
ATOM   1701 N  NH1   . ARG A 1 207 ? 1.259  -19.704 -19.431 1.00 34.84  ? 209 ARG A NH1   1 
ATOM   1702 N  NH2   . ARG A 1 207 ? 3.058  -20.238 -20.736 1.00 34.57  ? 209 ARG A NH2   1 
ATOM   1703 N  N     . LYS A 1 208 ? 4.635  -19.592 -13.117 1.00 32.72  ? 210 LYS A N     1 
ATOM   1704 C  CA    . LYS A 1 208 ? 5.998  -19.779 -12.645 1.00 33.41  ? 210 LYS A CA    1 
ATOM   1705 C  C     . LYS A 1 208 ? 6.709  -20.748 -13.581 1.00 33.46  ? 210 LYS A C     1 
ATOM   1706 O  O     . LYS A 1 208 ? 6.138  -21.751 -14.001 1.00 34.69  ? 210 LYS A O     1 
ATOM   1707 C  CB    . LYS A 1 208 ? 5.978  -20.298 -11.204 1.00 34.72  ? 210 LYS A CB    1 
ATOM   1708 C  CG    . LYS A 1 208 ? 7.330  -20.301 -10.487 1.00 37.38  ? 210 LYS A CG    1 
ATOM   1709 C  CD    . LYS A 1 208 ? 7.983  -21.692 -10.503 1.00 41.67  ? 210 LYS A CD    1 
ATOM   1710 C  CE    . LYS A 1 208 ? 9.369  -21.657 -9.869  1.00 44.29  ? 210 LYS A CE    1 
ATOM   1711 N  NZ    . LYS A 1 208 ? 10.045 -22.982 -9.863  1.00 46.33  ? 210 LYS A NZ    1 
ATOM   1712 N  N     . GLY A 1 209 ? 7.951  -20.442 -13.922 1.00 32.85  ? 211 GLY A N     1 
ATOM   1713 C  CA    . GLY A 1 209 ? 8.730  -21.319 -14.789 1.00 33.21  ? 211 GLY A CA    1 
ATOM   1714 C  C     . GLY A 1 209 ? 10.123 -21.576 -14.261 1.00 33.41  ? 211 GLY A C     1 
ATOM   1715 O  O     . GLY A 1 209 ? 10.393 -21.390 -13.079 1.00 33.72  ? 211 GLY A O     1 
ATOM   1716 N  N     . GLU A 1 210 ? 11.005 -22.011 -15.153 1.00 33.58  ? 212 GLU A N     1 
ATOM   1717 C  CA    . GLU A 1 210 ? 12.407 -22.242 -14.818 1.00 34.13  ? 212 GLU A CA    1 
ATOM   1718 C  C     . GLU A 1 210 ? 13.190 -20.951 -14.916 1.00 32.31  ? 212 GLU A C     1 
ATOM   1719 O  O     . GLU A 1 210 ? 14.262 -20.821 -14.337 1.00 32.46  ? 212 GLU A O     1 
ATOM   1720 C  CB    . GLU A 1 210 ? 13.015 -23.275 -15.767 1.00 34.63  ? 212 GLU A CB    1 
ATOM   1721 C  CG    . GLU A 1 210 ? 12.668 -24.721 -15.414 1.00 37.57  ? 212 GLU A CG    1 
ATOM   1722 C  CD    . GLU A 1 210 ? 13.020 -25.705 -16.522 1.00 38.58  ? 212 GLU A CD    1 
ATOM   1723 O  OE1   . GLU A 1 210 ? 13.021 -26.931 -16.250 1.00 41.18  ? 212 GLU A OE1   1 
ATOM   1724 O  OE2   . GLU A 1 210 ? 13.290 -25.257 -17.667 1.00 40.47  ? 212 GLU A OE2   1 
ATOM   1725 N  N     . GLU A 1 211 ? 12.653 -19.998 -15.667 1.00 30.67  ? 213 GLU A N     1 
ATOM   1726 C  CA    . GLU A 1 211 ? 13.358 -18.755 -15.940 1.00 30.07  ? 213 GLU A CA    1 
ATOM   1727 C  C     . GLU A 1 211 ? 12.362 -17.661 -16.309 1.00 27.62  ? 213 GLU A C     1 
ATOM   1728 O  O     . GLU A 1 211 ? 11.219 -17.952 -16.640 1.00 27.37  ? 213 GLU A O     1 
ATOM   1729 C  CB    . GLU A 1 211 ? 14.390 -18.960 -17.068 1.00 30.33  ? 213 GLU A CB    1 
ATOM   1730 C  CG    . GLU A 1 211 ? 13.769 -19.348 -18.434 1.00 32.28  ? 213 GLU A CG    1 
ATOM   1731 C  CD    . GLU A 1 211 ? 14.787 -19.842 -19.455 1.00 33.18  ? 213 GLU A CD    1 
ATOM   1732 O  OE1   . GLU A 1 211 ? 16.010 -19.895 -19.139 1.00 36.83  ? 213 GLU A OE1   1 
ATOM   1733 O  OE2   . GLU A 1 211 ? 14.353 -20.193 -20.581 1.00 36.66  ? 213 GLU A OE2   1 
ATOM   1734 N  N     . PHE A 1 212 ? 12.804 -16.409 -16.251 1.00 25.84  ? 214 PHE A N     1 
ATOM   1735 C  CA    . PHE A 1 212 ? 11.952 -15.291 -16.642 1.00 24.04  ? 214 PHE A CA    1 
ATOM   1736 C  C     . PHE A 1 212 ? 11.660 -15.342 -18.142 1.00 23.17  ? 214 PHE A C     1 
ATOM   1737 O  O     . PHE A 1 212 ? 12.571 -15.316 -18.979 1.00 23.37  ? 214 PHE A O     1 
ATOM   1738 C  CB    . PHE A 1 212 ? 12.572 -13.953 -16.240 1.00 23.28  ? 214 PHE A CB    1 
ATOM   1739 C  CG    . PHE A 1 212 ? 11.705 -12.772 -16.548 1.00 21.37  ? 214 PHE A CG    1 
ATOM   1740 C  CD1   . PHE A 1 212 ? 10.682 -12.396 -15.679 1.00 19.68  ? 214 PHE A CD1   1 
ATOM   1741 C  CD2   . PHE A 1 212 ? 11.904 -12.027 -17.715 1.00 20.78  ? 214 PHE A CD2   1 
ATOM   1742 C  CE1   . PHE A 1 212 ? 9.874  -11.300 -15.966 1.00 20.40  ? 214 PHE A CE1   1 
ATOM   1743 C  CE2   . PHE A 1 212 ? 11.098 -10.926 -17.996 1.00 19.25  ? 214 PHE A CE2   1 
ATOM   1744 C  CZ    . PHE A 1 212 ? 10.072 -10.569 -17.108 1.00 18.71  ? 214 PHE A CZ    1 
ATOM   1745 N  N     . PHE A 1 213 ? 10.378 -15.404 -18.478 1.00 22.13  ? 215 PHE A N     1 
ATOM   1746 C  CA    . PHE A 1 213 ? 9.975  -15.774 -19.825 1.00 21.07  ? 215 PHE A CA    1 
ATOM   1747 C  C     . PHE A 1 213 ? 8.699  -15.025 -20.187 1.00 20.06  ? 215 PHE A C     1 
ATOM   1748 O  O     . PHE A 1 213 ? 7.680  -15.163 -19.513 1.00 19.68  ? 215 PHE A O     1 
ATOM   1749 C  CB    . PHE A 1 213 ? 9.757  -17.295 -19.860 1.00 21.49  ? 215 PHE A CB    1 
ATOM   1750 C  CG    . PHE A 1 213 ? 9.724  -17.911 -21.243 1.00 21.69  ? 215 PHE A CG    1 
ATOM   1751 C  CD1   . PHE A 1 213 ? 10.604 -18.935 -21.567 1.00 22.03  ? 215 PHE A CD1   1 
ATOM   1752 C  CD2   . PHE A 1 213 ? 8.777  -17.518 -22.196 1.00 21.01  ? 215 PHE A CD2   1 
ATOM   1753 C  CE1   . PHE A 1 213 ? 10.570 -19.544 -22.831 1.00 23.61  ? 215 PHE A CE1   1 
ATOM   1754 C  CE2   . PHE A 1 213 ? 8.732  -18.120 -23.464 1.00 21.48  ? 215 PHE A CE2   1 
ATOM   1755 C  CZ    . PHE A 1 213 ? 9.617  -19.137 -23.782 1.00 22.37  ? 215 PHE A CZ    1 
ATOM   1756 N  N     . VAL A 1 214 ? 8.771  -14.226 -21.248 1.00 19.22  ? 216 VAL A N     1 
ATOM   1757 C  CA    . VAL A 1 214 ? 7.614  -13.496 -21.761 1.00 18.82  ? 216 VAL A CA    1 
ATOM   1758 C  C     . VAL A 1 214 ? 7.262  -14.107 -23.118 1.00 18.93  ? 216 VAL A C     1 
ATOM   1759 O  O     . VAL A 1 214 ? 7.965  -13.879 -24.091 1.00 18.62  ? 216 VAL A O     1 
ATOM   1760 C  CB    . VAL A 1 214 ? 7.922  -11.969 -21.855 1.00 18.10  ? 216 VAL A CB    1 
ATOM   1761 C  CG1   . VAL A 1 214 ? 6.742  -11.200 -22.434 1.00 18.31  ? 216 VAL A CG1   1 
ATOM   1762 C  CG2   . VAL A 1 214 ? 8.291  -11.424 -20.476 1.00 17.66  ? 216 VAL A CG2   1 
ATOM   1763 N  N     . VAL A 1 215 ? 6.194  -14.903 -23.184 1.00 19.43  ? 217 VAL A N     1 
ATOM   1764 C  CA    . VAL A 1 215 ? 5.978  -15.692 -24.398 1.00 20.19  ? 217 VAL A CA    1 
ATOM   1765 C  C     . VAL A 1 215 ? 5.392  -14.820 -25.501 1.00 19.69  ? 217 VAL A C     1 
ATOM   1766 O  O     . VAL A 1 215 ? 4.446  -14.070 -25.277 1.00 19.81  ? 217 VAL A O     1 
ATOM   1767 C  CB    . VAL A 1 215 ? 5.261  -17.090 -24.195 1.00 21.34  ? 217 VAL A CB    1 
ATOM   1768 C  CG1   . VAL A 1 215 ? 5.116  -17.468 -22.702 1.00 21.50  ? 217 VAL A CG1   1 
ATOM   1769 C  CG2   . VAL A 1 215 ? 3.939  -17.210 -24.949 1.00 22.15  ? 217 VAL A CG2   1 
ATOM   1770 N  N     . ASP A 1 216 ? 6.029  -14.886 -26.669 1.00 19.06  ? 218 ASP A N     1 
ATOM   1771 C  CA    . ASP A 1 216 ? 5.639  -14.104 -27.836 1.00 18.27  ? 218 ASP A CA    1 
ATOM   1772 C  C     . ASP A 1 216 ? 4.266  -14.581 -28.287 1.00 18.45  ? 218 ASP A C     1 
ATOM   1773 O  O     . ASP A 1 216 ? 4.103  -15.758 -28.604 1.00 18.25  ? 218 ASP A O     1 
ATOM   1774 C  CB    . ASP A 1 216 ? 6.672  -14.308 -28.956 1.00 18.26  ? 218 ASP A CB    1 
ATOM   1775 C  CG    . ASP A 1 216 ? 6.549  -13.285 -30.075 1.00 17.60  ? 218 ASP A CG    1 
ATOM   1776 O  OD1   . ASP A 1 216 ? 5.457  -12.716 -30.280 1.00 17.59  ? 218 ASP A OD1   1 
ATOM   1777 O  OD2   . ASP A 1 216 ? 7.559  -13.053 -30.759 1.00 18.07  ? 218 ASP A OD2   1 
ATOM   1778 N  N     . PRO A 1 217 ? 3.269  -13.676 -28.307 1.00 18.86  ? 219 PRO A N     1 
ATOM   1779 C  CA    . PRO A 1 217 ? 1.895  -14.058 -28.723 1.00 20.07  ? 219 PRO A CA    1 
ATOM   1780 C  C     . PRO A 1 217 ? 1.833  -14.610 -30.155 1.00 21.01  ? 219 PRO A C     1 
ATOM   1781 O  O     . PRO A 1 217 ? 0.848  -15.204 -30.554 1.00 21.23  ? 219 PRO A O     1 
ATOM   1782 C  CB    . PRO A 1 217 ? 1.122  -12.733 -28.631 1.00 20.08  ? 219 PRO A CB    1 
ATOM   1783 C  CG    . PRO A 1 217 ? 2.163  -11.677 -28.736 1.00 19.50  ? 219 PRO A CG    1 
ATOM   1784 C  CD    . PRO A 1 217 ? 3.342  -12.243 -27.972 1.00 18.16  ? 219 PRO A CD    1 
ATOM   1785 N  N     . VAL A 1 218 ? 2.925  -14.425 -30.885 1.00 21.03  ? 220 VAL A N     1 
ATOM   1786 C  CA    . VAL A 1 218 ? 3.069  -14.823 -32.272 1.00 22.33  ? 220 VAL A CA    1 
ATOM   1787 C  C     . VAL A 1 218 ? 3.726  -16.198 -32.374 1.00 22.90  ? 220 VAL A C     1 
ATOM   1788 O  O     . VAL A 1 218 ? 3.528  -16.917 -33.359 1.00 23.57  ? 220 VAL A O     1 
ATOM   1789 C  CB    . VAL A 1 218 ? 3.910  -13.724 -32.979 1.00 22.61  ? 220 VAL A CB    1 
ATOM   1790 C  CG1   . VAL A 1 218 ? 4.866  -14.252 -34.006 1.00 22.50  ? 220 VAL A CG1   1 
ATOM   1791 C  CG2   . VAL A 1 218 ? 3.002  -12.594 -33.487 1.00 22.49  ? 220 VAL A CG2   1 
ATOM   1792 N  N     . ASP A 1 219 ? 4.490  -16.565 -31.344 1.00 22.85  ? 221 ASP A N     1 
ATOM   1793 C  CA    . ASP A 1 219 ? 5.297  -17.786 -31.347 1.00 23.81  ? 221 ASP A CA    1 
ATOM   1794 C  C     . ASP A 1 219 ? 5.495  -18.246 -29.914 1.00 24.10  ? 221 ASP A C     1 
ATOM   1795 O  O     . ASP A 1 219 ? 6.348  -17.714 -29.212 1.00 23.34  ? 221 ASP A O     1 
ATOM   1796 C  CB    . ASP A 1 219 ? 6.658  -17.505 -32.011 1.00 23.21  ? 221 ASP A CB    1 
ATOM   1797 C  CG    . ASP A 1 219 ? 7.542  -18.742 -32.128 1.00 24.88  ? 221 ASP A CG    1 
ATOM   1798 O  OD1   . ASP A 1 219 ? 7.104  -19.866 -31.781 1.00 24.69  ? 221 ASP A OD1   1 
ATOM   1799 O  OD2   . ASP A 1 219 ? 8.694  -18.580 -32.591 1.00 24.45  ? 221 ASP A OD2   1 
ATOM   1800 N  N     . GLU A 1 220 ? 4.716  -19.241 -29.483 1.00 25.40  ? 222 GLU A N     1 
ATOM   1801 C  CA    . GLU A 1 220 ? 4.740  -19.674 -28.073 1.00 26.30  ? 222 GLU A CA    1 
ATOM   1802 C  C     . GLU A 1 220 ? 6.078  -20.271 -27.614 1.00 26.00  ? 222 GLU A C     1 
ATOM   1803 O  O     . GLU A 1 220 ? 6.334  -20.387 -26.413 1.00 26.06  ? 222 GLU A O     1 
ATOM   1804 C  CB    . GLU A 1 220 ? 3.584  -20.634 -27.770 1.00 27.69  ? 222 GLU A CB    1 
ATOM   1805 C  CG    . GLU A 1 220 ? 3.610  -21.921 -28.582 1.00 31.54  ? 222 GLU A CG    1 
ATOM   1806 C  CD    . GLU A 1 220 ? 2.339  -22.717 -28.408 1.00 36.72  ? 222 GLU A CD    1 
ATOM   1807 O  OE1   . GLU A 1 220 ? 1.520  -22.743 -29.352 1.00 39.75  ? 222 GLU A OE1   1 
ATOM   1808 O  OE2   . GLU A 1 220 ? 2.140  -23.289 -27.316 1.00 38.58  ? 222 GLU A OE2   1 
ATOM   1809 N  N     . LYS A 1 221 ? 6.927  -20.634 -28.573 1.00 26.07  ? 223 LYS A N     1 
ATOM   1810 C  CA    . LYS A 1 221 ? 8.276  -21.100 -28.282 1.00 26.23  ? 223 LYS A CA    1 
ATOM   1811 C  C     . LYS A 1 221 ? 9.252  -19.952 -28.029 1.00 24.85  ? 223 LYS A C     1 
ATOM   1812 O  O     . LYS A 1 221 ? 10.323 -20.158 -27.463 1.00 24.89  ? 223 LYS A O     1 
ATOM   1813 C  CB    . LYS A 1 221 ? 8.788  -22.016 -29.403 1.00 27.52  ? 223 LYS A CB    1 
ATOM   1814 C  CG    . LYS A 1 221 ? 8.078  -23.381 -29.451 1.00 31.66  ? 223 LYS A CG    1 
ATOM   1815 C  CD    . LYS A 1 221 ? 7.941  -23.964 -28.042 1.00 35.66  ? 223 LYS A CD    1 
ATOM   1816 C  CE    . LYS A 1 221 ? 6.528  -24.462 -27.765 1.00 38.95  ? 223 LYS A CE    1 
ATOM   1817 N  NZ    . LYS A 1 221 ? 6.307  -24.653 -26.293 1.00 40.69  ? 223 LYS A NZ    1 
ATOM   1818 N  N     . ARG A 1 222 ? 8.865  -18.743 -28.429 1.00 23.70  ? 224 ARG A N     1 
ATOM   1819 C  CA    . ARG A 1 222 ? 9.742  -17.571 -28.359 1.00 22.43  ? 224 ARG A CA    1 
ATOM   1820 C  C     . ARG A 1 222 ? 9.637  -16.869 -27.013 1.00 20.81  ? 224 ARG A C     1 
ATOM   1821 O  O     . ARG A 1 222 ? 8.533  -16.488 -26.608 1.00 19.64  ? 224 ARG A O     1 
ATOM   1822 C  CB    . ARG A 1 222 ? 9.323  -16.568 -29.434 1.00 22.83  ? 224 ARG A CB    1 
ATOM   1823 C  CG    . ARG A 1 222 ? 10.433 -15.788 -30.061 1.00 24.71  ? 224 ARG A CG    1 
ATOM   1824 C  CD    . ARG A 1 222 ? 10.995 -14.644 -29.264 1.00 24.70  ? 224 ARG A CD    1 
ATOM   1825 N  NE    . ARG A 1 222 ? 12.441 -14.777 -29.332 1.00 25.39  ? 224 ARG A NE    1 
ATOM   1826 C  CZ    . ARG A 1 222 ? 13.350 -13.802 -29.369 1.00 25.27  ? 224 ARG A CZ    1 
ATOM   1827 N  NH1   . ARG A 1 222 ? 13.030 -12.513 -29.361 1.00 23.01  ? 224 ARG A NH1   1 
ATOM   1828 N  NH2   . ARG A 1 222 ? 14.627 -14.156 -29.423 1.00 25.20  ? 224 ARG A NH2   1 
ATOM   1829 N  N     . ASN A 1 223 ? 10.785 -16.692 -26.349 1.00 19.12  ? 225 ASN A N     1 
ATOM   1830 C  CA    . ASN A 1 223 ? 10.907 -15.816 -25.188 1.00 18.57  ? 225 ASN A CA    1 
ATOM   1831 C  C     . ASN A 1 223 ? 11.344 -14.418 -25.639 1.00 17.86  ? 225 ASN A C     1 
ATOM   1832 O  O     . ASN A 1 223 ? 12.498 -14.218 -26.036 1.00 17.67  ? 225 ASN A O     1 
ATOM   1833 C  CB    . ASN A 1 223 ? 11.911 -16.380 -24.159 1.00 18.53  ? 225 ASN A CB    1 
ATOM   1834 C  CG    . ASN A 1 223 ? 11.949 -15.565 -22.857 1.00 17.89  ? 225 ASN A CG    1 
ATOM   1835 O  OD1   . ASN A 1 223 ? 11.137 -14.669 -22.654 1.00 17.24  ? 225 ASN A OD1   1 
ATOM   1836 N  ND2   . ASN A 1 223 ? 12.900 -15.875 -21.980 1.00 17.77  ? 225 ASN A ND2   1 
ATOM   1837 N  N     . VAL A 1 224 ? 10.424 -13.459 -25.589 1.00 17.19  ? 226 VAL A N     1 
ATOM   1838 C  CA    . VAL A 1 224 ? 10.733 -12.081 -26.011 1.00 16.49  ? 226 VAL A CA    1 
ATOM   1839 C  C     . VAL A 1 224 ? 11.826 -11.477 -25.128 1.00 16.35  ? 226 VAL A C     1 
ATOM   1840 O  O     . VAL A 1 224 ? 12.663 -10.712 -25.603 1.00 16.53  ? 226 VAL A O     1 
ATOM   1841 C  CB    . VAL A 1 224 ? 9.476  -11.194 -26.031 1.00 16.13  ? 226 VAL A CB    1 
ATOM   1842 C  CG1   . VAL A 1 224 ? 9.801  -9.791  -26.558 1.00 16.92  ? 226 VAL A CG1   1 
ATOM   1843 C  CG2   . VAL A 1 224 ? 8.422  -11.826 -26.910 1.00 16.62  ? 226 VAL A CG2   1 
ATOM   1844 N  N     . ALA A 1 225 ? 11.819 -11.857 -23.849 1.00 16.36  ? 227 ALA A N     1 
ATOM   1845 C  CA    . ALA A 1 225 ? 12.835 -11.434 -22.895 1.00 16.37  ? 227 ALA A CA    1 
ATOM   1846 C  C     . ALA A 1 225 ? 14.018 -12.411 -22.828 1.00 16.28  ? 227 ALA A C     1 
ATOM   1847 O  O     . ALA A 1 225 ? 14.679 -12.494 -21.800 1.00 16.64  ? 227 ALA A O     1 
ATOM   1848 C  CB    . ALA A 1 225 ? 12.219 -11.276 -21.520 1.00 15.61  ? 227 ALA A CB    1 
ATOM   1849 N  N     . ALA A 1 226 ? 14.283 -13.148 -23.909 1.00 16.60  ? 228 ALA A N     1 
ATOM   1850 C  CA    . ALA A 1 226 ? 15.369 -14.142 -23.900 1.00 17.33  ? 228 ALA A CA    1 
ATOM   1851 C  C     . ALA A 1 226 ? 16.707 -13.538 -23.493 1.00 17.32  ? 228 ALA A C     1 
ATOM   1852 O  O     . ALA A 1 226 ? 17.469 -14.153 -22.762 1.00 18.38  ? 228 ALA A O     1 
ATOM   1853 C  CB    . ALA A 1 226 ? 15.485 -14.846 -25.253 1.00 17.62  ? 228 ALA A CB    1 
ATOM   1854 N  N     . ASN A 1 227 ? 16.984 -12.320 -23.945 1.00 16.78  ? 229 ASN A N     1 
ATOM   1855 C  CA    . ASN A 1 227 ? 18.301 -11.726 -23.722 1.00 17.43  ? 229 ASN A CA    1 
ATOM   1856 C  C     . ASN A 1 227 ? 18.335 -10.667 -22.604 1.00 17.56  ? 229 ASN A C     1 
ATOM   1857 O  O     . ASN A 1 227 ? 19.340 -9.978  -22.428 1.00 17.92  ? 229 ASN A O     1 
ATOM   1858 C  CB    . ASN A 1 227 ? 18.876 -11.167 -25.038 1.00 17.02  ? 229 ASN A CB    1 
ATOM   1859 C  CG    . ASN A 1 227 ? 20.398 -11.102 -25.029 1.00 17.33  ? 229 ASN A CG    1 
ATOM   1860 O  OD1   . ASN A 1 227 ? 21.058 -11.980 -24.489 1.00 17.00  ? 229 ASN A OD1   1 
ATOM   1861 N  ND2   . ASN A 1 227 ? 20.955 -10.069 -25.631 1.00 16.69  ? 229 ASN A ND2   1 
ATOM   1862 N  N     . LEU A 1 228 ? 17.233 -10.532 -21.866 1.00 17.55  ? 230 LEU A N     1 
ATOM   1863 C  CA    . LEU A 1 228 ? 17.221 -9.724  -20.645 1.00 18.16  ? 230 LEU A CA    1 
ATOM   1864 C  C     . LEU A 1 228 ? 18.027 -10.472 -19.586 1.00 19.11  ? 230 LEU A C     1 
ATOM   1865 O  O     . LEU A 1 228 ? 17.669 -11.582 -19.203 1.00 19.91  ? 230 LEU A O     1 
ATOM   1866 C  CB    . LEU A 1 228 ? 15.784 -9.501  -20.145 1.00 17.93  ? 230 LEU A CB    1 
ATOM   1867 C  CG    . LEU A 1 228 ? 15.570 -8.806  -18.800 1.00 16.68  ? 230 LEU A CG    1 
ATOM   1868 C  CD1   . LEU A 1 228 ? 16.103 -7.390  -18.855 1.00 16.59  ? 230 LEU A CD1   1 
ATOM   1869 C  CD2   . LEU A 1 228 ? 14.092 -8.815  -18.442 1.00 17.58  ? 230 LEU A CD2   1 
ATOM   1870 N  N     . SER A 1 229 ? 19.119 -9.871  -19.127 1.00 19.53  ? 231 SER A N     1 
ATOM   1871 C  CA    . SER A 1 229 ? 19.973 -10.496 -18.117 1.00 20.20  ? 231 SER A CA    1 
ATOM   1872 C  C     . SER A 1 229 ? 19.229 -10.575 -16.780 1.00 20.17  ? 231 SER A C     1 
ATOM   1873 O  O     . SER A 1 229 ? 18.305 -9.784  -16.529 1.00 20.03  ? 231 SER A O     1 
ATOM   1874 C  CB    . SER A 1 229 ? 21.253 -9.697  -17.941 1.00 20.75  ? 231 SER A CB    1 
ATOM   1875 O  OG    . SER A 1 229 ? 20.952 -8.410  -17.417 1.00 21.46  ? 231 SER A OG    1 
ATOM   1876 N  N     . LEU A 1 230 ? 19.615 -11.536 -15.940 1.00 20.31  ? 232 LEU A N     1 
ATOM   1877 C  CA    . LEU A 1 230 ? 19.080 -11.637 -14.577 1.00 20.23  ? 232 LEU A CA    1 
ATOM   1878 C  C     . LEU A 1 230 ? 19.308 -10.342 -13.801 1.00 19.99  ? 232 LEU A C     1 
ATOM   1879 O  O     . LEU A 1 230 ? 18.399 -9.861  -13.111 1.00 19.30  ? 232 LEU A O     1 
ATOM   1880 C  CB    . LEU A 1 230 ? 19.715 -12.821 -13.824 1.00 21.36  ? 232 LEU A CB    1 
ATOM   1881 C  CG    . LEU A 1 230 ? 19.579 -12.945 -12.292 1.00 21.79  ? 232 LEU A CG    1 
ATOM   1882 C  CD1   . LEU A 1 230 ? 18.119 -13.116 -11.852 1.00 21.19  ? 232 LEU A CD1   1 
ATOM   1883 C  CD2   . LEU A 1 230 ? 20.427 -14.109 -11.778 1.00 22.78  ? 232 LEU A CD2   1 
ATOM   1884 N  N     . ASP A 1 231 ? 20.514 -9.779  -13.914 1.00 20.45  ? 233 ASP A N     1 
ATOM   1885 C  CA    . ASP A 1 231 ? 20.861 -8.577  -13.164 1.00 20.93  ? 233 ASP A CA    1 
ATOM   1886 C  C     . ASP A 1 231 ? 20.089 -7.346  -13.602 1.00 20.60  ? 233 ASP A C     1 
ATOM   1887 O  O     . ASP A 1 231 ? 19.744 -6.505  -12.766 1.00 20.85  ? 233 ASP A O     1 
ATOM   1888 C  CB    . ASP A 1 231 ? 22.366 -8.336  -13.185 1.00 22.09  ? 233 ASP A CB    1 
ATOM   1889 C  CG    . ASP A 1 231 ? 23.110 -9.309  -12.300 1.00 23.30  ? 233 ASP A CG    1 
ATOM   1890 O  OD1   . ASP A 1 231 ? 22.454 -10.020 -11.511 1.00 24.98  ? 233 ASP A OD1   1 
ATOM   1891 O  OD2   . ASP A 1 231 ? 24.351 -9.367  -12.378 1.00 26.63  ? 233 ASP A OD2   1 
ATOM   1892 N  N     . ASN A 1 232 ? 19.802 -7.249  -14.900 1.00 19.53  ? 234 ASN A N     1 
ATOM   1893 C  CA    . ASN A 1 232 ? 19.002 -6.156  -15.427 1.00 18.92  ? 234 ASN A CA    1 
ATOM   1894 C  C     . ASN A 1 232 ? 17.514 -6.295  -15.102 1.00 18.86  ? 234 ASN A C     1 
ATOM   1895 O  O     . ASN A 1 232 ? 16.848 -5.290  -14.852 1.00 18.32  ? 234 ASN A O     1 
ATOM   1896 C  CB    . ASN A 1 232 ? 19.203 -5.992  -16.928 1.00 18.53  ? 234 ASN A CB    1 
ATOM   1897 C  CG    . ASN A 1 232 ? 20.504 -5.279  -17.273 1.00 18.97  ? 234 ASN A CG    1 
ATOM   1898 O  OD1   . ASN A 1 232 ? 20.985 -5.357  -18.408 1.00 18.69  ? 234 ASN A OD1   1 
ATOM   1899 N  ND2   . ASN A 1 232 ? 21.065 -4.570  -16.309 1.00 17.17  ? 234 ASN A ND2   1 
ATOM   1900 N  N     . LEU A 1 233 ? 17.006 -7.532  -15.109 1.00 18.74  ? 235 LEU A N     1 
ATOM   1901 C  CA    . LEU A 1 233 ? 15.670 -7.821  -14.573 1.00 18.85  ? 235 LEU A CA    1 
ATOM   1902 C  C     . LEU A 1 233 ? 15.589 -7.364  -13.112 1.00 19.53  ? 235 LEU A C     1 
ATOM   1903 O  O     . LEU A 1 233 ? 14.607 -6.716  -12.703 1.00 19.48  ? 235 LEU A O     1 
ATOM   1904 C  CB    . LEU A 1 233 ? 15.354 -9.322  -14.655 1.00 18.58  ? 235 LEU A CB    1 
ATOM   1905 C  CG    . LEU A 1 233 ? 14.110 -9.818  -13.891 1.00 17.78  ? 235 LEU A CG    1 
ATOM   1906 C  CD1   . LEU A 1 233 ? 12.832 -9.400  -14.608 1.00 16.23  ? 235 LEU A CD1   1 
ATOM   1907 C  CD2   . LEU A 1 233 ? 14.146 -11.336 -13.726 1.00 19.45  ? 235 LEU A CD2   1 
ATOM   1908 N  N     . ALA A 1 234 ? 16.622 -7.719  -12.339 1.00 20.30  ? 236 ALA A N     1 
ATOM   1909 C  CA    . ALA A 1 234 ? 16.730 -7.328  -10.933 1.00 21.34  ? 236 ALA A CA    1 
ATOM   1910 C  C     . ALA A 1 234 ? 16.720 -5.801  -10.800 1.00 21.58  ? 236 ALA A C     1 
ATOM   1911 O  O     . ALA A 1 234 ? 16.025 -5.248  -9.945  1.00 21.86  ? 236 ALA A O     1 
ATOM   1912 C  CB    . ALA A 1 234 ? 17.994 -7.921  -10.311 1.00 21.70  ? 236 ALA A CB    1 
ATOM   1913 N  N     . ARG A 1 235 ? 17.479 -5.131  -11.665 1.00 21.98  ? 237 ARG A N     1 
ATOM   1914 C  CA    . ARG A 1 235 ? 17.534 -3.662  -11.675 1.00 22.82  ? 237 ARG A CA    1 
ATOM   1915 C  C     . ARG A 1 235 ? 16.175 -3.005  -11.901 1.00 21.91  ? 237 ARG A C     1 
ATOM   1916 O  O     . ARG A 1 235 ? 15.815 -2.088  -11.177 1.00 22.36  ? 237 ARG A O     1 
ATOM   1917 C  CB    . ARG A 1 235 ? 18.596 -3.146  -12.649 1.00 22.89  ? 237 ARG A CB    1 
ATOM   1918 C  CG    . ARG A 1 235 ? 20.009 -3.341  -12.076 1.00 25.24  ? 237 ARG A CG    1 
ATOM   1919 C  CD    . ARG A 1 235 ? 21.157 -3.114  -13.056 1.00 25.31  ? 237 ARG A CD    1 
ATOM   1920 N  NE    . ARG A 1 235 ? 22.404 -3.569  -12.433 1.00 30.31  ? 237 ARG A NE    1 
ATOM   1921 C  CZ    . ARG A 1 235 ? 23.251 -4.466  -12.946 1.00 31.32  ? 237 ARG A CZ    1 
ATOM   1922 N  NH1   . ARG A 1 235 ? 23.038 -5.019  -14.139 1.00 29.79  ? 237 ARG A NH1   1 
ATOM   1923 N  NH2   . ARG A 1 235 ? 24.342 -4.796  -12.263 1.00 32.66  ? 237 ARG A NH2   1 
ATOM   1924 N  N     . PHE A 1 236 ? 15.416 -3.498  -12.877 1.00 21.09  ? 238 PHE A N     1 
ATOM   1925 C  CA    . PHE A 1 236 ? 14.078 -2.962  -13.174 1.00 20.50  ? 238 PHE A CA    1 
ATOM   1926 C  C     . PHE A 1 236 ? 13.093 -3.134  -12.015 1.00 20.41  ? 238 PHE A C     1 
ATOM   1927 O  O     . PHE A 1 236 ? 12.383 -2.187  -11.652 1.00 20.74  ? 238 PHE A O     1 
ATOM   1928 C  CB    . PHE A 1 236 ? 13.521 -3.603  -14.448 1.00 19.81  ? 238 PHE A CB    1 
ATOM   1929 C  CG    . PHE A 1 236 ? 12.157 -3.094  -14.847 1.00 20.27  ? 238 PHE A CG    1 
ATOM   1930 C  CD1   . PHE A 1 236 ? 11.993 -1.796  -15.316 1.00 19.89  ? 238 PHE A CD1   1 
ATOM   1931 C  CD2   . PHE A 1 236 ? 11.042 -3.921  -14.767 1.00 19.24  ? 238 PHE A CD2   1 
ATOM   1932 C  CE1   . PHE A 1 236 ? 10.742 -1.336  -15.706 1.00 19.51  ? 238 PHE A CE1   1 
ATOM   1933 C  CE2   . PHE A 1 236 ? 9.802  -3.469  -15.148 1.00 18.94  ? 238 PHE A CE2   1 
ATOM   1934 C  CZ    . PHE A 1 236 ? 9.651  -2.174  -15.621 1.00 18.96  ? 238 PHE A CZ    1 
ATOM   1935 N  N     . VAL A 1 237 ? 13.047 -4.340  -11.453 1.00 19.54  ? 239 VAL A N     1 
ATOM   1936 C  CA    . VAL A 1 237 ? 12.192 -4.639  -10.314 1.00 19.99  ? 239 VAL A CA    1 
ATOM   1937 C  C     . VAL A 1 237 ? 12.497 -3.669  -9.164  1.00 20.73  ? 239 VAL A C     1 
ATOM   1938 O  O     . VAL A 1 237 ? 11.583 -3.044  -8.624  1.00 20.97  ? 239 VAL A O     1 
ATOM   1939 C  CB    . VAL A 1 237 ? 12.341 -6.124  -9.854  1.00 19.86  ? 239 VAL A CB    1 
ATOM   1940 C  CG1   . VAL A 1 237 ? 11.740 -6.342  -8.461  1.00 20.49  ? 239 VAL A CG1   1 
ATOM   1941 C  CG2   . VAL A 1 237 ? 11.715 -7.082  -10.884 1.00 19.26  ? 239 VAL A CG2   1 
ATOM   1942 N  N     . HIS A 1 238 ? 13.785 -3.534  -8.821  1.00 21.16  ? 240 HIS A N     1 
ATOM   1943 C  CA    . HIS A 1 238 ? 14.229 -2.597  -7.790  1.00 21.98  ? 240 HIS A CA    1 
ATOM   1944 C  C     . HIS A 1 238 ? 13.831 -1.162  -8.106  1.00 22.16  ? 240 HIS A C     1 
ATOM   1945 O  O     . HIS A 1 238 ? 13.337 -0.446  -7.227  1.00 22.03  ? 240 HIS A O     1 
ATOM   1946 C  CB    . HIS A 1 238 ? 15.748 -2.663  -7.565  1.00 22.65  ? 240 HIS A CB    1 
ATOM   1947 C  CG    . HIS A 1 238 ? 16.204 -1.877  -6.374  1.00 24.00  ? 240 HIS A CG    1 
ATOM   1948 N  ND1   . HIS A 1 238 ? 16.918 -0.703  -6.481  1.00 26.10  ? 240 HIS A ND1   1 
ATOM   1949 C  CD2   . HIS A 1 238 ? 15.999 -2.071  -5.051  1.00 24.35  ? 240 HIS A CD2   1 
ATOM   1950 C  CE1   . HIS A 1 238 ? 17.148 -0.218  -5.275  1.00 24.20  ? 240 HIS A CE1   1 
ATOM   1951 N  NE2   . HIS A 1 238 ? 16.601 -1.030  -4.392  1.00 25.82  ? 240 HIS A NE2   1 
ATOM   1952 N  N     . LEU A 1 239 ? 14.060 -0.753  -9.357  1.00 21.39  ? 241 LEU A N     1 
ATOM   1953 C  CA    . LEU A 1 239 ? 13.688 0.584   -9.829  1.00 22.44  ? 241 LEU A CA    1 
ATOM   1954 C  C     . LEU A 1 239 ? 12.191 0.858   -9.714  1.00 22.27  ? 241 LEU A C     1 
ATOM   1955 O  O     . LEU A 1 239 ? 11.788 1.958   -9.313  1.00 22.76  ? 241 LEU A O     1 
ATOM   1956 C  CB    . LEU A 1 239 ? 14.150 0.807   -11.273 1.00 22.19  ? 241 LEU A CB    1 
ATOM   1957 C  CG    . LEU A 1 239 ? 15.504 1.488   -11.536 1.00 24.58  ? 241 LEU A CG    1 
ATOM   1958 C  CD1   . LEU A 1 239 ? 15.389 2.982   -11.336 1.00 25.15  ? 241 LEU A CD1   1 
ATOM   1959 C  CD2   . LEU A 1 239 ? 16.621 0.938   -10.660 1.00 28.72  ? 241 LEU A CD2   1 
ATOM   1960 N  N     . CYS A 1 240 ? 11.382 -0.144  -10.063 1.00 21.23  ? 242 CYS A N     1 
ATOM   1961 C  CA    . CYS A 1 240 ? 9.928  -0.072  -9.925  1.00 21.94  ? 242 CYS A CA    1 
ATOM   1962 C  C     . CYS A 1 240 ? 9.502  0.127   -8.472  1.00 23.06  ? 242 CYS A C     1 
ATOM   1963 O  O     . CYS A 1 240 ? 8.552  0.878   -8.190  1.00 24.05  ? 242 CYS A O     1 
ATOM   1964 C  CB    . CYS A 1 240 ? 9.261  -1.330  -10.497 1.00 21.10  ? 242 CYS A CB    1 
ATOM   1965 S  SG    . CYS A 1 240 ? 9.210  -1.361  -12.290 1.00 20.54  ? 242 CYS A SG    1 
ATOM   1966 N  N     . ARG A 1 241 ? 10.210 -0.539  -7.559  1.00 23.62  ? 243 ARG A N     1 
ATOM   1967 C  CA    . ARG A 1 241 ? 9.943  -0.415  -6.127  1.00 24.80  ? 243 ARG A CA    1 
ATOM   1968 C  C     . ARG A 1 241 ? 10.263 0.988   -5.636  1.00 26.08  ? 243 ARG A C     1 
ATOM   1969 O  O     . ARG A 1 241 ? 9.452  1.597   -4.942  1.00 26.71  ? 243 ARG A O     1 
ATOM   1970 C  CB    . ARG A 1 241 ? 10.723 -1.470  -5.331  1.00 25.16  ? 243 ARG A CB    1 
ATOM   1971 C  CG    . ARG A 1 241 ? 10.158 -2.871  -5.505  1.00 24.00  ? 243 ARG A CG    1 
ATOM   1972 C  CD    . ARG A 1 241 ? 11.069 -3.912  -4.913  1.00 23.94  ? 243 ARG A CD    1 
ATOM   1973 N  NE    . ARG A 1 241 ? 10.542 -5.258  -5.132  1.00 21.44  ? 243 ARG A NE    1 
ATOM   1974 C  CZ    . ARG A 1 241 ? 11.201 -6.384  -4.876  1.00 22.42  ? 243 ARG A CZ    1 
ATOM   1975 N  NH1   . ARG A 1 241 ? 12.443 -6.347  -4.387  1.00 22.40  ? 243 ARG A NH1   1 
ATOM   1976 N  NH2   . ARG A 1 241 ? 10.619 -7.556  -5.128  1.00 21.55  ? 243 ARG A NH2   1 
ATOM   1977 N  N     . GLU A 1 242 ? 11.436 1.495   -6.016  1.00 26.19  ? 244 GLU A N     1 
ATOM   1978 C  CA    . GLU A 1 242 ? 11.858 2.857   -5.684  1.00 27.74  ? 244 GLU A CA    1 
ATOM   1979 C  C     . GLU A 1 242 ? 10.891 3.890   -6.244  1.00 27.94  ? 244 GLU A C     1 
ATOM   1980 O  O     . GLU A 1 242 ? 10.454 4.780   -5.516  1.00 28.75  ? 244 GLU A O     1 
ATOM   1981 C  CB    . GLU A 1 242 ? 13.235 3.166   -6.256  1.00 27.85  ? 244 GLU A CB    1 
ATOM   1982 C  CG    . GLU A 1 242 ? 14.409 2.511   -5.594  1.00 28.99  ? 244 GLU A CG    1 
ATOM   1983 C  CD    . GLU A 1 242 ? 15.707 2.898   -6.300  1.00 30.99  ? 244 GLU A CD    1 
ATOM   1984 O  OE1   . GLU A 1 242 ? 15.768 2.807   -7.547  1.00 27.97  ? 244 GLU A OE1   1 
ATOM   1985 O  OE2   . GLU A 1 242 ? 16.661 3.318   -5.612  1.00 34.19  ? 244 GLU A OE2   1 
ATOM   1986 N  N     . PHE A 1 243 ? 10.575 3.779   -7.537  1.00 27.13  ? 245 PHE A N     1 
ATOM   1987 C  CA    . PHE A 1 243 ? 9.681  4.744   -8.186  1.00 27.78  ? 245 PHE A CA    1 
ATOM   1988 C  C     . PHE A 1 243 ? 8.353  4.873   -7.453  1.00 28.66  ? 245 PHE A C     1 
ATOM   1989 O  O     . PHE A 1 243 ? 7.892  5.981   -7.224  1.00 29.31  ? 245 PHE A O     1 
ATOM   1990 C  CB    . PHE A 1 243 ? 9.449  4.446   -9.676  1.00 26.59  ? 245 PHE A CB    1 
ATOM   1991 C  CG    . PHE A 1 243 ? 8.584  5.476   -10.370 1.00 27.15  ? 245 PHE A CG    1 
ATOM   1992 C  CD1   . PHE A 1 243 ? 9.107  6.719   -10.741 1.00 28.26  ? 245 PHE A CD1   1 
ATOM   1993 C  CD2   . PHE A 1 243 ? 7.241  5.212   -10.642 1.00 26.27  ? 245 PHE A CD2   1 
ATOM   1994 C  CE1   . PHE A 1 243 ? 8.301  7.685   -11.377 1.00 28.13  ? 245 PHE A CE1   1 
ATOM   1995 C  CE2   . PHE A 1 243 ? 6.431  6.163   -11.274 1.00 26.73  ? 245 PHE A CE2   1 
ATOM   1996 C  CZ    . PHE A 1 243 ? 6.967  7.404   -11.642 1.00 27.70  ? 245 PHE A CZ    1 
ATOM   1997 N  N     . MET A 1 244 ? 7.751  3.748   -7.078  1.00 28.97  ? 246 MET A N     1 
ATOM   1998 C  CA    . MET A 1 244 ? 6.457  3.785   -6.394  1.00 30.67  ? 246 MET A CA    1 
ATOM   1999 C  C     . MET A 1 244 ? 6.562  4.362   -4.990  1.00 32.48  ? 246 MET A C     1 
ATOM   2000 O  O     . MET A 1 244 ? 5.627  5.011   -4.513  1.00 33.04  ? 246 MET A O     1 
ATOM   2001 C  CB    . MET A 1 244 ? 5.791  2.409   -6.387  1.00 30.02  ? 246 MET A CB    1 
ATOM   2002 C  CG    . MET A 1 244 ? 5.464  1.900   -7.781  1.00 30.42  ? 246 MET A CG    1 
ATOM   2003 S  SD    . MET A 1 244 ? 4.108  2.730   -8.666  1.00 32.35  ? 246 MET A SD    1 
ATOM   2004 C  CE    . MET A 1 244 ? 4.506  4.469   -8.585  1.00 34.81  ? 246 MET A CE    1 
ATOM   2005 N  N     . GLU A 1 245 ? 7.711  4.142   -4.352  1.00 33.53  ? 247 GLU A N     1 
ATOM   2006 C  CA    . GLU A 1 245 ? 7.991  4.671   -3.016  1.00 35.92  ? 247 GLU A CA    1 
ATOM   2007 C  C     . GLU A 1 245 ? 8.214  6.178   -3.028  1.00 37.08  ? 247 GLU A C     1 
ATOM   2008 O  O     . GLU A 1 245 ? 7.707  6.899   -2.167  1.00 38.01  ? 247 GLU A O     1 
ATOM   2009 C  CB    . GLU A 1 245 ? 9.216  3.993   -2.409  1.00 36.15  ? 247 GLU A CB    1 
ATOM   2010 C  CG    . GLU A 1 245 ? 8.945  2.629   -1.819  1.00 38.64  ? 247 GLU A CG    1 
ATOM   2011 C  CD    . GLU A 1 245 ? 9.928  2.260   -0.718  1.00 42.42  ? 247 GLU A CD    1 
ATOM   2012 O  OE1   . GLU A 1 245 ? 9.472  1.664   0.289   1.00 44.79  ? 247 GLU A OE1   1 
ATOM   2013 O  OE2   . GLU A 1 245 ? 11.143 2.569   -0.851  1.00 43.83  ? 247 GLU A OE2   1 
ATOM   2014 N  N     . ALA A 1 246 ? 8.989  6.644   -4.002  1.00 36.74  ? 248 ALA A N     1 
ATOM   2015 C  CA    . ALA A 1 246 ? 9.309  8.055   -4.105  1.00 38.12  ? 248 ALA A CA    1 
ATOM   2016 C  C     . ALA A 1 246 ? 9.348  8.483   -5.571  1.00 37.60  ? 248 ALA A C     1 
ATOM   2017 O  O     . ALA A 1 246 ? 10.425 8.644   -6.135  1.00 37.58  ? 248 ALA A O     1 
ATOM   2018 C  CB    . ALA A 1 246 ? 10.632 8.345   -3.411  1.00 38.80  ? 248 ALA A CB    1 
ATOM   2019 N  N     . PRO A 1 247 ? 8.164  8.681   -6.184  1.00 37.71  ? 249 PRO A N     1 
ATOM   2020 C  CA    . PRO A 1 247 ? 8.037  9.023   -7.603  1.00 37.29  ? 249 PRO A CA    1 
ATOM   2021 C  C     . PRO A 1 247 ? 8.725  10.345  -7.929  1.00 38.37  ? 249 PRO A C     1 
ATOM   2022 O  O     . PRO A 1 247 ? 8.471  11.362  -7.276  1.00 39.59  ? 249 PRO A O     1 
ATOM   2023 C  CB    . PRO A 1 247 ? 6.524  9.150   -7.808  1.00 37.65  ? 249 PRO A CB    1 
ATOM   2024 C  CG    . PRO A 1 247 ? 5.904  8.484   -6.645  1.00 37.91  ? 249 PRO A CG    1 
ATOM   2025 C  CD    . PRO A 1 247 ? 6.853  8.604   -5.517  1.00 38.48  ? 249 PRO A CD    1 
ATOM   2026 N  N     . SER A 1 248 ? 9.587  10.313  -8.939  1.00 37.72  ? 250 SER A N     1 
ATOM   2027 C  CA    . SER A 1 248 ? 10.438 11.438  -9.288  1.00 38.61  ? 250 SER A CA    1 
ATOM   2028 C  C     . SER A 1 248 ? 10.514 11.540  -10.811 1.00 37.69  ? 250 SER A C     1 
ATOM   2029 O  O     . SER A 1 248 ? 10.568 10.526  -11.503 1.00 36.12  ? 250 SER A O     1 
ATOM   2030 C  CB    . SER A 1 248 ? 11.836 11.215  -8.703  1.00 38.87  ? 250 SER A CB    1 
ATOM   2031 O  OG    . SER A 1 248 ? 12.618 12.397  -8.724  1.00 41.41  ? 250 SER A OG    1 
ATOM   2032 N  N     . LEU A 1 249 ? 10.499 12.765  -11.330 1.00 38.36  ? 251 LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 249 ? 10.690 12.988  -12.762 1.00 37.58  ? 251 LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 249 ? 12.115 12.590  -13.156 1.00 36.87  ? 251 LEU A C     1 
ATOM   2035 O  O     . LEU A 1 249 ? 12.405 12.351  -14.335 1.00 36.13  ? 251 LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 249 ? 10.385 14.450  -13.131 1.00 39.01  ? 251 LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 249 ? 10.331 14.839  -14.614 1.00 38.72  ? 251 LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 249 ? 9.366  13.954  -15.400 1.00 36.42  ? 251 LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 249 ? 9.970  16.308  -14.777 1.00 40.36  ? 251 LEU A CD2   1 
ATOM   2040 N  N     . GLY A 1 250 ? 12.985 12.493  -12.149 1.00 36.86  ? 252 GLY A N     1 
ATOM   2041 C  CA    . GLY A 1 250 ? 14.374 12.097  -12.333 1.00 36.32  ? 252 GLY A CA    1 
ATOM   2042 C  C     . GLY A 1 250 ? 14.561 10.673  -12.823 1.00 34.81  ? 252 GLY A C     1 
ATOM   2043 O  O     . GLY A 1 250 ? 15.627 10.337  -13.347 1.00 35.21  ? 252 GLY A O     1 
ATOM   2044 N  N     . PHE A 1 251 ? 13.535 9.837   -12.652 1.00 33.52  ? 253 PHE A N     1 
ATOM   2045 C  CA    . PHE A 1 251 ? 13.533 8.465   -13.184 1.00 31.80  ? 253 PHE A CA    1 
ATOM   2046 C  C     . PHE A 1 251 ? 13.473 8.412   -14.717 1.00 30.86  ? 253 PHE A C     1 
ATOM   2047 O  O     . PHE A 1 251 ? 13.808 7.388   -15.324 1.00 29.78  ? 253 PHE A O     1 
ATOM   2048 C  CB    . PHE A 1 251 ? 12.363 7.665   -12.596 1.00 31.39  ? 253 PHE A CB    1 
ATOM   2049 C  CG    . PHE A 1 251 ? 12.601 7.163   -11.192 1.00 31.71  ? 253 PHE A CG    1 
ATOM   2050 C  CD1   . PHE A 1 251 ? 12.230 7.932   -10.093 1.00 33.04  ? 253 PHE A CD1   1 
ATOM   2051 C  CD2   . PHE A 1 251 ? 13.184 5.918   -10.970 1.00 31.61  ? 253 PHE A CD2   1 
ATOM   2052 C  CE1   . PHE A 1 251 ? 12.436 7.475   -8.780  1.00 33.12  ? 253 PHE A CE1   1 
ATOM   2053 C  CE2   . PHE A 1 251 ? 13.393 5.445   -9.664  1.00 32.82  ? 253 PHE A CE2   1 
ATOM   2054 C  CZ    . PHE A 1 251 ? 13.016 6.231   -8.567  1.00 32.75  ? 253 PHE A CZ    1 
ATOM   2055 N  N     . PHE A 1 252 ? 13.040 9.513   -15.329 1.00 31.30  ? 254 PHE A N     1 
ATOM   2056 C  CA    . PHE A 1 252 ? 12.855 9.595   -16.784 1.00 30.93  ? 254 PHE A CA    1 
ATOM   2057 C  C     . PHE A 1 252 ? 13.952 10.400  -17.477 1.00 32.03  ? 254 PHE A C     1 
ATOM   2058 O  O     . PHE A 1 252 ? 13.883 10.638  -18.682 1.00 31.90  ? 254 PHE A O     1 
ATOM   2059 C  CB    . PHE A 1 252 ? 11.466 10.162  -17.130 1.00 30.68  ? 254 PHE A CB    1 
ATOM   2060 C  CG    . PHE A 1 252 ? 10.337 9.293   -16.675 1.00 29.54  ? 254 PHE A CG    1 
ATOM   2061 C  CD1   . PHE A 1 252 ? 9.792  9.450   -15.397 1.00 29.19  ? 254 PHE A CD1   1 
ATOM   2062 C  CD2   . PHE A 1 252 ? 9.836  8.292   -17.504 1.00 28.33  ? 254 PHE A CD2   1 
ATOM   2063 C  CE1   . PHE A 1 252 ? 8.762  8.640   -14.956 1.00 29.04  ? 254 PHE A CE1   1 
ATOM   2064 C  CE2   . PHE A 1 252 ? 8.796  7.469   -17.075 1.00 28.97  ? 254 PHE A CE2   1 
ATOM   2065 C  CZ    . PHE A 1 252 ? 8.260  7.638   -15.789 1.00 28.58  ? 254 PHE A CZ    1 
ATOM   2066 N  N     . LYS A 1 253 ? 14.961 10.807  -16.711 1.00 33.36  ? 255 LYS A N     1 
ATOM   2067 C  CA    . LYS A 1 253 ? 16.122 11.515  -17.247 1.00 34.99  ? 255 LYS A CA    1 
ATOM   2068 C  C     . LYS A 1 253 ? 17.401 10.713  -16.986 1.00 34.91  ? 255 LYS A C     1 
ATOM   2069 O  O     . LYS A 1 253 ? 17.604 10.215  -15.880 1.00 35.22  ? 255 LYS A O     1 
ATOM   2070 C  CB    . LYS A 1 253 ? 16.242 12.898  -16.608 1.00 36.36  ? 255 LYS A CB    1 
ATOM   2071 C  CG    . LYS A 1 253 ? 15.027 13.778  -16.787 1.00 38.02  ? 255 LYS A CG    1 
ATOM   2072 C  CD    . LYS A 1 253 ? 15.170 15.042  -15.960 1.00 40.94  ? 255 LYS A CD    1 
ATOM   2073 C  CE    . LYS A 1 253 ? 13.900 15.872  -15.984 1.00 42.95  ? 255 LYS A CE    1 
ATOM   2074 N  NZ    . LYS A 1 253 ? 13.942 16.947  -14.941 1.00 46.29  ? 255 LYS A NZ    1 
ATOM   2075 N  N     . PRO A 1 254 ? 18.278 10.594  -17.998 1.00 35.34  ? 256 PRO A N     1 
ATOM   2076 C  CA    . PRO A 1 254 ? 19.477 9.742   -17.866 1.00 35.27  ? 256 PRO A CA    1 
ATOM   2077 C  C     . PRO A 1 254 ? 20.485 10.229  -16.814 1.00 36.45  ? 256 PRO A C     1 
ATOM   2078 O  O     . PRO A 1 254 ? 20.727 11.430  -16.698 1.00 37.45  ? 256 PRO A O     1 
ATOM   2079 C  CB    . PRO A 1 254 ? 20.097 9.784   -19.266 1.00 35.41  ? 256 PRO A CB    1 
ATOM   2080 C  CG    . PRO A 1 254 ? 18.974 10.269  -20.173 1.00 35.58  ? 256 PRO A CG    1 
ATOM   2081 C  CD    . PRO A 1 254 ? 18.200 11.227  -19.324 1.00 35.49  ? 256 PRO A CD    1 
ATOM   2082 N  N     . ILE A 1 260 ? 34.270 12.500  -12.455 1.00 52.89  ? 262 ILE A N     1 
ATOM   2083 C  CA    . ILE A 1 260 ? 35.336 12.412  -11.456 1.00 52.59  ? 262 ILE A CA    1 
ATOM   2084 C  C     . ILE A 1 260 ? 36.691 12.769  -12.076 1.00 52.72  ? 262 ILE A C     1 
ATOM   2085 O  O     . ILE A 1 260 ? 36.946 12.456  -13.246 1.00 52.17  ? 262 ILE A O     1 
ATOM   2086 C  CB    . ILE A 1 260 ? 35.378 11.010  -10.799 1.00 50.97  ? 262 ILE A CB    1 
ATOM   2087 C  CG1   . ILE A 1 260 ? 35.976 11.089  -9.391  1.00 51.44  ? 262 ILE A CG1   1 
ATOM   2088 C  CG2   . ILE A 1 260 ? 36.126 10.002  -11.682 1.00 49.89  ? 262 ILE A CG2   1 
ATOM   2089 C  CD1   . ILE A 1 260 ? 35.609 9.919   -8.499  1.00 50.06  ? 262 ILE A CD1   1 
ATOM   2090 N  N     . GLU A 1 261 ? 37.544 13.445  -11.306 1.00 53.40  ? 263 GLU A N     1 
ATOM   2091 C  CA    . GLU A 1 261 ? 38.894 13.768  -11.773 1.00 53.47  ? 263 GLU A CA    1 
ATOM   2092 C  C     . GLU A 1 261 ? 39.839 12.637  -11.389 1.00 51.55  ? 263 GLU A C     1 
ATOM   2093 O  O     . GLU A 1 261 ? 39.675 12.043  -10.320 1.00 51.05  ? 263 GLU A O     1 
ATOM   2094 C  CB    . GLU A 1 261 ? 39.384 15.130  -11.246 1.00 55.69  ? 263 GLU A CB    1 
ATOM   2095 C  CG    . GLU A 1 261 ? 39.656 15.212  -9.741  1.00 57.21  ? 263 GLU A CG    1 
ATOM   2096 C  CD    . GLU A 1 261 ? 38.414 15.533  -8.910  1.00 59.20  ? 263 GLU A CD    1 
ATOM   2097 O  OE1   . GLU A 1 261 ? 38.575 16.051  -7.777  1.00 60.19  ? 263 GLU A OE1   1 
ATOM   2098 O  OE2   . GLU A 1 261 ? 37.281 15.273  -9.383  1.00 59.39  ? 263 GLU A OE2   1 
ATOM   2099 N  N     . PRO A 1 262 ? 40.823 12.326  -12.261 1.00 50.54  ? 264 PRO A N     1 
ATOM   2100 C  CA    . PRO A 1 262 ? 41.702 11.164  -12.054 1.00 48.75  ? 264 PRO A CA    1 
ATOM   2101 C  C     . PRO A 1 262 ? 42.402 11.186  -10.699 1.00 48.48  ? 264 PRO A C     1 
ATOM   2102 O  O     . PRO A 1 262 ? 42.819 10.136  -10.203 1.00 47.23  ? 264 PRO A O     1 
ATOM   2103 C  CB    . PRO A 1 262 ? 42.729 11.291  -13.186 1.00 49.01  ? 264 PRO A CB    1 
ATOM   2104 C  CG    . PRO A 1 262 ? 42.019 12.053  -14.248 1.00 49.86  ? 264 PRO A CG    1 
ATOM   2105 C  CD    . PRO A 1 262 ? 41.172 13.048  -13.499 1.00 51.38  ? 264 PRO A CD    1 
ATOM   2106 N  N     . GLU A 1 263 ? 42.509 12.383  -10.118 1.00 49.22  ? 265 GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 263 ? 43.104 12.582  -8.806  1.00 49.19  ? 265 GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 263 ? 42.249 12.010  -7.670  1.00 48.00  ? 265 GLU A C     1 
ATOM   2109 O  O     . GLU A 1 263 ? 42.772 11.296  -6.810  1.00 47.41  ? 265 GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 263 ? 43.390 14.066  -8.570  1.00 51.32  ? 265 GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 263 ? 44.271 14.330  -7.368  1.00 53.07  ? 265 GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 263 ? 45.551 13.513  -7.393  1.00 53.10  ? 265 GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 263 ? 46.310 13.625  -8.379  1.00 53.86  ? 265 GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 263 ? 45.798 12.760  -6.426  1.00 52.78  ? 265 GLU A OE2   1 
ATOM   2115 N  N     . ARG A 1 264 ? 40.952 12.325  -7.663  1.00 47.21  ? 266 ARG A N     1 
ATOM   2116 C  CA    . ARG A 1 264 ? 40.044 11.801  -6.640  1.00 45.99  ? 266 ARG A CA    1 
ATOM   2117 C  C     . ARG A 1 264 ? 39.929 10.283  -6.763  1.00 43.35  ? 266 ARG A C     1 
ATOM   2118 O  O     . ARG A 1 264 ? 39.887 9.570   -5.757  1.00 42.44  ? 266 ARG A O     1 
ATOM   2119 C  CB    . ARG A 1 264 ? 38.659 12.443  -6.728  1.00 46.94  ? 266 ARG A CB    1 
ATOM   2120 C  CG    . ARG A 1 264 ? 37.795 12.178  -5.494  1.00 48.57  ? 266 ARG A CG    1 
ATOM   2121 C  CD    . ARG A 1 264 ? 36.308 12.427  -5.726  1.00 51.53  ? 266 ARG A CD    1 
ATOM   2122 N  NE    . ARG A 1 264 ? 35.505 11.806  -4.666  1.00 53.36  ? 266 ARG A NE    1 
ATOM   2123 C  CZ    . ARG A 1 264 ? 34.246 11.388  -4.804  1.00 53.46  ? 266 ARG A CZ    1 
ATOM   2124 N  NH1   . ARG A 1 264 ? 33.609 11.518  -5.965  1.00 53.06  ? 266 ARG A NH1   1 
ATOM   2125 N  NH2   . ARG A 1 264 ? 33.618 10.831  -3.774  1.00 53.23  ? 266 ARG A NH2   1 
ATOM   2126 N  N     . LEU A 1 265 ? 39.883 9.807   -8.005  1.00 41.54  ? 267 LEU A N     1 
ATOM   2127 C  CA    . LEU A 1 265 ? 39.845 8.380   -8.300  1.00 39.27  ? 267 LEU A CA    1 
ATOM   2128 C  C     . LEU A 1 265 ? 41.108 7.654   -7.805  1.00 38.10  ? 267 LEU A C     1 
ATOM   2129 O  O     . LEU A 1 265 ? 41.025 6.523   -7.331  1.00 36.88  ? 267 LEU A O     1 
ATOM   2130 C  CB    . LEU A 1 265 ? 39.617 8.155   -9.802  1.00 38.59  ? 267 LEU A CB    1 
ATOM   2131 C  CG    . LEU A 1 265 ? 39.307 6.737   -10.306 1.00 38.06  ? 267 LEU A CG    1 
ATOM   2132 C  CD1   . LEU A 1 265 ? 37.996 6.225   -9.734  1.00 38.11  ? 267 LEU A CD1   1 
ATOM   2133 C  CD2   . LEU A 1 265 ? 39.266 6.701   -11.835 1.00 36.91  ? 267 LEU A CD2   1 
ATOM   2134 N  N     . ARG A 1 266 ? 42.263 8.312   -7.901  1.00 38.28  ? 268 ARG A N     1 
ATOM   2135 C  CA    . ARG A 1 266 ? 43.516 7.756   -7.383  1.00 37.98  ? 268 ARG A CA    1 
ATOM   2136 C  C     . ARG A 1 266 ? 43.465 7.561   -5.861  1.00 37.41  ? 268 ARG A C     1 
ATOM   2137 O  O     . ARG A 1 266 ? 43.801 6.478   -5.363  1.00 36.32  ? 268 ARG A O     1 
ATOM   2138 C  CB    . ARG A 1 266 ? 44.713 8.630   -7.777  1.00 39.41  ? 268 ARG A CB    1 
ATOM   2139 C  CG    . ARG A 1 266 ? 46.066 7.997   -7.443  1.00 41.55  ? 268 ARG A CG    1 
ATOM   2140 C  CD    . ARG A 1 266 ? 47.202 9.019   -7.450  1.00 45.73  ? 268 ARG A CD    1 
ATOM   2141 N  NE    . ARG A 1 266 ? 46.967 10.133  -6.524  1.00 49.06  ? 268 ARG A NE    1 
ATOM   2142 C  CZ    . ARG A 1 266 ? 47.358 10.159  -5.252  1.00 51.06  ? 268 ARG A CZ    1 
ATOM   2143 N  NH1   . ARG A 1 266 ? 48.012 9.129   -4.728  1.00 50.97  ? 268 ARG A NH1   1 
ATOM   2144 N  NH2   . ARG A 1 266 ? 47.095 11.222  -4.497  1.00 53.35  ? 268 ARG A NH2   1 
ATOM   2145 N  N     . LYS A 1 267 ? 43.025 8.604   -5.150  1.00 37.50  ? 269 LYS A N     1 
ATOM   2146 C  CA    . LYS A 1 267 ? 42.807 8.575   -3.697  1.00 37.27  ? 269 LYS A CA    1 
ATOM   2147 C  C     . LYS A 1 267 ? 41.797 7.517   -3.244  1.00 35.48  ? 269 LYS A C     1 
ATOM   2148 O  O     . LYS A 1 267 ? 42.003 6.853   -2.223  1.00 34.97  ? 269 LYS A O     1 
ATOM   2149 C  CB    . LYS A 1 267 ? 42.318 9.932   -3.195  1.00 39.03  ? 269 LYS A CB    1 
ATOM   2150 C  CG    . LYS A 1 267 ? 43.357 11.038  -3.135  1.00 41.38  ? 269 LYS A CG    1 
ATOM   2151 C  CD    . LYS A 1 267 ? 42.798 12.206  -2.317  1.00 44.51  ? 269 LYS A CD    1 
ATOM   2152 C  CE    . LYS A 1 267 ? 43.445 13.540  -2.669  1.00 47.10  ? 269 LYS A CE    1 
ATOM   2153 N  NZ    . LYS A 1 267 ? 43.288 13.875  -4.115  1.00 47.64  ? 269 LYS A NZ    1 
ATOM   2154 N  N     . ILE A 1 268 ? 40.695 7.387   -3.982  1.00 33.98  ? 270 ILE A N     1 
ATOM   2155 C  CA    . ILE A 1 268 ? 39.687 6.370   -3.679  1.00 32.35  ? 270 ILE A CA    1 
ATOM   2156 C  C     . ILE A 1 268 ? 40.293 4.965   -3.776  1.00 30.76  ? 270 ILE A C     1 
ATOM   2157 O  O     . ILE A 1 268 ? 40.076 4.123   -2.898  1.00 30.33  ? 270 ILE A O     1 
ATOM   2158 C  CB    . ILE A 1 268 ? 38.461 6.466   -4.615  1.00 32.18  ? 270 ILE A CB    1 
ATOM   2159 C  CG1   . ILE A 1 268 ? 37.647 7.721   -4.303  1.00 33.04  ? 270 ILE A CG1   1 
ATOM   2160 C  CG2   . ILE A 1 268 ? 37.596 5.203   -4.501  1.00 31.00  ? 270 ILE A CG2   1 
ATOM   2161 C  CD1   . ILE A 1 268 ? 36.756 8.174   -5.445  1.00 33.48  ? 270 ILE A CD1   1 
ATOM   2162 N  N     . VAL A 1 269 ? 41.049 4.719   -4.841  1.00 29.31  ? 271 VAL A N     1 
ATOM   2163 C  CA    . VAL A 1 269 ? 41.715 3.436   -5.005  1.00 28.21  ? 271 VAL A CA    1 
ATOM   2164 C  C     . VAL A 1 269 ? 42.692 3.172   -3.863  1.00 28.54  ? 271 VAL A C     1 
ATOM   2165 O  O     . VAL A 1 269 ? 42.735 2.059   -3.332  1.00 27.55  ? 271 VAL A O     1 
ATOM   2166 C  CB    . VAL A 1 269 ? 42.406 3.302   -6.374  1.00 27.68  ? 271 VAL A CB    1 
ATOM   2167 C  CG1   . VAL A 1 269 ? 43.264 2.031   -6.418  1.00 27.44  ? 271 VAL A CG1   1 
ATOM   2168 C  CG2   . VAL A 1 269 ? 41.361 3.257   -7.484  1.00 27.10  ? 271 VAL A CG2   1 
ATOM   2169 N  N     . GLU A 1 270 ? 43.454 4.189   -3.464  1.00 29.90  ? 272 GLU A N     1 
ATOM   2170 C  CA    . GLU A 1 270 ? 44.378 4.002   -2.347  1.00 31.65  ? 272 GLU A CA    1 
ATOM   2171 C  C     . GLU A 1 270 ? 43.661 3.836   -0.991  1.00 31.81  ? 272 GLU A C     1 
ATOM   2172 O  O     . GLU A 1 270 ? 44.154 3.112   -0.132  1.00 31.90  ? 272 GLU A O     1 
ATOM   2173 C  CB    . GLU A 1 270 ? 45.472 5.069   -2.333  1.00 32.74  ? 272 GLU A CB    1 
ATOM   2174 C  CG    . GLU A 1 270 ? 45.104 6.359   -1.634  1.00 35.88  ? 272 GLU A CG    1 
ATOM   2175 C  CD    . GLU A 1 270 ? 46.252 7.352   -1.608  1.00 37.71  ? 272 GLU A CD    1 
ATOM   2176 O  OE1   . GLU A 1 270 ? 46.652 7.818   -2.701  1.00 41.77  ? 272 GLU A OE1   1 
ATOM   2177 O  OE2   . GLU A 1 270 ? 46.742 7.673   -0.498  1.00 41.18  ? 272 GLU A OE2   1 
ATOM   2178 N  N     . GLU A 1 271 ? 42.501 4.483   -0.818  1.00 32.37  ? 273 GLU A N     1 
ATOM   2179 C  CA    . GLU A 1 271 ? 41.615 4.248   0.349   1.00 33.44  ? 273 GLU A CA    1 
ATOM   2180 C  C     . GLU A 1 271 ? 41.164 2.782   0.425   1.00 30.80  ? 273 GLU A C     1 
ATOM   2181 O  O     . GLU A 1 271 ? 41.125 2.182   1.494   1.00 30.57  ? 273 GLU A O     1 
ATOM   2182 C  CB    . GLU A 1 271 ? 40.339 5.089   0.257   1.00 33.71  ? 273 GLU A CB    1 
ATOM   2183 C  CG    . GLU A 1 271 ? 40.418 6.521   0.700   1.00 37.74  ? 273 GLU A CG    1 
ATOM   2184 C  CD    . GLU A 1 271 ? 39.025 7.098   1.015   1.00 39.52  ? 273 GLU A CD    1 
ATOM   2185 O  OE1   . GLU A 1 271 ? 38.124 6.315   1.431   1.00 42.41  ? 273 GLU A OE1   1 
ATOM   2186 O  OE2   . GLU A 1 271 ? 38.839 8.334   0.862   1.00 44.24  ? 273 GLU A OE2   1 
ATOM   2187 N  N     . ARG A 1 272 ? 40.796 2.237   -0.730  1.00 28.77  ? 274 ARG A N     1 
ATOM   2188 C  CA    . ARG A 1 272 ? 40.342 0.855   -0.857  1.00 26.85  ? 274 ARG A CA    1 
ATOM   2189 C  C     . ARG A 1 272 ? 41.464 -0.150  -0.612  1.00 25.39  ? 274 ARG A C     1 
ATOM   2190 O  O     . ARG A 1 272 ? 41.217 -1.242  -0.091  1.00 24.48  ? 274 ARG A O     1 
ATOM   2191 C  CB    . ARG A 1 272 ? 39.719 0.635   -2.239  1.00 25.66  ? 274 ARG A CB    1 
ATOM   2192 C  CG    . ARG A 1 272 ? 38.576 1.609   -2.522  1.00 27.69  ? 274 ARG A CG    1 
ATOM   2193 C  CD    . ARG A 1 272 ? 37.857 1.341   -3.841  1.00 26.67  ? 274 ARG A CD    1 
ATOM   2194 N  NE    . ARG A 1 272 ? 36.444 1.187   -3.533  1.00 31.42  ? 274 ARG A NE    1 
ATOM   2195 C  CZ    . ARG A 1 272 ? 35.718 0.086   -3.719  1.00 28.85  ? 274 ARG A CZ    1 
ATOM   2196 N  NH1   . ARG A 1 272 ? 36.219 -0.985  -4.301  1.00 25.90  ? 274 ARG A NH1   1 
ATOM   2197 N  NH2   . ARG A 1 272 ? 34.448 0.091   -3.351  1.00 31.25  ? 274 ARG A NH2   1 
ATOM   2198 N  N     . GLY A 1 273 ? 42.687 0.220   -0.985  1.00 24.60  ? 275 GLY A N     1 
ATOM   2199 C  CA    . GLY A 1 273 ? 43.854 -0.640  -0.773  1.00 23.89  ? 275 GLY A CA    1 
ATOM   2200 C  C     . GLY A 1 273 ? 43.914 -1.845  -1.708  1.00 22.98  ? 275 GLY A C     1 
ATOM   2201 O  O     . GLY A 1 273 ? 44.664 -2.801  -1.464  1.00 22.28  ? 275 GLY A O     1 
ATOM   2202 N  N     . THR A 1 274 ? 43.126 -1.779  -2.784  1.00 21.93  ? 276 THR A N     1 
ATOM   2203 C  CA    . THR A 1 274 ? 42.977 -2.859  -3.755  1.00 20.86  ? 276 THR A CA    1 
ATOM   2204 C  C     . THR A 1 274 ? 43.950 -2.726  -4.928  1.00 21.12  ? 276 THR A C     1 
ATOM   2205 O  O     . THR A 1 274 ? 44.481 -1.643  -5.174  1.00 21.70  ? 276 THR A O     1 
ATOM   2206 C  CB    . THR A 1 274 ? 41.578 -2.842  -4.368  1.00 19.98  ? 276 THR A CB    1 
ATOM   2207 O  OG1   . THR A 1 274 ? 41.282 -1.514  -4.827  1.00 20.37  ? 276 THR A OG1   1 
ATOM   2208 C  CG2   . THR A 1 274 ? 40.529 -3.286  -3.365  1.00 19.13  ? 276 THR A CG2   1 
ATOM   2209 N  N     . ALA A 1 275 ? 44.161 -3.836  -5.640  1.00 20.57  ? 277 ALA A N     1 
ATOM   2210 C  CA    . ALA A 1 275 ? 44.841 -3.820  -6.928  1.00 20.96  ? 277 ALA A CA    1 
ATOM   2211 C  C     . ALA A 1 275 ? 43.826 -3.552  -8.036  1.00 20.69  ? 277 ALA A C     1 
ATOM   2212 O  O     . ALA A 1 275 ? 42.918 -4.347  -8.262  1.00 20.58  ? 277 ALA A O     1 
ATOM   2213 C  CB    . ALA A 1 275 ? 45.565 -5.139  -7.171  1.00 19.94  ? 277 ALA A CB    1 
ATOM   2214 N  N     . VAL A 1 276 ? 43.987 -2.417  -8.708  1.00 21.48  ? 278 VAL A N     1 
ATOM   2215 C  CA    . VAL A 1 276 ? 43.109 -1.994  -9.801  1.00 21.48  ? 278 VAL A CA    1 
ATOM   2216 C  C     . VAL A 1 276 ? 43.962 -1.884  -11.055 1.00 21.26  ? 278 VAL A C     1 
ATOM   2217 O  O     . VAL A 1 276 ? 45.020 -1.254  -11.053 1.00 22.06  ? 278 VAL A O     1 
ATOM   2218 C  CB    . VAL A 1 276 ? 42.415 -0.633  -9.515  1.00 21.88  ? 278 VAL A CB    1 
ATOM   2219 C  CG1   . VAL A 1 276 ? 41.506 -0.218  -10.675 1.00 22.47  ? 278 VAL A CG1   1 
ATOM   2220 C  CG2   . VAL A 1 276 ? 41.602 -0.701  -8.238  1.00 22.74  ? 278 VAL A CG2   1 
ATOM   2221 N  N     . PHE A 1 277 ? 43.510 -2.526  -12.121 1.00 20.78  ? 279 PHE A N     1 
ATOM   2222 C  CA    . PHE A 1 277 ? 44.289 -2.583  -13.346 1.00 21.00  ? 279 PHE A CA    1 
ATOM   2223 C  C     . PHE A 1 277 ? 43.399 -2.931  -14.528 1.00 20.24  ? 279 PHE A C     1 
ATOM   2224 O  O     . PHE A 1 277 ? 42.247 -3.339  -14.348 1.00 20.12  ? 279 PHE A O     1 
ATOM   2225 C  CB    . PHE A 1 277 ? 45.463 -3.572  -13.209 1.00 20.83  ? 279 PHE A CB    1 
ATOM   2226 C  CG    . PHE A 1 277 ? 45.045 -4.992  -12.902 1.00 20.60  ? 279 PHE A CG    1 
ATOM   2227 C  CD1   . PHE A 1 277 ? 44.856 -5.915  -13.936 1.00 20.77  ? 279 PHE A CD1   1 
ATOM   2228 C  CD2   . PHE A 1 277 ? 44.870 -5.414  -11.586 1.00 20.70  ? 279 PHE A CD2   1 
ATOM   2229 C  CE1   . PHE A 1 277 ? 44.481 -7.231  -13.663 1.00 21.25  ? 279 PHE A CE1   1 
ATOM   2230 C  CE2   . PHE A 1 277 ? 44.498 -6.736  -11.292 1.00 19.87  ? 279 PHE A CE2   1 
ATOM   2231 C  CZ    . PHE A 1 277 ? 44.297 -7.644  -12.332 1.00 20.02  ? 279 PHE A CZ    1 
ATOM   2232 N  N     . ALA A 1 278 ? 43.950 -2.776  -15.729 1.00 20.02  ? 280 ALA A N     1 
ATOM   2233 C  CA    . ALA A 1 278 ? 43.243 -3.095  -16.958 1.00 19.61  ? 280 ALA A CA    1 
ATOM   2234 C  C     . ALA A 1 278 ? 44.132 -3.874  -17.907 1.00 19.55  ? 280 ALA A C     1 
ATOM   2235 O  O     . ALA A 1 278 ? 45.342 -3.661  -17.942 1.00 19.59  ? 280 ALA A O     1 
ATOM   2236 C  CB    . ALA A 1 278 ? 42.794 -1.802  -17.639 1.00 20.23  ? 280 ALA A CB    1 
ATOM   2237 N  N     . VAL A 1 279 ? 43.515 -4.782  -18.662 1.00 19.34  ? 281 VAL A N     1 
ATOM   2238 C  CA    . VAL A 1 279 ? 44.108 -5.329  -19.881 1.00 19.26  ? 281 VAL A CA    1 
ATOM   2239 C  C     . VAL A 1 279 ? 43.646 -4.453  -21.053 1.00 19.73  ? 281 VAL A C     1 
ATOM   2240 O  O     . VAL A 1 279 ? 42.434 -4.306  -21.285 1.00 19.30  ? 281 VAL A O     1 
ATOM   2241 C  CB    . VAL A 1 279 ? 43.649 -6.788  -20.127 1.00 19.10  ? 281 VAL A CB    1 
ATOM   2242 C  CG1   . VAL A 1 279 ? 44.318 -7.359  -21.345 1.00 17.76  ? 281 VAL A CG1   1 
ATOM   2243 C  CG2   . VAL A 1 279 ? 43.918 -7.645  -18.896 1.00 18.69  ? 281 VAL A CG2   1 
ATOM   2244 N  N     . LYS A 1 280 ? 44.607 -3.851  -21.753 1.00 20.17  ? 282 LYS A N     1 
ATOM   2245 C  CA    . LYS A 1 280 ? 44.328 -2.987  -22.912 1.00 20.98  ? 282 LYS A CA    1 
ATOM   2246 C  C     . LYS A 1 280 ? 44.844 -3.642  -24.186 1.00 20.79  ? 282 LYS A C     1 
ATOM   2247 O  O     . LYS A 1 280 ? 45.961 -4.133  -24.222 1.00 21.12  ? 282 LYS A O     1 
ATOM   2248 C  CB    . LYS A 1 280 ? 44.957 -1.604  -22.724 1.00 21.55  ? 282 LYS A CB    1 
ATOM   2249 C  CG    . LYS A 1 280 ? 44.874 -0.676  -23.945 1.00 23.72  ? 282 LYS A CG    1 
ATOM   2250 C  CD    . LYS A 1 280 ? 45.468 0.677   -23.604 1.00 26.07  ? 282 LYS A CD    1 
ATOM   2251 C  CE    . LYS A 1 280 ? 45.588 1.582   -24.821 1.00 27.66  ? 282 LYS A CE    1 
ATOM   2252 N  NZ    . LYS A 1 280 ? 46.154 2.897   -24.409 1.00 29.53  ? 282 LYS A NZ    1 
ATOM   2253 N  N     . PHE A 1 281 ? 44.004 -3.674  -25.210 1.00 21.03  ? 283 PHE A N     1 
ATOM   2254 C  CA    . PHE A 1 281 ? 44.349 -4.259  -26.497 1.00 21.62  ? 283 PHE A CA    1 
ATOM   2255 C  C     . PHE A 1 281 ? 43.548 -3.533  -27.579 1.00 22.27  ? 283 PHE A C     1 
ATOM   2256 O  O     . PHE A 1 281 ? 42.601 -2.805  -27.271 1.00 21.74  ? 283 PHE A O     1 
ATOM   2257 C  CB    . PHE A 1 281 ? 44.097 -5.780  -26.499 1.00 21.16  ? 283 PHE A CB    1 
ATOM   2258 C  CG    . PHE A 1 281 ? 42.683 -6.164  -26.159 1.00 21.14  ? 283 PHE A CG    1 
ATOM   2259 C  CD1   . PHE A 1 281 ? 41.760 -6.448  -27.177 1.00 20.84  ? 283 PHE A CD1   1 
ATOM   2260 C  CD2   . PHE A 1 281 ? 42.267 -6.228  -24.836 1.00 21.27  ? 283 PHE A CD2   1 
ATOM   2261 C  CE1   . PHE A 1 281 ? 40.431 -6.789  -26.881 1.00 20.62  ? 283 PHE A CE1   1 
ATOM   2262 C  CE2   . PHE A 1 281 ? 40.948 -6.569  -24.516 1.00 21.41  ? 283 PHE A CE2   1 
ATOM   2263 C  CZ    . PHE A 1 281 ? 40.025 -6.859  -25.546 1.00 21.77  ? 283 PHE A CZ    1 
ATOM   2264 N  N     . ARG A 1 282 ? 43.947 -3.706  -28.838 1.00 23.10  ? 284 ARG A N     1 
ATOM   2265 C  CA    . ARG A 1 282 ? 43.269 -3.048  -29.960 1.00 23.88  ? 284 ARG A CA    1 
ATOM   2266 C  C     . ARG A 1 282 ? 41.877 -3.646  -30.198 1.00 22.97  ? 284 ARG A C     1 
ATOM   2267 O  O     . ARG A 1 282 ? 41.704 -4.870  -30.195 1.00 21.91  ? 284 ARG A O     1 
ATOM   2268 C  CB    . ARG A 1 282 ? 44.137 -3.115  -31.216 1.00 25.04  ? 284 ARG A CB    1 
ATOM   2269 C  CG    . ARG A 1 282 ? 45.447 -2.328  -31.067 1.00 28.28  ? 284 ARG A CG    1 
ATOM   2270 C  CD    . ARG A 1 282 ? 46.047 -1.939  -32.412 1.00 32.78  ? 284 ARG A CD    1 
ATOM   2271 N  NE    . ARG A 1 282 ? 46.646 -0.604  -32.352 1.00 38.04  ? 284 ARG A NE    1 
ATOM   2272 C  CZ    . ARG A 1 282 ? 45.974 0.534   -32.546 1.00 40.59  ? 284 ARG A CZ    1 
ATOM   2273 N  NH1   . ARG A 1 282 ? 44.670 0.513   -32.812 1.00 42.72  ? 284 ARG A NH1   1 
ATOM   2274 N  NH2   . ARG A 1 282 ? 46.601 1.699   -32.465 1.00 42.42  ? 284 ARG A NH2   1 
ATOM   2275 N  N     . LYS A 1 283 ? 40.878 -2.781  -30.362 1.00 22.79  ? 285 LYS A N     1 
ATOM   2276 C  CA    . LYS A 1 283 ? 39.528 -3.258  -30.635 1.00 22.38  ? 285 LYS A CA    1 
ATOM   2277 C  C     . LYS A 1 283 ? 39.475 -3.952  -31.998 1.00 22.10  ? 285 LYS A C     1 
ATOM   2278 O  O     . LYS A 1 283 ? 39.876 -3.361  -32.997 1.00 22.43  ? 285 LYS A O     1 
ATOM   2279 C  CB    . LYS A 1 283 ? 38.515 -2.117  -30.602 1.00 23.01  ? 285 LYS A CB    1 
ATOM   2280 C  CG    . LYS A 1 283 ? 37.079 -2.588  -30.755 1.00 24.34  ? 285 LYS A CG    1 
ATOM   2281 C  CD    . LYS A 1 283 ? 36.086 -1.454  -30.617 1.00 26.43  ? 285 LYS A CD    1 
ATOM   2282 C  CE    . LYS A 1 283 ? 35.943 -0.683  -31.903 1.00 29.57  ? 285 LYS A CE    1 
ATOM   2283 N  NZ    . LYS A 1 283 ? 34.814 0.299   -31.800 1.00 32.60  ? 285 LYS A NZ    1 
ATOM   2284 N  N     . PRO A 1 284 ? 38.988 -5.215  -32.034 1.00 21.32  ? 286 PRO A N     1 
ATOM   2285 C  CA    . PRO A 1 284 ? 38.721 -5.884  -33.309 1.00 21.68  ? 286 PRO A CA    1 
ATOM   2286 C  C     . PRO A 1 284 ? 37.677 -5.081  -34.099 1.00 21.67  ? 286 PRO A C     1 
ATOM   2287 O  O     . PRO A 1 284 ? 36.743 -4.550  -33.488 1.00 20.75  ? 286 PRO A O     1 
ATOM   2288 C  CB    . PRO A 1 284 ? 38.126 -7.233  -32.886 1.00 21.48  ? 286 PRO A CB    1 
ATOM   2289 C  CG    . PRO A 1 284 ? 38.514 -7.425  -31.472 1.00 20.83  ? 286 PRO A CG    1 
ATOM   2290 C  CD    . PRO A 1 284 ? 38.655 -6.066  -30.875 1.00 20.70  ? 286 PRO A CD    1 
ATOM   2291 N  N     . ASP A 1 285 ? 37.855 -4.975  -35.423 1.00 21.91  ? 287 ASP A N     1 
ATOM   2292 C  CA    . ASP A 1 285 ? 36.949 -4.207  -36.292 1.00 22.54  ? 287 ASP A CA    1 
ATOM   2293 C  C     . ASP A 1 285 ? 35.719 -5.051  -36.641 1.00 21.93  ? 287 ASP A C     1 
ATOM   2294 O  O     . ASP A 1 285 ? 35.590 -5.547  -37.759 1.00 22.20  ? 287 ASP A O     1 
ATOM   2295 C  CB    . ASP A 1 285 ? 37.684 -3.748  -37.570 1.00 24.17  ? 287 ASP A CB    1 
ATOM   2296 C  CG    . ASP A 1 285 ? 36.805 -2.914  -38.502 1.00 26.78  ? 287 ASP A CG    1 
ATOM   2297 O  OD1   . ASP A 1 285 ? 35.776 -2.359  -38.052 1.00 29.46  ? 287 ASP A OD1   1 
ATOM   2298 O  OD2   . ASP A 1 285 ? 37.137 -2.823  -39.701 1.00 29.28  ? 287 ASP A OD2   1 
ATOM   2299 N  N     . ILE A 1 286 ? 34.839 -5.224  -35.655 1.00 20.78  ? 288 ILE A N     1 
ATOM   2300 C  CA    . ILE A 1 286 ? 33.655 -6.092  -35.751 1.00 20.52  ? 288 ILE A CA    1 
ATOM   2301 C  C     . ILE A 1 286 ? 32.444 -5.392  -35.134 1.00 20.25  ? 288 ILE A C     1 
ATOM   2302 O  O     . ILE A 1 286 ? 32.617 -4.440  -34.355 1.00 19.75  ? 288 ILE A O     1 
ATOM   2303 C  CB    . ILE A 1 286 ? 33.903 -7.470  -35.034 1.00 19.64  ? 288 ILE A CB    1 
ATOM   2304 C  CG1   . ILE A 1 286 ? 34.031 -7.292  -33.507 1.00 18.09  ? 288 ILE A CG1   1 
ATOM   2305 C  CG2   . ILE A 1 286 ? 35.109 -8.198  -35.658 1.00 20.07  ? 288 ILE A CG2   1 
ATOM   2306 C  CD1   . ILE A 1 286 ? 34.497 -8.516  -32.753 1.00 18.03  ? 288 ILE A CD1   1 
ATOM   2307 N  N     . VAL A 1 287 ? 31.232 -5.850  -35.467 1.00 20.53  ? 289 VAL A N     1 
ATOM   2308 C  CA    . VAL A 1 287 ? 30.002 -5.247  -34.907 1.00 20.64  ? 289 VAL A CA    1 
ATOM   2309 C  C     . VAL A 1 287 ? 29.868 -5.449  -33.393 1.00 20.00  ? 289 VAL A C     1 
ATOM   2310 O  O     . VAL A 1 287 ? 30.410 -6.409  -32.841 1.00 19.93  ? 289 VAL A O     1 
ATOM   2311 C  CB    . VAL A 1 287 ? 28.665 -5.694  -35.645 1.00 21.69  ? 289 VAL A CB    1 
ATOM   2312 C  CG1   . VAL A 1 287 ? 28.618 -5.187  -37.105 1.00 22.32  ? 289 VAL A CG1   1 
ATOM   2313 C  CG2   . VAL A 1 287 ? 28.444 -7.190  -35.565 1.00 21.17  ? 289 VAL A CG2   1 
ATOM   2314 N  N     . ASP A 1 288 ? 29.159 -4.535  -32.731 1.00 20.37  ? 290 ASP A N     1 
ATOM   2315 C  CA    . ASP A 1 288 ? 28.919 -4.600  -31.279 1.00 20.06  ? 290 ASP A CA    1 
ATOM   2316 C  C     . ASP A 1 288 ? 28.389 -5.962  -30.823 1.00 19.92  ? 290 ASP A C     1 
ATOM   2317 O  O     . ASP A 1 288 ? 28.753 -6.472  -29.756 1.00 19.15  ? 290 ASP A O     1 
ATOM   2318 C  CB    . ASP A 1 288 ? 27.886 -3.557  -30.878 1.00 20.96  ? 290 ASP A CB    1 
ATOM   2319 C  CG    . ASP A 1 288 ? 28.442 -2.157  -30.845 1.00 23.08  ? 290 ASP A CG    1 
ATOM   2320 O  OD1   . ASP A 1 288 ? 29.647 -1.983  -31.123 1.00 24.52  ? 290 ASP A OD1   1 
ATOM   2321 O  OD2   . ASP A 1 288 ? 27.667 -1.232  -30.515 1.00 24.40  ? 290 ASP A OD2   1 
ATOM   2322 N  N     . ASP A 1 289 ? 27.502 -6.521  -31.638 1.00 20.50  ? 291 ASP A N     1 
ATOM   2323 C  CA    . ASP A 1 289 ? 26.798 -7.738  -31.303 1.00 20.56  ? 291 ASP A CA    1 
ATOM   2324 C  C     . ASP A 1 289 ? 27.702 -8.957  -31.333 1.00 20.08  ? 291 ASP A C     1 
ATOM   2325 O  O     . ASP A 1 289 ? 27.397 -9.971  -30.699 1.00 19.90  ? 291 ASP A O     1 
ATOM   2326 C  CB    . ASP A 1 289 ? 25.556 -7.864  -32.184 1.00 21.48  ? 291 ASP A CB    1 
ATOM   2327 C  CG    . ASP A 1 289 ? 24.725 -6.601  -32.151 1.00 21.87  ? 291 ASP A CG    1 
ATOM   2328 O  OD1   . ASP A 1 289 ? 24.951 -5.725  -33.016 1.00 22.13  ? 291 ASP A OD1   1 
ATOM   2329 O  OD2   . ASP A 1 289 ? 23.893 -6.446  -31.227 1.00 22.29  ? 291 ASP A OD2   1 
ATOM   2330 N  N     . ASN A 1 290 ? 28.831 -8.827  -32.030 1.00 19.93  ? 292 ASN A N     1 
ATOM   2331 C  CA    . ASN A 1 290 ? 29.919 -9.802  -31.961 1.00 19.49  ? 292 ASN A CA    1 
ATOM   2332 C  C     . ASN A 1 290 ? 30.909 -9.469  -30.847 1.00 18.87  ? 292 ASN A C     1 
ATOM   2333 O  O     . ASN A 1 290 ? 31.317 -10.354 -30.085 1.00 17.92  ? 292 ASN A O     1 
ATOM   2334 C  CB    . ASN A 1 290 ? 30.640 -9.932  -33.316 1.00 19.73  ? 292 ASN A CB    1 
ATOM   2335 C  CG    . ASN A 1 290 ? 29.778 -10.614 -34.372 1.00 20.96  ? 292 ASN A CG    1 
ATOM   2336 O  OD1   . ASN A 1 290 ? 28.802 -11.313 -34.052 1.00 22.19  ? 292 ASN A OD1   1 
ATOM   2337 N  ND2   . ASN A 1 290 ? 30.136 -10.423 -35.636 1.00 19.78  ? 292 ASN A ND2   1 
ATOM   2338 N  N     . LEU A 1 291 ? 31.258 -8.187  -30.731 1.00 18.82  ? 293 LEU A N     1 
ATOM   2339 C  CA    . LEU A 1 291 ? 32.283 -7.754  -29.782 1.00 18.05  ? 293 LEU A CA    1 
ATOM   2340 C  C     . LEU A 1 291 ? 31.929 -7.975  -28.307 1.00 18.19  ? 293 LEU A C     1 
ATOM   2341 O  O     . LEU A 1 291 ? 32.736 -8.526  -27.555 1.00 17.43  ? 293 LEU A O     1 
ATOM   2342 C  CB    . LEU A 1 291 ? 32.654 -6.284  -30.016 1.00 18.31  ? 293 LEU A CB    1 
ATOM   2343 C  CG    . LEU A 1 291 ? 33.656 -5.633  -29.052 1.00 17.37  ? 293 LEU A CG    1 
ATOM   2344 C  CD1   . LEU A 1 291 ? 35.023 -6.300  -29.156 1.00 17.57  ? 293 LEU A CD1   1 
ATOM   2345 C  CD2   . LEU A 1 291 ? 33.748 -4.113  -29.302 1.00 17.87  ? 293 LEU A CD2   1 
ATOM   2346 N  N     . TYR A 1 292 ? 30.727 -7.564  -27.900 1.00 19.20  ? 294 TYR A N     1 
ATOM   2347 C  CA    . TYR A 1 292 ? 30.402 -7.502  -26.478 1.00 19.75  ? 294 TYR A CA    1 
ATOM   2348 C  C     . TYR A 1 292 ? 30.373 -8.834  -25.761 1.00 19.46  ? 294 TYR A C     1 
ATOM   2349 O  O     . TYR A 1 292 ? 30.991 -8.944  -24.689 1.00 19.56  ? 294 TYR A O     1 
ATOM   2350 C  CB    . TYR A 1 292 ? 29.165 -6.647  -26.204 1.00 20.67  ? 294 TYR A CB    1 
ATOM   2351 C  CG    . TYR A 1 292 ? 29.521 -5.174  -26.194 1.00 21.76  ? 294 TYR A CG    1 
ATOM   2352 C  CD1   . TYR A 1 292 ? 29.589 -4.449  -27.381 1.00 23.21  ? 294 TYR A CD1   1 
ATOM   2353 C  CD2   . TYR A 1 292 ? 29.805 -4.510  -25.002 1.00 22.38  ? 294 TYR A CD2   1 
ATOM   2354 C  CE1   . TYR A 1 292 ? 29.927 -3.107  -27.389 1.00 22.87  ? 294 TYR A CE1   1 
ATOM   2355 C  CE2   . TYR A 1 292 ? 30.155 -3.154  -24.999 1.00 23.06  ? 294 TYR A CE2   1 
ATOM   2356 C  CZ    . TYR A 1 292 ? 30.211 -2.467  -26.202 1.00 22.59  ? 294 TYR A CZ    1 
ATOM   2357 O  OH    . TYR A 1 292 ? 30.546 -1.136  -26.227 1.00 23.60  ? 294 TYR A OH    1 
ATOM   2358 N  N     . PRO A 1 293 ? 29.717 -9.860  -26.356 1.00 20.03  ? 295 PRO A N     1 
ATOM   2359 C  CA    . PRO A 1 293 ? 29.822 -11.206 -25.772 1.00 19.90  ? 295 PRO A CA    1 
ATOM   2360 C  C     . PRO A 1 293 ? 31.267 -11.700 -25.663 1.00 19.00  ? 295 PRO A C     1 
ATOM   2361 O  O     . PRO A 1 293 ? 31.578 -12.440 -24.740 1.00 19.08  ? 295 PRO A O     1 
ATOM   2362 C  CB    . PRO A 1 293 ? 29.004 -12.075 -26.733 1.00 21.14  ? 295 PRO A CB    1 
ATOM   2363 C  CG    . PRO A 1 293 ? 28.039 -11.117 -27.362 1.00 21.33  ? 295 PRO A CG    1 
ATOM   2364 C  CD    . PRO A 1 293 ? 28.835 -9.864  -27.543 1.00 20.40  ? 295 PRO A CD    1 
ATOM   2365 N  N     . GLN A 1 294 ? 32.145 -11.275 -26.574 1.00 18.67  ? 296 GLN A N     1 
ATOM   2366 C  CA    . GLN A 1 294 ? 33.551 -11.660 -26.484 1.00 17.60  ? 296 GLN A CA    1 
ATOM   2367 C  C     . GLN A 1 294 ? 34.269 -10.932 -25.339 1.00 17.24  ? 296 GLN A C     1 
ATOM   2368 O  O     . GLN A 1 294 ? 35.097 -11.523 -24.661 1.00 17.40  ? 296 GLN A O     1 
ATOM   2369 C  CB    . GLN A 1 294 ? 34.278 -11.463 -27.814 1.00 17.52  ? 296 GLN A CB    1 
ATOM   2370 C  CG    . GLN A 1 294 ? 33.868 -12.466 -28.924 1.00 17.59  ? 296 GLN A CG    1 
ATOM   2371 C  CD    . GLN A 1 294 ? 34.591 -12.195 -30.224 1.00 18.16  ? 296 GLN A CD    1 
ATOM   2372 O  OE1   . GLN A 1 294 ? 35.800 -11.913 -30.229 1.00 17.51  ? 296 GLN A OE1   1 
ATOM   2373 N  NE2   . GLN A 1 294 ? 33.865 -12.266 -31.333 1.00 18.23  ? 296 GLN A NE2   1 
ATOM   2374 N  N     . LEU A 1 295 ? 33.934 -9.659  -25.129 1.00 17.26  ? 297 LEU A N     1 
ATOM   2375 C  CA    . LEU A 1 295 ? 34.472 -8.872  -24.017 1.00 17.01  ? 297 LEU A CA    1 
ATOM   2376 C  C     . LEU A 1 295 ? 33.992 -9.431  -22.670 1.00 17.31  ? 297 LEU A C     1 
ATOM   2377 O  O     . LEU A 1 295 ? 34.760 -9.507  -21.703 1.00 17.41  ? 297 LEU A O     1 
ATOM   2378 C  CB    . LEU A 1 295 ? 34.079 -7.395  -24.164 1.00 16.46  ? 297 LEU A CB    1 
ATOM   2379 C  CG    . LEU A 1 295 ? 34.705 -6.563  -25.285 1.00 17.22  ? 297 LEU A CG    1 
ATOM   2380 C  CD1   . LEU A 1 295 ? 34.187 -5.127  -25.192 1.00 16.15  ? 297 LEU A CD1   1 
ATOM   2381 C  CD2   . LEU A 1 295 ? 36.240 -6.594  -25.206 1.00 14.52  ? 297 LEU A CD2   1 
ATOM   2382 N  N     . GLU A 1 296 ? 32.723 -9.812  -22.623 1.00 18.26  ? 298 GLU A N     1 
ATOM   2383 C  CA    . GLU A 1 296 ? 32.150 -10.549 -21.500 1.00 19.14  ? 298 GLU A CA    1 
ATOM   2384 C  C     . GLU A 1 296 ? 32.886 -11.863 -21.201 1.00 18.77  ? 298 GLU A C     1 
ATOM   2385 O  O     . GLU A 1 296 ? 33.189 -12.139 -20.038 1.00 18.32  ? 298 GLU A O     1 
ATOM   2386 C  CB    . GLU A 1 296 ? 30.680 -10.860 -21.775 1.00 19.90  ? 298 GLU A CB    1 
ATOM   2387 C  CG    . GLU A 1 296 ? 29.766 -9.670  -21.714 1.00 21.82  ? 298 GLU A CG    1 
ATOM   2388 C  CD    . GLU A 1 296 ? 28.316 -10.016 -22.070 1.00 22.54  ? 298 GLU A CD    1 
ATOM   2389 O  OE1   . GLU A 1 296 ? 28.072 -11.056 -22.729 1.00 27.01  ? 298 GLU A OE1   1 
ATOM   2390 O  OE2   . GLU A 1 296 ? 27.415 -9.239  -21.688 1.00 26.13  ? 298 GLU A OE2   1 
ATOM   2391 N  N     . ARG A 1 297 ? 33.153 -12.667 -22.233 1.00 18.67  ? 299 ARG A N     1 
ATOM   2392 C  CA    . ARG A 1 297 ? 33.880 -13.935 -22.067 1.00 19.26  ? 299 ARG A CA    1 
ATOM   2393 C  C     . ARG A 1 297 ? 35.300 -13.729 -21.550 1.00 18.70  ? 299 ARG A C     1 
ATOM   2394 O  O     . ARG A 1 297 ? 35.696 -14.334 -20.554 1.00 18.32  ? 299 ARG A O     1 
ATOM   2395 C  CB    . ARG A 1 297 ? 33.948 -14.759 -23.370 1.00 19.69  ? 299 ARG A CB    1 
ATOM   2396 C  CG    . ARG A 1 297 ? 34.567 -16.147 -23.135 1.00 20.59  ? 299 ARG A CG    1 
ATOM   2397 C  CD    . ARG A 1 297 ? 35.029 -16.911 -24.373 1.00 21.65  ? 299 ARG A CD    1 
ATOM   2398 N  NE    . ARG A 1 297 ? 34.694 -18.324 -24.210 1.00 28.57  ? 299 ARG A NE    1 
ATOM   2399 C  CZ    . ARG A 1 297 ? 35.452 -19.261 -23.642 1.00 31.69  ? 299 ARG A CZ    1 
ATOM   2400 N  NH1   . ARG A 1 297 ? 36.668 -18.998 -23.186 1.00 33.95  ? 299 ARG A NH1   1 
ATOM   2401 N  NH2   . ARG A 1 297 ? 34.992 -20.494 -23.549 1.00 34.57  ? 299 ARG A NH2   1 
ATOM   2402 N  N     . ALA A 1 298 ? 36.061 -12.894 -22.251 1.00 18.53  ? 300 ALA A N     1 
ATOM   2403 C  CA    . ALA A 1 298 ? 37.434 -12.581 -21.869 1.00 18.95  ? 300 ALA A CA    1 
ATOM   2404 C  C     . ALA A 1 298 ? 37.507 -12.079 -20.422 1.00 18.96  ? 300 ALA A C     1 
ATOM   2405 O  O     . ALA A 1 298 ? 38.386 -12.488 -19.663 1.00 19.56  ? 300 ALA A O     1 
ATOM   2406 C  CB    . ALA A 1 298 ? 38.016 -11.546 -22.805 1.00 18.11  ? 300 ALA A CB    1 
ATOM   2407 N  N     . SER A 1 299 ? 36.588 -11.187 -20.056 1.00 19.26  ? 301 SER A N     1 
ATOM   2408 C  CA    . SER A 1 299 ? 36.513 -10.654 -18.700 1.00 19.93  ? 301 SER A CA    1 
ATOM   2409 C  C     . SER A 1 299 ? 36.259 -11.773 -17.673 1.00 19.75  ? 301 SER A C     1 
ATOM   2410 O  O     . SER A 1 299 ? 36.910 -11.832 -16.629 1.00 18.86  ? 301 SER A O     1 
ATOM   2411 C  CB    . SER A 1 299 ? 35.428 -9.585  -18.614 1.00 20.07  ? 301 SER A CB    1 
ATOM   2412 O  OG    . SER A 1 299 ? 35.369 -9.061  -17.303 1.00 24.57  ? 301 SER A OG    1 
ATOM   2413 N  N     . ARG A 1 300 ? 35.334 -12.672 -17.997 1.00 20.09  ? 302 ARG A N     1 
ATOM   2414 C  CA    . ARG A 1 300 ? 34.983 -13.770 -17.106 1.00 20.87  ? 302 ARG A CA    1 
ATOM   2415 C  C     . ARG A 1 300 ? 36.106 -14.790 -16.953 1.00 20.47  ? 302 ARG A C     1 
ATOM   2416 O  O     . ARG A 1 300 ? 36.385 -15.242 -15.846 1.00 20.55  ? 302 ARG A O     1 
ATOM   2417 C  CB    . ARG A 1 300 ? 33.730 -14.478 -17.616 1.00 22.00  ? 302 ARG A CB    1 
ATOM   2418 C  CG    . ARG A 1 300 ? 33.042 -15.314 -16.561 1.00 24.04  ? 302 ARG A CG    1 
ATOM   2419 C  CD    . ARG A 1 300 ? 32.009 -16.199 -17.218 1.00 28.75  ? 302 ARG A CD    1 
ATOM   2420 N  NE    . ARG A 1 300 ? 32.532 -17.553 -17.344 1.00 32.84  ? 302 ARG A NE    1 
ATOM   2421 C  CZ    . ARG A 1 300 ? 32.756 -18.189 -18.484 1.00 33.16  ? 302 ARG A CZ    1 
ATOM   2422 N  NH1   . ARG A 1 300 ? 32.481 -17.623 -19.650 1.00 32.75  ? 302 ARG A NH1   1 
ATOM   2423 N  NH2   . ARG A 1 300 ? 33.241 -19.420 -18.440 1.00 35.50  ? 302 ARG A NH2   1 
ATOM   2424 N  N     . LYS A 1 301 ? 36.737 -15.165 -18.065 1.00 20.15  ? 303 LYS A N     1 
ATOM   2425 C  CA    . LYS A 1 301 ? 37.831 -16.128 -18.018 1.00 19.80  ? 303 LYS A CA    1 
ATOM   2426 C  C     . LYS A 1 301 ? 39.000 -15.640 -17.158 1.00 19.41  ? 303 LYS A C     1 
ATOM   2427 O  O     . LYS A 1 301 ? 39.569 -16.418 -16.390 1.00 19.28  ? 303 LYS A O     1 
ATOM   2428 C  CB    . LYS A 1 301 ? 38.307 -16.491 -19.423 1.00 20.23  ? 303 LYS A CB    1 
ATOM   2429 C  CG    . LYS A 1 301 ? 37.255 -17.210 -20.282 1.00 20.56  ? 303 LYS A CG    1 
ATOM   2430 C  CD    . LYS A 1 301 ? 36.783 -18.518 -19.656 1.00 22.23  ? 303 LYS A CD    1 
ATOM   2431 C  CE    . LYS A 1 301 ? 37.793 -19.623 -19.846 1.00 22.81  ? 303 LYS A CE    1 
ATOM   2432 N  NZ    . LYS A 1 301 ? 37.306 -20.897 -19.245 1.00 26.45  ? 303 LYS A NZ    1 
ATOM   2433 N  N     . ILE A 1 302 ? 39.340 -14.359 -17.289 1.00 18.63  ? 304 ILE A N     1 
ATOM   2434 C  CA    . ILE A 1 302 ? 40.415 -13.748 -16.495 1.00 18.70  ? 304 ILE A CA    1 
ATOM   2435 C  C     . ILE A 1 302 ? 40.034 -13.619 -15.015 1.00 18.36  ? 304 ILE A C     1 
ATOM   2436 O  O     . ILE A 1 302 ? 40.872 -13.849 -14.151 1.00 18.51  ? 304 ILE A O     1 
ATOM   2437 C  CB    . ILE A 1 302 ? 40.852 -12.383 -17.065 1.00 18.40  ? 304 ILE A CB    1 
ATOM   2438 C  CG1   . ILE A 1 302 ? 41.364 -12.552 -18.500 1.00 19.50  ? 304 ILE A CG1   1 
ATOM   2439 C  CG2   . ILE A 1 302 ? 41.935 -11.723 -16.173 1.00 17.98  ? 304 ILE A CG2   1 
ATOM   2440 C  CD1   . ILE A 1 302 ? 41.610 -11.239 -19.246 1.00 18.57  ? 304 ILE A CD1   1 
ATOM   2441 N  N     . PHE A 1 303 ? 38.774 -13.267 -14.745 1.00 18.39  ? 305 PHE A N     1 
ATOM   2442 C  CA    . PHE A 1 303 ? 38.235 -13.193 -13.389 1.00 18.61  ? 305 PHE A CA    1 
ATOM   2443 C  C     . PHE A 1 303 ? 38.349 -14.555 -12.702 1.00 18.90  ? 305 PHE A C     1 
ATOM   2444 O  O     . PHE A 1 303 ? 38.781 -14.645 -11.550 1.00 19.01  ? 305 PHE A O     1 
ATOM   2445 C  CB    . PHE A 1 303 ? 36.766 -12.755 -13.416 1.00 19.33  ? 305 PHE A CB    1 
ATOM   2446 C  CG    . PHE A 1 303 ? 36.221 -12.334 -12.068 1.00 21.03  ? 305 PHE A CG    1 
ATOM   2447 C  CD1   . PHE A 1 303 ? 36.230 -10.991 -11.686 1.00 21.01  ? 305 PHE A CD1   1 
ATOM   2448 C  CD2   . PHE A 1 303 ? 35.702 -13.277 -11.176 1.00 22.86  ? 305 PHE A CD2   1 
ATOM   2449 C  CE1   . PHE A 1 303 ? 35.716 -10.600 -10.444 1.00 20.53  ? 305 PHE A CE1   1 
ATOM   2450 C  CE2   . PHE A 1 303 ? 35.196 -12.890 -9.921  1.00 22.00  ? 305 PHE A CE2   1 
ATOM   2451 C  CZ    . PHE A 1 303 ? 35.210 -11.559 -9.559  1.00 21.04  ? 305 PHE A CZ    1 
ATOM   2452 N  N     . GLU A 1 304 ? 37.960 -15.603 -13.420 1.00 18.51  ? 306 GLU A N     1 
ATOM   2453 C  CA    . GLU A 1 304 ? 37.982 -16.956 -12.896 1.00 18.81  ? 306 GLU A CA    1 
ATOM   2454 C  C     . GLU A 1 304 ? 39.394 -17.433 -12.624 1.00 18.15  ? 306 GLU A C     1 
ATOM   2455 O  O     . GLU A 1 304 ? 39.628 -18.141 -11.648 1.00 17.61  ? 306 GLU A O     1 
ATOM   2456 C  CB    . GLU A 1 304 ? 37.234 -17.907 -13.829 1.00 19.71  ? 306 GLU A CB    1 
ATOM   2457 C  CG    . GLU A 1 304 ? 35.720 -17.688 -13.763 1.00 21.39  ? 306 GLU A CG    1 
ATOM   2458 C  CD    . GLU A 1 304 ? 34.947 -18.427 -14.820 1.00 25.85  ? 306 GLU A CD    1 
ATOM   2459 O  OE1   . GLU A 1 304 ? 35.553 -19.113 -15.677 1.00 27.81  ? 306 GLU A OE1   1 
ATOM   2460 O  OE2   . GLU A 1 304 ? 33.706 -18.307 -14.789 1.00 27.96  ? 306 GLU A OE2   1 
ATOM   2461 N  N     . PHE A 1 305 ? 40.323 -17.041 -13.495 1.00 17.55  ? 307 PHE A N     1 
ATOM   2462 C  CA    . PHE A 1 305 ? 41.733 -17.267 -13.261 1.00 17.62  ? 307 PHE A CA    1 
ATOM   2463 C  C     . PHE A 1 305 ? 42.144 -16.567 -11.967 1.00 18.23  ? 307 PHE A C     1 
ATOM   2464 O  O     . PHE A 1 305 ? 42.779 -17.178 -11.117 1.00 18.65  ? 307 PHE A O     1 
ATOM   2465 C  CB    . PHE A 1 305 ? 42.577 -16.765 -14.438 1.00 17.30  ? 307 PHE A CB    1 
ATOM   2466 C  CG    . PHE A 1 305 ? 44.021 -16.559 -14.093 1.00 17.12  ? 307 PHE A CG    1 
ATOM   2467 C  CD1   . PHE A 1 305 ? 44.902 -17.628 -14.079 1.00 18.40  ? 307 PHE A CD1   1 
ATOM   2468 C  CD2   . PHE A 1 305 ? 44.498 -15.291 -13.752 1.00 18.76  ? 307 PHE A CD2   1 
ATOM   2469 C  CE1   . PHE A 1 305 ? 46.250 -17.450 -13.737 1.00 18.49  ? 307 PHE A CE1   1 
ATOM   2470 C  CE2   . PHE A 1 305 ? 45.835 -15.103 -13.399 1.00 18.79  ? 307 PHE A CE2   1 
ATOM   2471 C  CZ    . PHE A 1 305 ? 46.715 -16.186 -13.407 1.00 18.37  ? 307 PHE A CZ    1 
ATOM   2472 N  N     . LEU A 1 306 ? 41.774 -15.287 -11.830 1.00 18.10  ? 308 LEU A N     1 
ATOM   2473 C  CA    . LEU A 1 306 ? 42.078 -14.510 -10.628 1.00 18.40  ? 308 LEU A CA    1 
ATOM   2474 C  C     . LEU A 1 306 ? 41.498 -15.134 -9.361  1.00 19.11  ? 308 LEU A C     1 
ATOM   2475 O  O     . LEU A 1 306 ? 42.176 -15.154 -8.340  1.00 18.90  ? 308 LEU A O     1 
ATOM   2476 C  CB    . LEU A 1 306 ? 41.638 -13.039 -10.767 1.00 17.81  ? 308 LEU A CB    1 
ATOM   2477 C  CG    . LEU A 1 306 ? 42.422 -12.177 -11.766 1.00 18.00  ? 308 LEU A CG    1 
ATOM   2478 C  CD1   . LEU A 1 306 ? 41.635 -10.925 -12.094 1.00 16.89  ? 308 LEU A CD1   1 
ATOM   2479 C  CD2   . LEU A 1 306 ? 43.848 -11.857 -11.265 1.00 16.70  ? 308 LEU A CD2   1 
ATOM   2480 N  N     . GLU A 1 307 ? 40.275 -15.668 -9.421  1.00 19.80  ? 309 GLU A N     1 
ATOM   2481 C  CA    . GLU A 1 307 ? 39.724 -16.355 -8.243  1.00 21.44  ? 309 GLU A CA    1 
ATOM   2482 C  C     . GLU A 1 307 ? 40.427 -17.639 -7.855  1.00 21.86  ? 309 GLU A C     1 
ATOM   2483 O  O     . GLU A 1 307 ? 40.787 -17.803 -6.686  1.00 22.08  ? 309 GLU A O     1 
ATOM   2484 C  CB    . GLU A 1 307 ? 38.198 -16.550 -8.224  1.00 21.40  ? 309 GLU A CB    1 
ATOM   2485 C  CG    . GLU A 1 307 ? 37.410 -16.230 -9.446  1.00 23.80  ? 309 GLU A CG    1 
ATOM   2486 C  CD    . GLU A 1 307 ? 35.941 -16.606 -9.272  1.00 24.46  ? 309 GLU A CD    1 
ATOM   2487 O  OE1   . GLU A 1 307 ? 35.275 -16.911 -10.283 1.00 30.29  ? 309 GLU A OE1   1 
ATOM   2488 O  OE2   . GLU A 1 307 ? 35.462 -16.626 -8.119  1.00 28.00  ? 309 GLU A OE2   1 
ATOM   2489 N  N     . ARG A 1 308 ? 40.641 -18.545 -8.808  1.00 21.65  ? 310 ARG A N     1 
ATOM   2490 C  CA    . ARG A 1 308 ? 41.334 -19.789 -8.473  1.00 22.40  ? 310 ARG A CA    1 
ATOM   2491 C  C     . ARG A 1 308 ? 42.811 -19.546 -8.120  1.00 21.99  ? 310 ARG A C     1 
ATOM   2492 O  O     . ARG A 1 308 ? 43.440 -20.401 -7.509  1.00 21.95  ? 310 ARG A O     1 
ATOM   2493 C  CB    . ARG A 1 308 ? 41.172 -20.860 -9.567  1.00 23.03  ? 310 ARG A CB    1 
ATOM   2494 C  CG    . ARG A 1 308 ? 41.907 -20.578 -10.863 1.00 23.35  ? 310 ARG A CG    1 
ATOM   2495 C  CD    . ARG A 1 308 ? 41.672 -21.691 -11.901 1.00 23.86  ? 310 ARG A CD    1 
ATOM   2496 N  NE    . ARG A 1 308 ? 42.214 -21.269 -13.193 1.00 24.22  ? 310 ARG A NE    1 
ATOM   2497 C  CZ    . ARG A 1 308 ? 41.525 -20.636 -14.142 1.00 23.82  ? 310 ARG A CZ    1 
ATOM   2498 N  NH1   . ARG A 1 308 ? 40.229 -20.363 -13.990 1.00 22.96  ? 310 ARG A NH1   1 
ATOM   2499 N  NH2   . ARG A 1 308 ? 42.138 -20.283 -15.259 1.00 23.12  ? 310 ARG A NH2   1 
ATOM   2500 N  N     . GLU A 1 309 ? 43.349 -18.378 -8.483  1.00 20.99  ? 311 GLU A N     1 
ATOM   2501 C  CA    . GLU A 1 309 ? 44.728 -18.009 -8.080  1.00 21.55  ? 311 GLU A CA    1 
ATOM   2502 C  C     . GLU A 1 309 ? 44.794 -17.298 -6.730  1.00 21.29  ? 311 GLU A C     1 
ATOM   2503 O  O     . GLU A 1 309 ? 45.870 -16.873 -6.297  1.00 21.80  ? 311 GLU A O     1 
ATOM   2504 C  CB    . GLU A 1 309 ? 45.458 -17.174 -9.145  1.00 21.21  ? 311 GLU A CB    1 
ATOM   2505 C  CG    . GLU A 1 309 ? 45.959 -17.962 -10.379 1.00 22.51  ? 311 GLU A CG    1 
ATOM   2506 C  CD    . GLU A 1 309 ? 46.773 -19.204 -10.044 1.00 24.08  ? 311 GLU A CD    1 
ATOM   2507 O  OE1   . GLU A 1 309 ? 46.661 -20.201 -10.786 1.00 24.16  ? 311 GLU A OE1   1 
ATOM   2508 O  OE2   . GLU A 1 309 ? 47.524 -19.198 -9.047  1.00 26.18  ? 311 GLU A OE2   1 
ATOM   2509 N  N     . ASN A 1 310 ? 43.649 -17.189 -6.061  1.00 20.79  ? 312 ASN A N     1 
ATOM   2510 C  CA    . ASN A 1 310 ? 43.585 -16.582 -4.723  1.00 20.84  ? 312 ASN A CA    1 
ATOM   2511 C  C     . ASN A 1 310 ? 43.940 -15.082 -4.641  1.00 20.15  ? 312 ASN A C     1 
ATOM   2512 O  O     . ASN A 1 310 ? 44.433 -14.611 -3.611  1.00 20.53  ? 312 ASN A O     1 
ATOM   2513 C  CB    . ASN A 1 310 ? 44.418 -17.396 -3.726  1.00 21.76  ? 312 ASN A CB    1 
ATOM   2514 C  CG    . ASN A 1 310 ? 43.784 -18.716 -3.415  1.00 22.54  ? 312 ASN A CG    1 
ATOM   2515 O  OD1   . ASN A 1 310 ? 44.326 -19.762 -3.742  1.00 24.38  ? 312 ASN A OD1   1 
ATOM   2516 N  ND2   . ASN A 1 310 ? 42.593 -18.677 -2.825  1.00 23.13  ? 312 ASN A ND2   1 
ATOM   2517 N  N     . PHE A 1 311 ? 43.668 -14.337 -5.709  1.00 18.87  ? 313 PHE A N     1 
ATOM   2518 C  CA    . PHE A 1 311 ? 43.833 -12.884 -5.673  1.00 18.45  ? 313 PHE A CA    1 
ATOM   2519 C  C     . PHE A 1 311 ? 42.565 -12.174 -5.197  1.00 18.59  ? 313 PHE A C     1 
ATOM   2520 O  O     . PHE A 1 311 ? 42.546 -10.942 -5.058  1.00 18.82  ? 313 PHE A O     1 
ATOM   2521 C  CB    . PHE A 1 311 ? 44.332 -12.345 -7.021  1.00 17.78  ? 313 PHE A CB    1 
ATOM   2522 C  CG    . PHE A 1 311 ? 45.748 -12.747 -7.333  1.00 19.08  ? 313 PHE A CG    1 
ATOM   2523 C  CD1   . PHE A 1 311 ? 46.801 -12.296 -6.541  1.00 17.97  ? 313 PHE A CD1   1 
ATOM   2524 C  CD2   . PHE A 1 311 ? 46.028 -13.615 -8.389  1.00 19.94  ? 313 PHE A CD2   1 
ATOM   2525 C  CE1   . PHE A 1 311 ? 48.120 -12.685 -6.809  1.00 19.30  ? 313 PHE A CE1   1 
ATOM   2526 C  CE2   . PHE A 1 311 ? 47.349 -14.012 -8.658  1.00 19.51  ? 313 PHE A CE2   1 
ATOM   2527 C  CZ    . PHE A 1 311 ? 48.384 -13.543 -7.872  1.00 19.42  ? 313 PHE A CZ    1 
ATOM   2528 N  N     . MET A 1 312 ? 41.526 -12.963 -4.927  1.00 18.21  ? 314 MET A N     1 
ATOM   2529 C  CA    . MET A 1 312 ? 40.251 -12.463 -4.403  1.00 19.05  ? 314 MET A CA    1 
ATOM   2530 C  C     . MET A 1 312 ? 39.711 -11.275 -5.227  1.00 18.10  ? 314 MET A C     1 
ATOM   2531 O  O     . MET A 1 312 ? 39.596 -10.145 -4.722  1.00 17.23  ? 314 MET A O     1 
ATOM   2532 C  CB    . MET A 1 312 ? 40.390 -12.097 -2.921  1.00 19.59  ? 314 MET A CB    1 
ATOM   2533 C  CG    . MET A 1 312 ? 40.924 -13.223 -2.040  1.00 20.32  ? 314 MET A CG    1 
ATOM   2534 S  SD    . MET A 1 312 ? 41.211 -12.658 -0.354  1.00 23.20  ? 314 MET A SD    1 
ATOM   2535 C  CE    . MET A 1 312 ? 39.533 -12.429 0.231   1.00 22.50  ? 314 MET A CE    1 
ATOM   2536 N  N     . PRO A 1 313 ? 39.399 -11.526 -6.517  1.00 17.81  ? 315 PRO A N     1 
ATOM   2537 C  CA    . PRO A 1 313 ? 38.862 -10.467 -7.358  1.00 17.27  ? 315 PRO A CA    1 
ATOM   2538 C  C     . PRO A 1 313 ? 37.517 -9.995  -6.805  1.00 18.24  ? 315 PRO A C     1 
ATOM   2539 O  O     . PRO A 1 313 ? 36.751 -10.801 -6.279  1.00 17.43  ? 315 PRO A O     1 
ATOM   2540 C  CB    . PRO A 1 313 ? 38.707 -11.148 -8.724  1.00 17.36  ? 315 PRO A CB    1 
ATOM   2541 C  CG    . PRO A 1 313 ? 38.579 -12.596 -8.424  1.00 17.04  ? 315 PRO A CG    1 
ATOM   2542 C  CD    . PRO A 1 313 ? 39.505 -12.804 -7.242  1.00 17.73  ? 315 PRO A CD    1 
ATOM   2543 N  N     . LEU A 1 314 ? 37.257 -8.694  -6.891  1.00 18.31  ? 316 LEU A N     1 
ATOM   2544 C  CA    . LEU A 1 314 ? 36.013 -8.144  -6.360  1.00 19.68  ? 316 LEU A CA    1 
ATOM   2545 C  C     . LEU A 1 314 ? 34.950 -8.075  -7.459  1.00 19.94  ? 316 LEU A C     1 
ATOM   2546 O  O     . LEU A 1 314 ? 33.936 -8.764  -7.402  1.00 20.11  ? 316 LEU A O     1 
ATOM   2547 C  CB    . LEU A 1 314 ? 36.252 -6.776  -5.690  1.00 19.45  ? 316 LEU A CB    1 
ATOM   2548 C  CG    . LEU A 1 314 ? 37.016 -6.834  -4.357  1.00 20.25  ? 316 LEU A CG    1 
ATOM   2549 C  CD1   . LEU A 1 314 ? 37.444 -5.454  -3.916  1.00 20.38  ? 316 LEU A CD1   1 
ATOM   2550 C  CD2   . LEU A 1 314 ? 36.187 -7.462  -3.263  1.00 21.25  ? 316 LEU A CD2   1 
ATOM   2551 N  N     . ARG A 1 315 ? 35.220 -7.263  -8.472  1.00 20.46  ? 317 ARG A N     1 
ATOM   2552 C  CA    . ARG A 1 315 ? 34.355 -7.140  -9.623  1.00 21.12  ? 317 ARG A CA    1 
ATOM   2553 C  C     . ARG A 1 315 ? 35.219 -6.968  -10.857 1.00 20.72  ? 317 ARG A C     1 
ATOM   2554 O  O     . ARG A 1 315 ? 36.443 -6.814  -10.773 1.00 20.52  ? 317 ARG A O     1 
ATOM   2555 C  CB    . ARG A 1 315 ? 33.401 -5.948  -9.482  1.00 21.95  ? 317 ARG A CB    1 
ATOM   2556 C  CG    . ARG A 1 315 ? 32.378 -6.055  -8.365  1.00 24.30  ? 317 ARG A CG    1 
ATOM   2557 C  CD    . ARG A 1 315 ? 31.494 -4.825  -8.370  1.00 26.39  ? 317 ARG A CD    1 
ATOM   2558 N  NE    . ARG A 1 315 ? 30.372 -4.965  -9.288  1.00 26.14  ? 317 ARG A NE    1 
ATOM   2559 C  CZ    . ARG A 1 315 ? 29.488 -4.007  -9.557  1.00 27.79  ? 317 ARG A CZ    1 
ATOM   2560 N  NH1   . ARG A 1 315 ? 29.593 -2.800  -9.009  1.00 27.13  ? 317 ARG A NH1   1 
ATOM   2561 N  NH2   . ARG A 1 315 ? 28.496 -4.260  -10.394 1.00 26.61  ? 317 ARG A NH2   1 
ATOM   2562 N  N     . SER A 1 316 ? 34.566 -7.021  -12.007 1.00 20.89  ? 318 SER A N     1 
ATOM   2563 C  CA    . SER A 1 316 ? 35.213 -6.764  -13.275 1.00 20.32  ? 318 SER A CA    1 
ATOM   2564 C  C     . SER A 1 316 ? 34.314 -5.844  -14.083 1.00 20.70  ? 318 SER A C     1 
ATOM   2565 O  O     . SER A 1 316 ? 33.125 -5.656  -13.756 1.00 20.64  ? 318 SER A O     1 
ATOM   2566 C  CB    . SER A 1 316 ? 35.415 -8.079  -14.024 1.00 20.46  ? 318 SER A CB    1 
ATOM   2567 O  OG    . SER A 1 316 ? 34.146 -8.638  -14.303 1.00 21.26  ? 318 SER A OG    1 
ATOM   2568 N  N     . ALA A 1 317 ? 34.892 -5.266  -15.132 1.00 20.50  ? 319 ALA A N     1 
ATOM   2569 C  CA    . ALA A 1 317 ? 34.171 -4.401  -16.050 1.00 20.83  ? 319 ALA A CA    1 
ATOM   2570 C  C     . ALA A 1 317 ? 34.963 -4.335  -17.345 1.00 20.83  ? 319 ALA A C     1 
ATOM   2571 O  O     . ALA A 1 317 ? 36.105 -4.798  -17.415 1.00 20.50  ? 319 ALA A O     1 
ATOM   2572 C  CB    . ALA A 1 317 ? 33.995 -3.007  -15.454 1.00 21.42  ? 319 ALA A CB    1 
ATOM   2573 N  N     . PHE A 1 318 ? 34.354 -3.773  -18.378 1.00 21.34  ? 320 PHE A N     1 
ATOM   2574 C  CA    . PHE A 1 318 ? 35.019 -3.646  -19.670 1.00 21.36  ? 320 PHE A CA    1 
ATOM   2575 C  C     . PHE A 1 318 ? 34.442 -2.444  -20.408 1.00 21.99  ? 320 PHE A C     1 
ATOM   2576 O  O     . PHE A 1 318 ? 33.336 -1.973  -20.102 1.00 21.97  ? 320 PHE A O     1 
ATOM   2577 C  CB    . PHE A 1 318 ? 34.924 -4.945  -20.500 1.00 21.48  ? 320 PHE A CB    1 
ATOM   2578 C  CG    . PHE A 1 318 ? 33.516 -5.389  -20.782 1.00 22.54  ? 320 PHE A CG    1 
ATOM   2579 C  CD1   . PHE A 1 318 ? 32.768 -4.783  -21.780 1.00 23.82  ? 320 PHE A CD1   1 
ATOM   2580 C  CD2   . PHE A 1 318 ? 32.938 -6.407  -20.041 1.00 23.38  ? 320 PHE A CD2   1 
ATOM   2581 C  CE1   . PHE A 1 318 ? 31.447 -5.180  -22.030 1.00 25.40  ? 320 PHE A CE1   1 
ATOM   2582 C  CE2   . PHE A 1 318 ? 31.618 -6.811  -20.291 1.00 24.97  ? 320 PHE A CE2   1 
ATOM   2583 C  CZ    . PHE A 1 318 ? 30.880 -6.192  -21.287 1.00 24.43  ? 320 PHE A CZ    1 
ATOM   2584 N  N     . LYS A 1 319 ? 35.210 -1.940  -21.363 1.00 22.01  ? 321 LYS A N     1 
ATOM   2585 C  CA    . LYS A 1 319 ? 34.817 -0.765  -22.125 1.00 23.00  ? 321 LYS A CA    1 
ATOM   2586 C  C     . LYS A 1 319 ? 35.520 -0.831  -23.462 1.00 22.97  ? 321 LYS A C     1 
ATOM   2587 O  O     . LYS A 1 319 ? 36.718 -1.118  -23.533 1.00 22.74  ? 321 LYS A O     1 
ATOM   2588 C  CB    . LYS A 1 319 ? 35.184 0.525   -21.379 1.00 23.27  ? 321 LYS A CB    1 
ATOM   2589 C  CG    . LYS A 1 319 ? 34.784 1.819   -22.108 1.00 25.85  ? 321 LYS A CG    1 
ATOM   2590 C  CD    . LYS A 1 319 ? 35.976 2.562   -22.627 1.00 28.16  ? 321 LYS A CD    1 
ATOM   2591 C  CE    . LYS A 1 319 ? 35.555 3.680   -23.591 1.00 31.04  ? 321 LYS A CE    1 
ATOM   2592 N  NZ    . LYS A 1 319 ? 34.486 4.533   -23.004 1.00 33.10  ? 321 LYS A NZ    1 
ATOM   2593 N  N     . ALA A 1 320 ? 34.759 -0.597  -24.518 1.00 23.41  ? 322 ALA A N     1 
ATOM   2594 C  CA    . ALA A 1 320 ? 35.321 -0.470  -25.843 1.00 23.99  ? 322 ALA A CA    1 
ATOM   2595 C  C     . ALA A 1 320 ? 35.295 1.000   -26.264 1.00 25.20  ? 322 ALA A C     1 
ATOM   2596 O  O     . ALA A 1 320 ? 34.229 1.610   -26.338 1.00 24.90  ? 322 ALA A O     1 
ATOM   2597 C  CB    . ALA A 1 320 ? 34.542 -1.341  -26.832 1.00 23.97  ? 322 ALA A CB    1 
ATOM   2598 N  N     . SER A 1 321 ? 36.478 1.569   -26.499 1.00 26.62  ? 323 SER A N     1 
ATOM   2599 C  CA    . SER A 1 321 ? 36.599 2.897   -27.121 1.00 28.66  ? 323 SER A CA    1 
ATOM   2600 C  C     . SER A 1 321 ? 36.659 2.741   -28.648 1.00 30.02  ? 323 SER A C     1 
ATOM   2601 O  O     . SER A 1 321 ? 36.522 1.634   -29.176 1.00 29.92  ? 323 SER A O     1 
ATOM   2602 C  CB    . SER A 1 321 ? 37.840 3.635   -26.588 1.00 29.18  ? 323 SER A CB    1 
ATOM   2603 O  OG    . SER A 1 321 ? 39.031 3.202   -27.237 1.00 28.76  ? 323 SER A OG    1 
ATOM   2604 N  N     . GLU A 1 322 ? 36.882 3.840   -29.360 1.00 32.06  ? 324 GLU A N     1 
ATOM   2605 C  CA    . GLU A 1 322 ? 37.003 3.782   -30.813 1.00 33.57  ? 324 GLU A CA    1 
ATOM   2606 C  C     . GLU A 1 322 ? 38.105 2.818   -31.256 1.00 32.60  ? 324 GLU A C     1 
ATOM   2607 O  O     . GLU A 1 322 ? 37.898 2.029   -32.170 1.00 32.97  ? 324 GLU A O     1 
ATOM   2608 C  CB    . GLU A 1 322 ? 37.238 5.178   -31.415 1.00 35.46  ? 324 GLU A CB    1 
ATOM   2609 C  CG    . GLU A 1 322 ? 36.180 6.240   -31.043 1.00 39.76  ? 324 GLU A CG    1 
ATOM   2610 C  CD    . GLU A 1 322 ? 34.743 5.701   -30.999 1.00 42.48  ? 324 GLU A CD    1 
ATOM   2611 O  OE1   . GLU A 1 322 ? 34.201 5.318   -32.064 1.00 45.74  ? 324 GLU A OE1   1 
ATOM   2612 O  OE2   . GLU A 1 322 ? 34.160 5.672   -29.895 1.00 42.98  ? 324 GLU A OE2   1 
ATOM   2613 N  N     . GLU A 1 323 ? 39.255 2.868   -30.593 1.00 31.75  ? 325 GLU A N     1 
ATOM   2614 C  CA    . GLU A 1 323 ? 40.422 2.112   -31.038 1.00 31.69  ? 325 GLU A CA    1 
ATOM   2615 C  C     . GLU A 1 323 ? 40.895 0.989   -30.094 1.00 29.61  ? 325 GLU A C     1 
ATOM   2616 O  O     . GLU A 1 323 ? 41.549 0.044   -30.539 1.00 28.82  ? 325 GLU A O     1 
ATOM   2617 C  CB    . GLU A 1 323 ? 41.561 3.071   -31.449 1.00 33.22  ? 325 GLU A CB    1 
ATOM   2618 C  CG    . GLU A 1 323 ? 42.364 3.750   -30.325 1.00 37.26  ? 325 GLU A CG    1 
ATOM   2619 C  CD    . GLU A 1 323 ? 41.636 4.877   -29.558 1.00 42.17  ? 325 GLU A CD    1 
ATOM   2620 O  OE1   . GLU A 1 323 ? 40.717 4.583   -28.756 1.00 42.91  ? 325 GLU A OE1   1 
ATOM   2621 O  OE2   . GLU A 1 323 ? 42.028 6.060   -29.720 1.00 44.46  ? 325 GLU A OE2   1 
ATOM   2622 N  N     . PHE A 1 324 ? 40.529 1.073   -28.813 1.00 28.06  ? 326 PHE A N     1 
ATOM   2623 C  CA    . PHE A 1 324 ? 40.947 0.077   -27.817 1.00 26.30  ? 326 PHE A CA    1 
ATOM   2624 C  C     . PHE A 1 324 ? 39.801 -0.550  -27.036 1.00 24.70  ? 326 PHE A C     1 
ATOM   2625 O  O     . PHE A 1 324 ? 38.723 0.028   -26.935 1.00 25.00  ? 326 PHE A O     1 
ATOM   2626 C  CB    . PHE A 1 324 ? 41.962 0.684   -26.836 1.00 26.58  ? 326 PHE A CB    1 
ATOM   2627 C  CG    . PHE A 1 324 ? 43.249 1.100   -27.483 1.00 28.11  ? 326 PHE A CG    1 
ATOM   2628 C  CD1   . PHE A 1 324 ? 43.515 2.443   -27.733 1.00 30.19  ? 326 PHE A CD1   1 
ATOM   2629 C  CD2   . PHE A 1 324 ? 44.191 0.148   -27.855 1.00 28.65  ? 326 PHE A CD2   1 
ATOM   2630 C  CE1   . PHE A 1 324 ? 44.711 2.830   -28.341 1.00 31.92  ? 326 PHE A CE1   1 
ATOM   2631 C  CE2   . PHE A 1 324 ? 45.383 0.525   -28.465 1.00 29.33  ? 326 PHE A CE2   1 
ATOM   2632 C  CZ    . PHE A 1 324 ? 45.642 1.866   -28.704 1.00 30.22  ? 326 PHE A CZ    1 
ATOM   2633 N  N     . CYS A 1 325 ? 40.059 -1.743  -26.497 1.00 23.17  ? 327 CYS A N     1 
ATOM   2634 C  CA    . CYS A 1 325 ? 39.202 -2.393  -25.514 1.00 21.93  ? 327 CYS A CA    1 
ATOM   2635 C  C     . CYS A 1 325 ? 39.959 -2.519  -24.196 1.00 21.43  ? 327 CYS A C     1 
ATOM   2636 O  O     . CYS A 1 325 ? 41.178 -2.704  -24.179 1.00 21.11  ? 327 CYS A O     1 
ATOM   2637 C  CB    . CYS A 1 325 ? 38.777 -3.781  -25.980 1.00 21.48  ? 327 CYS A CB    1 
ATOM   2638 S  SG    . CYS A 1 325 ? 37.630 -3.803  -27.350 1.00 22.99  ? 327 CYS A SG    1 
ATOM   2639 N  N     . TYR A 1 326 ? 39.217 -2.410  -23.099 1.00 21.22  ? 328 TYR A N     1 
ATOM   2640 C  CA    . TYR A 1 326 ? 39.765 -2.502  -21.755 1.00 20.70  ? 328 TYR A CA    1 
ATOM   2641 C  C     . TYR A 1 326 ? 38.968 -3.519  -20.956 1.00 20.00  ? 328 TYR A C     1 
ATOM   2642 O  O     . TYR A 1 326 ? 37.724 -3.453  -20.904 1.00 19.72  ? 328 TYR A O     1 
ATOM   2643 C  CB    . TYR A 1 326 ? 39.685 -1.152  -21.052 1.00 21.43  ? 328 TYR A CB    1 
ATOM   2644 C  CG    . TYR A 1 326 ? 40.300 0.001   -21.818 1.00 22.44  ? 328 TYR A CG    1 
ATOM   2645 C  CD1   . TYR A 1 326 ? 39.575 0.675   -22.805 1.00 23.93  ? 328 TYR A CD1   1 
ATOM   2646 C  CD2   . TYR A 1 326 ? 41.596 0.432   -21.538 1.00 22.07  ? 328 TYR A CD2   1 
ATOM   2647 C  CE1   . TYR A 1 326 ? 40.136 1.750   -23.509 1.00 24.12  ? 328 TYR A CE1   1 
ATOM   2648 C  CE2   . TYR A 1 326 ? 42.166 1.500   -22.223 1.00 24.13  ? 328 TYR A CE2   1 
ATOM   2649 C  CZ    . TYR A 1 326 ? 41.433 2.149   -23.209 1.00 24.76  ? 328 TYR A CZ    1 
ATOM   2650 O  OH    . TYR A 1 326 ? 41.996 3.191   -23.895 1.00 25.81  ? 328 TYR A OH    1 
ATOM   2651 N  N     . LEU A 1 327 ? 39.685 -4.463  -20.356 1.00 18.49  ? 329 LEU A N     1 
ATOM   2652 C  CA    . LEU A 1 327 ? 39.110 -5.372  -19.371 1.00 18.05  ? 329 LEU A CA    1 
ATOM   2653 C  C     . LEU A 1 327 ? 39.609 -4.918  -17.999 1.00 18.25  ? 329 LEU A C     1 
ATOM   2654 O  O     . LEU A 1 327 ? 40.802 -4.888  -17.763 1.00 18.08  ? 329 LEU A O     1 
ATOM   2655 C  CB    . LEU A 1 327 ? 39.525 -6.815  -19.679 1.00 17.67  ? 329 LEU A CB    1 
ATOM   2656 C  CG    . LEU A 1 327 ? 39.374 -7.180  -21.162 1.00 16.76  ? 329 LEU A CG    1 
ATOM   2657 C  CD1   . LEU A 1 327 ? 39.974 -8.546  -21.485 1.00 17.94  ? 329 LEU A CD1   1 
ATOM   2658 C  CD2   . LEU A 1 327 ? 37.875 -7.107  -21.582 1.00 15.00  ? 329 LEU A CD2   1 
ATOM   2659 N  N     . LEU A 1 328 ? 38.680 -4.559  -17.115 1.00 18.58  ? 330 LEU A N     1 
ATOM   2660 C  CA    . LEU A 1 328 ? 39.005 -3.925  -15.836 1.00 19.63  ? 330 LEU A CA    1 
ATOM   2661 C  C     . LEU A 1 328 ? 38.786 -4.880  -14.675 1.00 18.95  ? 330 LEU A C     1 
ATOM   2662 O  O     . LEU A 1 328 ? 37.781 -5.601  -14.650 1.00 18.60  ? 330 LEU A O     1 
ATOM   2663 C  CB    . LEU A 1 328 ? 38.161 -2.657  -15.645 1.00 19.96  ? 330 LEU A CB    1 
ATOM   2664 C  CG    . LEU A 1 328 ? 38.302 -1.636  -16.790 1.00 22.86  ? 330 LEU A CG    1 
ATOM   2665 C  CD1   . LEU A 1 328 ? 37.073 -0.718  -16.900 1.00 23.85  ? 330 LEU A CD1   1 
ATOM   2666 C  CD2   . LEU A 1 328 ? 39.581 -0.821  -16.649 1.00 24.21  ? 330 LEU A CD2   1 
ATOM   2667 N  N     . PHE A 1 329 ? 39.725 -4.866  -13.724 1.00 18.60  ? 331 PHE A N     1 
ATOM   2668 C  CA    . PHE A 1 329 ? 39.684 -5.746  -12.548 1.00 18.77  ? 331 PHE A CA    1 
ATOM   2669 C  C     . PHE A 1 329 ? 40.099 -5.014  -11.281 1.00 18.76  ? 331 PHE A C     1 
ATOM   2670 O  O     . PHE A 1 329 ? 40.958 -4.139  -11.320 1.00 19.80  ? 331 PHE A O     1 
ATOM   2671 C  CB    . PHE A 1 329 ? 40.576 -6.982  -12.750 1.00 18.72  ? 331 PHE A CB    1 
ATOM   2672 C  CG    . PHE A 1 329 ? 40.296 -7.728  -14.030 1.00 19.27  ? 331 PHE A CG    1 
ATOM   2673 C  CD1   . PHE A 1 329 ? 39.268 -8.674  -14.092 1.00 20.25  ? 331 PHE A CD1   1 
ATOM   2674 C  CD2   . PHE A 1 329 ? 41.047 -7.472  -15.180 1.00 20.55  ? 331 PHE A CD2   1 
ATOM   2675 C  CE1   . PHE A 1 329 ? 38.986 -9.351  -15.287 1.00 19.84  ? 331 PHE A CE1   1 
ATOM   2676 C  CE2   . PHE A 1 329 ? 40.771 -8.149  -16.382 1.00 19.74  ? 331 PHE A CE2   1 
ATOM   2677 C  CZ    . PHE A 1 329 ? 39.743 -9.079  -16.432 1.00 20.39  ? 331 PHE A CZ    1 
ATOM   2678 N  N     . GLU A 1 330 ? 39.466 -5.369  -10.167 1.00 18.85  ? 332 GLU A N     1 
ATOM   2679 C  CA    . GLU A 1 330 ? 39.870 -4.922  -8.831  1.00 19.29  ? 332 GLU A CA    1 
ATOM   2680 C  C     . GLU A 1 330 ? 39.994 -6.163  -7.957  1.00 19.15  ? 332 GLU A C     1 
ATOM   2681 O  O     . GLU A 1 330 ? 39.076 -6.969  -7.912  1.00 18.71  ? 332 GLU A O     1 
ATOM   2682 C  CB    . GLU A 1 330 ? 38.857 -3.939  -8.210  1.00 19.82  ? 332 GLU A CB    1 
ATOM   2683 C  CG    . GLU A 1 330 ? 39.339 -3.318  -6.879  1.00 20.00  ? 332 GLU A CG    1 
ATOM   2684 C  CD    . GLU A 1 330 ? 38.362 -2.320  -6.223  1.00 21.23  ? 332 GLU A CD    1 
ATOM   2685 O  OE1   . GLU A 1 330 ? 37.126 -2.448  -6.402  1.00 22.29  ? 332 GLU A OE1   1 
ATOM   2686 O  OE2   . GLU A 1 330 ? 38.833 -1.412  -5.490  1.00 20.49  ? 332 GLU A OE2   1 
ATOM   2687 N  N     . CYS A 1 331 ? 41.130 -6.294  -7.269  1.00 19.19  ? 333 CYS A N     1 
ATOM   2688 C  CA    . CYS A 1 331 ? 41.449 -7.459  -6.447  1.00 19.73  ? 333 CYS A CA    1 
ATOM   2689 C  C     . CYS A 1 331 ? 41.824 -7.049  -5.013  1.00 20.10  ? 333 CYS A C     1 
ATOM   2690 O  O     . CYS A 1 331 ? 42.469 -6.007  -4.802  1.00 20.12  ? 333 CYS A O     1 
ATOM   2691 C  CB    . CYS A 1 331 ? 42.630 -8.215  -7.058  1.00 19.14  ? 333 CYS A CB    1 
ATOM   2692 S  SG    . CYS A 1 331 ? 42.290 -9.000  -8.629  1.00 21.38  ? 333 CYS A SG    1 
ATOM   2693 N  N     . GLN A 1 332 ? 41.429 -7.878  -4.038  1.00 19.80  ? 334 GLN A N     1 
ATOM   2694 C  CA    . GLN A 1 332 ? 41.772 -7.629  -2.628  1.00 20.24  ? 334 GLN A CA    1 
ATOM   2695 C  C     . GLN A 1 332 ? 43.252 -7.844  -2.350  1.00 20.42  ? 334 GLN A C     1 
ATOM   2696 O  O     . GLN A 1 332 ? 43.793 -7.307  -1.371  1.00 20.86  ? 334 GLN A O     1 
ATOM   2697 C  CB    . GLN A 1 332 ? 40.942 -8.513  -1.692  1.00 20.44  ? 334 GLN A CB    1 
ATOM   2698 C  CG    . GLN A 1 332 ? 39.449 -8.291  -1.854  1.00 21.67  ? 334 GLN A CG    1 
ATOM   2699 C  CD    . GLN A 1 332 ? 38.612 -8.955  -0.786  1.00 24.14  ? 334 GLN A CD    1 
ATOM   2700 O  OE1   . GLN A 1 332 ? 37.601 -9.596  -1.085  1.00 26.26  ? 334 GLN A OE1   1 
ATOM   2701 N  NE2   . GLN A 1 332 ? 39.008 -8.793  0.460   1.00 22.68  ? 334 GLN A NE2   1 
ATOM   2702 N  N     . ILE A 1 333 ? 43.896 -8.635  -3.205  1.00 19.53  ? 335 ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 333 ? 45.283 -9.051  -2.997  1.00 20.14  ? 335 ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 333 ? 46.233 -8.405  -4.009  1.00 20.11  ? 335 ILE A C     1 
ATOM   2705 O  O     . ILE A 1 333 ? 46.262 -8.788  -5.180  1.00 18.91  ? 335 ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 333 ? 45.407 -10.608 -3.010  1.00 19.70  ? 335 ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 333 ? 44.585 -11.227 -1.862  1.00 20.00  ? 335 ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 333 ? 46.883 -11.069 -2.960  1.00 21.16  ? 335 ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 333 ? 44.820 -10.590 -0.478  1.00 19.88  ? 335 ILE A CD1   1 
ATOM   2710 N  N     . LYS A 1 334 ? 46.989 -7.414  -3.537  1.00 20.98  ? 336 LYS A N     1 
ATOM   2711 C  CA    . LYS A 1 334 ? 48.027 -6.746  -4.327  1.00 21.57  ? 336 LYS A CA    1 
ATOM   2712 C  C     . LYS A 1 334 ? 49.249 -7.644  -4.515  1.00 21.83  ? 336 LYS A C     1 
ATOM   2713 O  O     . LYS A 1 334 ? 49.911 -7.613  -5.560  1.00 20.86  ? 336 LYS A O     1 
ATOM   2714 C  CB    . LYS A 1 334 ? 48.452 -5.438  -3.651  1.00 22.08  ? 336 LYS A CB    1 
ATOM   2715 C  CG    . LYS A 1 334 ? 47.487 -4.281  -3.901  1.00 22.98  ? 336 LYS A CG    1 
ATOM   2716 C  CD    . LYS A 1 334 ? 47.762 -3.081  -2.981  1.00 24.21  ? 336 LYS A CD    1 
ATOM   2717 C  CE    . LYS A 1 334 ? 48.249 -1.877  -3.751  1.00 26.89  ? 336 LYS A CE    1 
ATOM   2718 N  NZ    . LYS A 1 334 ? 48.343 -0.669  -2.856  1.00 30.26  ? 336 LYS A NZ    1 
ATOM   2719 N  N     . GLU A 1 335 ? 49.545 -8.440  -3.489  1.00 22.18  ? 337 GLU A N     1 
ATOM   2720 C  CA    . GLU A 1 335 ? 50.676 -9.350  -3.522  1.00 23.34  ? 337 GLU A CA    1 
ATOM   2721 C  C     . GLU A 1 335 ? 50.442 -10.537 -2.598  1.00 22.56  ? 337 GLU A C     1 
ATOM   2722 O  O     . GLU A 1 335 ? 50.084 -10.372 -1.426  1.00 22.13  ? 337 GLU A O     1 
ATOM   2723 C  CB    . GLU A 1 335 ? 51.984 -8.637  -3.137  1.00 24.49  ? 337 GLU A CB    1 
ATOM   2724 C  CG    . GLU A 1 335 ? 53.229 -9.462  -3.444  1.00 26.46  ? 337 GLU A CG    1 
ATOM   2725 C  CD    . GLU A 1 335 ? 54.526 -8.689  -3.277  1.00 29.46  ? 337 GLU A CD    1 
ATOM   2726 O  OE1   . GLU A 1 335 ? 54.619 -7.838  -2.361  1.00 34.17  ? 337 GLU A OE1   1 
ATOM   2727 O  OE2   . GLU A 1 335 ? 55.466 -8.947  -4.067  1.00 35.41  ? 337 GLU A OE2   1 
ATOM   2728 N  N     . ILE A 1 336 ? 50.647 -11.728 -3.151  1.00 21.79  ? 338 ILE A N     1 
ATOM   2729 C  CA    . ILE A 1 336 ? 50.559 -12.970 -2.406  1.00 21.28  ? 338 ILE A CA    1 
ATOM   2730 C  C     . ILE A 1 336 ? 51.971 -13.561 -2.228  1.00 22.56  ? 338 ILE A C     1 
ATOM   2731 O  O     . ILE A 1 336 ? 52.890 -13.238 -2.992  1.00 22.67  ? 338 ILE A O     1 
ATOM   2732 C  CB    . ILE A 1 336 ? 49.587 -13.968 -3.107  1.00 20.49  ? 338 ILE A CB    1 
ATOM   2733 C  CG1   . ILE A 1 336 ? 49.096 -15.038 -2.122  1.00 20.02  ? 338 ILE A CG1   1 
ATOM   2734 C  CG2   . ILE A 1 336 ? 50.220 -14.559 -4.400  1.00 19.51  ? 338 ILE A CG2   1 
ATOM   2735 C  CD1   . ILE A 1 336 ? 47.786 -15.701 -2.530  1.00 19.59  ? 338 ILE A CD1   1 
ATOM   2736 N  N     . SER A 1 337 ? 52.134 -14.415 -1.216  1.00 23.05  ? 339 SER A N     1 
ATOM   2737 C  CA    . SER A 1 337 ? 53.397 -15.087 -0.958  1.00 24.41  ? 339 SER A CA    1 
ATOM   2738 C  C     . SER A 1 337 ? 53.788 -15.989 -2.119  1.00 25.14  ? 339 SER A C     1 
ATOM   2739 O  O     . SER A 1 337 ? 52.936 -16.433 -2.894  1.00 24.07  ? 339 SER A O     1 
ATOM   2740 C  CB    . SER A 1 337 ? 53.325 -15.904 0.334   1.00 24.74  ? 339 SER A CB    1 
ATOM   2741 O  OG    . SER A 1 337 ? 52.448 -17.006 0.189   1.00 23.34  ? 339 SER A OG    1 
ATOM   2742 N  N     . ARG A 1 338 ? 55.086 -16.254 -2.235  1.00 21.71  ? 340 ARG A N     1 
ATOM   2743 C  CA    . ARG A 1 338 ? 55.554 -17.189 -3.231  1.00 23.14  ? 340 ARG A CA    1 
ATOM   2744 C  C     . ARG A 1 338 ? 55.127 -18.607 -2.854  1.00 23.32  ? 340 ARG A C     1 
ATOM   2745 O  O     . ARG A 1 338 ? 54.644 -19.361 -3.703  1.00 23.76  ? 340 ARG A O     1 
ATOM   2746 C  CB    . ARG A 1 338 ? 57.066 -17.074 -3.425  1.00 24.04  ? 340 ARG A CB    1 
ATOM   2747 C  CG    . ARG A 1 338 ? 57.513 -17.615 -4.757  1.00 27.13  ? 340 ARG A CG    1 
ATOM   2748 C  CD    . ARG A 1 338 ? 58.538 -16.727 -5.420  1.00 31.05  ? 340 ARG A CD    1 
ATOM   2749 N  NE    . ARG A 1 338 ? 58.216 -16.621 -6.835  1.00 35.88  ? 340 ARG A NE    1 
ATOM   2750 C  CZ    . ARG A 1 338 ? 58.001 -15.484 -7.487  1.00 37.53  ? 340 ARG A CZ    1 
ATOM   2751 N  NH1   . ARG A 1 338 ? 58.119 -14.314 -6.878  1.00 37.05  ? 340 ARG A NH1   1 
ATOM   2752 N  NH2   . ARG A 1 338 ? 57.692 -15.518 -8.771  1.00 41.27  ? 340 ARG A NH2   1 
ATOM   2753 N  N     . VAL A 1 339 ? 55.266 -18.959 -1.580  1.00 23.30  ? 341 VAL A N     1 
ATOM   2754 C  CA    . VAL A 1 339 ? 54.878 -20.312 -1.132  1.00 23.96  ? 341 VAL A CA    1 
ATOM   2755 C  C     . VAL A 1 339 ? 53.376 -20.503 -0.954  1.00 23.87  ? 341 VAL A C     1 
ATOM   2756 O  O     . VAL A 1 339 ? 52.662 -19.599 -0.544  1.00 23.98  ? 341 VAL A O     1 
ATOM   2757 C  CB    . VAL A 1 339 ? 55.632 -20.805 0.154   1.00 23.70  ? 341 VAL A CB    1 
ATOM   2758 C  CG1   . VAL A 1 339 ? 57.095 -20.640 -0.008  1.00 25.78  ? 341 VAL A CG1   1 
ATOM   2759 C  CG2   . VAL A 1 339 ? 55.178 -20.068 1.403   1.00 23.41  ? 341 VAL A CG2   1 
ATOM   2760 N  N     . PHE A 1 340 ? 52.905 -21.699 -1.288  1.00 25.14  ? 342 PHE A N     1 
ATOM   2761 C  CA    . PHE A 1 340 ? 51.527 -22.085 -0.999  1.00 26.24  ? 342 PHE A CA    1 
ATOM   2762 C  C     . PHE A 1 340 ? 51.538 -23.552 -0.599  1.00 26.61  ? 342 PHE A C     1 
ATOM   2763 O  O     . PHE A 1 340 ? 52.583 -24.202 -0.680  1.00 26.78  ? 342 PHE A O     1 
ATOM   2764 C  CB    . PHE A 1 340 ? 50.598 -21.793 -2.197  1.00 26.56  ? 342 PHE A CB    1 
ATOM   2765 C  CG    . PHE A 1 340 ? 50.843 -22.669 -3.408  1.00 26.96  ? 342 PHE A CG    1 
ATOM   2766 C  CD1   . PHE A 1 340 ? 50.113 -23.850 -3.594  1.00 26.86  ? 342 PHE A CD1   1 
ATOM   2767 C  CD2   . PHE A 1 340 ? 51.784 -22.308 -4.367  1.00 27.52  ? 342 PHE A CD2   1 
ATOM   2768 C  CE1   . PHE A 1 340 ? 50.328 -24.667 -4.719  1.00 28.43  ? 342 PHE A CE1   1 
ATOM   2769 C  CE2   . PHE A 1 340 ? 52.009 -23.113 -5.501  1.00 29.39  ? 342 PHE A CE2   1 
ATOM   2770 C  CZ    . PHE A 1 340 ? 51.272 -24.298 -5.677  1.00 29.34  ? 342 PHE A CZ    1 
ATOM   2771 N  N     . ARG A 1 341 ? 50.402 -24.075 -0.146  1.00 27.92  ? 343 ARG A N     1 
ATOM   2772 C  CA    . ARG A 1 341 ? 50.331 -25.506 0.191   1.00 28.77  ? 343 ARG A CA    1 
ATOM   2773 C  C     . ARG A 1 341 ? 49.549 -26.321 -0.839  1.00 29.90  ? 343 ARG A C     1 
ATOM   2774 O  O     . ARG A 1 341 ? 48.532 -25.870 -1.380  1.00 30.50  ? 343 ARG A O     1 
ATOM   2775 C  CB    . ARG A 1 341 ? 49.859 -25.778 1.647   1.00 28.89  ? 343 ARG A CB    1 
ATOM   2776 C  CG    . ARG A 1 341 ? 48.809 -24.827 2.215   1.00 29.77  ? 343 ARG A CG    1 
ATOM   2777 C  CD    . ARG A 1 341 ? 48.638 -25.021 3.730   1.00 29.79  ? 343 ARG A CD    1 
ATOM   2778 N  NE    . ARG A 1 341 ? 47.769 -26.153 4.039   1.00 30.94  ? 343 ARG A NE    1 
ATOM   2779 C  CZ    . ARG A 1 341 ? 47.706 -26.767 5.216   1.00 32.49  ? 343 ARG A CZ    1 
ATOM   2780 N  NH1   . ARG A 1 341 ? 48.466 -26.374 6.235   1.00 33.14  ? 343 ARG A NH1   1 
ATOM   2781 N  NH2   . ARG A 1 341 ? 46.878 -27.787 5.378   1.00 32.59  ? 343 ARG A NH2   1 
ATOM   2782 N  N     . ARG A 1 342 ? 50.065 -27.511 -1.123  1.00 30.27  ? 344 ARG A N     1 
ATOM   2783 C  CA    . ARG A 1 342 ? 49.406 -28.460 -2.014  1.00 31.74  ? 344 ARG A CA    1 
ATOM   2784 C  C     . ARG A 1 342 ? 48.957 -29.658 -1.191  1.00 30.90  ? 344 ARG A C     1 
ATOM   2785 O  O     . ARG A 1 342 ? 49.730 -30.191 -0.395  1.00 30.10  ? 344 ARG A O     1 
ATOM   2786 C  CB    . ARG A 1 342 ? 50.358 -28.903 -3.129  1.00 32.34  ? 344 ARG A CB    1 
ATOM   2787 C  CG    . ARG A 1 342 ? 49.668 -29.649 -4.271  1.00 35.49  ? 344 ARG A CG    1 
ATOM   2788 C  CD    . ARG A 1 342 ? 50.642 -30.030 -5.386  1.00 36.61  ? 344 ARG A CD    1 
ATOM   2789 N  NE    . ARG A 1 342 ? 50.103 -29.616 -6.680  1.00 43.20  ? 344 ARG A NE    1 
ATOM   2790 C  CZ    . ARG A 1 342 ? 50.423 -28.481 -7.311  1.00 45.35  ? 344 ARG A CZ    1 
ATOM   2791 N  NH1   . ARG A 1 342 ? 51.308 -27.641 -6.792  1.00 45.93  ? 344 ARG A NH1   1 
ATOM   2792 N  NH2   . ARG A 1 342 ? 49.865 -28.189 -8.476  1.00 48.44  ? 344 ARG A NH2   1 
ATOM   2793 N  N     . MET A 1 343 ? 47.701 -30.055 -1.370  1.00 31.32  ? 345 MET A N     1 
ATOM   2794 C  CA    . MET A 1 343 ? 47.148 -31.206 -0.671  1.00 31.29  ? 345 MET A CA    1 
ATOM   2795 C  C     . MET A 1 343 ? 47.610 -32.526 -1.280  1.00 30.80  ? 345 MET A C     1 
ATOM   2796 O  O     . MET A 1 343 ? 47.474 -32.763 -2.484  1.00 31.57  ? 345 MET A O     1 
ATOM   2797 C  CB    . MET A 1 343 ? 45.624 -31.145 -0.649  1.00 32.32  ? 345 MET A CB    1 
ATOM   2798 C  CG    . MET A 1 343 ? 44.993 -32.151 0.285   1.00 33.16  ? 345 MET A CG    1 
ATOM   2799 S  SD    . MET A 1 343 ? 43.211 -32.291 0.085   1.00 36.29  ? 345 MET A SD    1 
ATOM   2800 C  CE    . MET A 1 343 ? 43.087 -33.075 -1.530  1.00 37.12  ? 345 MET A CE    1 
ATOM   2801 N  N     . GLY A 1 344 ? 48.165 -33.381 -0.432  1.00 29.51  ? 346 GLY A N     1 
ATOM   2802 C  CA    . GLY A 1 344 ? 48.559 -34.713 -0.847  1.00 29.01  ? 346 GLY A CA    1 
ATOM   2803 C  C     . GLY A 1 344 ? 47.629 -35.789 -0.312  1.00 28.78  ? 346 GLY A C     1 
ATOM   2804 O  O     . GLY A 1 344 ? 46.538 -35.492 0.191   1.00 28.85  ? 346 GLY A O     1 
ATOM   2805 N  N     . PRO A 1 345 ? 48.066 -37.051 -0.403  1.00 28.39  ? 347 PRO A N     1 
ATOM   2806 C  CA    . PRO A 1 345 ? 47.226 -38.182 -0.026  1.00 28.77  ? 347 PRO A CA    1 
ATOM   2807 C  C     . PRO A 1 345 ? 47.136 -38.387 1.497   1.00 27.70  ? 347 PRO A C     1 
ATOM   2808 O  O     . PRO A 1 345 ? 47.917 -37.798 2.263   1.00 26.47  ? 347 PRO A O     1 
ATOM   2809 C  CB    . PRO A 1 345 ? 47.928 -39.369 -0.695  1.00 29.14  ? 347 PRO A CB    1 
ATOM   2810 C  CG    . PRO A 1 345 ? 49.353 -38.974 -0.772  1.00 28.44  ? 347 PRO A CG    1 
ATOM   2811 C  CD    . PRO A 1 345 ? 49.405 -37.470 -0.854  1.00 28.41  ? 347 PRO A CD    1 
ATOM   2812 N  N     . GLN A 1 346 ? 46.170 -39.195 1.922   1.00 28.24  ? 348 GLN A N     1 
ATOM   2813 C  CA    . GLN A 1 346 ? 46.093 -39.625 3.309   1.00 28.60  ? 348 GLN A CA    1 
ATOM   2814 C  C     . GLN A 1 346 ? 47.281 -40.522 3.614   1.00 27.80  ? 348 GLN A C     1 
ATOM   2815 O  O     . GLN A 1 346 ? 47.730 -41.275 2.738   1.00 28.18  ? 348 GLN A O     1 
ATOM   2816 C  CB    . GLN A 1 346 ? 44.786 -40.366 3.577   1.00 29.54  ? 348 GLN A CB    1 
ATOM   2817 C  CG    . GLN A 1 346 ? 43.578 -39.438 3.706   1.00 31.12  ? 348 GLN A CG    1 
ATOM   2818 C  CD    . GLN A 1 346 ? 42.254 -40.192 3.742   1.00 33.54  ? 348 GLN A CD    1 
ATOM   2819 O  OE1   . GLN A 1 346 ? 42.167 -41.366 3.356   1.00 35.17  ? 348 GLN A OE1   1 
ATOM   2820 N  NE2   . GLN A 1 346 ? 41.212 -39.516 4.213   1.00 36.27  ? 348 GLN A NE2   1 
ATOM   2821 N  N     . PHE A 1 347 ? 47.781 -40.442 4.849   1.00 26.98  ? 349 PHE A N     1 
ATOM   2822 C  CA    . PHE A 1 347 ? 48.964 -41.211 5.275   1.00 26.47  ? 349 PHE A CA    1 
ATOM   2823 C  C     . PHE A 1 347 ? 48.833 -42.711 4.983   1.00 27.14  ? 349 PHE A C     1 
ATOM   2824 O  O     . PHE A 1 347 ? 49.815 -43.400 4.746   1.00 27.14  ? 349 PHE A O     1 
ATOM   2825 C  CB    . PHE A 1 347 ? 49.283 -40.955 6.760   1.00 25.27  ? 349 PHE A CB    1 
ATOM   2826 C  CG    . PHE A 1 347 ? 48.483 -41.798 7.748   1.00 24.53  ? 349 PHE A CG    1 
ATOM   2827 C  CD1   . PHE A 1 347 ? 48.926 -43.065 8.128   1.00 24.67  ? 349 PHE A CD1   1 
ATOM   2828 C  CD2   . PHE A 1 347 ? 47.330 -41.295 8.346   1.00 24.66  ? 349 PHE A CD2   1 
ATOM   2829 C  CE1   . PHE A 1 347 ? 48.215 -43.828 9.058   1.00 23.17  ? 349 PHE A CE1   1 
ATOM   2830 C  CE2   . PHE A 1 347 ? 46.616 -42.051 9.280   1.00 22.57  ? 349 PHE A CE2   1 
ATOM   2831 C  CZ    . PHE A 1 347 ? 47.057 -43.313 9.632   1.00 23.50  ? 349 PHE A CZ    1 
ATOM   2832 N  N     . GLU A 1 348 ? 47.586 -43.168 4.989   1.00 28.35  ? 350 GLU A N     1 
ATOM   2833 C  CA    . GLU A 1 348 ? 47.177 -44.542 4.750   1.00 29.73  ? 350 GLU A CA    1 
ATOM   2834 C  C     . GLU A 1 348 ? 47.691 -45.191 3.436   1.00 30.35  ? 350 GLU A C     1 
ATOM   2835 O  O     . GLU A 1 348 ? 48.227 -46.291 3.462   1.00 30.38  ? 350 GLU A O     1 
ATOM   2836 C  CB    . GLU A 1 348 ? 45.641 -44.580 4.784   1.00 31.14  ? 350 GLU A CB    1 
ATOM   2837 C  CG    . GLU A 1 348 ? 44.990 -43.546 5.759   1.00 31.68  ? 350 GLU A CG    1 
ATOM   2838 C  CD    . GLU A 1 348 ? 44.877 -44.114 7.139   1.00 32.52  ? 350 GLU A CD    1 
ATOM   2839 O  OE1   . GLU A 1 348 ? 43.948 -43.766 7.890   1.00 31.42  ? 350 GLU A OE1   1 
ATOM   2840 O  OE2   . GLU A 1 348 ? 45.722 -44.966 7.456   1.00 35.84  ? 350 GLU A OE2   1 
ATOM   2841 N  N     . ASP A 1 349 ? 47.516 -44.557 2.283   1.00 31.47  ? 351 ASP A N     1 
ATOM   2842 C  CA    . ASP A 1 349 ? 47.936 -45.264 1.054   1.00 32.82  ? 351 ASP A CA    1 
ATOM   2843 C  C     . ASP A 1 349 ? 49.372 -44.960 0.662   1.00 32.26  ? 351 ASP A C     1 
ATOM   2844 O  O     . ASP A 1 349 ? 49.688 -43.860 0.195   1.00 31.82  ? 351 ASP A O     1 
ATOM   2845 C  CB    . ASP A 1 349 ? 46.958 -45.124 -0.122  1.00 35.00  ? 351 ASP A CB    1 
ATOM   2846 C  CG    . ASP A 1 349 ? 46.728 -43.697 -0.533  1.00 35.40  ? 351 ASP A CG    1 
ATOM   2847 O  OD1   . ASP A 1 349 ? 46.819 -42.819 0.349   1.00 34.01  ? 351 ASP A OD1   1 
ATOM   2848 O  OD2   . ASP A 1 349 ? 46.446 -43.471 -1.736  1.00 36.77  ? 351 ASP A OD2   1 
ATOM   2849 N  N     . GLU A 1 350 ? 50.240 -45.940 0.882   1.00 32.09  ? 352 GLU A N     1 
ATOM   2850 C  CA    . GLU A 1 350 ? 51.664 -45.702 0.737   1.00 32.66  ? 352 GLU A CA    1 
ATOM   2851 C  C     . GLU A 1 350 ? 52.123 -45.574 -0.706  1.00 33.24  ? 352 GLU A C     1 
ATOM   2852 O  O     . GLU A 1 350 ? 53.169 -44.979 -0.960  1.00 33.37  ? 352 GLU A O     1 
ATOM   2853 C  CB    . GLU A 1 350 ? 52.507 -46.704 1.526   1.00 32.53  ? 352 GLU A CB    1 
ATOM   2854 C  CG    . GLU A 1 350 ? 52.595 -48.113 1.012   1.00 35.07  ? 352 GLU A CG    1 
ATOM   2855 C  CD    . GLU A 1 350 ? 53.728 -48.874 1.694   1.00 35.88  ? 352 GLU A CD    1 
ATOM   2856 O  OE1   . GLU A 1 350 ? 54.900 -48.426 1.607   1.00 38.90  ? 352 GLU A OE1   1 
ATOM   2857 O  OE2   . GLU A 1 350 ? 53.449 -49.915 2.330   1.00 39.64  ? 352 GLU A OE2   1 
ATOM   2858 N  N     . ARG A 1 351 ? 51.330 -46.094 -1.642  1.00 33.87  ? 353 ARG A N     1 
ATOM   2859 C  CA    . ARG A 1 351 ? 51.648 -45.962 -3.064  1.00 35.69  ? 353 ARG A CA    1 
ATOM   2860 C  C     . ARG A 1 351 ? 51.664 -44.492 -3.470  1.00 34.61  ? 353 ARG A C     1 
ATOM   2861 O  O     . ARG A 1 351 ? 52.628 -44.011 -4.064  1.00 35.30  ? 353 ARG A O     1 
ATOM   2862 C  CB    . ARG A 1 351 ? 50.645 -46.727 -3.935  1.00 37.52  ? 353 ARG A CB    1 
ATOM   2863 C  CG    . ARG A 1 351 ? 51.243 -47.288 -5.211  1.00 42.59  ? 353 ARG A CG    1 
ATOM   2864 C  CD    . ARG A 1 351 ? 51.284 -48.821 -5.128  1.00 48.79  ? 353 ARG A CD    1 
ATOM   2865 N  NE    . ARG A 1 351 ? 52.448 -49.426 -5.781  1.00 53.51  ? 353 ARG A NE    1 
ATOM   2866 C  CZ    . ARG A 1 351 ? 53.635 -49.604 -5.196  1.00 54.49  ? 353 ARG A CZ    1 
ATOM   2867 N  NH1   . ARG A 1 351 ? 53.838 -49.207 -3.940  1.00 53.08  ? 353 ARG A NH1   1 
ATOM   2868 N  NH2   . ARG A 1 351 ? 54.628 -50.174 -5.873  1.00 57.36  ? 353 ARG A NH2   1 
ATOM   2869 N  N     . ASN A 1 352 ? 50.592 -43.786 -3.127  1.00 33.08  ? 354 ASN A N     1 
ATOM   2870 C  CA    . ASN A 1 352 ? 50.422 -42.387 -3.510  1.00 32.24  ? 354 ASN A CA    1 
ATOM   2871 C  C     . ASN A 1 352 ? 51.268 -41.438 -2.678  1.00 30.15  ? 354 ASN A C     1 
ATOM   2872 O  O     . ASN A 1 352 ? 51.729 -40.410 -3.180  1.00 29.51  ? 354 ASN A O     1 
ATOM   2873 C  CB    . ASN A 1 352 ? 48.944 -42.002 -3.475  1.00 32.26  ? 354 ASN A CB    1 
ATOM   2874 C  CG    . ASN A 1 352 ? 48.183 -42.554 -4.663  1.00 35.45  ? 354 ASN A CG    1 
ATOM   2875 O  OD1   . ASN A 1 352 ? 48.432 -42.169 -5.811  1.00 36.74  ? 354 ASN A OD1   1 
ATOM   2876 N  ND2   . ASN A 1 352 ? 47.266 -43.477 -4.400  1.00 37.08  ? 354 ASN A ND2   1 
ATOM   2877 N  N     . VAL A 1 353 ? 51.494 -41.805 -1.420  1.00 28.50  ? 355 VAL A N     1 
ATOM   2878 C  CA    . VAL A 1 353 ? 52.436 -41.082 -0.567  1.00 27.50  ? 355 VAL A CA    1 
ATOM   2879 C  C     . VAL A 1 353 ? 53.852 -41.146 -1.160  1.00 28.41  ? 355 VAL A C     1 
ATOM   2880 O  O     . VAL A 1 353 ? 54.526 -40.123 -1.262  1.00 28.20  ? 355 VAL A O     1 
ATOM   2881 C  CB    . VAL A 1 353 ? 52.408 -41.581 0.903   1.00 26.41  ? 355 VAL A CB    1 
ATOM   2882 C  CG1   . VAL A 1 353 ? 53.501 -40.901 1.731   1.00 25.63  ? 355 VAL A CG1   1 
ATOM   2883 C  CG2   . VAL A 1 353 ? 51.036 -41.327 1.539   1.00 25.73  ? 355 VAL A CG2   1 
ATOM   2884 N  N     . LYS A 1 354 ? 54.290 -42.337 -1.560  1.00 29.38  ? 356 LYS A N     1 
ATOM   2885 C  CA    . LYS A 1 354 ? 55.584 -42.494 -2.223  1.00 31.63  ? 356 LYS A CA    1 
ATOM   2886 C  C     . LYS A 1 354 ? 55.726 -41.549 -3.418  1.00 32.33  ? 356 LYS A C     1 
ATOM   2887 O  O     . LYS A 1 354 ? 56.744 -40.879 -3.564  1.00 32.85  ? 356 LYS A O     1 
ATOM   2888 C  CB    . LYS A 1 354 ? 55.801 -43.942 -2.693  1.00 33.05  ? 356 LYS A CB    1 
ATOM   2889 C  CG    . LYS A 1 354 ? 56.312 -44.892 -1.612  1.00 33.44  ? 356 LYS A CG    1 
ATOM   2890 C  CD    . LYS A 1 354 ? 56.923 -46.160 -2.218  1.00 36.08  ? 356 LYS A CD    1 
ATOM   2891 C  CE    . LYS A 1 354 ? 58.329 -45.904 -2.773  1.00 40.47  ? 356 LYS A CE    1 
ATOM   2892 N  NZ    . LYS A 1 354 ? 59.027 -47.180 -3.112  1.00 42.69  ? 356 LYS A NZ    1 
ATOM   2893 N  N     . LYS A 1 355 ? 54.699 -41.505 -4.262  1.00 32.91  ? 357 LYS A N     1 
ATOM   2894 C  CA    . LYS A 1 355 ? 54.717 -40.685 -5.473  1.00 34.38  ? 357 LYS A CA    1 
ATOM   2895 C  C     . LYS A 1 355 ? 54.679 -39.194 -5.160  1.00 33.30  ? 357 LYS A C     1 
ATOM   2896 O  O     . LYS A 1 355 ? 55.330 -38.397 -5.844  1.00 34.51  ? 357 LYS A O     1 
ATOM   2897 C  CB    . LYS A 1 355 ? 53.562 -41.067 -6.394  1.00 35.58  ? 357 LYS A CB    1 
ATOM   2898 C  CG    . LYS A 1 355 ? 53.681 -42.487 -6.970  1.00 37.47  ? 357 LYS A CG    1 
ATOM   2899 C  CD    . LYS A 1 355 ? 52.492 -42.851 -7.850  1.00 39.66  ? 357 LYS A CD    1 
ATOM   2900 C  CE    . LYS A 1 355 ? 52.453 -42.002 -9.102  1.00 43.45  ? 357 LYS A CE    1 
ATOM   2901 N  NZ    . LYS A 1 355 ? 51.202 -42.238 -9.857  1.00 47.83  ? 357 LYS A NZ    1 
ATOM   2902 N  N     . PHE A 1 356 ? 53.911 -38.830 -4.135  1.00 31.21  ? 358 PHE A N     1 
ATOM   2903 C  CA    . PHE A 1 356 ? 53.783 -37.449 -3.689  1.00 30.60  ? 358 PHE A CA    1 
ATOM   2904 C  C     . PHE A 1 356 ? 55.118 -36.955 -3.131  1.00 31.01  ? 358 PHE A C     1 
ATOM   2905 O  O     . PHE A 1 356 ? 55.516 -35.822 -3.393  1.00 31.16  ? 358 PHE A O     1 
ATOM   2906 C  CB    . PHE A 1 356 ? 52.656 -37.336 -2.648  1.00 28.80  ? 358 PHE A CB    1 
ATOM   2907 C  CG    . PHE A 1 356 ? 52.381 -35.923 -2.172  1.00 27.92  ? 358 PHE A CG    1 
ATOM   2908 C  CD1   . PHE A 1 356 ? 51.770 -34.987 -3.017  1.00 28.03  ? 358 PHE A CD1   1 
ATOM   2909 C  CD2   . PHE A 1 356 ? 52.721 -35.535 -0.873  1.00 26.67  ? 358 PHE A CD2   1 
ATOM   2910 C  CE1   . PHE A 1 356 ? 51.510 -33.682 -2.576  1.00 26.98  ? 358 PHE A CE1   1 
ATOM   2911 C  CE2   . PHE A 1 356 ? 52.470 -34.234 -0.417  1.00 25.62  ? 358 PHE A CE2   1 
ATOM   2912 C  CZ    . PHE A 1 356 ? 51.860 -33.304 -1.271  1.00 25.65  ? 358 PHE A CZ    1 
ATOM   2913 N  N     . LEU A 1 357 ? 55.823 -37.823 -2.401  1.00 31.54  ? 359 LEU A N     1 
ATOM   2914 C  CA    . LEU A 1 357 ? 57.098 -37.464 -1.771  1.00 32.43  ? 359 LEU A CA    1 
ATOM   2915 C  C     . LEU A 1 357 ? 58.302 -37.596 -2.695  1.00 35.10  ? 359 LEU A C     1 
ATOM   2916 O  O     . LEU A 1 357 ? 59.385 -37.101 -2.378  1.00 36.01  ? 359 LEU A O     1 
ATOM   2917 C  CB    . LEU A 1 357 ? 57.329 -38.274 -0.489  1.00 31.85  ? 359 LEU A CB    1 
ATOM   2918 C  CG    . LEU A 1 357 ? 56.359 -38.095 0.690   1.00 30.63  ? 359 LEU A CG    1 
ATOM   2919 C  CD1   . LEU A 1 357 ? 56.805 -38.939 1.861   1.00 31.74  ? 359 LEU A CD1   1 
ATOM   2920 C  CD2   . LEU A 1 357 ? 56.221 -36.644 1.123   1.00 31.52  ? 359 LEU A CD2   1 
ATOM   2921 N  N     . SER A 1 358 ? 58.115 -38.256 -3.835  1.00 37.17  ? 360 SER A N     1 
ATOM   2922 C  CA    . SER A 1 358 ? 59.193 -38.439 -4.801  1.00 40.30  ? 360 SER A CA    1 
ATOM   2923 C  C     . SER A 1 358 ? 59.512 -37.157 -5.574  1.00 41.54  ? 360 SER A C     1 
ATOM   2924 O  O     . SER A 1 358 ? 60.603 -37.022 -6.123  1.00 43.89  ? 360 SER A O     1 
ATOM   2925 C  CB    . SER A 1 358 ? 58.872 -39.591 -5.756  1.00 41.78  ? 360 SER A CB    1 
ATOM   2926 O  OG    . SER A 1 358 ? 57.895 -39.206 -6.706  1.00 42.94  ? 360 SER A OG    1 
ATOM   2927 N  N     . ARG A 1 359 ? 58.563 -36.223 -5.618  1.00 40.91  ? 361 ARG A N     1 
ATOM   2928 C  CA    . ARG A 1 359 ? 58.791 -34.922 -6.245  1.00 42.11  ? 361 ARG A CA    1 
ATOM   2929 C  C     . ARG A 1 359 ? 59.870 -34.162 -5.479  1.00 41.85  ? 361 ARG A C     1 
ATOM   2930 O  O     . ARG A 1 359 ? 59.815 -34.049 -4.255  1.00 40.04  ? 361 ARG A O     1 
ATOM   2931 C  CB    . ARG A 1 359 ? 57.499 -34.091 -6.302  1.00 40.82  ? 361 ARG A CB    1 
ATOM   2932 C  CG    . ARG A 1 359 ? 56.323 -34.743 -7.038  1.00 43.22  ? 361 ARG A CG    1 
ATOM   2933 C  CD    . ARG A 1 359 ? 56.723 -35.181 -8.450  1.00 48.92  ? 361 ARG A CD    1 
ATOM   2934 N  NE    . ARG A 1 359 ? 55.730 -34.870 -9.479  1.00 52.18  ? 361 ARG A NE    1 
ATOM   2935 C  CZ    . ARG A 1 359 ? 55.624 -33.695 -10.100 1.00 54.12  ? 361 ARG A CZ    1 
ATOM   2936 N  NH1   . ARG A 1 359 ? 56.425 -32.685 -9.782  1.00 54.70  ? 361 ARG A NH1   1 
ATOM   2937 N  NH2   . ARG A 1 359 ? 54.697 -33.521 -11.033 1.00 56.20  ? 361 ARG A NH2   1 
ATOM   2938 N  N     . ASN A 1 360 ? 60.866 -33.674 -6.208  1.00 43.89  ? 362 ASN A N     1 
ATOM   2939 C  CA    . ASN A 1 360 ? 61.909 -32.842 -5.630  1.00 44.18  ? 362 ASN A CA    1 
ATOM   2940 C  C     . ASN A 1 360 ? 61.359 -31.445 -5.363  1.00 42.19  ? 362 ASN A C     1 
ATOM   2941 O  O     . ASN A 1 360 ? 60.941 -30.745 -6.287  1.00 42.47  ? 362 ASN A O     1 
ATOM   2942 C  CB    . ASN A 1 360 ? 63.150 -32.813 -6.536  1.00 47.49  ? 362 ASN A CB    1 
ATOM   2943 C  CG    . ASN A 1 360 ? 62.871 -33.354 -7.942  1.00 51.58  ? 362 ASN A CG    1 
ATOM   2944 O  OD1   . ASN A 1 360 ? 61.725 -33.355 -8.415  1.00 53.19  ? 362 ASN A OD1   1 
ATOM   2945 N  ND2   . ASN A 1 360 ? 63.924 -33.820 -8.616  1.00 55.43  ? 362 ASN A ND2   1 
ATOM   2946 N  N     . ARG A 1 361 ? 61.318 -31.064 -4.088  1.00 40.04  ? 363 ARG A N     1 
ATOM   2947 C  CA    . ARG A 1 361 ? 60.736 -29.782 -3.689  1.00 38.25  ? 363 ARG A CA    1 
ATOM   2948 C  C     . ARG A 1 361 ? 61.712 -28.977 -2.850  1.00 37.88  ? 363 ARG A C     1 
ATOM   2949 O  O     . ARG A 1 361 ? 62.668 -29.520 -2.306  1.00 38.64  ? 363 ARG A O     1 
ATOM   2950 C  CB    . ARG A 1 361 ? 59.425 -29.987 -2.916  1.00 36.25  ? 363 ARG A CB    1 
ATOM   2951 C  CG    . ARG A 1 361 ? 58.381 -30.846 -3.627  1.00 36.33  ? 363 ARG A CG    1 
ATOM   2952 C  CD    . ARG A 1 361 ? 57.163 -31.048 -2.743  1.00 35.36  ? 363 ARG A CD    1 
ATOM   2953 N  NE    . ARG A 1 361 ? 56.406 -32.252 -3.099  1.00 37.21  ? 363 ARG A NE    1 
ATOM   2954 C  CZ    . ARG A 1 361 ? 55.296 -32.249 -3.830  1.00 37.53  ? 363 ARG A CZ    1 
ATOM   2955 N  NH1   . ARG A 1 361 ? 54.810 -31.105 -4.285  1.00 39.19  ? 363 ARG A NH1   1 
ATOM   2956 N  NH2   . ARG A 1 361 ? 54.669 -33.387 -4.111  1.00 37.47  ? 363 ARG A NH2   1 
ATOM   2957 N  N     . ALA A 1 362 ? 61.458 -27.677 -2.753  1.00 36.91  ? 364 ALA A N     1 
ATOM   2958 C  CA    . ALA A 1 362 ? 62.284 -26.782 -1.952  1.00 37.15  ? 364 ALA A CA    1 
ATOM   2959 C  C     . ALA A 1 362 ? 62.141 -27.012 -0.449  1.00 35.91  ? 364 ALA A C     1 
ATOM   2960 O  O     . ALA A 1 362 ? 63.112 -26.866 0.286   1.00 36.96  ? 364 ALA A O     1 
ATOM   2961 C  CB    . ALA A 1 362 ? 61.975 -25.321 -2.295  1.00 36.33  ? 364 ALA A CB    1 
ATOM   2962 N  N     . PHE A 1 363 ? 60.949 -27.402 0.000   1.00 34.53  ? 365 PHE A N     1 
ATOM   2963 C  CA    . PHE A 1 363 ? 60.607 -27.252 1.416   1.00 33.82  ? 365 PHE A CA    1 
ATOM   2964 C  C     . PHE A 1 363 ? 60.022 -28.389 2.229   1.00 34.20  ? 365 PHE A C     1 
ATOM   2965 O  O     . PHE A 1 363 ? 59.318 -28.119 3.207   1.00 35.07  ? 365 PHE A O     1 
ATOM   2966 C  CB    . PHE A 1 363 ? 59.679 -26.053 1.593   1.00 32.06  ? 365 PHE A CB    1 
ATOM   2967 C  CG    . PHE A 1 363 ? 60.369 -24.744 1.497   1.00 31.01  ? 365 PHE A CG    1 
ATOM   2968 C  CD1   . PHE A 1 363 ? 60.053 -23.858 0.476   1.00 29.60  ? 365 PHE A CD1   1 
ATOM   2969 C  CD2   . PHE A 1 363 ? 61.335 -24.385 2.431   1.00 30.47  ? 365 PHE A CD2   1 
ATOM   2970 C  CE1   . PHE A 1 363 ? 60.694 -22.626 0.381   1.00 29.46  ? 365 PHE A CE1   1 
ATOM   2971 C  CE2   . PHE A 1 363 ? 61.982 -23.154 2.340   1.00 30.67  ? 365 PHE A CE2   1 
ATOM   2972 C  CZ    . PHE A 1 363 ? 61.659 -22.275 1.312   1.00 30.41  ? 365 PHE A CZ    1 
ATOM   2973 N  N     . ARG A 1 364 ? 60.289 -29.642 1.880   1.00 34.84  ? 366 ARG A N     1 
ATOM   2974 C  CA    . ARG A 1 364 ? 59.962 -30.764 2.788   1.00 34.01  ? 366 ARG A CA    1 
ATOM   2975 C  C     . ARG A 1 364 ? 58.476 -30.825 3.200   1.00 31.48  ? 366 ARG A C     1 
ATOM   2976 O  O     . ARG A 1 364 ? 58.000 -29.991 3.988   1.00 30.55  ? 366 ARG A O     1 
ATOM   2977 C  CB    . ARG A 1 364 ? 60.869 -30.724 4.030   1.00 35.51  ? 366 ARG A CB    1 
ATOM   2978 C  CG    . ARG A 1 364 ? 61.147 -32.051 4.685   1.00 38.38  ? 366 ARG A CG    1 
ATOM   2979 C  CD    . ARG A 1 364 ? 62.507 -32.023 5.393   1.00 44.29  ? 366 ARG A CD    1 
ATOM   2980 N  NE    . ARG A 1 364 ? 63.201 -33.313 5.273   1.00 48.81  ? 366 ARG A NE    1 
ATOM   2981 C  CZ    . ARG A 1 364 ? 64.476 -33.544 5.604   1.00 52.11  ? 366 ARG A CZ    1 
ATOM   2982 N  NH1   . ARG A 1 364 ? 65.247 -32.578 6.098   1.00 53.45  ? 366 ARG A NH1   1 
ATOM   2983 N  NH2   . ARG A 1 364 ? 64.983 -34.762 5.443   1.00 53.62  ? 366 ARG A NH2   1 
ATOM   2984 N  N     . PRO A 1 365 ? 57.734 -31.804 2.650   1.00 30.22  ? 367 PRO A N     1 
ATOM   2985 C  CA    . PRO A 1 365 ? 56.319 -32.014 2.961   1.00 28.49  ? 367 PRO A CA    1 
ATOM   2986 C  C     . PRO A 1 365 ? 56.070 -32.409 4.414   1.00 27.81  ? 367 PRO A C     1 
ATOM   2987 O  O     . PRO A 1 365 ? 57.001 -32.795 5.130   1.00 27.91  ? 367 PRO A O     1 
ATOM   2988 C  CB    . PRO A 1 365 ? 55.925 -33.151 2.011   1.00 28.68  ? 367 PRO A CB    1 
ATOM   2989 C  CG    . PRO A 1 365 ? 56.904 -33.043 0.897   1.00 29.73  ? 367 PRO A CG    1 
ATOM   2990 C  CD    . PRO A 1 365 ? 58.184 -32.751 1.615   1.00 30.90  ? 367 PRO A CD    1 
ATOM   2991 N  N     . PHE A 1 366 ? 54.814 -32.288 4.838   1.00 26.81  ? 368 PHE A N     1 
ATOM   2992 C  CA    . PHE A 1 366 ? 54.441 -32.468 6.234   1.00 26.31  ? 368 PHE A CA    1 
ATOM   2993 C  C     . PHE A 1 366 ? 53.109 -33.197 6.367   1.00 25.74  ? 368 PHE A C     1 
ATOM   2994 O  O     . PHE A 1 366 ? 52.301 -33.208 5.439   1.00 25.35  ? 368 PHE A O     1 
ATOM   2995 C  CB    . PHE A 1 366 ? 54.404 -31.109 6.976   1.00 26.15  ? 368 PHE A CB    1 
ATOM   2996 C  CG    . PHE A 1 366 ? 53.442 -30.098 6.390   1.00 25.57  ? 368 PHE A CG    1 
ATOM   2997 C  CD1   . PHE A 1 366 ? 53.818 -29.291 5.315   1.00 24.54  ? 368 PHE A CD1   1 
ATOM   2998 C  CD2   . PHE A 1 366 ? 52.171 -29.925 6.938   1.00 25.52  ? 368 PHE A CD2   1 
ATOM   2999 C  CE1   . PHE A 1 366 ? 52.935 -28.357 4.777   1.00 24.01  ? 368 PHE A CE1   1 
ATOM   3000 C  CE2   . PHE A 1 366 ? 51.283 -28.985 6.414   1.00 25.13  ? 368 PHE A CE2   1 
ATOM   3001 C  CZ    . PHE A 1 366 ? 51.666 -28.197 5.331   1.00 25.08  ? 368 PHE A CZ    1 
ATOM   3002 N  N     . ILE A 1 367 ? 52.901 -33.813 7.526   1.00 25.40  ? 369 ILE A N     1 
ATOM   3003 C  CA    . ILE A 1 367 ? 51.623 -34.426 7.859   1.00 25.37  ? 369 ILE A CA    1 
ATOM   3004 C  C     . ILE A 1 367 ? 50.777 -33.445 8.668   1.00 25.74  ? 369 ILE A C     1 
ATOM   3005 O  O     . ILE A 1 367 ? 51.251 -32.836 9.628   1.00 26.00  ? 369 ILE A O     1 
ATOM   3006 C  CB    . ILE A 1 367 ? 51.804 -35.793 8.616   1.00 25.98  ? 369 ILE A CB    1 
ATOM   3007 C  CG1   . ILE A 1 367 ? 52.591 -36.789 7.747   1.00 25.13  ? 369 ILE A CG1   1 
ATOM   3008 C  CG2   . ILE A 1 367 ? 50.444 -36.408 9.009   1.00 26.33  ? 369 ILE A CG2   1 
ATOM   3009 C  CD1   . ILE A 1 367 ? 53.022 -38.091 8.469   1.00 26.08  ? 369 ILE A CD1   1 
ATOM   3010 N  N     . GLU A 1 368 ? 49.524 -33.276 8.259   1.00 25.68  ? 370 GLU A N     1 
ATOM   3011 C  CA    . GLU A 1 368 ? 48.571 -32.492 9.043   1.00 26.42  ? 370 GLU A CA    1 
ATOM   3012 C  C     . GLU A 1 368 ? 47.184 -33.083 8.936   1.00 26.82  ? 370 GLU A C     1 
ATOM   3013 O  O     . GLU A 1 368 ? 46.695 -33.311 7.835   1.00 26.66  ? 370 GLU A O     1 
ATOM   3014 C  CB    . GLU A 1 368 ? 48.552 -31.033 8.578   1.00 26.51  ? 370 GLU A CB    1 
ATOM   3015 C  CG    . GLU A 1 368 ? 47.505 -30.180 9.283   1.00 27.32  ? 370 GLU A CG    1 
ATOM   3016 C  CD    . GLU A 1 368 ? 47.236 -28.889 8.554   1.00 27.89  ? 370 GLU A CD    1 
ATOM   3017 O  OE1   . GLU A 1 368 ? 48.112 -28.010 8.581   1.00 26.33  ? 370 GLU A OE1   1 
ATOM   3018 O  OE2   . GLU A 1 368 ? 46.144 -28.752 7.963   1.00 29.51  ? 370 GLU A OE2   1 
ATOM   3019 N  N     . ASN A 1 369 ? 46.551 -33.307 10.085  1.00 28.12  ? 371 ASN A N     1 
ATOM   3020 C  CA    . ASN A 1 369 ? 45.217 -33.913 10.169  1.00 29.55  ? 371 ASN A CA    1 
ATOM   3021 C  C     . ASN A 1 369 ? 45.062 -35.157 9.290   1.00 29.10  ? 371 ASN A C     1 
ATOM   3022 O  O     . ASN A 1 369 ? 44.097 -35.276 8.528   1.00 29.57  ? 371 ASN A O     1 
ATOM   3023 C  CB    . ASN A 1 369 ? 44.113 -32.886 9.873   1.00 30.81  ? 371 ASN A CB    1 
ATOM   3024 C  CG    . ASN A 1 369 ? 44.088 -31.738 10.877  1.00 32.70  ? 371 ASN A CG    1 
ATOM   3025 O  OD1   . ASN A 1 369 ? 44.087 -31.950 12.087  1.00 35.21  ? 371 ASN A OD1   1 
ATOM   3026 N  ND2   . ASN A 1 369 ? 44.045 -30.517 10.373  1.00 32.54  ? 371 ASN A ND2   1 
ATOM   3027 N  N     . GLY A 1 370 ? 46.035 -36.064 9.392   1.00 28.09  ? 372 GLY A N     1 
ATOM   3028 C  CA    . GLY A 1 370 ? 45.952 -37.372 8.747   1.00 28.06  ? 372 GLY A CA    1 
ATOM   3029 C  C     . GLY A 1 370 ? 46.372 -37.429 7.295   1.00 27.10  ? 372 GLY A C     1 
ATOM   3030 O  O     . GLY A 1 370 ? 46.359 -38.499 6.689   1.00 27.09  ? 372 GLY A O     1 
ATOM   3031 N  N     . ARG A 1 371 ? 46.751 -36.289 6.726   1.00 27.03  ? 373 ARG A N     1 
ATOM   3032 C  CA    . ARG A 1 371 ? 47.182 -36.280 5.327   1.00 27.07  ? 373 ARG A CA    1 
ATOM   3033 C  C     . ARG A 1 371 ? 48.462 -35.495 5.062   1.00 25.85  ? 373 ARG A C     1 
ATOM   3034 O  O     . ARG A 1 371 ? 48.846 -34.616 5.829   1.00 25.64  ? 373 ARG A O     1 
ATOM   3035 C  CB    . ARG A 1 371 ? 46.039 -35.893 4.369   1.00 28.13  ? 373 ARG A CB    1 
ATOM   3036 C  CG    . ARG A 1 371 ? 45.590 -34.447 4.408   1.00 29.72  ? 373 ARG A CG    1 
ATOM   3037 C  CD    . ARG A 1 371 ? 44.338 -34.192 3.519   1.00 30.83  ? 373 ARG A CD    1 
ATOM   3038 N  NE    . ARG A 1 371 ? 44.460 -34.812 2.208   1.00 31.73  ? 373 ARG A NE    1 
ATOM   3039 C  CZ    . ARG A 1 371 ? 43.661 -35.764 1.725   1.00 33.68  ? 373 ARG A CZ    1 
ATOM   3040 N  NH1   . ARG A 1 371 ? 42.625 -36.219 2.418   1.00 35.37  ? 373 ARG A NH1   1 
ATOM   3041 N  NH2   . ARG A 1 371 ? 43.902 -36.259 0.525   1.00 32.26  ? 373 ARG A NH2   1 
ATOM   3042 N  N     . TRP A 1 372 ? 49.131 -35.865 3.981   1.00 25.17  ? 374 TRP A N     1 
ATOM   3043 C  CA    . TRP A 1 372 ? 50.354 -35.212 3.547   1.00 24.38  ? 374 TRP A CA    1 
ATOM   3044 C  C     . TRP A 1 372 ? 50.044 -33.907 2.814   1.00 24.50  ? 374 TRP A C     1 
ATOM   3045 O  O     . TRP A 1 372 ? 49.023 -33.798 2.124   1.00 24.19  ? 374 TRP A O     1 
ATOM   3046 C  CB    . TRP A 1 372 ? 51.133 -36.146 2.635   1.00 24.21  ? 374 TRP A CB    1 
ATOM   3047 C  CG    . TRP A 1 372 ? 51.858 -37.194 3.399   1.00 23.86  ? 374 TRP A CG    1 
ATOM   3048 C  CD1   . TRP A 1 372 ? 51.416 -38.456 3.707   1.00 23.73  ? 374 TRP A CD1   1 
ATOM   3049 C  CD2   . TRP A 1 372 ? 53.155 -37.067 3.983   1.00 23.94  ? 374 TRP A CD2   1 
ATOM   3050 N  NE1   . TRP A 1 372 ? 52.373 -39.126 4.435   1.00 23.72  ? 374 TRP A NE1   1 
ATOM   3051 C  CE2   . TRP A 1 372 ? 53.451 -38.296 4.618   1.00 24.03  ? 374 TRP A CE2   1 
ATOM   3052 C  CE3   . TRP A 1 372 ? 54.101 -36.032 4.032   1.00 24.09  ? 374 TRP A CE3   1 
ATOM   3053 C  CZ2   . TRP A 1 372 ? 54.658 -38.520 5.282   1.00 24.37  ? 374 TRP A CZ2   1 
ATOM   3054 C  CZ3   . TRP A 1 372 ? 55.294 -36.257 4.701   1.00 24.61  ? 374 TRP A CZ3   1 
ATOM   3055 C  CH2   . TRP A 1 372 ? 55.560 -37.494 5.319   1.00 24.46  ? 374 TRP A CH2   1 
ATOM   3056 N  N     . TRP A 1 373 ? 50.925 -32.927 3.003   1.00 24.19  ? 375 TRP A N     1 
ATOM   3057 C  CA    . TRP A 1 373 ? 50.834 -31.628 2.337   1.00 24.67  ? 375 TRP A CA    1 
ATOM   3058 C  C     . TRP A 1 373 ? 52.219 -31.207 1.898   1.00 24.94  ? 375 TRP A C     1 
ATOM   3059 O  O     . TRP A 1 373 ? 53.204 -31.529 2.564   1.00 24.56  ? 375 TRP A O     1 
ATOM   3060 C  CB    . TRP A 1 373 ? 50.284 -30.554 3.273   1.00 24.38  ? 375 TRP A CB    1 
ATOM   3061 C  CG    . TRP A 1 373 ? 48.913 -30.792 3.758   1.00 24.46  ? 375 TRP A CG    1 
ATOM   3062 C  CD1   . TRP A 1 373 ? 48.537 -31.612 4.791   1.00 25.21  ? 375 TRP A CD1   1 
ATOM   3063 C  CD2   . TRP A 1 373 ? 47.715 -30.207 3.251   1.00 25.27  ? 375 TRP A CD2   1 
ATOM   3064 N  NE1   . TRP A 1 373 ? 47.176 -31.570 4.949   1.00 25.77  ? 375 TRP A NE1   1 
ATOM   3065 C  CE2   . TRP A 1 373 ? 46.644 -30.720 4.017   1.00 26.63  ? 375 TRP A CE2   1 
ATOM   3066 C  CE3   . TRP A 1 373 ? 47.436 -29.296 2.222   1.00 25.81  ? 375 TRP A CE3   1 
ATOM   3067 C  CZ2   . TRP A 1 373 ? 45.313 -30.347 3.790   1.00 27.42  ? 375 TRP A CZ2   1 
ATOM   3068 C  CZ3   . TRP A 1 373 ? 46.117 -28.934 1.994   1.00 27.03  ? 375 TRP A CZ3   1 
ATOM   3069 C  CH2   . TRP A 1 373 ? 45.071 -29.462 2.775   1.00 27.45  ? 375 TRP A CH2   1 
ATOM   3070 N  N     . ALA A 1 374 ? 52.293 -30.478 0.787   1.00 25.79  ? 376 ALA A N     1 
ATOM   3071 C  CA    . ALA A 1 374 ? 53.572 -29.964 0.311   1.00 26.51  ? 376 ALA A CA    1 
ATOM   3072 C  C     . ALA A 1 374 ? 53.574 -28.446 0.228   1.00 26.75  ? 376 ALA A C     1 
ATOM   3073 O  O     . ALA A 1 374 ? 52.555 -27.838 -0.090  1.00 26.95  ? 376 ALA A O     1 
ATOM   3074 C  CB    . ALA A 1 374 ? 53.905 -30.558 -1.036  1.00 27.53  ? 376 ALA A CB    1 
ATOM   3075 N  N     . PHE A 1 375 ? 54.722 -27.838 0.521   1.00 26.77  ? 377 PHE A N     1 
ATOM   3076 C  CA    . PHE A 1 375 ? 54.938 -26.442 0.157   1.00 26.87  ? 377 PHE A CA    1 
ATOM   3077 C  C     . PHE A 1 375 ? 55.405 -26.363 -1.295  1.00 27.73  ? 377 PHE A C     1 
ATOM   3078 O  O     . PHE A 1 375 ? 56.278 -27.127 -1.733  1.00 28.23  ? 377 PHE A O     1 
ATOM   3079 C  CB    . PHE A 1 375 ? 55.949 -25.757 1.072   1.00 26.43  ? 377 PHE A CB    1 
ATOM   3080 C  CG    . PHE A 1 375 ? 55.461 -25.547 2.469   1.00 27.12  ? 377 PHE A CG    1 
ATOM   3081 C  CD1   . PHE A 1 375 ? 56.083 -26.191 3.536   1.00 26.78  ? 377 PHE A CD1   1 
ATOM   3082 C  CD2   . PHE A 1 375 ? 54.380 -24.700 2.731   1.00 26.08  ? 377 PHE A CD2   1 
ATOM   3083 C  CE1   . PHE A 1 375 ? 55.643 -25.992 4.838   1.00 26.27  ? 377 PHE A CE1   1 
ATOM   3084 C  CE2   . PHE A 1 375 ? 53.932 -24.511 4.028   1.00 25.22  ? 377 PHE A CE2   1 
ATOM   3085 C  CZ    . PHE A 1 375 ? 54.569 -25.154 5.086   1.00 25.75  ? 377 PHE A CZ    1 
ATOM   3086 N  N     . GLU A 1 376 ? 54.816 -25.429 -2.034  1.00 27.53  ? 378 GLU A N     1 
ATOM   3087 C  CA    . GLU A 1 376 ? 55.098 -25.291 -3.450  1.00 28.84  ? 378 GLU A CA    1 
ATOM   3088 C  C     . GLU A 1 376 ? 55.331 -23.805 -3.737  1.00 28.17  ? 378 GLU A C     1 
ATOM   3089 O  O     . GLU A 1 376 ? 54.931 -22.956 -2.928  1.00 26.85  ? 378 GLU A O     1 
ATOM   3090 C  CB    . GLU A 1 376 ? 53.925 -25.854 -4.247  1.00 29.77  ? 378 GLU A CB    1 
ATOM   3091 C  CG    . GLU A 1 376 ? 54.329 -26.679 -5.449  1.00 35.06  ? 378 GLU A CG    1 
ATOM   3092 C  CD    . GLU A 1 376 ? 54.697 -28.115 -5.092  1.00 39.13  ? 378 GLU A CD    1 
ATOM   3093 O  OE1   . GLU A 1 376 ? 55.906 -28.434 -5.121  1.00 41.70  ? 378 GLU A OE1   1 
ATOM   3094 O  OE2   . GLU A 1 376 ? 53.786 -28.924 -4.790  1.00 39.95  ? 378 GLU A OE2   1 
ATOM   3095 N  N     . MET A 1 377 ? 55.994 -23.492 -4.850  1.00 28.31  ? 379 MET A N     1 
ATOM   3096 C  CA    . MET A 1 377 ? 56.314 -22.094 -5.195  1.00 28.35  ? 379 MET A CA    1 
ATOM   3097 C  C     . MET A 1 377 ? 55.534 -21.589 -6.405  1.00 28.56  ? 379 MET A C     1 
ATOM   3098 O  O     . MET A 1 377 ? 55.508 -22.242 -7.457  1.00 29.56  ? 379 MET A O     1 
ATOM   3099 C  CB    . MET A 1 377 ? 57.824 -21.895 -5.437  1.00 29.44  ? 379 MET A CB    1 
ATOM   3100 C  CG    . MET A 1 377 ? 58.718 -22.234 -4.229  1.00 30.73  ? 379 MET A CG    1 
ATOM   3101 S  SD    . MET A 1 377 ? 58.447 -21.167 -2.792  1.00 32.25  ? 379 MET A SD    1 
ATOM   3102 C  CE    . MET A 1 377 ? 59.788 -19.980 -2.962  1.00 33.13  ? 379 MET A CE    1 
ATOM   3103 N  N     . ARG A 1 378 ? 54.916 -20.422 -6.246  1.00 27.43  ? 380 ARG A N     1 
ATOM   3104 C  CA    . ARG A 1 378 ? 54.233 -19.722 -7.350  1.00 27.98  ? 380 ARG A CA    1 
ATOM   3105 C  C     . ARG A 1 378 ? 55.201 -19.128 -8.364  1.00 28.94  ? 380 ARG A C     1 
ATOM   3106 O  O     . ARG A 1 378 ? 56.320 -18.748 -8.010  1.00 28.61  ? 380 ARG A O     1 
ATOM   3107 C  CB    . ARG A 1 378 ? 53.360 -18.590 -6.797  1.00 27.14  ? 380 ARG A CB    1 
ATOM   3108 C  CG    . ARG A 1 378 ? 52.152 -19.070 -6.015  1.00 27.02  ? 380 ARG A CG    1 
ATOM   3109 C  CD    . ARG A 1 378 ? 51.303 -17.900 -5.558  1.00 25.64  ? 380 ARG A CD    1 
ATOM   3110 N  NE    . ARG A 1 378 ? 50.041 -18.368 -4.986  1.00 25.20  ? 380 ARG A NE    1 
ATOM   3111 C  CZ    . ARG A 1 378 ? 49.844 -18.611 -3.697  1.00 23.49  ? 380 ARG A CZ    1 
ATOM   3112 N  NH1   . ARG A 1 378 ? 50.822 -18.426 -2.819  1.00 22.40  ? 380 ARG A NH1   1 
ATOM   3113 N  NH2   . ARG A 1 378 ? 48.663 -19.043 -3.286  1.00 24.26  ? 380 ARG A NH2   1 
ATOM   3114 N  N     . LYS A 1 379 ? 54.739 -19.021 -9.614  1.00 30.34  ? 381 LYS A N     1 
ATOM   3115 C  CA    . LYS A 1 379 ? 55.470 -18.378 -10.708 1.00 31.81  ? 381 LYS A CA    1 
ATOM   3116 C  C     . LYS A 1 379 ? 55.230 -16.871 -10.760 1.00 30.60  ? 381 LYS A C     1 
ATOM   3117 O  O     . LYS A 1 379 ? 55.955 -16.154 -11.440 1.00 31.66  ? 381 LYS A O     1 
ATOM   3118 C  CB    . LYS A 1 379 ? 55.041 -18.979 -12.054 1.00 34.78  ? 381 LYS A CB    1 
ATOM   3119 C  CG    . LYS A 1 379 ? 55.632 -20.349 -12.362 1.00 37.84  ? 381 LYS A CG    1 
ATOM   3120 C  CD    . LYS A 1 379 ? 56.814 -20.203 -13.312 1.00 42.94  ? 381 LYS A CD    1 
ATOM   3121 C  CE    . LYS A 1 379 ? 57.153 -21.520 -13.997 1.00 46.58  ? 381 LYS A CE    1 
ATOM   3122 N  NZ    . LYS A 1 379 ? 57.442 -22.571 -12.979 1.00 46.23  ? 381 LYS A NZ    1 
ATOM   3123 N  N     . PHE A 1 380 ? 54.189 -16.409 -10.068 1.00 28.70  ? 382 PHE A N     1 
ATOM   3124 C  CA    . PHE A 1 380 ? 53.830 -14.988 -10.016 1.00 27.79  ? 382 PHE A CA    1 
ATOM   3125 C  C     . PHE A 1 380 ? 53.261 -14.665 -8.644  1.00 25.92  ? 382 PHE A C     1 
ATOM   3126 O  O     . PHE A 1 380 ? 52.727 -15.545 -7.965  1.00 25.16  ? 382 PHE A O     1 
ATOM   3127 C  CB    . PHE A 1 380 ? 52.827 -14.610 -11.125 1.00 29.17  ? 382 PHE A CB    1 
ATOM   3128 C  CG    . PHE A 1 380 ? 51.749 -15.627 -11.348 1.00 29.49  ? 382 PHE A CG    1 
ATOM   3129 C  CD1   . PHE A 1 380 ? 50.709 -15.783 -10.431 1.00 28.23  ? 382 PHE A CD1   1 
ATOM   3130 C  CD2   . PHE A 1 380 ? 51.769 -16.435 -12.480 1.00 32.31  ? 382 PHE A CD2   1 
ATOM   3131 C  CE1   . PHE A 1 380 ? 49.720 -16.732 -10.627 1.00 29.09  ? 382 PHE A CE1   1 
ATOM   3132 C  CE2   . PHE A 1 380 ? 50.774 -17.382 -12.692 1.00 33.18  ? 382 PHE A CE2   1 
ATOM   3133 C  CZ    . PHE A 1 380 ? 49.749 -17.532 -11.754 1.00 31.38  ? 382 PHE A CZ    1 
ATOM   3134 N  N     . THR A 1 381 ? 53.382 -13.412 -8.222  1.00 25.15  ? 383 THR A N     1 
ATOM   3135 C  CA    . THR A 1 381 ? 52.931 -13.040 -6.877  1.00 23.97  ? 383 THR A CA    1 
ATOM   3136 C  C     . THR A 1 381 ? 51.959 -11.872 -6.864  1.00 24.27  ? 383 THR A C     1 
ATOM   3137 O  O     . THR A 1 381 ? 51.446 -11.490 -5.807  1.00 23.48  ? 383 THR A O     1 
ATOM   3138 C  CB    . THR A 1 381 ? 54.120 -12.766 -5.911  1.00 23.29  ? 383 THR A CB    1 
ATOM   3139 O  OG1   . THR A 1 381 ? 54.969 -11.752 -6.450  1.00 23.25  ? 383 THR A OG1   1 
ATOM   3140 C  CG2   . THR A 1 381 ? 54.915 -14.042 -5.669  1.00 23.30  ? 383 THR A CG2   1 
ATOM   3141 N  N     . THR A 1 382 ? 51.687 -11.311 -8.038  1.00 21.12  ? 384 THR A N     1 
ATOM   3142 C  CA    . THR A 1 382 ? 50.710 -10.227 -8.118  1.00 20.57  ? 384 THR A CA    1 
ATOM   3143 C  C     . THR A 1 382 ? 49.620 -10.555 -9.130  1.00 19.42  ? 384 THR A C     1 
ATOM   3144 O  O     . THR A 1 382 ? 49.838 -11.355 -10.026 1.00 18.88  ? 384 THR A O     1 
ATOM   3145 C  CB    . THR A 1 382 ? 51.365 -8.868  -8.461  1.00 20.72  ? 384 THR A CB    1 
ATOM   3146 O  OG1   . THR A 1 382 ? 51.695 -8.841  -9.850  1.00 21.90  ? 384 THR A OG1   1 
ATOM   3147 C  CG2   . THR A 1 382 ? 52.612 -8.625  -7.617  1.00 22.19  ? 384 THR A CG2   1 
ATOM   3148 N  N     . PRO A 1 383 ? 48.430 -9.950  -8.976  1.00 19.29  ? 385 PRO A N     1 
ATOM   3149 C  CA    . PRO A 1 383 ? 47.382 -10.223 -9.956  1.00 18.85  ? 385 PRO A CA    1 
ATOM   3150 C  C     . PRO A 1 383 ? 47.795 -9.799  -11.380 1.00 18.89  ? 385 PRO A C     1 
ATOM   3151 O  O     . PRO A 1 383 ? 47.457 -10.489 -12.342 1.00 18.54  ? 385 PRO A O     1 
ATOM   3152 C  CB    . PRO A 1 383 ? 46.187 -9.422  -9.436  1.00 18.42  ? 385 PRO A CB    1 
ATOM   3153 C  CG    . PRO A 1 383 ? 46.758 -8.420  -8.496  1.00 19.34  ? 385 PRO A CG    1 
ATOM   3154 C  CD    . PRO A 1 383 ? 47.985 -9.016  -7.925  1.00 19.29  ? 385 PRO A CD    1 
ATOM   3155 N  N     . GLU A 1 384 ? 48.558 -8.711  -11.499 1.00 19.52  ? 386 GLU A N     1 
ATOM   3156 C  CA    . GLU A 1 384 ? 49.056 -8.251  -12.800 1.00 19.93  ? 386 GLU A CA    1 
ATOM   3157 C  C     . GLU A 1 384 ? 50.031 -9.229  -13.458 1.00 20.38  ? 386 GLU A C     1 
ATOM   3158 O  O     . GLU A 1 384 ? 49.916 -9.506  -14.648 1.00 20.42  ? 386 GLU A O     1 
ATOM   3159 C  CB    . GLU A 1 384 ? 49.701 -6.871  -12.696 1.00 20.15  ? 386 GLU A CB    1 
ATOM   3160 C  CG    . GLU A 1 384 ? 48.753 -5.787  -12.250 1.00 21.16  ? 386 GLU A CG    1 
ATOM   3161 C  CD    . GLU A 1 384 ? 48.804 -5.507  -10.754 1.00 22.48  ? 386 GLU A CD    1 
ATOM   3162 O  OE1   . GLU A 1 384 ? 49.080 -6.423  -9.931  1.00 19.08  ? 386 GLU A OE1   1 
ATOM   3163 O  OE2   . GLU A 1 384 ? 48.556 -4.334  -10.404 1.00 25.06  ? 386 GLU A OE2   1 
ATOM   3164 N  N     . GLU A 1 385 ? 51.006 -9.723  -12.695 1.00 21.44  ? 387 GLU A N     1 
ATOM   3165 C  CA    . GLU A 1 385 ? 51.922 -10.747 -13.193 1.00 22.21  ? 387 GLU A CA    1 
ATOM   3166 C  C     . GLU A 1 385 ? 51.150 -11.997 -13.631 1.00 21.38  ? 387 GLU A C     1 
ATOM   3167 O  O     . GLU A 1 385 ? 51.466 -12.607 -14.655 1.00 21.47  ? 387 GLU A O     1 
ATOM   3168 C  CB    . GLU A 1 385 ? 52.923 -11.134 -12.111 1.00 23.19  ? 387 GLU A CB    1 
ATOM   3169 C  CG    . GLU A 1 385 ? 54.033 -10.126 -11.881 1.00 24.43  ? 387 GLU A CG    1 
ATOM   3170 C  CD    . GLU A 1 385 ? 54.892 -10.461 -10.678 1.00 26.54  ? 387 GLU A CD    1 
ATOM   3171 O  OE1   . GLU A 1 385 ? 54.682 -11.535 -10.047 1.00 25.36  ? 387 GLU A OE1   1 
ATOM   3172 O  OE2   . GLU A 1 385 ? 55.786 -9.630  -10.373 1.00 30.73  ? 387 GLU A OE2   1 
ATOM   3173 N  N     . GLY A 1 386 ? 50.143 -12.366 -12.840 1.00 20.20  ? 388 GLY A N     1 
ATOM   3174 C  CA    . GLY A 1 386 ? 49.281 -13.509 -13.141 1.00 19.29  ? 388 GLY A CA    1 
ATOM   3175 C  C     . GLY A 1 386 ? 48.535 -13.358 -14.461 1.00 18.47  ? 388 GLY A C     1 
ATOM   3176 O  O     . GLY A 1 386 ? 48.567 -14.258 -15.302 1.00 18.41  ? 388 GLY A O     1 
ATOM   3177 N  N     . VAL A 1 387 ? 47.880 -12.211 -14.650 1.00 17.72  ? 389 VAL A N     1 
ATOM   3178 C  CA    . VAL A 1 387 ? 47.095 -11.959 -15.872 1.00 16.97  ? 389 VAL A CA    1 
ATOM   3179 C  C     . VAL A 1 387 ? 48.001 -11.874 -17.107 1.00 17.45  ? 389 VAL A C     1 
ATOM   3180 O  O     . VAL A 1 387 ? 47.643 -12.342 -18.194 1.00 16.38  ? 389 VAL A O     1 
ATOM   3181 C  CB    . VAL A 1 387 ? 46.182 -10.723 -15.719 1.00 16.85  ? 389 VAL A CB    1 
ATOM   3182 C  CG1   . VAL A 1 387 ? 45.475 -10.385 -17.034 1.00 16.11  ? 389 VAL A CG1   1 
ATOM   3183 C  CG2   . VAL A 1 387 ? 45.150 -10.997 -14.634 1.00 14.98  ? 389 VAL A CG2   1 
ATOM   3184 N  N     . ARG A 1 388 ? 49.194 -11.314 -16.928 1.00 18.22  ? 390 ARG A N     1 
ATOM   3185 C  CA    . ARG A 1 388 ? 50.167 -11.282 -18.015 1.00 19.37  ? 390 ARG A CA    1 
ATOM   3186 C  C     . ARG A 1 388 ? 50.484 -12.690 -18.479 1.00 19.77  ? 390 ARG A C     1 
ATOM   3187 O  O     . ARG A 1 388 ? 50.517 -12.956 -19.675 1.00 20.73  ? 390 ARG A O     1 
ATOM   3188 C  CB    . ARG A 1 388 ? 51.454 -10.587 -17.594 1.00 20.35  ? 390 ARG A CB    1 
ATOM   3189 C  CG    . ARG A 1 388 ? 52.414 -10.381 -18.758 1.00 22.69  ? 390 ARG A CG    1 
ATOM   3190 C  CD    . ARG A 1 388 ? 53.850 -10.514 -18.309 1.00 28.14  ? 390 ARG A CD    1 
ATOM   3191 N  NE    . ARG A 1 388 ? 54.361 -9.336  -17.620 1.00 31.52  ? 390 ARG A NE    1 
ATOM   3192 C  CZ    . ARG A 1 388 ? 54.898 -9.333  -16.397 1.00 33.01  ? 390 ARG A CZ    1 
ATOM   3193 N  NH1   . ARG A 1 388 ? 55.008 -10.451 -15.687 1.00 33.83  ? 390 ARG A NH1   1 
ATOM   3194 N  NH2   . ARG A 1 388 ? 55.351 -8.197  -15.887 1.00 32.80  ? 390 ARG A NH2   1 
ATOM   3195 N  N     . SER A 1 389 ? 50.729 -13.581 -17.527 1.00 20.04  ? 391 SER A N     1 
ATOM   3196 C  CA    . SER A 1 389 ? 50.995 -14.979 -17.832 1.00 20.58  ? 391 SER A CA    1 
ATOM   3197 C  C     . SER A 1 389 ? 49.775 -15.609 -18.495 1.00 19.73  ? 391 SER A C     1 
ATOM   3198 O  O     . SER A 1 389 ? 49.885 -16.240 -19.549 1.00 20.10  ? 391 SER A O     1 
ATOM   3199 C  CB    . SER A 1 389 ? 51.392 -15.731 -16.559 1.00 20.99  ? 391 SER A CB    1 
ATOM   3200 O  OG    . SER A 1 389 ? 51.463 -17.121 -16.813 1.00 23.23  ? 391 SER A OG    1 
ATOM   3201 N  N     . TYR A 1 390 ? 48.609 -15.399 -17.885 1.00 18.78  ? 392 TYR A N     1 
ATOM   3202 C  CA    . TYR A 1 390 ? 47.364 -16.007 -18.351 1.00 18.00  ? 392 TYR A CA    1 
ATOM   3203 C  C     . TYR A 1 390 ? 46.956 -15.555 -19.769 1.00 17.78  ? 392 TYR A C     1 
ATOM   3204 O  O     . TYR A 1 390 ? 46.710 -16.386 -20.643 1.00 18.24  ? 392 TYR A O     1 
ATOM   3205 C  CB    . TYR A 1 390 ? 46.226 -15.752 -17.346 1.00 16.62  ? 392 TYR A CB    1 
ATOM   3206 C  CG    . TYR A 1 390 ? 44.923 -16.349 -17.813 1.00 16.42  ? 392 TYR A CG    1 
ATOM   3207 C  CD1   . TYR A 1 390 ? 44.699 -17.730 -17.729 1.00 16.32  ? 392 TYR A CD1   1 
ATOM   3208 C  CD2   . TYR A 1 390 ? 43.934 -15.554 -18.398 1.00 15.70  ? 392 TYR A CD2   1 
ATOM   3209 C  CE1   . TYR A 1 390 ? 43.507 -18.288 -18.188 1.00 14.44  ? 392 TYR A CE1   1 
ATOM   3210 C  CE2   . TYR A 1 390 ? 42.736 -16.112 -18.850 1.00 15.81  ? 392 TYR A CE2   1 
ATOM   3211 C  CZ    . TYR A 1 390 ? 42.544 -17.479 -18.747 1.00 15.45  ? 392 TYR A CZ    1 
ATOM   3212 O  OH    . TYR A 1 390 ? 41.371 -18.036 -19.186 1.00 15.75  ? 392 TYR A OH    1 
ATOM   3213 N  N     . ALA A 1 391 ? 46.901 -14.243 -19.987 1.00 17.12  ? 393 ALA A N     1 
ATOM   3214 C  CA    . ALA A 1 391 ? 46.533 -13.684 -21.279 1.00 17.18  ? 393 ALA A CA    1 
ATOM   3215 C  C     . ALA A 1 391 ? 47.525 -14.010 -22.413 1.00 18.10  ? 393 ALA A C     1 
ATOM   3216 O  O     . ALA A 1 391 ? 47.110 -14.130 -23.574 1.00 18.03  ? 393 ALA A O     1 
ATOM   3217 C  CB    . ALA A 1 391 ? 46.267 -12.167 -21.173 1.00 16.29  ? 393 ALA A CB    1 
ATOM   3218 N  N     . SER A 1 392 ? 48.814 -14.154 -22.082 1.00 18.23  ? 394 SER A N     1 
ATOM   3219 C  CA    . SER A 1 392 ? 49.824 -14.507 -23.080 1.00 19.69  ? 394 SER A CA    1 
ATOM   3220 C  C     . SER A 1 392 ? 49.705 -15.947 -23.554 1.00 20.86  ? 394 SER A C     1 
ATOM   3221 O  O     . SER A 1 392 ? 49.938 -16.225 -24.730 1.00 21.36  ? 394 SER A O     1 
ATOM   3222 C  CB    . SER A 1 392 ? 51.249 -14.281 -22.558 1.00 20.05  ? 394 SER A CB    1 
ATOM   3223 O  OG    . SER A 1 392 ? 51.463 -12.936 -22.219 1.00 19.67  ? 394 SER A OG    1 
ATOM   3224 N  N     . THR A 1 393 ? 49.368 -16.862 -22.642 1.00 21.96  ? 395 THR A N     1 
ATOM   3225 C  CA    . THR A 1 393 ? 49.251 -18.282 -23.002 1.00 23.94  ? 395 THR A CA    1 
ATOM   3226 C  C     . THR A 1 393 ? 47.818 -18.727 -23.333 1.00 23.77  ? 395 THR A C     1 
ATOM   3227 O  O     . THR A 1 393 ? 47.636 -19.654 -24.107 1.00 24.76  ? 395 THR A O     1 
ATOM   3228 C  CB    . THR A 1 393 ? 49.836 -19.221 -21.925 1.00 24.55  ? 395 THR A CB    1 
ATOM   3229 O  OG1   . THR A 1 393 ? 49.187 -18.972 -20.675 1.00 26.05  ? 395 THR A OG1   1 
ATOM   3230 C  CG2   . THR A 1 393 ? 51.327 -19.008 -21.766 1.00 24.98  ? 395 THR A CG2   1 
ATOM   3231 N  N     . HIS A 1 394 ? 46.814 -18.068 -22.759 1.00 23.09  ? 396 HIS A N     1 
ATOM   3232 C  CA    . HIS A 1 394 ? 45.405 -18.448 -22.970 1.00 22.76  ? 396 HIS A CA    1 
ATOM   3233 C  C     . HIS A 1 394 ? 44.624 -17.453 -23.826 1.00 21.85  ? 396 HIS A C     1 
ATOM   3234 O  O     . HIS A 1 394 ? 43.407 -17.327 -23.667 1.00 21.61  ? 396 HIS A O     1 
ATOM   3235 C  CB    . HIS A 1 394 ? 44.680 -18.605 -21.621 1.00 22.72  ? 396 HIS A CB    1 
ATOM   3236 C  CG    . HIS A 1 394 ? 45.106 -19.804 -20.831 1.00 24.30  ? 396 HIS A CG    1 
ATOM   3237 N  ND1   . HIS A 1 394 ? 44.225 -20.804 -20.474 1.00 26.61  ? 396 HIS A ND1   1 
ATOM   3238 C  CD2   . HIS A 1 394 ? 46.309 -20.159 -20.319 1.00 25.18  ? 396 HIS A CD2   1 
ATOM   3239 C  CE1   . HIS A 1 394 ? 44.873 -21.729 -19.787 1.00 26.96  ? 396 HIS A CE1   1 
ATOM   3240 N  NE2   . HIS A 1 394 ? 46.138 -21.362 -19.677 1.00 26.95  ? 396 HIS A NE2   1 
ATOM   3241 N  N     . TRP A 1 395 ? 45.303 -16.753 -24.732 1.00 21.69  ? 397 TRP A N     1 
ATOM   3242 C  CA    . TRP A 1 395 ? 44.623 -15.813 -25.646 1.00 21.39  ? 397 TRP A CA    1 
ATOM   3243 C  C     . TRP A 1 395 ? 43.458 -16.496 -26.381 1.00 21.95  ? 397 TRP A C     1 
ATOM   3244 O  O     . TRP A 1 395 ? 42.381 -15.910 -26.540 1.00 21.18  ? 397 TRP A O     1 
ATOM   3245 C  CB    . TRP A 1 395 ? 45.608 -15.199 -26.655 1.00 21.64  ? 397 TRP A CB    1 
ATOM   3246 C  CG    . TRP A 1 395 ? 46.312 -16.224 -27.497 1.00 22.35  ? 397 TRP A CG    1 
ATOM   3247 C  CD1   . TRP A 1 395 ? 47.496 -16.834 -27.205 1.00 22.91  ? 397 TRP A CD1   1 
ATOM   3248 C  CD2   . TRP A 1 395 ? 45.868 -16.785 -28.748 1.00 22.79  ? 397 TRP A CD2   1 
ATOM   3249 N  NE1   . TRP A 1 395 ? 47.824 -17.728 -28.194 1.00 24.40  ? 397 TRP A NE1   1 
ATOM   3250 C  CE2   . TRP A 1 395 ? 46.843 -17.720 -29.152 1.00 24.46  ? 397 TRP A CE2   1 
ATOM   3251 C  CE3   . TRP A 1 395 ? 44.745 -16.581 -29.567 1.00 23.77  ? 397 TRP A CE3   1 
ATOM   3252 C  CZ2   . TRP A 1 395 ? 46.734 -18.460 -30.344 1.00 25.17  ? 397 TRP A CZ2   1 
ATOM   3253 C  CZ3   . TRP A 1 395 ? 44.630 -17.320 -30.749 1.00 24.34  ? 397 TRP A CZ3   1 
ATOM   3254 C  CH2   . TRP A 1 395 ? 45.622 -18.245 -31.125 1.00 24.94  ? 397 TRP A CH2   1 
ATOM   3255 N  N     . HIS A 1 396 ? 43.676 -17.742 -26.811 1.00 22.69  ? 398 HIS A N     1 
ATOM   3256 C  CA    . HIS A 1 396 ? 42.713 -18.450 -27.674 1.00 23.81  ? 398 HIS A CA    1 
ATOM   3257 C  C     . HIS A 1 396 ? 41.353 -18.713 -27.012 1.00 23.21  ? 398 HIS A C     1 
ATOM   3258 O  O     . HIS A 1 396 ? 40.349 -18.915 -27.700 1.00 23.48  ? 398 HIS A O     1 
ATOM   3259 C  CB    . HIS A 1 396 ? 43.317 -19.746 -28.235 1.00 25.02  ? 398 HIS A CB    1 
ATOM   3260 C  CG    . HIS A 1 396 ? 42.484 -20.394 -29.306 1.00 28.51  ? 398 HIS A CG    1 
ATOM   3261 N  ND1   . HIS A 1 396 ? 41.560 -21.385 -29.038 1.00 31.36  ? 398 HIS A ND1   1 
ATOM   3262 C  CD2   . HIS A 1 396 ? 42.437 -20.191 -30.646 1.00 29.74  ? 398 HIS A CD2   1 
ATOM   3263 C  CE1   . HIS A 1 396 ? 40.981 -21.760 -30.167 1.00 31.90  ? 398 HIS A CE1   1 
ATOM   3264 N  NE2   . HIS A 1 396 ? 41.495 -21.051 -31.156 1.00 30.04  ? 398 HIS A NE2   1 
ATOM   3265 N  N     . THR A 1 397 ? 41.312 -18.709 -25.687 1.00 22.19  ? 399 THR A N     1 
ATOM   3266 C  CA    . THR A 1 397 ? 40.037 -18.922 -24.991 1.00 21.98  ? 399 THR A CA    1 
ATOM   3267 C  C     . THR A 1 397 ? 39.279 -17.616 -24.654 1.00 20.69  ? 399 THR A C     1 
ATOM   3268 O  O     . THR A 1 397 ? 38.241 -17.654 -23.988 1.00 20.49  ? 399 THR A O     1 
ATOM   3269 C  CB    . THR A 1 397 ? 40.234 -19.813 -23.716 1.00 22.37  ? 399 THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 397 ? 38.982 -20.387 -23.326 1.00 23.06  ? 399 THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 397 ? 40.820 -19.012 -22.558 1.00 20.47  ? 399 THR A CG2   1 
ATOM   3272 N  N     . LEU A 1 398 ? 39.789 -16.474 -25.108 1.00 19.80  ? 400 LEU A N     1 
ATOM   3273 C  CA    . LEU A 1 398 ? 39.222 -15.178 -24.705 1.00 20.14  ? 400 LEU A CA    1 
ATOM   3274 C  C     . LEU A 1 398 ? 38.360 -14.542 -25.792 1.00 20.47  ? 400 LEU A C     1 
ATOM   3275 O  O     . LEU A 1 398 ? 38.302 -13.310 -25.913 1.00 21.21  ? 400 LEU A O     1 
ATOM   3276 C  CB    . LEU A 1 398 ? 40.328 -14.202 -24.246 1.00 19.19  ? 400 LEU A CB    1 
ATOM   3277 C  CG    . LEU A 1 398 ? 41.331 -14.687 -23.188 1.00 19.35  ? 400 LEU A CG    1 
ATOM   3278 C  CD1   . LEU A 1 398 ? 42.388 -13.618 -22.884 1.00 18.70  ? 400 LEU A CD1   1 
ATOM   3279 C  CD2   . LEU A 1 398 ? 40.626 -15.136 -21.909 1.00 18.17  ? 400 LEU A CD2   1 
ATOM   3280 N  N     . GLY A 1 399 ? 37.692 -15.384 -26.573 1.00 21.57  ? 401 GLY A N     1 
ATOM   3281 C  CA    . GLY A 1 399 ? 36.843 -14.932 -27.681 1.00 21.90  ? 401 GLY A CA    1 
ATOM   3282 C  C     . GLY A 1 399 ? 37.595 -15.002 -28.998 1.00 22.21  ? 401 GLY A C     1 
ATOM   3283 O  O     . GLY A 1 399 ? 38.803 -14.751 -29.041 1.00 22.28  ? 401 GLY A O     1 
ATOM   3284 N  N     . LYS A 1 400 ? 36.886 -15.346 -30.069 1.00 22.46  ? 402 LYS A N     1 
ATOM   3285 C  CA    . LYS A 1 400 ? 37.500 -15.506 -31.391 1.00 23.08  ? 402 LYS A CA    1 
ATOM   3286 C  C     . LYS A 1 400 ? 38.325 -14.284 -31.804 1.00 22.56  ? 402 LYS A C     1 
ATOM   3287 O  O     . LYS A 1 400 ? 39.513 -14.409 -32.086 1.00 22.79  ? 402 LYS A O     1 
ATOM   3288 C  CB    . LYS A 1 400 ? 36.436 -15.850 -32.448 1.00 24.18  ? 402 LYS A CB    1 
ATOM   3289 C  CG    . LYS A 1 400 ? 36.873 -15.751 -33.919 1.00 26.24  ? 402 LYS A CG    1 
ATOM   3290 C  CD    . LYS A 1 400 ? 37.816 -16.850 -34.319 1.00 30.72  ? 402 LYS A CD    1 
ATOM   3291 C  CE    . LYS A 1 400 ? 38.111 -16.765 -35.810 1.00 34.70  ? 402 LYS A CE    1 
ATOM   3292 N  NZ    . LYS A 1 400 ? 39.389 -17.465 -36.116 1.00 38.47  ? 402 LYS A NZ    1 
ATOM   3293 N  N     . ASN A 1 401 ? 37.705 -13.110 -31.817 1.00 21.55  ? 403 ASN A N     1 
ATOM   3294 C  CA    . ASN A 1 401 ? 38.367 -11.909 -32.324 1.00 21.19  ? 403 ASN A CA    1 
ATOM   3295 C  C     . ASN A 1 401 ? 39.144 -11.184 -31.234 1.00 20.19  ? 403 ASN A C     1 
ATOM   3296 O  O     . ASN A 1 401 ? 40.282 -10.759 -31.442 1.00 20.06  ? 403 ASN A O     1 
ATOM   3297 C  CB    . ASN A 1 401 ? 37.353 -10.978 -33.008 1.00 21.23  ? 403 ASN A CB    1 
ATOM   3298 C  CG    . ASN A 1 401 ? 36.599 -11.665 -34.143 1.00 21.74  ? 403 ASN A CG    1 
ATOM   3299 O  OD1   . ASN A 1 401 ? 37.148 -11.873 -35.227 1.00 20.73  ? 403 ASN A OD1   1 
ATOM   3300 N  ND2   . ASN A 1 401 ? 35.338 -12.023 -33.895 1.00 18.16  ? 403 ASN A ND2   1 
ATOM   3301 N  N     . VAL A 1 402 ? 38.525 -11.058 -30.066 1.00 19.82  ? 404 VAL A N     1 
ATOM   3302 C  CA    . VAL A 1 402 ? 39.177 -10.490 -28.887 1.00 18.93  ? 404 VAL A CA    1 
ATOM   3303 C  C     . VAL A 1 402 ? 40.458 -11.287 -28.561 1.00 19.50  ? 404 VAL A C     1 
ATOM   3304 O  O     . VAL A 1 402 ? 41.511 -10.704 -28.332 1.00 18.87  ? 404 VAL A O     1 
ATOM   3305 C  CB    . VAL A 1 402 ? 38.172 -10.387 -27.671 1.00 18.28  ? 404 VAL A CB    1 
ATOM   3306 C  CG1   . VAL A 1 402 ? 38.897 -10.132 -26.325 1.00 16.86  ? 404 VAL A CG1   1 
ATOM   3307 C  CG2   . VAL A 1 402 ? 37.144 -9.293  -27.936 1.00 17.44  ? 404 VAL A CG2   1 
ATOM   3308 N  N     . GLY A 1 403 ? 40.366 -12.618 -28.573 1.00 20.58  ? 405 GLY A N     1 
ATOM   3309 C  CA    . GLY A 1 403 ? 41.525 -13.472 -28.282 1.00 21.08  ? 405 GLY A CA    1 
ATOM   3310 C  C     . GLY A 1 403 ? 42.654 -13.314 -29.284 1.00 22.11  ? 405 GLY A C     1 
ATOM   3311 O  O     . GLY A 1 403 ? 43.832 -13.291 -28.911 1.00 22.52  ? 405 GLY A O     1 
ATOM   3312 N  N     . GLU A 1 404 ? 42.292 -13.203 -30.557 1.00 23.14  ? 406 GLU A N     1 
ATOM   3313 C  CA    . GLU A 1 404 ? 43.265 -12.964 -31.627 1.00 24.73  ? 406 GLU A CA    1 
ATOM   3314 C  C     . GLU A 1 404 ? 43.933 -11.613 -31.500 1.00 23.60  ? 406 GLU A C     1 
ATOM   3315 O  O     . GLU A 1 404 ? 45.128 -11.502 -31.743 1.00 23.75  ? 406 GLU A O     1 
ATOM   3316 C  CB    . GLU A 1 404 ? 42.619 -13.089 -33.010 1.00 25.68  ? 406 GLU A CB    1 
ATOM   3317 C  CG    . GLU A 1 404 ? 42.220 -14.522 -33.363 1.00 28.21  ? 406 GLU A CG    1 
ATOM   3318 C  CD    . GLU A 1 404 ? 41.378 -14.623 -34.621 1.00 29.89  ? 406 GLU A CD    1 
ATOM   3319 O  OE1   . GLU A 1 404 ? 41.152 -15.769 -35.068 1.00 34.84  ? 406 GLU A OE1   1 
ATOM   3320 O  OE2   . GLU A 1 404 ? 40.932 -13.579 -35.164 1.00 35.06  ? 406 GLU A OE2   1 
ATOM   3321 N  N     . SER A 1 405 ? 43.170 -10.588 -31.121 1.00 22.37  ? 407 SER A N     1 
ATOM   3322 C  CA    . SER A 1 405 ? 43.755 -9.255  -30.938 1.00 21.92  ? 407 SER A CA    1 
ATOM   3323 C  C     . SER A 1 405 ? 44.721 -9.231  -29.752 1.00 21.33  ? 407 SER A C     1 
ATOM   3324 O  O     . SER A 1 405 ? 45.799 -8.632  -29.837 1.00 20.81  ? 407 SER A O     1 
ATOM   3325 C  CB    . SER A 1 405 ? 42.678 -8.196  -30.752 1.00 21.23  ? 407 SER A CB    1 
ATOM   3326 O  OG    . SER A 1 405 ? 43.269 -6.939  -30.464 1.00 21.01  ? 407 SER A OG    1 
ATOM   3327 N  N     . ILE A 1 406 ? 44.311 -9.865  -28.649 1.00 20.28  ? 408 ILE A N     1 
ATOM   3328 C  CA    . ILE A 1 406 ? 45.158 -10.012 -27.452 1.00 20.11  ? 408 ILE A CA    1 
ATOM   3329 C  C     . ILE A 1 406 ? 46.472 -10.744 -27.773 1.00 20.37  ? 408 ILE A C     1 
ATOM   3330 O  O     . ILE A 1 406 ? 47.535 -10.384 -27.265 1.00 19.82  ? 408 ILE A O     1 
ATOM   3331 C  CB    . ILE A 1 406 ? 44.364 -10.669 -26.266 1.00 19.47  ? 408 ILE A CB    1 
ATOM   3332 C  CG1   . ILE A 1 406 ? 43.414 -9.642  -25.629 1.00 19.21  ? 408 ILE A CG1   1 
ATOM   3333 C  CG2   . ILE A 1 406 ? 45.282 -11.240 -25.184 1.00 19.52  ? 408 ILE A CG2   1 
ATOM   3334 C  CD1   . ILE A 1 406 ? 42.268 -10.270 -24.824 1.00 19.18  ? 408 ILE A CD1   1 
ATOM   3335 N  N     . ARG A 1 407 ? 46.384 -11.760 -28.629 1.00 21.24  ? 409 ARG A N     1 
ATOM   3336 C  CA    . ARG A 1 407 ? 47.555 -12.475 -29.152 1.00 22.80  ? 409 ARG A CA    1 
ATOM   3337 C  C     . ARG A 1 407 ? 48.529 -11.538 -29.892 1.00 23.21  ? 409 ARG A C     1 
ATOM   3338 O  O     . ARG A 1 407 ? 49.733 -11.698 -29.771 1.00 23.54  ? 409 ARG A O     1 
ATOM   3339 C  CB    . ARG A 1 407 ? 47.107 -13.612 -30.089 1.00 23.21  ? 409 ARG A CB    1 
ATOM   3340 C  CG    . ARG A 1 407 ? 48.221 -14.586 -30.518 1.00 25.87  ? 409 ARG A CG    1 
ATOM   3341 C  CD    . ARG A 1 407 ? 47.905 -15.283 -31.853 1.00 27.39  ? 409 ARG A CD    1 
ATOM   3342 N  NE    . ARG A 1 407 ? 47.522 -14.312 -32.890 1.00 33.92  ? 409 ARG A NE    1 
ATOM   3343 C  CZ    . ARG A 1 407 ? 46.323 -14.232 -33.485 1.00 35.76  ? 409 ARG A CZ    1 
ATOM   3344 N  NH1   . ARG A 1 407 ? 45.357 -15.099 -33.198 1.00 37.48  ? 409 ARG A NH1   1 
ATOM   3345 N  NH2   . ARG A 1 407 ? 46.094 -13.290 -34.393 1.00 34.95  ? 409 ARG A NH2   1 
ATOM   3346 N  N     . GLU A 1 408 ? 48.006 -10.570 -30.652 1.00 22.97  ? 410 GLU A N     1 
ATOM   3347 C  CA    . GLU A 1 408 ? 48.842 -9.590  -31.367 1.00 24.27  ? 410 GLU A CA    1 
ATOM   3348 C  C     . GLU A 1 408 ? 49.459 -8.556  -30.439 1.00 23.20  ? 410 GLU A C     1 
ATOM   3349 O  O     . GLU A 1 408 ? 50.574 -8.116  -30.656 1.00 23.38  ? 410 GLU A O     1 
ATOM   3350 C  CB    . GLU A 1 408 ? 48.024 -8.821  -32.398 1.00 24.13  ? 410 GLU A CB    1 
ATOM   3351 C  CG    . GLU A 1 408 ? 47.343 -9.654  -33.455 1.00 26.91  ? 410 GLU A CG    1 
ATOM   3352 C  CD    . GLU A 1 408 ? 46.369 -8.832  -34.292 1.00 27.25  ? 410 GLU A CD    1 
ATOM   3353 O  OE1   . GLU A 1 408 ? 45.861 -9.358  -35.314 1.00 31.68  ? 410 GLU A OE1   1 
ATOM   3354 O  OE2   . GLU A 1 408 ? 46.115 -7.657  -33.936 1.00 30.24  ? 410 GLU A OE2   1 
ATOM   3355 N  N     . TYR A 1 409 ? 48.707 -8.129  -29.431 1.00 22.52  ? 411 TYR A N     1 
ATOM   3356 C  CA    . TYR A 1 409 ? 49.169 -7.073  -28.537 1.00 22.81  ? 411 TYR A CA    1 
ATOM   3357 C  C     . TYR A 1 409 ? 48.237 -6.920  -27.351 1.00 21.97  ? 411 TYR A C     1 
ATOM   3358 O  O     . TYR A 1 409 ? 47.022 -6.867  -27.515 1.00 20.91  ? 411 TYR A O     1 
ATOM   3359 C  CB    . TYR A 1 409 ? 49.276 -5.723  -29.288 1.00 24.20  ? 411 TYR A CB    1 
ATOM   3360 C  CG    . TYR A 1 409 ? 49.050 -4.512  -28.406 1.00 24.80  ? 411 TYR A CG    1 
ATOM   3361 C  CD1   . TYR A 1 409 ? 47.818 -3.848  -28.413 1.00 25.67  ? 411 TYR A CD1   1 
ATOM   3362 C  CD2   . TYR A 1 409 ? 50.048 -4.050  -27.541 1.00 25.70  ? 411 TYR A CD2   1 
ATOM   3363 C  CE1   . TYR A 1 409 ? 47.579 -2.757  -27.592 1.00 25.55  ? 411 TYR A CE1   1 
ATOM   3364 C  CE2   . TYR A 1 409 ? 49.821 -2.948  -26.714 1.00 27.01  ? 411 TYR A CE2   1 
ATOM   3365 C  CZ    . TYR A 1 409 ? 48.575 -2.310  -26.751 1.00 26.31  ? 411 TYR A CZ    1 
ATOM   3366 O  OH    . TYR A 1 409 ? 48.322 -1.228  -25.951 1.00 25.89  ? 411 TYR A OH    1 
ATOM   3367 N  N     . PHE A 1 410 ? 48.820 -6.845  -26.158 1.00 21.54  ? 412 PHE A N     1 
ATOM   3368 C  CA    . PHE A 1 410 ? 48.103 -6.365  -24.985 1.00 21.45  ? 412 PHE A CA    1 
ATOM   3369 C  C     . PHE A 1 410 ? 49.086 -5.772  -23.983 1.00 22.34  ? 412 PHE A C     1 
ATOM   3370 O  O     . PHE A 1 410 ? 50.298 -6.017  -24.047 1.00 22.26  ? 412 PHE A O     1 
ATOM   3371 C  CB    . PHE A 1 410 ? 47.219 -7.459  -24.352 1.00 20.08  ? 412 PHE A CB    1 
ATOM   3372 C  CG    . PHE A 1 410 ? 47.966 -8.430  -23.487 1.00 20.06  ? 412 PHE A CG    1 
ATOM   3373 C  CD1   . PHE A 1 410 ? 48.141 -8.184  -22.125 1.00 20.86  ? 412 PHE A CD1   1 
ATOM   3374 C  CD2   . PHE A 1 410 ? 48.470 -9.608  -24.023 1.00 19.93  ? 412 PHE A CD2   1 
ATOM   3375 C  CE1   . PHE A 1 410 ? 48.821 -9.083  -21.324 1.00 19.99  ? 412 PHE A CE1   1 
ATOM   3376 C  CE2   . PHE A 1 410 ? 49.149 -10.502 -23.238 1.00 19.92  ? 412 PHE A CE2   1 
ATOM   3377 C  CZ    . PHE A 1 410 ? 49.331 -10.245 -21.888 1.00 20.35  ? 412 PHE A CZ    1 
ATOM   3378 N  N     . GLU A 1 411 ? 48.557 -4.961  -23.079 1.00 22.54  ? 413 GLU A N     1 
ATOM   3379 C  CA    . GLU A 1 411 ? 49.352 -4.457  -21.980 1.00 23.87  ? 413 GLU A CA    1 
ATOM   3380 C  C     . GLU A 1 411 ? 48.495 -4.388  -20.725 1.00 23.27  ? 413 GLU A C     1 
ATOM   3381 O  O     . GLU A 1 411 ? 47.258 -4.285  -20.799 1.00 23.25  ? 413 GLU A O     1 
ATOM   3382 C  CB    . GLU A 1 411 ? 49.963 -3.095  -22.322 1.00 24.86  ? 413 GLU A CB    1 
ATOM   3383 C  CG    . GLU A 1 411 ? 48.948 -2.026  -22.630 1.00 26.25  ? 413 GLU A CG    1 
ATOM   3384 C  CD    . GLU A 1 411 ? 49.590 -0.707  -22.987 1.00 29.36  ? 413 GLU A CD    1 
ATOM   3385 O  OE1   . GLU A 1 411 ? 50.288 -0.121  -22.128 1.00 30.24  ? 413 GLU A OE1   1 
ATOM   3386 O  OE2   . GLU A 1 411 ? 49.370 -0.247  -24.128 1.00 29.64  ? 413 GLU A OE2   1 
ATOM   3387 N  N     . ILE A 1 412 ? 49.142 -4.479  -19.572 1.00 23.12  ? 414 ILE A N     1 
ATOM   3388 C  CA    . ILE A 1 412 ? 48.428 -4.304  -18.308 1.00 23.05  ? 414 ILE A CA    1 
ATOM   3389 C  C     . ILE A 1 412 ? 48.738 -2.923  -17.756 1.00 24.15  ? 414 ILE A C     1 
ATOM   3390 O  O     . ILE A 1 412 ? 49.905 -2.518  -17.687 1.00 25.12  ? 414 ILE A O     1 
ATOM   3391 C  CB    . ILE A 1 412 ? 48.727 -5.446  -17.304 1.00 22.55  ? 414 ILE A CB    1 
ATOM   3392 C  CG1   . ILE A 1 412 ? 48.242 -6.770  -17.900 1.00 22.14  ? 414 ILE A CG1   1 
ATOM   3393 C  CG2   . ILE A 1 412 ? 48.043 -5.188  -15.942 1.00 21.70  ? 414 ILE A CG2   1 
ATOM   3394 C  CD1   . ILE A 1 412 ? 48.668 -7.980  -17.126 1.00 23.85  ? 414 ILE A CD1   1 
ATOM   3395 N  N     . ILE A 1 413 ? 47.688 -2.183  -17.416 1.00 24.36  ? 415 ILE A N     1 
ATOM   3396 C  CA    . ILE A 1 413 ? 47.848 -0.801  -16.966 1.00 26.22  ? 415 ILE A CA    1 
ATOM   3397 C  C     . ILE A 1 413 ? 47.287 -0.645  -15.553 1.00 26.40  ? 415 ILE A C     1 
ATOM   3398 O  O     . ILE A 1 413 ? 46.259 -1.206  -15.237 1.00 24.46  ? 415 ILE A O     1 
ATOM   3399 C  CB    . ILE A 1 413 ? 47.135 0.210   -17.918 1.00 26.43  ? 415 ILE A CB    1 
ATOM   3400 C  CG1   . ILE A 1 413 ? 47.585 0.042   -19.373 1.00 27.94  ? 415 ILE A CG1   1 
ATOM   3401 C  CG2   . ILE A 1 413 ? 47.376 1.641   -17.479 1.00 28.29  ? 415 ILE A CG2   1 
ATOM   3402 C  CD1   . ILE A 1 413 ? 48.994 0.526   -19.632 1.00 29.38  ? 415 ILE A CD1   1 
ATOM   3403 N  N     . SER A 1 414 ? 47.987 0.119   -14.718 1.00 28.70  ? 416 SER A N     1 
ATOM   3404 C  CA    . SER A 1 414 ? 47.482 0.528   -13.401 1.00 30.54  ? 416 SER A CA    1 
ATOM   3405 C  C     . SER A 1 414 ? 47.872 1.984   -13.070 1.00 32.64  ? 416 SER A C     1 
ATOM   3406 O  O     . SER A 1 414 ? 48.424 2.695   -13.915 1.00 33.21  ? 416 SER A O     1 
ATOM   3407 C  CB    . SER A 1 414 ? 47.971 -0.430  -12.314 1.00 30.06  ? 416 SER A CB    1 
ATOM   3408 O  OG    . SER A 1 414 ? 49.379 -0.560  -12.370 1.00 32.25  ? 416 SER A OG    1 
ATOM   3409 N  N     . GLY A 1 415 ? 47.538 2.425   -11.857 1.00 34.22  ? 417 GLY A N     1 
ATOM   3410 C  CA    . GLY A 1 415 ? 48.007 3.696   -11.317 1.00 36.77  ? 417 GLY A CA    1 
ATOM   3411 C  C     . GLY A 1 415 ? 47.674 4.924   -12.135 1.00 38.58  ? 417 GLY A C     1 
ATOM   3412 O  O     . GLY A 1 415 ? 46.640 4.962   -12.816 1.00 38.34  ? 417 GLY A O     1 
ATOM   3413 N  N     . GLU A 1 416 ? 48.567 5.916   -12.072 1.00 40.83  ? 418 GLU A N     1 
ATOM   3414 C  CA    . GLU A 1 416 ? 48.414 7.201   -12.767 1.00 42.90  ? 418 GLU A CA    1 
ATOM   3415 C  C     . GLU A 1 416 ? 48.158 6.984   -14.254 1.00 42.31  ? 418 GLU A C     1 
ATOM   3416 O  O     . GLU A 1 416 ? 47.371 7.701   -14.873 1.00 42.93  ? 418 GLU A O     1 
ATOM   3417 C  CB    . GLU A 1 416 ? 49.663 8.098   -12.597 1.00 45.01  ? 418 GLU A CB    1 
ATOM   3418 C  CG    . GLU A 1 416 ? 50.459 7.963   -11.270 1.00 48.11  ? 418 GLU A CG    1 
ATOM   3419 C  CD    . GLU A 1 416 ? 49.810 8.650   -10.051 1.00 51.42  ? 418 GLU A CD    1 
ATOM   3420 O  OE1   . GLU A 1 416 ? 50.277 8.403   -8.910  1.00 51.25  ? 418 GLU A OE1   1 
ATOM   3421 O  OE2   . GLU A 1 416 ? 48.846 9.436   -10.226 1.00 53.00  ? 418 GLU A OE2   1 
ATOM   3422 N  N     . LYS A 1 417 ? 48.839 5.987   -14.812 1.00 41.65  ? 419 LYS A N     1 
ATOM   3423 C  CA    . LYS A 1 417 ? 48.697 5.619   -16.209 1.00 41.20  ? 419 LYS A CA    1 
ATOM   3424 C  C     . LYS A 1 417 ? 47.266 5.163   -16.531 1.00 39.70  ? 419 LYS A C     1 
ATOM   3425 O  O     . LYS A 1 417 ? 46.729 5.511   -17.583 1.00 39.92  ? 419 LYS A O     1 
ATOM   3426 C  CB    . LYS A 1 417 ? 49.732 4.545   -16.564 1.00 40.89  ? 419 LYS A CB    1 
ATOM   3427 C  CG    . LYS A 1 417 ? 50.355 4.709   -17.952 1.00 43.29  ? 419 LYS A CG    1 
ATOM   3428 C  CD    . LYS A 1 417 ? 51.900 4.673   -17.901 1.00 45.43  ? 419 LYS A CD    1 
ATOM   3429 C  CE    . LYS A 1 417 ? 52.530 6.068   -18.042 1.00 47.71  ? 419 LYS A CE    1 
ATOM   3430 N  NZ    . LYS A 1 417 ? 52.241 6.984   -16.896 1.00 48.70  ? 419 LYS A NZ    1 
ATOM   3431 N  N     . LEU A 1 418 ? 46.646 4.417   -15.614 1.00 38.33  ? 420 LEU A N     1 
ATOM   3432 C  CA    . LEU A 1 418 ? 45.297 3.871   -15.837 1.00 37.01  ? 420 LEU A CA    1 
ATOM   3433 C  C     . LEU A 1 418 ? 44.200 4.921   -15.757 1.00 37.23  ? 420 LEU A C     1 
ATOM   3434 O  O     . LEU A 1 418 ? 43.258 4.902   -16.553 1.00 36.89  ? 420 LEU A O     1 
ATOM   3435 C  CB    . LEU A 1 418 ? 44.994 2.734   -14.852 1.00 36.04  ? 420 LEU A CB    1 
ATOM   3436 C  CG    . LEU A 1 418 ? 43.572 2.155   -14.803 1.00 35.14  ? 420 LEU A CG    1 
ATOM   3437 C  CD1   . LEU A 1 418 ? 43.209 1.489   -16.108 1.00 34.48  ? 420 LEU A CD1   1 
ATOM   3438 C  CD2   . LEU A 1 418 ? 43.441 1.188   -13.640 1.00 34.60  ? 420 LEU A CD2   1 
ATOM   3439 N  N     . PHE A 1 419 ? 44.321 5.820   -14.786 1.00 38.04  ? 421 PHE A N     1 
ATOM   3440 C  CA    . PHE A 1 419 ? 43.323 6.861   -14.562 1.00 38.99  ? 421 PHE A CA    1 
ATOM   3441 C  C     . PHE A 1 419 ? 43.285 7.881   -15.712 1.00 39.91  ? 421 PHE A C     1 
ATOM   3442 O  O     . PHE A 1 419 ? 42.330 8.650   -15.823 1.00 40.55  ? 421 PHE A O     1 
ATOM   3443 C  CB    . PHE A 1 419 ? 43.534 7.538   -13.200 1.00 39.91  ? 421 PHE A CB    1 
ATOM   3444 C  CG    . PHE A 1 419 ? 43.641 6.565   -12.046 1.00 39.84  ? 421 PHE A CG    1 
ATOM   3445 C  CD1   . PHE A 1 419 ? 44.727 6.611   -11.177 1.00 41.18  ? 421 PHE A CD1   1 
ATOM   3446 C  CD2   . PHE A 1 419 ? 42.655 5.599   -11.833 1.00 38.86  ? 421 PHE A CD2   1 
ATOM   3447 C  CE1   . PHE A 1 419 ? 44.835 5.708   -10.114 1.00 41.14  ? 421 PHE A CE1   1 
ATOM   3448 C  CE2   . PHE A 1 419 ? 42.747 4.696   -10.774 1.00 38.75  ? 421 PHE A CE2   1 
ATOM   3449 C  CZ    . PHE A 1 419 ? 43.840 4.746   -9.912  1.00 38.83  ? 421 PHE A CZ    1 
ATOM   3450 N  N     . LYS A 1 420 ? 44.311 7.847   -16.570 1.00 40.08  ? 422 LYS A N     1 
ATOM   3451 C  CA    . LYS A 1 420 ? 44.384 8.670   -17.787 1.00 40.86  ? 422 LYS A CA    1 
ATOM   3452 C  C     . LYS A 1 420 ? 43.691 8.028   -19.002 1.00 39.60  ? 422 LYS A C     1 
ATOM   3453 O  O     . LYS A 1 420 ? 43.467 8.700   -20.014 1.00 40.02  ? 422 LYS A O     1 
ATOM   3454 C  CB    . LYS A 1 420 ? 45.843 9.004   -18.132 1.00 41.82  ? 422 LYS A CB    1 
ATOM   3455 C  CG    . LYS A 1 420 ? 46.441 10.147  -17.316 1.00 44.26  ? 422 LYS A CG    1 
ATOM   3456 C  CD    . LYS A 1 420 ? 47.913 10.384  -17.656 1.00 45.10  ? 422 LYS A CD    1 
ATOM   3457 C  CE    . LYS A 1 420 ? 48.433 11.687  -17.057 1.00 48.08  ? 422 LYS A CE    1 
ATOM   3458 N  NZ    . LYS A 1 420 ? 48.223 12.868  -17.969 1.00 50.21  ? 422 LYS A NZ    1 
ATOM   3459 N  N     . GLU A 1 421 ? 43.359 6.738   -18.901 1.00 37.54  ? 423 GLU A N     1 
ATOM   3460 C  CA    . GLU A 1 421 ? 42.605 6.045   -19.950 1.00 36.52  ? 423 GLU A CA    1 
ATOM   3461 C  C     . GLU A 1 421 ? 41.116 6.400   -19.864 1.00 36.14  ? 423 GLU A C     1 
ATOM   3462 O  O     . GLU A 1 421 ? 40.641 6.826   -18.804 1.00 36.48  ? 423 GLU A O     1 
ATOM   3463 C  CB    . GLU A 1 421 ? 42.793 4.524   -19.860 1.00 35.23  ? 423 GLU A CB    1 
ATOM   3464 C  CG    . GLU A 1 421 ? 44.242 4.041   -19.948 1.00 35.79  ? 423 GLU A CG    1 
ATOM   3465 C  CD    . GLU A 1 421 ? 44.862 4.150   -21.343 1.00 36.82  ? 423 GLU A CD    1 
ATOM   3466 O  OE1   . GLU A 1 421 ? 44.136 4.189   -22.357 1.00 36.11  ? 423 GLU A OE1   1 
ATOM   3467 O  OE2   . GLU A 1 421 ? 46.105 4.191   -21.420 1.00 39.16  ? 423 GLU A OE2   1 
ATOM   3468 N  N     . PRO A 1 422 ? 40.375 6.243   -20.980 1.00 35.66  ? 424 PRO A N     1 
ATOM   3469 C  CA    . PRO A 1 422 ? 38.941 6.568   -20.991 1.00 35.49  ? 424 PRO A CA    1 
ATOM   3470 C  C     . PRO A 1 422 ? 38.060 5.524   -20.290 1.00 34.02  ? 424 PRO A C     1 
ATOM   3471 O  O     . PRO A 1 422 ? 37.063 5.064   -20.860 1.00 33.70  ? 424 PRO A O     1 
ATOM   3472 C  CB    . PRO A 1 422 ? 38.618 6.638   -22.488 1.00 35.60  ? 424 PRO A CB    1 
ATOM   3473 C  CG    . PRO A 1 422 ? 39.580 5.674   -23.108 1.00 35.18  ? 424 PRO A CG    1 
ATOM   3474 C  CD    . PRO A 1 422 ? 40.843 5.789   -22.307 1.00 35.50  ? 424 PRO A CD    1 
ATOM   3475 N  N     . VAL A 1 423 ? 38.417 5.180   -19.054 1.00 33.40  ? 425 VAL A N     1 
ATOM   3476 C  CA    . VAL A 1 423 ? 37.749 4.109   -18.306 1.00 32.03  ? 425 VAL A CA    1 
ATOM   3477 C  C     . VAL A 1 423 ? 37.211 4.541   -16.938 1.00 32.54  ? 425 VAL A C     1 
ATOM   3478 O  O     . VAL A 1 423 ? 36.857 3.697   -16.121 1.00 31.96  ? 425 VAL A O     1 
ATOM   3479 C  CB    . VAL A 1 423 ? 38.693 2.891   -18.115 1.00 31.30  ? 425 VAL A CB    1 
ATOM   3480 C  CG1   . VAL A 1 423 ? 38.977 2.216   -19.458 1.00 30.57  ? 425 VAL A CG1   1 
ATOM   3481 C  CG2   . VAL A 1 423 ? 39.996 3.303   -17.405 1.00 30.34  ? 425 VAL A CG2   1 
ATOM   3482 N  N     . THR A 1 424 ? 37.139 5.850   -16.699 1.00 33.68  ? 426 THR A N     1 
ATOM   3483 C  CA    . THR A 1 424 ? 36.831 6.378   -15.362 1.00 34.21  ? 426 THR A CA    1 
ATOM   3484 C  C     . THR A 1 424 ? 35.384 6.133   -14.945 1.00 34.03  ? 426 THR A C     1 
ATOM   3485 O  O     . THR A 1 424 ? 35.119 5.838   -13.773 1.00 34.37  ? 426 THR A O     1 
ATOM   3486 C  CB    . THR A 1 424 ? 37.138 7.888   -15.239 1.00 35.70  ? 426 THR A CB    1 
ATOM   3487 O  OG1   . THR A 1 424 ? 36.455 8.590   -16.280 1.00 36.66  ? 426 THR A OG1   1 
ATOM   3488 C  CG2   . THR A 1 424 ? 38.645 8.154   -15.331 1.00 35.18  ? 426 THR A CG2   1 
ATOM   3489 N  N     . ALA A 1 425 ? 34.462 6.243   -15.898 1.00 33.57  ? 427 ALA A N     1 
ATOM   3490 C  CA    . ALA A 1 425 ? 33.052 5.961   -15.647 1.00 33.06  ? 427 ALA A CA    1 
ATOM   3491 C  C     . ALA A 1 425 ? 32.857 4.518   -15.188 1.00 31.65  ? 427 ALA A C     1 
ATOM   3492 O  O     . ALA A 1 425 ? 32.166 4.252   -14.197 1.00 31.40  ? 427 ALA A O     1 
ATOM   3493 C  CB    . ALA A 1 425 ? 32.221 6.244   -16.894 1.00 33.48  ? 427 ALA A CB    1 
ATOM   3494 N  N     . GLU A 1 426 ? 33.479 3.596   -15.916 1.00 30.35  ? 428 GLU A N     1 
ATOM   3495 C  CA    . GLU A 1 426 ? 33.403 2.167   -15.620 1.00 28.92  ? 428 GLU A CA    1 
ATOM   3496 C  C     . GLU A 1 426 ? 34.026 1.845   -14.264 1.00 28.13  ? 428 GLU A C     1 
ATOM   3497 O  O     . GLU A 1 426 ? 33.470 1.048   -13.508 1.00 27.43  ? 428 GLU A O     1 
ATOM   3498 C  CB    . GLU A 1 426 ? 34.086 1.333   -16.722 1.00 28.30  ? 428 GLU A CB    1 
ATOM   3499 C  CG    . GLU A 1 426 ? 33.363 1.273   -18.078 1.00 29.07  ? 428 GLU A CG    1 
ATOM   3500 C  CD    . GLU A 1 426 ? 33.334 2.602   -18.840 1.00 31.50  ? 428 GLU A CD    1 
ATOM   3501 O  OE1   . GLU A 1 426 ? 34.248 3.455   -18.672 1.00 31.58  ? 428 GLU A OE1   1 
ATOM   3502 O  OE2   . GLU A 1 426 ? 32.380 2.795   -19.624 1.00 32.38  ? 428 GLU A OE2   1 
ATOM   3503 N  N     . LEU A 1 427 ? 35.178 2.450   -13.965 1.00 28.02  ? 429 LEU A N     1 
ATOM   3504 C  CA    . LEU A 1 427 ? 35.860 2.232   -12.677 1.00 27.97  ? 429 LEU A CA    1 
ATOM   3505 C  C     . LEU A 1 427 ? 35.005 2.669   -11.484 1.00 28.66  ? 429 LEU A C     1 
ATOM   3506 O  O     . LEU A 1 427 ? 34.894 1.934   -10.493 1.00 28.02  ? 429 LEU A O     1 
ATOM   3507 C  CB    . LEU A 1 427 ? 37.246 2.896   -12.632 1.00 27.96  ? 429 LEU A CB    1 
ATOM   3508 C  CG    . LEU A 1 427 ? 38.374 2.228   -13.442 1.00 27.80  ? 429 LEU A CG    1 
ATOM   3509 C  CD1   . LEU A 1 427 ? 39.680 3.023   -13.357 1.00 27.26  ? 429 LEU A CD1   1 
ATOM   3510 C  CD2   . LEU A 1 427 ? 38.611 0.777   -13.042 1.00 25.59  ? 429 LEU A CD2   1 
ATOM   3511 N  N     . CYS A 1 428 ? 34.392 3.849   -11.594 1.00 29.76  ? 430 CYS A N     1 
ATOM   3512 C  CA    . CYS A 1 428 ? 33.494 4.359   -10.552 1.00 31.35  ? 430 CYS A CA    1 
ATOM   3513 C  C     . CYS A 1 428 ? 32.312 3.433   -10.295 1.00 31.20  ? 430 CYS A C     1 
ATOM   3514 O  O     . CYS A 1 428 ? 31.989 3.141   -9.139  1.00 31.46  ? 430 CYS A O     1 
ATOM   3515 C  CB    . CYS A 1 428 ? 32.988 5.761   -10.898 1.00 32.56  ? 430 CYS A CB    1 
ATOM   3516 S  SG    . CYS A 1 428 ? 34.268 6.995   -10.853 1.00 35.47  ? 430 CYS A SG    1 
ATOM   3517 N  N     . GLU A 1 429 ? 31.684 2.968   -11.374 1.00 31.00  ? 431 GLU A N     1 
ATOM   3518 C  CA    . GLU A 1 429 ? 30.558 2.042   -11.299 1.00 31.55  ? 431 GLU A CA    1 
ATOM   3519 C  C     . GLU A 1 429 ? 30.986 0.708   -10.667 1.00 30.59  ? 431 GLU A C     1 
ATOM   3520 O  O     . GLU A 1 429 ? 30.293 0.159   -9.807  1.00 30.39  ? 431 GLU A O     1 
ATOM   3521 C  CB    . GLU A 1 429 ? 29.979 1.827   -12.700 1.00 31.71  ? 431 GLU A CB    1 
ATOM   3522 C  CG    . GLU A 1 429 ? 28.927 0.730   -12.814 1.00 35.08  ? 431 GLU A CG    1 
ATOM   3523 C  CD    . GLU A 1 429 ? 27.600 1.073   -12.117 1.00 40.21  ? 431 GLU A CD    1 
ATOM   3524 O  OE1   . GLU A 1 429 ? 27.362 2.269   -11.797 1.00 41.08  ? 431 GLU A OE1   1 
ATOM   3525 O  OE2   . GLU A 1 429 ? 26.795 0.132   -11.894 1.00 41.69  ? 431 GLU A OE2   1 
ATOM   3526 N  N     . MET A 1 430 ? 32.149 0.221   -11.091 1.00 29.08  ? 432 MET A N     1 
ATOM   3527 C  CA    . MET A 1 430 ? 32.752 -0.994  -10.574 1.00 28.76  ? 432 MET A CA    1 
ATOM   3528 C  C     . MET A 1 430 ? 33.003 -0.965  -9.051  1.00 27.93  ? 432 MET A C     1 
ATOM   3529 O  O     . MET A 1 430 ? 32.892 -1.993  -8.372  1.00 27.23  ? 432 MET A O     1 
ATOM   3530 C  CB    . MET A 1 430 ? 34.074 -1.199  -11.293 1.00 28.02  ? 432 MET A CB    1 
ATOM   3531 C  CG    . MET A 1 430 ? 34.459 -2.630  -11.560 1.00 28.26  ? 432 MET A CG    1 
ATOM   3532 S  SD    . MET A 1 430 ? 36.073 -2.591  -12.375 1.00 29.71  ? 432 MET A SD    1 
ATOM   3533 C  CE    . MET A 1 430 ? 37.183 -2.471  -10.987 1.00 29.87  ? 432 MET A CE    1 
ATOM   3534 N  N     . MET A 1 431 ? 33.351 0.208   -8.531  1.00 27.61  ? 433 MET A N     1 
ATOM   3535 C  CA    . MET A 1 431 ? 33.731 0.362   -7.122  1.00 27.45  ? 433 MET A CA    1 
ATOM   3536 C  C     . MET A 1 431 ? 32.619 0.977   -6.274  1.00 28.21  ? 433 MET A C     1 
ATOM   3537 O  O     . MET A 1 431 ? 32.787 1.183   -5.068  1.00 28.12  ? 433 MET A O     1 
ATOM   3538 C  CB    . MET A 1 431 ? 35.000 1.209   -7.010  1.00 27.69  ? 433 MET A CB    1 
ATOM   3539 C  CG    . MET A 1 431 ? 36.175 0.680   -7.826  1.00 26.70  ? 433 MET A CG    1 
ATOM   3540 S  SD    . MET A 1 431 ? 37.723 1.542   -7.498  1.00 27.20  ? 433 MET A SD    1 
ATOM   3541 C  CE    . MET A 1 431 ? 37.314 3.242   -7.908  1.00 28.81  ? 433 MET A CE    1 
ATOM   3542 N  N     . GLY A 1 432 ? 31.488 1.273   -6.909  1.00 28.62  ? 434 GLY A N     1 
ATOM   3543 C  CA    . GLY A 1 432 ? 30.348 1.881   -6.215  1.00 30.38  ? 434 GLY A CA    1 
ATOM   3544 C  C     . GLY A 1 432 ? 30.635 3.282   -5.700  1.00 31.91  ? 434 GLY A C     1 
ATOM   3545 O  O     . GLY A 1 432 ? 30.138 3.683   -4.647  1.00 32.47  ? 434 GLY A O     1 
ATOM   3546 N  N     . VAL A 1 433 ? 31.437 4.028   -6.451  1.00 32.36  ? 435 VAL A N     1 
ATOM   3547 C  CA    . VAL A 1 433 ? 31.760 5.411   -6.115  1.00 34.73  ? 435 VAL A CA    1 
ATOM   3548 C  C     . VAL A 1 433 ? 30.498 6.264   -6.254  1.00 36.95  ? 435 VAL A C     1 
ATOM   3549 O  O     . VAL A 1 433 ? 29.816 6.208   -7.275  1.00 36.96  ? 435 VAL A O     1 
ATOM   3550 C  CB    . VAL A 1 433 ? 32.885 5.974   -7.022  1.00 34.25  ? 435 VAL A CB    1 
ATOM   3551 C  CG1   . VAL A 1 433 ? 33.201 7.408   -6.658  1.00 34.94  ? 435 VAL A CG1   1 
ATOM   3552 C  CG2   . VAL A 1 433 ? 34.139 5.122   -6.913  1.00 33.02  ? 435 VAL A CG2   1 
ATOM   3553 N  N     . LYS A 1 434 ? 30.180 7.033   -5.219  1.00 39.83  ? 436 LYS A N     1 
ATOM   3554 C  CA    . LYS A 1 434 ? 28.972 7.854   -5.235  1.00 42.56  ? 436 LYS A CA    1 
ATOM   3555 C  C     . LYS A 1 434 ? 29.288 9.345   -5.149  1.00 44.92  ? 436 LYS A C     1 
ATOM   3556 O  O     . LYS A 1 434 ? 30.458 9.726   -5.042  1.00 45.10  ? 436 LYS A O     1 
ATOM   3557 C  CB    . LYS A 1 434 ? 27.999 7.417   -4.135  1.00 43.33  ? 436 LYS A CB    1 
ATOM   3558 C  CG    . LYS A 1 434 ? 28.572 7.322   -2.734  1.00 43.44  ? 436 LYS A CG    1 
ATOM   3559 C  CD    . LYS A 1 434 ? 27.474 6.912   -1.779  1.00 44.79  ? 436 LYS A CD    1 
ATOM   3560 C  CE    . LYS A 1 434 ? 27.994 6.670   -0.385  1.00 45.91  ? 436 LYS A CE    1 
ATOM   3561 N  NZ    . LYS A 1 434 ? 26.900 6.195   0.499   1.00 47.10  ? 436 LYS A NZ    1 
ATOM   3562 N  N     . ASP A 1 435 ? 28.241 10.174  -5.206  1.00 47.43  ? 437 ASP A N     1 
ATOM   3563 C  CA    . ASP A 1 435 ? 28.348 11.650  -5.180  1.00 49.96  ? 437 ASP A CA    1 
ATOM   3564 C  C     . ASP A 1 435 ? 27.996 12.209  -6.555  1.00 50.42  ? 437 ASP A C     1 
ATOM   3565 O  O     . ASP A 1 435 ? 27.922 11.465  -7.537  1.00 49.33  ? 437 ASP A O     1 
ATOM   3566 C  CB    . ASP A 1 435 ? 29.753 12.124  -4.766  1.00 50.26  ? 437 ASP A CB    1 
ATOM   3567 C  CG    . ASP A 1 435 ? 29.745 13.478  -4.078  1.00 53.25  ? 437 ASP A CG    1 
ATOM   3568 O  OD1   . ASP A 1 435 ? 29.327 13.549  -2.901  1.00 56.29  ? 437 ASP A OD1   1 
ATOM   3569 O  OD2   . ASP A 1 435 ? 30.183 14.471  -4.700  1.00 55.58  ? 437 ASP A OD2   1 
ATOM   3570 O  OXT   . ASP A 1 435 ? 27.774 13.411  -6.719  1.00 52.30  ? 437 ASP A OXT   1 
ATOM   3571 O  OP3   . G   B 2 1   ? 35.095 -15.559 -37.480 1.00 59.88  ? 1   G   C OP3   1 
ATOM   3572 P  P     . G   B 2 1   ? 34.106 -16.416 -36.760 1.00 58.55  ? 1   G   C P     1 
ATOM   3573 O  OP1   . G   B 2 1   ? 34.887 -17.501 -36.106 1.00 58.45  ? 1   G   C OP1   1 
ATOM   3574 O  OP2   . G   B 2 1   ? 33.069 -16.775 -37.772 1.00 59.70  ? 1   G   C OP2   1 
ATOM   3575 O  "O5'" . G   B 2 1   ? 33.379 -15.515 -35.613 1.00 49.76  ? 1   G   C "O5'" 1 
ATOM   3576 C  "C5'" . G   B 2 1   ? 32.885 -16.046 -34.377 1.00 38.29  ? 1   G   C "C5'" 1 
ATOM   3577 C  "C4'" . G   B 2 1   ? 32.337 -14.944 -33.468 1.00 30.25  ? 1   G   C "C4'" 1 
ATOM   3578 O  "O4'" . G   B 2 1   ? 31.171 -14.302 -34.023 1.00 27.61  ? 1   G   C "O4'" 1 
ATOM   3579 C  "C3'" . G   B 2 1   ? 31.844 -15.473 -32.137 1.00 26.36  ? 1   G   C "C3'" 1 
ATOM   3580 O  "O3'" . G   B 2 1   ? 32.909 -15.441 -31.205 1.00 23.67  ? 1   G   C "O3'" 1 
ATOM   3581 C  "C2'" . G   B 2 1   ? 30.693 -14.558 -31.720 1.00 23.41  ? 1   G   C "C2'" 1 
ATOM   3582 O  "O2'" . G   B 2 1   ? 31.092 -13.333 -31.104 1.00 23.37  ? 1   G   C "O2'" 1 
ATOM   3583 C  "C1'" . G   B 2 1   ? 30.103 -14.277 -33.082 1.00 22.01  ? 1   G   C "C1'" 1 
ATOM   3584 N  N9    . G   B 2 1   ? 29.020 -15.168 -33.502 1.00 20.86  ? 1   G   C N9    1 
ATOM   3585 C  C8    . G   B 2 1   ? 29.032 -16.074 -34.534 1.00 22.08  ? 1   G   C C8    1 
ATOM   3586 N  N7    . G   B 2 1   ? 27.892 -16.699 -34.691 1.00 22.14  ? 1   G   C N7    1 
ATOM   3587 C  C5    . G   B 2 1   ? 27.069 -16.192 -33.692 1.00 20.80  ? 1   G   C C5    1 
ATOM   3588 C  C6    . G   B 2 1   ? 25.720 -16.485 -33.366 1.00 21.02  ? 1   G   C C6    1 
ATOM   3589 O  O6    . G   B 2 1   ? 24.958 -17.290 -33.916 1.00 20.68  ? 1   G   C O6    1 
ATOM   3590 N  N1    . G   B 2 1   ? 25.254 -15.721 -32.292 1.00 19.06  ? 1   G   C N1    1 
ATOM   3591 C  C2    . G   B 2 1   ? 26.013 -14.793 -31.609 1.00 19.43  ? 1   G   C C2    1 
ATOM   3592 N  N2    . G   B 2 1   ? 25.426 -14.166 -30.580 1.00 16.93  ? 1   G   C N2    1 
ATOM   3593 N  N3    . G   B 2 1   ? 27.284 -14.516 -31.903 1.00 18.46  ? 1   G   C N3    1 
ATOM   3594 C  C4    . G   B 2 1   ? 27.747 -15.244 -32.952 1.00 20.56  ? 1   G   C C4    1 
ATOM   3595 P  P     . G   B 2 2   ? 33.099 -16.675 -30.218 1.00 23.39  ? 2   G   C P     1 
ATOM   3596 O  OP1   . G   B 2 2   ? 34.384 -16.440 -29.491 1.00 22.79  ? 2   G   C OP1   1 
ATOM   3597 O  OP2   . G   B 2 2   ? 32.948 -17.923 -30.988 1.00 24.11  ? 2   G   C OP2   1 
ATOM   3598 O  "O5'" . G   B 2 2   ? 31.870 -16.517 -29.210 1.00 22.09  ? 2   G   C "O5'" 1 
ATOM   3599 C  "C5'" . G   B 2 2   ? 31.837 -15.457 -28.242 1.00 20.03  ? 2   G   C "C5'" 1 
ATOM   3600 C  "C4'" . G   B 2 2   ? 30.489 -15.377 -27.553 1.00 20.78  ? 2   G   C "C4'" 1 
ATOM   3601 O  "O4'" . G   B 2 2   ? 29.456 -15.033 -28.515 1.00 18.91  ? 2   G   C "O4'" 1 
ATOM   3602 C  "C3'" . G   B 2 2   ? 29.979 -16.665 -26.918 1.00 21.23  ? 2   G   C "C3'" 1 
ATOM   3603 O  "O3'" . G   B 2 2   ? 30.574 -16.911 -25.645 1.00 21.22  ? 2   G   C "O3'" 1 
ATOM   3604 C  "C2'" . G   B 2 2   ? 28.507 -16.308 -26.794 1.00 21.26  ? 2   G   C "C2'" 1 
ATOM   3605 O  "O2'" . G   B 2 2   ? 28.252 -15.345 -25.791 1.00 23.15  ? 2   G   C "O2'" 1 
ATOM   3606 C  "C1'" . G   B 2 2   ? 28.252 -15.688 -28.157 1.00 20.28  ? 2   G   C "C1'" 1 
ATOM   3607 N  N9    . G   B 2 2   ? 27.869 -16.689 -29.162 1.00 20.38  ? 2   G   C N9    1 
ATOM   3608 C  C8    . G   B 2 2   ? 28.663 -17.209 -30.163 1.00 20.56  ? 2   G   C C8    1 
ATOM   3609 N  N7    . G   B 2 2   ? 28.059 -18.095 -30.912 1.00 21.03  ? 2   G   C N7    1 
ATOM   3610 C  C5    . G   B 2 2   ? 26.781 -18.166 -30.366 1.00 21.46  ? 2   G   C C5    1 
ATOM   3611 C  C6    . G   B 2 2   ? 25.670 -18.950 -30.765 1.00 22.05  ? 2   G   C C6    1 
ATOM   3612 O  O6    . G   B 2 2   ? 25.619 -19.754 -31.698 1.00 23.19  ? 2   G   C O6    1 
ATOM   3613 N  N1    . G   B 2 2   ? 24.542 -18.725 -29.973 1.00 21.02  ? 2   G   C N1    1 
ATOM   3614 C  C2    . G   B 2 2   ? 24.500 -17.853 -28.910 1.00 21.18  ? 2   G   C C2    1 
ATOM   3615 N  N2    . G   B 2 2   ? 23.328 -17.782 -28.259 1.00 21.37  ? 2   G   C N2    1 
ATOM   3616 N  N3    . G   B 2 2   ? 25.542 -17.116 -28.508 1.00 20.27  ? 2   G   C N3    1 
ATOM   3617 C  C4    . G   B 2 2   ? 26.644 -17.311 -29.287 1.00 20.66  ? 2   G   C C4    1 
ATOM   3618 P  P     . A   B 2 3   ? 30.612 -18.404 -25.029 1.00 23.91  ? 3   A   C P     1 
ATOM   3619 O  OP1   . A   B 2 3   ? 31.411 -18.300 -23.787 1.00 23.58  ? 3   A   C OP1   1 
ATOM   3620 O  OP2   . A   B 2 3   ? 31.034 -19.350 -26.082 1.00 24.24  ? 3   A   C OP2   1 
ATOM   3621 O  "O5'" . A   B 2 3   ? 29.067 -18.739 -24.722 1.00 22.98  ? 3   A   C "O5'" 1 
ATOM   3622 C  "C5'" . A   B 2 3   ? 28.379 -18.119 -23.663 1.00 25.57  ? 3   A   C "C5'" 1 
ATOM   3623 C  "C4'" . A   B 2 3   ? 26.940 -18.585 -23.624 1.00 26.66  ? 3   A   C "C4'" 1 
ATOM   3624 O  "O4'" . A   B 2 3   ? 26.270 -18.292 -24.875 1.00 26.60  ? 3   A   C "O4'" 1 
ATOM   3625 C  "C3'" . A   B 2 3   ? 26.783 -20.087 -23.500 1.00 28.65  ? 3   A   C "C3'" 1 
ATOM   3626 O  "O3'" . A   B 2 3   ? 27.056 -20.473 -22.165 1.00 32.55  ? 3   A   C "O3'" 1 
ATOM   3627 C  "C2'" . A   B 2 3   ? 25.323 -20.236 -23.932 1.00 29.20  ? 3   A   C "C2'" 1 
ATOM   3628 O  "O2'" . A   B 2 3   ? 24.379 -19.837 -22.950 1.00 29.85  ? 3   A   C "O2'" 1 
ATOM   3629 C  "C1'" . A   B 2 3   ? 25.305 -19.289 -25.132 1.00 27.39  ? 3   A   C "C1'" 1 
ATOM   3630 N  N9    . A   B 2 3   ? 25.636 -19.998 -26.363 1.00 27.12  ? 3   A   C N9    1 
ATOM   3631 C  C8    . A   B 2 3   ? 26.817 -19.975 -27.056 1.00 26.25  ? 3   A   C C8    1 
ATOM   3632 N  N7    . A   B 2 3   ? 26.807 -20.741 -28.122 1.00 26.87  ? 3   A   C N7    1 
ATOM   3633 C  C5    . A   B 2 3   ? 25.532 -21.296 -28.131 1.00 28.87  ? 3   A   C C5    1 
ATOM   3634 C  C6    . A   B 2 3   ? 24.875 -22.195 -29.001 1.00 29.83  ? 3   A   C C6    1 
ATOM   3635 N  N6    . A   B 2 3   ? 25.448 -22.710 -30.088 1.00 31.02  ? 3   A   C N6    1 
ATOM   3636 N  N1    . A   B 2 3   ? 23.603 -22.559 -28.717 1.00 31.58  ? 3   A   C N1    1 
ATOM   3637 C  C2    . A   B 2 3   ? 23.016 -22.052 -27.625 1.00 30.82  ? 3   A   C C2    1 
ATOM   3638 N  N3    . A   B 2 3   ? 23.521 -21.187 -26.746 1.00 29.56  ? 3   A   C N3    1 
ATOM   3639 C  C4    . A   B 2 3   ? 24.795 -20.850 -27.049 1.00 28.24  ? 3   A   C C4    1 
ATOM   3640 P  P     . A   B 2 4   ? 27.360 -22.013 -21.819 1.00 35.46  ? 4   A   C P     1 
ATOM   3641 O  OP1   . A   B 2 4   ? 27.602 -22.079 -20.361 1.00 36.21  ? 4   A   C OP1   1 
ATOM   3642 O  OP2   . A   B 2 4   ? 28.362 -22.548 -22.773 1.00 34.11  ? 4   A   C OP2   1 
ATOM   3643 O  "O5'" . A   B 2 4   ? 25.970 -22.716 -22.172 1.00 37.38  ? 4   A   C "O5'" 1 
ATOM   3644 C  "C5'" . A   B 2 4   ? 24.880 -22.724 -21.258 1.00 40.10  ? 4   A   C "C5'" 1 
ATOM   3645 C  "C4'" . A   B 2 4   ? 23.780 -23.569 -21.863 1.00 42.18  ? 4   A   C "C4'" 1 
ATOM   3646 O  "O4'" . A   B 2 4   ? 23.550 -23.125 -23.225 1.00 40.33  ? 4   A   C "O4'" 1 
ATOM   3647 C  "C3'" . A   B 2 4   ? 24.129 -25.035 -22.059 1.00 44.31  ? 4   A   C "C3'" 1 
ATOM   3648 O  "O3'" . A   B 2 4   ? 24.007 -25.775 -20.851 1.00 48.74  ? 4   A   C "O3'" 1 
ATOM   3649 C  "C2'" . A   B 2 4   ? 23.111 -25.443 -23.121 1.00 44.78  ? 4   A   C "C2'" 1 
ATOM   3650 O  "O2'" . A   B 2 4   ? 21.801 -25.641 -22.621 1.00 46.97  ? 4   A   C "O2'" 1 
ATOM   3651 C  "C1'" . A   B 2 4   ? 23.168 -24.225 -24.036 1.00 41.48  ? 4   A   C "C1'" 1 
ATOM   3652 N  N9    . A   B 2 4   ? 24.125 -24.397 -25.132 1.00 40.08  ? 4   A   C N9    1 
ATOM   3653 C  C8    . A   B 2 4   ? 25.393 -23.889 -25.221 1.00 37.80  ? 4   A   C C8    1 
ATOM   3654 N  N7    . A   B 2 4   ? 26.024 -24.211 -26.326 1.00 37.28  ? 4   A   C N7    1 
ATOM   3655 C  C5    . A   B 2 4   ? 25.108 -24.995 -27.006 1.00 40.01  ? 4   A   C C5    1 
ATOM   3656 C  C6    . A   B 2 4   ? 25.164 -25.652 -28.254 1.00 41.32  ? 4   A   C C6    1 
ATOM   3657 N  N6    . A   B 2 4   ? 26.243 -25.604 -29.044 1.00 40.54  ? 4   A   C N6    1 
ATOM   3658 N  N1    . A   B 2 4   ? 24.076 -26.351 -28.660 1.00 43.24  ? 4   A   C N1    1 
ATOM   3659 C  C2    . A   B 2 4   ? 23.004 -26.390 -27.854 1.00 44.46  ? 4   A   C C2    1 
ATOM   3660 N  N3    . A   B 2 4   ? 22.836 -25.811 -26.661 1.00 43.37  ? 4   A   C N3    1 
ATOM   3661 C  C4    . A   B 2 4   ? 23.931 -25.121 -26.290 1.00 41.05  ? 4   A   C C4    1 
ATOM   3662 P  P     . G   B 2 5   ? 24.992 -27.001 -20.546 1.00 49.81  ? 5   G   C P     1 
ATOM   3663 O  OP1   . G   B 2 5   ? 24.658 -27.497 -19.194 1.00 53.32  ? 5   G   C OP1   1 
ATOM   3664 O  OP2   . G   B 2 5   ? 26.392 -26.599 -20.818 1.00 47.26  ? 5   G   C OP2   1 
ATOM   3665 O  "O5'" . G   B 2 5   ? 24.548 -28.067 -21.658 1.00 52.86  ? 5   G   C "O5'" 1 
ATOM   3666 C  "C5'" . G   B 2 5   ? 23.353 -28.814 -21.470 1.00 58.65  ? 5   G   C "C5'" 1 
ATOM   3667 C  "C4'" . G   B 2 5   ? 22.864 -29.444 -22.761 1.00 61.96  ? 5   G   C "C4'" 1 
ATOM   3668 O  "O4'" . G   B 2 5   ? 23.068 -28.560 -23.892 1.00 59.66  ? 5   G   C "O4'" 1 
ATOM   3669 C  "C3'" . G   B 2 5   ? 23.589 -30.704 -23.202 1.00 64.60  ? 5   G   C "C3'" 1 
ATOM   3670 O  "O3'" . G   B 2 5   ? 23.197 -31.814 -22.413 1.00 70.31  ? 5   G   C "O3'" 1 
ATOM   3671 C  "C2'" . G   B 2 5   ? 23.090 -30.810 -24.639 1.00 64.87  ? 5   G   C "C2'" 1 
ATOM   3672 O  "O2'" . G   B 2 5   ? 21.762 -31.292 -24.742 1.00 68.59  ? 5   G   C "O2'" 1 
ATOM   3673 C  "C1'" . G   B 2 5   ? 23.151 -29.344 -25.072 1.00 60.42  ? 5   G   C "C1'" 1 
ATOM   3674 N  N9    . G   B 2 5   ? 24.371 -29.008 -25.814 1.00 57.66  ? 5   G   C N9    1 
ATOM   3675 C  C8    . G   B 2 5   ? 25.441 -28.245 -25.401 1.00 54.49  ? 5   G   C C8    1 
ATOM   3676 N  N7    . G   B 2 5   ? 26.383 -28.136 -26.299 1.00 53.24  ? 5   G   C N7    1 
ATOM   3677 C  C5    . G   B 2 5   ? 25.910 -28.878 -27.379 1.00 55.54  ? 5   G   C C5    1 
ATOM   3678 C  C6    . G   B 2 5   ? 26.489 -29.130 -28.652 1.00 56.18  ? 5   G   C C6    1 
ATOM   3679 O  O6    . G   B 2 5   ? 27.583 -28.728 -29.088 1.00 54.75  ? 5   G   C O6    1 
ATOM   3680 N  N1    . G   B 2 5   ? 25.670 -29.936 -29.450 1.00 59.20  ? 5   G   C N1    1 
ATOM   3681 C  C2    . G   B 2 5   ? 24.442 -30.438 -29.062 1.00 61.44  ? 5   G   C C2    1 
ATOM   3682 N  N2    . G   B 2 5   ? 23.775 -31.198 -29.946 1.00 64.75  ? 5   G   C N2    1 
ATOM   3683 N  N3    . G   B 2 5   ? 23.892 -30.203 -27.878 1.00 60.96  ? 5   G   C N3    1 
ATOM   3684 C  C4    . G   B 2 5   ? 24.675 -29.420 -27.093 1.00 57.87  ? 5   G   C C4    1 
ATOM   3685 P  P     . U   B 2 6   ? 24.257 -32.969 -22.057 1.00 73.60  ? 6   U   C P     1 
ATOM   3686 O  OP1   . U   B 2 6   ? 23.670 -33.769 -20.954 1.00 76.31  ? 6   U   C OP1   1 
ATOM   3687 O  OP2   . U   B 2 6   ? 25.599 -32.353 -21.885 1.00 69.44  ? 6   U   C OP2   1 
ATOM   3688 O  "O5'" . U   B 2 6   ? 24.288 -33.845 -23.405 1.00 75.76  ? 6   U   C "O5'" 1 
ATOM   3689 C  "C5'" . U   B 2 6   ? 23.134 -34.571 -23.855 1.00 80.06  ? 6   U   C "C5'" 1 
ATOM   3690 C  "C4'" . U   B 2 6   ? 23.345 -35.175 -25.234 1.00 81.59  ? 6   U   C "C4'" 1 
ATOM   3691 O  "O4'" . U   B 2 6   ? 23.482 -34.121 -26.223 1.00 78.16  ? 6   U   C "O4'" 1 
ATOM   3692 C  "C3'" . U   B 2 6   ? 24.619 -35.993 -25.420 1.00 82.42  ? 6   U   C "C3'" 1 
ATOM   3693 O  "O3'" . U   B 2 6   ? 24.510 -37.310 -24.897 1.00 87.94  ? 6   U   C "O3'" 1 
ATOM   3694 C  "C2'" . U   B 2 6   ? 24.774 -35.972 -26.938 1.00 82.04  ? 6   U   C "C2'" 1 
ATOM   3695 O  "O2'" . U   B 2 6   ? 23.875 -36.829 -27.618 1.00 86.87  ? 6   U   C "O2'" 1 
ATOM   3696 C  "C1'" . U   B 2 6   ? 24.424 -34.514 -27.212 1.00 77.50  ? 6   U   C "C1'" 1 
ATOM   3697 N  N1    . U   B 2 6   ? 25.627 -33.603 -27.210 1.00 72.63  ? 6   U   C N1    1 
ATOM   3698 C  C2    . U   B 2 6   ? 26.343 -33.449 -28.385 1.00 71.47  ? 6   U   C C2    1 
ATOM   3699 O  O2    . U   B 2 6   ? 26.060 -34.009 -29.426 1.00 74.14  ? 6   U   C O2    1 
ATOM   3700 N  N3    . U   B 2 6   ? 27.423 -32.603 -28.301 1.00 67.73  ? 6   U   C N3    1 
ATOM   3701 C  C4    . U   B 2 6   ? 27.853 -31.910 -27.185 1.00 65.34  ? 6   U   C C4    1 
ATOM   3702 O  O4    . U   B 2 6   ? 28.841 -31.188 -27.272 1.00 63.19  ? 6   U   C O4    1 
ATOM   3703 C  C5    . U   B 2 6   ? 27.066 -32.118 -25.994 1.00 66.08  ? 6   U   C C5    1 
ATOM   3704 C  C6    . U   B 2 6   ? 26.010 -32.937 -26.052 1.00 69.77  ? 6   U   C C6    1 
ATOM   3705 P  P     . A   B 2 7   ? 25.787 -37.984 -24.198 1.00 88.51  ? 7   A   C P     1 
ATOM   3706 O  OP1   . A   B 2 7   ? 25.316 -39.246 -23.585 1.00 93.07  ? 7   A   C OP1   1 
ATOM   3707 O  OP2   . A   B 2 7   ? 26.450 -36.964 -23.353 1.00 84.03  ? 7   A   C OP2   1 
ATOM   3708 O  "O5'" . A   B 2 7   ? 26.766 -38.320 -25.424 1.00 88.67  ? 7   A   C "O5'" 1 
ATOM   3709 C  "C5'" . A   B 2 7   ? 26.460 -39.411 -26.297 1.00 94.25  ? 7   A   C "C5'" 1 
ATOM   3710 C  "C4'" . A   B 2 7   ? 27.318 -39.420 -27.552 1.00 94.21  ? 7   A   C "C4'" 1 
ATOM   3711 O  "O4'" . A   B 2 7   ? 27.203 -38.154 -28.258 1.00 91.00  ? 7   A   C "O4'" 1 
ATOM   3712 C  "C3'" . A   B 2 7   ? 28.825 -39.566 -27.355 1.00 92.59  ? 7   A   C "C3'" 1 
ATOM   3713 O  "O3'" . A   B 2 7   ? 29.270 -40.883 -27.005 1.00 96.14  ? 7   A   C "O3'" 1 
ATOM   3714 C  "C2'" . A   B 2 7   ? 29.313 -39.099 -28.724 1.00 91.48  ? 7   A   C "C2'" 1 
ATOM   3715 O  "O2'" . A   B 2 7   ? 29.092 -40.041 -29.759 1.00 95.78  ? 7   A   C "O2'" 1 
ATOM   3716 C  "C1'" . A   B 2 7   ? 28.434 -37.862 -28.905 1.00 88.51  ? 7   A   C "C1'" 1 
ATOM   3717 N  N9    . A   B 2 7   ? 29.032 -36.651 -28.334 1.00 83.41  ? 7   A   C N9    1 
ATOM   3718 C  C8    . A   B 2 7   ? 28.762 -36.083 -27.117 1.00 81.28  ? 7   A   C C8    1 
ATOM   3719 N  N7    . A   B 2 7   ? 29.458 -34.998 -26.861 1.00 77.34  ? 7   A   C N7    1 
ATOM   3720 C  C5    . A   B 2 7   ? 30.244 -34.839 -27.991 1.00 76.85  ? 7   A   C C5    1 
ATOM   3721 C  C6    . A   B 2 7   ? 31.206 -33.869 -28.352 1.00 73.77  ? 7   A   C C6    1 
ATOM   3722 N  N6    . A   B 2 7   ? 31.540 -32.846 -27.559 1.00 70.54  ? 7   A   C N6    1 
ATOM   3723 N  N1    . A   B 2 7   ? 31.815 -33.995 -29.555 1.00 74.72  ? 7   A   C N1    1 
ATOM   3724 C  C2    . A   B 2 7   ? 31.480 -35.030 -30.341 1.00 78.61  ? 7   A   C C2    1 
ATOM   3725 N  N3    . A   B 2 7   ? 30.590 -36.001 -30.112 1.00 81.47  ? 7   A   C N3    1 
ATOM   3726 C  C4    . A   B 2 7   ? 29.998 -35.850 -28.910 1.00 80.66  ? 7   A   C C4    1 
ATOM   3727 P  P     . G   B 2 8   ? 30.539 -41.014 -26.022 1.00 94.77  ? 8   G   C P     1 
ATOM   3728 O  OP1   . G   B 2 8   ? 30.683 -42.445 -25.672 1.00 99.13  ? 8   G   C OP1   1 
ATOM   3729 O  OP2   . G   B 2 8   ? 30.415 -40.012 -24.938 1.00 91.12  ? 8   G   C OP2   1 
ATOM   3730 O  "O5'" . G   B 2 8   ? 31.782 -40.558 -26.930 1.00 91.86  ? 8   G   C "O5'" 1 
ATOM   3731 C  "C5'" . G   B 2 8   ? 32.175 -41.363 -28.042 1.00 94.49  ? 8   G   C "C5'" 1 
ATOM   3732 C  "C4'" . G   B 2 8   ? 33.134 -40.668 -28.994 1.00 91.29  ? 8   G   C "C4'" 1 
ATOM   3733 O  "O4'" . G   B 2 8   ? 32.621 -39.391 -29.460 1.00 87.95  ? 8   G   C "O4'" 1 
ATOM   3734 C  "C3'" . G   B 2 8   ? 34.493 -40.277 -28.439 1.00 87.61  ? 8   G   C "C3'" 1 
ATOM   3735 O  "O3'" . G   B 2 8   ? 35.329 -41.397 -28.176 1.00 90.53  ? 8   G   C "O3'" 1 
ATOM   3736 C  "C2'" . G   B 2 8   ? 34.977 -39.433 -29.613 1.00 85.72  ? 8   G   C "C2'" 1 
ATOM   3737 O  "O2'" . G   B 2 8   ? 35.331 -40.174 -30.767 1.00 88.79  ? 8   G   C "O2'" 1 
ATOM   3738 C  "C1'" . G   B 2 8   ? 33.727 -38.588 -29.853 1.00 84.29  ? 8   G   C "C1'" 1 
ATOM   3739 N  N9    . G   B 2 8   ? 33.818 -37.359 -29.060 1.00 79.48  ? 8   G   C N9    1 
ATOM   3740 C  C8    . G   B 2 8   ? 33.164 -37.048 -27.890 1.00 77.65  ? 8   G   C C8    1 
ATOM   3741 N  N7    . G   B 2 8   ? 33.484 -35.877 -27.416 1.00 73.77  ? 8   G   C N7    1 
ATOM   3742 C  C5    . G   B 2 8   ? 34.412 -35.381 -28.322 1.00 72.89  ? 8   G   C C5    1 
ATOM   3743 C  C6    . G   B 2 8   ? 35.115 -34.147 -28.343 1.00 69.95  ? 8   G   C C6    1 
ATOM   3744 O  O6    . G   B 2 8   ? 35.052 -33.213 -27.531 1.00 67.11  ? 8   G   C O6    1 
ATOM   3745 N  N1    . G   B 2 8   ? 35.963 -34.045 -29.449 1.00 70.68  ? 8   G   C N1    1 
ATOM   3746 C  C2    . G   B 2 8   ? 36.119 -35.012 -30.417 1.00 73.85  ? 8   G   C C2    1 
ATOM   3747 N  N2    . G   B 2 8   ? 36.982 -34.744 -31.408 1.00 74.50  ? 8   G   C N2    1 
ATOM   3748 N  N3    . G   B 2 8   ? 35.465 -36.166 -30.407 1.00 76.81  ? 8   G   C N3    1 
ATOM   3749 C  C4    . G   B 2 8   ? 34.632 -36.283 -29.339 1.00 76.17  ? 8   G   C C4    1 
ATOM   3750 P  P     . A   B 2 9   ? 36.543 -41.282 -27.128 1.00 87.99  ? 9   A   C P     1 
ATOM   3751 O  OP1   . A   B 2 9   ? 37.023 -42.662 -26.890 1.00 91.92  ? 9   A   C OP1   1 
ATOM   3752 O  OP2   . A   B 2 9   ? 36.138 -40.438 -25.979 1.00 84.39  ? 9   A   C OP2   1 
ATOM   3753 O  "O5'" . A   B 2 9   ? 37.661 -40.476 -27.941 1.00 85.23  ? 9   A   C "O5'" 1 
ATOM   3754 C  "C5'" . A   B 2 9   ? 38.139 -40.948 -29.209 1.00 87.04  ? 9   A   C "C5'" 1 
ATOM   3755 C  "C4'" . A   B 2 9   ? 39.074 -39.920 -29.816 1.00 83.74  ? 9   A   C "C4'" 1 
ATOM   3756 O  "O4'" . A   B 2 9   ? 38.365 -38.699 -30.158 1.00 80.76  ? 9   A   C "O4'" 1 
ATOM   3757 C  "C3'" . A   B 2 9   ? 40.141 -39.431 -28.852 1.00 79.73  ? 9   A   C "C3'" 1 
ATOM   3758 O  "O3'" . A   B 2 9   ? 41.175 -40.378 -28.685 1.00 81.29  ? 9   A   C "O3'" 1 
ATOM   3759 C  "C2'" . A   B 2 9   ? 40.577 -38.138 -29.534 1.00 77.08  ? 9   A   C "C2'" 1 
ATOM   3760 O  "O2'" . A   B 2 9   ? 41.357 -38.325 -30.700 1.00 79.24  ? 9   A   C "O2'" 1 
ATOM   3761 C  "C1'" . A   B 2 9   ? 39.199 -37.582 -29.871 1.00 76.29  ? 9   A   C "C1'" 1 
ATOM   3762 N  N9    . A   B 2 9   ? 38.650 -36.796 -28.764 1.00 72.67  ? 9   A   C N9    1 
ATOM   3763 C  C8    . A   B 2 9   ? 37.639 -37.142 -27.906 1.00 72.62  ? 9   A   C C8    1 
ATOM   3764 N  N7    . A   B 2 9   ? 37.367 -36.227 -27.004 1.00 69.57  ? 9   A   C N7    1 
ATOM   3765 C  C5    . A   B 2 9   ? 38.264 -35.210 -27.287 1.00 67.24  ? 9   A   C C5    1 
ATOM   3766 C  C6    . A   B 2 9   ? 38.495 -33.950 -26.698 1.00 64.02  ? 9   A   C C6    1 
ATOM   3767 N  N6    . A   B 2 9   ? 37.802 -33.493 -25.652 1.00 62.39  ? 9   A   C N6    1 
ATOM   3768 N  N1    . A   B 2 9   ? 39.471 -33.176 -27.222 1.00 63.04  ? 9   A   C N1    1 
ATOM   3769 C  C2    . A   B 2 9   ? 40.172 -33.629 -28.269 1.00 65.03  ? 9   A   C C2    1 
ATOM   3770 N  N3    . A   B 2 9   ? 40.044 -34.790 -28.909 1.00 68.17  ? 9   A   C N3    1 
ATOM   3771 C  C4    . A   B 2 9   ? 39.067 -35.543 -28.365 1.00 69.18  ? 9   A   C C4    1 
ATOM   3772 P  P     . U   B 2 10  ? 42.205 -40.176 -27.476 1.00 78.74  ? 10  U   C P     1 
ATOM   3773 O  OP1   . U   B 2 10  ? 42.848 -41.485 -27.211 1.00 81.65  ? 10  U   C OP1   1 
ATOM   3774 O  OP2   . U   B 2 10  ? 41.552 -39.428 -26.371 1.00 74.73  ? 10  U   C OP2   1 
ATOM   3775 O  "O5'" . U   B 2 10  ? 43.261 -39.213 -28.183 1.00 76.57  ? 10  U   C "O5'" 1 
ATOM   3776 C  "C5'" . U   B 2 10  ? 44.284 -38.652 -27.425 1.00 73.01  ? 10  U   C "C5'" 1 
ATOM   3777 C  "C4'" . U   B 2 10  ? 44.475 -37.191 -27.767 1.00 69.45  ? 10  U   C "C4'" 1 
ATOM   3778 O  "O4'" . U   B 2 10  ? 43.235 -36.449 -27.858 1.00 67.95  ? 10  U   C "O4'" 1 
ATOM   3779 C  "C3'" . U   B 2 10  ? 45.205 -36.476 -26.658 1.00 66.44  ? 10  U   C "C3'" 1 
ATOM   3780 O  "O3'" . U   B 2 10  ? 46.557 -36.841 -26.715 1.00 68.25  ? 10  U   C "O3'" 1 
ATOM   3781 C  "C2'" . U   B 2 10  ? 44.951 -35.025 -27.018 1.00 63.65  ? 10  U   C "C2'" 1 
ATOM   3782 O  "O2'" . U   B 2 10  ? 45.745 -34.577 -28.102 1.00 64.37  ? 10  U   C "O2'" 1 
ATOM   3783 C  "C1'" . U   B 2 10  ? 43.467 -35.118 -27.392 1.00 63.91  ? 10  U   C "C1'" 1 
ATOM   3784 N  N1    . U   B 2 10  ? 42.547 -34.785 -26.234 1.00 60.99  ? 10  U   C N1    1 
ATOM   3785 C  C2    . U   B 2 10  ? 42.579 -33.517 -25.659 1.00 57.86  ? 10  U   C C2    1 
ATOM   3786 O  O2    . U   B 2 10  ? 43.310 -32.612 -26.023 1.00 56.91  ? 10  U   C O2    1 
ATOM   3787 N  N3    . U   B 2 10  ? 41.704 -33.325 -24.617 1.00 56.15  ? 10  U   C N3    1 
ATOM   3788 C  C4    . U   B 2 10  ? 40.813 -34.245 -24.092 1.00 57.95  ? 10  U   C C4    1 
ATOM   3789 O  O4    . U   B 2 10  ? 40.092 -33.916 -23.151 1.00 56.79  ? 10  U   C O4    1 
ATOM   3790 C  C5    . U   B 2 10  ? 40.832 -35.542 -24.733 1.00 60.72  ? 10  U   C C5    1 
ATOM   3791 C  C6    . U   B 2 10  ? 41.676 -35.754 -25.755 1.00 61.94  ? 10  U   C C6    1 
ATOM   3792 P  P     . G   B 2 11  ? 47.281 -37.245 -25.359 1.00 68.44  ? 11  G   C P     1 
ATOM   3793 O  OP1   . G   B 2 11  ? 48.410 -38.148 -25.681 1.00 70.51  ? 11  G   C OP1   1 
ATOM   3794 O  OP2   . G   B 2 11  ? 46.258 -37.674 -24.375 1.00 68.09  ? 11  G   C OP2   1 
ATOM   3795 O  "O5'" . G   B 2 11  ? 47.851 -35.811 -24.937 1.00 64.17  ? 11  G   C "O5'" 1 
ATOM   3796 C  "C5'" . G   B 2 11  ? 48.664 -35.105 -25.870 1.00 62.14  ? 11  G   C "C5'" 1 
ATOM   3797 C  "C4'" . G   B 2 11  ? 48.778 -33.645 -25.500 1.00 57.48  ? 11  G   C "C4'" 1 
ATOM   3798 O  "O4'" . G   B 2 11  ? 47.476 -33.024 -25.623 1.00 55.13  ? 11  G   C "O4'" 1 
ATOM   3799 C  "C3'" . G   B 2 11  ? 49.148 -33.375 -24.051 1.00 54.83  ? 11  G   C "C3'" 1 
ATOM   3800 O  "O3'" . G   B 2 11  ? 50.529 -33.559 -23.792 1.00 56.65  ? 11  G   C "O3'" 1 
ATOM   3801 C  "C2'" . G   B 2 11  ? 48.706 -31.926 -23.922 1.00 51.48  ? 11  G   C "C2'" 1 
ATOM   3802 O  "O2'" . G   B 2 11  ? 49.527 -31.003 -24.605 1.00 51.23  ? 11  G   C "O2'" 1 
ATOM   3803 C  "C1'" . G   B 2 11  ? 47.360 -32.025 -24.621 1.00 49.84  ? 11  G   C "C1'" 1 
ATOM   3804 N  N9    . G   B 2 11  ? 46.266 -32.339 -23.703 1.00 48.11  ? 11  G   C N9    1 
ATOM   3805 C  C8    . G   B 2 11  ? 45.555 -33.512 -23.586 1.00 48.54  ? 11  G   C C8    1 
ATOM   3806 N  N7    . G   B 2 11  ? 44.622 -33.463 -22.674 1.00 47.27  ? 11  G   C N7    1 
ATOM   3807 C  C5    . G   B 2 11  ? 44.725 -32.177 -22.154 1.00 45.46  ? 11  G   C C5    1 
ATOM   3808 C  C6    . G   B 2 11  ? 43.983 -31.528 -21.133 1.00 43.99  ? 11  G   C C6    1 
ATOM   3809 O  O6    . G   B 2 11  ? 43.048 -31.992 -20.467 1.00 44.23  ? 11  G   C O6    1 
ATOM   3810 N  N1    . G   B 2 11  ? 44.411 -30.213 -20.914 1.00 42.68  ? 11  G   C N1    1 
ATOM   3811 C  C2    . G   B 2 11  ? 45.434 -29.604 -21.599 1.00 42.63  ? 11  G   C C2    1 
ATOM   3812 N  N2    . G   B 2 11  ? 45.717 -28.342 -21.274 1.00 41.86  ? 11  G   C N2    1 
ATOM   3813 N  N3    . G   B 2 11  ? 46.133 -30.197 -22.558 1.00 44.43  ? 11  G   C N3    1 
ATOM   3814 C  C4    . G   B 2 11  ? 45.732 -31.476 -22.778 1.00 45.51  ? 11  G   C C4    1 
ATOM   3815 P  P     . G   B 2 12  ? 50.974 -34.108 -22.357 1.00 57.31  ? 12  G   C P     1 
ATOM   3816 O  OP1   . G   B 2 12  ? 52.417 -34.425 -22.448 1.00 59.26  ? 12  G   C OP1   1 
ATOM   3817 O  OP2   . G   B 2 12  ? 50.005 -35.136 -21.901 1.00 57.01  ? 12  G   C OP2   1 
ATOM   3818 O  "O5'" . G   B 2 12  ? 50.794 -32.857 -21.383 1.00 53.70  ? 12  G   C "O5'" 1 
ATOM   3819 C  "C5'" . G   B 2 12  ? 51.567 -31.685 -21.570 1.00 52.23  ? 12  G   C "C5'" 1 
ATOM   3820 C  "C4'" . G   B 2 12  ? 50.950 -30.568 -20.763 1.00 48.79  ? 12  G   C "C4'" 1 
ATOM   3821 O  "O4'" . G   B 2 12  ? 49.528 -30.528 -21.029 1.00 47.22  ? 12  G   C "O4'" 1 
ATOM   3822 C  "C3'" . G   B 2 12  ? 50.987 -30.798 -19.267 1.00 47.65  ? 12  G   C "C3'" 1 
ATOM   3823 O  "O3'" . G   B 2 12  ? 52.256 -30.482 -18.726 1.00 49.35  ? 12  G   C "O3'" 1 
ATOM   3824 C  "C2'" . G   B 2 12  ? 49.894 -29.852 -18.795 1.00 45.62  ? 12  G   C "C2'" 1 
ATOM   3825 O  "O2'" . G   B 2 12  ? 50.274 -28.491 -18.833 1.00 45.35  ? 12  G   C "O2'" 1 
ATOM   3826 C  "C1'" . G   B 2 12  ? 48.842 -30.107 -19.862 1.00 44.62  ? 12  G   C "C1'" 1 
ATOM   3827 N  N9    . G   B 2 12  ? 47.829 -31.096 -19.490 1.00 44.00  ? 12  G   C N9    1 
ATOM   3828 C  C8    . G   B 2 12  ? 47.672 -32.370 -19.983 1.00 44.76  ? 12  G   C C8    1 
ATOM   3829 N  N7    . G   B 2 12  ? 46.655 -33.003 -19.468 1.00 44.82  ? 12  G   C N7    1 
ATOM   3830 C  C5    . G   B 2 12  ? 46.102 -32.090 -18.576 1.00 43.76  ? 12  G   C C5    1 
ATOM   3831 C  C6    . G   B 2 12  ? 44.979 -32.205 -17.718 1.00 43.73  ? 12  G   C C6    1 
ATOM   3832 O  O6    . G   B 2 12  ? 44.228 -33.174 -17.576 1.00 45.01  ? 12  G   C O6    1 
ATOM   3833 N  N1    . G   B 2 12  ? 44.754 -31.048 -16.971 1.00 42.63  ? 12  G   C N1    1 
ATOM   3834 C  C2    . G   B 2 12  ? 45.530 -29.911 -17.053 1.00 42.00  ? 12  G   C C2    1 
ATOM   3835 N  N2    . G   B 2 12  ? 45.172 -28.887 -16.268 1.00 41.31  ? 12  G   C N2    1 
ATOM   3836 N  N3    . G   B 2 12  ? 46.583 -29.785 -17.856 1.00 41.65  ? 12  G   C N3    1 
ATOM   3837 C  C4    . G   B 2 12  ? 46.813 -30.909 -18.582 1.00 42.61  ? 12  G   C C4    1 
ATOM   3838 P  P     . U   B 2 13  ? 52.800 -31.323 -17.472 1.00 50.25  ? 13  U   C P     1 
ATOM   3839 O  OP1   . U   B 2 13  ? 54.171 -30.845 -17.181 1.00 51.05  ? 13  U   C OP1   1 
ATOM   3840 O  OP2   . U   B 2 13  ? 52.561 -32.767 -17.738 1.00 51.32  ? 13  U   C OP2   1 
ATOM   3841 O  "O5'" . U   B 2 13  ? 51.830 -30.878 -16.290 1.00 48.20  ? 13  U   C "O5'" 1 
ATOM   3842 C  "C5'" . U   B 2 13  ? 51.864 -29.536 -15.812 1.00 47.26  ? 13  U   C "C5'" 1 
ATOM   3843 C  "C4'" . U   B 2 13  ? 50.687 -29.298 -14.894 1.00 45.10  ? 13  U   C "C4'" 1 
ATOM   3844 O  "O4'" . U   B 2 13  ? 49.452 -29.669 -15.557 1.00 44.92  ? 13  U   C "O4'" 1 
ATOM   3845 C  "C3'" . U   B 2 13  ? 50.669 -30.194 -13.674 1.00 44.75  ? 13  U   C "C3'" 1 
ATOM   3846 O  "O3'" . U   B 2 13  ? 51.605 -29.753 -12.698 1.00 44.24  ? 13  U   C "O3'" 1 
ATOM   3847 C  "C2'" . U   B 2 13  ? 49.216 -30.061 -13.232 1.00 44.20  ? 13  U   C "C2'" 1 
ATOM   3848 O  "O2'" . U   B 2 13  ? 48.954 -28.851 -12.542 1.00 45.03  ? 13  U   C "O2'" 1 
ATOM   3849 C  "C1'" . U   B 2 13  ? 48.508 -30.086 -14.583 1.00 43.59  ? 13  U   C "C1'" 1 
ATOM   3850 N  N1    . U   B 2 13  ? 47.933 -31.430 -14.963 1.00 43.77  ? 13  U   C N1    1 
ATOM   3851 C  C2    . U   B 2 13  ? 46.753 -31.831 -14.350 1.00 43.82  ? 13  U   C C2    1 
ATOM   3852 O  O2    . U   B 2 13  ? 46.164 -31.165 -13.515 1.00 43.57  ? 13  U   C O2    1 
ATOM   3853 N  N3    . U   B 2 13  ? 46.276 -33.056 -14.748 1.00 44.86  ? 13  U   C N3    1 
ATOM   3854 C  C4    . U   B 2 13  ? 46.854 -33.903 -15.677 1.00 45.37  ? 13  U   C C4    1 
ATOM   3855 O  O4    . U   B 2 13  ? 46.295 -34.965 -15.914 1.00 47.28  ? 13  U   C O4    1 
ATOM   3856 C  C5    . U   B 2 13  ? 48.082 -33.427 -16.282 1.00 44.42  ? 13  U   C C5    1 
ATOM   3857 C  C6    . U   B 2 13  ? 48.565 -32.229 -15.908 1.00 43.25  ? 13  U   C C6    1 
ATOM   3858 P  P     . U   B 2 14  ? 52.509 -30.850 -11.968 1.00 44.78  ? 14  U   C P     1 
ATOM   3859 O  OP1   . U   B 2 14  ? 53.445 -30.142 -11.061 1.00 45.28  ? 14  U   C OP1   1 
ATOM   3860 O  OP2   . U   B 2 14  ? 53.034 -31.802 -12.968 1.00 44.95  ? 14  U   C OP2   1 
ATOM   3861 O  "O5'" . U   B 2 14  ? 51.413 -31.622 -11.104 1.00 43.67  ? 14  U   C "O5'" 1 
ATOM   3862 C  "C5'" . U   B 2 14  ? 50.726 -30.944 -10.063 1.00 43.32  ? 14  U   C "C5'" 1 
ATOM   3863 C  "C4'" . U   B 2 14  ? 49.613 -31.821 -9.536  1.00 42.73  ? 14  U   C "C4'" 1 
ATOM   3864 O  "O4'" . U   B 2 14  ? 48.662 -32.097 -10.597 1.00 42.26  ? 14  U   C "O4'" 1 
ATOM   3865 C  "C3'" . U   B 2 14  ? 50.071 -33.204 -9.095  1.00 42.34  ? 14  U   C "C3'" 1 
ATOM   3866 O  "O3'" . U   B 2 14  ? 50.720 -33.120 -7.829  1.00 42.17  ? 14  U   C "O3'" 1 
ATOM   3867 C  "C2'" . U   B 2 14  ? 48.733 -33.935 -9.088  1.00 42.89  ? 14  U   C "C2'" 1 
ATOM   3868 O  "O2'" . U   B 2 14  ? 47.964 -33.694 -7.922  1.00 42.84  ? 14  U   C "O2'" 1 
ATOM   3869 C  "C1'" . U   B 2 14  ? 48.075 -33.363 -10.355 1.00 42.40  ? 14  U   C "C1'" 1 
ATOM   3870 N  N1    . U   B 2 14  ? 48.289 -34.261 -11.538 1.00 41.95  ? 14  U   C N1    1 
ATOM   3871 C  C2    . U   B 2 14  ? 47.396 -35.303 -11.751 1.00 42.79  ? 14  U   C C2    1 
ATOM   3872 O  O2    . U   B 2 14  ? 46.422 -35.531 -11.054 1.00 44.25  ? 14  U   C O2    1 
ATOM   3873 N  N3    . U   B 2 14  ? 47.677 -36.088 -12.840 1.00 44.16  ? 14  U   C N3    1 
ATOM   3874 C  C4    . U   B 2 14  ? 48.743 -35.950 -13.713 1.00 43.61  ? 14  U   C C4    1 
ATOM   3875 O  O4    . U   B 2 14  ? 48.850 -36.742 -14.641 1.00 44.90  ? 14  U   C O4    1 
ATOM   3876 C  C5    . U   B 2 14  ? 49.637 -34.848 -13.431 1.00 41.85  ? 14  U   C C5    1 
ATOM   3877 C  C6    . U   B 2 14  ? 49.381 -34.061 -12.373 1.00 40.95  ? 14  U   C C6    1 
ATOM   3878 P  P     . C   B 2 15  ? 52.080 -33.921 -7.535  1.00 42.10  ? 15  C   C P     1 
ATOM   3879 O  OP1   . C   B 2 15  ? 52.593 -33.393 -6.249  1.00 42.89  ? 15  C   C OP1   1 
ATOM   3880 O  OP2   . C   B 2 15  ? 52.953 -33.901 -8.732  1.00 40.45  ? 15  C   C OP2   1 
ATOM   3881 O  "O5'" . C   B 2 15  ? 51.509 -35.414 -7.356  1.00 41.55  ? 15  C   C "O5'" 1 
ATOM   3882 C  "C5'" . C   B 2 15  ? 52.343 -36.577 -7.306  1.00 41.62  ? 15  C   C "C5'" 1 
ATOM   3883 C  "C4'" . C   B 2 15  ? 51.544 -37.826 -6.951  1.00 42.08  ? 15  C   C "C4'" 1 
ATOM   3884 O  "O4'" . C   B 2 15  ? 51.016 -37.738 -5.602  1.00 42.66  ? 15  C   C "O4'" 1 
ATOM   3885 C  "C3'" . C   B 2 15  ? 50.281 -38.080 -7.764  1.00 42.41  ? 15  C   C "C3'" 1 
ATOM   3886 O  "O3'" . C   B 2 15  ? 50.594 -38.614 -9.047  1.00 43.51  ? 15  C   C "O3'" 1 
ATOM   3887 C  "C2'" . C   B 2 15  ? 49.557 -39.089 -6.878  1.00 43.08  ? 15  C   C "C2'" 1 
ATOM   3888 O  "O2'" . C   B 2 15  ? 50.064 -40.401 -6.989  1.00 44.41  ? 15  C   C "O2'" 1 
ATOM   3889 C  "C1'" . C   B 2 15  ? 49.852 -38.550 -5.482  1.00 43.35  ? 15  C   C "C1'" 1 
ATOM   3890 N  N1    . C   B 2 15  ? 48.690 -37.798 -4.868  1.00 42.80  ? 15  C   C N1    1 
ATOM   3891 C  C2    . C   B 2 15  ? 48.644 -36.393 -4.870  1.00 41.29  ? 15  C   C C2    1 
ATOM   3892 O  O2    . C   B 2 15  ? 49.554 -35.747 -5.382  1.00 41.45  ? 15  C   C O2    1 
ATOM   3893 N  N3    . C   B 2 15  ? 47.597 -35.737 -4.314  1.00 41.90  ? 15  C   C N3    1 
ATOM   3894 C  C4    . C   B 2 15  ? 46.611 -36.429 -3.757  1.00 44.74  ? 15  C   C C4    1 
ATOM   3895 N  N4    . C   B 2 15  ? 45.609 -35.714 -3.222  1.00 46.28  ? 15  C   C N4    1 
ATOM   3896 C  C5    . C   B 2 15  ? 46.632 -37.869 -3.733  1.00 46.11  ? 15  C   C C5    1 
ATOM   3897 C  C6    . C   B 2 15  ? 47.670 -38.510 -4.291  1.00 44.29  ? 15  C   C C6    1 
ATOM   3898 P  P     . A   B 2 16  ? 49.880 -38.110 -10.383 1.00 43.45  ? 16  A   C P     1 
ATOM   3899 O  OP1   . A   B 2 16  ? 50.415 -38.948 -11.472 1.00 45.15  ? 16  A   C OP1   1 
ATOM   3900 O  OP2   . A   B 2 16  ? 50.036 -36.640 -10.481 1.00 40.66  ? 16  A   C OP2   1 
ATOM   3901 O  "O5'" . A   B 2 16  ? 48.334 -38.499 -10.175 1.00 45.93  ? 16  A   C "O5'" 1 
ATOM   3902 C  "C5'" . A   B 2 16  ? 47.959 -39.885 -10.133 1.00 50.83  ? 16  A   C "C5'" 1 
ATOM   3903 C  "C4'" . A   B 2 16  ? 46.541 -40.110 -9.644  1.00 54.91  ? 16  A   C "C4'" 1 
ATOM   3904 O  "O4'" . A   B 2 16  ? 46.399 -39.684 -8.267  1.00 54.79  ? 16  A   C "O4'" 1 
ATOM   3905 C  "C3'" . A   B 2 16  ? 45.463 -39.341 -10.398 1.00 56.39  ? 16  A   C "C3'" 1 
ATOM   3906 O  "O3'" . A   B 2 16  ? 45.086 -40.054 -11.566 1.00 61.24  ? 16  A   C "O3'" 1 
ATOM   3907 C  "C2'" . A   B 2 16  ? 44.334 -39.279 -9.370  1.00 57.41  ? 16  A   C "C2'" 1 
ATOM   3908 O  "O2'" . A   B 2 16  ? 43.530 -40.445 -9.322  1.00 60.78  ? 16  A   C "O2'" 1 
ATOM   3909 C  "C1'" . A   B 2 16  ? 45.122 -39.106 -8.073  1.00 55.87  ? 16  A   C "C1'" 1 
ATOM   3910 N  N9    . A   B 2 16  ? 45.274 -37.695 -7.713  1.00 53.86  ? 16  A   C N9    1 
ATOM   3911 C  C8    . A   B 2 16  ? 46.275 -36.836 -8.083  1.00 51.04  ? 16  A   C C8    1 
ATOM   3912 N  N7    . A   B 2 16  ? 46.130 -35.625 -7.603  1.00 50.41  ? 16  A   C N7    1 
ATOM   3913 C  C5    . A   B 2 16  ? 44.954 -35.690 -6.867  1.00 52.41  ? 16  A   C C5    1 
ATOM   3914 C  C6    . A   B 2 16  ? 44.237 -34.738 -6.099  1.00 53.13  ? 16  A   C C6    1 
ATOM   3915 N  N6    . A   B 2 16  ? 44.630 -33.472 -5.944  1.00 52.06  ? 16  A   C N6    1 
ATOM   3916 N  N1    . A   B 2 16  ? 43.094 -35.133 -5.489  1.00 55.49  ? 16  A   C N1    1 
ATOM   3917 C  C2    . A   B 2 16  ? 42.685 -36.401 -5.635  1.00 57.26  ? 16  A   C C2    1 
ATOM   3918 N  N3    . A   B 2 16  ? 43.273 -37.382 -6.327  1.00 57.40  ? 16  A   C N3    1 
ATOM   3919 C  C4    . A   B 2 16  ? 44.410 -36.960 -6.928  1.00 54.65  ? 16  A   C C4    1 
ATOM   3920 P  P     . A   B 2 17  ? 44.919 -39.315 -12.978 1.00 62.88  ? 17  A   C P     1 
ATOM   3921 O  OP1   . A   B 2 17  ? 44.602 -40.396 -13.942 1.00 65.03  ? 17  A   C OP1   1 
ATOM   3922 O  OP2   . A   B 2 17  ? 46.092 -38.436 -13.221 1.00 60.22  ? 17  A   C OP2   1 
ATOM   3923 O  "O5'" . A   B 2 17  ? 43.632 -38.379 -12.767 1.00 64.01  ? 17  A   C "O5'" 1 
ATOM   3924 C  "C5'" . A   B 2 17  ? 42.343 -38.977 -12.610 1.00 70.44  ? 17  A   C "C5'" 1 
ATOM   3925 C  "C4'" . A   B 2 17  ? 41.272 -38.148 -13.284 1.00 72.75  ? 17  A   C "C4'" 1 
ATOM   3926 O  "O4'" . A   B 2 17  ? 41.167 -36.903 -12.558 1.00 71.42  ? 17  A   C "O4'" 1 
ATOM   3927 C  "C3'" . A   B 2 17  ? 41.565 -37.762 -14.734 1.00 73.46  ? 17  A   C "C3'" 1 
ATOM   3928 O  "O3'" . A   B 2 17  ? 41.085 -38.747 -15.701 1.00 78.77  ? 17  A   C "O3'" 1 
ATOM   3929 C  "C2'" . A   B 2 17  ? 40.975 -36.355 -14.878 1.00 71.27  ? 17  A   C "C2'" 1 
ATOM   3930 O  "O2'" . A   B 2 17  ? 39.654 -36.319 -15.383 1.00 72.76  ? 17  A   C "O2'" 1 
ATOM   3931 C  "C1'" . A   B 2 17  ? 40.970 -35.821 -13.446 1.00 70.04  ? 17  A   C "C1'" 1 
ATOM   3932 N  N9    . A   B 2 17  ? 41.986 -34.807 -13.169 1.00 67.70  ? 17  A   C N9    1 
ATOM   3933 C  C8    . A   B 2 17  ? 43.279 -34.764 -13.622 1.00 66.47  ? 17  A   C C8    1 
ATOM   3934 N  N7    . A   B 2 17  ? 43.954 -33.721 -13.201 1.00 64.91  ? 17  A   C N7    1 
ATOM   3935 C  C5    . A   B 2 17  ? 43.043 -33.037 -12.415 1.00 65.29  ? 17  A   C C5    1 
ATOM   3936 C  C6    . A   B 2 17  ? 43.138 -31.841 -11.672 1.00 64.94  ? 17  A   C C6    1 
ATOM   3937 N  N6    . A   B 2 17  ? 44.258 -31.109 -11.612 1.00 63.60  ? 17  A   C N6    1 
ATOM   3938 N  N1    . A   B 2 17  ? 42.037 -31.431 -10.993 1.00 65.94  ? 17  A   C N1    1 
ATOM   3939 C  C2    . A   B 2 17  ? 40.916 -32.171 -11.053 1.00 67.19  ? 17  A   C C2    1 
ATOM   3940 N  N3    . A   B 2 17  ? 40.708 -33.309 -11.720 1.00 67.81  ? 17  A   C N3    1 
ATOM   3941 C  C4    . A   B 2 17  ? 41.820 -33.690 -12.385 1.00 66.81  ? 17  A   C C4    1 
ATOM   3942 P  P     . G   B 2 18  ? 39.557 -39.137 -16.041 1.00 83.82  ? 18  G   C P     1 
ATOM   3943 O  OP1   . G   B 2 18  ? 38.683 -38.797 -14.897 1.00 84.37  ? 18  G   C OP1   1 
ATOM   3944 O  OP2   . G   B 2 18  ? 39.581 -40.540 -16.518 1.00 86.98  ? 18  G   C OP2   1 
ATOM   3945 O  "O5'" . G   B 2 18  ? 39.189 -38.156 -17.261 1.00 82.67  ? 18  G   C "O5'" 1 
ATOM   3946 C  "C5'" . G   B 2 18  ? 38.203 -38.503 -18.241 1.00 86.32  ? 18  G   C "C5'" 1 
ATOM   3947 C  "C4'" . G   B 2 18  ? 36.826 -37.887 -18.009 1.00 87.93  ? 18  G   C "C4'" 1 
ATOM   3948 O  "O4'" . G   B 2 18  ? 35.917 -38.910 -17.525 1.00 92.38  ? 18  G   C "O4'" 1 
ATOM   3949 C  "C3'" . G   B 2 18  ? 36.694 -36.749 -16.997 1.00 86.42  ? 18  G   C "C3'" 1 
ATOM   3950 O  "O3'" . G   B 2 18  ? 37.026 -35.478 -17.599 1.00 82.91  ? 18  G   C "O3'" 1 
ATOM   3951 C  "C2'" . G   B 2 18  ? 35.214 -36.841 -16.602 1.00 89.14  ? 18  G   C "C2'" 1 
ATOM   3952 O  "O2'" . G   B 2 18  ? 34.342 -36.122 -17.460 1.00 88.48  ? 18  G   C "O2'" 1 
ATOM   3953 C  "C1'" . G   B 2 18  ? 34.923 -38.336 -16.690 1.00 93.86  ? 18  G   C "C1'" 1 
ATOM   3954 N  N9    . G   B 2 18  ? 34.929 -39.008 -15.388 1.00 96.46  ? 18  G   C N9    1 
ATOM   3955 C  C8    . G   B 2 18  ? 35.867 -39.907 -14.933 1.00 97.74  ? 18  G   C C8    1 
ATOM   3956 N  N7    . G   B 2 18  ? 35.633 -40.361 -13.733 1.00 100.08 ? 18  G   C N7    1 
ATOM   3957 C  C5    . G   B 2 18  ? 34.457 -39.723 -13.358 1.00 100.66 ? 18  G   C C5    1 
ATOM   3958 C  C6    . G   B 2 18  ? 33.715 -39.822 -12.152 1.00 103.10 ? 18  G   C C6    1 
ATOM   3959 O  O6    . G   B 2 18  ? 33.971 -40.518 -11.158 1.00 105.31 ? 18  G   C O6    1 
ATOM   3960 N  N1    . G   B 2 18  ? 32.576 -39.011 -12.164 1.00 103.11 ? 18  G   C N1    1 
ATOM   3961 C  C2    . G   B 2 18  ? 32.203 -38.205 -13.217 1.00 100.94 ? 18  G   C C2    1 
ATOM   3962 N  N2    . G   B 2 18  ? 31.076 -37.495 -13.052 1.00 101.54 ? 18  G   C N2    1 
ATOM   3963 N  N3    . G   B 2 18  ? 32.892 -38.104 -14.355 1.00 98.63  ? 18  G   C N3    1 
ATOM   3964 C  C4    . G   B 2 18  ? 34.007 -38.886 -14.363 1.00 98.52  ? 18  G   C C4    1 
ATOM   3965 P  P     . U   B 2 19  ? 37.449 -34.180 -16.745 1.00 79.51  ? 19  U   C P     1 
ATOM   3966 O  OP1   . U   B 2 19  ? 37.117 -32.982 -17.550 1.00 78.06  ? 19  U   C OP1   1 
ATOM   3967 O  OP2   . U   B 2 19  ? 38.839 -34.367 -16.285 1.00 78.36  ? 19  U   C OP2   1 
ATOM   3968 O  "O5'" . U   B 2 19  ? 36.490 -34.240 -15.465 1.00 81.00  ? 19  U   C "O5'" 1 
ATOM   3969 C  "C5'" . U   B 2 19  ? 35.362 -33.376 -15.306 1.00 80.61  ? 19  U   C "C5'" 1 
ATOM   3970 C  "C4'" . U   B 2 19  ? 35.266 -32.989 -13.846 1.00 81.06  ? 19  U   C "C4'" 1 
ATOM   3971 O  "O4'" . U   B 2 19  ? 34.845 -34.141 -13.077 1.00 84.61  ? 19  U   C "O4'" 1 
ATOM   3972 C  "C3'" . U   B 2 19  ? 36.615 -32.588 -13.258 1.00 78.98  ? 19  U   C "C3'" 1 
ATOM   3973 O  "O3'" . U   B 2 19  ? 36.939 -31.187 -13.474 1.00 74.77  ? 19  U   C "O3'" 1 
ATOM   3974 C  "C2'" . U   B 2 19  ? 36.551 -33.039 -11.795 1.00 81.91  ? 19  U   C "C2'" 1 
ATOM   3975 O  "O2'" . U   B 2 19  ? 36.092 -32.040 -10.906 1.00 82.67  ? 19  U   C "O2'" 1 
ATOM   3976 C  "C1'" . U   B 2 19  ? 35.562 -34.211 -11.855 1.00 85.32  ? 19  U   C "C1'" 1 
ATOM   3977 N  N1    . U   B 2 19  ? 36.203 -35.570 -11.724 1.00 87.09  ? 19  U   C N1    1 
ATOM   3978 C  C2    . U   B 2 19  ? 35.960 -36.326 -10.586 1.00 90.06  ? 19  U   C C2    1 
ATOM   3979 O  O2    . U   B 2 19  ? 35.248 -35.958 -9.667  1.00 91.63  ? 19  U   C O2    1 
ATOM   3980 N  N3    . U   B 2 19  ? 36.591 -37.551 -10.555 1.00 91.70  ? 19  U   C N3    1 
ATOM   3981 C  C4    . U   B 2 19  ? 37.425 -38.092 -11.524 1.00 90.42  ? 19  U   C C4    1 
ATOM   3982 O  O4    . U   B 2 19  ? 37.923 -39.206 -11.357 1.00 91.96  ? 19  U   C O4    1 
ATOM   3983 C  C5    . U   B 2 19  ? 37.628 -37.245 -12.675 1.00 87.29  ? 19  U   C C5    1 
ATOM   3984 C  C6    . U   B 2 19  ? 37.026 -36.050 -12.733 1.00 85.80  ? 19  U   C C6    1 
ATOM   3985 P  P     . C   B 2 20  ? 35.968 -29.904 -13.360 1.00 72.37  ? 20  C   C P     1 
ATOM   3986 O  OP1   . C   B 2 20  ? 34.612 -30.288 -12.897 1.00 74.82  ? 20  C   C OP1   1 
ATOM   3987 O  OP2   . C   B 2 20  ? 36.104 -29.113 -14.607 1.00 69.96  ? 20  C   C OP2   1 
ATOM   3988 O  "O5'" . C   B 2 20  ? 36.711 -29.158 -12.147 1.00 69.40  ? 20  C   C "O5'" 1 
ATOM   3989 C  "C5'" . C   B 2 20  ? 37.129 -27.807 -12.218 1.00 62.35  ? 20  C   C "C5'" 1 
ATOM   3990 C  "C4'" . C   B 2 20  ? 38.643 -27.661 -12.240 1.00 57.42  ? 20  C   C "C4'" 1 
ATOM   3991 O  "O4'" . C   B 2 20  ? 39.378 -28.908 -12.105 1.00 56.57  ? 20  C   C "O4'" 1 
ATOM   3992 C  "C3'" . C   B 2 20  ? 39.174 -27.107 -13.548 1.00 53.07  ? 20  C   C "C3'" 1 
ATOM   3993 O  "O3'" . C   B 2 20  ? 38.879 -25.740 -13.637 1.00 49.74  ? 20  C   C "O3'" 1 
ATOM   3994 C  "C2'" . C   B 2 20  ? 40.661 -27.364 -13.381 1.00 51.95  ? 20  C   C "C2'" 1 
ATOM   3995 O  "O2'" . C   B 2 20  ? 41.290 -26.468 -12.495 1.00 51.79  ? 20  C   C "O2'" 1 
ATOM   3996 C  "C1'" . C   B 2 20  ? 40.636 -28.754 -12.763 1.00 53.50  ? 20  C   C "C1'" 1 
ATOM   3997 N  N1    . C   B 2 20  ? 40.889 -29.856 -13.777 1.00 52.96  ? 20  C   C N1    1 
ATOM   3998 C  C2    . C   B 2 20  ? 42.120 -29.923 -14.475 1.00 51.33  ? 20  C   C C2    1 
ATOM   3999 O  O2    . C   B 2 20  ? 43.005 -29.077 -14.284 1.00 49.81  ? 20  C   C O2    1 
ATOM   4000 N  N3    . C   B 2 20  ? 42.312 -30.933 -15.367 1.00 51.42  ? 20  C   C N3    1 
ATOM   4001 C  C4    . C   B 2 20  ? 41.354 -31.842 -15.574 1.00 52.91  ? 20  C   C C4    1 
ATOM   4002 N  N4    . C   B 2 20  ? 41.601 -32.809 -16.463 1.00 53.71  ? 20  C   C N4    1 
ATOM   4003 C  C5    . C   B 2 20  ? 40.104 -31.800 -14.879 1.00 53.51  ? 20  C   C C5    1 
ATOM   4004 C  C6    . C   B 2 20  ? 39.920 -30.803 -14.005 1.00 53.72  ? 20  C   C C6    1 
ATOM   4005 P  P     . C   B 2 21  ? 38.507 -25.115 -15.052 1.00 48.17  ? 21  C   C P     1 
ATOM   4006 O  OP1   . C   B 2 21  ? 37.891 -23.792 -14.807 1.00 48.65  ? 21  C   C OP1   1 
ATOM   4007 O  OP2   . C   B 2 21  ? 37.790 -26.118 -15.883 1.00 47.94  ? 21  C   C OP2   1 
ATOM   4008 O  "O5'" . C   B 2 21  ? 39.959 -24.898 -15.680 1.00 45.32  ? 21  C   C "O5'" 1 
ATOM   4009 C  "C5'" . C   B 2 21  ? 40.907 -24.033 -15.055 1.00 41.51  ? 21  C   C "C5'" 1 
ATOM   4010 C  "C4'" . C   B 2 21  ? 42.172 -24.010 -15.881 1.00 37.74  ? 21  C   C "C4'" 1 
ATOM   4011 O  "O4'" . C   B 2 21  ? 42.793 -25.313 -15.807 1.00 37.14  ? 21  C   C "O4'" 1 
ATOM   4012 C  "C3'" . C   B 2 21  ? 41.954 -23.793 -17.370 1.00 35.60  ? 21  C   C "C3'" 1 
ATOM   4013 O  "O3'" . C   B 2 21  ? 41.838 -22.399 -17.652 1.00 34.19  ? 21  C   C "O3'" 1 
ATOM   4014 C  "C2'" . C   B 2 21  ? 43.209 -24.428 -17.962 1.00 34.74  ? 21  C   C "C2'" 1 
ATOM   4015 O  "O2'" . C   B 2 21  ? 44.354 -23.614 -17.816 1.00 32.57  ? 21  C   C "O2'" 1 
ATOM   4016 C  "C1'" . C   B 2 21  ? 43.356 -25.650 -17.066 1.00 34.88  ? 21  C   C "C1'" 1 
ATOM   4017 N  N1    . C   B 2 21  ? 42.762 -26.959 -17.557 1.00 35.15  ? 21  C   C N1    1 
ATOM   4018 C  C2    . C   B 2 21  ? 43.435 -27.712 -18.538 1.00 35.36  ? 21  C   C C2    1 
ATOM   4019 O  O2    . C   B 2 21  ? 44.499 -27.296 -19.008 1.00 35.13  ? 21  C   C O2    1 
ATOM   4020 N  N3    . C   B 2 21  ? 42.907 -28.899 -18.946 1.00 36.34  ? 21  C   C N3    1 
ATOM   4021 C  C4    . C   B 2 21  ? 41.757 -29.343 -18.425 1.00 36.47  ? 21  C   C C4    1 
ATOM   4022 N  N4    . C   B 2 21  ? 41.283 -30.509 -18.868 1.00 36.37  ? 21  C   C N4    1 
ATOM   4023 C  C5    . C   B 2 21  ? 41.050 -28.596 -17.429 1.00 36.26  ? 21  C   C C5    1 
ATOM   4024 C  C6    . C   B 2 21  ? 41.586 -27.432 -17.028 1.00 35.86  ? 21  C   C C6    1 
ATOM   4025 P  P     . A   B 2 22  ? 40.874 -21.898 -18.813 1.00 34.57  ? 22  A   C P     1 
ATOM   4026 O  OP1   . A   B 2 22  ? 40.874 -20.416 -18.766 1.00 33.41  ? 22  A   C OP1   1 
ATOM   4027 O  OP2   . A   B 2 22  ? 39.594 -22.636 -18.716 1.00 34.12  ? 22  A   C OP2   1 
ATOM   4028 O  "O5'" . A   B 2 22  ? 41.643 -22.347 -20.153 1.00 34.29  ? 22  A   C "O5'" 1 
ATOM   4029 C  "C5'" . A   B 2 22  ? 41.059 -23.129 -21.195 1.00 34.23  ? 22  A   C "C5'" 1 
ATOM   4030 C  "C4'" . A   B 2 22  ? 42.162 -23.800 -21.994 1.00 34.34  ? 22  A   C "C4'" 1 
ATOM   4031 O  "O4'" . A   B 2 22  ? 42.624 -24.959 -21.264 1.00 34.99  ? 22  A   C "O4'" 1 
ATOM   4032 C  "C3'" . A   B 2 22  ? 41.773 -24.372 -23.356 1.00 36.06  ? 22  A   C "C3'" 1 
ATOM   4033 O  "O3'" . A   B 2 22  ? 41.837 -23.392 -24.383 1.00 36.04  ? 22  A   C "O3'" 1 
ATOM   4034 C  "C2'" . A   B 2 22  ? 42.832 -25.447 -23.570 1.00 36.62  ? 22  A   C "C2'" 1 
ATOM   4035 O  "O2'" . A   B 2 22  ? 44.097 -24.966 -23.969 1.00 37.79  ? 22  A   C "O2'" 1 
ATOM   4036 C  "C1'" . A   B 2 22  ? 42.937 -26.011 -22.167 1.00 36.49  ? 22  A   C "C1'" 1 
ATOM   4037 N  N9    . A   B 2 22  ? 42.033 -27.147 -21.999 1.00 37.02  ? 22  A   C N9    1 
ATOM   4038 C  C8    . A   B 2 22  ? 40.929 -27.231 -21.192 1.00 36.60  ? 22  A   C C8    1 
ATOM   4039 N  N7    . A   B 2 22  ? 40.320 -28.391 -21.260 1.00 37.90  ? 22  A   C N7    1 
ATOM   4040 C  C5    . A   B 2 22  ? 41.071 -29.109 -22.182 1.00 38.89  ? 22  A   C C5    1 
ATOM   4041 C  C6    . A   B 2 22  ? 40.958 -30.419 -22.706 1.00 40.33  ? 22  A   C C6    1 
ATOM   4042 N  N6    . A   B 2 22  ? 39.988 -31.268 -22.350 1.00 40.82  ? 22  A   C N6    1 
ATOM   4043 N  N1    . A   B 2 22  ? 41.880 -30.822 -23.620 1.00 41.23  ? 22  A   C N1    1 
ATOM   4044 C  C2    . A   B 2 22  ? 42.856 -29.978 -23.989 1.00 40.24  ? 22  A   C C2    1 
ATOM   4045 N  N3    . A   B 2 22  ? 43.065 -28.735 -23.558 1.00 38.84  ? 22  A   C N3    1 
ATOM   4046 C  C4    . A   B 2 22  ? 42.131 -28.355 -22.653 1.00 38.12  ? 22  A   C C4    1 
ATOM   4047 P  P     . U   B 2 23  ? 40.806 -23.403 -25.610 1.00 37.43  ? 23  U   C P     1 
ATOM   4048 O  OP1   . U   B 2 23  ? 40.995 -22.135 -26.354 1.00 37.56  ? 23  U   C OP1   1 
ATOM   4049 O  OP2   . U   B 2 23  ? 39.461 -23.753 -25.101 1.00 36.15  ? 23  U   C OP2   1 
ATOM   4050 O  "O5'" . U   B 2 23  ? 41.350 -24.598 -26.513 1.00 38.93  ? 23  U   C "O5'" 1 
ATOM   4051 C  "C5'" . U   B 2 23  ? 42.662 -24.513 -27.073 1.00 41.51  ? 23  U   C "C5'" 1 
ATOM   4052 C  "C4'" . U   B 2 23  ? 43.008 -25.786 -27.819 1.00 44.49  ? 23  U   C "C4'" 1 
ATOM   4053 O  "O4'" . U   B 2 23  ? 43.101 -26.899 -26.891 1.00 43.79  ? 23  U   C "O4'" 1 
ATOM   4054 C  "C3'" . U   B 2 23  ? 41.958 -26.269 -28.803 1.00 46.54  ? 23  U   C "C3'" 1 
ATOM   4055 O  "O3'" . U   B 2 23  ? 41.951 -25.503 -30.010 1.00 49.85  ? 23  U   C "O3'" 1 
ATOM   4056 C  "C2'" . U   B 2 23  ? 42.417 -27.712 -28.984 1.00 47.34  ? 23  U   C "C2'" 1 
ATOM   4057 O  "O2'" . U   B 2 23  ? 43.626 -27.843 -29.708 1.00 49.57  ? 23  U   C "O2'" 1 
ATOM   4058 C  "C1'" . U   B 2 23  ? 42.661 -28.086 -27.528 1.00 45.27  ? 23  U   C "C1'" 1 
ATOM   4059 N  N1    . U   B 2 23  ? 41.458 -28.690 -26.824 1.00 44.37  ? 23  U   C N1    1 
ATOM   4060 C  C2    . U   B 2 23  ? 41.163 -30.033 -27.037 1.00 45.81  ? 23  U   C C2    1 
ATOM   4061 O  O2    . U   B 2 23  ? 41.817 -30.761 -27.771 1.00 47.91  ? 23  U   C O2    1 
ATOM   4062 N  N3    . U   B 2 23  ? 40.059 -30.506 -26.359 1.00 45.23  ? 23  U   C N3    1 
ATOM   4063 C  C4    . U   B 2 23  ? 39.239 -29.786 -25.506 1.00 43.82  ? 23  U   C C4    1 
ATOM   4064 O  O4    . U   B 2 23  ? 38.289 -30.340 -24.964 1.00 43.80  ? 23  U   C O4    1 
ATOM   4065 C  C5    . U   B 2 23  ? 39.608 -28.401 -25.333 1.00 42.35  ? 23  U   C C5    1 
ATOM   4066 C  C6    . U   B 2 23  ? 40.676 -27.918 -25.983 1.00 41.94  ? 23  U   C C6    1 
ATOM   4067 P  P     . U   B 2 24  ? 40.569 -25.270 -30.782 1.00 52.04  ? 24  U   C P     1 
ATOM   4068 O  OP1   . U   B 2 24  ? 40.855 -24.399 -31.943 1.00 53.40  ? 24  U   C OP1   1 
ATOM   4069 O  OP2   . U   B 2 24  ? 39.511 -24.874 -29.831 1.00 49.20  ? 24  U   C OP2   1 
ATOM   4070 O  "O5'" . U   B 2 24  ? 40.219 -26.749 -31.293 1.00 55.13  ? 24  U   C "O5'" 1 
ATOM   4071 C  "C5'" . U   B 2 24  ? 41.048 -27.403 -32.269 1.00 60.37  ? 24  U   C "C5'" 1 
ATOM   4072 C  "C4'" . U   B 2 24  ? 40.603 -28.837 -32.483 1.00 63.06  ? 24  U   C "C4'" 1 
ATOM   4073 O  "O4'" . U   B 2 24  ? 40.698 -29.571 -31.234 1.00 60.72  ? 24  U   C "O4'" 1 
ATOM   4074 C  "C3'" . U   B 2 24  ? 39.142 -28.999 -32.893 1.00 64.42  ? 24  U   C "C3'" 1 
ATOM   4075 O  "O3'" . U   B 2 24  ? 38.945 -28.767 -34.284 1.00 69.53  ? 24  U   C "O3'" 1 
ATOM   4076 C  "C2'" . U   B 2 24  ? 38.911 -30.451 -32.497 1.00 64.98  ? 24  U   C "C2'" 1 
ATOM   4077 O  "O2'" . U   B 2 24  ? 39.477 -31.368 -33.413 1.00 68.07  ? 24  U   C "O2'" 1 
ATOM   4078 C  "C1'" . U   B 2 24  ? 39.629 -30.499 -31.147 1.00 61.41  ? 24  U   C "C1'" 1 
ATOM   4079 N  N1    . U   B 2 24  ? 38.679 -30.197 -30.001 1.00 58.57  ? 24  U   C N1    1 
ATOM   4080 C  C2    . U   B 2 24  ? 37.862 -31.218 -29.537 1.00 59.26  ? 24  U   C C2    1 
ATOM   4081 O  O2    . U   B 2 24  ? 37.877 -32.347 -29.989 1.00 62.03  ? 24  U   C O2    1 
ATOM   4082 N  N3    . U   B 2 24  ? 37.015 -30.883 -28.510 1.00 57.44  ? 24  U   C N3    1 
ATOM   4083 C  C4    . U   B 2 24  ? 36.896 -29.647 -27.902 1.00 54.85  ? 24  U   C C4    1 
ATOM   4084 O  O4    . U   B 2 24  ? 36.090 -29.504 -26.988 1.00 53.72  ? 24  U   C O4    1 
ATOM   4085 C  C5    . U   B 2 24  ? 37.771 -28.628 -28.432 1.00 53.88  ? 24  U   C C5    1 
ATOM   4086 C  C6    . U   B 2 24  ? 38.608 -28.931 -29.437 1.00 55.49  ? 24  U   C C6    1 
ATOM   4087 P  P     . U   B 2 25  ? 37.485 -28.442 -34.880 1.00 71.80  ? 25  U   C P     1 
ATOM   4088 O  OP1   . U   B 2 25  ? 37.678 -27.747 -36.171 1.00 73.43  ? 25  U   C OP1   1 
ATOM   4089 O  OP2   . U   B 2 25  ? 36.642 -27.808 -33.839 1.00 69.25  ? 25  U   C OP2   1 
ATOM   4090 O  "O5'" . U   B 2 25  ? 36.881 -29.900 -35.143 1.00 75.44  ? 25  U   C "O5'" 1 
ATOM   4091 C  "C5'" . U   B 2 25  ? 37.485 -30.811 -36.070 1.00 79.85  ? 25  U   C "C5'" 1 
ATOM   4092 C  "C4'" . U   B 2 25  ? 36.714 -32.119 -36.123 1.00 82.48  ? 25  U   C "C4'" 1 
ATOM   4093 O  "O4'" . U   B 2 25  ? 36.826 -32.809 -34.848 1.00 80.44  ? 25  U   C "O4'" 1 
ATOM   4094 C  "C3'" . U   B 2 25  ? 35.212 -31.972 -36.333 1.00 82.85  ? 25  U   C "C3'" 1 
ATOM   4095 O  "O3'" . U   B 2 25  ? 34.888 -31.810 -37.708 1.00 87.17  ? 25  U   C "O3'" 1 
ATOM   4096 C  "C2'" . U   B 2 25  ? 34.693 -33.281 -35.748 1.00 84.00  ? 25  U   C "C2'" 1 
ATOM   4097 O  "O2'" . U   B 2 25  ? 34.860 -34.395 -36.614 1.00 88.72  ? 25  U   C "O2'" 1 
ATOM   4098 C  "C1'" . U   B 2 25  ? 35.578 -33.401 -34.508 1.00 80.52  ? 25  U   C "C1'" 1 
ATOM   4099 N  N1    . U   B 2 25  ? 34.986 -32.752 -33.269 1.00 76.07  ? 25  U   C N1    1 
ATOM   4100 C  C2    . U   B 2 25  ? 33.929 -33.367 -32.608 1.00 76.30  ? 25  U   C C2    1 
ATOM   4101 O  O2    . U   B 2 25  ? 33.418 -34.420 -32.954 1.00 79.17  ? 25  U   C O2    1 
ATOM   4102 N  N3    . U   B 2 25  ? 33.473 -32.692 -31.498 1.00 73.38  ? 25  U   C N3    1 
ATOM   4103 C  C4    . U   B 2 25  ? 33.946 -31.492 -30.991 1.00 70.24  ? 25  U   C C4    1 
ATOM   4104 O  O4    . U   B 2 25  ? 33.426 -31.015 -29.989 1.00 68.39  ? 25  U   C O4    1 
ATOM   4105 C  C5    . U   B 2 25  ? 35.043 -30.909 -31.723 1.00 69.42  ? 25  U   C C5    1 
ATOM   4106 C  C6    . U   B 2 25  ? 35.504 -31.551 -32.805 1.00 72.25  ? 25  U   C C6    1 
ATOM   4107 P  P     . A   B 2 26  ? 33.626 -30.911 -38.125 1.00 87.41  ? 26  A   C P     1 
ATOM   4108 O  OP1   . A   B 2 26  ? 33.660 -30.752 -39.596 1.00 90.40  ? 26  A   C OP1   1 
ATOM   4109 O  OP2   . A   B 2 26  ? 33.596 -29.705 -37.263 1.00 83.32  ? 26  A   C OP2   1 
ATOM   4110 O  "O5'" . A   B 2 26  ? 32.373 -31.823 -37.715 1.00 88.62  ? 26  A   C "O5'" 1 
ATOM   4111 C  "C5'" . A   B 2 26  ? 32.070 -33.015 -38.442 1.00 92.78  ? 26  A   C "C5'" 1 
ATOM   4112 C  "C4'" . A   B 2 26  ? 31.050 -33.865 -37.708 1.00 93.32  ? 26  A   C "C4'" 1 
ATOM   4113 O  "O4'" . A   B 2 26  ? 31.502 -34.149 -36.359 1.00 90.90  ? 26  A   C "O4'" 1 
ATOM   4114 C  "C3'" . A   B 2 26  ? 29.693 -33.214 -37.483 1.00 91.78  ? 26  A   C "C3'" 1 
ATOM   4115 O  "O3'" . A   B 2 26  ? 28.905 -33.214 -38.670 1.00 95.06  ? 26  A   C "O3'" 1 
ATOM   4116 C  "C2'" . A   B 2 26  ? 29.134 -34.105 -36.379 1.00 91.91  ? 26  A   C "C2'" 1 
ATOM   4117 O  "O2'" . A   B 2 26  ? 28.693 -35.373 -36.827 1.00 96.91  ? 26  A   C "O2'" 1 
ATOM   4118 C  "C1'" . A   B 2 26  ? 30.375 -34.254 -35.502 1.00 89.47  ? 26  A   C "C1'" 1 
ATOM   4119 N  N9    . A   B 2 26  ? 30.442 -33.264 -34.418 1.00 84.66  ? 26  A   C N9    1 
ATOM   4120 C  C8    . A   B 2 26  ? 31.184 -32.112 -34.363 1.00 81.22  ? 26  A   C C8    1 
ATOM   4121 N  N7    . A   B 2 26  ? 31.034 -31.432 -33.249 1.00 77.66  ? 26  A   C N7    1 
ATOM   4122 C  C5    . A   B 2 26  ? 30.128 -32.187 -32.521 1.00 78.95  ? 26  A   C C5    1 
ATOM   4123 C  C6    . A   B 2 26  ? 29.542 -32.022 -31.246 1.00 77.54  ? 26  A   C C6    1 
ATOM   4124 N  N6    . A   B 2 26  ? 29.799 -30.984 -30.447 1.00 74.25  ? 26  A   C N6    1 
ATOM   4125 N  N1    . A   B 2 26  ? 28.671 -32.966 -30.816 1.00 80.13  ? 26  A   C N1    1 
ATOM   4126 C  C2    . A   B 2 26  ? 28.401 -34.012 -31.610 1.00 83.84  ? 26  A   C C2    1 
ATOM   4127 N  N3    . A   B 2 26  ? 28.889 -34.272 -32.823 1.00 85.62  ? 26  A   C N3    1 
ATOM   4128 C  C4    . A   B 2 26  ? 29.752 -33.317 -33.227 1.00 83.11  ? 26  A   C C4    1 
ATOM   4129 P  P     . C   B 2 27  ? 27.938 -31.977 -39.011 1.00 93.76  ? 27  C   C P     1 
ATOM   4130 O  OP1   . C   B 2 27  ? 27.410 -32.201 -40.377 1.00 97.72  ? 27  C   C OP1   1 
ATOM   4131 O  OP2   . C   B 2 27  ? 28.630 -30.703 -38.705 1.00 88.91  ? 27  C   C OP2   1 
ATOM   4132 O  "O5'" . C   B 2 27  ? 26.740 -32.161 -37.962 1.00 92.86  ? 27  C   C "O5'" 1 
ATOM   4133 C  "C5'" . C   B 2 27  ? 25.838 -33.269 -38.085 1.00 96.40  ? 27  C   C "C5'" 1 
ATOM   4134 C  "C4'" . C   B 2 27  ? 25.075 -33.524 -36.797 1.00 95.11  ? 27  C   C "C4'" 1 
ATOM   4135 O  "O4'" . C   B 2 27  ? 25.987 -33.650 -35.671 1.00 92.46  ? 27  C   C "O4'" 1 
ATOM   4136 C  "C3'" . C   B 2 27  ? 24.155 -32.401 -36.348 1.00 91.93  ? 27  C   C "C3'" 1 
ATOM   4137 O  "O3'" . C   B 2 27  ? 22.959 -32.315 -37.126 1.00 93.73  ? 27  C   C "O3'" 1 
ATOM   4138 C  "C2'" . C   B 2 27  ? 23.952 -32.769 -34.877 1.00 90.85  ? 27  C   C "C2'" 1 
ATOM   4139 O  "O2'" . C   B 2 27  ? 23.139 -33.912 -34.667 1.00 94.98  ? 27  C   C "O2'" 1 
ATOM   4140 C  "C1'" . C   B 2 27  ? 25.398 -33.083 -34.507 1.00 89.10  ? 27  C   C "C1'" 1 
ATOM   4141 N  N1    . C   B 2 27  ? 26.198 -31.892 -33.995 1.00 84.05  ? 27  C   C N1    1 
ATOM   4142 C  C2    . C   B 2 27  ? 26.164 -31.583 -32.622 1.00 81.55  ? 27  C   C C2    1 
ATOM   4143 O  O2    . C   B 2 27  ? 25.482 -32.282 -31.860 1.00 83.33  ? 27  C   C O2    1 
ATOM   4144 N  N3    . C   B 2 27  ? 26.882 -30.522 -32.157 1.00 77.44  ? 27  C   C N3    1 
ATOM   4145 C  C4    . C   B 2 27  ? 27.612 -29.787 -33.001 1.00 76.34  ? 27  C   C C4    1 
ATOM   4146 N  N4    . C   B 2 27  ? 28.299 -28.758 -32.499 1.00 73.35  ? 27  C   C N4    1 
ATOM   4147 C  C5    . C   B 2 27  ? 27.667 -30.078 -34.400 1.00 78.90  ? 27  C   C C5    1 
ATOM   4148 C  C6    . C   B 2 27  ? 26.956 -31.124 -34.845 1.00 82.35  ? 27  C   C C6    1 
ATOM   4149 P  P     . U   B 2 28  ? 22.257 -30.879 -37.301 1.00 90.70  ? 28  U   C P     1 
ATOM   4150 O  OP1   . U   B 2 28  ? 21.217 -31.004 -38.350 1.00 93.29  ? 28  U   C OP1   1 
ATOM   4151 O  OP2   . U   B 2 28  ? 23.305 -29.832 -37.419 1.00 86.84  ? 28  U   C OP2   1 
ATOM   4152 O  "O5'" . U   B 2 28  ? 21.548 -30.678 -35.881 1.00 87.14  ? 28  U   C "O5'" 1 
ATOM   4153 C  "C5'" . U   B 2 28  ? 20.431 -31.483 -35.501 1.00 87.43  ? 28  U   C "C5'" 1 
ATOM   4154 C  "C4'" . U   B 2 28  ? 20.004 -31.133 -34.092 1.00 83.22  ? 28  U   C "C4'" 1 
ATOM   4155 O  "O4'" . U   B 2 28  ? 21.135 -31.256 -33.191 1.00 80.42  ? 28  U   C "O4'" 1 
ATOM   4156 C  "C3'" . U   B 2 28  ? 19.602 -29.684 -33.875 1.00 78.21  ? 28  U   C "C3'" 1 
ATOM   4157 O  "O3'" . U   B 2 28  ? 18.340 -29.344 -34.439 1.00 77.61  ? 28  U   C "O3'" 1 
ATOM   4158 C  "C2'" . U   B 2 28  ? 19.651 -29.612 -32.354 1.00 76.58  ? 28  U   C "C2'" 1 
ATOM   4159 O  "O2'" . U   B 2 28  ? 18.594 -30.295 -31.702 1.00 79.31  ? 28  U   C "O2'" 1 
ATOM   4160 C  "C1'" . U   B 2 28  ? 20.980 -30.327 -32.127 1.00 76.23  ? 28  U   C "C1'" 1 
ATOM   4161 N  N1    . U   B 2 28  ? 22.162 -29.395 -32.043 1.00 72.04  ? 28  U   C N1    1 
ATOM   4162 C  C2    . U   B 2 28  ? 22.401 -28.753 -30.839 1.00 69.36  ? 28  U   C C2    1 
ATOM   4163 O  O2    . U   B 2 28  ? 21.714 -28.907 -29.842 1.00 69.88  ? 28  U   C O2    1 
ATOM   4164 N  N3    . U   B 2 28  ? 23.500 -27.924 -30.829 1.00 66.40  ? 28  U   C N3    1 
ATOM   4165 C  C4    . U   B 2 28  ? 24.366 -27.668 -31.878 1.00 65.65  ? 28  U   C C4    1 
ATOM   4166 O  O4    . U   B 2 28  ? 25.305 -26.895 -31.701 1.00 62.84  ? 28  U   C O4    1 
ATOM   4167 C  C5    . U   B 2 28  ? 24.050 -28.362 -33.107 1.00 68.32  ? 28  U   C C5    1 
ATOM   4168 C  C6    . U   B 2 28  ? 22.985 -29.181 -33.142 1.00 71.40  ? 28  U   C C6    1 
ATOM   4169 P  P     . U   B 2 29  ? 18.255 -28.049 -35.382 1.00 73.27  ? 29  U   C P     1 
ATOM   4170 O  OP1   . U   B 2 29  ? 17.553 -28.453 -36.623 1.00 76.77  ? 29  U   C OP1   1 
ATOM   4171 O  OP2   . U   B 2 29  ? 19.590 -27.400 -35.458 1.00 70.45  ? 29  U   C OP2   1 
ATOM   4172 O  "O5'" . U   B 2 29  ? 17.310 -27.074 -34.550 1.00 69.00  ? 29  U   C "O5'" 1 
ATOM   4173 C  "C5'" . U   B 2 29  ? 17.895 -26.076 -33.779 1.00 61.11  ? 29  U   C "C5'" 1 
ATOM   4174 C  "C4'" . U   B 2 29  ? 17.519 -26.234 -32.326 1.00 58.57  ? 29  U   C "C4'" 1 
ATOM   4175 O  "O4'" . U   B 2 29  ? 18.599 -26.861 -31.594 1.00 57.49  ? 29  U   C "O4'" 1 
ATOM   4176 C  "C3'" . U   B 2 29  ? 17.391 -24.870 -31.695 1.00 54.42  ? 29  U   C "C3'" 1 
ATOM   4177 O  "O3'" . U   B 2 29  ? 16.051 -24.434 -31.786 1.00 53.50  ? 29  U   C "O3'" 1 
ATOM   4178 C  "C2'" . U   B 2 29  ? 17.907 -25.040 -30.275 1.00 53.27  ? 29  U   C "C2'" 1 
ATOM   4179 O  "O2'" . U   B 2 29  ? 16.933 -25.594 -29.412 1.00 56.41  ? 29  U   C "O2'" 1 
ATOM   4180 C  "C1'" . U   B 2 29  ? 19.045 -26.023 -30.535 1.00 53.05  ? 29  U   C "C1'" 1 
ATOM   4181 N  N1    . U   B 2 29  ? 20.377 -25.420 -30.917 1.00 49.30  ? 29  U   C N1    1 
ATOM   4182 C  C2    . U   B 2 29  ? 21.098 -24.640 -30.022 1.00 45.40  ? 29  U   C C2    1 
ATOM   4183 O  O2    . U   B 2 29  ? 20.743 -24.356 -28.895 1.00 45.02  ? 29  U   C O2    1 
ATOM   4184 N  N3    . U   B 2 29  ? 22.294 -24.177 -30.505 1.00 43.77  ? 29  U   C N3    1 
ATOM   4185 C  C4    . U   B 2 29  ? 22.847 -24.402 -31.754 1.00 44.93  ? 29  U   C C4    1 
ATOM   4186 O  O4    . U   B 2 29  ? 23.934 -23.911 -32.037 1.00 43.88  ? 29  U   C O4    1 
ATOM   4187 C  C5    . U   B 2 29  ? 22.049 -25.220 -32.631 1.00 48.27  ? 29  U   C C5    1 
ATOM   4188 C  C6    . U   B 2 29  ? 20.879 -25.688 -32.183 1.00 49.83  ? 29  U   C C6    1 
ATOM   4189 P  P     . C   B 2 30  ? 15.836 -22.976 -32.407 1.00 50.30  ? 30  C   C P     1 
ATOM   4190 O  OP1   . C   B 2 30  ? 14.373 -22.773 -32.523 1.00 51.29  ? 30  C   C OP1   1 
ATOM   4191 O  OP2   . C   B 2 30  ? 16.731 -22.792 -33.582 1.00 48.14  ? 30  C   C OP2   1 
ATOM   4192 O  "O5'" . C   B 2 30  ? 16.401 -22.003 -31.269 1.00 44.27  ? 30  C   C "O5'" 1 
ATOM   4193 C  "C5'" . C   B 2 30  ? 15.865 -22.019 -29.950 1.00 40.74  ? 30  C   C "C5'" 1 
ATOM   4194 C  "C4'" . C   B 2 30  ? 16.776 -21.206 -29.059 1.00 35.77  ? 30  C   C "C4'" 1 
ATOM   4195 O  "O4'" . C   B 2 30  ? 18.084 -21.820 -29.024 1.00 33.61  ? 30  C   C "O4'" 1 
ATOM   4196 C  "C3'" . C   B 2 30  ? 17.082 -19.801 -29.556 1.00 31.36  ? 30  C   C "C3'" 1 
ATOM   4197 O  "O3'" . C   B 2 30  ? 15.953 -18.964 -29.377 1.00 28.11  ? 30  C   C "O3'" 1 
ATOM   4198 C  "C2'" . C   B 2 30  ? 18.273 -19.489 -28.664 1.00 29.45  ? 30  C   C "C2'" 1 
ATOM   4199 O  "O2'" . C   B 2 30  ? 17.916 -19.269 -27.320 1.00 29.78  ? 30  C   C "O2'" 1 
ATOM   4200 C  "C1'" . C   B 2 30  ? 19.037 -20.801 -28.789 1.00 31.40  ? 30  C   C "C1'" 1 
ATOM   4201 N  N1    . C   B 2 30  ? 20.080 -20.797 -29.879 1.00 30.22  ? 30  C   C N1    1 
ATOM   4202 C  C2    . C   B 2 30  ? 21.272 -20.101 -29.662 1.00 27.82  ? 30  C   C C2    1 
ATOM   4203 O  O2    . C   B 2 30  ? 21.420 -19.512 -28.588 1.00 27.19  ? 30  C   C O2    1 
ATOM   4204 N  N3    . C   B 2 30  ? 22.229 -20.108 -30.633 1.00 27.16  ? 30  C   C N3    1 
ATOM   4205 C  C4    . C   B 2 30  ? 22.020 -20.763 -31.782 1.00 28.66  ? 30  C   C C4    1 
ATOM   4206 N  N4    . C   B 2 30  ? 22.987 -20.731 -32.708 1.00 29.13  ? 30  C   C N4    1 
ATOM   4207 C  C5    . C   B 2 30  ? 20.809 -21.480 -32.030 1.00 30.52  ? 30  C   C C5    1 
ATOM   4208 C  C6    . C   B 2 30  ? 19.883 -21.469 -31.059 1.00 31.58  ? 30  C   C C6    1 
ATOM   4209 P  P     . C   B 2 31  ? 15.787 -17.543 -30.079 1.00 26.56  ? 31  C   C P     1 
ATOM   4210 O  OP1   . C   B 2 31  ? 14.497 -17.004 -29.592 1.00 25.74  ? 31  C   C OP1   1 
ATOM   4211 O  OP2   . C   B 2 31  ? 16.034 -17.623 -31.541 1.00 25.98  ? 31  C   C OP2   1 
ATOM   4212 O  "O5'" . C   B 2 31  ? 16.991 -16.699 -29.467 1.00 23.26  ? 31  C   C "O5'" 1 
ATOM   4213 C  "C5'" . C   B 2 31  ? 16.985 -16.233 -28.120 1.00 24.10  ? 31  C   C "C5'" 1 
ATOM   4214 C  "C4'" . C   B 2 31  ? 18.205 -15.377 -27.855 1.00 21.43  ? 31  C   C "C4'" 1 
ATOM   4215 O  "O4'" . C   B 2 31  ? 19.387 -16.164 -28.148 1.00 21.79  ? 31  C   C "O4'" 1 
ATOM   4216 C  "C3'" . C   B 2 31  ? 18.364 -14.176 -28.771 1.00 20.91  ? 31  C   C "C3'" 1 
ATOM   4217 O  "O3'" . C   B 2 31  ? 17.539 -13.086 -28.322 1.00 20.36  ? 31  C   C "O3'" 1 
ATOM   4218 C  "C2'" . C   B 2 31  ? 19.876 -13.908 -28.687 1.00 19.54  ? 31  C   C "C2'" 1 
ATOM   4219 O  "O2'" . C   B 2 31  ? 20.288 -13.323 -27.465 1.00 19.48  ? 31  C   C "O2'" 1 
ATOM   4220 C  "C1'" . C   B 2 31  ? 20.411 -15.325 -28.699 1.00 20.11  ? 31  C   C "C1'" 1 
ATOM   4221 N  N1    . C   B 2 31  ? 20.878 -15.909 -30.015 1.00 19.50  ? 31  C   C N1    1 
ATOM   4222 C  C2    . C   B 2 31  ? 22.169 -15.631 -30.520 1.00 19.55  ? 31  C   C C2    1 
ATOM   4223 O  O2    . C   B 2 31  ? 22.944 -14.855 -29.941 1.00 18.20  ? 31  C   C O2    1 
ATOM   4224 N  N3    . C   B 2 31  ? 22.559 -16.229 -31.679 1.00 19.77  ? 31  C   C N3    1 
ATOM   4225 C  C4    . C   B 2 31  ? 21.736 -17.061 -32.327 1.00 21.22  ? 31  C   C C4    1 
ATOM   4226 N  N4    . C   B 2 31  ? 22.192 -17.604 -33.456 1.00 21.28  ? 31  C   C N4    1 
ATOM   4227 C  C5    . C   B 2 31  ? 20.420 -17.368 -31.835 1.00 22.40  ? 31  C   C C5    1 
ATOM   4228 C  C6    . C   B 2 31  ? 20.045 -16.779 -30.685 1.00 21.18  ? 31  C   C C6    1 
ATOM   4229 P  P     . A   B 2 32  ? 17.056 -11.958 -29.347 1.00 19.82  ? 32  A   C P     1 
ATOM   4230 O  OP1   . A   B 2 32  ? 16.122 -11.041 -28.638 1.00 20.77  ? 32  A   C OP1   1 
ATOM   4231 O  OP2   . A   B 2 32  ? 16.635 -12.633 -30.610 1.00 19.39  ? 32  A   C OP2   1 
ATOM   4232 O  "O5'" . A   B 2 32  ? 18.368 -11.113 -29.673 1.00 16.61  ? 32  A   C "O5'" 1 
ATOM   4233 C  "C5'" . A   B 2 32  ? 18.995 -10.351 -28.661 1.00 17.09  ? 32  A   C "C5'" 1 
ATOM   4234 C  "C4'" . A   B 2 32  ? 20.315 -9.813  -29.172 1.00 16.25  ? 32  A   C "C4'" 1 
ATOM   4235 O  "O4'" . A   B 2 32  ? 21.211 -10.909 -29.473 1.00 17.16  ? 32  A   C "O4'" 1 
ATOM   4236 C  "C3'" . A   B 2 32  ? 20.249 -9.079  -30.495 1.00 16.73  ? 32  A   C "C3'" 1 
ATOM   4237 O  "O3'" . A   B 2 32  ? 19.747 -7.769  -30.283 1.00 16.84  ? 32  A   C "O3'" 1 
ATOM   4238 C  "C2'" . A   B 2 32  ? 21.727 -9.087  -30.869 1.00 15.12  ? 32  A   C "C2'" 1 
ATOM   4239 O  "O2'" . A   B 2 32  ? 22.510 -8.221  -30.053 1.00 16.58  ? 32  A   C "O2'" 1 
ATOM   4240 C  "C1'" . A   B 2 32  ? 22.072 -10.528 -30.533 1.00 16.05  ? 32  A   C "C1'" 1 
ATOM   4241 N  N9    . A   B 2 32  ? 22.029 -11.520 -31.622 1.00 16.20  ? 32  A   C N9    1 
ATOM   4242 C  C8    . A   B 2 32  ? 20.983 -12.287 -32.062 1.00 16.43  ? 32  A   C C8    1 
ATOM   4243 N  N7    . A   B 2 32  ? 21.285 -13.103 -33.043 1.00 16.25  ? 32  A   C N7    1 
ATOM   4244 C  C5    . A   B 2 32  ? 22.631 -12.852 -33.270 1.00 17.60  ? 32  A   C C5    1 
ATOM   4245 C  C6    . A   B 2 32  ? 23.558 -13.370 -34.195 1.00 17.06  ? 32  A   C C6    1 
ATOM   4246 N  N6    . A   B 2 32  ? 23.258 -14.322 -35.103 1.00 18.34  ? 32  A   C N6    1 
ATOM   4247 N  N1    . A   B 2 32  ? 24.829 -12.884 -34.134 1.00 17.45  ? 32  A   C N1    1 
ATOM   4248 C  C2    . A   B 2 32  ? 25.148 -11.938 -33.238 1.00 17.59  ? 32  A   C C2    1 
ATOM   4249 N  N3    . A   B 2 32  ? 24.355 -11.366 -32.320 1.00 17.57  ? 32  A   C N3    1 
ATOM   4250 C  C4    . A   B 2 32  ? 23.106 -11.880 -32.394 1.00 17.10  ? 32  A   C C4    1 
ATOM   4251 P  P     . C   B 2 33  ? 18.840 -7.022  -31.374 1.00 17.76  ? 33  C   C P     1 
ATOM   4252 O  OP1   . C   B 2 33  ? 18.455 -5.715  -30.808 1.00 14.97  ? 33  C   C OP1   1 
ATOM   4253 O  OP2   . C   B 2 33  ? 17.792 -7.975  -31.796 1.00 17.79  ? 33  C   C OP2   1 
ATOM   4254 O  "O5'" . C   B 2 33  ? 19.831 -6.806  -32.601 1.00 17.63  ? 33  C   C "O5'" 1 
ATOM   4255 C  "C5'" . C   B 2 33  ? 20.917 -5.923  -32.497 1.00 18.78  ? 33  C   C "C5'" 1 
ATOM   4256 C  "C4'" . C   B 2 33  ? 21.696 -5.944  -33.795 1.00 19.05  ? 33  C   C "C4'" 1 
ATOM   4257 O  "O4'" . C   B 2 33  ? 22.245 -7.269  -33.946 1.00 21.04  ? 33  C   C "O4'" 1 
ATOM   4258 C  "C3'" . C   B 2 33  ? 20.874 -5.739  -35.060 1.00 18.67  ? 33  C   C "C3'" 1 
ATOM   4259 O  "O3'" . C   B 2 33  ? 20.652 -4.361  -35.324 1.00 18.36  ? 33  C   C "O3'" 1 
ATOM   4260 C  "C2'" . C   B 2 33  ? 21.723 -6.406  -36.124 1.00 19.66  ? 33  C   C "C2'" 1 
ATOM   4261 O  "O2'" . C   B 2 33  ? 22.815 -5.640  -36.567 1.00 20.47  ? 33  C   C "O2'" 1 
ATOM   4262 C  "C1'" . C   B 2 33  ? 22.300 -7.571  -35.343 1.00 21.60  ? 33  C   C "C1'" 1 
ATOM   4263 N  N1    . C   B 2 33  ? 21.640 -8.877  -35.661 1.00 20.70  ? 33  C   C N1    1 
ATOM   4264 C  C2    . C   B 2 33  ? 22.029 -9.556  -36.820 1.00 21.68  ? 33  C   C C2    1 
ATOM   4265 O  O2    . C   B 2 33  ? 22.897 -9.067  -37.554 1.00 23.09  ? 33  C   C O2    1 
ATOM   4266 N  N3    . C   B 2 33  ? 21.446 -10.750 -37.091 1.00 23.31  ? 33  C   C N3    1 
ATOM   4267 C  C4    . C   B 2 33  ? 20.520 -11.261 -36.265 1.00 22.25  ? 33  C   C C4    1 
ATOM   4268 N  N4    . C   B 2 33  ? 19.975 -12.438 -36.588 1.00 21.70  ? 33  C   C N4    1 
ATOM   4269 C  C5    . C   B 2 33  ? 20.114 -10.581 -35.075 1.00 20.45  ? 33  C   C C5    1 
ATOM   4270 C  C6    . C   B 2 33  ? 20.693 -9.405  -34.820 1.00 20.95  ? 33  C   C C6    1 
ATOM   4271 P  P     . C   B 2 34  ? 19.150 -3.795  -35.342 1.00 19.57  ? 34  C   C P     1 
ATOM   4272 O  OP1   . C   B 2 34  ? 19.245 -2.360  -35.718 1.00 19.40  ? 34  C   C OP1   1 
ATOM   4273 O  OP2   . C   B 2 34  ? 18.487 -4.211  -34.082 1.00 19.61  ? 34  C   C OP2   1 
ATOM   4274 O  "O5'" . C   B 2 34  ? 18.470 -4.665  -36.510 1.00 18.52  ? 34  C   C "O5'" 1 
ATOM   4275 C  "C5'" . C   B 2 34  ? 18.229 -4.156  -37.797 1.00 18.08  ? 34  C   C "C5'" 1 
ATOM   4276 C  "C4'" . C   B 2 34  ? 16.745 -4.183  -38.078 1.00 18.88  ? 34  C   C "C4'" 1 
ATOM   4277 O  "O4'" . C   B 2 34  ? 16.346 -5.569  -38.183 1.00 17.26  ? 34  C   C "O4'" 1 
ATOM   4278 C  "C3'" . C   B 2 34  ? 15.826 -3.589  -37.002 1.00 17.65  ? 34  C   C "C3'" 1 
ATOM   4279 O  "O3'" . C   B 2 34  ? 15.707 -2.177  -37.169 1.00 16.49  ? 34  C   C "O3'" 1 
ATOM   4280 C  "C2'" . C   B 2 34  ? 14.513 -4.331  -37.224 1.00 17.45  ? 34  C   C "C2'" 1 
ATOM   4281 O  "O2'" . C   B 2 34  ? 13.706 -3.766  -38.251 1.00 17.37  ? 34  C   C "O2'" 1 
ATOM   4282 C  "C1'" . C   B 2 34  ? 15.018 -5.704  -37.665 1.00 17.32  ? 34  C   C "C1'" 1 
ATOM   4283 N  N1    . C   B 2 34  ? 15.069 -6.821  -36.630 1.00 17.31  ? 34  C   C N1    1 
ATOM   4284 C  C2    . C   B 2 34  ? 14.001 -7.715  -36.499 1.00 18.13  ? 34  C   C C2    1 
ATOM   4285 O  O2    . C   B 2 34  ? 12.981 -7.563  -37.183 1.00 18.69  ? 34  C   C O2    1 
ATOM   4286 N  N3    . C   B 2 34  ? 14.105 -8.733  -35.594 1.00 19.40  ? 34  C   C N3    1 
ATOM   4287 C  C4    . C   B 2 34  ? 15.209 -8.894  -34.848 1.00 18.24  ? 34  C   C C4    1 
ATOM   4288 N  N4    . C   B 2 34  ? 15.227 -9.919  -33.976 1.00 17.71  ? 34  C   C N4    1 
ATOM   4289 C  C5    . C   B 2 34  ? 16.328 -8.005  -34.970 1.00 17.62  ? 34  C   C C5    1 
ATOM   4290 C  C6    . C   B 2 34  ? 16.210 -7.006  -35.864 1.00 18.21  ? 34  C   C C6    1 
HETATM 4291 P  PG    . APC C 3 .   ? 12.160 1.530   -30.928 1.00 23.17  ? 501 APC A PG    1 
HETATM 4292 O  O1G   . APC C 3 .   ? 11.213 2.461   -30.205 1.00 22.63  ? 501 APC A O1G   1 
HETATM 4293 O  O2G   . APC C 3 .   ? 13.260 0.989   -30.037 1.00 22.36  ? 501 APC A O2G   1 
HETATM 4294 O  O3G   . APC C 3 .   ? 12.653 2.098   -32.228 1.00 21.71  ? 501 APC A O3G   1 
HETATM 4295 P  PB    . APC C 3 .   ? 11.262 -0.888  -32.413 1.00 21.07  ? 501 APC A PB    1 
HETATM 4296 O  O1B   . APC C 3 .   ? 10.442 -2.004  -31.819 1.00 18.21  ? 501 APC A O1B   1 
HETATM 4297 O  O2B   . APC C 3 .   ? 10.757 -0.266  -33.703 1.00 21.08  ? 501 APC A O2B   1 
HETATM 4298 O  O3B   . APC C 3 .   ? 11.213 0.244   -31.244 1.00 20.74  ? 501 APC A O3B   1 
HETATM 4299 P  PA    . APC C 3 .   ? 13.511 -2.113  -33.951 1.00 18.48  ? 501 APC A PA    1 
HETATM 4300 O  O1A   . APC C 3 .   ? 13.339 -1.161  -35.110 1.00 18.83  ? 501 APC A O1A   1 
HETATM 4301 O  O2A   . APC C 3 .   ? 14.918 -2.609  -33.660 1.00 17.08  ? 501 APC A O2A   1 
HETATM 4302 C  C3A   . APC C 3 .   ? 12.828 -1.416  -32.599 1.00 19.66  ? 501 APC A C3A   1 
HETATM 4303 O  "O5'" . APC C 3 .   ? 12.581 -3.380  -34.263 1.00 18.71  ? 501 APC A "O5'" 1 
HETATM 4304 C  "C5'" . APC C 3 .   ? 11.499 -3.284  -35.185 1.00 17.41  ? 501 APC A "C5'" 1 
HETATM 4305 C  "C4'" . APC C 3 .   ? 10.542 -4.418  -34.917 1.00 17.04  ? 501 APC A "C4'" 1 
HETATM 4306 O  "O4'" . APC C 3 .   ? 11.221 -5.654  -35.163 1.00 17.20  ? 501 APC A "O4'" 1 
HETATM 4307 C  "C3'" . APC C 3 .   ? 10.082 -4.500  -33.466 1.00 17.22  ? 501 APC A "C3'" 1 
HETATM 4308 O  "O3'" . APC C 3 .   ? 8.927  -3.708  -33.203 1.00 17.38  ? 501 APC A "O3'" 1 
HETATM 4309 C  "C2'" . APC C 3 .   ? 9.837  -5.979  -33.283 1.00 16.26  ? 501 APC A "C2'" 1 
HETATM 4310 O  "O2'" . APC C 3 .   ? 8.605  -6.370  -33.878 1.00 17.43  ? 501 APC A "O2'" 1 
HETATM 4311 C  "C1'" . APC C 3 .   ? 10.928 -6.595  -34.134 1.00 17.53  ? 501 APC A "C1'" 1 
HETATM 4312 N  N9    . APC C 3 .   ? 12.171 -6.861  -33.363 1.00 18.04  ? 501 APC A N9    1 
HETATM 4313 C  C8    . APC C 3 .   ? 13.381 -6.318  -33.601 1.00 18.08  ? 501 APC A C8    1 
HETATM 4314 N  N7    . APC C 3 .   ? 14.305 -6.784  -32.726 1.00 19.30  ? 501 APC A N7    1 
HETATM 4315 C  C5    . APC C 3 .   ? 13.670 -7.654  -31.903 1.00 18.12  ? 501 APC A C5    1 
HETATM 4316 C  C6    . APC C 3 .   ? 14.041 -8.506  -30.752 1.00 17.08  ? 501 APC A C6    1 
HETATM 4317 N  N6    . APC C 3 .   ? 15.318 -8.533  -30.294 1.00 17.10  ? 501 APC A N6    1 
HETATM 4318 N  N1    . APC C 3 .   ? 13.062 -9.257  -30.180 1.00 17.41  ? 501 APC A N1    1 
HETATM 4319 C  C2    . APC C 3 .   ? 11.786 -9.234  -30.605 1.00 18.02  ? 501 APC A C2    1 
HETATM 4320 N  N3    . APC C 3 .   ? 11.384 -8.495  -31.650 1.00 17.43  ? 501 APC A N3    1 
HETATM 4321 C  C4    . APC C 3 .   ? 12.263 -7.699  -32.325 1.00 18.29  ? 501 APC A C4    1 
HETATM 4322 S  S     . SO4 D 4 .   ? 34.195 -21.866 -20.418 1.00 54.24  ? 503 SO4 A S     1 
HETATM 4323 O  O1    . SO4 D 4 .   ? 33.549 -23.176 -20.349 1.00 53.51  ? 503 SO4 A O1    1 
HETATM 4324 O  O2    . SO4 D 4 .   ? 35.340 -21.945 -21.324 1.00 54.07  ? 503 SO4 A O2    1 
HETATM 4325 O  O3    . SO4 D 4 .   ? 33.257 -20.862 -20.910 1.00 54.35  ? 503 SO4 A O3    1 
HETATM 4326 O  O4    . SO4 D 4 .   ? 34.644 -21.473 -19.084 1.00 54.28  ? 503 SO4 A O4    1 
HETATM 4327 MG MG    . MG  E 5 .   ? 12.644 1.735   -35.078 1.00 35.22  ? 601 MG  A MG    1 
HETATM 4328 C  C1    . EDO F 6 .   ? 10.705 -7.271  -53.828 1.00 45.52  ? 701 EDO A C1    1 
HETATM 4329 O  O1    . EDO F 6 .   ? 9.333  -7.314  -54.233 1.00 45.77  ? 701 EDO A O1    1 
HETATM 4330 C  C2    . EDO F 6 .   ? 10.773 -7.571  -52.341 1.00 45.31  ? 701 EDO A C2    1 
HETATM 4331 O  O2    . EDO F 6 .   ? 10.451 -6.375  -51.630 1.00 45.68  ? 701 EDO A O2    1 
HETATM 4332 C  C1    . EDO G 6 .   ? -6.702 -9.095  -25.855 1.00 33.41  ? 702 EDO A C1    1 
HETATM 4333 O  O1    . EDO G 6 .   ? -6.831 -10.059 -26.914 1.00 33.65  ? 702 EDO A O1    1 
HETATM 4334 C  C2    . EDO G 6 .   ? -5.600 -8.090  -26.156 1.00 33.32  ? 702 EDO A C2    1 
HETATM 4335 O  O2    . EDO G 6 .   ? -6.090 -6.747  -26.084 1.00 32.85  ? 702 EDO A O2    1 
HETATM 4336 C  C1    . EDO H 6 .   ? 16.281 -18.266 -38.700 1.00 47.67  ? 703 EDO A C1    1 
HETATM 4337 O  O1    . EDO H 6 .   ? 17.207 -17.373 -38.073 1.00 46.37  ? 703 EDO A O1    1 
HETATM 4338 C  C2    . EDO H 6 .   ? 16.643 -19.698 -38.342 1.00 48.45  ? 703 EDO A C2    1 
HETATM 4339 O  O2    . EDO H 6 .   ? 15.475 -20.324 -37.797 1.00 50.64  ? 703 EDO A O2    1 
HETATM 4340 O  O     . HOH I 7 .   ? 6.866  -5.088  -35.862 1.00 17.24  ? 1   HOH A O     1 
HETATM 4341 O  O     . HOH I 7 .   ? 8.417  -0.833  -30.143 1.00 21.98  ? 2   HOH A O     1 
HETATM 4342 O  O     . HOH I 7 .   ? 31.372 -8.070  -37.540 1.00 20.60  ? 438 HOH A O     1 
HETATM 4343 O  O     . HOH I 7 .   ? 45.788 -5.813  -29.731 1.00 16.88  ? 439 HOH A O     1 
HETATM 4344 O  O     . HOH I 7 .   ? 27.331 -13.188 -35.517 1.00 19.99  ? 440 HOH A O     1 
HETATM 4345 O  O     . HOH I 7 .   ? 39.751 -19.088 -16.464 1.00 19.28  ? 441 HOH A O     1 
HETATM 4346 O  O     . HOH I 7 .   ? 21.054 -0.360  -55.603 1.00 24.67  ? 442 HOH A O     1 
HETATM 4347 O  O     . HOH I 7 .   ? 25.376 -5.540  -35.631 1.00 19.85  ? 443 HOH A O     1 
HETATM 4348 O  O     . HOH I 7 .   ? -5.013 -7.987  -21.872 1.00 31.67  ? 444 HOH A O     1 
HETATM 4349 O  O     . HOH I 7 .   ? 14.832 -14.552 -34.323 1.00 22.97  ? 445 HOH A O     1 
HETATM 4350 O  O     . HOH I 7 .   ? 8.011  1.648   -40.073 1.00 13.32  ? 446 HOH A O     1 
HETATM 4351 O  O     . HOH I 7 .   ? 40.264 -6.264  -36.634 1.00 31.59  ? 447 HOH A O     1 
HETATM 4352 O  O     . HOH I 7 .   ? 11.981 4.974   -30.158 1.00 30.11  ? 448 HOH A O     1 
HETATM 4353 O  O     . HOH I 7 .   ? 59.810 -14.360 -3.437  1.00 35.96  ? 449 HOH A O     1 
HETATM 4354 O  O     . HOH I 7 .   ? 53.046 -6.471  -10.817 1.00 27.80  ? 450 HOH A O     1 
HETATM 4355 O  O     . HOH I 7 .   ? 18.652 -20.201 -48.324 1.00 24.23  ? 451 HOH A O     1 
HETATM 4356 O  O     . HOH I 7 .   ? 30.379 -5.449  -13.819 1.00 34.48  ? 452 HOH A O     1 
HETATM 4357 O  O     . HOH I 7 .   ? -1.704 6.004   -23.769 1.00 37.67  ? 453 HOH A O     1 
HETATM 4358 O  O     . HOH I 7 .   ? 49.642 -5.739  -7.478  1.00 19.19  ? 454 HOH A O     1 
HETATM 4359 O  O     . HOH I 7 .   ? 41.140 -9.583  -34.080 1.00 28.01  ? 455 HOH A O     1 
HETATM 4360 O  O     . HOH I 7 .   ? 11.779 -10.311 -35.194 1.00 18.57  ? 456 HOH A O     1 
HETATM 4361 O  O     . HOH I 7 .   ? 7.032  -12.721 -42.218 1.00 18.53  ? 457 HOH A O     1 
HETATM 4362 O  O     . HOH I 7 .   ? 58.743 -26.337 -1.938  1.00 29.48  ? 458 HOH A O     1 
HETATM 4363 O  O     . HOH I 7 .   ? 23.351 -6.414  -53.529 1.00 33.41  ? 459 HOH A O     1 
HETATM 4364 O  O     . HOH I 7 .   ? 40.605 -15.746 -4.974  1.00 13.00  ? 460 HOH A O     1 
HETATM 4365 O  O     . HOH I 7 .   ? 10.129 -12.042 -30.373 1.00 16.18  ? 461 HOH A O     1 
HETATM 4366 O  O     . HOH I 7 .   ? 51.483 -7.335  -32.933 1.00 28.02  ? 462 HOH A O     1 
HETATM 4367 O  O     . HOH I 7 .   ? 54.034 -12.969 -15.106 1.00 26.06  ? 463 HOH A O     1 
HETATM 4368 O  O     . HOH I 7 .   ? 33.176 -7.814  -16.822 1.00 24.09  ? 464 HOH A O     1 
HETATM 4369 O  O     . HOH I 7 .   ? 14.091 -8.014  -24.308 1.00 21.39  ? 465 HOH A O     1 
HETATM 4370 O  O     . HOH I 7 .   ? 22.999 -11.152 -15.036 1.00 18.58  ? 466 HOH A O     1 
HETATM 4371 O  O     . HOH I 7 .   ? 14.203 -3.990  -3.825  1.00 23.52  ? 467 HOH A O     1 
HETATM 4372 O  O     . HOH I 7 .   ? 1.891  -14.790 -25.395 1.00 20.98  ? 468 HOH A O     1 
HETATM 4373 O  O     . HOH I 7 .   ? 9.693  1.840   -37.031 1.00 16.74  ? 469 HOH A O     1 
HETATM 4374 O  O     . HOH I 7 .   ? 45.230 0.395   -3.666  1.00 24.18  ? 470 HOH A O     1 
HETATM 4375 O  O     . HOH I 7 .   ? 50.896 5.038   -10.804 1.00 42.06  ? 471 HOH A O     1 
HETATM 4376 O  O     . HOH I 7 .   ? -7.184 1.224   -15.877 1.00 27.93  ? 472 HOH A O     1 
HETATM 4377 O  O     . HOH I 7 .   ? 47.121 -2.426  -9.313  1.00 38.95  ? 473 HOH A O     1 
HETATM 4378 O  O     . HOH I 7 .   ? 2.751  1.399   -3.692  1.00 46.27  ? 474 HOH A O     1 
HETATM 4379 O  O     . HOH I 7 .   ? 10.646 -20.917 -35.594 1.00 37.10  ? 475 HOH A O     1 
HETATM 4380 O  O     . HOH I 7 .   ? 48.134 -17.997 -6.888  1.00 22.35  ? 476 HOH A O     1 
HETATM 4381 O  O     . HOH I 7 .   ? 29.923 -14.434 -23.687 1.00 27.81  ? 477 HOH A O     1 
HETATM 4382 O  O     . HOH I 7 .   ? 20.865 -14.959 -24.223 1.00 38.30  ? 478 HOH A O     1 
HETATM 4383 O  O     . HOH I 7 .   ? -4.353 -3.846  -22.189 1.00 24.86  ? 479 HOH A O     1 
HETATM 4384 O  O     . HOH I 7 .   ? 43.215 -5.964  -34.026 1.00 32.27  ? 480 HOH A O     1 
HETATM 4385 O  O     . HOH I 7 .   ? 24.995 -5.748  -19.895 1.00 45.73  ? 481 HOH A O     1 
HETATM 4386 O  O     . HOH I 7 .   ? 45.996 -0.541  -7.470  1.00 24.54  ? 482 HOH A O     1 
HETATM 4387 O  O     . HOH I 7 .   ? -4.970 -6.295  -18.518 1.00 35.51  ? 483 HOH A O     1 
HETATM 4388 O  O     . HOH I 7 .   ? 50.357 -28.043 10.322  1.00 20.32  ? 484 HOH A O     1 
HETATM 4389 O  O     . HOH I 7 .   ? 1.006  -4.581  -41.975 1.00 35.35  ? 485 HOH A O     1 
HETATM 4390 O  O     . HOH I 7 .   ? 11.553 -11.977 -32.639 1.00 18.03  ? 486 HOH A O     1 
HETATM 4391 O  O     . HOH I 7 .   ? -4.500 -6.668  -33.923 1.00 27.97  ? 487 HOH A O     1 
HETATM 4392 O  O     . HOH I 7 .   ? 29.117 -11.890 -38.094 1.00 23.46  ? 488 HOH A O     1 
HETATM 4393 O  O     . HOH I 7 .   ? 4.831  -12.805 -43.687 1.00 22.94  ? 489 HOH A O     1 
HETATM 4394 O  O     . HOH I 7 .   ? 5.251  -14.981 -11.035 1.00 44.36  ? 490 HOH A O     1 
HETATM 4395 O  O     . HOH I 7 .   ? -5.794 -1.285  -35.986 1.00 39.54  ? 491 HOH A O     1 
HETATM 4396 O  O     . HOH I 7 .   ? 20.775 -15.612 -36.088 1.00 20.73  ? 492 HOH A O     1 
HETATM 4397 O  O     . HOH I 7 .   ? 23.798 1.259   -25.900 1.00 30.14  ? 493 HOH A O     1 
HETATM 4398 O  O     . HOH I 7 .   ? 3.804  -3.207  -51.164 1.00 25.26  ? 494 HOH A O     1 
HETATM 4399 O  O     . HOH I 7 .   ? 5.536  -14.209 -52.018 1.00 35.01  ? 495 HOH A O     1 
HETATM 4400 O  O     . HOH I 7 .   ? -8.832 -3.320  -32.270 1.00 33.76  ? 496 HOH A O     1 
HETATM 4401 O  O     . HOH I 7 .   ? 9.663  16.389  -30.513 1.00 39.70  ? 497 HOH A O     1 
HETATM 4402 O  O     . HOH I 7 .   ? 9.617  -10.203 -5.796  1.00 29.93  ? 498 HOH A O     1 
HETATM 4403 O  O     . HOH I 7 .   ? 14.882 8.257   -21.764 1.00 32.86  ? 499 HOH A O     1 
HETATM 4404 O  O     . HOH I 7 .   ? 10.643 -22.228 -25.746 1.00 41.93  ? 500 HOH A O     1 
HETATM 4405 O  O     . HOH I 7 .   ? 18.596 17.405  -41.596 1.00 43.77  ? 502 HOH A O     1 
HETATM 4406 O  O     . HOH I 7 .   ? 18.478 -14.335 -41.084 1.00 21.11  ? 504 HOH A O     1 
HETATM 4407 O  O     . HOH I 7 .   ? 57.421 -9.950  -13.050 1.00 28.87  ? 505 HOH A O     1 
HETATM 4408 O  O     . HOH I 7 .   ? 6.514  -21.153 -20.753 1.00 35.04  ? 506 HOH A O     1 
HETATM 4409 O  O     . HOH I 7 .   ? -4.025 -0.515  -16.262 1.00 36.21  ? 507 HOH A O     1 
HETATM 4410 O  O     . HOH I 7 .   ? 2.592  -0.434  -44.987 1.00 19.09  ? 508 HOH A O     1 
HETATM 4411 O  O     . HOH I 7 .   ? 23.728 -7.545  -17.161 1.00 27.87  ? 509 HOH A O     1 
HETATM 4412 O  O     . HOH I 7 .   ? 2.631  7.830   -46.556 1.00 43.31  ? 510 HOH A O     1 
HETATM 4413 O  O     . HOH I 7 .   ? 24.194 -3.011  -9.582  1.00 32.23  ? 511 HOH A O     1 
HETATM 4414 O  O     . HOH I 7 .   ? 15.235 9.834   -37.096 1.00 19.73  ? 512 HOH A O     1 
HETATM 4415 O  O     . HOH I 7 .   ? 25.364 -4.923  -29.052 1.00 16.41  ? 513 HOH A O     1 
HETATM 4416 O  O     . HOH I 7 .   ? 25.143 -2.199  -29.812 1.00 17.24  ? 514 HOH A O     1 
HETATM 4417 O  O     . HOH I 7 .   ? 23.394 -2.780  -41.926 1.00 22.84  ? 515 HOH A O     1 
HETATM 4418 O  O     . HOH I 7 .   ? 12.454 -23.718 -40.764 1.00 55.68  ? 516 HOH A O     1 
HETATM 4419 O  O     . HOH I 7 .   ? 3.824  -12.714 -23.114 1.00 35.72  ? 517 HOH A O     1 
HETATM 4420 O  O     . HOH I 7 .   ? 55.671 -12.463 -2.276  1.00 25.82  ? 518 HOH A O     1 
HETATM 4421 O  O     . HOH I 7 .   ? 11.760 -4.100  -30.422 1.00 18.40  ? 519 HOH A O     1 
HETATM 4422 O  O     . HOH I 7 .   ? -3.357 -13.966 -29.414 1.00 27.52  ? 520 HOH A O     1 
HETATM 4423 O  O     . HOH I 7 .   ? 31.919 -8.402  -11.801 1.00 29.89  ? 521 HOH A O     1 
HETATM 4424 O  O     . HOH I 7 .   ? 19.995 -13.438 -45.759 1.00 29.17  ? 522 HOH A O     1 
HETATM 4425 O  O     . HOH I 7 .   ? 38.341 -8.741  -38.086 1.00 44.48  ? 523 HOH A O     1 
HETATM 4426 O  O     . HOH I 7 .   ? 13.114 4.796   -56.584 1.00 21.55  ? 524 HOH A O     1 
HETATM 4427 O  O     . HOH I 7 .   ? 2.730  -6.623  -41.139 1.00 19.32  ? 525 HOH A O     1 
HETATM 4428 O  O     . HOH I 7 .   ? 31.153 -3.731  -18.072 1.00 26.84  ? 526 HOH A O     1 
HETATM 4429 O  O     . HOH I 7 .   ? 5.505  -0.931  -55.038 1.00 40.73  ? 527 HOH A O     1 
HETATM 4430 O  O     . HOH I 7 .   ? 4.826  -20.278 -44.700 1.00 36.06  ? 528 HOH A O     1 
HETATM 4431 O  O     . HOH I 7 .   ? 25.391 -7.274  -51.740 1.00 35.78  ? 529 HOH A O     1 
HETATM 4432 O  O     . HOH I 7 .   ? 19.387 1.842   -22.409 1.00 28.92  ? 530 HOH A O     1 
HETATM 4433 O  O     . HOH I 7 .   ? 28.236 -2.069  -34.296 1.00 22.39  ? 531 HOH A O     1 
HETATM 4434 O  O     . HOH I 7 .   ? 8.109  -22.235 -35.110 1.00 35.03  ? 532 HOH A O     1 
HETATM 4435 O  O     . HOH I 7 .   ? -5.972 -4.625  -19.842 1.00 28.27  ? 533 HOH A O     1 
HETATM 4436 O  O     . HOH I 7 .   ? 7.171  0.310   -3.861  1.00 20.39  ? 534 HOH A O     1 
HETATM 4437 O  O     . HOH I 7 .   ? 16.617 6.465   -58.675 1.00 21.45  ? 535 HOH A O     1 
HETATM 4438 O  O     . HOH I 7 .   ? 6.130  -16.678 -49.916 1.00 23.28  ? 536 HOH A O     1 
HETATM 4439 O  O     . HOH I 7 .   ? 52.410 -20.428 -10.174 1.00 31.26  ? 537 HOH A O     1 
HETATM 4440 O  O     . HOH I 7 .   ? 28.741 -6.336  -41.831 1.00 32.07  ? 538 HOH A O     1 
HETATM 4441 O  O     . HOH I 7 .   ? -1.717 0.412   -34.172 1.00 32.63  ? 539 HOH A O     1 
HETATM 4442 O  O     . HOH I 7 .   ? 18.261 5.252   -56.725 1.00 28.18  ? 540 HOH A O     1 
HETATM 4443 O  O     . HOH I 7 .   ? 16.539 -14.099 -15.715 1.00 38.57  ? 541 HOH A O     1 
HETATM 4444 O  O     . HOH I 7 .   ? 23.834 7.052   -43.346 1.00 51.78  ? 542 HOH A O     1 
HETATM 4445 O  O     . HOH I 7 .   ? 13.021 -8.923  -27.405 1.00 17.98  ? 543 HOH A O     1 
HETATM 4446 O  O     . HOH I 7 .   ? 12.615 5.448   -3.743  1.00 35.20  ? 544 HOH A O     1 
HETATM 4447 O  O     . HOH I 7 .   ? 19.357 -17.651 -39.671 1.00 42.99  ? 545 HOH A O     1 
HETATM 4448 O  O     . HOH I 7 .   ? 13.843 -22.922 -52.083 1.00 21.66  ? 546 HOH A O     1 
HETATM 4449 O  O     . HOH I 7 .   ? 14.438 12.150  -36.701 1.00 35.53  ? 547 HOH A O     1 
HETATM 4450 O  O     . HOH I 7 .   ? 44.673 -21.363 -15.900 1.00 35.01  ? 548 HOH A O     1 
HETATM 4451 O  O     . HOH I 7 .   ? 36.584 8.204   -19.023 1.00 39.91  ? 549 HOH A O     1 
HETATM 4452 O  O     . HOH I 7 .   ? -5.095 -11.881 -33.509 1.00 48.15  ? 550 HOH A O     1 
HETATM 4453 O  O     . HOH I 7 .   ? 21.550 -13.717 -17.105 1.00 27.31  ? 551 HOH A O     1 
HETATM 4454 O  O     . HOH I 7 .   ? 0.680  5.000   -16.533 1.00 21.22  ? 552 HOH A O     1 
HETATM 4455 O  O     . HOH I 7 .   ? 0.385  -3.916  -7.455  1.00 36.51  ? 553 HOH A O     1 
HETATM 4456 O  O     . HOH I 7 .   ? 20.404 -8.517  -57.065 1.00 38.48  ? 554 HOH A O     1 
HETATM 4457 O  O     . HOH I 7 .   ? 24.262 -0.307  -39.257 1.00 45.31  ? 555 HOH A O     1 
HETATM 4458 O  O     . HOH I 7 .   ? -2.663 -15.595 -14.174 1.00 32.14  ? 556 HOH A O     1 
HETATM 4459 O  O     . HOH I 7 .   ? 19.266 0.041   -36.799 1.00 29.97  ? 557 HOH A O     1 
HETATM 4460 O  O     . HOH I 7 .   ? 11.726 -12.806 -36.020 1.00 12.58  ? 558 HOH A O     1 
HETATM 4461 O  O     . HOH I 7 .   ? 63.870 -26.893 -5.303  1.00 40.62  ? 559 HOH A O     1 
HETATM 4462 O  O     . HOH I 7 .   ? 32.946 -15.374 -12.811 1.00 39.34  ? 560 HOH A O     1 
HETATM 4463 O  O     . HOH I 7 .   ? 16.946 -0.920  -34.436 1.00 22.34  ? 561 HOH A O     1 
HETATM 4464 O  O     . HOH I 7 .   ? 2.051  -17.668 -28.069 1.00 21.17  ? 562 HOH A O     1 
HETATM 4465 O  O     . HOH I 7 .   ? 28.439 -12.403 -30.447 1.00 19.14  ? 563 HOH A O     1 
HETATM 4466 O  O     . HOH I 7 .   ? 1.703  -11.051 -41.852 1.00 49.83  ? 564 HOH A O     1 
HETATM 4467 O  O     . HOH I 7 .   ? 1.980  -9.766  -12.922 1.00 19.49  ? 565 HOH A O     1 
HETATM 4468 O  O     . HOH I 7 .   ? 1.803  4.003   -51.993 1.00 43.08  ? 566 HOH A O     1 
HETATM 4469 O  O     . HOH I 7 .   ? 15.598 0.140   -30.122 1.00 32.47  ? 567 HOH A O     1 
HETATM 4470 O  O     . HOH I 7 .   ? 1.848  2.552   -49.932 1.00 49.86  ? 568 HOH A O     1 
HETATM 4471 O  O     . HOH I 7 .   ? 14.569 4.237   -58.816 1.00 29.49  ? 569 HOH A O     1 
HETATM 4472 O  O     . HOH I 7 .   ? 23.852 -3.330  -32.113 1.00 24.26  ? 570 HOH A O     1 
HETATM 4473 O  O     . HOH I 7 .   ? 21.867 -1.254  -36.714 1.00 23.33  ? 571 HOH A O     1 
HETATM 4474 O  O     . HOH I 7 .   ? 16.205 -4.701  -32.468 1.00 24.82  ? 572 HOH A O     1 
HETATM 4475 O  O     . HOH I 7 .   ? 18.033 -20.241 -45.695 1.00 31.36  ? 573 HOH A O     1 
HETATM 4476 O  O     . HOH I 7 .   ? 25.961 -3.103  -36.266 1.00 27.84  ? 574 HOH A O     1 
HETATM 4477 O  O     . HOH I 7 .   ? 35.030 -3.723  -7.992  1.00 26.03  ? 575 HOH A O     1 
HETATM 4478 O  O     . HOH I 7 .   ? 14.143 13.203  -50.337 1.00 28.47  ? 576 HOH A O     1 
HETATM 4479 O  O     . HOH I 7 .   ? 47.760 -22.993 -0.512  1.00 33.28  ? 577 HOH A O     1 
HETATM 4480 O  O     . HOH I 7 .   ? 24.450 7.211   -51.041 1.00 47.05  ? 578 HOH A O     1 
HETATM 4481 O  O     . HOH I 7 .   ? 18.005 -12.092 -63.457 1.00 41.78  ? 579 HOH A O     1 
HETATM 4482 O  O     . HOH I 7 .   ? 0.933  -16.858 -10.844 1.00 31.09  ? 580 HOH A O     1 
HETATM 4483 O  O     . HOH I 7 .   ? 25.421 -13.993 -49.893 1.00 39.80  ? 581 HOH A O     1 
HETATM 4484 O  O     . HOH I 7 .   ? 2.445  5.882   -39.478 1.00 41.85  ? 582 HOH A O     1 
HETATM 4485 O  O     . HOH I 7 .   ? 11.249 14.350  -43.207 1.00 26.63  ? 583 HOH A O     1 
HETATM 4486 O  O     . HOH I 7 .   ? 16.241 4.220   -32.393 1.00 39.21  ? 584 HOH A O     1 
HETATM 4487 O  O     . HOH I 7 .   ? 32.082 6.640   -2.679  1.00 26.28  ? 585 HOH A O     1 
HETATM 4488 O  O     . HOH I 7 .   ? 6.565  -11.319 -52.069 1.00 38.69  ? 586 HOH A O     1 
HETATM 4489 O  O     . HOH I 7 .   ? 27.033 6.774   -44.297 1.00 35.61  ? 587 HOH A O     1 
HETATM 4490 O  O     . HOH I 7 .   ? 46.769 -5.663  -32.179 1.00 27.58  ? 588 HOH A O     1 
HETATM 4491 O  O     . HOH I 7 .   ? 22.776 -2.633  -19.648 1.00 23.00  ? 589 HOH A O     1 
HETATM 4492 O  O     . HOH I 7 .   ? 17.926 -2.038  -57.790 1.00 49.92  ? 590 HOH A O     1 
HETATM 4493 O  O     . HOH I 7 .   ? 26.158 6.318   -48.169 1.00 31.46  ? 591 HOH A O     1 
HETATM 4494 O  O     . HOH I 7 .   ? 28.240 -10.850 -42.123 1.00 46.00  ? 592 HOH A O     1 
HETATM 4495 O  O     . HOH I 7 .   ? 31.342 0.199   -28.851 1.00 37.35  ? 593 HOH A O     1 
HETATM 4496 O  O     . HOH I 7 .   ? 37.117 -19.654 -10.514 1.00 32.11  ? 594 HOH A O     1 
HETATM 4497 O  O     . HOH I 7 .   ? 37.580 6.990   -28.381 1.00 34.61  ? 595 HOH A O     1 
HETATM 4498 O  O     . HOH I 7 .   ? 31.974 -0.028  -23.984 1.00 25.35  ? 596 HOH A O     1 
HETATM 4499 O  O     . HOH I 7 .   ? 31.098 2.482   -24.355 1.00 34.45  ? 597 HOH A O     1 
HETATM 4500 O  O     . HOH I 7 .   ? 28.101 4.629   -25.809 1.00 52.10  ? 598 HOH A O     1 
HETATM 4501 O  O     . HOH I 7 .   ? 44.261 6.057   -25.148 1.00 53.22  ? 599 HOH A O     1 
HETATM 4502 O  O     . HOH I 7 .   ? 46.615 -21.416 -1.980  1.00 37.51  ? 600 HOH A O     1 
HETATM 4503 O  O     . HOH I 7 .   ? 45.336 -26.401 -0.374  1.00 37.99  ? 602 HOH A O     1 
HETATM 4504 O  O     . HOH I 7 .   ? 44.993 -28.138 -2.358  1.00 38.52  ? 603 HOH A O     1 
HETATM 4505 O  O     . HOH I 7 .   ? 44.330 -32.500 6.455   1.00 40.51  ? 604 HOH A O     1 
HETATM 4506 O  O     . HOH I 7 .   ? 42.109 -33.849 5.883   1.00 47.00  ? 605 HOH A O     1 
HETATM 4507 O  O     . HOH I 7 .   ? 60.287 -33.678 -10.600 1.00 41.88  ? 606 HOH A O     1 
HETATM 4508 O  O     . HOH I 7 .   ? 63.053 -36.302 -2.542  1.00 36.04  ? 607 HOH A O     1 
HETATM 4509 O  O     . HOH I 7 .   ? 49.460 -19.829 -17.719 1.00 42.90  ? 608 HOH A O     1 
HETATM 4510 O  O     . HOH I 7 .   ? 40.819 -16.795 -30.268 1.00 36.62  ? 609 HOH A O     1 
HETATM 4511 O  O     . HOH I 7 .   ? 26.864 -7.721  -47.119 1.00 34.25  ? 610 HOH A O     1 
HETATM 4512 O  O     . HOH I 7 .   ? 51.795 -1.049  -19.607 1.00 35.81  ? 611 HOH A O     1 
HETATM 4513 O  O     . HOH I 7 .   ? 4.667  2.253   -1.980  1.00 43.98  ? 612 HOH A O     1 
HETATM 4514 O  O     . HOH I 7 .   ? 50.214 -21.017 -8.772  1.00 47.21  ? 613 HOH A O     1 
HETATM 4515 O  O     . HOH I 7 .   ? 46.786 -20.310 -5.251  1.00 37.19  ? 614 HOH A O     1 
HETATM 4516 O  O     . HOH I 7 .   ? 0.620  0.339   -4.344  1.00 40.54  ? 615 HOH A O     1 
HETATM 4517 O  O     . HOH I 7 .   ? 49.005 -12.406 -34.072 1.00 34.30  ? 616 HOH A O     1 
HETATM 4518 O  O     . HOH I 7 .   ? 52.761 -18.138 -19.052 1.00 32.38  ? 617 HOH A O     1 
HETATM 4519 O  O     . HOH I 7 .   ? -3.522 3.147   -15.333 1.00 35.57  ? 618 HOH A O     1 
HETATM 4520 O  O     . HOH I 7 .   ? 27.010 0.168   -7.810  1.00 39.91  ? 619 HOH A O     1 
HETATM 4521 O  O     . HOH I 7 .   ? 38.577 -0.920  -34.679 1.00 32.96  ? 620 HOH A O     1 
HETATM 4522 O  O     . HOH I 7 .   ? 7.735  13.817  -48.294 1.00 23.16  ? 621 HOH A O     1 
HETATM 4523 O  O     . HOH I 7 .   ? 29.694 -9.024  -39.309 1.00 39.23  ? 622 HOH A O     1 
HETATM 4524 O  O     . HOH I 7 .   ? 15.331 -13.474 -19.383 1.00 25.00  ? 623 HOH A O     1 
HETATM 4525 O  O     . HOH I 7 .   ? 33.722 -10.313 -38.011 1.00 37.42  ? 624 HOH A O     1 
HETATM 4526 O  O     . HOH I 7 .   ? 23.441 11.035  -16.498 1.00 44.58  ? 625 HOH A O     1 
HETATM 4527 O  O     . HOH I 7 .   ? 26.680 11.748  -16.093 1.00 46.87  ? 626 HOH A O     1 
HETATM 4528 O  O     . HOH I 7 .   ? 22.328 -1.905  -16.221 1.00 36.59  ? 627 HOH A O     1 
HETATM 4529 O  O     . HOH I 7 .   ? 6.300  6.274   0.003   0.50 28.03  ? 628 HOH A O     1 
HETATM 4530 O  O     . HOH I 7 .   ? 21.835 2.554   -22.237 1.00 44.96  ? 629 HOH A O     1 
HETATM 4531 O  O     . HOH I 7 .   ? 4.791  0.112   -57.553 1.00 35.79  ? 630 HOH A O     1 
HETATM 4532 O  O     . HOH I 7 .   ? 59.291 -26.129 -4.359  1.00 36.27  ? 631 HOH A O     1 
HETATM 4533 O  O     . HOH I 7 .   ? 4.468  20.776  -38.066 1.00 38.05  ? 632 HOH A O     1 
HETATM 4534 O  O     . HOH I 7 .   ? 16.235 -21.171 -41.953 1.00 31.66  ? 633 HOH A O     1 
HETATM 4535 O  O     . HOH I 7 .   ? 40.176 -36.142 5.317   1.00 47.36  ? 634 HOH A O     1 
HETATM 4536 O  O     . HOH I 7 .   ? -1.537 5.945   -15.482 1.00 31.68  ? 635 HOH A O     1 
HETATM 4537 O  O     . HOH I 7 .   ? 43.855 -30.102 7.603   1.00 35.95  ? 636 HOH A O     1 
HETATM 4538 O  O     . HOH J 7 .   ? 13.415 -17.739 -27.113 1.00 17.45  ? 35  HOH C O     1 
HETATM 4539 O  O     . HOH J 7 .   ? 15.444 -10.849 -25.979 1.00 16.96  ? 36  HOH C O     1 
HETATM 4540 O  O     . HOH J 7 .   ? 27.496 -15.113 -37.777 1.00 48.97  ? 37  HOH C O     1 
HETATM 4541 O  O     . HOH J 7 .   ? 14.344 -12.350 -32.552 1.00 18.27  ? 38  HOH C O     1 
HETATM 4542 O  O     . HOH J 7 .   ? 31.150 -16.496 -22.095 1.00 31.93  ? 39  HOH C O     1 
HETATM 4543 O  O     . HOH J 7 .   ? 14.397 -17.999 -33.773 1.00 24.83  ? 40  HOH C O     1 
HETATM 4544 O  O     . HOH J 7 .   ? 44.223 -21.071 -25.621 1.00 40.00  ? 58  HOH C O     1 
HETATM 4545 O  O     . HOH J 7 .   ? 12.379 -19.316 -30.200 1.00 27.39  ? 69  HOH C O     1 
HETATM 4546 O  O     . HOH J 7 .   ? 19.103 -14.204 -34.285 1.00 15.14  ? 73  HOH C O     1 
HETATM 4547 O  O     . HOH J 7 .   ? 17.257 -14.926 -32.655 1.00 27.14  ? 119 HOH C O     1 
HETATM 4548 O  O     . HOH J 7 .   ? 44.221 -38.324 -2.468  1.00 39.64  ? 123 HOH C O     1 
HETATM 4549 O  O     . HOH J 7 .   ? 14.398 -3.653  -30.026 1.00 22.52  ? 131 HOH C O     1 
HETATM 4550 O  O     . HOH J 7 .   ? 16.707 -4.479  -29.129 1.00 20.01  ? 138 HOH C O     1 
HETATM 4551 O  O     . HOH J 7 .   ? 17.688 -10.443 -32.771 1.00 16.55  ? 146 HOH C O     1 
HETATM 4552 O  O     . HOH J 7 .   ? 18.596 -2.980  -31.531 1.00 23.18  ? 149 HOH C O     1 
HETATM 4553 O  O     . HOH J 7 .   ? 25.170 -15.999 -36.788 1.00 27.62  ? 164 HOH C O     1 
HETATM 4554 O  O     . HOH J 7 .   ? 25.432 -15.345 -26.422 1.00 33.12  ? 171 HOH C O     1 
HETATM 4555 O  O     . HOH J 7 .   ? 23.070 -16.236 -25.748 1.00 40.21  ? 172 HOH C O     1 
HETATM 4556 O  O     . HOH J 7 .   ? 29.065 -19.563 -32.671 1.00 32.05  ? 176 HOH C O     1 
HETATM 4557 O  O     . HOH J 7 .   ? 19.972 -19.133 -34.964 1.00 31.52  ? 178 HOH C O     1 
HETATM 4558 O  O     . HOH J 7 .   ? 43.346 -35.336 -10.132 1.00 44.68  ? 227 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . VAL A 1   ? 0.7353 0.6788 0.6418 0.0761  0.0810  -0.0976 3   VAL A N     
2    C CA    . VAL A 1   ? 0.7118 0.6599 0.6311 0.0689  0.0733  -0.0857 3   VAL A CA    
3    C C     . VAL A 1   ? 0.7143 0.6497 0.6414 0.0807  0.0722  -0.0806 3   VAL A C     
4    O O     . VAL A 1   ? 0.7127 0.6314 0.6393 0.0755  0.0672  -0.0760 3   VAL A O     
5    C CB    . VAL A 1   ? 0.6805 0.6638 0.6157 0.0639  0.0707  -0.0760 3   VAL A CB    
6    C CG1   . VAL A 1   ? 0.6602 0.6438 0.6034 0.0539  0.0630  -0.0666 3   VAL A CG1   
7    C CG2   . VAL A 1   ? 0.6861 0.6859 0.6139 0.0560  0.0729  -0.0800 3   VAL A CG2   
8    N N     . GLU A 2   ? 0.7201 0.6652 0.6546 0.0966  0.0769  -0.0811 4   GLU A N     
9    C CA    . GLU A 2   ? 0.7229 0.6595 0.6656 0.1100  0.0757  -0.0758 4   GLU A CA    
10   C C     . GLU A 2   ? 0.7438 0.6392 0.6714 0.1128  0.0751  -0.0800 4   GLU A C     
11   O O     . GLU A 2   ? 0.7427 0.6265 0.6743 0.1161  0.0708  -0.0726 4   GLU A O     
12   C CB    . GLU A 2   ? 0.7308 0.6874 0.6836 0.1274  0.0815  -0.0770 4   GLU A CB    
13   C CG    . GLU A 2   ? 0.7181 0.7131 0.6924 0.1269  0.0791  -0.0668 4   GLU A CG    
14   C CD    . GLU A 2   ? 0.7499 0.7750 0.7316 0.1347  0.0864  -0.0699 4   GLU A CD    
15   O OE1   . GLU A 2   ? 0.7761 0.8014 0.7595 0.1519  0.0920  -0.0744 4   GLU A OE1   
16   O OE2   . GLU A 2   ? 0.7413 0.7905 0.7271 0.1238  0.0866  -0.0675 4   GLU A OE2   
17   N N     . GLU A 3   ? 0.7607 0.6335 0.6697 0.1103  0.0793  -0.0916 5   GLU A N     
18   C CA    . GLU A 3   ? 0.7839 0.6137 0.6755 0.1105  0.0792  -0.0966 5   GLU A CA    
19   C C     . GLU A 3   ? 0.7629 0.5802 0.6506 0.0923  0.0725  -0.0915 5   GLU A C     
20   O O     . GLU A 3   ? 0.7767 0.5662 0.6583 0.0926  0.0701  -0.0882 5   GLU A O     
21   C CB    . GLU A 3   ? 0.8199 0.6291 0.6915 0.1111  0.0856  -0.1118 5   GLU A CB    
22   C CG    . GLU A 3   ? 0.8352 0.6662 0.7094 0.1240  0.0933  -0.1189 5   GLU A CG    
23   C CD    . GLU A 3   ? 0.8635 0.6902 0.7439 0.1478  0.0979  -0.1189 5   GLU A CD    
24   O OE1   . GLU A 3   ? 0.8412 0.6886 0.7409 0.1557  0.0949  -0.1076 5   GLU A OE1   
25   O OE2   . GLU A 3   ? 0.8979 0.7010 0.7636 0.1589  0.1044  -0.1306 5   GLU A OE2   
26   N N     . ILE A 4   ? 0.7264 0.5649 0.6173 0.0769  0.0698  -0.0905 6   ILE A N     
27   C CA    . ILE A 4   ? 0.7034 0.5371 0.5928 0.0595  0.0639  -0.0858 6   ILE A CA    
28   C C     . ILE A 4   ? 0.6728 0.5138 0.5762 0.0610  0.0589  -0.0731 6   ILE A C     
29   O O     . ILE A 4   ? 0.6759 0.4978 0.5744 0.0539  0.0557  -0.0694 6   ILE A O     
30   C CB    . ILE A 4   ? 0.6836 0.5425 0.5750 0.0452  0.0621  -0.0871 6   ILE A CB    
31   C CG1   . ILE A 4   ? 0.7102 0.5624 0.5854 0.0423  0.0665  -0.1001 6   ILE A CG1   
32   C CG2   . ILE A 4   ? 0.6626 0.5214 0.5555 0.0288  0.0560  -0.0816 6   ILE A CG2   
33   C CD1   . ILE A 4   ? 0.7408 0.5565 0.5960 0.0341  0.0668  -0.1091 6   ILE A CD1   
34   N N     . LEU A 5   ? 0.6389 0.5081 0.5589 0.0695  0.0584  -0.0666 7   LEU A N     
35   C CA    . LEU A 5   ? 0.6081 0.4871 0.5413 0.0713  0.0536  -0.0553 7   LEU A CA    
36   C C     . LEU A 5   ? 0.6231 0.4774 0.5522 0.0824  0.0532  -0.0522 7   LEU A C     
37   O O     . LEU A 5   ? 0.6100 0.4597 0.5419 0.0795  0.0487  -0.0442 7   LEU A O     
38   C CB    . LEU A 5   ? 0.5816 0.4956 0.5324 0.0768  0.0532  -0.0501 7   LEU A CB    
39   C CG    . LEU A 5   ? 0.5610 0.4996 0.5161 0.0661  0.0530  -0.0508 7   LEU A CG    
40   C CD1   . LEU A 5   ? 0.5435 0.5137 0.5149 0.0712  0.0531  -0.0453 7   LEU A CD1   
41   C CD2   . LEU A 5   ? 0.5488 0.4864 0.5032 0.0511  0.0480  -0.0470 7   LEU A CD2   
42   N N     . GLU A 6   ? 0.6444 0.4824 0.5659 0.0955  0.0580  -0.0587 8   GLU A N     
43   C CA    . GLU A 6   ? 0.6678 0.4763 0.5820 0.1069  0.0578  -0.0565 8   GLU A CA    
44   C C     . GLU A 6   ? 0.6787 0.4532 0.5767 0.0943  0.0559  -0.0568 8   GLU A C     
45   O O     . GLU A 6   ? 0.6838 0.4451 0.5807 0.0947  0.0523  -0.0485 8   GLU A O     
46   C CB    . GLU A 6   ? 0.6978 0.4937 0.6060 0.1243  0.0641  -0.0647 8   GLU A CB    
47   C CG    . GLU A 6   ? 0.7042 0.5351 0.6288 0.1380  0.0671  -0.0645 8   GLU A CG    
48   C CD    . GLU A 6   ? 0.7143 0.5648 0.6563 0.1484  0.0626  -0.0529 8   GLU A CD    
49   O OE1   . GLU A 6   ? 0.6947 0.5633 0.6465 0.1379  0.0569  -0.0446 8   GLU A OE1   
50   O OE2   . GLU A 6   ? 0.7377 0.5866 0.6835 0.1674  0.0647  -0.0524 8   GLU A OE2   
51   N N     . LYS A 7   ? 0.6836 0.4455 0.5687 0.0823  0.0583  -0.0661 9   LYS A N     
52   C CA    . LYS A 7   ? 0.6960 0.4290 0.5664 0.0671  0.0566  -0.0670 9   LYS A CA    
53   C C     . LYS A 7   ? 0.6608 0.4098 0.5398 0.0534  0.0513  -0.0576 9   LYS A C     
54   O O     . LYS A 7   ? 0.6670 0.3956 0.5390 0.0468  0.0492  -0.0524 9   LYS A O     
55   C CB    . LYS A 7   ? 0.7115 0.4343 0.5680 0.0552  0.0594  -0.0793 9   LYS A CB    
56   C CG    . LYS A 7   ? 0.7552 0.4550 0.5982 0.0668  0.0653  -0.0908 9   LYS A CG    
57   C CD    . LYS A 7   ? 0.7932 0.4776 0.6189 0.0515  0.0669  -0.1029 9   LYS A CD    
58   C CE    . LYS A 7   ? 0.8190 0.5025 0.6366 0.0612  0.0731  -0.1159 9   LYS A CE    
59   N NZ    . LYS A 7   ? 0.8632 0.5105 0.6683 0.0781  0.0778  -0.1215 9   LYS A NZ    
60   N N     . ALA A 8   ? 0.6210 0.4061 0.5146 0.0494  0.0496  -0.0554 10  ALA A N     
61   C CA    . ALA A 8   ? 0.5902 0.3935 0.4931 0.0377  0.0452  -0.0476 10  ALA A CA    
62   C C     . ALA A 8   ? 0.5796 0.3826 0.4890 0.0442  0.0419  -0.0369 10  ALA A C     
63   O O     . ALA A 8   ? 0.5716 0.3734 0.4807 0.0342  0.0392  -0.0313 10  ALA A O     
64   C CB    . ALA A 8   ? 0.5561 0.3951 0.4722 0.0342  0.0442  -0.0478 10  ALA A CB    
65   N N     . LEU A 9   ? 0.5774 0.3830 0.4923 0.0608  0.0423  -0.0343 11  LEU A N     
66   C CA    . LEU A 9   ? 0.5745 0.3782 0.4936 0.0684  0.0388  -0.0244 11  LEU A CA    
67   C C     . LEU A 9   ? 0.5967 0.3678 0.5011 0.0634  0.0379  -0.0206 11  LEU A C     
68   O O     . LEU A 9   ? 0.5917 0.3645 0.4978 0.0614  0.0344  -0.0119 11  LEU A O     
69   C CB    . LEU A 9   ? 0.5811 0.3890 0.5063 0.0880  0.0396  -0.0233 11  LEU A CB    
70   C CG    . LEU A 9   ? 0.5609 0.4053 0.5036 0.0944  0.0397  -0.0234 11  LEU A CG    
71   C CD1   . LEU A 9   ? 0.5807 0.4265 0.5279 0.1140  0.0414  -0.0233 11  LEU A CD1   
72   C CD2   . LEU A 9   ? 0.5351 0.4050 0.4906 0.0883  0.0344  -0.0154 11  LEU A CD2   
73   N N     . GLU A 10  ? 0.6198 0.3608 0.5087 0.0606  0.0412  -0.0273 12  GLU A N     
74   C CA    . GLU A 10  ? 0.6463 0.3527 0.5193 0.0541  0.0409  -0.0238 12  GLU A CA    
75   C C     . GLU A 10  ? 0.6264 0.3386 0.4983 0.0340  0.0394  -0.0211 12  GLU A C     
76   O O     . GLU A 10  ? 0.6405 0.3325 0.5025 0.0270  0.0385  -0.0152 12  GLU A O     
77   C CB    . GLU A 10  ? 0.6882 0.3590 0.5441 0.0556  0.0450  -0.0328 12  GLU A CB    
78   C CG    . GLU A 10  ? 0.7143 0.3832 0.5721 0.0760  0.0480  -0.0381 12  GLU A CG    
79   C CD    . GLU A 10  ? 0.7777 0.4025 0.6159 0.0816  0.0517  -0.0448 12  GLU A CD    
80   O OE1   . GLU A 10  ? 0.8240 0.4166 0.6465 0.0702  0.0513  -0.0432 12  GLU A OE1   
81   O OE2   . GLU A 10  ? 0.7935 0.4153 0.6314 0.0974  0.0554  -0.0517 12  GLU A OE2   
82   N N     . LEU A 11  ? 0.5896 0.3308 0.4720 0.0252  0.0391  -0.0248 13  LEU A N     
83   C CA    . LEU A 11  ? 0.5683 0.3202 0.4523 0.0078  0.0378  -0.0227 13  LEU A CA    
84   C C     . LEU A 11  ? 0.5364 0.3142 0.4335 0.0090  0.0346  -0.0141 13  LEU A C     
85   O O     . LEU A 11  ? 0.5295 0.3113 0.4261 -0.0024 0.0338  -0.0100 13  LEU A O     
86   C CB    . LEU A 11  ? 0.5547 0.3224 0.4415 -0.0028 0.0388  -0.0312 13  LEU A CB    
87   C CG    . LEU A 11  ? 0.5767 0.3250 0.4511 -0.0051 0.0417  -0.0419 13  LEU A CG    
88   C CD1   . LEU A 11  ? 0.5537 0.3251 0.4329 -0.0164 0.0413  -0.0482 13  LEU A CD1   
89   C CD2   . LEU A 11  ? 0.6127 0.3227 0.4688 -0.0136 0.0432  -0.0433 13  LEU A CD2   
90   N N     . VAL A 12  ? 0.5163 0.3118 0.4245 0.0223  0.0330  -0.0120 14  VAL A N     
91   C CA    . VAL A 12  ? 0.4859 0.3071 0.4066 0.0230  0.0298  -0.0056 14  VAL A CA    
92   C C     . VAL A 12  ? 0.4954 0.3114 0.4154 0.0329  0.0269  0.0028  14  VAL A C     
93   O O     . VAL A 12  ? 0.4775 0.3079 0.4028 0.0306  0.0242  0.0083  14  VAL A O     
94   C CB    . VAL A 12  ? 0.4600 0.3112 0.3956 0.0266  0.0291  -0.0086 14  VAL A CB    
95   C CG1   . VAL A 12  ? 0.4426 0.3034 0.3793 0.0153  0.0307  -0.0150 14  VAL A CG1   
96   C CG2   . VAL A 12  ? 0.4525 0.3054 0.3917 0.0412  0.0299  -0.0107 14  VAL A CG2   
97   N N     . ILE A 13  ? 0.5187 0.3142 0.4316 0.0444  0.0274  0.0037  15  ILE A N     
98   C CA    . ILE A 13  ? 0.5328 0.3240 0.4448 0.0552  0.0239  0.0122  15  ILE A CA    
99   C C     . ILE A 13  ? 0.5621 0.3245 0.4579 0.0497  0.0239  0.0182  15  ILE A C     
100  O O     . ILE A 13  ? 0.5893 0.3233 0.4722 0.0469  0.0269  0.0153  15  ILE A O     
101  C CB    . ILE A 13  ? 0.5441 0.3331 0.4597 0.0735  0.0238  0.0114  15  ILE A CB    
102  C CG1   . ILE A 13  ? 0.5181 0.3385 0.4501 0.0777  0.0242  0.0065  15  ILE A CG1   
103  C CG2   . ILE A 13  ? 0.5481 0.3335 0.4626 0.0851  0.0193  0.0212  15  ILE A CG2   
104  C CD1   . ILE A 13  ? 0.5513 0.3716 0.4871 0.0940  0.0261  0.0034  15  ILE A CD1   
105  N N     . PRO A 14  ? 0.5516 0.3555 0.4142 0.0858  0.0292  0.0064  16  PRO A N     
106  C CA    . PRO A 14  ? 0.5715 0.3570 0.4274 0.0805  0.0288  0.0075  16  PRO A CA    
107  C C     . PRO A 14  ? 0.6070 0.3715 0.4516 0.0952  0.0359  0.0128  16  PRO A C     
108  O O     . PRO A 14  ? 0.6029 0.3817 0.4559 0.1093  0.0390  0.0196  16  PRO A O     
109  C CB    . PRO A 14  ? 0.5379 0.3495 0.4140 0.0751  0.0234  0.0135  16  PRO A CB    
110  C CG    . PRO A 14  ? 0.5145 0.3541 0.4057 0.0733  0.0199  0.0128  16  PRO A CG    
111  C CD    . PRO A 14  ? 0.5165 0.3536 0.4015 0.0843  0.0249  0.0117  16  PRO A CD    
112  N N     . ASP A 15  ? 0.6464 0.3773 0.4718 0.0919  0.0387  0.0097  17  ASP A N     
113  C CA    . ASP A 15  ? 0.6893 0.3959 0.5015 0.1066  0.0458  0.0151  17  ASP A CA    
114  C C     . ASP A 15  ? 0.6815 0.4000 0.5053 0.1107  0.0443  0.0260  17  ASP A C     
115  O O     . ASP A 15  ? 0.6532 0.3958 0.4933 0.1004  0.0379  0.0280  17  ASP A O     
116  C CB    . ASP A 15  ? 0.7342 0.3965 0.5194 0.1014  0.0499  0.0081  17  ASP A CB    
117  C CG    . ASP A 15  ? 0.7569 0.4095 0.5395 0.0818  0.0455  0.0053  17  ASP A CG    
118  O OD1   . ASP A 15  ? 0.8005 0.4256 0.5649 0.0706  0.0465  -0.0037 17  ASP A OD1   
119  O OD2   . ASP A 15  ? 0.7533 0.4261 0.5514 0.0769  0.0412  0.0117  17  ASP A OD2   
120  N N     . GLU A 16  ? 0.7089 0.4102 0.5231 0.1262  0.0502  0.0329  18  GLU A N     
121  C CA    . GLU A 16  ? 0.7018 0.4172 0.5265 0.1339  0.0491  0.0444  18  GLU A CA    
122  C C     . GLU A 16  ? 0.6925 0.4025 0.5168 0.1192  0.0447  0.0459  18  GLU A C     
123  O O     . GLU A 16  ? 0.6698 0.4031 0.5084 0.1198  0.0408  0.0535  18  GLU A O     
124  C CB    . GLU A 16  ? 0.7396 0.4350 0.5515 0.1550  0.0566  0.0516  18  GLU A CB    
125  C CG    . GLU A 16  ? 0.7582 0.4717 0.5773 0.1728  0.0607  0.0535  18  GLU A CG    
126  C CD    . GLU A 16  ? 0.8247 0.5091 0.6248 0.1937  0.0700  0.0572  18  GLU A CD    
127  O OE1   . GLU A 16  ? 0.8624 0.5189 0.6479 0.1976  0.0724  0.0620  18  GLU A OE1   
128  O OE2   . GLU A 16  ? 0.8339 0.5226 0.6329 0.2067  0.0752  0.0554  18  GLU A OE2   
129  N N     . GLU A 17  ? 0.7099 0.3903 0.5176 0.1056  0.0456  0.0385  19  GLU A N     
130  C CA    . GLU A 17  ? 0.7088 0.3822 0.5145 0.0902  0.0426  0.0394  19  GLU A CA    
131  C C     . GLU A 17  ? 0.6641 0.3718 0.4903 0.0751  0.0347  0.0361  19  GLU A C     
132  O O     . GLU A 17  ? 0.6453 0.3656 0.4797 0.0688  0.0313  0.0409  19  GLU A O     
133  C CB    . GLU A 17  ? 0.7472 0.3791 0.5292 0.0790  0.0463  0.0320  19  GLU A CB    
134  C CG    . GLU A 17  ? 0.7855 0.3993 0.5589 0.0691  0.0469  0.0366  19  GLU A CG    
135  C CD    . GLU A 17  ? 0.8437 0.4361 0.6050 0.0861  0.0527  0.0480  19  GLU A CD    
136  O OE1   . GLU A 17  ? 0.8336 0.4424 0.6042 0.0888  0.0503  0.0577  19  GLU A OE1   
137  O OE2   . GLU A 17  ? 0.8905 0.4494 0.6322 0.0975  0.0596  0.0473  19  GLU A OE2   
138  N N     . GLU A 18  ? 0.6417 0.3634 0.4746 0.0702  0.0321  0.0279  20  GLU A N     
139  C CA    . GLU A 18  ? 0.6033 0.3565 0.4547 0.0579  0.0250  0.0246  20  GLU A CA    
140  C C     . GLU A 18  ? 0.5658 0.3528 0.4377 0.0658  0.0219  0.0320  20  GLU A C     
141  O O     . GLU A 18  ? 0.5501 0.3577 0.4349 0.0572  0.0170  0.0333  20  GLU A O     
142  C CB    . GLU A 18  ? 0.5985 0.3557 0.4494 0.0522  0.0233  0.0147  20  GLU A CB    
143  C CG    . GLU A 18  ? 0.5692 0.3542 0.4361 0.0392  0.0163  0.0107  20  GLU A CG    
144  C CD    . GLU A 18  ? 0.5678 0.3583 0.4339 0.0358  0.0144  0.0023  20  GLU A CD    
145  O OE1   . GLU A 18  ? 0.5995 0.3677 0.4493 0.0383  0.0181  -0.0029 20  GLU A OE1   
146  O OE2   . GLU A 18  ? 0.5618 0.3782 0.4425 0.0312  0.0095  0.0008  20  GLU A OE2   
147  N N     . VAL A 19  ? 0.5593 0.3525 0.4339 0.0817  0.0251  0.0365  21  VAL A N     
148  C CA    . VAL A 19  ? 0.5309 0.3551 0.4238 0.0897  0.0227  0.0441  21  VAL A CA    
149  C C     . VAL A 19  ? 0.5344 0.3597 0.4282 0.0903  0.0214  0.0522  21  VAL A C     
150  O O     . VAL A 19  ? 0.5040 0.3551 0.4127 0.0857  0.0163  0.0550  21  VAL A O     
151  C CB    . VAL A 19  ? 0.5377 0.3665 0.4315 0.1075  0.0275  0.0481  21  VAL A CB    
152  C CG1   . VAL A 19  ? 0.5151 0.3776 0.4282 0.1147  0.0249  0.0563  21  VAL A CG1   
153  C CG2   . VAL A 19  ? 0.5314 0.3607 0.4238 0.1070  0.0291  0.0406  21  VAL A CG2   
154  N N     . ARG A 20  ? 0.5652 0.3608 0.4414 0.0959  0.0260  0.0556  22  ARG A N     
155  C CA    . ARG A 20  ? 0.5777 0.3697 0.4508 0.0973  0.0255  0.0640  22  ARG A CA    
156  C C     . ARG A 20  ? 0.5561 0.3562 0.4344 0.0794  0.0206  0.0613  22  ARG A C     
157  O O     . ARG A 20  ? 0.5387 0.3592 0.4269 0.0787  0.0169  0.0669  22  ARG A O     
158  C CB    . ARG A 20  ? 0.6213 0.3734 0.4711 0.1049  0.0322  0.0674  22  ARG A CB    
159  C CG    . ARG A 20  ? 0.6676 0.4180 0.5139 0.1145  0.0329  0.0793  22  ARG A CG    
160  C CD    . ARG A 20  ? 0.7589 0.4643 0.5795 0.1177  0.0395  0.0821  22  ARG A CD    
161  N NE    . ARG A 20  ? 0.8120 0.4969 0.6228 0.0972  0.0394  0.0751  22  ARG A NE    
162  C CZ    . ARG A 20  ? 0.8396 0.5165 0.6447 0.0877  0.0389  0.0795  22  ARG A CZ    
163  N NH1   . ARG A 20  ? 0.8492 0.5347 0.6555 0.0973  0.0381  0.0909  22  ARG A NH1   
164  N NH2   . ARG A 20  ? 0.8579 0.5191 0.6557 0.0683  0.0391  0.0725  22  ARG A NH2   
165  N N     . LYS A 21  ? 0.5568 0.3430 0.4286 0.0652  0.0205  0.0524  23  LYS A N     
166  C CA    . LYS A 21  ? 0.5369 0.3333 0.4147 0.0480  0.0163  0.0488  23  LYS A CA    
167  C C     . LYS A 21  ? 0.4933 0.3272 0.3924 0.0454  0.0103  0.0484  23  LYS A C     
168  O O     . LYS A 21  ? 0.4762 0.3235 0.3816 0.0387  0.0073  0.0507  23  LYS A O     
169  C CB    . LYS A 21  ? 0.5493 0.3308 0.4194 0.0342  0.0167  0.0385  23  LYS A CB    
170  C CG    . LYS A 21  ? 0.5946 0.3451 0.4468 0.0245  0.0203  0.0379  23  LYS A CG    
171  C CD    . LYS A 21  ? 0.6193 0.3642 0.4682 0.0082  0.0190  0.0268  23  LYS A CD    
172  C CE    . LYS A 21  ? 0.6006 0.3752 0.4659 -0.0051 0.0133  0.0235  23  LYS A CE    
173  N NZ    . LYS A 21  ? 0.6134 0.3885 0.4779 -0.0194 0.0111  0.0128  23  LYS A NZ    
174  N N     . GLY A 22  ? 0.4668 0.3159 0.3756 0.0503  0.0091  0.0451  24  GLY A N     
175  C CA    . GLY A 22  ? 0.4274 0.3088 0.3550 0.0485  0.0041  0.0447  24  GLY A CA    
176  C C     . GLY A 22  ? 0.4114 0.3110 0.3475 0.0556  0.0023  0.0532  24  GLY A C     
177  O O     . GLY A 22  ? 0.3837 0.3015 0.3292 0.0486  -0.0019 0.0533  24  GLY A O     
178  N N     . ARG A 23  ? 0.4180 0.3130 0.3502 0.0697  0.0054  0.0600  25  ARG A N     
179  C CA    . ARG A 23  ? 0.4156 0.3296 0.3554 0.0780  0.0034  0.0686  25  ARG A CA    
180  C C     . ARG A 23  ? 0.4174 0.3281 0.3518 0.0725  0.0016  0.0728  25  ARG A C     
181  O O     . ARG A 23  ? 0.4043 0.3380 0.3484 0.0714  -0.0027 0.0761  25  ARG A O     
182  C CB    . ARG A 23  ? 0.4335 0.3414 0.3683 0.0957  0.0076  0.0757  25  ARG A CB    
183  C CG    . ARG A 23  ? 0.4490 0.3612 0.3883 0.1029  0.0105  0.0726  25  ARG A CG    
184  C CD    . ARG A 23  ? 0.4409 0.3887 0.4003 0.1030  0.0067  0.0732  25  ARG A CD    
185  N NE    . ARG A 23  ? 0.4611 0.4129 0.4239 0.1110  0.0106  0.0717  25  ARG A NE    
186  C CZ    . ARG A 23  ? 0.4559 0.4127 0.4238 0.1041  0.0103  0.0649  25  ARG A CZ    
187  N NH1   . ARG A 23  ? 0.4400 0.3988 0.4111 0.0896  0.0062  0.0588  25  ARG A NH1   
188  N NH2   . ARG A 23  ? 0.4400 0.4001 0.4094 0.1126  0.0146  0.0646  25  ARG A NH2   
189  N N     . GLU A 24  ? 0.4397 0.3214 0.3578 0.0685  0.0051  0.0726  26  GLU A N     
190  C CA    . GLU A 24  ? 0.4488 0.3245 0.3596 0.0627  0.0046  0.0771  26  GLU A CA    
191  C C     . GLU A 24  ? 0.4205 0.3127 0.3404 0.0471  0.0004  0.0711  26  GLU A C     
192  O O     . GLU A 24  ? 0.4168 0.3210 0.3386 0.0438  -0.0021 0.0749  26  GLU A O     
193  C CB    . GLU A 24  ? 0.4832 0.3213 0.3733 0.0610  0.0103  0.0781  26  GLU A CB    
194  C CG    . GLU A 24  ? 0.5335 0.3504 0.4110 0.0779  0.0154  0.0851  26  GLU A CG    
195  C CD    . GLU A 24  ? 0.6029 0.3783 0.4579 0.0747  0.0215  0.0853  26  GLU A CD    
196  O OE1   . GLU A 24  ? 0.6478 0.4043 0.4892 0.0858  0.0252  0.0945  26  GLU A OE1   
197  O OE2   . GLU A 24  ? 0.6253 0.3869 0.4757 0.0609  0.0226  0.0764  26  GLU A OE2   
198  N N     . ALA A 25  ? 0.4033 0.2961 0.3278 0.0383  -0.0002 0.0619  27  ALA A N     
199  C CA    . ALA A 25  ? 0.3790 0.2892 0.3134 0.0256  -0.0039 0.0557  27  ALA A CA    
200  C C     . ALA A 25  ? 0.3509 0.2910 0.3009 0.0284  -0.0086 0.0564  27  ALA A C     
201  O O     . ALA A 25  ? 0.3361 0.2908 0.2913 0.0218  -0.0115 0.0557  27  ALA A O     
202  C CB    . ALA A 25  ? 0.3743 0.2790 0.3096 0.0180  -0.0036 0.0465  27  ALA A CB    
203  N N     . GLU A 26  ? 0.3421 0.2908 0.2990 0.0377  -0.0090 0.0574  28  GLU A N     
204  C CA    . GLU A 26  ? 0.3283 0.3039 0.2991 0.0404  -0.0130 0.0589  28  GLU A CA    
205  C C     . GLU A 26  ? 0.3256 0.3114 0.2955 0.0435  -0.0151 0.0662  28  GLU A C     
206  O O     . GLU A 26  ? 0.3127 0.3171 0.2900 0.0379  -0.0191 0.0648  28  GLU A O     
207  C CB    . GLU A 26  ? 0.3278 0.3096 0.3047 0.0505  -0.0118 0.0603  28  GLU A CB    
208  C CG    . GLU A 26  ? 0.3206 0.3306 0.3118 0.0528  -0.0156 0.0626  28  GLU A CG    
209  C CD    . GLU A 26  ? 0.3200 0.3377 0.3166 0.0640  -0.0135 0.0662  28  GLU A CD    
210  O OE1   . GLU A 26  ? 0.3362 0.3369 0.3255 0.0704  -0.0089 0.0660  28  GLU A OE1   
211  O OE2   . GLU A 26  ? 0.3329 0.3746 0.3411 0.0661  -0.0162 0.0690  28  GLU A OE2   
212  N N     . GLU A 27  ? 0.3456 0.3183 0.3052 0.0530  -0.0124 0.0739  29  GLU A N     
213  C CA    . GLU A 27  ? 0.3553 0.3379 0.3126 0.0579  -0.0146 0.0821  29  GLU A CA    
214  C C     . GLU A 27  ? 0.3440 0.3255 0.2961 0.0468  -0.0160 0.0810  29  GLU A C     
215  O O     . GLU A 27  ? 0.3330 0.3331 0.2886 0.0457  -0.0199 0.0835  29  GLU A O     
216  C CB    . GLU A 27  ? 0.3818 0.3464 0.3265 0.0714  -0.0107 0.0913  29  GLU A CB    
217  C CG    . GLU A 27  ? 0.4352 0.4126 0.3775 0.0790  -0.0135 0.1010  29  GLU A CG    
218  C CD    . GLU A 27  ? 0.4848 0.4925 0.4413 0.0886  -0.0174 0.1045  29  GLU A CD    
219  O OE1   . GLU A 27  ? 0.4707 0.4988 0.4422 0.0827  -0.0204 0.0980  29  GLU A OE1   
220  O OE2   . GLU A 27  ? 0.5154 0.5265 0.4677 0.1021  -0.0174 0.1141  29  GLU A OE2   
221  N N     . GLU A 28  ? 0.3489 0.3102 0.2927 0.0381  -0.0126 0.0768  30  GLU A N     
222  C CA    . GLU A 28  ? 0.3545 0.3151 0.2933 0.0272  -0.0128 0.0757  30  GLU A CA    
223  C C     . GLU A 28  ? 0.3335 0.3173 0.2851 0.0183  -0.0169 0.0682  30  GLU A C     
224  O O     . GLU A 28  ? 0.3310 0.3258 0.2818 0.0135  -0.0187 0.0690  30  GLU A O     
225  C CB    . GLU A 28  ? 0.3701 0.3043 0.2973 0.0193  -0.0078 0.0733  30  GLU A CB    
226  C CG    . GLU A 28  ? 0.3716 0.3067 0.2948 0.0066  -0.0070 0.0717  30  GLU A CG    
227  C CD    . GLU A 28  ? 0.3766 0.3132 0.2907 0.0091  -0.0069 0.0808  30  GLU A CD    
228  O OE1   . GLU A 28  ? 0.3884 0.3277 0.3000 0.0211  -0.0083 0.0885  30  GLU A OE1   
229  O OE2   . GLU A 28  ? 0.3973 0.3335 0.3065 -0.0007 -0.0052 0.0805  30  GLU A OE2   
230  N N     . LEU A 29  ? 0.3202 0.3097 0.2819 0.0166  -0.0179 0.0610  31  LEU A N     
231  C CA    . LEU A 29  ? 0.3050 0.3139 0.2784 0.0102  -0.0213 0.0540  31  LEU A CA    
232  C C     . LEU A 29  ? 0.2937 0.3237 0.2734 0.0134  -0.0256 0.0566  31  LEU A C     
233  O O     . LEU A 29  ? 0.2874 0.3289 0.2685 0.0074  -0.0278 0.0540  31  LEU A O     
234  C CB    . LEU A 29  ? 0.3012 0.3098 0.2824 0.0108  -0.0213 0.0481  31  LEU A CB    
235  C CG    . LEU A 29  ? 0.3002 0.3103 0.2864 0.0029  -0.0215 0.0395  31  LEU A CG    
236  C CD1   . LEU A 29  ? 0.2946 0.3038 0.2770 -0.0063 -0.0206 0.0366  31  LEU A CD1   
237  C CD2   . LEU A 29  ? 0.2837 0.2799 0.2676 0.0055  -0.0191 0.0374  31  LEU A CD2   
238  N N     . ARG A 30  ? 0.2967 0.3328 0.2802 0.0226  -0.0267 0.0614  32  ARG A N     
239  C CA    . ARG A 30  ? 0.3012 0.3596 0.2909 0.0254  -0.0313 0.0645  32  ARG A CA    
240  C C     . ARG A 30  ? 0.2992 0.3611 0.2801 0.0240  -0.0328 0.0690  32  ARG A C     
241  O O     . ARG A 30  ? 0.2860 0.3645 0.2701 0.0190  -0.0366 0.0664  32  ARG A O     
242  C CB    . ARG A 30  ? 0.3038 0.3685 0.2976 0.0369  -0.0315 0.0709  32  ARG A CB    
243  C CG    . ARG A 30  ? 0.3243 0.3835 0.3242 0.0400  -0.0288 0.0679  32  ARG A CG    
244  C CD    . ARG A 30  ? 0.3340 0.4101 0.3431 0.0491  -0.0299 0.0725  32  ARG A CD    
245  N NE    . ARG A 30  ? 0.4099 0.5063 0.4323 0.0424  -0.0331 0.0673  32  ARG A NE    
246  C CZ    . ARG A 30  ? 0.4249 0.5222 0.4548 0.0412  -0.0314 0.0633  32  ARG A CZ    
247  N NH1   . ARG A 30  ? 0.4540 0.5350 0.4799 0.0468  -0.0267 0.0635  32  ARG A NH1   
248  N NH2   . ARG A 30  ? 0.4313 0.5447 0.4715 0.0340  -0.0341 0.0590  32  ARG A NH2   
249  N N     . ARG A 31  ? 0.3088 0.3531 0.2771 0.0282  -0.0294 0.0757  33  ARG A N     
250  C CA    . ARG A 31  ? 0.3179 0.3623 0.2753 0.0275  -0.0299 0.0814  33  ARG A CA    
251  C C     . ARG A 31  ? 0.3049 0.3530 0.2608 0.0154  -0.0300 0.0750  33  ARG A C     
252  O O     . ARG A 31  ? 0.3055 0.3678 0.2590 0.0133  -0.0330 0.0761  33  ARG A O     
253  C CB    . ARG A 31  ? 0.3403 0.3595 0.2830 0.0335  -0.0249 0.0896  33  ARG A CB    
254  C CG    . ARG A 31  ? 0.3660 0.3848 0.3066 0.0484  -0.0252 0.0988  33  ARG A CG    
255  C CD    . ARG A 31  ? 0.3941 0.3812 0.3201 0.0544  -0.0189 0.1045  33  ARG A CD    
256  N NE    . ARG A 31  ? 0.4078 0.3942 0.3302 0.0708  -0.0187 0.1143  33  ARG A NE    
257  C CZ    . ARG A 31  ? 0.4411 0.3998 0.3486 0.0798  -0.0134 0.1215  33  ARG A CZ    
258  N NH1   . ARG A 31  ? 0.4315 0.3600 0.3260 0.0720  -0.0079 0.1197  33  ARG A NH1   
259  N NH2   . ARG A 31  ? 0.4587 0.4201 0.3641 0.0965  -0.0135 0.1305  33  ARG A NH2   
260  N N     . ARG A 32  ? 0.2919 0.3286 0.2491 0.0080  -0.0267 0.0683  34  ARG A N     
261  C CA    . ARG A 32  ? 0.2867 0.3285 0.2441 -0.0024 -0.0261 0.0617  34  ARG A CA    
262  C C     . ARG A 32  ? 0.2713 0.3338 0.2391 -0.0052 -0.0305 0.0546  34  ARG A C     
263  O O     . ARG A 32  ? 0.2619 0.3346 0.2273 -0.0102 -0.0316 0.0520  34  ARG A O     
264  C CB    . ARG A 32  ? 0.2839 0.3119 0.2421 -0.0087 -0.0221 0.0563  34  ARG A CB    
265  C CG    . ARG A 32  ? 0.3044 0.3097 0.2503 -0.0090 -0.0172 0.0620  34  ARG A CG    
266  C CD    . ARG A 32  ? 0.2768 0.2714 0.2246 -0.0162 -0.0142 0.0555  34  ARG A CD    
267  N NE    . ARG A 32  ? 0.2890 0.2591 0.2242 -0.0178 -0.0095 0.0600  34  ARG A NE    
268  C CZ    . ARG A 32  ? 0.2920 0.2514 0.2253 -0.0268 -0.0063 0.0554  34  ARG A CZ    
269  N NH1   . ARG A 32  ? 0.2632 0.2363 0.2070 -0.0336 -0.0077 0.0467  34  ARG A NH1   
270  N NH2   . ARG A 32  ? 0.3085 0.2433 0.2287 -0.0290 -0.0018 0.0595  34  ARG A NH2   
271  N N     . LEU A 33  ? 0.2660 0.3333 0.2443 -0.0021 -0.0325 0.0516  35  LEU A N     
272  C CA    . LEU A 33  ? 0.2621 0.3454 0.2499 -0.0052 -0.0362 0.0448  35  LEU A CA    
273  C C     . LEU A 33  ? 0.2728 0.3735 0.2603 -0.0036 -0.0410 0.0478  35  LEU A C     
274  O O     . LEU A 33  ? 0.2654 0.3772 0.2540 -0.0091 -0.0435 0.0420  35  LEU A O     
275  C CB    . LEU A 33  ? 0.2455 0.3275 0.2434 -0.0029 -0.0363 0.0417  35  LEU A CB    
276  C CG    . LEU A 33  ? 0.2491 0.3187 0.2489 -0.0056 -0.0330 0.0363  35  LEU A CG    
277  C CD1   . LEU A 33  ? 0.2252 0.2905 0.2312 -0.0007 -0.0324 0.0366  35  LEU A CD1   
278  C CD2   . LEU A 33  ? 0.2432 0.3184 0.2466 -0.0121 -0.0334 0.0279  35  LEU A CD2   
279  N N     . ASP A 34  ? 0.2902 0.3933 0.2754 0.0042  -0.0423 0.0564  36  ASP A N     
280  C CA    . ASP A 34  ? 0.3059 0.4281 0.2903 0.0064  -0.0475 0.0603  36  ASP A CA    
281  C C     . ASP A 34  ? 0.3217 0.4465 0.2944 0.0028  -0.0481 0.0615  36  ASP A C     
282  O O     . ASP A 34  ? 0.3290 0.4710 0.3010 0.0003  -0.0528 0.0600  36  ASP A O     
283  C CB    . ASP A 34  ? 0.3127 0.4375 0.2970 0.0176  -0.0483 0.0704  36  ASP A CB    
284  C CG    . ASP A 34  ? 0.3032 0.4304 0.2995 0.0217  -0.0479 0.0694  36  ASP A CG    
285  O OD1   . ASP A 34  ? 0.2966 0.4270 0.3018 0.0150  -0.0482 0.0613  36  ASP A OD1   
286  O OD2   . ASP A 34  ? 0.3211 0.4461 0.3172 0.0321  -0.0467 0.0771  36  ASP A OD2   
287  N N     . GLU A 35  ? 0.3399 0.4479 0.3029 0.0019  -0.0432 0.0641  37  GLU A N     
288  C CA    . GLU A 35  ? 0.3616 0.4708 0.3125 -0.0019 -0.0425 0.0658  37  GLU A CA    
289  C C     . GLU A 35  ? 0.3545 0.4727 0.3079 -0.0110 -0.0431 0.0551  37  GLU A C     
290  O O     . GLU A 35  ? 0.3577 0.4853 0.3032 -0.0140 -0.0446 0.0545  37  GLU A O     
291  C CB    . GLU A 35  ? 0.3757 0.4637 0.3163 -0.0023 -0.0361 0.0709  37  GLU A CB    
292  C CG    . GLU A 35  ? 0.4219 0.5095 0.3488 -0.0065 -0.0340 0.0740  37  GLU A CG    
293  C CD    . GLU A 35  ? 0.4761 0.5773 0.3946 -0.0014 -0.0386 0.0811  37  GLU A CD    
294  O OE1   . GLU A 35  ? 0.5075 0.6124 0.4272 0.0079  -0.0419 0.0881  37  GLU A OE1   
295  O OE2   . GLU A 35  ? 0.5085 0.6178 0.4187 -0.0062 -0.0387 0.0799  37  GLU A OE2   
296  N N     . LEU A 36  ? 0.3465 0.4613 0.3100 -0.0145 -0.0419 0.0469  38  LEU A N     
297  C CA    . LEU A 36  ? 0.3400 0.4608 0.3059 -0.0213 -0.0419 0.0367  38  LEU A CA    
298  C C     . LEU A 36  ? 0.3356 0.4703 0.3076 -0.0228 -0.0472 0.0314  38  LEU A C     
299  O O     . LEU A 36  ? 0.3426 0.4820 0.3138 -0.0280 -0.0477 0.0230  38  LEU A O     
300  C CB    . LEU A 36  ? 0.3301 0.4401 0.3024 -0.0239 -0.0376 0.0308  38  LEU A CB    
301  C CG    . LEU A 36  ? 0.3364 0.4348 0.3030 -0.0258 -0.0322 0.0336  38  LEU A CG    
302  C CD1   . LEU A 36  ? 0.3154 0.4057 0.2903 -0.0271 -0.0295 0.0287  38  LEU A CD1   
303  C CD2   . LEU A 36  ? 0.3560 0.4600 0.3141 -0.0309 -0.0296 0.0316  38  LEU A CD2   
304  N N     . GLY A 37  ? 0.3338 0.4751 0.3115 -0.0183 -0.0509 0.0361  39  GLY A N     
305  C CA    . GLY A 37  ? 0.3244 0.4804 0.3090 -0.0210 -0.0561 0.0317  39  GLY A CA    
306  C C     . GLY A 37  ? 0.3178 0.4681 0.3117 -0.0251 -0.0548 0.0232  39  GLY A C     
307  O O     . GLY A 37  ? 0.3152 0.4726 0.3114 -0.0307 -0.0576 0.0162  39  GLY A O     
308  N N     . VAL A 38  ? 0.3084 0.4448 0.3063 -0.0223 -0.0505 0.0238  40  VAL A N     
309  C CA    . VAL A 38  ? 0.3034 0.4322 0.3086 -0.0247 -0.0485 0.0169  40  VAL A CA    
310  C C     . VAL A 38  ? 0.2951 0.4283 0.3104 -0.0230 -0.0503 0.0186  40  VAL A C     
311  O O     . VAL A 38  ? 0.2937 0.4317 0.3114 -0.0176 -0.0512 0.0261  40  VAL A O     
312  C CB    . VAL A 38  ? 0.3006 0.4148 0.3047 -0.0227 -0.0434 0.0169  40  VAL A CB    
313  C CG1   . VAL A 38  ? 0.3113 0.4176 0.3232 -0.0217 -0.0417 0.0137  40  VAL A CG1   
314  C CG2   . VAL A 38  ? 0.3127 0.4257 0.3099 -0.0266 -0.0411 0.0120  40  VAL A CG2   
315  N N     . GLU A 39  ? 0.2880 0.4195 0.3085 -0.0274 -0.0503 0.0119  41  GLU A N     
316  C CA    . GLU A 39  ? 0.2820 0.4161 0.3120 -0.0268 -0.0507 0.0134  41  GLU A CA    
317  C C     . GLU A 39  ? 0.2660 0.3857 0.2991 -0.0226 -0.0464 0.0138  41  GLU A C     
318  O O     . GLU A 39  ? 0.2596 0.3689 0.2912 -0.0243 -0.0441 0.0082  41  GLU A O     
319  C CB    . GLU A 39  ? 0.2866 0.4256 0.3197 -0.0348 -0.0529 0.0067  41  GLU A CB    
320  C CG    . GLU A 39  ? 0.3023 0.4484 0.3456 -0.0357 -0.0535 0.0093  41  GLU A CG    
321  C CD    . GLU A 39  ? 0.3064 0.4537 0.3518 -0.0453 -0.0547 0.0024  41  GLU A CD    
322  O OE1   . GLU A 39  ? 0.3604 0.5051 0.3987 -0.0512 -0.0562 -0.0046 41  GLU A OE1   
323  O OE2   . GLU A 39  ? 0.3460 0.4960 0.3994 -0.0474 -0.0539 0.0038  41  GLU A OE2   
324  N N     . TYR A 40  ? 0.2536 0.3737 0.2905 -0.0166 -0.0453 0.0204  42  TYR A N     
325  C CA    . TYR A 40  ? 0.2452 0.3519 0.2830 -0.0122 -0.0414 0.0212  42  TYR A CA    
326  C C     . TYR A 40  ? 0.2399 0.3503 0.2848 -0.0079 -0.0405 0.0257  42  TYR A C     
327  O O     . TYR A 40  ? 0.2461 0.3708 0.2955 -0.0070 -0.0427 0.0297  42  TYR A O     
328  C CB    . TYR A 40  ? 0.2381 0.3358 0.2688 -0.0082 -0.0395 0.0245  42  TYR A CB    
329  C CG    . TYR A 40  ? 0.2480 0.3511 0.2762 -0.0029 -0.0404 0.0324  42  TYR A CG    
330  C CD1   . TYR A 40  ? 0.2348 0.3338 0.2645 0.0046  -0.0384 0.0380  42  TYR A CD1   
331  C CD2   . TYR A 40  ? 0.2511 0.3627 0.2743 -0.0042 -0.0431 0.0345  42  TYR A CD2   
332  C CE1   . TYR A 40  ? 0.2531 0.3559 0.2798 0.0113  -0.0389 0.0457  42  TYR A CE1   
333  C CE2   . TYR A 40  ? 0.2615 0.3776 0.2814 0.0022  -0.0440 0.0427  42  TYR A CE2   
334  C CZ    . TYR A 40  ? 0.2556 0.3669 0.2775 0.0104  -0.0418 0.0484  42  TYR A CZ    
335  O OH    . TYR A 40  ? 0.2693 0.3841 0.2872 0.0184  -0.0424 0.0570  42  TYR A OH    
336  N N     . VAL A 41  ? 0.2323 0.3313 0.2778 -0.0050 -0.0372 0.0252  43  VAL A N     
337  C CA    . VAL A 41  ? 0.2304 0.3310 0.2808 0.0004  -0.0351 0.0296  43  VAL A CA    
338  C C     . VAL A 41  ? 0.2271 0.3120 0.2724 0.0057  -0.0315 0.0301  43  VAL A C     
339  O O     . VAL A 41  ? 0.2253 0.2999 0.2668 0.0034  -0.0307 0.0255  43  VAL A O     
340  C CB    . VAL A 41  ? 0.2319 0.3382 0.2898 -0.0040 -0.0347 0.0276  43  VAL A CB    
341  C CG1   . VAL A 41  ? 0.2128 0.3057 0.2680 -0.0073 -0.0331 0.0217  43  VAL A CG1   
342  C CG2   . VAL A 41  ? 0.2403 0.3525 0.3040 0.0016  -0.0321 0.0329  43  VAL A CG2   
343  N N     . PHE A 42  ? 0.2307 0.3143 0.2751 0.0132  -0.0295 0.0356  44  PHE A N     
344  C CA    . PHE A 42  ? 0.2254 0.2936 0.2641 0.0180  -0.0260 0.0355  44  PHE A CA    
345  C C     . PHE A 42  ? 0.2197 0.2877 0.2626 0.0188  -0.0237 0.0343  44  PHE A C     
346  O O     . PHE A 42  ? 0.2022 0.2820 0.2523 0.0203  -0.0231 0.0373  44  PHE A O     
347  C CB    . PHE A 42  ? 0.2428 0.3060 0.2764 0.0264  -0.0239 0.0414  44  PHE A CB    
348  C CG    . PHE A 42  ? 0.2513 0.3078 0.2768 0.0258  -0.0249 0.0429  44  PHE A CG    
349  C CD1   . PHE A 42  ? 0.2568 0.3257 0.2842 0.0235  -0.0283 0.0451  44  PHE A CD1   
350  C CD2   . PHE A 42  ? 0.2602 0.2979 0.2756 0.0267  -0.0224 0.0422  44  PHE A CD2   
351  C CE1   . PHE A 42  ? 0.2701 0.3325 0.2889 0.0229  -0.0287 0.0473  44  PHE A CE1   
352  C CE2   . PHE A 42  ? 0.2609 0.2913 0.2683 0.0250  -0.0226 0.0442  44  PHE A CE2   
353  C CZ    . PHE A 42  ? 0.2788 0.3214 0.2877 0.0236  -0.0255 0.0471  44  PHE A CZ    
354  N N     . VAL A 43  ? 0.2127 0.2687 0.2511 0.0177  -0.0225 0.0301  45  VAL A N     
355  C CA    . VAL A 43  ? 0.2164 0.2705 0.2566 0.0186  -0.0203 0.0291  45  VAL A CA    
356  C C     . VAL A 43  ? 0.2217 0.2618 0.2536 0.0226  -0.0181 0.0275  45  VAL A C     
357  O O     . VAL A 43  ? 0.2316 0.2631 0.2568 0.0241  -0.0179 0.0272  45  VAL A O     
358  C CB    . VAL A 43  ? 0.2042 0.2601 0.2476 0.0122  -0.0219 0.0250  45  VAL A CB    
359  C CG1   . VAL A 43  ? 0.2071 0.2761 0.2578 0.0072  -0.0239 0.0259  45  VAL A CG1   
360  C CG2   . VAL A 43  ? 0.2102 0.2587 0.2486 0.0093  -0.0238 0.0200  45  VAL A CG2   
361  N N     . GLY A 44  ? 0.2232 0.2604 0.2545 0.0236  -0.0164 0.0263  46  GLY A N     
362  C CA    . GLY A 44  ? 0.2286 0.2539 0.2513 0.0266  -0.0149 0.0240  46  GLY A CA    
363  C C     . GLY A 44  ? 0.2350 0.2542 0.2522 0.0336  -0.0114 0.0267  46  GLY A C     
364  O O     . GLY A 44  ? 0.2353 0.2620 0.2571 0.0378  -0.0094 0.0314  46  GLY A O     
365  N N     . SER A 45  ? 0.2430 0.2492 0.2501 0.0351  -0.0106 0.0235  47  SER A N     
366  C CA    . SER A 45  ? 0.2565 0.2527 0.2553 0.0421  -0.0067 0.0247  47  SER A CA    
367  C C     . SER A 45  ? 0.2627 0.2543 0.2591 0.0460  -0.0053 0.0280  47  SER A C     
368  O O     . SER A 45  ? 0.2742 0.2633 0.2678 0.0544  -0.0012 0.0314  47  SER A O     
369  C CB    . SER A 45  ? 0.2708 0.2533 0.2577 0.0414  -0.0066 0.0193  47  SER A CB    
370  O OG    . SER A 45  ? 0.2700 0.2462 0.2530 0.0348  -0.0098 0.0151  47  SER A OG    
371  N N     . TYR A 46  ? 0.2594 0.2497 0.2560 0.0410  -0.0082 0.0275  48  TYR A N     
372  C CA    . TYR A 46  ? 0.2650 0.2505 0.2584 0.0452  -0.0069 0.0319  48  TYR A CA    
373  C C     . TYR A 46  ? 0.2621 0.2641 0.2653 0.0512  -0.0061 0.0383  48  TYR A C     
374  O O     . TYR A 46  ? 0.2602 0.2595 0.2605 0.0603  -0.0029 0.0429  48  TYR A O     
375  C CB    . TYR A 46  ? 0.2674 0.2492 0.2585 0.0382  -0.0097 0.0309  48  TYR A CB    
376  C CG    . TYR A 46  ? 0.2893 0.2658 0.2761 0.0440  -0.0080 0.0368  48  TYR A CG    
377  C CD1   . TYR A 46  ? 0.3143 0.2700 0.2881 0.0497  -0.0040 0.0377  48  TYR A CD1   
378  C CD2   . TYR A 46  ? 0.2894 0.2811 0.2840 0.0448  -0.0103 0.0418  48  TYR A CD2   
379  C CE1   . TYR A 46  ? 0.3286 0.2774 0.2971 0.0568  -0.0020 0.0440  48  TYR A CE1   
380  C CE2   . TYR A 46  ? 0.3153 0.3031 0.3053 0.0518  -0.0089 0.0482  48  TYR A CE2   
381  C CZ    . TYR A 46  ? 0.3282 0.2939 0.3051 0.0583  -0.0046 0.0497  48  TYR A CZ    
382  O OH    . TYR A 46  ? 0.3396 0.2990 0.3104 0.0667  -0.0028 0.0567  48  TYR A OH    
383  N N     . ALA A 47  ? 0.2503 0.2697 0.2649 0.0461  -0.0091 0.0384  49  ALA A N     
384  C CA    . ALA A 47  ? 0.2534 0.2918 0.2788 0.0490  -0.0093 0.0436  49  ALA A CA    
385  C C     . ALA A 47  ? 0.2613 0.3059 0.2900 0.0563  -0.0049 0.0465  49  ALA A C     
386  O O     . ALA A 47  ? 0.2594 0.3186 0.2952 0.0620  -0.0038 0.0519  49  ALA A O     
387  C CB    . ALA A 47  ? 0.2412 0.2938 0.2761 0.0398  -0.0134 0.0418  49  ALA A CB    
388  N N     . ARG A 48  ? 0.2672 0.3021 0.2906 0.0566  -0.0023 0.0431  50  ARG A N     
389  C CA    . ARG A 48  ? 0.2814 0.3208 0.3059 0.0638  0.0028  0.0457  50  ARG A CA    
390  C C     . ARG A 48  ? 0.3011 0.3240 0.3131 0.0738  0.0076  0.0457  50  ARG A C     
391  O O     . ARG A 48  ? 0.3063 0.3324 0.3179 0.0813  0.0126  0.0478  50  ARG A O     
392  C CB    . ARG A 48  ? 0.2753 0.3152 0.3007 0.0587  0.0034  0.0427  50  ARG A CB    
393  C CG    . ARG A 48  ? 0.2735 0.3281 0.3104 0.0501  0.0006  0.0432  50  ARG A CG    
394  C CD    . ARG A 48  ? 0.3001 0.3469 0.3330 0.0452  0.0004  0.0395  50  ARG A CD    
395  N NE    . ARG A 48  ? 0.3402 0.3908 0.3786 0.0364  -0.0040 0.0373  50  ARG A NE    
396  C CZ    . ARG A 48  ? 0.3288 0.3705 0.3627 0.0321  -0.0065 0.0329  50  ARG A CZ    
397  N NH1   . ARG A 48  ? 0.3107 0.3404 0.3349 0.0348  -0.0060 0.0301  50  ARG A NH1   
398  N NH2   . ARG A 48  ? 0.3623 0.4081 0.4014 0.0253  -0.0097 0.0312  50  ARG A NH2   
399  N N     . ASN A 49  ? 0.3155 0.3203 0.3167 0.0737  0.0064  0.0433  51  ASN A N     
400  C CA    . ASN A 49  ? 0.3395 0.3228 0.3256 0.0814  0.0108  0.0417  51  ASN A CA    
401  C C     . ASN A 49  ? 0.3382 0.3133 0.3166 0.0816  0.0135  0.0370  51  ASN A C     
402  O O     . ASN A 49  ? 0.3478 0.3155 0.3184 0.0909  0.0190  0.0374  51  ASN A O     
403  C CB    . ASN A 49  ? 0.3568 0.3425 0.3427 0.0947  0.0154  0.0481  51  ASN A CB    
404  C CG    . ASN A 49  ? 0.3954 0.3891 0.3870 0.0956  0.0124  0.0535  51  ASN A CG    
405  O OD1   . ASN A 49  ? 0.4443 0.4228 0.4277 0.0922  0.0104  0.0524  51  ASN A OD1   
406  N ND2   . ASN A 49  ? 0.4266 0.4453 0.4321 0.1000  0.0122  0.0595  51  ASN A ND2   
407  N N     . THR A 50  ? 0.3231 0.3000 0.3030 0.0720  0.0096  0.0326  52  THR A N     
408  C CA    . THR A 50  ? 0.3273 0.2978 0.2994 0.0715  0.0109  0.0282  52  THR A CA    
409  C C     . THR A 50  ? 0.3281 0.2837 0.2898 0.0640  0.0072  0.0211  52  THR A C     
410  O O     . THR A 50  ? 0.3160 0.2696 0.2726 0.0613  0.0061  0.0171  52  THR A O     
411  C CB    . THR A 50  ? 0.3116 0.2987 0.2939 0.0679  0.0101  0.0298  52  THR A CB    
412  O OG1   . THR A 50  ? 0.3082 0.3034 0.2997 0.0591  0.0047  0.0293  52  THR A OG1   
413  C CG2   . THR A 50  ? 0.3071 0.3100 0.2990 0.0742  0.0147  0.0362  52  THR A CG2   
414  N N     . TRP A 51  ? 0.3315 0.2780 0.2902 0.0604  0.0052  0.0201  53  TRP A N     
415  C CA    . TRP A 51  ? 0.3440 0.2789 0.2943 0.0518  0.0017  0.0135  53  TRP A CA    
416  C C     . TRP A 51  ? 0.3750 0.2885 0.3077 0.0541  0.0047  0.0085  53  TRP A C     
417  O O     . TRP A 51  ? 0.3896 0.2913 0.3146 0.0628  0.0099  0.0107  53  TRP A O     
418  C CB    . TRP A 51  ? 0.3437 0.2779 0.2975 0.0453  -0.0012 0.0143  53  TRP A CB    
419  C CG    . TRP A 51  ? 0.3725 0.2877 0.3155 0.0478  0.0018  0.0153  53  TRP A CG    
420  C CD1   . TRP A 51  ? 0.4041 0.2983 0.3326 0.0431  0.0025  0.0100  53  TRP A CD1   
421  C CD2   . TRP A 51  ? 0.3803 0.2945 0.3248 0.0557  0.0046  0.0221  53  TRP A CD2   
422  N NE1   . TRP A 51  ? 0.4213 0.2984 0.3411 0.0476  0.0061  0.0133  53  TRP A NE1   
423  C CE2   . TRP A 51  ? 0.4125 0.3021 0.3420 0.0563  0.0074  0.0212  53  TRP A CE2   
424  C CE3   . TRP A 51  ? 0.3568 0.2890 0.3137 0.0621  0.0049  0.0291  53  TRP A CE3   
425  C CZ2   . TRP A 51  ? 0.4189 0.3003 0.3448 0.0648  0.0106  0.0277  53  TRP A CZ2   
426  C CZ3   . TRP A 51  ? 0.3773 0.3050 0.3320 0.0701  0.0074  0.0352  53  TRP A CZ3   
427  C CH2   . TRP A 51  ? 0.4087 0.3106 0.3476 0.0723  0.0104  0.0348  53  TRP A CH2   
428  N N     . LEU A 52  ? 0.3790 0.2880 0.3050 0.0464  0.0014  0.0017  54  LEU A N     
429  C CA    . LEU A 52  ? 0.4106 0.3000 0.3188 0.0459  0.0031  -0.0048 54  LEU A CA    
430  C C     . LEU A 52  ? 0.4285 0.2974 0.3266 0.0413  0.0041  -0.0071 54  LEU A C     
431  O O     . LEU A 52  ? 0.4227 0.2949 0.3266 0.0329  0.0008  -0.0068 54  LEU A O     
432  C CB    . LEU A 52  ? 0.4066 0.3026 0.3124 0.0385  -0.0019 -0.0111 54  LEU A CB    
433  C CG    . LEU A 52  ? 0.4366 0.3224 0.3265 0.0396  -0.0011 -0.0175 54  LEU A CG    
434  C CD1   . LEU A 52  ? 0.4350 0.3180 0.3201 0.0520  0.0051  -0.0142 54  LEU A CD1   
435  C CD2   . LEU A 52  ? 0.4143 0.3156 0.3077 0.0337  -0.0073 -0.0210 54  LEU A CD2   
436  N N     . LYS A 53  ? 0.4557 0.3021 0.3377 0.0472  0.0092  -0.0091 55  LYS A N     
437  C CA    . LYS A 53  ? 0.4814 0.3019 0.3494 0.0432  0.0114  -0.0117 55  LYS A CA    
438  C C     . LYS A 53  ? 0.4821 0.3011 0.3479 0.0271  0.0061  -0.0184 55  LYS A C     
439  O O     . LYS A 53  ? 0.4819 0.3054 0.3441 0.0210  0.0027  -0.0252 55  LYS A O     
440  C CB    . LYS A 53  ? 0.5120 0.3073 0.3598 0.0508  0.0172  -0.0159 55  LYS A CB    
441  C CG    . LYS A 53  ? 0.5540 0.3168 0.3829 0.0455  0.0199  -0.0204 55  LYS A CG    
442  C CD    . LYS A 53  ? 0.5980 0.3365 0.4053 0.0512  0.0249  -0.0272 55  LYS A CD    
443  C CE    . LYS A 53  ? 0.6448 0.3466 0.4328 0.0535  0.0309  -0.0281 55  LYS A CE    
444  N NZ    . LYS A 53  ? 0.6603 0.3488 0.4430 0.0365  0.0277  -0.0322 55  LYS A NZ    
445  N N     . GLY A 54  ? 0.4914 0.3058 0.3596 0.0202  0.0054  -0.0161 56  GLY A N     
446  C CA    . GLY A 54  ? 0.5000 0.3143 0.3670 0.0042  0.0012  -0.0219 56  GLY A CA    
447  C C     . GLY A 54  ? 0.4752 0.3197 0.3605 -0.0021 -0.0049 -0.0213 56  GLY A C     
448  O O     . GLY A 54  ? 0.4768 0.3264 0.3640 -0.0148 -0.0083 -0.0254 56  GLY A O     
449  N N     . SER A 55  ? 0.4570 0.3214 0.3557 0.0066  -0.0058 -0.0163 57  SER A N     
450  C CA    . SER A 55  ? 0.4342 0.3251 0.3491 0.0027  -0.0110 -0.0157 57  SER A CA    
451  C C     . SER A 55  ? 0.4131 0.3173 0.3419 0.0080  -0.0105 -0.0079 57  SER A C     
452  O O     . SER A 55  ? 0.4011 0.3233 0.3411 0.0115  -0.0125 -0.0059 57  SER A O     
453  C CB    . SER A 55  ? 0.4277 0.3305 0.3441 0.0064  -0.0133 -0.0185 57  SER A CB    
454  O OG    . SER A 55  ? 0.4536 0.3484 0.3578 0.0003  -0.0151 -0.0264 57  SER A OG    
455  N N     . LEU A 56  ? 0.4160 0.3104 0.3428 0.0084  -0.0079 -0.0035 58  LEU A N     
456  C CA    . LEU A 56  ? 0.3918 0.2990 0.3303 0.0134  -0.0078 0.0038  58  LEU A CA    
457  C C     . LEU A 56  ? 0.3684 0.2934 0.3183 0.0052  -0.0119 0.0033  58  LEU A C     
458  O O     . LEU A 56  ? 0.3726 0.2943 0.3197 -0.0043 -0.0128 0.0006  58  LEU A O     
459  C CB    . LEU A 56  ? 0.4068 0.2982 0.3381 0.0185  -0.0037 0.0095  58  LEU A CB    
460  C CG    . LEU A 56  ? 0.3976 0.3022 0.3392 0.0234  -0.0040 0.0173  58  LEU A CG    
461  C CD1   . LEU A 56  ? 0.3785 0.3035 0.3329 0.0302  -0.0052 0.0198  58  LEU A CD1   
462  C CD2   . LEU A 56  ? 0.4216 0.3092 0.3538 0.0311  0.0002  0.0234  58  LEU A CD2   
463  N N     . GLU A 57  ? 0.3400 0.2835 0.3023 0.0089  -0.0138 0.0058  59  GLU A N     
464  C CA    . GLU A 57  ? 0.3222 0.2814 0.2949 0.0040  -0.0166 0.0066  59  GLU A CA    
465  C C     . GLU A 57  ? 0.3009 0.2706 0.2822 0.0103  -0.0164 0.0124  59  GLU A C     
466  O O     . GLU A 57  ? 0.2974 0.2730 0.2830 0.0160  -0.0161 0.0136  59  GLU A O     
467  C CB    . GLU A 57  ? 0.3109 0.2832 0.2896 -0.0004 -0.0202 0.0014  59  GLU A CB    
468  C CG    . GLU A 57  ? 0.3034 0.2924 0.2931 -0.0026 -0.0224 0.0022  59  GLU A CG    
469  C CD    . GLU A 57  ? 0.2925 0.2933 0.2873 -0.0046 -0.0254 -0.0024 59  GLU A CD    
470  O OE1   . GLU A 57  ? 0.2660 0.2742 0.2664 0.0002  -0.0262 -0.0015 59  GLU A OE1   
471  O OE2   . GLU A 57  ? 0.3097 0.3123 0.3024 -0.0109 -0.0268 -0.0067 59  GLU A OE2   
472  N N     . ILE A 58  ? 0.2931 0.2658 0.2764 0.0085  -0.0166 0.0160  60  ILE A N     
473  C CA    . ILE A 58  ? 0.2729 0.2580 0.2643 0.0127  -0.0173 0.0209  60  ILE A CA    
474  C C     . ILE A 58  ? 0.2546 0.2558 0.2556 0.0082  -0.0205 0.0180  60  ILE A C     
475  O O     . ILE A 58  ? 0.2547 0.2588 0.2561 0.0016  -0.0219 0.0146  60  ILE A O     
476  C CB    . ILE A 58  ? 0.2805 0.2611 0.2675 0.0134  -0.0163 0.0263  60  ILE A CB    
477  C CG1   . ILE A 58  ? 0.3038 0.2658 0.2799 0.0200  -0.0125 0.0297  60  ILE A CG1   
478  C CG2   . ILE A 58  ? 0.2617 0.2588 0.2573 0.0162  -0.0183 0.0307  60  ILE A CG2   
479  C CD1   . ILE A 58  ? 0.3120 0.2664 0.2815 0.0229  -0.0110 0.0363  60  ILE A CD1   
480  N N     . ASP A 59  ? 0.2371 0.2483 0.2457 0.0115  -0.0212 0.0193  61  ASP A N     
481  C CA    . ASP A 59  ? 0.2254 0.2486 0.2415 0.0078  -0.0236 0.0167  61  ASP A CA    
482  C C     . ASP A 59  ? 0.2149 0.2479 0.2355 0.0072  -0.0249 0.0199  61  ASP A C     
483  O O     . ASP A 59  ? 0.2160 0.2534 0.2395 0.0113  -0.0244 0.0243  61  ASP A O     
484  C CB    . ASP A 59  ? 0.2183 0.2442 0.2384 0.0100  -0.0235 0.0153  61  ASP A CB    
485  C CG    . ASP A 59  ? 0.2331 0.2516 0.2483 0.0107  -0.0231 0.0118  61  ASP A CG    
486  O OD1   . ASP A 59  ? 0.2499 0.2618 0.2610 0.0151  -0.0210 0.0132  61  ASP A OD1   
487  O OD2   . ASP A 59  ? 0.2318 0.2524 0.2469 0.0071  -0.0249 0.0075  61  ASP A OD2   
488  N N     . VAL A 60  ? 0.2108 0.2488 0.2318 0.0021  -0.0265 0.0177  62  VAL A N     
489  C CA    . VAL A 60  ? 0.2078 0.2562 0.2320 0.0005  -0.0284 0.0195  62  VAL A CA    
490  C C     . VAL A 60  ? 0.1995 0.2545 0.2281 -0.0033 -0.0299 0.0144  62  VAL A C     
491  O O     . VAL A 60  ? 0.2067 0.2606 0.2340 -0.0061 -0.0298 0.0099  62  VAL A O     
492  C CB    . VAL A 60  ? 0.2155 0.2631 0.2340 -0.0016 -0.0284 0.0218  62  VAL A CB    
493  C CG1   . VAL A 60  ? 0.2090 0.2689 0.2297 -0.0032 -0.0309 0.0231  62  VAL A CG1   
494  C CG2   . VAL A 60  ? 0.2272 0.2645 0.2394 0.0031  -0.0264 0.0272  62  VAL A CG2   
495  N N     . PHE A 61  ? 0.1887 0.2504 0.2224 -0.0034 -0.0309 0.0150  63  PHE A N     
496  C CA    . PHE A 61  ? 0.1837 0.2483 0.2200 -0.0071 -0.0319 0.0102  63  PHE A CA    
497  C C     . PHE A 61  ? 0.1889 0.2622 0.2251 -0.0113 -0.0341 0.0091  63  PHE A C     
498  O O     . PHE A 61  ? 0.1909 0.2724 0.2291 -0.0116 -0.0357 0.0128  63  PHE A O     
499  C CB    . PHE A 61  ? 0.1836 0.2473 0.2244 -0.0062 -0.0310 0.0108  63  PHE A CB    
500  C CG    . PHE A 61  ? 0.1786 0.2333 0.2179 -0.0036 -0.0293 0.0086  63  PHE A CG    
501  C CD1   . PHE A 61  ? 0.1822 0.2313 0.2181 -0.0001 -0.0283 0.0093  63  PHE A CD1   
502  C CD2   . PHE A 61  ? 0.1718 0.2229 0.2120 -0.0048 -0.0288 0.0058  63  PHE A CD2   
503  C CE1   . PHE A 61  ? 0.1634 0.2065 0.1975 0.0023  -0.0275 0.0072  63  PHE A CE1   
504  C CE2   . PHE A 61  ? 0.1755 0.2190 0.2135 -0.0012 -0.0275 0.0046  63  PHE A CE2   
505  C CZ    . PHE A 61  ? 0.1672 0.2082 0.2024 0.0024  -0.0272 0.0053  63  PHE A CZ    
506  N N     . LEU A 62  ? 0.1914 0.2643 0.2247 -0.0142 -0.0343 0.0039  64  LEU A N     
507  C CA    . LEU A 62  ? 0.2054 0.2855 0.2366 -0.0185 -0.0362 0.0014  64  LEU A CA    
508  C C     . LEU A 62  ? 0.2139 0.2930 0.2470 -0.0219 -0.0368 -0.0029 64  LEU A C     
509  O O     . LEU A 62  ? 0.2232 0.2940 0.2560 -0.0210 -0.0351 -0.0069 64  LEU A O     
510  C CB    . LEU A 62  ? 0.2070 0.2869 0.2331 -0.0197 -0.0352 -0.0021 64  LEU A CB    
511  C CG    . LEU A 62  ? 0.2106 0.2884 0.2341 -0.0181 -0.0336 0.0013  64  LEU A CG    
512  C CD1   . LEU A 62  ? 0.1880 0.2681 0.2081 -0.0202 -0.0319 -0.0027 64  LEU A CD1   
513  C CD2   . LEU A 62  ? 0.2292 0.3100 0.2500 -0.0175 -0.0346 0.0080  64  LEU A CD2   
514  N N     . LEU A 63  ? 0.2183 0.3059 0.2533 -0.0258 -0.0393 -0.0020 65  LEU A N     
515  C CA    . LEU A 63  ? 0.2274 0.3131 0.2642 -0.0308 -0.0397 -0.0057 65  LEU A CA    
516  C C     . LEU A 63  ? 0.2350 0.3200 0.2656 -0.0362 -0.0409 -0.0129 65  LEU A C     
517  O O     . LEU A 63  ? 0.2345 0.3302 0.2629 -0.0400 -0.0439 -0.0133 65  LEU A O     
518  C CB    . LEU A 63  ? 0.2300 0.3269 0.2735 -0.0333 -0.0416 -0.0011 65  LEU A CB    
519  C CG    . LEU A 63  ? 0.2223 0.3200 0.2714 -0.0274 -0.0398 0.0057  65  LEU A CG    
520  C CD1   . LEU A 63  ? 0.2265 0.3404 0.2828 -0.0289 -0.0417 0.0107  65  LEU A CD1   
521  C CD2   . LEU A 63  ? 0.2230 0.3081 0.2730 -0.0262 -0.0364 0.0044  65  LEU A CD2   
522  N N     . PHE A 64  ? 0.2335 0.3057 0.2604 -0.0356 -0.0384 -0.0185 66  PHE A N     
523  C CA    . PHE A 64  ? 0.2465 0.3149 0.2659 -0.0394 -0.0384 -0.0263 66  PHE A CA    
524  C C     . PHE A 64  ? 0.2525 0.3126 0.2701 -0.0462 -0.0385 -0.0309 66  PHE A C     
525  O O     . PHE A 64  ? 0.2512 0.3023 0.2721 -0.0457 -0.0365 -0.0292 66  PHE A O     
526  C CB    . PHE A 64  ? 0.2491 0.3091 0.2642 -0.0333 -0.0351 -0.0300 66  PHE A CB    
527  C CG    . PHE A 64  ? 0.2379 0.3070 0.2525 -0.0300 -0.0349 -0.0276 66  PHE A CG    
528  C CD1   . PHE A 64  ? 0.2654 0.3415 0.2738 -0.0325 -0.0355 -0.0307 66  PHE A CD1   
529  C CD2   . PHE A 64  ? 0.2260 0.2962 0.2453 -0.0253 -0.0339 -0.0224 66  PHE A CD2   
530  C CE1   . PHE A 64  ? 0.2579 0.3417 0.2651 -0.0304 -0.0347 -0.0278 66  PHE A CE1   
531  C CE2   . PHE A 64  ? 0.2491 0.3261 0.2673 -0.0239 -0.0334 -0.0202 66  PHE A CE2   
532  C CZ    . PHE A 64  ? 0.2523 0.3360 0.2646 -0.0265 -0.0335 -0.0225 66  PHE A CZ    
533  N N     . PRO A 65  ? 0.2632 0.3251 0.2743 -0.0530 -0.0404 -0.0371 67  PRO A N     
534  C CA    . PRO A 65  ? 0.2824 0.3332 0.2897 -0.0609 -0.0401 -0.0428 67  PRO A CA    
535  C C     . PRO A 65  ? 0.2928 0.3213 0.2953 -0.0563 -0.0352 -0.0463 67  PRO A C     
536  O O     . PRO A 65  ? 0.2916 0.3145 0.2899 -0.0483 -0.0327 -0.0485 67  PRO A O     
537  C CB    . PRO A 65  ? 0.2908 0.3457 0.2890 -0.0673 -0.0426 -0.0502 67  PRO A CB    
538  C CG    . PRO A 65  ? 0.2859 0.3607 0.2863 -0.0645 -0.0457 -0.0453 67  PRO A CG    
539  C CD    . PRO A 65  ? 0.2625 0.3355 0.2680 -0.0542 -0.0428 -0.0392 67  PRO A CD    
540  N N     . GLU A 66  ? 0.3036 0.3203 0.3067 -0.0612 -0.0337 -0.0464 68  GLU A N     
541  C CA    . GLU A 66  ? 0.3210 0.3146 0.3187 -0.0564 -0.0289 -0.0482 68  GLU A CA    
542  C C     . GLU A 66  ? 0.3299 0.3081 0.3155 -0.0526 -0.0263 -0.0567 68  GLU A C     
543  O O     . GLU A 66  ? 0.3336 0.2979 0.3157 -0.0431 -0.0225 -0.0568 68  GLU A O     
544  C CB    . GLU A 66  ? 0.3407 0.3225 0.3384 -0.0651 -0.0275 -0.0477 68  GLU A CB    
545  C CG    . GLU A 66  ? 0.3789 0.3404 0.3738 -0.0579 -0.0226 -0.0448 68  GLU A CG    
546  C CD    . GLU A 66  ? 0.4349 0.3812 0.4276 -0.0673 -0.0201 -0.0443 68  GLU A CD    
547  O OE1   . GLU A 66  ? 0.4352 0.3946 0.4347 -0.0786 -0.0225 -0.0426 68  GLU A OE1   
548  O OE2   . GLU A 66  ? 0.4814 0.4031 0.4654 -0.0632 -0.0156 -0.0452 68  GLU A OE2   
549  N N     . GLU A 67  ? 0.3315 0.3132 0.3103 -0.0594 -0.0283 -0.0636 69  GLU A N     
550  C CA    . GLU A 67  ? 0.3413 0.3079 0.3071 -0.0564 -0.0254 -0.0727 69  GLU A CA    
551  C C     . GLU A 67  ? 0.3294 0.3029 0.2953 -0.0440 -0.0235 -0.0724 69  GLU A C     
552  O O     . GLU A 67  ? 0.3461 0.3064 0.3027 -0.0376 -0.0196 -0.0786 69  GLU A O     
553  C CB    . GLU A 67  ? 0.3580 0.3278 0.3153 -0.0675 -0.0283 -0.0808 69  GLU A CB    
554  C CG    . GLU A 67  ? 0.3668 0.3263 0.3211 -0.0814 -0.0295 -0.0841 69  GLU A CG    
555  C CD    . GLU A 67  ? 0.3773 0.3581 0.3450 -0.0896 -0.0342 -0.0767 69  GLU A CD    
556  O OE1   . GLU A 67  ? 0.4080 0.3831 0.3758 -0.1015 -0.0349 -0.0781 69  GLU A OE1   
557  O OE2   . GLU A 67  ? 0.3630 0.3660 0.3407 -0.0845 -0.0370 -0.0694 69  GLU A OE2   
558  N N     . PHE A 68  ? 0.3031 0.2972 0.2791 -0.0408 -0.0258 -0.0654 70  PHE A N     
559  C CA    . PHE A 68  ? 0.2954 0.2994 0.2722 -0.0317 -0.0243 -0.0650 70  PHE A CA    
560  C C     . PHE A 68  ? 0.3003 0.2931 0.2772 -0.0203 -0.0200 -0.0646 70  PHE A C     
561  O O     . PHE A 68  ? 0.2931 0.2768 0.2737 -0.0181 -0.0194 -0.0604 70  PHE A O     
562  C CB    . PHE A 68  ? 0.2773 0.3020 0.2641 -0.0319 -0.0273 -0.0570 70  PHE A CB    
563  C CG    . PHE A 68  ? 0.2954 0.3348 0.2802 -0.0391 -0.0310 -0.0571 70  PHE A CG    
564  C CD1   . PHE A 68  ? 0.3089 0.3460 0.2873 -0.0482 -0.0334 -0.0623 70  PHE A CD1   
565  C CD2   . PHE A 68  ? 0.3050 0.3606 0.2938 -0.0370 -0.0322 -0.0518 70  PHE A CD2   
566  C CE1   . PHE A 68  ? 0.3244 0.3772 0.3005 -0.0541 -0.0375 -0.0620 70  PHE A CE1   
567  C CE2   . PHE A 68  ? 0.3076 0.3763 0.2934 -0.0425 -0.0356 -0.0508 70  PHE A CE2   
568  C CZ    . PHE A 68  ? 0.3100 0.3785 0.2897 -0.0505 -0.0385 -0.0558 70  PHE A CZ    
569  N N     . SER A 69  ? 0.3056 0.3006 0.2785 -0.0126 -0.0170 -0.0688 71  SER A N     
570  C CA    . SER A 69  ? 0.3134 0.3035 0.2880 -0.0005 -0.0136 -0.0678 71  SER A CA    
571  C C     . SER A 69  ? 0.3037 0.3093 0.2903 0.0028  -0.0154 -0.0597 71  SER A C     
572  O O     . SER A 69  ? 0.2814 0.3025 0.2738 -0.0025 -0.0183 -0.0558 71  SER A O     
573  C CB    . SER A 69  ? 0.3274 0.3191 0.2956 0.0074  -0.0095 -0.0744 71  SER A CB    
574  O OG    . SER A 69  ? 0.2986 0.3131 0.2720 0.0072  -0.0101 -0.0729 71  SER A OG    
575  N N     . LYS A 70  ? 0.3148 0.3148 0.3039 0.0120  -0.0137 -0.0572 72  LYS A N     
576  C CA    . LYS A 70  ? 0.3111 0.3245 0.3098 0.0160  -0.0152 -0.0510 72  LYS A CA    
577  C C     . LYS A 70  ? 0.2982 0.3328 0.3015 0.0165  -0.0153 -0.0515 72  LYS A C     
578  O O     . LYS A 70  ? 0.2815 0.3290 0.2918 0.0131  -0.0175 -0.0467 72  LYS A O     
579  C CB    . LYS A 70  ? 0.3307 0.3346 0.3287 0.0272  -0.0133 -0.0496 72  LYS A CB    
580  C CG    . LYS A 70  ? 0.3600 0.3808 0.3650 0.0357  -0.0134 -0.0476 72  LYS A CG    
581  C CD    . LYS A 70  ? 0.4097 0.4331 0.4115 0.0461  -0.0097 -0.0528 72  LYS A CD    
582  C CE    . LYS A 70  ? 0.4022 0.4497 0.4133 0.0526  -0.0102 -0.0512 72  LYS A CE    
583  N NZ    . LYS A 70  ? 0.4026 0.4705 0.4208 0.0432  -0.0120 -0.0501 72  LYS A NZ    
584  N N     . GLU A 71  ? 0.3056 0.3426 0.3040 0.0202  -0.0122 -0.0575 73  GLU A N     
585  C CA    . GLU A 71  ? 0.3017 0.3589 0.3036 0.0200  -0.0111 -0.0582 73  GLU A CA    
586  C C     . GLU A 71  ? 0.2870 0.3525 0.2883 0.0093  -0.0133 -0.0565 73  GLU A C     
587  O O     . GLU A 71  ? 0.2692 0.3503 0.2756 0.0068  -0.0135 -0.0534 73  GLU A O     
588  C CB    . GLU A 71  ? 0.3135 0.3718 0.3097 0.0279  -0.0064 -0.0651 73  GLU A CB    
589  C CG    . GLU A 71  ? 0.3499 0.4054 0.3481 0.0411  -0.0040 -0.0656 73  GLU A CG    
590  C CD    . GLU A 71  ? 0.4161 0.4447 0.4045 0.0465  -0.0023 -0.0685 73  GLU A CD    
591  O OE1   . GLU A 71  ? 0.4113 0.4234 0.3927 0.0382  -0.0035 -0.0701 73  GLU A OE1   
592  O OE2   . GLU A 71  ? 0.4647 0.4890 0.4523 0.0591  0.0002  -0.0690 73  GLU A OE2   
593  N N     . GLU A 72  ? 0.2976 0.3527 0.2922 0.0028  -0.0149 -0.0585 74  GLU A N     
594  C CA    . GLU A 72  ? 0.2956 0.3590 0.2894 -0.0064 -0.0177 -0.0559 74  GLU A CA    
595  C C     . GLU A 72  ? 0.2731 0.3409 0.2750 -0.0095 -0.0209 -0.0478 74  GLU A C     
596  O O     . GLU A 72  ? 0.2600 0.3388 0.2638 -0.0132 -0.0220 -0.0437 74  GLU A O     
597  C CB    . GLU A 72  ? 0.3078 0.3617 0.2932 -0.0130 -0.0195 -0.0600 74  GLU A CB    
598  C CG    . GLU A 72  ? 0.3582 0.4169 0.3339 -0.0153 -0.0180 -0.0661 74  GLU A CG    
599  C CD    . GLU A 72  ? 0.3694 0.4457 0.3459 -0.0188 -0.0188 -0.0619 74  GLU A CD    
600  O OE1   . GLU A 72  ? 0.3990 0.4800 0.3759 -0.0253 -0.0229 -0.0574 74  GLU A OE1   
601  O OE2   . GLU A 72  ? 0.3767 0.4626 0.3534 -0.0148 -0.0151 -0.0627 74  GLU A OE2   
602  N N     . LEU A 73  ? 0.2708 0.3289 0.2765 -0.0077 -0.0220 -0.0453 75  LEU A N     
603  C CA    . LEU A 73  ? 0.2677 0.3290 0.2802 -0.0093 -0.0244 -0.0381 75  LEU A CA    
604  C C     . LEU A 73  ? 0.2593 0.3317 0.2766 -0.0070 -0.0237 -0.0352 75  LEU A C     
605  O O     . LEU A 73  ? 0.2554 0.3334 0.2746 -0.0110 -0.0251 -0.0305 75  LEU A O     
606  C CB    . LEU A 73  ? 0.2666 0.3160 0.2814 -0.0069 -0.0249 -0.0360 75  LEU A CB    
607  C CG    . LEU A 73  ? 0.2773 0.3227 0.2921 -0.0136 -0.0272 -0.0338 75  LEU A CG    
608  C CD1   . LEU A 73  ? 0.3084 0.3462 0.3160 -0.0178 -0.0268 -0.0400 75  LEU A CD1   
609  C CD2   . LEU A 73  ? 0.2604 0.2982 0.2790 -0.0121 -0.0273 -0.0294 75  LEU A CD2   
610  N N     . ARG A 74  ? 0.2705 0.3462 0.2894 -0.0008 -0.0214 -0.0381 76  ARG A N     
611  C CA    . ARG A 74  ? 0.2727 0.3615 0.2968 -0.0004 -0.0208 -0.0360 76  ARG A CA    
612  C C     . ARG A 74  ? 0.2675 0.3676 0.2898 -0.0056 -0.0194 -0.0361 76  ARG A C     
613  O O     . ARG A 74  ? 0.2606 0.3659 0.2850 -0.0101 -0.0200 -0.0318 76  ARG A O     
614  C CB    . ARG A 74  ? 0.2797 0.3739 0.3078 0.0075  -0.0193 -0.0383 76  ARG A CB    
615  C CG    . ARG A 74  ? 0.3313 0.4248 0.3562 0.0145  -0.0163 -0.0441 76  ARG A CG    
616  C CD    . ARG A 74  ? 0.3898 0.4975 0.4209 0.0220  -0.0149 -0.0451 76  ARG A CD    
617  N NE    . ARG A 74  ? 0.4212 0.5476 0.4574 0.0163  -0.0143 -0.0440 76  ARG A NE    
618  C CZ    . ARG A 74  ? 0.4478 0.5854 0.4827 0.0143  -0.0109 -0.0468 76  ARG A CZ    
619  N NH1   . ARG A 74  ? 0.4711 0.6030 0.4993 0.0185  -0.0081 -0.0516 76  ARG A NH1   
620  N NH2   . ARG A 74  ? 0.4522 0.6058 0.4915 0.0078  -0.0100 -0.0449 76  ARG A NH2   
621  N N     . GLU A 75  ? 0.2722 0.3746 0.2892 -0.0050 -0.0171 -0.0409 77  GLU A N     
622  C CA    . GLU A 75  ? 0.2737 0.3868 0.2873 -0.0099 -0.0152 -0.0408 77  GLU A CA    
623  C C     . GLU A 75  ? 0.2684 0.3790 0.2786 -0.0169 -0.0179 -0.0353 77  GLU A C     
624  O O     . GLU A 75  ? 0.2636 0.3804 0.2743 -0.0211 -0.0173 -0.0307 77  GLU A O     
625  C CB    . GLU A 75  ? 0.2879 0.4020 0.2944 -0.0073 -0.0122 -0.0476 77  GLU A CB    
626  C CG    . GLU A 75  ? 0.2987 0.4213 0.3087 0.0005  -0.0082 -0.0520 77  GLU A CG    
627  C CD    . GLU A 75  ? 0.3178 0.4379 0.3195 0.0051  -0.0046 -0.0595 77  GLU A CD    
628  O OE1   . GLU A 75  ? 0.3536 0.4799 0.3574 0.0135  -0.0009 -0.0633 77  GLU A OE1   
629  O OE2   . GLU A 75  ? 0.3551 0.4673 0.3476 0.0008  -0.0055 -0.0617 77  GLU A OE2   
630  N N     . ARG A 76  ? 0.2729 0.3744 0.2795 -0.0182 -0.0207 -0.0356 78  ARG A N     
631  C CA    . ARG A 76  ? 0.2763 0.3776 0.2803 -0.0233 -0.0237 -0.0302 78  ARG A CA    
632  C C     . ARG A 76  ? 0.2627 0.3614 0.2722 -0.0236 -0.0252 -0.0233 78  ARG A C     
633  O O     . ARG A 76  ? 0.2600 0.3612 0.2672 -0.0266 -0.0256 -0.0178 78  ARG A O     
634  C CB    . ARG A 76  ? 0.2834 0.3789 0.2838 -0.0252 -0.0266 -0.0326 78  ARG A CB    
635  C CG    . ARG A 76  ? 0.3383 0.4360 0.3297 -0.0270 -0.0257 -0.0389 78  ARG A CG    
636  C CD    . ARG A 76  ? 0.4067 0.5127 0.3915 -0.0320 -0.0280 -0.0357 78  ARG A CD    
637  N NE    . ARG A 76  ? 0.4391 0.5517 0.4249 -0.0325 -0.0269 -0.0284 78  ARG A NE    
638  C CZ    . ARG A 76  ? 0.4557 0.5706 0.4406 -0.0345 -0.0298 -0.0209 78  ARG A CZ    
639  N NH1   . ARG A 76  ? 0.4561 0.5713 0.4408 -0.0360 -0.0342 -0.0196 78  ARG A NH1   
640  N NH2   . ARG A 76  ? 0.4709 0.5880 0.4548 -0.0349 -0.0279 -0.0146 78  ARG A NH2   
641  N N     . GLY A 77  ? 0.2474 0.3397 0.2624 -0.0201 -0.0258 -0.0235 79  GLY A N     
642  C CA    . GLY A 77  ? 0.2396 0.3283 0.2587 -0.0198 -0.0269 -0.0181 79  GLY A CA    
643  C C     . GLY A 77  ? 0.2418 0.3351 0.2617 -0.0216 -0.0250 -0.0159 79  GLY A C     
644  O O     . GLY A 77  ? 0.2436 0.3337 0.2620 -0.0238 -0.0254 -0.0106 79  GLY A O     
645  N N     . LEU A 78  ? 0.2420 0.3427 0.2640 -0.0206 -0.0228 -0.0200 80  LEU A N     
646  C CA    . LEU A 78  ? 0.2454 0.3529 0.2687 -0.0243 -0.0208 -0.0186 80  LEU A CA    
647  C C     . LEU A 78  ? 0.2531 0.3632 0.2703 -0.0300 -0.0191 -0.0151 80  LEU A C     
648  O O     . LEU A 78  ? 0.2549 0.3625 0.2704 -0.0345 -0.0182 -0.0108 80  LEU A O     
649  C CB    . LEU A 78  ? 0.2402 0.3593 0.2687 -0.0217 -0.0188 -0.0237 80  LEU A CB    
650  C CG    . LEU A 78  ? 0.2513 0.3695 0.2853 -0.0148 -0.0202 -0.0265 80  LEU A CG    
651  C CD1   . LEU A 78  ? 0.2450 0.3793 0.2847 -0.0127 -0.0183 -0.0301 80  LEU A CD1   
652  C CD2   . LEU A 78  ? 0.2621 0.3717 0.2976 -0.0147 -0.0229 -0.0232 80  LEU A CD2   
653  N N     . GLU A 79  ? 0.2607 0.3740 0.2731 -0.0299 -0.0186 -0.0168 81  GLU A N     
654  C CA    . GLU A 79  ? 0.2806 0.3966 0.2853 -0.0344 -0.0173 -0.0132 81  GLU A CA    
655  C C     . GLU A 79  ? 0.2694 0.3758 0.2703 -0.0356 -0.0196 -0.0057 81  GLU A C     
656  O O     . GLU A 79  ? 0.2709 0.3751 0.2672 -0.0394 -0.0177 -0.0005 81  GLU A O     
657  C CB    . GLU A 79  ? 0.2831 0.4035 0.2825 -0.0332 -0.0173 -0.0174 81  GLU A CB    
658  C CG    . GLU A 79  ? 0.3255 0.4525 0.3162 -0.0371 -0.0150 -0.0153 81  GLU A CG    
659  C CD    . GLU A 79  ? 0.3465 0.4770 0.3304 -0.0360 -0.0155 -0.0205 81  GLU A CD    
660  O OE1   . GLU A 79  ? 0.4068 0.5416 0.3917 -0.0332 -0.0131 -0.0278 81  GLU A OE1   
661  O OE2   . GLU A 79  ? 0.3950 0.5242 0.3721 -0.0375 -0.0185 -0.0176 81  GLU A OE2   
662  N N     . ILE A 80  ? 0.2570 0.3577 0.2598 -0.0321 -0.0231 -0.0051 82  ILE A N     
663  C CA    . ILE A 80  ? 0.2527 0.3461 0.2532 -0.0312 -0.0253 0.0019  82  ILE A CA    
664  C C     . ILE A 80  ? 0.2534 0.3379 0.2553 -0.0314 -0.0239 0.0054  82  ILE A C     
665  O O     . ILE A 80  ? 0.2612 0.3390 0.2574 -0.0323 -0.0231 0.0118  82  ILE A O     
666  C CB    . ILE A 80  ? 0.2480 0.3405 0.2519 -0.0279 -0.0290 0.0014  82  ILE A CB    
667  C CG1   . ILE A 80  ? 0.2479 0.3480 0.2476 -0.0295 -0.0308 -0.0014 82  ILE A CG1   
668  C CG2   . ILE A 80  ? 0.2388 0.3254 0.2425 -0.0253 -0.0306 0.0086  82  ILE A CG2   
669  C CD1   . ILE A 80  ? 0.2446 0.3445 0.2484 -0.0286 -0.0334 -0.0060 82  ILE A CD1   
670  N N     . GLY A 81  ? 0.2410 0.3244 0.2492 -0.0304 -0.0237 0.0013  83  GLY A N     
671  C CA    . GLY A 81  ? 0.2415 0.3167 0.2503 -0.0313 -0.0228 0.0031  83  GLY A CA    
672  C C     . GLY A 81  ? 0.2498 0.3237 0.2534 -0.0376 -0.0196 0.0055  83  GLY A C     
673  O O     . GLY A 81  ? 0.2556 0.3176 0.2538 -0.0390 -0.0187 0.0103  83  GLY A O     
674  N N     . LYS A 82  ? 0.2503 0.3355 0.2549 -0.0415 -0.0175 0.0023  84  LYS A N     
675  C CA    . LYS A 82  ? 0.2642 0.3503 0.2644 -0.0491 -0.0138 0.0044  84  LYS A CA    
676  C C     . LYS A 82  ? 0.2753 0.3524 0.2648 -0.0510 -0.0123 0.0119  84  LYS A C     
677  O O     . LYS A 82  ? 0.2870 0.3545 0.2704 -0.0565 -0.0094 0.0159  84  LYS A O     
678  C CB    . LYS A 82  ? 0.2655 0.3690 0.2699 -0.0519 -0.0113 -0.0006 84  LYS A CB    
679  C CG    . LYS A 82  ? 0.2751 0.3880 0.2894 -0.0501 -0.0122 -0.0070 84  LYS A CG    
680  C CD    . LYS A 82  ? 0.3243 0.4528 0.3431 -0.0464 -0.0111 -0.0124 84  LYS A CD    
681  C CE    . LYS A 82  ? 0.3493 0.4934 0.3696 -0.0523 -0.0066 -0.0138 84  LYS A CE    
682  N NZ    . LYS A 82  ? 0.3680 0.5261 0.3914 -0.0467 -0.0050 -0.0193 84  LYS A NZ    
683  N N     . ALA A 83  ? 0.2693 0.3491 0.2557 -0.0466 -0.0142 0.0138  85  ALA A N     
684  C CA    . ALA A 83  ? 0.2827 0.3566 0.2583 -0.0469 -0.0134 0.0214  85  ALA A CA    
685  C C     . ALA A 83  ? 0.2890 0.3462 0.2602 -0.0431 -0.0143 0.0280  85  ALA A C     
686  O O     . ALA A 83  ? 0.3052 0.3530 0.2663 -0.0433 -0.0126 0.0355  85  ALA A O     
687  C CB    . ALA A 83  ? 0.2771 0.3610 0.2508 -0.0432 -0.0161 0.0209  85  ALA A CB    
688  N N     . VAL A 84  ? 0.2749 0.3281 0.2530 -0.0391 -0.0166 0.0253  86  VAL A N     
689  C CA    . VAL A 84  ? 0.2798 0.3204 0.2555 -0.0329 -0.0179 0.0304  86  VAL A CA    
690  C C     . VAL A 84  ? 0.2895 0.3137 0.2628 -0.0346 -0.0156 0.0306  86  VAL A C     
691  O O     . VAL A 84  ? 0.2872 0.2982 0.2562 -0.0291 -0.0155 0.0350  86  VAL A O     
692  C CB    . VAL A 84  ? 0.2721 0.3216 0.2564 -0.0266 -0.0221 0.0277  86  VAL A CB    
693  C CG1   . VAL A 84  ? 0.2605 0.3034 0.2506 -0.0233 -0.0227 0.0253  86  VAL A CG1   
694  C CG2   . VAL A 84  ? 0.2647 0.3187 0.2458 -0.0215 -0.0246 0.0335  86  VAL A CG2   
695  N N     . LEU A 85  ? 0.2958 0.3215 0.2712 -0.0422 -0.0136 0.0257  87  LEU A N     
696  C CA    . LEU A 85  ? 0.3092 0.3208 0.2821 -0.0455 -0.0120 0.0242  87  LEU A CA    
697  C C     . LEU A 85  ? 0.3308 0.3343 0.2957 -0.0558 -0.0077 0.0258  87  LEU A C     
698  O O     . LEU A 85  ? 0.3368 0.3519 0.3024 -0.0617 -0.0059 0.0254  87  LEU A O     
699  C CB    . LEU A 85  ? 0.2980 0.3194 0.2811 -0.0460 -0.0142 0.0164  87  LEU A CB    
700  C CG    . LEU A 85  ? 0.2691 0.2987 0.2604 -0.0375 -0.0178 0.0141  87  LEU A CG    
701  C CD1   . LEU A 85  ? 0.2627 0.3044 0.2628 -0.0390 -0.0193 0.0069  87  LEU A CD1   
702  C CD2   . LEU A 85  ? 0.2573 0.2740 0.2461 -0.0305 -0.0186 0.0170  87  LEU A CD2   
703  N N     . ASP A 86  ? 0.3503 0.3330 0.3067 -0.0584 -0.0055 0.0274  88  ASP A N     
704  C CA    . ASP A 86  ? 0.3716 0.3420 0.3183 -0.0694 -0.0008 0.0296  88  ASP A CA    
705  C C     . ASP A 86  ? 0.3728 0.3593 0.3276 -0.0809 -0.0002 0.0224  88  ASP A C     
706  O O     . ASP A 86  ? 0.3766 0.3680 0.3290 -0.0904 0.0033  0.0237  88  ASP A O     
707  C CB    . ASP A 86  ? 0.3910 0.3326 0.3256 -0.0696 0.0016  0.0318  88  ASP A CB    
708  C CG    . ASP A 86  ? 0.4048 0.3300 0.3300 -0.0578 0.0022  0.0402  88  ASP A CG    
709  O OD1   . ASP A 86  ? 0.3842 0.3206 0.3113 -0.0513 0.0007  0.0450  88  ASP A OD1   
710  O OD2   . ASP A 86  ? 0.4270 0.3283 0.3423 -0.0547 0.0041  0.0418  88  ASP A OD2   
711  N N     . SER A 87  ? 0.3655 0.3607 0.3295 -0.0795 -0.0036 0.0154  89  SER A N     
712  C CA    . SER A 87  ? 0.3628 0.3782 0.3370 -0.0873 -0.0045 0.0082  89  SER A CA    
713  C C     . SER A 87  ? 0.3488 0.3786 0.3342 -0.0774 -0.0093 0.0036  89  SER A C     
714  O O     . SER A 87  ? 0.3441 0.3644 0.3279 -0.0677 -0.0113 0.0056  89  SER A O     
715  C CB    . SER A 87  ? 0.3794 0.3842 0.3491 -0.0984 -0.0033 0.0047  89  SER A CB    
716  O OG    . SER A 87  ? 0.3772 0.3646 0.3420 -0.0928 -0.0053 0.0034  89  SER A OG    
717  N N     . TYR A 88  ? 0.3365 0.3893 0.3330 -0.0794 -0.0107 -0.0019 90  TYR A N     
718  C CA    . TYR A 88  ? 0.3261 0.3909 0.3319 -0.0695 -0.0146 -0.0056 90  TYR A CA    
719  C C     . TYR A 88  ? 0.3213 0.4070 0.3372 -0.0720 -0.0164 -0.0121 90  TYR A C     
720  O O     . TYR A 88  ? 0.3224 0.4207 0.3413 -0.0813 -0.0144 -0.0140 90  TYR A O     
721  C CB    . TYR A 88  ? 0.3217 0.3934 0.3296 -0.0621 -0.0147 -0.0034 90  TYR A CB    
722  C CG    . TYR A 88  ? 0.3247 0.4145 0.3365 -0.0662 -0.0121 -0.0048 90  TYR A CG    
723  C CD1   . TYR A 88  ? 0.3185 0.4286 0.3404 -0.0635 -0.0131 -0.0103 90  TYR A CD1   
724  C CD2   . TYR A 88  ? 0.3350 0.4213 0.3395 -0.0718 -0.0083 -0.0001 90  TYR A CD2   
725  C CE1   . TYR A 88  ? 0.3298 0.4574 0.3551 -0.0663 -0.0100 -0.0119 90  TYR A CE1   
726  C CE2   . TYR A 88  ? 0.3500 0.4536 0.3573 -0.0755 -0.0053 -0.0014 90  TYR A CE2   
727  C CZ    . TYR A 88  ? 0.3368 0.4616 0.3549 -0.0726 -0.0060 -0.0076 90  TYR A CZ    
728  O OH    . TYR A 88  ? 0.3458 0.4886 0.3667 -0.0750 -0.0024 -0.0092 90  TYR A OH    
729  N N     . GLU A 89  ? 0.3158 0.4058 0.3371 -0.0634 -0.0201 -0.0150 91  GLU A N     
730  C CA    . GLU A 89  ? 0.3152 0.4264 0.3463 -0.0617 -0.0224 -0.0203 91  GLU A CA    
731  C C     . GLU A 89  ? 0.2971 0.4133 0.3328 -0.0498 -0.0239 -0.0207 91  GLU A C     
732  O O     . GLU A 89  ? 0.2928 0.3949 0.3247 -0.0432 -0.0251 -0.0183 91  GLU A O     
733  C CB    . GLU A 89  ? 0.3212 0.4295 0.3517 -0.0623 -0.0258 -0.0233 91  GLU A CB    
734  C CG    . GLU A 89  ? 0.3781 0.4796 0.4030 -0.0747 -0.0251 -0.0247 91  GLU A CG    
735  C CD    . GLU A 89  ? 0.4196 0.5183 0.4426 -0.0736 -0.0291 -0.0285 91  GLU A CD    
736  O OE1   . GLU A 89  ? 0.4580 0.5346 0.4705 -0.0756 -0.0288 -0.0277 91  GLU A OE1   
737  O OE2   . GLU A 89  ? 0.4285 0.5469 0.4597 -0.0695 -0.0326 -0.0320 91  GLU A OE2   
738  N N     . ILE A 90  ? 0.2875 0.4238 0.3313 -0.0469 -0.0237 -0.0238 92  ILE A N     
739  C CA    . ILE A 90  ? 0.2830 0.4222 0.3303 -0.0353 -0.0251 -0.0251 92  ILE A CA    
740  C C     . ILE A 90  ? 0.2796 0.4343 0.3339 -0.0302 -0.0278 -0.0288 92  ILE A C     
741  O O     . ILE A 90  ? 0.2776 0.4535 0.3391 -0.0315 -0.0269 -0.0316 92  ILE A O     
742  C CB    . ILE A 90  ? 0.2829 0.4271 0.3305 -0.0326 -0.0221 -0.0252 92  ILE A CB    
743  C CG1   . ILE A 90  ? 0.2925 0.4211 0.3321 -0.0362 -0.0206 -0.0208 92  ILE A CG1   
744  C CG2   . ILE A 90  ? 0.2802 0.4243 0.3299 -0.0212 -0.0232 -0.0272 92  ILE A CG2   
745  C CD1   . ILE A 90  ? 0.3017 0.4376 0.3395 -0.0389 -0.0171 -0.0205 92  ILE A CD1   
746  N N     . ARG A 91  ? 0.2726 0.4179 0.3249 -0.0240 -0.0309 -0.0284 93  ARG A N     
747  C CA    . ARG A 91  ? 0.2793 0.4372 0.3363 -0.0179 -0.0340 -0.0309 93  ARG A CA    
748  C C     . ARG A 91  ? 0.2648 0.4078 0.3176 -0.0083 -0.0358 -0.0289 93  ARG A C     
749  O O     . ARG A 91  ? 0.2676 0.3941 0.3141 -0.0100 -0.0364 -0.0267 93  ARG A O     
750  C CB    . ARG A 91  ? 0.2831 0.4489 0.3407 -0.0265 -0.0365 -0.0329 93  ARG A CB    
751  C CG    . ARG A 91  ? 0.3107 0.5031 0.3770 -0.0238 -0.0393 -0.0364 93  ARG A CG    
752  C CD    . ARG A 91  ? 0.3162 0.5202 0.3840 -0.0364 -0.0412 -0.0393 93  ARG A CD    
753  N NE    . ARG A 91  ? 0.3815 0.6060 0.4545 -0.0329 -0.0462 -0.0422 93  ARG A NE    
754  C CZ    . ARG A 91  ? 0.4067 0.6607 0.4907 -0.0288 -0.0472 -0.0443 93  ARG A CZ    
755  N NH1   . ARG A 91  ? 0.4153 0.6815 0.5060 -0.0275 -0.0429 -0.0442 93  ARG A NH1   
756  N NH2   . ARG A 91  ? 0.4228 0.6953 0.5105 -0.0252 -0.0524 -0.0464 93  ARG A NH2   
757  N N     . TYR A 92  ? 0.2510 0.3988 0.3065 0.0021  -0.0359 -0.0296 94  TYR A N     
758  C CA    . TYR A 92  ? 0.2376 0.3701 0.2884 0.0108  -0.0366 -0.0273 94  TYR A CA    
759  C C     . TYR A 92  ? 0.2247 0.3667 0.2784 0.0222  -0.0374 -0.0284 94  TYR A C     
760  O O     . TYR A 92  ? 0.2248 0.3846 0.2845 0.0242  -0.0367 -0.0310 94  TYR A O     
761  C CB    . TYR A 92  ? 0.2366 0.3527 0.2836 0.0104  -0.0339 -0.0253 94  TYR A CB    
762  C CG    . TYR A 92  ? 0.2346 0.3562 0.2837 0.0112  -0.0311 -0.0274 94  TYR A CG    
763  C CD1   . TYR A 92  ? 0.2249 0.3447 0.2737 0.0205  -0.0299 -0.0289 94  TYR A CD1   
764  C CD2   . TYR A 92  ? 0.2269 0.3539 0.2769 0.0030  -0.0292 -0.0280 94  TYR A CD2   
765  C CE1   . TYR A 92  ? 0.2339 0.3576 0.2831 0.0216  -0.0269 -0.0317 94  TYR A CE1   
766  C CE2   . TYR A 92  ? 0.2239 0.3566 0.2746 0.0040  -0.0263 -0.0302 94  TYR A CE2   
767  C CZ    . TYR A 92  ? 0.2402 0.3713 0.2904 0.0133  -0.0252 -0.0325 94  TYR A CZ    
768  O OH    . TYR A 92  ? 0.2526 0.3877 0.3019 0.0147  -0.0220 -0.0355 94  TYR A OH    
769  N N     . ALA A 93  ? 0.2133 0.3434 0.2623 0.0302  -0.0385 -0.0260 95  ALA A N     
770  C CA    . ALA A 93  ? 0.2075 0.3423 0.2568 0.0428  -0.0391 -0.0258 95  ALA A CA    
771  C C     . ALA A 93  ? 0.2077 0.3302 0.2544 0.0493  -0.0354 -0.0259 95  ALA A C     
772  O O     . ALA A 93  ? 0.2133 0.3442 0.2621 0.0581  -0.0343 -0.0275 95  ALA A O     
773  C CB    . ALA A 93  ? 0.2105 0.3375 0.2541 0.0482  -0.0418 -0.0226 95  ALA A CB    
774  N N     . GLU A 94  ? 0.2040 0.3067 0.2456 0.0452  -0.0334 -0.0242 96  GLU A N     
775  C CA    . GLU A 94  ? 0.2129 0.3011 0.2504 0.0495  -0.0301 -0.0249 96  GLU A CA    
776  C C     . GLU A 94  ? 0.2100 0.2887 0.2460 0.0399  -0.0284 -0.0253 96  GLU A C     
777  O O     . GLU A 94  ? 0.2001 0.2810 0.2364 0.0383  -0.0263 -0.0285 96  GLU A O     
778  C CB    . GLU A 94  ? 0.2249 0.2960 0.2556 0.0575  -0.0298 -0.0214 96  GLU A CB    
779  C CG    . GLU A 94  ? 0.2338 0.2864 0.2585 0.0611  -0.0261 -0.0223 96  GLU A CG    
780  C CD    . GLU A 94  ? 0.2395 0.2762 0.2610 0.0517  -0.0248 -0.0211 96  GLU A CD    
781  O OE1   . GLU A 94  ? 0.2732 0.3066 0.2941 0.0468  -0.0231 -0.0243 96  GLU A OE1   
782  O OE2   . GLU A 94  ? 0.2604 0.2894 0.2799 0.0493  -0.0256 -0.0169 96  GLU A OE2   
783  N N     . HIS A 95  ? 0.2065 0.2759 0.2406 0.0341  -0.0293 -0.0220 97  HIS A N     
784  C CA    . HIS A 95  ? 0.2113 0.2738 0.2444 0.0260  -0.0283 -0.0216 97  HIS A CA    
785  C C     . HIS A 95  ? 0.2050 0.2787 0.2414 0.0183  -0.0290 -0.0222 97  HIS A C     
786  O O     . HIS A 95  ? 0.1999 0.2778 0.2375 0.0155  -0.0306 -0.0205 97  HIS A O     
787  C CB    . HIS A 95  ? 0.2090 0.2580 0.2391 0.0239  -0.0283 -0.0175 97  HIS A CB    
788  C CG    . HIS A 95  ? 0.2210 0.2658 0.2510 0.0165  -0.0276 -0.0171 97  HIS A CG    
789  N ND1   . HIS A 95  ? 0.2236 0.2737 0.2555 0.0105  -0.0286 -0.0153 97  HIS A ND1   
790  C CD2   . HIS A 95  ? 0.2189 0.2557 0.2466 0.0143  -0.0263 -0.0184 97  HIS A CD2   
791  C CE1   . HIS A 95  ? 0.2117 0.2591 0.2432 0.0058  -0.0282 -0.0149 97  HIS A CE1   
792  N NE2   . HIS A 95  ? 0.2364 0.2764 0.2655 0.0072  -0.0270 -0.0171 97  HIS A NE2   
793  N N     . PRO A 96  ? 0.2067 0.2836 0.2431 0.0147  -0.0274 -0.0246 98  PRO A N     
794  C CA    . PRO A 96  ? 0.2064 0.2933 0.2446 0.0077  -0.0273 -0.0247 98  PRO A CA    
795  C C     . PRO A 96  ? 0.2040 0.2846 0.2405 0.0015  -0.0282 -0.0207 98  PRO A C     
796  O O     . PRO A 96  ? 0.2069 0.2774 0.2413 0.0014  -0.0285 -0.0184 98  PRO A O     
797  C CB    . PRO A 96  ? 0.2147 0.3041 0.2512 0.0070  -0.0251 -0.0281 98  PRO A CB    
798  C CG    . PRO A 96  ? 0.2281 0.3031 0.2605 0.0101  -0.0248 -0.0287 98  PRO A CG    
799  C CD    . PRO A 96  ? 0.2080 0.2778 0.2410 0.0170  -0.0255 -0.0275 98  PRO A CD    
800  N N     . TYR A 97  ? 0.2020 0.2885 0.2392 -0.0035 -0.0284 -0.0196 99  TYR A N     
801  C CA    . TYR A 97  ? 0.1977 0.2775 0.2320 -0.0086 -0.0286 -0.0156 99  TYR A CA    
802  C C     . TYR A 97  ? 0.2001 0.2860 0.2339 -0.0148 -0.0278 -0.0156 99  TYR A C     
803  O O     . TYR A 97  ? 0.1994 0.2967 0.2367 -0.0157 -0.0275 -0.0187 99  TYR A O     
804  C CB    . TYR A 97  ? 0.1920 0.2619 0.2249 -0.0059 -0.0298 -0.0128 99  TYR A CB    
805  C CG    . TYR A 97  ? 0.1849 0.2571 0.2181 -0.0050 -0.0309 -0.0141 99  TYR A CG    
806  C CD1   . TYR A 97  ? 0.1857 0.2546 0.2158 -0.0098 -0.0310 -0.0130 99  TYR A CD1   
807  C CD2   . TYR A 97  ? 0.1643 0.2410 0.1996 0.0006  -0.0320 -0.0163 99  TYR A CD2   
808  C CE1   . TYR A 97  ? 0.1517 0.2231 0.1811 -0.0102 -0.0325 -0.0151 99  TYR A CE1   
809  C CE2   . TYR A 97  ? 0.1434 0.2246 0.1787 0.0015  -0.0338 -0.0176 99  TYR A CE2   
810  C CZ    . TYR A 97  ? 0.1780 0.2571 0.2104 -0.0046 -0.0343 -0.0174 99  TYR A CZ    
811  O OH    . TYR A 97  ? 0.1706 0.2547 0.2021 -0.0047 -0.0366 -0.0195 99  TYR A OH    
812  N N     . VAL A 98  ? 0.2057 0.2845 0.2353 -0.0191 -0.0271 -0.0118 100 VAL A N     
813  C CA    . VAL A 98  ? 0.2105 0.2904 0.2375 -0.0261 -0.0257 -0.0108 100 VAL A CA    
814  C C     . VAL A 98  ? 0.2232 0.2898 0.2454 -0.0272 -0.0260 -0.0081 100 VAL A C     
815  O O     . VAL A 98  ? 0.2174 0.2736 0.2364 -0.0238 -0.0262 -0.0043 100 VAL A O     
816  C CB    . VAL A 98  ? 0.2150 0.2960 0.2383 -0.0300 -0.0237 -0.0083 100 VAL A CB    
817  C CG1   . VAL A 98  ? 0.2145 0.2955 0.2341 -0.0382 -0.0213 -0.0069 100 VAL A CG1   
818  C CG2   . VAL A 98  ? 0.2004 0.2930 0.2268 -0.0281 -0.0231 -0.0117 100 VAL A CG2   
819  N N     . HIS A 99  ? 0.2281 0.2960 0.2497 -0.0319 -0.0261 -0.0103 101 HIS A N     
820  C CA    . HIS A 99  ? 0.2455 0.2989 0.2603 -0.0343 -0.0258 -0.0087 101 HIS A CA    
821  C C     . HIS A 99  ? 0.2601 0.3070 0.2688 -0.0426 -0.0230 -0.0065 101 HIS A C     
822  O O     . HIS A 99  ? 0.2604 0.3183 0.2716 -0.0493 -0.0218 -0.0083 101 HIS A O     
823  C CB    . HIS A 99  ? 0.2490 0.3056 0.2648 -0.0354 -0.0278 -0.0131 101 HIS A CB    
824  C CG    . HIS A 99  ? 0.2743 0.3140 0.2814 -0.0369 -0.0275 -0.0125 101 HIS A CG    
825  N ND1   . HIS A 99  ? 0.2974 0.3255 0.3009 -0.0294 -0.0276 -0.0102 101 HIS A ND1   
826  C CD2   . HIS A 99  ? 0.3086 0.3395 0.3088 -0.0453 -0.0264 -0.0140 101 HIS A CD2   
827  C CE1   . HIS A 99  ? 0.3201 0.3331 0.3145 -0.0318 -0.0265 -0.0105 101 HIS A CE1   
828  N NE2   . HIS A 99  ? 0.3383 0.3513 0.3300 -0.0418 -0.0259 -0.0130 101 HIS A NE2   
829  N N     . GLY A 100 ? 0.2691 0.2980 0.2693 -0.0419 -0.0215 -0.0023 102 GLY A N     
830  C CA    . GLY A 100 ? 0.2854 0.3038 0.2774 -0.0493 -0.0183 0.0006  102 GLY A CA    
831  C C     . GLY A 100 ? 0.2993 0.2945 0.2804 -0.0473 -0.0166 0.0041  102 GLY A C     
832  O O     . GLY A 100 ? 0.3011 0.2895 0.2810 -0.0421 -0.0178 0.0026  102 GLY A O     
833  N N     . VAL A 101 ? 0.3132 0.2959 0.2855 -0.0507 -0.0134 0.0091  103 VAL A N     
834  C CA    . VAL A 101 ? 0.3308 0.2883 0.2905 -0.0488 -0.0107 0.0129  103 VAL A CA    
835  C C     . VAL A 101 ? 0.3347 0.2852 0.2884 -0.0442 -0.0086 0.0212  103 VAL A C     
836  O O     . VAL A 101 ? 0.3288 0.2868 0.2826 -0.0492 -0.0075 0.0235  103 VAL A O     
837  C CB    . VAL A 101 ? 0.3540 0.2971 0.3045 -0.0609 -0.0081 0.0098  103 VAL A CB    
838  C CG1   . VAL A 101 ? 0.3819 0.2947 0.3170 -0.0581 -0.0046 0.0133  103 VAL A CG1   
839  C CG2   . VAL A 101 ? 0.3505 0.3047 0.3073 -0.0661 -0.0110 0.0012  103 VAL A CG2   
840  N N     . VAL A 102 ? 0.3343 0.2728 0.2832 -0.0338 -0.0081 0.0259  104 VAL A N     
841  C CA    . VAL A 102 ? 0.3412 0.2705 0.2822 -0.0280 -0.0060 0.0347  104 VAL A CA    
842  C C     . VAL A 102 ? 0.3619 0.2634 0.2893 -0.0231 -0.0025 0.0379  104 VAL A C     
843  O O     . VAL A 102 ? 0.3557 0.2526 0.2839 -0.0158 -0.0029 0.0360  104 VAL A O     
844  C CB    . VAL A 102 ? 0.3262 0.2725 0.2758 -0.0178 -0.0092 0.0383  104 VAL A CB    
845  C CG1   . VAL A 102 ? 0.3354 0.2744 0.2765 -0.0114 -0.0078 0.0478  104 VAL A CG1   
846  C CG2   . VAL A 102 ? 0.3105 0.2810 0.2716 -0.0223 -0.0124 0.0342  104 VAL A CG2   
847  N N     . LYS A 103 ? 0.3801 0.2617 0.2940 -0.0272 0.0016  0.0426  105 LYS A N     
848  C CA    . LYS A 103 ? 0.4087 0.2589 0.3065 -0.0223 0.0060  0.0461  105 LYS A CA    
849  C C     . LYS A 103 ? 0.4109 0.2488 0.3058 -0.0245 0.0065  0.0382  105 LYS A C     
850  O O     . LYS A 103 ? 0.4164 0.2412 0.3060 -0.0136 0.0080  0.0391  105 LYS A O     
851  C CB    . LYS A 103 ? 0.4057 0.2535 0.3010 -0.0057 0.0063  0.0550  105 LYS A CB    
852  C CG    . LYS A 103 ? 0.4205 0.2771 0.3146 -0.0039 0.0058  0.0634  105 LYS A CG    
853  C CD    . LYS A 103 ? 0.4232 0.2769 0.3134 0.0126  0.0061  0.0728  105 LYS A CD    
854  C CE    . LYS A 103 ? 0.4668 0.2849 0.3373 0.0181  0.0120  0.0785  105 LYS A CE    
855  N NZ    . LYS A 103 ? 0.4838 0.3025 0.3516 0.0360  0.0120  0.0881  105 LYS A NZ    
856  N N     . GLY A 104 ? 0.4052 0.2496 0.3039 -0.0382 0.0053  0.0302  106 GLY A N     
857  C CA    . GLY A 104 ? 0.4156 0.2515 0.3114 -0.0426 0.0049  0.0217  106 GLY A CA    
858  C C     . GLY A 104 ? 0.3967 0.2509 0.3043 -0.0353 0.0008  0.0170  106 GLY A C     
859  O O     . GLY A 104 ? 0.3989 0.2491 0.3042 -0.0390 -0.0001 0.0098  106 GLY A O     
860  N N     . VAL A 105 ? 0.3834 0.2572 0.3026 -0.0255 -0.0017 0.0210  107 VAL A N     
861  C CA    . VAL A 105 ? 0.3660 0.2561 0.2960 -0.0186 -0.0050 0.0176  107 VAL A CA    
862  C C     . VAL A 105 ? 0.3437 0.2616 0.2888 -0.0238 -0.0093 0.0138  107 VAL A C     
863  O O     . VAL A 105 ? 0.3326 0.2633 0.2836 -0.0261 -0.0102 0.0167  107 VAL A O     
864  C CB    . VAL A 105 ? 0.3576 0.2493 0.2897 -0.0035 -0.0042 0.0242  107 VAL A CB    
865  C CG1   . VAL A 105 ? 0.3721 0.2802 0.3123 -0.0013 -0.0059 0.0301  107 VAL A CG1   
866  C CG2   . VAL A 105 ? 0.3424 0.2467 0.2831 0.0026  -0.0063 0.0210  107 VAL A CG2   
867  N N     . GLU A 106 ? 0.3349 0.2611 0.2849 -0.0247 -0.0119 0.0075  108 GLU A N     
868  C CA    . GLU A 106 ? 0.3159 0.2666 0.2793 -0.0266 -0.0158 0.0040  108 GLU A CA    
869  C C     . GLU A 106 ? 0.2855 0.2497 0.2584 -0.0181 -0.0171 0.0081  108 GLU A C     
870  O O     . GLU A 106 ? 0.2778 0.2372 0.2497 -0.0092 -0.0162 0.0115  108 GLU A O     
871  C CB    . GLU A 106 ? 0.3264 0.2802 0.2906 -0.0264 -0.0180 -0.0021 108 GLU A CB    
872  C CG    . GLU A 106 ? 0.3831 0.3223 0.3365 -0.0343 -0.0172 -0.0071 108 GLU A CG    
873  C CD    . GLU A 106 ? 0.4443 0.3979 0.4029 -0.0456 -0.0196 -0.0121 108 GLU A CD    
874  O OE1   . GLU A 106 ? 0.4656 0.4351 0.4310 -0.0452 -0.0232 -0.0165 108 GLU A OE1   
875  O OE2   . GLU A 106 ? 0.4956 0.4457 0.4516 -0.0545 -0.0177 -0.0112 108 GLU A OE2   
876  N N     . VAL A 107 ? 0.2644 0.2462 0.2465 -0.0211 -0.0192 0.0073  109 VAL A N     
877  C CA    . VAL A 107 ? 0.2466 0.2410 0.2368 -0.0154 -0.0206 0.0101  109 VAL A CA    
878  C C     . VAL A 107 ? 0.2299 0.2410 0.2293 -0.0175 -0.0232 0.0054  109 VAL A C     
879  O O     . VAL A 107 ? 0.2337 0.2513 0.2344 -0.0241 -0.0235 0.0019  109 VAL A O     
880  C CB    . VAL A 107 ? 0.2539 0.2492 0.2423 -0.0162 -0.0196 0.0154  109 VAL A CB    
881  C CG1   . VAL A 107 ? 0.2179 0.2263 0.2137 -0.0111 -0.0216 0.0179  109 VAL A CG1   
882  C CG2   . VAL A 107 ? 0.2670 0.2435 0.2442 -0.0138 -0.0166 0.0208  109 VAL A CG2   
883  N N     . ASP A 108 ? 0.2206 0.2387 0.2262 -0.0119 -0.0246 0.0054  110 ASP A N     
884  C CA    . ASP A 108 ? 0.2065 0.2381 0.2197 -0.0123 -0.0265 0.0022  110 ASP A CA    
885  C C     . ASP A 108 ? 0.1993 0.2367 0.2156 -0.0108 -0.0268 0.0049  110 ASP A C     
886  O O     . ASP A 108 ? 0.2050 0.2401 0.2219 -0.0067 -0.0267 0.0085  110 ASP A O     
887  C CB    . ASP A 108 ? 0.2030 0.2363 0.2192 -0.0078 -0.0277 -0.0001 110 ASP A CB    
888  C CG    . ASP A 108 ? 0.2065 0.2423 0.2219 -0.0099 -0.0288 -0.0046 110 ASP A CG    
889  O OD1   . ASP A 108 ? 0.2274 0.2670 0.2421 -0.0160 -0.0288 -0.0068 110 ASP A OD1   
890  O OD2   . ASP A 108 ? 0.2027 0.2379 0.2181 -0.0058 -0.0298 -0.0057 110 ASP A OD2   
891  N N     . VAL A 109 ? 0.1982 0.2444 0.2166 -0.0144 -0.0271 0.0028  111 VAL A N     
892  C CA    . VAL A 109 ? 0.1936 0.2462 0.2141 -0.0139 -0.0279 0.0038  111 VAL A CA    
893  C C     . VAL A 109 ? 0.1873 0.2463 0.2126 -0.0128 -0.0288 -0.0010 111 VAL A C     
894  O O     . VAL A 109 ? 0.1877 0.2523 0.2142 -0.0143 -0.0284 -0.0050 111 VAL A O     
895  C CB    . VAL A 109 ? 0.1984 0.2547 0.2151 -0.0182 -0.0271 0.0053  111 VAL A CB    
896  C CG1   . VAL A 109 ? 0.1905 0.2533 0.2081 -0.0175 -0.0286 0.0063  111 VAL A CG1   
897  C CG2   . VAL A 109 ? 0.2065 0.2531 0.2164 -0.0194 -0.0255 0.0104  111 VAL A CG2   
898  N N     . VAL A 110 ? 0.1879 0.2458 0.2157 -0.0099 -0.0296 -0.0003 112 VAL A N     
899  C CA    . VAL A 110 ? 0.1892 0.2476 0.2198 -0.0078 -0.0299 -0.0041 112 VAL A CA    
900  C C     . VAL A 110 ? 0.1989 0.2595 0.2303 -0.0093 -0.0305 -0.0053 112 VAL A C     
901  O O     . VAL A 110 ? 0.1986 0.2595 0.2311 -0.0102 -0.0313 -0.0022 112 VAL A O     
902  C CB    . VAL A 110 ? 0.1897 0.2416 0.2212 -0.0038 -0.0296 -0.0026 112 VAL A CB    
903  C CG1   . VAL A 110 ? 0.1681 0.2183 0.2008 -0.0009 -0.0295 -0.0057 112 VAL A CG1   
904  C CG2   . VAL A 110 ? 0.1946 0.2435 0.2238 -0.0029 -0.0294 -0.0019 112 VAL A CG2   
905  N N     . PRO A 111 ? 0.2082 0.2709 0.2389 -0.0097 -0.0301 -0.0102 113 PRO A N     
906  C CA    . PRO A 111 ? 0.2143 0.2764 0.2439 -0.0119 -0.0306 -0.0128 113 PRO A CA    
907  C C     . PRO A 111 ? 0.2246 0.2783 0.2554 -0.0100 -0.0301 -0.0133 113 PRO A C     
908  O O     . PRO A 111 ? 0.2210 0.2696 0.2519 -0.0055 -0.0290 -0.0141 113 PRO A O     
909  C CB    . PRO A 111 ? 0.2139 0.2794 0.2407 -0.0118 -0.0295 -0.0182 113 PRO A CB    
910  C CG    . PRO A 111 ? 0.2175 0.2847 0.2463 -0.0078 -0.0283 -0.0189 113 PRO A CG    
911  C CD    . PRO A 111 ? 0.2112 0.2773 0.2419 -0.0079 -0.0291 -0.0140 113 PRO A CD    
912  N N     . CYS A 112 ? 0.2338 0.2865 0.2652 -0.0138 -0.0309 -0.0125 114 CYS A N     
913  C CA    . CYS A 112 ? 0.2527 0.2963 0.2844 -0.0139 -0.0298 -0.0128 114 CYS A CA    
914  C C     . CYS A 112 ? 0.2534 0.2966 0.2838 -0.0207 -0.0307 -0.0156 114 CYS A C     
915  O O     . CYS A 112 ? 0.2448 0.2976 0.2752 -0.0249 -0.0329 -0.0158 114 CYS A O     
916  C CB    . CYS A 112 ? 0.2497 0.2930 0.2853 -0.0121 -0.0293 -0.0069 114 CYS A CB    
917  S SG    . CYS A 112 ? 0.3418 0.3941 0.3823 -0.0174 -0.0306 -0.0025 114 CYS A SG    
918  N N     . TYR A 113 ? 0.2618 0.2934 0.2900 -0.0220 -0.0290 -0.0176 115 TYR A N     
919  C CA    . TYR A 113 ? 0.2671 0.2962 0.2932 -0.0303 -0.0296 -0.0210 115 TYR A CA    
920  C C     . TYR A 113 ? 0.2734 0.3114 0.3061 -0.0361 -0.0309 -0.0163 115 TYR A C     
921  O O     . TYR A 113 ? 0.2672 0.3046 0.3041 -0.0335 -0.0294 -0.0110 115 TYR A O     
922  C CB    . TYR A 113 ? 0.2703 0.2804 0.2897 -0.0301 -0.0267 -0.0254 115 TYR A CB    
923  C CG    . TYR A 113 ? 0.2610 0.2646 0.2738 -0.0245 -0.0254 -0.0311 115 TYR A CG    
924  C CD1   . TYR A 113 ? 0.2562 0.2535 0.2678 -0.0147 -0.0232 -0.0302 115 TYR A CD1   
925  C CD2   . TYR A 113 ? 0.2798 0.2855 0.2875 -0.0284 -0.0263 -0.0373 115 TYR A CD2   
926  C CE1   . TYR A 113 ? 0.2422 0.2367 0.2490 -0.0085 -0.0217 -0.0352 115 TYR A CE1   
927  C CE2   . TYR A 113 ? 0.2810 0.2821 0.2826 -0.0224 -0.0243 -0.0426 115 TYR A CE2   
928  C CZ    . TYR A 113 ? 0.2710 0.2672 0.2729 -0.0122 -0.0219 -0.0414 115 TYR A CZ    
929  O OH    . TYR A 113 ? 0.2594 0.2543 0.2566 -0.0053 -0.0197 -0.0464 115 TYR A OH    
930  N N     . LYS A 114 ? 0.2893 0.3371 0.3227 -0.0438 -0.0338 -0.0182 116 LYS A N     
931  C CA    . LYS A 114 ? 0.3009 0.3612 0.3416 -0.0499 -0.0354 -0.0142 116 LYS A CA    
932  C C     . LYS A 114 ? 0.3196 0.3692 0.3589 -0.0581 -0.0335 -0.0169 116 LYS A C     
933  O O     . LYS A 114 ? 0.3357 0.3843 0.3713 -0.0670 -0.0351 -0.0226 116 LYS A O     
934  C CB    . LYS A 114 ? 0.2977 0.3757 0.3395 -0.0543 -0.0400 -0.0149 116 LYS A CB    
935  C CG    . LYS A 114 ? 0.3133 0.4102 0.3644 -0.0580 -0.0423 -0.0094 116 LYS A CG    
936  C CD    . LYS A 114 ? 0.3296 0.4445 0.3805 -0.0619 -0.0474 -0.0101 116 LYS A CD    
937  C CE    . LYS A 114 ? 0.3553 0.4921 0.4167 -0.0649 -0.0499 -0.0044 116 LYS A CE    
938  N NZ    . LYS A 114 ? 0.3565 0.5134 0.4177 -0.0666 -0.0555 -0.0037 116 LYS A NZ    
939  N N     . LEU A 115 ? 0.3309 0.3710 0.3719 -0.0555 -0.0298 -0.0131 117 LEU A N     
940  C CA    . LEU A 115 ? 0.3641 0.3908 0.4025 -0.0634 -0.0269 -0.0147 117 LEU A CA    
941  C C     . LEU A 115 ? 0.3804 0.4228 0.4285 -0.0717 -0.0272 -0.0102 117 LEU A C     
942  O O     . LEU A 115 ? 0.3667 0.4274 0.4235 -0.0676 -0.0284 -0.0043 117 LEU A O     
943  C CB    . LEU A 115 ? 0.3641 0.3709 0.3975 -0.0560 -0.0222 -0.0125 117 LEU A CB    
944  C CG    . LEU A 115 ? 0.3537 0.3482 0.3797 -0.0451 -0.0214 -0.0151 117 LEU A CG    
945  C CD1   . LEU A 115 ? 0.3525 0.3326 0.3752 -0.0378 -0.0174 -0.0109 117 LEU A CD1   
946  C CD2   . LEU A 115 ? 0.3671 0.3485 0.3838 -0.0476 -0.0214 -0.0233 117 LEU A CD2   
947  N N     . LYS A 116 ? 0.4200 0.4554 0.4664 -0.0837 -0.0260 -0.0132 118 LYS A N     
948  C CA    . LYS A 116 ? 0.4489 0.4928 0.5035 -0.0911 -0.0237 -0.0080 118 LYS A CA    
949  C C     . LYS A 116 ? 0.4700 0.4896 0.5180 -0.0874 -0.0175 -0.0055 118 LYS A C     
950  O O     . LYS A 116 ? 0.4960 0.4908 0.5324 -0.0870 -0.0155 -0.0103 118 LYS A O     
951  C CB    . LYS A 116 ? 0.4655 0.5169 0.5222 -0.1081 -0.0257 -0.0125 118 LYS A CB    
952  C CG    . LYS A 116 ? 0.5133 0.5408 0.5568 -0.1161 -0.0253 -0.0219 118 LYS A CG    
953  C CD    . LYS A 116 ? 0.5674 0.5706 0.6047 -0.1245 -0.0194 -0.0221 118 LYS A CD    
954  C CE    . LYS A 116 ? 0.6013 0.6137 0.6427 -0.1442 -0.0205 -0.0251 118 LYS A CE    
955  N NZ    . LYS A 116 ? 0.6479 0.6334 0.6817 -0.1537 -0.0140 -0.0251 118 LYS A NZ    
956  N N     . GLU A 117 ? 0.4719 0.4979 0.5261 -0.0835 -0.0143 0.0022  119 GLU A N     
957  C CA    . GLU A 117 ? 0.4865 0.4913 0.5337 -0.0785 -0.0085 0.0060  119 GLU A CA    
958  C C     . GLU A 117 ? 0.4792 0.4712 0.5186 -0.0638 -0.0089 0.0053  119 GLU A C     
959  O O     . GLU A 117 ? 0.4784 0.4602 0.5109 -0.0617 -0.0109 -0.0008 119 GLU A O     
960  C CB    . GLU A 117 ? 0.5173 0.4982 0.5556 -0.0892 -0.0047 0.0030  119 GLU A CB    
961  C CG    . GLU A 117 ? 0.5561 0.5469 0.6001 -0.1074 -0.0051 0.0009  119 GLU A CG    
962  C CD    . GLU A 117 ? 0.5950 0.5994 0.6486 -0.1135 -0.0010 0.0085  119 GLU A CD    
963  O OE1   . GLU A 117 ? 0.6156 0.6123 0.6670 -0.1048 0.0037  0.0151  119 GLU A OE1   
964  O OE2   . GLU A 117 ? 0.5998 0.6241 0.6631 -0.1270 -0.0025 0.0079  119 GLU A OE2   
965  N N     . PRO A 118 ? 0.4709 0.4644 0.5112 -0.0538 -0.0067 0.0113  120 PRO A N     
966  C CA    . PRO A 118 ? 0.4681 0.4504 0.5011 -0.0410 -0.0069 0.0109  120 PRO A CA    
967  C C     . PRO A 118 ? 0.4923 0.4487 0.5139 -0.0388 -0.0028 0.0113  120 PRO A C     
968  O O     . PRO A 118 ? 0.4925 0.4420 0.5094 -0.0291 -0.0009 0.0153  120 PRO A O     
969  C CB    . PRO A 118 ? 0.4531 0.4481 0.4910 -0.0331 -0.0064 0.0168  120 PRO A CB    
970  C CG    . PRO A 118 ? 0.4513 0.4610 0.4981 -0.0407 -0.0043 0.0213  120 PRO A CG    
971  C CD    . PRO A 118 ? 0.4664 0.4732 0.5142 -0.0543 -0.0038 0.0184  120 PRO A CD    
972  N N     . LYS A 119 ? 0.5122 0.4540 0.5285 -0.0478 -0.0014 0.0073  121 LYS A N     
973  C CA    . LYS A 119 ? 0.5389 0.4521 0.5424 -0.0459 0.0028  0.0071  121 LYS A CA    
974  C C     . LYS A 119 ? 0.5401 0.4408 0.5358 -0.0419 0.0009  -0.0005 121 LYS A C     
975  O O     . LYS A 119 ? 0.5393 0.4492 0.5383 -0.0480 -0.0025 -0.0068 121 LYS A O     
976  C CB    . LYS A 119 ? 0.5610 0.4623 0.5621 -0.0601 0.0072  0.0084  121 LYS A CB    
977  C CG    . LYS A 119 ? 0.5803 0.4995 0.5916 -0.0669 0.0092  0.0152  121 LYS A CG    
978  C CD    . LYS A 119 ? 0.6161 0.5348 0.6256 -0.0554 0.0123  0.0232  121 LYS A CD    
979  C CE    . LYS A 119 ? 0.6137 0.5602 0.6361 -0.0562 0.0118  0.0279  121 LYS A CE    
980  N NZ    . LYS A 119 ? 0.6272 0.5721 0.6463 -0.0473 0.0157  0.0353  121 LYS A NZ    
981  N N     . ASN A 120 ? 0.5426 0.4231 0.5276 -0.0312 0.0033  0.0002  122 ASN A N     
982  C CA    . ASN A 120 ? 0.5387 0.4085 0.5162 -0.0237 0.0023  -0.0064 122 ASN A CA    
983  C C     . ASN A 120 ? 0.5001 0.3937 0.4862 -0.0207 -0.0030 -0.0104 122 ASN A C     
984  O O     . ASN A 120 ? 0.5085 0.4029 0.4932 -0.0244 -0.0047 -0.0176 122 ASN A O     
985  C CB    . ASN A 120 ? 0.5708 0.4186 0.5388 -0.0331 0.0048  -0.0128 122 ASN A CB    
986  C CG    . ASN A 120 ? 0.6049 0.4330 0.5670 -0.0431 0.0099  -0.0089 122 ASN A CG    
987  O OD1   . ASN A 120 ? 0.6250 0.4440 0.5836 -0.0375 0.0134  -0.0013 122 ASN A OD1   
988  N ND2   . ASN A 120 ? 0.6262 0.4481 0.5868 -0.0588 0.0104  -0.0142 122 ASN A ND2   
989  N N     . ILE A 121 ? 0.4579 0.3698 0.4516 -0.0143 -0.0053 -0.0059 123 ILE A N     
990  C CA    . ILE A 121 ? 0.4102 0.3437 0.4117 -0.0120 -0.0098 -0.0086 123 ILE A CA    
991  C C     . ILE A 121 ? 0.4003 0.3296 0.3966 -0.0053 -0.0106 -0.0149 123 ILE A C     
992  O O     . ILE A 121 ? 0.4115 0.3244 0.3995 0.0028  -0.0081 -0.0155 123 ILE A O     
993  C CB    . ILE A 121 ? 0.3943 0.3428 0.4019 -0.0056 -0.0113 -0.0030 123 ILE A CB    
994  C CG1   . ILE A 121 ? 0.3933 0.3342 0.3951 0.0068  -0.0104 -0.0007 123 ILE A CG1   
995  C CG2   . ILE A 121 ? 0.3893 0.3429 0.4018 -0.0119 -0.0097 0.0029  123 ILE A CG2   
996  C CD1   . ILE A 121 ? 0.3752 0.3314 0.3817 0.0127  -0.0127 0.0026  123 ILE A CD1   
997  N N     . LYS A 122 ? 0.3646 0.3086 0.3654 -0.0083 -0.0137 -0.0193 124 LYS A N     
998  C CA    . LYS A 122 ? 0.3567 0.2989 0.3529 -0.0029 -0.0138 -0.0256 124 LYS A CA    
999  C C     . LYS A 122 ? 0.3270 0.2845 0.3279 0.0067  -0.0157 -0.0244 124 LYS A C     
1000 O O     . LYS A 122 ? 0.3389 0.2921 0.3358 0.0162  -0.0144 -0.0265 124 LYS A O     
1001 C CB    . LYS A 122 ? 0.3541 0.3012 0.3497 -0.0122 -0.0154 -0.0319 124 LYS A CB    
1002 C CG    . LYS A 122 ? 0.3787 0.3207 0.3672 -0.0074 -0.0143 -0.0392 124 LYS A CG    
1003 C CD    . LYS A 122 ? 0.4036 0.3388 0.3860 -0.0178 -0.0144 -0.0461 124 LYS A CD    
1004 C CE    . LYS A 122 ? 0.4378 0.3817 0.4172 -0.0158 -0.0152 -0.0527 124 LYS A CE    
1005 N NZ    . LYS A 122 ? 0.4659 0.4006 0.4388 -0.0035 -0.0117 -0.0562 124 LYS A NZ    
1006 N N     . SER A 123 ? 0.2919 0.2669 0.3009 0.0041  -0.0184 -0.0211 125 SER A N     
1007 C CA    . SER A 123 ? 0.2649 0.2528 0.2781 0.0111  -0.0201 -0.0192 125 SER A CA    
1008 C C     . SER A 123 ? 0.2568 0.2436 0.2713 0.0143  -0.0200 -0.0130 125 SER A C     
1009 O O     . SER A 123 ? 0.2484 0.2293 0.2629 0.0098  -0.0188 -0.0095 125 SER A O     
1010 C CB    . SER A 123 ? 0.2443 0.2496 0.2632 0.0066  -0.0227 -0.0200 125 SER A CB    
1011 O OG    . SER A 123 ? 0.2308 0.2422 0.2543 0.0017  -0.0240 -0.0153 125 SER A OG    
1012 N N     . ALA A 124 ? 0.2462 0.2402 0.2618 0.0217  -0.0212 -0.0120 126 ALA A N     
1013 C CA    . ALA A 124 ? 0.2442 0.2390 0.2598 0.0252  -0.0216 -0.0069 126 ALA A CA    
1014 C C     . ALA A 124 ? 0.2323 0.2329 0.2520 0.0190  -0.0221 -0.0035 126 ALA A C     
1015 O O     . ALA A 124 ? 0.2346 0.2317 0.2528 0.0205  -0.0211 0.0009  126 ALA A O     
1016 C CB    . ALA A 124 ? 0.2424 0.2476 0.2589 0.0324  -0.0237 -0.0078 126 ALA A CB    
1017 N N     . VAL A 125 ? 0.2238 0.2334 0.2480 0.0129  -0.0235 -0.0051 127 VAL A N     
1018 C CA    . VAL A 125 ? 0.2102 0.2262 0.2380 0.0092  -0.0240 -0.0017 127 VAL A CA    
1019 C C     . VAL A 125 ? 0.2163 0.2316 0.2468 0.0026  -0.0229 0.0004  127 VAL A C     
1020 O O     . VAL A 125 ? 0.2088 0.2309 0.2429 0.0007  -0.0230 0.0037  127 VAL A O     
1021 C CB    . VAL A 125 ? 0.2022 0.2291 0.2326 0.0077  -0.0261 -0.0032 127 VAL A CB    
1022 C CG1   . VAL A 125 ? 0.1917 0.2222 0.2207 0.0124  -0.0273 -0.0055 127 VAL A CG1   
1023 C CG2   . VAL A 125 ? 0.1873 0.2189 0.2192 0.0025  -0.0269 -0.0061 127 VAL A CG2   
1024 N N     . ASP A 126 ? 0.2296 0.2368 0.2580 -0.0007 -0.0217 -0.0017 128 ASP A N     
1025 C CA    . ASP A 126 ? 0.2352 0.2442 0.2666 -0.0091 -0.0213 -0.0010 128 ASP A CA    
1026 C C     . ASP A 126 ? 0.2453 0.2571 0.2805 -0.0111 -0.0194 0.0047  128 ASP A C     
1027 O O     . ASP A 126 ? 0.2545 0.2753 0.2950 -0.0177 -0.0199 0.0059  128 ASP A O     
1028 C CB    . ASP A 126 ? 0.2509 0.2473 0.2775 -0.0133 -0.0199 -0.0052 128 ASP A CB    
1029 C CG    . ASP A 126 ? 0.2389 0.2353 0.2622 -0.0129 -0.0215 -0.0115 128 ASP A CG    
1030 O OD1   . ASP A 126 ? 0.2299 0.2388 0.2562 -0.0122 -0.0239 -0.0124 128 ASP A OD1   
1031 O OD2   . ASP A 126 ? 0.2689 0.2518 0.2859 -0.0130 -0.0198 -0.0156 128 ASP A OD2   
1032 N N     . ARG A 127 ? 0.2473 0.2535 0.2798 -0.0052 -0.0173 0.0084  129 ARG A N     
1033 C CA    . ARG A 127 ? 0.2542 0.2641 0.2898 -0.0062 -0.0146 0.0140  129 ARG A CA    
1034 C C     . ARG A 127 ? 0.2342 0.2582 0.2751 -0.0043 -0.0158 0.0164  129 ARG A C     
1035 O O     . ARG A 127 ? 0.2276 0.2596 0.2735 -0.0062 -0.0140 0.0205  129 ARG A O     
1036 C CB    . ARG A 127 ? 0.2546 0.2539 0.2838 0.0000  -0.0117 0.0173  129 ARG A CB    
1037 C CG    . ARG A 127 ? 0.2910 0.2746 0.3145 -0.0022 -0.0087 0.0179  129 ARG A CG    
1038 C CD    . ARG A 127 ? 0.3015 0.2749 0.3171 0.0056  -0.0062 0.0219  129 ARG A CD    
1039 N NE    . ARG A 127 ? 0.3601 0.3323 0.3715 0.0140  -0.0093 0.0190  129 ARG A NE    
1040 C CZ    . ARG A 127 ? 0.3573 0.3176 0.3614 0.0197  -0.0091 0.0181  129 ARG A CZ    
1041 N NH1   . ARG A 127 ? 0.3641 0.3080 0.3621 0.0184  -0.0055 0.0202  129 ARG A NH1   
1042 N NH2   . ARG A 127 ? 0.3639 0.3289 0.3667 0.0269  -0.0124 0.0152  129 ARG A NH2   
1043 N N     . THR A 128 ? 0.2201 0.2468 0.2597 -0.0005 -0.0185 0.0141  130 THR A N     
1044 C CA    . THR A 128 ? 0.2095 0.2438 0.2508 0.0029  -0.0190 0.0164  130 THR A CA    
1045 C C     . THR A 128 ? 0.2040 0.2507 0.2521 0.0000  -0.0191 0.0195  130 THR A C     
1046 O O     . THR A 128 ? 0.1997 0.2508 0.2494 0.0037  -0.0171 0.0235  130 THR A O     
1047 C CB    . THR A 128 ? 0.2049 0.2385 0.2428 0.0055  -0.0216 0.0130  130 THR A CB    
1048 O OG1   . THR A 128 ? 0.2043 0.2302 0.2370 0.0094  -0.0215 0.0110  130 THR A OG1   
1049 C CG2   . THR A 128 ? 0.1847 0.2217 0.2222 0.0085  -0.0215 0.0153  130 THR A CG2   
1050 N N     . PRO A 129 ? 0.1992 0.2525 0.2509 -0.0060 -0.0215 0.0175  131 PRO A N     
1051 C CA    . PRO A 129 ? 0.1942 0.2623 0.2530 -0.0088 -0.0221 0.0208  131 PRO A CA    
1052 C C     . PRO A 129 ? 0.1857 0.2592 0.2499 -0.0109 -0.0189 0.0248  131 PRO A C     
1053 O O     . PRO A 129 ? 0.1827 0.2697 0.2530 -0.0091 -0.0182 0.0291  131 PRO A O     
1054 C CB    . PRO A 129 ? 0.1957 0.2684 0.2556 -0.0161 -0.0255 0.0168  131 PRO A CB    
1055 C CG    . PRO A 129 ? 0.1927 0.2549 0.2458 -0.0143 -0.0267 0.0121  131 PRO A CG    
1056 C CD    . PRO A 129 ? 0.2033 0.2527 0.2523 -0.0099 -0.0239 0.0120  131 PRO A CD    
1057 N N     . PHE A 130 ? 0.1872 0.2506 0.2490 -0.0144 -0.0166 0.0237  132 PHE A N     
1058 C CA    . PHE A 130 ? 0.1859 0.2527 0.2517 -0.0176 -0.0125 0.0277  132 PHE A CA    
1059 C C     . PHE A 130 ? 0.1839 0.2495 0.2479 -0.0093 -0.0086 0.0323  132 PHE A C     
1060 O O     . PHE A 130 ? 0.1834 0.2602 0.2533 -0.0094 -0.0054 0.0369  132 PHE A O     
1061 C CB    . PHE A 130 ? 0.2005 0.2531 0.2620 -0.0243 -0.0108 0.0254  132 PHE A CB    
1062 C CG    . PHE A 130 ? 0.2132 0.2664 0.2758 -0.0338 -0.0138 0.0205  132 PHE A CG    
1063 C CD1   . PHE A 130 ? 0.2321 0.2745 0.2881 -0.0329 -0.0164 0.0148  132 PHE A CD1   
1064 C CD2   . PHE A 130 ? 0.2303 0.2965 0.3006 -0.0440 -0.0138 0.0213  132 PHE A CD2   
1065 C CE1   . PHE A 130 ? 0.2301 0.2721 0.2853 -0.0414 -0.0189 0.0095  132 PHE A CE1   
1066 C CE2   . PHE A 130 ? 0.2541 0.3206 0.3240 -0.0537 -0.0169 0.0158  132 PHE A CE2   
1067 C CZ    . PHE A 130 ? 0.2386 0.2917 0.3001 -0.0520 -0.0193 0.0097  132 PHE A CZ    
1068 N N     . HIS A 131 ? 0.1842 0.2376 0.2398 -0.0022 -0.0089 0.0307  133 HIS A N     
1069 C CA    . HIS A 131 ? 0.1860 0.2376 0.2377 0.0062  -0.0059 0.0337  133 HIS A CA    
1070 C C     . HIS A 131 ? 0.1872 0.2521 0.2443 0.0101  -0.0055 0.0367  133 HIS A C     
1071 O O     . HIS A 131 ? 0.1860 0.2567 0.2448 0.0143  -0.0013 0.0409  133 HIS A O     
1072 C CB    . HIS A 131 ? 0.1854 0.2252 0.2281 0.0117  -0.0080 0.0302  133 HIS A CB    
1073 C CG    . HIS A 131 ? 0.1906 0.2180 0.2269 0.0115  -0.0081 0.0282  133 HIS A CG    
1074 N ND1   . HIS A 131 ? 0.1981 0.2184 0.2282 0.0151  -0.0109 0.0245  133 HIS A ND1   
1075 C CD2   . HIS A 131 ? 0.1920 0.2128 0.2268 0.0084  -0.0056 0.0298  133 HIS A CD2   
1076 C CE1   . HIS A 131 ? 0.2219 0.2330 0.2472 0.0158  -0.0104 0.0241  133 HIS A CE1   
1077 N NE2   . HIS A 131 ? 0.2117 0.2210 0.2388 0.0119  -0.0069 0.0274  133 HIS A NE2   
1078 N N     . HIS A 132 ? 0.1806 0.2499 0.2395 0.0098  -0.0095 0.0347  134 HIS A N     
1079 C CA    . HIS A 132 ? 0.1775 0.2578 0.2402 0.0147  -0.0094 0.0380  134 HIS A CA    
1080 C C     . HIS A 132 ? 0.1809 0.2807 0.2547 0.0125  -0.0078 0.0425  134 HIS A C     
1081 O O     . HIS A 132 ? 0.1771 0.2850 0.2534 0.0194  -0.0045 0.0469  134 HIS A O     
1082 C CB    . HIS A 132 ? 0.1775 0.2580 0.2389 0.0141  -0.0140 0.0357  134 HIS A CB    
1083 C CG    . HIS A 132 ? 0.1810 0.2693 0.2438 0.0209  -0.0137 0.0398  134 HIS A CG    
1084 N ND1   . HIS A 132 ? 0.1955 0.2745 0.2514 0.0295  -0.0109 0.0412  134 HIS A ND1   
1085 C CD2   . HIS A 132 ? 0.1817 0.2858 0.2513 0.0209  -0.0158 0.0430  134 HIS A CD2   
1086 C CE1   . HIS A 132 ? 0.2094 0.2963 0.2674 0.0354  -0.0107 0.0454  134 HIS A CE1   
1087 N NE2   . HIS A 132 ? 0.2054 0.3087 0.2720 0.0307  -0.0139 0.0469  134 HIS A NE2   
1088 N N     . LYS A 133 ? 0.1840 0.2917 0.2640 0.0027  -0.0098 0.0413  135 LYS A N     
1089 C CA    . LYS A 133 ? 0.1971 0.3259 0.2887 -0.0015 -0.0086 0.0452  135 LYS A CA    
1090 C C     . LYS A 133 ? 0.1972 0.3277 0.2905 0.0004  -0.0022 0.0492  135 LYS A C     
1091 O O     . LYS A 133 ? 0.1925 0.3413 0.2940 0.0039  0.0007  0.0541  135 LYS A O     
1092 C CB    . LYS A 133 ? 0.2016 0.3358 0.2978 -0.0144 -0.0119 0.0419  135 LYS A CB    
1093 C CG    . LYS A 133 ? 0.2398 0.3797 0.3361 -0.0164 -0.0180 0.0390  135 LYS A CG    
1094 C CD    . LYS A 133 ? 0.2967 0.4617 0.4024 -0.0134 -0.0200 0.0436  135 LYS A CD    
1095 C CE    . LYS A 133 ? 0.3382 0.5078 0.4418 -0.0144 -0.0261 0.0414  135 LYS A CE    
1096 N NZ    . LYS A 133 ? 0.3611 0.5321 0.4651 -0.0275 -0.0298 0.0357  135 LYS A NZ    
1097 N N     . TRP A 134 ? 0.2002 0.3124 0.2853 -0.0010 0.0003  0.0475  136 TRP A N     
1098 C CA    . TRP A 134 ? 0.2075 0.3185 0.2916 0.0005  0.0068  0.0514  136 TRP A CA    
1099 C C     . TRP A 134 ? 0.2133 0.3261 0.2942 0.0131  0.0104  0.0544  136 TRP A C     
1100 O O     . TRP A 134 ? 0.2124 0.3383 0.2987 0.0158  0.0157  0.0592  136 TRP A O     
1101 C CB    . TRP A 134 ? 0.2086 0.2981 0.2826 -0.0024 0.0082  0.0493  136 TRP A CB    
1102 C CG    . TRP A 134 ? 0.2224 0.3122 0.2960 -0.0041 0.0150  0.0541  136 TRP A CG    
1103 C CD1   . TRP A 134 ? 0.2193 0.3150 0.2990 -0.0149 0.0179  0.0564  136 TRP A CD1   
1104 C CD2   . TRP A 134 ? 0.2149 0.2996 0.2812 0.0047  0.0201  0.0572  136 TRP A CD2   
1105 N NE1   . TRP A 134 ? 0.2269 0.3214 0.3038 -0.0134 0.0248  0.0614  136 TRP A NE1   
1106 C CE2   . TRP A 134 ? 0.2236 0.3119 0.2921 -0.0009 0.0263  0.0620  136 TRP A CE2   
1107 C CE3   . TRP A 134 ? 0.2199 0.2968 0.2771 0.0160  0.0202  0.0562  136 TRP A CE3   
1108 C CZ2   . TRP A 134 ? 0.2270 0.3121 0.2885 0.0053  0.0326  0.0661  136 TRP A CZ2   
1109 C CZ3   . TRP A 134 ? 0.2261 0.2995 0.2761 0.0221  0.0260  0.0594  136 TRP A CZ3   
1110 C CH2   . TRP A 134 ? 0.2445 0.3222 0.2965 0.0172  0.0322  0.0645  136 TRP A CH2   
1111 N N     . LEU A 135 ? 0.2158 0.3157 0.2878 0.0203  0.0079  0.0514  137 LEU A N     
1112 C CA    . LEU A 135 ? 0.2324 0.3279 0.2977 0.0318  0.0111  0.0527  137 LEU A CA    
1113 C C     . LEU A 135 ? 0.2394 0.3498 0.3111 0.0386  0.0116  0.0560  137 LEU A C     
1114 O O     . LEU A 135 ? 0.2445 0.3566 0.3136 0.0482  0.0165  0.0587  137 LEU A O     
1115 C CB    . LEU A 135 ? 0.2248 0.3002 0.2776 0.0350  0.0080  0.0477  137 LEU A CB    
1116 C CG    . LEU A 135 ? 0.2621 0.3214 0.3021 0.0393  0.0103  0.0458  137 LEU A CG    
1117 C CD1   . LEU A 135 ? 0.2610 0.3218 0.2999 0.0390  0.0158  0.0493  137 LEU A CD1   
1118 C CD2   . LEU A 135 ? 0.2297 0.2752 0.2627 0.0361  0.0052  0.0405  137 LEU A CD2   
1119 N N     . GLU A 136 ? 0.2417 0.3625 0.3209 0.0344  0.0067  0.0557  138 GLU A N     
1120 C CA    . GLU A 136 ? 0.2604 0.3956 0.3453 0.0411  0.0057  0.0591  138 GLU A CA    
1121 C C     . GLU A 136 ? 0.2594 0.4110 0.3505 0.0497  0.0117  0.0648  138 GLU A C     
1122 O O     . GLU A 136 ? 0.2645 0.4114 0.3500 0.0618  0.0144  0.0666  138 GLU A O     
1123 C CB    . GLU A 136 ? 0.2540 0.4053 0.3489 0.0323  0.0000  0.0590  138 GLU A CB    
1124 C CG    . GLU A 136 ? 0.2809 0.4396 0.3767 0.0386  -0.0036 0.0611  138 GLU A CG    
1125 C CD    . GLU A 136 ? 0.2763 0.4481 0.3788 0.0291  -0.0100 0.0597  138 GLU A CD    
1126 O OE1   . GLU A 136 ? 0.3431 0.5169 0.4434 0.0332  -0.0136 0.0609  138 GLU A OE1   
1127 O OE2   . GLU A 136 ? 0.3047 0.4834 0.4132 0.0174  -0.0113 0.0574  138 GLU A OE2   
1128 N N     . GLY A 137 ? 0.2538 0.4238 0.3560 0.0432  0.0142  0.0676  139 GLY A N     
1129 C CA    . GLY A 137 ? 0.2609 0.4527 0.3721 0.0503  0.0200  0.0735  139 GLY A CA    
1130 C C     . GLY A 137 ? 0.2681 0.4528 0.3738 0.0533  0.0277  0.0745  139 GLY A C     
1131 O O     . GLY A 137 ? 0.2762 0.4805 0.3902 0.0569  0.0336  0.0794  139 GLY A O     
1132 N N     . ARG A 138 ? 0.2719 0.4302 0.3635 0.0520  0.0276  0.0702  140 ARG A N     
1133 C CA    . ARG A 138 ? 0.2836 0.4327 0.3669 0.0550  0.0342  0.0709  140 ARG A CA    
1134 C C     . ARG A 138 ? 0.2953 0.4234 0.3624 0.0669  0.0358  0.0681  140 ARG A C     
1135 O O     . ARG A 138 ? 0.3035 0.4301 0.3645 0.0747  0.0426  0.0697  140 ARG A O     
1136 C CB    . ARG A 138 ? 0.2816 0.4194 0.3614 0.0432  0.0334  0.0691  140 ARG A CB    
1137 C CG    . ARG A 138 ? 0.2743 0.4304 0.3680 0.0306  0.0339  0.0720  140 ARG A CG    
1138 C CD    . ARG A 138 ? 0.2889 0.4293 0.3770 0.0196  0.0336  0.0704  140 ARG A CD    
1139 N NE    . ARG A 138 ? 0.3215 0.4739 0.4212 0.0057  0.0311  0.0705  140 ARG A NE    
1140 C CZ    . ARG A 138 ? 0.3308 0.4887 0.4353 -0.0048 0.0354  0.0735  140 ARG A CZ    
1141 N NH1   . ARG A 138 ? 0.3845 0.5375 0.4831 -0.0026 0.0428  0.0775  140 ARG A NH1   
1142 N NH2   . ARG A 138 ? 0.3217 0.4890 0.4356 -0.0184 0.0325  0.0725  140 ARG A NH2   
1143 N N     . ILE A 139 ? 0.2969 0.4092 0.3567 0.0677  0.0300  0.0636  141 ILE A N     
1144 C CA    . ILE A 139 ? 0.3152 0.4055 0.3587 0.0765  0.0309  0.0599  141 ILE A CA    
1145 C C     . ILE A 139 ? 0.3349 0.4274 0.3767 0.0895  0.0341  0.0620  141 ILE A C     
1146 O O     . ILE A 139 ? 0.3497 0.4244 0.3772 0.0978  0.0369  0.0593  141 ILE A O     
1147 C CB    . ILE A 139 ? 0.3094 0.3806 0.3447 0.0705  0.0239  0.0538  141 ILE A CB    
1148 C CG1   . ILE A 139 ? 0.3088 0.3579 0.3266 0.0746  0.0250  0.0490  141 ILE A CG1   
1149 C CG2   . ILE A 139 ? 0.2945 0.3670 0.3332 0.0712  0.0193  0.0537  141 ILE A CG2   
1150 C CD1   . ILE A 139 ? 0.2951 0.3403 0.3071 0.0722  0.0275  0.0485  141 ILE A CD1   
1151 N N     . LYS A 140 ? 0.3424 0.4566 0.3980 0.0915  0.0338  0.0669  142 LYS A N     
1152 C CA    . LYS A 140 ? 0.3594 0.4769 0.4143 0.1049  0.0361  0.0701  142 LYS A CA    
1153 C C     . LYS A 140 ? 0.3694 0.4834 0.4164 0.1179  0.0449  0.0713  142 LYS A C     
1154 O O     . LYS A 140 ? 0.3632 0.4935 0.4170 0.1181  0.0503  0.0743  142 LYS A O     
1155 C CB    . LYS A 140 ? 0.3611 0.5091 0.4344 0.1044  0.0343  0.0760  142 LYS A CB    
1156 C CG    . LYS A 140 ? 0.3911 0.5388 0.4645 0.1098  0.0297  0.0777  142 LYS A CG    
1157 C CD    . LYS A 140 ? 0.4231 0.5742 0.5023 0.0962  0.0213  0.0756  142 LYS A CD    
1158 C CE    . LYS A 140 ? 0.4438 0.6187 0.5349 0.0987  0.0173  0.0807  142 LYS A CE    
1159 N NZ    . LYS A 140 ? 0.4912 0.6572 0.5741 0.1136  0.0183  0.0841  142 LYS A NZ    
1160 N N     . GLY A 141 ? 0.3794 0.4711 0.4111 0.1283  0.0468  0.0688  143 GLY A N     
1161 C CA    . GLY A 141 ? 0.3865 0.4693 0.4066 0.1414  0.0552  0.0685  143 GLY A CA    
1162 C C     . GLY A 141 ? 0.3942 0.4536 0.3971 0.1382  0.0568  0.0619  143 GLY A C     
1163 O O     . GLY A 141 ? 0.4102 0.4559 0.3989 0.1487  0.0631  0.0597  143 GLY A O     
1164 N N     . LYS A 142 ? 0.3442 0.3898 0.3902 0.0917  -0.0024 0.0253  144 LYS A N     
1165 C CA    . LYS A 142 ? 0.3395 0.3778 0.3818 0.0839  0.0034  0.0197  144 LYS A CA    
1166 C C     . LYS A 142 ? 0.3397 0.3522 0.3672 0.0772  0.0044  0.0183  144 LYS A C     
1167 O O     . LYS A 142 ? 0.3245 0.3329 0.3491 0.0686  0.0075  0.0146  144 LYS A O     
1168 C CB    . LYS A 142 ? 0.3244 0.3826 0.3760 0.0735  0.0025  0.0193  144 LYS A CB    
1169 C CG    . LYS A 142 ? 0.3400 0.4249 0.4063 0.0777  0.0033  0.0200  144 LYS A CG    
1170 C CD    . LYS A 142 ? 0.3722 0.4725 0.4454 0.0659  0.0030  0.0200  144 LYS A CD    
1171 C CE    . LYS A 142 ? 0.3936 0.5232 0.4823 0.0670  0.0011  0.0230  144 LYS A CE    
1172 N NZ    . LYS A 142 ? 0.4285 0.5648 0.5207 0.0675  -0.0066 0.0274  144 LYS A NZ    
1173 N N     . GLU A 143 ? 0.3509 0.3476 0.3696 0.0814  0.0018  0.0220  145 GLU A N     
1174 C CA    . GLU A 143 ? 0.3596 0.3330 0.3641 0.0749  0.0025  0.0222  145 GLU A CA    
1175 C C     . GLU A 143 ? 0.3596 0.3160 0.3563 0.0716  0.0086  0.0166  145 GLU A C     
1176 O O     . GLU A 143 ? 0.3548 0.3043 0.3461 0.0612  0.0100  0.0147  145 GLU A O     
1177 C CB    . GLU A 143 ? 0.3870 0.3454 0.3826 0.0827  -0.0005 0.0279  145 GLU A CB    
1178 C CG    . GLU A 143 ? 0.4041 0.3795 0.4089 0.0939  -0.0057 0.0329  145 GLU A CG    
1179 C CD    . GLU A 143 ? 0.3996 0.3921 0.4089 0.0876  -0.0120 0.0362  145 GLU A CD    
1180 O OE1   . GLU A 143 ? 0.3702 0.3775 0.3857 0.0944  -0.0175 0.0408  145 GLU A OE1   
1181 O OE2   . GLU A 143 ? 0.4240 0.4150 0.4300 0.0759  -0.0113 0.0339  145 GLU A OE2   
1182 N N     . ASN A 144 ? 0.3658 0.3159 0.3618 0.0808  0.0120  0.0138  146 ASN A N     
1183 C CA    . ASN A 144 ? 0.3673 0.2993 0.3541 0.0780  0.0174  0.0077  146 ASN A CA    
1184 C C     . ASN A 144 ? 0.3452 0.2912 0.3373 0.0705  0.0204  0.0022  146 ASN A C     
1185 O O     . ASN A 144 ? 0.3518 0.2856 0.3358 0.0636  0.0236  -0.0027 146 ASN A O     
1186 C CB    . ASN A 144 ? 0.3960 0.3134 0.3781 0.0913  0.0202  0.0059  146 ASN A CB    
1187 C CG    . ASN A 144 ? 0.4181 0.3163 0.3919 0.0985  0.0171  0.0122  146 ASN A CG    
1188 O OD1   . ASN A 144 ? 0.4484 0.3373 0.4151 0.0909  0.0143  0.0167  146 ASN A OD1   
1189 N ND2   . ASN A 144 ? 0.4474 0.3401 0.4217 0.1138  0.0177  0.0130  146 ASN A ND2   
1190 N N     . GLU A 145 ? 0.3181 0.2896 0.3232 0.0710  0.0190  0.0033  147 GLU A N     
1191 C CA    . GLU A 145 ? 0.2947 0.2808 0.3049 0.0632  0.0210  0.0000  147 GLU A CA    
1192 C C     . GLU A 145 ? 0.2746 0.2580 0.2819 0.0512  0.0190  0.0011  147 GLU A C     
1193 O O     . GLU A 145 ? 0.2654 0.2476 0.2696 0.0439  0.0211  -0.0025 147 GLU A O     
1194 C CB    . GLU A 145 ? 0.2740 0.2868 0.2983 0.0656  0.0197  0.0024  147 GLU A CB    
1195 C CG    . GLU A 145 ? 0.3020 0.3239 0.3322 0.0783  0.0222  0.0015  147 GLU A CG    
1196 C CD    . GLU A 145 ? 0.3247 0.3395 0.3486 0.0823  0.0288  -0.0056 147 GLU A CD    
1197 O OE1   . GLU A 145 ? 0.3244 0.3391 0.3441 0.0737  0.0313  -0.0094 147 GLU A OE1   
1198 O OE2   . GLU A 145 ? 0.3674 0.3769 0.3902 0.0947  0.0314  -0.0075 147 GLU A OE2   
1199 N N     . VAL A 146 ? 0.2682 0.2519 0.2765 0.0497  0.0147  0.0059  148 VAL A N     
1200 C CA    . VAL A 146 ? 0.2513 0.2326 0.2569 0.0400  0.0132  0.0068  148 VAL A CA    
1201 C C     . VAL A 146 ? 0.2603 0.2225 0.2545 0.0354  0.0160  0.0042  148 VAL A C     
1202 O O     . VAL A 146 ? 0.2490 0.2127 0.2423 0.0271  0.0172  0.0020  148 VAL A O     
1203 C CB    . VAL A 146 ? 0.2532 0.2362 0.2593 0.0400  0.0086  0.0116  148 VAL A CB    
1204 C CG1   . VAL A 146 ? 0.2464 0.2273 0.2493 0.0311  0.0082  0.0115  148 VAL A CG1   
1205 C CG2   . VAL A 146 ? 0.2383 0.2403 0.2554 0.0428  0.0052  0.0138  148 VAL A CG2   
1206 N N     . ARG A 147 ? 0.2740 0.2186 0.2599 0.0406  0.0169  0.0049  149 ARG A N     
1207 C CA    . ARG A 147 ? 0.2865 0.2100 0.2602 0.0353  0.0195  0.0029  149 ARG A CA    
1208 C C     . ARG A 147 ? 0.2879 0.2092 0.2591 0.0308  0.0232  -0.0038 149 ARG A C     
1209 O O     . ARG A 147 ? 0.2920 0.2074 0.2579 0.0211  0.0244  -0.0059 149 ARG A O     
1210 C CB    . ARG A 147 ? 0.3101 0.2127 0.2745 0.0428  0.0194  0.0058  149 ARG A CB    
1211 C CG    . ARG A 147 ? 0.3033 0.2062 0.2666 0.0446  0.0154  0.0129  149 ARG A CG    
1212 C CD    . ARG A 147 ? 0.3216 0.2077 0.2776 0.0549  0.0141  0.0172  149 ARG A CD    
1213 N NE    . ARG A 147 ? 0.3247 0.2035 0.2730 0.0521  0.0114  0.0238  149 ARG A NE    
1214 C CZ    . ARG A 147 ? 0.3500 0.2234 0.2946 0.0608  0.0077  0.0303  149 ARG A CZ    
1215 N NH1   . ARG A 147 ? 0.3422 0.2179 0.2918 0.0740  0.0063  0.0312  149 ARG A NH1   
1216 N NH2   . ARG A 147 ? 0.3581 0.2255 0.2939 0.0565  0.0055  0.0362  149 ARG A NH2   
1217 N N     . LEU A 148 ? 0.2836 0.2120 0.2589 0.0375  0.0248  -0.0071 150 LEU A N     
1218 C CA    . LEU A 148 ? 0.2904 0.2212 0.2635 0.0333  0.0280  -0.0137 150 LEU A CA    
1219 C C     . LEU A 148 ? 0.2670 0.2150 0.2460 0.0236  0.0266  -0.0136 150 LEU A C     
1220 O O     . LEU A 148 ? 0.2793 0.2240 0.2530 0.0154  0.0278  -0.0174 150 LEU A O     
1221 C CB    . LEU A 148 ? 0.2931 0.2323 0.2702 0.0431  0.0305  -0.0169 150 LEU A CB    
1222 C CG    . LEU A 148 ? 0.3255 0.2459 0.2946 0.0534  0.0336  -0.0204 150 LEU A CG    
1223 C CD1   . LEU A 148 ? 0.3265 0.2632 0.3038 0.0646  0.0361  -0.0221 150 LEU A CD1   
1224 C CD2   . LEU A 148 ? 0.3567 0.2551 0.3113 0.0477  0.0369  -0.0278 150 LEU A CD2   
1225 N N     . LEU A 149 ? 0.2475 0.2130 0.2370 0.0244  0.0239  -0.0091 151 LEU A N     
1226 C CA    . LEU A 149 ? 0.2245 0.2045 0.2195 0.0170  0.0224  -0.0082 151 LEU A CA    
1227 C C     . LEU A 149 ? 0.2283 0.2024 0.2196 0.0090  0.0216  -0.0075 151 LEU A C     
1228 O O     . LEU A 149 ? 0.2177 0.1974 0.2088 0.0021  0.0219  -0.0094 151 LEU A O     
1229 C CB    . LEU A 149 ? 0.2113 0.2076 0.2170 0.0194  0.0197  -0.0037 151 LEU A CB    
1230 C CG    . LEU A 149 ? 0.1924 0.2023 0.2037 0.0136  0.0182  -0.0023 151 LEU A CG    
1231 C CD1   . LEU A 149 ? 0.1745 0.1914 0.1842 0.0110  0.0203  -0.0054 151 LEU A CD1   
1232 C CD2   . LEU A 149 ? 0.1860 0.2070 0.2061 0.0157  0.0155  0.0021  151 LEU A CD2   
1233 N N     . LYS A 150 ? 0.2289 0.1934 0.2174 0.0102  0.0207  -0.0044 152 LYS A N     
1234 C CA    . LYS A 150 ? 0.2300 0.1897 0.2147 0.0029  0.0208  -0.0033 152 LYS A CA    
1235 C C     . LYS A 150 ? 0.2473 0.1960 0.2236 -0.0043 0.0233  -0.0073 152 LYS A C     
1236 O O     . LYS A 150 ? 0.2527 0.2081 0.2301 -0.0126 0.0235  -0.0081 152 LYS A O     
1237 C CB    . LYS A 150 ? 0.2315 0.1814 0.2120 0.0057  0.0198  0.0010  152 LYS A CB    
1238 C CG    . LYS A 150 ? 0.2131 0.1740 0.2004 0.0100  0.0166  0.0046  152 LYS A CG    
1239 C CD    . LYS A 150 ? 0.2169 0.1683 0.1976 0.0114  0.0155  0.0086  152 LYS A CD    
1240 C CE    . LYS A 150 ? 0.1952 0.1575 0.1809 0.0136  0.0121  0.0111  152 LYS A CE    
1241 N NZ    . LYS A 150 ? 0.1934 0.1474 0.1709 0.0148  0.0107  0.0149  152 LYS A NZ    
1242 N N     . GLY A 151 ? 0.2667 0.1988 0.2349 -0.0011 0.0251  -0.0100 153 GLY A N     
1243 C CA    . GLY A 151 ? 0.2875 0.2045 0.2453 -0.0083 0.0274  -0.0147 153 GLY A CA    
1244 C C     . GLY A 151 ? 0.2909 0.2196 0.2504 -0.0141 0.0277  -0.0199 153 GLY A C     
1245 O O     . GLY A 151 ? 0.3006 0.2280 0.2560 -0.0246 0.0280  -0.0226 153 GLY A O     
1246 N N     . PHE A 152 ? 0.2896 0.2310 0.2549 -0.0079 0.0273  -0.0211 154 PHE A N     
1247 C CA    . PHE A 152 ? 0.2863 0.2421 0.2534 -0.0123 0.0271  -0.0248 154 PHE A CA    
1248 C C     . PHE A 152 ? 0.2742 0.2470 0.2487 -0.0197 0.0245  -0.0217 154 PHE A C     
1249 O O     . PHE A 152 ? 0.2774 0.2556 0.2495 -0.0282 0.0239  -0.0247 154 PHE A O     
1250 C CB    . PHE A 152 ? 0.2724 0.2404 0.2454 -0.0038 0.0274  -0.0242 154 PHE A CB    
1251 C CG    . PHE A 152 ? 0.2813 0.2624 0.2537 -0.0073 0.0275  -0.0276 154 PHE A CG    
1252 C CD1   . PHE A 152 ? 0.2941 0.2662 0.2555 -0.0089 0.0302  -0.0351 154 PHE A CD1   
1253 C CD2   . PHE A 152 ? 0.2682 0.2695 0.2495 -0.0085 0.0250  -0.0232 154 PHE A CD2   
1254 C CE1   . PHE A 152 ? 0.2909 0.2763 0.2501 -0.0123 0.0301  -0.0382 154 PHE A CE1   
1255 C CE2   . PHE A 152 ? 0.2717 0.2855 0.2512 -0.0116 0.0248  -0.0252 154 PHE A CE2   
1256 C CZ    . PHE A 152 ? 0.2745 0.2814 0.2428 -0.0137 0.0273  -0.0327 154 PHE A CZ    
1257 N N     . LEU A 153 ? 0.2640 0.2456 0.2473 -0.0160 0.0228  -0.0160 155 LEU A N     
1258 C CA    . LEU A 153 ? 0.2553 0.2526 0.2462 -0.0205 0.0208  -0.0131 155 LEU A CA    
1259 C C     . LEU A 153 ? 0.2634 0.2574 0.2513 -0.0292 0.0216  -0.0137 155 LEU A C     
1260 O O     . LEU A 153 ? 0.2614 0.2690 0.2531 -0.0355 0.0205  -0.0141 155 LEU A O     
1261 C CB    . LEU A 153 ? 0.2415 0.2453 0.2406 -0.0142 0.0192  -0.0079 155 LEU A CB    
1262 C CG    . LEU A 153 ? 0.2321 0.2456 0.2371 -0.0086 0.0178  -0.0061 155 LEU A CG    
1263 C CD1   . LEU A 153 ? 0.2331 0.2463 0.2430 -0.0031 0.0164  -0.0021 155 LEU A CD1   
1264 C CD2   . LEU A 153 ? 0.2012 0.2302 0.2113 -0.0114 0.0159  -0.0049 155 LEU A CD2   
1265 N N     . LYS A 154 ? 0.2753 0.2521 0.2563 -0.0297 0.0234  -0.0133 156 LYS A N     
1266 C CA    . LYS A 154 ? 0.2871 0.2594 0.2642 -0.0387 0.0248  -0.0129 156 LYS A CA    
1267 C C     . LYS A 154 ? 0.2962 0.2658 0.2673 -0.0492 0.0253  -0.0181 156 LYS A C     
1268 O O     . LYS A 154 ? 0.2868 0.2677 0.2608 -0.0586 0.0251  -0.0181 156 LYS A O     
1269 C CB    . LYS A 154 ? 0.3016 0.2535 0.2705 -0.0366 0.0266  -0.0104 156 LYS A CB    
1270 C CG    . LYS A 154 ? 0.3476 0.2942 0.3116 -0.0465 0.0286  -0.0088 156 LYS A CG    
1271 C CD    . LYS A 154 ? 0.3866 0.3365 0.3527 -0.0436 0.0292  -0.0035 156 LYS A CD    
1272 C CE    . LYS A 154 ? 0.4369 0.3770 0.3948 -0.0535 0.0321  -0.0012 156 LYS A CE    
1273 N NZ    . LYS A 154 ? 0.4874 0.4005 0.4322 -0.0508 0.0328  0.0015  156 LYS A NZ    
1274 N N     . ALA A 155 ? 0.3079 0.2636 0.2706 -0.0476 0.0259  -0.0227 157 ALA A N     
1275 C CA    . ALA A 155 ? 0.3301 0.2800 0.2844 -0.0576 0.0262  -0.0290 157 ALA A CA    
1276 C C     . ALA A 155 ? 0.3177 0.2927 0.2791 -0.0628 0.0234  -0.0306 157 ALA A C     
1277 O O     . ALA A 155 ? 0.3418 0.3190 0.2987 -0.0742 0.0225  -0.0348 157 ALA A O     
1278 C CB    . ALA A 155 ? 0.3439 0.2734 0.2873 -0.0523 0.0279  -0.0345 157 ALA A CB    
1279 N N     . ASN A 156 ? 0.2938 0.2872 0.2659 -0.0549 0.0215  -0.0268 158 ASN A N     
1280 C CA    . ASN A 156 ? 0.2847 0.3018 0.2637 -0.0577 0.0184  -0.0265 158 ASN A CA    
1281 C C     . ASN A 156 ? 0.2700 0.3074 0.2620 -0.0572 0.0166  -0.0207 158 ASN A C     
1282 O O     . ASN A 156 ? 0.2646 0.3211 0.2641 -0.0551 0.0137  -0.0185 158 ASN A O     
1283 C CB    . ASN A 156 ? 0.2821 0.3037 0.2611 -0.0498 0.0176  -0.0269 158 ASN A CB    
1284 C CG    . ASN A 156 ? 0.3070 0.3141 0.2731 -0.0515 0.0194  -0.0341 158 ASN A CG    
1285 O OD1   . ASN A 156 ? 0.3180 0.3285 0.2777 -0.0601 0.0182  -0.0392 158 ASN A OD1   
1286 N ND2   . ASN A 156 ? 0.3190 0.3101 0.2809 -0.0429 0.0224  -0.0351 158 ASN A ND2   
1287 N N     . GLY A 157 ? 0.2617 0.2945 0.2557 -0.0585 0.0186  -0.0183 159 GLY A N     
1288 C CA    . GLY A 157 ? 0.2594 0.3110 0.2644 -0.0590 0.0182  -0.0143 159 GLY A CA    
1289 C C     . GLY A 157 ? 0.2429 0.3046 0.2575 -0.0479 0.0169  -0.0097 159 GLY A C     
1290 O O     . GLY A 157 ? 0.2307 0.3101 0.2549 -0.0468 0.0161  -0.0070 159 GLY A O     
1291 N N     . ILE A 158 ? 0.2429 0.2935 0.2550 -0.0397 0.0168  -0.0088 160 ILE A N     
1292 C CA    . ILE A 158 ? 0.2362 0.2936 0.2560 -0.0305 0.0152  -0.0048 160 ILE A CA    
1293 C C     . ILE A 158 ? 0.2349 0.2784 0.2526 -0.0242 0.0166  -0.0033 160 ILE A C     
1294 O O     . ILE A 158 ? 0.2247 0.2689 0.2460 -0.0175 0.0151  -0.0008 160 ILE A O     
1295 C CB    . ILE A 158 ? 0.2340 0.2993 0.2557 -0.0273 0.0123  -0.0038 160 ILE A CB    
1296 C CG1   . ILE A 158 ? 0.2476 0.3010 0.2606 -0.0276 0.0134  -0.0071 160 ILE A CG1   
1297 C CG2   . ILE A 158 ? 0.2399 0.3233 0.2656 -0.0320 0.0098  -0.0037 160 ILE A CG2   
1298 C CD1   . ILE A 158 ? 0.2405 0.3009 0.2545 -0.0239 0.0116  -0.0054 160 ILE A CD1   
1299 N N     . TYR A 159 ? 0.2410 0.2720 0.2522 -0.0273 0.0192  -0.0043 161 TYR A N     
1300 C CA    . TYR A 159 ? 0.2388 0.2584 0.2472 -0.0221 0.0200  -0.0023 161 TYR A CA    
1301 C C     . TYR A 159 ? 0.2328 0.2583 0.2443 -0.0220 0.0213  -0.0005 161 TYR A C     
1302 O O     . TYR A 159 ? 0.2469 0.2768 0.2578 -0.0283 0.0236  -0.0009 161 TYR A O     
1303 C CB    . TYR A 159 ? 0.2534 0.2542 0.2515 -0.0239 0.0217  -0.0035 161 TYR A CB    
1304 C CG    . TYR A 159 ? 0.2563 0.2471 0.2514 -0.0176 0.0215  -0.0007 161 TYR A CG    
1305 C CD1   . TYR A 159 ? 0.2527 0.2447 0.2514 -0.0101 0.0192  0.0004  161 TYR A CD1   
1306 C CD2   . TYR A 159 ? 0.2734 0.2550 0.2619 -0.0201 0.0233  0.0012  161 TYR A CD2   
1307 C CE1   . TYR A 159 ? 0.2551 0.2405 0.2515 -0.0050 0.0181  0.0029  161 TYR A CE1   
1308 C CE2   . TYR A 159 ? 0.2800 0.2537 0.2648 -0.0144 0.0224  0.0041  161 TYR A CE2   
1309 C CZ    . TYR A 159 ? 0.2701 0.2464 0.2593 -0.0069 0.0194  0.0047  161 TYR A CZ    
1310 O OH    . TYR A 159 ? 0.2734 0.2442 0.2592 -0.0021 0.0176  0.0074  161 TYR A OH    
1311 N N     . GLY A 160 ? 0.2188 0.2445 0.2331 -0.0153 0.0202  0.0012  162 GLY A N     
1312 C CA    . GLY A 160 ? 0.2008 0.2313 0.2168 -0.0139 0.0217  0.0019  162 GLY A CA    
1313 C C     . GLY A 160 ? 0.1930 0.2358 0.2180 -0.0091 0.0203  0.0022  162 GLY A C     
1314 O O     . GLY A 160 ? 0.1776 0.2315 0.2086 -0.0102 0.0191  0.0024  162 GLY A O     
1315 N N     . ALA A 161 ? 0.1853 0.2252 0.2103 -0.0037 0.0200  0.0024  163 ALA A N     
1316 C CA    . ALA A 161 ? 0.1781 0.2249 0.2099 0.0021  0.0188  0.0026  163 ALA A CA    
1317 C C     . ALA A 161 ? 0.1787 0.2372 0.2147 0.0036  0.0221  0.0014  163 ALA A C     
1318 O O     . ALA A 161 ? 0.1734 0.2376 0.2154 0.0097  0.0215  0.0014  163 ALA A O     
1319 C CB    . ALA A 161 ? 0.1789 0.2148 0.2077 0.0066  0.0166  0.0025  163 ALA A CB    
1320 N N     . GLU A 162 ? 0.1770 0.2391 0.2098 -0.0018 0.0259  0.0006  164 GLU A N     
1321 C CA    . GLU A 162 ? 0.1841 0.2604 0.2214 -0.0010 0.0301  -0.0005 164 GLU A CA    
1322 C C     . GLU A 162 ? 0.1804 0.2754 0.2294 -0.0001 0.0290  0.0004  164 GLU A C     
1323 O O     . GLU A 162 ? 0.1784 0.2750 0.2292 -0.0037 0.0258  0.0017  164 GLU A O     
1324 C CB    . GLU A 162 ? 0.1903 0.2668 0.2210 -0.0087 0.0346  -0.0006 164 GLU A CB    
1325 C CG    . GLU A 162 ? 0.1998 0.2786 0.2298 -0.0189 0.0346  0.0005  164 GLU A CG    
1326 C CD    . GLU A 162 ? 0.2388 0.2975 0.2591 -0.0220 0.0323  0.0014  164 GLU A CD    
1327 O OE1   . GLU A 162 ? 0.2622 0.3159 0.2772 -0.0306 0.0336  0.0018  164 GLU A OE1   
1328 O OE2   . GLU A 162 ? 0.2297 0.2775 0.2477 -0.0160 0.0292  0.0015  164 GLU A OE2   
1329 N N     . TYR A 163 ? 0.1859 0.2957 0.2425 0.0056  0.0316  -0.0004 165 TYR A N     
1330 C CA    . TYR A 163 ? 0.1816 0.3119 0.2507 0.0084  0.0300  0.0011  165 TYR A CA    
1331 C C     . TYR A 163 ? 0.1808 0.3252 0.2535 -0.0019 0.0292  0.0022  165 TYR A C     
1332 O O     . TYR A 163 ? 0.1711 0.3262 0.2504 -0.0014 0.0251  0.0041  165 TYR A O     
1333 C CB    . TYR A 163 ? 0.1905 0.3364 0.2678 0.0172  0.0338  -0.0001 165 TYR A CB    
1334 C CG    . TYR A 163 ? 0.2009 0.3347 0.2779 0.0294  0.0320  -0.0006 165 TYR A CG    
1335 C CD1   . TYR A 163 ? 0.2178 0.3420 0.2890 0.0355  0.0358  -0.0044 165 TYR A CD1   
1336 C CD2   . TYR A 163 ? 0.1963 0.3266 0.2771 0.0341  0.0263  0.0026  165 TYR A CD2   
1337 C CE1   . TYR A 163 ? 0.2197 0.3294 0.2891 0.0456  0.0339  -0.0056 165 TYR A CE1   
1338 C CE2   . TYR A 163 ? 0.2100 0.3258 0.2892 0.0439  0.0244  0.0026  165 TYR A CE2   
1339 C CZ    . TYR A 163 ? 0.2326 0.3372 0.3061 0.0495  0.0281  -0.0018 165 TYR A CZ    
1340 O OH    . TYR A 163 ? 0.2302 0.3176 0.3008 0.0582  0.0260  -0.0023 165 TYR A OH    
1341 N N     . LYS A 164 ? 0.1861 0.3295 0.2532 -0.0119 0.0329  0.0011  166 LYS A N     
1342 C CA    . LYS A 164 ? 0.1952 0.3482 0.2635 -0.0238 0.0321  0.0014  166 LYS A CA    
1343 C C     . LYS A 164 ? 0.1937 0.3357 0.2576 -0.0267 0.0268  0.0016  166 LYS A C     
1344 O O     . LYS A 164 ? 0.1960 0.3506 0.2638 -0.0330 0.0243  0.0016  166 LYS A O     
1345 C CB    . LYS A 164 ? 0.2036 0.3506 0.2636 -0.0347 0.0368  0.0007  166 LYS A CB    
1346 C CG    . LYS A 164 ? 0.2093 0.3679 0.2711 -0.0486 0.0367  0.0005  166 LYS A CG    
1347 C CD    . LYS A 164 ? 0.2311 0.3837 0.2847 -0.0599 0.0419  0.0008  166 LYS A CD    
1348 C CE    . LYS A 164 ? 0.2545 0.4133 0.3077 -0.0756 0.0410  0.0002  166 LYS A CE    
1349 N NZ    . LYS A 164 ? 0.3206 0.4670 0.3630 -0.0873 0.0459  0.0012  166 LYS A NZ    
1350 N N     . VAL A 165 ? 0.1856 0.3057 0.2413 -0.0224 0.0253  0.0016  167 VAL A N     
1351 C CA    . VAL A 165 ? 0.1903 0.2995 0.2408 -0.0246 0.0215  0.0014  167 VAL A CA    
1352 C C     . VAL A 165 ? 0.1895 0.2993 0.2442 -0.0156 0.0175  0.0035  167 VAL A C     
1353 O O     . VAL A 165 ? 0.1910 0.3049 0.2461 -0.0175 0.0141  0.0042  167 VAL A O     
1354 C CB    . VAL A 165 ? 0.1955 0.2808 0.2340 -0.0266 0.0227  0.0004  167 VAL A CB    
1355 C CG1   . VAL A 165 ? 0.1775 0.2535 0.2114 -0.0275 0.0196  -0.0004 167 VAL A CG1   
1356 C CG2   . VAL A 165 ? 0.2008 0.2813 0.2329 -0.0360 0.0265  -0.0006 167 VAL A CG2   
1357 N N     . ARG A 166 ? 0.1956 0.3003 0.2520 -0.0067 0.0179  0.0045  168 ARG A N     
1358 C CA    . ARG A 166 ? 0.2003 0.3004 0.2587 0.0009  0.0143  0.0070  168 ARG A CA    
1359 C C     . ARG A 166 ? 0.1999 0.2883 0.2519 -0.0019 0.0119  0.0075  168 ARG A C     
1360 O O     . ARG A 166 ? 0.1895 0.2820 0.2433 -0.0007 0.0086  0.0100  168 ARG A O     
1361 C CB    . ARG A 166 ? 0.1962 0.3141 0.2642 0.0052  0.0116  0.0099  168 ARG A CB    
1362 C CG    . ARG A 166 ? 0.2024 0.3319 0.2785 0.0123  0.0139  0.0098  168 ARG A CG    
1363 C CD    . ARG A 166 ? 0.2208 0.3657 0.3062 0.0191  0.0101  0.0139  168 ARG A CD    
1364 N NE    . ARG A 166 ? 0.2777 0.4344 0.3720 0.0284  0.0123  0.0139  168 ARG A NE    
1365 C CZ    . ARG A 166 ? 0.2950 0.4406 0.3895 0.0394  0.0126  0.0143  168 ARG A CZ    
1366 N NH1   . ARG A 166 ? 0.3043 0.4273 0.3910 0.0407  0.0104  0.0152  168 ARG A NH1   
1367 N NH2   . ARG A 166 ? 0.2650 0.4221 0.3674 0.0488  0.0152  0.0135  168 ARG A NH2   
1368 N N     . GLY A 167 ? 0.2034 0.2782 0.2478 -0.0051 0.0137  0.0055  169 GLY A N     
1369 C CA    . GLY A 167 ? 0.2014 0.2669 0.2403 -0.0071 0.0124  0.0052  169 GLY A CA    
1370 C C     . GLY A 167 ? 0.2023 0.2546 0.2379 -0.0031 0.0121  0.0058  169 GLY A C     
1371 O O     . GLY A 167 ? 0.2037 0.2542 0.2419 0.0017  0.0110  0.0072  169 GLY A O     
1372 N N     . PHE A 168 ? 0.2021 0.2453 0.2318 -0.0051 0.0127  0.0045  170 PHE A N     
1373 C CA    . PHE A 168 ? 0.2064 0.2400 0.2336 -0.0018 0.0119  0.0052  170 PHE A CA    
1374 C C     . PHE A 168 ? 0.2143 0.2386 0.2362 -0.0017 0.0134  0.0044  170 PHE A C     
1375 O O     . PHE A 168 ? 0.2210 0.2399 0.2375 -0.0050 0.0155  0.0031  170 PHE A O     
1376 C CB    . PHE A 168 ? 0.2077 0.2385 0.2320 -0.0025 0.0121  0.0044  170 PHE A CB    
1377 C CG    . PHE A 168 ? 0.2071 0.2469 0.2346 -0.0028 0.0108  0.0057  170 PHE A CG    
1378 C CD1   . PHE A 168 ? 0.1994 0.2478 0.2274 -0.0062 0.0105  0.0050  170 PHE A CD1   
1379 C CD2   . PHE A 168 ? 0.1962 0.2370 0.2255 -0.0004 0.0097  0.0077  170 PHE A CD2   
1380 C CE1   . PHE A 168 ? 0.1957 0.2527 0.2249 -0.0066 0.0090  0.0068  170 PHE A CE1   
1381 C CE2   . PHE A 168 ? 0.1994 0.2487 0.2303 -0.0013 0.0089  0.0096  170 PHE A CE2   
1382 C CZ    . PHE A 168 ? 0.2018 0.2585 0.2319 -0.0041 0.0085  0.0093  170 PHE A CZ    
1383 N N     . SER A 169 ? 0.2112 0.2325 0.2334 0.0015  0.0122  0.0052  171 SER A N     
1384 C CA    . SER A 169 ? 0.2168 0.2299 0.2325 0.0018  0.0130  0.0049  171 SER A CA    
1385 C C     . SER A 169 ? 0.2184 0.2241 0.2302 0.0030  0.0118  0.0058  171 SER A C     
1386 O O     . SER A 169 ? 0.2118 0.2200 0.2271 0.0044  0.0105  0.0063  171 SER A O     
1387 C CB    . SER A 169 ? 0.2235 0.2355 0.2391 0.0046  0.0116  0.0046  171 SER A CB    
1388 O OG    . SER A 169 ? 0.2083 0.2194 0.2270 0.0065  0.0081  0.0057  171 SER A OG    
1389 N N     . GLY A 170 ? 0.2183 0.2159 0.2227 0.0030  0.0125  0.0064  172 GLY A N     
1390 C CA    . GLY A 170 ? 0.2207 0.2112 0.2214 0.0060  0.0110  0.0080  172 GLY A CA    
1391 C C     . GLY A 170 ? 0.2074 0.2027 0.2129 0.0096  0.0071  0.0091  172 GLY A C     
1392 O O     . GLY A 170 ? 0.2005 0.1974 0.2088 0.0125  0.0060  0.0099  172 GLY A O     
1393 N N     . TYR A 171 ? 0.2099 0.2078 0.2161 0.0090  0.0054  0.0087  173 TYR A N     
1394 C CA    . TYR A 171 ? 0.2079 0.2100 0.2182 0.0102  0.0013  0.0094  173 TYR A CA    
1395 C C     . TYR A 171 ? 0.2055 0.2150 0.2245 0.0098  0.0007  0.0099  173 TYR A C     
1396 O O     . TYR A 171 ? 0.2050 0.2199 0.2284 0.0107  -0.0017 0.0114  173 TYR A O     
1397 C CB    . TYR A 171 ? 0.2117 0.2119 0.2191 0.0089  0.0000  0.0076  173 TYR A CB    
1398 C CG    . TYR A 171 ? 0.2184 0.2210 0.2287 0.0081  -0.0047 0.0077  173 TYR A CG    
1399 C CD1   . TYR A 171 ? 0.2119 0.2174 0.2218 0.0089  -0.0085 0.0096  173 TYR A CD1   
1400 C CD2   . TYR A 171 ? 0.2112 0.2128 0.2242 0.0064  -0.0055 0.0061  173 TYR A CD2   
1401 C CE1   . TYR A 171 ? 0.2356 0.2451 0.2487 0.0064  -0.0131 0.0095  173 TYR A CE1   
1402 C CE2   . TYR A 171 ? 0.2064 0.2082 0.2210 0.0038  -0.0099 0.0060  173 TYR A CE2   
1403 C CZ    . TYR A 171 ? 0.2329 0.2396 0.2478 0.0030  -0.0137 0.0076  173 TYR A CZ    
1404 O OH    . TYR A 171 ? 0.2224 0.2311 0.2393 -0.0012 -0.0184 0.0074  173 TYR A OH    
1405 N N     . LEU A 172 ? 0.1966 0.2082 0.2182 0.0083  0.0029  0.0090  174 LEU A N     
1406 C CA    . LEU A 172 ? 0.2018 0.2202 0.2296 0.0076  0.0028  0.0102  174 LEU A CA    
1407 C C     . LEU A 172 ? 0.2000 0.2216 0.2287 0.0092  0.0041  0.0105  174 LEU A C     
1408 O O     . LEU A 172 ? 0.1970 0.2258 0.2307 0.0094  0.0032  0.0121  174 LEU A O     
1409 C CB    . LEU A 172 ? 0.1964 0.2173 0.2258 0.0062  0.0046  0.0098  174 LEU A CB    
1410 C CG    . LEU A 172 ? 0.1999 0.2281 0.2339 0.0052  0.0044  0.0117  174 LEU A CG    
1411 C CD1   . LEU A 172 ? 0.1991 0.2288 0.2369 0.0044  0.0017  0.0145  174 LEU A CD1   
1412 C CD2   . LEU A 172 ? 0.2040 0.2358 0.2392 0.0045  0.0052  0.0119  174 LEU A CD2   
1413 N N     . CYS A 173 ? 0.2035 0.2193 0.2270 0.0102  0.0065  0.0090  175 CYS A N     
1414 C CA    . CYS A 173 ? 0.2115 0.2266 0.2339 0.0131  0.0081  0.0083  175 CYS A CA    
1415 C C     . CYS A 173 ? 0.2122 0.2308 0.2377 0.0175  0.0059  0.0102  175 CYS A C     
1416 O O     . CYS A 173 ? 0.2127 0.2386 0.2424 0.0203  0.0068  0.0103  175 CYS A O     
1417 C CB    . CYS A 173 ? 0.2218 0.2253 0.2362 0.0129  0.0107  0.0064  175 CYS A CB    
1418 S SG    . CYS A 173 ? 0.2394 0.2426 0.2512 0.0067  0.0133  0.0038  175 CYS A SG    
1419 N N     . GLU A 174 ? 0.2116 0.2269 0.2350 0.0181  0.0031  0.0116  176 GLU A N     
1420 C CA    . GLU A 174 ? 0.2089 0.2300 0.2356 0.0218  -0.0002 0.0139  176 GLU A CA    
1421 C C     . GLU A 174 ? 0.1919 0.2266 0.2279 0.0193  -0.0023 0.0151  176 GLU A C     
1422 O O     . GLU A 174 ? 0.1882 0.2336 0.2306 0.0223  -0.0030 0.0165  176 GLU A O     
1423 C CB    . GLU A 174 ? 0.2045 0.2195 0.2252 0.0219  -0.0034 0.0151  176 GLU A CB    
1424 C CG    . GLU A 174 ? 0.2383 0.2412 0.2502 0.0255  -0.0018 0.0159  176 GLU A CG    
1425 C CD    . GLU A 174 ? 0.2535 0.2496 0.2568 0.0244  -0.0040 0.0174  176 GLU A CD    
1426 O OE1   . GLU A 174 ? 0.2537 0.2454 0.2521 0.0289  -0.0060 0.0204  176 GLU A OE1   
1427 O OE2   . GLU A 174 ? 0.2676 0.2626 0.2685 0.0195  -0.0036 0.0157  176 GLU A OE2   
1428 N N     . LEU A 175 ? 0.1844 0.2186 0.2212 0.0140  -0.0031 0.0148  177 LEU A N     
1429 C CA    . LEU A 175 ? 0.1839 0.2276 0.2278 0.0100  -0.0050 0.0166  177 LEU A CA    
1430 C C     . LEU A 175 ? 0.1807 0.2342 0.2299 0.0105  -0.0019 0.0175  177 LEU A C     
1431 O O     . LEU A 175 ? 0.1797 0.2456 0.2360 0.0092  -0.0028 0.0197  177 LEU A O     
1432 C CB    . LEU A 175 ? 0.1705 0.2076 0.2126 0.0053  -0.0061 0.0161  177 LEU A CB    
1433 C CG    . LEU A 175 ? 0.1755 0.2044 0.2123 0.0040  -0.0092 0.0145  177 LEU A CG    
1434 C CD1   . LEU A 175 ? 0.1652 0.1874 0.2011 0.0008  -0.0095 0.0138  177 LEU A CD1   
1435 C CD2   . LEU A 175 ? 0.1577 0.1930 0.1969 0.0024  -0.0138 0.0156  177 LEU A CD2   
1436 N N     . LEU A 176 ? 0.1931 0.2422 0.2385 0.0118  0.0019  0.0156  178 LEU A N     
1437 C CA    . LEU A 176 ? 0.1978 0.2553 0.2455 0.0124  0.0053  0.0155  178 LEU A CA    
1438 C C     . LEU A 176 ? 0.2049 0.2695 0.2553 0.0183  0.0071  0.0147  178 LEU A C     
1439 O O     . LEU A 176 ? 0.2072 0.2848 0.2628 0.0185  0.0091  0.0157  178 LEU A O     
1440 C CB    . LEU A 176 ? 0.2051 0.2560 0.2467 0.0117  0.0082  0.0129  178 LEU A CB    
1441 C CG    . LEU A 176 ? 0.2001 0.2483 0.2407 0.0073  0.0069  0.0140  178 LEU A CG    
1442 C CD1   . LEU A 176 ? 0.2010 0.2445 0.2360 0.0067  0.0091  0.0111  178 LEU A CD1   
1443 C CD2   . LEU A 176 ? 0.1904 0.2474 0.2352 0.0038  0.0062  0.0178  178 LEU A CD2   
1444 N N     . ILE A 177 ? 0.2097 0.2661 0.2564 0.0235  0.0068  0.0133  179 ILE A N     
1445 C CA    . ILE A 177 ? 0.2202 0.2822 0.2698 0.0312  0.0080  0.0131  179 ILE A CA    
1446 C C     . ILE A 177 ? 0.2160 0.2953 0.2760 0.0314  0.0047  0.0166  179 ILE A C     
1447 O O     . ILE A 177 ? 0.2188 0.3125 0.2857 0.0356  0.0069  0.0170  179 ILE A O     
1448 C CB    . ILE A 177 ? 0.2312 0.2776 0.2730 0.0371  0.0078  0.0119  179 ILE A CB    
1449 C CG1   . ILE A 177 ? 0.2371 0.2679 0.2691 0.0354  0.0115  0.0082  179 ILE A CG1   
1450 C CG2   . ILE A 177 ? 0.2238 0.2754 0.2690 0.0472  0.0084  0.0125  179 ILE A CG2   
1451 C CD1   . ILE A 177 ? 0.2483 0.2828 0.2796 0.0363  0.0162  0.0045  179 ILE A CD1   
1452 N N     . VAL A 178 ? 0.2179 0.2968 0.2790 0.0264  -0.0003 0.0188  180 VAL A N     
1453 C CA    . VAL A 178 ? 0.2194 0.3150 0.2900 0.0237  -0.0041 0.0219  180 VAL A CA    
1454 C C     . VAL A 178 ? 0.2143 0.3235 0.2920 0.0176  -0.0019 0.0235  180 VAL A C     
1455 O O     . VAL A 178 ? 0.2154 0.3441 0.3029 0.0176  -0.0019 0.0257  180 VAL A O     
1456 C CB    . VAL A 178 ? 0.2270 0.3167 0.2949 0.0180  -0.0100 0.0228  180 VAL A CB    
1457 C CG1   . VAL A 178 ? 0.2194 0.3263 0.2968 0.0123  -0.0143 0.0256  180 VAL A CG1   
1458 C CG2   . VAL A 178 ? 0.2265 0.3059 0.2871 0.0239  -0.0123 0.0224  180 VAL A CG2   
1459 N N     . PHE A 179 ? 0.2106 0.3107 0.2832 0.0126  -0.0001 0.0230  181 PHE A N     
1460 C CA    . PHE A 179 ? 0.2099 0.3201 0.2867 0.0063  0.0018  0.0256  181 PHE A CA    
1461 C C     . PHE A 179 ? 0.2162 0.3400 0.2962 0.0109  0.0075  0.0249  181 PHE A C     
1462 O O     . PHE A 179 ? 0.2140 0.3562 0.3023 0.0083  0.0086  0.0277  181 PHE A O     
1463 C CB    . PHE A 179 ? 0.2098 0.3067 0.2800 0.0013  0.0018  0.0259  181 PHE A CB    
1464 C CG    . PHE A 179 ? 0.2092 0.3134 0.2826 -0.0063 0.0021  0.0303  181 PHE A CG    
1465 C CD1   . PHE A 179 ? 0.2146 0.3187 0.2913 -0.0138 -0.0021 0.0335  181 PHE A CD1   
1466 C CD2   . PHE A 179 ? 0.2107 0.3209 0.2824 -0.0067 0.0063  0.0314  181 PHE A CD2   
1467 C CE1   . PHE A 179 ? 0.2334 0.3418 0.3120 -0.0217 -0.0019 0.0385  181 PHE A CE1   
1468 C CE2   . PHE A 179 ? 0.2287 0.3451 0.3020 -0.0141 0.0066  0.0367  181 PHE A CE2   
1469 C CZ    . PHE A 179 ? 0.2323 0.3471 0.3092 -0.0218 0.0025  0.0407  181 PHE A CZ    
1470 N N     . TYR A 180 ? 0.2200 0.3350 0.2931 0.0173  0.0112  0.0207  182 TYR A N     
1471 C CA    . TYR A 180 ? 0.2267 0.3510 0.2995 0.0216  0.0172  0.0185  182 TYR A CA    
1472 C C     . TYR A 180 ? 0.2307 0.3621 0.3073 0.0321  0.0197  0.0160  182 TYR A C     
1473 O O     . TYR A 180 ? 0.2319 0.3770 0.3115 0.0361  0.0248  0.0146  182 TYR A O     
1474 C CB    . TYR A 180 ? 0.2306 0.3414 0.2925 0.0211  0.0199  0.0148  182 TYR A CB    
1475 C CG    . TYR A 180 ? 0.2368 0.3464 0.2963 0.0125  0.0185  0.0180  182 TYR A CG    
1476 C CD1   . TYR A 180 ? 0.2381 0.3623 0.3008 0.0075  0.0204  0.0218  182 TYR A CD1   
1477 C CD2   . TYR A 180 ? 0.2329 0.3275 0.2869 0.0096  0.0156  0.0177  182 TYR A CD2   
1478 C CE1   . TYR A 180 ? 0.2338 0.3551 0.2935 0.0003  0.0186  0.0260  182 TYR A CE1   
1479 C CE2   . TYR A 180 ? 0.2471 0.3406 0.2993 0.0034  0.0140  0.0212  182 TYR A CE2   
1480 C CZ    . TYR A 180 ? 0.2401 0.3457 0.2947 -0.0010 0.0152  0.0255  182 TYR A CZ    
1481 O OH    . TYR A 180 ? 0.2608 0.3636 0.3130 -0.0063 0.0132  0.0300  182 TYR A OH    
1482 N N     . GLY A 181 ? 0.2322 0.3541 0.3080 0.0374  0.0163  0.0155  183 GLY A N     
1483 C CA    . GLY A 181 ? 0.2369 0.3645 0.3168 0.0488  0.0174  0.0144  183 GLY A CA    
1484 C C     . GLY A 181 ? 0.2483 0.3552 0.3174 0.0571  0.0201  0.0098  183 GLY A C     
1485 O O     . GLY A 181 ? 0.2578 0.3613 0.3276 0.0667  0.0191  0.0099  183 GLY A O     
1486 N N     . SER A 182 ? 0.2469 0.3398 0.3058 0.0533  0.0232  0.0059  184 SER A N     
1487 C CA    . SER A 182 ? 0.2528 0.3254 0.3003 0.0591  0.0264  0.0006  184 SER A CA    
1488 C C     . SER A 182 ? 0.2500 0.3101 0.2876 0.0504  0.0275  -0.0024 184 SER A C     
1489 O O     . SER A 182 ? 0.2404 0.3099 0.2805 0.0422  0.0265  -0.0003 184 SER A O     
1490 C CB    . SER A 182 ? 0.2631 0.3426 0.3114 0.0690  0.0325  -0.0038 184 SER A CB    
1491 O OG    . SER A 182 ? 0.2394 0.3298 0.2866 0.0640  0.0368  -0.0063 184 SER A OG    
1492 N N     . PHE A 183 ? 0.2589 0.2981 0.2851 0.0520  0.0291  -0.0068 185 PHE A N     
1493 C CA    . PHE A 183 ? 0.2630 0.2919 0.2800 0.0434  0.0299  -0.0102 185 PHE A CA    
1494 C C     . PHE A 183 ? 0.2681 0.3087 0.2837 0.0410  0.0337  -0.0135 185 PHE A C     
1495 O O     . PHE A 183 ? 0.2562 0.3023 0.2709 0.0327  0.0325  -0.0124 185 PHE A O     
1496 C CB    . PHE A 183 ? 0.2762 0.2806 0.2811 0.0451  0.0313  -0.0146 185 PHE A CB    
1497 C CG    . PHE A 183 ? 0.2878 0.2837 0.2830 0.0366  0.0327  -0.0194 185 PHE A CG    
1498 C CD1   . PHE A 183 ? 0.3105 0.3009 0.2970 0.0382  0.0372  -0.0267 185 PHE A CD1   
1499 C CD2   . PHE A 183 ? 0.2771 0.2713 0.2716 0.0271  0.0296  -0.0172 185 PHE A CD2   
1500 C CE1   . PHE A 183 ? 0.3163 0.3004 0.2935 0.0291  0.0376  -0.0314 185 PHE A CE1   
1501 C CE2   . PHE A 183 ? 0.2683 0.2582 0.2552 0.0189  0.0302  -0.0213 185 PHE A CE2   
1502 C CZ    . PHE A 183 ? 0.2830 0.2678 0.2611 0.0192  0.0338  -0.0283 185 PHE A CZ    
1503 N N     . LEU A 184 ? 0.2828 0.3277 0.2980 0.0492  0.0384  -0.0173 186 LEU A N     
1504 C CA    . LEU A 184 ? 0.2919 0.3471 0.3032 0.0480  0.0431  -0.0216 186 LEU A CA    
1505 C C     . LEU A 184 ? 0.2802 0.3585 0.3004 0.0419  0.0421  -0.0157 186 LEU A C     
1506 O O     . LEU A 184 ? 0.2826 0.3658 0.2979 0.0347  0.0425  -0.0161 186 LEU A O     
1507 C CB    . LEU A 184 ? 0.3033 0.3590 0.3131 0.0600  0.0490  -0.0271 186 LEU A CB    
1508 C CG    . LEU A 184 ? 0.3174 0.3795 0.3192 0.0604  0.0553  -0.0340 186 LEU A CG    
1509 C CD1   . LEU A 184 ? 0.3295 0.3720 0.3151 0.0534  0.0554  -0.0408 186 LEU A CD1   
1510 C CD2   . LEU A 184 ? 0.3340 0.3994 0.3368 0.0745  0.0615  -0.0390 186 LEU A CD2   
1511 N N     . GLU A 185 ? 0.2762 0.3682 0.3088 0.0444  0.0403  -0.0100 187 GLU A N     
1512 C CA    . GLU A 185 ? 0.2715 0.3825 0.3125 0.0372  0.0386  -0.0034 187 GLU A CA    
1513 C C     . GLU A 185 ? 0.2567 0.3605 0.2954 0.0274  0.0335  0.0005  187 GLU A C     
1514 O O     . GLU A 185 ? 0.2514 0.3646 0.2903 0.0207  0.0333  0.0040  187 GLU A O     
1515 C CB    . GLU A 185 ? 0.2708 0.3964 0.3254 0.0403  0.0367  0.0016  187 GLU A CB    
1516 C CG    . GLU A 185 ? 0.3069 0.4516 0.3677 0.0479  0.0424  0.0000  187 GLU A CG    
1517 C CD    . GLU A 185 ? 0.3464 0.5088 0.4068 0.0420  0.0467  0.0013  187 GLU A CD    
1518 O OE1   . GLU A 185 ? 0.3545 0.5289 0.4214 0.0330  0.0441  0.0082  187 GLU A OE1   
1519 O OE2   . GLU A 185 ? 0.3625 0.5256 0.4150 0.0462  0.0528  -0.0048 187 GLU A OE2   
1520 N N     . THR A 186 ? 0.2548 0.3424 0.2913 0.0272  0.0297  0.0002  188 THR A N     
1521 C CA    . THR A 186 ? 0.2424 0.3234 0.2770 0.0197  0.0256  0.0030  188 THR A CA    
1522 C C     . THR A 186 ? 0.2494 0.3290 0.2754 0.0153  0.0272  0.0001  188 THR A C     
1523 O O     . THR A 186 ? 0.2431 0.3293 0.2696 0.0096  0.0254  0.0041  188 THR A O     
1524 C CB    . THR A 186 ? 0.2439 0.3087 0.2763 0.0206  0.0225  0.0023  188 THR A CB    
1525 O OG1   . THR A 186 ? 0.2254 0.2924 0.2646 0.0247  0.0205  0.0049  188 THR A OG1   
1526 C CG2   . THR A 186 ? 0.2250 0.2857 0.2566 0.0139  0.0190  0.0048  188 THR A CG2   
1527 N N     . VAL A 187 ? 0.2559 0.3260 0.2732 0.0181  0.0303  -0.0067 189 VAL A N     
1528 C CA    . VAL A 187 ? 0.2677 0.3360 0.2752 0.0133  0.0314  -0.0107 189 VAL A CA    
1529 C C     . VAL A 187 ? 0.2667 0.3514 0.2729 0.0112  0.0338  -0.0094 189 VAL A C     
1530 O O     . VAL A 187 ? 0.2679 0.3574 0.2704 0.0050  0.0318  -0.0075 189 VAL A O     
1531 C CB    . VAL A 187 ? 0.2848 0.3367 0.2821 0.0158  0.0341  -0.0190 189 VAL A CB    
1532 C CG1   . VAL A 187 ? 0.3113 0.3637 0.2974 0.0109  0.0359  -0.0246 189 VAL A CG1   
1533 C CG2   . VAL A 187 ? 0.2806 0.3164 0.2770 0.0139  0.0310  -0.0186 189 VAL A CG2   
1534 N N     . LYS A 188 ? 0.2674 0.3624 0.2771 0.0165  0.0380  -0.0098 190 LYS A N     
1535 C CA    . LYS A 188 ? 0.2743 0.3871 0.2830 0.0144  0.0412  -0.0079 190 LYS A CA    
1536 C C     . LYS A 188 ? 0.2597 0.3826 0.2743 0.0073  0.0373  0.0017  190 LYS A C     
1537 O O     . LYS A 188 ? 0.2612 0.3916 0.2702 0.0020  0.0371  0.0042  190 LYS A O     
1538 C CB    . LYS A 188 ? 0.2857 0.4100 0.2994 0.0220  0.0470  -0.0098 190 LYS A CB    
1539 C CG    . LYS A 188 ? 0.3166 0.4339 0.3202 0.0291  0.0528  -0.0201 190 LYS A CG    
1540 C CD    . LYS A 188 ? 0.3683 0.4874 0.3790 0.0405  0.0566  -0.0226 190 LYS A CD    
1541 C CE    . LYS A 188 ? 0.4073 0.5498 0.4222 0.0448  0.0632  -0.0229 190 LYS A CE    
1542 N NZ    . LYS A 188 ? 0.4381 0.5788 0.4544 0.0586  0.0686  -0.0295 190 LYS A NZ    
1543 N N     . ASN A 189 ? 0.2440 0.3658 0.2690 0.0072  0.0338  0.0071  191 ASN A N     
1544 C CA    . ASN A 189 ? 0.2345 0.3617 0.2646 0.0008  0.0300  0.0158  191 ASN A CA    
1545 C C     . ASN A 189 ? 0.2314 0.3486 0.2576 -0.0033 0.0250  0.0181  191 ASN A C     
1546 O O     . ASN A 189 ? 0.2277 0.3494 0.2529 -0.0081 0.0229  0.0245  191 ASN A O     
1547 C CB    . ASN A 189 ? 0.2302 0.3593 0.2716 0.0015  0.0279  0.0197  191 ASN A CB    
1548 C CG    . ASN A 189 ? 0.2322 0.3794 0.2801 0.0032  0.0323  0.0208  191 ASN A CG    
1549 O OD1   . ASN A 189 ? 0.2326 0.3927 0.2824 -0.0024 0.0335  0.0264  191 ASN A OD1   
1550 N ND2   . ASN A 189 ? 0.2135 0.3620 0.2647 0.0112  0.0348  0.0157  191 ASN A ND2   
1551 N N     . ALA A 190 ? 0.2291 0.3334 0.2529 -0.0012 0.0233  0.0134  192 ALA A N     
1552 C CA    . ALA A 190 ? 0.2347 0.3323 0.2563 -0.0043 0.0191  0.0149  192 ALA A CA    
1553 C C     . ALA A 190 ? 0.2463 0.3509 0.2600 -0.0080 0.0188  0.0152  192 ALA A C     
1554 O O     . ALA A 190 ? 0.2447 0.3497 0.2585 -0.0105 0.0148  0.0195  192 ALA A O     
1555 C CB    . ALA A 190 ? 0.2312 0.3162 0.2515 -0.0022 0.0184  0.0094  192 ALA A CB    
1556 N N     . ARG A 191 ? 0.2622 0.3731 0.2689 -0.0078 0.0231  0.0108  193 ARG A N     
1557 C CA    . ARG A 191 ? 0.2799 0.3995 0.2773 -0.0118 0.0230  0.0110  193 ARG A CA    
1558 C C     . ARG A 191 ? 0.2856 0.4145 0.2848 -0.0152 0.0203  0.0213  193 ARG A C     
1559 O O     . ARG A 191 ? 0.2966 0.4313 0.2894 -0.0185 0.0176  0.0242  193 ARG A O     
1560 C CB    . ARG A 191 ? 0.2894 0.4145 0.2785 -0.0103 0.0291  0.0043  193 ARG A CB    
1561 C CG    . ARG A 191 ? 0.2916 0.4046 0.2749 -0.0073 0.0316  -0.0065 193 ARG A CG    
1562 C CD    . ARG A 191 ? 0.3181 0.4357 0.2915 -0.0050 0.0380  -0.0139 193 ARG A CD    
1563 N NE    . ARG A 191 ? 0.3347 0.4613 0.3151 0.0005  0.0429  -0.0119 193 ARG A NE    
1564 C CZ    . ARG A 191 ? 0.3572 0.4902 0.3322 0.0050  0.0497  -0.0178 193 ARG A CZ    
1565 N NH1   . ARG A 191 ? 0.3771 0.5055 0.3376 0.0045  0.0526  -0.0270 193 ARG A NH1   
1566 N NH2   . ARG A 191 ? 0.3442 0.4889 0.3284 0.0098  0.0537  -0.0149 193 ARG A NH2   
1567 N N     . ARG A 192 ? 0.2902 0.4202 0.2976 -0.0147 0.0207  0.0271  194 ARG A N     
1568 C CA    . ARG A 192 ? 0.2965 0.4323 0.3051 -0.0187 0.0186  0.0375  194 ARG A CA    
1569 C C     . ARG A 192 ? 0.2804 0.4053 0.2963 -0.0187 0.0132  0.0435  194 ARG A C     
1570 O O     . ARG A 192 ? 0.2829 0.4078 0.3003 -0.0218 0.0113  0.0523  194 ARG A O     
1571 C CB    . ARG A 192 ? 0.2985 0.4454 0.3093 -0.0204 0.0234  0.0403  194 ARG A CB    
1572 C CG    . ARG A 192 ? 0.3351 0.4952 0.3364 -0.0208 0.0290  0.0361  194 ARG A CG    
1573 C CD    . ARG A 192 ? 0.3484 0.5227 0.3536 -0.0218 0.0349  0.0384  194 ARG A CD    
1574 N NE    . ARG A 192 ? 0.4319 0.6032 0.4501 -0.0199 0.0344  0.0391  194 ARG A NE    
1575 C CZ    . ARG A 192 ? 0.4556 0.6266 0.4792 -0.0135 0.0373  0.0316  194 ARG A CZ    
1576 N NH1   . ARG A 192 ? 0.4723 0.6435 0.4892 -0.0079 0.0416  0.0223  194 ARG A NH1   
1577 N NH2   . ARG A 192 ? 0.4609 0.6306 0.4959 -0.0127 0.0356  0.0336  194 ARG A NH2   
1578 N N     . TRP A 193 ? 0.2687 0.3834 0.2883 -0.0153 0.0112  0.0387  195 TRP A N     
1579 C CA    . TRP A 193 ? 0.2598 0.3642 0.2848 -0.0142 0.0067  0.0428  195 TRP A CA    
1580 C C     . TRP A 193 ? 0.2628 0.3687 0.2844 -0.0146 0.0026  0.0484  195 TRP A C     
1581 O O     . TRP A 193 ? 0.2677 0.3813 0.2836 -0.0152 0.0023  0.0464  195 TRP A O     
1582 C CB    . TRP A 193 ? 0.2474 0.3428 0.2757 -0.0107 0.0062  0.0361  195 TRP A CB    
1583 C CG    . TRP A 193 ? 0.2374 0.3284 0.2699 -0.0090 0.0085  0.0319  195 TRP A CG    
1584 C CD1   . TRP A 193 ? 0.2311 0.3266 0.2669 -0.0099 0.0105  0.0334  195 TRP A CD1   
1585 C CD2   . TRP A 193 ? 0.2348 0.3173 0.2688 -0.0060 0.0086  0.0262  195 TRP A CD2   
1586 N NE1   . TRP A 193 ? 0.2247 0.3157 0.2642 -0.0069 0.0113  0.0290  195 TRP A NE1   
1587 C CE2   . TRP A 193 ? 0.2284 0.3101 0.2660 -0.0045 0.0102  0.0248  195 TRP A CE2   
1588 C CE3   . TRP A 193 ? 0.2291 0.3059 0.2617 -0.0048 0.0075  0.0227  195 TRP A CE3   
1589 C CZ2   . TRP A 193 ? 0.2285 0.3023 0.2671 -0.0014 0.0103  0.0204  195 TRP A CZ2   
1590 C CZ3   . TRP A 193 ? 0.2192 0.2879 0.2526 -0.0026 0.0084  0.0182  195 TRP A CZ3   
1591 C CH2   . TRP A 193 ? 0.2296 0.2959 0.2653 -0.0007 0.0096  0.0173  195 TRP A CH2   
1592 N N     . THR A 194 ? 0.2631 0.3611 0.2880 -0.0140 -0.0008 0.0555  196 THR A N     
1593 C CA    . THR A 194 ? 0.2662 0.3640 0.2894 -0.0122 -0.0053 0.0618  196 THR A CA    
1594 C C     . THR A 194 ? 0.2644 0.3508 0.2939 -0.0070 -0.0079 0.0606  196 THR A C     
1595 O O     . THR A 194 ? 0.2573 0.3358 0.2909 -0.0062 -0.0062 0.0554  196 THR A O     
1596 C CB    . THR A 194 ? 0.2795 0.3759 0.2991 -0.0153 -0.0069 0.0729  196 THR A CB    
1597 O OG1   . THR A 194 ? 0.2749 0.3564 0.2990 -0.0153 -0.0081 0.0763  196 THR A OG1   
1598 C CG2   . THR A 194 ? 0.2789 0.3865 0.2933 -0.0211 -0.0027 0.0739  196 THR A CG2   
1599 N N     . ARG A 195 ? 0.2661 0.3526 0.2959 -0.0031 -0.0119 0.0655  197 ARG A N     
1600 C CA    . ARG A 195 ? 0.2600 0.3369 0.2956 0.0031  -0.0139 0.0648  197 ARG A CA    
1601 C C     . ARG A 195 ? 0.2695 0.3286 0.3061 0.0038  -0.0147 0.0687  197 ARG A C     
1602 O O     . ARG A 195 ? 0.2703 0.3189 0.3104 0.0093  -0.0158 0.0675  197 ARG A O     
1603 C CB    . ARG A 195 ? 0.2635 0.3484 0.3002 0.0085  -0.0180 0.0692  197 ARG A CB    
1604 C CG    . ARG A 195 ? 0.2704 0.3523 0.3033 0.0100  -0.0219 0.0808  197 ARG A CG    
1605 C CD    . ARG A 195 ? 0.2773 0.3732 0.3108 0.0147  -0.0263 0.0850  197 ARG A CD    
1606 N NE    . ARG A 195 ? 0.2491 0.3639 0.2783 0.0091  -0.0259 0.0815  197 ARG A NE    
1607 C CZ    . ARG A 195 ? 0.2583 0.3900 0.2887 0.0109  -0.0295 0.0818  197 ARG A CZ    
1608 N NH1   . ARG A 195 ? 0.2431 0.3776 0.2805 0.0193  -0.0334 0.0858  197 ARG A NH1   
1609 N NH2   . ARG A 195 ? 0.2418 0.3883 0.2664 0.0043  -0.0290 0.0774  197 ARG A NH2   
1610 N N     . ARG A 196 ? 0.2754 0.3318 0.3087 -0.0024 -0.0137 0.0731  198 ARG A N     
1611 C CA    . ARG A 196 ? 0.2937 0.3330 0.3271 -0.0045 -0.0146 0.0769  198 ARG A CA    
1612 C C     . ARG A 196 ? 0.2743 0.3138 0.3094 -0.0110 -0.0116 0.0725  198 ARG A C     
1613 O O     . ARG A 196 ? 0.2784 0.3069 0.3133 -0.0155 -0.0124 0.0756  198 ARG A O     
1614 C CB    . ARG A 196 ? 0.3115 0.3459 0.3395 -0.0073 -0.0171 0.0885  198 ARG A CB    
1615 C CG    . ARG A 196 ? 0.3750 0.4169 0.4000 -0.0021 -0.0202 0.0947  198 ARG A CG    
1616 C CD    . ARG A 196 ? 0.4494 0.4802 0.4774 0.0078  -0.0237 0.0958  198 ARG A CD    
1617 N NE    . ARG A 196 ? 0.5218 0.5343 0.5454 0.0092  -0.0270 0.1062  198 ARG A NE    
1618 C CZ    . ARG A 196 ? 0.5555 0.5562 0.5804 0.0192  -0.0304 0.1096  198 ARG A CZ    
1619 N NH1   . ARG A 196 ? 0.5496 0.5583 0.5811 0.0283  -0.0305 0.1033  198 ARG A NH1   
1620 N NH2   . ARG A 196 ? 0.5746 0.5553 0.5939 0.0203  -0.0333 0.1194  198 ARG A NH2   
1621 N N     . THR A 197 ? 0.2545 0.3064 0.2913 -0.0114 -0.0085 0.0654  199 THR A N     
1622 C CA    . THR A 197 ? 0.2430 0.2980 0.2825 -0.0155 -0.0058 0.0611  199 THR A CA    
1623 C C     . THR A 197 ? 0.2432 0.2855 0.2859 -0.0143 -0.0071 0.0566  199 THR A C     
1624 O O     . THR A 197 ? 0.2424 0.2799 0.2859 -0.0089 -0.0074 0.0514  199 THR A O     
1625 C CB    . THR A 197 ? 0.2298 0.2988 0.2691 -0.0143 -0.0022 0.0546  199 THR A CB    
1626 O OG1   . THR A 197 ? 0.2461 0.3269 0.2808 -0.0166 -0.0008 0.0583  199 THR A OG1   
1627 C CG2   . THR A 197 ? 0.2096 0.2825 0.2526 -0.0162 0.0004  0.0503  199 THR A CG2   
1628 N N     . VAL A 198 ? 0.2437 0.2814 0.2879 -0.0201 -0.0078 0.0587  200 VAL A N     
1629 C CA    . VAL A 198 ? 0.2371 0.2650 0.2833 -0.0204 -0.0092 0.0539  200 VAL A CA    
1630 C C     . VAL A 198 ? 0.2296 0.2703 0.2801 -0.0236 -0.0073 0.0505  200 VAL A C     
1631 O O     . VAL A 198 ? 0.2252 0.2758 0.2780 -0.0295 -0.0062 0.0545  200 VAL A O     
1632 C CB    . VAL A 198 ? 0.2574 0.2677 0.3015 -0.0251 -0.0126 0.0580  200 VAL A CB    
1633 C CG1   . VAL A 198 ? 0.2483 0.2495 0.2930 -0.0265 -0.0144 0.0518  200 VAL A CG1   
1634 C CG2   . VAL A 198 ? 0.2618 0.2579 0.3017 -0.0198 -0.0145 0.0617  200 VAL A CG2   
1635 N N     . ILE A 199 ? 0.2190 0.2604 0.2705 -0.0191 -0.0067 0.0437  201 ILE A N     
1636 C CA    . ILE A 199 ? 0.2112 0.2631 0.2667 -0.0200 -0.0057 0.0406  201 ILE A CA    
1637 C C     . ILE A 199 ? 0.2205 0.2638 0.2766 -0.0221 -0.0091 0.0379  201 ILE A C     
1638 O O     . ILE A 199 ? 0.2159 0.2483 0.2684 -0.0182 -0.0102 0.0337  201 ILE A O     
1639 C CB    . ILE A 199 ? 0.1982 0.2565 0.2530 -0.0136 -0.0026 0.0354  201 ILE A CB    
1640 C CG1   . ILE A 199 ? 0.1864 0.2530 0.2392 -0.0125 0.0005  0.0368  201 ILE A CG1   
1641 C CG2   . ILE A 199 ? 0.1954 0.2630 0.2545 -0.0127 -0.0020 0.0328  201 ILE A CG2   
1642 C CD1   . ILE A 199 ? 0.1884 0.2563 0.2384 -0.0072 0.0031  0.0312  201 ILE A CD1   
1643 N N     . ASP A 200 ? 0.2253 0.2752 0.2856 -0.0288 -0.0108 0.0401  202 ASP A N     
1644 C CA    . ASP A 200 ? 0.2355 0.2789 0.2958 -0.0329 -0.0149 0.0377  202 ASP A CA    
1645 C C     . ASP A 200 ? 0.2362 0.2969 0.3029 -0.0328 -0.0152 0.0361  202 ASP A C     
1646 O O     . ASP A 200 ? 0.2250 0.2996 0.2984 -0.0393 -0.0158 0.0395  202 ASP A O     
1647 C CB    . ASP A 200 ? 0.2512 0.2860 0.3108 -0.0426 -0.0177 0.0423  202 ASP A CB    
1648 C CG    . ASP A 200 ? 0.2613 0.2842 0.3179 -0.0477 -0.0226 0.0388  202 ASP A CG    
1649 O OD1   . ASP A 200 ? 0.2581 0.2846 0.3148 -0.0449 -0.0241 0.0337  202 ASP A OD1   
1650 O OD2   . ASP A 200 ? 0.2883 0.2970 0.3415 -0.0551 -0.0250 0.0412  202 ASP A OD2   
1651 N N     . VAL A 201 ? 0.2315 0.2920 0.2964 -0.0254 -0.0148 0.0315  203 VAL A N     
1652 C CA    . VAL A 201 ? 0.2341 0.3096 0.3042 -0.0225 -0.0152 0.0304  203 VAL A CA    
1653 C C     . VAL A 201 ? 0.2368 0.3198 0.3115 -0.0298 -0.0203 0.0313  203 VAL A C     
1654 O O     . VAL A 201 ? 0.2257 0.3285 0.3094 -0.0313 -0.0202 0.0336  203 VAL A O     
1655 C CB    . VAL A 201 ? 0.2355 0.3046 0.3004 -0.0139 -0.0147 0.0260  203 VAL A CB    
1656 C CG1   . VAL A 201 ? 0.2504 0.3344 0.3206 -0.0079 -0.0130 0.0261  203 VAL A CG1   
1657 C CG2   . VAL A 201 ? 0.2686 0.3263 0.3273 -0.0096 -0.0110 0.0244  203 VAL A CG2   
1658 N N     . ALA A 202 ? 0.2446 0.3128 0.3133 -0.0345 -0.0246 0.0290  204 ALA A N     
1659 C CA    . ALA A 202 ? 0.2543 0.3282 0.3258 -0.0432 -0.0303 0.0290  204 ALA A CA    
1660 C C     . ALA A 202 ? 0.2560 0.3432 0.3360 -0.0533 -0.0306 0.0342  204 ALA A C     
1661 O O     . ALA A 202 ? 0.2622 0.3663 0.3496 -0.0593 -0.0342 0.0353  204 ALA A O     
1662 C CB    . ALA A 202 ? 0.2689 0.3208 0.3299 -0.0472 -0.0342 0.0248  204 ALA A CB    
1663 N N     . LYS A 203 ? 0.2526 0.3336 0.3317 -0.0557 -0.0271 0.0378  205 LYS A N     
1664 C CA    . LYS A 203 ? 0.2548 0.3465 0.3401 -0.0663 -0.0266 0.0438  205 LYS A CA    
1665 C C     . LYS A 203 ? 0.2354 0.3507 0.3293 -0.0625 -0.0210 0.0474  205 LYS A C     
1666 O O     . LYS A 203 ? 0.2299 0.3593 0.3301 -0.0709 -0.0196 0.0527  205 LYS A O     
1667 C CB    . LYS A 203 ? 0.2737 0.3430 0.3513 -0.0722 -0.0266 0.0468  205 LYS A CB    
1668 C CG    . LYS A 203 ? 0.3205 0.3677 0.3904 -0.0794 -0.0323 0.0436  205 LYS A CG    
1669 C CD    . LYS A 203 ? 0.3717 0.3980 0.4353 -0.0868 -0.0325 0.0481  205 LYS A CD    
1670 C CE    . LYS A 203 ? 0.4311 0.4321 0.4856 -0.0930 -0.0378 0.0435  205 LYS A CE    
1671 N NZ    . LYS A 203 ? 0.4884 0.4725 0.5388 -0.1056 -0.0395 0.0490  205 LYS A NZ    
1672 N N     . GLY A 204 ? 0.2221 0.3411 0.3155 -0.0502 -0.0175 0.0444  206 GLY A N     
1673 C CA    . GLY A 204 ? 0.2221 0.3606 0.3214 -0.0447 -0.0117 0.0460  206 GLY A CA    
1674 C C     . GLY A 204 ? 0.2310 0.3679 0.3273 -0.0480 -0.0073 0.0504  206 GLY A C     
1675 O O     . GLY A 204 ? 0.2274 0.3840 0.3295 -0.0497 -0.0031 0.0537  206 GLY A O     
1676 N N     . GLU A 205 ? 0.2402 0.3547 0.3270 -0.0480 -0.0082 0.0506  207 GLU A N     
1677 C CA    . GLU A 205 ? 0.2645 0.3742 0.3471 -0.0531 -0.0062 0.0564  207 GLU A CA    
1678 C C     . GLU A 205 ? 0.2693 0.3644 0.3432 -0.0458 -0.0047 0.0552  207 GLU A C     
1679 O O     . GLU A 205 ? 0.2578 0.3385 0.3276 -0.0400 -0.0067 0.0505  207 GLU A O     
1680 C CB    . GLU A 205 ? 0.2782 0.3747 0.3590 -0.0647 -0.0106 0.0606  207 GLU A CB    
1681 C CG    . GLU A 205 ? 0.3090 0.3915 0.3827 -0.0689 -0.0101 0.0670  207 GLU A CG    
1682 C CD    . GLU A 205 ? 0.3559 0.4248 0.4277 -0.0813 -0.0142 0.0715  207 GLU A CD    
1683 O OE1   . GLU A 205 ? 0.3800 0.4230 0.4441 -0.0804 -0.0177 0.0702  207 GLU A OE1   
1684 O OE2   . GLU A 205 ? 0.3678 0.4518 0.4457 -0.0920 -0.0138 0.0760  207 GLU A OE2   
1685 N N     . VAL A 206 ? 0.2838 0.3850 0.3552 -0.0466 -0.0011 0.0596  208 VAL A N     
1686 C CA    . VAL A 206 ? 0.3011 0.3909 0.3645 -0.0418 -0.0006 0.0604  208 VAL A CA    
1687 C C     . VAL A 206 ? 0.3175 0.3989 0.3766 -0.0493 -0.0021 0.0691  208 VAL A C     
1688 O O     . VAL A 206 ? 0.3277 0.4211 0.3885 -0.0567 0.0000  0.0750  208 VAL A O     
1689 C CB    . VAL A 206 ? 0.2928 0.3960 0.3542 -0.0358 0.0043  0.0580  208 VAL A CB    
1690 C CG1   . VAL A 206 ? 0.3018 0.3958 0.3552 -0.0327 0.0038  0.0596  208 VAL A CG1   
1691 C CG2   . VAL A 206 ? 0.2955 0.4024 0.3594 -0.0280 0.0057  0.0499  208 VAL A CG2   
1692 N N     . ARG A 207 ? 0.3341 0.3951 0.3876 -0.0469 -0.0055 0.0701  209 ARG A N     
1693 C CA    . ARG A 207 ? 0.3591 0.4081 0.4070 -0.0518 -0.0073 0.0789  209 ARG A CA    
1694 C C     . ARG A 207 ? 0.3645 0.4046 0.4065 -0.0435 -0.0083 0.0800  209 ARG A C     
1695 O O     . ARG A 207 ? 0.3489 0.3953 0.3914 -0.0358 -0.0070 0.0740  209 ARG A O     
1696 C CB    . ARG A 207 ? 0.3715 0.4014 0.4188 -0.0588 -0.0115 0.0807  209 ARG A CB    
1697 C CG    . ARG A 207 ? 0.3788 0.3930 0.4255 -0.0530 -0.0144 0.0727  209 ARG A CG    
1698 C CD    . ARG A 207 ? 0.3968 0.3914 0.4412 -0.0608 -0.0184 0.0733  209 ARG A CD    
1699 N NE    . ARG A 207 ? 0.4176 0.3986 0.4601 -0.0548 -0.0206 0.0646  209 ARG A NE    
1700 C CZ    . ARG A 207 ? 0.4300 0.4181 0.4760 -0.0559 -0.0215 0.0577  209 ARG A CZ    
1701 N NH1   . ARG A 207 ? 0.4205 0.4296 0.4737 -0.0621 -0.0206 0.0584  209 ARG A NH1   
1702 N NH2   . ARG A 207 ? 0.4318 0.4073 0.4743 -0.0504 -0.0231 0.0504  209 ARG A NH2   
1703 N N     . LYS A 208 ? 0.3935 0.4197 0.4300 -0.0455 -0.0108 0.0881  210 LYS A N     
1704 C CA    . LYS A 208 ? 0.4061 0.4254 0.4378 -0.0374 -0.0126 0.0907  210 LYS A CA    
1705 C C     . LYS A 208 ? 0.4156 0.4101 0.4456 -0.0330 -0.0164 0.0899  210 LYS A C     
1706 O O     . LYS A 208 ? 0.4374 0.4154 0.4655 -0.0391 -0.0184 0.0927  210 LYS A O     
1707 C CB    . LYS A 208 ? 0.4234 0.4469 0.4489 -0.0414 -0.0125 0.1018  210 LYS A CB    
1708 C CG    . LYS A 208 ? 0.4586 0.4822 0.4795 -0.0330 -0.0146 0.1053  210 LYS A CG    
1709 C CD    . LYS A 208 ? 0.5222 0.5225 0.5385 -0.0302 -0.0192 0.1135  210 LYS A CD    
1710 C CE    . LYS A 208 ? 0.5552 0.5588 0.5688 -0.0203 -0.0219 0.1168  210 LYS A CE    
1711 N NZ    . LYS A 208 ? 0.5900 0.5710 0.5994 -0.0150 -0.0264 0.1252  210 LYS A NZ    
1712 N N     . GLY A 209 ? 0.4085 0.4007 0.4390 -0.0226 -0.0173 0.0856  211 GLY A N     
1713 C CA    . GLY A 209 ? 0.4209 0.3912 0.4498 -0.0162 -0.0200 0.0841  211 GLY A CA    
1714 C C     . GLY A 209 ? 0.4243 0.3932 0.4518 -0.0060 -0.0218 0.0879  211 GLY A C     
1715 O O     . GLY A 209 ? 0.4247 0.4058 0.4506 -0.0059 -0.0222 0.0944  211 GLY A O     
1716 N N     . GLU A 210 ? 0.4307 0.3861 0.4590 0.0029  -0.0230 0.0837  212 GLU A N     
1717 C CA    . GLU A 210 ? 0.4369 0.3935 0.4663 0.0144  -0.0247 0.0865  212 GLU A CA    
1718 C C     . GLU A 210 ? 0.4044 0.3836 0.4396 0.0189  -0.0226 0.0798  212 GLU A C     
1719 O O     . GLU A 210 ? 0.4020 0.3921 0.4394 0.0259  -0.0240 0.0826  212 GLU A O     
1720 C CB    . GLU A 210 ? 0.4516 0.3845 0.4796 0.0229  -0.0260 0.0841  212 GLU A CB    
1721 C CG    . GLU A 210 ? 0.5001 0.4068 0.5207 0.0213  -0.0291 0.0930  212 GLU A CG    
1722 C CD    . GLU A 210 ? 0.5231 0.4022 0.5406 0.0283  -0.0297 0.0880  212 GLU A CD    
1723 O OE1   . GLU A 210 ? 0.5666 0.4207 0.5774 0.0299  -0.0325 0.0951  212 GLU A OE1   
1724 O OE2   . GLU A 210 ? 0.5453 0.4264 0.5657 0.0320  -0.0273 0.0771  212 GLU A OE2   
1725 N N     . GLU A 211 ? 0.3805 0.3667 0.4181 0.0146  -0.0196 0.0712  213 GLU A N     
1726 C CA    . GLU A 211 ? 0.3656 0.3693 0.4077 0.0177  -0.0173 0.0643  213 GLU A CA    
1727 C C     . GLU A 211 ? 0.3319 0.3432 0.3744 0.0104  -0.0144 0.0582  213 GLU A C     
1728 O O     . GLU A 211 ? 0.3319 0.3353 0.3728 0.0045  -0.0143 0.0582  213 GLU A O     
1729 C CB    . GLU A 211 ? 0.3699 0.3675 0.4150 0.0267  -0.0167 0.0585  213 GLU A CB    
1730 C CG    . GLU A 211 ? 0.4011 0.3814 0.4439 0.0254  -0.0156 0.0522  213 GLU A CG    
1731 C CD    . GLU A 211 ? 0.4151 0.3867 0.4589 0.0352  -0.0147 0.0473  213 GLU A CD    
1732 O OE1   . GLU A 211 ? 0.4569 0.4375 0.5050 0.0438  -0.0148 0.0489  213 GLU A OE1   
1733 O OE2   . GLU A 211 ? 0.4652 0.4223 0.5054 0.0343  -0.0138 0.0415  213 GLU A OE2   
1734 N N     . PHE A 212 ? 0.3036 0.3301 0.3482 0.0110  -0.0123 0.0534  214 PHE A N     
1735 C CA    . PHE A 212 ? 0.2788 0.3111 0.3235 0.0061  -0.0095 0.0477  214 PHE A CA    
1736 C C     . PHE A 212 ? 0.2712 0.2926 0.3164 0.0069  -0.0088 0.0418  214 PHE A C     
1737 O O     . PHE A 212 ? 0.2744 0.2929 0.3206 0.0121  -0.0082 0.0378  214 PHE A O     
1738 C CB    . PHE A 212 ? 0.2640 0.3112 0.3093 0.0063  -0.0075 0.0438  214 PHE A CB    
1739 C CG    . PHE A 212 ? 0.2390 0.2898 0.2834 0.0025  -0.0046 0.0384  214 PHE A CG    
1740 C CD1   . PHE A 212 ? 0.2160 0.2734 0.2585 -0.0018 -0.0033 0.0400  214 PHE A CD1   
1741 C CD2   . PHE A 212 ? 0.2323 0.2800 0.2773 0.0040  -0.0029 0.0321  214 PHE A CD2   
1742 C CE1   . PHE A 212 ? 0.2242 0.2846 0.2663 -0.0033 -0.0005 0.0351  214 PHE A CE1   
1743 C CE2   . PHE A 212 ? 0.2127 0.2621 0.2564 0.0018  -0.0006 0.0280  214 PHE A CE2   
1744 C CZ    . PHE A 212 ? 0.2042 0.2599 0.2469 -0.0012 0.0005  0.0294  214 PHE A CZ    
1745 N N     . PHE A 213 ? 0.2596 0.2771 0.3040 0.0016  -0.0088 0.0413  215 PHE A N     
1746 C CA    . PHE A 213 ? 0.2505 0.2561 0.2939 0.0013  -0.0094 0.0370  215 PHE A CA    
1747 C C     . PHE A 213 ? 0.2354 0.2470 0.2797 -0.0038 -0.0087 0.0346  215 PHE A C     
1748 O O     . PHE A 213 ? 0.2283 0.2452 0.2741 -0.0092 -0.0091 0.0384  215 PHE A O     
1749 C CB    . PHE A 213 ? 0.2620 0.2515 0.3030 -0.0001 -0.0123 0.0410  215 PHE A CB    
1750 C CG    . PHE A 213 ? 0.2708 0.2446 0.3087 0.0009  -0.0134 0.0357  215 PHE A CG    
1751 C CD1   . PHE A 213 ? 0.2811 0.2397 0.3162 0.0069  -0.0142 0.0354  215 PHE A CD1   
1752 C CD2   . PHE A 213 ? 0.2625 0.2365 0.2994 -0.0037 -0.0137 0.0311  215 PHE A CD2   
1753 C CE1   . PHE A 213 ? 0.3080 0.2507 0.3383 0.0079  -0.0149 0.0294  215 PHE A CE1   
1754 C CE2   . PHE A 213 ? 0.2749 0.2344 0.3070 -0.0036 -0.0151 0.0258  215 PHE A CE2   
1755 C CZ    . PHE A 213 ? 0.2928 0.2360 0.3210 0.0019  -0.0154 0.0244  215 PHE A CZ    
1756 N N     . VAL A 214 ? 0.2249 0.2368 0.2685 -0.0018 -0.0077 0.0288  216 VAL A N     
1757 C CA    . VAL A 214 ? 0.2178 0.2350 0.2623 -0.0048 -0.0076 0.0266  216 VAL A CA    
1758 C C     . VAL A 214 ? 0.2237 0.2302 0.2654 -0.0061 -0.0101 0.0235  216 VAL A C     
1759 O O     . VAL A 214 ? 0.2228 0.2238 0.2610 -0.0024 -0.0095 0.0191  216 VAL A O     
1760 C CB    . VAL A 214 ? 0.2061 0.2312 0.2503 -0.0016 -0.0047 0.0232  216 VAL A CB    
1761 C CG1   . VAL A 214 ? 0.2069 0.2366 0.2521 -0.0026 -0.0050 0.0216  216 VAL A CG1   
1762 C CG2   . VAL A 214 ? 0.1971 0.2316 0.2424 -0.0012 -0.0025 0.0253  216 VAL A CG2   
1763 N N     . VAL A 215 ? 0.2305 0.2344 0.2732 -0.0122 -0.0130 0.0255  217 VAL A N     
1764 C CA    . VAL A 215 ? 0.2459 0.2372 0.2841 -0.0144 -0.0160 0.0220  217 VAL A CA    
1765 C C     . VAL A 215 ? 0.2380 0.2350 0.2751 -0.0143 -0.0169 0.0179  217 VAL A C     
1766 O O     . VAL A 215 ? 0.2335 0.2439 0.2753 -0.0160 -0.0171 0.0196  217 VAL A O     
1767 C CB    . VAL A 215 ? 0.2640 0.2453 0.3015 -0.0222 -0.0194 0.0250  217 VAL A CB    
1768 C CG1   . VAL A 215 ? 0.2632 0.2492 0.3045 -0.0250 -0.0185 0.0325  217 VAL A CG1   
1769 C CG2   . VAL A 215 ? 0.2729 0.2577 0.3111 -0.0299 -0.0231 0.0235  217 VAL A CG2   
1770 N N     . ASP A 216 ? 0.2355 0.2229 0.2659 -0.0113 -0.0171 0.0128  218 ASP A N     
1771 C CA    . ASP A 216 ? 0.2254 0.2163 0.2524 -0.0107 -0.0182 0.0094  218 ASP A CA    
1772 C C     . ASP A 216 ? 0.2266 0.2200 0.2543 -0.0179 -0.0233 0.0096  218 ASP A C     
1773 O O     . ASP A 216 ? 0.2291 0.2112 0.2531 -0.0229 -0.0261 0.0079  218 ASP A O     
1774 C CB    . ASP A 216 ? 0.2320 0.2115 0.2502 -0.0067 -0.0169 0.0039  218 ASP A CB    
1775 C CG    . ASP A 216 ? 0.2240 0.2076 0.2370 -0.0051 -0.0170 0.0015  218 ASP A CG    
1776 O OD1   . ASP A 216 ? 0.2204 0.2127 0.2354 -0.0075 -0.0199 0.0033  218 ASP A OD1   
1777 O OD2   . ASP A 216 ? 0.2336 0.2126 0.2405 -0.0010 -0.0140 -0.0017 218 ASP A OD2   
1778 N N     . PRO A 217 ? 0.2252 0.2337 0.2579 -0.0186 -0.0246 0.0116  219 PRO A N     
1779 C CA    . PRO A 217 ? 0.2370 0.2532 0.2726 -0.0258 -0.0299 0.0123  219 PRO A CA    
1780 C C     . PRO A 217 ? 0.2553 0.2616 0.2814 -0.0290 -0.0342 0.0072  219 PRO A C     
1781 O O     . PRO A 217 ? 0.2568 0.2664 0.2836 -0.0368 -0.0394 0.0069  219 PRO A O     
1782 C CB    . PRO A 217 ? 0.2288 0.2632 0.2708 -0.0217 -0.0296 0.0149  219 PRO A CB    
1783 C CG    . PRO A 217 ? 0.2246 0.2542 0.2620 -0.0132 -0.0253 0.0136  219 PRO A CG    
1784 C CD    . PRO A 217 ? 0.2117 0.2308 0.2476 -0.0124 -0.0214 0.0132  219 PRO A CD    
1785 N N     . VAL A 218 ? 0.2624 0.2573 0.2792 -0.0235 -0.0319 0.0031  220 VAL A N     
1786 C CA    . VAL A 218 ? 0.2861 0.2711 0.2914 -0.0250 -0.0347 -0.0027 220 VAL A CA    
1787 C C     . VAL A 218 ? 0.3021 0.2674 0.3007 -0.0272 -0.0343 -0.0071 220 VAL A C     
1788 O O     . VAL A 218 ? 0.3171 0.2722 0.3062 -0.0316 -0.0377 -0.0125 220 VAL A O     
1789 C CB    . VAL A 218 ? 0.2915 0.2770 0.2905 -0.0172 -0.0312 -0.0041 220 VAL A CB    
1790 C CG1   . VAL A 218 ? 0.2992 0.2703 0.2855 -0.0155 -0.0296 -0.0105 220 VAL A CG1   
1791 C CG2   . VAL A 218 ? 0.2850 0.2845 0.2851 -0.0163 -0.0343 -0.0011 220 VAL A CG2   
1792 N N     . ASP A 219 ? 0.3020 0.2615 0.3049 -0.0240 -0.0303 -0.0048 221 ASP A N     
1793 C CA    . ASP A 219 ? 0.3228 0.2623 0.3197 -0.0229 -0.0290 -0.0083 221 ASP A CA    
1794 C C     . ASP A 219 ? 0.3242 0.2625 0.3292 -0.0228 -0.0274 -0.0023 221 ASP A C     
1795 O O     . ASP A 219 ? 0.3112 0.2550 0.3206 -0.0159 -0.0232 0.0004  221 ASP A O     
1796 C CB    . ASP A 219 ? 0.3193 0.2531 0.3094 -0.0137 -0.0242 -0.0131 221 ASP A CB    
1797 C CG    . ASP A 219 ? 0.3493 0.2630 0.3332 -0.0101 -0.0224 -0.0175 221 ASP A CG    
1798 O OD1   . ASP A 219 ? 0.3519 0.2518 0.3346 -0.0152 -0.0254 -0.0172 221 ASP A OD1   
1799 O OD2   . ASP A 219 ? 0.3459 0.2574 0.3258 -0.0020 -0.0178 -0.0213 221 ASP A OD2   
1800 N N     . GLU A 220 ? 0.3427 0.2737 0.3486 -0.0312 -0.0309 0.0000  222 GLU A N     
1801 C CA    . GLU A 220 ? 0.3519 0.2828 0.3646 -0.0325 -0.0297 0.0071  222 GLU A CA    
1802 C C     . GLU A 220 ? 0.3539 0.2703 0.3639 -0.0240 -0.0265 0.0075  222 GLU A C     
1803 O O     . GLU A 220 ? 0.3518 0.2711 0.3671 -0.0226 -0.0250 0.0141  222 GLU A O     
1804 C CB    . GLU A 220 ? 0.3708 0.2967 0.3844 -0.0449 -0.0342 0.0102  222 GLU A CB    
1805 C CG    . GLU A 220 ? 0.4320 0.3321 0.4344 -0.0497 -0.0374 0.0046  222 GLU A CG    
1806 C CD    . GLU A 220 ? 0.4981 0.3956 0.5014 -0.0646 -0.0423 0.0073  222 GLU A CD    
1807 O OE1   . GLU A 220 ? 0.5365 0.4371 0.5367 -0.0725 -0.0467 0.0026  222 GLU A OE1   
1808 O OE2   . GLU A 220 ? 0.5216 0.4156 0.5286 -0.0693 -0.0420 0.0146  222 GLU A OE2   
1809 N N     . LYS A 221 ? 0.3621 0.2645 0.3639 -0.0180 -0.0253 0.0006  223 LYS A N     
1810 C CA    . LYS A 221 ? 0.3681 0.2601 0.3686 -0.0077 -0.0218 0.0003  223 LYS A CA    
1811 C C     . LYS A 221 ? 0.3427 0.2525 0.3490 0.0010  -0.0173 0.0012  223 LYS A C     
1812 O O     . LYS A 221 ? 0.3425 0.2515 0.3517 0.0090  -0.0147 0.0032  223 LYS A O     
1813 C CB    . LYS A 221 ? 0.3955 0.2654 0.3847 -0.0040 -0.0217 -0.0082 223 LYS A CB    
1814 C CG    . LYS A 221 ? 0.4583 0.3041 0.4403 -0.0120 -0.0260 -0.0090 223 LYS A CG    
1815 C CD    . LYS A 221 ? 0.5085 0.3499 0.4963 -0.0143 -0.0271 0.0008  223 LYS A CD    
1816 C CE    . LYS A 221 ? 0.5516 0.3892 0.5391 -0.0296 -0.0319 0.0045  223 LYS A CE    
1817 N NZ    . LYS A 221 ? 0.5696 0.4121 0.5643 -0.0328 -0.0320 0.0156  223 LYS A NZ    
1818 N N     . ARG A 222 ? 0.3221 0.2481 0.3304 -0.0009 -0.0167 0.0001  224 ARG A N     
1819 C CA    . ARG A 222 ? 0.2998 0.2406 0.3118 0.0054  -0.0125 0.0002  224 ARG A CA    
1820 C C     . ARG A 222 ? 0.2715 0.2269 0.2923 0.0045  -0.0118 0.0070  224 ARG A C     
1821 O O     . ARG A 222 ? 0.2531 0.2161 0.2771 -0.0016 -0.0138 0.0100  224 ARG A O     
1822 C CB    . ARG A 222 ? 0.3037 0.2520 0.3118 0.0035  -0.0124 -0.0035 224 ARG A CB    
1823 C CG    . ARG A 222 ? 0.3265 0.2803 0.3322 0.0097  -0.0078 -0.0067 224 ARG A CG    
1824 C CD    . ARG A 222 ? 0.3191 0.2875 0.3318 0.0119  -0.0048 -0.0029 224 ARG A CD    
1825 N NE    . ARG A 222 ? 0.3272 0.2969 0.3406 0.0185  -0.0005 -0.0048 224 ARG A NE    
1826 C CZ    . ARG A 222 ? 0.3212 0.3021 0.3367 0.0208  0.0034  -0.0048 224 ARG A CZ    
1827 N NH1   . ARG A 222 ? 0.2900 0.2789 0.3054 0.0172  0.0040  -0.0032 224 ARG A NH1   
1828 N NH2   . ARG A 222 ? 0.3187 0.3025 0.3363 0.0268  0.0069  -0.0065 224 ARG A NH2   
1829 N N     . ASN A 223 ? 0.2471 0.2077 0.2717 0.0107  -0.0089 0.0088  225 ASN A N     
1830 C CA    . ASN A 223 ? 0.2329 0.2087 0.2640 0.0104  -0.0077 0.0135  225 ASN A CA    
1831 C C     . ASN A 223 ? 0.2202 0.2071 0.2514 0.0119  -0.0046 0.0106  225 ASN A C     
1832 O O     . ASN A 223 ? 0.2171 0.2062 0.2479 0.0166  -0.0018 0.0081  225 ASN A O     
1833 C CB    . ASN A 223 ? 0.2309 0.2076 0.2657 0.0153  -0.0072 0.0177  225 ASN A CB    
1834 C CG    . ASN A 223 ? 0.2160 0.2080 0.2556 0.0136  -0.0066 0.0224  225 ASN A CG    
1835 O OD1   . ASN A 223 ? 0.2050 0.2048 0.2453 0.0090  -0.0062 0.0224  225 ASN A OD1   
1836 N ND2   . ASN A 223 ? 0.2121 0.2085 0.2547 0.0178  -0.0066 0.0260  225 ASN A ND2   
1837 N N     . VAL A 224 ? 0.2092 0.2030 0.2409 0.0078  -0.0050 0.0113  226 VAL A N     
1838 C CA    . VAL A 224 ? 0.1984 0.1993 0.2288 0.0087  -0.0024 0.0092  226 VAL A CA    
1839 C C     . VAL A 224 ? 0.1926 0.2022 0.2265 0.0106  0.0004  0.0104  226 VAL A C     
1840 O O     . VAL A 224 ? 0.1943 0.2071 0.2266 0.0118  0.0032  0.0081  226 VAL A O     
1841 C CB    . VAL A 224 ? 0.1924 0.1978 0.2228 0.0055  -0.0036 0.0101  226 VAL A CB    
1842 C CG1   . VAL A 224 ? 0.2026 0.2107 0.2297 0.0068  -0.0010 0.0084  226 VAL A CG1   
1843 C CG2   . VAL A 224 ? 0.2012 0.2011 0.2291 0.0028  -0.0072 0.0091  226 VAL A CG2   
1844 N N     . ALA A 225 ? 0.1899 0.2038 0.2279 0.0101  -0.0006 0.0142  227 ALA A N     
1845 C CA    . ALA A 225 ? 0.1858 0.2092 0.2269 0.0113  0.0009  0.0156  227 ALA A CA    
1846 C C     . ALA A 225 ? 0.1839 0.2072 0.2276 0.0162  0.0007  0.0165  227 ALA A C     
1847 O O     . ALA A 225 ? 0.1844 0.2161 0.2317 0.0173  0.0002  0.0196  227 ALA A O     
1848 C CB    . ALA A 225 ? 0.1735 0.2032 0.2165 0.0084  -0.0001 0.0194  227 ALA A CB    
1849 N N     . ALA A 226 ? 0.1915 0.2060 0.2333 0.0197  0.0011  0.0137  228 ALA A N     
1850 C CA    . ALA A 226 ? 0.2002 0.2135 0.2447 0.0265  0.0013  0.0142  228 ALA A CA    
1851 C C     . ALA A 226 ? 0.1929 0.2224 0.2428 0.0291  0.0034  0.0144  228 ALA A C     
1852 O O     . ALA A 226 ? 0.2029 0.2379 0.2577 0.0337  0.0021  0.0178  228 ALA A O     
1853 C CB    . ALA A 226 ? 0.2094 0.2108 0.2494 0.0303  0.0025  0.0093  228 ALA A CB    
1854 N N     . ASN A 227 ? 0.1838 0.2210 0.2328 0.0255  0.0062  0.0114  229 ASN A N     
1855 C CA    . ASN A 227 ? 0.1849 0.2383 0.2391 0.0261  0.0084  0.0110  229 ASN A CA    
1856 C C     . ASN A 227 ? 0.1826 0.2466 0.2381 0.0198  0.0075  0.0128  229 ASN A C     
1857 O O     . ASN A 227 ? 0.1814 0.2590 0.2403 0.0177  0.0090  0.0120  229 ASN A O     
1858 C CB    . ASN A 227 ? 0.1797 0.2353 0.2317 0.0259  0.0129  0.0064  229 ASN A CB    
1859 C CG    . ASN A 227 ? 0.1752 0.2485 0.2346 0.0288  0.0155  0.0059  229 ASN A CG    
1860 O OD1   . ASN A 227 ? 0.1666 0.2465 0.2327 0.0355  0.0141  0.0081  229 ASN A OD1   
1861 N ND2   . ASN A 227 ? 0.1647 0.2462 0.2232 0.0239  0.0193  0.0036  229 ASN A ND2   
1862 N N     . LEU A 228 ? 0.1855 0.2437 0.2378 0.0164  0.0053  0.0148  230 LEU A N     
1863 C CA    . LEU A 228 ? 0.1902 0.2572 0.2424 0.0115  0.0043  0.0161  230 LEU A CA    
1864 C C     . LEU A 228 ? 0.1969 0.2749 0.2543 0.0146  0.0015  0.0204  230 LEU A C     
1865 O O     . LEU A 228 ? 0.2086 0.2813 0.2667 0.0185  -0.0010 0.0246  230 LEU A O     
1866 C CB    . LEU A 228 ? 0.1914 0.2507 0.2391 0.0085  0.0033  0.0171  230 LEU A CB    
1867 C CG    . LEU A 228 ? 0.1738 0.2404 0.2196 0.0042  0.0027  0.0179  230 LEU A CG    
1868 C CD1   . LEU A 228 ? 0.1724 0.2427 0.2154 -0.0004 0.0050  0.0134  230 LEU A CD1   
1869 C CD2   . LEU A 228 ? 0.1882 0.2487 0.2309 0.0029  0.0026  0.0190  230 LEU A CD2   
1870 N N     . SER A 229 ? 0.1960 0.2894 0.2568 0.0125  0.0015  0.0199  231 SER A N     
1871 C CA    . SER A 229 ? 0.1981 0.3053 0.2642 0.0156  -0.0019 0.0244  231 SER A CA    
1872 C C     . SER A 229 ? 0.1993 0.3061 0.2609 0.0127  -0.0050 0.0282  231 SER A C     
1873 O O     . SER A 229 ? 0.2016 0.3025 0.2569 0.0070  -0.0037 0.0258  231 SER A O     
1874 C CB    . SER A 229 ? 0.1970 0.3235 0.2679 0.0120  -0.0016 0.0224  231 SER A CB    
1875 O OG    . SER A 229 ? 0.2077 0.3352 0.2726 0.0025  -0.0010 0.0191  231 SER A OG    
1876 N N     . LEU A 230 ? 0.1982 0.3111 0.2625 0.0173  -0.0088 0.0345  232 LEU A N     
1877 C CA    . LEU A 230 ? 0.1979 0.3136 0.2571 0.0141  -0.0117 0.0390  232 LEU A CA    
1878 C C     . LEU A 230 ? 0.1920 0.3200 0.2473 0.0060  -0.0116 0.0352  232 LEU A C     
1879 O O     . LEU A 230 ? 0.1870 0.3114 0.2349 0.0010  -0.0109 0.0343  232 LEU A O     
1880 C CB    . LEU A 230 ? 0.2089 0.3311 0.2714 0.0208  -0.0164 0.0473  232 LEU A CB    
1881 C CG    . LEU A 230 ? 0.2133 0.3442 0.2705 0.0179  -0.0203 0.0534  232 LEU A CG    
1882 C CD1   . LEU A 230 ? 0.2127 0.3307 0.2617 0.0136  -0.0190 0.0555  232 LEU A CD1   
1883 C CD2   . LEU A 230 ? 0.2223 0.3596 0.2838 0.0263  -0.0254 0.0622  232 LEU A CD2   
1884 N N     . ASP A 231 ? 0.1914 0.3340 0.2515 0.0043  -0.0121 0.0325  233 ASP A N     
1885 C CA    . ASP A 231 ? 0.1953 0.3489 0.2510 -0.0046 -0.0126 0.0283  233 ASP A CA    
1886 C C     . ASP A 231 ? 0.1979 0.3386 0.2463 -0.0112 -0.0081 0.0211  233 ASP A C     
1887 O O     . ASP A 231 ? 0.2036 0.3447 0.2440 -0.0176 -0.0080 0.0178  233 ASP A O     
1888 C CB    . ASP A 231 ? 0.2006 0.3748 0.2641 -0.0060 -0.0146 0.0278  233 ASP A CB    
1889 C CG    . ASP A 231 ? 0.2086 0.3994 0.2772 -0.0003 -0.0204 0.0353  233 ASP A CG    
1890 O OD1   . ASP A 231 ? 0.2334 0.4188 0.2971 0.0027  -0.0229 0.0409  233 ASP A OD1   
1891 O OD2   . ASP A 231 ? 0.2411 0.4515 0.3190 0.0012  -0.0226 0.0362  233 ASP A OD2   
1892 N N     . ASN A 232 ? 0.1876 0.3163 0.2380 -0.0090 -0.0045 0.0186  234 ASN A N     
1893 C CA    . ASN A 232 ? 0.1868 0.3016 0.2305 -0.0135 -0.0006 0.0130  234 ASN A CA    
1894 C C     . ASN A 232 ? 0.1920 0.2947 0.2300 -0.0117 0.0004  0.0137  234 ASN A C     
1895 O O     . ASN A 232 ? 0.1897 0.2856 0.2207 -0.0155 0.0026  0.0094  234 ASN A O     
1896 C CB    . ASN A 232 ? 0.1834 0.2908 0.2300 -0.0119 0.0026  0.0109  234 ASN A CB    
1897 C CG    . ASN A 232 ? 0.1842 0.3026 0.2339 -0.0173 0.0036  0.0082  234 ASN A CG    
1898 O OD1   . ASN A 232 ? 0.1794 0.2977 0.2330 -0.0157 0.0060  0.0076  234 ASN A OD1   
1899 N ND2   . ASN A 232 ? 0.1588 0.2875 0.2062 -0.0246 0.0018  0.0063  234 ASN A ND2   
1900 N N     . LEU A 233 ? 0.1902 0.2903 0.2314 -0.0061 -0.0012 0.0191  235 LEU A N     
1901 C CA    . LEU A 233 ? 0.1951 0.2889 0.2323 -0.0057 -0.0008 0.0212  235 LEU A CA    
1902 C C     . LEU A 233 ? 0.2028 0.3055 0.2337 -0.0099 -0.0015 0.0210  235 LEU A C     
1903 O O     . LEU A 233 ? 0.2054 0.3043 0.2305 -0.0119 0.0011  0.0181  235 LEU A O     
1904 C CB    . LEU A 233 ? 0.1915 0.2818 0.2325 -0.0008 -0.0030 0.0279  235 LEU A CB    
1905 C CG    . LEU A 233 ? 0.1833 0.2712 0.2210 -0.0019 -0.0030 0.0320  235 LEU A CG    
1906 C CD1   . LEU A 233 ? 0.1670 0.2458 0.2039 -0.0026 0.0000  0.0287  235 LEU A CD1   
1907 C CD2   . LEU A 233 ? 0.2046 0.2894 0.2449 0.0014  -0.0062 0.0398  235 LEU A CD2   
1908 N N     . ALA A 234 ? 0.2079 0.3236 0.2399 -0.0106 -0.0051 0.0241  236 ALA A N     
1909 C CA    . ALA A 234 ? 0.2199 0.3462 0.2448 -0.0151 -0.0066 0.0238  236 ALA A CA    
1910 C C     . ALA A 234 ? 0.2261 0.3500 0.2438 -0.0214 -0.0038 0.0148  236 ALA A C     
1911 O O     . ALA A 234 ? 0.2328 0.3559 0.2419 -0.0241 -0.0020 0.0118  236 ALA A O     
1912 C CB    . ALA A 234 ? 0.2180 0.3602 0.2464 -0.0145 -0.0119 0.0288  236 ALA A CB    
1913 N N     . ARG A 235 ? 0.2308 0.3526 0.2517 -0.0236 -0.0030 0.0105  237 ARG A N     
1914 C CA    . ARG A 235 ? 0.2461 0.3615 0.2595 -0.0301 -0.0003 0.0021  237 ARG A CA    
1915 C C     . ARG A 235 ? 0.2420 0.3411 0.2492 -0.0282 0.0042  -0.0018 237 ARG A C     
1916 O O     . ARG A 235 ? 0.2522 0.3474 0.2499 -0.0317 0.0061  -0.0075 237 ARG A O     
1917 C CB    . ARG A 235 ? 0.2453 0.3611 0.2634 -0.0336 -0.0001 -0.0003 237 ARG A CB    
1918 C CG    . ARG A 235 ? 0.2668 0.4031 0.2893 -0.0380 -0.0045 0.0012  237 ARG A CG    
1919 C CD    . ARG A 235 ? 0.2628 0.4055 0.2932 -0.0407 -0.0042 0.0005  237 ARG A CD    
1920 N NE    . ARG A 235 ? 0.3158 0.4827 0.3532 -0.0426 -0.0090 0.0036  237 ARG A NE    
1921 C CZ    . ARG A 235 ? 0.3199 0.5007 0.3696 -0.0368 -0.0106 0.0086  237 ARG A CZ    
1922 N NH1   . ARG A 235 ? 0.3015 0.4735 0.3570 -0.0295 -0.0074 0.0104  237 ARG A NH1   
1923 N NH2   . ARG A 235 ? 0.3267 0.5314 0.3828 -0.0380 -0.0156 0.0116  237 ARG A NH2   
1924 N N     . PHE A 236 ? 0.2328 0.3232 0.2453 -0.0223 0.0059  0.0010  238 PHE A N     
1925 C CA    . PHE A 236 ? 0.2307 0.3087 0.2395 -0.0192 0.0096  -0.0017 238 PHE A CA    
1926 C C     . PHE A 236 ? 0.2296 0.3123 0.2338 -0.0180 0.0109  -0.0012 238 PHE A C     
1927 O O     . PHE A 236 ? 0.2381 0.3147 0.2353 -0.0178 0.0143  -0.0067 238 PHE A O     
1928 C CB    . PHE A 236 ? 0.2219 0.2930 0.2378 -0.0139 0.0100  0.0019  238 PHE A CB    
1929 C CG    . PHE A 236 ? 0.2317 0.2930 0.2456 -0.0102 0.0130  0.0000  238 PHE A CG    
1930 C CD1   . PHE A 236 ? 0.2327 0.2821 0.2411 -0.0103 0.0156  -0.0053 238 PHE A CD1   
1931 C CD2   . PHE A 236 ? 0.2162 0.2807 0.2342 -0.0065 0.0130  0.0041  238 PHE A CD2   
1932 C CE1   . PHE A 236 ? 0.2306 0.2723 0.2382 -0.0052 0.0180  -0.0064 238 PHE A CE1   
1933 C CE2   . PHE A 236 ? 0.2140 0.2735 0.2321 -0.0027 0.0153  0.0027  238 PHE A CE2   
1934 C CZ    . PHE A 236 ? 0.2196 0.2681 0.2328 -0.0012 0.0177  -0.0025 238 PHE A CZ    
1935 N N     . VAL A 237 ? 0.2139 0.3069 0.2217 -0.0169 0.0084  0.0056  239 VAL A N     
1936 C CA    . VAL A 237 ? 0.2187 0.3187 0.2220 -0.0169 0.0096  0.0075  239 VAL A CA    
1937 C C     . VAL A 237 ? 0.2304 0.3347 0.2226 -0.0213 0.0108  0.0011  239 VAL A C     
1938 O O     . VAL A 237 ? 0.2363 0.3387 0.2219 -0.0204 0.0149  -0.0033 239 VAL A O     
1939 C CB    . VAL A 237 ? 0.2128 0.3218 0.2202 -0.0163 0.0060  0.0170  239 VAL A CB    
1940 C CG1   . VAL A 237 ? 0.2198 0.3387 0.2200 -0.0183 0.0071  0.0195  239 VAL A CG1   
1941 C CG2   . VAL A 237 ? 0.2045 0.3067 0.2206 -0.0124 0.0056  0.0221  239 VAL A CG2   
1942 N N     . HIS A 238 ? 0.2344 0.3449 0.2245 -0.0261 0.0071  0.0003  240 HIS A N     
1943 C CA    . HIS A 238 ? 0.2474 0.3616 0.2260 -0.0321 0.0072  -0.0066 240 HIS A CA    
1944 C C     . HIS A 238 ? 0.2573 0.3559 0.2287 -0.0330 0.0118  -0.0167 240 HIS A C     
1945 O O     . HIS A 238 ? 0.2601 0.3566 0.2203 -0.0343 0.0148  -0.0230 240 HIS A O     
1946 C CB    . HIS A 238 ? 0.2519 0.3770 0.2316 -0.0378 0.0017  -0.0058 240 HIS A CB    
1947 C CG    . HIS A 238 ? 0.2711 0.4026 0.2382 -0.0453 0.0005  -0.0123 240 HIS A CG    
1948 N ND1   . HIS A 238 ? 0.3015 0.4273 0.2629 -0.0526 0.0004  -0.0209 240 HIS A ND1   
1949 C CD2   . HIS A 238 ? 0.2752 0.4173 0.2325 -0.0473 -0.0005 -0.0118 240 HIS A CD2   
1950 C CE1   . HIS A 238 ? 0.2794 0.4118 0.2282 -0.0589 -0.0009 -0.0261 240 HIS A CE1   
1951 N NE2   . HIS A 238 ? 0.2974 0.4404 0.2433 -0.0555 -0.0014 -0.0207 240 HIS A NE2   
1952 N N     . LEU A 239 ? 0.2497 0.3365 0.2264 -0.0321 0.0124  -0.0179 241 LEU A N     
1953 C CA    . LEU A 239 ? 0.2714 0.3399 0.2415 -0.0321 0.0164  -0.0259 241 LEU A CA    
1954 C C     . LEU A 239 ? 0.2724 0.3338 0.2398 -0.0246 0.0214  -0.0279 241 LEU A C     
1955 O O     . LEU A 239 ? 0.2858 0.3361 0.2428 -0.0243 0.0251  -0.0360 241 LEU A O     
1956 C CB    . LEU A 239 ? 0.2693 0.3276 0.2460 -0.0321 0.0160  -0.0246 241 LEU A CB    
1957 C CG    . LEU A 239 ? 0.3011 0.3574 0.2754 -0.0411 0.0141  -0.0279 241 LEU A CG    
1958 C CD1   . LEU A 239 ? 0.3188 0.3567 0.2800 -0.0455 0.0171  -0.0370 241 LEU A CD1   
1959 C CD2   . LEU A 239 ? 0.3463 0.4226 0.3222 -0.0475 0.0094  -0.0261 241 LEU A CD2   
1960 N N     . CYS A 240 ? 0.2540 0.3220 0.2308 -0.0187 0.0215  -0.0209 242 CYS A N     
1961 C CA    . CYS A 240 ? 0.2630 0.3305 0.2402 -0.0118 0.0259  -0.0214 242 CYS A CA    
1962 C C     . CYS A 240 ? 0.2775 0.3536 0.2452 -0.0126 0.0289  -0.0252 242 CYS A C     
1963 O O     . CYS A 240 ? 0.2932 0.3647 0.2559 -0.0075 0.0341  -0.0309 242 CYS A O     
1964 C CB    . CYS A 240 ? 0.2456 0.3211 0.2348 -0.0080 0.0245  -0.0125 242 CYS A CB    
1965 S SG    . CYS A 240 ? 0.2395 0.3032 0.2378 -0.0045 0.0229  -0.0100 242 CYS A SG    
1966 N N     . ARG A 241 ? 0.2811 0.3703 0.2458 -0.0183 0.0257  -0.0221 243 ARG A N     
1967 C CA    . ARG A 241 ? 0.2965 0.3955 0.2502 -0.0203 0.0280  -0.0253 243 ARG A CA    
1968 C C     . ARG A 241 ? 0.3212 0.4090 0.2606 -0.0231 0.0304  -0.0373 243 ARG A C     
1969 O O     . ARG A 241 ? 0.3327 0.4190 0.2631 -0.0198 0.0359  -0.0439 243 ARG A O     
1970 C CB    . ARG A 241 ? 0.2959 0.4111 0.2490 -0.0258 0.0228  -0.0180 243 ARG A CB    
1971 C CG    . ARG A 241 ? 0.2746 0.3992 0.2381 -0.0230 0.0216  -0.0065 243 ARG A CG    
1972 C CD    . ARG A 241 ? 0.2699 0.4063 0.2335 -0.0272 0.0156  0.0018  243 ARG A CD    
1973 N NE    . ARG A 241 ? 0.2338 0.3746 0.2061 -0.0249 0.0144  0.0128  243 ARG A NE    
1974 C CZ    . ARG A 241 ? 0.2431 0.3905 0.2180 -0.0263 0.0090  0.0223  243 ARG A CZ    
1975 N NH1   . ARG A 241 ? 0.2422 0.3960 0.2131 -0.0293 0.0040  0.0226  243 ARG A NH1   
1976 N NH2   . ARG A 241 ? 0.2300 0.3771 0.2117 -0.0246 0.0084  0.0317  243 ARG A NH2   
1977 N N     . GLU A 242 ? 0.3260 0.4057 0.2634 -0.0293 0.0266  -0.0404 244 GLU A N     
1978 C CA    . GLU A 242 ? 0.3552 0.4204 0.2786 -0.0340 0.0282  -0.0519 244 GLU A CA    
1979 C C     . GLU A 242 ? 0.3655 0.4103 0.2858 -0.0264 0.0343  -0.0585 244 GLU A C     
1980 O O     . GLU A 242 ? 0.3830 0.4191 0.2901 -0.0250 0.0388  -0.0681 244 GLU A O     
1981 C CB    . GLU A 242 ? 0.3576 0.4180 0.2825 -0.0427 0.0232  -0.0525 244 GLU A CB    
1982 C CG    . GLU A 242 ? 0.3655 0.4450 0.2909 -0.0510 0.0168  -0.0487 244 GLU A CG    
1983 C CD    . GLU A 242 ? 0.3906 0.4670 0.3198 -0.0592 0.0127  -0.0495 244 GLU A CD    
1984 O OE1   . GLU A 242 ? 0.3515 0.4203 0.2911 -0.0561 0.0132  -0.0456 244 GLU A OE1   
1985 O OE2   . GLU A 242 ? 0.4317 0.5141 0.3531 -0.0692 0.0092  -0.0541 244 GLU A OE2   
1986 N N     . PHE A 243 ? 0.3541 0.3909 0.2858 -0.0209 0.0343  -0.0536 245 PHE A N     
1987 C CA    . PHE A 243 ? 0.3695 0.3869 0.2992 -0.0126 0.0391  -0.0583 245 PHE A CA    
1988 C C     . PHE A 243 ? 0.3799 0.4024 0.3065 -0.0034 0.0451  -0.0617 245 PHE A C     
1989 O O     . PHE A 243 ? 0.3968 0.4035 0.3132 0.0013  0.0499  -0.0707 245 PHE A O     
1990 C CB    . PHE A 243 ? 0.3519 0.3639 0.2946 -0.0077 0.0375  -0.0510 245 PHE A CB    
1991 C CG    . PHE A 243 ? 0.3665 0.3586 0.3067 0.0013  0.0415  -0.0547 245 PHE A CG    
1992 C CD1   . PHE A 243 ? 0.3923 0.3595 0.3218 -0.0015 0.0422  -0.0610 245 PHE A CD1   
1993 C CD2   . PHE A 243 ? 0.3504 0.3489 0.2988 0.0125  0.0444  -0.0516 245 PHE A CD2   
1994 C CE1   . PHE A 243 ? 0.3986 0.3453 0.3249 0.0081  0.0456  -0.0636 245 PHE A CE1   
1995 C CE2   . PHE A 243 ? 0.3624 0.3441 0.3091 0.0224  0.0476  -0.0544 245 PHE A CE2   
1996 C CZ    . PHE A 243 ? 0.3875 0.3421 0.3227 0.0209  0.0482  -0.0602 245 PHE A CZ    
1997 N N     . MET A 244 ? 0.3738 0.4180 0.3090 -0.0011 0.0453  -0.0546 246 MET A N     
1998 C CA    . MET A 244 ? 0.3925 0.4461 0.3266 0.0071  0.0516  -0.0569 246 MET A CA    
1999 C C     . MET A 244 ? 0.4207 0.4757 0.3378 0.0043  0.0554  -0.0664 246 MET A C     
2000 O O     . MET A 244 ? 0.4305 0.4834 0.3416 0.0123  0.0622  -0.0734 246 MET A O     
2001 C CB    . MET A 244 ? 0.3723 0.4486 0.3197 0.0083  0.0509  -0.0461 246 MET A CB    
2002 C CG    . MET A 244 ? 0.3729 0.4472 0.3358 0.0120  0.0479  -0.0383 246 MET A CG    
2003 S SD    . MET A 244 ? 0.3979 0.4639 0.3672 0.0253  0.0526  -0.0410 246 MET A SD    
2004 C CE    . MET A 244 ? 0.4436 0.4821 0.3969 0.0285  0.0557  -0.0534 246 MET A CE    
2005 N N     . GLU A 245 ? 0.4353 0.4943 0.3445 -0.0066 0.0508  -0.0669 247 GLU A N     
2006 C CA    . GLU A 245 ? 0.4711 0.5316 0.3620 -0.0115 0.0529  -0.0763 247 GLU A CA    
2007 C C     . GLU A 245 ? 0.4995 0.5336 0.3759 -0.0114 0.0557  -0.0898 247 GLU A C     
2008 O O     . GLU A 245 ? 0.5176 0.5467 0.3798 -0.0080 0.0616  -0.1002 247 GLU A O     
2009 C CB    . GLU A 245 ? 0.4708 0.5445 0.3583 -0.0235 0.0458  -0.0721 247 GLU A CB    
2010 C CG    . GLU A 245 ? 0.4919 0.5909 0.3855 -0.0241 0.0443  -0.0612 247 GLU A CG    
2011 C CD    . GLU A 245 ? 0.5388 0.6513 0.4216 -0.0341 0.0392  -0.0604 247 GLU A CD    
2012 O OE1   . GLU A 245 ? 0.5650 0.6946 0.4421 -0.0344 0.0412  -0.0571 247 GLU A OE1   
2013 O OE2   . GLU A 245 ? 0.5593 0.6668 0.4392 -0.0421 0.0333  -0.0627 247 GLU A OE2   
2014 N N     . ALA A 246 ? 0.5002 0.5165 0.3792 -0.0155 0.0516  -0.0897 248 ALA A N     
2015 C CA    . ALA A 246 ? 0.5319 0.5198 0.3968 -0.0174 0.0535  -0.1014 248 ALA A CA    
2016 C C     . ALA A 246 ? 0.5290 0.4971 0.4027 -0.0139 0.0523  -0.0977 248 ALA A C     
2017 O O     . ALA A 246 ? 0.5312 0.4914 0.4053 -0.0236 0.0474  -0.0961 248 ALA A O     
2018 C CB    . ALA A 246 ? 0.5451 0.5319 0.3970 -0.0326 0.0485  -0.1071 248 ALA A CB    
2019 N N     . PRO A 247 ? 0.5302 0.4920 0.4107 0.0000  0.0570  -0.0961 249 PRO A N     
2020 C CA    . PRO A 247 ? 0.5277 0.4727 0.4165 0.0050  0.0558  -0.0913 249 PRO A CA    
2021 C C     . PRO A 247 ? 0.5570 0.4692 0.4315 -0.0004 0.0557  -0.0991 249 PRO A C     
2022 O O     . PRO A 247 ? 0.5840 0.4774 0.4427 0.0021  0.0602  -0.1103 249 PRO A O     
2023 C CB    . PRO A 247 ? 0.5298 0.4760 0.4247 0.0216  0.0615  -0.0907 249 PRO A CB    
2024 C CG    . PRO A 247 ? 0.5246 0.4959 0.4200 0.0240  0.0650  -0.0918 249 PRO A CG    
2025 C CD    . PRO A 247 ? 0.5364 0.5089 0.4169 0.0119  0.0637  -0.0988 249 PRO A CD    
2026 N N     . SER A 248 ? 0.5494 0.4546 0.4291 -0.0080 0.0510  -0.0932 250 SER A N     
2027 C CA    . SER A 248 ? 0.5745 0.4511 0.4415 -0.0170 0.0500  -0.0987 250 SER A CA    
2028 C C     . SER A 248 ? 0.5639 0.4286 0.4394 -0.0149 0.0482  -0.0901 250 SER A C     
2029 O O     . SER A 248 ? 0.5324 0.4167 0.4235 -0.0140 0.0451  -0.0800 250 SER A O     
2030 C CB    . SER A 248 ? 0.5757 0.4629 0.4384 -0.0348 0.0452  -0.1008 250 SER A CB    
2031 O OG    . SER A 248 ? 0.6220 0.4821 0.4694 -0.0457 0.0448  -0.1087 250 SER A OG    
2032 N N     . LEU A 249 ? 0.5873 0.4188 0.4513 -0.0140 0.0501  -0.0941 251 LEU A N     
2033 C CA    . LEU A 249 ? 0.5804 0.3982 0.4491 -0.0138 0.0482  -0.0859 251 LEU A CA    
2034 C C     . LEU A 249 ? 0.5668 0.3946 0.4395 -0.0309 0.0435  -0.0815 251 LEU A C     
2035 O O     . LEU A 249 ? 0.5547 0.3828 0.4352 -0.0322 0.0415  -0.0729 251 LEU A O     
2036 C CB    . LEU A 249 ? 0.6174 0.3945 0.4705 -0.0095 0.0514  -0.0909 251 LEU A CB    
2037 C CG    . LEU A 249 ? 0.6190 0.3779 0.4741 -0.0064 0.0502  -0.0820 251 LEU A CG    
2038 C CD1   . LEU A 249 ? 0.5774 0.3567 0.4497 0.0077  0.0493  -0.0720 251 LEU A CD1   
2039 C CD2   . LEU A 249 ? 0.6600 0.3761 0.4975 -0.0009 0.0535  -0.0873 251 LEU A CD2   
2040 N N     . GLY A 250 ? 0.5649 0.4031 0.4324 -0.0434 0.0418  -0.0875 252 GLY A N     
2041 C CA    . GLY A 250 ? 0.5516 0.4044 0.4240 -0.0594 0.0373  -0.0842 252 GLY A CA    
2042 C C     . GLY A 250 ? 0.5155 0.4001 0.4073 -0.0571 0.0341  -0.0737 252 GLY A C     
2043 O O     . GLY A 250 ? 0.5147 0.4102 0.4131 -0.0671 0.0310  -0.0690 252 GLY A O     
2044 N N     . PHE A 251 ? 0.4911 0.3906 0.3919 -0.0441 0.0351  -0.0702 253 PHE A N     
2045 C CA    . PHE A 251 ? 0.4550 0.3800 0.3730 -0.0403 0.0324  -0.0603 253 PHE A CA    
2046 C C     . PHE A 251 ? 0.4434 0.3608 0.3684 -0.0370 0.0321  -0.0527 253 PHE A C     
2047 O O     . PHE A 251 ? 0.4197 0.3549 0.3570 -0.0371 0.0296  -0.0454 253 PHE A O     
2048 C CB    . PHE A 251 ? 0.4427 0.3830 0.3670 -0.0286 0.0338  -0.0587 253 PHE A CB    
2049 C CG    . PHE A 251 ? 0.4414 0.4003 0.3632 -0.0329 0.0328  -0.0622 253 PHE A CG    
2050 C CD1   . PHE A 251 ? 0.4658 0.4159 0.3736 -0.0325 0.0360  -0.0718 253 PHE A CD1   
2051 C CD2   . PHE A 251 ? 0.4281 0.4126 0.3604 -0.0365 0.0288  -0.0557 253 PHE A CD2   
2052 C CE1   . PHE A 251 ? 0.4623 0.4304 0.3660 -0.0368 0.0350  -0.0748 253 PHE A CE1   
2053 C CE2   . PHE A 251 ? 0.4388 0.4405 0.3677 -0.0401 0.0274  -0.0577 253 PHE A CE2   
2054 C CZ    . PHE A 251 ? 0.4452 0.4395 0.3595 -0.0407 0.0304  -0.0671 253 PHE A CZ    
2055 N N     . PHE A 252 ? 0.4612 0.3511 0.3770 -0.0336 0.0347  -0.0544 254 PHE A N     
2056 C CA    . PHE A 252 ? 0.4585 0.3387 0.3780 -0.0296 0.0345  -0.0471 254 PHE A CA    
2057 C C     . PHE A 252 ? 0.4805 0.3442 0.3923 -0.0420 0.0343  -0.0466 254 PHE A C     
2058 O O     . PHE A 252 ? 0.4827 0.3353 0.3942 -0.0401 0.0345  -0.0406 254 PHE A O     
2059 C CB    . PHE A 252 ? 0.4622 0.3253 0.3783 -0.0148 0.0370  -0.0469 254 PHE A CB    
2060 C CG    . PHE A 252 ? 0.4378 0.3206 0.3641 -0.0030 0.0374  -0.0456 254 PHE A CG    
2061 C CD1   . PHE A 252 ? 0.4335 0.3197 0.3557 0.0009  0.0400  -0.0528 254 PHE A CD1   
2062 C CD2   . PHE A 252 ? 0.4127 0.3117 0.3522 0.0030  0.0352  -0.0375 254 PHE A CD2   
2063 C CE1   . PHE A 252 ? 0.4218 0.3281 0.3535 0.0104  0.0409  -0.0511 254 PHE A CE1   
2064 C CE2   . PHE A 252 ? 0.4113 0.3292 0.3604 0.0120  0.0355  -0.0360 254 PHE A CE2   
2065 C CZ    . PHE A 252 ? 0.4060 0.3284 0.3517 0.0155  0.0385  -0.0424 254 PHE A CZ    
2066 N N     . LYS A 253 ? 0.4997 0.3631 0.4048 -0.0554 0.0337  -0.0525 255 LYS A N     
2067 C CA    . LYS A 253 ? 0.5262 0.3783 0.4251 -0.0703 0.0334  -0.0522 255 LYS A CA    
2068 C C     . LYS A 253 ? 0.5119 0.3937 0.4209 -0.0822 0.0304  -0.0508 255 LYS A C     
2069 O O     . LYS A 253 ? 0.5087 0.4088 0.4206 -0.0840 0.0284  -0.0547 255 LYS A O     
2070 C CB    . LYS A 253 ? 0.5595 0.3819 0.4400 -0.0777 0.0352  -0.0612 255 LYS A CB    
2071 C CG    . LYS A 253 ? 0.5946 0.3856 0.4642 -0.0647 0.0384  -0.0633 255 LYS A CG    
2072 C CD    . LYS A 253 ? 0.6479 0.4094 0.4983 -0.0716 0.0403  -0.0740 255 LYS A CD    
2073 C CE    . LYS A 253 ? 0.6868 0.4181 0.5269 -0.0558 0.0439  -0.0771 255 LYS A CE    
2074 N NZ    . LYS A 253 ? 0.7443 0.4490 0.5654 -0.0605 0.0461  -0.0898 255 LYS A NZ    
2075 N N     . PRO A 254 ? 0.5136 0.4014 0.4279 -0.0899 0.0301  -0.0448 256 PRO A N     
2076 C CA    . PRO A 254 ? 0.4980 0.4175 0.4246 -0.0987 0.0275  -0.0426 256 PRO A CA    
2077 C C     . PRO A 254 ? 0.5125 0.4384 0.4341 -0.1141 0.0254  -0.0494 256 PRO A C     
2078 O O     . PRO A 254 ? 0.5376 0.4399 0.4453 -0.1246 0.0266  -0.0545 256 PRO A O     
2079 C CB    . PRO A 254 ? 0.4986 0.4181 0.4289 -0.1034 0.0291  -0.0357 256 PRO A CB    
2080 C CG    . PRO A 254 ? 0.5122 0.4048 0.4349 -0.0928 0.0315  -0.0324 256 PRO A CG    
2081 C CD    . PRO A 254 ? 0.5241 0.3911 0.4332 -0.0902 0.0323  -0.0395 256 PRO A CD    
2082 N N     . ILE A 260 ? 0.8090 0.5221 0.6786 0.0493  -0.0683 -0.0051 262 ILE A N     
2083 C CA    . ILE A 260 ? 0.8085 0.5138 0.6756 0.0347  -0.0714 -0.0098 262 ILE A CA    
2084 C C     . ILE A 260 ? 0.8155 0.5046 0.6829 0.0125  -0.0763 -0.0018 262 ILE A C     
2085 O O     . ILE A 260 ? 0.8004 0.5027 0.6793 0.0052  -0.0739 0.0083  262 ILE A O     
2086 C CB    . ILE A 260 ? 0.7684 0.5142 0.6541 0.0314  -0.0649 -0.0126 262 ILE A CB    
2087 C CG1   . ILE A 260 ? 0.7807 0.5166 0.6572 0.0268  -0.0682 -0.0213 262 ILE A CG1   
2088 C CG2   . ILE A 260 ? 0.7386 0.5118 0.6453 0.0157  -0.0614 -0.0034 262 ILE A CG2   
2089 C CD1   . ILE A 260 ? 0.7484 0.5178 0.6358 0.0314  -0.0615 -0.0258 262 ILE A CD1   
2090 N N     . GLU A 261 ? 0.8377 0.4990 0.6921 0.0018  -0.0833 -0.0063 263 GLU A N     
2091 C CA    . GLU A 261 ? 0.8419 0.4916 0.6983 -0.0215 -0.0880 0.0010  263 GLU A CA    
2092 C C     . GLU A 261 ? 0.7992 0.4842 0.6753 -0.0361 -0.0853 0.0014  263 GLU A C     
2093 O O     . GLU A 261 ? 0.7872 0.4870 0.6654 -0.0307 -0.0838 -0.0070 263 GLU A O     
2094 C CB    . GLU A 261 ? 0.8944 0.4948 0.7268 -0.0282 -0.0980 -0.0035 263 GLU A CB    
2095 C CG    . GLU A 261 ? 0.9196 0.5115 0.7424 -0.0287 -0.1027 -0.0165 263 GLU A CG    
2096 C CD    . GLU A 261 ? 0.9549 0.5337 0.7609 -0.0035 -0.1021 -0.0280 263 GLU A CD    
2097 O OE1   . GLU A 261 ? 0.9808 0.5367 0.7696 -0.0020 -0.1082 -0.0391 263 GLU A OE1   
2098 O OE2   . GLU A 261 ? 0.9513 0.5442 0.7611 0.0150  -0.0958 -0.0262 263 GLU A OE2   
2099 N N     . PRO A 262 ? 0.7769 0.4765 0.6668 -0.0536 -0.0845 0.0116  264 PRO A N     
2100 C CA    . PRO A 262 ? 0.7354 0.4718 0.6450 -0.0650 -0.0813 0.0131  264 PRO A CA    
2101 C C     . PRO A 262 ? 0.7346 0.4675 0.6398 -0.0722 -0.0867 0.0043  264 PRO A C     
2102 O O     . PRO A 262 ? 0.7042 0.4674 0.6227 -0.0747 -0.0838 0.0027  264 PRO A O     
2103 C CB    . PRO A 262 ? 0.7340 0.4757 0.6526 -0.0828 -0.0816 0.0251  264 PRO A CB    
2104 C CG    . PRO A 262 ? 0.7551 0.4755 0.6639 -0.0757 -0.0810 0.0316  264 PRO A CG    
2105 C CD    . PRO A 262 ? 0.7943 0.4770 0.6809 -0.0626 -0.0861 0.0228  264 PRO A CD    
2106 N N     . GLU A 263 ? 0.7635 0.4579 0.6487 -0.0748 -0.0950 -0.0015 265 GLU A N     
2107 C CA    . GLU A 263 ? 0.7687 0.4545 0.6456 -0.0809 -0.1019 -0.0113 265 GLU A CA    
2108 C C     . GLU A 263 ? 0.7518 0.4480 0.6240 -0.0626 -0.0986 -0.0219 265 GLU A C     
2109 O O     . GLU A 263 ? 0.7352 0.4524 0.6137 -0.0664 -0.0989 -0.0261 265 GLU A O     
2110 C CB    . GLU A 263 ? 0.8194 0.4568 0.6737 -0.0887 -0.1122 -0.0152 265 GLU A CB    
2111 C CG    . GLU A 263 ? 0.8468 0.4758 0.6937 -0.1005 -0.1211 -0.0244 265 GLU A CG    
2112 C CD    . GLU A 263 ? 0.8275 0.4937 0.6963 -0.1193 -0.1211 -0.0191 265 GLU A CD    
2113 O OE1   . GLU A 263 ? 0.8310 0.5041 0.7114 -0.1357 -0.1209 -0.0081 265 GLU A OE1   
2114 O OE2   . GLU A 263 ? 0.8140 0.5034 0.6879 -0.1168 -0.1211 -0.0256 265 GLU A OE2   
2115 N N     . ARG A 264 ? 0.7499 0.4329 0.6109 -0.0427 -0.0955 -0.0258 266 ARG A N     
2116 C CA    . ARG A 264 ? 0.7317 0.4273 0.5886 -0.0247 -0.0911 -0.0348 266 ARG A CA    
2117 C C     . ARG A 264 ? 0.6756 0.4166 0.5550 -0.0234 -0.0819 -0.0300 266 ARG A C     
2118 O O     . ARG A 264 ? 0.6578 0.4162 0.5386 -0.0193 -0.0795 -0.0353 266 ARG A O     
2119 C CB    . ARG A 264 ? 0.7546 0.4316 0.5972 -0.0031 -0.0890 -0.0388 266 ARG A CB    
2120 C CG    . ARG A 264 ? 0.7757 0.4603 0.6092 0.0149  -0.0858 -0.0495 266 ARG A CG    
2121 C CD    . ARG A 264 ? 0.8154 0.4993 0.6431 0.0381  -0.0804 -0.0513 266 ARG A CD    
2122 N NE    . ARG A 264 ? 0.8314 0.5377 0.6582 0.0531  -0.0742 -0.0586 266 ARG A NE    
2123 C CZ    . ARG A 264 ? 0.8229 0.5520 0.6563 0.0702  -0.0659 -0.0581 266 ARG A CZ    
2124 N NH1   . ARG A 264 ? 0.8140 0.5469 0.6552 0.0758  -0.0634 -0.0515 266 ARG A NH1   
2125 N NH2   . ARG A 264 ? 0.8134 0.5635 0.6457 0.0814  -0.0600 -0.0640 266 ARG A NH2   
2126 N N     . LEU A 265 ? 0.6416 0.3996 0.5370 -0.0269 -0.0769 -0.0200 267 LEU A N     
2127 C CA    . LEU A 265 ? 0.5930 0.3901 0.5090 -0.0273 -0.0689 -0.0150 267 LEU A CA    
2128 C C     . LEU A 265 ? 0.5690 0.3841 0.4945 -0.0414 -0.0706 -0.0141 267 LEU A C     
2129 O O     . LEU A 265 ? 0.5420 0.3826 0.4766 -0.0380 -0.0654 -0.0147 267 LEU A O     
2130 C CB    . LEU A 265 ? 0.5768 0.3843 0.5050 -0.0285 -0.0647 -0.0053 267 LEU A CB    
2131 C CG    . LEU A 265 ? 0.5517 0.3954 0.4990 -0.0262 -0.0564 -0.0008 267 LEU A CG    
2132 C CD1   . LEU A 265 ? 0.5485 0.4040 0.4954 -0.0102 -0.0507 -0.0061 267 LEU A CD1   
2133 C CD2   . LEU A 265 ? 0.5322 0.3819 0.4882 -0.0291 -0.0543 0.0082  267 LEU A CD2   
2134 N N     . ARG A 266 ? 0.5765 0.3785 0.4996 -0.0571 -0.0780 -0.0124 268 ARG A N     
2135 C CA    . ARG A 266 ? 0.5639 0.3838 0.4954 -0.0701 -0.0810 -0.0120 268 ARG A CA    
2136 C C     . ARG A 266 ? 0.5601 0.3798 0.4814 -0.0641 -0.0835 -0.0220 268 ARG A C     
2137 O O     . ARG A 266 ? 0.5346 0.3805 0.4649 -0.0635 -0.0804 -0.0215 268 ARG A O     
2138 C CB    . ARG A 266 ? 0.5867 0.3930 0.5176 -0.0893 -0.0890 -0.0084 268 ARG A CB    
2139 C CG    . ARG A 266 ? 0.6009 0.4333 0.5447 -0.1031 -0.0917 -0.0065 268 ARG A CG    
2140 C CD    . ARG A 266 ? 0.6601 0.4772 0.6003 -0.1229 -0.1015 -0.0057 268 ARG A CD    
2141 N NE    . ARG A 266 ? 0.7217 0.5022 0.6399 -0.1226 -0.1102 -0.0159 268 ARG A NE    
2142 C CZ    . ARG A 266 ? 0.7503 0.5295 0.6603 -0.1238 -0.1167 -0.0254 268 ARG A CZ    
2143 N NH1   . ARG A 266 ? 0.7336 0.5469 0.6560 -0.1253 -0.1157 -0.0253 268 ARG A NH1   
2144 N NH2   . ARG A 266 ? 0.7988 0.5416 0.6865 -0.1227 -0.1248 -0.0353 268 ARG A NH2   
2145 N N     . LYS A 267 ? 0.5783 0.3674 0.4792 -0.0584 -0.0890 -0.0307 269 LYS A N     
2146 C CA    . LYS A 267 ? 0.5813 0.3666 0.4681 -0.0499 -0.0914 -0.0413 269 LYS A CA    
2147 C C     . LYS A 267 ? 0.5497 0.3579 0.4404 -0.0336 -0.0815 -0.0420 269 LYS A C     
2148 O O     . LYS A 267 ? 0.5391 0.3618 0.4279 -0.0311 -0.0808 -0.0456 269 LYS A O     
2149 C CB    . LYS A 267 ? 0.6251 0.3706 0.4873 -0.0434 -0.0981 -0.0508 269 LYS A CB    
2150 C CG    . LYS A 267 ? 0.6677 0.3848 0.5198 -0.0603 -0.1102 -0.0536 269 LYS A CG    
2151 C CD    . LYS A 267 ? 0.7302 0.4071 0.5539 -0.0505 -0.1169 -0.0659 269 LYS A CD    
2152 C CE    . LYS A 267 ? 0.7807 0.4175 0.5915 -0.0653 -0.1279 -0.0670 269 LYS A CE    
2153 N NZ    . LYS A 267 ? 0.7874 0.4160 0.6065 -0.0698 -0.1247 -0.0555 269 LYS A NZ    
2154 N N     . ILE A 268 ? 0.5282 0.3396 0.4235 -0.0229 -0.0741 -0.0385 270 ILE A N     
2155 C CA    . ILE A 268 ? 0.4977 0.3327 0.3989 -0.0098 -0.0643 -0.0381 270 ILE A CA    
2156 C C     . ILE A 268 ? 0.4613 0.3271 0.3801 -0.0171 -0.0597 -0.0314 270 ILE A C     
2157 O O     . ILE A 268 ? 0.4509 0.3323 0.3691 -0.0116 -0.0553 -0.0329 270 ILE A O     
2158 C CB    . ILE A 268 ? 0.4934 0.3300 0.3994 0.0008  -0.0581 -0.0348 270 ILE A CB    
2159 C CG1   . ILE A 268 ? 0.5202 0.3286 0.4065 0.0138  -0.0613 -0.0424 270 ILE A CG1   
2160 C CG2   . ILE A 268 ? 0.4642 0.3314 0.3823 0.0088  -0.0478 -0.0321 270 ILE A CG2   
2161 C CD1   . ILE A 268 ? 0.5266 0.3296 0.4159 0.0216  -0.0589 -0.0384 270 ILE A CD1   
2162 N N     . VAL A 269 ? 0.4357 0.3093 0.3687 -0.0288 -0.0604 -0.0237 271 VAL A N     
2163 C CA    . VAL A 269 ? 0.4077 0.3080 0.3560 -0.0347 -0.0568 -0.0177 271 VAL A CA    
2164 C C     . VAL A 269 ? 0.4118 0.3173 0.3552 -0.0393 -0.0616 -0.0211 271 VAL A C     
2165 O O     . VAL A 269 ? 0.3918 0.3158 0.3391 -0.0358 -0.0572 -0.0196 271 VAL A O     
2166 C CB    . VAL A 269 ? 0.3936 0.3017 0.3564 -0.0452 -0.0568 -0.0095 271 VAL A CB    
2167 C CG1   . VAL A 269 ? 0.3775 0.3116 0.3535 -0.0502 -0.0543 -0.0046 271 VAL A CG1   
2168 C CG2   . VAL A 269 ? 0.3841 0.2931 0.3526 -0.0388 -0.0510 -0.0056 271 VAL A CG2   
2169 N N     . GLU A 270 ? 0.4380 0.3264 0.3717 -0.0472 -0.0711 -0.0258 272 GLU A N     
2170 C CA    . GLU A 270 ? 0.4599 0.3545 0.3883 -0.0515 -0.0770 -0.0300 272 GLU A CA    
2171 C C     . GLU A 270 ? 0.4682 0.3597 0.3807 -0.0385 -0.0753 -0.0375 272 GLU A C     
2172 O O     . GLU A 270 ? 0.4649 0.3711 0.3761 -0.0376 -0.0759 -0.0381 272 GLU A O     
2173 C CB    . GLU A 270 ? 0.4799 0.3600 0.4041 -0.0661 -0.0884 -0.0328 272 GLU A CB    
2174 C CG    . GLU A 270 ? 0.5379 0.3852 0.4403 -0.0638 -0.0956 -0.0429 272 GLU A CG    
2175 C CD    . GLU A 270 ? 0.5672 0.3997 0.4659 -0.0812 -0.1075 -0.0455 272 GLU A CD    
2176 O OE1   . GLU A 270 ? 0.6174 0.4446 0.5250 -0.0928 -0.1088 -0.0389 272 GLU A OE1   
2177 O OE2   . GLU A 270 ? 0.6174 0.4437 0.5037 -0.0837 -0.1157 -0.0540 272 GLU A OE2   
2178 N N     . GLU A 271 ? 0.4853 0.3592 0.3855 -0.0274 -0.0729 -0.0427 273 GLU A N     
2179 C CA    . GLU A 271 ? 0.5030 0.3782 0.3894 -0.0129 -0.0685 -0.0486 273 GLU A CA    
2180 C C     . GLU A 271 ? 0.4568 0.3592 0.3544 -0.0074 -0.0580 -0.0417 273 GLU A C     
2181 O O     . GLU A 271 ? 0.4532 0.3652 0.3431 -0.0018 -0.0558 -0.0433 273 GLU A O     
2182 C CB    . GLU A 271 ? 0.5161 0.3733 0.3915 -0.0003 -0.0657 -0.0536 273 GLU A CB    
2183 C CG    . GLU A 271 ? 0.5848 0.4095 0.4395 0.0013  -0.0751 -0.0637 273 GLU A CG    
2184 C CD    . GLU A 271 ? 0.6162 0.4288 0.4565 0.0199  -0.0706 -0.0700 273 GLU A CD    
2185 O OE1   . GLU A 271 ? 0.6449 0.4786 0.4878 0.0315  -0.0609 -0.0687 273 GLU A OE1   
2186 O OE2   . GLU A 271 ? 0.6910 0.4730 0.5170 0.0231  -0.0768 -0.0762 273 GLU A OE2   
2187 N N     . ARG A 272 ? 0.4219 0.3349 0.3362 -0.0092 -0.0517 -0.0340 274 ARG A N     
2188 C CA    . ARG A 272 ? 0.3864 0.3218 0.3121 -0.0061 -0.0422 -0.0271 274 ARG A CA    
2189 C C     . ARG A 272 ? 0.3609 0.3109 0.2928 -0.0128 -0.0435 -0.0224 274 ARG A C     
2190 O O     . ARG A 272 ? 0.3450 0.3081 0.2773 -0.0084 -0.0374 -0.0189 274 ARG A O     
2191 C CB    . ARG A 272 ? 0.3645 0.3052 0.3052 -0.0071 -0.0369 -0.0214 274 ARG A CB    
2192 C CG    . ARG A 272 ? 0.3964 0.3245 0.3312 0.0014  -0.0357 -0.0256 274 ARG A CG    
2193 C CD    . ARG A 272 ? 0.3759 0.3122 0.3251 0.0017  -0.0307 -0.0201 274 ARG A CD    
2194 N NE    . ARG A 272 ? 0.4338 0.3785 0.3815 0.0135  -0.0234 -0.0219 274 ARG A NE    
2195 C CZ    . ARG A 272 ? 0.3906 0.3560 0.3494 0.0147  -0.0152 -0.0174 274 ARG A CZ    
2196 N NH1   . ARG A 272 ? 0.3453 0.3221 0.3166 0.0060  -0.0132 -0.0111 274 ARG A NH1   
2197 N NH2   . ARG A 272 ? 0.4185 0.3933 0.3758 0.0248  -0.0091 -0.0194 274 ARG A NH2   
2198 N N     . GLY A 273 ? 0.3501 0.2983 0.2865 -0.0232 -0.0515 -0.0218 275 GLY A N     
2199 C CA    . GLY A 273 ? 0.3337 0.2979 0.2762 -0.0285 -0.0538 -0.0177 275 GLY A CA    
2200 C C     . GLY A 273 ? 0.3115 0.2917 0.2700 -0.0294 -0.0471 -0.0091 275 GLY A C     
2201 O O     . GLY A 273 ? 0.2968 0.2907 0.2589 -0.0297 -0.0470 -0.0052 275 GLY A O     
2202 N N     . THR A 274 ? 0.2963 0.2740 0.2630 -0.0291 -0.0421 -0.0066 276 THR A N     
2203 C CA    . THR A 274 ? 0.2742 0.2641 0.2542 -0.0294 -0.0357 0.0002  276 THR A CA    
2204 C C     . THR A 274 ? 0.2716 0.2674 0.2636 -0.0379 -0.0390 0.0041  276 THR A C     
2205 O O     . THR A 274 ? 0.2816 0.2700 0.2729 -0.0447 -0.0453 0.0023  276 THR A O     
2206 C CB    . THR A 274 ? 0.2633 0.2499 0.2462 -0.0248 -0.0290 0.0004  276 THR A CB    
2207 O OG1   . THR A 274 ? 0.2736 0.2468 0.2538 -0.0259 -0.0329 -0.0030 276 THR A OG1   
2208 C CG2   . THR A 274 ? 0.2547 0.2426 0.2295 -0.0166 -0.0231 -0.0013 276 THR A CG2   
2209 N N     . ALA A 275 ? 0.2572 0.2654 0.2591 -0.0376 -0.0346 0.0095  277 ALA A N     
2210 C CA    . ALA A 275 ? 0.2556 0.2716 0.2692 -0.0435 -0.0355 0.0136  277 ALA A CA    
2211 C C     . ALA A 275 ? 0.2527 0.2630 0.2705 -0.0428 -0.0315 0.0145  277 ALA A C     
2212 O O     . ALA A 275 ? 0.2500 0.2623 0.2697 -0.0378 -0.0255 0.0153  277 ALA A O     
2213 C CB    . ALA A 275 ? 0.2355 0.2668 0.2556 -0.0415 -0.0330 0.0180  277 ALA A CB    
2214 N N     . VAL A 276 ? 0.2648 0.2678 0.2835 -0.0483 -0.0352 0.0147  278 VAL A N     
2215 C CA    . VAL A 276 ? 0.2659 0.2631 0.2873 -0.0472 -0.0327 0.0159  278 VAL A CA    
2216 C C     . VAL A 276 ? 0.2575 0.2628 0.2876 -0.0540 -0.0337 0.0214  278 VAL A C     
2217 O O     . VAL A 276 ? 0.2671 0.2732 0.2980 -0.0621 -0.0386 0.0230  278 VAL A O     
2218 C CB    . VAL A 276 ? 0.2806 0.2584 0.2923 -0.0457 -0.0359 0.0119  278 VAL A CB    
2219 C CG1   . VAL A 276 ? 0.2889 0.2620 0.3029 -0.0429 -0.0336 0.0139  278 VAL A CG1   
2220 C CG2   . VAL A 276 ? 0.2965 0.2687 0.2987 -0.0379 -0.0344 0.0063  278 VAL A CG2   
2221 N N     . PHE A 277 ? 0.2468 0.2596 0.2832 -0.0512 -0.0291 0.0241  279 PHE A N     
2222 C CA    . PHE A 277 ? 0.2437 0.2669 0.2874 -0.0559 -0.0289 0.0294  279 PHE A CA    
2223 C C     . PHE A 277 ? 0.2324 0.2577 0.2791 -0.0516 -0.0248 0.0307  279 PHE A C     
2224 O O     . PHE A 277 ? 0.2324 0.2544 0.2776 -0.0456 -0.0219 0.0276  279 PHE A O     
2225 C CB    . PHE A 277 ? 0.2337 0.2744 0.2833 -0.0568 -0.0284 0.0314  279 PHE A CB    
2226 C CG    . PHE A 277 ? 0.2291 0.2747 0.2789 -0.0490 -0.0239 0.0297  279 PHE A CG    
2227 C CD1   . PHE A 277 ? 0.2274 0.2804 0.2815 -0.0454 -0.0198 0.0312  279 PHE A CD1   
2228 C CD2   . PHE A 277 ? 0.2335 0.2750 0.2778 -0.0456 -0.0241 0.0266  279 PHE A CD2   
2229 C CE1   . PHE A 277 ? 0.2337 0.2871 0.2865 -0.0394 -0.0162 0.0296  279 PHE A CE1   
2230 C CE2   . PHE A 277 ? 0.2229 0.2662 0.2660 -0.0394 -0.0198 0.0262  279 PHE A CE2   
2231 C CZ    . PHE A 277 ? 0.2217 0.2696 0.2691 -0.0369 -0.0160 0.0276  279 PHE A CZ    
2232 N N     . ALA A 278 ? 0.2256 0.2584 0.2766 -0.0551 -0.0245 0.0356  280 ALA A N     
2233 C CA    . ALA A 278 ? 0.2185 0.2550 0.2715 -0.0512 -0.0214 0.0369  280 ALA A CA    
2234 C C     . ALA A 278 ? 0.2103 0.2637 0.2689 -0.0518 -0.0191 0.0404  280 ALA A C     
2235 O O     . ALA A 278 ? 0.2068 0.2691 0.2684 -0.0572 -0.0203 0.0441  280 ALA A O     
2236 C CB    . ALA A 278 ? 0.2317 0.2567 0.2803 -0.0529 -0.0236 0.0397  280 ALA A CB    
2237 N N     . VAL A 279 ? 0.2055 0.2640 0.2652 -0.0462 -0.0159 0.0387  281 VAL A N     
2238 C CA    . VAL A 279 ? 0.1992 0.2713 0.2614 -0.0449 -0.0137 0.0415  281 VAL A CA    
2239 C C     . VAL A 279 ? 0.2065 0.2765 0.2664 -0.0458 -0.0141 0.0451  281 VAL A C     
2240 O O     . VAL A 279 ? 0.2045 0.2670 0.2619 -0.0422 -0.0145 0.0425  281 VAL A O     
2241 C CB    . VAL A 279 ? 0.1959 0.2715 0.2582 -0.0383 -0.0109 0.0369  281 VAL A CB    
2242 C CG1   . VAL A 279 ? 0.1744 0.2631 0.2371 -0.0353 -0.0089 0.0386  281 VAL A CG1   
2243 C CG2   . VAL A 279 ? 0.1916 0.2648 0.2537 -0.0365 -0.0104 0.0340  281 VAL A CG2   
2244 N N     . LYS A 280 ? 0.2093 0.2871 0.2700 -0.0507 -0.0141 0.0516  282 LYS A N     
2245 C CA    . LYS A 280 ? 0.2216 0.2972 0.2783 -0.0518 -0.0143 0.0569  282 LYS A CA    
2246 C C     . LYS A 280 ? 0.2130 0.3064 0.2705 -0.0488 -0.0109 0.0595  282 LYS A C     
2247 O O     . LYS A 280 ? 0.2108 0.3193 0.2724 -0.0500 -0.0088 0.0614  282 LYS A O     
2248 C CB    . LYS A 280 ? 0.2322 0.2995 0.2870 -0.0613 -0.0169 0.0635  282 LYS A CB    
2249 C CG    . LYS A 280 ? 0.2625 0.3267 0.3119 -0.0636 -0.0167 0.0713  282 LYS A CG    
2250 C CD    . LYS A 280 ? 0.2978 0.3486 0.3440 -0.0746 -0.0199 0.0776  282 LYS A CD    
2251 C CE    . LYS A 280 ? 0.3213 0.3686 0.3612 -0.0784 -0.0191 0.0875  282 LYS A CE    
2252 N NZ    . LYS A 280 ? 0.3521 0.3820 0.3879 -0.0909 -0.0227 0.0935  282 LYS A NZ    
2253 N N     . PHE A 281 ? 0.2179 0.3104 0.2707 -0.0437 -0.0104 0.0592  283 PHE A N     
2254 C CA    . PHE A 281 ? 0.2209 0.3289 0.2717 -0.0394 -0.0075 0.0608  283 PHE A CA    
2255 C C     . PHE A 281 ? 0.2329 0.3365 0.2766 -0.0372 -0.0086 0.0643  283 PHE A C     
2256 O O     . PHE A 281 ? 0.2321 0.3209 0.2731 -0.0370 -0.0116 0.0638  283 PHE A O     
2257 C CB    . PHE A 281 ? 0.2130 0.3264 0.2645 -0.0319 -0.0062 0.0522  283 PHE A CB    
2258 C CG    . PHE A 281 ? 0.2170 0.3187 0.2676 -0.0286 -0.0085 0.0448  283 PHE A CG    
2259 C CD1   . PHE A 281 ? 0.2140 0.3176 0.2603 -0.0238 -0.0094 0.0417  283 PHE A CD1   
2260 C CD2   . PHE A 281 ? 0.2210 0.3121 0.2751 -0.0307 -0.0097 0.0413  283 PHE A CD2   
2261 C CE1   . PHE A 281 ? 0.2131 0.3098 0.2605 -0.0220 -0.0117 0.0351  283 PHE A CE1   
2262 C CE2   . PHE A 281 ? 0.2251 0.3089 0.2795 -0.0284 -0.0110 0.0353  283 PHE A CE2   
2263 C CZ    . PHE A 281 ? 0.2292 0.3168 0.2812 -0.0246 -0.0121 0.0322  283 PHE A CZ    
2264 N N     . ARG A 282 ? 0.2404 0.3575 0.2799 -0.0344 -0.0060 0.0681  284 ARG A N     
2265 C CA    . ARG A 282 ? 0.2539 0.3686 0.2850 -0.0313 -0.0071 0.0723  284 ARG A CA    
2266 C C     . ARG A 282 ? 0.2443 0.3553 0.2730 -0.0233 -0.0100 0.0635  284 ARG A C     
2267 O O     . ARG A 282 ? 0.2282 0.3455 0.2590 -0.0192 -0.0095 0.0551  284 ARG A O     
2268 C CB    . ARG A 282 ? 0.2643 0.3966 0.2906 -0.0303 -0.0031 0.0790  284 ARG A CB    
2269 C CG    . ARG A 282 ? 0.3022 0.4406 0.3318 -0.0403 -0.0002 0.0896  284 ARG A CG    
2270 C CD    . ARG A 282 ? 0.3566 0.5096 0.3794 -0.0406 0.0038  0.0995  284 ARG A CD    
2271 N NE    . ARG A 282 ? 0.4256 0.5721 0.4476 -0.0525 0.0042  0.1120  284 ARG A NE    
2272 C CZ    . ARG A 282 ? 0.4677 0.5934 0.4812 -0.0551 0.0012  0.1181  284 ARG A CZ    
2273 N NH1   . ARG A 282 ? 0.5012 0.6145 0.5076 -0.0456 -0.0024 0.1129  284 ARG A NH1   
2274 N NH2   . ARG A 282 ? 0.4943 0.6113 0.5060 -0.0672 0.0015  0.1294  284 ARG A NH2   
2275 N N     . LYS A 283 ? 0.2470 0.3473 0.2714 -0.0214 -0.0133 0.0653  285 LYS A N     
2276 C CA    . LYS A 283 ? 0.2419 0.3430 0.2654 -0.0143 -0.0165 0.0576  285 LYS A CA    
2277 C C     . LYS A 283 ? 0.2356 0.3510 0.2530 -0.0086 -0.0162 0.0556  285 LYS A C     
2278 O O     . LYS A 283 ? 0.2410 0.3611 0.2503 -0.0072 -0.0151 0.0635  285 LYS A O     
2279 C CB    . LYS A 283 ? 0.2551 0.3445 0.2747 -0.0113 -0.0203 0.0606  285 LYS A CB    
2280 C CG    . LYS A 283 ? 0.2697 0.3641 0.2912 -0.0045 -0.0239 0.0524  285 LYS A CG    
2281 C CD    . LYS A 283 ? 0.3005 0.3851 0.3186 0.0006  -0.0276 0.0551  285 LYS A CD    
2282 C CE    . LYS A 283 ? 0.3438 0.4293 0.3504 0.0063  -0.0295 0.0627  285 LYS A CE    
2283 N NZ    . LYS A 283 ? 0.3864 0.4632 0.3890 0.0143  -0.0338 0.0641  285 LYS A NZ    
2284 N N     . PRO A 284 ? 0.2228 0.3443 0.2429 -0.0056 -0.0173 0.0452  286 PRO A N     
2285 C CA    . PRO A 284 ? 0.2262 0.3589 0.2387 0.0004  -0.0185 0.0410  286 PRO A CA    
2286 C C     . PRO A 284 ? 0.2275 0.3617 0.2341 0.0053  -0.0228 0.0436  286 PRO A C     
2287 O O     . PRO A 284 ? 0.2167 0.3440 0.2279 0.0052  -0.0259 0.0428  286 PRO A O     
2288 C CB    . PRO A 284 ? 0.2221 0.3544 0.2395 0.0004  -0.0204 0.0287  286 PRO A CB    
2289 C CG    . PRO A 284 ? 0.2140 0.3371 0.2403 -0.0052 -0.0180 0.0281  286 PRO A CG    
2290 C CD    . PRO A 284 ? 0.2139 0.3300 0.2426 -0.0083 -0.0175 0.0369  286 PRO A CD    
2291 N N     . ASP A 285 ? 0.2310 0.3747 0.2267 0.0104  -0.0230 0.0469  287 ASP A N     
2292 C CA    . ASP A 285 ? 0.2408 0.3871 0.2285 0.0166  -0.0273 0.0504  287 ASP A CA    
2293 C C     . ASP A 285 ? 0.2298 0.3846 0.2190 0.0209  -0.0332 0.0384  287 ASP A C     
2294 O O     . ASP A 285 ? 0.2325 0.3983 0.2128 0.0260  -0.0354 0.0347  287 ASP A O     
2295 C CB    . ASP A 285 ? 0.2635 0.4173 0.2375 0.0203  -0.0247 0.0597  287 ASP A CB    
2296 C CG    . ASP A 285 ? 0.2995 0.4549 0.2629 0.0278  -0.0293 0.0648  287 ASP A CG    
2297 O OD1   . ASP A 285 ? 0.3346 0.4829 0.3016 0.0300  -0.0339 0.0639  287 ASP A OD1   
2298 O OD2   . ASP A 285 ? 0.3324 0.4972 0.2829 0.0327  -0.0283 0.0697  287 ASP A OD2   
2299 N N     . ILE A 286 ? 0.2128 0.3635 0.2132 0.0181  -0.0358 0.0323  288 ILE A N     
2300 C CA    . ILE A 286 ? 0.2048 0.3646 0.2104 0.0188  -0.0412 0.0207  288 ILE A CA    
2301 C C     . ILE A 286 ? 0.1984 0.3589 0.2120 0.0204  -0.0448 0.0208  288 ILE A C     
2302 O O     . ILE A 286 ? 0.1951 0.3445 0.2109 0.0202  -0.0424 0.0280  288 ILE A O     
2303 C CB    . ILE A 286 ? 0.1924 0.3487 0.2053 0.0118  -0.0394 0.0110  288 ILE A CB    
2304 C CG1   . ILE A 286 ? 0.1728 0.3179 0.1968 0.0058  -0.0359 0.0128  288 ILE A CG1   
2305 C CG2   . ILE A 286 ? 0.2009 0.3570 0.2047 0.0128  -0.0359 0.0100  288 ILE A CG2   
2306 C CD1   . ILE A 286 ? 0.1726 0.3111 0.2013 -0.0003 -0.0331 0.0062  288 ILE A CD1   
2307 N N     . VAL A 287 ? 0.1960 0.3703 0.2138 0.0223  -0.0507 0.0127  289 VAL A N     
2308 C CA    . VAL A 287 ? 0.1924 0.3727 0.2192 0.0253  -0.0540 0.0122  289 VAL A CA    
2309 C C     . VAL A 287 ? 0.1823 0.3554 0.2221 0.0185  -0.0504 0.0099  289 VAL A C     
2310 O O     . VAL A 287 ? 0.1821 0.3493 0.2259 0.0103  -0.0470 0.0055  289 VAL A O     
2311 C CB    . VAL A 287 ? 0.1971 0.3997 0.2274 0.0284  -0.0618 0.0039  289 VAL A CB    
2312 C CG1   . VAL A 287 ? 0.2072 0.4179 0.2230 0.0382  -0.0664 0.0077  289 VAL A CG1   
2313 C CG2   . VAL A 287 ? 0.1862 0.3949 0.2234 0.0188  -0.0633 -0.0080 289 VAL A CG2   
2314 N N     . ASP A 288 ? 0.1854 0.3584 0.2300 0.0232  -0.0509 0.0131  290 ASP A N     
2315 C CA    . ASP A 288 ? 0.1796 0.3476 0.2352 0.0186  -0.0475 0.0112  290 ASP A CA    
2316 C C     . ASP A 288 ? 0.1703 0.3490 0.2376 0.0093  -0.0474 0.0016  290 ASP A C     
2317 O O     . ASP A 288 ? 0.1618 0.3315 0.2345 0.0020  -0.0428 0.0003  290 ASP A O     
2318 C CB    . ASP A 288 ? 0.1880 0.3615 0.2469 0.0277  -0.0496 0.0134  290 ASP A CB    
2319 C CG    . ASP A 288 ? 0.2252 0.3794 0.2724 0.0352  -0.0487 0.0231  290 ASP A CG    
2320 O OD1   . ASP A 288 ? 0.2516 0.3904 0.2898 0.0316  -0.0461 0.0288  290 ASP A OD1   
2321 O OD2   . ASP A 288 ? 0.2419 0.3963 0.2889 0.0446  -0.0505 0.0250  290 ASP A OD2   
2322 N N     . ASP A 289 ? 0.1703 0.3678 0.2409 0.0092  -0.0528 -0.0047 291 ASP A N     
2323 C CA    . ASP A 289 ? 0.1636 0.3723 0.2454 -0.0007 -0.0540 -0.0137 291 ASP A CA    
2324 C C     . ASP A 289 ? 0.1635 0.3584 0.2410 -0.0099 -0.0517 -0.0179 291 ASP A C     
2325 O O     . ASP A 289 ? 0.1588 0.3533 0.2440 -0.0199 -0.0506 -0.0235 291 ASP A O     
2326 C CB    . ASP A 289 ? 0.1651 0.3994 0.2518 0.0017  -0.0616 -0.0193 291 ASP A CB    
2327 C CG    . ASP A 289 ? 0.1647 0.4121 0.2542 0.0138  -0.0638 -0.0144 291 ASP A CG    
2328 O OD1   . ASP A 289 ? 0.1726 0.4176 0.2505 0.0247  -0.0665 -0.0090 291 ASP A OD1   
2329 O OD2   . ASP A 289 ? 0.1620 0.4208 0.2641 0.0134  -0.0623 -0.0153 291 ASP A OD2   
2330 N N     . ASN A 290 ? 0.1699 0.3531 0.2344 -0.0060 -0.0505 -0.0145 292 ASN A N     
2331 C CA    . ASN A 290 ? 0.1713 0.3395 0.2299 -0.0114 -0.0472 -0.0168 292 ASN A CA    
2332 C C     . ASN A 290 ? 0.1685 0.3206 0.2278 -0.0126 -0.0404 -0.0103 292 ASN A C     
2333 O O     . ASN A 290 ? 0.1592 0.3011 0.2207 -0.0190 -0.0372 -0.0130 292 ASN A O     
2334 C CB    . ASN A 290 ? 0.1790 0.3471 0.2236 -0.0059 -0.0491 -0.0172 292 ASN A CB    
2335 C CG    . ASN A 290 ? 0.1908 0.3723 0.2331 -0.0064 -0.0564 -0.0264 292 ASN A CG    
2336 O OD1   . ASN A 290 ? 0.2010 0.3894 0.2527 -0.0139 -0.0598 -0.0339 292 ASN A OD1   
2337 N ND2   . ASN A 290 ? 0.1786 0.3648 0.2080 0.0009  -0.0590 -0.0259 292 ASN A ND2   
2338 N N     . LEU A 291 ? 0.1698 0.3188 0.2263 -0.0066 -0.0387 -0.0017 293 LEU A N     
2339 C CA    . LEU A 291 ? 0.1652 0.2996 0.2211 -0.0080 -0.0334 0.0045  293 LEU A CA    
2340 C C     . LEU A 291 ? 0.1654 0.2949 0.2306 -0.0132 -0.0306 0.0029  293 LEU A C     
2341 O O     . LEU A 291 ? 0.1593 0.2784 0.2246 -0.0176 -0.0268 0.0030  293 LEU A O     
2342 C CB    . LEU A 291 ? 0.1720 0.3019 0.2219 -0.0019 -0.0332 0.0138  293 LEU A CB    
2343 C CG    . LEU A 291 ? 0.1652 0.2804 0.2143 -0.0043 -0.0290 0.0203  293 LEU A CG    
2344 C CD1   . LEU A 291 ? 0.1703 0.2814 0.2160 -0.0082 -0.0255 0.0213  293 LEU A CD1   
2345 C CD2   . LEU A 291 ? 0.1762 0.2844 0.2185 0.0008  -0.0300 0.0289  293 LEU A CD2   
2346 N N     . TYR A 292 ? 0.1727 0.3115 0.2454 -0.0117 -0.0322 0.0015  294 TYR A N     
2347 C CA    . TYR A 292 ? 0.1784 0.3138 0.2584 -0.0146 -0.0288 0.0016  294 TYR A CA    
2348 C C     . TYR A 292 ? 0.1737 0.3068 0.2589 -0.0238 -0.0262 -0.0032 294 TYR A C     
2349 O O     . TYR A 292 ? 0.1790 0.3005 0.2638 -0.0264 -0.0220 -0.0010 294 TYR A O     
2350 C CB    . TYR A 292 ? 0.1839 0.3315 0.2698 -0.0087 -0.0306 0.0018  294 TYR A CB    
2351 C CG    . TYR A 292 ? 0.2037 0.3412 0.2819 0.0002  -0.0310 0.0085  294 TYR A CG    
2352 C CD1   . TYR A 292 ? 0.2244 0.3627 0.2947 0.0071  -0.0347 0.0122  294 TYR A CD1   
2353 C CD2   . TYR A 292 ? 0.2161 0.3410 0.2932 0.0014  -0.0278 0.0113  294 TYR A CD2   
2354 C CE1   . TYR A 292 ? 0.2274 0.3524 0.2889 0.0141  -0.0352 0.0192  294 TYR A CE1   
2355 C CE2   . TYR A 292 ? 0.2323 0.3436 0.3005 0.0085  -0.0289 0.0170  294 TYR A CE2   
2356 C CZ    . TYR A 292 ? 0.2292 0.3396 0.2896 0.0143  -0.0325 0.0212  294 TYR A CZ    
2357 O OH    . TYR A 292 ? 0.2509 0.3446 0.3011 0.0203  -0.0338 0.0276  294 TYR A OH    
2358 N N     . PRO A 293 ? 0.1767 0.3191 0.2654 -0.0290 -0.0290 -0.0096 295 PRO A N     
2359 C CA    . PRO A 293 ? 0.1770 0.3115 0.2675 -0.0385 -0.0267 -0.0136 295 PRO A CA    
2360 C C     . PRO A 293 ? 0.1751 0.2907 0.2561 -0.0384 -0.0239 -0.0119 295 PRO A C     
2361 O O     . PRO A 293 ? 0.1797 0.2843 0.2608 -0.0434 -0.0205 -0.0120 295 PRO A O     
2362 C CB    . PRO A 293 ? 0.1885 0.3335 0.2812 -0.0436 -0.0318 -0.0210 295 PRO A CB    
2363 C CG    . PRO A 293 ? 0.1823 0.3480 0.2801 -0.0375 -0.0360 -0.0208 295 PRO A CG    
2364 C CD    . PRO A 293 ? 0.1753 0.3344 0.2655 -0.0270 -0.0348 -0.0137 295 PRO A CD    
2365 N N     . GLN A 294 ? 0.1744 0.2877 0.2472 -0.0322 -0.0251 -0.0097 296 GLN A N     
2366 C CA    . GLN A 294 ? 0.1678 0.2681 0.2329 -0.0308 -0.0222 -0.0076 296 GLN A CA    
2367 C C     . GLN A 294 ? 0.1652 0.2584 0.2316 -0.0299 -0.0183 -0.0010 296 GLN A C     
2368 O O     . GLN A 294 ? 0.1713 0.2545 0.2353 -0.0313 -0.0155 -0.0003 296 GLN A O     
2369 C CB    . GLN A 294 ? 0.1686 0.2720 0.2249 -0.0248 -0.0240 -0.0068 296 GLN A CB    
2370 C CG    . GLN A 294 ? 0.1701 0.2766 0.2214 -0.0253 -0.0280 -0.0150 296 GLN A CG    
2371 C CD    . GLN A 294 ? 0.1791 0.2906 0.2203 -0.0180 -0.0291 -0.0138 296 GLN A CD    
2372 O OE1   . GLN A 294 ? 0.1734 0.2819 0.2100 -0.0142 -0.0254 -0.0084 296 GLN A OE1   
2373 N NE2   . GLN A 294 ? 0.1779 0.2992 0.2157 -0.0162 -0.0340 -0.0185 296 GLN A NE2   
2374 N N     . LEU A 295 ? 0.1630 0.2606 0.2320 -0.0269 -0.0188 0.0033  297 LEU A N     
2375 C CA    . LEU A 295 ? 0.1623 0.2523 0.2317 -0.0265 -0.0162 0.0083  297 LEU A CA    
2376 C C     . LEU A 295 ? 0.1657 0.2521 0.2399 -0.0307 -0.0134 0.0063  297 LEU A C     
2377 O O     . LEU A 295 ? 0.1706 0.2482 0.2429 -0.0319 -0.0109 0.0085  297 LEU A O     
2378 C CB    . LEU A 295 ? 0.1548 0.2469 0.2237 -0.0217 -0.0180 0.0124  297 LEU A CB    
2379 C CG    . LEU A 295 ? 0.1667 0.2587 0.2289 -0.0179 -0.0199 0.0174  297 LEU A CG    
2380 C CD1   . LEU A 295 ? 0.1549 0.2437 0.2151 -0.0130 -0.0218 0.0215  297 LEU A CD1   
2381 C CD2   . LEU A 295 ? 0.1360 0.2215 0.1941 -0.0203 -0.0176 0.0217  297 LEU A CD2   
2382 N N     . GLU A 296 ? 0.1727 0.2680 0.2532 -0.0332 -0.0141 0.0024  298 GLU A N     
2383 C CA    . GLU A 296 ? 0.1826 0.2770 0.2677 -0.0388 -0.0109 0.0007  298 GLU A CA    
2384 C C     . GLU A 296 ? 0.1836 0.2653 0.2643 -0.0437 -0.0090 -0.0004 298 GLU A C     
2385 O O     . GLU A 296 ? 0.1810 0.2547 0.2603 -0.0455 -0.0055 0.0017  298 GLU A O     
2386 C CB    . GLU A 296 ? 0.1841 0.2940 0.2778 -0.0423 -0.0124 -0.0034 298 GLU A CB    
2387 C CG    . GLU A 296 ? 0.2021 0.3259 0.3010 -0.0361 -0.0134 -0.0023 298 GLU A CG    
2388 C CD    . GLU A 296 ? 0.2008 0.3455 0.3101 -0.0394 -0.0153 -0.0064 298 GLU A CD    
2389 O OE1   . GLU A 296 ? 0.2558 0.4034 0.3670 -0.0467 -0.0176 -0.0107 298 GLU A OE1   
2390 O OE2   . GLU A 296 ? 0.2395 0.3983 0.3548 -0.0344 -0.0149 -0.0058 298 GLU A OE2   
2391 N N     . ARG A 297 ? 0.1845 0.2636 0.2613 -0.0447 -0.0113 -0.0040 299 ARG A N     
2392 C CA    . ARG A 297 ? 0.1990 0.2634 0.2692 -0.0471 -0.0100 -0.0056 299 ARG A CA    
2393 C C     . ARG A 297 ? 0.1969 0.2525 0.2611 -0.0420 -0.0078 -0.0011 299 ARG A C     
2394 O O     . ARG A 297 ? 0.1966 0.2417 0.2580 -0.0433 -0.0051 0.0005  299 ARG A O     
2395 C CB    . ARG A 297 ? 0.2070 0.2692 0.2718 -0.0471 -0.0135 -0.0113 299 ARG A CB    
2396 C CG    . ARG A 297 ? 0.2276 0.2710 0.2837 -0.0487 -0.0124 -0.0137 299 ARG A CG    
2397 C CD    . ARG A 297 ? 0.2463 0.2835 0.2929 -0.0451 -0.0155 -0.0196 299 ARG A CD    
2398 N NE    . ARG A 297 ? 0.3419 0.3612 0.3826 -0.0514 -0.0164 -0.0247 299 ARG A NE    
2399 C CZ    . ARG A 297 ? 0.3912 0.3903 0.4226 -0.0494 -0.0143 -0.0241 299 ARG A CZ    
2400 N NH1   . ARG A 297 ? 0.4217 0.4188 0.4494 -0.0406 -0.0113 -0.0191 299 ARG A NH1   
2401 N NH2   . ARG A 297 ? 0.4359 0.4163 0.4611 -0.0563 -0.0155 -0.0286 299 ARG A NH2   
2402 N N     . ALA A 298 ? 0.1936 0.2547 0.2559 -0.0364 -0.0091 0.0013  300 ALA A N     
2403 C CA    . ALA A 298 ? 0.2012 0.2589 0.2599 -0.0325 -0.0075 0.0058  300 ALA A CA    
2404 C C     . ALA A 298 ? 0.2017 0.2558 0.2627 -0.0340 -0.0055 0.0094  300 ALA A C     
2405 O O     . ALA A 298 ? 0.2125 0.2603 0.2702 -0.0328 -0.0040 0.0113  300 ALA A O     
2406 C CB    . ALA A 298 ? 0.1878 0.2544 0.2459 -0.0287 -0.0090 0.0091  300 ALA A CB    
2407 N N     . SER A 299 ? 0.2024 0.2611 0.2681 -0.0353 -0.0058 0.0100  301 SER A N     
2408 C CA    . SER A 299 ? 0.2118 0.2672 0.2782 -0.0359 -0.0041 0.0122  301 SER A CA    
2409 C C     . SER A 299 ? 0.2122 0.2609 0.2772 -0.0391 -0.0010 0.0114  301 SER A C     
2410 O O     . SER A 299 ? 0.2042 0.2468 0.2655 -0.0383 0.0004  0.0138  301 SER A O     
2411 C CB    . SER A 299 ? 0.2100 0.2720 0.2805 -0.0348 -0.0049 0.0119  301 SER A CB    
2412 O OG    . SER A 299 ? 0.2688 0.3269 0.3380 -0.0340 -0.0033 0.0132  301 SER A OG    
2413 N N     . ARG A 300 ? 0.2154 0.2649 0.2829 -0.0433 -0.0004 0.0083  302 ARG A N     
2414 C CA    . ARG A 300 ? 0.2287 0.2702 0.2942 -0.0481 0.0028  0.0084  302 ARG A CA    
2415 C C     . ARG A 300 ? 0.2313 0.2583 0.2881 -0.0463 0.0032  0.0094  302 ARG A C     
2416 O O     . ARG A 300 ? 0.2368 0.2552 0.2889 -0.0465 0.0058  0.0124  302 ARG A O     
2417 C CB    . ARG A 300 ? 0.2398 0.2857 0.3104 -0.0551 0.0026  0.0048  302 ARG A CB    
2418 C CG    . ARG A 300 ? 0.2671 0.3083 0.3379 -0.0623 0.0067  0.0064  302 ARG A CG    
2419 C CD    . ARG A 300 ? 0.3245 0.3681 0.3998 -0.0714 0.0056  0.0025  302 ARG A CD    
2420 N NE    . ARG A 300 ? 0.3863 0.4090 0.4523 -0.0749 0.0053  0.0015  302 ARG A NE    
2421 C CZ    . ARG A 300 ? 0.3943 0.4094 0.4560 -0.0752 0.0013  -0.0036 302 ARG A CZ    
2422 N NH1   . ARG A 300 ? 0.3830 0.4117 0.4496 -0.0730 -0.0028 -0.0079 302 ARG A NH1   
2423 N NH2   . ARG A 300 ? 0.4351 0.4277 0.4860 -0.0770 0.0013  -0.0044 302 ARG A NH2   
2424 N N     . LYS A 301 ? 0.2290 0.2538 0.2826 -0.0432 0.0008  0.0070  303 LYS A N     
2425 C CA    . LYS A 301 ? 0.2318 0.2441 0.2765 -0.0389 0.0010  0.0074  303 LYS A CA    
2426 C C     . LYS A 301 ? 0.2272 0.2407 0.2696 -0.0333 0.0017  0.0121  303 LYS A C     
2427 O O     . LYS A 301 ? 0.2314 0.2342 0.2669 -0.0307 0.0030  0.0141  303 LYS A O     
2428 C CB    . LYS A 301 ? 0.2382 0.2511 0.2795 -0.0347 -0.0016 0.0035  303 LYS A CB    
2429 C CG    . LYS A 301 ? 0.2437 0.2526 0.2847 -0.0403 -0.0034 -0.0024 303 LYS A CG    
2430 C CD    . LYS A 301 ? 0.2730 0.2632 0.3083 -0.0461 -0.0021 -0.0037 303 LYS A CD    
2431 C CE    . LYS A 301 ? 0.2909 0.2627 0.3132 -0.0393 -0.0025 -0.0052 303 LYS A CE    
2432 N NZ    . LYS A 301 ? 0.3471 0.2960 0.3618 -0.0455 -0.0015 -0.0058 303 LYS A NZ    
2433 N N     . ILE A 302 ? 0.2116 0.2373 0.2590 -0.0318 0.0004  0.0139  304 ILE A N     
2434 C CA    . ILE A 302 ? 0.2117 0.2406 0.2582 -0.0286 0.0000  0.0177  304 ILE A CA    
2435 C C     . ILE A 302 ? 0.2096 0.2337 0.2544 -0.0306 0.0017  0.0197  304 ILE A C     
2436 O O     . ILE A 302 ? 0.2140 0.2352 0.2541 -0.0275 0.0017  0.0222  304 ILE A O     
2437 C CB    . ILE A 302 ? 0.2023 0.2430 0.2538 -0.0285 -0.0023 0.0193  304 ILE A CB    
2438 C CG1   . ILE A 302 ? 0.2140 0.2613 0.2657 -0.0257 -0.0032 0.0184  304 ILE A CG1   
2439 C CG2   . ILE A 302 ? 0.1960 0.2401 0.2470 -0.0275 -0.0036 0.0228  304 ILE A CG2   
2440 C CD1   . ILE A 302 ? 0.1974 0.2550 0.2530 -0.0269 -0.0049 0.0210  304 ILE A CD1   
2441 N N     . PHE A 303 ? 0.2084 0.2337 0.2568 -0.0349 0.0031  0.0186  305 PHE A N     
2442 C CA    . PHE A 303 ? 0.2129 0.2353 0.2590 -0.0364 0.0057  0.0202  305 PHE A CA    
2443 C C     . PHE A 303 ? 0.2228 0.2334 0.2617 -0.0369 0.0084  0.0222  305 PHE A C     
2444 O O     . PHE A 303 ? 0.2277 0.2341 0.2604 -0.0346 0.0095  0.0251  305 PHE A O     
2445 C CB    . PHE A 303 ? 0.2178 0.2469 0.2700 -0.0402 0.0074  0.0183  305 PHE A CB    
2446 C CG    . PHE A 303 ? 0.2394 0.2700 0.2896 -0.0401 0.0103  0.0197  305 PHE A CG    
2447 C CD1   . PHE A 303 ? 0.2377 0.2727 0.2879 -0.0365 0.0086  0.0190  305 PHE A CD1   
2448 C CD2   . PHE A 303 ? 0.2653 0.2913 0.3119 -0.0433 0.0147  0.0220  305 PHE A CD2   
2449 C CE1   . PHE A 303 ? 0.2325 0.2686 0.2789 -0.0348 0.0112  0.0193  305 PHE A CE1   
2450 C CE2   . PHE A 303 ? 0.2543 0.2836 0.2979 -0.0423 0.0180  0.0235  305 PHE A CE2   
2451 C CZ    . PHE A 303 ? 0.2405 0.2754 0.2838 -0.0374 0.0162  0.0217  305 PHE A CZ    
2452 N N     . GLU A 304 ? 0.2206 0.2242 0.2587 -0.0398 0.0091  0.0205  306 GLU A N     
2453 C CA    . GLU A 304 ? 0.2325 0.2201 0.2620 -0.0410 0.0115  0.0225  306 GLU A CA    
2454 C C     . GLU A 304 ? 0.2298 0.2095 0.2505 -0.0326 0.0100  0.0248  306 GLU A C     
2455 O O     . GLU A 304 ? 0.2297 0.1979 0.2414 -0.0308 0.0119  0.0286  306 GLU A O     
2456 C CB    . GLU A 304 ? 0.2464 0.2262 0.2764 -0.0469 0.0114  0.0191  306 GLU A CB    
2457 C CG    . GLU A 304 ? 0.2617 0.2505 0.3004 -0.0564 0.0135  0.0181  306 GLU A CG    
2458 C CD    . GLU A 304 ? 0.3184 0.3041 0.3599 -0.0635 0.0120  0.0135  306 GLU A CD    
2459 O OE1   . GLU A 304 ? 0.3490 0.3233 0.3843 -0.0607 0.0091  0.0103  306 GLU A OE1   
2460 O OE2   . GLU A 304 ? 0.3387 0.3350 0.3886 -0.0718 0.0134  0.0127  306 GLU A OE2   
2461 N N     . PHE A 305 ? 0.2188 0.2062 0.2419 -0.0271 0.0068  0.0229  307 PHE A N     
2462 C CA    . PHE A 305 ? 0.2215 0.2090 0.2391 -0.0183 0.0052  0.0250  307 PHE A CA    
2463 C C     . PHE A 305 ? 0.2274 0.2209 0.2442 -0.0170 0.0048  0.0286  307 PHE A C     
2464 O O     . PHE A 305 ? 0.2377 0.2246 0.2462 -0.0117 0.0050  0.0317  307 PHE A O     
2465 C CB    . PHE A 305 ? 0.2113 0.2120 0.2341 -0.0141 0.0025  0.0229  307 PHE A CB    
2466 C CG    . PHE A 305 ? 0.2060 0.2165 0.2278 -0.0065 0.0006  0.0256  307 PHE A CG    
2467 C CD1   . PHE A 305 ? 0.2271 0.2313 0.2406 0.0029  0.0004  0.0263  307 PHE A CD1   
2468 C CD2   . PHE A 305 ? 0.2195 0.2454 0.2482 -0.0087 -0.0015 0.0273  307 PHE A CD2   
2469 C CE1   . PHE A 305 ? 0.2236 0.2413 0.2376 0.0105  -0.0016 0.0289  307 PHE A CE1   
2470 C CE2   . PHE A 305 ? 0.2156 0.2535 0.2448 -0.0034 -0.0039 0.0298  307 PHE A CE2   
2471 C CZ    . PHE A 305 ? 0.2130 0.2492 0.2359 0.0065  -0.0038 0.0307  307 PHE A CZ    
2472 N N     . LEU A 306 ? 0.2195 0.2244 0.2437 -0.0212 0.0040  0.0278  308 LEU A N     
2473 C CA    . LEU A 306 ? 0.2224 0.2319 0.2448 -0.0205 0.0029  0.0297  308 LEU A CA    
2474 C C     . LEU A 306 ? 0.2377 0.2370 0.2515 -0.0208 0.0063  0.0324  308 LEU A C     
2475 O O     . LEU A 306 ? 0.2374 0.2363 0.2444 -0.0166 0.0052  0.0350  308 LEU A O     
2476 C CB    . LEU A 306 ? 0.2096 0.2283 0.2390 -0.0246 0.0013  0.0276  308 LEU A CB    
2477 C CG    . LEU A 306 ? 0.2062 0.2352 0.2424 -0.0248 -0.0024 0.0267  308 LEU A CG    
2478 C CD1   . LEU A 306 ? 0.1896 0.2214 0.2307 -0.0289 -0.0033 0.0248  308 LEU A CD1   
2479 C CD2   . LEU A 306 ? 0.1877 0.2242 0.2227 -0.0221 -0.0062 0.0286  308 LEU A CD2   
2480 N N     . GLU A 307 ? 0.2487 0.2410 0.2626 -0.0262 0.0104  0.0324  309 GLU A N     
2481 C CA    . GLU A 307 ? 0.2754 0.2584 0.2808 -0.0275 0.0146  0.0364  309 GLU A CA    
2482 C C     . GLU A 307 ? 0.2898 0.2574 0.2833 -0.0227 0.0151  0.0405  309 GLU A C     
2483 O O     . GLU A 307 ? 0.2969 0.2610 0.2809 -0.0188 0.0159  0.0446  309 GLU A O     
2484 C CB    . GLU A 307 ? 0.2737 0.2565 0.2830 -0.0359 0.0195  0.0363  309 GLU A CB    
2485 C CG    . GLU A 307 ? 0.2977 0.2881 0.3184 -0.0411 0.0188  0.0318  309 GLU A CG    
2486 C CD    . GLU A 307 ? 0.3039 0.2966 0.3287 -0.0497 0.0236  0.0325  309 GLU A CD    
2487 O OE1   . GLU A 307 ? 0.3748 0.3694 0.4067 -0.0554 0.0230  0.0295  309 GLU A OE1   
2488 O OE2   . GLU A 307 ? 0.3498 0.3437 0.3704 -0.0510 0.0279  0.0363  309 GLU A OE2   
2489 N N     . ARG A 308 ? 0.2910 0.2484 0.2833 -0.0219 0.0144  0.0393  310 ARG A N     
2490 C CA    . ARG A 308 ? 0.3108 0.2504 0.2898 -0.0153 0.0146  0.0430  310 ARG A CA    
2491 C C     . ARG A 308 ? 0.3042 0.2518 0.2796 -0.0039 0.0105  0.0443  310 ARG A C     
2492 O O     . ARG A 308 ? 0.3117 0.2474 0.2748 0.0038  0.0103  0.0484  310 ARG A O     
2493 C CB    . ARG A 308 ? 0.3252 0.2487 0.3012 -0.0163 0.0145  0.0404  310 ARG A CB    
2494 C CG    . ARG A 308 ? 0.3239 0.2571 0.3062 -0.0110 0.0106  0.0350  310 ARG A CG    
2495 C CD    . ARG A 308 ? 0.3383 0.2533 0.3150 -0.0114 0.0103  0.0314  310 ARG A CD    
2496 N NE    . ARG A 308 ? 0.3362 0.2644 0.3197 -0.0069 0.0073  0.0259  310 ARG A NE    
2497 C CZ    . ARG A 308 ? 0.3238 0.2634 0.3178 -0.0138 0.0067  0.0215  310 ARG A CZ    
2498 N NH1   . ARG A 308 ? 0.3104 0.2512 0.3107 -0.0253 0.0084  0.0210  310 ARG A NH1   
2499 N NH2   . ARG A 308 ? 0.3097 0.2611 0.3076 -0.0086 0.0043  0.0178  310 ARG A NH2   
2500 N N     . GLU A 309 ? 0.2812 0.2491 0.2671 -0.0031 0.0070  0.0411  311 GLU A N     
2501 C CA    . GLU A 309 ? 0.2845 0.2649 0.2694 0.0054  0.0027  0.0423  311 GLU A CA    
2502 C C     . GLU A 309 ? 0.2801 0.2671 0.2618 0.0049  0.0016  0.0443  311 GLU A C     
2503 O O     . GLU A 309 ? 0.2824 0.2819 0.2641 0.0102  -0.0029 0.0448  311 GLU A O     
2504 C CB    . GLU A 309 ? 0.2699 0.2691 0.2669 0.0057  -0.0008 0.0387  311 GLU A CB    
2505 C CG    . GLU A 309 ? 0.2869 0.2841 0.2841 0.0115  -0.0009 0.0370  311 GLU A CG    
2506 C CD    . GLU A 309 ? 0.3143 0.3011 0.2994 0.0235  -0.0013 0.0396  311 GLU A CD    
2507 O OE1   . GLU A 309 ? 0.3223 0.2945 0.3013 0.0276  0.0001  0.0380  311 GLU A OE1   
2508 O OE2   . GLU A 309 ? 0.3407 0.3330 0.3211 0.0297  -0.0034 0.0431  311 GLU A OE2   
2509 N N     . ASN A 310 ? 0.2771 0.2571 0.2558 -0.0012 0.0055  0.0453  312 ASN A N     
2510 C CA    . ASN A 310 ? 0.2783 0.2626 0.2510 -0.0007 0.0051  0.0468  312 ASN A CA    
2511 C C     . ASN A 310 ? 0.2615 0.2622 0.2420 -0.0028 0.0004  0.0423  312 ASN A C     
2512 O O     . ASN A 310 ? 0.2666 0.2725 0.2409 0.0002  -0.0027 0.0425  312 ASN A O     
2513 C CB    . ASN A 310 ? 0.2966 0.2749 0.2554 0.0084  0.0039  0.0520  312 ASN A CB    
2514 C CG    . ASN A 310 ? 0.3173 0.2746 0.2644 0.0087  0.0094  0.0576  312 ASN A CG    
2515 O OD1   . ASN A 310 ? 0.3469 0.2921 0.2874 0.0149  0.0090  0.0602  312 ASN A OD1   
2516 N ND2   . ASN A 310 ? 0.3275 0.2797 0.2717 0.0017  0.0149  0.0596  312 ASN A ND2   
2517 N N     . PHE A 311 ? 0.2392 0.2463 0.2316 -0.0080 -0.0005 0.0383  313 PHE A N     
2518 C CA    . PHE A 311 ? 0.2285 0.2459 0.2266 -0.0114 -0.0046 0.0344  313 PHE A CA    
2519 C C     . PHE A 311 ? 0.2318 0.2460 0.2286 -0.0151 -0.0016 0.0321  313 PHE A C     
2520 O O     . PHE A 311 ? 0.2328 0.2510 0.2314 -0.0170 -0.0049 0.0284  313 PHE A O     
2521 C CB    . PHE A 311 ? 0.2132 0.2392 0.2230 -0.0142 -0.0075 0.0323  313 PHE A CB    
2522 C CG    . PHE A 311 ? 0.2260 0.2613 0.2376 -0.0097 -0.0111 0.0341  313 PHE A CG    
2523 C CD1   . PHE A 311 ? 0.2092 0.2546 0.2189 -0.0078 -0.0164 0.0344  313 PHE A CD1   
2524 C CD2   . PHE A 311 ? 0.2359 0.2712 0.2505 -0.0065 -0.0093 0.0351  313 PHE A CD2   
2525 C CE1   . PHE A 311 ? 0.2206 0.2793 0.2334 -0.0029 -0.0197 0.0362  313 PHE A CE1   
2526 C CE2   . PHE A 311 ? 0.2261 0.2729 0.2424 -0.0002 -0.0121 0.0367  313 PHE A CE2   
2527 C CZ    . PHE A 311 ? 0.2205 0.2805 0.2368 0.0016  -0.0171 0.0376  313 PHE A CZ    
2528 N N     . MET A 312 ? 0.2306 0.2376 0.2237 -0.0160 0.0046  0.0345  314 MET A N     
2529 C CA    . MET A 312 ? 0.2413 0.2489 0.2334 -0.0183 0.0088  0.0331  314 MET A CA    
2530 C C     . MET A 312 ? 0.2241 0.2375 0.2260 -0.0212 0.0070  0.0281  314 MET A C     
2531 O O     . MET A 312 ? 0.2134 0.2287 0.2126 -0.0196 0.0047  0.0246  314 MET A O     
2532 C CB    . MET A 312 ? 0.2523 0.2600 0.2323 -0.0141 0.0083  0.0333  314 MET A CB    
2533 C CG    . MET A 312 ? 0.2674 0.2690 0.2356 -0.0100 0.0098  0.0391  314 MET A CG    
2534 S SD    . MET A 312 ? 0.3082 0.3122 0.2610 -0.0041 0.0078  0.0386  314 MET A SD    
2535 C CE    . MET A 312 ? 0.2999 0.3053 0.2498 -0.0060 0.0163  0.0386  314 MET A CE    
2536 N N     . PRO A 313 ? 0.2168 0.2314 0.2284 -0.0246 0.0077  0.0276  315 PRO A N     
2537 C CA    . PRO A 313 ? 0.2057 0.2252 0.2254 -0.0263 0.0060  0.0239  315 PRO A CA    
2538 C C     . PRO A 313 ? 0.2169 0.2398 0.2361 -0.0257 0.0100  0.0221  315 PRO A C     
2539 O O     . PRO A 313 ? 0.2070 0.2309 0.2244 -0.0270 0.0156  0.0246  315 PRO A O     
2540 C CB    . PRO A 313 ? 0.2038 0.2242 0.2317 -0.0294 0.0068  0.0243  315 PRO A CB    
2541 C CG    . PRO A 313 ? 0.2031 0.2173 0.2270 -0.0304 0.0107  0.0275  315 PRO A CG    
2542 C CD    . PRO A 313 ? 0.2166 0.2266 0.2303 -0.0262 0.0096  0.0302  315 PRO A CD    
2543 N N     . LEU A 314 ? 0.2171 0.2415 0.2370 -0.0234 0.0073  0.0183  316 LEU A N     
2544 C CA    . LEU A 314 ? 0.2333 0.2625 0.2520 -0.0202 0.0109  0.0160  316 LEU A CA    
2545 C C     . LEU A 314 ? 0.2302 0.2677 0.2599 -0.0217 0.0127  0.0151  316 LEU A C     
2546 O O     . LEU A 314 ? 0.2278 0.2741 0.2623 -0.0238 0.0180  0.0165  316 LEU A O     
2547 C CB    . LEU A 314 ? 0.2350 0.2587 0.2452 -0.0149 0.0067  0.0117  316 LEU A CB    
2548 C CG    . LEU A 314 ? 0.2511 0.2696 0.2488 -0.0127 0.0053  0.0116  316 LEU A CG    
2549 C CD1   . LEU A 314 ? 0.2584 0.2683 0.2476 -0.0093 -0.0010 0.0062  316 LEU A CD1   
2550 C CD2   . LEU A 314 ? 0.2639 0.2879 0.2555 -0.0098 0.0123  0.0134  316 LEU A CD2   
2551 N N     . ARG A 315 ? 0.2361 0.2714 0.2698 -0.0212 0.0078  0.0132  317 ARG A N     
2552 C CA    . ARG A 315 ? 0.2388 0.2820 0.2819 -0.0216 0.0081  0.0124  317 ARG A CA    
2553 C C     . ARG A 315 ? 0.2340 0.2729 0.2803 -0.0242 0.0034  0.0132  317 ARG A C     
2554 O O     . ARG A 315 ? 0.2354 0.2668 0.2776 -0.0256 0.0000  0.0144  317 ARG A O     
2555 C CB    . ARG A 315 ? 0.2484 0.2951 0.2905 -0.0145 0.0079  0.0091  317 ARG A CB    
2556 C CG    . ARG A 315 ? 0.2758 0.3318 0.3157 -0.0105 0.0136  0.0081  317 ARG A CG    
2557 C CD    . ARG A 315 ? 0.3015 0.3612 0.3400 -0.0010 0.0127  0.0042  317 ARG A CD    
2558 N NE    . ARG A 315 ? 0.2889 0.3652 0.3392 -0.0004 0.0144  0.0041  317 ARG A NE    
2559 C CZ    . ARG A 315 ? 0.3072 0.3901 0.3585 0.0089  0.0134  0.0013  317 ARG A CZ    
2560 N NH1   . ARG A 315 ? 0.3069 0.3775 0.3465 0.0187  0.0109  -0.0020 317 ARG A NH1   
2561 N NH2   . ARG A 315 ? 0.2822 0.3835 0.3454 0.0088  0.0145  0.0015  317 ARG A NH2   
2562 N N     . SER A 316 ? 0.2313 0.2772 0.2852 -0.0249 0.0031  0.0128  318 SER A N     
2563 C CA    . SER A 316 ? 0.2240 0.2679 0.2802 -0.0263 -0.0008 0.0138  318 SER A CA    
2564 C C     . SER A 316 ? 0.2263 0.2748 0.2854 -0.0221 -0.0026 0.0125  318 SER A C     
2565 O O     . SER A 316 ? 0.2220 0.2786 0.2837 -0.0183 -0.0005 0.0104  318 SER A O     
2566 C CB    . SER A 316 ? 0.2230 0.2706 0.2837 -0.0309 0.0005  0.0147  318 SER A CB    
2567 O OG    . SER A 316 ? 0.2279 0.2850 0.2948 -0.0324 0.0030  0.0129  318 SER A OG    
2568 N N     . ALA A 317 ? 0.2252 0.2699 0.2838 -0.0222 -0.0064 0.0141  319 ALA A N     
2569 C CA    . ALA A 317 ? 0.2281 0.2755 0.2877 -0.0175 -0.0088 0.0140  319 ALA A CA    
2570 C C     . ALA A 317 ? 0.2286 0.2747 0.2882 -0.0201 -0.0115 0.0171  319 ALA A C     
2571 O O     . ALA A 317 ? 0.2256 0.2690 0.2844 -0.0249 -0.0115 0.0191  319 ALA A O     
2572 C CB    . ALA A 317 ? 0.2419 0.2782 0.2938 -0.0114 -0.0110 0.0133  319 ALA A CB    
2573 N N     . PHE A 318 ? 0.2337 0.2834 0.2938 -0.0162 -0.0136 0.0178  320 PHE A N     
2574 C CA    . PHE A 318 ? 0.2344 0.2841 0.2931 -0.0179 -0.0158 0.0214  320 PHE A CA    
2575 C C     . PHE A 318 ? 0.2450 0.2912 0.2993 -0.0116 -0.0190 0.0236  320 PHE A C     
2576 O O     . PHE A 318 ? 0.2440 0.2922 0.2985 -0.0048 -0.0195 0.0212  320 PHE A O     
2577 C CB    . PHE A 318 ? 0.2300 0.2920 0.2942 -0.0206 -0.0145 0.0196  320 PHE A CB    
2578 C CG    . PHE A 318 ? 0.2371 0.3119 0.3073 -0.0182 -0.0145 0.0156  320 PHE A CG    
2579 C CD1   . PHE A 318 ? 0.2512 0.3328 0.3212 -0.0129 -0.0175 0.0159  320 PHE A CD1   
2580 C CD2   . PHE A 318 ? 0.2440 0.3247 0.3198 -0.0217 -0.0116 0.0119  320 PHE A CD2   
2581 C CE1   . PHE A 318 ? 0.2636 0.3609 0.3407 -0.0110 -0.0181 0.0119  320 PHE A CE1   
2582 C CE2   . PHE A 318 ? 0.2568 0.3522 0.3398 -0.0214 -0.0116 0.0084  320 PHE A CE2   
2583 C CZ    . PHE A 318 ? 0.2463 0.3513 0.3306 -0.0160 -0.0151 0.0080  320 PHE A CZ    
2584 N N     . LYS A 319 ? 0.2484 0.2896 0.2981 -0.0132 -0.0209 0.0288  321 LYS A N     
2585 C CA    . LYS A 319 ? 0.2656 0.2998 0.3084 -0.0074 -0.0241 0.0326  321 LYS A CA    
2586 C C     . LYS A 319 ? 0.2648 0.3028 0.3053 -0.0102 -0.0246 0.0379  321 LYS A C     
2587 O O     . LYS A 319 ? 0.2619 0.2995 0.3026 -0.0173 -0.0231 0.0408  321 LYS A O     
2588 C CB    . LYS A 319 ? 0.2792 0.2919 0.3131 -0.0068 -0.0262 0.0349  321 LYS A CB    
2589 C CG    . LYS A 319 ? 0.3196 0.3191 0.3434 -0.0001 -0.0298 0.0395  321 LYS A CG    
2590 C CD    . LYS A 319 ? 0.3563 0.3411 0.3725 -0.0075 -0.0313 0.0474  321 LYS A CD    
2591 C CE    . LYS A 319 ? 0.4006 0.3728 0.4058 -0.0008 -0.0344 0.0536  321 LYS A CE    
2592 N NZ    . LYS A 319 ? 0.4337 0.3922 0.4318 0.0108  -0.0371 0.0501  321 LYS A NZ    
2593 N N     . ALA A 320 ? 0.2689 0.3133 0.3072 -0.0039 -0.0266 0.0391  322 ALA A N     
2594 C CA    . ALA A 320 ? 0.2770 0.3244 0.3103 -0.0048 -0.0272 0.0450  322 ALA A CA    
2595 C C     . ALA A 320 ? 0.3016 0.3325 0.3236 -0.0008 -0.0300 0.0525  322 ALA A C     
2596 O O     . ALA A 320 ? 0.3000 0.3278 0.3184 0.0085  -0.0327 0.0516  322 ALA A O     
2597 C CB    . ALA A 320 ? 0.2692 0.3355 0.3061 -0.0006 -0.0280 0.0411  322 ALA A CB    
2598 N N     . SER A 321 ? 0.3250 0.3452 0.3412 -0.0079 -0.0293 0.0600  323 SER A N     
2599 C CA    . SER A 321 ? 0.3609 0.3637 0.3645 -0.0063 -0.0317 0.0691  323 SER A CA    
2600 C C     . SER A 321 ? 0.3756 0.3905 0.3747 -0.0038 -0.0313 0.0748  323 SER A C     
2601 O O     . SER A 321 ? 0.3652 0.4011 0.3707 -0.0026 -0.0298 0.0703  323 SER A O     
2602 C CB    . SER A 321 ? 0.3747 0.3599 0.3743 -0.0174 -0.0314 0.0750  323 SER A CB    
2603 O OG    . SER A 321 ? 0.3643 0.3618 0.3667 -0.0266 -0.0282 0.0806  323 SER A OG    
2604 N N     . GLU A 322 ? 0.4104 0.4107 0.3970 -0.0032 -0.0327 0.0848  324 GLU A N     
2605 C CA    . GLU A 322 ? 0.4280 0.4393 0.4081 -0.0007 -0.0320 0.0916  324 GLU A CA    
2606 C C     . GLU A 322 ? 0.4072 0.4379 0.3936 -0.0090 -0.0273 0.0923  324 GLU A C     
2607 O O     . GLU A 322 ? 0.4055 0.4552 0.3922 -0.0044 -0.0265 0.0900  324 GLU A O     
2608 C CB    . GLU A 322 ? 0.4647 0.4538 0.4288 -0.0007 -0.0336 0.1043  324 GLU A CB    
2609 C CG    . GLU A 322 ? 0.5301 0.4960 0.4845 0.0100  -0.0386 0.1043  324 GLU A CG    
2610 C CD    . GLU A 322 ? 0.5574 0.5391 0.5176 0.0241  -0.0414 0.0944  324 GLU A CD    
2611 O OE1   . GLU A 322 ? 0.5933 0.5927 0.5518 0.0316  -0.0425 0.0948  324 GLU A OE1   
2612 O OE2   . GLU A 322 ? 0.5630 0.5407 0.5293 0.0274  -0.0425 0.0863  324 GLU A OE2   
2613 N N     . GLU A 323 ? 0.3962 0.4229 0.3871 -0.0203 -0.0246 0.0947  325 GLU A N     
2614 C CA    . GLU A 323 ? 0.3875 0.4332 0.3833 -0.0272 -0.0200 0.0970  325 GLU A CA    
2615 C C     . GLU A 323 ? 0.3531 0.4102 0.3619 -0.0309 -0.0179 0.0880  325 GLU A C     
2616 O O     . GLU A 323 ? 0.3354 0.4114 0.3483 -0.0315 -0.0145 0.0866  325 GLU A O     
2617 C CB    . GLU A 323 ? 0.4113 0.4503 0.4008 -0.0374 -0.0178 0.1104  325 GLU A CB    
2618 C CG    . GLU A 323 ? 0.4663 0.4900 0.4595 -0.0497 -0.0185 0.1129  325 GLU A CG    
2619 C CD    . GLU A 323 ? 0.5415 0.5338 0.5269 -0.0484 -0.0237 0.1125  325 GLU A CD    
2620 O OE1   . GLU A 323 ? 0.5514 0.5390 0.5401 -0.0407 -0.0263 0.1024  325 GLU A OE1   
2621 O OE2   . GLU A 323 ? 0.5807 0.5524 0.5562 -0.0555 -0.0251 0.1224  325 GLU A OE2   
2622 N N     . PHE A 324 ? 0.3357 0.3809 0.3494 -0.0319 -0.0201 0.0820  326 PHE A N     
2623 C CA    . PHE A 324 ? 0.3072 0.3605 0.3314 -0.0350 -0.0185 0.0744  326 PHE A CA    
2624 C C     . PHE A 324 ? 0.2860 0.3378 0.3149 -0.0288 -0.0201 0.0641  326 PHE A C     
2625 O O     . PHE A 324 ? 0.2942 0.3364 0.3194 -0.0230 -0.0229 0.0626  326 PHE A O     
2626 C CB    . PHE A 324 ? 0.3131 0.3570 0.3397 -0.0453 -0.0187 0.0778  326 PHE A CB    
2627 C CG    . PHE A 324 ? 0.3303 0.3816 0.3559 -0.0542 -0.0163 0.0878  326 PHE A CG    
2628 C CD1   . PHE A 324 ? 0.3649 0.3998 0.3825 -0.0609 -0.0180 0.0973  326 PHE A CD1   
2629 C CD2   . PHE A 324 ? 0.3273 0.4018 0.3594 -0.0556 -0.0122 0.0879  326 PHE A CD2   
2630 C CE1   . PHE A 324 ? 0.3838 0.4278 0.4014 -0.0710 -0.0153 0.1076  326 PHE A CE1   
2631 C CE2   . PHE A 324 ? 0.3319 0.4181 0.3645 -0.0636 -0.0093 0.0976  326 PHE A CE2   
2632 C CZ    . PHE A 324 ? 0.3501 0.4221 0.3762 -0.0724 -0.0106 0.1078  326 PHE A CZ    
2633 N N     . CYS A 325 ? 0.2607 0.3226 0.2972 -0.0297 -0.0181 0.0576  327 CYS A N     
2634 C CA    . CYS A 325 ? 0.2438 0.3039 0.2855 -0.0269 -0.0186 0.0491  327 CYS A CA    
2635 C C     . CYS A 325 ? 0.2378 0.2929 0.2835 -0.0325 -0.0178 0.0478  327 CYS A C     
2636 O O     . CYS A 325 ? 0.2314 0.2920 0.2788 -0.0375 -0.0162 0.0510  327 CYS A O     
2637 C CB    . CYS A 325 ? 0.2324 0.3059 0.2778 -0.0235 -0.0174 0.0425  327 CYS A CB    
2638 S SG    . CYS A 325 ? 0.2502 0.3318 0.2917 -0.0164 -0.0198 0.0410  327 CYS A SG    
2639 N N     . TYR A 326 ? 0.2375 0.2842 0.2844 -0.0308 -0.0188 0.0431  328 TYR A N     
2640 C CA    . TYR A 326 ? 0.2322 0.2733 0.2811 -0.0348 -0.0186 0.0411  328 TYR A CA    
2641 C C     . TYR A 326 ? 0.2208 0.2654 0.2739 -0.0317 -0.0169 0.0342  328 TYR A C     
2642 O O     . TYR A 326 ? 0.2171 0.2615 0.2706 -0.0270 -0.0172 0.0308  328 TYR A O     
2643 C CB    . TYR A 326 ? 0.2492 0.2730 0.2923 -0.0361 -0.0216 0.0427  328 TYR A CB    
2644 C CG    . TYR A 326 ? 0.2666 0.2821 0.3038 -0.0404 -0.0237 0.0504  328 TYR A CG    
2645 C CD1   . TYR A 326 ? 0.2892 0.2996 0.3206 -0.0354 -0.0249 0.0538  328 TYR A CD1   
2646 C CD2   . TYR A 326 ? 0.2629 0.2757 0.3000 -0.0498 -0.0246 0.0549  328 TYR A CD2   
2647 C CE1   . TYR A 326 ? 0.2974 0.2975 0.3215 -0.0398 -0.0265 0.0622  328 TYR A CE1   
2648 C CE2   . TYR A 326 ? 0.2936 0.2980 0.3253 -0.0559 -0.0262 0.0629  328 TYR A CE2   
2649 C CZ    . TYR A 326 ? 0.3066 0.3033 0.3310 -0.0508 -0.0269 0.0669  328 TYR A CZ    
2650 O OH    . TYR A 326 ? 0.3256 0.3120 0.3431 -0.0573 -0.0282 0.0761  328 TYR A OH    
2651 N N     . LEU A 327 ? 0.1992 0.2481 0.2552 -0.0342 -0.0150 0.0326  329 LEU A N     
2652 C CA    . LEU A 327 ? 0.1929 0.2418 0.2512 -0.0329 -0.0131 0.0276  329 LEU A CA    
2653 C C     . LEU A 327 ? 0.1990 0.2398 0.2549 -0.0350 -0.0139 0.0276  329 LEU A C     
2654 O O     . LEU A 327 ? 0.1965 0.2384 0.2522 -0.0384 -0.0147 0.0300  329 LEU A O     
2655 C CB    . LEU A 327 ? 0.1849 0.2410 0.2454 -0.0329 -0.0108 0.0259  329 LEU A CB    
2656 C CG    . LEU A 327 ? 0.1708 0.2345 0.2314 -0.0310 -0.0109 0.0258  329 LEU A CG    
2657 C CD1   . LEU A 327 ? 0.1845 0.2524 0.2446 -0.0298 -0.0091 0.0236  329 LEU A CD1   
2658 C CD2   . LEU A 327 ? 0.1474 0.2130 0.2096 -0.0288 -0.0118 0.0224  329 LEU A CD2   
2659 N N     . LEU A 328 ? 0.2058 0.2405 0.2598 -0.0324 -0.0138 0.0245  330 LEU A N     
2660 C CA    . LEU A 328 ? 0.2238 0.2492 0.2730 -0.0332 -0.0153 0.0236  330 LEU A CA    
2661 C C     . LEU A 328 ? 0.2145 0.2420 0.2637 -0.0321 -0.0124 0.0208  330 LEU A C     
2662 O O     . LEU A 328 ? 0.2073 0.2400 0.2594 -0.0299 -0.0092 0.0187  330 LEU A O     
2663 C CB    . LEU A 328 ? 0.2331 0.2481 0.2771 -0.0291 -0.0175 0.0222  330 LEU A CB    
2664 C CG    . LEU A 328 ? 0.2726 0.2818 0.3141 -0.0296 -0.0205 0.0261  330 LEU A CG    
2665 C CD1   . LEU A 328 ? 0.2891 0.2909 0.3260 -0.0219 -0.0217 0.0244  330 LEU A CD1   
2666 C CD2   . LEU A 328 ? 0.2944 0.2937 0.3316 -0.0367 -0.0240 0.0296  330 LEU A CD2   
2667 N N     . PHE A 329 ? 0.2123 0.2365 0.2581 -0.0343 -0.0138 0.0210  331 PHE A N     
2668 C CA    . PHE A 329 ? 0.2149 0.2399 0.2583 -0.0330 -0.0113 0.0195  331 PHE A CA    
2669 C C     . PHE A 329 ? 0.2197 0.2372 0.2557 -0.0328 -0.0141 0.0178  331 PHE A C     
2670 O O     . PHE A 329 ? 0.2351 0.2483 0.2690 -0.0363 -0.0188 0.0185  331 PHE A O     
2671 C CB    . PHE A 329 ? 0.2114 0.2427 0.2574 -0.0342 -0.0100 0.0217  331 PHE A CB    
2672 C CG    . PHE A 329 ? 0.2148 0.2515 0.2660 -0.0341 -0.0080 0.0223  331 PHE A CG    
2673 C CD1   . PHE A 329 ? 0.2265 0.2637 0.2791 -0.0333 -0.0045 0.0205  331 PHE A CD1   
2674 C CD2   . PHE A 329 ? 0.2283 0.2703 0.2825 -0.0354 -0.0098 0.0245  331 PHE A CD2   
2675 C CE1   . PHE A 329 ? 0.2189 0.2600 0.2751 -0.0336 -0.0037 0.0199  331 PHE A CE1   
2676 C CE2   . PHE A 329 ? 0.2153 0.2622 0.2724 -0.0344 -0.0083 0.0242  331 PHE A CE2   
2677 C CZ    . PHE A 329 ? 0.2238 0.2694 0.2815 -0.0334 -0.0057 0.0213  331 PHE A CZ    
2678 N N     . GLU A 330 ? 0.2229 0.2392 0.2542 -0.0294 -0.0114 0.0156  332 GLU A N     
2679 C CA    . GLU A 330 ? 0.2334 0.2438 0.2557 -0.0282 -0.0138 0.0134  332 GLU A CA    
2680 C C     . GLU A 330 ? 0.2310 0.2458 0.2508 -0.0267 -0.0102 0.0149  332 GLU A C     
2681 O O     . GLU A 330 ? 0.2237 0.2419 0.2453 -0.0251 -0.0047 0.0157  332 GLU A O     
2682 C CB    . GLU A 330 ? 0.2450 0.2478 0.2602 -0.0232 -0.0137 0.0091  332 GLU A CB    
2683 C CG    . GLU A 330 ? 0.2540 0.2485 0.2574 -0.0216 -0.0174 0.0055  332 GLU A CG    
2684 C CD    . GLU A 330 ? 0.2757 0.2613 0.2696 -0.0145 -0.0174 0.0002  332 GLU A CD    
2685 O OE1   . GLU A 330 ? 0.2864 0.2776 0.2830 -0.0091 -0.0123 -0.0003 332 GLU A OE1   
2686 O OE2   . GLU A 330 ? 0.2741 0.2475 0.2570 -0.0140 -0.0228 -0.0040 332 GLU A OE2   
2687 N N     . CYS A 331 ? 0.2329 0.2479 0.2483 -0.0276 -0.0136 0.0156  333 CYS A N     
2688 C CA    . CYS A 331 ? 0.2403 0.2581 0.2514 -0.0252 -0.0112 0.0179  333 CYS A CA    
2689 C C     . CYS A 331 ? 0.2498 0.2646 0.2495 -0.0227 -0.0142 0.0157  333 CYS A C     
2690 O O     . CYS A 331 ? 0.2518 0.2640 0.2488 -0.0249 -0.0205 0.0126  333 CYS A O     
2691 C CB    . CYS A 331 ? 0.2289 0.2531 0.2451 -0.0265 -0.0129 0.0214  333 CYS A CB    
2692 S SG    . CYS A 331 ? 0.2531 0.2803 0.2791 -0.0277 -0.0092 0.0235  333 CYS A SG    
2693 N N     . GLN A 332 ? 0.2485 0.2631 0.2407 -0.0186 -0.0099 0.0174  334 GLN A N     
2694 C CA    . GLN A 332 ? 0.2590 0.2717 0.2384 -0.0150 -0.0124 0.0156  334 GLN A CA    
2695 C C     . GLN A 332 ? 0.2601 0.2776 0.2380 -0.0155 -0.0187 0.0168  334 GLN A C     
2696 O O     . GLN A 332 ? 0.2688 0.2861 0.2376 -0.0142 -0.0240 0.0138  334 GLN A O     
2697 C CB    . GLN A 332 ? 0.2645 0.2766 0.2354 -0.0106 -0.0053 0.0185  334 GLN A CB    
2698 C CG    . GLN A 332 ? 0.2791 0.2917 0.2526 -0.0101 0.0012  0.0173  334 GLN A CG    
2699 C CD    . GLN A 332 ? 0.3127 0.3272 0.2772 -0.0067 0.0085  0.0203  334 GLN A CD    
2700 O OE1   . GLN A 332 ? 0.3366 0.3548 0.3066 -0.0088 0.0156  0.0235  334 GLN A OE1   
2701 N NE2   . GLN A 332 ? 0.2994 0.3124 0.2498 -0.0019 0.0068  0.0194  334 GLN A NE2   
2702 N N     . ILE A 333 ? 0.2441 0.2672 0.2306 -0.0167 -0.0184 0.0209  335 ILE A N     
2703 C CA    . ILE A 333 ? 0.2490 0.2807 0.2355 -0.0152 -0.0234 0.0230  335 ILE A CA    
2704 C C     . ILE A 333 ? 0.2417 0.2825 0.2399 -0.0210 -0.0287 0.0223  335 ILE A C     
2705 O O     . ILE A 333 ? 0.2223 0.2663 0.2298 -0.0223 -0.0261 0.0246  335 ILE A O     
2706 C CB    . ILE A 333 ? 0.2444 0.2757 0.2286 -0.0095 -0.0188 0.0288  335 ILE A CB    
2707 C CG1   . ILE A 333 ? 0.2554 0.2780 0.2264 -0.0050 -0.0137 0.0310  335 ILE A CG1   
2708 C CG2   . ILE A 333 ? 0.2585 0.3014 0.2439 -0.0057 -0.0240 0.0312  335 ILE A CG2   
2709 C CD1   . ILE A 333 ? 0.2575 0.2814 0.2164 -0.0023 -0.0178 0.0283  335 ILE A CD1   
2710 N N     . LYS A 334 ? 0.2519 0.2968 0.2487 -0.0251 -0.0362 0.0190  336 LYS A N     
2711 C CA    . LYS A 334 ? 0.2521 0.3078 0.2596 -0.0325 -0.0417 0.0192  336 LYS A CA    
2712 C C     . LYS A 334 ? 0.2473 0.3214 0.2609 -0.0292 -0.0433 0.0234  336 LYS A C     
2713 O O     . LYS A 334 ? 0.2271 0.3133 0.2522 -0.0327 -0.0437 0.0258  336 LYS A O     
2714 C CB    . LYS A 334 ? 0.2610 0.3140 0.2640 -0.0393 -0.0500 0.0141  336 LYS A CB    
2715 C CG    . LYS A 334 ? 0.2794 0.3146 0.2790 -0.0435 -0.0497 0.0100  336 LYS A CG    
2716 C CD    . LYS A 334 ? 0.3013 0.3274 0.2911 -0.0483 -0.0581 0.0035  336 LYS A CD    
2717 C CE    . LYS A 334 ? 0.3348 0.3564 0.3305 -0.0600 -0.0637 0.0027  336 LYS A CE    
2718 N NZ    . LYS A 334 ? 0.3868 0.3929 0.3700 -0.0647 -0.0720 -0.0048 336 LYS A NZ    
2719 N N     . GLU A 335 ? 0.2536 0.3305 0.2585 -0.0214 -0.0439 0.0244  337 GLU A N     
2720 C CA    . GLU A 335 ? 0.2615 0.3554 0.2699 -0.0152 -0.0457 0.0283  337 GLU A CA    
2721 C C     . GLU A 335 ? 0.2583 0.3451 0.2537 -0.0039 -0.0426 0.0311  337 GLU A C     
2722 O O     . GLU A 335 ? 0.2593 0.3388 0.2426 -0.0020 -0.0440 0.0294  337 GLU A O     
2723 C CB    . GLU A 335 ? 0.2678 0.3816 0.2813 -0.0203 -0.0550 0.0267  337 GLU A CB    
2724 C CG    . GLU A 335 ? 0.2823 0.4197 0.3034 -0.0138 -0.0567 0.0309  337 GLU A CG    
2725 C CD    . GLU A 335 ? 0.3087 0.4714 0.3393 -0.0213 -0.0658 0.0296  337 GLU A CD    
2726 O OE1   . GLU A 335 ? 0.3708 0.5315 0.3959 -0.0277 -0.0727 0.0251  337 GLU A OE1   
2727 O OE2   . GLU A 335 ? 0.3720 0.5578 0.4154 -0.0207 -0.0662 0.0329  337 GLU A OE2   
2728 N N     . ILE A 336 ? 0.2478 0.3358 0.2445 0.0038  -0.0385 0.0356  338 ILE A N     
2729 C CA    . ILE A 336 ? 0.2485 0.3279 0.2323 0.0149  -0.0357 0.0397  338 ILE A CA    
2730 C C     . ILE A 336 ? 0.2581 0.3563 0.2428 0.0243  -0.0407 0.0424  338 ILE A C     
2731 O O     . ILE A 336 ? 0.2485 0.3668 0.2463 0.0223  -0.0441 0.0418  338 ILE A O     
2732 C CB    . ILE A 336 ? 0.2454 0.3062 0.2268 0.0173  -0.0271 0.0424  338 ILE A CB    
2733 C CG1   . ILE A 336 ? 0.2506 0.2948 0.2154 0.0250  -0.0232 0.0469  338 ILE A CG1   
2734 C CG2   . ILE A 336 ? 0.2275 0.2958 0.2182 0.0210  -0.0261 0.0436  338 ILE A CG2   
2735 C CD1   . ILE A 336 ? 0.2531 0.2765 0.2146 0.0220  -0.0150 0.0486  338 ILE A CD1   
2736 N N     . SER A 337 ? 0.2709 0.3638 0.2413 0.0348  -0.0411 0.0460  339 SER A N     
2737 C CA    . SER A 337 ? 0.2828 0.3926 0.2518 0.0467  -0.0458 0.0491  339 SER A CA    
2738 C C     . SER A 337 ? 0.2895 0.4012 0.2645 0.0542  -0.0423 0.0517  339 SER A C     
2739 O O     . SER A 337 ? 0.2825 0.3752 0.2570 0.0523  -0.0355 0.0521  339 SER A O     
2740 C CB    . SER A 337 ? 0.2973 0.3959 0.2466 0.0578  -0.0460 0.0535  339 SER A CB    
2741 O OG    . SER A 337 ? 0.2924 0.3638 0.2306 0.0627  -0.0378 0.0581  339 SER A OG    
2742 N N     . ARG A 338 ? 0.2991 0.2845 0.2413 0.0047  0.0172  0.0419  340 ARG A N     
2743 C CA    . ARG A 338 ? 0.3219 0.3064 0.2510 0.0087  0.0215  0.0416  340 ARG A CA    
2744 C C     . ARG A 338 ? 0.3303 0.3083 0.2477 0.0095  0.0181  0.0341  340 ARG A C     
2745 O O     . ARG A 338 ? 0.3455 0.3147 0.2428 0.0105  0.0167  0.0324  340 ARG A O     
2746 C CB    . ARG A 338 ? 0.3267 0.3166 0.2701 0.0121  0.0305  0.0466  340 ARG A CB    
2747 C CG    . ARG A 338 ? 0.3747 0.3559 0.3003 0.0174  0.0444  0.0487  340 ARG A CG    
2748 C CD    . ARG A 338 ? 0.4181 0.4029 0.3589 0.0203  0.0583  0.0586  340 ARG A CD    
2749 N NE    . ARG A 338 ? 0.4984 0.4635 0.4013 0.0216  0.0682  0.0605  340 ARG A NE    
2750 C CZ    . ARG A 338 ? 0.5225 0.4850 0.4183 0.0191  0.0681  0.0669  340 ARG A CZ    
2751 N NH1   . ARG A 338 ? 0.4989 0.4810 0.4277 0.0163  0.0612  0.0718  340 ARG A NH1   
2752 N NH2   . ARG A 338 ? 0.5944 0.5290 0.4447 0.0185  0.0740  0.0687  340 ARG A NH2   
2753 N N     . VAL A 339 ? 0.3279 0.3045 0.2528 0.0077  0.0148  0.0299  341 VAL A N     
2754 C CA    . VAL A 339 ? 0.3417 0.3120 0.2568 0.0082  0.0118  0.0232  341 VAL A CA    
2755 C C     . VAL A 339 ? 0.3432 0.3084 0.2553 0.0061  0.0084  0.0212  341 VAL A C     
2756 O O     . VAL A 339 ? 0.3417 0.3053 0.2640 0.0037  0.0102  0.0239  341 VAL A O     
2757 C CB    . VAL A 339 ? 0.3389 0.3032 0.2583 0.0060  0.0075  0.0205  341 VAL A CB    
2758 C CG1   . VAL A 339 ? 0.3568 0.3277 0.2951 0.0074  0.0079  0.0265  341 VAL A CG1   
2759 C CG2   . VAL A 339 ? 0.3421 0.2915 0.2558 0.0003  0.0045  0.0194  341 VAL A CG2   
2760 N N     . PHE A 340 ? 0.3638 0.3250 0.2662 0.0071  0.0044  0.0178  342 PHE A N     
2761 C CA    . PHE A 340 ? 0.3766 0.3335 0.2868 0.0050  0.0001  0.0181  342 PHE A CA    
2762 C C     . PHE A 340 ? 0.3864 0.3379 0.2870 0.0060  -0.0025 0.0118  342 PHE A C     
2763 O O     . PHE A 340 ? 0.3926 0.3438 0.2812 0.0085  -0.0013 0.0077  342 PHE A O     
2764 C CB    . PHE A 340 ? 0.3798 0.3355 0.2937 0.0027  -0.0101 0.0254  342 PHE A CB    
2765 C CG    . PHE A 340 ? 0.3990 0.3426 0.2827 0.0029  -0.0191 0.0241  342 PHE A CG    
2766 C CD1   . PHE A 340 ? 0.4037 0.3364 0.2803 0.0010  -0.0308 0.0229  342 PHE A CD1   
2767 C CD2   . PHE A 340 ? 0.4165 0.3534 0.2756 0.0048  -0.0140 0.0247  342 PHE A CD2   
2768 C CE1   . PHE A 340 ? 0.4443 0.3545 0.2814 0.0003  -0.0391 0.0209  342 PHE A CE1   
2769 C CE2   . PHE A 340 ? 0.4617 0.3744 0.2806 0.0051  -0.0170 0.0230  342 PHE A CE2   
2770 C CZ    . PHE A 340 ? 0.4715 0.3682 0.2753 0.0024  -0.0306 0.0205  342 PHE A CZ    
2771 N N     . ARG A 341 ? 0.4006 0.3479 0.3125 0.0044  -0.0045 0.0125  343 ARG A N     
2772 C CA    . ARG A 341 ? 0.4158 0.3577 0.3194 0.0051  -0.0081 0.0071  343 ARG A CA    
2773 C C     . ARG A 341 ? 0.4323 0.3699 0.3338 0.0038  -0.0222 0.0098  343 ARG A C     
2774 O O     . ARG A 341 ? 0.4342 0.3712 0.3536 0.0006  -0.0310 0.0183  343 ARG A O     
2775 C CB    . ARG A 341 ? 0.4181 0.3511 0.3285 0.0039  0.0012  0.0050  343 ARG A CB    
2776 C CG    . ARG A 341 ? 0.4237 0.3511 0.3564 0.0027  0.0133  0.0112  343 ARG A CG    
2777 C CD    . ARG A 341 ? 0.4352 0.3401 0.3565 0.0017  0.0292  0.0077  343 ARG A CD    
2778 N NE    . ARG A 341 ? 0.4472 0.3478 0.3807 0.0022  0.0313  0.0087  343 ARG A NE    
2779 C CZ    . ARG A 341 ? 0.4804 0.3586 0.3957 0.0011  0.0425  0.0046  343 ARG A CZ    
2780 N NH1   . ARG A 341 ? 0.5099 0.3620 0.3874 -0.0018 0.0495  -0.0008 343 ARG A NH1   
2781 N NH2   . ARG A 341 ? 0.4762 0.3534 0.4085 0.0019  0.0446  0.0071  343 ARG A NH2   
2782 N N     . ARG A 342 ? 0.4465 0.3775 0.3263 0.0056  -0.0263 0.0036  344 ARG A N     
2783 C CA    . ARG A 342 ? 0.4739 0.3912 0.3409 0.0033  -0.0421 0.0047  344 ARG A CA    
2784 C C     . ARG A 342 ? 0.4601 0.3769 0.3371 0.0033  -0.0441 0.0015  344 ARG A C     
2785 O O     . ARG A 342 ? 0.4508 0.3708 0.3221 0.0063  -0.0346 -0.0056 344 ARG A O     
2786 C CB    . ARG A 342 ? 0.5009 0.4014 0.3263 0.0058  -0.0416 -0.0001 344 ARG A CB    
2787 C CG    . ARG A 342 ? 0.5607 0.4322 0.3555 0.0012  -0.0611 0.0018  344 ARG A CG    
2788 C CD    . ARG A 342 ? 0.6026 0.4446 0.3437 0.0043  -0.0531 -0.0037 344 ARG A CD    
2789 N NE    . ARG A 342 ? 0.7098 0.5185 0.4132 -0.0026 -0.0697 0.0025  344 ARG A NE    
2790 C CZ    . ARG A 342 ? 0.7430 0.5465 0.4337 -0.0033 -0.0640 0.0072  344 ARG A CZ    
2791 N NH1   . ARG A 342 ? 0.7323 0.5642 0.4487 0.0031  -0.0415 0.0063  344 ARG A NH1   
2792 N NH2   . ARG A 342 ? 0.8082 0.5740 0.4582 -0.0116 -0.0837 0.0137  344 ARG A NH2   
2793 N N     . MET A 343 ? 0.4605 0.3726 0.3570 -0.0010 -0.0583 0.0085  345 MET A N     
2794 C CA    . MET A 343 ? 0.4561 0.3668 0.3661 -0.0013 -0.0606 0.0074  345 MET A CA    
2795 C C     . MET A 343 ? 0.4664 0.3619 0.3418 -0.0008 -0.0716 0.0000  345 MET A C     
2796 O O     . MET A 343 ? 0.4917 0.3672 0.3406 -0.0040 -0.0884 0.0016  345 MET A O     
2797 C CB    . MET A 343 ? 0.4536 0.3653 0.4092 -0.0060 -0.0714 0.0210  345 MET A CB    
2798 C CG    . MET A 343 ? 0.4559 0.3683 0.4357 -0.0056 -0.0670 0.0220  345 MET A CG    
2799 S SD    . MET A 343 ? 0.4734 0.3858 0.5195 -0.0114 -0.0831 0.0421  345 MET A SD    
2800 C CE    . MET A 343 ? 0.5016 0.3923 0.5165 -0.0193 -0.1260 0.0446  345 MET A CE    
2801 N N     . GLY A 344 ? 0.4504 0.3493 0.3214 0.0026  -0.0622 -0.0079 346 GLY A N     
2802 C CA    . GLY A 344 ? 0.4578 0.3424 0.3022 0.0039  -0.0695 -0.0148 346 GLY A CA    
2803 C C     . GLY A 344 ? 0.4491 0.3318 0.3126 0.0012  -0.0794 -0.0126 346 GLY A C     
2804 O O     . GLY A 344 ? 0.4349 0.3252 0.3359 -0.0019 -0.0812 -0.0033 346 GLY A O     
2805 N N     . PRO A 345 ? 0.4548 0.3266 0.2971 0.0030  -0.0833 -0.0200 347 PRO A N     
2806 C CA    . PRO A 345 ? 0.4560 0.3236 0.3136 0.0002  -0.0949 -0.0178 347 PRO A CA    
2807 C C     . PRO A 345 ? 0.4286 0.3110 0.3128 0.0015  -0.0802 -0.0179 347 PRO A C     
2808 O O     . PRO A 345 ? 0.4116 0.3018 0.2921 0.0040  -0.0639 -0.0216 347 PRO A O     
2809 C CB    . PRO A 345 ? 0.4807 0.3275 0.2990 0.0024  -0.1007 -0.0272 347 PRO A CB    
2810 C CG    . PRO A 345 ? 0.4774 0.3274 0.2759 0.0089  -0.0814 -0.0347 347 PRO A CG    
2811 C CD    . PRO A 345 ? 0.4697 0.3319 0.2779 0.0084  -0.0740 -0.0296 347 PRO A CD    
2812 N N     . GLN A 346 ? 0.4280 0.3087 0.3362 -0.0012 -0.0871 -0.0127 348 GLN A N     
2813 C CA    . GLN A 346 ? 0.4272 0.3112 0.3484 -0.0004 -0.0724 -0.0134 348 GLN A CA    
2814 C C     . GLN A 346 ? 0.4283 0.3083 0.3197 0.0022  -0.0716 -0.0246 348 GLN A C     
2815 O O     . GLN A 346 ? 0.4419 0.3149 0.3137 0.0037  -0.0833 -0.0302 348 GLN A O     
2816 C CB    . GLN A 346 ? 0.4276 0.3095 0.3853 -0.0035 -0.0788 -0.0035 348 GLN A CB    
2817 C CG    . GLN A 346 ? 0.4297 0.3171 0.4357 -0.0054 -0.0715 0.0115  348 GLN A CG    
2818 C CD    . GLN A 346 ? 0.4438 0.3303 0.5003 -0.0087 -0.0814 0.0254  348 GLN A CD    
2819 O OE1   . GLN A 346 ? 0.4686 0.3489 0.5188 -0.0111 -0.1023 0.0238  348 GLN A OE1   
2820 N NE2   . GLN A 346 ? 0.4587 0.3496 0.5698 -0.0088 -0.0653 0.0405  348 GLN A NE2   
2821 N N     . PHE A 347 ? 0.4202 0.2986 0.3063 0.0021  -0.0582 -0.0270 349 PHE A N     
2822 C CA    . PHE A 347 ? 0.4215 0.2960 0.2883 0.0033  -0.0602 -0.0346 349 PHE A CA    
2823 C C     . PHE A 347 ? 0.4313 0.3018 0.2979 0.0041  -0.0721 -0.0378 349 PHE A C     
2824 O O     . PHE A 347 ? 0.4357 0.3044 0.2910 0.0068  -0.0759 -0.0438 349 PHE A O     
2825 C CB    . PHE A 347 ? 0.4135 0.2762 0.2704 -0.0005 -0.0505 -0.0339 349 PHE A CB    
2826 C CG    . PHE A 347 ? 0.4082 0.2570 0.2670 -0.0036 -0.0464 -0.0312 349 PHE A CG    
2827 C CD1   . PHE A 347 ? 0.4142 0.2574 0.2658 -0.0046 -0.0559 -0.0348 349 PHE A CD1   
2828 C CD2   . PHE A 347 ? 0.4094 0.2482 0.2793 -0.0052 -0.0297 -0.0242 349 PHE A CD2   
2829 C CE1   . PHE A 347 ? 0.4006 0.2284 0.2514 -0.0078 -0.0510 -0.0318 349 PHE A CE1   
2830 C CE2   . PHE A 347 ? 0.3881 0.2098 0.2597 -0.0074 -0.0204 -0.0205 349 PHE A CE2   
2831 C CZ    . PHE A 347 ? 0.4057 0.2219 0.2653 -0.0091 -0.0319 -0.0246 349 PHE A CZ    
2832 N N     . GLU A 348 ? 0.4413 0.3097 0.3260 0.0017  -0.0770 -0.0321 350 GLU A N     
2833 C CA    . GLU A 348 ? 0.4596 0.3221 0.3480 0.0010  -0.0905 -0.0330 350 GLU A CA    
2834 C C     . GLU A 348 ? 0.4784 0.3315 0.3434 0.0035  -0.1046 -0.0398 350 GLU A C     
2835 O O     . GLU A 348 ? 0.4848 0.3308 0.3386 0.0054  -0.1084 -0.0460 350 GLU A O     
2836 C CB    . GLU A 348 ? 0.4657 0.3287 0.3890 -0.0026 -0.0950 -0.0213 350 GLU A CB    
2837 C CG    . GLU A 348 ? 0.4635 0.3296 0.4105 -0.0036 -0.0730 -0.0126 350 GLU A CG    
2838 C CD    . GLU A 348 ? 0.4782 0.3337 0.4239 -0.0046 -0.0576 -0.0119 350 GLU A CD    
2839 O OE1   . GLU A 348 ? 0.4584 0.3070 0.4283 -0.0054 -0.0384 -0.0023 350 GLU A OE1   
2840 O OE2   . GLU A 348 ? 0.5304 0.3806 0.4506 -0.0046 -0.0637 -0.0202 350 GLU A OE2   
2841 N N     . ASP A 349 ? 0.4986 0.3452 0.3519 0.0032  -0.1113 -0.0385 351 ASP A N     
2842 C CA    . ASP A 349 ? 0.5358 0.3584 0.3528 0.0048  -0.1217 -0.0453 351 ASP A CA    
2843 C C     . ASP A 349 ? 0.5381 0.3573 0.3302 0.0116  -0.1045 -0.0535 351 ASP A C     
2844 O O     . ASP A 349 ? 0.5344 0.3558 0.3187 0.0128  -0.0966 -0.0523 351 ASP A O     
2845 C CB    . ASP A 349 ? 0.5752 0.3755 0.3791 -0.0013 -0.1441 -0.0393 351 ASP A CB    
2846 C CG    . ASP A 349 ? 0.5766 0.3831 0.3853 -0.0031 -0.1423 -0.0329 351 ASP A CG    
2847 O OD1   . ASP A 349 ? 0.5405 0.3735 0.3782 -0.0012 -0.1256 -0.0300 351 ASP A OD1   
2848 O OD2   . ASP A 349 ? 0.6132 0.3923 0.3917 -0.0075 -0.1588 -0.0307 351 ASP A OD2   
2849 N N     . GLU A 350 ? 0.5394 0.3539 0.3259 0.0162  -0.0978 -0.0602 352 GLU A N     
2850 C CA    . GLU A 350 ? 0.5473 0.3635 0.3300 0.0233  -0.0784 -0.0643 352 GLU A CA    
2851 C C     . GLU A 350 ? 0.5781 0.3641 0.3208 0.0279  -0.0688 -0.0687 352 GLU A C     
2852 O O     . GLU A 350 ? 0.5780 0.3668 0.3232 0.0338  -0.0489 -0.0688 352 GLU A O     
2853 C CB    . GLU A 350 ? 0.5373 0.3597 0.3392 0.0266  -0.0737 -0.0668 352 GLU A CB    
2854 C CG    . GLU A 350 ? 0.5832 0.3819 0.3675 0.0298  -0.0759 -0.0730 352 GLU A CG    
2855 C CD    . GLU A 350 ? 0.5814 0.3884 0.3934 0.0344  -0.0671 -0.0735 352 GLU A CD    
2856 O OE1   . GLU A 350 ? 0.6118 0.4247 0.4415 0.0400  -0.0504 -0.0712 352 GLU A OE1   
2857 O OE2   . GLU A 350 ? 0.6256 0.4334 0.4473 0.0320  -0.0782 -0.0743 352 GLU A OE2   
2858 N N     . ARG A 351 ? 0.6102 0.3626 0.3143 0.0242  -0.0832 -0.0709 353 ARG A N     
2859 C CA    . ARG A 351 ? 0.6667 0.3747 0.3145 0.0265  -0.0751 -0.0751 353 ARG A CA    
2860 C C     . ARG A 351 ? 0.6520 0.3670 0.2961 0.0252  -0.0698 -0.0701 353 ARG A C     
2861 O O     . ARG A 351 ? 0.6711 0.3733 0.2969 0.0317  -0.0456 -0.0722 353 ARG A O     
2862 C CB    . ARG A 351 ? 0.7216 0.3831 0.3209 0.0189  -0.1009 -0.0766 353 ARG A CB    
2863 C CG    . ARG A 351 ? 0.8316 0.4291 0.3575 0.0227  -0.0873 -0.0852 353 ARG A CG    
2864 C CD    . ARG A 351 ? 0.9225 0.4966 0.4349 0.0245  -0.0907 -0.0921 353 ARG A CD    
2865 N NE    . ARG A 351 ? 1.0094 0.5420 0.4818 0.0353  -0.0563 -0.1014 353 ARG A NE    
2866 C CZ    . ARG A 351 ? 0.9970 0.5585 0.5149 0.0469  -0.0244 -0.1027 353 ARG A CZ    
2867 N NH1   . ARG A 351 ? 0.9320 0.5591 0.5259 0.0476  -0.0268 -0.0963 353 ARG A NH1   
2868 N NH2   . ARG A 351 ? 1.0579 0.5768 0.5445 0.0573  0.0102  -0.1091 353 ARG A NH2   
2869 N N     . ASN A 352 ? 0.6182 0.3534 0.2851 0.0172  -0.0903 -0.0622 354 ASN A N     
2870 C CA    . ASN A 352 ? 0.6058 0.3474 0.2719 0.0147  -0.0895 -0.0563 354 ASN A CA    
2871 C C     . ASN A 352 ? 0.5529 0.3341 0.2584 0.0201  -0.0682 -0.0546 354 ASN A C     
2872 O O     . ASN A 352 ? 0.5482 0.3285 0.2444 0.0220  -0.0566 -0.0528 354 ASN A O     
2873 C CB    . ASN A 352 ? 0.5983 0.3447 0.2828 0.0044  -0.1185 -0.0463 354 ASN A CB    
2874 C CG    . ASN A 352 ? 0.6720 0.3674 0.3075 -0.0039 -0.1460 -0.0445 354 ASN A CG    
2875 O OD1   . ASN A 352 ? 0.7204 0.3753 0.3003 -0.0058 -0.1467 -0.0459 354 ASN A OD1   
2876 N ND2   . ASN A 352 ? 0.6887 0.3799 0.3404 -0.0099 -0.1701 -0.0406 354 ASN A ND2   
2877 N N     . VAL A 353 ? 0.5092 0.3195 0.2542 0.0216  -0.0650 -0.0547 355 VAL A N     
2878 C CA    . VAL A 353 ? 0.4768 0.3148 0.2531 0.0250  -0.0497 -0.0528 355 VAL A CA    
2879 C C     . VAL A 353 ? 0.4939 0.3223 0.2632 0.0333  -0.0280 -0.0554 355 VAL A C     
2880 O O     . VAL A 353 ? 0.4840 0.3227 0.2646 0.0357  -0.0157 -0.0516 355 VAL A O     
2881 C CB    . VAL A 353 ? 0.4459 0.3037 0.2539 0.0227  -0.0545 -0.0518 355 VAL A CB    
2882 C CG1   . VAL A 353 ? 0.4223 0.2972 0.2544 0.0239  -0.0450 -0.0486 355 VAL A CG1   
2883 C CG2   . VAL A 353 ? 0.4307 0.2959 0.2508 0.0159  -0.0664 -0.0470 355 VAL A CG2   
2884 N N     . LYS A 354 ? 0.5183 0.3253 0.2727 0.0381  -0.0212 -0.0608 356 LYS A N     
2885 C CA    . LYS A 354 ? 0.5530 0.3445 0.3044 0.0476  0.0060  -0.0619 356 LYS A CA    
2886 C C     . LYS A 354 ? 0.5815 0.3498 0.2970 0.0498  0.0208  -0.0611 356 LYS A C     
2887 O O     . LYS A 354 ? 0.5785 0.3547 0.3152 0.0558  0.0430  -0.0564 356 LYS A O     
2888 C CB    . LYS A 354 ? 0.5894 0.3489 0.3174 0.0526  0.0137  -0.0688 356 LYS A CB    
2889 C CG    . LYS A 354 ? 0.5716 0.3529 0.3460 0.0544  0.0107  -0.0678 356 LYS A CG    
2890 C CD    . LYS A 354 ? 0.6209 0.3695 0.3806 0.0627  0.0295  -0.0732 356 LYS A CD    
2891 C CE    . LYS A 354 ? 0.6725 0.4118 0.4533 0.0741  0.0670  -0.0688 356 LYS A CE    
2892 N NZ    . LYS A 354 ? 0.7092 0.4206 0.4923 0.0834  0.0897  -0.0721 356 LYS A NZ    
2893 N N     . LYS A 355 ? 0.6168 0.3541 0.2795 0.0439  0.0063  -0.0639 357 LYS A N     
2894 C CA    . LYS A 355 ? 0.6623 0.3665 0.2774 0.0437  0.0159  -0.0630 357 LYS A CA    
2895 C C     . LYS A 355 ? 0.6270 0.3655 0.2726 0.0410  0.0138  -0.0555 357 LYS A C     
2896 O O     . LYS A 355 ? 0.6508 0.3776 0.2827 0.0450  0.0342  -0.0529 357 LYS A O     
2897 C CB    . LYS A 355 ? 0.7152 0.3715 0.2652 0.0348  -0.0087 -0.0658 357 LYS A CB    
2898 C CG    . LYS A 355 ? 0.7726 0.3780 0.2731 0.0373  -0.0039 -0.0743 357 LYS A CG    
2899 C CD    . LYS A 355 ? 0.8407 0.3922 0.2741 0.0254  -0.0369 -0.0751 357 LYS A CD    
2900 C CE    . LYS A 355 ? 0.9285 0.4286 0.2937 0.0212  -0.0343 -0.0731 357 LYS A CE    
2901 N NZ    . LYS A 355 ? 1.0206 0.4692 0.3276 0.0060  -0.0774 -0.0701 357 LYS A NZ    
2902 N N     . PHE A 356 ? 0.5749 0.3512 0.2597 0.0346  -0.0082 -0.0517 358 PHE A N     
2903 C CA    . PHE A 356 ? 0.5472 0.3541 0.2615 0.0317  -0.0108 -0.0450 358 PHE A CA    
2904 C C     . PHE A 356 ? 0.5311 0.3626 0.2844 0.0381  0.0101  -0.0419 358 PHE A C     
2905 O O     . PHE A 356 ? 0.5284 0.3673 0.2883 0.0391  0.0194  -0.0371 358 PHE A O     
2906 C CB    . PHE A 356 ? 0.5057 0.3382 0.2504 0.0243  -0.0328 -0.0418 358 PHE A CB    
2907 C CG    . PHE A 356 ? 0.4777 0.3348 0.2483 0.0212  -0.0338 -0.0353 358 PHE A CG    
2908 C CD1   . PHE A 356 ? 0.4876 0.3350 0.2425 0.0173  -0.0405 -0.0304 358 PHE A CD1   
2909 C CD2   . PHE A 356 ? 0.4413 0.3246 0.2474 0.0210  -0.0297 -0.0335 358 PHE A CD2   
2910 C CE1   . PHE A 356 ? 0.4583 0.3275 0.2394 0.0150  -0.0398 -0.0243 358 PHE A CE1   
2911 C CE2   . PHE A 356 ? 0.4173 0.3156 0.2405 0.0181  -0.0288 -0.0282 358 PHE A CE2   
2912 C CZ    . PHE A 356 ? 0.4221 0.3161 0.2363 0.0158  -0.0323 -0.0238 358 PHE A CZ    
2913 N N     . LEU A 357 ? 0.5250 0.3667 0.3066 0.0418  0.0150  -0.0432 359 LEU A N     
2914 C CA    . LEU A 357 ? 0.5132 0.3767 0.3422 0.0459  0.0274  -0.0368 359 LEU A CA    
2915 C C     . LEU A 357 ? 0.5516 0.3982 0.3840 0.0559  0.0578  -0.0343 359 LEU A C     
2916 O O     . LEU A 357 ? 0.5415 0.4056 0.4211 0.0593  0.0690  -0.0254 359 LEU A O     
2917 C CB    . LEU A 357 ? 0.4890 0.3687 0.3523 0.0433  0.0146  -0.0361 359 LEU A CB    
2918 C CG    . LEU A 357 ? 0.4687 0.3614 0.3339 0.0340  -0.0084 -0.0365 359 LEU A CG    
2919 C CD1   . LEU A 357 ? 0.4723 0.3708 0.3628 0.0313  -0.0187 -0.0350 359 LEU A CD1   
2920 C CD2   . LEU A 357 ? 0.4729 0.3786 0.3461 0.0291  -0.0122 -0.0313 359 LEU A CD2   
2921 N N     . SER A 358 ? 0.6075 0.4150 0.3897 0.0603  0.0718  -0.0408 360 SER A N     
2922 C CA    . SER A 358 ? 0.6589 0.4381 0.4341 0.0711  0.1092  -0.0389 360 SER A CA    
2923 C C     . SER A 358 ? 0.6811 0.4530 0.4442 0.0729  0.1266  -0.0333 360 SER A C     
2924 O O     . SER A 358 ? 0.7097 0.4689 0.4893 0.0824  0.1618  -0.0273 360 SER A O     
2925 C CB    . SER A 358 ? 0.7172 0.4429 0.4275 0.0743  0.1201  -0.0488 360 SER A CB    
2926 O OG    . SER A 358 ? 0.7690 0.4575 0.4050 0.0678  0.1091  -0.0537 360 SER A OG    
2927 N N     . ARG A 359 ? 0.6787 0.4579 0.4179 0.0641  0.1041  -0.0338 361 ARG A N     
2928 C CA    . ARG A 359 ? 0.6975 0.4741 0.4283 0.0644  0.1159  -0.0278 361 ARG A CA    
2929 C C     . ARG A 359 ? 0.6551 0.4731 0.4618 0.0677  0.1249  -0.0167 361 ARG A C     
2930 O O     . ARG A 359 ? 0.6048 0.4594 0.4572 0.0626  0.1023  -0.0140 361 ARG A O     
2931 C CB    . ARG A 359 ? 0.6893 0.4701 0.3914 0.0535  0.0859  -0.0289 361 ARG A CB    
2932 C CG    . ARG A 359 ? 0.7560 0.4954 0.3907 0.0470  0.0670  -0.0359 361 ARG A CG    
2933 C CD    . ARG A 359 ? 0.8740 0.5482 0.4365 0.0515  0.0920  -0.0396 361 ARG A CD    
2934 N NE    . ARG A 359 ? 0.9556 0.5827 0.4443 0.0418  0.0721  -0.0403 361 ARG A NE    
2935 C CZ    . ARG A 359 ? 0.9904 0.6076 0.4583 0.0380  0.0722  -0.0344 361 ARG A CZ    
2936 N NH1   . ARG A 359 ? 0.9691 0.6232 0.4860 0.0438  0.0923  -0.0280 361 ARG A NH1   
2937 N NH2   . ARG A 359 ? 1.0559 0.6242 0.4551 0.0272  0.0482  -0.0335 361 ARG A NH2   
2938 N N     . ASN A 360 ? 0.6816 0.4873 0.4987 0.0758  0.1581  -0.0092 362 ASN A N     
2939 C CA    . ASN A 360 ? 0.6484 0.4897 0.5407 0.0781  0.1649  0.0044  362 ASN A CA    
2940 C C     . ASN A 360 ? 0.6163 0.4796 0.5071 0.0696  0.1432  0.0070  362 ASN A C     
2941 O O     . ASN A 360 ? 0.6422 0.4848 0.4867 0.0688  0.1507  0.0056  362 ASN A O     
2942 C CB    . ASN A 360 ? 0.6909 0.5104 0.6030 0.0906  0.2122  0.0137  362 ASN A CB    
2943 C CG    . ASN A 360 ? 0.7924 0.5492 0.6181 0.0964  0.2428  0.0046  362 ASN A CG    
2944 O OD1   . ASN A 360 ? 0.8476 0.5778 0.5957 0.0889  0.2235  -0.0063 362 ASN A OD1   
2945 N ND2   . ASN A 360 ? 0.8468 0.5739 0.6853 0.1093  0.2908  0.0104  362 ASN A ND2   
2946 N N     . ARG A 361 ? 0.5622 0.4613 0.4977 0.0624  0.1154  0.0108  363 ARG A N     
2947 C CA    . ARG A 361 ? 0.5344 0.4511 0.4677 0.0542  0.0951  0.0125  363 ARG A CA    
2948 C C     . ARG A 361 ? 0.4997 0.4425 0.4969 0.0519  0.0885  0.0253  363 ARG A C     
2949 O O     . ARG A 361 ? 0.4896 0.4409 0.5377 0.0539  0.0890  0.0332  363 ARG A O     
2950 C CB    . ARG A 361 ? 0.5160 0.4378 0.4235 0.0453  0.0656  0.0033  363 ARG A CB    
2951 C CG    . ARG A 361 ? 0.5437 0.4403 0.3965 0.0453  0.0635  -0.0069 363 ARG A CG    
2952 C CD    . ARG A 361 ? 0.5305 0.4363 0.3765 0.0372  0.0371  -0.0122 363 ARG A CD    
2953 N NE    . ARG A 361 ? 0.5717 0.4574 0.3847 0.0370  0.0310  -0.0199 363 ARG A NE    
2954 C CZ    . ARG A 361 ? 0.5950 0.4617 0.3694 0.0329  0.0203  -0.0225 363 ARG A CZ    
2955 N NH1   . ARG A 361 ? 0.6189 0.4857 0.3845 0.0291  0.0157  -0.0180 363 ARG A NH1   
2956 N NH2   . ARG A 361 ? 0.6103 0.4560 0.3574 0.0316  0.0111  -0.0280 363 ARG A NH2   
2957 N N     . ALA A 362 ? 0.4846 0.4374 0.4805 0.0468  0.0795  0.0286  364 ALA A N     
2958 C CA    . ALA A 362 ? 0.4638 0.4353 0.5123 0.0423  0.0676  0.0410  364 ALA A CA    
2959 C C     . ALA A 362 ? 0.4424 0.4190 0.5029 0.0324  0.0356  0.0403  364 ALA A C     
2960 O O     . ALA A 362 ? 0.4375 0.4203 0.5466 0.0283  0.0224  0.0523  364 ALA A O     
2961 C CB    . ALA A 362 ? 0.4560 0.4320 0.4924 0.0394  0.0671  0.0436  364 ALA A CB    
2962 N N     . PHE A 363 ? 0.4423 0.4112 0.4586 0.0278  0.0228  0.0279  365 PHE A N     
2963 C CA    . PHE A 363 ? 0.4371 0.4009 0.4472 0.0172  -0.0036 0.0266  365 PHE A CA    
2964 C C     . PHE A 363 ? 0.4523 0.4054 0.4417 0.0135  -0.0157 0.0187  365 PHE A C     
2965 O O     . PHE A 363 ? 0.4763 0.4166 0.4396 0.0055  -0.0297 0.0146  365 PHE A O     
2966 C CB    . PHE A 363 ? 0.4257 0.3862 0.4064 0.0121  -0.0081 0.0229  365 PHE A CB    
2967 C CG    . PHE A 363 ? 0.4027 0.3692 0.4066 0.0102  -0.0091 0.0328  365 PHE A CG    
2968 C CD1   . PHE A 363 ? 0.3847 0.3590 0.3808 0.0145  0.0058  0.0331  365 PHE A CD1   
2969 C CD2   . PHE A 363 ? 0.3879 0.3489 0.4209 0.0026  -0.0285 0.0432  365 PHE A CD2   
2970 C CE1   . PHE A 363 ? 0.3732 0.3537 0.3925 0.0127  0.0050  0.0428  365 PHE A CE1   
2971 C CE2   . PHE A 363 ? 0.3808 0.3463 0.4383 0.0000  -0.0321 0.0537  365 PHE A CE2   
2972 C CZ    . PHE A 363 ? 0.3754 0.3527 0.4272 0.0058  -0.0134 0.0530  365 PHE A CZ    
2973 N N     . ARG A 364 ? 0.4572 0.4110 0.4556 0.0193  -0.0082 0.0166  366 ARG A N     
2974 C CA    . ARG A 364 ? 0.4536 0.3977 0.4411 0.0150  -0.0225 0.0116  366 ARG A CA    
2975 C C     . ARG A 364 ? 0.4402 0.3742 0.3818 0.0109  -0.0270 0.0008  366 ARG A C     
2976 O O     . ARG A 364 ? 0.4375 0.3615 0.3616 0.0037  -0.0355 0.0007  366 ARG A O     
2977 C CB    . ARG A 364 ? 0.4662 0.4022 0.4808 0.0055  -0.0468 0.0217  366 ARG A CB    
2978 C CG    . ARG A 364 ? 0.5019 0.4301 0.5264 0.0031  -0.0592 0.0221  366 ARG A CG    
2979 C CD    . ARG A 364 ? 0.5609 0.4854 0.6365 -0.0040 -0.0816 0.0388  366 ARG A CD    
2980 N NE    . ARG A 364 ? 0.6022 0.5330 0.7195 0.0008  -0.0800 0.0439  366 ARG A NE    
2981 C CZ    . ARG A 364 ? 0.6212 0.5547 0.8042 -0.0023 -0.0950 0.0616  366 ARG A CZ    
2982 N NH1   . ARG A 364 ? 0.6292 0.5580 0.8435 -0.0116 -0.1172 0.0769  366 ARG A NH1   
2983 N NH2   . ARG A 364 ? 0.6255 0.5646 0.8473 0.0034  -0.0893 0.0655  366 ARG A NH2   
2984 N N     . PRO A 365 ? 0.4305 0.3636 0.3541 0.0156  -0.0197 -0.0072 367 PRO A N     
2985 C CA    . PRO A 365 ? 0.4209 0.3466 0.3151 0.0126  -0.0230 -0.0144 367 PRO A CA    
2986 C C     . PRO A 365 ? 0.4206 0.3312 0.3049 0.0048  -0.0355 -0.0153 367 PRO A C     
2987 O O     . PRO A 365 ? 0.4201 0.3240 0.3164 0.0011  -0.0468 -0.0112 367 PRO A O     
2988 C CB    . PRO A 365 ? 0.4270 0.3516 0.3111 0.0186  -0.0170 -0.0200 367 PRO A CB    
2989 C CG    . PRO A 365 ? 0.4362 0.3633 0.3301 0.0258  -0.0030 -0.0172 367 PRO A CG    
2990 C CD    . PRO A 365 ? 0.4363 0.3709 0.3669 0.0244  -0.0061 -0.0089 367 PRO A CD    
2991 N N     . PHE A 366 ? 0.4178 0.3192 0.2816 0.0020  -0.0329 -0.0189 368 PHE A N     
2992 C CA    . PHE A 366 ? 0.4265 0.3034 0.2698 -0.0054 -0.0380 -0.0197 368 PHE A CA    
2993 C C     . PHE A 366 ? 0.4236 0.2958 0.2584 -0.0043 -0.0309 -0.0235 368 PHE A C     
2994 O O     . PHE A 366 ? 0.4100 0.2970 0.2561 0.0003  -0.0251 -0.0240 368 PHE A O     
2995 C CB    . PHE A 366 ? 0.4368 0.2941 0.2627 -0.0115 -0.0362 -0.0167 368 PHE A CB    
2996 C CG    . PHE A 366 ? 0.4252 0.2915 0.2547 -0.0080 -0.0213 -0.0166 368 PHE A CG    
2997 C CD1   . PHE A 366 ? 0.3986 0.2871 0.2467 -0.0038 -0.0196 -0.0138 368 PHE A CD1   
2998 C CD2   . PHE A 366 ? 0.4340 0.2839 0.2519 -0.0090 -0.0077 -0.0174 368 PHE A CD2   
2999 C CE1   . PHE A 366 ? 0.3877 0.2832 0.2414 -0.0017 -0.0094 -0.0121 368 PHE A CE1   
3000 C CE2   . PHE A 366 ? 0.4212 0.2800 0.2534 -0.0061 0.0050  -0.0145 368 PHE A CE2   
3001 C CZ    . PHE A 366 ? 0.4072 0.2892 0.2565 -0.0030 0.0016  -0.0120 368 PHE A CZ    
3002 N N     . ILE A 367 ? 0.4338 0.2820 0.2494 -0.0097 -0.0333 -0.0246 369 ILE A N     
3003 C CA    . ILE A 367 ? 0.4377 0.2774 0.2490 -0.0092 -0.0233 -0.0259 369 ILE A CA    
3004 C C     . ILE A 367 ? 0.4567 0.2705 0.2507 -0.0123 -0.0056 -0.0236 369 ILE A C     
3005 O O     . ILE A 367 ? 0.4818 0.2633 0.2429 -0.0188 -0.0054 -0.0233 369 ILE A O     
3006 C CB    . ILE A 367 ? 0.4542 0.2792 0.2536 -0.0124 -0.0318 -0.0280 369 ILE A CB    
3007 C CG1   . ILE A 367 ? 0.4284 0.2774 0.2492 -0.0078 -0.0448 -0.0301 369 ILE A CG1   
3008 C CG2   . ILE A 367 ? 0.4619 0.2770 0.2613 -0.0119 -0.0188 -0.0276 369 ILE A CG2   
3009 C CD1   . ILE A 367 ? 0.4465 0.2832 0.2611 -0.0112 -0.0564 -0.0312 369 ILE A CD1   
3010 N N     . GLU A 368 ? 0.4451 0.2686 0.2621 -0.0082 0.0088  -0.0205 370 GLU A N     
3011 C CA    . GLU A 368 ? 0.4658 0.2626 0.2754 -0.0093 0.0332  -0.0167 370 GLU A CA    
3012 C C     . GLU A 368 ? 0.4574 0.2603 0.3013 -0.0057 0.0467  -0.0110 370 GLU A C     
3013 O O     . GLU A 368 ? 0.4316 0.2660 0.3155 -0.0022 0.0367  -0.0071 370 GLU A O     
3014 C CB    . GLU A 368 ? 0.4612 0.2654 0.2805 -0.0078 0.0399  -0.0139 370 GLU A CB    
3015 C CG    . GLU A 368 ? 0.4811 0.2572 0.3000 -0.0073 0.0700  -0.0090 370 GLU A CG    
3016 C CD    . GLU A 368 ? 0.4732 0.2670 0.3193 -0.0043 0.0754  -0.0043 370 GLU A CD    
3017 O OE1   . GLU A 368 ? 0.4635 0.2511 0.2857 -0.0069 0.0690  -0.0073 370 GLU A OE1   
3018 O OE2   . GLU A 368 ? 0.4712 0.2839 0.3662 -0.0001 0.0840  0.0040  370 GLU A OE2   
3019 N N     . ASN A 369 ? 0.4916 0.2584 0.3183 -0.0074 0.0692  -0.0091 371 ASN A N     
3020 C CA    . ASN A 369 ? 0.4960 0.2645 0.3624 -0.0040 0.0863  -0.0008 371 ASN A CA    
3021 C C     . ASN A 369 ? 0.4676 0.2704 0.3677 -0.0026 0.0617  0.0000  371 ASN A C     
3022 O O     . ASN A 369 ? 0.4483 0.2736 0.4017 0.0001  0.0588  0.0093  371 ASN A O     
3023 C CB    . ASN A 369 ? 0.4943 0.2684 0.4078 0.0003  0.1090  0.0100  371 ASN A CB    
3024 C CG    . ASN A 369 ? 0.5455 0.2749 0.4222 -0.0004 0.1412  0.0094  371 ASN A CG    
3025 O OD1   . ASN A 369 ? 0.6098 0.2896 0.4382 -0.0032 0.1629  0.0066  371 ASN A OD1   
3026 N ND2   . ASN A 369 ? 0.5338 0.2743 0.4281 0.0015  0.1448  0.0123  371 ASN A ND2   
3027 N N     . GLY A 370 ? 0.4652 0.2679 0.3342 -0.0052 0.0420  -0.0085 372 GLY A N     
3028 C CA    . GLY A 370 ? 0.4510 0.2751 0.3400 -0.0041 0.0218  -0.0094 372 GLY A CA    
3029 C C     . GLY A 370 ? 0.4237 0.2785 0.3273 -0.0018 -0.0023 -0.0117 372 GLY A C     
3030 O O     . GLY A 370 ? 0.4177 0.2826 0.3288 -0.0012 -0.0192 -0.0133 372 GLY A O     
3031 N N     . ARG A 371 ? 0.4205 0.2841 0.3225 -0.0009 -0.0027 -0.0118 373 ARG A N     
3032 C CA    . ARG A 371 ? 0.4133 0.2965 0.3188 0.0010  -0.0216 -0.0138 373 ARG A CA    
3033 C C     . ARG A 371 ? 0.4041 0.2912 0.2868 0.0020  -0.0229 -0.0192 373 ARG A C     
3034 O O     . ARG A 371 ? 0.4086 0.2861 0.2793 0.0003  -0.0123 -0.0193 373 ARG A O     
3035 C CB    . ARG A 371 ? 0.4116 0.3048 0.3523 0.0007  -0.0283 -0.0040 373 ARG A CB    
3036 C CG    . ARG A 371 ? 0.4247 0.3202 0.3842 0.0008  -0.0152 0.0032  373 ARG A CG    
3037 C CD    . ARG A 371 ? 0.4204 0.3244 0.4266 -0.0011 -0.0267 0.0169  373 ARG A CD    
3038 N NE    . ARG A 371 ? 0.4353 0.3408 0.4296 -0.0036 -0.0560 0.0160  373 ARG A NE    
3039 C CZ    . ARG A 371 ? 0.4550 0.3561 0.4687 -0.0071 -0.0765 0.0227  373 ARG A CZ    
3040 N NH1   . ARG A 371 ? 0.4608 0.3630 0.5201 -0.0080 -0.0703 0.0329  373 ARG A NH1   
3041 N NH2   . ARG A 371 ? 0.4502 0.3404 0.4351 -0.0103 -0.1026 0.0201  373 ARG A NH2   
3042 N N     . TRP A 372 ? 0.3950 0.2911 0.2703 0.0044  -0.0351 -0.0230 374 TRP A N     
3043 C CA    . TRP A 372 ? 0.3874 0.2885 0.2505 0.0065  -0.0341 -0.0258 374 TRP A CA    
3044 C C     . TRP A 372 ? 0.3845 0.2923 0.2540 0.0068  -0.0311 -0.0211 374 TRP A C     
3045 O O     . TRP A 372 ? 0.3765 0.2851 0.2574 0.0057  -0.0371 -0.0161 374 TRP A O     
3046 C CB    . TRP A 372 ? 0.3888 0.2900 0.2411 0.0104  -0.0405 -0.0307 374 TRP A CB    
3047 C CG    . TRP A 372 ? 0.3861 0.2836 0.2370 0.0107  -0.0424 -0.0345 374 TRP A CG    
3048 C CD1   . TRP A 372 ? 0.3867 0.2782 0.2369 0.0099  -0.0486 -0.0369 374 TRP A CD1   
3049 C CD2   . TRP A 372 ? 0.3855 0.2838 0.2404 0.0106  -0.0413 -0.0342 374 TRP A CD2   
3050 N NE1   . TRP A 372 ? 0.3871 0.2757 0.2383 0.0097  -0.0506 -0.0389 374 TRP A NE1   
3051 C CE2   . TRP A 372 ? 0.3882 0.2804 0.2446 0.0096  -0.0478 -0.0364 374 TRP A CE2   
3052 C CE3   . TRP A 372 ? 0.3833 0.2863 0.2455 0.0105  -0.0381 -0.0306 374 TRP A CE3   
3053 C CZ2   . TRP A 372 ? 0.3896 0.2795 0.2567 0.0079  -0.0533 -0.0339 374 TRP A CZ2   
3054 C CZ3   . TRP A 372 ? 0.3865 0.2872 0.2613 0.0086  -0.0441 -0.0275 374 TRP A CZ3   
3055 C CH2   . TRP A 372 ? 0.3858 0.2796 0.2640 0.0070  -0.0526 -0.0286 374 TRP A CH2   
3056 N N     . TRP A 373 ? 0.3812 0.2918 0.2462 0.0071  -0.0250 -0.0211 375 TRP A N     
3057 C CA    . TRP A 373 ? 0.3834 0.3006 0.2532 0.0074  -0.0217 -0.0168 375 TRP A CA    
3058 C C     . TRP A 373 ? 0.3874 0.3096 0.2506 0.0101  -0.0195 -0.0180 375 TRP A C     
3059 O O     . TRP A 373 ? 0.3830 0.3035 0.2467 0.0099  -0.0197 -0.0196 375 TRP A O     
3060 C CB    . TRP A 373 ? 0.3786 0.2910 0.2567 0.0045  -0.0117 -0.0129 375 TRP A CB    
3061 C CG    . TRP A 373 ? 0.3761 0.2822 0.2711 0.0031  -0.0061 -0.0087 375 TRP A CG    
3062 C CD1   . TRP A 373 ? 0.3914 0.2837 0.2828 0.0017  -0.0002 -0.0102 375 TRP A CD1   
3063 C CD2   . TRP A 373 ? 0.3747 0.2863 0.2992 0.0028  -0.0046 0.0001  375 TRP A CD2   
3064 N NE1   . TRP A 373 ? 0.3897 0.2795 0.3098 0.0017  0.0088  -0.0026 375 TRP A NE1   
3065 C CE2   . TRP A 373 ? 0.3878 0.2906 0.3334 0.0022  0.0049  0.0046  375 TRP A CE2   
3066 C CE3   . TRP A 373 ? 0.3736 0.2949 0.3123 0.0025  -0.0109 0.0063  375 TRP A CE3   
3067 C CZ2   . TRP A 373 ? 0.3815 0.2879 0.3723 0.0018  0.0088  0.0169  375 TRP A CZ2   
3068 C CZ3   . TRP A 373 ? 0.3750 0.2986 0.3535 0.0009  -0.0115 0.0179  375 TRP A CZ3   
3069 C CH2   . TRP A 373 ? 0.3720 0.2898 0.3814 0.0009  -0.0015 0.0238  375 TRP A CH2   
3070 N N     . ALA A 374 ? 0.3977 0.3239 0.2582 0.0119  -0.0180 -0.0153 376 ALA A N     
3071 C CA    . ALA A 374 ? 0.4055 0.3359 0.2657 0.0152  -0.0110 -0.0141 376 ALA A CA    
3072 C C     . ALA A 374 ? 0.4039 0.3409 0.2717 0.0136  -0.0075 -0.0089 376 ALA A C     
3073 O O     . ALA A 374 ? 0.4062 0.3431 0.2746 0.0114  -0.0100 -0.0060 376 ALA A O     
3074 C CB    . ALA A 374 ? 0.4280 0.3486 0.2693 0.0198  -0.0071 -0.0159 376 ALA A CB    
3075 N N     . PHE A 375 ? 0.3986 0.3409 0.2776 0.0142  -0.0033 -0.0060 377 PHE A N     
3076 C CA    . PHE A 375 ? 0.3958 0.3441 0.2812 0.0137  0.0009  -0.0007 377 PHE A CA    
3077 C C     . PHE A 375 ? 0.4096 0.3572 0.2868 0.0188  0.0098  0.0015  377 PHE A C     
3078 O O     . PHE A 375 ? 0.4173 0.3608 0.2945 0.0238  0.0183  0.0009  377 PHE A O     
3079 C CB    . PHE A 375 ? 0.3842 0.3342 0.2859 0.0108  -0.0016 0.0035  377 PHE A CB    
3080 C CG    . PHE A 375 ? 0.4006 0.3366 0.2933 0.0041  -0.0087 0.0017  377 PHE A CG    
3081 C CD1   . PHE A 375 ? 0.4014 0.3244 0.2918 -0.0002 -0.0186 0.0012  377 PHE A CD1   
3082 C CD2   . PHE A 375 ? 0.3923 0.3219 0.2767 0.0018  -0.0041 0.0013  377 PHE A CD2   
3083 C CE1   . PHE A 375 ? 0.4114 0.3082 0.2786 -0.0074 -0.0233 -0.0007 377 PHE A CE1   
3084 C CE2   . PHE A 375 ? 0.3947 0.3008 0.2627 -0.0036 -0.0035 -0.0006 377 PHE A CE2   
3085 C CZ    . PHE A 375 ? 0.4131 0.2992 0.2660 -0.0086 -0.0129 -0.0022 377 PHE A CZ    
3086 N N     . GLU A 376 ? 0.4103 0.3569 0.2790 0.0175  0.0099  0.0048  378 GLU A N     
3087 C CA    . GLU A 376 ? 0.4380 0.3728 0.2849 0.0206  0.0180  0.0071  378 GLU A CA    
3088 C C     . GLU A 376 ? 0.4235 0.3664 0.2805 0.0195  0.0220  0.0140  378 GLU A C     
3089 O O     . GLU A 376 ? 0.3963 0.3513 0.2727 0.0157  0.0155  0.0160  378 GLU A O     
3090 C CB    . GLU A 376 ? 0.4667 0.3820 0.2825 0.0174  0.0064  0.0051  378 GLU A CB    
3091 C CG    . GLU A 376 ? 0.5578 0.4428 0.3314 0.0207  0.0144  0.0024  378 GLU A CG    
3092 C CD    . GLU A 376 ? 0.6122 0.4915 0.3830 0.0246  0.0186  -0.0045 378 GLU A CD    
3093 O OE1   . GLU A 376 ? 0.6419 0.5211 0.4214 0.0315  0.0384  -0.0049 378 GLU A OE1   
3094 O OE2   . GLU A 376 ? 0.6257 0.5008 0.3914 0.0209  0.0027  -0.0080 378 GLU A OE2   
3095 N N     . MET A 377 ? 0.4342 0.3659 0.2755 0.0230  0.0353  0.0178  379 MET A N     
3096 C CA    . MET A 377 ? 0.4289 0.3678 0.2805 0.0223  0.0404  0.0253  379 MET A CA    
3097 C C     . MET A 377 ? 0.4503 0.3689 0.2659 0.0189  0.0355  0.0283  379 MET A C     
3098 O O     . MET A 377 ? 0.4881 0.3754 0.2597 0.0197  0.0403  0.0266  379 MET A O     
3099 C CB    . MET A 377 ? 0.4348 0.3773 0.3066 0.0287  0.0615  0.0311  379 MET A CB    
3100 C CG    . MET A 377 ? 0.4300 0.3911 0.3465 0.0298  0.0597  0.0326  379 MET A CG    
3101 S SD    . MET A 377 ? 0.4345 0.4131 0.3777 0.0217  0.0388  0.0345  379 MET A SD    
3102 C CE    . MET A 377 ? 0.4288 0.4186 0.4115 0.0230  0.0470  0.0478  379 MET A CE    
3103 N N     . ARG A 378 ? 0.4269 0.3574 0.2579 0.0141  0.0252  0.0333  380 ARG A N     
3104 C CA    . ARG A 378 ? 0.4487 0.3611 0.2534 0.0092  0.0166  0.0393  380 ARG A CA    
3105 C C     . ARG A 378 ? 0.4734 0.3705 0.2558 0.0123  0.0349  0.0444  380 ARG A C     
3106 O O     . ARG A 378 ? 0.4544 0.3683 0.2646 0.0178  0.0527  0.0466  380 ARG A O     
3107 C CB    . ARG A 378 ? 0.4201 0.3523 0.2589 0.0042  0.0034  0.0446  380 ARG A CB    
3108 C CG    . ARG A 378 ? 0.4094 0.3483 0.2691 0.0008  -0.0112 0.0429  380 ARG A CG    
3109 C CD    . ARG A 378 ? 0.3751 0.3279 0.2711 -0.0028 -0.0170 0.0498  380 ARG A CD    
3110 N NE    . ARG A 378 ? 0.3607 0.3151 0.2818 -0.0055 -0.0269 0.0513  380 ARG A NE    
3111 C CZ    . ARG A 378 ? 0.3284 0.2920 0.2721 -0.0031 -0.0172 0.0466  380 ARG A CZ    
3112 N NH1   . ARG A 378 ? 0.3141 0.2831 0.2539 0.0003  -0.0033 0.0398  380 ARG A NH1   
3113 N NH2   . ARG A 378 ? 0.3299 0.2923 0.2995 -0.0050 -0.0222 0.0501  380 ARG A NH2   
3114 N N     . LYS A 379 ? 0.5197 0.3808 0.2523 0.0076  0.0287  0.0480  381 LYS A N     
3115 C CA    . LYS A 379 ? 0.5579 0.3936 0.2572 0.0092  0.0469  0.0540  381 LYS A CA    
3116 C C     . LYS A 379 ? 0.5288 0.3819 0.2519 0.0049  0.0388  0.0629  381 LYS A C     
3117 O O     . LYS A 379 ? 0.5504 0.3922 0.2603 0.0070  0.0562  0.0690  381 LYS A O     
3118 C CB    . LYS A 379 ? 0.6431 0.4173 0.2610 0.0039  0.0413  0.0538  381 LYS A CB    
3119 C CG    . LYS A 379 ? 0.7063 0.4477 0.2838 0.0100  0.0615  0.0456  381 LYS A CG    
3120 C CD    . LYS A 379 ? 0.7964 0.5008 0.3344 0.0173  0.1013  0.0485  381 LYS A CD    
3121 C CE    . LYS A 379 ? 0.8833 0.5310 0.3556 0.0213  0.1216  0.0413  381 LYS A CE    
3122 N NZ    . LYS A 379 ? 0.8513 0.5330 0.3722 0.0284  0.1258  0.0338  381 LYS A NZ    
3123 N N     . PHE A 380 ? 0.4846 0.3622 0.2435 -0.0007 0.0148  0.0645  382 PHE A N     
3124 C CA    . PHE A 380 ? 0.4579 0.3526 0.2453 -0.0047 0.0063  0.0729  382 PHE A CA    
3125 C C     . PHE A 380 ? 0.4032 0.3340 0.2477 -0.0047 -0.0015 0.0710  382 PHE A C     
3126 O O     . PHE A 380 ? 0.3887 0.3242 0.2432 -0.0046 -0.0078 0.0652  382 PHE A O     
3127 C CB    . PHE A 380 ? 0.4973 0.3604 0.2506 -0.0149 -0.0175 0.0817  382 PHE A CB    
3128 C CG    . PHE A 380 ? 0.5160 0.3560 0.2485 -0.0216 -0.0427 0.0809  382 PHE A CG    
3129 C CD1   . PHE A 380 ? 0.4740 0.3400 0.2586 -0.0238 -0.0593 0.0818  382 PHE A CD1   
3130 C CD2   . PHE A 380 ? 0.5942 0.3805 0.2532 -0.0261 -0.0488 0.0802  382 PHE A CD2   
3131 C CE1   . PHE A 380 ? 0.4946 0.3410 0.2696 -0.0303 -0.0837 0.0835  382 PHE A CE1   
3132 C CE2   . PHE A 380 ? 0.6199 0.3812 0.2595 -0.0339 -0.0770 0.0807  382 PHE A CE2   
3133 C CZ    . PHE A 380 ? 0.5644 0.3597 0.2682 -0.0360 -0.0957 0.0831  382 PHE A CZ    
3134 N N     . THR A 381 ? 0.3755 0.3267 0.2534 -0.0048 0.0013  0.0757  383 THR A N     
3135 C CA    . THR A 381 ? 0.3385 0.3124 0.2598 -0.0045 -0.0002 0.0732  383 THR A CA    
3136 C C     . THR A 381 ? 0.3310 0.3107 0.2804 -0.0090 -0.0098 0.0815  383 THR A C     
3137 O O     . THR A 381 ? 0.3069 0.2969 0.2884 -0.0085 -0.0067 0.0801  383 THR A O     
3138 C CB    . THR A 381 ? 0.3192 0.3077 0.2579 0.0000  0.0141  0.0691  383 THR A CB    
3139 O OG1   . THR A 381 ? 0.3162 0.3086 0.2586 0.0007  0.0213  0.0760  383 THR A OG1   
3140 C CG2   . THR A 381 ? 0.3244 0.3099 0.2508 0.0043  0.0214  0.0622  383 THR A CG2   
3141 N N     . THR A 382 ? 0.2138 0.3346 0.2540 -0.0073 -0.0327 0.0380  384 THR A N     
3142 C CA    . THR A 382 ? 0.2112 0.3187 0.2517 -0.0177 -0.0324 0.0353  384 THR A CA    
3143 C C     . THR A 382 ? 0.2011 0.2949 0.2420 -0.0176 -0.0261 0.0350  384 THR A C     
3144 O O     . THR A 382 ? 0.1919 0.2899 0.2354 -0.0123 -0.0230 0.0365  384 THR A O     
3145 C CB    . THR A 382 ? 0.2055 0.3260 0.2556 -0.0292 -0.0375 0.0348  384 THR A CB    
3146 O OG1   . THR A 382 ? 0.2136 0.3452 0.2735 -0.0312 -0.0349 0.0375  384 THR A OG1   
3147 C CG2   . THR A 382 ? 0.2171 0.3566 0.2694 -0.0304 -0.0446 0.0350  384 THR A CG2   
3148 N N     . PRO A 383 ? 0.2058 0.2838 0.2433 -0.0225 -0.0246 0.0325  385 PRO A N     
3149 C CA    . PRO A 383 ? 0.2029 0.2712 0.2419 -0.0229 -0.0195 0.0320  385 PRO A CA    
3150 C C     . PRO A 383 ? 0.1968 0.2758 0.2452 -0.0264 -0.0195 0.0332  385 PRO A C     
3151 O O     . PRO A 383 ? 0.1925 0.2699 0.2420 -0.0232 -0.0158 0.0334  385 PRO A O     
3152 C CB    . PRO A 383 ? 0.2033 0.2583 0.2384 -0.0271 -0.0189 0.0292  385 PRO A CB    
3153 C CG    . PRO A 383 ? 0.2149 0.2724 0.2475 -0.0308 -0.0246 0.0278  385 PRO A CG    
3154 C CD    . PRO A 383 ? 0.2105 0.2802 0.2424 -0.0269 -0.0276 0.0297  385 PRO A CD    
3155 N N     . GLU A 384 ? 0.1994 0.2889 0.2534 -0.0332 -0.0237 0.0343  386 GLU A N     
3156 C CA    . GLU A 384 ? 0.1978 0.2993 0.2602 -0.0374 -0.0233 0.0370  386 GLU A CA    
3157 C C     . GLU A 384 ? 0.1962 0.3155 0.2627 -0.0305 -0.0214 0.0394  386 GLU A C     
3158 O O     . GLU A 384 ? 0.1947 0.3176 0.2636 -0.0285 -0.0180 0.0403  386 GLU A O     
3159 C CB    . GLU A 384 ? 0.1970 0.3047 0.2638 -0.0482 -0.0283 0.0384  386 GLU A CB    
3160 C CG    . GLU A 384 ? 0.2183 0.3062 0.2795 -0.0538 -0.0304 0.0357  386 GLU A CG    
3161 C CD    . GLU A 384 ? 0.2396 0.3206 0.2940 -0.0544 -0.0348 0.0321  386 GLU A CD    
3162 O OE1   . GLU A 384 ? 0.1960 0.2817 0.2472 -0.0477 -0.0346 0.0313  386 GLU A OE1   
3163 O OE2   . GLU A 384 ? 0.2775 0.3467 0.3281 -0.0610 -0.0387 0.0300  386 GLU A OE2   
3164 N N     . GLU A 385 ? 0.2056 0.3370 0.2723 -0.0258 -0.0238 0.0402  387 GLU A N     
3165 C CA    . GLU A 385 ? 0.2090 0.3570 0.2780 -0.0160 -0.0219 0.0420  387 GLU A CA    
3166 C C     . GLU A 385 ? 0.2066 0.3383 0.2675 -0.0062 -0.0171 0.0399  387 GLU A C     
3167 O O     . GLU A 385 ? 0.2049 0.3440 0.2669 0.0002  -0.0142 0.0402  387 GLU A O     
3168 C CB    . GLU A 385 ? 0.2173 0.3783 0.2857 -0.0105 -0.0258 0.0428  387 GLU A CB    
3169 C CG    . GLU A 385 ? 0.2214 0.4068 0.3002 -0.0194 -0.0312 0.0450  387 GLU A CG    
3170 C CD    . GLU A 385 ? 0.2444 0.4423 0.3218 -0.0142 -0.0362 0.0450  387 GLU A CD    
3171 O OE1   . GLU A 385 ? 0.2363 0.4236 0.3036 -0.0021 -0.0351 0.0442  387 GLU A OE1   
3172 O OE2   . GLU A 385 ? 0.2877 0.5062 0.3737 -0.0229 -0.0417 0.0460  387 GLU A OE2   
3173 N N     . GLY A 386 ? 0.2018 0.3115 0.2541 -0.0054 -0.0163 0.0378  388 GLY A N     
3174 C CA    . GLY A 386 ? 0.1993 0.2904 0.2435 0.0007  -0.0122 0.0358  388 GLY A CA    
3175 C C     . GLY A 386 ? 0.1892 0.2764 0.2362 -0.0028 -0.0095 0.0340  388 GLY A C     
3176 O O     . GLY A 386 ? 0.1903 0.2751 0.2341 0.0038  -0.0072 0.0325  388 GLY A O     
3177 N N     . VAL A 387 ? 0.1786 0.2645 0.2302 -0.0122 -0.0102 0.0337  389 VAL A N     
3178 C CA    . VAL A 387 ? 0.1694 0.2523 0.2230 -0.0152 -0.0082 0.0323  389 VAL A CA    
3179 C C     . VAL A 387 ? 0.1681 0.2686 0.2263 -0.0129 -0.0076 0.0341  389 VAL A C     
3180 O O     . VAL A 387 ? 0.1557 0.2547 0.2120 -0.0098 -0.0055 0.0323  389 VAL A O     
3181 C CB    . VAL A 387 ? 0.1692 0.2459 0.2252 -0.0238 -0.0095 0.0319  389 VAL A CB    
3182 C CG1   . VAL A 387 ? 0.1591 0.2356 0.2172 -0.0258 -0.0082 0.0312  389 VAL A CG1   
3183 C CG2   . VAL A 387 ? 0.1523 0.2138 0.2032 -0.0242 -0.0086 0.0297  389 VAL A CG2   
3184 N N     . ARG A 388 ? 0.1698 0.2886 0.2340 -0.0146 -0.0096 0.0378  390 ARG A N     
3185 C CA    . ARG A 388 ? 0.1757 0.3156 0.2448 -0.0121 -0.0081 0.0405  390 ARG A CA    
3186 C C     . ARG A 388 ? 0.1822 0.3233 0.2456 0.0010  -0.0055 0.0380  390 ARG A C     
3187 O O     . ARG A 388 ? 0.1929 0.3397 0.2551 0.0050  -0.0029 0.0373  390 ARG A O     
3188 C CB    . ARG A 388 ? 0.1778 0.3401 0.2554 -0.0165 -0.0108 0.0450  390 ARG A CB    
3189 C CG    . ARG A 388 ? 0.1966 0.3846 0.2809 -0.0161 -0.0085 0.0491  390 ARG A CG    
3190 C CD    . ARG A 388 ? 0.2541 0.4692 0.3458 -0.0134 -0.0100 0.0521  390 ARG A CD    
3191 N NE    . ARG A 388 ? 0.2911 0.5155 0.3909 -0.0268 -0.0145 0.0555  390 ARG A NE    
3192 C CZ    . ARG A 388 ? 0.3077 0.5373 0.4094 -0.0275 -0.0191 0.0548  390 ARG A CZ    
3193 N NH1   . ARG A 388 ? 0.3211 0.5474 0.4169 -0.0147 -0.0195 0.0519  390 ARG A NH1   
3194 N NH2   . ARG A 388 ? 0.3002 0.5374 0.4086 -0.0412 -0.0239 0.0572  390 ARG A NH2   
3195 N N     . SER A 389 ? 0.1895 0.3240 0.2478 0.0084  -0.0063 0.0367  391 SER A N     
3196 C CA    . SER A 389 ? 0.2010 0.3304 0.2508 0.0221  -0.0044 0.0340  391 SER A CA    
3197 C C     . SER A 389 ? 0.2006 0.3068 0.2421 0.0224  -0.0024 0.0292  391 SER A C     
3198 O O     . SER A 389 ? 0.2066 0.3135 0.2435 0.0297  -0.0006 0.0264  391 SER A O     
3199 C CB    . SER A 389 ? 0.2103 0.3329 0.2542 0.0294  -0.0061 0.0345  391 SER A CB    
3200 O OG    . SER A 389 ? 0.2468 0.3565 0.2794 0.0427  -0.0044 0.0317  391 SER A OG    
3201 N N     . TYR A 390 ? 0.1954 0.2829 0.2353 0.0142  -0.0030 0.0280  392 TYR A N     
3202 C CA    . TYR A 390 ? 0.1945 0.2614 0.2281 0.0125  -0.0018 0.0235  392 TYR A CA    
3203 C C     . TYR A 390 ? 0.1885 0.2622 0.2249 0.0097  -0.0011 0.0215  392 TYR A C     
3204 O O     . TYR A 390 ? 0.1990 0.2654 0.2286 0.0149  -0.0004 0.0170  392 TYR A O     
3205 C CB    . TYR A 390 ? 0.1821 0.2337 0.2155 0.0039  -0.0021 0.0235  392 TYR A CB    
3206 C CG    . TYR A 390 ? 0.1867 0.2213 0.2159 0.0004  -0.0010 0.0191  392 TYR A CG    
3207 C CD1   . TYR A 390 ? 0.1952 0.2107 0.2141 0.0049  -0.0002 0.0164  392 TYR A CD1   
3208 C CD2   . TYR A 390 ? 0.1746 0.2123 0.2097 -0.0074 -0.0013 0.0177  392 TYR A CD2   
3209 C CE1   . TYR A 390 ? 0.1773 0.1781 0.1932 -0.0005 0.0001  0.0122  392 TYR A CE1   
3210 C CE2   . TYR A 390 ? 0.1807 0.2066 0.2134 -0.0113 -0.0010 0.0134  392 TYR A CE2   
3211 C CZ    . TYR A 390 ? 0.1850 0.1932 0.2086 -0.0087 -0.0004 0.0105  392 TYR A CZ    
3212 O OH    . TYR A 390 ? 0.1932 0.1903 0.2151 -0.0146 -0.0007 0.0061  392 TYR A OH    
3213 N N     . ALA A 391 ? 0.1731 0.2593 0.2180 0.0019  -0.0018 0.0247  393 ALA A N     
3214 C CA    . ALA A 391 ? 0.1709 0.2640 0.2176 -0.0006 -0.0014 0.0243  393 ALA A CA    
3215 C C     . ALA A 391 ? 0.1778 0.2872 0.2227 0.0075  0.0004  0.0246  393 ALA A C     
3216 O O     . ALA A 391 ? 0.1780 0.2879 0.2191 0.0093  0.0011  0.0220  393 ALA A O     
3217 C CB    . ALA A 391 ? 0.1553 0.2543 0.2094 -0.0104 -0.0027 0.0286  393 ALA A CB    
3218 N N     . SER A 392 ? 0.1736 0.2982 0.2210 0.0130  0.0011  0.0278  394 SER A N     
3219 C CA    . SER A 392 ? 0.1860 0.3299 0.2321 0.0223  0.0036  0.0283  394 SER A CA    
3220 C C     . SER A 392 ? 0.2094 0.3402 0.2431 0.0350  0.0045  0.0214  394 SER A C     
3221 O O     . SER A 392 ? 0.2146 0.3537 0.2433 0.0419  0.0064  0.0191  394 SER A O     
3222 C CB    . SER A 392 ? 0.1801 0.3479 0.2336 0.0252  0.0039  0.0336  394 SER A CB    
3223 O OG    . SER A 392 ? 0.1679 0.3475 0.2320 0.0125  0.0026  0.0397  394 SER A OG    
3224 N N     . THR A 393 ? 0.2327 0.3418 0.2598 0.0382  0.0031  0.0181  395 THR A N     
3225 C CA    . THR A 393 ? 0.2687 0.3593 0.2817 0.0497  0.0033  0.0114  395 THR A CA    
3226 C C     . THR A 393 ? 0.2774 0.3422 0.2835 0.0434  0.0018  0.0052  395 THR A C     
3227 O O     . THR A 393 ? 0.2979 0.3502 0.2925 0.0506  0.0015  -0.0014 395 THR A O     
3228 C CB    . THR A 393 ? 0.2821 0.3619 0.2889 0.0589  0.0027  0.0117  395 THR A CB    
3229 O OG1   . THR A 393 ? 0.3047 0.3708 0.3145 0.0491  0.0012  0.0143  395 THR A OG1   
3230 C CG2   . THR A 393 ? 0.2759 0.3845 0.2887 0.0682  0.0038  0.0164  395 THR A CG2   
3231 N N     . HIS A 394 ? 0.2689 0.3268 0.2816 0.0304  0.0006  0.0069  396 HIS A N     
3232 C CA    . HIS A 394 ? 0.2728 0.3105 0.2815 0.0230  -0.0009 0.0016  396 HIS A CA    
3233 C C     . HIS A 394 ? 0.2554 0.3040 0.2708 0.0150  -0.0018 0.0014  396 HIS A C     
3234 O O     . HIS A 394 ? 0.2547 0.2940 0.2725 0.0062  -0.0033 -0.0006 396 HIS A O     
3235 C CB    . HIS A 394 ? 0.2773 0.2987 0.2874 0.0153  -0.0013 0.0033  396 HIS A CB    
3236 C CG    . HIS A 394 ? 0.3069 0.3097 0.3067 0.0224  -0.0009 0.0029  396 HIS A CG    
3237 N ND1   . HIS A 394 ? 0.3479 0.3240 0.3391 0.0185  -0.0014 -0.0003 396 HIS A ND1   
3238 C CD2   . HIS A 394 ? 0.3179 0.3247 0.3140 0.0332  -0.0003 0.0059  396 HIS A CD2   
3239 C CE1   . HIS A 394 ? 0.3607 0.3221 0.3417 0.0271  -0.0010 0.0010  396 HIS A CE1   
3240 N NE2   . HIS A 394 ? 0.3532 0.3336 0.3370 0.0370  -0.0004 0.0046  396 HIS A NE2   
3241 N N     . TRP A 395 ? 0.2456 0.3148 0.2638 0.0184  -0.0008 0.0040  397 TRP A N     
3242 C CA    . TRP A 395 ? 0.2373 0.3160 0.2594 0.0125  -0.0017 0.0046  397 TRP A CA    
3243 C C     . TRP A 395 ? 0.2512 0.3165 0.2663 0.0111  -0.0043 -0.0035 397 TRP A C     
3244 O O     . TRP A 395 ? 0.2399 0.3053 0.2597 0.0034  -0.0062 -0.0039 397 TRP A O     
3245 C CB    . TRP A 395 ? 0.2327 0.3342 0.2555 0.0176  0.0005  0.0087  397 TRP A CB    
3246 C CG    . TRP A 395 ? 0.2442 0.3484 0.2564 0.0301  0.0019  0.0039  397 TRP A CG    
3247 C CD1   . TRP A 395 ? 0.2501 0.3605 0.2598 0.0401  0.0041  0.0046  397 TRP A CD1   
3248 C CD2   . TRP A 395 ? 0.2546 0.3552 0.2560 0.0354  0.0008  -0.0032 397 TRP A CD2   
3249 N NE1   . TRP A 395 ? 0.2731 0.3832 0.2706 0.0522  0.0049  -0.0016 397 TRP A NE1   
3250 C CE2   . TRP A 395 ? 0.2781 0.3814 0.2698 0.0492  0.0027  -0.0068 397 TRP A CE2   
3251 C CE3   . TRP A 395 ? 0.2694 0.3657 0.2679 0.0306  -0.0021 -0.0073 397 TRP A CE3   
3252 C CZ2   . TRP A 395 ? 0.2929 0.3926 0.2707 0.0583  0.0020  -0.0149 397 TRP A CZ2   
3253 C CZ3   . TRP A 395 ? 0.2818 0.3758 0.2673 0.0386  -0.0033 -0.0152 397 TRP A CZ3   
3254 C CH2   . TRP A 395 ? 0.2928 0.3874 0.2675 0.0522  -0.0012 -0.0192 397 TRP A CH2   
3255 N N     . HIS A 396 ? 0.2683 0.3221 0.2719 0.0189  -0.0047 -0.0102 398 HIS A N     
3256 C CA    . HIS A 396 ? 0.2893 0.3310 0.2845 0.0178  -0.0080 -0.0191 398 HIS A CA    
3257 C C     . HIS A 396 ? 0.2857 0.3115 0.2846 0.0061  -0.0107 -0.0219 398 HIS A C     
3258 O O     . HIS A 396 ? 0.2909 0.3134 0.2879 0.0013  -0.0141 -0.0279 398 HIS A O     
3259 C CB    . HIS A 396 ? 0.3140 0.3432 0.2936 0.0295  -0.0084 -0.0265 398 HIS A CB    
3260 C CG    . HIS A 396 ? 0.3651 0.3837 0.3344 0.0289  -0.0125 -0.0366 398 HIS A CG    
3261 N ND1   . HIS A 396 ? 0.4117 0.4048 0.3750 0.0224  -0.0162 -0.0438 398 HIS A ND1   
3262 C CD2   . HIS A 396 ? 0.3788 0.4092 0.3420 0.0336  -0.0139 -0.0406 398 HIS A CD2   
3263 C CE1   . HIS A 396 ? 0.4226 0.4123 0.3771 0.0225  -0.0204 -0.0526 398 HIS A CE1   
3264 N NE2   . HIS A 396 ? 0.3918 0.4041 0.3455 0.0300  -0.0191 -0.0510 398 HIS A NE2   
3265 N N     . THR A 397 ? 0.2734 0.2917 0.2779 0.0014  -0.0090 -0.0175 399 THR A N     
3266 C CA    . THR A 397 ? 0.2731 0.2799 0.2820 -0.0100 -0.0104 -0.0189 399 THR A CA    
3267 C C     . THR A 397 ? 0.2472 0.2695 0.2695 -0.0177 -0.0102 -0.0141 399 THR A C     
3268 O O     . THR A 397 ? 0.2443 0.2622 0.2721 -0.0264 -0.0105 -0.0143 399 THR A O     
3269 C CB    . THR A 397 ? 0.2862 0.2730 0.2907 -0.0108 -0.0085 -0.0172 399 THR A CB    
3270 O OG1   . THR A 397 ? 0.2992 0.2722 0.3046 -0.0219 -0.0098 -0.0201 399 THR A OG1   
3271 C CG2   . THR A 397 ? 0.2566 0.2525 0.2688 -0.0103 -0.0056 -0.0089 399 THR A CG2   
3272 N N     . LEU A 398 ? 0.2285 0.2684 0.2553 -0.0143 -0.0096 -0.0096 400 LEU A N     
3273 C CA    . LEU A 398 ? 0.2258 0.2765 0.2629 -0.0196 -0.0096 -0.0045 400 LEU A CA    
3274 C C     . LEU A 398 ? 0.2257 0.2873 0.2649 -0.0210 -0.0125 -0.0064 400 LEU A C     
3275 O O     . LEU A 398 ? 0.2299 0.3020 0.2739 -0.0210 -0.0126 -0.0014 400 LEU A O     
3276 C CB    . LEU A 398 ? 0.2098 0.2693 0.2502 -0.0168 -0.0074 0.0030  400 LEU A CB    
3277 C CG    . LEU A 398 ? 0.2143 0.2678 0.2530 -0.0141 -0.0052 0.0056  400 LEU A CG    
3278 C CD1   . LEU A 398 ? 0.2004 0.2664 0.2437 -0.0131 -0.0042 0.0125  400 LEU A CD1   
3279 C CD2   . LEU A 398 ? 0.2033 0.2438 0.2432 -0.0192 -0.0045 0.0050  400 LEU A CD2   
3280 N N     . GLY A 399 ? 0.2424 0.3001 0.2769 -0.0220 -0.0154 -0.0138 401 GLY A N     
3281 C CA    . GLY A 399 ? 0.2425 0.3117 0.2778 -0.0225 -0.0191 -0.0167 401 GLY A CA    
3282 C C     . GLY A 399 ? 0.2478 0.3228 0.2733 -0.0144 -0.0199 -0.0182 401 GLY A C     
3283 O O     . GLY A 399 ? 0.2486 0.3269 0.2712 -0.0085 -0.0166 -0.0134 401 GLY A O     
3284 N N     . LYS A 400 ? 0.2513 0.3299 0.2721 -0.0142 -0.0243 -0.0250 402 LYS A N     
3285 C CA    . LYS A 400 ? 0.2611 0.3456 0.2703 -0.0057 -0.0252 -0.0276 402 LYS A CA    
3286 C C     . LYS A 400 ? 0.2495 0.3488 0.2591 -0.0002 -0.0219 -0.0180 402 LYS A C     
3287 O O     . LYS A 400 ? 0.2533 0.3556 0.2570 0.0064  -0.0184 -0.0155 402 LYS A O     
3288 C CB    . LYS A 400 ? 0.2753 0.3637 0.2799 -0.0071 -0.0315 -0.0362 402 LYS A CB    
3289 C CG    . LYS A 400 ? 0.3022 0.4007 0.2942 0.0021  -0.0329 -0.0383 402 LYS A CG    
3290 C CD    . LYS A 400 ? 0.3669 0.4550 0.3452 0.0096  -0.0316 -0.0445 402 LYS A CD    
3291 C CE    . LYS A 400 ? 0.4179 0.5178 0.3827 0.0191  -0.0331 -0.0474 402 LYS A CE    
3292 N NZ    . LYS A 400 ? 0.4711 0.5668 0.4236 0.0300  -0.0291 -0.0495 402 LYS A NZ    
3293 N N     . ASN A 401 ? 0.2314 0.3397 0.2477 -0.0030 -0.0231 -0.0123 403 ASN A N     
3294 C CA    . ASN A 401 ? 0.2235 0.3432 0.2385 0.0008  -0.0207 -0.0027 403 ASN A CA    
3295 C C     . ASN A 401 ? 0.2092 0.3263 0.2316 -0.0024 -0.0165 0.0060  403 ASN A C     
3296 O O     . ASN A 401 ? 0.2060 0.3296 0.2264 0.0000  -0.0129 0.0126  403 ASN A O     
3297 C CB    . ASN A 401 ? 0.2211 0.3492 0.2363 0.0010  -0.0246 -0.0006 403 ASN A CB    
3298 C CG    . ASN A 401 ? 0.2284 0.3617 0.2358 0.0041  -0.0298 -0.0096 403 ASN A CG    
3299 O OD1   . ASN A 401 ? 0.2173 0.3568 0.2135 0.0105  -0.0295 -0.0105 403 ASN A OD1   
3300 N ND2   . ASN A 401 ? 0.1814 0.3138 0.1947 -0.0008 -0.0345 -0.0164 403 ASN A ND2   
3301 N N     . VAL A 402 ? 0.2043 0.3133 0.2354 -0.0081 -0.0171 0.0056  404 VAL A N     
3302 C CA    . VAL A 402 ? 0.1925 0.2971 0.2297 -0.0114 -0.0141 0.0119  404 VAL A CA    
3303 C C     . VAL A 402 ? 0.2009 0.3041 0.2358 -0.0090 -0.0107 0.0118  404 VAL A C     
3304 O O     . VAL A 402 ? 0.1905 0.2992 0.2272 -0.0090 -0.0081 0.0186  404 VAL A O     
3305 C CB    . VAL A 402 ? 0.1844 0.2808 0.2294 -0.0167 -0.0152 0.0100  404 VAL A CB    
3306 C CG1   . VAL A 402 ? 0.1671 0.2570 0.2164 -0.0196 -0.0124 0.0142  404 VAL A CG1   
3307 C CG2   . VAL A 402 ? 0.1715 0.2723 0.2191 -0.0167 -0.0179 0.0123  404 VAL A CG2   
3308 N N     . GLY A 403 ? 0.2185 0.3144 0.2491 -0.0067 -0.0111 0.0041  405 GLY A N     
3309 C CA    . GLY A 403 ? 0.2269 0.3204 0.2537 -0.0019 -0.0083 0.0033  405 GLY A CA    
3310 C C     . GLY A 403 ? 0.2368 0.3449 0.2582 0.0053  -0.0059 0.0065  405 GLY A C     
3311 O O     . GLY A 403 ? 0.2391 0.3542 0.2623 0.0082  -0.0027 0.0109  405 GLY A O     
3312 N N     . GLU A 404 ? 0.2497 0.3647 0.2647 0.0085  -0.0073 0.0044  406 GLU A N     
3313 C CA    . GLU A 404 ? 0.2664 0.3979 0.2753 0.0153  -0.0043 0.0082  406 GLU A CA    
3314 C C     . GLU A 404 ? 0.2455 0.3899 0.2614 0.0108  -0.0015 0.0201  406 GLU A C     
3315 O O     . GLU A 404 ? 0.2426 0.4015 0.2584 0.0141  0.0026  0.0253  406 GLU A O     
3316 C CB    . GLU A 404 ? 0.2804 0.4160 0.2793 0.0196  -0.0069 0.0035  406 GLU A CB    
3317 C CG    . GLU A 404 ? 0.3198 0.4435 0.3087 0.0248  -0.0098 -0.0092 406 GLU A CG    
3318 C CD    . GLU A 404 ? 0.3432 0.4698 0.3226 0.0272  -0.0141 -0.0153 406 GLU A CD    
3319 O OE1   . GLU A 404 ? 0.4126 0.5295 0.3816 0.0317  -0.0170 -0.0262 406 GLU A OE1   
3320 O OE2   . GLU A 404 ? 0.4045 0.5418 0.3857 0.0251  -0.0152 -0.0096 406 GLU A OE2   
3321 N N     . SER A 405 ? 0.2298 0.3690 0.2514 0.0033  -0.0037 0.0244  407 SER A N     
3322 C CA    . SER A 405 ? 0.2201 0.3660 0.2468 -0.0024 -0.0018 0.0355  407 SER A CA    
3323 C C     . SER A 405 ? 0.2097 0.3563 0.2444 -0.0062 0.0002  0.0386  407 SER A C     
3324 O O     . SER A 405 ? 0.1977 0.3573 0.2355 -0.0087 0.0030  0.0466  407 SER A O     
3325 C CB    . SER A 405 ? 0.2138 0.3503 0.2425 -0.0077 -0.0052 0.0383  407 SER A CB    
3326 O OG    . SER A 405 ? 0.2096 0.3472 0.2416 -0.0139 -0.0040 0.0485  407 SER A OG    
3327 N N     . ILE A 406 ? 0.1996 0.3332 0.2378 -0.0072 -0.0015 0.0328  408 ILE A N     
3328 C CA    . ILE A 406 ? 0.1954 0.3290 0.2397 -0.0093 -0.0003 0.0346  408 ILE A CA    
3329 C C     . ILE A 406 ? 0.1941 0.3429 0.2370 -0.0022 0.0030  0.0350  408 ILE A C     
3330 O O     . ILE A 406 ? 0.1811 0.3416 0.2302 -0.0045 0.0045  0.0406  408 ILE A O     
3331 C CB    . ILE A 406 ? 0.1926 0.3088 0.2385 -0.0106 -0.0024 0.0283  408 ILE A CB    
3332 C CG1   . ILE A 406 ? 0.1911 0.2978 0.2411 -0.0178 -0.0048 0.0302  408 ILE A CG1   
3333 C CG2   . ILE A 406 ? 0.1922 0.3085 0.2408 -0.0090 -0.0013 0.0285  408 ILE A CG2   
3334 C CD1   . ILE A 406 ? 0.1951 0.2878 0.2457 -0.0188 -0.0063 0.0239  408 ILE A CD1   
3335 N N     . ARG A 407 ? 0.2077 0.3572 0.2422 0.0068  0.0038  0.0288  409 ARG A N     
3336 C CA    . ARG A 407 ? 0.2236 0.3886 0.2542 0.0167  0.0072  0.0284  409 ARG A CA    
3337 C C     . ARG A 407 ? 0.2191 0.4093 0.2532 0.0150  0.0109  0.0380  409 ARG A C     
3338 O O     . ARG A 407 ? 0.2159 0.4245 0.2539 0.0188  0.0141  0.0414  409 ARG A O     
3339 C CB    . ARG A 407 ? 0.2354 0.3932 0.2534 0.0267  0.0067  0.0190  409 ARG A CB    
3340 C CG    . ARG A 407 ? 0.2676 0.4367 0.2787 0.0402  0.0099  0.0160  409 ARG A CG    
3341 C CD    . ARG A 407 ? 0.2920 0.4597 0.2887 0.0498  0.0097  0.0084  409 ARG A CD    
3342 N NE    . ARG A 407 ? 0.3713 0.5508 0.3670 0.0455  0.0101  0.0130  409 ARG A NE    
3343 C CZ    . ARG A 407 ? 0.4001 0.5684 0.3901 0.0425  0.0061  0.0083  409 ARG A CZ    
3344 N NH1   . ARG A 407 ? 0.4309 0.5769 0.4164 0.0419  0.0015  -0.0017 409 ARG A NH1   
3345 N NH2   . ARG A 407 ? 0.3864 0.5668 0.3748 0.0398  0.0066  0.0141  409 ARG A NH2   
3346 N N     . GLU A 408 ? 0.2161 0.4080 0.2487 0.0094  0.0106  0.0427  410 GLU A N     
3347 C CA    . GLU A 408 ? 0.2246 0.4380 0.2596 0.0056  0.0144  0.0535  410 GLU A CA    
3348 C C     . GLU A 408 ? 0.2059 0.4233 0.2524 -0.0064 0.0142  0.0622  410 GLU A C     
3349 O O     . GLU A 408 ? 0.1990 0.4383 0.2508 -0.0096 0.0178  0.0702  410 GLU A O     
3350 C CB    . GLU A 408 ? 0.2264 0.4362 0.2543 0.0032  0.0135  0.0568  410 GLU A CB    
3351 C CG    . GLU A 408 ? 0.2666 0.4737 0.2821 0.0135  0.0126  0.0485  410 GLU A CG    
3352 C CD    . GLU A 408 ? 0.2747 0.4766 0.2838 0.0109  0.0102  0.0515  410 GLU A CD    
3353 O OE1   . GLU A 408 ? 0.3342 0.5375 0.3322 0.0188  0.0092  0.0458  410 GLU A OE1   
3354 O OE2   . GLU A 408 ? 0.3131 0.5088 0.3270 0.0016  0.0090  0.0595  410 GLU A OE2   
3355 N N     . TYR A 409 ? 0.2029 0.3998 0.2530 -0.0136 0.0099  0.0606  411 TYR A N     
3356 C CA    . TYR A 409 ? 0.2038 0.4001 0.2626 -0.0254 0.0085  0.0676  411 TYR A CA    
3357 C C     . TYR A 409 ? 0.2008 0.3731 0.2610 -0.0293 0.0039  0.0627  411 TYR A C     
3358 O O     . TYR A 409 ? 0.1944 0.3506 0.2495 -0.0278 0.0017  0.0587  411 TYR A O     
3359 C CB    . TYR A 409 ? 0.2206 0.4206 0.2782 -0.0344 0.0095  0.0782  411 TYR A CB    
3360 C CG    . TYR A 409 ? 0.2326 0.4160 0.2938 -0.0467 0.0056  0.0825  411 TYR A CG    
3361 C CD1   . TYR A 409 ? 0.2533 0.4136 0.3084 -0.0480 0.0021  0.0815  411 TYR A CD1   
3362 C CD2   . TYR A 409 ? 0.2385 0.4294 0.3086 -0.0561 0.0048  0.0868  411 TYR A CD2   
3363 C CE1   . TYR A 409 ? 0.2574 0.3998 0.3134 -0.0571 -0.0017 0.0844  411 TYR A CE1   
3364 C CE2   . TYR A 409 ? 0.2608 0.4334 0.3320 -0.0671 0.0004  0.0893  411 TYR A CE2   
3365 C CZ    . TYR A 409 ? 0.2632 0.4101 0.3264 -0.0669 -0.0026 0.0880  411 TYR A CZ    
3366 O OH    . TYR A 409 ? 0.2651 0.3916 0.3271 -0.0757 -0.0070 0.0896  411 TYR A OH    
3367 N N     . PHE A 410 ? 0.1930 0.3654 0.2601 -0.0338 0.0024  0.0630  412 PHE A N     
3368 C CA    . PHE A 410 ? 0.1983 0.3503 0.2664 -0.0392 -0.0017 0.0605  412 PHE A CA    
3369 C C     . PHE A 410 ? 0.2051 0.3630 0.2805 -0.0477 -0.0035 0.0644  412 PHE A C     
3370 O O     . PHE A 410 ? 0.1950 0.3746 0.2761 -0.0479 -0.0017 0.0677  412 PHE A O     
3371 C CB    . PHE A 410 ? 0.1864 0.3246 0.2517 -0.0320 -0.0027 0.0513  412 PHE A CB    
3372 C CG    . PHE A 410 ? 0.1836 0.3272 0.2514 -0.0276 -0.0022 0.0483  412 PHE A CG    
3373 C CD1   . PHE A 410 ? 0.1947 0.3321 0.2658 -0.0319 -0.0048 0.0480  412 PHE A CD1   
3374 C CD2   . PHE A 410 ? 0.1795 0.3332 0.2447 -0.0177 0.0005  0.0454  412 PHE A CD2   
3375 C CE1   . PHE A 410 ? 0.1816 0.3240 0.2538 -0.0267 -0.0047 0.0458  412 PHE A CE1   
3376 C CE2   . PHE A 410 ? 0.1779 0.3349 0.2438 -0.0119 0.0006  0.0431  412 PHE A CE2   
3377 C CZ    . PHE A 410 ? 0.1838 0.3358 0.2535 -0.0163 -0.0020 0.0437  412 PHE A CZ    
3378 N N     . GLU A 411 ? 0.2139 0.3538 0.2887 -0.0543 -0.0074 0.0638  413 GLU A N     
3379 C CA    . GLU A 411 ? 0.2283 0.3704 0.3083 -0.0622 -0.0105 0.0654  413 GLU A CA    
3380 C C     . GLU A 411 ? 0.2290 0.3497 0.3054 -0.0617 -0.0140 0.0592  413 GLU A C     
3381 O O     . GLU A 411 ? 0.2363 0.3400 0.3072 -0.0584 -0.0142 0.0559  413 GLU A O     
3382 C CB    . GLU A 411 ? 0.2393 0.3839 0.3213 -0.0751 -0.0119 0.0737  413 GLU A CB    
3383 C CG    . GLU A 411 ? 0.2675 0.3883 0.3416 -0.0787 -0.0138 0.0754  413 GLU A CG    
3384 C CD    . GLU A 411 ? 0.3073 0.4267 0.3815 -0.0922 -0.0153 0.0845  413 GLU A CD    
3385 O OE1   . GLU A 411 ? 0.3176 0.4358 0.3954 -0.1024 -0.0191 0.0856  413 GLU A OE1   
3386 O OE2   . GLU A 411 ? 0.3127 0.4311 0.3823 -0.0928 -0.0130 0.0907  413 GLU A OE2   
3387 N N     . ILE A 412 ? 0.2249 0.3489 0.3045 -0.0642 -0.0166 0.0576  414 ILE A N     
3388 C CA    . ILE A 412 ? 0.2319 0.3369 0.3070 -0.0641 -0.0198 0.0523  414 ILE A CA    
3389 C C     . ILE A 412 ? 0.2492 0.3451 0.3234 -0.0753 -0.0248 0.0545  414 ILE A C     
3390 O O     . ILE A 412 ? 0.2550 0.3647 0.3348 -0.0836 -0.0269 0.0586  414 ILE A O     
3391 C CB    . ILE A 412 ? 0.2236 0.3339 0.2993 -0.0573 -0.0197 0.0481  414 ILE A CB    
3392 C CG1   . ILE A 412 ? 0.2185 0.3304 0.2923 -0.0467 -0.0153 0.0454  414 ILE A CG1   
3393 C CG2   . ILE A 412 ? 0.2207 0.3132 0.2907 -0.0575 -0.0227 0.0434  414 ILE A CG2   
3394 C CD1   . ILE A 412 ? 0.2390 0.3553 0.3118 -0.0391 -0.0147 0.0428  414 ILE A CD1   
3395 N N     . ILE A 413 ? 0.2620 0.3349 0.3288 -0.0756 -0.0268 0.0518  415 ILE A N     
3396 C CA    . ILE A 413 ? 0.2919 0.3497 0.3545 -0.0854 -0.0320 0.0530  415 ILE A CA    
3397 C C     . ILE A 413 ? 0.3019 0.3434 0.3577 -0.0827 -0.0355 0.0459  415 ILE A C     
3398 O O     . ILE A 413 ? 0.2807 0.3156 0.3330 -0.0735 -0.0330 0.0413  415 ILE A O     
3399 C CB    . ILE A 413 ? 0.3022 0.3435 0.3587 -0.0873 -0.0320 0.0568  415 ILE A CB    
3400 C CG1   . ILE A 413 ? 0.3144 0.3719 0.3755 -0.0888 -0.0279 0.0643  415 ILE A CG1   
3401 C CG2   . ILE A 413 ? 0.3345 0.3559 0.3845 -0.0978 -0.0378 0.0583  415 ILE A CG2   
3402 C CD1   . ILE A 413 ? 0.3255 0.3980 0.3929 -0.1014 -0.0290 0.0714  415 ILE A CD1   
3403 N N     . SER A 414 ? 0.3334 0.3697 0.3873 -0.0915 -0.0412 0.0450  416 SER A N     
3404 C CA    . SER A 414 ? 0.3659 0.3839 0.4104 -0.0895 -0.0453 0.0380  416 SER A CA    
3405 C C     . SER A 414 ? 0.4009 0.4004 0.4387 -0.1010 -0.0524 0.0378  416 SER A C     
3406 O O     . SER A 414 ? 0.4075 0.4064 0.4478 -0.1111 -0.0536 0.0441  416 SER A O     
3407 C CB    . SER A 414 ? 0.3545 0.3862 0.4013 -0.0857 -0.0458 0.0342  416 SER A CB    
3408 O OG    . SER A 414 ? 0.3722 0.4250 0.4279 -0.0936 -0.0483 0.0378  416 SER A OG    
3409 N N     . GLY A 415 ? 0.4300 0.4126 0.4577 -0.0993 -0.0569 0.0306  417 GLY A N     
3410 C CA    . GLY A 415 ? 0.4715 0.4348 0.4909 -0.1103 -0.0650 0.0285  417 GLY A CA    
3411 C C     . GLY A 415 ? 0.5050 0.4439 0.5171 -0.1159 -0.0668 0.0322  417 GLY A C     
3412 O O     . GLY A 415 ? 0.5062 0.4358 0.5147 -0.1066 -0.0624 0.0336  417 GLY A O     
3413 N N     . GLU A 416 ? 0.5376 0.4666 0.5473 -0.1316 -0.0736 0.0342  418 GLU A N     
3414 C CA    . GLU A 416 ? 0.5761 0.4772 0.5766 -0.1396 -0.0765 0.0387  418 GLU A CA    
3415 C C     . GLU A 416 ? 0.5635 0.4739 0.5704 -0.1372 -0.0695 0.0484  418 GLU A C     
3416 O O     . GLU A 416 ? 0.5826 0.4694 0.5793 -0.1331 -0.0690 0.0509  418 GLU A O     
3417 C CB    . GLU A 416 ? 0.6044 0.5004 0.6054 -0.1609 -0.0843 0.0414  418 GLU A CB    
3418 C CG    . GLU A 416 ? 0.6402 0.5452 0.6425 -0.1674 -0.0914 0.0336  418 GLU A CG    
3419 C CD    . GLU A 416 ? 0.6998 0.5712 0.6826 -0.1619 -0.0982 0.0219  418 GLU A CD    
3420 O OE1   . GLU A 416 ? 0.6952 0.5749 0.6772 -0.1632 -0.1034 0.0145  418 GLU A OE1   
3421 O OE2   . GLU A 416 ? 0.7363 0.5738 0.7036 -0.1550 -0.0986 0.0200  418 GLU A OE2   
3422 N N     . LYS A 417 ? 0.5382 0.4835 0.5609 -0.1388 -0.0644 0.0536  419 LYS A N     
3423 C CA    . LYS A 417 ? 0.5259 0.4849 0.5548 -0.1358 -0.0576 0.0620  419 LYS A CA    
3424 C C     . LYS A 417 ? 0.5111 0.4626 0.5348 -0.1180 -0.0529 0.0587  419 LYS A C     
3425 O O     . LYS A 417 ? 0.5177 0.4616 0.5375 -0.1150 -0.0503 0.0641  419 LYS A O     
3426 C CB    . LYS A 417 ? 0.5033 0.5017 0.5488 -0.1386 -0.0535 0.0660  419 LYS A CB    
3427 C CG    . LYS A 417 ? 0.5263 0.5401 0.5784 -0.1465 -0.0493 0.0774  419 LYS A CG    
3428 C CD    . LYS A 417 ? 0.5397 0.5817 0.6049 -0.1614 -0.0507 0.0825  419 LYS A CD    
3429 C CE    . LYS A 417 ? 0.5750 0.6012 0.6364 -0.1817 -0.0560 0.0891  419 LYS A CE    
3430 N NZ    . LYS A 417 ? 0.6029 0.5953 0.6522 -0.1871 -0.0648 0.0816  419 LYS A NZ    
3431 N N     . LEU A 418 ? 0.4929 0.4473 0.5162 -0.1069 -0.0520 0.0501  420 LEU A N     
3432 C CA    . LEU A 418 ? 0.4777 0.4301 0.4984 -0.0914 -0.0474 0.0467  420 LEU A CA    
3433 C C     . LEU A 418 ? 0.4952 0.4176 0.5020 -0.0850 -0.0500 0.0442  420 LEU A C     
3434 O O     . LEU A 418 ? 0.4922 0.4125 0.4971 -0.0760 -0.0469 0.0459  420 LEU A O     
3435 C CB    . LEU A 418 ? 0.4598 0.4250 0.4844 -0.0829 -0.0451 0.0396  420 LEU A CB    
3436 C CG    . LEU A 418 ? 0.4495 0.4136 0.4721 -0.0688 -0.0408 0.0351  420 LEU A CG    
3437 C CD1   . LEU A 418 ? 0.4342 0.4124 0.4637 -0.0648 -0.0358 0.0395  420 LEU A CD1   
3438 C CD2   . LEU A 418 ? 0.4390 0.4122 0.4633 -0.0637 -0.0392 0.0291  420 LEU A CD2   
3439 N N     . PHE A 419 ? 0.5165 0.4162 0.5127 -0.0887 -0.0560 0.0395  421 PHE A N     
3440 C CA    . PHE A 419 ? 0.5441 0.4128 0.5246 -0.0808 -0.0591 0.0357  421 PHE A CA    
3441 C C     . PHE A 419 ? 0.5645 0.4141 0.5378 -0.0847 -0.0606 0.0440  421 PHE A C     
3442 O O     . PHE A 419 ? 0.5850 0.4105 0.5454 -0.0749 -0.0621 0.0425  421 PHE A O     
3443 C CB    . PHE A 419 ? 0.5667 0.4143 0.5355 -0.0833 -0.0657 0.0276  421 PHE A CB    
3444 C CG    . PHE A 419 ? 0.5578 0.4241 0.5319 -0.0796 -0.0644 0.0205  421 PHE A CG    
3445 C CD1   . PHE A 419 ? 0.5736 0.4427 0.5482 -0.0905 -0.0696 0.0177  421 PHE A CD1   
3446 C CD2   . PHE A 419 ? 0.5388 0.4203 0.5172 -0.0657 -0.0581 0.0171  421 PHE A CD2   
3447 C CE1   . PHE A 419 ? 0.5665 0.4523 0.5443 -0.0860 -0.0685 0.0120  421 PHE A CE1   
3448 C CE2   . PHE A 419 ? 0.5314 0.4280 0.5129 -0.0625 -0.0565 0.0120  421 PHE A CE2   
3449 C CZ    . PHE A 419 ? 0.5322 0.4306 0.5127 -0.0718 -0.0616 0.0095  421 PHE A CZ    
3450 N N     . LYS A 420 ? 0.5599 0.4218 0.5412 -0.0980 -0.0597 0.0532  422 LYS A N     
3451 C CA    . LYS A 420 ? 0.5762 0.4247 0.5518 -0.1031 -0.0598 0.0633  422 LYS A CA    
3452 C C     . LYS A 420 ? 0.5525 0.4187 0.5334 -0.0924 -0.0534 0.0682  422 LYS A C     
3453 O O     . LYS A 420 ? 0.5646 0.4182 0.5379 -0.0922 -0.0533 0.0761  422 LYS A O     
3454 C CB    . LYS A 420 ? 0.5842 0.4393 0.5656 -0.1237 -0.0615 0.0717  422 LYS A CB    
3455 C CG    . LYS A 420 ? 0.6284 0.4542 0.5991 -0.1373 -0.0698 0.0697  422 LYS A CG    
3456 C CD    . LYS A 420 ? 0.6317 0.4706 0.6114 -0.1596 -0.0712 0.0784  422 LYS A CD    
3457 C CE    . LYS A 420 ? 0.6852 0.4894 0.6521 -0.1756 -0.0802 0.0777  422 LYS A CE    
3458 N NZ    . LYS A 420 ? 0.7284 0.4989 0.6805 -0.1812 -0.0816 0.0875  422 LYS A NZ    
3459 N N     . GLU A 421 ? 0.5133 0.4072 0.5058 -0.0840 -0.0486 0.0636  423 GLU A N     
3460 C CA    . GLU A 421 ? 0.4933 0.4039 0.4904 -0.0736 -0.0435 0.0659  423 GLU A CA    
3461 C C     . GLU A 421 ? 0.4966 0.3920 0.4846 -0.0580 -0.0444 0.0611  423 GLU A C     
3462 O O     . GLU A 421 ? 0.5088 0.3876 0.4898 -0.0531 -0.0473 0.0540  423 GLU A O     
3463 C CB    . GLU A 421 ? 0.4615 0.4040 0.4730 -0.0711 -0.0387 0.0622  423 GLU A CB    
3464 C CG    . GLU A 421 ? 0.4587 0.4211 0.4802 -0.0832 -0.0374 0.0664  423 GLU A CG    
3465 C CD    . GLU A 421 ? 0.4671 0.4411 0.4908 -0.0889 -0.0346 0.0766  423 GLU A CD    
3466 O OE1   . GLU A 421 ? 0.4596 0.4329 0.4793 -0.0816 -0.0325 0.0798  423 GLU A OE1   
3467 O OE2   . GLU A 421 ? 0.4905 0.4769 0.5204 -0.1008 -0.0344 0.0818  423 GLU A OE2   
3468 N N     . PRO A 422 ? 0.4881 0.3909 0.4759 -0.0495 -0.0419 0.0647  424 PRO A N     
3469 C CA    . PRO A 422 ? 0.4914 0.3849 0.4721 -0.0338 -0.0429 0.0607  424 PRO A CA    
3470 C C     . PRO A 422 ? 0.4634 0.3761 0.4533 -0.0245 -0.0400 0.0512  424 PRO A C     
3471 O O     . PRO A 422 ? 0.4534 0.3800 0.4471 -0.0145 -0.0381 0.0498  424 PRO A O     
3472 C CB    . PRO A 422 ? 0.4912 0.3913 0.4701 -0.0297 -0.0416 0.0684  424 PRO A CB    
3473 C CG    . PRO A 422 ? 0.4735 0.3991 0.4640 -0.0393 -0.0376 0.0722  424 PRO A CG    
3474 C CD    . PRO A 422 ? 0.4780 0.3996 0.4714 -0.0533 -0.0385 0.0727  424 PRO A CD    
3475 N N     . VAL A 423 ? 0.4542 0.3676 0.4472 -0.0282 -0.0400 0.0451  425 VAL A N     
3476 C CA    . VAL A 423 ? 0.4279 0.3596 0.4295 -0.0221 -0.0365 0.0376  425 VAL A CA    
3477 C C     . VAL A 423 ? 0.4411 0.3597 0.4356 -0.0157 -0.0380 0.0301  425 VAL A C     
3478 O O     . VAL A 423 ? 0.4272 0.3596 0.4276 -0.0130 -0.0349 0.0246  425 VAL A O     
3479 C CB    . VAL A 423 ? 0.4081 0.3600 0.4213 -0.0311 -0.0335 0.0376  425 VAL A CB    
3480 C CG1   . VAL A 423 ? 0.3905 0.3600 0.4110 -0.0336 -0.0308 0.0429  425 VAL A CG1   
3481 C CG2   . VAL A 423 ? 0.4000 0.3423 0.4106 -0.0424 -0.0365 0.0386  425 VAL A CG2   
3482 N N     . THR A 424 ? 0.4696 0.3604 0.4497 -0.0130 -0.0427 0.0299  426 THR A N     
3483 C CA    . THR A 424 ? 0.4849 0.3596 0.4551 -0.0074 -0.0449 0.0221  426 THR A CA    
3484 C C     . THR A 424 ? 0.4791 0.3642 0.4499 0.0087  -0.0417 0.0161  426 THR A C     
3485 O O     . THR A 424 ? 0.4823 0.3714 0.4521 0.0124  -0.0401 0.0095  426 THR A O     
3486 C CB    . THR A 424 ? 0.5223 0.3600 0.4744 -0.0084 -0.0515 0.0228  426 THR A CB    
3487 O OG1   . THR A 424 ? 0.5403 0.3669 0.4856 0.0001  -0.0526 0.0277  426 THR A OG1   
3488 C CG2   . THR A 424 ? 0.5187 0.3473 0.4707 -0.0270 -0.0550 0.0277  426 THR A CG2   
3489 N N     . ALA A 425 ? 0.4703 0.3622 0.4429 0.0180  -0.0407 0.0187  427 ALA A N     
3490 C CA    . ALA A 425 ? 0.4572 0.3656 0.4335 0.0327  -0.0375 0.0138  427 ALA A CA    
3491 C C     . ALA A 425 ? 0.4240 0.3626 0.4158 0.0287  -0.0317 0.0110  427 ALA A C     
3492 O O     . ALA A 425 ? 0.4177 0.3652 0.4102 0.0355  -0.0287 0.0054  427 ALA A O     
3493 C CB    . ALA A 425 ? 0.4601 0.3745 0.4373 0.0419  -0.0383 0.0179  427 ALA A CB    
3494 N N     . GLU A 426 ? 0.3991 0.3522 0.4019 0.0180  -0.0300 0.0153  428 GLU A N     
3495 C CA    . GLU A 426 ? 0.3685 0.3458 0.3845 0.0129  -0.0250 0.0137  428 GLU A CA    
3496 C C     . GLU A 426 ? 0.3607 0.3339 0.3742 0.0081  -0.0238 0.0103  428 GLU A C     
3497 O O     . GLU A 426 ? 0.3453 0.3329 0.3639 0.0101  -0.0194 0.0070  428 GLU A O     
3498 C CB    . GLU A 426 ? 0.3539 0.3426 0.3788 0.0035  -0.0243 0.0185  428 GLU A CB    
3499 C CG    . GLU A 426 ? 0.3584 0.3585 0.3876 0.0080  -0.0248 0.0211  428 GLU A CG    
3500 C CD    . GLU A 426 ? 0.3987 0.3811 0.4171 0.0134  -0.0292 0.0253  428 GLU A CD    
3501 O OE1   . GLU A 426 ? 0.4104 0.3706 0.4191 0.0087  -0.0321 0.0284  428 GLU A OE1   
3502 O OE2   . GLU A 426 ? 0.4068 0.3975 0.4260 0.0222  -0.0301 0.0259  428 GLU A OE2   
3503 N N     . LEU A 427 ? 0.3682 0.3226 0.3738 0.0012  -0.0277 0.0115  429 LEU A N     
3504 C CA    . LEU A 427 ? 0.3702 0.3204 0.3720 -0.0032 -0.0279 0.0081  429 LEU A CA    
3505 C C     . LEU A 427 ? 0.3839 0.3284 0.3766 0.0074  -0.0271 0.0014  429 LEU A C     
3506 O O     . LEU A 427 ? 0.3717 0.3268 0.3660 0.0078  -0.0235 -0.0014 429 LEU A O     
3507 C CB    . LEU A 427 ? 0.3780 0.3110 0.3736 -0.0135 -0.0334 0.0103  429 LEU A CB    
3508 C CG    . LEU A 427 ? 0.3688 0.3132 0.3743 -0.0250 -0.0332 0.0164  429 LEU A CG    
3509 C CD1   . LEU A 427 ? 0.3685 0.2985 0.3687 -0.0358 -0.0387 0.0189  429 LEU A CD1   
3510 C CD2   . LEU A 427 ? 0.3307 0.2957 0.3458 -0.0272 -0.0287 0.0159  429 LEU A CD2   
3511 N N     . CYS A 428 ? 0.4068 0.3348 0.3890 0.0169  -0.0301 -0.0007 430 CYS A N     
3512 C CA    . CYS A 428 ? 0.4321 0.3550 0.4041 0.0299  -0.0292 -0.0076 430 CYS A CA    
3513 C C     . CYS A 428 ? 0.4171 0.3688 0.3997 0.0371  -0.0218 -0.0090 430 CYS A C     
3514 O O     . CYS A 428 ? 0.4192 0.3775 0.3987 0.0413  -0.0184 -0.0132 430 CYS A O     
3515 C CB    . CYS A 428 ? 0.4598 0.3593 0.4182 0.0409  -0.0338 -0.0092 430 CYS A CB    
3516 S SG    . CYS A 428 ? 0.5152 0.3754 0.4571 0.0319  -0.0427 -0.0088 430 CYS A SG    
3517 N N     . GLU A 429 ? 0.4044 0.3738 0.3994 0.0378  -0.0196 -0.0053 431 GLU A N     
3518 C CA    . GLU A 429 ? 0.3975 0.3964 0.4050 0.0418  -0.0132 -0.0059 431 GLU A CA    
3519 C C     . GLU A 429 ? 0.3782 0.3907 0.3936 0.0311  -0.0085 -0.0048 431 GLU A C     
3520 O O     . GLU A 429 ? 0.3696 0.3975 0.3876 0.0342  -0.0030 -0.0068 431 GLU A O     
3521 C CB    . GLU A 429 ? 0.3912 0.4043 0.4096 0.0423  -0.0136 -0.0023 431 GLU A CB    
3522 C CG    . GLU A 429 ? 0.4179 0.4631 0.4518 0.0420  -0.0079 -0.0025 431 GLU A CG    
3523 C CD    . GLU A 429 ? 0.4776 0.5385 0.5117 0.0557  -0.0043 -0.0066 431 GLU A CD    
3524 O OE1   . GLU A 429 ? 0.4979 0.5437 0.5192 0.0687  -0.0070 -0.0097 431 GLU A OE1   
3525 O OE2   . GLU A 429 ? 0.4830 0.5713 0.5298 0.0532  0.0012  -0.0067 431 GLU A OE2   
3526 N N     . MET A 430 ? 0.3602 0.3665 0.3782 0.0193  -0.0106 -0.0012 432 MET A N     
3527 C CA    . MET A 430 ? 0.3518 0.3662 0.3748 0.0101  -0.0073 0.0004  432 MET A CA    
3528 C C     . MET A 430 ? 0.3464 0.3552 0.3597 0.0120  -0.0059 -0.0028 432 MET A C     
3529 O O     . MET A 430 ? 0.3327 0.3530 0.3491 0.0090  -0.0010 -0.0018 432 MET A O     
3530 C CB    . MET A 430 ? 0.3445 0.3509 0.3693 0.0002  -0.0110 0.0042  432 MET A CB    
3531 C CG    . MET A 430 ? 0.3402 0.3591 0.3743 -0.0078 -0.0078 0.0072  432 MET A CG    
3532 S SD    . MET A 430 ? 0.3613 0.3719 0.3957 -0.0164 -0.0124 0.0113  432 MET A SD    
3533 C CE    . MET A 430 ? 0.3694 0.3704 0.3952 -0.0194 -0.0145 0.0100  432 MET A CE    
3534 N N     . MET A 431 ? 0.3532 0.3427 0.3531 0.0167  -0.0106 -0.0064 433 MET A N     
3535 C CA    . MET A 431 ? 0.3578 0.3394 0.3458 0.0186  -0.0109 -0.0103 433 MET A CA    
3536 C C     . MET A 431 ? 0.3701 0.3528 0.3489 0.0322  -0.0082 -0.0159 433 MET A C     
3537 O O     . MET A 431 ? 0.3751 0.3516 0.3418 0.0360  -0.0082 -0.0201 433 MET A O     
3538 C CB    . MET A 431 ? 0.3719 0.3305 0.3498 0.0131  -0.0189 -0.0117 433 MET A CB    
3539 C CG    . MET A 431 ? 0.3557 0.3161 0.3426 0.0005  -0.0214 -0.0060 433 MET A CG    
3540 S SD    . MET A 431 ? 0.3720 0.3121 0.3494 -0.0084 -0.0304 -0.0072 433 MET A SD    
3541 C CE    . MET A 431 ? 0.4053 0.3189 0.3705 -0.0031 -0.0361 -0.0104 433 MET A CE    
3542 N N     . GLY A 432 ? 0.3703 0.3625 0.3545 0.0406  -0.0060 -0.0161 434 GLY A N     
3543 C CA    . GLY A 432 ? 0.3935 0.3906 0.3702 0.0558  -0.0029 -0.0213 434 GLY A CA    
3544 C C     . GLY A 432 ? 0.4292 0.3975 0.3857 0.0649  -0.0093 -0.0278 434 GLY A C     
3545 O O     . GLY A 432 ? 0.4407 0.4079 0.3852 0.0762  -0.0073 -0.0336 434 GLY A O     
3546 N N     . VAL A 433 ? 0.4444 0.3888 0.3963 0.0597  -0.0169 -0.0267 435 VAL A N     
3547 C CA    . VAL A 433 ? 0.4920 0.4037 0.4239 0.0662  -0.0242 -0.0325 435 VAL A CA    
3548 C C     . VAL A 433 ? 0.5232 0.4328 0.4481 0.0852  -0.0233 -0.0364 435 VAL A C     
3549 O O     . VAL A 433 ? 0.5156 0.4376 0.4510 0.0890  -0.0217 -0.0323 435 VAL A O     
3550 C CB    . VAL A 433 ? 0.4943 0.3823 0.4245 0.0540  -0.0320 -0.0285 435 VAL A CB    
3551 C CG1   . VAL A 433 ? 0.5227 0.3735 0.4311 0.0588  -0.0400 -0.0344 435 VAL A CG1   
3552 C CG2   . VAL A 433 ? 0.4739 0.3683 0.4124 0.0367  -0.0328 -0.0247 435 VAL A CG2   
3553 N N     . LYS A 434 ? 0.5706 0.4658 0.4770 0.0982  -0.0244 -0.0446 436 LYS A N     
3554 C CA    . LYS A 434 ? 0.6085 0.5023 0.5063 0.1194  -0.0233 -0.0491 436 LYS A CA    
3555 C C     . LYS A 434 ? 0.6613 0.5109 0.5346 0.1276  -0.0324 -0.0551 436 LYS A C     
3556 O O     . LYS A 434 ? 0.6761 0.4974 0.5400 0.1148  -0.0395 -0.0557 436 LYS A O     
3557 C CB    . LYS A 434 ? 0.6093 0.5301 0.5069 0.1321  -0.0149 -0.0537 436 LYS A CB    
3558 C CG    . LYS A 434 ? 0.6181 0.5307 0.5016 0.1304  -0.0148 -0.0596 436 LYS A CG    
3559 C CD    . LYS A 434 ? 0.6252 0.5677 0.5088 0.1443  -0.0053 -0.0627 436 LYS A CD    
3560 C CE    . LYS A 434 ? 0.6452 0.5841 0.5151 0.1427  -0.0041 -0.0674 436 LYS A CE    
3561 N NZ    . LYS A 434 ? 0.6489 0.6206 0.5200 0.1554  0.0066  -0.0688 436 LYS A NZ    
3562 N N     . ASP A 435 ? 0.6984 0.5424 0.5613 0.1489  -0.0322 -0.0595 437 ASP A N     
3563 C CA    . ASP A 435 ? 0.7543 0.5527 0.5911 0.1603  -0.0408 -0.0654 437 ASP A CA    
3564 C C     . ASP A 435 ? 0.7626 0.5512 0.6021 0.1651  -0.0440 -0.0591 437 ASP A C     
3565 O O     . ASP A 435 ? 0.7332 0.5472 0.5940 0.1559  -0.0409 -0.0504 437 ASP A O     
3566 C CB    . ASP A 435 ? 0.7758 0.5361 0.5978 0.1441  -0.0495 -0.0681 437 ASP A CB    
3567 C CG    . ASP A 435 ? 0.8388 0.5547 0.6296 0.1577  -0.0570 -0.0787 437 ASP A CG    
3568 O OD1   . ASP A 435 ? 0.8804 0.5996 0.6586 0.1709  -0.0546 -0.0882 437 ASP A OD1   
3569 O OD2   . ASP A 435 ? 0.8862 0.5622 0.6635 0.1549  -0.0654 -0.0776 437 ASP A OD2   
3570 O OXT   . ASP A 435 ? 0.8048 0.5586 0.6237 0.1787  -0.0500 -0.0626 437 ASP A OXT   
3571 O OP3   . G   B 1   ? 0.6461 1.0363 0.5928 0.2179  -0.0066 0.1651  1   G   C OP3   
3572 P P     . G   B 1   ? 0.6595 0.9750 0.5901 0.2023  -0.0243 0.1173  1   G   C P     
3573 O OP1   . G   B 1   ? 0.6674 0.9704 0.5830 0.2049  -0.0335 0.1039  1   G   C OP1   
3574 O OP2   . G   B 1   ? 0.6832 0.9941 0.5912 0.2349  -0.0360 0.0910  1   G   C OP2   
3575 O "O5'" . G   B 1   ? 0.5553 0.8183 0.5170 0.1479  -0.0198 0.1183  1   G   C "O5'" 
3576 C "C5'" . G   B 1   ? 0.4300 0.6334 0.3916 0.1190  -0.0282 0.0931  1   G   C "C5'" 
3577 C "C4'" . G   B 1   ? 0.3303 0.5026 0.3166 0.0802  -0.0219 0.1003  1   G   C "C4'" 
3578 O "O4'" . G   B 1   ? 0.2975 0.4624 0.2892 0.0806  -0.0202 0.0953  1   G   C "O4'" 
3579 C "C3'" . G   B 1   ? 0.2988 0.4203 0.2823 0.0564  -0.0272 0.0792  1   G   C "C3'" 
3580 O "O3'" . G   B 1   ? 0.2638 0.3840 0.2516 0.0418  -0.0261 0.0902  1   G   C "O3'" 
3581 C "C2'" . G   B 1   ? 0.2663 0.3606 0.2624 0.0364  -0.0239 0.0753  1   G   C "C2'" 
3582 O "O2'" . G   B 1   ? 0.2611 0.3521 0.2746 0.0164  -0.0208 0.0923  1   G   C "O2'" 
3583 C "C1'" . G   B 1   ? 0.2413 0.3582 0.2367 0.0571  -0.0230 0.0762  1   G   C "C1'" 
3584 N N9    . G   B 1   ? 0.2358 0.3351 0.2216 0.0704  -0.0327 0.0509  1   G   C N9    
3585 C C8    . G   B 1   ? 0.2516 0.3657 0.2218 0.1028  -0.0448 0.0376  1   G   C C8    
3586 N N7    . G   B 1   ? 0.2604 0.3475 0.2334 0.1065  -0.0588 0.0150  1   G   C N7    
3587 C C5    . G   B 1   ? 0.2465 0.3059 0.2379 0.0747  -0.0507 0.0174  1   G   C C5    
3588 C C6    . G   B 1   ? 0.2529 0.2845 0.2613 0.0635  -0.0575 0.0055  1   G   C C6    
3589 O O6    . G   B 1   ? 0.2498 0.2694 0.2665 0.0760  -0.0765 -0.0108 1   G   C O6    
3590 N N1    . G   B 1   ? 0.2286 0.2480 0.2476 0.0376  -0.0429 0.0153  1   G   C N1    
3591 C C2    . G   B 1   ? 0.2336 0.2581 0.2465 0.0248  -0.0296 0.0293  1   G   C C2    
3592 N N2    . G   B 1   ? 0.2052 0.2147 0.2233 0.0080  -0.0215 0.0321  1   G   C N2    
3593 N N3    . G   B 1   ? 0.2174 0.2624 0.2218 0.0307  -0.0273 0.0406  1   G   C N3    
3594 C C4    . G   B 1   ? 0.2404 0.3058 0.2349 0.0553  -0.0354 0.0365  1   G   C C4    
3595 P P     . G   B 2   ? 0.2743 0.3669 0.2474 0.0374  -0.0327 0.0726  2   G   C P     
3596 O OP1   . G   B 2   ? 0.2620 0.3637 0.2403 0.0269  -0.0312 0.0879  2   G   C OP1   
3597 O OP2   . G   B 2   ? 0.2874 0.3845 0.2441 0.0634  -0.0431 0.0561  2   G   C OP2   
3598 O "O5'" . G   B 2   ? 0.2702 0.3217 0.2474 0.0169  -0.0317 0.0597  2   G   C "O5'" 
3599 C "C5'" . G   B 2   ? 0.2465 0.2832 0.2315 -0.0023 -0.0276 0.0660  2   G   C "C5'" 
3600 C "C4'" . G   B 2   ? 0.2650 0.2754 0.2492 -0.0102 -0.0248 0.0545  2   G   C "C4'" 
3601 O "O4'" . G   B 2   ? 0.2372 0.2523 0.2290 -0.0043 -0.0233 0.0513  2   G   C "O4'" 
3602 C "C3'" . G   B 2   ? 0.2772 0.2728 0.2569 -0.0102 -0.0260 0.0459  2   G   C "C3'" 
3603 O "O3'" . G   B 2   ? 0.2835 0.2692 0.2536 -0.0167 -0.0246 0.0479  2   G   C "O3'" 
3604 C "C2'" . G   B 2   ? 0.2776 0.2640 0.2662 -0.0136 -0.0212 0.0428  2   G   C "C2'" 
3605 O "O2'" . G   B 2   ? 0.3063 0.2845 0.2887 -0.0194 -0.0150 0.0444  2   G   C "O2'" 
3606 C "C1'" . G   B 2   ? 0.2589 0.2581 0.2537 -0.0060 -0.0230 0.0417  2   G   C "C1'" 
3607 N N9    . G   B 2   ? 0.2571 0.2602 0.2570 0.0070  -0.0327 0.0333  2   G   C N9    
3608 C C8    . G   B 2   ? 0.2567 0.2763 0.2481 0.0253  -0.0413 0.0302  2   G   C C8    
3609 N N7    . G   B 2   ? 0.2631 0.2774 0.2586 0.0400  -0.0562 0.0168  2   G   C N7    
3610 C C5    . G   B 2   ? 0.2685 0.2630 0.2839 0.0255  -0.0562 0.0152  2   G   C C5    
3611 C C6    . G   B 2   ? 0.2735 0.2535 0.3108 0.0295  -0.0732 0.0055  2   G   C C6    
3612 O O6    . G   B 2   ? 0.2889 0.2645 0.3279 0.0493  -0.0960 -0.0096 2   G   C O6    
3613 N N1    . G   B 2   ? 0.2554 0.2273 0.3159 0.0113  -0.0648 0.0150  2   G   C N1    
3614 C C2    . G   B 2   ? 0.2581 0.2347 0.3118 -0.0028 -0.0432 0.0277  2   G   C C2    
3615 N N2    . G   B 2   ? 0.2536 0.2298 0.3287 -0.0124 -0.0365 0.0375  2   G   C N2    
3616 N N3    . G   B 2   ? 0.2527 0.2354 0.2823 -0.0045 -0.0321 0.0310  2   G   C N3    
3617 C C4    . G   B 2   ? 0.2593 0.2508 0.2749 0.0072  -0.0392 0.0264  2   G   C C4    
3618 P P     . A   B 3   ? 0.3209 0.2983 0.2894 -0.0160 -0.0278 0.0468  3   A   C P     
3619 O OP1   . A   B 3   ? 0.3231 0.2954 0.2775 -0.0201 -0.0249 0.0501  3   A   C OP1   
3620 O OP2   . A   B 3   ? 0.3223 0.3060 0.2929 -0.0049 -0.0394 0.0414  3   A   C OP2   
3621 O "O5'" . A   B 3   ? 0.3060 0.2763 0.2909 -0.0194 -0.0241 0.0494  3   A   C "O5'" 
3622 C "C5'" . A   B 3   ? 0.3400 0.3101 0.3213 -0.0222 -0.0125 0.0554  3   A   C "C5'" 
3623 C "C4'" . A   B 3   ? 0.3442 0.3183 0.3503 -0.0239 -0.0092 0.0644  3   A   C "C4'" 
3624 O "O4'" . A   B 3   ? 0.3387 0.3128 0.3592 -0.0230 -0.0151 0.0570  3   A   C "O4'" 
3625 C "C3'" . A   B 3   ? 0.3623 0.3333 0.3930 -0.0277 -0.0183 0.0745  3   A   C "C3'" 
3626 O "O3'" . A   B 3   ? 0.4121 0.3888 0.4357 -0.0280 -0.0093 0.0888  3   A   C "O3'" 
3627 C "C2'" . A   B 3   ? 0.3559 0.3318 0.4218 -0.0309 -0.0204 0.0827  3   A   C "C2'" 
3628 O "O2'" . A   B 3   ? 0.3555 0.3499 0.4285 -0.0307 -0.0029 0.1015  3   A   C "O2'" 
3629 C "C1'" . A   B 3   ? 0.3379 0.3109 0.3918 -0.0259 -0.0235 0.0641  3   A   C "C1'" 
3630 N N9    . A   B 3   ? 0.3353 0.2986 0.3967 -0.0196 -0.0444 0.0504  3   A   C N9    
3631 C C8    . A   B 3   ? 0.3321 0.2957 0.3696 -0.0095 -0.0511 0.0376  3   A   C C8    
3632 N N7    . A   B 3   ? 0.3393 0.2970 0.3845 0.0033  -0.0724 0.0249  3   A   C N7    
3633 C C5    . A   B 3   ? 0.3561 0.3031 0.4378 -0.0027 -0.0838 0.0288  3   A   C C5    
3634 C C6    . A   B 3   ? 0.3639 0.2958 0.4736 0.0061  -0.1137 0.0178  3   A   C C6    
3635 N N6    . A   B 3   ? 0.3863 0.3116 0.4808 0.0297  -0.1376 -0.0043 3   A   C N6    
3636 N N1    . A   B 3   ? 0.3728 0.2985 0.5285 -0.0068 -0.1213 0.0309  3   A   C N1    
3637 C C2    . A   B 3   ? 0.3542 0.2952 0.5217 -0.0236 -0.0957 0.0554  3   A   C C2    
3638 N N3    . A   B 3   ? 0.3440 0.3001 0.4792 -0.0273 -0.0666 0.0634  3   A   C N3    
3639 C C4    . A   B 3   ? 0.3413 0.2958 0.4361 -0.0182 -0.0643 0.0481  3   A   C C4    
3640 P P     . A   B 4   ? 0.4439 0.4148 0.4887 -0.0326 -0.0203 0.1015  4   A   C P     
3641 O OP1   . A   B 4   ? 0.4540 0.4378 0.4842 -0.0289 -0.0053 0.1180  4   A   C OP1   
3642 O OP2   . A   B 4   ? 0.4348 0.3893 0.4721 -0.0300 -0.0395 0.0826  4   A   C OP2   
3643 O "O5'" . A   B 4   ? 0.4496 0.4239 0.5469 -0.0397 -0.0291 0.1186  4   A   C "O5'" 
3644 C "C5'" . A   B 4   ? 0.4673 0.4664 0.5901 -0.0419 -0.0136 0.1491  4   A   C "C5'" 
3645 C "C4'" . A   B 4   ? 0.4734 0.4706 0.6586 -0.0523 -0.0318 0.1650  4   A   C "C4'" 
3646 O "O4'" . A   B 4   ? 0.4563 0.4364 0.6396 -0.0504 -0.0464 0.1375  4   A   C "O4'" 
3647 C "C3'" . A   B 4   ? 0.4955 0.4711 0.7171 -0.0600 -0.0607 0.1710  4   A   C "C3'" 
3648 O "O3'" . A   B 4   ? 0.5362 0.5309 0.7849 -0.0656 -0.0524 0.2092  4   A   C "O3'" 
3649 C "C2'" . A   B 4   ? 0.4883 0.4507 0.7623 -0.0661 -0.0879 0.1690  4   A   C "C2'" 
3650 O "O2'" . A   B 4   ? 0.4877 0.4761 0.8208 -0.0766 -0.0823 0.2086  4   A   C "O2'" 
3651 C "C1'" . A   B 4   ? 0.4619 0.4215 0.6927 -0.0557 -0.0797 0.1363  4   A   C "C1'" 
3652 N N9    . A   B 4   ? 0.4626 0.3961 0.6640 -0.0440 -0.1015 0.1003  4   A   C N9    
3653 C C8    . A   B 4   ? 0.4523 0.3850 0.5991 -0.0340 -0.0913 0.0807  4   A   C C8    
3654 N N7    . A   B 4   ? 0.4558 0.3734 0.5874 -0.0195 -0.1136 0.0547  4   A   C N7    
3655 C C5    . A   B 4   ? 0.4812 0.3819 0.6570 -0.0184 -0.1443 0.0517  4   A   C C5    
3656 C C6    . A   B 4   ? 0.5035 0.3825 0.6838 0.0011  -0.1820 0.0247  4   A   C C6    
3657 N N6    . A   B 4   ? 0.5088 0.3884 0.6433 0.0257  -0.1889 -0.0010 4   A   C N6    
3658 N N1    . A   B 4   ? 0.5161 0.3761 0.7507 -0.0022 -0.2144 0.0262  4   A   C N1    
3659 C C2    . A   B 4   ? 0.5112 0.3804 0.7976 -0.0263 -0.2050 0.0595  4   A   C C2    
3660 N N3    . A   B 4   ? 0.4886 0.3860 0.7731 -0.0430 -0.1659 0.0901  4   A   C N3    
3661 C C4    . A   B 4   ? 0.4754 0.3845 0.6999 -0.0366 -0.1383 0.0812  4   A   C C4    
3662 P P     . G   B 5   ? 0.5545 0.5283 0.8096 -0.0688 -0.0718 0.2120  5   G   C P     
3663 O OP1   . G   B 5   ? 0.5790 0.5848 0.8620 -0.0725 -0.0545 0.2596  5   G   C OP1   
3664 O OP2   . G   B 5   ? 0.5500 0.5054 0.7402 -0.0579 -0.0705 0.1745  5   G   C OP2   
3665 O "O5'" . G   B 5   ? 0.5849 0.5251 0.8984 -0.0769 -0.1176 0.2052  5   G   C "O5'" 
3666 C "C5'" . G   B 5   ? 0.6276 0.5770 1.0237 -0.0918 -0.1329 0.2452  5   G   C "C5'" 
3667 C "C4'" . G   B 5   ? 0.6668 0.5785 1.1089 -0.0944 -0.1812 0.2249  5   G   C "C4'" 
3668 O "O4'" . G   B 5   ? 0.6594 0.5577 1.0498 -0.0792 -0.1817 0.1781  5   G   C "O4'" 
3669 C "C3'" . G   B 5   ? 0.7097 0.5764 1.1683 -0.0913 -0.2283 0.2071  5   G   C "C3'" 
3670 O "O3'" . G   B 5   ? 0.7563 0.6248 1.2903 -0.1090 -0.2454 0.2539  5   G   C "O3'" 
3671 C "C2'" . G   B 5   ? 0.7181 0.5520 1.1947 -0.0820 -0.2698 0.1722  5   G   C "C2'" 
3672 O "O2'" . G   B 5   ? 0.7354 0.5683 1.3023 -0.0987 -0.2958 0.2026  5   G   C "O2'" 
3673 C "C1'" . G   B 5   ? 0.6766 0.5328 1.0861 -0.0700 -0.2323 0.1472  5   G   C "C1'" 
3674 N N9    . G   B 5   ? 0.6715 0.5133 1.0061 -0.0464 -0.2335 0.1014  5   G   C N9    
3675 C C8    . G   B 5   ? 0.6478 0.5079 0.9147 -0.0394 -0.1976 0.0924  5   G   C C8    
3676 N N7    . G   B 5   ? 0.6517 0.5008 0.8704 -0.0171 -0.2085 0.0562  5   G   C N7    
3677 C C5    . G   B 5   ? 0.6807 0.5010 0.9286 -0.0037 -0.2549 0.0353  5   G   C C5    
3678 C C6    . G   B 5   ? 0.7054 0.5092 0.9201 0.0296  -0.2856 -0.0055 5   G   C C6    
3679 O O6    . G   B 5   ? 0.7025 0.5205 0.8575 0.0519  -0.2732 -0.0258 5   G   C O6    
3680 N N1    . G   B 5   ? 0.7393 0.5106 0.9994 0.0393  -0.3369 -0.0204 5   G   C N1    
3681 C C2    . G   B 5   ? 0.7463 0.5033 1.0850 0.0141  -0.3566 0.0060  5   G   C C2    
3682 N N2    . G   B 5   ? 0.7857 0.5068 1.1678 0.0270  -0.4139 -0.0138 5   G   C N2    
3683 N N3    . G   B 5   ? 0.7203 0.5005 1.0953 -0.0188 -0.3239 0.0511  5   G   C N3    
3684 C C4    . G   B 5   ? 0.6886 0.4998 1.0103 -0.0233 -0.2735 0.0611  5   G   C C4    
3685 P P     . U   B 6   ? 0.8078 0.6468 1.3418 -0.1072 -0.2713 0.2519  6   U   C P     
3686 O OP1   . U   B 6   ? 0.8081 0.6698 1.4216 -0.1284 -0.2708 0.3170  6   U   C OP1   
3687 O OP2   . U   B 6   ? 0.7860 0.6288 1.2238 -0.0899 -0.2415 0.2188  6   U   C OP2   
3688 O "O5'" . U   B 6   ? 0.8461 0.6253 1.4071 -0.0964 -0.3399 0.2108  6   U   C "O5'" 
3689 C "C5'" . U   B 6   ? 0.8756 0.6332 1.5330 -0.1097 -0.3882 0.2292  6   U   C "C5'" 
3690 C "C4'" . U   B 6   ? 0.9155 0.6138 1.5708 -0.0867 -0.4535 0.1735  6   U   C "C4'" 
3691 O "O4'" . U   B 6   ? 0.8947 0.5989 1.4762 -0.0627 -0.4366 0.1262  6   U   C "O4'" 
3692 C "C3'" . U   B 6   ? 0.9524 0.6122 1.5670 -0.0652 -0.4847 0.1390  6   U   C "C3'" 
3693 O "O3'" . U   B 6   ? 1.0054 0.6359 1.7001 -0.0811 -0.5294 0.1697  6   U   C "O3'" 
3694 C "C2'" . U   B 6   ? 0.9724 0.5957 1.5490 -0.0290 -0.5280 0.0748  6   U   C "C2'" 
3695 O "O2'" . U   B 6   ? 1.0216 0.5995 1.6795 -0.0286 -0.5991 0.0687  6   U   C "O2'" 
3696 C "C1'" . U   B 6   ? 0.9169 0.5832 1.4447 -0.0275 -0.4739 0.0694  6   U   C "C1'" 
3697 N N1    . U   B 6   ? 0.8802 0.5750 1.3046 -0.0084 -0.4246 0.0451  6   U   C N1    
3698 C C2    . U   B 6   ? 0.8910 0.5736 1.2511 0.0311  -0.4424 -0.0072 6   U   C C2    
3699 O O2    . U   B 6   ? 0.9317 0.5798 1.3054 0.0561  -0.4966 -0.0401 6   U   C O2    
3700 N N3    . U   B 6   ? 0.8592 0.5748 1.1393 0.0437  -0.3962 -0.0183 6   U   C N3    
3701 C C4    . U   B 6   ? 0.8251 0.5755 1.0821 0.0217  -0.3405 0.0111  6   U   C C4    
3702 O O4    . U   B 6   ? 0.8114 0.5860 1.0036 0.0353  -0.3097 -0.0025 6   U   C O4    
3703 C C5    . U   B 6   ? 0.8118 0.5703 1.1287 -0.0136 -0.3261 0.0586  6   U   C C5    
3704 C C6    . U   B 6   ? 0.8395 0.5747 1.2368 -0.0271 -0.3651 0.0765  6   U   C C6    
3705 P P     . A   B 7   ? 1.0278 0.6479 1.6875 -0.0752 -0.5274 0.1692  7   A   C P     
3706 O OP1   . A   B 7   ? 1.0579 0.6546 1.8238 -0.0996 -0.5715 0.2163  7   A   C OP1   
3707 O OP2   . A   B 7   ? 0.9788 0.6520 1.5621 -0.0774 -0.4507 0.1807  7   A   C OP2   
3708 O "O5'" . A   B 7   ? 1.0680 0.6412 1.6598 -0.0314 -0.5725 0.0948  7   A   C "O5'" 
3709 C "C5'" . A   B 7   ? 1.1421 0.6528 1.7863 -0.0152 -0.6577 0.0669  7   A   C "C5'" 
3710 C "C4'" . A   B 7   ? 1.1788 0.6625 1.7383 0.0380  -0.6885 -0.0070 7   A   C "C4'" 
3711 O "O4'" . A   B 7   ? 1.1475 0.6677 1.6424 0.0543  -0.6468 -0.0308 7   A   C "O4'" 
3712 C "C3'" . A   B 7   ? 1.1842 0.6736 1.6604 0.0631  -0.6713 -0.0310 7   A   C "C3'" 
3713 O "O3'" . A   B 7   ? 1.2322 0.6760 1.7447 0.0656  -0.7238 -0.0298 7   A   C "O3'" 
3714 C "C2'" . A   B 7   ? 1.1974 0.6876 1.5907 0.1159  -0.6825 -0.0935 7   A   C "C2'" 
3715 O "O2'" . A   B 7   ? 1.2643 0.6967 1.6782 0.1531  -0.7674 -0.1380 7   A   C "O2'" 
3716 C "C1'" . A   B 7   ? 1.1463 0.6763 1.5404 0.0982  -0.6361 -0.0781 7   A   C "C1'" 
3717 N N9    . A   B 7   ? 1.0830 0.6727 1.4135 0.0865  -0.5544 -0.0605 7   A   C N9    
3718 C C8    . A   B 7   ? 1.0374 0.6622 1.3886 0.0447  -0.4987 -0.0106 7   A   C C8    
3719 N N7    . A   B 7   ? 0.9954 0.6644 1.2786 0.0465  -0.4392 -0.0102 7   A   C N7    
3720 C C5    . A   B 7   ? 1.0109 0.6798 1.2293 0.0895  -0.4527 -0.0570 7   A   C C5    
3721 C C6    . A   B 7   ? 0.9841 0.6934 1.1252 0.1105  -0.4121 -0.0730 7   A   C C6    
3722 N N6    . A   B 7   ? 0.9381 0.6870 1.0550 0.0879  -0.3533 -0.0477 7   A   C N6    
3723 N N1    . A   B 7   ? 1.0123 0.7219 1.1049 0.1585  -0.4372 -0.1140 7   A   C N1    
3724 C C2    . A   B 7   ? 1.0693 0.7350 1.1825 0.1874  -0.5027 -0.1448 7   A   C C2    
3725 N N3    . A   B 7   ? 1.0976 0.7137 1.2841 0.1703  -0.5521 -0.1384 7   A   C N3    
3726 C C4    . A   B 7   ? 1.0670 0.6897 1.3078 0.1182  -0.5219 -0.0899 7   A   C C4    
3727 P P     . G   B 8   ? 1.2243 0.6895 1.6869 0.0622  -0.6841 -0.0161 8   G   C P     
3728 O OP1   . G   B 8   ? 1.2772 0.6892 1.8003 0.0589  -0.7470 -0.0078 8   G   C OP1   
3729 O OP2   . G   B 8   ? 1.1612 0.6867 1.6143 0.0261  -0.6022 0.0325  8   G   C OP2   
3730 O "O5'" . G   B 8   ? 1.2211 0.7007 1.5685 0.1149  -0.6728 -0.0756 8   G   C "O5'" 
3731 C "C5'" . G   B 8   ? 1.2773 0.7119 1.6010 0.1667  -0.7429 -0.1322 8   G   C "C5'" 
3732 C "C4'" . G   B 8   ? 1.2603 0.7305 1.4778 0.2186  -0.7200 -0.1783 8   G   C "C4'" 
3733 O "O4'" . G   B 8   ? 1.2111 0.7253 1.4053 0.2145  -0.6736 -0.1752 8   G   C "O4'" 
3734 C "C3'" . G   B 8   ? 1.2225 0.7371 1.3691 0.2240  -0.6654 -0.1725 8   G   C "C3'" 
3735 O "O3'" . G   B 8   ? 1.2726 0.7546 1.4126 0.2426  -0.7043 -0.1863 8   G   C "O3'" 
3736 C "C2'" . G   B 8   ? 1.2113 0.7675 1.2782 0.2718  -0.6466 -0.2086 8   G   C "C2'" 
3737 O "O2'" . G   B 8   ? 1.2706 0.8006 1.3024 0.3362  -0.7091 -0.2620 8   G   C "O2'" 
3738 C "C1'" . G   B 8   ? 1.1776 0.7442 1.2806 0.2460  -0.6282 -0.1928 8   G   C "C1'" 
3739 N N9    . G   B 8   ? 1.1033 0.7238 1.1927 0.2068  -0.5488 -0.1535 8   G   C N9    
3740 C C8    . G   B 8   ? 1.0611 0.6876 1.2018 0.1519  -0.5144 -0.1063 8   G   C C8    
3741 N N7    . G   B 8   ? 1.0068 0.6825 1.1135 0.1345  -0.4498 -0.0858 8   G   C N7    
3742 C C5    . G   B 8   ? 1.0091 0.7147 1.0459 0.1752  -0.4396 -0.1159 8   G   C C5    
3743 C C6    . G   B 8   ? 0.9703 0.7308 0.9566 0.1767  -0.3844 -0.1081 8   G   C C6    
3744 O O6    . G   B 8   ? 0.9245 0.7116 0.9136 0.1429  -0.3360 -0.0787 8   G   C O6    
3745 N N1    . G   B 8   ? 0.9895 0.7759 0.9201 0.2266  -0.3923 -0.1375 8   G   C N1    
3746 C C2    . G   B 8   ? 1.0432 0.8053 0.9577 0.2758  -0.4472 -0.1757 8   G   C C2    
3747 N N2    . G   B 8   ? 1.0574 0.8612 0.9121 0.3274  -0.4438 -0.1968 8   G   C N2    
3748 N N3    . G   B 8   ? 1.0861 0.7887 1.0437 0.2768  -0.5045 -0.1904 8   G   C N3    
3749 C C4    . G   B 8   ? 1.0649 0.7421 1.0870 0.2223  -0.4970 -0.1565 8   G   C C4    
3750 P P     . A   B 9   ? 1.2425 0.7579 1.3430 0.2287  -0.6538 -0.1638 9   A   C P     
3751 O OP1   . A   B 9   ? 1.3031 0.7675 1.4218 0.2434  -0.7116 -0.1766 9   A   C OP1   
3752 O OP2   . A   B 9   ? 1.1762 0.7269 1.3034 0.1728  -0.5881 -0.1107 9   A   C OP2   
3753 O "O5'" . A   B 9   ? 1.2215 0.7922 1.2247 0.2754  -0.6198 -0.1945 9   A   C "O5'" 
3754 C "C5'" . A   B 9   ? 1.2636 0.8258 1.2177 0.3430  -0.6674 -0.2467 9   A   C "C5'" 
3755 C "C4'" . A   B 9   ? 1.2237 0.8597 1.0985 0.3762  -0.6167 -0.2549 9   A   C "C4'" 
3756 O "O4'" . A   B 9   ? 1.1728 0.8445 1.0514 0.3584  -0.5758 -0.2396 9   A   C "O4'" 
3757 C "C3'" . A   B 9   ? 1.1666 0.8472 1.0155 0.3518  -0.5576 -0.2243 9   A   C "C3'" 
3758 O "O3'" . A   B 9   ? 1.1996 0.8677 1.0213 0.3806  -0.5841 -0.2414 9   A   C "O3'" 
3759 C "C2'" . A   B 9   ? 1.1251 0.8787 0.9247 0.3704  -0.5071 -0.2205 9   A   C "C2'" 
3760 O "O2'" . A   B 9   ? 1.1620 0.9474 0.9012 0.4404  -0.5266 -0.2538 9   A   C "O2'" 
3761 C "C1'" . A   B 9   ? 1.1069 0.8463 0.9454 0.3481  -0.5074 -0.2152 9   A   C "C1'" 
3762 N N9    . A   B 9   ? 1.0454 0.7915 0.9242 0.2832  -0.4592 -0.1722 9   A   C N9    
3763 C C8    . A   B 9   ? 1.0371 0.7416 0.9804 0.2370  -0.4684 -0.1496 9   A   C C8    
3764 N N7    . A   B 9   ? 0.9850 0.7143 0.9439 0.1923  -0.4163 -0.1132 9   A   C N7    
3765 C C5    . A   B 9   ? 0.9549 0.7388 0.8611 0.2063  -0.3741 -0.1131 9   A   C C5    
3766 C C6    . A   B 9   ? 0.9038 0.7293 0.7995 0.1784  -0.3179 -0.0861 9   A   C C6    
3767 N N6    . A   B 9   ? 0.8738 0.6936 0.8030 0.1345  -0.2917 -0.0569 9   A   C N6    
3768 N N1    . A   B 9   ? 0.8893 0.7648 0.7413 0.2004  -0.2924 -0.0886 9   A   C N1    
3769 C C2    . A   B 9   ? 0.9212 0.8130 0.7366 0.2509  -0.3157 -0.1142 9   A   C C2    
3770 N N3    . A   B 9   ? 0.9738 0.8317 0.7846 0.2872  -0.3674 -0.1456 9   A   C N3    
3771 C C4    . A   B 9   ? 0.9899 0.7893 0.8496 0.2605  -0.3972 -0.1450 9   A   C C4    
3772 P P     . U   B 10  ? 1.1620 0.8586 0.9712 0.3500  -0.5362 -0.2099 10  U   C P     
3773 O OP1   . U   B 10  ? 1.2137 0.8705 1.0182 0.3720  -0.5822 -0.2284 10  U   C OP1   
3774 O OP2   . U   B 10  ? 1.0948 0.7964 0.9480 0.2845  -0.4895 -0.1658 10  U   C OP2   
3775 O "O5'" . U   B 10  ? 1.1300 0.9062 0.8731 0.3862  -0.4939 -0.2136 10  U   C "O5'" 
3776 C "C5'" . U   B 10  ? 1.0764 0.8974 0.8003 0.3673  -0.4449 -0.1871 10  U   C "C5'" 
3777 C "C4'" . U   B 10  ? 1.0140 0.9028 0.7218 0.3607  -0.3910 -0.1656 10  U   C "C4'" 
3778 O "O4'" . U   B 10  ? 0.9874 0.8653 0.7291 0.3294  -0.3783 -0.1543 10  U   C "O4'" 
3779 C "C3'" . U   B 10  ? 0.9646 0.8836 0.6762 0.3207  -0.3422 -0.1313 10  U   C "C3'" 
3780 O "O3'" . U   B 10  ? 0.9888 0.9408 0.6637 0.3526  -0.3420 -0.1361 10  U   C "O3'" 
3781 C "C2'" . U   B 10  ? 0.9120 0.8789 0.6273 0.3060  -0.3007 -0.1102 10  U   C "C2'" 
3782 O "O2'" . U   B 10  ? 0.9113 0.9433 0.5911 0.3512  -0.2907 -0.1122 10  U   C "O2'" 
3783 C "C1'" . U   B 10  ? 0.9199 0.8439 0.6645 0.2960  -0.3224 -0.1214 10  U   C "C1'" 
3784 N N1    . U   B 10  ? 0.8789 0.7699 0.6685 0.2373  -0.3045 -0.0973 10  U   C N1    
3785 C C2    . U   B 10  ? 0.8266 0.7488 0.6229 0.2037  -0.2583 -0.0696 10  U   C C2    
3786 O O2    . U   B 10  ? 0.8044 0.7773 0.5806 0.2128  -0.2318 -0.0599 10  U   C O2    
3787 N N3    . U   B 10  ? 0.8029 0.6967 0.6339 0.1604  -0.2460 -0.0509 10  U   C N3    
3788 C C4    . U   B 10  ? 0.8301 0.6753 0.6965 0.1442  -0.2710 -0.0492 10  U   C C4    
3789 O O4    . U   B 10  ? 0.8089 0.6449 0.7041 0.1091  -0.2521 -0.0256 10  U   C O4    
3790 C C5    . U   B 10  ? 0.8758 0.6874 0.7438 0.1745  -0.3210 -0.0749 10  U   C C5    
3791 C C6    . U   B 10  ? 0.8982 0.7303 0.7250 0.2206  -0.3371 -0.1011 10  U   C C6    
3792 P P     . G   B 11  ? 0.9943 0.9302 0.6759 0.3229  -0.3320 -0.1211 11  G   C P     
3793 O OP1   . G   B 11  ? 1.0291 0.9774 0.6727 0.3700  -0.3559 -0.1411 11  G   C OP1   
3794 O OP2   . G   B 11  ? 0.9963 0.8696 0.7211 0.2786  -0.3427 -0.1128 11  G   C OP2   
3795 O "O5'" . G   B 11  ? 0.9201 0.9139 0.6039 0.2945  -0.2774 -0.0873 11  G   C "O5'" 
3796 C "C5'" . G   B 11  ? 0.8785 0.9439 0.5385 0.3270  -0.2590 -0.0800 11  G   C "C5'" 
3797 C "C4'" . G   B 11  ? 0.7992 0.9034 0.4814 0.2901  -0.2159 -0.0460 11  G   C "C4'" 
3798 O "O4'" . G   B 11  ? 0.7693 0.8494 0.4758 0.2649  -0.2103 -0.0439 11  G   C "O4'" 
3799 C "C3'" . G   B 11  ? 0.7655 0.8528 0.4652 0.2458  -0.1978 -0.0279 11  G   C "C3'" 
3800 O "O3'" . G   B 11  ? 0.7817 0.9044 0.4663 0.2597  -0.1926 -0.0200 11  G   C "O3'" 
3801 C "C2'" . G   B 11  ? 0.7078 0.8143 0.4340 0.2129  -0.1685 -0.0043 11  G   C "C2'" 
3802 O "O2'" . G   B 11  ? 0.6810 0.8556 0.4098 0.2262  -0.1496 0.0175  11  G   C "O2'" 
3803 C "C1'" . G   B 11  ? 0.6943 0.7729 0.4266 0.2173  -0.1811 -0.0191 11  G   C "C1'" 
3804 N N9    . G   B 11  ? 0.6854 0.7039 0.4385 0.1837  -0.1874 -0.0229 11  G   C N9    
3805 C C8    . G   B 11  ? 0.7059 0.6733 0.4651 0.1874  -0.2174 -0.0402 11  G   C C8    
3806 N N7    . G   B 11  ? 0.6925 0.6246 0.4790 0.1522  -0.2120 -0.0293 11  G   C N7    
3807 C C5    . G   B 11  ? 0.6594 0.6173 0.4505 0.1276  -0.1780 -0.0097 11  G   C C5    
3808 C C6    . G   B 11  ? 0.6393 0.5826 0.4496 0.0936  -0.1587 0.0067  11  G   C C6    
3809 O O6    . G   B 11  ? 0.6464 0.5577 0.4766 0.0772  -0.1633 0.0128  11  G   C O6    
3810 N N1    . G   B 11  ? 0.6135 0.5869 0.4213 0.0816  -0.1339 0.0188  11  G   C N1    
3811 C C2    . G   B 11  ? 0.6019 0.6177 0.4001 0.0957  -0.1274 0.0221  11  G   C C2    
3812 N N2    . G   B 11  ? 0.5818 0.6183 0.3903 0.0789  -0.1096 0.0370  11  G   C N2    
3813 N N3    . G   B 11  ? 0.6221 0.6616 0.4045 0.1274  -0.1399 0.0133  11  G   C N3    
3814 C C4    . G   B 11  ? 0.6490 0.6561 0.4239 0.1440  -0.1652 -0.0055 11  G   C C4    
3815 P P     . G   B 12  ? 0.8017 0.8877 0.4881 0.2341  -0.1946 -0.0189 12  G   C P     
3816 O OP1   . G   B 12  ? 0.8187 0.9478 0.4849 0.2609  -0.1947 -0.0154 12  G   C OP1   
3817 O OP2   . G   B 12  ? 0.8191 0.8371 0.5100 0.2253  -0.2192 -0.0368 12  G   C OP2   
3818 O "O5'" . G   B 12  ? 0.7466 0.8332 0.4605 0.1876  -0.1665 0.0050  12  G   C "O5'" 
3819 C "C5'" . G   B 12  ? 0.7052 0.8463 0.4332 0.1821  -0.1458 0.0286  12  G   C "C5'" 
3820 C "C4'" . G   B 12  ? 0.6593 0.7813 0.4132 0.1416  -0.1306 0.0412  12  G   C "C4'" 
3821 O "O4'" . G   B 12  ? 0.6487 0.7376 0.4079 0.1333  -0.1324 0.0317  12  G   C "O4'" 
3822 C "C3'" . G   B 12  ? 0.6591 0.7406 0.4108 0.1180  -0.1311 0.0384  12  G   C "C3'" 
3823 O "O3'" . G   B 12  ? 0.6709 0.7783 0.4260 0.1153  -0.1279 0.0498  12  G   C "O3'" 
3824 C "C2'" . G   B 12  ? 0.6354 0.6935 0.4045 0.0906  -0.1207 0.0430  12  G   C "C2'" 
3825 O "O2'" . G   B 12  ? 0.6151 0.7015 0.4066 0.0773  -0.1110 0.0592  12  G   C "O2'" 
3826 C "C1'" . G   B 12  ? 0.6243 0.6763 0.3947 0.1013  -0.1249 0.0348  12  G   C "C1'" 
3827 N N9    . G   B 12  ? 0.6332 0.6383 0.4002 0.0983  -0.1362 0.0229  12  G   C N9    
3828 C C8    . G   B 12  ? 0.6523 0.6383 0.4101 0.1191  -0.1584 0.0079  12  G   C C8    
3829 N N7    . G   B 12  ? 0.6626 0.6069 0.4334 0.1066  -0.1674 0.0067  12  G   C N7    
3830 C C5    . G   B 12  ? 0.6463 0.5875 0.4290 0.0796  -0.1459 0.0216  12  G   C C5    
3831 C C6    . G   B 12  ? 0.6491 0.5635 0.4490 0.0604  -0.1410 0.0326  12  G   C C6    
3832 O O6    . G   B 12  ? 0.6687 0.5555 0.4861 0.0583  -0.1556 0.0359  12  G   C O6    
3833 N N1    . G   B 12  ? 0.6318 0.5563 0.4315 0.0447  -0.1189 0.0430  12  G   C N1    
3834 C C2    . G   B 12  ? 0.6183 0.5681 0.4094 0.0435  -0.1085 0.0421  12  G   C C2    
3835 N N2    . G   B 12  ? 0.6093 0.5588 0.4015 0.0311  -0.0953 0.0483  12  G   C N2    
3836 N N3    . G   B 12  ? 0.6070 0.5833 0.3923 0.0560  -0.1131 0.0376  12  G   C N3    
3837 C C4    . G   B 12  ? 0.6224 0.5962 0.4006 0.0753  -0.1293 0.0279  12  G   C C4    
3838 P P     . U   B 13  ? 0.6980 0.7759 0.4352 0.1121  -0.1354 0.0415  13  U   C P     
3839 O OP1   . U   B 13  ? 0.6930 0.8072 0.4395 0.1119  -0.1338 0.0546  13  U   C OP1   
3840 O OP2   . U   B 13  ? 0.7271 0.7808 0.4420 0.1328  -0.1505 0.0248  13  U   C OP2   
3841 O "O5'" . U   B 13  ? 0.6849 0.7201 0.4264 0.0858  -0.1293 0.0405  13  U   C "O5'" 
3842 C "C5'" . U   B 13  ? 0.6648 0.7066 0.4242 0.0675  -0.1223 0.0495  13  U   C "C5'" 
3843 C "C4'" . U   B 13  ? 0.6517 0.6557 0.4061 0.0540  -0.1170 0.0452  13  U   C "C4'" 
3844 O "O4'" . U   B 13  ? 0.6528 0.6437 0.4104 0.0545  -0.1138 0.0429  13  U   C "O4'" 
3845 C "C3'" . U   B 13  ? 0.6638 0.6401 0.3963 0.0567  -0.1190 0.0408  13  U   C "C3'" 
3846 O "O3'" . U   B 13  ? 0.6589 0.6377 0.3844 0.0558  -0.1231 0.0397  13  U   C "O3'" 
3847 C "C2'" . U   B 13  ? 0.6642 0.6174 0.3977 0.0490  -0.1101 0.0435  13  U   C "C2'" 
3848 O "O2'" . U   B 13  ? 0.6754 0.6266 0.4090 0.0426  -0.1054 0.0432  13  U   C "O2'" 
3849 C "C1'" . U   B 13  ? 0.6488 0.6083 0.3989 0.0485  -0.1101 0.0433  13  U   C "C1'" 
3850 N N1    . U   B 13  ? 0.6568 0.5981 0.4082 0.0554  -0.1188 0.0417  13  U   C N1    
3851 C C2    . U   B 13  ? 0.6620 0.5806 0.4221 0.0477  -0.1151 0.0510  13  U   C C2    
3852 O O2    . U   B 13  ? 0.6595 0.5770 0.4188 0.0400  -0.1018 0.0594  13  U   C O2    
3853 N N3    . U   B 13  ? 0.6775 0.5767 0.4503 0.0520  -0.1304 0.0518  13  U   C N3    
3854 C C4    . U   B 13  ? 0.6861 0.5823 0.4555 0.0678  -0.1512 0.0381  13  U   C C4    
3855 O O4    . U   B 13  ? 0.7135 0.5843 0.4987 0.0712  -0.1709 0.0378  13  U   C O4    
3856 C C5    . U   B 13  ? 0.6703 0.5964 0.4211 0.0809  -0.1502 0.0273  13  U   C C5    
3857 C C6    . U   B 13  ? 0.6491 0.5982 0.3962 0.0719  -0.1333 0.0328  13  U   C C6    
3858 P P     . U   B 14  ? 0.6749 0.6476 0.3789 0.0667  -0.1297 0.0364  14  U   C P     
3859 O OP1   . U   B 14  ? 0.6808 0.6576 0.3822 0.0657  -0.1367 0.0338  14  U   C OP1   
3860 O OP2   . U   B 14  ? 0.6724 0.6596 0.3758 0.0787  -0.1358 0.0350  14  U   C OP2   
3861 O "O5'" . U   B 14  ? 0.6759 0.6184 0.3650 0.0677  -0.1233 0.0392  14  U   C "O5'" 
3862 C "C5'" . U   B 14  ? 0.6777 0.6097 0.3584 0.0658  -0.1154 0.0416  14  U   C "C5'" 
3863 C "C4'" . U   B 14  ? 0.6764 0.5937 0.3536 0.0679  -0.1065 0.0549  14  U   C "C4'" 
3864 O "O4'" . U   B 14  ? 0.6636 0.5776 0.3647 0.0596  -0.1054 0.0600  14  U   C "O4'" 
3865 C "C3'" . U   B 14  ? 0.6776 0.5854 0.3460 0.0752  -0.1124 0.0612  14  U   C "C3'" 
3866 O "O3'" . U   B 14  ? 0.6837 0.5926 0.3260 0.0862  -0.1111 0.0602  14  U   C "O3'" 
3867 C "C2'" . U   B 14  ? 0.6815 0.5786 0.3694 0.0704  -0.1070 0.0810  14  U   C "C2'" 
3868 O "O2'" . U   B 14  ? 0.6816 0.5846 0.3617 0.0756  -0.0914 0.0988  14  U   C "O2'" 
3869 C "C1'" . U   B 14  ? 0.6672 0.5667 0.3770 0.0605  -0.1078 0.0745  14  U   C "C1'" 
3870 N N1    . U   B 14  ? 0.6597 0.5503 0.3838 0.0619  -0.1256 0.0667  14  U   C N1    
3871 C C2    . U   B 14  ? 0.6687 0.5394 0.4178 0.0588  -0.1362 0.0787  14  U   C C2    
3872 O O2    . U   B 14  ? 0.6829 0.5490 0.4493 0.0519  -0.1282 0.1017  14  U   C O2    
3873 N N3    . U   B 14  ? 0.6875 0.5462 0.4441 0.0670  -0.1596 0.0645  14  U   C N3    
3874 C C4    . U   B 14  ? 0.6820 0.5550 0.4198 0.0811  -0.1681 0.0430  14  U   C C4    
3875 O O4    . U   B 14  ? 0.7008 0.5632 0.4418 0.0953  -0.1912 0.0300  14  U   C O4    
3876 C C5    . U   B 14  ? 0.6567 0.5581 0.3751 0.0805  -0.1516 0.0393  14  U   C C5    
3877 C C6    . U   B 14  ? 0.6457 0.5501 0.3601 0.0696  -0.1342 0.0494  14  U   C C6    
3878 P P     . C   B 15  ? 0.6884 0.5960 0.3153 0.0947  -0.1230 0.0535  15  C   C P     
3879 O OP1   . C   B 15  ? 0.7065 0.6165 0.3067 0.1069  -0.1221 0.0486  15  C   C OP1   
3880 O OP2   . C   B 15  ? 0.6600 0.5785 0.2984 0.0916  -0.1341 0.0414  15  C   C OP2   
3881 O "O5'" . C   B 15  ? 0.6841 0.5763 0.3184 0.0963  -0.1240 0.0718  15  C   C "O5'" 
3882 C "C5'" . C   B 15  ? 0.6901 0.5729 0.3182 0.1033  -0.1373 0.0705  15  C   C "C5'" 
3883 C "C4'" . C   B 15  ? 0.6960 0.5613 0.3416 0.1021  -0.1404 0.0947  15  C   C "C4'" 
3884 O "O4'" . C   B 15  ? 0.7035 0.5777 0.3396 0.1079  -0.1232 0.1182  15  C   C "O4'" 
3885 C "C3'" . C   B 15  ? 0.6912 0.5461 0.3742 0.0900  -0.1441 0.1066  15  C   C "C3'" 
3886 O "O3'" . C   B 15  ? 0.7059 0.5471 0.4000 0.0912  -0.1667 0.0881  15  C   C "O3'" 
3887 C "C2'" . C   B 15  ? 0.6954 0.5418 0.3996 0.0886  -0.1432 0.1418  15  C   C "C2'" 
3888 O "O2'" . C   B 15  ? 0.7166 0.5399 0.4309 0.0920  -0.1671 0.1436  15  C   C "O2'" 
3889 C "C1'" . C   B 15  ? 0.7027 0.5709 0.3734 0.1009  -0.1215 0.1511  15  C   C "C1'" 
3890 N N1    . C   B 15  ? 0.6868 0.5773 0.3620 0.1022  -0.0979 0.1735  15  C   C N1    
3891 C C2    . C   B 15  ? 0.6709 0.5753 0.3226 0.1066  -0.0863 0.1535  15  C   C C2    
3892 O O2    . C   B 15  ? 0.6803 0.5798 0.3149 0.1057  -0.0952 0.1218  15  C   C O2    
3893 N N3    . C   B 15  ? 0.6718 0.5971 0.3231 0.1133  -0.0670 0.1713  15  C   C N3    
3894 C C4    . C   B 15  ? 0.6945 0.6347 0.3707 0.1151  -0.0553 0.2132  15  C   C C4    
3895 N N4    . C   B 15  ? 0.7058 0.6744 0.3781 0.1266  -0.0344 0.2311  15  C   C N4    
3896 C C5    . C   B 15  ? 0.7048 0.6331 0.4141 0.1068  -0.0668 0.2403  15  C   C C5    
3897 C C6    . C   B 15  ? 0.6922 0.5921 0.3985 0.1008  -0.0897 0.2169  15  C   C C6    
3898 P P     . A   B 16  ? 0.6983 0.5402 0.4125 0.0852  -0.1712 0.0771  16  A   C P     
3899 O OP1   . A   B 16  ? 0.7239 0.5524 0.4390 0.0983  -0.1991 0.0572  16  A   C OP1   
3900 O OP2   . A   B 16  ? 0.6592 0.5267 0.3589 0.0817  -0.1516 0.0678  16  A   C OP2   
3901 O "O5'" . A   B 16  ? 0.7210 0.5488 0.4755 0.0717  -0.1703 0.1051  16  A   C "O5'" 
3902 C "C5'" . A   B 16  ? 0.7815 0.5814 0.5683 0.0702  -0.1949 0.1211  16  A   C "C5'" 
3903 C "C4'" . A   B 16  ? 0.8183 0.6171 0.6511 0.0551  -0.1885 0.1599  16  A   C "C4'" 
3904 O "O4'" . A   B 16  ? 0.8123 0.6386 0.6310 0.0558  -0.1575 0.1873  16  A   C "O4'" 
3905 C "C3'" . A   B 16  ? 0.8275 0.6329 0.6821 0.0450  -0.1819 0.1590  16  A   C "C3'" 
3906 O "O3'" . A   B 16  ? 0.8881 0.6635 0.7754 0.0441  -0.2170 0.1465  16  A   C "O3'" 
3907 C "C2'" . A   B 16  ? 0.8239 0.6487 0.7088 0.0348  -0.1603 0.2048  16  A   C "C2'" 
3908 O "O2'" . A   B 16  ? 0.8519 0.6589 0.7985 0.0238  -0.1824 0.2390  16  A   C "O2'" 
3909 C "C1'" . A   B 16  ? 0.8110 0.6566 0.6551 0.0469  -0.1383 0.2129  16  A   C "C1'" 
3910 N N9    . A   B 16  ? 0.7909 0.6632 0.5924 0.0546  -0.1105 0.1979  16  A   C N9    
3911 C C8    . A   B 16  ? 0.7683 0.6420 0.5290 0.0611  -0.1095 0.1601  16  A   C C8    
3912 N N7    . A   B 16  ? 0.7617 0.6560 0.4977 0.0668  -0.0892 0.1551  16  A   C N7    
3913 C C5    . A   B 16  ? 0.7750 0.6868 0.5294 0.0681  -0.0725 0.1903  16  A   C C5    
3914 C C6    . A   B 16  ? 0.7802 0.7197 0.5186 0.0798  -0.0491 0.2019  16  A   C C6    
3915 N N6    . A   B 16  ? 0.7774 0.7227 0.4779 0.0905  -0.0436 0.1738  16  A   C N6    
3916 N N1    . A   B 16  ? 0.7931 0.7562 0.5590 0.0825  -0.0342 0.2452  16  A   C N1    
3917 C C2    . A   B 16  ? 0.8016 0.7570 0.6171 0.0692  -0.0450 0.2778  16  A   C C2    
3918 N N3    . A   B 16  ? 0.8077 0.7291 0.6441 0.0563  -0.0724 0.2673  16  A   C N3    
3919 C C4    . A   B 16  ? 0.7918 0.6938 0.5909 0.0587  -0.0837 0.2210  16  A   C C4    
3920 P P     . A   B 17  ? 0.9114 0.6878 0.7899 0.0490  -0.2231 0.1137  17  A   C P     
3921 O OP1   . A   B 17  ? 0.9401 0.6792 0.8514 0.0554  -0.2684 0.1020  17  A   C OP1   
3922 O OP2   . A   B 17  ? 0.8874 0.6875 0.7134 0.0617  -0.2069 0.0860  17  A   C OP2   
3923 O "O5'" . A   B 17  ? 0.9114 0.7077 0.8128 0.0324  -0.1968 0.1362  17  A   C "O5'" 
3924 C "C5'" . A   B 17  ? 0.9765 0.7622 0.9375 0.0177  -0.2072 0.1696  17  A   C "C5'" 
3925 C "C4'" . A   B 17  ? 0.9964 0.7917 0.9760 0.0094  -0.1985 0.1687  17  A   C "C4'" 
3926 O "O4'" . A   B 17  ? 0.9778 0.8092 0.9268 0.0081  -0.1570 0.1767  17  A   C "O4'" 
3927 C "C3'" . A   B 17  ? 1.0156 0.8002 0.9752 0.0207  -0.2152 0.1263  17  A   C "C3'" 
3928 O "O3'" . A   B 17  ? 1.0818 0.8303 1.0810 0.0245  -0.2602 0.1164  17  A   C "O3'" 
3929 C "C2'" . A   B 17  ? 0.9825 0.7952 0.9304 0.0144  -0.1838 0.1258  17  A   C "C2'" 
3930 O "O2'" . A   B 17  ? 0.9884 0.7953 0.9808 0.0036  -0.1914 0.1377  17  A   C "O2'" 
3931 C "C1'" . A   B 17  ? 0.9629 0.8025 0.8957 0.0090  -0.1489 0.1521  17  A   C "C1'" 
3932 N N9    . A   B 17  ? 0.9448 0.8031 0.8245 0.0179  -0.1282 0.1317  17  A   C N9    
3933 C C8    . A   B 17  ? 0.9408 0.7971 0.7876 0.0291  -0.1368 0.1040  17  A   C C8    
3934 N N7    . A   B 17  ? 0.9255 0.8016 0.7393 0.0323  -0.1178 0.0953  17  A   C N7    
3935 C C5    . A   B 17  ? 0.9246 0.8131 0.7429 0.0264  -0.0968 0.1136  17  A   C C5    
3936 C C6    . A   B 17  ? 0.9230 0.8290 0.7153 0.0304  -0.0773 0.1113  17  A   C C6    
3937 N N6    . A   B 17  ? 0.9137 0.8249 0.6780 0.0359  -0.0780 0.0914  17  A   C N6    
3938 N N1    . A   B 17  ? 0.9293 0.8478 0.7285 0.0308  -0.0605 0.1310  17  A   C N1    
3939 C C2    . A   B 17  ? 0.9324 0.8509 0.7697 0.0234  -0.0605 0.1574  17  A   C C2    
3940 N N3    . A   B 17  ? 0.9345 0.8342 0.8077 0.0146  -0.0809 0.1642  17  A   C N3    
3941 C C4    . A   B 17  ? 0.9327 0.8152 0.7904 0.0183  -0.0997 0.1382  17  A   C C4    
3942 P P     . G   B 18  ? 1.1279 0.8587 1.1980 0.0085  -0.2819 0.1389  18  G   C P     
3943 O OP1   . G   B 18  ? 1.1151 0.8744 1.2160 -0.0124 -0.2489 0.1874  18  G   C OP1   
3944 O OP2   . G   B 18  ? 1.1708 0.8551 1.2789 0.0155  -0.3379 0.1313  18  G   C OP2   
3945 O "O5'" . G   B 18  ? 1.1167 0.8560 1.1684 0.0165  -0.2780 0.1087  18  G   C "O5'" 
3946 C "C5'" . G   B 18  ? 1.1566 0.8708 1.2525 0.0165  -0.3127 0.1013  18  G   C "C5'" 
3947 C "C4'" . G   B 18  ? 1.1566 0.8885 1.2958 -0.0061 -0.2925 0.1324  18  G   C "C4'" 
3948 O "O4'" . G   B 18  ? 1.1929 0.9060 1.4109 -0.0246 -0.3184 0.1721  18  G   C "O4'" 
3949 C "C3'" . G   B 18  ? 1.1306 0.9075 1.2456 -0.0179 -0.2365 0.1570  18  G   C "C3'" 
3950 O "O3'" . G   B 18  ? 1.0965 0.8936 1.1602 -0.0082 -0.2126 0.1278  18  G   C "O3'" 
3951 C "C2'" . G   B 18  ? 1.1391 0.9261 1.3217 -0.0385 -0.2330 0.2005  18  G   C "C2'" 
3952 O "O2'" . G   B 18  ? 1.1257 0.9167 1.3194 -0.0407 -0.2321 0.1891  18  G   C "O2'" 
3953 C "C1'" . G   B 18  ? 1.1890 0.9388 1.4387 -0.0453 -0.2821 0.2176  18  G   C "C1'" 
3954 N N9    . G   B 18  ? 1.2069 0.9704 1.4879 -0.0568 -0.2721 0.2663  18  G   C N9    
3955 C C8    . G   B 18  ? 1.2324 0.9769 1.5044 -0.0509 -0.2887 0.2661  18  G   C C8    
3956 N N7    . G   B 18  ? 1.2431 1.0100 1.5495 -0.0621 -0.2734 0.3187  18  G   C N7    
3957 C C5    . G   B 18  ? 1.2258 1.0331 1.5657 -0.0742 -0.2439 0.3576  18  G   C C5    
3958 C C6    . G   B 18  ? 1.2262 1.0812 1.6098 -0.0838 -0.2150 0.4251  18  G   C C6    
3959 O O6    . G   B 18  ? 1.2429 1.1126 1.6456 -0.0847 -0.2099 0.4653  18  G   C O6    
3960 N N1    . G   B 18  ? 1.2067 1.0993 1.6117 -0.0894 -0.1895 0.4474  18  G   C N1    
3961 C C2    . G   B 18  ? 1.1893 1.0694 1.5765 -0.0887 -0.1929 0.4077  18  G   C C2    
3962 N N2    . G   B 18  ? 1.1751 1.0961 1.5868 -0.0937 -0.1665 0.4366  18  G   C N2    
3963 N N3    . G   B 18  ? 1.1881 1.0238 1.5354 -0.0804 -0.2194 0.3460  18  G   C N3    
3964 C C4    . G   B 18  ? 1.2050 1.0083 1.5299 -0.0722 -0.2435 0.3245  18  G   C C4    
3965 P P     . U   B 19  ? 1.0567 0.8913 1.0733 -0.0098 -0.1647 0.1330  19  U   C P     
3966 O OP1   . U   B 19  ? 1.0393 0.8875 1.0390 -0.0077 -0.1514 0.1147  19  U   C OP1   
3967 O OP2   . U   B 19  ? 1.0556 0.8913 1.0303 0.0008  -0.1615 0.1208  19  U   C OP2   
3968 O "O5'" . U   B 19  ? 1.0576 0.9123 1.1079 -0.0239 -0.1431 0.1797  19  U   C "O5'" 
3969 C "C5'" . U   B 19  ? 1.0396 0.9187 1.1047 -0.0309 -0.1201 0.1974  19  U   C "C5'" 
3970 C "C4'" . U   B 19  ? 1.0390 0.9523 1.0885 -0.0276 -0.0864 0.2278  19  U   C "C4'" 
3971 O "O4'" . U   B 19  ? 1.0661 0.9848 1.1641 -0.0342 -0.0930 0.2720  19  U   C "O4'" 
3972 C "C3'" . U   B 19  ? 1.0322 0.9483 1.0206 -0.0144 -0.0746 0.2065  19  U   C "C3'" 
3973 O "O3'" . U   B 19  ? 0.9904 0.9159 0.9345 -0.0073 -0.0587 0.1786  19  U   C "O3'" 
3974 C "C2'" . U   B 19  ? 1.0606 1.0005 1.0511 -0.0085 -0.0577 0.2442  19  U   C "C2'" 
3975 O "O2'" . U   B 19  ? 1.0671 1.0423 1.0316 0.0043  -0.0269 0.2565  19  U   C "O2'" 
3976 C "C1'" . U   B 19  ? 1.0801 1.0173 1.1442 -0.0228 -0.0739 0.2852  19  U   C "C1'" 
3977 N N1    . U   B 19  ? 1.1036 1.0157 1.1900 -0.0268 -0.1002 0.2940  19  U   C N1    
3978 C C2    . U   B 19  ? 1.1239 1.0580 1.2399 -0.0269 -0.0918 0.3435  19  U   C C2    
3979 O O2    . U   B 19  ? 1.1266 1.1056 1.2494 -0.0207 -0.0619 0.3821  19  U   C O2    
3980 N N3    . U   B 19  ? 1.1472 1.0525 1.2844 -0.0311 -0.1203 0.3481  19  U   C N3    
3981 C C4    . U   B 19  ? 1.1500 1.0081 1.2772 -0.0311 -0.1565 0.3060  19  U   C C4    
3982 O O4    . U   B 19  ? 1.1710 1.0052 1.3179 -0.0321 -0.1822 0.3137  19  U   C O4    
3983 C C5    . U   B 19  ? 1.1264 0.9712 1.2191 -0.0265 -0.1605 0.2571  19  U   C C5    
3984 C C6    . U   B 19  ? 1.1041 0.9752 1.1807 -0.0265 -0.1327 0.2547  19  U   C C6    
3985 P P     . C   B 20  ? 0.9545 0.9027 0.8926 -0.0050 -0.0366 0.1820  20  C   C P     
3986 O OP1   . C   B 20  ? 0.9639 0.9334 0.9453 -0.0090 -0.0270 0.2224  20  C   C OP1   
3987 O OP2   . C   B 20  ? 0.9309 0.8669 0.8605 -0.0087 -0.0446 0.1507  20  C   C OP2   
3988 O "O5'" . C   B 20  ? 0.9289 0.8927 0.8154 0.0124  -0.0191 0.1764  20  C   C "O5'" 
3989 C "C5'" . C   B 20  ? 0.8518 0.8157 0.7017 0.0201  -0.0145 0.1488  20  C   C "C5'" 
3990 C "C4'" . C   B 20  ? 0.8040 0.7537 0.6241 0.0229  -0.0259 0.1235  20  C   C "C4'" 
3991 O "O4'" . C   B 20  ? 0.7947 0.7351 0.6197 0.0208  -0.0360 0.1295  20  C   C "O4'" 
3992 C "C3'" . C   B 20  ? 0.7514 0.6898 0.5750 0.0134  -0.0381 0.0993  20  C   C "C3'" 
3993 O "O3'" . C   B 20  ? 0.7110 0.6539 0.5249 0.0156  -0.0332 0.0885  20  C   C "O3'" 
3994 C "C2'" . C   B 20  ? 0.7457 0.6785 0.5495 0.0170  -0.0483 0.0867  20  C   C "C2'" 
3995 O "O2'" . C   B 20  ? 0.7521 0.6876 0.5281 0.0266  -0.0469 0.0771  20  C   C "O2'" 
3996 C "C1'" . C   B 20  ? 0.7644 0.6935 0.5747 0.0191  -0.0495 0.1044  20  C   C "C1'" 
3997 N N1    . C   B 20  ? 0.7551 0.6704 0.5868 0.0132  -0.0672 0.1011  20  C   C N1    
3998 C C2    . C   B 20  ? 0.7397 0.6527 0.5580 0.0171  -0.0798 0.0813  20  C   C C2    
3999 O O2    . C   B 20  ? 0.7241 0.6467 0.5217 0.0201  -0.0764 0.0708  20  C   C O2    
4000 N N3    . C   B 20  ? 0.7404 0.6423 0.5712 0.0202  -0.0985 0.0751  20  C   C N3    
4001 C C4    . C   B 20  ? 0.7544 0.6405 0.6153 0.0162  -0.1097 0.0861  20  C   C C4    
4002 N N4    . C   B 20  ? 0.7668 0.6366 0.6375 0.0242  -0.1356 0.0742  20  C   C N4    
4003 C C5    . C   B 20  ? 0.7531 0.6418 0.6383 0.0065  -0.0977 0.1112  20  C   C C5    
4004 C C6    . C   B 20  ? 0.7558 0.6628 0.6226 0.0070  -0.0742 0.1184  20  C   C C6    
4005 P P     . C   B 21  ? 0.6853 0.6264 0.5186 0.0052  -0.0375 0.0787  21  C   C P     
4006 O OP1   . C   B 21  ? 0.6927 0.6376 0.5181 0.0092  -0.0310 0.0738  21  C   C OP1   
4007 O OP2   . C   B 21  ? 0.6740 0.6113 0.5364 -0.0018 -0.0419 0.0874  21  C   C OP2   
4008 O "O5'" . C   B 21  ? 0.6516 0.5920 0.4783 0.0035  -0.0500 0.0642  21  C   C "O5'" 
4009 C "C5'" . C   B 21  ? 0.6088 0.5494 0.4190 0.0071  -0.0551 0.0557  21  C   C "C5'" 
4010 C "C4'" . C   B 21  ? 0.5553 0.5051 0.3735 0.0035  -0.0656 0.0517  21  C   C "C4'" 
4011 O "O4'" . C   B 21  ? 0.5501 0.4996 0.3615 0.0080  -0.0689 0.0535  21  C   C "O4'" 
4012 C "C3'" . C   B 21  ? 0.5171 0.4800 0.3556 -0.0006 -0.0660 0.0532  21  C   C "C3'" 
4013 O "O3'" . C   B 21  ? 0.4935 0.4614 0.3443 -0.0064 -0.0674 0.0534  21  C   C "O3'" 
4014 C "C2'" . C   B 21  ? 0.5007 0.4801 0.3393 0.0052  -0.0734 0.0542  21  C   C "C2'" 
4015 O "O2'" . C   B 21  ? 0.4661 0.4598 0.3117 0.0023  -0.0796 0.0582  21  C   C "O2'" 
4016 C "C1'" . C   B 21  ? 0.5132 0.4772 0.3351 0.0101  -0.0750 0.0523  21  C   C "C1'" 
4017 N N1    . C   B 21  ? 0.5187 0.4729 0.3442 0.0154  -0.0793 0.0517  21  C   C N1    
4018 C C2    . C   B 21  ? 0.5185 0.4826 0.3426 0.0279  -0.0908 0.0457  21  C   C C2    
4019 O O2    . C   B 21  ? 0.5083 0.4975 0.3290 0.0343  -0.0918 0.0460  21  C   C O2    
4020 N N3    . C   B 21  ? 0.5347 0.4822 0.3639 0.0355  -0.1036 0.0409  21  C   C N3    
4021 C C4    . C   B 21  ? 0.5386 0.4640 0.3830 0.0261  -0.1037 0.0481  21  C   C C4    
4022 N N4    . C   B 21  ? 0.5389 0.4449 0.3982 0.0319  -0.1233 0.0449  21  C   C N4    
4023 C C5    . C   B 21  ? 0.5353 0.4598 0.3826 0.0132  -0.0862 0.0602  21  C   C C5    
4024 C C6    . C   B 21  ? 0.5306 0.4681 0.3636 0.0109  -0.0754 0.0584  21  C   C C6    
4025 P P     . A   B 22  ? 0.4901 0.4653 0.3579 -0.0097 -0.0622 0.0558  22  A   C P     
4026 O OP1   . A   B 22  ? 0.4715 0.4462 0.3519 -0.0162 -0.0670 0.0568  22  A   C OP1   
4027 O OP2   . A   B 22  ? 0.4897 0.4525 0.3542 -0.0081 -0.0546 0.0545  22  A   C OP2   
4028 O "O5'" . A   B 22  ? 0.4744 0.4765 0.3521 -0.0032 -0.0652 0.0613  22  A   C "O5'" 
4029 C "C5'" . A   B 22  ? 0.4717 0.4790 0.3498 0.0066  -0.0648 0.0578  22  A   C "C5'" 
4030 C "C4'" . A   B 22  ? 0.4660 0.4996 0.3392 0.0229  -0.0710 0.0596  22  A   C "C4'" 
4031 O "O4'" . A   B 22  ? 0.4846 0.5027 0.3421 0.0273  -0.0775 0.0529  22  A   C "O4'" 
4032 C "C3'" . A   B 22  ? 0.4841 0.5312 0.3549 0.0430  -0.0762 0.0535  22  A   C "C3'" 
4033 O "O3'" . A   B 22  ? 0.4686 0.5492 0.3517 0.0484  -0.0700 0.0650  22  A   C "O3'" 
4034 C "C2'" . A   B 22  ? 0.4922 0.5526 0.3466 0.0637  -0.0862 0.0489  22  A   C "C2'" 
4035 O "O2'" . A   B 22  ? 0.4913 0.5962 0.3484 0.0729  -0.0816 0.0644  22  A   C "O2'" 
4036 C "C1'" . A   B 22  ? 0.5034 0.5315 0.3515 0.0491  -0.0881 0.0453  22  A   C "C1'" 
4037 N N9    . A   B 22  ? 0.5218 0.5160 0.3687 0.0512  -0.0995 0.0339  22  A   C N9    
4038 C C8    . A   B 22  ? 0.5222 0.4880 0.3806 0.0343  -0.0960 0.0369  22  A   C C8    
4039 N N7    . A   B 22  ? 0.5436 0.4856 0.4108 0.0385  -0.1119 0.0318  22  A   C N7    
4040 C C5    . A   B 22  ? 0.5577 0.5076 0.4122 0.0627  -0.1297 0.0184  22  A   C C5    
4041 C C6    . A   B 22  ? 0.5825 0.5112 0.4387 0.0812  -0.1587 0.0038  22  A   C C6    
4042 N N6    . A   B 22  ? 0.5918 0.4850 0.4743 0.0715  -0.1756 0.0056  22  A   C N6    
4043 N N1    . A   B 22  ? 0.5954 0.5428 0.4285 0.1126  -0.1727 -0.0109 22  A   C N1    
4044 C C2    . A   B 22  ? 0.5738 0.5655 0.3897 0.1220  -0.1549 -0.0042 22  A   C C2    
4045 N N3    . A   B 22  ? 0.5466 0.5602 0.3691 0.1012  -0.1290 0.0137  22  A   C N3    
4046 C C4    . A   B 22  ? 0.5407 0.5276 0.3801 0.0728  -0.1194 0.0208  22  A   C C4    
4047 P P     . U   B 23  ? 0.4843 0.5698 0.3682 0.0630  -0.0719 0.0576  23  U   C P     
4048 O OP1   . U   B 23  ? 0.4679 0.5904 0.3688 0.0627  -0.0615 0.0773  23  U   C OP1   
4049 O OP2   . U   B 23  ? 0.4812 0.5240 0.3685 0.0500  -0.0754 0.0445  23  U   C OP2   
4050 O "O5'" . U   B 23  ? 0.5044 0.6077 0.3672 0.0986  -0.0858 0.0461  23  U   C "O5'" 
4051 C "C5'" . U   B 23  ? 0.5222 0.6765 0.3784 0.1201  -0.0822 0.0605  23  U   C "C5'" 
4052 C "C4'" . U   B 23  ? 0.5664 0.7297 0.3943 0.1606  -0.0999 0.0420  23  U   C "C4'" 
4053 O "O4'" . U   B 23  ? 0.5752 0.6954 0.3935 0.1538  -0.1145 0.0251  23  U   C "O4'" 
4054 C "C3'" . U   B 23  ? 0.6008 0.7493 0.4181 0.1850  -0.1163 0.0196  23  U   C "C3'" 
4055 O "O3'" . U   B 23  ? 0.6266 0.8251 0.4422 0.2087  -0.1066 0.0319  23  U   C "O3'" 
4056 C "C2'" . U   B 23  ? 0.6239 0.7600 0.4147 0.2182  -0.1428 -0.0044 23  U   C "C2'" 
4057 O "O2'" . U   B 23  ? 0.6407 0.8348 0.4080 0.2581  -0.1407 0.0030  23  U   C "O2'" 
4058 C "C1'" . U   B 23  ? 0.6069 0.7053 0.4080 0.1837  -0.1412 -0.0017 23  U   C "C1'" 
4059 N N1    . U   B 23  ? 0.6104 0.6467 0.4288 0.1595  -0.1557 -0.0149 23  U   C N1    
4060 C C2    . U   B 23  ? 0.6420 0.6431 0.4555 0.1793  -0.1896 -0.0385 23  U   C C2    
4061 O O2    . U   B 23  ? 0.6728 0.6866 0.4610 0.2193  -0.2103 -0.0553 23  U   C O2    
4062 N N3    . U   B 23  ? 0.6415 0.5932 0.4839 0.1530  -0.2014 -0.0401 23  U   C N3    
4063 C C4    . U   B 23  ? 0.6189 0.5593 0.4868 0.1147  -0.1796 -0.0215 23  U   C C4    
4064 O O4    . U   B 23  ? 0.6210 0.5261 0.5172 0.0969  -0.1912 -0.0184 23  U   C O4    
4065 C C5    . U   B 23  ? 0.5908 0.5658 0.4527 0.1010  -0.1465 -0.0046 23  U   C C5    
4066 C C6    . U   B 23  ? 0.5780 0.5958 0.4199 0.1210  -0.1379 -0.0014 23  U   C C6    
4067 P P     . U   B 24  ? 0.6592 0.8396 0.4784 0.2144  -0.1137 0.0176  24  U   C P     
4068 O OP1   . U   B 24  ? 0.6561 0.9002 0.4725 0.2406  -0.0989 0.0383  24  U   C OP1   
4069 O OP2   . U   B 24  ? 0.6313 0.7616 0.4764 0.1690  -0.1088 0.0165  24  U   C OP2   
4070 O "O5'" . U   B 24  ? 0.7170 0.8662 0.5115 0.2515  -0.1502 -0.0200 24  U   C "O5'" 
4071 C "C5'" . U   B 24  ? 0.7820 0.9708 0.5409 0.3084  -0.1648 -0.0310 24  U   C "C5'" 
4072 C "C4'" . U   B 24  ? 0.8383 0.9770 0.5808 0.3364  -0.2091 -0.0720 24  U   C "C4'" 
4073 O "O4'" . U   B 24  ? 0.8202 0.9084 0.5784 0.3029  -0.2186 -0.0759 24  U   C "O4'" 
4074 C "C3'" . U   B 24  ? 0.8656 0.9585 0.6237 0.3337  -0.2328 -0.0945 24  U   C "C3'" 
4075 O "O3'" . U   B 24  ? 0.9267 1.0557 0.6595 0.3836  -0.2410 -0.1060 24  U   C "O3'" 
4076 C "C2'" . U   B 24  ? 0.8919 0.9226 0.6543 0.3391  -0.2770 -0.1243 24  U   C "C2'" 
4077 O "O2'" . U   B 24  ? 0.9409 0.9815 0.6638 0.4026  -0.3124 -0.1543 24  U   C "O2'" 
4078 C "C1'" . U   B 24  ? 0.8450 0.8686 0.6198 0.2990  -0.2559 -0.1025 24  U   C "C1'" 
4079 N N1    . U   B 24  ? 0.8083 0.7903 0.6268 0.2398  -0.2430 -0.0864 24  U   C N1    
4080 C C2    . U   B 24  ? 0.8269 0.7500 0.6746 0.2261  -0.2759 -0.0990 24  U   C C2    
4081 O O2    . U   B 24  ? 0.8732 0.7680 0.7157 0.2565  -0.3193 -0.1253 24  U   C O2    
4082 N N3    . U   B 24  ? 0.7986 0.6985 0.6852 0.1775  -0.2591 -0.0776 24  U   C N3    
4083 C C4    . U   B 24  ? 0.7559 0.6794 0.6485 0.1454  -0.2167 -0.0521 24  U   C C4    
4084 O O4    . U   B 24  ? 0.7383 0.6412 0.6618 0.1107  -0.2066 -0.0359 24  U   C O4    
4085 C C5    . U   B 24  ? 0.7363 0.7110 0.6000 0.1596  -0.1902 -0.0445 24  U   C C5    
4086 C C6    . U   B 24  ? 0.7573 0.7618 0.5893 0.2034  -0.2022 -0.0579 24  U   C C6    
4087 P P     . U   B 25  ? 0.9587 1.0604 0.7089 0.3800  -0.2537 -0.1200 25  U   C P     
4088 O OP1   . U   B 25  ? 0.9677 1.1337 0.6886 0.4267  -0.2414 -0.1144 25  U   C OP1   
4089 O OP2   . U   B 25  ? 0.9228 0.9900 0.7182 0.3139  -0.2327 -0.1006 25  U   C OP2   
4090 O "O5'" . U   B 25  ? 1.0263 1.0648 0.7753 0.4074  -0.3143 -0.1651 25  U   C "O5'" 
4091 C "C5'" . U   B 25  ? 1.0932 1.1435 0.7971 0.4777  -0.3520 -0.1977 25  U   C "C5'" 
4092 C "C4'" . U   B 25  ? 1.1469 1.1197 0.8674 0.4902  -0.4169 -0.2394 25  U   C "C4'" 
4093 O "O4'" . U   B 25  ? 1.1256 1.0498 0.8810 0.4440  -0.4241 -0.2310 25  U   C "O4'" 
4094 C "C3'" . U   B 25  ? 1.1527 1.0813 0.9141 0.4684  -0.4370 -0.2492 25  U   C "C3'" 
4095 O "O3'" . U   B 25  ? 1.2111 1.1619 0.9391 0.5273  -0.4577 -0.2755 25  U   C "O3'" 
4096 C "C2'" . U   B 25  ? 1.1799 1.0285 0.9831 0.4521  -0.4924 -0.2701 25  U   C "C2'" 
4097 O "O2'" . U   B 25  ? 1.2580 1.0791 1.0340 0.5175  -0.5579 -0.3177 25  U   C "O2'" 
4098 C "C1'" . U   B 25  ? 1.1319 0.9857 0.9416 0.4138  -0.4618 -0.2419 25  U   C "C1'" 
4099 N N1    . U   B 25  ? 1.0620 0.9056 0.9227 0.3386  -0.4210 -0.2015 25  U   C N1    
4100 C C2    . U   B 25  ? 1.0635 0.8491 0.9864 0.3004  -0.4482 -0.1968 25  U   C C2    
4101 O O2    . U   B 25  ? 1.1082 0.8435 1.0563 0.3181  -0.5077 -0.2227 25  U   C O2    
4102 N N3    . U   B 25  ? 1.0128 0.8033 0.9718 0.2416  -0.4053 -0.1580 25  U   C N3    
4103 C C4    . U   B 25  ? 0.9642 0.8014 0.9032 0.2181  -0.3456 -0.1299 25  U   C C4    
4104 O O4    . U   B 25  ? 0.9311 0.7654 0.9021 0.1722  -0.3170 -0.1010 25  U   C O4    
4105 C C5    . U   B 25  ? 0.9552 0.8444 0.8382 0.2546  -0.3248 -0.1360 25  U   C C5    
4106 C C6    . U   B 25  ? 1.0009 0.8956 0.8486 0.3119  -0.3596 -0.1678 25  U   C C6    
4107 P P     . A   B 26  ? 1.2058 1.1549 0.9605 0.5067  -0.4458 -0.2689 26  A   C P     
4108 O OP1   . A   B 26  ? 1.2475 1.2359 0.9513 0.5810  -0.4623 -0.2945 26  A   C OP1   
4109 O OP2   . A   B 26  ? 1.1362 1.1128 0.9169 0.4429  -0.3821 -0.2212 26  A   C OP2   
4110 O "O5'" . A   B 26  ? 1.2297 1.0915 1.0458 0.4769  -0.4999 -0.2896 26  A   C "O5'" 
4111 C "C5'" . A   B 26  ? 1.3000 1.1128 1.1124 0.5276  -0.5759 -0.3384 26  A   C "C5'" 
4112 C "C4'" . A   B 26  ? 1.3071 1.0402 1.1984 0.4813  -0.6209 -0.3405 26  A   C "C4'" 
4113 O "O4'" . A   B 26  ? 1.2703 0.9914 1.1921 0.4284  -0.5974 -0.3082 26  A   C "O4'" 
4114 C "C3'" . A   B 26  ? 1.2727 0.9916 1.2229 0.4311  -0.6067 -0.3190 26  A   C "C3'" 
4115 O "O3'" . A   B 26  ? 1.3204 1.0266 1.2648 0.4734  -0.6478 -0.3536 26  A   C "O3'" 
4116 C "C2'" . A   B 26  ? 1.2677 0.9268 1.2975 0.3782  -0.6353 -0.3019 26  A   C "C2'" 
4117 O "O2'" . A   B 26  ? 1.3416 0.9353 1.4052 0.4059  -0.7207 -0.3386 26  A   C "O2'" 
4118 C "C1'" . A   B 26  ? 1.2389 0.9190 1.2416 0.3657  -0.6017 -0.2823 26  A   C "C1'" 
4119 N N9    . A   B 26  ? 1.1618 0.8783 1.1766 0.3074  -0.5290 -0.2333 26  A   C N9    
4120 C C8    . A   B 26  ? 1.1139 0.8916 1.0806 0.3055  -0.4660 -0.2141 26  A   C C8    
4121 N N7    . A   B 26  ? 1.0560 0.8470 1.0478 0.2508  -0.4176 -0.1746 26  A   C N7    
4122 C C5    . A   B 26  ? 1.0657 0.8092 1.1249 0.2157  -0.4452 -0.1630 26  A   C C5    
4123 C C6    . A   B 26  ? 1.0324 0.7709 1.1427 0.1601  -0.4183 -0.1227 26  A   C C6    
4124 N N6    . A   B 26  ? 0.9836 0.7595 1.0781 0.1313  -0.3590 -0.0931 26  A   C N6    
4125 N N1    . A   B 26  ? 1.0559 0.7516 1.2371 0.1381  -0.4574 -0.1120 26  A   C N1    
4126 C C2    . A   B 26  ? 1.1106 0.7615 1.3136 0.1672  -0.5254 -0.1438 26  A   C C2    
4127 N N3    . A   B 26  ? 1.1518 0.7959 1.3057 0.2231  -0.5608 -0.1902 26  A   C N3    
4128 C C4    . A   B 26  ? 1.1271 0.8234 1.2071 0.2464  -0.5145 -0.1962 26  A   C C4    
4129 P P     . C   B 27  ? 1.2904 1.0251 1.2470 0.4519  -0.6098 -0.3358 27  C   C P     
4130 O OP1   . C   B 27  ? 1.3521 1.0743 1.2864 0.5144  -0.6624 -0.3817 27  C   C OP1   
4131 O OP2   . C   B 27  ? 1.2184 1.0224 1.1374 0.4327  -0.5294 -0.2986 27  C   C OP2   
4132 O "O5'" . C   B 27  ? 1.2626 0.9511 1.3145 0.3782  -0.6154 -0.3062 27  C   C "O5'" 
4133 C "C5'" . C   B 27  ? 1.3083 0.9287 1.4256 0.3780  -0.6912 -0.3273 27  C   C "C5'" 
4134 C "C4'" . C   B 27  ? 1.2703 0.8645 1.4790 0.3046  -0.6838 -0.2823 27  C   C "C4'" 
4135 O "O4'" . C   B 27  ? 1.2345 0.8437 1.4349 0.2755  -0.6456 -0.2522 27  C   C "O4'" 
4136 C "C3'" . C   B 27  ? 1.2091 0.8344 1.4493 0.2561  -0.6290 -0.2429 27  C   C "C3'" 
4137 O "O3'" . C   B 27  ? 1.2263 0.8318 1.5033 0.2644  -0.6646 -0.2589 27  C   C "O3'" 
4138 C "C2'" . C   B 27  ? 1.1764 0.7923 1.4831 0.1954  -0.6112 -0.1944 27  C   C "C2'" 
4139 O "O2'" . C   B 27  ? 1.2164 0.7788 1.6137 0.1783  -0.6754 -0.1890 27  C   C "O2'" 
4140 C "C1'" . C   B 27  ? 1.1694 0.7961 1.4198 0.2112  -0.5958 -0.1997 27  C   C "C1'" 
4141 N N1    . C   B 27  ? 1.1054 0.7912 1.2970 0.1976  -0.5158 -0.1760 27  C   C N1    
4142 C C2    . C   B 27  ? 1.0590 0.7608 1.2788 0.1461  -0.4699 -0.1300 27  C   C C2    
4143 O O2    . C   B 27  ? 1.0664 0.7420 1.3579 0.1133  -0.4898 -0.1046 27  C   C O2    
4144 N N3    . C   B 27  ? 1.0080 0.7558 1.1785 0.1360  -0.4071 -0.1126 27  C   C N3    
4145 C C4    . C   B 27  ? 1.0053 0.7856 1.1099 0.1699  -0.3878 -0.1326 27  C   C C4    
4146 N N4    . C   B 27  ? 0.9653 0.7869 1.0346 0.1558  -0.3322 -0.1116 27  C   C N4    
4147 C C5    . C   B 27  ? 1.0497 0.8238 1.1245 0.2229  -0.4274 -0.1730 27  C   C C5    
4148 C C6    . C   B 27  ? 1.0962 0.8215 1.2112 0.2371  -0.4910 -0.1966 27  C   C C6    
4149 P P     . U   B 28  ? 1.1767 0.8269 1.4424 0.2464  -0.6078 -0.2396 28  U   C P     
4150 O OP1   . U   B 28  ? 1.2097 0.8338 1.5011 0.2717  -0.6588 -0.2695 28  U   C OP1   
4151 O OP2   . U   B 28  ? 1.1372 0.8441 1.3181 0.2624  -0.5443 -0.2357 28  U   C OP2   
4152 O "O5'" . U   B 28  ? 1.1049 0.7618 1.4441 0.1755  -0.5711 -0.1822 28  U   C "O5'" 
4153 C "C5'" . U   B 28  ? 1.0877 0.7071 1.5272 0.1449  -0.6159 -0.1633 28  U   C "C5'" 
4154 C "C4'" . U   B 28  ? 1.0085 0.6562 1.4975 0.0867  -0.5646 -0.1026 28  U   C "C4'" 
4155 O "O4'" . U   B 28  ? 0.9800 0.6424 1.4332 0.0775  -0.5309 -0.0868 28  U   C "O4'" 
4156 C "C3'" . U   B 28  ? 0.9376 0.6353 1.3986 0.0695  -0.4968 -0.0814 28  U   C "C3'" 
4157 O "O3'" . U   B 28  ? 0.9166 0.6123 1.4200 0.0658  -0.5122 -0.0820 28  U   C "O3'" 
4158 C "C2'" . U   B 28  ? 0.8988 0.6222 1.3886 0.0262  -0.4521 -0.0286 28  U   C "C2'" 
4159 O "O2'" . U   B 28  ? 0.9027 0.6174 1.4933 -0.0073 -0.4746 0.0120  28  U   C "O2'" 
4160 C "C1'" . U   B 28  ? 0.9126 0.6202 1.3636 0.0412  -0.4624 -0.0429 28  U   C "C1'" 
4161 N N1    . U   B 28  ? 0.8788 0.6206 1.2378 0.0551  -0.4090 -0.0529 28  U   C N1    
4162 C C2    . U   B 28  ? 0.8370 0.6123 1.1859 0.0260  -0.3529 -0.0165 28  U   C C2    
4163 O O2    . U   B 28  ? 0.8222 0.6067 1.2261 -0.0061 -0.3405 0.0237  28  U   C O2    
4164 N N3    . U   B 28  ? 0.8160 0.6174 1.0894 0.0388  -0.3132 -0.0268 28  U   C N3    
4165 C C4    . U   B 28  ? 0.8255 0.6315 1.0373 0.0761  -0.3189 -0.0621 28  U   C C4    
4166 O O4    . U   B 28  ? 0.7978 0.6328 0.9571 0.0803  -0.2809 -0.0597 28  U   C O4    
4167 C C5    . U   B 28  ? 0.8664 0.6440 1.0855 0.1100  -0.3735 -0.0975 28  U   C C5    
4168 C C6    . U   B 28  ? 0.8935 0.6365 1.1830 0.0988  -0.4181 -0.0950 28  U   C C6    
4169 P P     . U   B 29  ? 0.8747 0.5986 1.3106 0.0913  -0.4810 -0.1070 29  U   C P     
4170 O OP1   . U   B 29  ? 0.9230 0.6145 1.3795 0.1223  -0.5416 -0.1443 29  U   C OP1   
4171 O OP2   . U   B 29  ? 0.8603 0.6119 1.2046 0.1124  -0.4390 -0.1196 29  U   C OP2   
4172 O "O5'" . U   B 29  ? 0.7973 0.5585 1.2658 0.0503  -0.4285 -0.0623 29  U   C "O5'" 
4173 C "C5'" . U   B 29  ? 0.7011 0.5015 1.1193 0.0368  -0.3634 -0.0416 29  U   C "C5'" 
4174 C "C4'" . U   B 29  ? 0.6461 0.4644 1.1150 -0.0031 -0.3371 0.0088  29  U   C "C4'" 
4175 O "O4'" . U   B 29  ? 0.6399 0.4525 1.0918 -0.0065 -0.3331 0.0159  29  U   C "O4'" 
4176 C "C3'" . U   B 29  ? 0.5911 0.4521 1.0243 -0.0156 -0.2747 0.0293  29  U   C "C3'" 
4177 O "O3'" . U   B 29  ? 0.5597 0.4350 1.0382 -0.0273 -0.2717 0.0456  29  U   C "O3'" 
4178 C "C2'" . U   B 29  ? 0.5700 0.4494 1.0044 -0.0361 -0.2440 0.0637  29  U   C "C2'" 
4179 O "O2'" . U   B 29  ? 0.5792 0.4719 1.0923 -0.0615 -0.2470 0.1085  29  U   C "O2'" 
4180 C "C1'" . U   B 29  ? 0.5840 0.4326 0.9991 -0.0216 -0.2749 0.0410  29  U   C "C1'" 
4181 N N1    . U   B 29  ? 0.5632 0.4170 0.8929 0.0010  -0.2546 0.0121  29  U   C N1    
4182 C C2    . U   B 29  ? 0.5195 0.3994 0.8062 -0.0079 -0.2079 0.0270  29  U   C C2    
4183 O O2    . U   B 29  ? 0.5023 0.4026 0.8056 -0.0288 -0.1793 0.0589  29  U   C O2    
4184 N N3    . U   B 29  ? 0.5185 0.4033 0.7412 0.0123  -0.1972 0.0037  29  U   C N3    
4185 C C4    . U   B 29  ? 0.5468 0.4213 0.7392 0.0440  -0.2229 -0.0295 29  U   C C4    
4186 O O4    . U   B 29  ? 0.5453 0.4363 0.6856 0.0602  -0.2062 -0.0394 29  U   C O4    
4187 C C5    . U   B 29  ? 0.5857 0.4330 0.8153 0.0580  -0.2708 -0.0482 29  U   C C5    
4188 C C6    . U   B 29  ? 0.5870 0.4215 0.8848 0.0344  -0.2867 -0.0280 29  U   C C6    
4189 P P     . C   B 30  ? 0.5304 0.4259 0.9549 -0.0142 -0.2400 0.0279  30  C   C P     
4190 O OP1   . C   B 30  ? 0.5201 0.4264 1.0024 -0.0258 -0.2458 0.0446  30  C   C OP1   
4191 O OP2   . C   B 30  ? 0.5289 0.4089 0.8912 0.0183  -0.2536 -0.0152 30  C   C OP2   
4192 O "O5'" . C   B 30  ? 0.4585 0.3865 0.8369 -0.0252 -0.1832 0.0491  30  C   C "O5'" 
4193 C "C5'" . C   B 30  ? 0.3932 0.3482 0.8066 -0.0469 -0.1583 0.0912  30  C   C "C5'" 
4194 C "C4'" . C   B 30  ? 0.3445 0.3178 0.6967 -0.0457 -0.1168 0.0955  30  C   C "C4'" 
4195 O "O4'" . C   B 30  ? 0.3333 0.2872 0.6564 -0.0403 -0.1269 0.0815  30  C   C "O4'" 
4196 C "C3'" . C   B 30  ? 0.3071 0.2861 0.5984 -0.0327 -0.0940 0.0723  30  C   C "C3'" 
4197 O "O3'" . C   B 30  ? 0.2540 0.2552 0.5586 -0.0358 -0.0760 0.0852  30  C   C "O3'" 
4198 C "C2'" . C   B 30  ? 0.2967 0.2810 0.5414 -0.0327 -0.0707 0.0750  30  C   C "C2'" 
4199 O "O2'" . C   B 30  ? 0.2902 0.2996 0.5415 -0.0405 -0.0452 0.1039  30  C   C "O2'" 
4200 C "C1'" . C   B 30  ? 0.3242 0.2872 0.5817 -0.0327 -0.0973 0.0701  30  C   C "C1'" 
4201 N N1    . C   B 30  ? 0.3285 0.2742 0.5454 -0.0143 -0.1126 0.0376  30  C   C N1    
4202 C C2    . C   B 30  ? 0.3130 0.2661 0.4778 -0.0089 -0.0918 0.0313  30  C   C C2    
4203 O O2    . C   B 30  ? 0.3051 0.2711 0.4568 -0.0188 -0.0659 0.0468  30  C   C O2    
4204 N N3    . C   B 30  ? 0.3168 0.2657 0.4493 0.0100  -0.1027 0.0097  30  C   C N3    
4205 C C4    . C   B 30  ? 0.3369 0.2736 0.4785 0.0286  -0.1335 -0.0101 30  C   C C4    
4206 N N4    . C   B 30  ? 0.3533 0.2958 0.4575 0.0542  -0.1409 -0.0284 30  C   C N4    
4207 C C5    . C   B 30  ? 0.3492 0.2697 0.5407 0.0247  -0.1605 -0.0107 30  C   C C5    
4208 C C6    . C   B 30  ? 0.3472 0.2735 0.5792 0.0004  -0.1486 0.0159  30  C   C C6    
4209 P P     . C   B 31  ? 0.2471 0.2518 0.5103 -0.0241 -0.0614 0.0646  31  C   C P     
4210 O OP1   . C   B 31  ? 0.2195 0.2498 0.5087 -0.0285 -0.0453 0.0852  31  C   C OP1   
4211 O OP2   . C   B 31  ? 0.2503 0.2346 0.5022 -0.0102 -0.0858 0.0349  31  C   C OP2   
4212 O "O5'" . C   B 31  ? 0.2244 0.2309 0.4284 -0.0201 -0.0375 0.0590  31  C   C "O5'" 
4213 C "C5'" . C   B 31  ? 0.2334 0.2582 0.4239 -0.0228 -0.0127 0.0773  31  C   C "C5'" 
4214 C "C4'" . C   B 31  ? 0.2201 0.2366 0.3576 -0.0170 -0.0020 0.0637  31  C   C "C4'" 
4215 O "O4'" . C   B 31  ? 0.2325 0.2339 0.3616 -0.0185 -0.0150 0.0557  31  C   C "O4'" 
4216 C "C3'" . C   B 31  ? 0.2247 0.2335 0.3363 -0.0098 -0.0018 0.0451  31  C   C "C3'" 
4217 O "O3'" . C   B 31  ? 0.2170 0.2361 0.3204 -0.0050 0.0118  0.0480  31  C   C "O3'" 
4218 C "C2'" . C   B 31  ? 0.2216 0.2204 0.3006 -0.0088 -0.0020 0.0377  31  C   C "C2'" 
4219 O "O2'" . C   B 31  ? 0.2280 0.2276 0.2847 -0.0084 0.0092  0.0424  31  C   C "O2'" 
4220 C "C1'" . C   B 31  ? 0.2257 0.2197 0.3185 -0.0122 -0.0138 0.0403  31  C   C "C1'" 
4221 N N1    . C   B 31  ? 0.2198 0.2068 0.3143 -0.0038 -0.0326 0.0264  31  C   C N1    
4222 C C2    . C   B 31  ? 0.2290 0.2178 0.2959 0.0042  -0.0336 0.0198  31  C   C C2    
4223 O O2    . C   B 31  ? 0.2176 0.2091 0.2650 -0.0003 -0.0220 0.0253  31  C   C O2    
4224 N N3    . C   B 31  ? 0.2324 0.2227 0.2961 0.0202  -0.0500 0.0082  31  C   C N3    
4225 C C4    . C   B 31  ? 0.2462 0.2279 0.3320 0.0281  -0.0702 -0.0020 31  C   C C4    
4226 N N4    . C   B 31  ? 0.2503 0.2334 0.3247 0.0517  -0.0896 -0.0177 31  C   C N4    
4227 C C5    . C   B 31  ? 0.2515 0.2257 0.3739 0.0149  -0.0735 0.0050  31  C   C C5    
4228 C C6    . C   B 31  ? 0.2325 0.2140 0.3582 -0.0007 -0.0516 0.0218  31  C   C C6    
4229 P P     . A   B 32  ? 0.2141 0.2289 0.3100 0.0011  0.0100  0.0348  32  A   C P     
4230 O OP1   . A   B 32  ? 0.2246 0.2507 0.3139 0.0084  0.0223  0.0388  32  A   C OP1   
4231 O OP2   . A   B 32  ? 0.2011 0.2135 0.3220 0.0014  -0.0049 0.0285  32  A   C OP2   
4232 O "O5'" . A   B 32  ? 0.1883 0.1896 0.2534 0.0028  0.0071  0.0251  32  A   C "O5'" 
4233 C "C5'" . A   B 32  ? 0.2046 0.1991 0.2458 0.0041  0.0114  0.0253  32  A   C "C5'" 
4234 C "C4'" . A   B 32  ? 0.2010 0.1854 0.2309 0.0014  0.0034  0.0229  32  A   C "C4'" 
4235 O "O4'" . A   B 32  ? 0.2100 0.1984 0.2436 -0.0022 -0.0002 0.0260  32  A   C "O4'" 
4236 C "C3'" . A   B 32  ? 0.2042 0.1910 0.2402 0.0040  -0.0012 0.0218  32  A   C "C3'" 
4237 O "O3'" . A   B 32  ? 0.2105 0.1880 0.2414 0.0069  -0.0026 0.0186  32  A   C "O3'" 
4238 C "C2'" . A   B 32  ? 0.1836 0.1737 0.2171 0.0012  -0.0066 0.0297  32  A   C "C2'" 
4239 O "O2'" . A   B 32  ? 0.2084 0.1853 0.2362 -0.0043 -0.0125 0.0333  32  A   C "O2'" 
4240 C "C1'" . A   B 32  ? 0.1946 0.1882 0.2272 0.0001  -0.0057 0.0285  32  A   C "C1'" 
4241 N N9    . A   B 32  ? 0.1904 0.1952 0.2299 0.0087  -0.0109 0.0251  32  A   C N9    
4242 C C8    . A   B 32  ? 0.1890 0.1933 0.2421 0.0137  -0.0162 0.0171  32  A   C C8    
4243 N N7    . A   B 32  ? 0.1845 0.1949 0.2380 0.0269  -0.0279 0.0104  32  A   C N7    
4244 C C5    . A   B 32  ? 0.2029 0.2256 0.2403 0.0317  -0.0254 0.0179  32  A   C C5    
4245 C C6    . A   B 32  ? 0.1938 0.2348 0.2198 0.0510  -0.0325 0.0175  32  A   C C6    
4246 N N6    . A   B 32  ? 0.2099 0.2532 0.2338 0.0728  -0.0487 0.0022  32  A   C N6    
4247 N N1    . A   B 32  ? 0.1956 0.2540 0.2136 0.0504  -0.0253 0.0337  32  A   C N1    
4248 C C2    . A   B 32  ? 0.1981 0.2485 0.2216 0.0306  -0.0172 0.0458  32  A   C C2    
4249 N N3    . A   B 32  ? 0.2037 0.2316 0.2324 0.0152  -0.0139 0.0417  32  A   C N3    
4250 C C4    . A   B 32  ? 0.1993 0.2177 0.2329 0.0176  -0.0156 0.0288  32  A   C C4    
4251 P P     . C   B 33  ? 0.2180 0.1994 0.2576 0.0123  -0.0031 0.0165  33  C   C P     
4252 O OP1   . C   B 33  ? 0.1905 0.1565 0.2218 0.0161  -0.0082 0.0114  33  C   C OP1   
4253 O OP2   . C   B 33  ? 0.2103 0.2036 0.2618 0.0157  0.0018  0.0126  33  C   C OP2   
4254 O "O5'" . C   B 33  ? 0.2105 0.2022 0.2573 0.0124  -0.0080 0.0274  33  C   C "O5'" 
4255 C "C5'" . C   B 33  ? 0.2253 0.2119 0.2764 0.0065  -0.0159 0.0398  33  C   C "C5'" 
4256 C "C4'" . C   B 33  ? 0.2162 0.2291 0.2785 0.0112  -0.0152 0.0580  33  C   C "C4'" 
4257 O "O4'" . C   B 33  ? 0.2390 0.2668 0.2936 0.0164  -0.0111 0.0562  33  C   C "O4'" 
4258 C "C3'" . C   B 33  ? 0.2050 0.2341 0.2702 0.0242  -0.0113 0.0582  33  C   C "C3'" 
4259 O "O3'" . C   B 33  ? 0.1988 0.2221 0.2769 0.0213  -0.0165 0.0687  33  C   C "O3'" 
4260 C "C2'" . C   B 33  ? 0.2065 0.2696 0.2709 0.0384  -0.0083 0.0713  33  C   C "C2'" 
4261 O "O2'" . C   B 33  ? 0.2037 0.2896 0.2846 0.0374  -0.0088 0.1018  33  C   C "O2'" 
4262 C "C1'" . C   B 33  ? 0.2365 0.2931 0.2911 0.0340  -0.0088 0.0624  33  C   C "C1'" 
4263 N N1    . C   B 33  ? 0.2283 0.2850 0.2731 0.0464  -0.0110 0.0422  33  C   C N1    
4264 C C2    . C   B 33  ? 0.2349 0.3177 0.2710 0.0705  -0.0147 0.0421  33  C   C C2    
4265 O O2    . C   B 33  ? 0.2426 0.3565 0.2781 0.0822  -0.0104 0.0631  33  C   C O2    
4266 N N3    . C   B 33  ? 0.2598 0.3349 0.2910 0.0830  -0.0256 0.0205  33  C   C N3    
4267 C C4    . C   B 33  ? 0.2515 0.2995 0.2943 0.0680  -0.0299 0.0070  33  C   C C4    
4268 N N4    . C   B 33  ? 0.2453 0.2847 0.2944 0.0787  -0.0464 -0.0103 33  C   C N4    
4269 C C5    . C   B 33  ? 0.2317 0.2629 0.2823 0.0447  -0.0199 0.0124  33  C   C C5    
4270 C C6    . C   B 33  ? 0.2384 0.2722 0.2855 0.0370  -0.0122 0.0263  33  C   C C6    
4271 P P     . C   B 34  ? 0.2208 0.2282 0.2944 0.0254  -0.0163 0.0518  34  C   C P     
4272 O OP1   . C   B 34  ? 0.2150 0.2169 0.3053 0.0227  -0.0254 0.0673  34  C   C OP1   
4273 O OP2   . C   B 34  ? 0.2325 0.2195 0.2931 0.0216  -0.0149 0.0319  34  C   C OP2   
4274 O "O5'" . C   B 34  ? 0.2017 0.2321 0.2700 0.0417  -0.0090 0.0446  34  C   C "O5'" 
4275 C "C5'" . C   B 34  ? 0.1880 0.2385 0.2606 0.0556  -0.0079 0.0540  34  C   C "C5'" 
4276 C "C4'" . C   B 34  ? 0.2018 0.2445 0.2710 0.0630  -0.0076 0.0342  34  C   C "C4'" 
4277 O "O4'" . C   B 34  ? 0.1817 0.2278 0.2464 0.0705  -0.0094 0.0171  34  C   C "O4'" 
4278 C "C3'" . C   B 34  ? 0.1950 0.2108 0.2647 0.0518  -0.0084 0.0220  34  C   C "C3'" 
4279 O "O3'" . C   B 34  ? 0.1815 0.1881 0.2568 0.0506  -0.0133 0.0306  34  C   C "O3'" 
4280 C "C2'" . C   B 34  ? 0.1910 0.2097 0.2622 0.0593  -0.0066 0.0044  34  C   C "C2'" 
4281 O "O2'" . C   B 34  ? 0.1867 0.2126 0.2604 0.0713  -0.0079 0.0016  34  C   C "O2'" 
4282 C "C1'" . C   B 34  ? 0.1852 0.2164 0.2565 0.0656  -0.0098 0.0014  34  C   C "C1'" 
4283 N N1    . C   B 34  ? 0.1861 0.2093 0.2624 0.0551  -0.0103 -0.0040 34  C   C N1    
4284 C C2    . C   B 34  ? 0.1910 0.2130 0.2848 0.0549  -0.0151 -0.0138 34  C   C C2    
4285 O O2    . C   B 34  ? 0.1936 0.2189 0.2974 0.0631  -0.0196 -0.0212 34  C   C O2    
4286 N N3    . C   B 34  ? 0.2045 0.2231 0.3094 0.0450  -0.0161 -0.0117 34  C   C N3    
4287 C C4    . C   B 34  ? 0.1953 0.2101 0.2877 0.0374  -0.0116 -0.0048 34  C   C C4    
4288 N N4    . C   B 34  ? 0.1850 0.1981 0.2898 0.0288  -0.0124 -0.0010 34  C   C N4    
4289 C C5    . C   B 34  ? 0.1941 0.2084 0.2670 0.0377  -0.0078 0.0020  34  C   C C5    
4290 C C6    . C   B 34  ? 0.2011 0.2205 0.2701 0.0457  -0.0078 0.0042  34  C   C C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   3   3   VAL VAL A . n 
A 1 2   GLU 2   4   4   GLU GLU A . n 
A 1 3   GLU 3   5   5   GLU GLU A . n 
A 1 4   ILE 4   6   6   ILE ILE A . n 
A 1 5   LEU 5   7   7   LEU LEU A . n 
A 1 6   GLU 6   8   8   GLU GLU A . n 
A 1 7   LYS 7   9   9   LYS LYS A . n 
A 1 8   ALA 8   10  10  ALA ALA A . n 
A 1 9   LEU 9   11  11  LEU LEU A . n 
A 1 10  GLU 10  12  12  GLU GLU A . n 
A 1 11  LEU 11  13  13  LEU LEU A . n 
A 1 12  VAL 12  14  14  VAL VAL A . n 
A 1 13  ILE 13  15  15  ILE ILE A . n 
A 1 14  PRO 14  16  16  PRO PRO A . n 
A 1 15  ASP 15  17  17  ASP ASP A . n 
A 1 16  GLU 16  18  18  GLU GLU A . n 
A 1 17  GLU 17  19  19  GLU GLU A . n 
A 1 18  GLU 18  20  20  GLU GLU A . n 
A 1 19  VAL 19  21  21  VAL VAL A . n 
A 1 20  ARG 20  22  22  ARG ARG A . n 
A 1 21  LYS 21  23  23  LYS LYS A . n 
A 1 22  GLY 22  24  24  GLY GLY A . n 
A 1 23  ARG 23  25  25  ARG ARG A . n 
A 1 24  GLU 24  26  26  GLU GLU A . n 
A 1 25  ALA 25  27  27  ALA ALA A . n 
A 1 26  GLU 26  28  28  GLU GLU A . n 
A 1 27  GLU 27  29  29  GLU GLU A . n 
A 1 28  GLU 28  30  30  GLU GLU A . n 
A 1 29  LEU 29  31  31  LEU LEU A . n 
A 1 30  ARG 30  32  32  ARG ARG A . n 
A 1 31  ARG 31  33  33  ARG ARG A . n 
A 1 32  ARG 32  34  34  ARG ARG A . n 
A 1 33  LEU 33  35  35  LEU LEU A . n 
A 1 34  ASP 34  36  36  ASP ASP A . n 
A 1 35  GLU 35  37  37  GLU GLU A . n 
A 1 36  LEU 36  38  38  LEU LEU A . n 
A 1 37  GLY 37  39  39  GLY GLY A . n 
A 1 38  VAL 38  40  40  VAL VAL A . n 
A 1 39  GLU 39  41  41  GLU GLU A . n 
A 1 40  TYR 40  42  42  TYR TYR A . n 
A 1 41  VAL 41  43  43  VAL VAL A . n 
A 1 42  PHE 42  44  44  PHE PHE A . n 
A 1 43  VAL 43  45  45  VAL VAL A . n 
A 1 44  GLY 44  46  46  GLY GLY A . n 
A 1 45  SER 45  47  47  SER SER A . n 
A 1 46  TYR 46  48  48  TYR TYR A . n 
A 1 47  ALA 47  49  49  ALA ALA A . n 
A 1 48  ARG 48  50  50  ARG ARG A . n 
A 1 49  ASN 49  51  51  ASN ASN A . n 
A 1 50  THR 50  52  52  THR THR A . n 
A 1 51  TRP 51  53  53  TRP TRP A . n 
A 1 52  LEU 52  54  54  LEU LEU A . n 
A 1 53  LYS 53  55  55  LYS LYS A . n 
A 1 54  GLY 54  56  56  GLY GLY A . n 
A 1 55  SER 55  57  57  SER SER A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  GLU 57  59  59  GLU GLU A . n 
A 1 58  ILE 58  60  60  ILE ILE A . n 
A 1 59  ASP 59  61  61  ASP ASP A . n 
A 1 60  VAL 60  62  62  VAL VAL A . n 
A 1 61  PHE 61  63  63  PHE PHE A . n 
A 1 62  LEU 62  64  64  LEU LEU A . n 
A 1 63  LEU 63  65  65  LEU LEU A . n 
A 1 64  PHE 64  66  66  PHE PHE A . n 
A 1 65  PRO 65  67  67  PRO PRO A . n 
A 1 66  GLU 66  68  68  GLU GLU A . n 
A 1 67  GLU 67  69  69  GLU GLU A . n 
A 1 68  PHE 68  70  70  PHE PHE A . n 
A 1 69  SER 69  71  71  SER SER A . n 
A 1 70  LYS 70  72  72  LYS LYS A . n 
A 1 71  GLU 71  73  73  GLU GLU A . n 
A 1 72  GLU 72  74  74  GLU GLU A . n 
A 1 73  LEU 73  75  75  LEU LEU A . n 
A 1 74  ARG 74  76  76  ARG ARG A . n 
A 1 75  GLU 75  77  77  GLU GLU A . n 
A 1 76  ARG 76  78  78  ARG ARG A . n 
A 1 77  GLY 77  79  79  GLY GLY A . n 
A 1 78  LEU 78  80  80  LEU LEU A . n 
A 1 79  GLU 79  81  81  GLU GLU A . n 
A 1 80  ILE 80  82  82  ILE ILE A . n 
A 1 81  GLY 81  83  83  GLY GLY A . n 
A 1 82  LYS 82  84  84  LYS LYS A . n 
A 1 83  ALA 83  85  85  ALA ALA A . n 
A 1 84  VAL 84  86  86  VAL VAL A . n 
A 1 85  LEU 85  87  87  LEU LEU A . n 
A 1 86  ASP 86  88  88  ASP ASP A . n 
A 1 87  SER 87  89  89  SER SER A . n 
A 1 88  TYR 88  90  90  TYR TYR A . n 
A 1 89  GLU 89  91  91  GLU GLU A . n 
A 1 90  ILE 90  92  92  ILE ILE A . n 
A 1 91  ARG 91  93  93  ARG ARG A . n 
A 1 92  TYR 92  94  94  TYR TYR A . n 
A 1 93  ALA 93  95  95  ALA ALA A . n 
A 1 94  GLU 94  96  96  GLU GLU A . n 
A 1 95  HIS 95  97  97  HIS HIS A . n 
A 1 96  PRO 96  98  98  PRO PRO A . n 
A 1 97  TYR 97  99  99  TYR TYR A . n 
A 1 98  VAL 98  100 100 VAL VAL A . n 
A 1 99  HIS 99  101 101 HIS HIS A . n 
A 1 100 GLY 100 102 102 GLY GLY A . n 
A 1 101 VAL 101 103 103 VAL VAL A . n 
A 1 102 VAL 102 104 104 VAL VAL A . n 
A 1 103 LYS 103 105 105 LYS LYS A . n 
A 1 104 GLY 104 106 106 GLY GLY A . n 
A 1 105 VAL 105 107 107 VAL VAL A . n 
A 1 106 GLU 106 108 108 GLU GLU A . n 
A 1 107 VAL 107 109 109 VAL VAL A . n 
A 1 108 ASP 108 110 110 ASP ASP A . n 
A 1 109 VAL 109 111 111 VAL VAL A . n 
A 1 110 VAL 110 112 112 VAL VAL A . n 
A 1 111 PRO 111 113 113 PRO PRO A . n 
A 1 112 CYS 112 114 114 CYS CYS A . n 
A 1 113 TYR 113 115 115 TYR TYR A . n 
A 1 114 LYS 114 116 116 LYS LYS A . n 
A 1 115 LEU 115 117 117 LEU LEU A . n 
A 1 116 LYS 116 118 118 LYS LYS A . n 
A 1 117 GLU 117 119 119 GLU GLU A . n 
A 1 118 PRO 118 120 120 PRO PRO A . n 
A 1 119 LYS 119 121 121 LYS LYS A . n 
A 1 120 ASN 120 122 122 ASN ASN A . n 
A 1 121 ILE 121 123 123 ILE ILE A . n 
A 1 122 LYS 122 124 124 LYS LYS A . n 
A 1 123 SER 123 125 125 SER SER A . n 
A 1 124 ALA 124 126 126 ALA ALA A . n 
A 1 125 VAL 125 127 127 VAL VAL A . n 
A 1 126 ASP 126 128 128 ASP ASP A . n 
A 1 127 ARG 127 129 129 ARG ARG A . n 
A 1 128 THR 128 130 130 THR THR A . n 
A 1 129 PRO 129 131 131 PRO PRO A . n 
A 1 130 PHE 130 132 132 PHE PHE A . n 
A 1 131 HIS 131 133 133 HIS HIS A . n 
A 1 132 HIS 132 134 134 HIS HIS A . n 
A 1 133 LYS 133 135 135 LYS LYS A . n 
A 1 134 TRP 134 136 136 TRP TRP A . n 
A 1 135 LEU 135 137 137 LEU LEU A . n 
A 1 136 GLU 136 138 138 GLU GLU A . n 
A 1 137 GLY 137 139 139 GLY GLY A . n 
A 1 138 ARG 138 140 140 ARG ARG A . n 
A 1 139 ILE 139 141 141 ILE ILE A . n 
A 1 140 LYS 140 142 142 LYS LYS A . n 
A 1 141 GLY 141 143 143 GLY GLY A . n 
A 1 142 LYS 142 144 144 LYS LYS A . n 
A 1 143 GLU 143 145 145 GLU GLU A . n 
A 1 144 ASN 144 146 146 ASN ASN A . n 
A 1 145 GLU 145 147 147 GLU GLU A . n 
A 1 146 VAL 146 148 148 VAL VAL A . n 
A 1 147 ARG 147 149 149 ARG ARG A . n 
A 1 148 LEU 148 150 150 LEU LEU A . n 
A 1 149 LEU 149 151 151 LEU LEU A . n 
A 1 150 LYS 150 152 152 LYS LYS A . n 
A 1 151 GLY 151 153 153 GLY GLY A . n 
A 1 152 PHE 152 154 154 PHE PHE A . n 
A 1 153 LEU 153 155 155 LEU LEU A . n 
A 1 154 LYS 154 156 156 LYS LYS A . n 
A 1 155 ALA 155 157 157 ALA ALA A . n 
A 1 156 ASN 156 158 158 ASN ASN A . n 
A 1 157 GLY 157 159 159 GLY GLY A . n 
A 1 158 ILE 158 160 160 ILE ILE A . n 
A 1 159 TYR 159 161 161 TYR TYR A . n 
A 1 160 GLY 160 162 162 GLY GLY A . n 
A 1 161 ALA 161 163 163 ALA ALA A . n 
A 1 162 GLU 162 164 164 GLU GLU A . n 
A 1 163 TYR 163 165 165 TYR TYR A . n 
A 1 164 LYS 164 166 166 LYS LYS A . n 
A 1 165 VAL 165 167 167 VAL VAL A . n 
A 1 166 ARG 166 168 168 ARG ARG A . n 
A 1 167 GLY 167 169 169 GLY GLY A . n 
A 1 168 PHE 168 170 170 PHE PHE A . n 
A 1 169 SER 169 171 171 SER SER A . n 
A 1 170 GLY 170 172 172 GLY GLY A . n 
A 1 171 TYR 171 173 173 TYR TYR A . n 
A 1 172 LEU 172 174 174 LEU LEU A . n 
A 1 173 CYS 173 175 175 CYS CYS A . n 
A 1 174 GLU 174 176 176 GLU GLU A . n 
A 1 175 LEU 175 177 177 LEU LEU A . n 
A 1 176 LEU 176 178 178 LEU LEU A . n 
A 1 177 ILE 177 179 179 ILE ILE A . n 
A 1 178 VAL 178 180 180 VAL VAL A . n 
A 1 179 PHE 179 181 181 PHE PHE A . n 
A 1 180 TYR 180 182 182 TYR TYR A . n 
A 1 181 GLY 181 183 183 GLY GLY A . n 
A 1 182 SER 182 184 184 SER SER A . n 
A 1 183 PHE 183 185 185 PHE PHE A . n 
A 1 184 LEU 184 186 186 LEU LEU A . n 
A 1 185 GLU 185 187 187 GLU GLU A . n 
A 1 186 THR 186 188 188 THR THR A . n 
A 1 187 VAL 187 189 189 VAL VAL A . n 
A 1 188 LYS 188 190 190 LYS LYS A . n 
A 1 189 ASN 189 191 191 ASN ASN A . n 
A 1 190 ALA 190 192 192 ALA ALA A . n 
A 1 191 ARG 191 193 193 ARG ARG A . n 
A 1 192 ARG 192 194 194 ARG ARG A . n 
A 1 193 TRP 193 195 195 TRP TRP A . n 
A 1 194 THR 194 196 196 THR THR A . n 
A 1 195 ARG 195 197 197 ARG ARG A . n 
A 1 196 ARG 196 198 198 ARG ARG A . n 
A 1 197 THR 197 199 199 THR THR A . n 
A 1 198 VAL 198 200 200 VAL VAL A . n 
A 1 199 ILE 199 201 201 ILE ILE A . n 
A 1 200 ASP 200 202 202 ASP ASP A . n 
A 1 201 VAL 201 203 203 VAL VAL A . n 
A 1 202 ALA 202 204 204 ALA ALA A . n 
A 1 203 LYS 203 205 205 LYS LYS A . n 
A 1 204 GLY 204 206 206 GLY GLY A . n 
A 1 205 GLU 205 207 207 GLU GLU A . n 
A 1 206 VAL 206 208 208 VAL VAL A . n 
A 1 207 ARG 207 209 209 ARG ARG A . n 
A 1 208 LYS 208 210 210 LYS LYS A . n 
A 1 209 GLY 209 211 211 GLY GLY A . n 
A 1 210 GLU 210 212 212 GLU GLU A . n 
A 1 211 GLU 211 213 213 GLU GLU A . n 
A 1 212 PHE 212 214 214 PHE PHE A . n 
A 1 213 PHE 213 215 215 PHE PHE A . n 
A 1 214 VAL 214 216 216 VAL VAL A . n 
A 1 215 VAL 215 217 217 VAL VAL A . n 
A 1 216 ASP 216 218 218 ASP ASP A . n 
A 1 217 PRO 217 219 219 PRO PRO A . n 
A 1 218 VAL 218 220 220 VAL VAL A . n 
A 1 219 ASP 219 221 221 ASP ASP A . n 
A 1 220 GLU 220 222 222 GLU GLU A . n 
A 1 221 LYS 221 223 223 LYS LYS A . n 
A 1 222 ARG 222 224 224 ARG ARG A . n 
A 1 223 ASN 223 225 225 ASN ASN A . n 
A 1 224 VAL 224 226 226 VAL VAL A . n 
A 1 225 ALA 225 227 227 ALA ALA A . n 
A 1 226 ALA 226 228 228 ALA ALA A . n 
A 1 227 ASN 227 229 229 ASN ASN A . n 
A 1 228 LEU 228 230 230 LEU LEU A . n 
A 1 229 SER 229 231 231 SER SER A . n 
A 1 230 LEU 230 232 232 LEU LEU A . n 
A 1 231 ASP 231 233 233 ASP ASP A . n 
A 1 232 ASN 232 234 234 ASN ASN A . n 
A 1 233 LEU 233 235 235 LEU LEU A . n 
A 1 234 ALA 234 236 236 ALA ALA A . n 
A 1 235 ARG 235 237 237 ARG ARG A . n 
A 1 236 PHE 236 238 238 PHE PHE A . n 
A 1 237 VAL 237 239 239 VAL VAL A . n 
A 1 238 HIS 238 240 240 HIS HIS A . n 
A 1 239 LEU 239 241 241 LEU LEU A . n 
A 1 240 CYS 240 242 242 CYS CYS A . n 
A 1 241 ARG 241 243 243 ARG ARG A . n 
A 1 242 GLU 242 244 244 GLU GLU A . n 
A 1 243 PHE 243 245 245 PHE PHE A . n 
A 1 244 MET 244 246 246 MET MET A . n 
A 1 245 GLU 245 247 247 GLU GLU A . n 
A 1 246 ALA 246 248 248 ALA ALA A . n 
A 1 247 PRO 247 249 249 PRO PRO A . n 
A 1 248 SER 248 250 250 SER SER A . n 
A 1 249 LEU 249 251 251 LEU LEU A . n 
A 1 250 GLY 250 252 252 GLY GLY A . n 
A 1 251 PHE 251 253 253 PHE PHE A . n 
A 1 252 PHE 252 254 254 PHE PHE A . n 
A 1 253 LYS 253 255 255 LYS LYS A . n 
A 1 254 PRO 254 256 256 PRO PRO A . n 
A 1 255 LYS 255 257 ?   ?   ?   A . n 
A 1 256 HIS 256 258 ?   ?   ?   A . n 
A 1 257 PRO 257 259 ?   ?   ?   A . n 
A 1 258 LEU 258 260 ?   ?   ?   A . n 
A 1 259 GLU 259 261 ?   ?   ?   A . n 
A 1 260 ILE 260 262 262 ILE ILE A . n 
A 1 261 GLU 261 263 263 GLU GLU A . n 
A 1 262 PRO 262 264 264 PRO PRO A . n 
A 1 263 GLU 263 265 265 GLU GLU A . n 
A 1 264 ARG 264 266 266 ARG ARG A . n 
A 1 265 LEU 265 267 267 LEU LEU A . n 
A 1 266 ARG 266 268 268 ARG ARG A . n 
A 1 267 LYS 267 269 269 LYS LYS A . n 
A 1 268 ILE 268 270 270 ILE ILE A . n 
A 1 269 VAL 269 271 271 VAL VAL A . n 
A 1 270 GLU 270 272 272 GLU GLU A . n 
A 1 271 GLU 271 273 273 GLU GLU A . n 
A 1 272 ARG 272 274 274 ARG ARG A . n 
A 1 273 GLY 273 275 275 GLY GLY A . n 
A 1 274 THR 274 276 276 THR THR A . n 
A 1 275 ALA 275 277 277 ALA ALA A . n 
A 1 276 VAL 276 278 278 VAL VAL A . n 
A 1 277 PHE 277 279 279 PHE PHE A . n 
A 1 278 ALA 278 280 280 ALA ALA A . n 
A 1 279 VAL 279 281 281 VAL VAL A . n 
A 1 280 LYS 280 282 282 LYS LYS A . n 
A 1 281 PHE 281 283 283 PHE PHE A . n 
A 1 282 ARG 282 284 284 ARG ARG A . n 
A 1 283 LYS 283 285 285 LYS LYS A . n 
A 1 284 PRO 284 286 286 PRO PRO A . n 
A 1 285 ASP 285 287 287 ASP ASP A . n 
A 1 286 ILE 286 288 288 ILE ILE A . n 
A 1 287 VAL 287 289 289 VAL VAL A . n 
A 1 288 ASP 288 290 290 ASP ASP A . n 
A 1 289 ASP 289 291 291 ASP ASP A . n 
A 1 290 ASN 290 292 292 ASN ASN A . n 
A 1 291 LEU 291 293 293 LEU LEU A . n 
A 1 292 TYR 292 294 294 TYR TYR A . n 
A 1 293 PRO 293 295 295 PRO PRO A . n 
A 1 294 GLN 294 296 296 GLN GLN A . n 
A 1 295 LEU 295 297 297 LEU LEU A . n 
A 1 296 GLU 296 298 298 GLU GLU A . n 
A 1 297 ARG 297 299 299 ARG ARG A . n 
A 1 298 ALA 298 300 300 ALA ALA A . n 
A 1 299 SER 299 301 301 SER SER A . n 
A 1 300 ARG 300 302 302 ARG ARG A . n 
A 1 301 LYS 301 303 303 LYS LYS A . n 
A 1 302 ILE 302 304 304 ILE ILE A . n 
A 1 303 PHE 303 305 305 PHE PHE A . n 
A 1 304 GLU 304 306 306 GLU GLU A . n 
A 1 305 PHE 305 307 307 PHE PHE A . n 
A 1 306 LEU 306 308 308 LEU LEU A . n 
A 1 307 GLU 307 309 309 GLU GLU A . n 
A 1 308 ARG 308 310 310 ARG ARG A . n 
A 1 309 GLU 309 311 311 GLU GLU A . n 
A 1 310 ASN 310 312 312 ASN ASN A . n 
A 1 311 PHE 311 313 313 PHE PHE A . n 
A 1 312 MET 312 314 314 MET MET A . n 
A 1 313 PRO 313 315 315 PRO PRO A . n 
A 1 314 LEU 314 316 316 LEU LEU A . n 
A 1 315 ARG 315 317 317 ARG ARG A . n 
A 1 316 SER 316 318 318 SER SER A . n 
A 1 317 ALA 317 319 319 ALA ALA A . n 
A 1 318 PHE 318 320 320 PHE PHE A . n 
A 1 319 LYS 319 321 321 LYS LYS A . n 
A 1 320 ALA 320 322 322 ALA ALA A . n 
A 1 321 SER 321 323 323 SER SER A . n 
A 1 322 GLU 322 324 324 GLU GLU A . n 
A 1 323 GLU 323 325 325 GLU GLU A . n 
A 1 324 PHE 324 326 326 PHE PHE A . n 
A 1 325 CYS 325 327 327 CYS CYS A . n 
A 1 326 TYR 326 328 328 TYR TYR A . n 
A 1 327 LEU 327 329 329 LEU LEU A . n 
A 1 328 LEU 328 330 330 LEU LEU A . n 
A 1 329 PHE 329 331 331 PHE PHE A . n 
A 1 330 GLU 330 332 332 GLU GLU A . n 
A 1 331 CYS 331 333 333 CYS CYS A . n 
A 1 332 GLN 332 334 334 GLN GLN A . n 
A 1 333 ILE 333 335 335 ILE ILE A . n 
A 1 334 LYS 334 336 336 LYS LYS A . n 
A 1 335 GLU 335 337 337 GLU GLU A . n 
A 1 336 ILE 336 338 338 ILE ILE A . n 
A 1 337 SER 337 339 339 SER SER A . n 
A 1 338 ARG 338 340 340 ARG ARG A . n 
A 1 339 VAL 339 341 341 VAL VAL A . n 
A 1 340 PHE 340 342 342 PHE PHE A . n 
A 1 341 ARG 341 343 343 ARG ARG A . n 
A 1 342 ARG 342 344 344 ARG ARG A . n 
A 1 343 MET 343 345 345 MET MET A . n 
A 1 344 GLY 344 346 346 GLY GLY A . n 
A 1 345 PRO 345 347 347 PRO PRO A . n 
A 1 346 GLN 346 348 348 GLN GLN A . n 
A 1 347 PHE 347 349 349 PHE PHE A . n 
A 1 348 GLU 348 350 350 GLU GLU A . n 
A 1 349 ASP 349 351 351 ASP ASP A . n 
A 1 350 GLU 350 352 352 GLU GLU A . n 
A 1 351 ARG 351 353 353 ARG ARG A . n 
A 1 352 ASN 352 354 354 ASN ASN A . n 
A 1 353 VAL 353 355 355 VAL VAL A . n 
A 1 354 LYS 354 356 356 LYS LYS A . n 
A 1 355 LYS 355 357 357 LYS LYS A . n 
A 1 356 PHE 356 358 358 PHE PHE A . n 
A 1 357 LEU 357 359 359 LEU LEU A . n 
A 1 358 SER 358 360 360 SER SER A . n 
A 1 359 ARG 359 361 361 ARG ARG A . n 
A 1 360 ASN 360 362 362 ASN ASN A . n 
A 1 361 ARG 361 363 363 ARG ARG A . n 
A 1 362 ALA 362 364 364 ALA ALA A . n 
A 1 363 PHE 363 365 365 PHE PHE A . n 
A 1 364 ARG 364 366 366 ARG ARG A . n 
A 1 365 PRO 365 367 367 PRO PRO A . n 
A 1 366 PHE 366 368 368 PHE PHE A . n 
A 1 367 ILE 367 369 369 ILE ILE A . n 
A 1 368 GLU 368 370 370 GLU GLU A . n 
A 1 369 ASN 369 371 371 ASN ASN A . n 
A 1 370 GLY 370 372 372 GLY GLY A . n 
A 1 371 ARG 371 373 373 ARG ARG A . n 
A 1 372 TRP 372 374 374 TRP TRP A . n 
A 1 373 TRP 373 375 375 TRP TRP A . n 
A 1 374 ALA 374 376 376 ALA ALA A . n 
A 1 375 PHE 375 377 377 PHE PHE A . n 
A 1 376 GLU 376 378 378 GLU GLU A . n 
A 1 377 MET 377 379 379 MET MET A . n 
A 1 378 ARG 378 380 380 ARG ARG A . n 
A 1 379 LYS 379 381 381 LYS LYS A . n 
A 1 380 PHE 380 382 382 PHE PHE A . n 
A 1 381 THR 381 383 383 THR THR A . n 
A 1 382 THR 382 384 384 THR THR A . n 
A 1 383 PRO 383 385 385 PRO PRO A . n 
A 1 384 GLU 384 386 386 GLU GLU A . n 
A 1 385 GLU 385 387 387 GLU GLU A . n 
A 1 386 GLY 386 388 388 GLY GLY A . n 
A 1 387 VAL 387 389 389 VAL VAL A . n 
A 1 388 ARG 388 390 390 ARG ARG A . n 
A 1 389 SER 389 391 391 SER SER A . n 
A 1 390 TYR 390 392 392 TYR TYR A . n 
A 1 391 ALA 391 393 393 ALA ALA A . n 
A 1 392 SER 392 394 394 SER SER A . n 
A 1 393 THR 393 395 395 THR THR A . n 
A 1 394 HIS 394 396 396 HIS HIS A . n 
A 1 395 TRP 395 397 397 TRP TRP A . n 
A 1 396 HIS 396 398 398 HIS HIS A . n 
A 1 397 THR 397 399 399 THR THR A . n 
A 1 398 LEU 398 400 400 LEU LEU A . n 
A 1 399 GLY 399 401 401 GLY GLY A . n 
A 1 400 LYS 400 402 402 LYS LYS A . n 
A 1 401 ASN 401 403 403 ASN ASN A . n 
A 1 402 VAL 402 404 404 VAL VAL A . n 
A 1 403 GLY 403 405 405 GLY GLY A . n 
A 1 404 GLU 404 406 406 GLU GLU A . n 
A 1 405 SER 405 407 407 SER SER A . n 
A 1 406 ILE 406 408 408 ILE ILE A . n 
A 1 407 ARG 407 409 409 ARG ARG A . n 
A 1 408 GLU 408 410 410 GLU GLU A . n 
A 1 409 TYR 409 411 411 TYR TYR A . n 
A 1 410 PHE 410 412 412 PHE PHE A . n 
A 1 411 GLU 411 413 413 GLU GLU A . n 
A 1 412 ILE 412 414 414 ILE ILE A . n 
A 1 413 ILE 413 415 415 ILE ILE A . n 
A 1 414 SER 414 416 416 SER SER A . n 
A 1 415 GLY 415 417 417 GLY GLY A . n 
A 1 416 GLU 416 418 418 GLU GLU A . n 
A 1 417 LYS 417 419 419 LYS LYS A . n 
A 1 418 LEU 418 420 420 LEU LEU A . n 
A 1 419 PHE 419 421 421 PHE PHE A . n 
A 1 420 LYS 420 422 422 LYS LYS A . n 
A 1 421 GLU 421 423 423 GLU GLU A . n 
A 1 422 PRO 422 424 424 PRO PRO A . n 
A 1 423 VAL 423 425 425 VAL VAL A . n 
A 1 424 THR 424 426 426 THR THR A . n 
A 1 425 ALA 425 427 427 ALA ALA A . n 
A 1 426 GLU 426 428 428 GLU GLU A . n 
A 1 427 LEU 427 429 429 LEU LEU A . n 
A 1 428 CYS 428 430 430 CYS CYS A . n 
A 1 429 GLU 429 431 431 GLU GLU A . n 
A 1 430 MET 430 432 432 MET MET A . n 
A 1 431 MET 431 433 433 MET MET A . n 
A 1 432 GLY 432 434 434 GLY GLY A . n 
A 1 433 VAL 433 435 435 VAL VAL A . n 
A 1 434 LYS 434 436 436 LYS LYS A . n 
A 1 435 ASP 435 437 437 ASP ASP A . n 
B 2 1   G   1   1   1   G   G   C . n 
B 2 2   G   2   2   2   G   G   C . n 
B 2 3   A   3   3   3   A   A   C . n 
B 2 4   A   4   4   4   A   A   C . n 
B 2 5   G   5   5   5   G   G   C . n 
B 2 6   U   6   6   6   U   U   C . n 
B 2 7   A   7   7   7   A   A   C . n 
B 2 8   G   8   8   8   G   G   C . n 
B 2 9   A   9   9   9   A   A   C . n 
B 2 10  U   10  10  10  U   U   C . n 
B 2 11  G   11  11  11  G   G   C . n 
B 2 12  G   12  12  12  G   G   C . n 
B 2 13  U   13  13  13  U   U   C . n 
B 2 14  U   14  14  14  U   U   C . n 
B 2 15  C   15  15  15  C   C   C . n 
B 2 16  A   16  16  16  A   A   C . n 
B 2 17  A   17  17  17  A   A   C . n 
B 2 18  G   18  18  18  G   G   C . n 
B 2 19  U   19  19  19  U   U   C . n 
B 2 20  C   20  20  20  C   C   C . n 
B 2 21  C   21  21  21  C   C   C . n 
B 2 22  A   22  22  22  A   A   C . n 
B 2 23  U   23  23  23  U   U   C . n 
B 2 24  U   24  24  24  U   U   C . n 
B 2 25  U   25  25  25  U   U   C . n 
B 2 26  A   26  26  26  A   A   C . n 
B 2 27  C   27  27  27  C   C   C . n 
B 2 28  U   28  28  28  U   U   C . n 
B 2 29  U   29  29  29  U   U   C . n 
B 2 30  C   30  30  30  C   C   C . n 
B 2 31  C   31  31  31  C   C   C . n 
B 2 32  A   32  32  32  A   A   C . n 
B 2 33  C   33  33  33  C   C   C . n 
B 2 34  C   34  34  34  C   C   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14200 ? 
1 MORE         -92   ? 
1 'SSA (A^2)'  47470 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_645 y+1,x-1,-z 0.0000000000 1.0000000000 0.0000000000 57.9420000000 1.0000000000 0.0000000000 
0.0000000000 -57.9420000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     628 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? A GLU 57 ? A GLU 59  ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O3G ? C APC . ? A APC 501 ? 1_555 122.0 ? 
2 O   ? A GLU 57 ? A GLU 59  ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? C APC . ? A APC 501 ? 1_555 139.7 ? 
3 O3G ? C APC .  ? A APC 501 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A ? C APC . ? A APC 501 ? 1_555 97.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-01 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 11.2899 -1.9639  -42.8428 -0.0687 -0.0217 -0.0411 0.0000  -0.0282 0.0145  0.9646 0.7825 1.9761 
-0.0843 -0.3111 -0.0749 -0.0287 0.1312  0.0172  0.0017  0.1045  0.0581  -0.1217 -0.0715 -0.0758 
'X-RAY DIFFRACTION' 2 ? refined 8.9486  -3.4559  -18.1892 -0.0644 -0.0220 -0.0396 0.0037  0.0138  0.0046  1.2452 0.9097 1.9768 
0.1626  0.0093  -0.1164 0.0580  -0.1861 0.0289  0.0267  -0.0099 0.0505  -0.1529 -0.0429 -0.0481 
'X-RAY DIFFRACTION' 3 ? refined 40.7583 -5.1404  -17.1304 -0.0798 -0.0394 -0.0245 -0.0381 -0.0143 0.0285  1.2322 0.8886 2.4173 
-0.3934 0.2274  -0.0824 -0.0392 0.0747  0.0934  0.0471  -0.0456 -0.0104 -0.1540 0.0743  0.0848  
'X-RAY DIFFRACTION' 4 ? refined 52.7514 -32.0677 -0.4975  0.0787  -0.0086 -0.0852 0.0169  -0.0204 -0.0209 0.7032 7.6480 0.6108 
0.7935  0.0524  -1.9653 0.0805  0.2048  0.0040  -0.4416 -0.0083 -0.0236 0.1830  0.0606  -0.0722 
'X-RAY DIFFRACTION' 5 ? refined 33.5982 -28.0669 -24.8047 0.0921  -0.0172 0.0855  0.0304  -0.1548 0.0179  5.5788 2.8119 2.7108 
-3.8569 3.3324  -1.9803 0.7344  0.2108  -0.9125 -0.1814 -0.1952 0.7550  0.5386  0.2566  -0.5392 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 16  ? ? A 143 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 3   ? ? A 15  ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 144 ? ? A 256 ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 A 262 ? ? A 339 ? ? ? ? 
'X-RAY DIFFRACTION' 5 3 A 384 ? ? A 437 ? ? ? ? 
'X-RAY DIFFRACTION' 6 4 A 340 ? ? A 383 ? ? ? ? 
'X-RAY DIFFRACTION' 7 5 C 1   ? ? C 34  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASES   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    50 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            G 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            G 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.494 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.113 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 50 ? ? CZ    A ARG 50 ? ? NH2 A ARG 50 ? ? 117.26 120.30 -3.04 0.50 N 
2 1 "C3'" C A   17 ? ? "O3'" C A   17 ? ? P   C G   18 ? ? 127.84 119.70 8.14  1.20 Y 
3 1 "C3'" C U   19 ? ? "O3'" C U   19 ? ? P   C C   20 ? ? 128.44 119.70 8.74  1.20 Y 
4 1 "O4'" C U   24 ? ? "C1'" C U   24 ? ? N1  C U   24 ? ? 112.81 108.50 4.31  0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 96  ? ? -143.26 -60.43 
2 1 GLU A 119 ? ? 68.96   123.19 
3 1 PRO A 120 ? ? -82.64  44.73  
4 1 LEU A 316 ? ? -93.45  -63.88 
5 1 ARG A 366 ? ? 56.51   107.07 
6 1 TYR A 411 ? ? -171.04 133.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 257 ? A LYS 255 
2 1 Y 1 A HIS 258 ? A HIS 256 
3 1 Y 1 A PRO 259 ? A PRO 257 
4 1 Y 1 A LEU 260 ? A LEU 258 
5 1 Y 1 A GLU 261 ? A GLU 259 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3OVA 'double helix'         
3OVA 'a-form double helix'  
3OVA 'hairpin loop'         
3OVA 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B G 1  1_555 B C 31 1_555 -0.351 -0.240 0.337  5.822  -5.387  -0.318  1  C_G1:C31_C  C 1  ? C 31 ? 19 1 
1 B G 2  1_555 B C 30 1_555 -0.259 -0.228 0.269  2.412  -14.583 2.222   2  C_G2:C30_C  C 2  ? C 30 ? 19 1 
1 B A 3  1_555 B U 29 1_555 -0.101 -0.250 0.084  -3.314 -13.103 -3.046  3  C_A3:U29_C  C 3  ? C 29 ? 20 1 
1 B A 4  1_555 B U 28 1_555 0.333  -0.123 -0.080 -3.411 -15.333 6.180   4  C_A4:U28_C  C 4  ? C 28 ? 20 1 
1 B G 5  1_555 B C 27 1_555 -0.840 0.001  -0.307 -9.227 -24.603 11.749  5  C_G5:C27_C  C 5  ? C 27 ? 19 1 
1 B U 6  1_555 B A 26 1_555 0.571  -0.109 -0.023 0.281  -20.299 10.048  6  C_U6:A26_C  C 6  ? C 26 ? 20 1 
1 B A 7  1_555 B U 25 1_555 0.521  0.021  0.718  5.673  -8.270  14.294  7  C_A7:U25_C  C 7  ? C 25 ? ?  1 
1 B G 8  1_555 B U 24 1_555 -2.047 -0.267 -0.158 -2.739 -11.751 12.812  8  C_G8:U24_C  C 8  ? C 24 ? 28 1 
1 B A 9  1_555 B U 23 1_555 -0.226 -0.010 -0.119 -8.852 -10.329 7.604   9  C_A9:U23_C  C 9  ? C 23 ? 20 1 
1 B U 10 1_555 B A 22 1_555 0.130  -0.271 0.119  -1.229 -9.143  -0.545  10 C_U10:A22_C C 10 ? C 22 ? 20 1 
1 B G 11 1_555 B C 21 1_555 -0.302 -0.254 0.154  1.044  -11.989 -1.400  11 C_G11:C21_C C 11 ? C 21 ? 19 1 
1 B G 12 1_555 B C 20 1_555 -0.055 -0.095 0.098  -7.406 -15.573 -3.543  12 C_G12:C20_C C 12 ? C 20 ? 19 1 
1 B U 13 1_555 B A 17 1_555 4.326  -2.544 -0.117 -9.975 10.567  -90.441 13 C_U13:A17_C C 13 ? C 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B G 1  1_555 B C 31 1_555 B G 2  1_555 B C 30 1_555 0.122  -1.459 3.365 -0.819 4.394  36.008 -2.961 -0.312 3.167 7.074  1.319   
36.275 1  CC_G1G2:C30C31_CC   C 1  ? C 31 ? C 2  ? C 30 ? 
1 B G 2  1_555 B C 30 1_555 B A 3  1_555 B U 29 1_555 -0.361 -1.959 3.328 -0.467 4.370  32.613 -4.190 0.559  3.052 7.739  0.828   
32.900 2  CC_G2A3:U29C30_CC   C 2  ? C 30 ? C 3  ? C 29 ? 
1 B A 3  1_555 B U 29 1_555 B A 4  1_555 B U 28 1_555 -0.104 -1.684 3.292 1.332  6.115  29.428 -4.442 0.460  2.884 11.869 -2.585  
30.072 3  CC_A3A4:U28U29_CC   C 3  ? C 29 ? C 4  ? C 28 ? 
1 B A 4  1_555 B U 28 1_555 B G 5  1_555 B C 27 1_555 0.682  -1.953 3.407 2.987  11.136 21.685 -7.750 -0.760 2.223 27.257 -7.312  
24.527 4  CC_A4G5:C27U28_CC   C 4  ? C 28 ? C 5  ? C 27 ? 
1 B G 5  1_555 B C 27 1_555 B U 6  1_555 B A 26 1_555 -0.472 -0.959 3.067 -3.251 5.739  38.071 -2.103 0.343  2.926 8.718  4.938   
38.618 5  CC_G5U6:A26C27_CC   C 5  ? C 27 ? C 6  ? C 26 ? 
1 B U 6  1_555 B A 26 1_555 B A 7  1_555 B U 25 1_555 0.324  -1.435 2.966 -4.059 10.777 28.808 -4.403 -1.253 2.233 20.649 7.778   
30.980 6  CC_U6A7:U25A26_CC   C 6  ? C 26 ? C 7  ? C 25 ? 
1 B A 7  1_555 B U 25 1_555 B G 8  1_555 B U 24 1_555 0.838  -2.377 3.270 5.763  11.241 18.593 -9.602 -0.360 1.747 30.628 -15.701 
22.447 7  CC_A7G8:U24U25_CC   C 7  ? C 25 ? C 8  ? C 24 ? 
1 B G 8  1_555 B U 24 1_555 B A 9  1_555 B U 23 1_555 -0.529 -1.586 3.393 -2.965 7.505  36.061 -3.515 0.436  3.046 11.940 4.717   
36.924 8  CC_G8A9:U23U24_CC   C 8  ? C 24 ? C 9  ? C 23 ? 
1 B A 9  1_555 B U 23 1_555 B U 10 1_555 B A 22 1_555 0.067  -2.469 3.118 0.198  -0.853 28.785 -4.781 -0.092 3.189 -1.716 -0.399  
28.798 9  CC_A9U10:A22U23_CC  C 9  ? C 23 ? C 10 ? C 22 ? 
1 B U 10 1_555 B A 22 1_555 B G 11 1_555 B C 21 1_555 -1.058 -2.067 3.128 -2.194 4.823  24.734 -5.999 1.835  2.763 11.098 5.049   
25.286 10 CC_U10G11:C21A22_CC C 10 ? C 22 ? C 11 ? C 21 ? 
1 B G 11 1_555 B C 21 1_555 B G 12 1_555 B C 20 1_555 0.512  -1.783 3.376 3.017  5.897  36.685 -3.570 -0.402 3.093 9.276  -4.747  
37.258 11 CC_G11G12:C20C21_CC C 11 ? C 21 ? C 12 ? C 20 ? 
1 B G 12 1_555 B C 20 1_555 B U 13 1_555 B A 17 1_555 -2.034 -2.016 3.423 4.725  -1.233 80.065 -1.531 1.708  3.344 -0.958 -3.670  
80.189 12 CC_G12U13:A17C20_CC C 12 ? C 20 ? C 13 ? C 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' APC 
4 'SULFATE ION'                                   SO4 
5 'MAGNESIUM ION'                                 MG  
6 1,2-ETHANEDIOL                                  EDO 
7 water                                           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 APC 1   501 501 APC APC A . 
D 4 SO4 1   503 503 SO4 SO4 A . 
E 5 MG  1   601 601 MG  MG  A . 
F 6 EDO 1   701 701 EDO EDO A . 
G 6 EDO 1   702 702 EDO EDO A . 
H 6 EDO 1   703 703 EDO EDO A . 
I 7 HOH 1   1   1   HOH HOH A . 
I 7 HOH 2   2   2   HOH HOH A . 
I 7 HOH 3   438 438 HOH HOH A . 
I 7 HOH 4   439 439 HOH HOH A . 
I 7 HOH 5   440 440 HOH HOH A . 
I 7 HOH 6   441 441 HOH HOH A . 
I 7 HOH 7   442 442 HOH HOH A . 
I 7 HOH 8   443 443 HOH HOH A . 
I 7 HOH 9   444 444 HOH HOH A . 
I 7 HOH 10  445 445 HOH HOH A . 
I 7 HOH 11  446 446 HOH HOH A . 
I 7 HOH 12  447 447 HOH HOH A . 
I 7 HOH 13  448 448 HOH HOH A . 
I 7 HOH 14  449 449 HOH HOH A . 
I 7 HOH 15  450 450 HOH HOH A . 
I 7 HOH 16  451 451 HOH HOH A . 
I 7 HOH 17  452 452 HOH HOH A . 
I 7 HOH 18  453 453 HOH HOH A . 
I 7 HOH 19  454 454 HOH HOH A . 
I 7 HOH 20  455 455 HOH HOH A . 
I 7 HOH 21  456 456 HOH HOH A . 
I 7 HOH 22  457 457 HOH HOH A . 
I 7 HOH 23  458 458 HOH HOH A . 
I 7 HOH 24  459 459 HOH HOH A . 
I 7 HOH 25  460 460 HOH HOH A . 
I 7 HOH 26  461 461 HOH HOH A . 
I 7 HOH 27  462 462 HOH HOH A . 
I 7 HOH 28  463 463 HOH HOH A . 
I 7 HOH 29  464 464 HOH HOH A . 
I 7 HOH 30  465 465 HOH HOH A . 
I 7 HOH 31  466 466 HOH HOH A . 
I 7 HOH 32  467 467 HOH HOH A . 
I 7 HOH 33  468 468 HOH HOH A . 
I 7 HOH 34  469 469 HOH HOH A . 
I 7 HOH 35  470 470 HOH HOH A . 
I 7 HOH 36  471 471 HOH HOH A . 
I 7 HOH 37  472 472 HOH HOH A . 
I 7 HOH 38  473 473 HOH HOH A . 
I 7 HOH 39  474 474 HOH HOH A . 
I 7 HOH 40  475 475 HOH HOH A . 
I 7 HOH 41  476 476 HOH HOH A . 
I 7 HOH 42  477 477 HOH HOH A . 
I 7 HOH 43  478 478 HOH HOH A . 
I 7 HOH 44  479 479 HOH HOH A . 
I 7 HOH 45  480 480 HOH HOH A . 
I 7 HOH 46  481 481 HOH HOH A . 
I 7 HOH 47  482 482 HOH HOH A . 
I 7 HOH 48  483 483 HOH HOH A . 
I 7 HOH 49  484 484 HOH HOH A . 
I 7 HOH 50  485 485 HOH HOH A . 
I 7 HOH 51  486 486 HOH HOH A . 
I 7 HOH 52  487 487 HOH HOH A . 
I 7 HOH 53  488 488 HOH HOH A . 
I 7 HOH 54  489 489 HOH HOH A . 
I 7 HOH 55  490 490 HOH HOH A . 
I 7 HOH 56  491 491 HOH HOH A . 
I 7 HOH 57  492 492 HOH HOH A . 
I 7 HOH 58  493 493 HOH HOH A . 
I 7 HOH 59  494 494 HOH HOH A . 
I 7 HOH 60  495 495 HOH HOH A . 
I 7 HOH 61  496 496 HOH HOH A . 
I 7 HOH 62  497 497 HOH HOH A . 
I 7 HOH 63  498 498 HOH HOH A . 
I 7 HOH 64  499 499 HOH HOH A . 
I 7 HOH 65  500 500 HOH HOH A . 
I 7 HOH 66  502 502 HOH HOH A . 
I 7 HOH 67  504 504 HOH HOH A . 
I 7 HOH 68  505 505 HOH HOH A . 
I 7 HOH 69  506 506 HOH HOH A . 
I 7 HOH 70  507 507 HOH HOH A . 
I 7 HOH 71  508 508 HOH HOH A . 
I 7 HOH 72  509 509 HOH HOH A . 
I 7 HOH 73  510 510 HOH HOH A . 
I 7 HOH 74  511 511 HOH HOH A . 
I 7 HOH 75  512 512 HOH HOH A . 
I 7 HOH 76  513 513 HOH HOH A . 
I 7 HOH 77  514 514 HOH HOH A . 
I 7 HOH 78  515 515 HOH HOH A . 
I 7 HOH 79  516 516 HOH HOH A . 
I 7 HOH 80  517 517 HOH HOH A . 
I 7 HOH 81  518 518 HOH HOH A . 
I 7 HOH 82  519 519 HOH HOH A . 
I 7 HOH 83  520 520 HOH HOH A . 
I 7 HOH 84  521 521 HOH HOH A . 
I 7 HOH 85  522 522 HOH HOH A . 
I 7 HOH 86  523 523 HOH HOH A . 
I 7 HOH 87  524 524 HOH HOH A . 
I 7 HOH 88  525 525 HOH HOH A . 
I 7 HOH 89  526 526 HOH HOH A . 
I 7 HOH 90  527 527 HOH HOH A . 
I 7 HOH 91  528 528 HOH HOH A . 
I 7 HOH 92  529 529 HOH HOH A . 
I 7 HOH 93  530 530 HOH HOH A . 
I 7 HOH 94  531 531 HOH HOH A . 
I 7 HOH 95  532 532 HOH HOH A . 
I 7 HOH 96  533 533 HOH HOH A . 
I 7 HOH 97  534 534 HOH HOH A . 
I 7 HOH 98  535 535 HOH HOH A . 
I 7 HOH 99  536 536 HOH HOH A . 
I 7 HOH 100 537 537 HOH HOH A . 
I 7 HOH 101 538 538 HOH HOH A . 
I 7 HOH 102 539 539 HOH HOH A . 
I 7 HOH 103 540 540 HOH HOH A . 
I 7 HOH 104 541 541 HOH HOH A . 
I 7 HOH 105 542 542 HOH HOH A . 
I 7 HOH 106 543 543 HOH HOH A . 
I 7 HOH 107 544 544 HOH HOH A . 
I 7 HOH 108 545 545 HOH HOH A . 
I 7 HOH 109 546 546 HOH HOH A . 
I 7 HOH 110 547 547 HOH HOH A . 
I 7 HOH 111 548 548 HOH HOH A . 
I 7 HOH 112 549 549 HOH HOH A . 
I 7 HOH 113 550 550 HOH HOH A . 
I 7 HOH 114 551 551 HOH HOH A . 
I 7 HOH 115 552 552 HOH HOH A . 
I 7 HOH 116 553 553 HOH HOH A . 
I 7 HOH 117 554 554 HOH HOH A . 
I 7 HOH 118 555 555 HOH HOH A . 
I 7 HOH 119 556 556 HOH HOH A . 
I 7 HOH 120 557 557 HOH HOH A . 
I 7 HOH 121 558 558 HOH HOH A . 
I 7 HOH 122 559 559 HOH HOH A . 
I 7 HOH 123 560 560 HOH HOH A . 
I 7 HOH 124 561 561 HOH HOH A . 
I 7 HOH 125 562 562 HOH HOH A . 
I 7 HOH 126 563 563 HOH HOH A . 
I 7 HOH 127 564 564 HOH HOH A . 
I 7 HOH 128 565 565 HOH HOH A . 
I 7 HOH 129 566 566 HOH HOH A . 
I 7 HOH 130 567 567 HOH HOH A . 
I 7 HOH 131 568 568 HOH HOH A . 
I 7 HOH 132 569 569 HOH HOH A . 
I 7 HOH 133 570 570 HOH HOH A . 
I 7 HOH 134 571 571 HOH HOH A . 
I 7 HOH 135 572 572 HOH HOH A . 
I 7 HOH 136 573 573 HOH HOH A . 
I 7 HOH 137 574 574 HOH HOH A . 
I 7 HOH 138 575 575 HOH HOH A . 
I 7 HOH 139 576 576 HOH HOH A . 
I 7 HOH 140 577 577 HOH HOH A . 
I 7 HOH 141 578 578 HOH HOH A . 
I 7 HOH 142 579 579 HOH HOH A . 
I 7 HOH 143 580 580 HOH HOH A . 
I 7 HOH 144 581 581 HOH HOH A . 
I 7 HOH 145 582 582 HOH HOH A . 
I 7 HOH 146 583 583 HOH HOH A . 
I 7 HOH 147 584 584 HOH HOH A . 
I 7 HOH 148 585 585 HOH HOH A . 
I 7 HOH 149 586 586 HOH HOH A . 
I 7 HOH 150 587 587 HOH HOH A . 
I 7 HOH 151 588 588 HOH HOH A . 
I 7 HOH 152 589 589 HOH HOH A . 
I 7 HOH 153 590 590 HOH HOH A . 
I 7 HOH 154 591 591 HOH HOH A . 
I 7 HOH 155 592 592 HOH HOH A . 
I 7 HOH 156 593 593 HOH HOH A . 
I 7 HOH 157 594 594 HOH HOH A . 
I 7 HOH 158 595 595 HOH HOH A . 
I 7 HOH 159 596 596 HOH HOH A . 
I 7 HOH 160 597 597 HOH HOH A . 
I 7 HOH 161 598 598 HOH HOH A . 
I 7 HOH 162 599 599 HOH HOH A . 
I 7 HOH 163 600 600 HOH HOH A . 
I 7 HOH 164 602 602 HOH HOH A . 
I 7 HOH 165 603 603 HOH HOH A . 
I 7 HOH 166 604 604 HOH HOH A . 
I 7 HOH 167 605 605 HOH HOH A . 
I 7 HOH 168 606 606 HOH HOH A . 
I 7 HOH 169 607 607 HOH HOH A . 
I 7 HOH 170 608 608 HOH HOH A . 
I 7 HOH 171 609 609 HOH HOH A . 
I 7 HOH 172 610 610 HOH HOH A . 
I 7 HOH 173 611 611 HOH HOH A . 
I 7 HOH 174 612 612 HOH HOH A . 
I 7 HOH 175 613 613 HOH HOH A . 
I 7 HOH 176 614 614 HOH HOH A . 
I 7 HOH 177 615 615 HOH HOH A . 
I 7 HOH 178 616 616 HOH HOH A . 
I 7 HOH 179 617 617 HOH HOH A . 
I 7 HOH 180 618 618 HOH HOH A . 
I 7 HOH 181 619 619 HOH HOH A . 
I 7 HOH 182 620 620 HOH HOH A . 
I 7 HOH 183 621 621 HOH HOH A . 
I 7 HOH 184 622 622 HOH HOH A . 
I 7 HOH 185 623 623 HOH HOH A . 
I 7 HOH 186 624 624 HOH HOH A . 
I 7 HOH 187 625 625 HOH HOH A . 
I 7 HOH 188 626 626 HOH HOH A . 
I 7 HOH 189 627 627 HOH HOH A . 
I 7 HOH 190 628 628 HOH HOH A . 
I 7 HOH 191 629 629 HOH HOH A . 
I 7 HOH 192 630 630 HOH HOH A . 
I 7 HOH 193 631 631 HOH HOH A . 
I 7 HOH 194 632 632 HOH HOH A . 
I 7 HOH 195 633 633 HOH HOH A . 
I 7 HOH 196 634 634 HOH HOH A . 
I 7 HOH 197 635 635 HOH HOH A . 
I 7 HOH 198 636 636 HOH HOH A . 
J 7 HOH 1   35  35  HOH HOH C . 
J 7 HOH 2   36  36  HOH HOH C . 
J 7 HOH 3   37  37  HOH HOH C . 
J 7 HOH 4   38  38  HOH HOH C . 
J 7 HOH 5   39  39  HOH HOH C . 
J 7 HOH 6   40  40  HOH HOH C . 
J 7 HOH 7   58  58  HOH HOH C . 
J 7 HOH 8   69  69  HOH HOH C . 
J 7 HOH 9   73  73  HOH HOH C . 
J 7 HOH 10  119 119 HOH HOH C . 
J 7 HOH 11  123 123 HOH HOH C . 
J 7 HOH 12  131 131 HOH HOH C . 
J 7 HOH 13  138 138 HOH HOH C . 
J 7 HOH 14  146 146 HOH HOH C . 
J 7 HOH 15  149 149 HOH HOH C . 
J 7 HOH 16  164 164 HOH HOH C . 
J 7 HOH 17  171 171 HOH HOH C . 
J 7 HOH 18  172 172 HOH HOH C . 
J 7 HOH 19  176 176 HOH HOH C . 
J 7 HOH 20  178 178 HOH HOH C . 
J 7 HOH 21  227 227 HOH HOH C . 
#